data_2NZ2
# 
_entry.id   2NZ2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NZ2         
RCSB  RCSB040480   
WWPDB D_1000040480 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2NZ2 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karlberg, T.'                         1  
'Uppenberg, J.'                        2  
'Arrowsmith, C.'                       3  
'Berglund, H.'                         4  
'Busam, R.D.'                          5  
'Collins, R.'                          6  
'Edwards, A.'                          7  
'Ericsson, U.B.'                       8  
'Flodin, S.'                           9  
'Flores, A.'                           10 
'Graslund, S.'                         11 
'Hallberg, B.M.'                       12 
'Hammarstrom, M.'                      13 
'Hogbom, M.'                           14 
'Johansson, I.'                        15 
'Kotenyova, T.'                        16 
'Magnusdottir, A.'                     17 
'Moche, M.'                            18 
'Nilsson, M.E.'                        19 
'Nordlund, P.'                         20 
'Nyman, T.'                            21 
'Ogg, D.'                              22 
'Persson, C.'                          23 
'Sagemark, J.'                         24 
'Stenmark, P.'                         25 
'Sundstrom, M.'                        26 
'Thorsell, A.G.'                       27 
'Van Den Berg, S.'                     28 
'Wallden, K.'                          29 
'Weigelt, J.'                          30 
'Holmberg-Schiavone, L.'               31 
'Structural Genomics Consortium (SGC)' 32 
# 
_citation.id                        primary 
_citation.title                     'Structure of human argininosuccinate synthetase.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            64 
_citation.page_first                279 
_citation.page_last                 286 
_citation.year                      2008 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18323623 
_citation.pdbx_database_id_DOI      10.1107/S0907444907067455 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karlberg, T.'           1 
primary 'Collins, R.'            2 
primary 'van den Berg, S.'       3 
primary 'Flores, A.'             4 
primary 'Hammarstrom, M.'        5 
primary 'Hogbom, M.'             6 
primary 'Holmberg Schiavone, L.' 7 
primary 'Uppenberg, J.'          8 
# 
_cell.entry_id           2NZ2 
_cell.length_a           95.940 
_cell.length_b           117.470 
_cell.length_c           155.150 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2NZ2 
_symmetry.space_group_name_H-M             'F 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                22 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Argininosuccinate synthase' 46680.348 1   6.3.4.5 ? ? ? 
2 non-polymer syn 'SODIUM ION'                 22.990    1   ?       ? ? ? 
3 non-polymer syn 'ASPARTIC ACID'              133.103   1   ?       ? ? ? 
4 non-polymer syn CITRULLINE                   175.186   1   ?       ? ? ? 
5 water       nat water                        18.015    210 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Citrulline--aspartate ligase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
SALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRND
LMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVK
DGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAE
LVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRL
KEYHRLQSKVTAK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
SALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRND
LMEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVK
DGTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAE
LVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRL
KEYHRLQSKVTAK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   SER n 
1 4   SER n 
1 5   LYS n 
1 6   GLY n 
1 7   SER n 
1 8   VAL n 
1 9   VAL n 
1 10  LEU n 
1 11  ALA n 
1 12  TYR n 
1 13  SER n 
1 14  GLY n 
1 15  GLY n 
1 16  LEU n 
1 17  ASP n 
1 18  THR n 
1 19  SER n 
1 20  CYS n 
1 21  ILE n 
1 22  LEU n 
1 23  VAL n 
1 24  TRP n 
1 25  LEU n 
1 26  LYS n 
1 27  GLU n 
1 28  GLN n 
1 29  GLY n 
1 30  TYR n 
1 31  ASP n 
1 32  VAL n 
1 33  ILE n 
1 34  ALA n 
1 35  TYR n 
1 36  LEU n 
1 37  ALA n 
1 38  ASN n 
1 39  ILE n 
1 40  GLY n 
1 41  GLN n 
1 42  LYS n 
1 43  GLU n 
1 44  ASP n 
1 45  PHE n 
1 46  GLU n 
1 47  GLU n 
1 48  ALA n 
1 49  ARG n 
1 50  LYS n 
1 51  LYS n 
1 52  ALA n 
1 53  LEU n 
1 54  LYS n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  LYS n 
1 59  LYS n 
1 60  VAL n 
1 61  PHE n 
1 62  ILE n 
1 63  GLU n 
1 64  ASP n 
1 65  VAL n 
1 66  SER n 
1 67  ARG n 
1 68  GLU n 
1 69  PHE n 
1 70  VAL n 
1 71  GLU n 
1 72  GLU n 
1 73  PHE n 
1 74  ILE n 
1 75  TRP n 
1 76  PRO n 
1 77  ALA n 
1 78  ILE n 
1 79  GLN n 
1 80  SER n 
1 81  SER n 
1 82  ALA n 
1 83  LEU n 
1 84  TYR n 
1 85  GLU n 
1 86  ASP n 
1 87  ARG n 
1 88  TYR n 
1 89  LEU n 
1 90  LEU n 
1 91  GLY n 
1 92  THR n 
1 93  SER n 
1 94  LEU n 
1 95  ALA n 
1 96  ARG n 
1 97  PRO n 
1 98  CYS n 
1 99  ILE n 
1 100 ALA n 
1 101 ARG n 
1 102 LYS n 
1 103 GLN n 
1 104 VAL n 
1 105 GLU n 
1 106 ILE n 
1 107 ALA n 
1 108 GLN n 
1 109 ARG n 
1 110 GLU n 
1 111 GLY n 
1 112 ALA n 
1 113 LYS n 
1 114 TYR n 
1 115 VAL n 
1 116 SER n 
1 117 HIS n 
1 118 GLY n 
1 119 ALA n 
1 120 THR n 
1 121 GLY n 
1 122 LYS n 
1 123 GLY n 
1 124 ASN n 
1 125 ASP n 
1 126 GLN n 
1 127 VAL n 
1 128 ARG n 
1 129 PHE n 
1 130 GLU n 
1 131 LEU n 
1 132 SER n 
1 133 CYS n 
1 134 TYR n 
1 135 SER n 
1 136 LEU n 
1 137 ALA n 
1 138 PRO n 
1 139 GLN n 
1 140 ILE n 
1 141 LYS n 
1 142 VAL n 
1 143 ILE n 
1 144 ALA n 
1 145 PRO n 
1 146 TRP n 
1 147 ARG n 
1 148 MET n 
1 149 PRO n 
1 150 GLU n 
1 151 PHE n 
1 152 TYR n 
1 153 ASN n 
1 154 ARG n 
1 155 PHE n 
1 156 LYS n 
1 157 GLY n 
1 158 ARG n 
1 159 ASN n 
1 160 ASP n 
1 161 LEU n 
1 162 MET n 
1 163 GLU n 
1 164 TYR n 
1 165 ALA n 
1 166 LYS n 
1 167 GLN n 
1 168 HIS n 
1 169 GLY n 
1 170 ILE n 
1 171 PRO n 
1 172 ILE n 
1 173 PRO n 
1 174 VAL n 
1 175 THR n 
1 176 PRO n 
1 177 LYS n 
1 178 ASN n 
1 179 PRO n 
1 180 TRP n 
1 181 SER n 
1 182 MET n 
1 183 ASP n 
1 184 GLU n 
1 185 ASN n 
1 186 LEU n 
1 187 MET n 
1 188 HIS n 
1 189 ILE n 
1 190 SER n 
1 191 TYR n 
1 192 GLU n 
1 193 ALA n 
1 194 GLY n 
1 195 ILE n 
1 196 LEU n 
1 197 GLU n 
1 198 ASN n 
1 199 PRO n 
1 200 LYS n 
1 201 ASN n 
1 202 GLN n 
1 203 ALA n 
1 204 PRO n 
1 205 PRO n 
1 206 GLY n 
1 207 LEU n 
1 208 TYR n 
1 209 THR n 
1 210 LYS n 
1 211 THR n 
1 212 GLN n 
1 213 ASP n 
1 214 PRO n 
1 215 ALA n 
1 216 LYS n 
1 217 ALA n 
1 218 PRO n 
1 219 ASN n 
1 220 THR n 
1 221 PRO n 
1 222 ASP n 
1 223 ILE n 
1 224 LEU n 
1 225 GLU n 
1 226 ILE n 
1 227 GLU n 
1 228 PHE n 
1 229 LYS n 
1 230 LYS n 
1 231 GLY n 
1 232 VAL n 
1 233 PRO n 
1 234 VAL n 
1 235 LYS n 
1 236 VAL n 
1 237 THR n 
1 238 ASN n 
1 239 VAL n 
1 240 LYS n 
1 241 ASP n 
1 242 GLY n 
1 243 THR n 
1 244 THR n 
1 245 HIS n 
1 246 GLN n 
1 247 THR n 
1 248 SER n 
1 249 LEU n 
1 250 GLU n 
1 251 LEU n 
1 252 PHE n 
1 253 MET n 
1 254 TYR n 
1 255 LEU n 
1 256 ASN n 
1 257 GLU n 
1 258 VAL n 
1 259 ALA n 
1 260 GLY n 
1 261 LYS n 
1 262 HIS n 
1 263 GLY n 
1 264 VAL n 
1 265 GLY n 
1 266 ARG n 
1 267 ILE n 
1 268 ASP n 
1 269 ILE n 
1 270 VAL n 
1 271 GLU n 
1 272 ASN n 
1 273 ARG n 
1 274 PHE n 
1 275 ILE n 
1 276 GLY n 
1 277 MET n 
1 278 LYS n 
1 279 SER n 
1 280 ARG n 
1 281 GLY n 
1 282 ILE n 
1 283 TYR n 
1 284 GLU n 
1 285 THR n 
1 286 PRO n 
1 287 ALA n 
1 288 GLY n 
1 289 THR n 
1 290 ILE n 
1 291 LEU n 
1 292 TYR n 
1 293 HIS n 
1 294 ALA n 
1 295 HIS n 
1 296 LEU n 
1 297 ASP n 
1 298 ILE n 
1 299 GLU n 
1 300 ALA n 
1 301 PHE n 
1 302 THR n 
1 303 MET n 
1 304 ASP n 
1 305 ARG n 
1 306 GLU n 
1 307 VAL n 
1 308 ARG n 
1 309 LYS n 
1 310 ILE n 
1 311 LYS n 
1 312 GLN n 
1 313 GLY n 
1 314 LEU n 
1 315 GLY n 
1 316 LEU n 
1 317 LYS n 
1 318 PHE n 
1 319 ALA n 
1 320 GLU n 
1 321 LEU n 
1 322 VAL n 
1 323 TYR n 
1 324 THR n 
1 325 GLY n 
1 326 PHE n 
1 327 TRP n 
1 328 HIS n 
1 329 SER n 
1 330 PRO n 
1 331 GLU n 
1 332 CYS n 
1 333 GLU n 
1 334 PHE n 
1 335 VAL n 
1 336 ARG n 
1 337 HIS n 
1 338 CYS n 
1 339 ILE n 
1 340 ALA n 
1 341 LYS n 
1 342 SER n 
1 343 GLN n 
1 344 GLU n 
1 345 ARG n 
1 346 VAL n 
1 347 GLU n 
1 348 GLY n 
1 349 LYS n 
1 350 VAL n 
1 351 GLN n 
1 352 VAL n 
1 353 SER n 
1 354 VAL n 
1 355 LEU n 
1 356 LYS n 
1 357 GLY n 
1 358 GLN n 
1 359 VAL n 
1 360 TYR n 
1 361 ILE n 
1 362 LEU n 
1 363 GLY n 
1 364 ARG n 
1 365 GLU n 
1 366 SER n 
1 367 PRO n 
1 368 LEU n 
1 369 SER n 
1 370 LEU n 
1 371 TYR n 
1 372 ASN n 
1 373 GLU n 
1 374 GLU n 
1 375 LEU n 
1 376 VAL n 
1 377 SER n 
1 378 MET n 
1 379 ASN n 
1 380 VAL n 
1 381 GLN n 
1 382 GLY n 
1 383 ASP n 
1 384 TYR n 
1 385 GLU n 
1 386 PRO n 
1 387 THR n 
1 388 ASP n 
1 389 ALA n 
1 390 THR n 
1 391 GLY n 
1 392 PHE n 
1 393 ILE n 
1 394 ASN n 
1 395 ILE n 
1 396 ASN n 
1 397 SER n 
1 398 LEU n 
1 399 ARG n 
1 400 LEU n 
1 401 LYS n 
1 402 GLU n 
1 403 TYR n 
1 404 HIS n 
1 405 ARG n 
1 406 LEU n 
1 407 GLN n 
1 408 SER n 
1 409 LYS n 
1 410 VAL n 
1 411 THR n 
1 412 ALA n 
1 413 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'ASS1, ASS' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL-21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PNIC-BSA4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ASSY_HUMAN 
_struct_ref.pdbx_db_accession          P00966 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSS
ALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATGKGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDL
MEYAKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAEL
VYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYILGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLK
EYHRLQSKVTAK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NZ2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 413 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00966 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  412 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       412 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2NZ2 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P00966 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'CLONING ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            0 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CIR 'L-peptide linking' n CITRULLINE      ? 'C6 H13 N3 O3'   175.186 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2NZ2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.34 
_exptl_crystal.density_percent_sol   47.44 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '16% PEG 3350, 0.15M DL-MALIC ACID, pH 7.0, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2006-08-21 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Double Crystal Monochromator, Si-111 crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95373 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.95373 
# 
_reflns.entry_id                     2NZ2 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   17358 
_reflns.number_all                   17403 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.152 
_reflns.pdbx_Rsym_value              0.205 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        28.8 
_reflns.pdbx_redundancy              7.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.268 
_reflns_shell.pdbx_Rsym_value        0.455 
_reflns_shell.meanI_over_sigI_obs    3.98 
_reflns_shell.pdbx_redundancy        7.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1967 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2NZ2 
_refine.ls_number_reflns_obs                     16407 
_refine.ls_number_reflns_all                     16407 
_refine.pdbx_ls_sigma_I                          2.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.41 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    100.00 
_refine.ls_R_factor_obs                          0.19757 
_refine.ls_R_factor_all                          0.19757 
_refine.ls_R_factor_R_work                       0.1939 
_refine.ls_R_factor_R_free                       0.26475 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  864 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.926 
_refine.correlation_coeff_Fo_to_Fc_free          0.857 
_refine.B_iso_mean                               17.865 
_refine.aniso_B[1][1]                            1.05 
_refine.aniso_B[2][2]                            0.30 
_refine.aniso_B[3][3]                            -1.36 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1VL2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.530 
_refine.pdbx_overall_ESU_R_Free                  0.295 
_refine.overall_SU_ML                            0.218 
_refine.overall_SU_B                             9.151 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3191 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             210 
_refine_hist.number_atoms_total               3423 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        19.41 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.014  0.022  ? 3277 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.858  1.968  ? 4427 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       14.546 5.000  ? 398  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       39.051 24.238 ? 151  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.682 15.000 ? 576  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       15.730 15.000 ? 19   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.162  0.200  ? 480  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.005  0.020  ? 2478 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.229  0.200  ? 1546 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 2179 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.195  0.200  ? 217  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.264  0.200  ? 125  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.223  0.200  ? 25   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.669  1.500  ? 2061 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.108  2.000  ? 3220 'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.726  3.000  ? 1396 'X-RAY DIFFRACTION' ? 
r_scangle_it                 2.667  4.500  ? 1207 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.461 
_refine_ls_shell.number_reflns_R_work             1173 
_refine_ls_shell.R_factor_R_work                  0.191 
_refine_ls_shell.percent_reflns_obs               100.00 
_refine_ls_shell.R_factor_R_free                  0.259 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             62 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                1967 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NZ2 
_struct.title                     'Crystal structure of human argininosuccinate synthase in complex with aspartate and citrulline' 
_struct.pdbx_descriptor           'Argininosuccinate synthase (E.C.6.3.4.5)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NZ2 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            
'Amino-acid biosynthesis, synthase, aspartate, citrulline, Structural Genomics, Structural Genomics Consortium, SGC, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 15  ? GLN A 28  ? GLY A 14  GLN A 27  1 ? 14 
HELX_P HELX_P2  2  ASP A 44  ? GLY A 56  ? ASP A 43  GLY A 55  1 ? 13 
HELX_P HELX_P3  3  VAL A 65  ? PHE A 73  ? VAL A 64  PHE A 72  1 ? 9  
HELX_P HELX_P4  4  PHE A 73  ? SER A 80  ? PHE A 72  SER A 79  1 ? 8  
HELX_P HELX_P5  5  LEU A 83  ? ARG A 87  ? LEU A 82  ARG A 86  5 ? 5  
HELX_P HELX_P6  6  LEU A 94  ? GLY A 111 ? LEU A 93  GLY A 110 1 ? 18 
HELX_P HELX_P7  7  ASN A 124 ? ALA A 137 ? ASN A 123 ALA A 136 1 ? 14 
HELX_P HELX_P8  8  ALA A 144 ? ARG A 147 ? ALA A 143 ARG A 146 5 ? 4  
HELX_P HELX_P9  9  MET A 148 ? ASN A 153 ? MET A 147 ASN A 152 1 ? 6  
HELX_P HELX_P10 10 ARG A 158 ? HIS A 168 ? ARG A 157 HIS A 167 1 ? 11 
HELX_P HELX_P11 11 ALA A 193 ? ASN A 198 ? ALA A 192 ASN A 197 5 ? 6  
HELX_P HELX_P12 12 PRO A 204 ? TYR A 208 ? PRO A 203 TYR A 207 5 ? 5  
HELX_P HELX_P13 13 THR A 247 ? GLY A 263 ? THR A 246 GLY A 262 1 ? 17 
HELX_P HELX_P14 14 THR A 285 ? MET A 303 ? THR A 284 MET A 302 1 ? 19 
HELX_P HELX_P15 15 ASP A 304 ? GLY A 325 ? ASP A 303 GLY A 324 1 ? 22 
HELX_P HELX_P16 16 SER A 329 ? GLN A 343 ? SER A 328 GLN A 342 1 ? 15 
HELX_P HELX_P17 17 ASN A 372 ? SER A 377 ? ASN A 371 SER A 376 1 ? 6  
HELX_P HELX_P18 18 GLU A 385 ? LEU A 406 ? GLU A 384 LEU A 405 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 59  ? ASP A 64  ? LYS A 58  ASP A 63  
A 2 TYR A 30  ? ASN A 38  ? TYR A 29  ASN A 37  
A 3 GLY A 6   ? ALA A 11  ? GLY A 5   ALA A 10  
A 4 TYR A 114 ? SER A 116 ? TYR A 113 SER A 115 
A 5 LYS A 141 ? ILE A 143 ? LYS A 140 ILE A 142 
B 1 MET A 182 ? GLU A 184 ? MET A 181 GLU A 183 
B 2 ILE A 189 ? TYR A 191 ? ILE A 188 TYR A 190 
B 3 LYS A 278 ? GLU A 284 ? LYS A 277 GLU A 283 
B 4 ARG A 266 ? ASN A 272 ? ARG A 265 ASN A 271 
C 1 THR A 244 ? HIS A 245 ? THR A 243 HIS A 244 
C 2 VAL A 232 ? ASN A 238 ? VAL A 231 ASN A 237 
C 3 ASP A 222 ? LYS A 229 ? ASP A 221 LYS A 228 
C 4 GLY A 348 ? LEU A 355 ? GLY A 347 LEU A 354 
C 5 GLN A 358 ? GLU A 365 ? GLN A 357 GLU A 364 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 63  ? O GLU A 62  N ASN A 38  ? N ASN A 37  
A 2 3 O ILE A 33  ? O ILE A 32  N VAL A 8   ? N VAL A 7   
A 3 4 N ALA A 11  ? N ALA A 10  O SER A 116 ? O SER A 115 
A 4 5 N VAL A 115 ? N VAL A 114 O LYS A 141 ? O LYS A 140 
B 1 2 N ASP A 183 ? N ASP A 182 O SER A 190 ? O SER A 189 
B 2 3 N TYR A 191 ? N TYR A 190 O ILE A 282 ? O ILE A 281 
B 3 4 O SER A 279 ? O SER A 278 N GLU A 271 ? N GLU A 270 
C 1 2 O HIS A 245 ? O HIS A 244 N VAL A 236 ? N VAL A 235 
C 2 3 O VAL A 234 ? O VAL A 233 N GLU A 227 ? N GLU A 226 
C 3 4 N ILE A 226 ? N ILE A 225 O VAL A 350 ? O VAL A 349 
C 4 5 N GLN A 351 ? N GLN A 350 O LEU A 362 ? O LEU A 361 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE NA A 503'  
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE ASP A 501' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CIR A 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 1  GLN A 108 ? GLN A 107 . ? 1_555 ? 
2  AC2 10 ALA A 119 ? ALA A 118 . ? 1_555 ? 
3  AC2 10 THR A 120 ? THR A 119 . ? 1_555 ? 
4  AC2 10 GLY A 123 ? GLY A 122 . ? 1_555 ? 
5  AC2 10 ASN A 124 ? ASN A 123 . ? 1_555 ? 
6  AC2 10 ASP A 125 ? ASP A 124 . ? 1_555 ? 
7  AC2 10 GLU A 192 ? GLU A 191 . ? 1_555 ? 
8  AC2 10 CIR D .   ? CIR A 502 . ? 1_555 ? 
9  AC2 10 HOH E .   ? HOH A 511 . ? 1_555 ? 
10 AC2 10 HOH E .   ? HOH A 569 . ? 1_555 ? 
11 AC2 10 HOH E .   ? HOH A 664 . ? 1_555 ? 
12 AC3 15 TYR A 88  ? TYR A 87  . ? 1_555 ? 
13 AC3 15 THR A 92  ? THR A 91  . ? 1_555 ? 
14 AC3 15 ASN A 124 ? ASN A 123 . ? 1_555 ? 
15 AC3 15 ASP A 125 ? ASP A 124 . ? 1_555 ? 
16 AC3 15 ARG A 128 ? ARG A 127 . ? 1_555 ? 
17 AC3 15 SER A 181 ? SER A 180 . ? 1_555 ? 
18 AC3 15 MET A 182 ? MET A 181 . ? 1_555 ? 
19 AC3 15 ASP A 183 ? ASP A 182 . ? 1_555 ? 
20 AC3 15 SER A 190 ? SER A 189 . ? 1_555 ? 
21 AC3 15 GLU A 192 ? GLU A 191 . ? 1_555 ? 
22 AC3 15 GLU A 271 ? GLU A 270 . ? 1_555 ? 
23 AC3 15 TYR A 283 ? TYR A 282 . ? 1_555 ? 
24 AC3 15 ASP C .   ? ASP A 501 . ? 1_555 ? 
25 AC3 15 HOH E .   ? HOH A 569 . ? 1_555 ? 
26 AC3 15 HOH E .   ? HOH A 647 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2NZ2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2NZ2 
_atom_sites.fract_transf_matrix[1][1]   0.010423 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008513 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006445 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 5   ? -20.905 45.877 31.541 1.00 27.12 ? 4   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 5   ? -21.009 47.364 31.314 1.00 27.21 ? 4   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 5   ? -19.804 48.197 31.815 1.00 26.80 ? 4   LYS A C   1 
ATOM   4    O  O   . LYS A 1 5   ? -19.100 47.842 32.767 1.00 26.61 ? 4   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 5   ? -22.322 47.914 31.899 1.00 27.86 ? 4   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 5   ? -22.697 49.326 31.425 1.00 28.84 ? 4   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 5   ? -24.199 49.471 31.234 1.00 30.65 ? 4   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 5   ? -24.467 49.907 29.822 1.00 31.43 ? 4   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 5   ? -25.275 51.152 29.795 1.00 34.91 ? 4   LYS A NZ  1 
ATOM   10   N  N   . GLY A 1 6   ? -19.615 49.344 31.172 1.00 26.47 ? 5   GLY A N   1 
ATOM   11   C  CA  . GLY A 1 6   ? -18.418 50.151 31.327 1.00 25.08 ? 5   GLY A CA  1 
ATOM   12   C  C   . GLY A 1 6   ? -17.583 50.057 30.063 1.00 23.92 ? 5   GLY A C   1 
ATOM   13   O  O   . GLY A 1 6   ? -17.995 49.464 29.074 1.00 23.28 ? 5   GLY A O   1 
ATOM   14   N  N   . SER A 1 7   ? -16.394 50.637 30.124 1.00 23.39 ? 6   SER A N   1 
ATOM   15   C  CA  . SER A 1 7   ? -15.535 50.797 28.980 1.00 22.67 ? 6   SER A CA  1 
ATOM   16   C  C   . SER A 1 7   ? -14.373 49.812 29.074 1.00 22.07 ? 6   SER A C   1 
ATOM   17   O  O   . SER A 1 7   ? -13.806 49.607 30.149 1.00 21.98 ? 6   SER A O   1 
ATOM   18   C  CB  . SER A 1 7   ? -15.023 52.236 28.936 1.00 22.99 ? 6   SER A CB  1 
ATOM   19   O  OG  . SER A 1 7   ? -14.297 52.498 27.744 1.00 24.51 ? 6   SER A OG  1 
ATOM   20   N  N   . VAL A 1 8   ? -14.039 49.203 27.936 1.00 21.03 ? 7   VAL A N   1 
ATOM   21   C  CA  . VAL A 1 8   ? -12.953 48.233 27.850 1.00 19.81 ? 7   VAL A CA  1 
ATOM   22   C  C   . VAL A 1 8   ? -11.986 48.587 26.723 1.00 19.39 ? 7   VAL A C   1 
ATOM   23   O  O   . VAL A 1 8   ? -12.414 48.932 25.611 1.00 18.92 ? 7   VAL A O   1 
ATOM   24   C  CB  . VAL A 1 8   ? -13.476 46.768 27.733 1.00 19.71 ? 7   VAL A CB  1 
ATOM   25   C  CG1 . VAL A 1 8   ? -14.298 46.540 26.479 1.00 18.58 ? 7   VAL A CG1 1 
ATOM   26   C  CG2 . VAL A 1 8   ? -12.326 45.782 27.810 1.00 20.06 ? 7   VAL A CG2 1 
ATOM   27   N  N   . VAL A 1 9   ? -10.686 48.554 27.031 1.00 18.23 ? 8   VAL A N   1 
ATOM   28   C  CA  . VAL A 1 9   ? -9.681  48.701 25.997 1.00 17.78 ? 8   VAL A CA  1 
ATOM   29   C  C   . VAL A 1 9   ? -9.241  47.311 25.541 1.00 17.64 ? 8   VAL A C   1 
ATOM   30   O  O   . VAL A 1 9   ? -8.661  46.538 26.309 1.00 17.43 ? 8   VAL A O   1 
ATOM   31   C  CB  . VAL A 1 9   ? -8.482  49.539 26.442 1.00 18.11 ? 8   VAL A CB  1 
ATOM   32   C  CG1 . VAL A 1 9   ? -7.462  49.624 25.312 1.00 17.98 ? 8   VAL A CG1 1 
ATOM   33   C  CG2 . VAL A 1 9   ? -8.931  50.944 26.852 1.00 17.83 ? 8   VAL A CG2 1 
ATOM   34   N  N   . LEU A 1 10  ? -9.577  46.992 24.293 1.00 17.01 ? 9   LEU A N   1 
ATOM   35   C  CA  . LEU A 1 10  ? -9.272  45.707 23.710 1.00 16.62 ? 9   LEU A CA  1 
ATOM   36   C  C   . LEU A 1 10  ? -8.046  45.820 22.809 1.00 16.33 ? 9   LEU A C   1 
ATOM   37   O  O   . LEU A 1 10  ? -8.026  46.633 21.901 1.00 17.31 ? 9   LEU A O   1 
ATOM   38   C  CB  . LEU A 1 10  ? -10.497 45.164 22.943 1.00 16.09 ? 9   LEU A CB  1 
ATOM   39   C  CG  . LEU A 1 10  ? -10.254 43.981 21.988 1.00 16.51 ? 9   LEU A CG  1 
ATOM   40   C  CD1 . LEU A 1 10  ? -9.863  42.729 22.754 1.00 13.65 ? 9   LEU A CD1 1 
ATOM   41   C  CD2 . LEU A 1 10  ? -11.445 43.727 21.006 1.00 16.32 ? 9   LEU A CD2 1 
ATOM   42   N  N   . ALA A 1 11  ? -7.021  45.018 23.076 1.00 16.16 ? 10  ALA A N   1 
ATOM   43   C  CA  . ALA A 1 11  ? -5.902  44.869 22.145 1.00 16.03 ? 10  ALA A CA  1 
ATOM   44   C  C   . ALA A 1 11  ? -6.416  44.174 20.903 1.00 16.20 ? 10  ALA A C   1 
ATOM   45   O  O   . ALA A 1 11  ? -6.710  42.971 20.899 1.00 16.08 ? 10  ALA A O   1 
ATOM   46   C  CB  . ALA A 1 11  ? -4.776  44.081 22.763 1.00 15.78 ? 10  ALA A CB  1 
ATOM   47   N  N   . TYR A 1 12  ? -6.526  44.958 19.853 1.00 16.63 ? 11  TYR A N   1 
ATOM   48   C  CA  . TYR A 1 12  ? -7.217  44.575 18.645 1.00 17.95 ? 11  TYR A CA  1 
ATOM   49   C  C   . TYR A 1 12  ? -6.222  44.501 17.509 1.00 18.56 ? 11  TYR A C   1 
ATOM   50   O  O   . TYR A 1 12  ? -5.327  45.325 17.424 1.00 19.45 ? 11  TYR A O   1 
ATOM   51   C  CB  . TYR A 1 12  ? -8.252  45.666 18.372 1.00 18.21 ? 11  TYR A CB  1 
ATOM   52   C  CG  . TYR A 1 12  ? -9.044  45.494 17.127 1.00 18.80 ? 11  TYR A CG  1 
ATOM   53   C  CD1 . TYR A 1 12  ? -9.983  44.460 17.008 1.00 20.24 ? 11  TYR A CD1 1 
ATOM   54   C  CD2 . TYR A 1 12  ? -8.878  46.367 16.053 1.00 17.61 ? 11  TYR A CD2 1 
ATOM   55   C  CE1 . TYR A 1 12  ? -10.737 44.306 15.828 1.00 20.77 ? 11  TYR A CE1 1 
ATOM   56   C  CE2 . TYR A 1 12  ? -9.629  46.227 14.881 1.00 18.13 ? 11  TYR A CE2 1 
ATOM   57   C  CZ  . TYR A 1 12  ? -10.552 45.204 14.781 1.00 18.91 ? 11  TYR A CZ  1 
ATOM   58   O  OH  . TYR A 1 12  ? -11.270 45.054 13.634 1.00 19.89 ? 11  TYR A OH  1 
ATOM   59   N  N   . SER A 1 13  ? -6.359  43.518 16.635 1.00 19.62 ? 12  SER A N   1 
ATOM   60   C  CA  . SER A 1 13  ? -5.438  43.368 15.515 1.00 20.44 ? 12  SER A CA  1 
ATOM   61   C  C   . SER A 1 13  ? -6.151  43.419 14.159 1.00 21.49 ? 12  SER A C   1 
ATOM   62   O  O   . SER A 1 13  ? -5.526  43.660 13.115 1.00 22.29 ? 12  SER A O   1 
ATOM   63   C  CB  . SER A 1 13  ? -4.669  42.061 15.651 1.00 20.68 ? 12  SER A CB  1 
ATOM   64   O  OG  . SER A 1 13  ? -5.555  40.948 15.745 1.00 21.92 ? 12  SER A OG  1 
ATOM   65   N  N   . GLY A 1 14  ? -7.458  43.186 14.171 1.00 22.14 ? 13  GLY A N   1 
ATOM   66   C  CA  . GLY A 1 14  ? -8.234  43.167 12.940 1.00 22.50 ? 13  GLY A CA  1 
ATOM   67   C  C   . GLY A 1 14  ? -8.532  41.783 12.396 1.00 22.61 ? 13  GLY A C   1 
ATOM   68   O  O   . GLY A 1 14  ? -9.184  41.666 11.372 1.00 23.30 ? 13  GLY A O   1 
ATOM   69   N  N   . GLY A 1 15  ? -8.056  40.736 13.072 1.00 22.74 ? 14  GLY A N   1 
ATOM   70   C  CA  . GLY A 1 15  ? -8.280  39.358 12.632 1.00 22.23 ? 14  GLY A CA  1 
ATOM   71   C  C   . GLY A 1 15  ? -9.570  38.817 13.207 1.00 22.71 ? 14  GLY A C   1 
ATOM   72   O  O   . GLY A 1 15  ? -10.251 39.514 13.990 1.00 23.16 ? 14  GLY A O   1 
ATOM   73   N  N   . LEU A 1 16  ? -9.914  37.583 12.822 1.00 22.36 ? 15  LEU A N   1 
ATOM   74   C  CA  . LEU A 1 16  ? -11.172 36.949 13.221 1.00 22.09 ? 15  LEU A CA  1 
ATOM   75   C  C   . LEU A 1 16  ? -11.400 36.952 14.740 1.00 22.06 ? 15  LEU A C   1 
ATOM   76   O  O   . LEU A 1 16  ? -12.422 37.441 15.192 1.00 22.27 ? 15  LEU A O   1 
ATOM   77   C  CB  . LEU A 1 16  ? -11.286 35.521 12.643 1.00 22.42 ? 15  LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 16  ? -12.623 34.747 12.777 1.00 22.37 ? 15  LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 16  ? -13.722 35.414 11.970 1.00 21.32 ? 15  LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 16  ? -12.482 33.277 12.365 1.00 22.01 ? 15  LEU A CD2 1 
ATOM   81   N  N   . ASP A 1 17  ? -10.457 36.424 15.524 1.00 22.00 ? 16  ASP A N   1 
ATOM   82   C  CA  . ASP A 1 17  ? -10.625 36.387 16.986 1.00 22.08 ? 16  ASP A CA  1 
ATOM   83   C  C   . ASP A 1 17  ? -11.055 37.749 17.556 1.00 21.24 ? 16  ASP A C   1 
ATOM   84   O  O   . ASP A 1 17  ? -12.159 37.845 18.119 1.00 21.83 ? 16  ASP A O   1 
ATOM   85   C  CB  . ASP A 1 17  ? -9.363  35.865 17.711 1.00 22.72 ? 16  ASP A CB  1 
ATOM   86   C  CG  . ASP A 1 17  ? -9.099  34.378 17.456 1.00 25.72 ? 16  ASP A CG  1 
ATOM   87   O  OD1 . ASP A 1 17  ? -9.297  33.911 16.306 1.00 27.67 ? 16  ASP A OD1 1 
ATOM   88   O  OD2 . ASP A 1 17  ? -8.669  33.679 18.408 1.00 28.42 ? 16  ASP A OD2 1 
ATOM   89   N  N   . THR A 1 18  ? -10.217 38.788 17.370 1.00 19.35 ? 17  THR A N   1 
ATOM   90   C  CA  . THR A 1 18  ? -10.412 40.116 17.986 1.00 17.97 ? 17  THR A CA  1 
ATOM   91   C  C   . THR A 1 18  ? -11.486 41.014 17.346 1.00 17.53 ? 17  THR A C   1 
ATOM   92   O  O   . THR A 1 18  ? -11.953 41.964 17.968 1.00 17.37 ? 17  THR A O   1 
ATOM   93   C  CB  . THR A 1 18  ? -9.079  40.919 18.119 1.00 17.88 ? 17  THR A CB  1 
ATOM   94   O  OG1 . THR A 1 18  ? -8.506  41.166 16.817 1.00 17.44 ? 17  THR A OG1 1 
ATOM   95   C  CG2 . THR A 1 18  ? -8.093  40.184 19.010 1.00 16.27 ? 17  THR A CG2 1 
ATOM   96   N  N   . SER A 1 19  ? -11.834 40.739 16.095 1.00 17.77 ? 18  SER A N   1 
ATOM   97   C  CA  . SER A 1 19  ? -13.054 41.255 15.486 1.00 18.23 ? 18  SER A CA  1 
ATOM   98   C  C   . SER A 1 19  ? -14.282 40.690 16.179 1.00 18.04 ? 18  SER A C   1 
ATOM   99   O  O   . SER A 1 19  ? -15.230 41.427 16.460 1.00 17.76 ? 18  SER A O   1 
ATOM   100  C  CB  . SER A 1 19  ? -13.114 40.865 14.017 1.00 18.28 ? 18  SER A CB  1 
ATOM   101  O  OG  . SER A 1 19  ? -11.997 41.413 13.344 1.00 22.30 ? 18  SER A OG  1 
ATOM   102  N  N   . CYS A 1 20  ? -14.271 39.380 16.437 1.00 17.93 ? 19  CYS A N   1 
ATOM   103  C  CA  . CYS A 1 20  ? -15.417 38.717 17.064 1.00 18.07 ? 19  CYS A CA  1 
ATOM   104  C  C   . CYS A 1 20  ? -15.543 39.197 18.502 1.00 17.92 ? 19  CYS A C   1 
ATOM   105  O  O   . CYS A 1 20  ? -16.629 39.590 18.931 1.00 17.32 ? 19  CYS A O   1 
ATOM   106  C  CB  . CYS A 1 20  ? -15.312 37.186 16.985 1.00 18.01 ? 19  CYS A CB  1 
ATOM   107  S  SG  . CYS A 1 20  ? -15.530 36.504 15.298 1.00 17.52 ? 19  CYS A SG  1 
ATOM   108  N  N   . ILE A 1 21  ? -14.410 39.222 19.212 1.00 17.89 ? 20  ILE A N   1 
ATOM   109  C  CA  . ILE A 1 21  ? -14.360 39.689 20.618 1.00 17.65 ? 20  ILE A CA  1 
ATOM   110  C  C   . ILE A 1 21  ? -14.894 41.129 20.775 1.00 17.36 ? 20  ILE A C   1 
ATOM   111  O  O   . ILE A 1 21  ? -15.653 41.415 21.701 1.00 17.18 ? 20  ILE A O   1 
ATOM   112  C  CB  . ILE A 1 21  ? -12.938 39.492 21.238 1.00 17.15 ? 20  ILE A CB  1 
ATOM   113  C  CG1 . ILE A 1 21  ? -12.706 38.001 21.475 1.00 17.17 ? 20  ILE A CG1 1 
ATOM   114  C  CG2 . ILE A 1 21  ? -12.781 40.278 22.539 1.00 16.89 ? 20  ILE A CG2 1 
ATOM   115  C  CD1 . ILE A 1 21  ? -11.276 37.561 21.556 1.00 14.43 ? 20  ILE A CD1 1 
ATOM   116  N  N   . LEU A 1 22  ? -14.510 42.016 19.860 1.00 17.07 ? 21  LEU A N   1 
ATOM   117  C  CA  . LEU A 1 22  ? -15.063 43.373 19.831 1.00 17.13 ? 21  LEU A CA  1 
ATOM   118  C  C   . LEU A 1 22  ? -16.599 43.335 19.876 1.00 17.40 ? 21  LEU A C   1 
ATOM   119  O  O   . LEU A 1 22  ? -17.224 43.949 20.751 1.00 17.11 ? 21  LEU A O   1 
ATOM   120  C  CB  . LEU A 1 22  ? -14.576 44.126 18.588 1.00 16.76 ? 21  LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 22  ? -14.524 45.664 18.562 1.00 16.13 ? 21  LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 22  ? -13.813 46.146 17.283 1.00 11.69 ? 21  LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 22  ? -15.897 46.294 18.690 1.00 14.90 ? 21  LEU A CD2 1 
ATOM   124  N  N   . VAL A 1 23  ? -17.187 42.574 18.953 1.00 18.15 ? 22  VAL A N   1 
ATOM   125  C  CA  . VAL A 1 23  ? -18.637 42.487 18.800 1.00 18.33 ? 22  VAL A CA  1 
ATOM   126  C  C   . VAL A 1 23  ? -19.241 41.839 20.037 1.00 19.05 ? 22  VAL A C   1 
ATOM   127  O  O   . VAL A 1 23  ? -20.258 42.326 20.568 1.00 20.01 ? 22  VAL A O   1 
ATOM   128  C  CB  . VAL A 1 23  ? -19.025 41.763 17.472 1.00 18.39 ? 22  VAL A CB  1 
ATOM   129  C  CG1 . VAL A 1 23  ? -20.533 41.448 17.392 1.00 18.15 ? 22  VAL A CG1 1 
ATOM   130  C  CG2 . VAL A 1 23  ? -18.607 42.619 16.271 1.00 18.30 ? 22  VAL A CG2 1 
ATOM   131  N  N   . TRP A 1 24  ? -18.594 40.776 20.519 1.00 19.32 ? 23  TRP A N   1 
ATOM   132  C  CA  . TRP A 1 24  ? -19.041 40.037 21.716 1.00 19.50 ? 23  TRP A CA  1 
ATOM   133  C  C   . TRP A 1 24  ? -19.075 40.889 22.996 1.00 20.44 ? 23  TRP A C   1 
ATOM   134  O  O   . TRP A 1 24  ? -20.068 40.874 23.702 1.00 21.01 ? 23  TRP A O   1 
ATOM   135  C  CB  . TRP A 1 24  ? -18.196 38.771 21.909 1.00 18.56 ? 23  TRP A CB  1 
ATOM   136  C  CG  . TRP A 1 24  ? -18.662 37.857 23.038 1.00 18.17 ? 23  TRP A CG  1 
ATOM   137  C  CD1 . TRP A 1 24  ? -19.634 36.890 22.970 1.00 16.56 ? 23  TRP A CD1 1 
ATOM   138  C  CD2 . TRP A 1 24  ? -18.141 37.797 24.370 1.00 16.35 ? 23  TRP A CD2 1 
ATOM   139  N  NE1 . TRP A 1 24  ? -19.762 36.263 24.169 1.00 16.02 ? 23  TRP A NE1 1 
ATOM   140  C  CE2 . TRP A 1 24  ? -18.860 36.791 25.051 1.00 16.92 ? 23  TRP A CE2 1 
ATOM   141  C  CE3 . TRP A 1 24  ? -17.136 38.496 25.056 1.00 16.52 ? 23  TRP A CE3 1 
ATOM   142  C  CZ2 . TRP A 1 24  ? -18.612 36.473 26.385 1.00 18.17 ? 23  TRP A CZ2 1 
ATOM   143  C  CZ3 . TRP A 1 24  ? -16.889 38.186 26.384 1.00 16.41 ? 23  TRP A CZ3 1 
ATOM   144  C  CH2 . TRP A 1 24  ? -17.617 37.191 27.034 1.00 18.12 ? 23  TRP A CH2 1 
ATOM   145  N  N   . LEU A 1 25  ? -18.006 41.639 23.281 1.00 21.73 ? 24  LEU A N   1 
ATOM   146  C  CA  . LEU A 1 25  ? -17.944 42.539 24.453 1.00 22.63 ? 24  LEU A CA  1 
ATOM   147  C  C   . LEU A 1 25  ? -18.983 43.648 24.354 1.00 23.65 ? 24  LEU A C   1 
ATOM   148  O  O   . LEU A 1 25  ? -19.505 44.111 25.374 1.00 24.17 ? 24  LEU A O   1 
ATOM   149  C  CB  . LEU A 1 25  ? -16.558 43.199 24.584 1.00 22.46 ? 24  LEU A CB  1 
ATOM   150  C  CG  . LEU A 1 25  ? -15.301 42.392 24.938 1.00 21.68 ? 24  LEU A CG  1 
ATOM   151  C  CD1 . LEU A 1 25  ? -14.068 43.083 24.373 1.00 18.66 ? 24  LEU A CD1 1 
ATOM   152  C  CD2 . LEU A 1 25  ? -15.177 42.177 26.441 1.00 19.81 ? 24  LEU A CD2 1 
ATOM   153  N  N   . LYS A 1 26  ? -19.236 44.093 23.124 1.00 24.42 ? 25  LYS A N   1 
ATOM   154  C  CA  . LYS A 1 26  ? -20.283 45.056 22.819 1.00 25.80 ? 25  LYS A CA  1 
ATOM   155  C  C   . LYS A 1 26  ? -21.666 44.423 23.129 1.00 25.81 ? 25  LYS A C   1 
ATOM   156  O  O   . LYS A 1 26  ? -22.439 44.977 23.891 1.00 26.21 ? 25  LYS A O   1 
ATOM   157  C  CB  . LYS A 1 26  ? -20.146 45.504 21.354 1.00 25.46 ? 25  LYS A CB  1 
ATOM   158  C  CG  . LYS A 1 26  ? -20.978 46.712 20.923 1.00 27.71 ? 25  LYS A CG  1 
ATOM   159  C  CD  . LYS A 1 26  ? -20.874 46.926 19.389 1.00 27.74 ? 25  LYS A CD  1 
ATOM   160  C  CE  . LYS A 1 26  ? -21.955 46.125 18.613 1.00 31.52 ? 25  LYS A CE  1 
ATOM   161  N  NZ  . LYS A 1 26  ? -21.613 45.817 17.172 1.00 30.34 ? 25  LYS A NZ  1 
ATOM   162  N  N   . GLU A 1 27  ? -21.953 43.243 22.581 1.00 26.36 ? 26  GLU A N   1 
ATOM   163  C  CA  . GLU A 1 27  ? -23.163 42.488 22.953 1.00 26.93 ? 26  GLU A CA  1 
ATOM   164  C  C   . GLU A 1 27  ? -23.310 42.273 24.464 1.00 26.26 ? 26  GLU A C   1 
ATOM   165  O  O   . GLU A 1 27  ? -24.429 42.145 24.958 1.00 26.55 ? 26  GLU A O   1 
ATOM   166  C  CB  . GLU A 1 27  ? -23.186 41.111 22.282 1.00 26.88 ? 26  GLU A CB  1 
ATOM   167  C  CG  . GLU A 1 27  ? -23.441 41.098 20.780 1.00 28.63 ? 26  GLU A CG  1 
ATOM   168  C  CD  . GLU A 1 27  ? -23.807 39.699 20.251 1.00 29.26 ? 26  GLU A CD  1 
ATOM   169  O  OE1 . GLU A 1 27  ? -24.861 39.600 19.582 1.00 31.69 ? 26  GLU A OE1 1 
ATOM   170  O  OE2 . GLU A 1 27  ? -23.056 38.710 20.499 1.00 30.92 ? 26  GLU A OE2 1 
ATOM   171  N  N   . GLN A 1 28  ? -22.191 42.213 25.191 1.00 25.40 ? 27  GLN A N   1 
ATOM   172  C  CA  . GLN A 1 28  ? -22.229 41.931 26.629 1.00 24.56 ? 27  GLN A CA  1 
ATOM   173  C  C   . GLN A 1 28  ? -22.508 43.164 27.505 1.00 24.25 ? 27  GLN A C   1 
ATOM   174  O  O   . GLN A 1 28  ? -22.641 43.036 28.732 1.00 24.16 ? 27  GLN A O   1 
ATOM   175  C  CB  . GLN A 1 28  ? -20.949 41.215 27.110 1.00 24.37 ? 27  GLN A CB  1 
ATOM   176  C  CG  . GLN A 1 28  ? -20.629 39.876 26.419 1.00 23.30 ? 27  GLN A CG  1 
ATOM   177  C  CD  . GLN A 1 28  ? -21.690 38.797 26.628 1.00 23.35 ? 27  GLN A CD  1 
ATOM   178  O  OE1 . GLN A 1 28  ? -22.077 38.504 27.761 1.00 24.46 ? 27  GLN A OE1 1 
ATOM   179  N  NE2 . GLN A 1 28  ? -22.144 38.185 25.536 1.00 22.03 ? 27  GLN A NE2 1 
ATOM   180  N  N   . GLY A 1 29  ? -22.586 44.346 26.892 1.00 23.33 ? 28  GLY A N   1 
ATOM   181  C  CA  . GLY A 1 29  ? -22.791 45.583 27.658 1.00 22.71 ? 28  GLY A CA  1 
ATOM   182  C  C   . GLY A 1 29  ? -21.695 46.641 27.584 1.00 22.53 ? 28  GLY A C   1 
ATOM   183  O  O   . GLY A 1 29  ? -21.972 47.831 27.775 1.00 23.05 ? 28  GLY A O   1 
ATOM   184  N  N   . TYR A 1 30  ? -20.462 46.226 27.297 1.00 21.91 ? 29  TYR A N   1 
ATOM   185  C  CA  . TYR A 1 30  ? -19.303 47.132 27.268 1.00 21.61 ? 29  TYR A CA  1 
ATOM   186  C  C   . TYR A 1 30  ? -19.268 48.111 26.094 1.00 21.20 ? 29  TYR A C   1 
ATOM   187  O  O   . TYR A 1 30  ? -19.769 47.813 25.017 1.00 21.00 ? 29  TYR A O   1 
ATOM   188  C  CB  . TYR A 1 30  ? -17.981 46.327 27.289 1.00 21.72 ? 29  TYR A CB  1 
ATOM   189  C  CG  . TYR A 1 30  ? -17.844 45.400 28.476 1.00 21.19 ? 29  TYR A CG  1 
ATOM   190  C  CD1 . TYR A 1 30  ? -17.260 45.840 29.658 1.00 20.40 ? 29  TYR A CD1 1 
ATOM   191  C  CD2 . TYR A 1 30  ? -18.329 44.094 28.423 1.00 21.74 ? 29  TYR A CD2 1 
ATOM   192  C  CE1 . TYR A 1 30  ? -17.158 45.005 30.757 1.00 21.84 ? 29  TYR A CE1 1 
ATOM   193  C  CE2 . TYR A 1 30  ? -18.225 43.238 29.516 1.00 21.67 ? 29  TYR A CE2 1 
ATOM   194  C  CZ  . TYR A 1 30  ? -17.636 43.699 30.680 1.00 22.01 ? 29  TYR A CZ  1 
ATOM   195  O  OH  . TYR A 1 30  ? -17.517 42.861 31.769 1.00 22.34 ? 29  TYR A OH  1 
ATOM   196  N  N   . ASP A 1 31  ? -18.685 49.283 26.343 1.00 21.15 ? 30  ASP A N   1 
ATOM   197  C  CA  . ASP A 1 31  ? -18.249 50.226 25.315 1.00 21.40 ? 30  ASP A CA  1 
ATOM   198  C  C   . ASP A 1 31  ? -16.820 49.835 24.946 1.00 21.28 ? 30  ASP A C   1 
ATOM   199  O  O   . ASP A 1 31  ? -15.939 49.789 25.822 1.00 21.70 ? 30  ASP A O   1 
ATOM   200  C  CB  . ASP A 1 31  ? -18.227 51.660 25.868 1.00 21.79 ? 30  ASP A CB  1 
ATOM   201  C  CG  . ASP A 1 31  ? -19.621 52.288 26.009 1.00 23.69 ? 30  ASP A CG  1 
ATOM   202  O  OD1 . ASP A 1 31  ? -20.475 52.105 25.114 1.00 24.05 ? 30  ASP A OD1 1 
ATOM   203  O  OD2 . ASP A 1 31  ? -19.847 53.002 27.021 1.00 26.36 ? 30  ASP A OD2 1 
ATOM   204  N  N   . VAL A 1 32  ? -16.563 49.535 23.680 1.00 20.50 ? 31  VAL A N   1 
ATOM   205  C  CA  . VAL A 1 32  ? -15.255 48.969 23.339 1.00 19.55 ? 31  VAL A CA  1 
ATOM   206  C  C   . VAL A 1 32  ? -14.345 50.019 22.720 1.00 19.05 ? 31  VAL A C   1 
ATOM   207  O  O   . VAL A 1 32  ? -14.743 50.709 21.782 1.00 18.90 ? 31  VAL A O   1 
ATOM   208  C  CB  . VAL A 1 32  ? -15.375 47.683 22.462 1.00 20.01 ? 31  VAL A CB  1 
ATOM   209  C  CG1 . VAL A 1 32  ? -13.993 47.101 22.115 1.00 19.60 ? 31  VAL A CG1 1 
ATOM   210  C  CG2 . VAL A 1 32  ? -16.213 46.626 23.175 1.00 18.84 ? 31  VAL A CG2 1 
ATOM   211  N  N   . ILE A 1 33  ? -13.141 50.159 23.288 1.00 17.98 ? 32  ILE A N   1 
ATOM   212  C  CA  . ILE A 1 33  ? -12.072 50.993 22.714 1.00 16.62 ? 32  ILE A CA  1 
ATOM   213  C  C   . ILE A 1 33  ? -11.129 50.051 21.960 1.00 16.53 ? 32  ILE A C   1 
ATOM   214  O  O   . ILE A 1 33  ? -10.500 49.199 22.564 1.00 16.51 ? 32  ILE A O   1 
ATOM   215  C  CB  . ILE A 1 33  ? -11.309 51.826 23.823 1.00 16.74 ? 32  ILE A CB  1 
ATOM   216  C  CG1 . ILE A 1 33  ? -12.249 52.821 24.514 1.00 14.33 ? 32  ILE A CG1 1 
ATOM   217  C  CG2 . ILE A 1 33  ? -10.110 52.597 23.247 1.00 15.64 ? 32  ILE A CG2 1 
ATOM   218  C  CD1 . ILE A 1 33  ? -11.928 53.057 25.942 1.00 12.71 ? 32  ILE A CD1 1 
ATOM   219  N  N   . ALA A 1 34  ? -11.058 50.180 20.638 1.00 16.18 ? 33  ALA A N   1 
ATOM   220  C  CA  . ALA A 1 34  ? -10.199 49.319 19.847 1.00 16.20 ? 33  ALA A CA  1 
ATOM   221  C  C   . ALA A 1 34  ? -8.773  49.895 19.820 1.00 16.33 ? 33  ALA A C   1 
ATOM   222  O  O   . ALA A 1 34  ? -8.575  51.066 19.479 1.00 15.85 ? 33  ALA A O   1 
ATOM   223  C  CB  . ALA A 1 34  ? -10.766 49.132 18.421 1.00 16.28 ? 33  ALA A CB  1 
ATOM   224  N  N   . TYR A 1 35  ? -7.796  49.077 20.223 1.00 16.01 ? 34  TYR A N   1 
ATOM   225  C  CA  . TYR A 1 35  ? -6.424  49.540 20.342 1.00 16.10 ? 34  TYR A CA  1 
ATOM   226  C  C   . TYR A 1 35  ? -5.489  48.751 19.444 1.00 16.54 ? 34  TYR A C   1 
ATOM   227  O  O   . TYR A 1 35  ? -5.213  47.571 19.664 1.00 15.85 ? 34  TYR A O   1 
ATOM   228  C  CB  . TYR A 1 35  ? -5.960  49.563 21.807 1.00 16.19 ? 34  TYR A CB  1 
ATOM   229  C  CG  . TYR A 1 35  ? -4.457  49.414 22.019 1.00 15.77 ? 34  TYR A CG  1 
ATOM   230  C  CD1 . TYR A 1 35  ? -3.563  50.363 21.532 1.00 13.38 ? 34  TYR A CD1 1 
ATOM   231  C  CD2 . TYR A 1 35  ? -3.938  48.303 22.713 1.00 16.33 ? 34  TYR A CD2 1 
ATOM   232  C  CE1 . TYR A 1 35  ? -2.195  50.214 21.726 1.00 16.10 ? 34  TYR A CE1 1 
ATOM   233  C  CE2 . TYR A 1 35  ? -2.570  48.149 22.924 1.00 14.96 ? 34  TYR A CE2 1 
ATOM   234  C  CZ  . TYR A 1 35  ? -1.700  49.109 22.432 1.00 16.33 ? 34  TYR A CZ  1 
ATOM   235  O  OH  . TYR A 1 35  ? -0.343  48.973 22.635 1.00 15.04 ? 34  TYR A OH  1 
ATOM   236  N  N   . LEU A 1 36  ? -5.006  49.452 18.419 1.00 17.34 ? 35  LEU A N   1 
ATOM   237  C  CA  . LEU A 1 36  ? -4.175  48.883 17.387 1.00 17.80 ? 35  LEU A CA  1 
ATOM   238  C  C   . LEU A 1 36  ? -2.759  49.301 17.702 1.00 17.75 ? 35  LEU A C   1 
ATOM   239  O  O   . LEU A 1 36  ? -2.388  50.466 17.523 1.00 17.09 ? 35  LEU A O   1 
ATOM   240  C  CB  . LEU A 1 36  ? -4.550  49.475 16.031 1.00 18.62 ? 35  LEU A CB  1 
ATOM   241  C  CG  . LEU A 1 36  ? -5.615  49.027 15.031 1.00 19.51 ? 35  LEU A CG  1 
ATOM   242  C  CD1 . LEU A 1 36  ? -5.088  47.866 14.202 1.00 18.60 ? 35  LEU A CD1 1 
ATOM   243  C  CD2 . LEU A 1 36  ? -6.975  48.712 15.682 1.00 20.21 ? 35  LEU A CD2 1 
ATOM   244  N  N   . ALA A 1 37  ? -1.959  48.348 18.174 1.00 18.04 ? 36  ALA A N   1 
ATOM   245  C  CA  . ALA A 1 37  ? -0.556  48.616 18.359 1.00 18.29 ? 36  ALA A CA  1 
ATOM   246  C  C   . ALA A 1 37  ? 0.144   48.444 17.022 1.00 18.43 ? 36  ALA A C   1 
ATOM   247  O  O   . ALA A 1 37  ? 0.148   47.336 16.458 1.00 18.29 ? 36  ALA A O   1 
ATOM   248  C  CB  . ALA A 1 37  ? 0.039   47.709 19.429 1.00 18.30 ? 36  ALA A CB  1 
ATOM   249  N  N   . ASN A 1 38  ? 0.695   49.543 16.491 1.00 18.50 ? 37  ASN A N   1 
ATOM   250  C  CA  . ASN A 1 38  ? 1.549   49.442 15.308 1.00 18.98 ? 37  ASN A CA  1 
ATOM   251  C  C   . ASN A 1 38  ? 2.988   49.213 15.747 1.00 19.42 ? 37  ASN A C   1 
ATOM   252  O  O   . ASN A 1 38  ? 3.651   50.133 16.244 1.00 19.18 ? 37  ASN A O   1 
ATOM   253  C  CB  . ASN A 1 38  ? 1.410   50.640 14.357 1.00 18.87 ? 37  ASN A CB  1 
ATOM   254  C  CG  . ASN A 1 38  ? 2.454   50.636 13.206 1.00 18.55 ? 37  ASN A CG  1 
ATOM   255  O  OD1 . ASN A 1 38  ? 3.159   49.657 12.964 1.00 15.10 ? 37  ASN A OD1 1 
ATOM   256  N  ND2 . ASN A 1 38  ? 2.546   51.760 12.513 1.00 17.60 ? 37  ASN A ND2 1 
ATOM   257  N  N   . ILE A 1 39  ? 3.435   47.967 15.555 1.00 19.38 ? 38  ILE A N   1 
ATOM   258  C  CA  . ILE A 1 39  ? 4.723   47.481 16.031 1.00 19.22 ? 38  ILE A CA  1 
ATOM   259  C  C   . ILE A 1 39  ? 5.558   46.874 14.894 1.00 20.08 ? 38  ILE A C   1 
ATOM   260  O  O   . ILE A 1 39  ? 6.375   45.989 15.109 1.00 20.13 ? 38  ILE A O   1 
ATOM   261  C  CB  . ILE A 1 39  ? 4.541   46.500 17.244 1.00 19.11 ? 38  ILE A CB  1 
ATOM   262  C  CG1 . ILE A 1 39  ? 5.866   46.256 17.971 1.00 16.75 ? 38  ILE A CG1 1 
ATOM   263  C  CG2 . ILE A 1 39  ? 3.856   45.187 16.825 1.00 18.60 ? 38  ILE A CG2 1 
ATOM   264  C  CD1 . ILE A 1 39  ? 5.705   46.188 19.437 1.00 12.78 ? 38  ILE A CD1 1 
ATOM   265  N  N   . GLY A 1 40  ? 5.358   47.376 13.683 1.00 20.85 ? 39  GLY A N   1 
ATOM   266  C  CA  . GLY A 1 40  ? 6.206   47.025 12.562 1.00 21.82 ? 39  GLY A CA  1 
ATOM   267  C  C   . GLY A 1 40  ? 5.654   45.914 11.708 1.00 23.20 ? 39  GLY A C   1 
ATOM   268  O  O   . GLY A 1 40  ? 6.316   45.462 10.774 1.00 23.81 ? 39  GLY A O   1 
ATOM   269  N  N   . GLN A 1 41  ? 4.452   45.457 12.035 1.00 23.90 ? 40  GLN A N   1 
ATOM   270  C  CA  . GLN A 1 41  ? 3.735   44.530 11.182 1.00 25.68 ? 40  GLN A CA  1 
ATOM   271  C  C   . GLN A 1 41  ? 3.231   45.217 9.897  1.00 27.27 ? 40  GLN A C   1 
ATOM   272  O  O   . GLN A 1 41  ? 3.345   46.441 9.745  1.00 27.29 ? 40  GLN A O   1 
ATOM   273  C  CB  . GLN A 1 41  ? 2.579   43.848 11.953 1.00 25.40 ? 40  GLN A CB  1 
ATOM   274  C  CG  . GLN A 1 41  ? 1.361   44.736 12.257 1.00 23.85 ? 40  GLN A CG  1 
ATOM   275  C  CD  . GLN A 1 41  ? 1.449   45.456 13.591 1.00 21.66 ? 40  GLN A CD  1 
ATOM   276  O  OE1 . GLN A 1 41  ? 2.397   46.177 13.848 1.00 23.46 ? 40  GLN A OE1 1 
ATOM   277  N  NE2 . GLN A 1 41  ? 0.450   45.272 14.437 1.00 21.60 ? 40  GLN A NE2 1 
ATOM   278  N  N   . LYS A 1 42  ? 2.656   44.426 8.995  1.00 29.46 ? 41  LYS A N   1 
ATOM   279  C  CA  . LYS A 1 42  ? 2.238   44.909 7.670  1.00 31.67 ? 41  LYS A CA  1 
ATOM   280  C  C   . LYS A 1 42  ? 0.752   45.305 7.505  1.00 32.38 ? 41  LYS A C   1 
ATOM   281  O  O   . LYS A 1 42  ? 0.221   45.248 6.396  1.00 32.95 ? 41  LYS A O   1 
ATOM   282  C  CB  . LYS A 1 42  ? 2.640   43.892 6.591  1.00 31.96 ? 41  LYS A CB  1 
ATOM   283  C  CG  . LYS A 1 42  ? 3.799   44.352 5.705  1.00 34.68 ? 41  LYS A CG  1 
ATOM   284  C  CD  . LYS A 1 42  ? 5.121   44.526 6.484  1.00 38.06 ? 41  LYS A CD  1 
ATOM   285  C  CE  . LYS A 1 42  ? 5.983   43.258 6.428  1.00 41.21 ? 41  LYS A CE  1 
ATOM   286  N  NZ  . LYS A 1 42  ? 7.158   43.307 7.366  1.00 43.46 ? 41  LYS A NZ  1 
ATOM   287  N  N   . GLU A 1 43  ? 0.094   45.714 8.586  1.00 33.11 ? 42  GLU A N   1 
ATOM   288  C  CA  . GLU A 1 43  ? -1.332  46.062 8.539  1.00 34.12 ? 42  GLU A CA  1 
ATOM   289  C  C   . GLU A 1 43  ? -1.637  47.344 7.749  1.00 33.68 ? 42  GLU A C   1 
ATOM   290  O  O   . GLU A 1 43  ? -0.787  48.216 7.588  1.00 34.01 ? 42  GLU A O   1 
ATOM   291  C  CB  . GLU A 1 43  ? -1.912  46.170 9.961  1.00 33.91 ? 42  GLU A CB  1 
ATOM   292  C  CG  . GLU A 1 43  ? -2.093  44.836 10.704 1.00 36.15 ? 42  GLU A CG  1 
ATOM   293  C  CD  . GLU A 1 43  ? -2.151  44.983 12.248 1.00 36.67 ? 42  GLU A CD  1 
ATOM   294  O  OE1 . GLU A 1 43  ? -1.725  46.032 12.775 1.00 39.63 ? 42  GLU A OE1 1 
ATOM   295  O  OE2 . GLU A 1 43  ? -2.604  44.036 12.944 1.00 40.45 ? 42  GLU A OE2 1 
ATOM   296  N  N   . ASP A 1 44  ? -2.855  47.418 7.224  1.00 33.65 ? 43  ASP A N   1 
ATOM   297  C  CA  . ASP A 1 44  ? -3.440  48.644 6.715  1.00 33.15 ? 43  ASP A CA  1 
ATOM   298  C  C   . ASP A 1 44  ? -4.247  49.127 7.919  1.00 32.48 ? 43  ASP A C   1 
ATOM   299  O  O   . ASP A 1 44  ? -5.437  48.833 8.058  1.00 32.42 ? 43  ASP A O   1 
ATOM   300  C  CB  . ASP A 1 44  ? -4.318  48.315 5.488  1.00 33.89 ? 43  ASP A CB  1 
ATOM   301  C  CG  . ASP A 1 44  ? -5.059  49.540 4.897  1.00 35.07 ? 43  ASP A CG  1 
ATOM   302  O  OD1 . ASP A 1 44  ? -5.465  50.459 5.631  1.00 36.25 ? 43  ASP A OD1 1 
ATOM   303  O  OD2 . ASP A 1 44  ? -5.275  49.560 3.668  1.00 37.15 ? 43  ASP A OD2 1 
ATOM   304  N  N   . PHE A 1 45  ? -3.564  49.828 8.819  1.00 31.88 ? 44  PHE A N   1 
ATOM   305  C  CA  . PHE A 1 45  ? -4.137  50.287 10.099 1.00 30.91 ? 44  PHE A CA  1 
ATOM   306  C  C   . PHE A 1 45  ? -5.389  51.157 9.953  1.00 30.44 ? 44  PHE A C   1 
ATOM   307  O  O   . PHE A 1 45  ? -6.335  51.018 10.731 1.00 30.79 ? 44  PHE A O   1 
ATOM   308  C  CB  . PHE A 1 45  ? -3.064  51.010 10.932 1.00 30.81 ? 44  PHE A CB  1 
ATOM   309  C  CG  . PHE A 1 45  ? -1.854  50.176 11.186 1.00 30.53 ? 44  PHE A CG  1 
ATOM   310  C  CD1 . PHE A 1 45  ? -1.800  49.327 12.289 1.00 31.01 ? 44  PHE A CD1 1 
ATOM   311  C  CD2 . PHE A 1 45  ? -0.782  50.200 10.297 1.00 30.10 ? 44  PHE A CD2 1 
ATOM   312  C  CE1 . PHE A 1 45  ? -0.684  48.539 12.519 1.00 30.91 ? 44  PHE A CE1 1 
ATOM   313  C  CE2 . PHE A 1 45  ? 0.335   49.408 10.512 1.00 29.65 ? 44  PHE A CE2 1 
ATOM   314  C  CZ  . PHE A 1 45  ? 0.384   48.571 11.621 1.00 30.80 ? 44  PHE A CZ  1 
ATOM   315  N  N   . GLU A 1 46  ? -5.392  52.030 8.948  1.00 29.35 ? 45  GLU A N   1 
ATOM   316  C  CA  . GLU A 1 46  ? -6.532  52.908 8.649  1.00 28.69 ? 45  GLU A CA  1 
ATOM   317  C  C   . GLU A 1 46  ? -7.811  52.119 8.319  1.00 27.23 ? 45  GLU A C   1 
ATOM   318  O  O   . GLU A 1 46  ? -8.901  52.504 8.725  1.00 26.88 ? 45  GLU A O   1 
ATOM   319  C  CB  . GLU A 1 46  ? -6.180  53.858 7.501  1.00 29.04 ? 45  GLU A CB  1 
ATOM   320  C  CG  . GLU A 1 46  ? -4.670  54.150 7.361  1.00 32.42 ? 45  GLU A CG  1 
ATOM   321  C  CD  . GLU A 1 46  ? -3.837  52.960 6.814  1.00 35.71 ? 45  GLU A CD  1 
ATOM   322  O  OE1 . GLU A 1 46  ? -2.883  52.531 7.501  1.00 38.03 ? 45  GLU A OE1 1 
ATOM   323  O  OE2 . GLU A 1 46  ? -4.121  52.460 5.698  1.00 37.05 ? 45  GLU A OE2 1 
ATOM   324  N  N   . GLU A 1 47  ? -7.660  51.019 7.591  1.00 25.85 ? 46  GLU A N   1 
ATOM   325  C  CA  . GLU A 1 47  ? -8.776  50.164 7.237  1.00 25.46 ? 46  GLU A CA  1 
ATOM   326  C  C   . GLU A 1 47  ? -9.234  49.316 8.427  1.00 24.45 ? 46  GLU A C   1 
ATOM   327  O  O   . GLU A 1 47  ? -10.429 49.101 8.632  1.00 24.09 ? 46  GLU A O   1 
ATOM   328  C  CB  . GLU A 1 47  ? -8.414  49.288 6.030  1.00 25.53 ? 46  GLU A CB  1 
ATOM   329  C  CG  . GLU A 1 47  ? -9.576  48.473 5.456  1.00 27.82 ? 46  GLU A CG  1 
ATOM   330  C  CD  . GLU A 1 47  ? -10.836 49.306 5.183  1.00 31.76 ? 46  GLU A CD  1 
ATOM   331  O  OE1 . GLU A 1 47  ? -10.741 50.360 4.489  1.00 33.25 ? 46  GLU A OE1 1 
ATOM   332  O  OE2 . GLU A 1 47  ? -11.924 48.903 5.672  1.00 32.54 ? 46  GLU A OE2 1 
ATOM   333  N  N   . ALA A 1 48  ? -8.266  48.847 9.209  1.00 23.72 ? 47  ALA A N   1 
ATOM   334  C  CA  . ALA A 1 48  ? -8.540  48.158 10.465 1.00 22.86 ? 47  ALA A CA  1 
ATOM   335  C  C   . ALA A 1 48  ? -9.273  49.087 11.451 1.00 22.30 ? 47  ALA A C   1 
ATOM   336  O  O   . ALA A 1 48  ? -10.162 48.640 12.188 1.00 21.86 ? 47  ALA A O   1 
ATOM   337  C  CB  . ALA A 1 48  ? -7.244  47.603 11.065 1.00 22.35 ? 47  ALA A CB  1 
ATOM   338  N  N   . ARG A 1 49  ? -8.897  50.369 11.450 1.00 21.33 ? 48  ARG A N   1 
ATOM   339  C  CA  . ARG A 1 49  ? -9.651  51.394 12.159 1.00 21.26 ? 48  ARG A CA  1 
ATOM   340  C  C   . ARG A 1 49  ? -11.085 51.533 11.622 1.00 20.75 ? 48  ARG A C   1 
ATOM   341  O  O   . ARG A 1 49  ? -12.025 51.577 12.404 1.00 20.10 ? 48  ARG A O   1 
ATOM   342  C  CB  . ARG A 1 49  ? -8.936  52.756 12.133 1.00 21.14 ? 48  ARG A CB  1 
ATOM   343  C  CG  . ARG A 1 49  ? -9.769  53.834 12.733 1.00 22.87 ? 48  ARG A CG  1 
ATOM   344  C  CD  . ARG A 1 49  ? -9.096  55.167 12.824 1.00 30.31 ? 48  ARG A CD  1 
ATOM   345  N  NE  . ARG A 1 49  ? -9.919  56.067 13.642 1.00 35.51 ? 48  ARG A NE  1 
ATOM   346  C  CZ  . ARG A 1 49  ? -10.885 56.868 13.182 1.00 37.17 ? 48  ARG A CZ  1 
ATOM   347  N  NH1 . ARG A 1 49  ? -11.570 57.629 14.032 1.00 38.23 ? 48  ARG A NH1 1 
ATOM   348  N  NH2 . ARG A 1 49  ? -11.180 56.911 11.886 1.00 36.61 ? 48  ARG A NH2 1 
ATOM   349  N  N   . LYS A 1 50  ? -11.241 51.616 10.298 1.00 20.96 ? 49  LYS A N   1 
ATOM   350  C  CA  . LYS A 1 50  ? -12.568 51.686 9.680  1.00 21.17 ? 49  LYS A CA  1 
ATOM   351  C  C   . LYS A 1 50  ? -13.409 50.470 10.058 1.00 20.76 ? 49  LYS A C   1 
ATOM   352  O  O   . LYS A 1 50  ? -14.546 50.619 10.510 1.00 20.34 ? 49  LYS A O   1 
ATOM   353  C  CB  . LYS A 1 50  ? -12.477 51.812 8.159  1.00 21.35 ? 49  LYS A CB  1 
ATOM   354  C  CG  . LYS A 1 50  ? -12.134 53.211 7.645  1.00 23.58 ? 49  LYS A CG  1 
ATOM   355  C  CD  . LYS A 1 50  ? -11.679 53.142 6.181  1.00 27.04 ? 49  LYS A CD  1 
ATOM   356  C  CE  . LYS A 1 50  ? -10.544 54.127 5.885  1.00 28.40 ? 49  LYS A CE  1 
ATOM   357  N  NZ  . LYS A 1 50  ? -9.398  53.428 5.183  1.00 29.63 ? 49  LYS A NZ  1 
ATOM   358  N  N   . LYS A 1 51  ? -12.823 49.279 9.894  1.00 20.59 ? 50  LYS A N   1 
ATOM   359  C  CA  . LYS A 1 51  ? -13.438 48.004 10.304 1.00 20.31 ? 50  LYS A CA  1 
ATOM   360  C  C   . LYS A 1 51  ? -13.874 48.000 11.767 1.00 20.17 ? 50  LYS A C   1 
ATOM   361  O  O   . LYS A 1 51  ? -14.989 47.614 12.059 1.00 20.50 ? 50  LYS A O   1 
ATOM   362  C  CB  . LYS A 1 51  ? -12.509 46.807 10.000 1.00 20.27 ? 50  LYS A CB  1 
ATOM   363  C  CG  . LYS A 1 51  ? -13.058 45.440 10.439 1.00 19.55 ? 50  LYS A CG  1 
ATOM   364  C  CD  . LYS A 1 51  ? -12.032 44.332 10.303 1.00 20.88 ? 50  LYS A CD  1 
ATOM   365  C  CE  . LYS A 1 51  ? -12.725 42.945 10.421 1.00 23.49 ? 50  LYS A CE  1 
ATOM   366  N  NZ  . LYS A 1 51  ? -11.882 41.802 9.941  1.00 21.24 ? 50  LYS A NZ  1 
ATOM   367  N  N   . ALA A 1 52  ? -13.005 48.442 12.674 1.00 20.55 ? 51  ALA A N   1 
ATOM   368  C  CA  . ALA A 1 52  ? -13.350 48.566 14.104 1.00 20.96 ? 51  ALA A CA  1 
ATOM   369  C  C   . ALA A 1 52  ? -14.535 49.502 14.381 1.00 21.83 ? 51  ALA A C   1 
ATOM   370  O  O   . ALA A 1 52  ? -15.353 49.221 15.265 1.00 22.80 ? 51  ALA A O   1 
ATOM   371  C  CB  . ALA A 1 52  ? -12.138 48.989 14.922 1.00 20.23 ? 51  ALA A CB  1 
ATOM   372  N  N   . LEU A 1 53  ? -14.640 50.603 13.636 1.00 21.82 ? 52  LEU A N   1 
ATOM   373  C  CA  . LEU A 1 53  ? -15.774 51.526 13.803 1.00 22.13 ? 52  LEU A CA  1 
ATOM   374  C  C   . LEU A 1 53  ? -17.080 50.937 13.305 1.00 23.10 ? 52  LEU A C   1 
ATOM   375  O  O   . LEU A 1 53  ? -18.106 51.037 13.973 1.00 23.93 ? 52  LEU A O   1 
ATOM   376  C  CB  . LEU A 1 53  ? -15.500 52.882 13.146 1.00 21.29 ? 52  LEU A CB  1 
ATOM   377  C  CG  . LEU A 1 53  ? -14.309 53.635 13.765 1.00 19.20 ? 52  LEU A CG  1 
ATOM   378  C  CD1 . LEU A 1 53  ? -13.818 54.749 12.852 1.00 15.01 ? 52  LEU A CD1 1 
ATOM   379  C  CD2 . LEU A 1 53  ? -14.627 54.125 15.192 1.00 16.82 ? 52  LEU A CD2 1 
ATOM   380  N  N   . LYS A 1 54  ? -17.022 50.314 12.136 1.00 24.29 ? 53  LYS A N   1 
ATOM   381  C  CA  . LYS A 1 54  ? -18.160 49.622 11.533 1.00 25.29 ? 53  LYS A CA  1 
ATOM   382  C  C   . LYS A 1 54  ? -18.668 48.564 12.502 1.00 25.12 ? 53  LYS A C   1 
ATOM   383  O  O   . LYS A 1 54  ? -19.883 48.337 12.604 1.00 25.39 ? 53  LYS A O   1 
ATOM   384  C  CB  . LYS A 1 54  ? -17.750 48.994 10.183 1.00 25.75 ? 53  LYS A CB  1 
ATOM   385  C  CG  . LYS A 1 54  ? -18.864 48.246 9.442  1.00 27.59 ? 53  LYS A CG  1 
ATOM   386  C  CD  . LYS A 1 54  ? -18.447 46.763 9.221  1.00 30.60 ? 53  LYS A CD  1 
ATOM   387  C  CE  . LYS A 1 54  ? -19.511 45.907 8.504  1.00 30.30 ? 53  LYS A CE  1 
ATOM   388  N  NZ  . LYS A 1 54  ? -19.264 45.737 7.006  1.00 32.27 ? 53  LYS A NZ  1 
ATOM   389  N  N   . LEU A 1 55  ? -17.732 47.959 13.237 1.00 24.70 ? 54  LEU A N   1 
ATOM   390  C  CA  . LEU A 1 55  ? -18.027 46.878 14.191 1.00 24.13 ? 54  LEU A CA  1 
ATOM   391  C  C   . LEU A 1 55  ? -18.646 47.351 15.511 1.00 23.68 ? 54  LEU A C   1 
ATOM   392  O  O   . LEU A 1 55  ? -19.237 46.554 16.236 1.00 24.12 ? 54  LEU A O   1 
ATOM   393  C  CB  . LEU A 1 55  ? -16.786 45.998 14.421 1.00 23.85 ? 54  LEU A CB  1 
ATOM   394  C  CG  . LEU A 1 55  ? -16.694 44.649 13.666 1.00 25.01 ? 54  LEU A CG  1 
ATOM   395  C  CD1 . LEU A 1 55  ? -17.461 44.577 12.306 1.00 25.10 ? 54  LEU A CD1 1 
ATOM   396  C  CD2 . LEU A 1 55  ? -15.252 44.147 13.498 1.00 23.44 ? 54  LEU A CD2 1 
ATOM   397  N  N   . GLY A 1 56  ? -18.542 48.648 15.796 1.00 23.23 ? 55  GLY A N   1 
ATOM   398  C  CA  . GLY A 1 56  ? -19.224 49.254 16.939 1.00 22.58 ? 55  GLY A CA  1 
ATOM   399  C  C   . GLY A 1 56  ? -18.304 49.800 18.022 1.00 22.68 ? 55  GLY A C   1 
ATOM   400  O  O   . GLY A 1 56  ? -18.753 50.121 19.115 1.00 22.68 ? 55  GLY A O   1 
ATOM   401  N  N   . ALA A 1 57  ? -17.014 49.901 17.720 1.00 22.73 ? 56  ALA A N   1 
ATOM   402  C  CA  . ALA A 1 57  ? -16.049 50.509 18.623 1.00 22.69 ? 56  ALA A CA  1 
ATOM   403  C  C   . ALA A 1 57  ? -16.444 51.940 18.936 1.00 23.01 ? 56  ALA A C   1 
ATOM   404  O  O   . ALA A 1 57  ? -16.757 52.707 18.021 1.00 23.27 ? 56  ALA A O   1 
ATOM   405  C  CB  . ALA A 1 57  ? -14.655 50.469 17.998 1.00 22.48 ? 56  ALA A CB  1 
ATOM   406  N  N   . LYS A 1 58  ? -16.446 52.302 20.223 1.00 23.46 ? 57  LYS A N   1 
ATOM   407  C  CA  . LYS A 1 58  ? -16.672 53.700 20.639 1.00 23.78 ? 57  LYS A CA  1 
ATOM   408  C  C   . LYS A 1 58  ? -15.518 54.594 20.197 1.00 23.56 ? 57  LYS A C   1 
ATOM   409  O  O   . LYS A 1 58  ? -15.697 55.806 20.036 1.00 24.29 ? 57  LYS A O   1 
ATOM   410  C  CB  . LYS A 1 58  ? -16.798 53.816 22.165 1.00 24.13 ? 57  LYS A CB  1 
ATOM   411  C  CG  . LYS A 1 58  ? -17.684 54.969 22.640 1.00 26.65 ? 57  LYS A CG  1 
ATOM   412  C  CD  . LYS A 1 58  ? -17.009 55.924 23.679 1.00 28.49 ? 57  LYS A CD  1 
ATOM   413  C  CE  . LYS A 1 58  ? -16.873 55.353 25.110 1.00 27.03 ? 57  LYS A CE  1 
ATOM   414  N  NZ  . LYS A 1 58  ? -15.504 54.807 25.409 1.00 23.52 ? 57  LYS A NZ  1 
ATOM   415  N  N   . LYS A 1 59  ? -14.342 53.996 20.004 1.00 22.80 ? 58  LYS A N   1 
ATOM   416  C  CA  . LYS A 1 59  ? -13.081 54.738 19.893 1.00 22.51 ? 58  LYS A CA  1 
ATOM   417  C  C   . LYS A 1 59  ? -12.001 53.837 19.290 1.00 21.61 ? 58  LYS A C   1 
ATOM   418  O  O   . LYS A 1 59  ? -12.051 52.615 19.468 1.00 21.54 ? 58  LYS A O   1 
ATOM   419  C  CB  . LYS A 1 59  ? -12.659 55.200 21.299 1.00 23.13 ? 58  LYS A CB  1 
ATOM   420  C  CG  . LYS A 1 59  ? -12.198 56.646 21.411 1.00 24.79 ? 58  LYS A CG  1 
ATOM   421  C  CD  . LYS A 1 59  ? -12.428 57.173 22.812 1.00 26.82 ? 58  LYS A CD  1 
ATOM   422  C  CE  . LYS A 1 59  ? -12.952 58.623 22.768 1.00 30.27 ? 58  LYS A CE  1 
ATOM   423  N  NZ  . LYS A 1 59  ? -13.301 59.164 24.129 1.00 30.98 ? 58  LYS A NZ  1 
ATOM   424  N  N   . VAL A 1 60  ? -11.047 54.420 18.562 1.00 20.69 ? 59  VAL A N   1 
ATOM   425  C  CA  . VAL A 1 60  ? -9.930  53.649 17.985 1.00 20.12 ? 59  VAL A CA  1 
ATOM   426  C  C   . VAL A 1 60  ? -8.597  54.365 18.191 1.00 20.63 ? 59  VAL A C   1 
ATOM   427  O  O   . VAL A 1 60  ? -8.416  55.515 17.756 1.00 20.62 ? 59  VAL A O   1 
ATOM   428  C  CB  . VAL A 1 60  ? -10.055 53.331 16.444 1.00 19.82 ? 59  VAL A CB  1 
ATOM   429  C  CG1 . VAL A 1 60  ? -8.815  52.606 15.974 1.00 18.86 ? 59  VAL A CG1 1 
ATOM   430  C  CG2 . VAL A 1 60  ? -11.302 52.482 16.088 1.00 19.24 ? 59  VAL A CG2 1 
ATOM   431  N  N   . PHE A 1 61  ? -7.656  53.671 18.828 1.00 20.55 ? 60  PHE A N   1 
ATOM   432  C  CA  . PHE A 1 61  ? -6.317  54.202 18.987 1.00 20.81 ? 60  PHE A CA  1 
ATOM   433  C  C   . PHE A 1 61  ? -5.328  53.369 18.207 1.00 20.65 ? 60  PHE A C   1 
ATOM   434  O  O   . PHE A 1 61  ? -5.183  52.179 18.439 1.00 21.04 ? 60  PHE A O   1 
ATOM   435  C  CB  . PHE A 1 61  ? -5.912  54.255 20.458 1.00 20.79 ? 60  PHE A CB  1 
ATOM   436  C  CG  . PHE A 1 61  ? -6.713  55.214 21.271 1.00 21.60 ? 60  PHE A CG  1 
ATOM   437  C  CD1 . PHE A 1 61  ? -6.264  56.509 21.473 1.00 22.65 ? 60  PHE A CD1 1 
ATOM   438  C  CD2 . PHE A 1 61  ? -7.919  54.816 21.860 1.00 21.00 ? 60  PHE A CD2 1 
ATOM   439  C  CE1 . PHE A 1 61  ? -7.012  57.405 22.238 1.00 23.75 ? 60  PHE A CE1 1 
ATOM   440  C  CE2 . PHE A 1 61  ? -8.667  55.702 22.624 1.00 21.23 ? 60  PHE A CE2 1 
ATOM   441  C  CZ  . PHE A 1 61  ? -8.213  57.002 22.818 1.00 21.41 ? 60  PHE A CZ  1 
ATOM   442  N  N   . ILE A 1 62  ? -4.674  54.002 17.252 1.00 20.89 ? 61  ILE A N   1 
ATOM   443  C  CA  . ILE A 1 62  ? -3.557  53.385 16.575 1.00 21.06 ? 61  ILE A CA  1 
ATOM   444  C  C   . ILE A 1 62  ? -2.301  54.027 17.110 1.00 21.44 ? 61  ILE A C   1 
ATOM   445  O  O   . ILE A 1 62  ? -2.107  55.247 16.971 1.00 21.41 ? 61  ILE A O   1 
ATOM   446  C  CB  . ILE A 1 62  ? -3.640  53.506 15.034 1.00 21.44 ? 61  ILE A CB  1 
ATOM   447  C  CG1 . ILE A 1 62  ? -4.951  52.840 14.536 1.00 21.24 ? 61  ILE A CG1 1 
ATOM   448  C  CG2 . ILE A 1 62  ? -2.358  52.889 14.390 1.00 19.88 ? 61  ILE A CG2 1 
ATOM   449  C  CD1 . ILE A 1 62  ? -5.223  52.954 13.057 1.00 20.66 ? 61  ILE A CD1 1 
ATOM   450  N  N   . GLU A 1 63  ? -1.470  53.195 17.739 1.00 21.28 ? 62  GLU A N   1 
ATOM   451  C  CA  . GLU A 1 63  ? -0.237  53.649 18.367 1.00 21.10 ? 62  GLU A CA  1 
ATOM   452  C  C   . GLU A 1 63  ? 0.954   53.064 17.639 1.00 20.83 ? 62  GLU A C   1 
ATOM   453  O  O   . GLU A 1 63  ? 1.078   51.849 17.496 1.00 20.96 ? 62  GLU A O   1 
ATOM   454  C  CB  . GLU A 1 63  ? -0.200  53.251 19.839 1.00 21.01 ? 62  GLU A CB  1 
ATOM   455  C  CG  . GLU A 1 63  ? -1.399  53.759 20.647 1.00 23.49 ? 62  GLU A CG  1 
ATOM   456  C  CD  . GLU A 1 63  ? -1.552  55.293 20.679 1.00 22.88 ? 62  GLU A CD  1 
ATOM   457  O  OE1 . GLU A 1 63  ? -0.552  56.036 20.607 1.00 21.25 ? 62  GLU A OE1 1 
ATOM   458  O  OE2 . GLU A 1 63  ? -2.699  55.748 20.808 1.00 24.54 ? 62  GLU A OE2 1 
ATOM   459  N  N   . ASP A 1 64  ? 1.812   53.951 17.153 1.00 20.54 ? 63  ASP A N   1 
ATOM   460  C  CA  . ASP A 1 64  ? 3.020   53.548 16.500 1.00 20.10 ? 63  ASP A CA  1 
ATOM   461  C  C   . ASP A 1 64  ? 4.082   53.485 17.557 1.00 19.77 ? 63  ASP A C   1 
ATOM   462  O  O   . ASP A 1 64  ? 4.538   54.505 18.101 1.00 20.21 ? 63  ASP A O   1 
ATOM   463  C  CB  . ASP A 1 64  ? 3.419   54.504 15.380 1.00 20.41 ? 63  ASP A CB  1 
ATOM   464  C  CG  . ASP A 1 64  ? 4.688   54.060 14.668 1.00 20.54 ? 63  ASP A CG  1 
ATOM   465  O  OD1 . ASP A 1 64  ? 5.284   53.028 15.052 1.00 19.91 ? 63  ASP A OD1 1 
ATOM   466  O  OD2 . ASP A 1 64  ? 5.095   54.752 13.718 1.00 23.20 ? 63  ASP A OD2 1 
ATOM   467  N  N   . VAL A 1 65  ? 4.512   52.256 17.785 1.00 19.05 ? 64  VAL A N   1 
ATOM   468  C  CA  . VAL A 1 65  ? 5.192   51.848 19.000 1.00 17.81 ? 64  VAL A CA  1 
ATOM   469  C  C   . VAL A 1 65  ? 6.549   51.223 18.601 1.00 17.35 ? 64  VAL A C   1 
ATOM   470  O  O   . VAL A 1 65  ? 7.342   50.815 19.453 1.00 17.77 ? 64  VAL A O   1 
ATOM   471  C  CB  . VAL A 1 65  ? 4.194   50.901 19.752 1.00 17.72 ? 64  VAL A CB  1 
ATOM   472  C  CG1 . VAL A 1 65  ? 4.829   49.682 20.313 1.00 18.20 ? 64  VAL A CG1 1 
ATOM   473  C  CG2 . VAL A 1 65  ? 3.309   51.668 20.791 1.00 17.09 ? 64  VAL A CG2 1 
ATOM   474  N  N   . SER A 1 66  ? 6.818   51.199 17.293 1.00 16.16 ? 65  SER A N   1 
ATOM   475  C  CA  . SER A 1 66  ? 8.045   50.625 16.729 1.00 15.72 ? 65  SER A CA  1 
ATOM   476  C  C   . SER A 1 66  ? 9.387   51.145 17.294 1.00 15.57 ? 65  SER A C   1 
ATOM   477  O  O   . SER A 1 66  ? 10.282  50.341 17.592 1.00 15.31 ? 65  SER A O   1 
ATOM   478  C  CB  . SER A 1 66  ? 8.066   50.783 15.215 1.00 15.05 ? 65  SER A CB  1 
ATOM   479  O  OG  . SER A 1 66  ? 6.896   50.263 14.653 1.00 14.09 ? 65  SER A OG  1 
ATOM   480  N  N   . ARG A 1 67  ? 9.538   52.461 17.399 1.00 15.06 ? 66  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 67  ? 10.832  53.042 17.802 1.00 15.50 ? 66  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 67  ? 11.183  52.699 19.228 1.00 14.80 ? 66  ARG A C   1 
ATOM   483  O  O   . ARG A 1 67  ? 12.294  52.248 19.494 1.00 14.82 ? 66  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 67  ? 10.867  54.558 17.644 1.00 15.30 ? 66  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 67  ? 12.261  55.122 17.866 1.00 16.99 ? 66  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 67  ? 12.372  56.546 17.385 1.00 18.05 ? 66  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 67  ? 11.949  56.675 15.989 1.00 21.07 ? 66  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 67  ? 12.706  56.369 14.941 1.00 21.68 ? 66  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 67  ? 13.945  55.888 15.116 1.00 21.90 ? 66  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 67  ? 12.217  56.538 13.721 1.00 19.93 ? 66  ARG A NH2 1 
ATOM   491  N  N   . GLU A 1 68  ? 10.228  52.913 20.131 1.00 14.23 ? 67  GLU A N   1 
ATOM   492  C  CA  . GLU A 1 68  ? 10.354  52.468 21.513 1.00 13.95 ? 67  GLU A CA  1 
ATOM   493  C  C   . GLU A 1 68  ? 10.443  50.930 21.667 1.00 13.89 ? 67  GLU A C   1 
ATOM   494  O  O   . GLU A 1 68  ? 11.129  50.443 22.553 1.00 14.49 ? 67  GLU A O   1 
ATOM   495  C  CB  . GLU A 1 68  ? 9.258   53.082 22.374 1.00 14.04 ? 67  GLU A CB  1 
ATOM   496  C  CG  . GLU A 1 68  ? 7.862   52.453 22.211 1.00 14.92 ? 67  GLU A CG  1 
ATOM   497  C  CD  . GLU A 1 68  ? 6.754   53.402 22.655 1.00 15.34 ? 67  GLU A CD  1 
ATOM   498  O  OE1 . GLU A 1 68  ? 6.566   54.450 21.988 1.00 14.96 ? 67  GLU A OE1 1 
ATOM   499  O  OE2 . GLU A 1 68  ? 6.090   53.102 23.668 1.00 13.65 ? 67  GLU A OE2 1 
ATOM   500  N  N   . PHE A 1 69  ? 9.791   50.168 20.799 1.00 13.68 ? 68  PHE A N   1 
ATOM   501  C  CA  . PHE A 1 69  ? 10.007  48.734 20.775 1.00 13.99 ? 68  PHE A CA  1 
ATOM   502  C  C   . PHE A 1 69  ? 11.492  48.347 20.539 1.00 14.25 ? 68  PHE A C   1 
ATOM   503  O  O   . PHE A 1 69  ? 12.061  47.526 21.281 1.00 14.39 ? 68  PHE A O   1 
ATOM   504  C  CB  . PHE A 1 69  ? 9.096   48.062 19.742 1.00 14.14 ? 68  PHE A CB  1 
ATOM   505  C  CG  . PHE A 1 69  ? 9.277   46.556 19.648 1.00 14.30 ? 68  PHE A CG  1 
ATOM   506  C  CD1 . PHE A 1 69  ? 9.361   45.766 20.813 1.00 12.84 ? 68  PHE A CD1 1 
ATOM   507  C  CD2 . PHE A 1 69  ? 9.331   45.922 18.400 1.00 12.64 ? 68  PHE A CD2 1 
ATOM   508  C  CE1 . PHE A 1 69  ? 9.501   44.386 20.732 1.00 11.02 ? 68  PHE A CE1 1 
ATOM   509  C  CE2 . PHE A 1 69  ? 9.475   44.524 18.317 1.00 9.80  ? 68  PHE A CE2 1 
ATOM   510  C  CZ  . PHE A 1 69  ? 9.558   43.766 19.481 1.00 11.72 ? 68  PHE A CZ  1 
ATOM   511  N  N   . VAL A 1 70  ? 12.105  48.941 19.516 1.00 13.76 ? 69  VAL A N   1 
ATOM   512  C  CA  . VAL A 1 70  ? 13.540  48.757 19.251 1.00 13.17 ? 69  VAL A CA  1 
ATOM   513  C  C   . VAL A 1 70  ? 14.413  49.202 20.428 1.00 13.18 ? 69  VAL A C   1 
ATOM   514  O  O   . VAL A 1 70  ? 15.258  48.461 20.900 1.00 13.17 ? 69  VAL A O   1 
ATOM   515  C  CB  . VAL A 1 70  ? 14.000  49.467 17.933 1.00 12.62 ? 69  VAL A CB  1 
ATOM   516  C  CG1 . VAL A 1 70  ? 15.505  49.293 17.726 1.00 12.39 ? 69  VAL A CG1 1 
ATOM   517  C  CG2 . VAL A 1 70  ? 13.270  48.874 16.739 1.00 10.57 ? 69  VAL A CG2 1 
ATOM   518  N  N   . GLU A 1 71  ? 14.168  50.405 20.923 1.00 13.56 ? 70  GLU A N   1 
ATOM   519  C  CA  . GLU A 1 71  ? 15.118  51.085 21.790 1.00 13.35 ? 70  GLU A CA  1 
ATOM   520  C  C   . GLU A 1 71  ? 15.012  50.691 23.251 1.00 12.55 ? 70  GLU A C   1 
ATOM   521  O  O   . GLU A 1 71  ? 16.024  50.698 23.956 1.00 13.09 ? 70  GLU A O   1 
ATOM   522  C  CB  . GLU A 1 71  ? 14.959  52.595 21.639 1.00 13.51 ? 70  GLU A CB  1 
ATOM   523  C  CG  . GLU A 1 71  ? 15.523  53.169 20.345 1.00 13.94 ? 70  GLU A CG  1 
ATOM   524  C  CD  . GLU A 1 71  ? 15.533  54.700 20.330 1.00 15.06 ? 70  GLU A CD  1 
ATOM   525  O  OE1 . GLU A 1 71  ? 14.925  55.316 21.232 1.00 16.94 ? 70  GLU A OE1 1 
ATOM   526  O  OE2 . GLU A 1 71  ? 16.155  55.294 19.414 1.00 18.73 ? 70  GLU A OE2 1 
ATOM   527  N  N   . GLU A 1 72  ? 13.803  50.352 23.702 1.00 11.44 ? 71  GLU A N   1 
ATOM   528  C  CA  . GLU A 1 72  ? 13.561  49.993 25.113 1.00 10.37 ? 71  GLU A CA  1 
ATOM   529  C  C   . GLU A 1 72  ? 13.428  48.514 25.358 1.00 9.75  ? 71  GLU A C   1 
ATOM   530  O  O   . GLU A 1 72  ? 13.495  48.095 26.516 1.00 10.39 ? 71  GLU A O   1 
ATOM   531  C  CB  . GLU A 1 72  ? 12.291  50.647 25.660 1.00 9.56  ? 71  GLU A CB  1 
ATOM   532  C  CG  . GLU A 1 72  ? 12.401  52.119 25.950 1.00 10.30 ? 71  GLU A CG  1 
ATOM   533  C  CD  . GLU A 1 72  ? 11.100  52.711 26.484 1.00 10.43 ? 71  GLU A CD  1 
ATOM   534  O  OE1 . GLU A 1 72  ? 10.322  53.278 25.681 1.00 7.45  ? 71  GLU A OE1 1 
ATOM   535  O  OE2 . GLU A 1 72  ? 10.851  52.587 27.717 1.00 12.75 ? 71  GLU A OE2 1 
ATOM   536  N  N   . PHE A 1 73  ? 13.197  47.732 24.300 1.00 8.93  ? 72  PHE A N   1 
ATOM   537  C  CA  . PHE A 1 73  ? 12.948  46.290 24.434 1.00 8.47  ? 72  PHE A CA  1 
ATOM   538  C  C   . PHE A 1 73  ? 13.987  45.432 23.708 1.00 8.17  ? 72  PHE A C   1 
ATOM   539  O  O   . PHE A 1 73  ? 14.657  44.617 24.339 1.00 7.23  ? 72  PHE A O   1 
ATOM   540  C  CB  . PHE A 1 73  ? 11.481  45.925 24.060 1.00 8.18  ? 72  PHE A CB  1 
ATOM   541  C  CG  . PHE A 1 73  ? 10.464  46.523 25.014 1.00 9.07  ? 72  PHE A CG  1 
ATOM   542  C  CD1 . PHE A 1 73  ? 10.039  47.834 24.869 1.00 6.85  ? 72  PHE A CD1 1 
ATOM   543  C  CD2 . PHE A 1 73  ? 9.992   45.796 26.106 1.00 10.70 ? 72  PHE A CD2 1 
ATOM   544  C  CE1 . PHE A 1 73  ? 9.163   48.411 25.778 1.00 8.22  ? 72  PHE A CE1 1 
ATOM   545  C  CE2 . PHE A 1 73  ? 9.091   46.389 27.026 1.00 11.01 ? 72  PHE A CE2 1 
ATOM   546  C  CZ  . PHE A 1 73  ? 8.689   47.692 26.850 1.00 8.88  ? 72  PHE A CZ  1 
ATOM   547  N  N   . ILE A 1 74  ? 14.125  45.629 22.396 1.00 8.05  ? 73  ILE A N   1 
ATOM   548  C  CA  . ILE A 1 74  ? 15.063  44.860 21.595 1.00 8.15  ? 73  ILE A CA  1 
ATOM   549  C  C   . ILE A 1 74  ? 16.521  45.138 21.993 1.00 8.58  ? 73  ILE A C   1 
ATOM   550  O  O   . ILE A 1 74  ? 17.346  44.216 22.028 1.00 9.56  ? 73  ILE A O   1 
ATOM   551  C  CB  . ILE A 1 74  ? 14.851  45.108 20.082 1.00 8.25  ? 73  ILE A CB  1 
ATOM   552  C  CG1 . ILE A 1 74  ? 13.422  44.746 19.663 1.00 8.02  ? 73  ILE A CG1 1 
ATOM   553  C  CG2 . ILE A 1 74  ? 15.903  44.361 19.260 1.00 8.65  ? 73  ILE A CG2 1 
ATOM   554  C  CD1 . ILE A 1 74  ? 13.111  44.876 18.151 1.00 7.12  ? 73  ILE A CD1 1 
ATOM   555  N  N   . TRP A 1 75  ? 16.828  46.391 22.302 1.00 8.78  ? 74  TRP A N   1 
ATOM   556  C  CA  . TRP A 1 75  ? 18.184  46.811 22.707 1.00 9.59  ? 74  TRP A CA  1 
ATOM   557  C  C   . TRP A 1 75  ? 18.682  46.114 23.989 1.00 9.43  ? 74  TRP A C   1 
ATOM   558  O  O   . TRP A 1 75  ? 19.790  45.564 23.993 1.00 9.57  ? 74  TRP A O   1 
ATOM   559  C  CB  . TRP A 1 75  ? 18.277  48.356 22.825 1.00 9.76  ? 74  TRP A CB  1 
ATOM   560  C  CG  . TRP A 1 75  ? 18.628  49.127 21.531 1.00 9.86  ? 74  TRP A CG  1 
ATOM   561  C  CD1 . TRP A 1 75  ? 19.052  50.440 21.449 1.00 10.17 ? 74  TRP A CD1 1 
ATOM   562  C  CD2 . TRP A 1 75  ? 18.606  48.637 20.173 1.00 9.07  ? 74  TRP A CD2 1 
ATOM   563  N  NE1 . TRP A 1 75  ? 19.282  50.788 20.132 1.00 10.34 ? 74  TRP A NE1 1 
ATOM   564  C  CE2 . TRP A 1 75  ? 19.009  49.704 19.334 1.00 10.43 ? 74  TRP A CE2 1 
ATOM   565  C  CE3 . TRP A 1 75  ? 18.285  47.401 19.587 1.00 9.26  ? 74  TRP A CE3 1 
ATOM   566  C  CZ2 . TRP A 1 75  ? 19.106  49.565 17.941 1.00 11.30 ? 74  TRP A CZ2 1 
ATOM   567  C  CZ3 . TRP A 1 75  ? 18.369  47.266 18.203 1.00 9.37  ? 74  TRP A CZ3 1 
ATOM   568  C  CH2 . TRP A 1 75  ? 18.779  48.339 17.396 1.00 10.85 ? 74  TRP A CH2 1 
ATOM   569  N  N   . PRO A 1 76  ? 17.889  46.147 25.082 1.00 9.15  ? 75  PRO A N   1 
ATOM   570  C  CA  . PRO A 1 76  ? 18.256  45.325 26.250 1.00 9.55  ? 75  PRO A CA  1 
ATOM   571  C  C   . PRO A 1 76  ? 18.331  43.811 25.981 1.00 9.94  ? 75  PRO A C   1 
ATOM   572  O  O   . PRO A 1 76  ? 19.189  43.133 26.556 1.00 10.09 ? 75  PRO A O   1 
ATOM   573  C  CB  . PRO A 1 76  ? 17.160  45.649 27.271 1.00 9.33  ? 75  PRO A CB  1 
ATOM   574  C  CG  . PRO A 1 76  ? 16.656  46.976 26.874 1.00 8.70  ? 75  PRO A CG  1 
ATOM   575  C  CD  . PRO A 1 76  ? 16.694  46.956 25.363 1.00 8.78  ? 75  PRO A CD  1 
ATOM   576  N  N   . ALA A 1 77  ? 17.478  43.291 25.095 1.00 10.03 ? 76  ALA A N   1 
ATOM   577  C  CA  . ALA A 1 77  ? 17.545  41.889 24.696 1.00 9.81  ? 76  ALA A CA  1 
ATOM   578  C  C   . ALA A 1 77  ? 18.881  41.515 23.991 1.00 10.38 ? 76  ALA A C   1 
ATOM   579  O  O   . ALA A 1 77  ? 19.430  40.423 24.194 1.00 9.83  ? 76  ALA A O   1 
ATOM   580  C  CB  . ALA A 1 77  ? 16.343  41.537 23.837 1.00 9.51  ? 76  ALA A CB  1 
ATOM   581  N  N   . ILE A 1 78  ? 19.391  42.423 23.157 1.00 11.02 ? 77  ILE A N   1 
ATOM   582  C  CA  . ILE A 1 78  ? 20.702  42.245 22.532 1.00 11.56 ? 77  ILE A CA  1 
ATOM   583  C  C   . ILE A 1 78  ? 21.784  42.375 23.589 1.00 12.16 ? 77  ILE A C   1 
ATOM   584  O  O   . ILE A 1 78  ? 22.718  41.566 23.631 1.00 12.92 ? 77  ILE A O   1 
ATOM   585  C  CB  . ILE A 1 78  ? 20.942  43.271 21.408 1.00 11.97 ? 77  ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 78  ? 20.012  42.999 20.214 1.00 12.35 ? 77  ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 78  ? 22.412  43.326 20.966 1.00 10.51 ? 77  ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 78  ? 19.788  44.278 19.373 1.00 13.68 ? 77  ILE A CD1 1 
ATOM   589  N  N   . GLN A 1 79  ? 21.675  43.374 24.456 1.00 12.44 ? 78  GLN A N   1 
ATOM   590  C  CA  . GLN A 1 79  ? 22.658  43.487 25.530 1.00 13.32 ? 78  GLN A CA  1 
ATOM   591  C  C   . GLN A 1 79  ? 22.806  42.151 26.270 1.00 13.74 ? 78  GLN A C   1 
ATOM   592  O  O   . GLN A 1 79  ? 23.930  41.727 26.569 1.00 13.73 ? 78  GLN A O   1 
ATOM   593  C  CB  . GLN A 1 79  ? 22.304  44.584 26.513 1.00 13.29 ? 78  GLN A CB  1 
ATOM   594  C  CG  . GLN A 1 79  ? 22.488  45.981 25.992 1.00 13.24 ? 78  GLN A CG  1 
ATOM   595  C  CD  . GLN A 1 79  ? 22.126  47.025 27.022 1.00 12.67 ? 78  GLN A CD  1 
ATOM   596  O  OE1 . GLN A 1 79  ? 21.211  46.819 27.831 1.00 12.86 ? 78  GLN A OE1 1 
ATOM   597  N  NE2 . GLN A 1 79  ? 22.857  48.142 27.025 1.00 10.80 ? 78  GLN A NE2 1 
ATOM   598  N  N   . SER A 1 80  ? 21.668  41.490 26.530 1.00 13.58 ? 79  SER A N   1 
ATOM   599  C  CA  . SER A 1 80  ? 21.616  40.206 27.264 1.00 12.55 ? 79  SER A CA  1 
ATOM   600  C  C   . SER A 1 80  ? 22.439  39.051 26.702 1.00 12.77 ? 79  SER A C   1 
ATOM   601  O  O   . SER A 1 80  ? 22.785  38.152 27.447 1.00 12.23 ? 79  SER A O   1 
ATOM   602  C  CB  . SER A 1 80  ? 20.171  39.748 27.456 1.00 11.62 ? 79  SER A CB  1 
ATOM   603  O  OG  . SER A 1 80  ? 19.759  38.899 26.406 1.00 9.60  ? 79  SER A OG  1 
ATOM   604  N  N   . SER A 1 81  ? 22.730  39.077 25.399 1.00 14.23 ? 80  SER A N   1 
ATOM   605  C  CA  . SER A 1 81  ? 23.358  37.953 24.647 1.00 15.12 ? 80  SER A CA  1 
ATOM   606  C  C   . SER A 1 81  ? 22.747  36.566 24.889 1.00 15.46 ? 80  SER A C   1 
ATOM   607  O  O   . SER A 1 81  ? 23.484  35.567 24.914 1.00 16.59 ? 80  SER A O   1 
ATOM   608  C  CB  . SER A 1 81  ? 24.858  37.862 24.927 1.00 15.09 ? 80  SER A CB  1 
ATOM   609  O  OG  . SER A 1 81  ? 25.453  39.152 24.976 1.00 19.37 ? 80  SER A OG  1 
ATOM   610  N  N   . ALA A 1 82  ? 21.433  36.475 25.071 1.00 14.83 ? 81  ALA A N   1 
ATOM   611  C  CA  . ALA A 1 82  ? 20.857  35.203 25.488 1.00 14.63 ? 81  ALA A CA  1 
ATOM   612  C  C   . ALA A 1 82  ? 19.659  34.800 24.643 1.00 14.52 ? 81  ALA A C   1 
ATOM   613  O  O   . ALA A 1 82  ? 18.988  35.650 24.040 1.00 14.13 ? 81  ALA A O   1 
ATOM   614  C  CB  . ALA A 1 82  ? 20.500  35.222 26.980 1.00 14.21 ? 81  ALA A CB  1 
ATOM   615  N  N   . LEU A 1 83  ? 19.441  33.486 24.588 1.00 14.42 ? 82  LEU A N   1 
ATOM   616  C  CA  . LEU A 1 83  ? 18.384  32.856 23.787 1.00 14.36 ? 82  LEU A CA  1 
ATOM   617  C  C   . LEU A 1 83  ? 17.521  32.000 24.724 1.00 14.35 ? 82  LEU A C   1 
ATOM   618  O  O   . LEU A 1 83  ? 18.047  31.244 25.545 1.00 15.76 ? 82  LEU A O   1 
ATOM   619  C  CB  . LEU A 1 83  ? 19.005  31.972 22.692 1.00 13.93 ? 82  LEU A CB  1 
ATOM   620  C  CG  . LEU A 1 83  ? 19.954  32.566 21.621 1.00 13.71 ? 82  LEU A CG  1 
ATOM   621  C  CD1 . LEU A 1 83  ? 20.765  31.531 20.872 1.00 13.44 ? 82  LEU A CD1 1 
ATOM   622  C  CD2 . LEU A 1 83  ? 19.228  33.405 20.605 1.00 11.91 ? 82  LEU A CD2 1 
ATOM   623  N  N   . TYR A 1 84  ? 16.203  32.113 24.627 1.00 13.68 ? 83  TYR A N   1 
ATOM   624  C  CA  . TYR A 1 84  ? 15.348  31.234 25.407 1.00 12.19 ? 83  TYR A CA  1 
ATOM   625  C  C   . TYR A 1 84  ? 15.609  29.823 24.987 1.00 12.15 ? 83  TYR A C   1 
ATOM   626  O  O   . TYR A 1 84  ? 15.455  29.490 23.813 1.00 12.81 ? 83  TYR A O   1 
ATOM   627  C  CB  . TYR A 1 84  ? 13.871  31.547 25.210 1.00 11.55 ? 83  TYR A CB  1 
ATOM   628  C  CG  . TYR A 1 84  ? 12.976  30.649 26.038 1.00 9.39  ? 83  TYR A CG  1 
ATOM   629  C  CD1 . TYR A 1 84  ? 12.947  30.762 27.429 1.00 9.23  ? 83  TYR A CD1 1 
ATOM   630  C  CD2 . TYR A 1 84  ? 12.168  29.692 25.434 1.00 7.60  ? 83  TYR A CD2 1 
ATOM   631  C  CE1 . TYR A 1 84  ? 12.130  29.930 28.214 1.00 10.06 ? 83  TYR A CE1 1 
ATOM   632  C  CE2 . TYR A 1 84  ? 11.336  28.856 26.201 1.00 9.57  ? 83  TYR A CE2 1 
ATOM   633  C  CZ  . TYR A 1 84  ? 11.330  28.979 27.592 1.00 10.13 ? 83  TYR A CZ  1 
ATOM   634  O  OH  . TYR A 1 84  ? 10.520  28.175 28.351 1.00 9.94  ? 83  TYR A OH  1 
ATOM   635  N  N   . GLU A 1 85  ? 16.014  28.998 25.939 1.00 12.13 ? 84  GLU A N   1 
ATOM   636  C  CA  . GLU A 1 85  ? 16.311  27.573 25.691 1.00 12.68 ? 84  GLU A CA  1 
ATOM   637  C  C   . GLU A 1 85  ? 17.268  27.345 24.504 1.00 12.41 ? 84  GLU A C   1 
ATOM   638  O  O   . GLU A 1 85  ? 17.095  26.424 23.717 1.00 12.18 ? 84  GLU A O   1 
ATOM   639  C  CB  . GLU A 1 85  ? 15.023  26.758 25.555 1.00 11.81 ? 84  GLU A CB  1 
ATOM   640  C  CG  . GLU A 1 85  ? 14.252  26.631 26.844 1.00 12.35 ? 84  GLU A CG  1 
ATOM   641  C  CD  . GLU A 1 85  ? 12.967  25.819 26.712 1.00 13.87 ? 84  GLU A CD  1 
ATOM   642  O  OE1 . GLU A 1 85  ? 12.296  25.844 25.652 1.00 15.80 ? 84  GLU A OE1 1 
ATOM   643  O  OE2 . GLU A 1 85  ? 12.617  25.145 27.690 1.00 16.42 ? 84  GLU A OE2 1 
ATOM   644  N  N   . ASP A 1 86  ? 18.263  28.222 24.402 1.00 12.97 ? 85  ASP A N   1 
ATOM   645  C  CA  . ASP A 1 86  ? 19.374  28.139 23.450 1.00 13.64 ? 85  ASP A CA  1 
ATOM   646  C  C   . ASP A 1 86  ? 19.006  28.312 21.993 1.00 13.93 ? 85  ASP A C   1 
ATOM   647  O  O   . ASP A 1 86  ? 19.847  28.052 21.120 1.00 13.86 ? 85  ASP A O   1 
ATOM   648  C  CB  . ASP A 1 86  ? 20.155  26.845 23.615 1.00 13.70 ? 85  ASP A CB  1 
ATOM   649  C  CG  . ASP A 1 86  ? 20.544  26.587 25.038 1.00 15.60 ? 85  ASP A CG  1 
ATOM   650  O  OD1 . ASP A 1 86  ? 21.513  27.209 25.512 1.00 16.02 ? 85  ASP A OD1 1 
ATOM   651  O  OD2 . ASP A 1 86  ? 19.876  25.742 25.680 1.00 18.78 ? 85  ASP A OD2 1 
ATOM   652  N  N   . ARG A 1 87  ? 17.763  28.732 21.723 1.00 14.31 ? 86  ARG A N   1 
ATOM   653  C  CA  . ARG A 1 87  ? 17.267  28.830 20.335 1.00 14.17 ? 86  ARG A CA  1 
ATOM   654  C  C   . ARG A 1 87  ? 16.401  30.034 20.015 1.00 14.00 ? 86  ARG A C   1 
ATOM   655  O  O   . ARG A 1 87  ? 16.548  30.630 18.962 1.00 14.62 ? 86  ARG A O   1 
ATOM   656  C  CB  . ARG A 1 87  ? 16.500  27.568 19.950 1.00 14.27 ? 86  ARG A CB  1 
ATOM   657  C  CG  . ARG A 1 87  ? 17.359  26.328 19.677 1.00 13.95 ? 86  ARG A CG  1 
ATOM   658  C  CD  . ARG A 1 87  ? 16.619  25.154 20.218 1.00 16.03 ? 86  ARG A CD  1 
ATOM   659  N  NE  . ARG A 1 87  ? 16.362  24.144 19.211 1.00 16.83 ? 86  ARG A NE  1 
ATOM   660  C  CZ  . ARG A 1 87  ? 15.359  23.278 19.262 1.00 15.86 ? 86  ARG A CZ  1 
ATOM   661  N  NH1 . ARG A 1 87  ? 14.501  23.298 20.261 1.00 13.73 ? 86  ARG A NH1 1 
ATOM   662  N  NH2 . ARG A 1 87  ? 15.211  22.401 18.292 1.00 16.39 ? 86  ARG A NH2 1 
ATOM   663  N  N   . TYR A 1 88  ? 15.499  30.379 20.916 1.00 13.99 ? 87  TYR A N   1 
ATOM   664  C  CA  . TYR A 1 88  ? 14.489  31.411 20.670 1.00 14.00 ? 87  TYR A CA  1 
ATOM   665  C  C   . TYR A 1 88  ? 14.970  32.821 21.009 1.00 13.78 ? 87  TYR A C   1 
ATOM   666  O  O   . TYR A 1 88  ? 15.328  33.111 22.145 1.00 14.49 ? 87  TYR A O   1 
ATOM   667  C  CB  . TYR A 1 88  ? 13.209  31.070 21.458 1.00 13.62 ? 87  TYR A CB  1 
ATOM   668  C  CG  . TYR A 1 88  ? 12.039  31.995 21.224 1.00 14.02 ? 87  TYR A CG  1 
ATOM   669  C  CD1 . TYR A 1 88  ? 11.689  32.410 19.935 1.00 13.23 ? 87  TYR A CD1 1 
ATOM   670  C  CD2 . TYR A 1 88  ? 11.255  32.448 22.298 1.00 14.73 ? 87  TYR A CD2 1 
ATOM   671  C  CE1 . TYR A 1 88  ? 10.605  33.263 19.729 1.00 13.16 ? 87  TYR A CE1 1 
ATOM   672  C  CE2 . TYR A 1 88  ? 10.170  33.300 22.088 1.00 13.09 ? 87  TYR A CE2 1 
ATOM   673  C  CZ  . TYR A 1 88  ? 9.862   33.697 20.808 1.00 12.45 ? 87  TYR A CZ  1 
ATOM   674  O  OH  . TYR A 1 88  ? 8.802   34.522 20.600 1.00 13.29 ? 87  TYR A OH  1 
ATOM   675  N  N   . LEU A 1 89  ? 14.952  33.692 20.006 1.00 13.86 ? 88  LEU A N   1 
ATOM   676  C  CA  . LEU A 1 89  ? 15.374  35.090 20.120 1.00 13.69 ? 88  LEU A CA  1 
ATOM   677  C  C   . LEU A 1 89  ? 14.282  36.027 20.640 1.00 13.55 ? 88  LEU A C   1 
ATOM   678  O  O   . LEU A 1 89  ? 14.460  37.246 20.671 1.00 13.87 ? 88  LEU A O   1 
ATOM   679  C  CB  . LEU A 1 89  ? 15.908  35.599 18.759 1.00 13.93 ? 88  LEU A CB  1 
ATOM   680  C  CG  . LEU A 1 89  ? 17.342  35.215 18.333 1.00 15.31 ? 88  LEU A CG  1 
ATOM   681  C  CD1 . LEU A 1 89  ? 17.644  35.563 16.888 1.00 16.12 ? 88  LEU A CD1 1 
ATOM   682  C  CD2 . LEU A 1 89  ? 18.344  35.945 19.218 1.00 17.77 ? 88  LEU A CD2 1 
ATOM   683  N  N   . LEU A 1 90  ? 13.142  35.469 21.023 1.00 13.44 ? 89  LEU A N   1 
ATOM   684  C  CA  . LEU A 1 90  ? 12.149  36.191 21.840 1.00 13.40 ? 89  LEU A CA  1 
ATOM   685  C  C   . LEU A 1 90  ? 11.299  37.254 21.134 1.00 13.61 ? 89  LEU A C   1 
ATOM   686  O  O   . LEU A 1 90  ? 10.703  38.088 21.804 1.00 14.98 ? 89  LEU A O   1 
ATOM   687  C  CB  . LEU A 1 90  ? 12.811  36.807 23.081 1.00 13.12 ? 89  LEU A CB  1 
ATOM   688  C  CG  . LEU A 1 90  ? 13.514  35.894 24.099 1.00 12.62 ? 89  LEU A CG  1 
ATOM   689  C  CD1 . LEU A 1 90  ? 14.513  36.714 24.962 1.00 9.60  ? 89  LEU A CD1 1 
ATOM   690  C  CD2 . LEU A 1 90  ? 12.517  35.117 24.963 1.00 10.47 ? 89  LEU A CD2 1 
ATOM   691  N  N   . GLY A 1 91  ? 11.189  37.192 19.810 1.00 13.24 ? 90  GLY A N   1 
ATOM   692  C  CA  . GLY A 1 91  ? 10.539  38.235 19.024 1.00 12.82 ? 90  GLY A CA  1 
ATOM   693  C  C   . GLY A 1 91  ? 9.179   38.711 19.505 1.00 12.75 ? 90  GLY A C   1 
ATOM   694  O  O   . GLY A 1 91  ? 8.977   39.902 19.677 1.00 13.02 ? 90  GLY A O   1 
ATOM   695  N  N   . THR A 1 92  ? 8.256   37.769 19.703 1.00 12.81 ? 91  THR A N   1 
ATOM   696  C  CA  . THR A 1 92  ? 6.904   38.017 20.220 1.00 12.56 ? 91  THR A CA  1 
ATOM   697  C  C   . THR A 1 92  ? 6.906   38.275 21.714 1.00 12.40 ? 91  THR A C   1 
ATOM   698  O  O   . THR A 1 92  ? 6.100   39.063 22.236 1.00 12.13 ? 91  THR A O   1 
ATOM   699  C  CB  . THR A 1 92  ? 5.999   36.793 19.984 1.00 12.67 ? 91  THR A CB  1 
ATOM   700  O  OG1 . THR A 1 92  ? 5.640   36.734 18.608 1.00 13.08 ? 91  THR A OG1 1 
ATOM   701  C  CG2 . THR A 1 92  ? 4.736   36.870 20.816 1.00 12.19 ? 91  THR A CG2 1 
ATOM   702  N  N   . SER A 1 93  ? 7.814   37.604 22.410 1.00 12.34 ? 92  SER A N   1 
ATOM   703  C  CA  . SER A 1 93  ? 7.841   37.698 23.858 1.00 12.28 ? 92  SER A CA  1 
ATOM   704  C  C   . SER A 1 93  ? 8.231   39.110 24.322 1.00 11.39 ? 92  SER A C   1 
ATOM   705  O  O   . SER A 1 93  ? 7.648   39.654 25.243 1.00 10.62 ? 92  SER A O   1 
ATOM   706  C  CB  . SER A 1 93  ? 8.734   36.597 24.415 1.00 11.94 ? 92  SER A CB  1 
ATOM   707  O  OG  . SER A 1 93  ? 10.021  37.116 24.614 1.00 17.00 ? 92  SER A OG  1 
ATOM   708  N  N   . LEU A 1 94  ? 9.191   39.708 23.629 1.00 11.55 ? 93  LEU A N   1 
ATOM   709  C  CA  . LEU A 1 94  ? 9.582   41.118 23.797 1.00 11.53 ? 93  LEU A CA  1 
ATOM   710  C  C   . LEU A 1 94  ? 8.486   42.163 23.481 1.00 12.02 ? 93  LEU A C   1 
ATOM   711  O  O   . LEU A 1 94  ? 8.503   43.287 24.018 1.00 11.86 ? 93  LEU A O   1 
ATOM   712  C  CB  . LEU A 1 94  ? 10.818  41.391 22.916 1.00 11.44 ? 93  LEU A CB  1 
ATOM   713  C  CG  . LEU A 1 94  ? 12.120  40.676 23.343 1.00 11.20 ? 93  LEU A CG  1 
ATOM   714  C  CD1 . LEU A 1 94  ? 13.156  40.673 22.246 1.00 8.07  ? 93  LEU A CD1 1 
ATOM   715  C  CD2 . LEU A 1 94  ? 12.680  41.297 24.642 1.00 10.11 ? 93  LEU A CD2 1 
ATOM   716  N  N   . ALA A 1 95  ? 7.567   41.816 22.579 1.00 12.42 ? 94  ALA A N   1 
ATOM   717  C  CA  . ALA A 1 95  ? 6.599   42.796 22.057 1.00 12.98 ? 94  ALA A CA  1 
ATOM   718  C  C   . ALA A 1 95  ? 5.460   43.039 23.005 1.00 13.07 ? 94  ALA A C   1 
ATOM   719  O  O   . ALA A 1 95  ? 4.975   44.167 23.105 1.00 13.89 ? 94  ALA A O   1 
ATOM   720  C  CB  . ALA A 1 95  ? 6.072   42.405 20.641 1.00 13.07 ? 94  ALA A CB  1 
ATOM   721  N  N   . ARG A 1 96  ? 5.051   41.990 23.714 1.00 13.11 ? 95  ARG A N   1 
ATOM   722  C  CA  . ARG A 1 96  ? 3.858   42.044 24.577 1.00 13.10 ? 95  ARG A CA  1 
ATOM   723  C  C   . ARG A 1 96  ? 3.887   43.106 25.664 1.00 12.91 ? 95  ARG A C   1 
ATOM   724  O  O   . ARG A 1 96  ? 2.878   43.775 25.834 1.00 13.60 ? 95  ARG A O   1 
ATOM   725  C  CB  . ARG A 1 96  ? 3.494   40.670 25.167 1.00 12.79 ? 95  ARG A CB  1 
ATOM   726  C  CG  . ARG A 1 96  ? 3.386   39.532 24.143 1.00 13.34 ? 95  ARG A CG  1 
ATOM   727  C  CD  . ARG A 1 96  ? 2.631   39.955 22.869 1.00 15.15 ? 95  ARG A CD  1 
ATOM   728  N  NE  . ARG A 1 96  ? 2.323   38.859 21.957 1.00 14.50 ? 95  ARG A NE  1 
ATOM   729  C  CZ  . ARG A 1 96  ? 1.656   39.004 20.807 1.00 15.26 ? 95  ARG A CZ  1 
ATOM   730  N  NH1 . ARG A 1 96  ? 1.251   40.201 20.403 1.00 13.83 ? 95  ARG A NH1 1 
ATOM   731  N  NH2 . ARG A 1 96  ? 1.389   37.947 20.053 1.00 13.84 ? 95  ARG A NH2 1 
ATOM   732  N  N   . PRO A 1 97  ? 5.005   43.228 26.434 1.00 12.79 ? 96  PRO A N   1 
ATOM   733  C  CA  . PRO A 1 97  ? 5.132   44.278 27.460 1.00 12.32 ? 96  PRO A CA  1 
ATOM   734  C  C   . PRO A 1 97  ? 5.139   45.685 26.864 1.00 12.63 ? 96  PRO A C   1 
ATOM   735  O  O   . PRO A 1 97  ? 4.750   46.656 27.516 1.00 12.23 ? 96  PRO A O   1 
ATOM   736  C  CB  . PRO A 1 97  ? 6.491   43.965 28.129 1.00 11.87 ? 96  PRO A CB  1 
ATOM   737  C  CG  . PRO A 1 97  ? 7.234   43.111 27.177 1.00 10.70 ? 96  PRO A CG  1 
ATOM   738  C  CD  . PRO A 1 97  ? 6.191   42.335 26.439 1.00 12.96 ? 96  PRO A CD  1 
ATOM   739  N  N   . CYS A 1 98  ? 5.599   45.778 25.624 1.00 13.01 ? 97  CYS A N   1 
ATOM   740  C  CA  . CYS A 1 98  ? 5.524   47.015 24.863 1.00 12.77 ? 97  CYS A CA  1 
ATOM   741  C  C   . CYS A 1 98  ? 4.059   47.359 24.523 1.00 12.11 ? 97  CYS A C   1 
ATOM   742  O  O   . CYS A 1 98  ? 3.646   48.519 24.590 1.00 12.89 ? 97  CYS A O   1 
ATOM   743  C  CB  . CYS A 1 98  ? 6.401   46.913 23.593 1.00 12.54 ? 97  CYS A CB  1 
ATOM   744  S  SG  . CYS A 1 98  ? 6.671   48.517 22.809 1.00 12.51 ? 97  CYS A SG  1 
ATOM   745  N  N   . ILE A 1 99  ? 3.292   46.343 24.155 1.00 11.47 ? 98  ILE A N   1 
ATOM   746  C  CA  . ILE A 1 99  ? 1.903   46.505 23.782 1.00 11.53 ? 98  ILE A CA  1 
ATOM   747  C  C   . ILE A 1 99  ? 1.023   46.719 25.016 1.00 11.47 ? 98  ILE A C   1 
ATOM   748  O  O   . ILE A 1 99  ? 0.189   47.636 25.044 1.00 12.59 ? 98  ILE A O   1 
ATOM   749  C  CB  . ILE A 1 99  ? 1.382   45.297 22.903 1.00 12.01 ? 98  ILE A CB  1 
ATOM   750  C  CG1 . ILE A 1 99  ? 2.107   45.248 21.532 1.00 11.68 ? 98  ILE A CG1 1 
ATOM   751  C  CG2 . ILE A 1 99  ? -0.163  45.347 22.743 1.00 9.72  ? 98  ILE A CG2 1 
ATOM   752  C  CD1 . ILE A 1 99  ? 2.158   43.853 20.916 1.00 11.63 ? 98  ILE A CD1 1 
ATOM   753  N  N   . ALA A 1 100 ? 1.230   45.897 26.034 1.00 10.92 ? 99  ALA A N   1 
ATOM   754  C  CA  . ALA A 1 100 ? 0.447   45.943 27.267 1.00 11.43 ? 99  ALA A CA  1 
ATOM   755  C  C   . ALA A 1 100 ? 0.564   47.274 28.019 1.00 11.62 ? 99  ALA A C   1 
ATOM   756  O  O   . ALA A 1 100 ? -0.419  47.765 28.621 1.00 11.95 ? 99  ALA A O   1 
ATOM   757  C  CB  . ALA A 1 100 ? 0.850   44.779 28.180 1.00 10.59 ? 99  ALA A CB  1 
ATOM   758  N  N   . ARG A 1 101 ? 1.768   47.838 27.988 1.00 11.72 ? 100 ARG A N   1 
ATOM   759  C  CA  . ARG A 1 101 ? 2.110   49.074 28.705 1.00 12.20 ? 100 ARG A CA  1 
ATOM   760  C  C   . ARG A 1 101 ? 1.353   50.279 28.130 1.00 12.54 ? 100 ARG A C   1 
ATOM   761  O  O   . ARG A 1 101 ? 0.826   51.106 28.871 1.00 12.36 ? 100 ARG A O   1 
ATOM   762  C  CB  . ARG A 1 101 ? 3.632   49.237 28.693 1.00 11.83 ? 100 ARG A CB  1 
ATOM   763  C  CG  . ARG A 1 101 ? 4.211   50.625 28.775 1.00 12.87 ? 100 ARG A CG  1 
ATOM   764  C  CD  . ARG A 1 101 ? 5.723   50.540 28.550 1.00 11.50 ? 100 ARG A CD  1 
ATOM   765  N  NE  . ARG A 1 101 ? 6.233   50.922 27.230 1.00 11.35 ? 100 ARG A NE  1 
ATOM   766  C  CZ  . ARG A 1 101 ? 7.481   51.386 27.032 1.00 14.39 ? 100 ARG A CZ  1 
ATOM   767  N  NH1 . ARG A 1 101 ? 8.311   51.506 28.059 1.00 12.65 ? 100 ARG A NH1 1 
ATOM   768  N  NH2 . ARG A 1 101 ? 7.927   51.735 25.820 1.00 14.47 ? 100 ARG A NH2 1 
ATOM   769  N  N   . LYS A 1 102 ? 1.261   50.325 26.804 1.00 13.81 ? 101 LYS A N   1 
ATOM   770  C  CA  . LYS A 1 102 ? 0.500   51.343 26.092 1.00 14.32 ? 101 LYS A CA  1 
ATOM   771  C  C   . LYS A 1 102 ? -0.993  51.130 26.249 1.00 14.85 ? 101 LYS A C   1 
ATOM   772  O  O   . LYS A 1 102 ? -1.759  52.093 26.246 1.00 15.67 ? 101 LYS A O   1 
ATOM   773  C  CB  . LYS A 1 102 ? 0.872   51.354 24.607 1.00 14.64 ? 101 LYS A CB  1 
ATOM   774  C  CG  . LYS A 1 102 ? 0.112   52.379 23.752 1.00 14.96 ? 101 LYS A CG  1 
ATOM   775  C  CD  . LYS A 1 102 ? 0.411   53.824 24.177 1.00 14.03 ? 101 LYS A CD  1 
ATOM   776  C  CE  . LYS A 1 102 ? 1.770   54.300 23.705 1.00 13.01 ? 101 LYS A CE  1 
ATOM   777  N  NZ  . LYS A 1 102 ? 2.167   55.563 24.386 1.00 12.81 ? 101 LYS A NZ  1 
ATOM   778  N  N   . GLN A 1 103 ? -1.403  49.878 26.396 1.00 14.76 ? 102 GLN A N   1 
ATOM   779  C  CA  . GLN A 1 103 ? -2.796  49.569 26.610 1.00 14.95 ? 102 GLN A CA  1 
ATOM   780  C  C   . GLN A 1 103 ? -3.285  50.065 27.971 1.00 15.28 ? 102 GLN A C   1 
ATOM   781  O  O   . GLN A 1 103 ? -4.343  50.710 28.068 1.00 15.24 ? 102 GLN A O   1 
ATOM   782  C  CB  . GLN A 1 103 ? -2.992  48.073 26.464 1.00 15.18 ? 102 GLN A CB  1 
ATOM   783  C  CG  . GLN A 1 103 ? -4.416  47.593 26.428 1.00 16.28 ? 102 GLN A CG  1 
ATOM   784  C  CD  . GLN A 1 103 ? -4.478  46.092 26.451 1.00 18.55 ? 102 GLN A CD  1 
ATOM   785  O  OE1 . GLN A 1 103 ? -3.466  45.433 26.696 1.00 20.47 ? 102 GLN A OE1 1 
ATOM   786  N  NE2 . GLN A 1 103 ? -5.659  45.529 26.187 1.00 18.25 ? 102 GLN A NE2 1 
ATOM   787  N  N   . VAL A 1 104 ? -2.535  49.732 29.021 1.00 16.11 ? 103 VAL A N   1 
ATOM   788  C  CA  . VAL A 1 104 ? -2.753  50.258 30.384 1.00 16.89 ? 103 VAL A CA  1 
ATOM   789  C  C   . VAL A 1 104 ? -2.758  51.810 30.389 1.00 17.55 ? 103 VAL A C   1 
ATOM   790  O  O   . VAL A 1 104 ? -3.610  52.429 31.025 1.00 18.14 ? 103 VAL A O   1 
ATOM   791  C  CB  . VAL A 1 104 ? -1.664  49.683 31.340 1.00 16.75 ? 103 VAL A CB  1 
ATOM   792  C  CG1 . VAL A 1 104 ? -1.512  50.465 32.634 1.00 15.89 ? 103 VAL A CG1 1 
ATOM   793  C  CG2 . VAL A 1 104 ? -1.945  48.234 31.614 1.00 18.21 ? 103 VAL A CG2 1 
ATOM   794  N  N   . GLU A 1 105 ? -1.827  52.411 29.649 1.00 17.84 ? 104 GLU A N   1 
ATOM   795  C  CA  . GLU A 1 105 ? -1.729  53.855 29.525 1.00 19.17 ? 104 GLU A CA  1 
ATOM   796  C  C   . GLU A 1 105 ? -2.984  54.480 28.904 1.00 19.07 ? 104 GLU A C   1 
ATOM   797  O  O   . GLU A 1 105 ? -3.441  55.537 29.342 1.00 19.05 ? 104 GLU A O   1 
ATOM   798  C  CB  . GLU A 1 105 ? -0.478  54.211 28.711 1.00 19.17 ? 104 GLU A CB  1 
ATOM   799  C  CG  . GLU A 1 105 ? -0.487  55.604 28.073 1.00 20.47 ? 104 GLU A CG  1 
ATOM   800  C  CD  . GLU A 1 105 ? 0.893   56.087 27.611 1.00 21.07 ? 104 GLU A CD  1 
ATOM   801  O  OE1 . GLU A 1 105 ? 1.145   57.311 27.741 1.00 25.92 ? 104 GLU A OE1 1 
ATOM   802  O  OE2 . GLU A 1 105 ? 1.718   55.271 27.124 1.00 22.98 ? 104 GLU A OE2 1 
ATOM   803  N  N   . ILE A 1 106 ? -3.519  53.823 27.868 1.00 19.35 ? 105 ILE A N   1 
ATOM   804  C  CA  . ILE A 1 106 ? -4.731  54.270 27.188 1.00 19.13 ? 105 ILE A CA  1 
ATOM   805  C  C   . ILE A 1 106 ? -5.926  54.070 28.116 1.00 19.54 ? 105 ILE A C   1 
ATOM   806  O  O   . ILE A 1 106 ? -6.833  54.899 28.149 1.00 19.71 ? 105 ILE A O   1 
ATOM   807  C  CB  . ILE A 1 106 ? -4.940  53.553 25.812 1.00 19.09 ? 105 ILE A CB  1 
ATOM   808  C  CG1 . ILE A 1 106 ? -3.792  53.867 24.852 1.00 18.61 ? 105 ILE A CG1 1 
ATOM   809  C  CG2 . ILE A 1 106 ? -6.288  53.943 25.156 1.00 18.31 ? 105 ILE A CG2 1 
ATOM   810  C  CD1 . ILE A 1 106 ? -3.811  53.009 23.571 1.00 18.69 ? 105 ILE A CD1 1 
ATOM   811  N  N   . ALA A 1 107 ? -5.915  52.980 28.886 1.00 19.87 ? 106 ALA A N   1 
ATOM   812  C  CA  . ALA A 1 107 ? -7.052  52.661 29.760 1.00 19.93 ? 106 ALA A CA  1 
ATOM   813  C  C   . ALA A 1 107 ? -7.169  53.645 30.924 1.00 19.78 ? 106 ALA A C   1 
ATOM   814  O  O   . ALA A 1 107 ? -8.258  54.063 31.288 1.00 19.18 ? 106 ALA A O   1 
ATOM   815  C  CB  . ALA A 1 107 ? -6.958  51.244 30.265 1.00 19.67 ? 106 ALA A CB  1 
ATOM   816  N  N   . GLN A 1 108 ? -6.031  54.023 31.490 1.00 20.28 ? 107 GLN A N   1 
ATOM   817  C  CA  . GLN A 1 108 ? -6.026  54.916 32.645 1.00 20.70 ? 107 GLN A CA  1 
ATOM   818  C  C   . GLN A 1 108 ? -6.311  56.330 32.213 1.00 21.46 ? 107 GLN A C   1 
ATOM   819  O  O   . GLN A 1 108 ? -6.904  57.109 32.969 1.00 22.40 ? 107 GLN A O   1 
ATOM   820  C  CB  . GLN A 1 108 ? -4.709  54.832 33.391 1.00 20.26 ? 107 GLN A CB  1 
ATOM   821  C  CG  . GLN A 1 108 ? -4.481  53.463 33.978 1.00 18.59 ? 107 GLN A CG  1 
ATOM   822  C  CD  . GLN A 1 108 ? -3.272  53.426 34.853 1.00 17.68 ? 107 GLN A CD  1 
ATOM   823  O  OE1 . GLN A 1 108 ? -2.223  53.956 34.495 1.00 16.26 ? 107 GLN A OE1 1 
ATOM   824  N  NE2 . GLN A 1 108 ? -3.406  52.805 36.024 1.00 18.05 ? 107 GLN A NE2 1 
ATOM   825  N  N   . ARG A 1 109 ? -5.925  56.654 30.986 1.00 21.40 ? 108 ARG A N   1 
ATOM   826  C  CA  . ARG A 1 109 ? -6.238  57.955 30.427 1.00 21.77 ? 108 ARG A CA  1 
ATOM   827  C  C   . ARG A 1 109 ? -7.733  58.100 30.200 1.00 21.38 ? 108 ARG A C   1 
ATOM   828  O  O   . ARG A 1 109 ? -8.321  59.120 30.557 1.00 22.00 ? 108 ARG A O   1 
ATOM   829  C  CB  . ARG A 1 109 ? -5.493  58.148 29.110 1.00 22.08 ? 108 ARG A CB  1 
ATOM   830  C  CG  . ARG A 1 109 ? -5.319  59.580 28.705 1.00 22.94 ? 108 ARG A CG  1 
ATOM   831  C  CD  . ARG A 1 109 ? -5.049  59.664 27.232 1.00 25.52 ? 108 ARG A CD  1 
ATOM   832  N  NE  . ARG A 1 109 ? -3.795  58.997 26.892 1.00 27.44 ? 108 ARG A NE  1 
ATOM   833  C  CZ  . ARG A 1 109 ? -3.561  58.392 25.731 1.00 27.74 ? 108 ARG A CZ  1 
ATOM   834  N  NH1 . ARG A 1 109 ? -4.519  58.346 24.805 1.00 27.65 ? 108 ARG A NH1 1 
ATOM   835  N  NH2 . ARG A 1 109 ? -2.379  57.820 25.507 1.00 26.46 ? 108 ARG A NH2 1 
ATOM   836  N  N   . GLU A 1 110 ? -8.331  57.074 29.595 1.00 21.19 ? 109 GLU A N   1 
ATOM   837  C  CA  . GLU A 1 110 ? -9.755  57.036 29.264 1.00 20.45 ? 109 GLU A CA  1 
ATOM   838  C  C   . GLU A 1 110 ? -10.669 56.877 30.478 1.00 20.16 ? 109 GLU A C   1 
ATOM   839  O  O   . GLU A 1 110 ? -11.861 57.160 30.385 1.00 20.64 ? 109 GLU A O   1 
ATOM   840  C  CB  . GLU A 1 110 ? -10.032 55.908 28.282 1.00 20.02 ? 109 GLU A CB  1 
ATOM   841  C  CG  . GLU A 1 110 ? -9.649  56.227 26.844 1.00 21.60 ? 109 GLU A CG  1 
ATOM   842  C  CD  . GLU A 1 110 ? -10.455 57.380 26.261 1.00 19.63 ? 109 GLU A CD  1 
ATOM   843  O  OE1 . GLU A 1 110 ? -11.690 57.287 26.248 1.00 20.32 ? 109 GLU A OE1 1 
ATOM   844  O  OE2 . GLU A 1 110 ? -9.851  58.382 25.831 1.00 19.58 ? 109 GLU A OE2 1 
ATOM   845  N  N   . GLY A 1 111 ? -10.117 56.439 31.607 1.00 19.43 ? 110 GLY A N   1 
ATOM   846  C  CA  . GLY A 1 111 ? -10.929 56.113 32.784 1.00 18.90 ? 110 GLY A CA  1 
ATOM   847  C  C   . GLY A 1 111 ? -11.673 54.800 32.600 1.00 18.47 ? 110 GLY A C   1 
ATOM   848  O  O   . GLY A 1 111 ? -12.750 54.602 33.164 1.00 18.39 ? 110 GLY A O   1 
ATOM   849  N  N   . ALA A 1 112 ? -11.077 53.910 31.805 1.00 18.02 ? 111 ALA A N   1 
ATOM   850  C  CA  . ALA A 1 112 ? -11.626 52.592 31.484 1.00 17.71 ? 111 ALA A CA  1 
ATOM   851  C  C   . ALA A 1 112 ? -11.278 51.605 32.594 1.00 17.83 ? 111 ALA A C   1 
ATOM   852  O  O   . ALA A 1 112 ? -10.117 51.528 32.986 1.00 18.11 ? 111 ALA A O   1 
ATOM   853  C  CB  . ALA A 1 112 ? -11.080 52.118 30.148 1.00 16.39 ? 111 ALA A CB  1 
ATOM   854  N  N   . LYS A 1 113 ? -12.276 50.878 33.118 1.00 18.01 ? 112 LYS A N   1 
ATOM   855  C  CA  . LYS A 1 113 ? -12.045 49.932 34.240 1.00 17.95 ? 112 LYS A CA  1 
ATOM   856  C  C   . LYS A 1 113 ? -11.451 48.577 33.825 1.00 17.05 ? 112 LYS A C   1 
ATOM   857  O  O   . LYS A 1 113 ? -10.908 47.841 34.668 1.00 16.85 ? 112 LYS A O   1 
ATOM   858  C  CB  . LYS A 1 113 ? -13.306 49.716 35.090 1.00 17.82 ? 112 LYS A CB  1 
ATOM   859  C  CG  . LYS A 1 113 ? -14.039 50.994 35.468 1.00 21.33 ? 112 LYS A CG  1 
ATOM   860  C  CD  . LYS A 1 113 ? -14.377 51.115 36.983 1.00 27.28 ? 112 LYS A CD  1 
ATOM   861  C  CE  . LYS A 1 113 ? -15.130 49.910 37.596 1.00 28.58 ? 112 LYS A CE  1 
ATOM   862  N  NZ  . LYS A 1 113 ? -16.317 49.428 36.833 1.00 29.02 ? 112 LYS A NZ  1 
ATOM   863  N  N   . TYR A 1 114 ? -11.545 48.276 32.531 1.00 16.04 ? 113 TYR A N   1 
ATOM   864  C  CA  . TYR A 1 114 ? -11.199 46.962 31.989 1.00 15.42 ? 113 TYR A CA  1 
ATOM   865  C  C   . TYR A 1 114 ? -10.303 47.071 30.773 1.00 14.99 ? 113 TYR A C   1 
ATOM   866  O  O   . TYR A 1 114 ? -10.400 48.026 29.997 1.00 14.56 ? 113 TYR A O   1 
ATOM   867  C  CB  . TYR A 1 114 ? -12.454 46.190 31.545 1.00 15.33 ? 113 TYR A CB  1 
ATOM   868  C  CG  . TYR A 1 114 ? -13.529 46.093 32.570 1.00 14.29 ? 113 TYR A CG  1 
ATOM   869  C  CD1 . TYR A 1 114 ? -14.406 47.157 32.799 1.00 12.71 ? 113 TYR A CD1 1 
ATOM   870  C  CD2 . TYR A 1 114 ? -13.704 44.914 33.294 1.00 13.73 ? 113 TYR A CD2 1 
ATOM   871  C  CE1 . TYR A 1 114 ? -15.406 47.057 33.776 1.00 14.75 ? 113 TYR A CE1 1 
ATOM   872  C  CE2 . TYR A 1 114 ? -14.701 44.797 34.252 1.00 12.85 ? 113 TYR A CE2 1 
ATOM   873  C  CZ  . TYR A 1 114 ? -15.537 45.865 34.493 1.00 14.18 ? 113 TYR A CZ  1 
ATOM   874  O  OH  . TYR A 1 114 ? -16.526 45.719 35.423 1.00 15.03 ? 113 TYR A OH  1 
ATOM   875  N  N   . VAL A 1 115 ? -9.445  46.062 30.628 1.00 14.67 ? 114 VAL A N   1 
ATOM   876  C  CA  . VAL A 1 115 ? -8.660  45.824 29.424 1.00 14.10 ? 114 VAL A CA  1 
ATOM   877  C  C   . VAL A 1 115 ? -9.006  44.399 28.983 1.00 14.45 ? 114 VAL A C   1 
ATOM   878  O  O   . VAL A 1 115 ? -9.582  43.628 29.758 1.00 13.49 ? 114 VAL A O   1 
ATOM   879  C  CB  . VAL A 1 115 ? -7.140  45.907 29.666 1.00 14.02 ? 114 VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 115 ? -6.715  47.316 30.040 1.00 13.30 ? 114 VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 115 ? -6.704  44.880 30.728 1.00 13.08 ? 114 VAL A CG2 1 
ATOM   882  N  N   . SER A 1 116 ? -8.634  44.054 27.748 1.00 14.30 ? 115 SER A N   1 
ATOM   883  C  CA  . SER A 1 116 ? -9.038  42.789 27.140 1.00 14.38 ? 115 SER A CA  1 
ATOM   884  C  C   . SER A 1 116 ? -8.065  42.411 26.015 1.00 14.60 ? 115 SER A C   1 
ATOM   885  O  O   . SER A 1 116 ? -7.346  43.277 25.499 1.00 15.16 ? 115 SER A O   1 
ATOM   886  C  CB  . SER A 1 116 ? -10.472 42.927 26.605 1.00 13.27 ? 115 SER A CB  1 
ATOM   887  O  OG  . SER A 1 116 ? -10.943 41.709 26.109 1.00 14.80 ? 115 SER A OG  1 
ATOM   888  N  N   . HIS A 1 117 ? -8.048  41.126 25.653 1.00 14.64 ? 116 HIS A N   1 
ATOM   889  C  CA  . HIS A 1 117 ? -7.151  40.566 24.632 1.00 14.47 ? 116 HIS A CA  1 
ATOM   890  C  C   . HIS A 1 117 ? -7.710  39.242 24.070 1.00 14.89 ? 116 HIS A C   1 
ATOM   891  O  O   . HIS A 1 117 ? -8.524  38.574 24.726 1.00 14.69 ? 116 HIS A O   1 
ATOM   892  C  CB  . HIS A 1 117 ? -5.737  40.306 25.218 1.00 14.76 ? 116 HIS A CB  1 
ATOM   893  C  CG  . HIS A 1 117 ? -5.705  39.243 26.276 1.00 12.62 ? 116 HIS A CG  1 
ATOM   894  N  ND1 . HIS A 1 117 ? -5.821  37.906 25.984 1.00 11.06 ? 116 HIS A ND1 1 
ATOM   895  C  CD2 . HIS A 1 117 ? -5.612  39.323 27.628 1.00 12.37 ? 116 HIS A CD2 1 
ATOM   896  C  CE1 . HIS A 1 117 ? -5.769  37.203 27.106 1.00 11.02 ? 116 HIS A CE1 1 
ATOM   897  N  NE2 . HIS A 1 117 ? -5.651  38.039 28.120 1.00 8.79  ? 116 HIS A NE2 1 
ATOM   898  N  N   . GLY A 1 118 ? -7.247  38.864 22.874 1.00 14.60 ? 117 GLY A N   1 
ATOM   899  C  CA  . GLY A 1 118 ? -7.717  37.661 22.195 1.00 14.74 ? 117 GLY A CA  1 
ATOM   900  C  C   . GLY A 1 118 ? -6.754  36.481 22.216 1.00 15.42 ? 117 GLY A C   1 
ATOM   901  O  O   . GLY A 1 118 ? -6.882  35.576 21.401 1.00 15.50 ? 117 GLY A O   1 
ATOM   902  N  N   . ALA A 1 119 ? -5.786  36.497 23.135 1.00 15.55 ? 118 ALA A N   1 
ATOM   903  C  CA  . ALA A 1 119 ? -4.881  35.365 23.360 1.00 15.93 ? 118 ALA A CA  1 
ATOM   904  C  C   . ALA A 1 119 ? -5.639  34.124 23.845 1.00 16.31 ? 118 ALA A C   1 
ATOM   905  O  O   . ALA A 1 119 ? -6.618  34.246 24.597 1.00 16.46 ? 118 ALA A O   1 
ATOM   906  C  CB  . ALA A 1 119 ? -3.805  35.750 24.366 1.00 15.75 ? 118 ALA A CB  1 
ATOM   907  N  N   . THR A 1 120 ? -5.192  32.945 23.409 1.00 16.44 ? 119 THR A N   1 
ATOM   908  C  CA  . THR A 1 120 ? -5.843  31.677 23.792 1.00 17.15 ? 119 THR A CA  1 
ATOM   909  C  C   . THR A 1 120 ? -5.465  31.205 25.209 1.00 16.45 ? 119 THR A C   1 
ATOM   910  O  O   . THR A 1 120 ? -4.497  31.701 25.803 1.00 17.14 ? 119 THR A O   1 
ATOM   911  C  CB  . THR A 1 120 ? -5.581  30.516 22.769 1.00 17.37 ? 119 THR A CB  1 
ATOM   912  O  OG1 . THR A 1 120 ? -4.320  29.882 23.034 1.00 19.49 ? 119 THR A OG1 1 
ATOM   913  C  CG2 . THR A 1 120 ? -5.617  31.004 21.333 1.00 17.45 ? 119 THR A CG2 1 
ATOM   914  N  N   . GLY A 1 121 ? -6.226  30.237 25.721 1.00 15.60 ? 120 GLY A N   1 
ATOM   915  C  CA  . GLY A 1 121 ? -6.118  29.757 27.102 1.00 14.13 ? 120 GLY A CA  1 
ATOM   916  C  C   . GLY A 1 121 ? -4.910  28.880 27.374 1.00 13.66 ? 120 GLY A C   1 
ATOM   917  O  O   . GLY A 1 121 ? -4.592  28.596 28.526 1.00 13.96 ? 120 GLY A O   1 
ATOM   918  N  N   . LYS A 1 122 ? -4.225  28.476 26.309 1.00 12.71 ? 121 LYS A N   1 
ATOM   919  C  CA  . LYS A 1 122 ? -3.095  27.566 26.371 1.00 11.37 ? 121 LYS A CA  1 
ATOM   920  C  C   . LYS A 1 122 ? -1.780  28.261 25.994 1.00 10.62 ? 121 LYS A C   1 
ATOM   921  O  O   . LYS A 1 122 ? -0.728  27.613 25.931 1.00 10.03 ? 121 LYS A O   1 
ATOM   922  C  CB  . LYS A 1 122 ? -3.329  26.419 25.398 1.00 11.78 ? 121 LYS A CB  1 
ATOM   923  C  CG  . LYS A 1 122 ? -4.622  25.640 25.636 1.00 13.27 ? 121 LYS A CG  1 
ATOM   924  C  CD  . LYS A 1 122 ? -4.930  24.705 24.474 1.00 15.11 ? 121 LYS A CD  1 
ATOM   925  C  CE  . LYS A 1 122 ? -5.754  23.512 24.946 1.00 15.51 ? 121 LYS A CE  1 
ATOM   926  N  NZ  . LYS A 1 122 ? -5.883  22.484 23.867 1.00 15.25 ? 121 LYS A NZ  1 
ATOM   927  N  N   . GLY A 1 123 ? -1.831  29.570 25.752 1.00 9.43  ? 122 GLY A N   1 
ATOM   928  C  CA  . GLY A 1 123 ? -0.644  30.325 25.362 1.00 8.52  ? 122 GLY A CA  1 
ATOM   929  C  C   . GLY A 1 123 ? 0.207   31.009 26.421 1.00 8.51  ? 122 GLY A C   1 
ATOM   930  O  O   . GLY A 1 123 ? -0.070  30.974 27.644 1.00 6.85  ? 122 GLY A O   1 
ATOM   931  N  N   . ASN A 1 124 ? 1.295   31.603 25.923 1.00 8.74  ? 123 ASN A N   1 
ATOM   932  C  CA  . ASN A 1 124 ? 2.199   32.461 26.699 1.00 8.15  ? 123 ASN A CA  1 
ATOM   933  C  C   . ASN A 1 124 ? 1.713   33.884 26.735 1.00 8.53  ? 123 ASN A C   1 
ATOM   934  O  O   . ASN A 1 124 ? 1.851   34.554 27.753 1.00 9.44  ? 123 ASN A O   1 
ATOM   935  C  CB  . ASN A 1 124 ? 3.575   32.473 26.069 1.00 7.72  ? 123 ASN A CB  1 
ATOM   936  C  CG  . ASN A 1 124 ? 4.321   31.194 26.292 1.00 7.51  ? 123 ASN A CG  1 
ATOM   937  O  OD1 . ASN A 1 124 ? 4.234   30.589 27.371 1.00 6.83  ? 123 ASN A OD1 1 
ATOM   938  N  ND2 . ASN A 1 124 ? 5.070   30.766 25.277 1.00 2.00  ? 123 ASN A ND2 1 
ATOM   939  N  N   . ASP A 1 125 ? 1.140   34.355 25.631 1.00 8.96  ? 124 ASP A N   1 
ATOM   940  C  CA  . ASP A 1 125 ? 0.804   35.777 25.492 1.00 10.03 ? 124 ASP A CA  1 
ATOM   941  C  C   . ASP A 1 125 ? -0.256  36.260 26.473 1.00 10.27 ? 124 ASP A C   1 
ATOM   942  O  O   . ASP A 1 125 ? -0.196  37.420 26.913 1.00 11.20 ? 124 ASP A O   1 
ATOM   943  C  CB  . ASP A 1 125 ? 0.372   36.122 24.065 1.00 10.29 ? 124 ASP A CB  1 
ATOM   944  C  CG  . ASP A 1 125 ? 1.520   36.042 23.052 1.00 11.62 ? 124 ASP A CG  1 
ATOM   945  O  OD1 . ASP A 1 125 ? 2.692   36.319 23.389 1.00 11.15 ? 124 ASP A OD1 1 
ATOM   946  O  OD2 . ASP A 1 125 ? 1.232   35.731 21.880 1.00 16.24 ? 124 ASP A OD2 1 
ATOM   947  N  N   . GLN A 1 126 ? -1.206  35.391 26.826 1.00 9.57  ? 125 GLN A N   1 
ATOM   948  C  CA  . GLN A 1 126 ? -2.237  35.751 27.805 1.00 9.96  ? 125 GLN A CA  1 
ATOM   949  C  C   . GLN A 1 126 ? -1.565  36.224 29.076 1.00 9.97  ? 125 GLN A C   1 
ATOM   950  O  O   . GLN A 1 126 ? -1.954  37.234 29.655 1.00 10.25 ? 125 GLN A O   1 
ATOM   951  C  CB  . GLN A 1 126 ? -3.200  34.568 28.096 1.00 9.72  ? 125 GLN A CB  1 
ATOM   952  C  CG  . GLN A 1 126 ? -2.488  33.219 28.291 1.00 10.83 ? 125 GLN A CG  1 
ATOM   953  C  CD  . GLN A 1 126 ? -3.362  32.085 28.775 1.00 10.46 ? 125 GLN A CD  1 
ATOM   954  O  OE1 . GLN A 1 126 ? -4.517  32.268 29.156 1.00 11.17 ? 125 GLN A OE1 1 
ATOM   955  N  NE2 . GLN A 1 126 ? -2.800  30.887 28.763 1.00 12.21 ? 125 GLN A NE2 1 
ATOM   956  N  N   . VAL A 1 127 ? -0.548  35.467 29.482 1.00 10.29 ? 126 VAL A N   1 
ATOM   957  C  CA  . VAL A 1 127 ? 0.238   35.691 30.673 1.00 10.50 ? 126 VAL A CA  1 
ATOM   958  C  C   . VAL A 1 127 ? 1.006   37.007 30.576 1.00 10.99 ? 126 VAL A C   1 
ATOM   959  O  O   . VAL A 1 127 ? 1.051   37.785 31.521 1.00 11.01 ? 126 VAL A O   1 
ATOM   960  C  CB  . VAL A 1 127 ? 1.275   34.526 30.863 1.00 11.15 ? 126 VAL A CB  1 
ATOM   961  C  CG1 . VAL A 1 127 ? 2.061   34.682 32.173 1.00 10.34 ? 126 VAL A CG1 1 
ATOM   962  C  CG2 . VAL A 1 127 ? 0.613   33.128 30.768 1.00 8.64  ? 126 VAL A CG2 1 
ATOM   963  N  N   . ARG A 1 128 ? 1.613   37.249 29.419 1.00 11.51 ? 127 ARG A N   1 
ATOM   964  C  CA  . ARG A 1 128 ? 2.483   38.405 29.241 1.00 11.16 ? 127 ARG A CA  1 
ATOM   965  C  C   . ARG A 1 128 ? 1.696   39.707 29.310 1.00 11.92 ? 127 ARG A C   1 
ATOM   966  O  O   . ARG A 1 128 ? 2.089   40.620 30.031 1.00 12.60 ? 127 ARG A O   1 
ATOM   967  C  CB  . ARG A 1 128 ? 3.306   38.277 27.945 1.00 10.48 ? 127 ARG A CB  1 
ATOM   968  C  CG  . ARG A 1 128 ? 4.108   36.981 27.870 1.00 9.18  ? 127 ARG A CG  1 
ATOM   969  C  CD  . ARG A 1 128 ? 4.646   36.720 26.447 1.00 9.87  ? 127 ARG A CD  1 
ATOM   970  N  NE  . ARG A 1 128 ? 5.639   35.643 26.404 1.00 5.75  ? 127 ARG A NE  1 
ATOM   971  C  CZ  . ARG A 1 128 ? 5.931   34.939 25.317 1.00 4.44  ? 127 ARG A CZ  1 
ATOM   972  N  NH1 . ARG A 1 128 ? 5.319   35.168 24.163 1.00 6.34  ? 127 ARG A NH1 1 
ATOM   973  N  NH2 . ARG A 1 128 ? 6.825   33.989 25.378 1.00 4.11  ? 127 ARG A NH2 1 
ATOM   974  N  N   . PHE A 1 129 ? 0.588   39.779 28.561 1.00 12.27 ? 128 PHE A N   1 
ATOM   975  C  CA  . PHE A 1 129 ? -0.310  40.937 28.569 1.00 12.10 ? 128 PHE A CA  1 
ATOM   976  C  C   . PHE A 1 129 ? -0.743  41.230 30.002 1.00 12.01 ? 128 PHE A C   1 
ATOM   977  O  O   . PHE A 1 129 ? -0.580  42.358 30.500 1.00 12.06 ? 128 PHE A O   1 
ATOM   978  C  CB  . PHE A 1 129 ? -1.575  40.694 27.714 1.00 11.96 ? 128 PHE A CB  1 
ATOM   979  C  CG  . PHE A 1 129 ? -1.350  40.809 26.224 1.00 14.63 ? 128 PHE A CG  1 
ATOM   980  C  CD1 . PHE A 1 129 ? -0.869  41.979 25.654 1.00 17.70 ? 128 PHE A CD1 1 
ATOM   981  C  CD2 . PHE A 1 129 ? -1.628  39.744 25.378 1.00 17.58 ? 128 PHE A CD2 1 
ATOM   982  C  CE1 . PHE A 1 129 ? -0.663  42.076 24.257 1.00 18.75 ? 128 PHE A CE1 1 
ATOM   983  C  CE2 . PHE A 1 129 ? -1.438  39.844 23.982 1.00 17.64 ? 128 PHE A CE2 1 
ATOM   984  C  CZ  . PHE A 1 129 ? -0.959  41.010 23.428 1.00 15.90 ? 128 PHE A CZ  1 
ATOM   985  N  N   . GLU A 1 130 ? -1.270  40.200 30.661 1.00 10.93 ? 129 GLU A N   1 
ATOM   986  C  CA  . GLU A 1 130 ? -1.972  40.390 31.907 1.00 10.97 ? 129 GLU A CA  1 
ATOM   987  C  C   . GLU A 1 130 ? -1.030  40.608 33.071 1.00 10.91 ? 129 GLU A C   1 
ATOM   988  O  O   . GLU A 1 130 ? -1.394  41.360 33.963 1.00 11.12 ? 129 GLU A O   1 
ATOM   989  C  CB  . GLU A 1 130 ? -2.952  39.232 32.213 1.00 11.67 ? 129 GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 130 ? -4.118  39.076 31.226 1.00 10.21 ? 129 GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 130 ? -5.000  37.877 31.559 1.00 10.30 ? 129 GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 130 ? -5.240  37.652 32.754 1.00 9.05  ? 129 GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 130 ? -5.467  37.166 30.638 1.00 7.86  ? 129 GLU A OE2 1 
ATOM   994  N  N   . LEU A 1 131 ? 0.148   39.964 33.081 1.00 10.37 ? 130 LEU A N   1 
ATOM   995  C  CA  . LEU A 1 131 ? 1.155   40.243 34.144 1.00 10.52 ? 130 LEU A CA  1 
ATOM   996  C  C   . LEU A 1 131 ? 1.638   41.679 34.112 1.00 10.42 ? 130 LEU A C   1 
ATOM   997  O  O   . LEU A 1 131 ? 1.807   42.274 35.158 1.00 10.49 ? 130 LEU A O   1 
ATOM   998  C  CB  . LEU A 1 131 ? 2.366   39.262 34.145 1.00 10.16 ? 130 LEU A CB  1 
ATOM   999  C  CG  . LEU A 1 131 ? 2.120   37.790 34.536 1.00 10.22 ? 130 LEU A CG  1 
ATOM   1000 C  CD1 . LEU A 1 131 ? 3.438   37.048 34.601 1.00 10.06 ? 130 LEU A CD1 1 
ATOM   1001 C  CD2 . LEU A 1 131 ? 1.332   37.604 35.849 1.00 8.36  ? 130 LEU A CD2 1 
ATOM   1002 N  N   . SER A 1 132 ? 1.860   42.227 32.911 1.00 11.54 ? 131 SER A N   1 
ATOM   1003 C  CA  . SER A 1 132 ? 2.239   43.654 32.733 1.00 11.99 ? 131 SER A CA  1 
ATOM   1004 C  C   . SER A 1 132 ? 1.118   44.614 33.123 1.00 12.01 ? 131 SER A C   1 
ATOM   1005 O  O   . SER A 1 132 ? 1.372   45.670 33.701 1.00 12.68 ? 131 SER A O   1 
ATOM   1006 C  CB  . SER A 1 132 ? 2.660   43.959 31.280 1.00 11.52 ? 131 SER A CB  1 
ATOM   1007 O  OG  . SER A 1 132 ? 3.944   43.440 30.994 1.00 10.93 ? 131 SER A OG  1 
ATOM   1008 N  N   . CYS A 1 133 ? -0.117  44.263 32.779 1.00 12.21 ? 132 CYS A N   1 
ATOM   1009 C  CA  . CYS A 1 133 ? -1.278  45.084 33.142 1.00 12.19 ? 132 CYS A CA  1 
ATOM   1010 C  C   . CYS A 1 133 ? -1.440  45.209 34.659 1.00 12.19 ? 132 CYS A C   1 
ATOM   1011 O  O   . CYS A 1 133 ? -1.537  46.315 35.177 1.00 12.01 ? 132 CYS A O   1 
ATOM   1012 C  CB  . CYS A 1 133 ? -2.544  44.507 32.530 1.00 12.17 ? 132 CYS A CB  1 
ATOM   1013 S  SG  . CYS A 1 133 ? -2.645  44.742 30.761 1.00 13.23 ? 132 CYS A SG  1 
ATOM   1014 N  N   . TYR A 1 134 ? -1.456  44.069 35.355 1.00 11.90 ? 133 TYR A N   1 
ATOM   1015 C  CA  . TYR A 1 134 ? -1.531  44.047 36.807 1.00 11.84 ? 133 TYR A CA  1 
ATOM   1016 C  C   . TYR A 1 134 ? -0.296  44.696 37.442 1.00 12.15 ? 133 TYR A C   1 
ATOM   1017 O  O   . TYR A 1 134 ? -0.410  45.437 38.389 1.00 11.50 ? 133 TYR A O   1 
ATOM   1018 C  CB  . TYR A 1 134 ? -1.688  42.615 37.318 1.00 11.53 ? 133 TYR A CB  1 
ATOM   1019 C  CG  . TYR A 1 134 ? -3.001  41.960 36.976 1.00 10.59 ? 133 TYR A CG  1 
ATOM   1020 C  CD1 . TYR A 1 134 ? -4.214  42.634 37.181 1.00 10.06 ? 133 TYR A CD1 1 
ATOM   1021 C  CD2 . TYR A 1 134 ? -3.042  40.663 36.471 1.00 8.88  ? 133 TYR A CD2 1 
ATOM   1022 C  CE1 . TYR A 1 134 ? -5.446  42.041 36.867 1.00 9.34  ? 133 TYR A CE1 1 
ATOM   1023 C  CE2 . TYR A 1 134 ? -4.276  40.032 36.165 1.00 9.81  ? 133 TYR A CE2 1 
ATOM   1024 C  CZ  . TYR A 1 134 ? -5.478  40.747 36.362 1.00 11.43 ? 133 TYR A CZ  1 
ATOM   1025 O  OH  . TYR A 1 134 ? -6.706  40.173 36.074 1.00 11.14 ? 133 TYR A OH  1 
ATOM   1026 N  N   . SER A 1 135 ? 0.887   44.414 36.905 1.00 12.81 ? 134 SER A N   1 
ATOM   1027 C  CA  . SER A 1 135 ? 2.102   44.965 37.477 1.00 13.31 ? 134 SER A CA  1 
ATOM   1028 C  C   . SER A 1 135 ? 2.093   46.479 37.415 1.00 12.96 ? 134 SER A C   1 
ATOM   1029 O  O   . SER A 1 135 ? 2.475   47.130 38.365 1.00 12.91 ? 134 SER A O   1 
ATOM   1030 C  CB  . SER A 1 135 ? 3.361   44.430 36.772 1.00 13.56 ? 134 SER A CB  1 
ATOM   1031 O  OG  . SER A 1 135 ? 4.526   44.898 37.441 1.00 13.24 ? 134 SER A OG  1 
ATOM   1032 N  N   . LEU A 1 136 ? 1.642   47.026 36.289 1.00 13.13 ? 135 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 136 ? 1.640   48.473 36.063 1.00 12.68 ? 135 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 136 ? 0.410   49.164 36.623 1.00 12.46 ? 135 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 136 ? 0.465   50.330 36.994 1.00 12.09 ? 135 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 136 ? 1.792   48.764 34.568 1.00 13.25 ? 135 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 136 ? 3.134   48.327 33.956 1.00 14.12 ? 135 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 136 ? 3.023   48.167 32.447 1.00 14.87 ? 135 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 136 ? 4.265   49.293 34.322 1.00 11.09 ? 135 LEU A CD2 1 
ATOM   1040 N  N   . ALA A 1 137 ? -0.700  48.431 36.687 1.00 13.07 ? 136 ALA A N   1 
ATOM   1041 C  CA  . ALA A 1 137 ? -1.964  48.937 37.220 1.00 13.52 ? 136 ALA A CA  1 
ATOM   1042 C  C   . ALA A 1 137 ? -2.661  47.837 37.990 1.00 14.09 ? 136 ALA A C   1 
ATOM   1043 O  O   . ALA A 1 137 ? -3.490  47.119 37.433 1.00 14.37 ? 136 ALA A O   1 
ATOM   1044 C  CB  . ALA A 1 137 ? -2.858  49.464 36.080 1.00 13.24 ? 136 ALA A CB  1 
ATOM   1045 N  N   . PRO A 1 138 ? -2.311  47.674 39.271 1.00 15.04 ? 137 PRO A N   1 
ATOM   1046 C  CA  . PRO A 1 138 ? -2.885  46.599 40.108 1.00 16.10 ? 137 PRO A CA  1 
ATOM   1047 C  C   . PRO A 1 138 ? -4.423  46.538 40.161 1.00 17.02 ? 137 PRO A C   1 
ATOM   1048 O  O   . PRO A 1 138 ? -4.992  45.464 40.351 1.00 17.73 ? 137 PRO A O   1 
ATOM   1049 C  CB  . PRO A 1 138 ? -2.306  46.891 41.505 1.00 15.97 ? 137 PRO A CB  1 
ATOM   1050 C  CG  . PRO A 1 138 ? -1.002  47.631 41.206 1.00 16.44 ? 137 PRO A CG  1 
ATOM   1051 C  CD  . PRO A 1 138 ? -1.317  48.478 40.004 1.00 14.83 ? 137 PRO A CD  1 
ATOM   1052 N  N   . GLN A 1 139 ? -5.091  47.668 39.979 1.00 17.48 ? 138 GLN A N   1 
ATOM   1053 C  CA  . GLN A 1 139 ? -6.539  47.678 40.045 1.00 18.27 ? 138 GLN A CA  1 
ATOM   1054 C  C   . GLN A 1 139 ? -7.280  47.417 38.728 1.00 17.07 ? 138 GLN A C   1 
ATOM   1055 O  O   . GLN A 1 139 ? -8.519  47.311 38.767 1.00 16.82 ? 138 GLN A O   1 
ATOM   1056 C  CB  . GLN A 1 139 ? -7.060  48.986 40.656 1.00 19.04 ? 138 GLN A CB  1 
ATOM   1057 C  CG  . GLN A 1 139 ? -6.530  49.348 42.028 1.00 22.76 ? 138 GLN A CG  1 
ATOM   1058 C  CD  . GLN A 1 139 ? -6.919  50.774 42.382 1.00 28.90 ? 138 GLN A CD  1 
ATOM   1059 O  OE1 . GLN A 1 139 ? -7.468  51.512 41.534 1.00 31.90 ? 138 GLN A OE1 1 
ATOM   1060 N  NE2 . GLN A 1 139 ? -6.644  51.184 43.634 1.00 31.83 ? 138 GLN A NE2 1 
ATOM   1061 N  N   . ILE A 1 140 ? -6.591  47.322 37.582 1.00 16.01 ? 139 ILE A N   1 
ATOM   1062 C  CA  . ILE A 1 140 ? -7.358  47.052 36.327 1.00 15.85 ? 139 ILE A CA  1 
ATOM   1063 C  C   . ILE A 1 140 ? -7.977  45.672 36.342 1.00 15.70 ? 139 ILE A C   1 
ATOM   1064 O  O   . ILE A 1 140 ? -7.521  44.773 37.047 1.00 16.33 ? 139 ILE A O   1 
ATOM   1065 C  CB  . ILE A 1 140 ? -6.602  47.215 34.943 1.00 15.48 ? 139 ILE A CB  1 
ATOM   1066 C  CG1 . ILE A 1 140 ? -5.162  46.724 35.013 1.00 15.69 ? 139 ILE A CG1 1 
ATOM   1067 C  CG2 . ILE A 1 140 ? -6.804  48.577 34.311 1.00 15.27 ? 139 ILE A CG2 1 
ATOM   1068 C  CD1 . ILE A 1 140 ? -5.090  45.206 34.936 1.00 14.66 ? 139 ILE A CD1 1 
ATOM   1069 N  N   . LYS A 1 141 ? -9.018  45.511 35.552 1.00 15.49 ? 140 LYS A N   1 
ATOM   1070 C  CA  . LYS A 1 141 ? -9.682  44.233 35.449 1.00 15.47 ? 140 LYS A CA  1 
ATOM   1071 C  C   . LYS A 1 141 ? -9.446  43.722 34.043 1.00 15.60 ? 140 LYS A C   1 
ATOM   1072 O  O   . LYS A 1 141 ? -9.384  44.509 33.087 1.00 15.86 ? 140 LYS A O   1 
ATOM   1073 C  CB  . LYS A 1 141 ? -11.181 44.376 35.764 1.00 15.11 ? 140 LYS A CB  1 
ATOM   1074 C  CG  . LYS A 1 141 ? -11.483 44.522 37.252 1.00 14.64 ? 140 LYS A CG  1 
ATOM   1075 C  CD  . LYS A 1 141 ? -12.908 45.004 37.489 1.00 15.91 ? 140 LYS A CD  1 
ATOM   1076 C  CE  . LYS A 1 141 ? -12.926 46.455 37.907 1.00 16.74 ? 140 LYS A CE  1 
ATOM   1077 N  NZ  . LYS A 1 141 ? -14.307 46.978 38.142 1.00 17.84 ? 140 LYS A NZ  1 
ATOM   1078 N  N   . VAL A 1 142 ? -9.297  42.407 33.924 1.00 15.23 ? 141 VAL A N   1 
ATOM   1079 C  CA  . VAL A 1 142 ? -9.099  41.802 32.641 1.00 14.77 ? 141 VAL A CA  1 
ATOM   1080 C  C   . VAL A 1 142 ? -10.319 41.007 32.215 1.00 15.07 ? 141 VAL A C   1 
ATOM   1081 O  O   . VAL A 1 142 ? -10.944 40.310 33.011 1.00 15.49 ? 141 VAL A O   1 
ATOM   1082 C  CB  . VAL A 1 142 ? -7.801  40.942 32.595 1.00 15.02 ? 141 VAL A CB  1 
ATOM   1083 C  CG1 . VAL A 1 142 ? -7.545  40.452 31.181 1.00 15.04 ? 141 VAL A CG1 1 
ATOM   1084 C  CG2 . VAL A 1 142 ? -6.596  41.768 33.066 1.00 14.06 ? 141 VAL A CG2 1 
ATOM   1085 N  N   . ILE A 1 143 ? -10.658 41.132 30.939 1.00 15.39 ? 142 ILE A N   1 
ATOM   1086 C  CA  . ILE A 1 143 ? -11.579 40.214 30.279 1.00 14.84 ? 142 ILE A CA  1 
ATOM   1087 C  C   . ILE A 1 143 ? -10.785 39.434 29.222 1.00 14.73 ? 142 ILE A C   1 
ATOM   1088 O  O   . ILE A 1 143 ? -10.276 39.992 28.254 1.00 14.36 ? 142 ILE A O   1 
ATOM   1089 C  CB  . ILE A 1 143 ? -12.826 40.956 29.708 1.00 14.89 ? 142 ILE A CB  1 
ATOM   1090 C  CG1 . ILE A 1 143 ? -13.567 41.664 30.836 1.00 14.10 ? 142 ILE A CG1 1 
ATOM   1091 C  CG2 . ILE A 1 143 ? -13.803 39.975 29.049 1.00 14.82 ? 142 ILE A CG2 1 
ATOM   1092 C  CD1 . ILE A 1 143 ? -14.246 42.938 30.384 1.00 15.45 ? 142 ILE A CD1 1 
ATOM   1093 N  N   . ALA A 1 144 ? -10.658 38.133 29.450 1.00 15.40 ? 143 ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 144 ? -9.979  37.217 28.536 1.00 15.37 ? 143 ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 144 ? -11.009 36.153 28.101 1.00 15.46 ? 143 ALA A C   1 
ATOM   1096 O  O   . ALA A 1 144 ? -11.099 35.072 28.727 1.00 15.37 ? 143 ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 144 ? -8.793  36.580 29.232 1.00 14.76 ? 143 ALA A CB  1 
ATOM   1098 N  N   . PRO A 1 145 ? -11.812 36.474 27.059 1.00 15.54 ? 144 PRO A N   1 
ATOM   1099 C  CA  . PRO A 1 145 ? -12.932 35.640 26.582 1.00 15.81 ? 144 PRO A CA  1 
ATOM   1100 C  C   . PRO A 1 145 ? -12.581 34.141 26.429 1.00 16.21 ? 144 PRO A C   1 
ATOM   1101 O  O   . PRO A 1 145 ? -13.345 33.265 26.884 1.00 16.71 ? 144 PRO A O   1 
ATOM   1102 C  CB  . PRO A 1 145 ? -13.272 36.265 25.217 1.00 15.80 ? 144 PRO A CB  1 
ATOM   1103 C  CG  . PRO A 1 145 ? -12.873 37.692 25.345 1.00 15.20 ? 144 PRO A CG  1 
ATOM   1104 C  CD  . PRO A 1 145 ? -11.689 37.720 26.270 1.00 15.25 ? 144 PRO A CD  1 
ATOM   1105 N  N   . TRP A 1 146 ? -11.431 33.852 25.823 1.00 15.57 ? 145 TRP A N   1 
ATOM   1106 C  CA  . TRP A 1 146 ? -10.945 32.471 25.704 1.00 15.80 ? 145 TRP A CA  1 
ATOM   1107 C  C   . TRP A 1 146 ? -10.819 31.684 27.040 1.00 15.81 ? 145 TRP A C   1 
ATOM   1108 O  O   . TRP A 1 146 ? -10.658 30.470 27.023 1.00 15.39 ? 145 TRP A O   1 
ATOM   1109 C  CB  . TRP A 1 146 ? -9.655  32.415 24.877 1.00 14.53 ? 145 TRP A CB  1 
ATOM   1110 C  CG  . TRP A 1 146 ? -9.881  32.662 23.410 1.00 14.71 ? 145 TRP A CG  1 
ATOM   1111 C  CD1 . TRP A 1 146 ? -9.298  33.648 22.630 1.00 14.81 ? 145 TRP A CD1 1 
ATOM   1112 C  CD2 . TRP A 1 146 ? -10.733 31.911 22.521 1.00 14.96 ? 145 TRP A CD2 1 
ATOM   1113 N  NE1 . TRP A 1 146 ? -9.738  33.553 21.324 1.00 13.77 ? 145 TRP A NE1 1 
ATOM   1114 C  CE2 . TRP A 1 146 ? -10.618 32.504 21.224 1.00 14.97 ? 145 TRP A CE2 1 
ATOM   1115 C  CE3 . TRP A 1 146 ? -11.590 30.798 22.686 1.00 13.65 ? 145 TRP A CE3 1 
ATOM   1116 C  CZ2 . TRP A 1 146 ? -11.332 32.017 20.104 1.00 14.17 ? 145 TRP A CZ2 1 
ATOM   1117 C  CZ3 . TRP A 1 146 ? -12.294 30.317 21.561 1.00 13.74 ? 145 TRP A CZ3 1 
ATOM   1118 C  CH2 . TRP A 1 146 ? -12.158 30.923 20.295 1.00 12.91 ? 145 TRP A CH2 1 
ATOM   1119 N  N   . ARG A 1 147 ? -10.940 32.381 28.173 1.00 16.69 ? 146 ARG A N   1 
ATOM   1120 C  CA  . ARG A 1 147 ? -10.966 31.752 29.504 1.00 17.33 ? 146 ARG A CA  1 
ATOM   1121 C  C   . ARG A 1 147 ? -12.335 31.866 30.166 1.00 17.84 ? 146 ARG A C   1 
ATOM   1122 O  O   . ARG A 1 147 ? -12.546 31.360 31.291 1.00 17.92 ? 146 ARG A O   1 
ATOM   1123 C  CB  . ARG A 1 147 ? -9.877  32.333 30.420 1.00 16.94 ? 146 ARG A CB  1 
ATOM   1124 C  CG  . ARG A 1 147 ? -8.450  32.150 29.860 1.00 17.36 ? 146 ARG A CG  1 
ATOM   1125 C  CD  . ARG A 1 147 ? -7.425  32.172 30.963 1.00 17.05 ? 146 ARG A CD  1 
ATOM   1126 N  NE  . ARG A 1 147 ? -7.573  33.341 31.829 1.00 15.46 ? 146 ARG A NE  1 
ATOM   1127 C  CZ  . ARG A 1 147 ? -6.904  34.469 31.665 1.00 14.86 ? 146 ARG A CZ  1 
ATOM   1128 N  NH1 . ARG A 1 147 ? -7.095  35.487 32.495 1.00 13.99 ? 146 ARG A NH1 1 
ATOM   1129 N  NH2 . ARG A 1 147 ? -6.042  34.575 30.667 1.00 14.81 ? 146 ARG A NH2 1 
ATOM   1130 N  N   . MET A 1 148 ? -13.258 32.527 29.467 1.00 17.75 ? 147 MET A N   1 
ATOM   1131 C  CA  . MET A 1 148 ? -14.647 32.588 29.912 1.00 18.68 ? 147 MET A CA  1 
ATOM   1132 C  C   . MET A 1 148 ? -15.473 31.434 29.338 1.00 18.64 ? 147 MET A C   1 
ATOM   1133 O  O   . MET A 1 148 ? -15.554 31.271 28.125 1.00 18.69 ? 147 MET A O   1 
ATOM   1134 C  CB  . MET A 1 148 ? -15.256 33.959 29.589 1.00 18.57 ? 147 MET A CB  1 
ATOM   1135 C  CG  . MET A 1 148 ? -14.610 35.045 30.432 1.00 18.36 ? 147 MET A CG  1 
ATOM   1136 S  SD  . MET A 1 148 ? -14.788 36.705 29.798 1.00 19.92 ? 147 MET A SD  1 
ATOM   1137 C  CE  . MET A 1 148 ? -16.436 37.113 30.394 1.00 22.75 ? 147 MET A CE  1 
ATOM   1138 N  N   . PRO A 1 149 ? -16.036 30.587 30.212 1.00 19.18 ? 148 PRO A N   1 
ATOM   1139 C  CA  . PRO A 1 149 ? -16.939 29.506 29.765 1.00 19.74 ? 148 PRO A CA  1 
ATOM   1140 C  C   . PRO A 1 149 ? -18.053 29.961 28.796 1.00 20.31 ? 148 PRO A C   1 
ATOM   1141 O  O   . PRO A 1 149 ? -18.200 29.389 27.712 1.00 20.69 ? 148 PRO A O   1 
ATOM   1142 C  CB  . PRO A 1 149 ? -17.516 28.969 31.084 1.00 19.70 ? 148 PRO A CB  1 
ATOM   1143 C  CG  . PRO A 1 149 ? -16.430 29.237 32.094 1.00 18.51 ? 148 PRO A CG  1 
ATOM   1144 C  CD  . PRO A 1 149 ? -15.812 30.553 31.673 1.00 19.20 ? 148 PRO A CD  1 
ATOM   1145 N  N   . GLU A 1 150 ? -18.809 30.995 29.158 1.00 20.94 ? 149 GLU A N   1 
ATOM   1146 C  CA  . GLU A 1 150 ? -19.857 31.518 28.264 1.00 21.51 ? 149 GLU A CA  1 
ATOM   1147 C  C   . GLU A 1 150 ? -19.362 31.731 26.806 1.00 21.10 ? 149 GLU A C   1 
ATOM   1148 O  O   . GLU A 1 150 ? -20.138 31.600 25.857 1.00 21.27 ? 149 GLU A O   1 
ATOM   1149 C  CB  . GLU A 1 150 ? -20.521 32.781 28.843 1.00 21.70 ? 149 GLU A CB  1 
ATOM   1150 C  CG  . GLU A 1 150 ? -19.542 33.923 29.239 1.00 24.92 ? 149 GLU A CG  1 
ATOM   1151 C  CD  . GLU A 1 150 ? -19.127 33.918 30.724 1.00 28.02 ? 149 GLU A CD  1 
ATOM   1152 O  OE1 . GLU A 1 150 ? -18.451 32.955 31.215 1.00 28.01 ? 149 GLU A OE1 1 
ATOM   1153 O  OE2 . GLU A 1 150 ? -19.467 34.918 31.392 1.00 28.93 ? 149 GLU A OE2 1 
ATOM   1154 N  N   . PHE A 1 151 ? -18.066 32.012 26.651 1.00 20.33 ? 150 PHE A N   1 
ATOM   1155 C  CA  . PHE A 1 151 ? -17.442 32.305 25.360 1.00 19.71 ? 150 PHE A CA  1 
ATOM   1156 C  C   . PHE A 1 151 ? -16.763 31.059 24.755 1.00 19.72 ? 150 PHE A C   1 
ATOM   1157 O  O   . PHE A 1 151 ? -17.059 30.687 23.626 1.00 19.48 ? 150 PHE A O   1 
ATOM   1158 C  CB  . PHE A 1 151 ? -16.429 33.473 25.522 1.00 19.41 ? 150 PHE A CB  1 
ATOM   1159 C  CG  . PHE A 1 151 ? -15.829 33.973 24.222 1.00 17.65 ? 150 PHE A CG  1 
ATOM   1160 C  CD1 . PHE A 1 151 ? -14.727 33.348 23.653 1.00 16.13 ? 150 PHE A CD1 1 
ATOM   1161 C  CD2 . PHE A 1 151 ? -16.360 35.090 23.576 1.00 17.74 ? 150 PHE A CD2 1 
ATOM   1162 C  CE1 . PHE A 1 151 ? -14.174 33.811 22.447 1.00 13.79 ? 150 PHE A CE1 1 
ATOM   1163 C  CE2 . PHE A 1 151 ? -15.810 35.560 22.366 1.00 15.02 ? 150 PHE A CE2 1 
ATOM   1164 C  CZ  . PHE A 1 151 ? -14.707 34.907 21.819 1.00 15.39 ? 150 PHE A CZ  1 
ATOM   1165 N  N   . TYR A 1 152 ? -15.869 30.407 25.497 1.00 19.68 ? 151 TYR A N   1 
ATOM   1166 C  CA  . TYR A 1 152 ? -15.043 29.352 24.891 1.00 20.27 ? 151 TYR A CA  1 
ATOM   1167 C  C   . TYR A 1 152 ? -15.755 28.021 24.617 1.00 21.50 ? 151 TYR A C   1 
ATOM   1168 O  O   . TYR A 1 152 ? -15.363 27.284 23.712 1.00 22.21 ? 151 TYR A O   1 
ATOM   1169 C  CB  . TYR A 1 152 ? -13.703 29.164 25.620 1.00 19.51 ? 151 TYR A CB  1 
ATOM   1170 C  CG  . TYR A 1 152 ? -13.757 28.481 26.966 1.00 17.95 ? 151 TYR A CG  1 
ATOM   1171 C  CD1 . TYR A 1 152 ? -13.308 29.126 28.102 1.00 16.55 ? 151 TYR A CD1 1 
ATOM   1172 C  CD2 . TYR A 1 152 ? -14.221 27.171 27.091 1.00 16.43 ? 151 TYR A CD2 1 
ATOM   1173 C  CE1 . TYR A 1 152 ? -13.340 28.497 29.354 1.00 17.73 ? 151 TYR A CE1 1 
ATOM   1174 C  CE2 . TYR A 1 152 ? -14.274 26.544 28.318 1.00 17.58 ? 151 TYR A CE2 1 
ATOM   1175 C  CZ  . TYR A 1 152 ? -13.825 27.201 29.449 1.00 17.50 ? 151 TYR A CZ  1 
ATOM   1176 O  OH  . TYR A 1 152 ? -13.869 26.553 30.657 1.00 17.65 ? 151 TYR A OH  1 
ATOM   1177 N  N   . ASN A 1 153 ? -16.800 27.728 25.384 1.00 22.76 ? 152 ASN A N   1 
ATOM   1178 C  CA  . ASN A 1 153 ? -17.663 26.575 25.125 1.00 23.84 ? 152 ASN A CA  1 
ATOM   1179 C  C   . ASN A 1 153 ? -18.612 26.801 23.930 1.00 24.63 ? 152 ASN A C   1 
ATOM   1180 O  O   . ASN A 1 153 ? -18.962 25.841 23.236 1.00 24.46 ? 152 ASN A O   1 
ATOM   1181 C  CB  . ASN A 1 153 ? -18.438 26.180 26.393 1.00 23.91 ? 152 ASN A CB  1 
ATOM   1182 C  CG  . ASN A 1 153 ? -17.557 25.477 27.426 1.00 23.72 ? 152 ASN A CG  1 
ATOM   1183 O  OD1 . ASN A 1 153 ? -16.705 24.644 27.085 1.00 24.29 ? 152 ASN A OD1 1 
ATOM   1184 N  ND2 . ASN A 1 153 ? -17.773 25.796 28.695 1.00 23.30 ? 152 ASN A ND2 1 
ATOM   1185 N  N   . ARG A 1 154 ? -18.948 28.049 23.619 1.00 25.47 ? 153 ARG A N   1 
ATOM   1186 C  CA  . ARG A 1 154 ? -19.695 28.369 22.424 1.00 26.47 ? 153 ARG A CA  1 
ATOM   1187 C  C   . ARG A 1 154 ? -18.861 28.332 21.122 1.00 26.97 ? 153 ARG A C   1 
ATOM   1188 O  O   . ARG A 1 154 ? -19.300 27.862 20.143 1.00 27.59 ? 153 ARG A O   1 
ATOM   1189 C  CB  . ARG A 1 154 ? -20.612 29.564 22.583 1.00 26.38 ? 153 ARG A CB  1 
ATOM   1190 C  CG  . ARG A 1 154 ? -20.061 30.886 22.318 1.00 27.38 ? 153 ARG A CG  1 
ATOM   1191 C  CD  . ARG A 1 154 ? -21.044 31.938 22.603 1.00 26.53 ? 153 ARG A CD  1 
ATOM   1192 N  NE  . ARG A 1 154 ? -21.926 32.156 21.499 1.00 27.79 ? 153 ARG A NE  1 
ATOM   1193 C  CZ  . ARG A 1 154 ? -22.482 33.306 21.202 1.00 29.16 ? 153 ARG A CZ  1 
ATOM   1194 N  NH1 . ARG A 1 154 ? -22.281 34.337 21.947 1.00 28.62 ? 153 ARG A NH1 1 
ATOM   1195 N  NH2 . ARG A 1 154 ? -23.265 33.417 20.157 1.00 29.45 ? 153 ARG A NH2 1 
ATOM   1196 N  N   . PHE A 1 155 ? -17.622 28.754 21.166 1.00 27.84 ? 154 PHE A N   1 
ATOM   1197 C  CA  . PHE A 1 155 ? -16.773 28.715 20.012 1.00 28.95 ? 154 PHE A CA  1 
ATOM   1198 C  C   . PHE A 1 155 ? -15.702 27.747 20.259 1.00 30.25 ? 154 PHE A C   1 
ATOM   1199 O  O   . PHE A 1 155 ? -14.594 28.061 20.524 1.00 31.23 ? 154 PHE A O   1 
ATOM   1200 C  CB  . PHE A 1 155 ? -16.203 30.043 19.568 1.00 28.44 ? 154 PHE A CB  1 
ATOM   1201 C  CG  . PHE A 1 155 ? -17.118 31.179 19.740 1.00 27.49 ? 154 PHE A CG  1 
ATOM   1202 C  CD1 . PHE A 1 155 ? -18.197 31.335 18.947 1.00 24.55 ? 154 PHE A CD1 1 
ATOM   1203 C  CD2 . PHE A 1 155 ? -16.901 32.078 20.712 1.00 25.24 ? 154 PHE A CD2 1 
ATOM   1204 C  CE1 . PHE A 1 155 ? -18.997 32.342 19.143 1.00 25.24 ? 154 PHE A CE1 1 
ATOM   1205 C  CE2 . PHE A 1 155 ? -17.708 33.071 20.882 1.00 24.79 ? 154 PHE A CE2 1 
ATOM   1206 C  CZ  . PHE A 1 155 ? -18.742 33.224 20.107 1.00 24.81 ? 154 PHE A CZ  1 
ATOM   1207 N  N   . LYS A 1 156 ? -16.149 26.528 20.155 1.00 31.45 ? 155 LYS A N   1 
ATOM   1208 C  CA  . LYS A 1 156 ? -15.449 25.337 20.332 1.00 32.28 ? 155 LYS A CA  1 
ATOM   1209 C  C   . LYS A 1 156 ? -14.453 25.167 19.227 1.00 32.93 ? 155 LYS A C   1 
ATOM   1210 O  O   . LYS A 1 156 ? -13.348 24.755 19.452 1.00 33.07 ? 155 LYS A O   1 
ATOM   1211 C  CB  . LYS A 1 156 ? -16.491 24.242 20.260 1.00 32.60 ? 155 LYS A CB  1 
ATOM   1212 C  CG  . LYS A 1 156 ? -16.650 23.650 18.846 1.00 33.88 ? 155 LYS A CG  1 
ATOM   1213 N  N   . ARG A 1 158 ? -12.988 27.299 15.632 1.00 33.32 ? 157 ARG A N   1 
ATOM   1214 C  CA  . ARG A 1 158 ? -12.545 28.264 14.610 1.00 33.35 ? 157 ARG A CA  1 
ATOM   1215 C  C   . ARG A 1 158 ? -13.546 28.408 13.461 1.00 33.25 ? 157 ARG A C   1 
ATOM   1216 O  O   . ARG A 1 158 ? -13.666 29.485 12.864 1.00 33.06 ? 157 ARG A O   1 
ATOM   1217 C  CB  . ARG A 1 158 ? -11.160 27.913 14.061 1.00 33.42 ? 157 ARG A CB  1 
ATOM   1218 N  N   . ASN A 1 159 ? -14.237 27.310 13.148 1.00 33.12 ? 158 ASN A N   1 
ATOM   1219 C  CA  . ASN A 1 159 ? -15.379 27.338 12.240 1.00 33.01 ? 158 ASN A CA  1 
ATOM   1220 C  C   . ASN A 1 159 ? -16.656 27.763 12.956 1.00 32.14 ? 158 ASN A C   1 
ATOM   1221 O  O   . ASN A 1 159 ? -17.615 28.189 12.306 1.00 31.71 ? 158 ASN A O   1 
ATOM   1222 C  CB  . ASN A 1 159 ? -15.590 25.980 11.556 1.00 33.71 ? 158 ASN A CB  1 
ATOM   1223 C  CG  . ASN A 1 159 ? -14.411 25.572 10.663 1.00 35.77 ? 158 ASN A CG  1 
ATOM   1224 O  OD1 . ASN A 1 159 ? -13.725 26.421 10.075 1.00 35.88 ? 158 ASN A OD1 1 
ATOM   1225 N  ND2 . ASN A 1 159 ? -14.180 24.256 10.557 1.00 37.84 ? 158 ASN A ND2 1 
ATOM   1226 N  N   . ASP A 1 160 ? -16.669 27.635 14.286 1.00 31.41 ? 159 ASP A N   1 
ATOM   1227 C  CA  . ASP A 1 160 ? -17.765 28.172 15.085 1.00 30.90 ? 159 ASP A CA  1 
ATOM   1228 C  C   . ASP A 1 160 ? -17.617 29.686 15.184 1.00 30.33 ? 159 ASP A C   1 
ATOM   1229 O  O   . ASP A 1 160 ? -18.618 30.410 15.181 1.00 30.24 ? 159 ASP A O   1 
ATOM   1230 C  CB  . ASP A 1 160 ? -17.846 27.527 16.476 1.00 31.35 ? 159 ASP A CB  1 
ATOM   1231 C  CG  . ASP A 1 160 ? -18.313 26.054 16.445 1.00 32.42 ? 159 ASP A CG  1 
ATOM   1232 O  OD1 . ASP A 1 160 ? -19.308 25.713 15.746 1.00 30.92 ? 159 ASP A OD1 1 
ATOM   1233 O  OD2 . ASP A 1 160 ? -17.676 25.232 17.157 1.00 33.67 ? 159 ASP A OD2 1 
ATOM   1234 N  N   . LEU A 1 161 ? -16.366 30.158 15.240 1.00 29.83 ? 160 LEU A N   1 
ATOM   1235 C  CA  . LEU A 1 161 ? -16.054 31.596 15.221 1.00 29.03 ? 160 LEU A CA  1 
ATOM   1236 C  C   . LEU A 1 161 ? -16.375 32.239 13.864 1.00 28.51 ? 160 LEU A C   1 
ATOM   1237 O  O   . LEU A 1 161 ? -16.938 33.335 13.823 1.00 27.71 ? 160 LEU A O   1 
ATOM   1238 C  CB  . LEU A 1 161 ? -14.591 31.847 15.618 1.00 29.10 ? 160 LEU A CB  1 
ATOM   1239 C  CG  . LEU A 1 161 ? -14.241 33.033 16.530 1.00 29.03 ? 160 LEU A CG  1 
ATOM   1240 C  CD1 . LEU A 1 161 ? -14.960 32.973 17.885 1.00 27.86 ? 160 LEU A CD1 1 
ATOM   1241 C  CD2 . LEU A 1 161 ? -12.755 33.075 16.764 1.00 29.13 ? 160 LEU A CD2 1 
ATOM   1242 N  N   . MET A 1 162 ? -16.027 31.549 12.771 1.00 28.23 ? 161 MET A N   1 
ATOM   1243 C  CA  . MET A 1 162 ? -16.395 31.967 11.401 1.00 28.64 ? 161 MET A CA  1 
ATOM   1244 C  C   . MET A 1 162 ? -17.891 32.147 11.225 1.00 28.14 ? 161 MET A C   1 
ATOM   1245 O  O   . MET A 1 162 ? -18.327 33.083 10.554 1.00 27.94 ? 161 MET A O   1 
ATOM   1246 C  CB  . MET A 1 162 ? -15.947 30.944 10.358 1.00 29.73 ? 161 MET A CB  1 
ATOM   1247 C  CG  . MET A 1 162 ? -14.528 31.072 9.886  1.00 32.05 ? 161 MET A CG  1 
ATOM   1248 S  SD  . MET A 1 162 ? -14.306 32.461 8.760  1.00 40.80 ? 161 MET A SD  1 
ATOM   1249 C  CE  . MET A 1 162 ? -12.537 32.293 8.341  1.00 34.72 ? 161 MET A CE  1 
ATOM   1250 N  N   . GLU A 1 163 ? -18.670 31.230 11.800 1.00 27.27 ? 162 GLU A N   1 
ATOM   1251 C  CA  . GLU A 1 163 ? -20.108 31.328 11.746 1.00 26.79 ? 162 GLU A CA  1 
ATOM   1252 C  C   . GLU A 1 163 ? -20.597 32.537 12.527 1.00 26.48 ? 162 GLU A C   1 
ATOM   1253 O  O   . GLU A 1 163 ? -21.523 33.225 12.104 1.00 26.69 ? 162 GLU A O   1 
ATOM   1254 C  CB  . GLU A 1 163 ? -20.770 30.049 12.272 1.00 27.13 ? 162 GLU A CB  1 
ATOM   1255 C  CG  . GLU A 1 163 ? -20.405 28.760 11.527 1.00 26.34 ? 162 GLU A CG  1 
ATOM   1256 C  CD  . GLU A 1 163 ? -20.663 28.792 10.015 1.00 27.05 ? 162 GLU A CD  1 
ATOM   1257 O  OE1 . GLU A 1 163 ? -19.851 28.164 9.303  1.00 27.58 ? 162 GLU A OE1 1 
ATOM   1258 O  OE2 . GLU A 1 163 ? -21.650 29.418 9.532  1.00 25.16 ? 162 GLU A OE2 1 
ATOM   1259 N  N   . TYR A 1 164 ? -19.963 32.795 13.665 1.00 25.94 ? 163 TYR A N   1 
ATOM   1260 C  CA  . TYR A 1 164 ? -20.334 33.911 14.516 1.00 25.44 ? 163 TYR A CA  1 
ATOM   1261 C  C   . TYR A 1 164 ? -20.140 35.217 13.743 1.00 25.21 ? 163 TYR A C   1 
ATOM   1262 O  O   . TYR A 1 164 ? -21.011 36.108 13.752 1.00 24.44 ? 163 TYR A O   1 
ATOM   1263 C  CB  . TYR A 1 164 ? -19.515 33.880 15.823 1.00 25.43 ? 163 TYR A CB  1 
ATOM   1264 C  CG  . TYR A 1 164 ? -19.761 35.058 16.732 1.00 25.38 ? 163 TYR A CG  1 
ATOM   1265 C  CD1 . TYR A 1 164 ? -20.749 35.014 17.713 1.00 24.71 ? 163 TYR A CD1 1 
ATOM   1266 C  CD2 . TYR A 1 164 ? -19.013 36.238 16.595 1.00 25.49 ? 163 TYR A CD2 1 
ATOM   1267 C  CE1 . TYR A 1 164 ? -20.982 36.112 18.543 1.00 24.54 ? 163 TYR A CE1 1 
ATOM   1268 C  CE2 . TYR A 1 164 ? -19.245 37.337 17.412 1.00 24.37 ? 163 TYR A CE2 1 
ATOM   1269 C  CZ  . TYR A 1 164 ? -20.221 37.265 18.390 1.00 25.15 ? 163 TYR A CZ  1 
ATOM   1270 O  OH  . TYR A 1 164 ? -20.439 38.360 19.203 1.00 25.85 ? 163 TYR A OH  1 
ATOM   1271 N  N   . ALA A 1 165 ? -18.993 35.305 13.070 1.00 25.05 ? 164 ALA A N   1 
ATOM   1272 C  CA  . ALA A 1 165 ? -18.680 36.409 12.175 1.00 25.41 ? 164 ALA A CA  1 
ATOM   1273 C  C   . ALA A 1 165 ? -19.793 36.607 11.142 1.00 26.15 ? 164 ALA A C   1 
ATOM   1274 O  O   . ALA A 1 165 ? -20.346 37.700 11.022 1.00 26.30 ? 164 ALA A O   1 
ATOM   1275 C  CB  . ALA A 1 165 ? -17.342 36.169 11.483 1.00 24.94 ? 164 ALA A CB  1 
ATOM   1276 N  N   . LYS A 1 166 ? -20.124 35.541 10.418 1.00 27.07 ? 165 LYS A N   1 
ATOM   1277 C  CA  . LYS A 1 166 ? -21.109 35.600 9.343  1.00 28.06 ? 165 LYS A CA  1 
ATOM   1278 C  C   . LYS A 1 166 ? -22.460 36.063 9.860  1.00 28.44 ? 165 LYS A C   1 
ATOM   1279 O  O   . LYS A 1 166 ? -23.139 36.827 9.182  1.00 28.69 ? 165 LYS A O   1 
ATOM   1280 C  CB  . LYS A 1 166 ? -21.249 34.245 8.640  1.00 28.00 ? 165 LYS A CB  1 
ATOM   1281 C  CG  . LYS A 1 166 ? -20.006 33.798 7.873  1.00 29.01 ? 165 LYS A CG  1 
ATOM   1282 C  CD  . LYS A 1 166 ? -20.342 32.738 6.837  1.00 29.87 ? 165 LYS A CD  1 
ATOM   1283 C  CE  . LYS A 1 166 ? -20.335 31.354 7.405  1.00 30.15 ? 165 LYS A CE  1 
ATOM   1284 N  NZ  . LYS A 1 166 ? -21.454 30.554 6.853  1.00 29.66 ? 165 LYS A NZ  1 
ATOM   1285 N  N   . GLN A 1 167 ? -22.824 35.608 11.061 1.00 29.14 ? 166 GLN A N   1 
ATOM   1286 C  CA  . GLN A 1 167 ? -24.132 35.895 11.679 1.00 29.72 ? 166 GLN A CA  1 
ATOM   1287 C  C   . GLN A 1 167 ? -24.241 37.329 12.213 1.00 29.83 ? 166 GLN A C   1 
ATOM   1288 O  O   . GLN A 1 167 ? -25.337 37.878 12.321 1.00 29.87 ? 166 GLN A O   1 
ATOM   1289 C  CB  . GLN A 1 167 ? -24.440 34.872 12.777 1.00 29.62 ? 166 GLN A CB  1 
ATOM   1290 C  CG  . GLN A 1 167 ? -24.791 33.482 12.249 1.00 32.18 ? 166 GLN A CG  1 
ATOM   1291 C  CD  . GLN A 1 167 ? -24.475 32.360 13.248 1.00 36.39 ? 166 GLN A CD  1 
ATOM   1292 O  OE1 . GLN A 1 167 ? -24.458 32.585 14.466 1.00 39.11 ? 166 GLN A OE1 1 
ATOM   1293 N  NE2 . GLN A 1 167 ? -24.219 31.146 12.734 1.00 35.23 ? 166 GLN A NE2 1 
ATOM   1294 N  N   . HIS A 1 168 ? -23.096 37.935 12.525 1.00 30.08 ? 167 HIS A N   1 
ATOM   1295 C  CA  . HIS A 1 168 ? -23.046 39.339 12.941 1.00 30.17 ? 167 HIS A CA  1 
ATOM   1296 C  C   . HIS A 1 168 ? -22.506 40.275 11.854 1.00 30.49 ? 167 HIS A C   1 
ATOM   1297 O  O   . HIS A 1 168 ? -22.243 41.451 12.117 1.00 30.60 ? 167 HIS A O   1 
ATOM   1298 C  CB  . HIS A 1 168 ? -22.230 39.481 14.228 1.00 30.06 ? 167 HIS A CB  1 
ATOM   1299 C  CG  . HIS A 1 168 ? -22.881 38.849 15.413 1.00 29.11 ? 167 HIS A CG  1 
ATOM   1300 N  ND1 . HIS A 1 168 ? -23.007 37.484 15.549 1.00 29.82 ? 167 HIS A ND1 1 
ATOM   1301 C  CD2 . HIS A 1 168 ? -23.464 39.393 16.506 1.00 29.06 ? 167 HIS A CD2 1 
ATOM   1302 C  CE1 . HIS A 1 168 ? -23.635 37.211 16.679 1.00 31.16 ? 167 HIS A CE1 1 
ATOM   1303 N  NE2 . HIS A 1 168 ? -23.912 38.353 17.285 1.00 31.08 ? 167 HIS A NE2 1 
ATOM   1304 N  N   . GLY A 1 169 ? -22.361 39.760 10.634 1.00 30.35 ? 168 GLY A N   1 
ATOM   1305 C  CA  . GLY A 1 169 ? -21.841 40.560 9.534  1.00 30.28 ? 168 GLY A CA  1 
ATOM   1306 C  C   . GLY A 1 169 ? -20.419 41.029 9.776  1.00 30.73 ? 168 GLY A C   1 
ATOM   1307 O  O   . GLY A 1 169 ? -20.060 42.145 9.413  1.00 30.88 ? 168 GLY A O   1 
ATOM   1308 N  N   . ILE A 1 170 ? -19.594 40.190 10.392 1.00 30.93 ? 169 ILE A N   1 
ATOM   1309 C  CA  . ILE A 1 170 ? -18.194 40.536 10.517 1.00 31.56 ? 169 ILE A CA  1 
ATOM   1310 C  C   . ILE A 1 170 ? -17.502 40.115 9.226  1.00 32.56 ? 169 ILE A C   1 
ATOM   1311 O  O   . ILE A 1 170 ? -17.562 38.937 8.850  1.00 32.59 ? 169 ILE A O   1 
ATOM   1312 C  CB  . ILE A 1 170 ? -17.520 39.908 11.769 1.00 31.56 ? 169 ILE A CB  1 
ATOM   1313 C  CG1 . ILE A 1 170 ? -18.177 40.423 13.062 1.00 31.16 ? 169 ILE A CG1 1 
ATOM   1314 C  CG2 . ILE A 1 170 ? -16.016 40.189 11.771 1.00 31.26 ? 169 ILE A CG2 1 
ATOM   1315 C  CD1 . ILE A 1 170 ? -17.807 39.640 14.312 1.00 30.93 ? 169 ILE A CD1 1 
ATOM   1316 N  N   . PRO A 1 171 ? -16.860 41.082 8.531  1.00 33.22 ? 170 PRO A N   1 
ATOM   1317 C  CA  . PRO A 1 171 ? -16.182 40.798 7.264  1.00 33.77 ? 170 PRO A CA  1 
ATOM   1318 C  C   . PRO A 1 171 ? -15.031 39.810 7.407  1.00 34.39 ? 170 PRO A C   1 
ATOM   1319 O  O   . PRO A 1 171 ? -14.360 39.772 8.435  1.00 34.50 ? 170 PRO A O   1 
ATOM   1320 C  CB  . PRO A 1 171 ? -15.649 42.166 6.816  1.00 33.57 ? 170 PRO A CB  1 
ATOM   1321 C  CG  . PRO A 1 171 ? -16.404 43.156 7.597  1.00 33.81 ? 170 PRO A CG  1 
ATOM   1322 C  CD  . PRO A 1 171 ? -16.749 42.503 8.896  1.00 33.11 ? 170 PRO A CD  1 
ATOM   1323 N  N   . ILE A 1 172 ? -14.915 38.910 6.461  1.00 35.44 ? 171 ILE A N   1 
ATOM   1324 C  CA  . ILE A 1 172 ? -13.803 38.018 6.319  1.00 36.27 ? 171 ILE A CA  1 
ATOM   1325 C  C   . ILE A 1 172 ? -13.042 38.396 5.098  1.00 37.36 ? 171 ILE A C   1 
ATOM   1326 O  O   . ILE A 1 172 ? -13.559 38.327 4.037  1.00 37.39 ? 171 ILE A O   1 
ATOM   1327 C  CB  . ILE A 1 172 ? -14.299 36.589 6.181  1.00 36.06 ? 171 ILE A CB  1 
ATOM   1328 C  CG1 . ILE A 1 172 ? -15.382 36.339 7.213  1.00 36.06 ? 171 ILE A CG1 1 
ATOM   1329 C  CG2 . ILE A 1 172 ? -13.193 35.622 6.311  1.00 35.22 ? 171 ILE A CG2 1 
ATOM   1330 C  CD1 . ILE A 1 172 ? -15.795 34.953 7.402  1.00 36.15 ? 171 ILE A CD1 1 
ATOM   1331 N  N   . PRO A 1 173 ? -11.807 38.836 5.251  1.00 38.71 ? 172 PRO A N   1 
ATOM   1332 C  CA  . PRO A 1 173 ? -10.934 38.937 4.099  1.00 39.51 ? 172 PRO A CA  1 
ATOM   1333 C  C   . PRO A 1 173 ? -10.941 37.657 3.283  1.00 40.10 ? 172 PRO A C   1 
ATOM   1334 O  O   . PRO A 1 173 ? -11.188 36.584 3.787  1.00 40.57 ? 172 PRO A O   1 
ATOM   1335 C  CB  . PRO A 1 173 ? -9.564  39.142 4.733  1.00 39.75 ? 172 PRO A CB  1 
ATOM   1336 C  CG  . PRO A 1 173 ? -9.804  39.453 6.098  1.00 39.42 ? 172 PRO A CG  1 
ATOM   1337 C  CD  . PRO A 1 173 ? -11.004 38.741 6.466  1.00 38.66 ? 172 PRO A CD  1 
ATOM   1338 N  N   . VAL A 1 174 ? -10.657 37.827 2.008  1.00 40.85 ? 173 VAL A N   1 
ATOM   1339 C  CA  . VAL A 1 174 ? -10.648 36.782 1.037  1.00 41.17 ? 173 VAL A CA  1 
ATOM   1340 C  C   . VAL A 1 174 ? -9.294  36.199 0.700  1.00 41.60 ? 173 VAL A C   1 
ATOM   1341 O  O   . VAL A 1 174 ? -9.179  35.650 -0.328 1.00 42.14 ? 173 VAL A O   1 
ATOM   1342 C  CB  . VAL A 1 174 ? -11.310 37.253 -0.231 1.00 41.04 ? 173 VAL A CB  1 
ATOM   1343 C  CG1 . VAL A 1 174 ? -12.626 37.813 0.041  1.00 41.26 ? 173 VAL A CG1 1 
ATOM   1344 C  CG2 . VAL A 1 174 ? -10.533 38.261 -0.831 1.00 40.87 ? 173 VAL A CG2 1 
ATOM   1345 N  N   . THR A 1 175 ? -8.279  36.274 1.561  1.00 41.97 ? 174 THR A N   1 
ATOM   1346 C  CA  . THR A 1 175 ? -6.871  36.328 1.122  1.00 42.14 ? 174 THR A CA  1 
ATOM   1347 C  C   . THR A 1 175 ? -6.114  35.005 1.185  1.00 42.00 ? 174 THR A C   1 
ATOM   1348 O  O   . THR A 1 175 ? -4.908  34.995 1.423  1.00 42.31 ? 174 THR A O   1 
ATOM   1349 C  CB  . THR A 1 175 ? -6.067  37.330 1.912  1.00 42.31 ? 174 THR A CB  1 
ATOM   1350 O  OG1 . THR A 1 175 ? -5.592  36.741 3.121  1.00 42.15 ? 174 THR A OG1 1 
ATOM   1351 C  CG2 . THR A 1 175 ? -6.906  38.465 2.242  1.00 43.28 ? 174 THR A CG2 1 
ATOM   1352 N  N   . PRO A 1 176 ? -6.824  33.896 0.959  1.00 41.38 ? 175 PRO A N   1 
ATOM   1353 C  CA  . PRO A 1 176 ? -7.303  32.974 1.998  1.00 40.32 ? 175 PRO A CA  1 
ATOM   1354 C  C   . PRO A 1 176 ? -6.395  32.398 3.110  1.00 39.30 ? 175 PRO A C   1 
ATOM   1355 O  O   . PRO A 1 176 ? -5.195  32.464 3.068  1.00 38.81 ? 175 PRO A O   1 
ATOM   1356 C  CB  . PRO A 1 176 ? -7.899  31.855 1.168  1.00 40.43 ? 175 PRO A CB  1 
ATOM   1357 C  CG  . PRO A 1 176 ? -7.098  31.821 -0.002 1.00 40.80 ? 175 PRO A CG  1 
ATOM   1358 C  CD  . PRO A 1 176 ? -6.639  33.194 -0.310 1.00 41.38 ? 175 PRO A CD  1 
ATOM   1359 N  N   . LYS A 1 177 ? -7.048  31.861 4.129  1.00 38.50 ? 176 LYS A N   1 
ATOM   1360 C  CA  . LYS A 1 177 ? -6.425  31.354 5.353  1.00 37.50 ? 176 LYS A CA  1 
ATOM   1361 C  C   . LYS A 1 177 ? -5.305  30.348 5.068  1.00 36.41 ? 176 LYS A C   1 
ATOM   1362 O  O   . LYS A 1 177 ? -5.310  29.632 4.057  1.00 36.80 ? 176 LYS A O   1 
ATOM   1363 C  CB  . LYS A 1 177 ? -7.495  30.695 6.249  1.00 37.75 ? 176 LYS A CB  1 
ATOM   1364 C  CG  . LYS A 1 177 ? -7.729  31.362 7.608  1.00 39.08 ? 176 LYS A CG  1 
ATOM   1365 C  CD  . LYS A 1 177 ? -6.613  31.009 8.616  1.00 41.11 ? 176 LYS A CD  1 
ATOM   1366 C  CE  . LYS A 1 177 ? -6.647  31.909 9.855  1.00 42.47 ? 176 LYS A CE  1 
ATOM   1367 N  NZ  . LYS A 1 177 ? -5.281  32.212 10.417 1.00 42.14 ? 176 LYS A NZ  1 
ATOM   1368 N  N   . ASN A 1 178 ? -4.337  30.329 5.967  1.00 34.66 ? 177 ASN A N   1 
ATOM   1369 C  CA  . ASN A 1 178 ? -3.259  29.379 5.942  1.00 32.89 ? 177 ASN A CA  1 
ATOM   1370 C  C   . ASN A 1 178 ? -3.588  28.425 7.073  1.00 31.35 ? 177 ASN A C   1 
ATOM   1371 O  O   . ASN A 1 178 ? -4.168  28.854 8.063  1.00 30.61 ? 177 ASN A O   1 
ATOM   1372 C  CB  . ASN A 1 178 ? -1.935  30.106 6.228  1.00 33.00 ? 177 ASN A CB  1 
ATOM   1373 C  CG  . ASN A 1 178 ? -1.333  30.765 4.984  1.00 33.46 ? 177 ASN A CG  1 
ATOM   1374 O  OD1 . ASN A 1 178 ? -0.980  30.090 4.006  1.00 34.31 ? 177 ASN A OD1 1 
ATOM   1375 N  ND2 . ASN A 1 178 ? -1.197  32.078 5.026  1.00 30.76 ? 177 ASN A ND2 1 
ATOM   1376 N  N   . PRO A 1 179 ? -3.237  27.131 6.937  1.00 30.46 ? 178 PRO A N   1 
ATOM   1377 C  CA  . PRO A 1 179 ? -3.490  26.193 8.053  1.00 30.07 ? 178 PRO A CA  1 
ATOM   1378 C  C   . PRO A 1 179 ? -2.459  26.309 9.191  1.00 29.20 ? 178 PRO A C   1 
ATOM   1379 O  O   . PRO A 1 179 ? -1.921  25.303 9.644  1.00 28.71 ? 178 PRO A O   1 
ATOM   1380 C  CB  . PRO A 1 179 ? -3.440  24.804 7.380  1.00 30.40 ? 178 PRO A CB  1 
ATOM   1381 C  CG  . PRO A 1 179 ? -3.179  25.069 5.897  1.00 30.26 ? 178 PRO A CG  1 
ATOM   1382 C  CD  . PRO A 1 179 ? -2.626  26.451 5.786  1.00 30.07 ? 178 PRO A CD  1 
ATOM   1383 N  N   . TRP A 1 180 ? -2.207  27.551 9.613  1.00 28.52 ? 179 TRP A N   1 
ATOM   1384 C  CA  . TRP A 1 180 ? -1.422  27.905 10.787 1.00 27.82 ? 179 TRP A CA  1 
ATOM   1385 C  C   . TRP A 1 180 ? -1.776  29.339 11.200 1.00 27.64 ? 179 TRP A C   1 
ATOM   1386 O  O   . TRP A 1 180 ? -2.382  30.085 10.420 1.00 27.45 ? 179 TRP A O   1 
ATOM   1387 C  CB  . TRP A 1 180 ? 0.080   27.781 10.505 1.00 27.88 ? 179 TRP A CB  1 
ATOM   1388 C  CG  . TRP A 1 180 ? 0.587   28.680 9.371  1.00 28.52 ? 179 TRP A CG  1 
ATOM   1389 C  CD1 . TRP A 1 180 ? 0.906   30.015 9.454  1.00 28.06 ? 179 TRP A CD1 1 
ATOM   1390 C  CD2 . TRP A 1 180 ? 0.827   28.299 8.004  1.00 27.53 ? 179 TRP A CD2 1 
ATOM   1391 N  NE1 . TRP A 1 180 ? 1.321   30.478 8.225  1.00 28.03 ? 179 TRP A NE1 1 
ATOM   1392 C  CE2 . TRP A 1 180 ? 1.281   29.443 7.322  1.00 27.64 ? 179 TRP A CE2 1 
ATOM   1393 C  CE3 . TRP A 1 180 ? 0.692   27.105 7.292  1.00 28.37 ? 179 TRP A CE3 1 
ATOM   1394 C  CZ2 . TRP A 1 180 ? 1.606   29.421 5.963  1.00 27.13 ? 179 TRP A CZ2 1 
ATOM   1395 C  CZ3 . TRP A 1 180 ? 1.027   27.085 5.951  1.00 27.53 ? 179 TRP A CZ3 1 
ATOM   1396 C  CH2 . TRP A 1 180 ? 1.476   28.233 5.301  1.00 27.53 ? 179 TRP A CH2 1 
ATOM   1397 N  N   . SER A 1 181 ? -1.414  29.714 12.429 1.00 27.22 ? 180 SER A N   1 
ATOM   1398 C  CA  . SER A 1 181 ? -1.507  31.103 12.881 1.00 26.81 ? 180 SER A CA  1 
ATOM   1399 C  C   . SER A 1 181 ? -0.144  31.792 12.812 1.00 26.32 ? 180 SER A C   1 
ATOM   1400 O  O   . SER A 1 181 ? 0.892   31.141 12.983 1.00 25.64 ? 180 SER A O   1 
ATOM   1401 C  CB  . SER A 1 181 ? -2.091  31.192 14.307 1.00 27.22 ? 180 SER A CB  1 
ATOM   1402 O  OG  . SER A 1 181 ? -1.473  30.267 15.182 1.00 27.12 ? 180 SER A OG  1 
ATOM   1403 N  N   . MET A 1 182 ? -0.167  33.105 12.558 1.00 26.17 ? 181 MET A N   1 
ATOM   1404 C  CA  . MET A 1 182 ? 1.044   33.936 12.443 1.00 26.56 ? 181 MET A CA  1 
ATOM   1405 C  C   . MET A 1 182 ? 1.085   35.004 13.545 1.00 24.99 ? 181 MET A C   1 
ATOM   1406 O  O   . MET A 1 182 ? 0.046   35.544 13.951 1.00 24.82 ? 181 MET A O   1 
ATOM   1407 C  CB  . MET A 1 182 ? 1.151   34.587 11.036 1.00 26.54 ? 181 MET A CB  1 
ATOM   1408 C  CG  . MET A 1 182 ? 1.455   33.586 9.865  1.00 28.82 ? 181 MET A CG  1 
ATOM   1409 S  SD  . MET A 1 182 ? 1.188   33.957 8.048  1.00 31.08 ? 181 MET A SD  1 
ATOM   1410 C  CE  . MET A 1 182 ? 2.536   35.076 7.643  1.00 30.66 ? 181 MET A CE  1 
ATOM   1411 N  N   . ASP A 1 183 ? 2.278   35.282 14.058 1.00 23.58 ? 182 ASP A N   1 
ATOM   1412 C  CA  . ASP A 1 183 ? 2.499   36.512 14.813 1.00 22.18 ? 182 ASP A CA  1 
ATOM   1413 C  C   . ASP A 1 183 ? 3.661   37.281 14.212 1.00 21.60 ? 182 ASP A C   1 
ATOM   1414 O  O   . ASP A 1 183 ? 4.771   36.777 14.119 1.00 21.95 ? 182 ASP A O   1 
ATOM   1415 C  CB  . ASP A 1 183 ? 2.761   36.234 16.300 1.00 22.08 ? 182 ASP A CB  1 
ATOM   1416 C  CG  . ASP A 1 183 ? 2.655   37.475 17.147 1.00 20.88 ? 182 ASP A CG  1 
ATOM   1417 O  OD1 . ASP A 1 183 ? 1.535   38.002 17.280 1.00 21.08 ? 182 ASP A OD1 1 
ATOM   1418 O  OD2 . ASP A 1 183 ? 3.684   37.940 17.682 1.00 20.61 ? 182 ASP A OD2 1 
ATOM   1419 N  N   . GLU A 1 184 ? 3.395   38.509 13.812 1.00 21.20 ? 183 GLU A N   1 
ATOM   1420 C  CA  . GLU A 1 184 ? 4.364   39.325 13.106 1.00 20.82 ? 183 GLU A CA  1 
ATOM   1421 C  C   . GLU A 1 184 ? 4.522   40.639 13.838 1.00 19.86 ? 183 GLU A C   1 
ATOM   1422 O  O   . GLU A 1 184 ? 3.530   41.218 14.298 1.00 19.57 ? 183 GLU A O   1 
ATOM   1423 C  CB  . GLU A 1 184 ? 3.868   39.594 11.687 1.00 20.74 ? 183 GLU A CB  1 
ATOM   1424 C  CG  . GLU A 1 184 ? 4.732   40.532 10.816 1.00 21.19 ? 183 GLU A CG  1 
ATOM   1425 C  CD  . GLU A 1 184 ? 3.980   40.970 9.554  1.00 22.02 ? 183 GLU A CD  1 
ATOM   1426 O  OE1 . GLU A 1 184 ? 3.020   40.275 9.139  1.00 22.60 ? 183 GLU A OE1 1 
ATOM   1427 O  OE2 . GLU A 1 184 ? 4.322   42.024 8.991  1.00 24.81 ? 183 GLU A OE2 1 
ATOM   1428 N  N   . ASN A 1 185 ? 5.779   41.069 13.962 1.00 18.39 ? 184 ASN A N   1 
ATOM   1429 C  CA  . ASN A 1 185 ? 6.132   42.417 14.385 1.00 17.41 ? 184 ASN A CA  1 
ATOM   1430 C  C   . ASN A 1 185 ? 7.413   42.817 13.683 1.00 17.45 ? 184 ASN A C   1 
ATOM   1431 O  O   . ASN A 1 185 ? 7.852   42.155 12.735 1.00 18.55 ? 184 ASN A O   1 
ATOM   1432 C  CB  . ASN A 1 185 ? 6.228   42.582 15.921 1.00 16.81 ? 184 ASN A CB  1 
ATOM   1433 C  CG  . ASN A 1 185 ? 7.171   41.592 16.588 1.00 16.41 ? 184 ASN A CG  1 
ATOM   1434 O  OD1 . ASN A 1 185 ? 8.341   41.445 16.219 1.00 15.58 ? 184 ASN A OD1 1 
ATOM   1435 N  ND2 . ASN A 1 185 ? 6.660   40.912 17.597 1.00 16.18 ? 184 ASN A ND2 1 
ATOM   1436 N  N   . LEU A 1 186 ? 8.004   43.908 14.127 1.00 17.27 ? 185 LEU A N   1 
ATOM   1437 C  CA  . LEU A 1 186 ? 9.246   44.417 13.568 1.00 17.24 ? 185 LEU A CA  1 
ATOM   1438 C  C   . LEU A 1 186 ? 10.425  43.422 13.695 1.00 16.99 ? 185 LEU A C   1 
ATOM   1439 O  O   . LEU A 1 186 ? 11.302  43.378 12.825 1.00 17.04 ? 185 LEU A O   1 
ATOM   1440 C  CB  . LEU A 1 186 ? 9.568   45.701 14.315 1.00 17.90 ? 185 LEU A CB  1 
ATOM   1441 C  CG  . LEU A 1 186 ? 10.636  46.681 13.893 1.00 18.29 ? 185 LEU A CG  1 
ATOM   1442 C  CD1 . LEU A 1 186 ? 10.462  47.107 12.431 1.00 18.39 ? 185 LEU A CD1 1 
ATOM   1443 C  CD2 . LEU A 1 186 ? 10.466  47.836 14.846 1.00 18.27 ? 185 LEU A CD2 1 
ATOM   1444 N  N   . MET A 1 187 ? 10.419  42.619 14.765 1.00 15.90 ? 186 MET A N   1 
ATOM   1445 C  CA  . MET A 1 187 ? 11.550  41.761 15.103 1.00 15.13 ? 186 MET A CA  1 
ATOM   1446 C  C   . MET A 1 187 ? 11.544  40.389 14.418 1.00 14.70 ? 186 MET A C   1 
ATOM   1447 O  O   . MET A 1 187 ? 12.602  39.798 14.155 1.00 13.74 ? 186 MET A O   1 
ATOM   1448 C  CB  . MET A 1 187 ? 11.672  41.584 16.620 1.00 14.64 ? 186 MET A CB  1 
ATOM   1449 C  CG  . MET A 1 187 ? 13.061  41.136 17.014 1.00 14.87 ? 186 MET A CG  1 
ATOM   1450 S  SD  . MET A 1 187 ? 13.344  40.850 18.760 1.00 15.93 ? 186 MET A SD  1 
ATOM   1451 C  CE  . MET A 1 187 ? 14.938  40.026 18.606 1.00 15.41 ? 186 MET A CE  1 
ATOM   1452 N  N   . HIS A 1 188 ? 10.350  39.879 14.129 1.00 14.26 ? 187 HIS A N   1 
ATOM   1453 C  CA  . HIS A 1 188 ? 10.245  38.544 13.595 1.00 12.98 ? 187 HIS A CA  1 
ATOM   1454 C  C   . HIS A 1 188 ? 8.868   38.242 13.042 1.00 12.80 ? 187 HIS A C   1 
ATOM   1455 O  O   . HIS A 1 188 ? 7.936   39.058 13.090 1.00 11.84 ? 187 HIS A O   1 
ATOM   1456 C  CB  . HIS A 1 188 ? 10.622  37.536 14.705 1.00 13.33 ? 187 HIS A CB  1 
ATOM   1457 C  CG  . HIS A 1 188 ? 9.469   37.078 15.550 1.00 12.59 ? 187 HIS A CG  1 
ATOM   1458 N  ND1 . HIS A 1 188 ? 9.475   35.870 16.201 1.00 12.69 ? 187 HIS A ND1 1 
ATOM   1459 C  CD2 . HIS A 1 188 ? 8.281   37.662 15.851 1.00 13.50 ? 187 HIS A CD2 1 
ATOM   1460 C  CE1 . HIS A 1 188 ? 8.343   35.727 16.868 1.00 12.58 ? 187 HIS A CE1 1 
ATOM   1461 N  NE2 . HIS A 1 188 ? 7.596   36.793 16.659 1.00 11.58 ? 187 HIS A NE2 1 
ATOM   1462 N  N   . ILE A 1 189 ? 8.749   37.031 12.530 1.00 13.30 ? 188 ILE A N   1 
ATOM   1463 C  CA  . ILE A 1 189 ? 7.442   36.427 12.332 1.00 13.80 ? 188 ILE A CA  1 
ATOM   1464 C  C   . ILE A 1 189 ? 7.472   35.006 12.892 1.00 13.91 ? 188 ILE A C   1 
ATOM   1465 O  O   . ILE A 1 189 ? 8.478   34.285 12.751 1.00 13.58 ? 188 ILE A O   1 
ATOM   1466 C  CB  . ILE A 1 189 ? 6.949   36.530 10.843 1.00 14.10 ? 188 ILE A CB  1 
ATOM   1467 C  CG1 . ILE A 1 189 ? 5.636   35.798 10.642 1.00 12.48 ? 188 ILE A CG1 1 
ATOM   1468 C  CG2 . ILE A 1 189 ? 8.013   36.027 9.848  1.00 14.87 ? 188 ILE A CG2 1 
ATOM   1469 C  CD1 . ILE A 1 189 ? 4.815   36.454 9.642  1.00 15.07 ? 188 ILE A CD1 1 
ATOM   1470 N  N   . SER A 1 190 ? 6.383   34.642 13.565 1.00 14.29 ? 189 SER A N   1 
ATOM   1471 C  CA  . SER A 1 190 ? 6.211   33.311 14.121 1.00 15.76 ? 189 SER A CA  1 
ATOM   1472 C  C   . SER A 1 190 ? 5.003   32.572 13.521 1.00 17.01 ? 189 SER A C   1 
ATOM   1473 O  O   . SER A 1 190 ? 3.938   33.147 13.316 1.00 18.30 ? 189 SER A O   1 
ATOM   1474 C  CB  . SER A 1 190 ? 6.039   33.410 15.635 1.00 15.67 ? 189 SER A CB  1 
ATOM   1475 O  OG  . SER A 1 190 ? 5.374   32.277 16.120 1.00 13.64 ? 189 SER A OG  1 
ATOM   1476 N  N   . TYR A 1 191 ? 5.134   31.320 13.239 1.00 17.89 ? 190 TYR A N   1 
ATOM   1477 C  CA  . TYR A 1 191 ? 4.058   30.533 12.765 1.00 18.19 ? 190 TYR A CA  1 
ATOM   1478 C  C   . TYR A 1 191 ? 3.909   29.315 13.653 1.00 18.40 ? 190 TYR A C   1 
ATOM   1479 O  O   . TYR A 1 191 ? 4.845   28.671 13.927 1.00 17.29 ? 190 TYR A O   1 
ATOM   1480 C  CB  . TYR A 1 191 ? 4.358   30.101 11.308 1.00 18.46 ? 190 TYR A CB  1 
ATOM   1481 C  CG  . TYR A 1 191 ? 4.939   31.125 10.363 1.00 18.38 ? 190 TYR A CG  1 
ATOM   1482 C  CD1 . TYR A 1 191 ? 6.261   31.462 10.395 1.00 18.31 ? 190 TYR A CD1 1 
ATOM   1483 C  CD2 . TYR A 1 191 ? 4.177   31.693 9.411  1.00 18.77 ? 190 TYR A CD2 1 
ATOM   1484 C  CE1 . TYR A 1 191 ? 6.771   32.330 9.549  1.00 18.66 ? 190 TYR A CE1 1 
ATOM   1485 C  CE2 . TYR A 1 191 ? 4.684   32.562 8.557  1.00 19.03 ? 190 TYR A CE2 1 
ATOM   1486 C  CZ  . TYR A 1 191 ? 5.975   32.886 8.601  1.00 18.19 ? 190 TYR A CZ  1 
ATOM   1487 O  OH  . TYR A 1 191 ? 6.418   33.781 7.718  1.00 17.19 ? 190 TYR A OH  1 
ATOM   1488 N  N   . GLU A 1 192 ? 2.701   28.992 14.078 1.00 19.67 ? 191 GLU A N   1 
ATOM   1489 C  CA  . GLU A 1 192 ? 2.498   27.937 15.098 1.00 20.43 ? 191 GLU A CA  1 
ATOM   1490 C  C   . GLU A 1 192 ? 1.419   26.894 15.190 1.00 20.62 ? 191 GLU A C   1 
ATOM   1491 O  O   . GLU A 1 192 ? 1.645   25.816 15.652 1.00 21.39 ? 191 GLU A O   1 
ATOM   1492 C  CB  . GLU A 1 192 ? 3.163   28.173 16.425 1.00 19.88 ? 191 GLU A CB  1 
ATOM   1493 C  CG  . GLU A 1 192 ? 2.367   28.972 17.338 1.00 19.35 ? 191 GLU A CG  1 
ATOM   1494 C  CD  . GLU A 1 192 ? 3.033   29.150 18.626 1.00 20.00 ? 191 GLU A CD  1 
ATOM   1495 O  OE1 . GLU A 1 192 ? 4.203   29.388 18.615 1.00 20.88 ? 191 GLU A OE1 1 
ATOM   1496 O  OE2 . GLU A 1 192 ? 2.409   29.006 19.661 1.00 18.82 ? 191 GLU A OE2 1 
ATOM   1497 N  N   . ALA A 1 193 ? 0.162   27.226 14.813 1.00 20.84 ? 192 ALA A N   1 
ATOM   1498 C  CA  . ALA A 1 193 ? -0.743  26.113 14.968 1.00 20.33 ? 192 ALA A CA  1 
ATOM   1499 C  C   . ALA A 1 193 ? -0.974  25.302 13.706 1.00 20.68 ? 192 ALA A C   1 
ATOM   1500 O  O   . ALA A 1 193 ? -0.139  25.225 12.881 1.00 20.83 ? 192 ALA A O   1 
ATOM   1501 C  CB  . ALA A 1 193 ? -1.943  26.534 15.553 1.00 20.16 ? 192 ALA A CB  1 
ATOM   1502 N  N   . GLY A 1 194 ? -2.106  24.630 13.621 1.00 21.22 ? 193 GLY A N   1 
ATOM   1503 C  CA  . GLY A 1 194 ? -2.543  24.005 12.395 1.00 20.61 ? 193 GLY A CA  1 
ATOM   1504 C  C   . GLY A 1 194 ? -1.641  22.864 12.074 1.00 20.48 ? 193 GLY A C   1 
ATOM   1505 O  O   . GLY A 1 194 ? -1.430  22.058 12.902 1.00 21.00 ? 193 GLY A O   1 
ATOM   1506 N  N   . ILE A 1 195 ? -1.096  22.846 10.885 1.00 19.72 ? 194 ILE A N   1 
ATOM   1507 C  CA  . ILE A 1 195 ? -0.321  21.755 10.426 1.00 19.85 ? 194 ILE A CA  1 
ATOM   1508 C  C   . ILE A 1 195 ? 1.015   21.525 11.078 1.00 19.43 ? 194 ILE A C   1 
ATOM   1509 O  O   . ILE A 1 195 ? 1.599   20.501 10.923 1.00 19.41 ? 194 ILE A O   1 
ATOM   1510 C  CB  . ILE A 1 195 ? -0.146  21.755 8.921  1.00 19.92 ? 194 ILE A CB  1 
ATOM   1511 C  CG1 . ILE A 1 195 ? -0.092  23.156 8.357  1.00 20.98 ? 194 ILE A CG1 1 
ATOM   1512 C  CG2 . ILE A 1 195 ? -1.156  20.960 8.325  1.00 20.81 ? 194 ILE A CG2 1 
ATOM   1513 C  CD1 . ILE A 1 195 ? 1.178   23.800 8.451  1.00 20.93 ? 194 ILE A CD1 1 
ATOM   1514 N  N   . LEU A 1 196 ? 1.463   22.514 11.822 1.00 19.34 ? 195 LEU A N   1 
ATOM   1515 C  CA  . LEU A 1 196 ? 2.767   22.571 12.367 1.00 19.05 ? 195 LEU A CA  1 
ATOM   1516 C  C   . LEU A 1 196 ? 2.789   21.956 13.703 1.00 19.14 ? 195 LEU A C   1 
ATOM   1517 O  O   . LEU A 1 196 ? 3.827   21.774 14.242 1.00 19.02 ? 195 LEU A O   1 
ATOM   1518 C  CB  . LEU A 1 196 ? 3.232   23.990 12.480 1.00 18.99 ? 195 LEU A CB  1 
ATOM   1519 C  CG  . LEU A 1 196 ? 3.521   24.742 11.214 1.00 18.75 ? 195 LEU A CG  1 
ATOM   1520 C  CD1 . LEU A 1 196 ? 3.661   26.159 11.542 1.00 17.92 ? 195 LEU A CD1 1 
ATOM   1521 C  CD2 . LEU A 1 196 ? 4.708   24.166 10.546 1.00 18.95 ? 195 LEU A CD2 1 
ATOM   1522 N  N   . GLU A 1 197 ? 1.597   21.642 14.198 1.00 19.11 ? 196 GLU A N   1 
ATOM   1523 C  CA  . GLU A 1 197 ? 1.370   20.956 15.470 1.00 19.45 ? 196 GLU A CA  1 
ATOM   1524 C  C   . GLU A 1 197 ? 1.903   19.518 15.462 1.00 18.78 ? 196 GLU A C   1 
ATOM   1525 O  O   . GLU A 1 197 ? 2.094   18.933 16.523 1.00 19.88 ? 196 GLU A O   1 
ATOM   1526 C  CB  . GLU A 1 197 ? -0.128  20.988 15.842 1.00 19.14 ? 196 GLU A CB  1 
ATOM   1527 C  CG  . GLU A 1 197 ? -0.526  22.289 16.554 1.00 20.78 ? 196 GLU A CG  1 
ATOM   1528 C  CD  . GLU A 1 197 ? -2.031  22.447 16.833 1.00 20.70 ? 196 GLU A CD  1 
ATOM   1529 O  OE1 . GLU A 1 197 ? -2.849  21.508 16.594 1.00 22.74 ? 196 GLU A OE1 1 
ATOM   1530 O  OE2 . GLU A 1 197 ? -2.392  23.555 17.287 1.00 21.64 ? 196 GLU A OE2 1 
ATOM   1531 N  N   . ASN A 1 198 ? 2.091   18.938 14.277 1.00 17.76 ? 197 ASN A N   1 
ATOM   1532 C  CA  . ASN A 1 198 ? 2.751   17.648 14.149 1.00 17.14 ? 197 ASN A CA  1 
ATOM   1533 C  C   . ASN A 1 198 ? 4.247   17.926 13.918 1.00 16.61 ? 197 ASN A C   1 
ATOM   1534 O  O   . ASN A 1 198 ? 4.631   18.298 12.810 1.00 16.36 ? 197 ASN A O   1 
ATOM   1535 C  CB  . ASN A 1 198 ? 2.127   16.802 13.006 1.00 16.24 ? 197 ASN A CB  1 
ATOM   1536 C  CG  . ASN A 1 198 ? 2.696   15.364 12.939 1.00 16.00 ? 197 ASN A CG  1 
ATOM   1537 O  OD1 . ASN A 1 198 ? 3.790   15.087 13.421 1.00 14.42 ? 197 ASN A OD1 1 
ATOM   1538 N  ND2 . ASN A 1 198 ? 1.931   14.450 12.363 1.00 15.69 ? 197 ASN A ND2 1 
ATOM   1539 N  N   . PRO A 1 199 ? 5.088   17.738 14.955 1.00 16.74 ? 198 PRO A N   1 
ATOM   1540 C  CA  . PRO A 1 199 ? 6.486   18.204 14.922 1.00 17.06 ? 198 PRO A CA  1 
ATOM   1541 C  C   . PRO A 1 199 ? 7.343   17.364 13.984 1.00 17.45 ? 198 PRO A C   1 
ATOM   1542 O  O   . PRO A 1 199 ? 8.499   17.731 13.694 1.00 16.83 ? 198 PRO A O   1 
ATOM   1543 C  CB  . PRO A 1 199 ? 6.960   18.051 16.374 1.00 16.74 ? 198 PRO A CB  1 
ATOM   1544 C  CG  . PRO A 1 199 ? 5.767   17.695 17.157 1.00 16.86 ? 198 PRO A CG  1 
ATOM   1545 C  CD  . PRO A 1 199 ? 4.799   17.051 16.222 1.00 16.80 ? 198 PRO A CD  1 
ATOM   1546 N  N   . LYS A 1 200 ? 6.746   16.272 13.489 1.00 17.65 ? 199 LYS A N   1 
ATOM   1547 C  CA  . LYS A 1 200 ? 7.332   15.479 12.425 1.00 18.20 ? 199 LYS A CA  1 
ATOM   1548 C  C   . LYS A 1 200 ? 7.159   16.144 11.062 1.00 18.26 ? 199 LYS A C   1 
ATOM   1549 O  O   . LYS A 1 200 ? 8.015   15.991 10.186 1.00 19.38 ? 199 LYS A O   1 
ATOM   1550 C  CB  . LYS A 1 200 ? 6.767   14.057 12.416 1.00 18.61 ? 199 LYS A CB  1 
ATOM   1551 C  CG  . LYS A 1 200 ? 7.560   13.136 11.497 1.00 20.60 ? 199 LYS A CG  1 
ATOM   1552 C  CD  . LYS A 1 200 ? 7.035   11.732 11.481 1.00 21.54 ? 199 LYS A CD  1 
ATOM   1553 C  CE  . LYS A 1 200 ? 7.588   10.991 10.286 1.00 22.34 ? 199 LYS A CE  1 
ATOM   1554 N  NZ  . LYS A 1 200 ? 7.616   9.530  10.574 1.00 26.13 ? 199 LYS A NZ  1 
ATOM   1555 N  N   . ASN A 1 201 ? 6.070   16.889 10.888 1.00 18.34 ? 200 ASN A N   1 
ATOM   1556 C  CA  . ASN A 1 201 ? 5.789   17.575 9.633  1.00 18.56 ? 200 ASN A CA  1 
ATOM   1557 C  C   . ASN A 1 201 ? 6.646   18.826 9.390  1.00 19.38 ? 200 ASN A C   1 
ATOM   1558 O  O   . ASN A 1 201 ? 6.778   19.705 10.262 1.00 18.38 ? 200 ASN A O   1 
ATOM   1559 C  CB  . ASN A 1 201 ? 4.309   17.944 9.535  1.00 18.27 ? 200 ASN A CB  1 
ATOM   1560 C  CG  . ASN A 1 201 ? 3.387   16.716 9.346  1.00 18.53 ? 200 ASN A CG  1 
ATOM   1561 O  OD1 . ASN A 1 201 ? 3.841   15.569 9.160  1.00 16.74 ? 200 ASN A OD1 1 
ATOM   1562 N  ND2 . ASN A 1 201 ? 2.086   16.971 9.395  1.00 13.60 ? 200 ASN A ND2 1 
ATOM   1563 N  N   . GLN A 1 202 ? 7.175   18.902 8.166  1.00 20.03 ? 201 GLN A N   1 
ATOM   1564 C  CA  . GLN A 1 202 ? 8.073   19.959 7.722  1.00 20.75 ? 201 GLN A CA  1 
ATOM   1565 C  C   . GLN A 1 202 ? 7.279   21.176 7.198  1.00 21.69 ? 201 GLN A C   1 
ATOM   1566 O  O   . GLN A 1 202 ? 6.211   21.010 6.587  1.00 21.36 ? 201 GLN A O   1 
ATOM   1567 C  CB  . GLN A 1 202 ? 9.061   19.394 6.679  1.00 20.34 ? 201 GLN A CB  1 
ATOM   1568 C  CG  . GLN A 1 202 ? 9.632   18.016 7.086  1.00 19.75 ? 201 GLN A CG  1 
ATOM   1569 C  CD  . GLN A 1 202 ? 10.725  17.456 6.157  1.00 21.17 ? 201 GLN A CD  1 
ATOM   1570 O  OE1 . GLN A 1 202 ? 11.030  18.030 5.093  1.00 20.88 ? 201 GLN A OE1 1 
ATOM   1571 N  NE2 . GLN A 1 202 ? 11.326  16.316 6.566  1.00 19.88 ? 201 GLN A NE2 1 
ATOM   1572 N  N   . ALA A 1 203 ? 7.773   22.388 7.479  1.00 22.27 ? 202 ALA A N   1 
ATOM   1573 C  CA  . ALA A 1 203 ? 7.193   23.605 6.907  1.00 23.47 ? 202 ALA A CA  1 
ATOM   1574 C  C   . ALA A 1 203 ? 7.100   23.481 5.399  1.00 24.65 ? 202 ALA A C   1 
ATOM   1575 O  O   . ALA A 1 203 ? 8.099   23.119 4.755  1.00 24.92 ? 202 ALA A O   1 
ATOM   1576 C  CB  . ALA A 1 203 ? 8.048   24.815 7.247  1.00 23.90 ? 202 ALA A CB  1 
ATOM   1577 N  N   . PRO A 1 204 ? 5.908   23.775 4.818  1.00 25.72 ? 203 PRO A N   1 
ATOM   1578 C  CA  . PRO A 1 204 ? 5.819   23.823 3.354  1.00 26.27 ? 203 PRO A CA  1 
ATOM   1579 C  C   . PRO A 1 204 ? 6.580   25.065 2.860  1.00 26.67 ? 203 PRO A C   1 
ATOM   1580 O  O   . PRO A 1 204 ? 6.726   26.010 3.622  1.00 26.79 ? 203 PRO A O   1 
ATOM   1581 C  CB  . PRO A 1 204 ? 4.313   23.926 3.082  1.00 26.22 ? 203 PRO A CB  1 
ATOM   1582 C  CG  . PRO A 1 204 ? 3.636   23.714 4.428  1.00 26.27 ? 203 PRO A CG  1 
ATOM   1583 C  CD  . PRO A 1 204 ? 4.619   24.092 5.462  1.00 25.51 ? 203 PRO A CD  1 
ATOM   1584 N  N   . PRO A 1 205 ? 7.103   25.049 1.617  1.00 27.11 ? 204 PRO A N   1 
ATOM   1585 C  CA  . PRO A 1 205 ? 7.965   26.169 1.183  1.00 27.28 ? 204 PRO A CA  1 
ATOM   1586 C  C   . PRO A 1 205 ? 7.272   27.544 1.180  1.00 27.18 ? 204 PRO A C   1 
ATOM   1587 O  O   . PRO A 1 205 ? 7.908   28.548 1.518  1.00 26.96 ? 204 PRO A O   1 
ATOM   1588 C  CB  . PRO A 1 205 ? 8.399   25.765 -0.238 1.00 27.49 ? 204 PRO A CB  1 
ATOM   1589 C  CG  . PRO A 1 205 ? 8.138   24.296 -0.327 1.00 27.39 ? 204 PRO A CG  1 
ATOM   1590 C  CD  . PRO A 1 205 ? 6.958   24.029 0.561  1.00 27.05 ? 204 PRO A CD  1 
ATOM   1591 N  N   . GLY A 1 206 ? 5.977   27.568 0.847  1.00 27.02 ? 205 GLY A N   1 
ATOM   1592 C  CA  . GLY A 1 206 ? 5.183   28.797 0.844  1.00 26.52 ? 205 GLY A CA  1 
ATOM   1593 C  C   . GLY A 1 206 ? 4.920   29.382 2.224  1.00 26.27 ? 205 GLY A C   1 
ATOM   1594 O  O   . GLY A 1 206 ? 4.229   30.395 2.358  1.00 26.65 ? 205 GLY A O   1 
ATOM   1595 N  N   . LEU A 1 207 ? 5.459   28.748 3.255  1.00 25.52 ? 206 LEU A N   1 
ATOM   1596 C  CA  . LEU A 1 207 ? 5.290   29.224 4.628  1.00 25.37 ? 206 LEU A CA  1 
ATOM   1597 C  C   . LEU A 1 207 ? 6.136   30.503 4.861  1.00 24.71 ? 206 LEU A C   1 
ATOM   1598 O  O   . LEU A 1 207 ? 5.693   31.454 5.486  1.00 24.07 ? 206 LEU A O   1 
ATOM   1599 C  CB  . LEU A 1 207 ? 5.700   28.099 5.593  1.00 25.63 ? 206 LEU A CB  1 
ATOM   1600 C  CG  . LEU A 1 207 ? 5.520   28.037 7.116  1.00 26.22 ? 206 LEU A CG  1 
ATOM   1601 C  CD1 . LEU A 1 207 ? 5.617   29.383 7.716  1.00 27.48 ? 206 LEU A CD1 1 
ATOM   1602 C  CD2 . LEU A 1 207 ? 4.247   27.347 7.567  1.00 25.56 ? 206 LEU A CD2 1 
ATOM   1603 N  N   . TYR A 1 208 ? 7.334   30.517 4.292  1.00 24.33 ? 207 TYR A N   1 
ATOM   1604 C  CA  . TYR A 1 208 ? 8.341   31.503 4.603  1.00 24.05 ? 207 TYR A CA  1 
ATOM   1605 C  C   . TYR A 1 208 ? 8.147   32.819 3.857  1.00 24.67 ? 207 TYR A C   1 
ATOM   1606 O  O   . TYR A 1 208 ? 8.522   32.960 2.695  1.00 25.12 ? 207 TYR A O   1 
ATOM   1607 C  CB  . TYR A 1 208 ? 9.731   30.905 4.355  1.00 22.94 ? 207 TYR A CB  1 
ATOM   1608 C  CG  . TYR A 1 208 ? 10.076  29.780 5.305  1.00 22.30 ? 207 TYR A CG  1 
ATOM   1609 C  CD1 . TYR A 1 208 ? 9.990   28.442 4.899  1.00 23.31 ? 207 TYR A CD1 1 
ATOM   1610 C  CD2 . TYR A 1 208 ? 10.480  30.048 6.618  1.00 20.27 ? 207 TYR A CD2 1 
ATOM   1611 C  CE1 . TYR A 1 208 ? 10.306  27.399 5.772  1.00 21.48 ? 207 TYR A CE1 1 
ATOM   1612 C  CE2 . TYR A 1 208 ? 10.793  29.030 7.491  1.00 20.05 ? 207 TYR A CE2 1 
ATOM   1613 C  CZ  . TYR A 1 208 ? 10.709  27.702 7.066  1.00 21.19 ? 207 TYR A CZ  1 
ATOM   1614 O  OH  . TYR A 1 208 ? 11.021  26.680 7.940  1.00 20.46 ? 207 TYR A OH  1 
ATOM   1615 N  N   . THR A 1 209 ? 7.602   33.798 4.563  1.00 24.95 ? 208 THR A N   1 
ATOM   1616 C  CA  . THR A 1 209 ? 7.226   35.070 3.970  1.00 25.45 ? 208 THR A CA  1 
ATOM   1617 C  C   . THR A 1 209 ? 8.257   36.220 4.141  1.00 25.56 ? 208 THR A C   1 
ATOM   1618 O  O   . THR A 1 209 ? 8.275   37.145 3.346  1.00 25.84 ? 208 THR A O   1 
ATOM   1619 C  CB  . THR A 1 209 ? 5.831   35.492 4.492  1.00 25.51 ? 208 THR A CB  1 
ATOM   1620 O  OG1 . THR A 1 209 ? 5.825   35.434 5.917  1.00 25.62 ? 208 THR A OG1 1 
ATOM   1621 C  CG2 . THR A 1 209 ? 4.752   34.529 3.979  1.00 25.81 ? 208 THR A CG2 1 
ATOM   1622 N  N   . LYS A 1 210 ? 9.114   36.153 5.158  1.00 25.70 ? 209 LYS A N   1 
ATOM   1623 C  CA  . LYS A 1 210 ? 10.017  37.263 5.490  1.00 25.85 ? 209 LYS A CA  1 
ATOM   1624 C  C   . LYS A 1 210 ? 11.453  37.045 5.019  1.00 25.40 ? 209 LYS A C   1 
ATOM   1625 O  O   . LYS A 1 210 ? 12.161  38.008 4.754  1.00 25.50 ? 209 LYS A O   1 
ATOM   1626 C  CB  . LYS A 1 210 ? 10.014  37.531 6.998  1.00 25.79 ? 209 LYS A CB  1 
ATOM   1627 C  CG  . LYS A 1 210 ? 9.702   38.967 7.365  1.00 29.22 ? 209 LYS A CG  1 
ATOM   1628 C  CD  . LYS A 1 210 ? 10.028  39.264 8.829  1.00 32.65 ? 209 LYS A CD  1 
ATOM   1629 C  CE  . LYS A 1 210 ? 10.398  40.758 9.025  1.00 34.87 ? 209 LYS A CE  1 
ATOM   1630 N  NZ  . LYS A 1 210 ? 10.725  41.137 10.461 1.00 33.86 ? 209 LYS A NZ  1 
ATOM   1631 N  N   . THR A 1 211 ? 11.888  35.788 4.945  1.00 25.04 ? 210 THR A N   1 
ATOM   1632 C  CA  . THR A 1 211 ? 13.234  35.458 4.451  1.00 25.10 ? 210 THR A CA  1 
ATOM   1633 C  C   . THR A 1 211 ? 13.179  34.758 3.075  1.00 25.37 ? 210 THR A C   1 
ATOM   1634 O  O   . THR A 1 211 ? 12.283  33.923 2.821  1.00 24.53 ? 210 THR A O   1 
ATOM   1635 C  CB  . THR A 1 211 ? 14.019  34.539 5.451  1.00 24.94 ? 210 THR A CB  1 
ATOM   1636 O  OG1 . THR A 1 211 ? 13.300  33.314 5.658  1.00 23.98 ? 210 THR A OG1 1 
ATOM   1637 C  CG2 . THR A 1 211 ? 14.247  35.231 6.794  1.00 23.81 ? 210 THR A CG2 1 
ATOM   1638 N  N   . GLN A 1 212 ? 14.073  35.134 2.186  1.00 25.54 ? 211 GLN A N   1 
ATOM   1639 C  CA  . GLN A 1 212 ? 14.372  34.363 0.995  1.00 26.43 ? 211 GLN A CA  1 
ATOM   1640 C  C   . GLN A 1 212 ? 14.777  32.949 1.323  1.00 27.27 ? 211 GLN A C   1 
ATOM   1641 O  O   . GLN A 1 212 ? 15.417  32.685 2.271  1.00 28.10 ? 211 GLN A O   1 
ATOM   1642 C  CB  . GLN A 1 212 ? 15.398  35.055 0.089  1.00 26.04 ? 211 GLN A CB  1 
ATOM   1643 C  CG  . GLN A 1 212 ? 15.565  34.470 -1.330 1.00 25.53 ? 211 GLN A CG  1 
ATOM   1644 C  CD  . GLN A 1 212 ? 14.288  34.486 -2.178 1.00 26.65 ? 211 GLN A CD  1 
ATOM   1645 O  OE1 . GLN A 1 212 ? 13.952  35.470 -2.754 1.00 27.74 ? 211 GLN A OE1 1 
ATOM   1646 N  NE2 . GLN A 1 212 ? 13.577  33.405 -2.203 1.00 24.79 ? 211 GLN A NE2 1 
ATOM   1647 N  N   . ASP A 1 213 ? 14.334  32.042 0.507  1.00 28.32 ? 212 ASP A N   1 
ATOM   1648 C  CA  . ASP A 1 213 ? 14.836  30.694 0.406  1.00 29.20 ? 212 ASP A CA  1 
ATOM   1649 C  C   . ASP A 1 213 ? 16.309  30.737 0.161  1.00 28.94 ? 212 ASP A C   1 
ATOM   1650 O  O   . ASP A 1 213 ? 16.741  31.358 -0.744 1.00 28.92 ? 212 ASP A O   1 
ATOM   1651 C  CB  . ASP A 1 213 ? 14.124  30.020 -0.765 1.00 29.92 ? 212 ASP A CB  1 
ATOM   1652 C  CG  . ASP A 1 213 ? 14.455  28.578 -0.898 1.00 31.61 ? 212 ASP A CG  1 
ATOM   1653 O  OD1 . ASP A 1 213 ? 15.019  27.975 0.011  1.00 33.10 ? 212 ASP A OD1 1 
ATOM   1654 O  OD2 . ASP A 1 213 ? 14.177  28.018 -1.940 1.00 33.99 ? 212 ASP A OD2 1 
ATOM   1655 N  N   . PRO A 1 214 ? 17.078  30.055 0.978  1.00 28.83 ? 213 PRO A N   1 
ATOM   1656 C  CA  . PRO A 1 214 ? 18.535  30.115 0.832  1.00 27.89 ? 213 PRO A CA  1 
ATOM   1657 C  C   . PRO A 1 214 ? 19.039  29.606 -0.507 1.00 27.09 ? 213 PRO A C   1 
ATOM   1658 O  O   . PRO A 1 214 ? 20.049  30.071 -0.933 1.00 27.03 ? 213 PRO A O   1 
ATOM   1659 C  CB  . PRO A 1 214 ? 19.049  29.304 2.006  1.00 28.22 ? 213 PRO A CB  1 
ATOM   1660 C  CG  . PRO A 1 214 ? 18.025  29.381 2.998  1.00 27.99 ? 213 PRO A CG  1 
ATOM   1661 C  CD  . PRO A 1 214 ? 16.696  29.541 2.297  1.00 28.81 ? 213 PRO A CD  1 
ATOM   1662 N  N   . ALA A 1 215 ? 18.285  28.752 -1.173 1.00 26.06 ? 214 ALA A N   1 
ATOM   1663 C  CA  . ALA A 1 215 ? 18.487  28.436 -2.579 1.00 25.12 ? 214 ALA A CA  1 
ATOM   1664 C  C   . ALA A 1 215 ? 18.118  29.448 -3.654 1.00 24.60 ? 214 ALA A C   1 
ATOM   1665 O  O   . ALA A 1 215 ? 18.482  29.327 -4.772 1.00 24.39 ? 214 ALA A O   1 
ATOM   1666 C  CB  . ALA A 1 215 ? 17.956  27.119 -2.890 1.00 24.78 ? 214 ALA A CB  1 
ATOM   1667 N  N   . LYS A 1 216 ? 17.434  30.494 -3.282 1.00 24.11 ? 215 LYS A N   1 
ATOM   1668 C  CA  . LYS A 1 216 ? 17.144  31.558 -4.246 1.00 23.59 ? 215 LYS A CA  1 
ATOM   1669 C  C   . LYS A 1 216 ? 17.915  32.853 -3.958 1.00 23.57 ? 215 LYS A C   1 
ATOM   1670 O  O   . LYS A 1 216 ? 17.933  33.795 -4.778 1.00 23.67 ? 215 LYS A O   1 
ATOM   1671 C  CB  . LYS A 1 216 ? 15.636  31.773 -4.357 1.00 23.13 ? 215 LYS A CB  1 
ATOM   1672 C  CG  . LYS A 1 216 ? 14.936  30.519 -4.857 1.00 22.37 ? 215 LYS A CG  1 
ATOM   1673 C  CD  . LYS A 1 216 ? 13.462  30.717 -5.028 1.00 21.50 ? 215 LYS A CD  1 
ATOM   1674 C  CE  . LYS A 1 216 ? 12.769  29.388 -5.202 1.00 21.85 ? 215 LYS A CE  1 
ATOM   1675 N  NZ  . LYS A 1 216 ? 11.416  29.541 -5.820 1.00 22.87 ? 215 LYS A NZ  1 
ATOM   1676 N  N   . ALA A 1 217 ? 18.574  32.867 -2.804 1.00 23.44 ? 216 ALA A N   1 
ATOM   1677 C  CA  . ALA A 1 217 ? 19.258  34.036 -2.266 1.00 23.57 ? 216 ALA A CA  1 
ATOM   1678 C  C   . ALA A 1 217 ? 20.462  34.465 -3.139 1.00 24.13 ? 216 ALA A C   1 
ATOM   1679 O  O   . ALA A 1 217 ? 21.045  33.632 -3.830 1.00 24.02 ? 216 ALA A O   1 
ATOM   1680 C  CB  . ALA A 1 217 ? 19.685  33.734 -0.824 1.00 22.85 ? 216 ALA A CB  1 
ATOM   1681 N  N   . PRO A 1 218 ? 20.822  35.766 -3.134 1.00 25.08 ? 217 PRO A N   1 
ATOM   1682 C  CA  . PRO A 1 218 ? 21.943  36.290 -3.923 1.00 26.10 ? 217 PRO A CA  1 
ATOM   1683 C  C   . PRO A 1 218 ? 23.247  35.506 -3.861 1.00 27.34 ? 217 PRO A C   1 
ATOM   1684 O  O   . PRO A 1 218 ? 23.582  34.900 -2.833 1.00 28.13 ? 217 PRO A O   1 
ATOM   1685 C  CB  . PRO A 1 218 ? 22.129  37.685 -3.345 1.00 25.98 ? 217 PRO A CB  1 
ATOM   1686 C  CG  . PRO A 1 218 ? 20.741  38.093 -3.035 1.00 25.22 ? 217 PRO A CG  1 
ATOM   1687 C  CD  . PRO A 1 218 ? 20.136  36.866 -2.427 1.00 25.39 ? 217 PRO A CD  1 
ATOM   1688 N  N   . ASN A 1 219 ? 23.970  35.516 -4.976 1.00 28.50 ? 218 ASN A N   1 
ATOM   1689 C  CA  . ASN A 1 219 ? 25.238  34.794 -5.087 1.00 29.72 ? 218 ASN A CA  1 
ATOM   1690 C  C   . ASN A 1 219 ? 26.429  35.549 -4.440 1.00 30.05 ? 218 ASN A C   1 
ATOM   1691 O  O   . ASN A 1 219 ? 27.368  34.920 -3.902 1.00 30.01 ? 218 ASN A O   1 
ATOM   1692 C  CB  . ASN A 1 219 ? 25.506  34.466 -6.561 1.00 30.33 ? 218 ASN A CB  1 
ATOM   1693 C  CG  . ASN A 1 219 ? 24.719  33.240 -7.061 1.00 32.20 ? 218 ASN A CG  1 
ATOM   1694 O  OD1 . ASN A 1 219 ? 24.221  32.413 -6.276 1.00 33.43 ? 218 ASN A OD1 1 
ATOM   1695 N  ND2 . ASN A 1 219 ? 24.642  33.104 -8.389 1.00 33.60 ? 218 ASN A ND2 1 
ATOM   1696 N  N   . THR A 1 220 ? 26.373  36.887 -4.513 1.00 30.06 ? 219 THR A N   1 
ATOM   1697 C  CA  . THR A 1 220 ? 27.295  37.803 -3.831 1.00 30.09 ? 219 THR A CA  1 
ATOM   1698 C  C   . THR A 1 220 ? 26.759  38.115 -2.425 1.00 29.60 ? 219 THR A C   1 
ATOM   1699 O  O   . THR A 1 220 ? 25.569  38.435 -2.288 1.00 29.94 ? 219 THR A O   1 
ATOM   1700 C  CB  . THR A 1 220 ? 27.381  39.172 -4.586 1.00 30.49 ? 219 THR A CB  1 
ATOM   1701 O  OG1 . THR A 1 220 ? 27.476  38.962 -6.001 1.00 31.53 ? 219 THR A OG1 1 
ATOM   1702 C  CG2 . THR A 1 220 ? 28.579  40.004 -4.124 1.00 31.24 ? 219 THR A CG2 1 
ATOM   1703 N  N   . PRO A 1 221 ? 27.630  38.076 -1.383 1.00 28.78 ? 220 PRO A N   1 
ATOM   1704 C  CA  . PRO A 1 221 ? 27.230  38.476 -0.033 1.00 27.81 ? 220 PRO A CA  1 
ATOM   1705 C  C   . PRO A 1 221 ? 27.024  39.980 0.140  1.00 26.92 ? 220 PRO A C   1 
ATOM   1706 O  O   . PRO A 1 221 ? 27.429  40.759 -0.712 1.00 26.78 ? 220 PRO A O   1 
ATOM   1707 C  CB  . PRO A 1 221 ? 28.420  38.019 0.823  1.00 27.96 ? 220 PRO A CB  1 
ATOM   1708 C  CG  . PRO A 1 221 ? 29.564  38.080 -0.077 1.00 28.09 ? 220 PRO A CG  1 
ATOM   1709 C  CD  . PRO A 1 221 ? 29.041  37.635 -1.405 1.00 28.91 ? 220 PRO A CD  1 
ATOM   1710 N  N   . ASP A 1 222 ? 26.371  40.376 1.229  1.00 25.88 ? 221 ASP A N   1 
ATOM   1711 C  CA  . ASP A 1 222 ? 26.367  41.772 1.641  1.00 25.38 ? 221 ASP A CA  1 
ATOM   1712 C  C   . ASP A 1 222 ? 27.354  41.865 2.796  1.00 24.87 ? 221 ASP A C   1 
ATOM   1713 O  O   . ASP A 1 222 ? 27.258  41.123 3.777  1.00 24.76 ? 221 ASP A O   1 
ATOM   1714 C  CB  . ASP A 1 222 ? 24.970  42.251 2.068  1.00 25.42 ? 221 ASP A CB  1 
ATOM   1715 C  CG  . ASP A 1 222 ? 24.311  43.162 1.036  1.00 26.88 ? 221 ASP A CG  1 
ATOM   1716 O  OD1 . ASP A 1 222 ? 23.327  42.742 0.387  1.00 27.92 ? 221 ASP A OD1 1 
ATOM   1717 O  OD2 . ASP A 1 222 ? 24.782  44.309 0.859  1.00 29.57 ? 221 ASP A OD2 1 
ATOM   1718 N  N   . ILE A 1 223 ? 28.342  42.737 2.669  1.00 24.02 ? 222 ILE A N   1 
ATOM   1719 C  CA  . ILE A 1 223 ? 29.263  42.876 3.765  1.00 23.16 ? 222 ILE A CA  1 
ATOM   1720 C  C   . ILE A 1 223 ? 28.997  44.206 4.462  1.00 22.40 ? 222 ILE A C   1 
ATOM   1721 O  O   . ILE A 1 223 ? 28.989  45.269 3.834  1.00 22.36 ? 222 ILE A O   1 
ATOM   1722 C  CB  . ILE A 1 223 ? 30.769  42.504 3.402  1.00 23.61 ? 222 ILE A CB  1 
ATOM   1723 C  CG1 . ILE A 1 223 ? 31.716  43.701 3.437  1.00 23.31 ? 222 ILE A CG1 1 
ATOM   1724 C  CG2 . ILE A 1 223 ? 30.876  41.662 2.113  1.00 23.14 ? 222 ILE A CG2 1 
ATOM   1725 C  CD1 . ILE A 1 223 ? 32.441  43.846 4.769  1.00 24.57 ? 222 ILE A CD1 1 
ATOM   1726 N  N   . LEU A 1 224 ? 28.701  44.110 5.754  1.00 21.31 ? 223 LEU A N   1 
ATOM   1727 C  CA  . LEU A 1 224 ? 28.279  45.236 6.557  1.00 20.39 ? 223 LEU A CA  1 
ATOM   1728 C  C   . LEU A 1 224 ? 29.250  45.461 7.687  1.00 20.02 ? 223 LEU A C   1 
ATOM   1729 O  O   . LEU A 1 224 ? 29.928  44.537 8.149  1.00 20.07 ? 223 LEU A O   1 
ATOM   1730 C  CB  . LEU A 1 224 ? 26.878  45.013 7.129  1.00 20.58 ? 223 LEU A CB  1 
ATOM   1731 C  CG  . LEU A 1 224 ? 25.769  44.421 6.247  1.00 20.55 ? 223 LEU A CG  1 
ATOM   1732 C  CD1 . LEU A 1 224 ? 24.613  43.927 7.123  1.00 20.59 ? 223 LEU A CD1 1 
ATOM   1733 C  CD2 . LEU A 1 224 ? 25.272  45.388 5.198  1.00 18.20 ? 223 LEU A CD2 1 
ATOM   1734 N  N   . GLU A 1 225 ? 29.339  46.716 8.100  1.00 19.37 ? 224 GLU A N   1 
ATOM   1735 C  CA  . GLU A 1 225 ? 30.088  47.068 9.275  1.00 18.56 ? 224 GLU A CA  1 
ATOM   1736 C  C   . GLU A 1 225 ? 29.083  47.576 10.298 1.00 17.45 ? 224 GLU A C   1 
ATOM   1737 O  O   . GLU A 1 225 ? 28.362  48.549 10.029 1.00 17.19 ? 224 GLU A O   1 
ATOM   1738 C  CB  . GLU A 1 225 ? 31.115  48.145 8.960  1.00 19.02 ? 224 GLU A CB  1 
ATOM   1739 C  CG  . GLU A 1 225 ? 32.151  48.321 10.062 1.00 21.27 ? 224 GLU A CG  1 
ATOM   1740 C  CD  . GLU A 1 225 ? 33.154  49.408 9.739  1.00 25.95 ? 224 GLU A CD  1 
ATOM   1741 O  OE1 . GLU A 1 225 ? 32.784  50.617 9.860  1.00 27.78 ? 224 GLU A OE1 1 
ATOM   1742 O  OE2 . GLU A 1 225 ? 34.308  49.048 9.381  1.00 25.68 ? 224 GLU A OE2 1 
ATOM   1743 N  N   . ILE A 1 226 ? 29.017  46.903 11.453 1.00 15.50 ? 225 ILE A N   1 
ATOM   1744 C  CA  . ILE A 1 226 ? 28.081  47.302 12.508 1.00 13.49 ? 225 ILE A CA  1 
ATOM   1745 C  C   . ILE A 1 226 ? 28.822  47.890 13.699 1.00 13.61 ? 225 ILE A C   1 
ATOM   1746 O  O   . ILE A 1 226 ? 29.756  47.281 14.238 1.00 12.46 ? 225 ILE A O   1 
ATOM   1747 C  CB  . ILE A 1 226 ? 27.135  46.142 12.951 1.00 13.06 ? 225 ILE A CB  1 
ATOM   1748 C  CG1 . ILE A 1 226 ? 26.562  45.433 11.725 1.00 10.82 ? 225 ILE A CG1 1 
ATOM   1749 C  CG2 . ILE A 1 226 ? 25.988  46.700 13.807 1.00 12.68 ? 225 ILE A CG2 1 
ATOM   1750 C  CD1 . ILE A 1 226 ? 25.745  44.191 12.008 1.00 12.51 ? 225 ILE A CD1 1 
ATOM   1751 N  N   . GLU A 1 227 ? 28.409  49.096 14.086 1.00 13.69 ? 226 GLU A N   1 
ATOM   1752 C  CA  . GLU A 1 227 ? 29.013  49.788 15.198 1.00 14.53 ? 226 GLU A CA  1 
ATOM   1753 C  C   . GLU A 1 227 ? 28.078  49.711 16.407 1.00 14.66 ? 226 GLU A C   1 
ATOM   1754 O  O   . GLU A 1 227 ? 26.858  49.867 16.281 1.00 14.17 ? 226 GLU A O   1 
ATOM   1755 C  CB  . GLU A 1 227 ? 29.403  51.241 14.844 1.00 13.93 ? 226 GLU A CB  1 
ATOM   1756 C  CG  . GLU A 1 227 ? 30.266  51.910 15.905 1.00 14.84 ? 226 GLU A CG  1 
ATOM   1757 C  CD  . GLU A 1 227 ? 30.664  53.351 15.592 1.00 17.31 ? 226 GLU A CD  1 
ATOM   1758 O  OE1 . GLU A 1 227 ? 31.003  54.094 16.552 1.00 18.39 ? 226 GLU A OE1 1 
ATOM   1759 O  OE2 . GLU A 1 227 ? 30.649  53.753 14.393 1.00 22.91 ? 226 GLU A OE2 1 
ATOM   1760 N  N   . PHE A 1 228 ? 28.688  49.420 17.561 1.00 15.01 ? 227 PHE A N   1 
ATOM   1761 C  CA  . PHE A 1 228 ? 28.018  49.316 18.832 1.00 15.38 ? 227 PHE A CA  1 
ATOM   1762 C  C   . PHE A 1 228 ? 28.521  50.392 19.759 1.00 16.56 ? 227 PHE A C   1 
ATOM   1763 O  O   . PHE A 1 228 ? 29.658  50.887 19.626 1.00 16.92 ? 227 PHE A O   1 
ATOM   1764 C  CB  . PHE A 1 228 ? 28.292  47.938 19.455 1.00 15.64 ? 227 PHE A CB  1 
ATOM   1765 C  CG  . PHE A 1 228 ? 27.638  46.788 18.693 1.00 14.17 ? 227 PHE A CG  1 
ATOM   1766 C  CD1 . PHE A 1 228 ? 28.225  46.285 17.512 1.00 12.84 ? 227 PHE A CD1 1 
ATOM   1767 C  CD2 . PHE A 1 228 ? 26.435  46.244 19.140 1.00 8.97  ? 227 PHE A CD2 1 
ATOM   1768 C  CE1 . PHE A 1 228 ? 27.619  45.239 16.812 1.00 13.90 ? 227 PHE A CE1 1 
ATOM   1769 C  CE2 . PHE A 1 228 ? 25.822  45.207 18.460 1.00 10.46 ? 227 PHE A CE2 1 
ATOM   1770 C  CZ  . PHE A 1 228 ? 26.398  44.702 17.293 1.00 13.27 ? 227 PHE A CZ  1 
ATOM   1771 N  N   . LYS A 1 229 ? 27.650  50.779 20.681 1.00 17.30 ? 228 LYS A N   1 
ATOM   1772 C  CA  . LYS A 1 229 ? 28.041  51.591 21.827 1.00 17.84 ? 228 LYS A CA  1 
ATOM   1773 C  C   . LYS A 1 229 ? 27.118  51.225 22.947 1.00 17.75 ? 228 LYS A C   1 
ATOM   1774 O  O   . LYS A 1 229 ? 25.885  51.233 22.753 1.00 17.55 ? 228 LYS A O   1 
ATOM   1775 C  CB  . LYS A 1 229 ? 27.937  53.091 21.541 1.00 18.28 ? 228 LYS A CB  1 
ATOM   1776 C  CG  . LYS A 1 229 ? 28.481  53.911 22.676 1.00 20.29 ? 228 LYS A CG  1 
ATOM   1777 C  CD  . LYS A 1 229 ? 29.156  55.147 22.205 1.00 24.47 ? 228 LYS A CD  1 
ATOM   1778 C  CE  . LYS A 1 229 ? 29.850  55.818 23.373 1.00 27.71 ? 228 LYS A CE  1 
ATOM   1779 N  NZ  . LYS A 1 229 ? 31.263  55.351 23.508 1.00 30.10 ? 228 LYS A NZ  1 
ATOM   1780 N  N   . LYS A 1 230 ? 27.705  50.897 24.106 1.00 17.48 ? 229 LYS A N   1 
ATOM   1781 C  CA  . LYS A 1 230 ? 26.936  50.491 25.287 1.00 17.43 ? 229 LYS A CA  1 
ATOM   1782 C  C   . LYS A 1 230 ? 26.116  49.223 24.990 1.00 16.18 ? 229 LYS A C   1 
ATOM   1783 O  O   . LYS A 1 230 ? 24.985  49.074 25.467 1.00 15.95 ? 229 LYS A O   1 
ATOM   1784 C  CB  . LYS A 1 230 ? 26.015  51.629 25.748 1.00 17.26 ? 229 LYS A CB  1 
ATOM   1785 C  CG  . LYS A 1 230 ? 26.740  52.903 26.239 1.00 19.42 ? 229 LYS A CG  1 
ATOM   1786 C  CD  . LYS A 1 230 ? 25.724  54.002 26.599 1.00 20.05 ? 229 LYS A CD  1 
ATOM   1787 C  CE  . LYS A 1 230 ? 26.332  55.027 27.547 1.00 23.78 ? 229 LYS A CE  1 
ATOM   1788 N  NZ  . LYS A 1 230 ? 26.912  54.377 28.775 1.00 26.97 ? 229 LYS A NZ  1 
ATOM   1789 N  N   . GLY A 1 231 ? 26.677  48.338 24.167 1.00 15.29 ? 230 GLY A N   1 
ATOM   1790 C  CA  . GLY A 1 231 ? 26.070  47.029 23.877 1.00 14.23 ? 230 GLY A CA  1 
ATOM   1791 C  C   . GLY A 1 231 ? 24.972  46.953 22.828 1.00 13.36 ? 230 GLY A C   1 
ATOM   1792 O  O   . GLY A 1 231 ? 24.416  45.883 22.583 1.00 12.75 ? 230 GLY A O   1 
ATOM   1793 N  N   . VAL A 1 232 ? 24.665  48.085 22.199 1.00 13.27 ? 231 VAL A N   1 
ATOM   1794 C  CA  . VAL A 1 232 ? 23.561  48.188 21.223 1.00 12.56 ? 231 VAL A CA  1 
ATOM   1795 C  C   . VAL A 1 232 ? 24.071  48.854 19.928 1.00 12.26 ? 231 VAL A C   1 
ATOM   1796 O  O   . VAL A 1 232 ? 24.958  49.711 19.986 1.00 12.30 ? 231 VAL A O   1 
ATOM   1797 C  CB  . VAL A 1 232 ? 22.338  48.985 21.810 1.00 12.51 ? 231 VAL A CB  1 
ATOM   1798 C  CG1 . VAL A 1 232 ? 21.775  48.301 23.062 1.00 12.24 ? 231 VAL A CG1 1 
ATOM   1799 C  CG2 . VAL A 1 232 ? 22.708  50.456 22.126 1.00 11.90 ? 231 VAL A CG2 1 
ATOM   1800 N  N   . PRO A 1 233 ? 23.504  48.479 18.765 1.00 12.17 ? 232 PRO A N   1 
ATOM   1801 C  CA  . PRO A 1 233 ? 23.995  49.008 17.496 1.00 12.17 ? 232 PRO A CA  1 
ATOM   1802 C  C   . PRO A 1 233 ? 23.615  50.462 17.326 1.00 12.78 ? 232 PRO A C   1 
ATOM   1803 O  O   . PRO A 1 233 ? 22.486  50.865 17.627 1.00 13.61 ? 232 PRO A O   1 
ATOM   1804 C  CB  . PRO A 1 233 ? 23.272  48.158 16.449 1.00 12.87 ? 232 PRO A CB  1 
ATOM   1805 C  CG  . PRO A 1 233 ? 22.085  47.568 17.172 1.00 11.72 ? 232 PRO A CG  1 
ATOM   1806 C  CD  . PRO A 1 233 ? 22.369  47.548 18.597 1.00 11.61 ? 232 PRO A CD  1 
ATOM   1807 N  N   . VAL A 1 234 ? 24.571  51.255 16.873 1.00 12.99 ? 233 VAL A N   1 
ATOM   1808 C  CA  . VAL A 1 234 ? 24.352  52.669 16.649 1.00 12.61 ? 233 VAL A CA  1 
ATOM   1809 C  C   . VAL A 1 234 ? 24.583  53.021 15.178 1.00 12.75 ? 233 VAL A C   1 
ATOM   1810 O  O   . VAL A 1 234 ? 24.115  54.049 14.708 1.00 12.60 ? 233 VAL A O   1 
ATOM   1811 C  CB  . VAL A 1 234 ? 25.235  53.539 17.582 1.00 12.78 ? 233 VAL A CB  1 
ATOM   1812 C  CG1 . VAL A 1 234 ? 24.812  53.376 19.054 1.00 10.78 ? 233 VAL A CG1 1 
ATOM   1813 C  CG2 . VAL A 1 234 ? 26.731  53.234 17.380 1.00 12.78 ? 233 VAL A CG2 1 
ATOM   1814 N  N   . LYS A 1 235 ? 25.299  52.167 14.452 1.00 13.20 ? 234 LYS A N   1 
ATOM   1815 C  CA  . LYS A 1 235 ? 25.577  52.427 13.040 1.00 14.43 ? 234 LYS A CA  1 
ATOM   1816 C  C   . LYS A 1 235 ? 25.638  51.152 12.246 1.00 14.71 ? 234 LYS A C   1 
ATOM   1817 O  O   . LYS A 1 235 ? 26.184  50.151 12.703 1.00 15.40 ? 234 LYS A O   1 
ATOM   1818 C  CB  . LYS A 1 235 ? 26.859  53.253 12.827 1.00 14.17 ? 234 LYS A CB  1 
ATOM   1819 C  CG  . LYS A 1 235 ? 26.966  53.837 11.413 1.00 16.92 ? 234 LYS A CG  1 
ATOM   1820 C  CD  . LYS A 1 235 ? 27.487  55.261 11.392 1.00 20.30 ? 234 LYS A CD  1 
ATOM   1821 C  CE  . LYS A 1 235 ? 28.967  55.320 11.061 1.00 23.63 ? 234 LYS A CE  1 
ATOM   1822 N  NZ  . LYS A 1 235 ? 29.477  56.741 11.141 1.00 26.43 ? 234 LYS A NZ  1 
ATOM   1823 N  N   . VAL A 1 236 ? 25.042  51.197 11.059 1.00 14.81 ? 235 VAL A N   1 
ATOM   1824 C  CA  . VAL A 1 236 ? 25.210  50.154 10.065 1.00 14.94 ? 235 VAL A CA  1 
ATOM   1825 C  C   . VAL A 1 236 ? 25.638  50.811 8.750  1.00 15.77 ? 235 VAL A C   1 
ATOM   1826 O  O   . VAL A 1 236 ? 25.000  51.748 8.260  1.00 15.71 ? 235 VAL A O   1 
ATOM   1827 C  CB  . VAL A 1 236 ? 23.928  49.308 9.890  1.00 14.46 ? 235 VAL A CB  1 
ATOM   1828 C  CG1 . VAL A 1 236 ? 24.079  48.339 8.749  1.00 13.40 ? 235 VAL A CG1 1 
ATOM   1829 C  CG2 . VAL A 1 236 ? 23.614  48.546 11.185 1.00 14.51 ? 235 VAL A CG2 1 
ATOM   1830 N  N   . THR A 1 237 ? 26.758  50.347 8.207  1.00 16.85 ? 236 THR A N   1 
ATOM   1831 C  CA  . THR A 1 237 ? 27.186  50.765 6.875  1.00 17.52 ? 236 THR A CA  1 
ATOM   1832 C  C   . THR A 1 237 ? 27.494  49.575 5.962  1.00 17.99 ? 236 THR A C   1 
ATOM   1833 O  O   . THR A 1 237 ? 28.151  48.603 6.363  1.00 17.05 ? 236 THR A O   1 
ATOM   1834 C  CB  . THR A 1 237 ? 28.277  51.908 6.913  1.00 17.93 ? 236 THR A CB  1 
ATOM   1835 O  OG1 . THR A 1 237 ? 29.369  51.620 6.021  1.00 19.72 ? 236 THR A OG1 1 
ATOM   1836 C  CG2 . THR A 1 237 ? 28.807  52.125 8.306  1.00 16.92 ? 236 THR A CG2 1 
ATOM   1837 N  N   . ASN A 1 238 ? 26.948  49.630 4.747  1.00 19.26 ? 237 ASN A N   1 
ATOM   1838 C  CA  . ASN A 1 238 ? 27.265  48.626 3.732  1.00 20.78 ? 237 ASN A CA  1 
ATOM   1839 C  C   . ASN A 1 238 ? 28.632  48.965 3.158  1.00 22.30 ? 237 ASN A C   1 
ATOM   1840 O  O   . ASN A 1 238 ? 28.837  50.081 2.656  1.00 22.40 ? 237 ASN A O   1 
ATOM   1841 C  CB  . ASN A 1 238 ? 26.216  48.609 2.617  1.00 20.51 ? 237 ASN A CB  1 
ATOM   1842 C  CG  . ASN A 1 238 ? 26.271  47.352 1.788  1.00 19.61 ? 237 ASN A CG  1 
ATOM   1843 O  OD1 . ASN A 1 238 ? 27.294  47.037 1.150  1.00 20.36 ? 237 ASN A OD1 1 
ATOM   1844 N  ND2 . ASN A 1 238 ? 25.177  46.609 1.798  1.00 17.07 ? 237 ASN A ND2 1 
ATOM   1845 N  N   . VAL A 1 239 ? 29.569  48.020 3.262  1.00 23.82 ? 238 VAL A N   1 
ATOM   1846 C  CA  . VAL A 1 239 ? 30.957  48.254 2.836  1.00 25.24 ? 238 VAL A CA  1 
ATOM   1847 C  C   . VAL A 1 239 ? 31.082  48.503 1.330  1.00 26.27 ? 238 VAL A C   1 
ATOM   1848 O  O   . VAL A 1 239 ? 31.872  49.349 0.905  1.00 26.13 ? 238 VAL A O   1 
ATOM   1849 C  CB  . VAL A 1 239 ? 31.899  47.131 3.331  1.00 25.19 ? 238 VAL A CB  1 
ATOM   1850 C  CG1 . VAL A 1 239 ? 33.211  47.112 2.579  1.00 25.24 ? 238 VAL A CG1 1 
ATOM   1851 C  CG2 . VAL A 1 239 ? 32.166  47.299 4.835  1.00 26.15 ? 238 VAL A CG2 1 
ATOM   1852 N  N   . LYS A 1 240 ? 30.288  47.777 0.541  1.00 28.04 ? 239 LYS A N   1 
ATOM   1853 C  CA  . LYS A 1 240 ? 30.275  47.927 -0.914 1.00 29.29 ? 239 LYS A CA  1 
ATOM   1854 C  C   . LYS A 1 240 ? 29.538  49.188 -1.317 1.00 29.61 ? 239 LYS A C   1 
ATOM   1855 O  O   . LYS A 1 240 ? 30.169  50.183 -1.654 1.00 30.00 ? 239 LYS A O   1 
ATOM   1856 C  CB  . LYS A 1 240 ? 29.629  46.725 -1.602 1.00 29.49 ? 239 LYS A CB  1 
ATOM   1857 C  CG  . LYS A 1 240 ? 30.511  45.493 -1.723 1.00 32.37 ? 239 LYS A CG  1 
ATOM   1858 C  CD  . LYS A 1 240 ? 30.339  44.854 -3.112 1.00 36.97 ? 239 LYS A CD  1 
ATOM   1859 C  CE  . LYS A 1 240 ? 30.940  43.443 -3.195 1.00 39.49 ? 239 LYS A CE  1 
ATOM   1860 N  NZ  . LYS A 1 240 ? 30.039  42.406 -2.561 1.00 41.63 ? 239 LYS A NZ  1 
ATOM   1861 N  N   . ASP A 1 241 ? 28.207  49.150 -1.246 1.00 30.13 ? 240 ASP A N   1 
ATOM   1862 C  CA  . ASP A 1 241 ? 27.360  50.199 -1.849 1.00 30.36 ? 240 ASP A CA  1 
ATOM   1863 C  C   . ASP A 1 241 ? 27.226  51.514 -1.075 1.00 29.87 ? 240 ASP A C   1 
ATOM   1864 O  O   . ASP A 1 241 ? 26.624  52.465 -1.577 1.00 29.83 ? 240 ASP A O   1 
ATOM   1865 C  CB  . ASP A 1 241 ? 25.983  49.639 -2.256 1.00 30.56 ? 240 ASP A CB  1 
ATOM   1866 C  CG  . ASP A 1 241 ? 25.113  49.281 -1.068 1.00 31.55 ? 240 ASP A CG  1 
ATOM   1867 O  OD1 . ASP A 1 241 ? 24.944  50.137 -0.169 1.00 32.79 ? 240 ASP A OD1 1 
ATOM   1868 O  OD2 . ASP A 1 241 ? 24.575  48.150 -1.048 1.00 31.51 ? 240 ASP A OD2 1 
ATOM   1869 N  N   . GLY A 1 242 ? 27.781  51.565 0.136  1.00 29.50 ? 241 GLY A N   1 
ATOM   1870 C  CA  . GLY A 1 242 ? 27.878  52.818 0.892  1.00 28.36 ? 241 GLY A CA  1 
ATOM   1871 C  C   . GLY A 1 242 ? 26.689  53.249 1.734  1.00 27.49 ? 241 GLY A C   1 
ATOM   1872 O  O   . GLY A 1 242 ? 26.769  54.260 2.438  1.00 27.82 ? 241 GLY A O   1 
ATOM   1873 N  N   . THR A 1 243 ? 25.590  52.498 1.671  1.00 26.65 ? 242 THR A N   1 
ATOM   1874 C  CA  . THR A 1 243 ? 24.384  52.779 2.473  1.00 25.57 ? 242 THR A CA  1 
ATOM   1875 C  C   . THR A 1 243 ? 24.703  52.904 3.968  1.00 25.03 ? 242 THR A C   1 
ATOM   1876 O  O   . THR A 1 243 ? 25.429  52.086 4.540  1.00 24.77 ? 242 THR A O   1 
ATOM   1877 C  CB  . THR A 1 243 ? 23.303  51.686 2.260  1.00 25.96 ? 242 THR A CB  1 
ATOM   1878 O  OG1 . THR A 1 243 ? 23.149  51.431 0.851  1.00 26.42 ? 242 THR A OG1 1 
ATOM   1879 C  CG2 . THR A 1 243 ? 21.960  52.106 2.852  1.00 24.39 ? 242 THR A CG2 1 
ATOM   1880 N  N   . THR A 1 244 ? 24.176  53.944 4.598  1.00 24.58 ? 243 THR A N   1 
ATOM   1881 C  CA  . THR A 1 244 ? 24.450  54.167 6.007  1.00 23.88 ? 243 THR A CA  1 
ATOM   1882 C  C   . THR A 1 244 ? 23.190  54.535 6.798  1.00 23.25 ? 243 THR A C   1 
ATOM   1883 O  O   . THR A 1 244 ? 22.365  55.355 6.355  1.00 22.55 ? 243 THR A O   1 
ATOM   1884 C  CB  . THR A 1 244 ? 25.610  55.191 6.218  1.00 23.93 ? 243 THR A CB  1 
ATOM   1885 O  OG1 . THR A 1 244 ? 25.914  55.311 7.618  1.00 24.37 ? 243 THR A OG1 1 
ATOM   1886 C  CG2 . THR A 1 244 ? 25.254  56.554 5.669  1.00 24.95 ? 243 THR A CG2 1 
ATOM   1887 N  N   . HIS A 1 245 ? 23.050  53.906 7.962  1.00 22.17 ? 244 HIS A N   1 
ATOM   1888 C  CA  . HIS A 1 245 ? 21.972  54.224 8.890  1.00 21.98 ? 244 HIS A CA  1 
ATOM   1889 C  C   . HIS A 1 245 ? 22.515  54.399 10.312 1.00 21.59 ? 244 HIS A C   1 
ATOM   1890 O  O   . HIS A 1 245 ? 23.159  53.508 10.847 1.00 20.69 ? 244 HIS A O   1 
ATOM   1891 C  CB  . HIS A 1 245 ? 20.871  53.157 8.821  1.00 21.93 ? 244 HIS A CB  1 
ATOM   1892 C  CG  . HIS A 1 245 ? 20.332  52.933 7.436  1.00 21.83 ? 244 HIS A CG  1 
ATOM   1893 N  ND1 . HIS A 1 245 ? 20.838  51.972 6.587  1.00 21.94 ? 244 HIS A ND1 1 
ATOM   1894 C  CD2 . HIS A 1 245 ? 19.358  53.572 6.741  1.00 20.00 ? 244 HIS A CD2 1 
ATOM   1895 C  CE1 . HIS A 1 245 ? 20.181  52.012 5.442  1.00 21.59 ? 244 HIS A CE1 1 
ATOM   1896 N  NE2 . HIS A 1 245 ? 19.276  52.973 5.510  1.00 19.97 ? 244 HIS A NE2 1 
ATOM   1897 N  N   . GLN A 1 246 ? 22.277  55.573 10.896 1.00 21.87 ? 245 GLN A N   1 
ATOM   1898 C  CA  . GLN A 1 246 ? 22.819  55.901 12.210 1.00 21.98 ? 245 GLN A CA  1 
ATOM   1899 C  C   . GLN A 1 246 ? 21.759  56.257 13.237 1.00 21.48 ? 245 GLN A C   1 
ATOM   1900 O  O   . GLN A 1 246 ? 22.069  56.892 14.254 1.00 21.77 ? 245 GLN A O   1 
ATOM   1901 C  CB  . GLN A 1 246 ? 23.946  56.962 12.166 1.00 23.01 ? 245 GLN A CB  1 
ATOM   1902 C  CG  . GLN A 1 246 ? 23.638  58.330 11.544 1.00 25.84 ? 245 GLN A CG  1 
ATOM   1903 C  CD  . GLN A 1 246 ? 23.899  58.369 10.031 1.00 30.64 ? 245 GLN A CD  1 
ATOM   1904 O  OE1 . GLN A 1 246 ? 24.499  57.445 9.456  1.00 30.96 ? 245 GLN A OE1 1 
ATOM   1905 N  NE2 . GLN A 1 246 ? 23.434  59.442 9.379  1.00 32.37 ? 245 GLN A NE2 1 
ATOM   1906 N  N   . THR A 1 247 ? 20.523  55.825 12.973 1.00 19.98 ? 246 THR A N   1 
ATOM   1907 C  CA  . THR A 1 247 ? 19.439  55.890 13.945 1.00 18.60 ? 246 THR A CA  1 
ATOM   1908 C  C   . THR A 1 247 ? 18.827  54.496 14.095 1.00 17.85 ? 246 THR A C   1 
ATOM   1909 O  O   . THR A 1 247 ? 18.790  53.730 13.130 1.00 18.03 ? 246 THR A O   1 
ATOM   1910 C  CB  . THR A 1 247 ? 18.346  56.926 13.553 1.00 18.85 ? 246 THR A CB  1 
ATOM   1911 O  OG1 . THR A 1 247 ? 17.781  56.588 12.276 1.00 18.70 ? 246 THR A OG1 1 
ATOM   1912 C  CG2 . THR A 1 247 ? 18.923  58.350 13.520 1.00 18.00 ? 246 THR A CG2 1 
ATOM   1913 N  N   . SER A 1 248 ? 18.335  54.204 15.300 1.00 16.72 ? 247 SER A N   1 
ATOM   1914 C  CA  . SER A 1 248 ? 17.936  52.859 15.763 1.00 15.84 ? 247 SER A CA  1 
ATOM   1915 C  C   . SER A 1 248 ? 16.956  52.112 14.894 1.00 14.85 ? 247 SER A C   1 
ATOM   1916 O  O   . SER A 1 248 ? 17.258  51.026 14.454 1.00 14.02 ? 247 SER A O   1 
ATOM   1917 C  CB  . SER A 1 248 ? 17.360  52.928 17.184 1.00 15.68 ? 247 SER A CB  1 
ATOM   1918 O  OG  . SER A 1 248 ? 16.248  53.814 17.205 1.00 17.60 ? 247 SER A OG  1 
ATOM   1919 N  N   . LEU A 1 249 ? 15.767  52.674 14.674 1.00 15.65 ? 248 LEU A N   1 
ATOM   1920 C  CA  . LEU A 1 249 ? 14.711  51.975 13.907 1.00 15.33 ? 248 LEU A CA  1 
ATOM   1921 C  C   . LEU A 1 249 ? 15.127  51.738 12.457 1.00 15.54 ? 248 LEU A C   1 
ATOM   1922 O  O   . LEU A 1 249 ? 14.899  50.648 11.908 1.00 15.09 ? 248 LEU A O   1 
ATOM   1923 C  CB  . LEU A 1 249 ? 13.373  52.711 13.984 1.00 14.83 ? 248 LEU A CB  1 
ATOM   1924 C  CG  . LEU A 1 249 ? 12.141  52.199 13.212 1.00 15.80 ? 248 LEU A CG  1 
ATOM   1925 C  CD1 . LEU A 1 249 ? 11.819  50.728 13.499 1.00 13.49 ? 248 LEU A CD1 1 
ATOM   1926 C  CD2 . LEU A 1 249 ? 10.893  53.089 13.470 1.00 15.11 ? 248 LEU A CD2 1 
ATOM   1927 N  N   . GLU A 1 250 ? 15.753  52.758 11.868 1.00 15.95 ? 249 GLU A N   1 
ATOM   1928 C  CA  . GLU A 1 250 ? 16.149  52.749 10.459 1.00 16.86 ? 249 GLU A CA  1 
ATOM   1929 C  C   . GLU A 1 250 ? 17.256  51.692 10.181 1.00 15.91 ? 249 GLU A C   1 
ATOM   1930 O  O   . GLU A 1 250 ? 17.185  50.983 9.142  1.00 16.01 ? 249 GLU A O   1 
ATOM   1931 C  CB  . GLU A 1 250 ? 16.512  54.181 9.953  1.00 16.71 ? 249 GLU A CB  1 
ATOM   1932 C  CG  . GLU A 1 250 ? 17.474  54.222 8.734  1.00 19.24 ? 249 GLU A CG  1 
ATOM   1933 C  CD  . GLU A 1 250 ? 18.099  55.611 8.370  1.00 19.29 ? 249 GLU A CD  1 
ATOM   1934 O  OE1 . GLU A 1 250 ? 18.903  56.182 9.143  1.00 23.18 ? 249 GLU A OE1 1 
ATOM   1935 O  OE2 . GLU A 1 250 ? 17.814  56.106 7.265  1.00 21.93 ? 249 GLU A OE2 1 
ATOM   1936 N  N   . LEU A 1 251 ? 18.246  51.581 11.086 1.00 14.55 ? 250 LEU A N   1 
ATOM   1937 C  CA  . LEU A 1 251 ? 19.306  50.557 10.946 1.00 14.14 ? 250 LEU A CA  1 
ATOM   1938 C  C   . LEU A 1 251 ? 18.762  49.144 11.144 1.00 13.97 ? 250 LEU A C   1 
ATOM   1939 O  O   . LEU A 1 251 ? 19.115  48.220 10.410 1.00 13.80 ? 250 LEU A O   1 
ATOM   1940 C  CB  . LEU A 1 251 ? 20.526  50.825 11.850 1.00 13.98 ? 250 LEU A CB  1 
ATOM   1941 C  CG  . LEU A 1 251 ? 20.478  50.828 13.379 1.00 13.90 ? 250 LEU A CG  1 
ATOM   1942 C  CD1 . LEU A 1 251 ? 20.631  49.425 13.934 1.00 14.63 ? 250 LEU A CD1 1 
ATOM   1943 C  CD2 . LEU A 1 251 ? 21.579  51.721 13.940 1.00 14.11 ? 250 LEU A CD2 1 
ATOM   1944 N  N   . PHE A 1 252 ? 17.866  48.998 12.110 1.00 14.09 ? 251 PHE A N   1 
ATOM   1945 C  CA  . PHE A 1 252 ? 17.196  47.731 12.349 1.00 14.99 ? 251 PHE A CA  1 
ATOM   1946 C  C   . PHE A 1 252 ? 16.410  47.221 11.116 1.00 15.30 ? 251 PHE A C   1 
ATOM   1947 O  O   . PHE A 1 252 ? 16.593  46.076 10.703 1.00 14.79 ? 251 PHE A O   1 
ATOM   1948 C  CB  . PHE A 1 252 ? 16.331  47.808 13.619 1.00 14.78 ? 251 PHE A CB  1 
ATOM   1949 C  CG  . PHE A 1 252 ? 15.946  46.463 14.152 1.00 14.99 ? 251 PHE A CG  1 
ATOM   1950 C  CD1 . PHE A 1 252 ? 16.807  45.768 14.999 1.00 14.41 ? 251 PHE A CD1 1 
ATOM   1951 C  CD2 . PHE A 1 252 ? 14.732  45.874 13.789 1.00 14.55 ? 251 PHE A CD2 1 
ATOM   1952 C  CE1 . PHE A 1 252 ? 16.471  44.520 15.478 1.00 14.80 ? 251 PHE A CE1 1 
ATOM   1953 C  CE2 . PHE A 1 252 ? 14.380  44.615 14.269 1.00 14.58 ? 251 PHE A CE2 1 
ATOM   1954 C  CZ  . PHE A 1 252 ? 15.242  43.936 15.107 1.00 14.89 ? 251 PHE A CZ  1 
ATOM   1955 N  N   . MET A 1 253 ? 15.579  48.076 10.517 1.00 16.08 ? 252 MET A N   1 
ATOM   1956 C  CA  . MET A 1 253 ? 14.817  47.720 9.307  1.00 18.06 ? 252 MET A CA  1 
ATOM   1957 C  C   . MET A 1 253 ? 15.731  47.405 8.134  1.00 17.11 ? 252 MET A C   1 
ATOM   1958 O  O   . MET A 1 253 ? 15.460  46.476 7.387  1.00 16.94 ? 252 MET A O   1 
ATOM   1959 C  CB  . MET A 1 253 ? 13.804  48.815 8.896  1.00 17.96 ? 252 MET A CB  1 
ATOM   1960 C  CG  . MET A 1 253 ? 12.802  49.207 9.971  1.00 19.45 ? 252 MET A CG  1 
ATOM   1961 S  SD  . MET A 1 253 ? 11.833  50.697 9.562  1.00 22.74 ? 252 MET A SD  1 
ATOM   1962 C  CE  . MET A 1 253 ? 10.581  49.950 8.508  1.00 25.04 ? 252 MET A CE  1 
ATOM   1963 N  N   . TYR A 1 254 ? 16.814  48.168 7.974  1.00 17.28 ? 253 TYR A N   1 
ATOM   1964 C  CA  . TYR A 1 254 ? 17.796  47.868 6.935  1.00 17.23 ? 253 TYR A CA  1 
ATOM   1965 C  C   . TYR A 1 254 ? 18.470  46.518 7.124  1.00 17.41 ? 253 TYR A C   1 
ATOM   1966 O  O   . TYR A 1 254 ? 18.781  45.816 6.135  1.00 17.87 ? 253 TYR A O   1 
ATOM   1967 C  CB  . TYR A 1 254 ? 18.866  48.944 6.857  1.00 17.98 ? 253 TYR A CB  1 
ATOM   1968 C  CG  . TYR A 1 254 ? 19.928  48.631 5.834  1.00 17.74 ? 253 TYR A CG  1 
ATOM   1969 C  CD1 . TYR A 1 254 ? 19.622  48.619 4.465  1.00 17.09 ? 253 TYR A CD1 1 
ATOM   1970 C  CD2 . TYR A 1 254 ? 21.229  48.345 6.224  1.00 17.69 ? 253 TYR A CD2 1 
ATOM   1971 C  CE1 . TYR A 1 254 ? 20.587  48.326 3.511  1.00 17.09 ? 253 TYR A CE1 1 
ATOM   1972 C  CE2 . TYR A 1 254 ? 22.215  48.044 5.271  1.00 19.09 ? 253 TYR A CE2 1 
ATOM   1973 C  CZ  . TYR A 1 254 ? 21.890  48.048 3.914  1.00 18.51 ? 253 TYR A CZ  1 
ATOM   1974 O  OH  . TYR A 1 254 ? 22.867  47.760 2.968  1.00 19.43 ? 253 TYR A OH  1 
ATOM   1975 N  N   . LEU A 1 255 ? 18.718  46.161 8.385  1.00 16.90 ? 254 LEU A N   1 
ATOM   1976 C  CA  . LEU A 1 255 ? 19.231  44.831 8.718  1.00 16.40 ? 254 LEU A CA  1 
ATOM   1977 C  C   . LEU A 1 255 ? 18.192  43.723 8.508  1.00 16.74 ? 254 LEU A C   1 
ATOM   1978 O  O   . LEU A 1 255 ? 18.564  42.609 8.171  1.00 17.04 ? 254 LEU A O   1 
ATOM   1979 C  CB  . LEU A 1 255 ? 19.784  44.799 10.147 1.00 16.19 ? 254 LEU A CB  1 
ATOM   1980 C  CG  . LEU A 1 255 ? 21.096  45.535 10.418 1.00 15.38 ? 254 LEU A CG  1 
ATOM   1981 C  CD1 . LEU A 1 255 ? 21.379  45.556 11.918 1.00 14.93 ? 254 LEU A CD1 1 
ATOM   1982 C  CD2 . LEU A 1 255 ? 22.292  44.930 9.631  1.00 14.70 ? 254 LEU A CD2 1 
ATOM   1983 N  N   . ASN A 1 256 ? 16.911  44.019 8.711  1.00 17.03 ? 255 ASN A N   1 
ATOM   1984 C  CA  . ASN A 1 256 ? 15.827  43.084 8.369  1.00 18.56 ? 255 ASN A CA  1 
ATOM   1985 C  C   . ASN A 1 256 ? 15.797  42.806 6.871  1.00 19.84 ? 255 ASN A C   1 
ATOM   1986 O  O   . ASN A 1 256 ? 15.607  41.672 6.421  1.00 20.26 ? 255 ASN A O   1 
ATOM   1987 C  CB  . ASN A 1 256 ? 14.442  43.618 8.816  1.00 17.96 ? 255 ASN A CB  1 
ATOM   1988 C  CG  . ASN A 1 256 ? 14.080  43.203 10.246 1.00 16.63 ? 255 ASN A CG  1 
ATOM   1989 O  OD1 . ASN A 1 256 ? 14.580  42.206 10.750 1.00 13.45 ? 255 ASN A OD1 1 
ATOM   1990 N  ND2 . ASN A 1 256 ? 13.205  43.970 10.894 1.00 13.84 ? 255 ASN A ND2 1 
ATOM   1991 N  N   . GLU A 1 257 ? 15.987  43.881 6.123  1.00 21.75 ? 256 GLU A N   1 
ATOM   1992 C  CA  . GLU A 1 257 ? 15.881  43.918 4.673  1.00 23.47 ? 256 GLU A CA  1 
ATOM   1993 C  C   . GLU A 1 257 ? 17.104  43.244 4.055  1.00 22.98 ? 256 GLU A C   1 
ATOM   1994 O  O   . GLU A 1 257 ? 16.980  42.482 3.099  1.00 23.28 ? 256 GLU A O   1 
ATOM   1995 C  CB  . GLU A 1 257 ? 15.699  45.381 4.256  1.00 23.05 ? 256 GLU A CB  1 
ATOM   1996 C  CG  . GLU A 1 257 ? 16.273  45.806 2.930  1.00 26.32 ? 256 GLU A CG  1 
ATOM   1997 C  CD  . GLU A 1 257 ? 16.435  47.336 2.833  1.00 26.33 ? 256 GLU A CD  1 
ATOM   1998 O  OE1 . GLU A 1 257 ? 15.599  48.075 3.447  1.00 30.77 ? 256 GLU A OE1 1 
ATOM   1999 O  OE2 . GLU A 1 257 ? 17.400  47.781 2.152  1.00 26.70 ? 256 GLU A OE2 1 
ATOM   2000 N  N   . VAL A 1 258 ? 18.274  43.479 4.645  1.00 22.89 ? 257 VAL A N   1 
ATOM   2001 C  CA  . VAL A 1 258 ? 19.502  42.779 4.240  1.00 22.01 ? 257 VAL A CA  1 
ATOM   2002 C  C   . VAL A 1 258 ? 19.457  41.308 4.581  1.00 21.63 ? 257 VAL A C   1 
ATOM   2003 O  O   . VAL A 1 258 ? 19.694  40.468 3.724  1.00 22.14 ? 257 VAL A O   1 
ATOM   2004 C  CB  . VAL A 1 258 ? 20.754  43.434 4.841  1.00 22.11 ? 257 VAL A CB  1 
ATOM   2005 C  CG1 . VAL A 1 258 ? 21.981  42.607 4.566  1.00 21.90 ? 257 VAL A CG1 1 
ATOM   2006 C  CG2 . VAL A 1 258 ? 20.924  44.809 4.253  1.00 21.87 ? 257 VAL A CG2 1 
ATOM   2007 N  N   . ALA A 1 259 ? 19.146  40.981 5.827  1.00 21.31 ? 258 ALA A N   1 
ATOM   2008 C  CA  . ALA A 1 259 ? 19.069  39.564 6.235  1.00 20.71 ? 258 ALA A CA  1 
ATOM   2009 C  C   . ALA A 1 259 ? 17.948  38.788 5.545  1.00 19.86 ? 258 ALA A C   1 
ATOM   2010 O  O   . ALA A 1 259 ? 18.111  37.617 5.233  1.00 20.82 ? 258 ALA A O   1 
ATOM   2011 C  CB  . ALA A 1 259 ? 18.948  39.436 7.762  1.00 20.55 ? 258 ALA A CB  1 
ATOM   2012 N  N   . GLY A 1 260 ? 16.808  39.424 5.320  1.00 19.38 ? 259 GLY A N   1 
ATOM   2013 C  CA  . GLY A 1 260 ? 15.684  38.756 4.646  1.00 18.78 ? 259 GLY A CA  1 
ATOM   2014 C  C   . GLY A 1 260 ? 15.986  38.432 3.197  1.00 18.07 ? 259 GLY A C   1 
ATOM   2015 O  O   . GLY A 1 260 ? 15.551  37.431 2.685  1.00 18.02 ? 259 GLY A O   1 
ATOM   2016 N  N   . LYS A 1 261 ? 16.735  39.322 2.557  1.00 18.25 ? 260 LYS A N   1 
ATOM   2017 C  CA  . LYS A 1 261 ? 17.215  39.202 1.191  1.00 17.88 ? 260 LYS A CA  1 
ATOM   2018 C  C   . LYS A 1 261 ? 18.146  37.977 0.998  1.00 16.88 ? 260 LYS A C   1 
ATOM   2019 O  O   . LYS A 1 261 ? 18.137  37.342 -0.055 1.00 16.31 ? 260 LYS A O   1 
ATOM   2020 C  CB  . LYS A 1 261 ? 17.914  40.527 0.861  1.00 18.96 ? 260 LYS A CB  1 
ATOM   2021 C  CG  . LYS A 1 261 ? 18.610  40.676 -0.506 1.00 22.11 ? 260 LYS A CG  1 
ATOM   2022 C  CD  . LYS A 1 261 ? 19.885  41.494 -0.321 1.00 25.15 ? 260 LYS A CD  1 
ATOM   2023 C  CE  . LYS A 1 261 ? 20.256  42.292 -1.564 1.00 28.83 ? 260 LYS A CE  1 
ATOM   2024 N  NZ  . LYS A 1 261 ? 20.475  41.431 -2.772 1.00 29.99 ? 260 LYS A NZ  1 
ATOM   2025 N  N   . HIS A 1 262 ? 18.908  37.628 2.035  1.00 15.71 ? 261 HIS A N   1 
ATOM   2026 C  CA  . HIS A 1 262 ? 19.871  36.528 1.979  1.00 14.60 ? 261 HIS A CA  1 
ATOM   2027 C  C   . HIS A 1 262 ? 19.369  35.234 2.631  1.00 15.81 ? 261 HIS A C   1 
ATOM   2028 O  O   . HIS A 1 262 ? 20.099  34.207 2.646  1.00 15.67 ? 261 HIS A O   1 
ATOM   2029 C  CB  . HIS A 1 262 ? 21.195  36.952 2.601  1.00 14.04 ? 261 HIS A CB  1 
ATOM   2030 C  CG  . HIS A 1 262 ? 21.941  37.969 1.793  1.00 11.06 ? 261 HIS A CG  1 
ATOM   2031 N  ND1 . HIS A 1 262 ? 22.707  37.632 0.702  1.00 11.97 ? 261 HIS A ND1 1 
ATOM   2032 C  CD2 . HIS A 1 262 ? 22.040  39.312 1.920  1.00 9.73  ? 261 HIS A CD2 1 
ATOM   2033 C  CE1 . HIS A 1 262 ? 23.241  38.722 0.183  1.00 10.55 ? 261 HIS A CE1 1 
ATOM   2034 N  NE2 . HIS A 1 262 ? 22.847  39.755 0.903  1.00 10.68 ? 261 HIS A NE2 1 
ATOM   2035 N  N   . GLY A 1 263 ? 18.130  35.275 3.160  1.00 15.36 ? 262 GLY A N   1 
ATOM   2036 C  CA  . GLY A 1 263 ? 17.474  34.084 3.678  1.00 14.57 ? 262 GLY A CA  1 
ATOM   2037 C  C   . GLY A 1 263 ? 17.822  33.764 5.118  1.00 15.10 ? 262 GLY A C   1 
ATOM   2038 O  O   . GLY A 1 263 ? 17.598  32.639 5.573  1.00 15.00 ? 262 GLY A O   1 
ATOM   2039 N  N   . VAL A 1 264 ? 18.329  34.774 5.835  1.00 15.12 ? 263 VAL A N   1 
ATOM   2040 C  CA  . VAL A 1 264 ? 18.895  34.646 7.208  1.00 15.03 ? 263 VAL A CA  1 
ATOM   2041 C  C   . VAL A 1 264 ? 17.825  34.764 8.295  1.00 14.82 ? 263 VAL A C   1 
ATOM   2042 O  O   . VAL A 1 264 ? 16.975  35.655 8.221  1.00 14.57 ? 263 VAL A O   1 
ATOM   2043 C  CB  . VAL A 1 264 ? 19.971  35.752 7.468  1.00 14.51 ? 263 VAL A CB  1 
ATOM   2044 C  CG1 . VAL A 1 264 ? 20.234  35.943 8.961  1.00 15.63 ? 263 VAL A CG1 1 
ATOM   2045 C  CG2 . VAL A 1 264 ? 21.260  35.423 6.774  1.00 14.85 ? 263 VAL A CG2 1 
ATOM   2046 N  N   . GLY A 1 265 ? 17.867  33.877 9.300  1.00 14.60 ? 264 GLY A N   1 
ATOM   2047 C  CA  . GLY A 1 265 ? 17.025  34.038 10.492 1.00 13.53 ? 264 GLY A CA  1 
ATOM   2048 C  C   . GLY A 1 265 ? 15.946  33.009 10.717 1.00 13.12 ? 264 GLY A C   1 
ATOM   2049 O  O   . GLY A 1 265 ? 15.007  33.249 11.494 1.00 13.58 ? 264 GLY A O   1 
ATOM   2050 N  N   . ARG A 1 266 ? 16.079  31.861 10.054 1.00 12.23 ? 265 ARG A N   1 
ATOM   2051 C  CA  . ARG A 1 266 ? 15.053  30.796 10.072 1.00 11.30 ? 265 ARG A CA  1 
ATOM   2052 C  C   . ARG A 1 266 ? 15.364  29.740 11.114 1.00 10.54 ? 265 ARG A C   1 
ATOM   2053 O  O   . ARG A 1 266 ? 16.453  29.152 11.118 1.00 10.21 ? 265 ARG A O   1 
ATOM   2054 C  CB  . ARG A 1 266 ? 14.948  30.105 8.700  1.00 11.72 ? 265 ARG A CB  1 
ATOM   2055 C  CG  . ARG A 1 266 ? 14.432  30.954 7.547  1.00 11.10 ? 265 ARG A CG  1 
ATOM   2056 C  CD  . ARG A 1 266 ? 14.234  30.087 6.304  1.00 11.04 ? 265 ARG A CD  1 
ATOM   2057 N  NE  . ARG A 1 266 ? 13.646  30.797 5.164  1.00 10.32 ? 265 ARG A NE  1 
ATOM   2058 C  CZ  . ARG A 1 266 ? 13.297  30.212 4.002  1.00 11.85 ? 265 ARG A CZ  1 
ATOM   2059 N  NH1 . ARG A 1 266 ? 13.458  28.880 3.795  1.00 9.21  ? 265 ARG A NH1 1 
ATOM   2060 N  NH2 . ARG A 1 266 ? 12.765  30.954 3.040  1.00 7.15  ? 265 ARG A NH2 1 
ATOM   2061 N  N   . ILE A 1 267 ? 14.411  29.498 12.003 1.00 10.01 ? 266 ILE A N   1 
ATOM   2062 C  CA  . ILE A 1 267 ? 14.517  28.364 12.912 1.00 9.87  ? 266 ILE A CA  1 
ATOM   2063 C  C   . ILE A 1 267 ? 13.236  27.478 12.939 1.00 9.94  ? 266 ILE A C   1 
ATOM   2064 O  O   . ILE A 1 267 ? 12.149  27.911 12.540 1.00 9.78  ? 266 ILE A O   1 
ATOM   2065 C  CB  . ILE A 1 267 ? 15.162  28.684 14.346 1.00 9.43  ? 266 ILE A CB  1 
ATOM   2066 C  CG1 . ILE A 1 267 ? 14.139  28.933 15.466 1.00 10.38 ? 266 ILE A CG1 1 
ATOM   2067 C  CG2 . ILE A 1 267 ? 16.359  29.659 14.283 1.00 9.47  ? 266 ILE A CG2 1 
ATOM   2068 C  CD1 . ILE A 1 267 ? 13.555  30.258 15.575 1.00 12.64 ? 266 ILE A CD1 1 
ATOM   2069 N  N   . ASP A 1 268 ? 13.413  26.226 13.339 1.00 9.53  ? 267 ASP A N   1 
ATOM   2070 C  CA  . ASP A 1 268 ? 12.309  25.325 13.579 1.00 10.12 ? 267 ASP A CA  1 
ATOM   2071 C  C   . ASP A 1 268 ? 12.571  24.620 14.905 1.00 10.45 ? 267 ASP A C   1 
ATOM   2072 O  O   . ASP A 1 268 ? 13.547  23.843 15.046 1.00 10.70 ? 267 ASP A O   1 
ATOM   2073 C  CB  . ASP A 1 268 ? 12.159  24.318 12.448 1.00 9.64  ? 267 ASP A CB  1 
ATOM   2074 C  CG  . ASP A 1 268 ? 10.991  23.380 12.658 1.00 10.25 ? 267 ASP A CG  1 
ATOM   2075 O  OD1 . ASP A 1 268 ? 10.651  23.097 13.810 1.00 9.45  ? 267 ASP A OD1 1 
ATOM   2076 O  OD2 . ASP A 1 268 ? 10.389  22.928 11.667 1.00 13.27 ? 267 ASP A OD2 1 
ATOM   2077 N  N   . ILE A 1 269 ? 11.705  24.899 15.874 1.00 10.39 ? 268 ILE A N   1 
ATOM   2078 C  CA  . ILE A 1 269 ? 11.942  24.477 17.260 1.00 10.38 ? 268 ILE A CA  1 
ATOM   2079 C  C   . ILE A 1 269 ? 10.695  23.972 17.967 1.00 10.58 ? 268 ILE A C   1 
ATOM   2080 O  O   . ILE A 1 269 ? 9.562   24.276 17.560 1.00 10.77 ? 268 ILE A O   1 
ATOM   2081 C  CB  . ILE A 1 269 ? 12.631  25.587 18.134 1.00 10.29 ? 268 ILE A CB  1 
ATOM   2082 C  CG1 . ILE A 1 269 ? 11.733  26.819 18.295 1.00 10.56 ? 268 ILE A CG1 1 
ATOM   2083 C  CG2 . ILE A 1 269 ? 13.997  25.938 17.568 1.00 8.55  ? 268 ILE A CG2 1 
ATOM   2084 C  CD1 . ILE A 1 269 ? 12.169  27.777 19.407 1.00 10.39 ? 268 ILE A CD1 1 
ATOM   2085 N  N   . VAL A 1 270 ? 10.935  23.138 18.976 1.00 10.26 ? 269 VAL A N   1 
ATOM   2086 C  CA  . VAL A 1 270 ? 9.950   22.825 19.983 1.00 10.79 ? 269 VAL A CA  1 
ATOM   2087 C  C   . VAL A 1 270 ? 10.403  23.497 21.275 1.00 11.11 ? 269 VAL A C   1 
ATOM   2088 O  O   . VAL A 1 270 ? 11.553  23.284 21.730 1.00 11.29 ? 269 VAL A O   1 
ATOM   2089 C  CB  . VAL A 1 270 ? 9.779   21.297 20.213 1.00 10.70 ? 269 VAL A CB  1 
ATOM   2090 C  CG1 . VAL A 1 270 ? 8.850   21.045 21.389 1.00 11.26 ? 269 VAL A CG1 1 
ATOM   2091 C  CG2 . VAL A 1 270 ? 9.215   20.620 18.955 1.00 10.97 ? 269 VAL A CG2 1 
ATOM   2092 N  N   . GLU A 1 271 ? 9.483   24.278 21.853 1.00 10.63 ? 270 GLU A N   1 
ATOM   2093 C  CA  . GLU A 1 271 ? 9.706   25.096 23.040 1.00 10.60 ? 270 GLU A CA  1 
ATOM   2094 C  C   . GLU A 1 271 ? 8.729   24.765 24.182 1.00 10.99 ? 270 GLU A C   1 
ATOM   2095 O  O   . GLU A 1 271 ? 7.635   24.212 23.967 1.00 10.53 ? 270 GLU A O   1 
ATOM   2096 C  CB  . GLU A 1 271 ? 9.541   26.563 22.674 1.00 11.07 ? 270 GLU A CB  1 
ATOM   2097 C  CG  . GLU A 1 271 ? 8.088   26.994 22.526 1.00 10.76 ? 270 GLU A CG  1 
ATOM   2098 C  CD  . GLU A 1 271 ? 7.937   28.318 21.816 1.00 12.24 ? 270 GLU A CD  1 
ATOM   2099 O  OE1 . GLU A 1 271 ? 8.189   28.381 20.588 1.00 13.32 ? 270 GLU A OE1 1 
ATOM   2100 O  OE2 . GLU A 1 271 ? 7.518   29.285 22.480 1.00 11.63 ? 270 GLU A OE2 1 
ATOM   2101 N  N   . ASN A 1 272 ? 9.110   25.132 25.396 1.00 10.57 ? 271 ASN A N   1 
ATOM   2102 C  CA  . ASN A 1 272 ? 8.245   24.859 26.540 1.00 11.16 ? 271 ASN A CA  1 
ATOM   2103 C  C   . ASN A 1 272 ? 7.631   26.058 27.245 1.00 10.76 ? 271 ASN A C   1 
ATOM   2104 O  O   . ASN A 1 272 ? 8.351   27.026 27.497 1.00 11.07 ? 271 ASN A O   1 
ATOM   2105 C  CB  . ASN A 1 272 ? 9.085   24.288 27.721 1.00 10.78 ? 271 ASN A CB  1 
ATOM   2106 C  CG  . ASN A 1 272 ? 9.532   22.874 27.538 1.00 11.04 ? 271 ASN A CG  1 
ATOM   2107 O  OD1 . ASN A 1 272 ? 8.737   21.947 27.640 1.00 13.87 ? 271 ASN A OD1 1 
ATOM   2108 N  ND2 . ASN A 1 272 ? 10.838  22.686 27.372 1.00 9.05  ? 271 ASN A ND2 1 
ATOM   2109 N  N   . ARG A 1 273 ? 6.332   26.077 27.519 1.00 10.36 ? 272 ARG A N   1 
ATOM   2110 C  CA  . ARG A 1 273 ? 5.442   27.176 27.223 1.00 10.46 ? 272 ARG A CA  1 
ATOM   2111 C  C   . ARG A 1 273 ? 5.417   27.429 28.754 1.00 10.60 ? 272 ARG A C   1 
ATOM   2112 O  O   . ARG A 1 273 ? 5.779   26.521 29.528 1.00 9.43  ? 272 ARG A O   1 
ATOM   2113 C  CB  . ARG A 1 273 ? 4.045   26.790 26.745 1.00 10.31 ? 272 ARG A CB  1 
ATOM   2114 C  CG  . ARG A 1 273 ? 3.769   27.187 25.312 1.00 10.31 ? 272 ARG A CG  1 
ATOM   2115 C  CD  . ARG A 1 273 ? 2.285   27.146 24.977 1.00 12.30 ? 272 ARG A CD  1 
ATOM   2116 N  NE  . ARG A 1 273 ? 2.101   27.430 23.563 1.00 11.66 ? 272 ARG A NE  1 
ATOM   2117 C  CZ  . ARG A 1 273 ? 1.044   27.097 22.838 1.00 13.70 ? 272 ARG A CZ  1 
ATOM   2118 N  NH1 . ARG A 1 273 ? 0.020   26.468 23.379 1.00 13.42 ? 272 ARG A NH1 1 
ATOM   2119 N  NH2 . ARG A 1 273 ? 1.020   27.390 21.543 1.00 14.16 ? 272 ARG A NH2 1 
ATOM   2120 N  N   . PHE A 1 274 ? 5.075   28.623 29.220 1.00 11.61 ? 273 PHE A N   1 
ATOM   2121 C  CA  . PHE A 1 274 ? 5.084   28.885 30.693 1.00 12.12 ? 273 PHE A CA  1 
ATOM   2122 C  C   . PHE A 1 274 ? 4.084   28.015 31.469 1.00 12.67 ? 273 PHE A C   1 
ATOM   2123 O  O   . PHE A 1 274 ? 4.392   27.525 32.556 1.00 13.10 ? 273 PHE A O   1 
ATOM   2124 C  CB  . PHE A 1 274 ? 4.925   30.390 31.006 1.00 11.57 ? 273 PHE A CB  1 
ATOM   2125 C  CG  . PHE A 1 274 ? 5.059   30.753 32.479 1.00 11.16 ? 273 PHE A CG  1 
ATOM   2126 C  CD1 . PHE A 1 274 ? 6.079   30.219 33.276 1.00 11.35 ? 273 PHE A CD1 1 
ATOM   2127 C  CD2 . PHE A 1 274 ? 4.180   31.668 33.059 1.00 11.31 ? 273 PHE A CD2 1 
ATOM   2128 C  CE1 . PHE A 1 274 ? 6.203   30.576 34.620 1.00 9.07  ? 273 PHE A CE1 1 
ATOM   2129 C  CE2 . PHE A 1 274 ? 4.293   32.020 34.404 1.00 10.92 ? 273 PHE A CE2 1 
ATOM   2130 C  CZ  . PHE A 1 274 ? 5.302   31.470 35.181 1.00 9.93  ? 273 PHE A CZ  1 
ATOM   2131 N  N   . ILE A 1 275 ? 2.911   27.775 30.895 1.00 14.18 ? 274 ILE A N   1 
ATOM   2132 C  CA  . ILE A 1 275 ? 1.944   26.834 31.501 1.00 15.12 ? 274 ILE A CA  1 
ATOM   2133 C  C   . ILE A 1 275 ? 2.369   25.354 31.453 1.00 15.38 ? 274 ILE A C   1 
ATOM   2134 O  O   . ILE A 1 275 ? 1.723   24.497 32.072 1.00 16.88 ? 274 ILE A O   1 
ATOM   2135 C  CB  . ILE A 1 275 ? 0.428   27.063 31.039 1.00 15.49 ? 274 ILE A CB  1 
ATOM   2136 C  CG1 . ILE A 1 275 ? 0.055   26.359 29.713 1.00 17.25 ? 274 ILE A CG1 1 
ATOM   2137 C  CG2 . ILE A 1 275 ? -0.029  28.582 31.136 1.00 14.81 ? 274 ILE A CG2 1 
ATOM   2138 C  CD1 . ILE A 1 275 ? 1.008   26.562 28.560 1.00 21.23 ? 274 ILE A CD1 1 
ATOM   2139 N  N   . GLY A 1 276 ? 3.441   25.034 30.727 1.00 15.49 ? 275 GLY A N   1 
ATOM   2140 C  CA  . GLY A 1 276 ? 4.021   23.670 30.781 1.00 14.56 ? 275 GLY A CA  1 
ATOM   2141 C  C   . GLY A 1 276 ? 3.737   22.731 29.614 1.00 14.31 ? 275 GLY A C   1 
ATOM   2142 O  O   . GLY A 1 276 ? 4.140   21.568 29.642 1.00 14.01 ? 275 GLY A O   1 
ATOM   2143 N  N   . MET A 1 277 ? 3.047   23.229 28.593 1.00 13.53 ? 276 MET A N   1 
ATOM   2144 C  CA  . MET A 1 277 ? 2.867   22.502 27.349 1.00 13.79 ? 276 MET A CA  1 
ATOM   2145 C  C   . MET A 1 277 ? 4.056   22.789 26.426 1.00 13.84 ? 276 MET A C   1 
ATOM   2146 O  O   . MET A 1 277 ? 4.509   23.925 26.302 1.00 13.86 ? 276 MET A O   1 
ATOM   2147 C  CB  . MET A 1 277 ? 1.597   22.964 26.620 1.00 13.93 ? 276 MET A CB  1 
ATOM   2148 C  CG  . MET A 1 277 ? 0.275   22.445 27.156 1.00 13.31 ? 276 MET A CG  1 
ATOM   2149 S  SD  . MET A 1 277 ? -1.076  23.297 26.321 1.00 14.63 ? 276 MET A SD  1 
ATOM   2150 C  CE  . MET A 1 277 ? -2.415  23.041 27.467 1.00 13.91 ? 276 MET A CE  1 
ATOM   2151 N  N   . LYS A 1 278 ? 4.564   21.739 25.795 1.00 13.62 ? 277 LYS A N   1 
ATOM   2152 C  CA  . LYS A 1 278 ? 5.542   21.877 24.742 1.00 12.93 ? 277 LYS A CA  1 
ATOM   2153 C  C   . LYS A 1 278 ? 4.794   22.345 23.500 1.00 13.03 ? 277 LYS A C   1 
ATOM   2154 O  O   . LYS A 1 278 ? 3.673   21.905 23.238 1.00 13.06 ? 277 LYS A O   1 
ATOM   2155 C  CB  . LYS A 1 278 ? 6.231   20.538 24.480 1.00 12.18 ? 277 LYS A CB  1 
ATOM   2156 C  CG  . LYS A 1 278 ? 7.356   20.262 25.436 1.00 11.53 ? 277 LYS A CG  1 
ATOM   2157 C  CD  . LYS A 1 278 ? 8.201   19.085 25.010 1.00 9.73  ? 277 LYS A CD  1 
ATOM   2158 C  CE  . LYS A 1 278 ? 9.523   19.002 25.767 1.00 8.94  ? 277 LYS A CE  1 
ATOM   2159 N  NZ  . LYS A 1 278 ? 9.471   19.214 27.249 1.00 9.51  ? 277 LYS A NZ  1 
ATOM   2160 N  N   . SER A 1 279 ? 5.416   23.243 22.742 1.00 12.80 ? 278 SER A N   1 
ATOM   2161 C  CA  . SER A 1 279 ? 4.806   23.753 21.525 1.00 12.35 ? 278 SER A CA  1 
ATOM   2162 C  C   . SER A 1 279 ? 5.810   23.805 20.375 1.00 12.13 ? 278 SER A C   1 
ATOM   2163 O  O   . SER A 1 279 ? 6.987   24.056 20.599 1.00 12.54 ? 278 SER A O   1 
ATOM   2164 C  CB  . SER A 1 279 ? 4.177   25.131 21.791 1.00 11.94 ? 278 SER A CB  1 
ATOM   2165 O  OG  . SER A 1 279 ? 3.622   25.664 20.608 1.00 9.72  ? 278 SER A OG  1 
ATOM   2166 N  N   . ARG A 1 280 ? 5.330   23.596 19.152 1.00 12.18 ? 279 ARG A N   1 
ATOM   2167 C  CA  . ARG A 1 280 ? 6.177   23.616 17.954 1.00 12.88 ? 279 ARG A CA  1 
ATOM   2168 C  C   . ARG A 1 280 ? 6.005   24.893 17.130 1.00 13.77 ? 279 ARG A C   1 
ATOM   2169 O  O   . ARG A 1 280 ? 4.890   25.249 16.705 1.00 14.48 ? 279 ARG A O   1 
ATOM   2170 C  CB  . ARG A 1 280 ? 5.948   22.366 17.092 1.00 12.65 ? 279 ARG A CB  1 
ATOM   2171 C  CG  . ARG A 1 280 ? 7.046   22.079 16.079 1.00 11.27 ? 279 ARG A CG  1 
ATOM   2172 C  CD  . ARG A 1 280 ? 6.881   22.902 14.795 1.00 11.17 ? 279 ARG A CD  1 
ATOM   2173 N  NE  . ARG A 1 280 ? 7.788   22.500 13.716 1.00 10.99 ? 279 ARG A NE  1 
ATOM   2174 C  CZ  . ARG A 1 280 ? 7.480   21.632 12.762 1.00 12.11 ? 279 ARG A CZ  1 
ATOM   2175 N  NH1 . ARG A 1 280 ? 6.288   21.036 12.759 1.00 10.68 ? 279 ARG A NH1 1 
ATOM   2176 N  NH2 . ARG A 1 280 ? 8.379   21.336 11.824 1.00 10.97 ? 279 ARG A NH2 1 
ATOM   2177 N  N   . GLY A 1 281 ? 7.123   25.579 16.907 1.00 14.47 ? 280 GLY A N   1 
ATOM   2178 C  CA  . GLY A 1 281 ? 7.111   26.890 16.296 1.00 14.68 ? 280 GLY A CA  1 
ATOM   2179 C  C   . GLY A 1 281 ? 8.269   27.045 15.340 1.00 15.77 ? 280 GLY A C   1 
ATOM   2180 O  O   . GLY A 1 281 ? 9.387   26.536 15.579 1.00 16.15 ? 280 GLY A O   1 
ATOM   2181 N  N   . ILE A 1 282 ? 7.998   27.729 14.236 1.00 15.35 ? 281 ILE A N   1 
ATOM   2182 C  CA  . ILE A 1 282 ? 9.065   28.160 13.392 1.00 15.25 ? 281 ILE A CA  1 
ATOM   2183 C  C   . ILE A 1 282 ? 9.082   29.700 13.354 1.00 14.13 ? 281 ILE A C   1 
ATOM   2184 O  O   . ILE A 1 282 ? 8.030   30.357 13.431 1.00 13.28 ? 281 ILE A O   1 
ATOM   2185 C  CB  . ILE A 1 282 ? 9.106   27.426 11.978 1.00 16.51 ? 281 ILE A CB  1 
ATOM   2186 C  CG1 . ILE A 1 282 ? 9.135   28.394 10.804 1.00 16.76 ? 281 ILE A CG1 1 
ATOM   2187 C  CG2 . ILE A 1 282 ? 8.037   26.305 11.828 1.00 18.01 ? 281 ILE A CG2 1 
ATOM   2188 C  CD1 . ILE A 1 282 ? 7.795   28.759 10.377 1.00 20.04 ? 281 ILE A CD1 1 
ATOM   2189 N  N   . TYR A 1 283 ? 10.291  30.252 13.256 1.00 12.81 ? 282 TYR A N   1 
ATOM   2190 C  CA  . TYR A 1 283 ? 10.500  31.661 13.416 1.00 12.53 ? 282 TYR A CA  1 
ATOM   2191 C  C   . TYR A 1 283 ? 11.373  32.223 12.316 1.00 12.84 ? 282 TYR A C   1 
ATOM   2192 O  O   . TYR A 1 283 ? 12.217  31.528 11.763 1.00 11.88 ? 282 TYR A O   1 
ATOM   2193 C  CB  . TYR A 1 283 ? 11.110  31.947 14.787 1.00 12.54 ? 282 TYR A CB  1 
ATOM   2194 C  CG  . TYR A 1 283 ? 10.261  31.480 15.932 1.00 11.44 ? 282 TYR A CG  1 
ATOM   2195 C  CD1 . TYR A 1 283 ? 9.249   32.281 16.442 1.00 11.39 ? 282 TYR A CD1 1 
ATOM   2196 C  CD2 . TYR A 1 283 ? 10.451  30.227 16.497 1.00 13.05 ? 282 TYR A CD2 1 
ATOM   2197 C  CE1 . TYR A 1 283 ? 8.445   31.837 17.497 1.00 12.10 ? 282 TYR A CE1 1 
ATOM   2198 C  CE2 . TYR A 1 283 ? 9.662   29.776 17.555 1.00 12.00 ? 282 TYR A CE2 1 
ATOM   2199 C  CZ  . TYR A 1 283 ? 8.665   30.592 18.040 1.00 12.21 ? 282 TYR A CZ  1 
ATOM   2200 O  OH  . TYR A 1 283 ? 7.878   30.145 19.056 1.00 13.44 ? 282 TYR A OH  1 
ATOM   2201 N  N   . GLU A 1 284 ? 11.133  33.494 11.993 1.00 13.77 ? 283 GLU A N   1 
ATOM   2202 C  CA  . GLU A 1 284 ? 11.974  34.257 11.069 1.00 14.08 ? 283 GLU A CA  1 
ATOM   2203 C  C   . GLU A 1 284 ? 12.355  35.556 11.746 1.00 13.53 ? 283 GLU A C   1 
ATOM   2204 O  O   . GLU A 1 284 ? 11.527  36.443 11.865 1.00 12.83 ? 283 GLU A O   1 
ATOM   2205 C  CB  . GLU A 1 284 ? 11.253  34.555 9.750  1.00 14.11 ? 283 GLU A CB  1 
ATOM   2206 C  CG  . GLU A 1 284 ? 11.019  33.343 8.835  1.00 15.08 ? 283 GLU A CG  1 
ATOM   2207 C  CD  . GLU A 1 284 ? 10.248  33.708 7.558  1.00 15.20 ? 283 GLU A CD  1 
ATOM   2208 O  OE1 . GLU A 1 284 ? 10.734  33.416 6.449  1.00 15.22 ? 283 GLU A OE1 1 
ATOM   2209 O  OE2 . GLU A 1 284 ? 9.154   34.316 7.662  1.00 19.66 ? 283 GLU A OE2 1 
ATOM   2210 N  N   . THR A 1 285 ? 13.628  35.648 12.152 1.00 13.40 ? 284 THR A N   1 
ATOM   2211 C  CA  . THR A 1 285 ? 14.197  36.768 12.900 1.00 12.42 ? 284 THR A CA  1 
ATOM   2212 C  C   . THR A 1 285 ? 15.450  37.255 12.187 1.00 12.79 ? 284 THR A C   1 
ATOM   2213 O  O   . THR A 1 285 ? 16.560  36.945 12.594 1.00 12.92 ? 284 THR A O   1 
ATOM   2214 C  CB  . THR A 1 285 ? 14.581  36.325 14.297 1.00 12.18 ? 284 THR A CB  1 
ATOM   2215 O  OG1 . THR A 1 285 ? 13.554  35.484 14.806 1.00 13.07 ? 284 THR A OG1 1 
ATOM   2216 C  CG2 . THR A 1 285 ? 14.756  37.501 15.218 1.00 10.29 ? 284 THR A CG2 1 
ATOM   2217 N  N   . PRO A 1 286 ? 15.277  38.002 11.093 1.00 12.99 ? 285 PRO A N   1 
ATOM   2218 C  CA  . PRO A 1 286 ? 16.407  38.290 10.249 1.00 12.74 ? 285 PRO A CA  1 
ATOM   2219 C  C   . PRO A 1 286 ? 17.452  39.211 10.877 1.00 12.41 ? 285 PRO A C   1 
ATOM   2220 O  O   . PRO A 1 286 ? 18.579  38.752 11.091 1.00 12.74 ? 285 PRO A O   1 
ATOM   2221 C  CB  . PRO A 1 286 ? 15.751  38.900 8.992  1.00 13.53 ? 285 PRO A CB  1 
ATOM   2222 C  CG  . PRO A 1 286 ? 14.280  38.403 9.063  1.00 13.76 ? 285 PRO A CG  1 
ATOM   2223 C  CD  . PRO A 1 286 ? 14.041  38.573 10.529 1.00 13.44 ? 285 PRO A CD  1 
ATOM   2224 N  N   . ALA A 1 287 ? 17.099  40.477 11.144 1.00 11.44 ? 286 ALA A N   1 
ATOM   2225 C  CA  . ALA A 1 287 ? 17.994  41.436 11.793 1.00 11.39 ? 286 ALA A CA  1 
ATOM   2226 C  C   . ALA A 1 287 ? 18.490  40.947 13.162 1.00 11.52 ? 286 ALA A C   1 
ATOM   2227 O  O   . ALA A 1 287 ? 19.682  41.069 13.484 1.00 11.17 ? 286 ALA A O   1 
ATOM   2228 C  CB  . ALA A 1 287 ? 17.304  42.783 11.955 1.00 11.21 ? 286 ALA A CB  1 
ATOM   2229 N  N   . GLY A 1 288 ? 17.550  40.424 13.959 1.00 11.14 ? 287 GLY A N   1 
ATOM   2230 C  CA  . GLY A 1 288 ? 17.844  39.835 15.243 1.00 10.26 ? 287 GLY A CA  1 
ATOM   2231 C  C   . GLY A 1 288 ? 18.943  38.799 15.155 1.00 10.18 ? 287 GLY A C   1 
ATOM   2232 O  O   . GLY A 1 288 ? 19.792  38.724 16.056 1.00 9.86  ? 287 GLY A O   1 
ATOM   2233 N  N   . THR A 1 289 ? 18.936  37.995 14.084 1.00 9.49  ? 288 THR A N   1 
ATOM   2234 C  CA  . THR A 1 289 ? 19.953  36.956 13.938 1.00 9.35  ? 288 THR A CA  1 
ATOM   2235 C  C   . THR A 1 289 ? 21.353  37.555 13.655 1.00 9.70  ? 288 THR A C   1 
ATOM   2236 O  O   . THR A 1 289 ? 22.357  37.033 14.154 1.00 10.17 ? 288 THR A O   1 
ATOM   2237 C  CB  . THR A 1 289 ? 19.518  35.843 12.944 1.00 9.75  ? 288 THR A CB  1 
ATOM   2238 O  OG1 . THR A 1 289 ? 18.278  35.286 13.400 1.00 10.46 ? 288 THR A OG1 1 
ATOM   2239 C  CG2 . THR A 1 289 ? 20.551  34.706 12.845 1.00 7.03  ? 288 THR A CG2 1 
ATOM   2240 N  N   . ILE A 1 290 ? 21.409  38.673 12.925 1.00 9.19  ? 289 ILE A N   1 
ATOM   2241 C  CA  . ILE A 1 290 ? 22.670  39.316 12.567 1.00 8.48  ? 289 ILE A CA  1 
ATOM   2242 C  C   . ILE A 1 290 ? 23.279  39.946 13.808 1.00 9.82  ? 289 ILE A C   1 
ATOM   2243 O  O   . ILE A 1 290 ? 24.481  39.852 14.091 1.00 10.75 ? 289 ILE A O   1 
ATOM   2244 C  CB  . ILE A 1 290 ? 22.481  40.424 11.471 1.00 7.71  ? 289 ILE A CB  1 
ATOM   2245 C  CG1 . ILE A 1 290 ? 22.029  39.810 10.132 1.00 7.32  ? 289 ILE A CG1 1 
ATOM   2246 C  CG2 . ILE A 1 290 ? 23.764  41.196 11.274 1.00 5.45  ? 289 ILE A CG2 1 
ATOM   2247 C  CD1 . ILE A 1 290 ? 21.858  40.771 8.991  1.00 7.15  ? 289 ILE A CD1 1 
ATOM   2248 N  N   . LEU A 1 291 ? 22.413  40.603 14.549 1.00 10.38 ? 290 LEU A N   1 
ATOM   2249 C  CA  . LEU A 1 291 ? 22.785  41.363 15.729 1.00 9.69  ? 290 LEU A CA  1 
ATOM   2250 C  C   . LEU A 1 291 ? 23.164  40.468 16.896 1.00 9.20  ? 290 LEU A C   1 
ATOM   2251 O  O   . LEU A 1 291 ? 24.005  40.857 17.712 1.00 9.89  ? 290 LEU A O   1 
ATOM   2252 C  CB  . LEU A 1 291 ? 21.590  42.241 16.107 1.00 9.79  ? 290 LEU A CB  1 
ATOM   2253 C  CG  . LEU A 1 291 ? 21.597  43.708 15.706 1.00 10.18 ? 290 LEU A CG  1 
ATOM   2254 C  CD1 . LEU A 1 291 ? 22.782  44.141 14.813 1.00 12.37 ? 290 LEU A CD1 1 
ATOM   2255 C  CD2 . LEU A 1 291 ? 20.227  44.129 15.162 1.00 10.58 ? 290 LEU A CD2 1 
ATOM   2256 N  N   . TYR A 1 292 ? 22.519  39.300 16.987 1.00 8.12  ? 291 TYR A N   1 
ATOM   2257 C  CA  . TYR A 1 292 ? 22.820  38.322 18.005 1.00 8.15  ? 291 TYR A CA  1 
ATOM   2258 C  C   . TYR A 1 292 ? 24.298  37.921 17.922 1.00 8.10  ? 291 TYR A C   1 
ATOM   2259 O  O   . TYR A 1 292 ? 25.016  37.898 18.918 1.00 7.48  ? 291 TYR A O   1 
ATOM   2260 C  CB  . TYR A 1 292 ? 21.951  37.060 17.838 1.00 8.36  ? 291 TYR A CB  1 
ATOM   2261 C  CG  . TYR A 1 292 ? 22.460  35.921 18.727 1.00 8.90  ? 291 TYR A CG  1 
ATOM   2262 C  CD1 . TYR A 1 292 ? 22.243  35.957 20.105 1.00 7.45  ? 291 TYR A CD1 1 
ATOM   2263 C  CD2 . TYR A 1 292 ? 23.179  34.843 18.196 1.00 8.63  ? 291 TYR A CD2 1 
ATOM   2264 C  CE1 . TYR A 1 292 ? 22.714  34.981 20.933 1.00 8.09  ? 291 TYR A CE1 1 
ATOM   2265 C  CE2 . TYR A 1 292 ? 23.654  33.830 19.017 1.00 7.89  ? 291 TYR A CE2 1 
ATOM   2266 C  CZ  . TYR A 1 292 ? 23.421  33.925 20.400 1.00 9.53  ? 291 TYR A CZ  1 
ATOM   2267 O  OH  . TYR A 1 292 ? 23.850  32.959 21.278 1.00 11.21 ? 291 TYR A OH  1 
ATOM   2268 N  N   . HIS A 1 293 ? 24.711  37.593 16.699 1.00 8.27  ? 292 HIS A N   1 
ATOM   2269 C  CA  . HIS A 1 293 ? 26.063  37.185 16.378 1.00 8.33  ? 292 HIS A CA  1 
ATOM   2270 C  C   . HIS A 1 293 ? 27.089  38.322 16.412 1.00 7.72  ? 292 HIS A C   1 
ATOM   2271 O  O   . HIS A 1 293 ? 28.166  38.144 16.976 1.00 7.54  ? 292 HIS A O   1 
ATOM   2272 C  CB  . HIS A 1 293 ? 26.065  36.479 15.031 1.00 8.97  ? 292 HIS A CB  1 
ATOM   2273 C  CG  . HIS A 1 293 ? 25.395  35.142 15.063 1.00 10.70 ? 292 HIS A CG  1 
ATOM   2274 N  ND1 . HIS A 1 293 ? 25.860  34.093 15.837 1.00 11.94 ? 292 HIS A ND1 1 
ATOM   2275 C  CD2 . HIS A 1 293 ? 24.287  34.683 14.431 1.00 11.13 ? 292 HIS A CD2 1 
ATOM   2276 C  CE1 . HIS A 1 293 ? 25.063  33.047 15.682 1.00 11.74 ? 292 HIS A CE1 1 
ATOM   2277 N  NE2 . HIS A 1 293 ? 24.112  33.373 14.822 1.00 12.36 ? 292 HIS A NE2 1 
ATOM   2278 N  N   . ALA A 1 294 ? 26.753  39.470 15.825 1.00 7.25  ? 293 ALA A N   1 
ATOM   2279 C  CA  . ALA A 1 294 ? 27.629  40.657 15.872 1.00 7.97  ? 293 ALA A CA  1 
ATOM   2280 C  C   . ALA A 1 294 ? 27.949  41.116 17.310 1.00 7.98  ? 293 ALA A C   1 
ATOM   2281 O  O   . ALA A 1 294 ? 29.108  41.389 17.644 1.00 7.69  ? 293 ALA A O   1 
ATOM   2282 C  CB  . ALA A 1 294 ? 27.024  41.841 15.054 1.00 7.30  ? 293 ALA A CB  1 
ATOM   2283 N  N   . HIS A 1 295 ? 26.901  41.212 18.131 1.00 8.38  ? 294 HIS A N   1 
ATOM   2284 C  CA  . HIS A 1 295 ? 27.013  41.659 19.497 1.00 8.88  ? 294 HIS A CA  1 
ATOM   2285 C  C   . HIS A 1 295 ? 27.830  40.722 20.384 1.00 8.78  ? 294 HIS A C   1 
ATOM   2286 O  O   . HIS A 1 295 ? 28.612  41.175 21.225 1.00 9.70  ? 294 HIS A O   1 
ATOM   2287 C  CB  . HIS A 1 295 ? 25.635  41.880 20.112 1.00 9.06  ? 294 HIS A CB  1 
ATOM   2288 C  CG  . HIS A 1 295 ? 25.685  42.099 21.594 1.00 9.32  ? 294 HIS A CG  1 
ATOM   2289 N  ND1 . HIS A 1 295 ? 25.542  41.074 22.503 1.00 8.58  ? 294 HIS A ND1 1 
ATOM   2290 C  CD2 . HIS A 1 295 ? 25.900  43.221 22.322 1.00 9.14  ? 294 HIS A CD2 1 
ATOM   2291 C  CE1 . HIS A 1 295 ? 25.644  41.558 23.728 1.00 9.35  ? 294 HIS A CE1 1 
ATOM   2292 N  NE2 . HIS A 1 295 ? 25.853  42.860 23.647 1.00 9.19  ? 294 HIS A NE2 1 
ATOM   2293 N  N   . LEU A 1 296 ? 27.646  39.427 20.190 1.00 8.63  ? 295 LEU A N   1 
ATOM   2294 C  CA  . LEU A 1 296 ? 28.421  38.390 20.886 1.00 8.60  ? 295 LEU A CA  1 
ATOM   2295 C  C   . LEU A 1 296 ? 29.877  38.609 20.615 1.00 8.27  ? 295 LEU A C   1 
ATOM   2296 O  O   . LEU A 1 296 ? 30.712  38.550 21.531 1.00 8.00  ? 295 LEU A O   1 
ATOM   2297 C  CB  . LEU A 1 296 ? 28.005  37.008 20.362 1.00 9.14  ? 295 LEU A CB  1 
ATOM   2298 C  CG  . LEU A 1 296 ? 27.719  35.746 21.183 1.00 11.26 ? 295 LEU A CG  1 
ATOM   2299 C  CD1 . LEU A 1 296 ? 27.033  35.996 22.519 1.00 11.63 ? 295 LEU A CD1 1 
ATOM   2300 C  CD2 . LEU A 1 296 ? 26.882  34.806 20.333 1.00 11.68 ? 295 LEU A CD2 1 
ATOM   2301 N  N   . ASP A 1 297 ? 30.188  38.870 19.348 1.00 8.09  ? 296 ASP A N   1 
ATOM   2302 C  CA  . ASP A 1 297 ? 31.572  39.081 18.944 1.00 8.71  ? 296 ASP A CA  1 
ATOM   2303 C  C   . ASP A 1 297 ? 32.193  40.334 19.570 1.00 8.77  ? 296 ASP A C   1 
ATOM   2304 O  O   . ASP A 1 297 ? 33.352  40.303 19.960 1.00 8.37  ? 296 ASP A O   1 
ATOM   2305 C  CB  . ASP A 1 297 ? 31.714  39.146 17.420 1.00 8.88  ? 296 ASP A CB  1 
ATOM   2306 C  CG  . ASP A 1 297 ? 33.161  39.019 16.982 1.00 10.10 ? 296 ASP A CG  1 
ATOM   2307 O  OD1 . ASP A 1 297 ? 33.607  37.869 16.850 1.00 9.95  ? 296 ASP A OD1 1 
ATOM   2308 O  OD2 . ASP A 1 297 ? 33.869  40.050 16.806 1.00 10.94 ? 296 ASP A OD2 1 
ATOM   2309 N  N   . ILE A 1 298 ? 31.414  41.419 19.648 1.00 9.32  ? 297 ILE A N   1 
ATOM   2310 C  CA  . ILE A 1 298 ? 31.893  42.683 20.192 1.00 9.90  ? 297 ILE A CA  1 
ATOM   2311 C  C   . ILE A 1 298 ? 31.960  42.727 21.727 1.00 10.65 ? 297 ILE A C   1 
ATOM   2312 O  O   . ILE A 1 298 ? 32.882  43.375 22.275 1.00 9.89  ? 297 ILE A O   1 
ATOM   2313 C  CB  . ILE A 1 298 ? 31.112  43.903 19.663 1.00 9.61  ? 297 ILE A CB  1 
ATOM   2314 C  CG1 . ILE A 1 298 ? 31.999  45.166 19.682 1.00 9.83  ? 297 ILE A CG1 1 
ATOM   2315 C  CG2 . ILE A 1 298 ? 29.866  44.142 20.490 1.00 10.21 ? 297 ILE A CG2 1 
ATOM   2316 C  CD1 . ILE A 1 298 ? 33.417  44.992 19.016 1.00 9.13  ? 297 ILE A CD1 1 
ATOM   2317 N  N   . GLU A 1 299 ? 30.999  42.072 22.415 1.00 11.04 ? 298 GLU A N   1 
ATOM   2318 C  CA  . GLU A 1 299 ? 31.136  41.960 23.880 1.00 11.63 ? 298 GLU A CA  1 
ATOM   2319 C  C   . GLU A 1 299 ? 32.294  41.060 24.287 1.00 11.07 ? 298 GLU A C   1 
ATOM   2320 O  O   . GLU A 1 299 ? 33.035  41.385 25.212 1.00 11.81 ? 298 GLU A O   1 
ATOM   2321 C  CB  . GLU A 1 299 ? 29.836  41.659 24.663 1.00 11.26 ? 298 GLU A CB  1 
ATOM   2322 C  CG  . GLU A 1 299 ? 29.116  40.440 24.304 1.00 13.03 ? 298 GLU A CG  1 
ATOM   2323 C  CD  . GLU A 1 299 ? 28.233  39.883 25.434 1.00 11.98 ? 298 GLU A CD  1 
ATOM   2324 O  OE1 . GLU A 1 299 ? 28.030  38.651 25.432 1.00 12.12 ? 298 GLU A OE1 1 
ATOM   2325 O  OE2 . GLU A 1 299 ? 27.742  40.643 26.292 1.00 9.99  ? 298 GLU A OE2 1 
ATOM   2326 N  N   . ALA A 1 300 ? 32.481  39.969 23.562 1.00 10.88 ? 299 ALA A N   1 
ATOM   2327 C  CA  . ALA A 1 300 ? 33.611  39.056 23.810 1.00 10.59 ? 299 ALA A CA  1 
ATOM   2328 C  C   . ALA A 1 300 ? 34.973  39.714 23.635 1.00 10.59 ? 299 ALA A C   1 
ATOM   2329 O  O   . ALA A 1 300 ? 35.904  39.340 24.317 1.00 10.58 ? 299 ALA A O   1 
ATOM   2330 C  CB  . ALA A 1 300 ? 33.505  37.833 22.947 1.00 9.67  ? 299 ALA A CB  1 
ATOM   2331 N  N   . PHE A 1 301 ? 35.063  40.704 22.741 1.00 11.22 ? 300 PHE A N   1 
ATOM   2332 C  CA  . PHE A 1 301 ? 36.303  41.461 22.442 1.00 11.14 ? 300 PHE A CA  1 
ATOM   2333 C  C   . PHE A 1 301 ? 36.616  42.571 23.476 1.00 10.95 ? 300 PHE A C   1 
ATOM   2334 O  O   . PHE A 1 301 ? 37.759  43.029 23.616 1.00 10.87 ? 300 PHE A O   1 
ATOM   2335 C  CB  . PHE A 1 301 ? 36.152  42.094 21.045 1.00 11.06 ? 300 PHE A CB  1 
ATOM   2336 C  CG  . PHE A 1 301 ? 37.461  42.507 20.384 1.00 11.47 ? 300 PHE A CG  1 
ATOM   2337 C  CD1 . PHE A 1 301 ? 38.432  41.560 20.055 1.00 11.80 ? 300 PHE A CD1 1 
ATOM   2338 C  CD2 . PHE A 1 301 ? 37.685  43.831 20.031 1.00 8.47  ? 300 PHE A CD2 1 
ATOM   2339 C  CE1 . PHE A 1 301 ? 39.616  41.948 19.432 1.00 11.57 ? 300 PHE A CE1 1 
ATOM   2340 C  CE2 . PHE A 1 301 ? 38.860  44.222 19.414 1.00 7.00  ? 300 PHE A CE2 1 
ATOM   2341 C  CZ  . PHE A 1 301 ? 39.824  43.293 19.116 1.00 9.51  ? 300 PHE A CZ  1 
ATOM   2342 N  N   . THR A 1 302 ? 35.586  42.996 24.190 1.00 10.53 ? 301 THR A N   1 
ATOM   2343 C  CA  . THR A 1 302 ? 35.653  44.191 25.014 1.00 10.66 ? 301 THR A CA  1 
ATOM   2344 C  C   . THR A 1 302 ? 35.296  43.926 26.454 1.00 10.64 ? 301 THR A C   1 
ATOM   2345 O  O   . THR A 1 302 ? 35.263  44.861 27.249 1.00 10.82 ? 301 THR A O   1 
ATOM   2346 C  CB  . THR A 1 302 ? 34.661  45.273 24.537 1.00 9.96  ? 301 THR A CB  1 
ATOM   2347 O  OG1 . THR A 1 302 ? 33.367  44.692 24.395 1.00 10.45 ? 301 THR A OG1 1 
ATOM   2348 C  CG2 . THR A 1 302 ? 35.096  45.836 23.202 1.00 11.19 ? 301 THR A CG2 1 
ATOM   2349 N  N   . MET A 1 303 ? 34.995  42.672 26.781 1.00 10.33 ? 302 MET A N   1 
ATOM   2350 C  CA  . MET A 1 303 ? 34.581  42.337 28.123 1.00 10.89 ? 302 MET A CA  1 
ATOM   2351 C  C   . MET A 1 303 ? 35.606  41.452 28.848 1.00 10.20 ? 302 MET A C   1 
ATOM   2352 O  O   . MET A 1 303 ? 36.299  40.628 28.232 1.00 9.55  ? 302 MET A O   1 
ATOM   2353 C  CB  . MET A 1 303 ? 33.186  41.699 28.126 1.00 10.81 ? 302 MET A CB  1 
ATOM   2354 C  CG  . MET A 1 303 ? 32.468  41.853 29.493 1.00 12.31 ? 302 MET A CG  1 
ATOM   2355 S  SD  . MET A 1 303 ? 30.806  41.203 29.493 1.00 13.41 ? 302 MET A SD  1 
ATOM   2356 C  CE  . MET A 1 303 ? 29.937  42.621 28.909 1.00 12.58 ? 302 MET A CE  1 
ATOM   2357 N  N   . ASP A 1 304 ? 35.703  41.659 30.157 1.00 9.71  ? 303 ASP A N   1 
ATOM   2358 C  CA  . ASP A 1 304 ? 36.552  40.854 30.991 1.00 9.51  ? 303 ASP A CA  1 
ATOM   2359 C  C   . ASP A 1 304 ? 35.970  39.467 31.023 1.00 9.63  ? 303 ASP A C   1 
ATOM   2360 O  O   . ASP A 1 304 ? 34.749  39.287 30.988 1.00 10.56 ? 303 ASP A O   1 
ATOM   2361 C  CB  . ASP A 1 304 ? 36.659  41.423 32.413 1.00 9.64  ? 303 ASP A CB  1 
ATOM   2362 C  CG  . ASP A 1 304 ? 37.344  40.447 33.367 1.00 9.48  ? 303 ASP A CG  1 
ATOM   2363 O  OD1 . ASP A 1 304 ? 38.596  40.400 33.377 1.00 9.49  ? 303 ASP A OD1 1 
ATOM   2364 O  OD2 . ASP A 1 304 ? 36.625  39.700 34.062 1.00 7.70  ? 303 ASP A OD2 1 
ATOM   2365 N  N   . ARG A 1 305 ? 36.849  38.481 31.080 1.00 9.96  ? 304 ARG A N   1 
ATOM   2366 C  CA  . ARG A 1 305 ? 36.444  37.094 30.992 1.00 9.78  ? 304 ARG A CA  1 
ATOM   2367 C  C   . ARG A 1 305 ? 35.463  36.720 32.097 1.00 9.79  ? 304 ARG A C   1 
ATOM   2368 O  O   . ARG A 1 305 ? 34.553  35.917 31.869 1.00 9.92  ? 304 ARG A O   1 
ATOM   2369 C  CB  . ARG A 1 305 ? 37.665  36.181 31.097 1.00 9.34  ? 304 ARG A CB  1 
ATOM   2370 C  CG  . ARG A 1 305 ? 37.278  34.699 31.104 1.00 8.74  ? 304 ARG A CG  1 
ATOM   2371 C  CD  . ARG A 1 305 ? 38.491  33.837 31.333 1.00 8.73  ? 304 ARG A CD  1 
ATOM   2372 N  NE  . ARG A 1 305 ? 38.879  33.828 32.743 1.00 9.44  ? 304 ARG A NE  1 
ATOM   2373 C  CZ  . ARG A 1 305 ? 40.010  33.307 33.209 1.00 6.34  ? 304 ARG A CZ  1 
ATOM   2374 N  NH1 . ARG A 1 305 ? 40.909  32.757 32.393 1.00 2.96  ? 304 ARG A NH1 1 
ATOM   2375 N  NH2 . ARG A 1 305 ? 40.221  33.324 34.503 1.00 2.41  ? 304 ARG A NH2 1 
ATOM   2376 N  N   . GLU A 1 306 ? 35.697  37.263 33.289 1.00 9.48  ? 305 GLU A N   1 
ATOM   2377 C  CA  . GLU A 1 306 ? 34.985  36.832 34.460 1.00 10.29 ? 305 GLU A CA  1 
ATOM   2378 C  C   . GLU A 1 306 ? 33.736  37.678 34.637 1.00 11.12 ? 305 GLU A C   1 
ATOM   2379 O  O   . GLU A 1 306 ? 32.704  37.179 35.085 1.00 11.72 ? 305 GLU A O   1 
ATOM   2380 C  CB  . GLU A 1 306 ? 35.881  36.850 35.694 1.00 10.54 ? 305 GLU A CB  1 
ATOM   2381 C  CG  . GLU A 1 306 ? 37.081  35.907 35.622 1.00 9.53  ? 305 GLU A CG  1 
ATOM   2382 C  CD  . GLU A 1 306 ? 36.688  34.453 35.614 1.00 11.43 ? 305 GLU A CD  1 
ATOM   2383 O  OE1 . GLU A 1 306 ? 35.738  34.090 36.340 1.00 15.50 ? 305 GLU A OE1 1 
ATOM   2384 O  OE2 . GLU A 1 306 ? 37.337  33.659 34.902 1.00 10.72 ? 305 GLU A OE2 1 
ATOM   2385 N  N   . VAL A 1 307 ? 33.788  38.938 34.224 1.00 11.65 ? 306 VAL A N   1 
ATOM   2386 C  CA  . VAL A 1 307 ? 32.541  39.698 34.155 1.00 12.41 ? 306 VAL A CA  1 
ATOM   2387 C  C   . VAL A 1 307 ? 31.563  38.922 33.253 1.00 12.93 ? 306 VAL A C   1 
ATOM   2388 O  O   . VAL A 1 307 ? 30.395  38.741 33.607 1.00 13.19 ? 306 VAL A O   1 
ATOM   2389 C  CB  . VAL A 1 307 ? 32.740  41.208 33.748 1.00 12.26 ? 306 VAL A CB  1 
ATOM   2390 C  CG1 . VAL A 1 307 ? 31.395  41.920 33.571 1.00 12.46 ? 306 VAL A CG1 1 
ATOM   2391 C  CG2 . VAL A 1 307 ? 33.564  41.954 34.810 1.00 10.46 ? 306 VAL A CG2 1 
ATOM   2392 N  N   . ARG A 1 308 ? 32.079  38.381 32.148 1.00 12.96 ? 307 ARG A N   1 
ATOM   2393 C  CA  . ARG A 1 308 ? 31.251  37.752 31.121 1.00 12.85 ? 307 ARG A CA  1 
ATOM   2394 C  C   . ARG A 1 308 ? 30.378  36.577 31.576 1.00 13.07 ? 307 ARG A C   1 
ATOM   2395 O  O   . ARG A 1 308 ? 29.227  36.482 31.172 1.00 12.70 ? 307 ARG A O   1 
ATOM   2396 C  CB  . ARG A 1 308 ? 32.115  37.345 29.939 1.00 12.35 ? 307 ARG A CB  1 
ATOM   2397 C  CG  . ARG A 1 308 ? 31.315  37.172 28.680 1.00 13.68 ? 307 ARG A CG  1 
ATOM   2398 C  CD  . ARG A 1 308 ? 32.086  36.394 27.636 1.00 13.79 ? 307 ARG A CD  1 
ATOM   2399 N  NE  . ARG A 1 308 ? 31.284  36.189 26.437 1.00 12.18 ? 307 ARG A NE  1 
ATOM   2400 C  CZ  . ARG A 1 308 ? 30.439  35.176 26.247 1.00 14.47 ? 307 ARG A CZ  1 
ATOM   2401 N  NH1 . ARG A 1 308 ? 30.246  34.248 27.189 1.00 12.62 ? 307 ARG A NH1 1 
ATOM   2402 N  NH2 . ARG A 1 308 ? 29.754  35.106 25.106 1.00 16.11 ? 307 ARG A NH2 1 
ATOM   2403 N  N   . LYS A 1 309 ? 30.927  35.688 32.405 1.00 13.38 ? 308 LYS A N   1 
ATOM   2404 C  CA  . LYS A 1 309 ? 30.198  34.504 32.872 1.00 14.05 ? 308 LYS A CA  1 
ATOM   2405 C  C   . LYS A 1 309 ? 29.128  34.826 33.894 1.00 13.46 ? 308 LYS A C   1 
ATOM   2406 O  O   . LYS A 1 309 ? 28.114  34.138 33.974 1.00 14.81 ? 308 LYS A O   1 
ATOM   2407 C  CB  . LYS A 1 309 ? 31.143  33.460 33.476 1.00 13.81 ? 308 LYS A CB  1 
ATOM   2408 C  CG  . LYS A 1 309 ? 32.516  33.448 32.862 1.00 17.22 ? 308 LYS A CG  1 
ATOM   2409 C  CD  . LYS A 1 309 ? 33.557  33.374 33.968 1.00 20.54 ? 308 LYS A CD  1 
ATOM   2410 C  CE  . LYS A 1 309 ? 34.050  31.960 34.175 1.00 21.25 ? 308 LYS A CE  1 
ATOM   2411 N  NZ  . LYS A 1 309 ? 35.503  31.875 33.827 1.00 23.08 ? 308 LYS A NZ  1 
ATOM   2412 N  N   . ILE A 1 310 ? 29.388  35.834 34.708 1.00 13.17 ? 309 ILE A N   1 
ATOM   2413 C  CA  . ILE A 1 310 ? 28.415  36.363 35.652 1.00 12.62 ? 309 ILE A CA  1 
ATOM   2414 C  C   . ILE A 1 310 ? 27.312  37.058 34.871 1.00 12.59 ? 309 ILE A C   1 
ATOM   2415 O  O   . ILE A 1 310 ? 26.129  36.870 35.152 1.00 13.09 ? 309 ILE A O   1 
ATOM   2416 C  CB  . ILE A 1 310 ? 29.071  37.362 36.644 1.00 12.05 ? 309 ILE A CB  1 
ATOM   2417 C  CG1 . ILE A 1 310 ? 30.144  36.657 37.486 1.00 11.33 ? 309 ILE A CG1 1 
ATOM   2418 C  CG2 . ILE A 1 310 ? 28.023  38.026 37.513 1.00 11.19 ? 309 ILE A CG2 1 
ATOM   2419 C  CD1 . ILE A 1 310 ? 31.156  37.632 38.179 1.00 12.03 ? 309 ILE A CD1 1 
ATOM   2420 N  N   . LYS A 1 311 ? 27.716  37.848 33.883 1.00 12.41 ? 310 LYS A N   1 
ATOM   2421 C  CA  . LYS A 1 311 ? 26.791  38.594 33.042 1.00 12.56 ? 310 LYS A CA  1 
ATOM   2422 C  C   . LYS A 1 311 ? 25.900  37.647 32.236 1.00 11.85 ? 310 LYS A C   1 
ATOM   2423 O  O   . LYS A 1 311 ? 24.699  37.877 32.090 1.00 11.87 ? 310 LYS A O   1 
ATOM   2424 C  CB  . LYS A 1 311 ? 27.570  39.563 32.140 1.00 12.87 ? 310 LYS A CB  1 
ATOM   2425 C  CG  . LYS A 1 311 ? 26.713  40.416 31.227 1.00 13.80 ? 310 LYS A CG  1 
ATOM   2426 C  CD  . LYS A 1 311 ? 26.519  39.766 29.877 1.00 15.31 ? 310 LYS A CD  1 
ATOM   2427 C  CE  . LYS A 1 311 ? 25.324  40.342 29.128 1.00 16.74 ? 310 LYS A CE  1 
ATOM   2428 N  NZ  . LYS A 1 311 ? 25.248  39.786 27.740 1.00 17.01 ? 310 LYS A NZ  1 
ATOM   2429 N  N   . GLN A 1 312 ? 26.479  36.563 31.748 1.00 11.68 ? 311 GLN A N   1 
ATOM   2430 C  CA  . GLN A 1 312 ? 25.734  35.617 30.926 1.00 11.50 ? 311 GLN A CA  1 
ATOM   2431 C  C   . GLN A 1 312 ? 24.703  34.812 31.712 1.00 11.14 ? 311 GLN A C   1 
ATOM   2432 O  O   . GLN A 1 312 ? 23.732  34.308 31.137 1.00 11.65 ? 311 GLN A O   1 
ATOM   2433 C  CB  . GLN A 1 312 ? 26.689  34.695 30.150 1.00 11.93 ? 311 GLN A CB  1 
ATOM   2434 C  CG  . GLN A 1 312 ? 27.415  35.381 28.996 1.00 12.21 ? 311 GLN A CG  1 
ATOM   2435 C  CD  . GLN A 1 312 ? 26.496  35.752 27.861 1.00 14.32 ? 311 GLN A CD  1 
ATOM   2436 O  OE1 . GLN A 1 312 ? 26.433  35.054 26.856 1.00 13.28 ? 311 GLN A OE1 1 
ATOM   2437 N  NE2 . GLN A 1 312 ? 25.774  36.854 28.014 1.00 15.38 ? 311 GLN A NE2 1 
ATOM   2438 N  N   . GLY A 1 313 ? 24.937  34.660 33.014 1.00 10.31 ? 312 GLY A N   1 
ATOM   2439 C  CA  . GLY A 1 313 ? 23.974  34.034 33.901 1.00 8.74  ? 312 GLY A CA  1 
ATOM   2440 C  C   . GLY A 1 313 ? 22.788  34.967 34.027 1.00 8.19  ? 312 GLY A C   1 
ATOM   2441 O  O   . GLY A 1 313 ? 21.651  34.516 34.060 1.00 8.33  ? 312 GLY A O   1 
ATOM   2442 N  N   . LEU A 1 314 ? 23.058  36.268 34.110 1.00 7.65  ? 313 LEU A N   1 
ATOM   2443 C  CA  . LEU A 1 314 ? 21.996  37.272 34.267 1.00 7.99  ? 313 LEU A CA  1 
ATOM   2444 C  C   . LEU A 1 314 ? 21.139  37.323 33.011 1.00 7.89  ? 313 LEU A C   1 
ATOM   2445 O  O   . LEU A 1 314 ? 19.918  37.353 33.116 1.00 7.69  ? 313 LEU A O   1 
ATOM   2446 C  CB  . LEU A 1 314 ? 22.561  38.677 34.564 1.00 8.02  ? 313 LEU A CB  1 
ATOM   2447 C  CG  . LEU A 1 314 ? 23.387  38.854 35.838 1.00 9.49  ? 313 LEU A CG  1 
ATOM   2448 C  CD1 . LEU A 1 314 ? 24.163  40.170 35.848 1.00 8.58  ? 313 LEU A CD1 1 
ATOM   2449 C  CD2 . LEU A 1 314 ? 22.518  38.713 37.085 1.00 10.61 ? 313 LEU A CD2 1 
ATOM   2450 N  N   . GLY A 1 315 ? 21.792  37.325 31.837 1.00 7.74  ? 314 GLY A N   1 
ATOM   2451 C  CA  . GLY A 1 315 ? 21.120  37.238 30.546 1.00 7.89  ? 314 GLY A CA  1 
ATOM   2452 C  C   . GLY A 1 315 ? 20.202  36.031 30.430 1.00 8.90  ? 314 GLY A C   1 
ATOM   2453 O  O   . GLY A 1 315 ? 19.038  36.152 30.011 1.00 8.13  ? 314 GLY A O   1 
ATOM   2454 N  N   . LEU A 1 316 ? 20.719  34.865 30.819 1.00 9.50  ? 315 LEU A N   1 
ATOM   2455 C  CA  . LEU A 1 316 ? 19.931  33.647 30.837 1.00 10.88 ? 315 LEU A CA  1 
ATOM   2456 C  C   . LEU A 1 316 ? 18.685  33.877 31.662 1.00 11.28 ? 315 LEU A C   1 
ATOM   2457 O  O   . LEU A 1 316 ? 17.602  33.442 31.284 1.00 11.74 ? 315 LEU A O   1 
ATOM   2458 C  CB  . LEU A 1 316 ? 20.722  32.469 31.429 1.00 11.28 ? 315 LEU A CB  1 
ATOM   2459 C  CG  . LEU A 1 316 ? 21.540  31.594 30.474 1.00 13.78 ? 315 LEU A CG  1 
ATOM   2460 C  CD1 . LEU A 1 316 ? 22.081  30.334 31.159 1.00 11.31 ? 315 LEU A CD1 1 
ATOM   2461 C  CD2 . LEU A 1 316 ? 20.716  31.224 29.211 1.00 14.50 ? 315 LEU A CD2 1 
ATOM   2462 N  N   . LYS A 1 317 ? 18.851  34.571 32.785 1.00 11.47 ? 316 LYS A N   1 
ATOM   2463 C  CA  . LYS A 1 317 ? 17.736  34.878 33.671 1.00 11.86 ? 316 LYS A CA  1 
ATOM   2464 C  C   . LYS A 1 317 ? 16.781  35.828 32.966 1.00 11.68 ? 316 LYS A C   1 
ATOM   2465 O  O   . LYS A 1 317 ? 15.581  35.575 32.927 1.00 11.69 ? 316 LYS A O   1 
ATOM   2466 C  CB  . LYS A 1 317 ? 18.222  35.406 35.035 1.00 11.07 ? 316 LYS A CB  1 
ATOM   2467 C  CG  . LYS A 1 317 ? 17.171  35.384 36.120 1.00 14.17 ? 316 LYS A CG  1 
ATOM   2468 C  CD  . LYS A 1 317 ? 16.638  33.950 36.405 1.00 17.69 ? 316 LYS A CD  1 
ATOM   2469 C  CE  . LYS A 1 317 ? 15.188  33.965 36.948 1.00 17.72 ? 316 LYS A CE  1 
ATOM   2470 N  NZ  . LYS A 1 317 ? 14.545  32.580 36.982 1.00 17.30 ? 316 LYS A NZ  1 
ATOM   2471 N  N   . PHE A 1 318 ? 17.329  36.891 32.374 1.00 12.10 ? 317 PHE A N   1 
ATOM   2472 C  CA  . PHE A 1 318 ? 16.567  37.810 31.488 1.00 11.90 ? 317 PHE A CA  1 
ATOM   2473 C  C   . PHE A 1 318 ? 15.721  37.103 30.429 1.00 11.48 ? 317 PHE A C   1 
ATOM   2474 O  O   . PHE A 1 318 ? 14.567  37.453 30.237 1.00 11.61 ? 317 PHE A O   1 
ATOM   2475 C  CB  . PHE A 1 318 ? 17.494  38.831 30.804 1.00 11.89 ? 317 PHE A CB  1 
ATOM   2476 C  CG  . PHE A 1 318 ? 16.791  39.706 29.771 1.00 12.15 ? 317 PHE A CG  1 
ATOM   2477 C  CD1 . PHE A 1 318 ? 16.179  40.903 30.149 1.00 11.05 ? 317 PHE A CD1 1 
ATOM   2478 C  CD2 . PHE A 1 318 ? 16.742  39.326 28.429 1.00 12.02 ? 317 PHE A CD2 1 
ATOM   2479 C  CE1 . PHE A 1 318 ? 15.530  41.691 29.207 1.00 11.19 ? 317 PHE A CE1 1 
ATOM   2480 C  CE2 . PHE A 1 318 ? 16.096  40.116 27.477 1.00 11.38 ? 317 PHE A CE2 1 
ATOM   2481 C  CZ  . PHE A 1 318 ? 15.497  41.301 27.859 1.00 11.07 ? 317 PHE A CZ  1 
ATOM   2482 N  N   . ALA A 1 319 ? 16.294  36.119 29.744 1.00 11.35 ? 318 ALA A N   1 
ATOM   2483 C  CA  . ALA A 1 319 ? 15.581  35.430 28.663 1.00 11.57 ? 318 ALA A CA  1 
ATOM   2484 C  C   . ALA A 1 319 ? 14.320  34.687 29.164 1.00 11.63 ? 318 ALA A C   1 
ATOM   2485 O  O   . ALA A 1 319 ? 13.256  34.734 28.522 1.00 11.67 ? 318 ALA A O   1 
ATOM   2486 C  CB  . ALA A 1 319 ? 16.511  34.496 27.910 1.00 10.38 ? 318 ALA A CB  1 
ATOM   2487 N  N   . GLU A 1 320 ? 14.459  34.032 30.317 1.00 11.43 ? 319 GLU A N   1 
ATOM   2488 C  CA  . GLU A 1 320 ? 13.389  33.298 30.941 1.00 12.01 ? 319 GLU A CA  1 
ATOM   2489 C  C   . GLU A 1 320 ? 12.310  34.240 31.517 1.00 11.30 ? 319 GLU A C   1 
ATOM   2490 O  O   . GLU A 1 320 ? 11.117  33.905 31.517 1.00 11.80 ? 319 GLU A O   1 
ATOM   2491 C  CB  . GLU A 1 320 ? 13.964  32.424 32.039 1.00 12.32 ? 319 GLU A CB  1 
ATOM   2492 C  CG  . GLU A 1 320 ? 13.168  31.167 32.307 1.00 16.34 ? 319 GLU A CG  1 
ATOM   2493 C  CD  . GLU A 1 320 ? 12.853  30.978 33.792 1.00 23.89 ? 319 GLU A CD  1 
ATOM   2494 O  OE1 . GLU A 1 320 ? 13.512  30.113 34.426 1.00 25.95 ? 319 GLU A OE1 1 
ATOM   2495 O  OE2 . GLU A 1 320 ? 11.945  31.694 34.326 1.00 24.56 ? 319 GLU A OE2 1 
ATOM   2496 N  N   . LEU A 1 321 ? 12.728  35.408 32.001 1.00 10.16 ? 320 LEU A N   1 
ATOM   2497 C  CA  . LEU A 1 321 ? 11.797  36.357 32.609 1.00 9.31  ? 320 LEU A CA  1 
ATOM   2498 C  C   . LEU A 1 321 ? 10.926  37.032 31.553 1.00 9.03  ? 320 LEU A C   1 
ATOM   2499 O  O   . LEU A 1 321 ? 9.732   37.198 31.724 1.00 8.97  ? 320 LEU A O   1 
ATOM   2500 C  CB  . LEU A 1 321 ? 12.546  37.385 33.455 1.00 8.50  ? 320 LEU A CB  1 
ATOM   2501 C  CG  . LEU A 1 321 ? 13.134  36.932 34.795 1.00 5.89  ? 320 LEU A CG  1 
ATOM   2502 C  CD1 . LEU A 1 321 ? 14.133  37.920 35.299 1.00 3.15  ? 320 LEU A CD1 1 
ATOM   2503 C  CD2 . LEU A 1 321 ? 12.069  36.735 35.802 1.00 3.72  ? 320 LEU A CD2 1 
ATOM   2504 N  N   . VAL A 1 322 ? 11.549  37.406 30.453 1.00 8.94  ? 321 VAL A N   1 
ATOM   2505 C  CA  . VAL A 1 322 ? 10.846  37.895 29.276 1.00 8.62  ? 321 VAL A CA  1 
ATOM   2506 C  C   . VAL A 1 322 ? 9.892   36.829 28.628 1.00 9.12  ? 321 VAL A C   1 
ATOM   2507 O  O   . VAL A 1 322 ? 8.716   37.114 28.352 1.00 8.38  ? 321 VAL A O   1 
ATOM   2508 C  CB  . VAL A 1 322 ? 11.878  38.352 28.260 1.00 8.11  ? 321 VAL A CB  1 
ATOM   2509 C  CG1 . VAL A 1 322 ? 11.195  38.817 26.992 1.00 9.28  ? 321 VAL A CG1 1 
ATOM   2510 C  CG2 . VAL A 1 322 ? 12.776  39.438 28.877 1.00 6.45  ? 321 VAL A CG2 1 
ATOM   2511 N  N   . TYR A 1 323 ? 10.396  35.612 28.402 1.00 8.81  ? 322 TYR A N   1 
ATOM   2512 C  CA  . TYR A 1 323 ? 9.557   34.558 27.815 1.00 9.08  ? 322 TYR A CA  1 
ATOM   2513 C  C   . TYR A 1 323 ? 8.289   34.275 28.617 1.00 9.47  ? 322 TYR A C   1 
ATOM   2514 O  O   . TYR A 1 323 ? 7.193   34.111 28.027 1.00 10.12 ? 322 TYR A O   1 
ATOM   2515 C  CB  . TYR A 1 323 ? 10.333  33.257 27.592 1.00 8.48  ? 322 TYR A CB  1 
ATOM   2516 C  CG  . TYR A 1 323 ? 9.506   32.177 26.901 1.00 9.12  ? 322 TYR A CG  1 
ATOM   2517 C  CD1 . TYR A 1 323 ? 9.381   32.151 25.511 1.00 7.01  ? 322 TYR A CD1 1 
ATOM   2518 C  CD2 . TYR A 1 323 ? 8.865   31.170 27.642 1.00 7.81  ? 322 TYR A CD2 1 
ATOM   2519 C  CE1 . TYR A 1 323 ? 8.641   31.180 24.886 1.00 8.26  ? 322 TYR A CE1 1 
ATOM   2520 C  CE2 . TYR A 1 323 ? 8.121   30.183 27.007 1.00 7.51  ? 322 TYR A CE2 1 
ATOM   2521 C  CZ  . TYR A 1 323 ? 8.015   30.190 25.634 1.00 8.21  ? 322 TYR A CZ  1 
ATOM   2522 O  OH  . TYR A 1 323 ? 7.263   29.215 24.999 1.00 8.38  ? 322 TYR A OH  1 
ATOM   2523 N  N   . THR A 1 324 ? 8.436   34.208 29.943 1.00 9.24  ? 323 THR A N   1 
ATOM   2524 C  CA  . THR A 1 324 ? 7.324   33.876 30.828 1.00 9.73  ? 323 THR A CA  1 
ATOM   2525 C  C   . THR A 1 324 ? 6.407   35.072 31.145 1.00 10.73 ? 323 THR A C   1 
ATOM   2526 O  O   . THR A 1 324 ? 5.325   34.888 31.684 1.00 11.82 ? 323 THR A O   1 
ATOM   2527 C  CB  . THR A 1 324 ? 7.817   33.214 32.122 1.00 10.15 ? 323 THR A CB  1 
ATOM   2528 O  OG1 . THR A 1 324 ? 8.665   34.111 32.833 1.00 11.34 ? 323 THR A OG1 1 
ATOM   2529 C  CG2 . THR A 1 324 ? 8.621   31.926 31.832 1.00 8.84  ? 323 THR A CG2 1 
ATOM   2530 N  N   . GLY A 1 325 ? 6.822   36.302 30.817 1.00 10.39 ? 324 GLY A N   1 
ATOM   2531 C  CA  . GLY A 1 325 ? 5.935   37.435 30.959 1.00 9.55  ? 324 GLY A CA  1 
ATOM   2532 C  C   . GLY A 1 325 ? 6.226   38.371 32.097 1.00 10.00 ? 324 GLY A C   1 
ATOM   2533 O  O   . GLY A 1 325 ? 5.364   39.193 32.444 1.00 9.77  ? 324 GLY A O   1 
ATOM   2534 N  N   . PHE A 1 326 ? 7.438   38.277 32.651 1.00 9.56  ? 325 PHE A N   1 
ATOM   2535 C  CA  . PHE A 1 326 ? 7.838   39.057 33.823 1.00 9.30  ? 325 PHE A CA  1 
ATOM   2536 C  C   . PHE A 1 326 ? 8.739   40.257 33.533 1.00 10.20 ? 325 PHE A C   1 
ATOM   2537 O  O   . PHE A 1 326 ? 9.591   40.610 34.374 1.00 11.34 ? 325 PHE A O   1 
ATOM   2538 C  CB  . PHE A 1 326 ? 8.532   38.148 34.855 1.00 9.51  ? 325 PHE A CB  1 
ATOM   2539 C  CG  . PHE A 1 326 ? 7.600   37.165 35.532 1.00 7.79  ? 325 PHE A CG  1 
ATOM   2540 C  CD1 . PHE A 1 326 ? 7.068   37.444 36.772 1.00 7.15  ? 325 PHE A CD1 1 
ATOM   2541 C  CD2 . PHE A 1 326 ? 7.253   35.979 34.926 1.00 7.21  ? 325 PHE A CD2 1 
ATOM   2542 C  CE1 . PHE A 1 326 ? 6.198   36.538 37.400 1.00 6.84  ? 325 PHE A CE1 1 
ATOM   2543 C  CE2 . PHE A 1 326 ? 6.375   35.074 35.554 1.00 7.80  ? 325 PHE A CE2 1 
ATOM   2544 C  CZ  . PHE A 1 326 ? 5.857   35.362 36.777 1.00 6.96  ? 325 PHE A CZ  1 
ATOM   2545 N  N   . TRP A 1 327 ? 8.571   40.900 32.373 1.00 9.97  ? 326 TRP A N   1 
ATOM   2546 C  CA  . TRP A 1 327 ? 9.340   42.095 32.060 1.00 9.49  ? 326 TRP A CA  1 
ATOM   2547 C  C   . TRP A 1 327 ? 9.105   43.148 33.119 1.00 10.11 ? 326 TRP A C   1 
ATOM   2548 O  O   . TRP A 1 327 ? 10.070  43.780 33.604 1.00 11.88 ? 326 TRP A O   1 
ATOM   2549 C  CB  . TRP A 1 327 ? 8.963   42.685 30.692 1.00 9.53  ? 326 TRP A CB  1 
ATOM   2550 C  CG  . TRP A 1 327 ? 9.710   44.000 30.358 1.00 10.03 ? 326 TRP A CG  1 
ATOM   2551 C  CD1 . TRP A 1 327 ? 9.421   45.265 30.823 1.00 9.88  ? 326 TRP A CD1 1 
ATOM   2552 C  CD2 . TRP A 1 327 ? 10.858  44.148 29.513 1.00 8.44  ? 326 TRP A CD2 1 
ATOM   2553 N  NE1 . TRP A 1 327 ? 10.304  46.174 30.311 1.00 8.44  ? 326 TRP A NE1 1 
ATOM   2554 C  CE2 . TRP A 1 327 ? 11.202  45.514 29.509 1.00 9.36  ? 326 TRP A CE2 1 
ATOM   2555 C  CE3 . TRP A 1 327 ? 11.622  43.259 28.755 1.00 8.39  ? 326 TRP A CE3 1 
ATOM   2556 C  CZ2 . TRP A 1 327 ? 12.278  46.012 28.764 1.00 9.14  ? 326 TRP A CZ2 1 
ATOM   2557 C  CZ3 . TRP A 1 327 ? 12.686  43.753 28.024 1.00 9.56  ? 326 TRP A CZ3 1 
ATOM   2558 C  CH2 . TRP A 1 327 ? 13.013  45.119 28.043 1.00 10.03 ? 326 TRP A CH2 1 
ATOM   2559 N  N   . HIS A 1 328 ? 7.835   43.390 33.440 1.00 8.93  ? 327 HIS A N   1 
ATOM   2560 C  CA  . HIS A 1 328 ? 7.496   44.389 34.428 1.00 8.21  ? 327 HIS A CA  1 
ATOM   2561 C  C   . HIS A 1 328 ? 7.486   43.732 35.790 1.00 8.38  ? 327 HIS A C   1 
ATOM   2562 O  O   . HIS A 1 328 ? 6.437   43.465 36.352 1.00 8.48  ? 327 HIS A O   1 
ATOM   2563 C  CB  . HIS A 1 328 ? 6.158   45.077 34.118 1.00 7.73  ? 327 HIS A CB  1 
ATOM   2564 C  CG  . HIS A 1 328 ? 6.148   45.821 32.819 1.00 5.76  ? 327 HIS A CG  1 
ATOM   2565 N  ND1 . HIS A 1 328 ? 6.898   46.958 32.603 1.00 8.12  ? 327 HIS A ND1 1 
ATOM   2566 C  CD2 . HIS A 1 328 ? 5.492   45.585 31.661 1.00 3.17  ? 327 HIS A CD2 1 
ATOM   2567 C  CE1 . HIS A 1 328 ? 6.688   47.400 31.372 1.00 6.02  ? 327 HIS A CE1 1 
ATOM   2568 N  NE2 . HIS A 1 328 ? 5.848   46.576 30.776 1.00 3.60  ? 327 HIS A NE2 1 
ATOM   2569 N  N   . SER A 1 329 ? 8.670   43.448 36.307 1.00 8.06  ? 328 SER A N   1 
ATOM   2570 C  CA  . SER A 1 329 ? 8.785   42.874 37.647 1.00 8.46  ? 328 SER A CA  1 
ATOM   2571 C  C   . SER A 1 329 ? 10.048  43.417 38.324 1.00 8.25  ? 328 SER A C   1 
ATOM   2572 O  O   . SER A 1 329 ? 10.943  43.878 37.649 1.00 8.47  ? 328 SER A O   1 
ATOM   2573 C  CB  . SER A 1 329 ? 8.783   41.342 37.601 1.00 8.20  ? 328 SER A CB  1 
ATOM   2574 O  OG  . SER A 1 329 ? 9.950   40.801 36.992 1.00 8.47  ? 328 SER A OG  1 
ATOM   2575 N  N   . PRO A 1 330 ? 10.095  43.412 39.666 1.00 8.62  ? 329 PRO A N   1 
ATOM   2576 C  CA  . PRO A 1 330 ? 11.356  43.820 40.273 1.00 8.68  ? 329 PRO A CA  1 
ATOM   2577 C  C   . PRO A 1 330 ? 12.542  42.956 39.815 1.00 9.49  ? 329 PRO A C   1 
ATOM   2578 O  O   . PRO A 1 330 ? 13.627  43.498 39.613 1.00 10.22 ? 329 PRO A O   1 
ATOM   2579 C  CB  . PRO A 1 330 ? 11.095  43.676 41.773 1.00 8.12  ? 329 PRO A CB  1 
ATOM   2580 C  CG  . PRO A 1 330 ? 9.814   42.950 41.888 1.00 7.52  ? 329 PRO A CG  1 
ATOM   2581 C  CD  . PRO A 1 330 ? 9.055   43.124 40.669 1.00 7.59  ? 329 PRO A CD  1 
ATOM   2582 N  N   . GLU A 1 331 ? 12.362  41.649 39.625 1.00 9.52  ? 330 GLU A N   1 
ATOM   2583 C  CA  . GLU A 1 331 ? 13.522  40.824 39.246 1.00 10.63 ? 330 GLU A CA  1 
ATOM   2584 C  C   . GLU A 1 331 ? 14.079  41.082 37.833 1.00 10.51 ? 330 GLU A C   1 
ATOM   2585 O  O   . GLU A 1 331 ? 15.312  41.032 37.617 1.00 10.65 ? 330 GLU A O   1 
ATOM   2586 C  CB  . GLU A 1 331 ? 13.273  39.323 39.471 1.00 10.80 ? 330 GLU A CB  1 
ATOM   2587 C  CG  . GLU A 1 331 ? 12.185  38.715 38.601 1.00 12.77 ? 330 GLU A CG  1 
ATOM   2588 C  CD  . GLU A 1 331 ? 10.796  38.822 39.188 1.00 13.74 ? 330 GLU A CD  1 
ATOM   2589 O  OE1 . GLU A 1 331 ? 10.549  39.747 39.992 1.00 13.10 ? 330 GLU A OE1 1 
ATOM   2590 O  OE2 . GLU A 1 331 ? 9.955   37.960 38.843 1.00 14.30 ? 330 GLU A OE2 1 
ATOM   2591 N  N   . CYS A 1 332 ? 13.193  41.338 36.873 1.00 10.25 ? 331 CYS A N   1 
ATOM   2592 C  CA  . CYS A 1 332 ? 13.661  41.677 35.530 1.00 10.78 ? 331 CYS A CA  1 
ATOM   2593 C  C   . CYS A 1 332 ? 14.236  43.108 35.506 1.00 11.54 ? 331 CYS A C   1 
ATOM   2594 O  O   . CYS A 1 332 ? 15.166  43.414 34.759 1.00 11.51 ? 331 CYS A O   1 
ATOM   2595 C  CB  . CYS A 1 332 ? 12.575  41.479 34.488 1.00 10.46 ? 331 CYS A CB  1 
ATOM   2596 S  SG  . CYS A 1 332 ? 13.222  41.171 32.845 1.00 9.35  ? 331 CYS A SG  1 
ATOM   2597 N  N   . GLU A 1 333 ? 13.712  43.976 36.361 1.00 12.39 ? 332 GLU A N   1 
ATOM   2598 C  CA  . GLU A 1 333 ? 14.227  45.330 36.414 1.00 13.49 ? 332 GLU A CA  1 
ATOM   2599 C  C   . GLU A 1 333 ? 15.667  45.365 36.946 1.00 13.27 ? 332 GLU A C   1 
ATOM   2600 O  O   . GLU A 1 333 ? 16.516  46.004 36.348 1.00 14.00 ? 332 GLU A O   1 
ATOM   2601 C  CB  . GLU A 1 333 ? 13.320  46.240 37.228 1.00 13.52 ? 332 GLU A CB  1 
ATOM   2602 C  CG  . GLU A 1 333 ? 13.642  47.709 36.977 1.00 16.68 ? 332 GLU A CG  1 
ATOM   2603 C  CD  . GLU A 1 333 ? 12.744  48.623 37.749 1.00 22.04 ? 332 GLU A CD  1 
ATOM   2604 O  OE1 . GLU A 1 333 ? 12.513  48.339 38.940 1.00 25.52 ? 332 GLU A OE1 1 
ATOM   2605 O  OE2 . GLU A 1 333 ? 12.254  49.619 37.177 1.00 24.96 ? 332 GLU A OE2 1 
ATOM   2606 N  N   . PHE A 1 334 ? 15.906  44.705 38.080 1.00 12.75 ? 333 PHE A N   1 
ATOM   2607 C  CA  . PHE A 1 334 ? 17.251  44.456 38.618 1.00 12.15 ? 333 PHE A CA  1 
ATOM   2608 C  C   . PHE A 1 334 ? 18.177  43.776 37.596 1.00 12.07 ? 333 PHE A C   1 
ATOM   2609 O  O   . PHE A 1 334 ? 19.325  44.163 37.458 1.00 12.69 ? 333 PHE A O   1 
ATOM   2610 C  CB  . PHE A 1 334 ? 17.160  43.616 39.922 1.00 10.77 ? 333 PHE A CB  1 
ATOM   2611 C  CG  . PHE A 1 334 ? 18.498  43.268 40.539 1.00 9.05  ? 333 PHE A CG  1 
ATOM   2612 C  CD1 . PHE A 1 334 ? 19.340  44.262 41.037 1.00 7.09  ? 333 PHE A CD1 1 
ATOM   2613 C  CD2 . PHE A 1 334 ? 18.893  41.937 40.668 1.00 8.16  ? 333 PHE A CD2 1 
ATOM   2614 C  CE1 . PHE A 1 334 ? 20.577  43.955 41.624 1.00 4.89  ? 333 PHE A CE1 1 
ATOM   2615 C  CE2 . PHE A 1 334 ? 20.112  41.605 41.251 1.00 7.82  ? 333 PHE A CE2 1 
ATOM   2616 C  CZ  . PHE A 1 334 ? 20.976  42.632 41.723 1.00 8.00  ? 333 PHE A CZ  1 
ATOM   2617 N  N   . VAL A 1 335 ? 17.687  42.752 36.908 1.00 12.35 ? 334 VAL A N   1 
ATOM   2618 C  CA  . VAL A 1 335 ? 18.496  42.032 35.921 1.00 12.40 ? 334 VAL A CA  1 
ATOM   2619 C  C   . VAL A 1 335 ? 18.854  42.907 34.715 1.00 11.80 ? 334 VAL A C   1 
ATOM   2620 O  O   . VAL A 1 335 ? 20.012  42.920 34.282 1.00 11.60 ? 334 VAL A O   1 
ATOM   2621 C  CB  . VAL A 1 335 ? 17.819  40.705 35.483 1.00 13.19 ? 334 VAL A CB  1 
ATOM   2622 C  CG1 . VAL A 1 335 ? 18.288  40.273 34.105 1.00 13.83 ? 334 VAL A CG1 1 
ATOM   2623 C  CG2 . VAL A 1 335 ? 18.125  39.576 36.501 1.00 13.87 ? 334 VAL A CG2 1 
ATOM   2624 N  N   . ARG A 1 336 ? 17.877  43.659 34.197 1.00 10.99 ? 335 ARG A N   1 
ATOM   2625 C  CA  . ARG A 1 336 ? 18.145  44.612 33.117 1.00 10.50 ? 335 ARG A CA  1 
ATOM   2626 C  C   . ARG A 1 336 ? 19.177  45.683 33.516 1.00 11.00 ? 335 ARG A C   1 
ATOM   2627 O  O   . ARG A 1 336 ? 19.995  46.132 32.678 1.00 10.28 ? 335 ARG A O   1 
ATOM   2628 C  CB  . ARG A 1 336 ? 16.860  45.253 32.579 1.00 10.70 ? 335 ARG A CB  1 
ATOM   2629 C  CG  . ARG A 1 336 ? 15.951  44.289 31.795 1.00 9.65  ? 335 ARG A CG  1 
ATOM   2630 C  CD  . ARG A 1 336 ? 14.831  45.003 31.079 1.00 9.46  ? 335 ARG A CD  1 
ATOM   2631 N  NE  . ARG A 1 336 ? 14.156  45.995 31.907 1.00 7.76  ? 335 ARG A NE  1 
ATOM   2632 C  CZ  . ARG A 1 336 ? 13.006  45.805 32.547 1.00 8.73  ? 335 ARG A CZ  1 
ATOM   2633 N  NH1 . ARG A 1 336 ? 12.353  44.653 32.466 1.00 10.51 ? 335 ARG A NH1 1 
ATOM   2634 N  NH2 . ARG A 1 336 ? 12.493  46.783 33.277 1.00 9.64  ? 335 ARG A NH2 1 
ATOM   2635 N  N   . HIS A 1 337 ? 19.142  46.066 34.792 1.00 10.70 ? 336 HIS A N   1 
ATOM   2636 C  CA  . HIS A 1 337 ? 20.039  47.072 35.307 1.00 11.31 ? 336 HIS A CA  1 
ATOM   2637 C  C   . HIS A 1 337 ? 21.459  46.527 35.354 1.00 11.25 ? 336 HIS A C   1 
ATOM   2638 O  O   . HIS A 1 337 ? 22.394  47.194 34.928 1.00 12.33 ? 336 HIS A O   1 
ATOM   2639 C  CB  . HIS A 1 337 ? 19.582  47.569 36.683 1.00 11.57 ? 336 HIS A CB  1 
ATOM   2640 C  CG  . HIS A 1 337 ? 20.580  48.468 37.342 1.00 13.40 ? 336 HIS A CG  1 
ATOM   2641 N  ND1 . HIS A 1 337 ? 21.692  47.986 38.008 1.00 14.80 ? 336 HIS A ND1 1 
ATOM   2642 C  CD2 . HIS A 1 337 ? 20.684  49.815 37.366 1.00 14.53 ? 336 HIS A CD2 1 
ATOM   2643 C  CE1 . HIS A 1 337 ? 22.423  48.995 38.432 1.00 12.50 ? 336 HIS A CE1 1 
ATOM   2644 N  NE2 . HIS A 1 337 ? 21.839  50.115 38.052 1.00 14.97 ? 336 HIS A NE2 1 
ATOM   2645 N  N   . CYS A 1 338 ? 21.611  45.299 35.832 1.00 11.33 ? 337 CYS A N   1 
ATOM   2646 C  CA  . CYS A 1 338 ? 22.927  44.614 35.924 1.00 11.00 ? 337 CYS A CA  1 
ATOM   2647 C  C   . CYS A 1 338 ? 23.546  44.343 34.557 1.00 10.83 ? 337 CYS A C   1 
ATOM   2648 O  O   . CYS A 1 338 ? 24.728  44.583 34.346 1.00 10.88 ? 337 CYS A O   1 
ATOM   2649 C  CB  . CYS A 1 338 ? 22.790  43.319 36.720 1.00 10.33 ? 337 CYS A CB  1 
ATOM   2650 S  SG  . CYS A 1 338 ? 22.329  43.627 38.451 1.00 12.64 ? 337 CYS A SG  1 
ATOM   2651 N  N   . ILE A 1 339 ? 22.714  43.856 33.635 1.00 10.92 ? 338 ILE A N   1 
ATOM   2652 C  CA  . ILE A 1 339 ? 23.062  43.676 32.223 1.00 9.96  ? 338 ILE A CA  1 
ATOM   2653 C  C   . ILE A 1 339 ? 23.500  44.980 31.532 1.00 9.64  ? 338 ILE A C   1 
ATOM   2654 O  O   . ILE A 1 339 ? 24.531  44.978 30.852 1.00 9.08  ? 338 ILE A O   1 
ATOM   2655 C  CB  . ILE A 1 339 ? 21.893  43.025 31.478 1.00 9.80  ? 338 ILE A CB  1 
ATOM   2656 C  CG1 . ILE A 1 339 ? 21.763  41.566 31.912 1.00 8.42  ? 338 ILE A CG1 1 
ATOM   2657 C  CG2 . ILE A 1 339 ? 22.077  43.128 29.979 1.00 10.91 ? 338 ILE A CG2 1 
ATOM   2658 C  CD1 . ILE A 1 339 ? 20.477  40.948 31.546 1.00 7.78  ? 338 ILE A CD1 1 
ATOM   2659 N  N   . ALA A 1 340 ? 22.739  46.074 31.728 1.00 8.88  ? 339 ALA A N   1 
ATOM   2660 C  CA  . ALA A 1 340 ? 23.107  47.407 31.228 1.00 8.90  ? 339 ALA A CA  1 
ATOM   2661 C  C   . ALA A 1 340 ? 24.480  47.872 31.716 1.00 9.39  ? 339 ALA A C   1 
ATOM   2662 O  O   . ALA A 1 340 ? 25.227  48.513 30.981 1.00 8.99  ? 339 ALA A O   1 
ATOM   2663 C  CB  . ALA A 1 340 ? 22.040  48.458 31.621 1.00 9.34  ? 339 ALA A CB  1 
ATOM   2664 N  N   . LYS A 1 341 ? 24.776  47.563 32.981 1.00 9.72  ? 340 LYS A N   1 
ATOM   2665 C  CA  . LYS A 1 341 ? 25.980  48.006 33.648 1.00 9.59  ? 340 LYS A CA  1 
ATOM   2666 C  C   . LYS A 1 341 ? 27.200  47.335 33.048 1.00 9.56  ? 340 LYS A C   1 
ATOM   2667 O  O   . LYS A 1 341 ? 28.230  47.984 32.825 1.00 9.92  ? 340 LYS A O   1 
ATOM   2668 C  CB  . LYS A 1 341 ? 25.877  47.738 35.164 1.00 10.47 ? 340 LYS A CB  1 
ATOM   2669 C  CG  . LYS A 1 341 ? 27.144  48.058 35.966 1.00 11.22 ? 340 LYS A CG  1 
ATOM   2670 C  CD  . LYS A 1 341 ? 27.455  49.565 35.962 1.00 12.35 ? 340 LYS A CD  1 
ATOM   2671 C  CE  . LYS A 1 341 ? 28.855  49.866 36.532 1.00 14.14 ? 340 LYS A CE  1 
ATOM   2672 N  NZ  . LYS A 1 341 ? 29.247  51.315 36.392 1.00 14.39 ? 340 LYS A NZ  1 
ATOM   2673 N  N   . SER A 1 342 ? 27.089  46.038 32.792 1.00 9.57  ? 341 SER A N   1 
ATOM   2674 C  CA  . SER A 1 342 ? 28.139  45.263 32.090 1.00 9.27  ? 341 SER A CA  1 
ATOM   2675 C  C   . SER A 1 342 ? 28.479  45.786 30.688 1.00 10.06 ? 341 SER A C   1 
ATOM   2676 O  O   . SER A 1 342 ? 29.576  45.555 30.185 1.00 9.88  ? 341 SER A O   1 
ATOM   2677 C  CB  . SER A 1 342 ? 27.683  43.805 31.973 1.00 9.62  ? 341 SER A CB  1 
ATOM   2678 O  OG  . SER A 1 342 ? 26.763  43.600 30.894 1.00 7.41  ? 341 SER A OG  1 
ATOM   2679 N  N   . GLN A 1 343 ? 27.541  46.515 30.065 1.00 10.52 ? 342 GLN A N   1 
ATOM   2680 C  CA  . GLN A 1 343 ? 27.688  46.911 28.665 1.00 10.99 ? 342 GLN A CA  1 
ATOM   2681 C  C   . GLN A 1 343 ? 28.375  48.249 28.469 1.00 12.00 ? 342 GLN A C   1 
ATOM   2682 O  O   . GLN A 1 343 ? 28.596  48.663 27.339 1.00 11.52 ? 342 GLN A O   1 
ATOM   2683 C  CB  . GLN A 1 343 ? 26.345  46.904 27.929 1.00 10.23 ? 342 GLN A CB  1 
ATOM   2684 C  CG  . GLN A 1 343 ? 25.633  45.576 27.898 1.00 9.59  ? 342 GLN A CG  1 
ATOM   2685 C  CD  . GLN A 1 343 ? 26.374  44.506 27.105 1.00 11.26 ? 342 GLN A CD  1 
ATOM   2686 O  OE1 . GLN A 1 343 ? 26.413  44.536 25.875 1.00 12.49 ? 342 GLN A OE1 1 
ATOM   2687 N  NE2 . GLN A 1 343 ? 26.922  43.529 27.805 1.00 10.30 ? 342 GLN A NE2 1 
ATOM   2688 N  N   . GLU A 1 344 ? 28.724  48.909 29.570 1.00 13.40 ? 343 GLU A N   1 
ATOM   2689 C  CA  . GLU A 1 344 ? 29.307  50.249 29.523 1.00 15.64 ? 343 GLU A CA  1 
ATOM   2690 C  C   . GLU A 1 344 ? 30.465  50.412 28.548 1.00 15.17 ? 343 GLU A C   1 
ATOM   2691 O  O   . GLU A 1 344 ? 30.590  51.469 27.935 1.00 16.08 ? 343 GLU A O   1 
ATOM   2692 C  CB  . GLU A 1 344 ? 29.739  50.708 30.918 1.00 15.50 ? 343 GLU A CB  1 
ATOM   2693 C  CG  . GLU A 1 344 ? 28.572  51.137 31.806 1.00 17.80 ? 343 GLU A CG  1 
ATOM   2694 C  CD  . GLU A 1 344 ? 29.033  51.828 33.093 1.00 19.53 ? 343 GLU A CD  1 
ATOM   2695 O  OE1 . GLU A 1 344 ? 30.236  51.683 33.479 1.00 23.59 ? 343 GLU A OE1 1 
ATOM   2696 O  OE2 . GLU A 1 344 ? 28.180  52.522 33.711 1.00 24.40 ? 343 GLU A OE2 1 
ATOM   2697 N  N   . ARG A 1 345 ? 31.300  49.387 28.430 1.00 14.82 ? 344 ARG A N   1 
ATOM   2698 C  CA  . ARG A 1 345 ? 32.447  49.377 27.522 1.00 15.78 ? 344 ARG A CA  1 
ATOM   2699 C  C   . ARG A 1 345 ? 32.211  48.564 26.244 1.00 15.32 ? 344 ARG A C   1 
ATOM   2700 O  O   . ARG A 1 345 ? 33.128  48.411 25.439 1.00 15.30 ? 344 ARG A O   1 
ATOM   2701 C  CB  . ARG A 1 345 ? 33.675  48.756 28.210 1.00 15.74 ? 344 ARG A CB  1 
ATOM   2702 C  CG  . ARG A 1 345 ? 34.287  49.552 29.380 1.00 17.19 ? 344 ARG A CG  1 
ATOM   2703 C  CD  . ARG A 1 345 ? 35.333  48.668 30.148 1.00 18.03 ? 344 ARG A CD  1 
ATOM   2704 N  NE  . ARG A 1 345 ? 36.702  48.728 29.622 1.00 18.75 ? 344 ARG A NE  1 
ATOM   2705 C  CZ  . ARG A 1 345 ? 37.166  48.072 28.554 1.00 20.75 ? 344 ARG A CZ  1 
ATOM   2706 N  NH1 . ARG A 1 345 ? 36.392  47.283 27.809 1.00 21.07 ? 344 ARG A NH1 1 
ATOM   2707 N  NH2 . ARG A 1 345 ? 38.439  48.225 28.208 1.00 23.17 ? 344 ARG A NH2 1 
ATOM   2708 N  N   . VAL A 1 346 ? 31.012  48.009 26.073 1.00 14.63 ? 345 VAL A N   1 
ATOM   2709 C  CA  . VAL A 1 346 ? 30.744  47.196 24.916 1.00 14.48 ? 345 VAL A CA  1 
ATOM   2710 C  C   . VAL A 1 346 ? 30.496  48.124 23.710 1.00 14.98 ? 345 VAL A C   1 
ATOM   2711 O  O   . VAL A 1 346 ? 29.413  48.695 23.531 1.00 14.93 ? 345 VAL A O   1 
ATOM   2712 C  CB  . VAL A 1 346 ? 29.629  46.158 25.195 1.00 14.67 ? 345 VAL A CB  1 
ATOM   2713 C  CG1 . VAL A 1 346 ? 29.287  45.369 23.937 1.00 14.55 ? 345 VAL A CG1 1 
ATOM   2714 C  CG2 . VAL A 1 346 ? 30.057  45.178 26.324 1.00 12.77 ? 345 VAL A CG2 1 
ATOM   2715 N  N   . GLU A 1 347 ? 31.558  48.314 22.929 1.00 15.47 ? 346 GLU A N   1 
ATOM   2716 C  CA  . GLU A 1 347 ? 31.578  49.240 21.799 1.00 15.76 ? 346 GLU A CA  1 
ATOM   2717 C  C   . GLU A 1 347 ? 32.706  48.891 20.853 1.00 15.19 ? 346 GLU A C   1 
ATOM   2718 O  O   . GLU A 1 347 ? 33.750  48.376 21.272 1.00 15.29 ? 346 GLU A O   1 
ATOM   2719 C  CB  . GLU A 1 347 ? 31.729  50.700 22.273 1.00 16.44 ? 346 GLU A CB  1 
ATOM   2720 C  CG  . GLU A 1 347 ? 33.132  51.143 22.788 1.00 15.92 ? 346 GLU A CG  1 
ATOM   2721 C  CD  . GLU A 1 347 ? 33.163  52.648 23.109 1.00 17.90 ? 346 GLU A CD  1 
ATOM   2722 O  OE1 . GLU A 1 347 ? 33.801  53.436 22.347 1.00 16.67 ? 346 GLU A OE1 1 
ATOM   2723 O  OE2 . GLU A 1 347 ? 32.512  53.043 24.119 1.00 21.81 ? 346 GLU A OE2 1 
ATOM   2724 N  N   . GLY A 1 348 ? 32.494  49.193 19.580 1.00 14.79 ? 347 GLY A N   1 
ATOM   2725 C  CA  . GLY A 1 348 ? 33.473  48.957 18.524 1.00 13.83 ? 347 GLY A CA  1 
ATOM   2726 C  C   . GLY A 1 348 ? 32.754  48.662 17.222 1.00 13.85 ? 347 GLY A C   1 
ATOM   2727 O  O   . GLY A 1 348 ? 31.597  49.039 17.048 1.00 13.60 ? 347 GLY A O   1 
ATOM   2728 N  N   . LYS A 1 349 ? 33.440  47.963 16.324 1.00 14.03 ? 348 LYS A N   1 
ATOM   2729 C  CA  . LYS A 1 349 ? 32.988  47.748 14.947 1.00 14.06 ? 348 LYS A CA  1 
ATOM   2730 C  C   . LYS A 1 349 ? 33.172  46.278 14.564 1.00 13.61 ? 348 LYS A C   1 
ATOM   2731 O  O   . LYS A 1 349 ? 34.236  45.699 14.802 1.00 13.23 ? 348 LYS A O   1 
ATOM   2732 C  CB  . LYS A 1 349 ? 33.789  48.646 13.975 1.00 14.23 ? 348 LYS A CB  1 
ATOM   2733 C  CG  . LYS A 1 349 ? 33.607  50.133 14.204 1.00 14.39 ? 348 LYS A CG  1 
ATOM   2734 C  CD  . LYS A 1 349 ? 33.725  50.884 12.900 1.00 18.21 ? 348 LYS A CD  1 
ATOM   2735 C  CE  . LYS A 1 349 ? 34.922  51.816 12.862 1.00 19.18 ? 348 LYS A CE  1 
ATOM   2736 N  NZ  . LYS A 1 349 ? 34.512  53.143 13.325 1.00 19.87 ? 348 LYS A NZ  1 
ATOM   2737 N  N   . VAL A 1 350 ? 32.122  45.667 14.025 1.00 13.10 ? 349 VAL A N   1 
ATOM   2738 C  CA  . VAL A 1 350 ? 32.182  44.277 13.631 1.00 12.83 ? 349 VAL A CA  1 
ATOM   2739 C  C   . VAL A 1 350 ? 31.926  44.215 12.130 1.00 13.67 ? 349 VAL A C   1 
ATOM   2740 O  O   . VAL A 1 350 ? 30.957  44.792 11.600 1.00 12.88 ? 349 VAL A O   1 
ATOM   2741 C  CB  . VAL A 1 350 ? 31.199  43.362 14.448 1.00 13.27 ? 349 VAL A CB  1 
ATOM   2742 C  CG1 . VAL A 1 350 ? 31.514  41.860 14.232 1.00 10.73 ? 349 VAL A CG1 1 
ATOM   2743 C  CG2 . VAL A 1 350 ? 31.289  43.681 15.945 1.00 13.44 ? 349 VAL A CG2 1 
ATOM   2744 N  N   . GLN A 1 351 ? 32.848  43.554 11.447 1.00 14.29 ? 350 GLN A N   1 
ATOM   2745 C  CA  . GLN A 1 351 ? 32.708  43.278 10.028 1.00 15.37 ? 350 GLN A CA  1 
ATOM   2746 C  C   . GLN A 1 351 ? 32.036  41.916 9.889  1.00 15.13 ? 350 GLN A C   1 
ATOM   2747 O  O   . GLN A 1 351 ? 32.481  40.929 10.497 1.00 14.77 ? 350 GLN A O   1 
ATOM   2748 C  CB  . GLN A 1 351 ? 34.085  43.312 9.356  1.00 15.73 ? 350 GLN A CB  1 
ATOM   2749 C  CG  . GLN A 1 351 ? 34.820  44.667 9.491  1.00 18.23 ? 350 GLN A CG  1 
ATOM   2750 C  CD  . GLN A 1 351 ? 36.130  44.586 10.286 1.00 24.16 ? 350 GLN A CD  1 
ATOM   2751 O  OE1 . GLN A 1 351 ? 37.064  43.816 9.935  1.00 25.50 ? 350 GLN A OE1 1 
ATOM   2752 N  NE2 . GLN A 1 351 ? 36.226  45.408 11.348 1.00 25.10 ? 350 GLN A NE2 1 
ATOM   2753 N  N   . VAL A 1 352 ? 30.946  41.878 9.121  1.00 15.35 ? 351 VAL A N   1 
ATOM   2754 C  CA  . VAL A 1 352 ? 30.087  40.674 9.001  1.00 15.25 ? 351 VAL A CA  1 
ATOM   2755 C  C   . VAL A 1 352 ? 29.694  40.466 7.553  1.00 16.11 ? 351 VAL A C   1 
ATOM   2756 O  O   . VAL A 1 352 ? 29.641  41.423 6.784  1.00 16.39 ? 351 VAL A O   1 
ATOM   2757 C  CB  . VAL A 1 352 ? 28.753  40.727 9.891  1.00 15.15 ? 351 VAL A CB  1 
ATOM   2758 C  CG1 . VAL A 1 352 ? 29.067  40.782 11.395 1.00 14.58 ? 351 VAL A CG1 1 
ATOM   2759 C  CG2 . VAL A 1 352 ? 27.839  41.902 9.507  1.00 13.84 ? 351 VAL A CG2 1 
ATOM   2760 N  N   . SER A 1 353 ? 29.400  39.218 7.196  1.00 16.43 ? 352 SER A N   1 
ATOM   2761 C  CA  . SER A 1 353 ? 28.982  38.866 5.858  1.00 17.05 ? 352 SER A CA  1 
ATOM   2762 C  C   . SER A 1 353 ? 27.677  38.099 5.944  1.00 17.81 ? 352 SER A C   1 
ATOM   2763 O  O   . SER A 1 353 ? 27.505  37.215 6.787  1.00 17.89 ? 352 SER A O   1 
ATOM   2764 C  CB  . SER A 1 353 ? 30.069  38.043 5.137  1.00 17.14 ? 352 SER A CB  1 
ATOM   2765 O  OG  . SER A 1 353 ? 29.688  37.721 3.810  1.00 17.79 ? 352 SER A OG  1 
ATOM   2766 N  N   . VAL A 1 354 ? 26.765  38.446 5.044  1.00 18.91 ? 353 VAL A N   1 
ATOM   2767 C  CA  . VAL A 1 354 ? 25.407  37.936 5.036  1.00 19.62 ? 353 VAL A CA  1 
ATOM   2768 C  C   . VAL A 1 354 ? 25.217  37.255 3.695  1.00 19.72 ? 353 VAL A C   1 
ATOM   2769 O  O   . VAL A 1 354 ? 25.184  37.912 2.661  1.00 19.90 ? 353 VAL A O   1 
ATOM   2770 C  CB  . VAL A 1 354 ? 24.358  39.075 5.163  1.00 19.82 ? 353 VAL A CB  1 
ATOM   2771 C  CG1 . VAL A 1 354 ? 23.036  38.498 5.586  1.00 20.84 ? 353 VAL A CG1 1 
ATOM   2772 C  CG2 . VAL A 1 354 ? 24.801  40.175 6.155  1.00 19.81 ? 353 VAL A CG2 1 
ATOM   2773 N  N   . LEU A 1 355 ? 25.095  35.933 3.724  1.00 20.11 ? 354 LEU A N   1 
ATOM   2774 C  CA  . LEU A 1 355 ? 25.035  35.135 2.520  1.00 19.90 ? 354 LEU A CA  1 
ATOM   2775 C  C   . LEU A 1 355 ? 24.373  33.774 2.778  1.00 20.39 ? 354 LEU A C   1 
ATOM   2776 O  O   . LEU A 1 355 ? 24.765  33.053 3.704  1.00 20.13 ? 354 LEU A O   1 
ATOM   2777 C  CB  . LEU A 1 355 ? 26.454  34.945 1.972  1.00 19.63 ? 354 LEU A CB  1 
ATOM   2778 C  CG  . LEU A 1 355 ? 26.648  34.045 0.758  1.00 18.70 ? 354 LEU A CG  1 
ATOM   2779 C  CD1 . LEU A 1 355 ? 26.467  34.868 -0.501 1.00 19.75 ? 354 LEU A CD1 1 
ATOM   2780 C  CD2 . LEU A 1 355 ? 28.027  33.377 0.822  1.00 17.78 ? 354 LEU A CD2 1 
ATOM   2781 N  N   . LYS A 1 356 ? 23.371  33.447 1.950  1.00 20.93 ? 355 LYS A N   1 
ATOM   2782 C  CA  . LYS A 1 356 ? 22.783  32.091 1.853  1.00 21.24 ? 355 LYS A CA  1 
ATOM   2783 C  C   . LYS A 1 356 ? 22.344  31.530 3.200  1.00 20.76 ? 355 LYS A C   1 
ATOM   2784 O  O   . LYS A 1 356 ? 22.739  30.412 3.596  1.00 21.38 ? 355 LYS A O   1 
ATOM   2785 C  CB  . LYS A 1 356 ? 23.756  31.096 1.158  1.00 21.79 ? 355 LYS A CB  1 
ATOM   2786 C  CG  . LYS A 1 356 ? 24.233  31.464 -0.278 1.00 22.25 ? 355 LYS A CG  1 
ATOM   2787 C  CD  . LYS A 1 356 ? 23.207  31.072 -1.307 1.00 23.36 ? 355 LYS A CD  1 
ATOM   2788 C  CE  . LYS A 1 356 ? 23.545  31.481 -2.758 1.00 23.86 ? 355 LYS A CE  1 
ATOM   2789 N  NZ  . LYS A 1 356 ? 22.403  31.001 -3.644 1.00 22.87 ? 355 LYS A NZ  1 
ATOM   2790 N  N   . GLY A 1 357 ? 21.533  32.309 3.907  1.00 19.91 ? 356 GLY A N   1 
ATOM   2791 C  CA  . GLY A 1 357 ? 20.934  31.857 5.171  1.00 18.60 ? 356 GLY A CA  1 
ATOM   2792 C  C   . GLY A 1 357 ? 21.884  31.827 6.350  1.00 17.70 ? 356 GLY A C   1 
ATOM   2793 O  O   . GLY A 1 357 ? 21.522  31.357 7.423  1.00 17.21 ? 356 GLY A O   1 
ATOM   2794 N  N   . GLN A 1 358 ? 23.091  32.353 6.160  1.00 17.11 ? 357 GLN A N   1 
ATOM   2795 C  CA  . GLN A 1 358 ? 24.080  32.425 7.229  1.00 16.68 ? 357 GLN A CA  1 
ATOM   2796 C  C   . GLN A 1 358 ? 24.685  33.814 7.381  1.00 15.93 ? 357 GLN A C   1 
ATOM   2797 O  O   . GLN A 1 358 ? 24.859  34.536 6.406  1.00 16.01 ? 357 GLN A O   1 
ATOM   2798 C  CB  . GLN A 1 358 ? 25.189  31.385 6.994  1.00 16.62 ? 357 GLN A CB  1 
ATOM   2799 C  CG  . GLN A 1 358 ? 26.169  31.248 8.126  1.00 17.03 ? 357 GLN A CG  1 
ATOM   2800 C  CD  . GLN A 1 358 ? 25.536  30.689 9.381  1.00 20.09 ? 357 GLN A CD  1 
ATOM   2801 O  OE1 . GLN A 1 358 ? 25.136  31.433 10.281 1.00 19.35 ? 357 GLN A OE1 1 
ATOM   2802 N  NE2 . GLN A 1 358 ? 25.437  29.366 9.448  1.00 20.92 ? 357 GLN A NE2 1 
ATOM   2803 N  N   . VAL A 1 359 ? 24.997  34.166 8.625  1.00 15.44 ? 358 VAL A N   1 
ATOM   2804 C  CA  . VAL A 1 359 ? 25.821  35.328 8.971  1.00 14.33 ? 358 VAL A CA  1 
ATOM   2805 C  C   . VAL A 1 359 ? 27.233  34.846 9.333  1.00 13.82 ? 358 VAL A C   1 
ATOM   2806 O  O   . VAL A 1 359 ? 27.375  33.835 10.047 1.00 13.78 ? 358 VAL A O   1 
ATOM   2807 C  CB  . VAL A 1 359 ? 25.263  36.072 10.208 1.00 14.06 ? 358 VAL A CB  1 
ATOM   2808 C  CG1 . VAL A 1 359 ? 25.952  37.424 10.364 1.00 14.94 ? 358 VAL A CG1 1 
ATOM   2809 C  CG2 . VAL A 1 359 ? 23.790  36.272 10.072 1.00 14.40 ? 358 VAL A CG2 1 
ATOM   2810 N  N   . TYR A 1 360 ? 28.252  35.589 8.875  1.00 12.83 ? 359 TYR A N   1 
ATOM   2811 C  CA  . TYR A 1 360 ? 29.658  35.328 9.202  1.00 12.00 ? 359 TYR A CA  1 
ATOM   2812 C  C   . TYR A 1 360 ? 30.346  36.555 9.779  1.00 11.40 ? 359 TYR A C   1 
ATOM   2813 O  O   . TYR A 1 360 ? 30.252  37.626 9.202  1.00 10.38 ? 359 TYR A O   1 
ATOM   2814 C  CB  . TYR A 1 360 ? 30.450  34.897 7.963  1.00 12.76 ? 359 TYR A CB  1 
ATOM   2815 C  CG  . TYR A 1 360 ? 29.867  33.708 7.248  1.00 12.95 ? 359 TYR A CG  1 
ATOM   2816 C  CD1 . TYR A 1 360 ? 28.901  33.889 6.274  1.00 15.02 ? 359 TYR A CD1 1 
ATOM   2817 C  CD2 . TYR A 1 360 ? 30.272  32.408 7.550  1.00 13.76 ? 359 TYR A CD2 1 
ATOM   2818 C  CE1 . TYR A 1 360 ? 28.325  32.823 5.621  1.00 15.24 ? 359 TYR A CE1 1 
ATOM   2819 C  CE2 . TYR A 1 360 ? 29.710  31.329 6.892  1.00 15.49 ? 359 TYR A CE2 1 
ATOM   2820 C  CZ  . TYR A 1 360 ? 28.734  31.564 5.914  1.00 14.66 ? 359 TYR A CZ  1 
ATOM   2821 O  OH  . TYR A 1 360 ? 28.140  30.551 5.230  1.00 15.54 ? 359 TYR A OH  1 
ATOM   2822 N  N   . ILE A 1 361 ? 31.040  36.370 10.912 1.00 10.51 ? 360 ILE A N   1 
ATOM   2823 C  CA  . ILE A 1 361 ? 31.942  37.370 11.487 1.00 9.55  ? 360 ILE A CA  1 
ATOM   2824 C  C   . ILE A 1 361 ? 33.266  37.391 10.706 1.00 10.00 ? 360 ILE A C   1 
ATOM   2825 O  O   . ILE A 1 361 ? 33.879  36.351 10.501 1.00 10.39 ? 360 ILE A O   1 
ATOM   2826 C  CB  . ILE A 1 361 ? 32.243  37.067 12.999 1.00 9.29  ? 360 ILE A CB  1 
ATOM   2827 C  CG1 . ILE A 1 361 ? 30.947  36.896 13.810 1.00 7.35  ? 360 ILE A CG1 1 
ATOM   2828 C  CG2 . ILE A 1 361 ? 33.195  38.117 13.603 1.00 5.92  ? 360 ILE A CG2 1 
ATOM   2829 C  CD1 . ILE A 1 361 ? 29.887  38.025 13.656 1.00 2.71  ? 360 ILE A CD1 1 
ATOM   2830 N  N   . LEU A 1 362 ? 33.695  38.564 10.266 1.00 10.20 ? 361 LEU A N   1 
ATOM   2831 C  CA  . LEU A 1 362 ? 34.906  38.677 9.436  1.00 11.21 ? 361 LEU A CA  1 
ATOM   2832 C  C   . LEU A 1 362 ? 36.087  39.314 10.179 1.00 10.84 ? 361 LEU A C   1 
ATOM   2833 O  O   . LEU A 1 362 ? 37.245  39.002 9.897  1.00 11.47 ? 361 LEU A O   1 
ATOM   2834 C  CB  . LEU A 1 362 ? 34.627  39.453 8.132  1.00 11.49 ? 361 LEU A CB  1 
ATOM   2835 C  CG  . LEU A 1 362 ? 33.486  38.999 7.191  1.00 12.47 ? 361 LEU A CG  1 
ATOM   2836 C  CD1 . LEU A 1 362 ? 33.132  40.138 6.278  1.00 12.04 ? 361 LEU A CD1 1 
ATOM   2837 C  CD2 . LEU A 1 362 ? 33.888  37.757 6.389  1.00 12.89 ? 361 LEU A CD2 1 
ATOM   2838 N  N   . GLY A 1 363 ? 35.780  40.188 11.126 1.00 10.24 ? 362 GLY A N   1 
ATOM   2839 C  CA  . GLY A 1 363 ? 36.777  40.892 11.892 1.00 10.27 ? 362 GLY A CA  1 
ATOM   2840 C  C   . GLY A 1 363 ? 36.106  41.851 12.852 1.00 10.52 ? 362 GLY A C   1 
ATOM   2841 O  O   . GLY A 1 363 ? 34.893  41.978 12.868 1.00 11.66 ? 362 GLY A O   1 
ATOM   2842 N  N   . ARG A 1 364 ? 36.899  42.507 13.678 1.00 10.25 ? 363 ARG A N   1 
ATOM   2843 C  CA  . ARG A 1 364 ? 36.379  43.425 14.665 1.00 10.20 ? 363 ARG A CA  1 
ATOM   2844 C  C   . ARG A 1 364 ? 37.542  44.287 15.214 1.00 11.18 ? 363 ARG A C   1 
ATOM   2845 O  O   . ARG A 1 364 ? 38.732  43.949 15.072 1.00 11.49 ? 363 ARG A O   1 
ATOM   2846 C  CB  . ARG A 1 364 ? 35.592  42.681 15.778 1.00 9.79  ? 363 ARG A CB  1 
ATOM   2847 C  CG  . ARG A 1 364 ? 36.380  42.074 16.944 1.00 8.12  ? 363 ARG A CG  1 
ATOM   2848 C  CD  . ARG A 1 364 ? 37.175  40.813 16.556 1.00 7.84  ? 363 ARG A CD  1 
ATOM   2849 N  NE  . ARG A 1 364 ? 36.297  39.699 16.152 1.00 7.39  ? 363 ARG A NE  1 
ATOM   2850 C  CZ  . ARG A 1 364 ? 36.695  38.628 15.465 1.00 6.80  ? 363 ARG A CZ  1 
ATOM   2851 N  NH1 . ARG A 1 364 ? 37.979  38.487 15.097 1.00 3.13  ? 363 ARG A NH1 1 
ATOM   2852 N  NH2 . ARG A 1 364 ? 35.808  37.672 15.183 1.00 2.82  ? 363 ARG A NH2 1 
ATOM   2853 N  N   . GLU A 1 365 ? 37.167  45.399 15.807 1.00 11.38 ? 364 GLU A N   1 
ATOM   2854 C  CA  . GLU A 1 365 ? 38.068  46.388 16.326 1.00 13.97 ? 364 GLU A CA  1 
ATOM   2855 C  C   . GLU A 1 365 ? 37.274  47.255 17.303 1.00 13.35 ? 364 GLU A C   1 
ATOM   2856 O  O   . GLU A 1 365 ? 36.039  47.318 17.242 1.00 12.57 ? 364 GLU A O   1 
ATOM   2857 C  CB  . GLU A 1 365 ? 38.670  47.251 15.198 1.00 13.51 ? 364 GLU A CB  1 
ATOM   2858 C  CG  . GLU A 1 365 ? 37.654  48.114 14.485 1.00 16.26 ? 364 GLU A CG  1 
ATOM   2859 C  CD  . GLU A 1 365 ? 38.276  49.049 13.475 1.00 18.25 ? 364 GLU A CD  1 
ATOM   2860 O  OE1 . GLU A 1 365 ? 39.180  49.836 13.863 1.00 22.33 ? 364 GLU A OE1 1 
ATOM   2861 O  OE2 . GLU A 1 365 ? 37.835  49.008 12.291 1.00 24.83 ? 364 GLU A OE2 1 
ATOM   2862 N  N   . SER A 1 366 ? 38.003  47.928 18.185 1.00 14.33 ? 365 SER A N   1 
ATOM   2863 C  CA  . SER A 1 366 ? 37.404  48.687 19.275 1.00 15.03 ? 365 SER A CA  1 
ATOM   2864 C  C   . SER A 1 366 ? 38.499  49.427 20.005 1.00 15.53 ? 365 SER A C   1 
ATOM   2865 O  O   . SER A 1 366 ? 39.535  48.826 20.309 1.00 15.58 ? 365 SER A O   1 
ATOM   2866 C  CB  . SER A 1 366 ? 36.732  47.751 20.269 1.00 15.12 ? 365 SER A CB  1 
ATOM   2867 O  OG  . SER A 1 366 ? 36.168  48.505 21.322 1.00 16.43 ? 365 SER A OG  1 
ATOM   2868 N  N   . PRO A 1 367 ? 38.278  50.728 20.292 1.00 15.86 ? 366 PRO A N   1 
ATOM   2869 C  CA  . PRO A 1 367 ? 39.180  51.522 21.130 1.00 15.92 ? 366 PRO A CA  1 
ATOM   2870 C  C   . PRO A 1 367 ? 39.147  51.108 22.611 1.00 15.89 ? 366 PRO A C   1 
ATOM   2871 O  O   . PRO A 1 367 ? 40.050  51.502 23.364 1.00 14.89 ? 366 PRO A O   1 
ATOM   2872 C  CB  . PRO A 1 367 ? 38.655  52.953 20.958 1.00 16.40 ? 366 PRO A CB  1 
ATOM   2873 C  CG  . PRO A 1 367 ? 37.176  52.773 20.661 1.00 17.32 ? 366 PRO A CG  1 
ATOM   2874 C  CD  . PRO A 1 367 ? 37.120  51.516 19.816 1.00 16.15 ? 366 PRO A CD  1 
ATOM   2875 N  N   . LEU A 1 368 ? 38.126  50.317 22.991 1.00 15.82 ? 367 LEU A N   1 
ATOM   2876 C  CA  . LEU A 1 368 ? 37.978  49.736 24.340 1.00 16.59 ? 367 LEU A CA  1 
ATOM   2877 C  C   . LEU A 1 368 ? 38.264  48.211 24.410 1.00 17.22 ? 367 LEU A C   1 
ATOM   2878 O  O   . LEU A 1 368 ? 37.966  47.532 25.420 1.00 17.84 ? 367 LEU A O   1 
ATOM   2879 C  CB  . LEU A 1 368 ? 36.601  50.061 24.946 1.00 16.30 ? 367 LEU A CB  1 
ATOM   2880 C  CG  . LEU A 1 368 ? 36.389  51.497 25.448 1.00 16.32 ? 367 LEU A CG  1 
ATOM   2881 C  CD1 . LEU A 1 368 ? 35.079  51.614 26.159 1.00 13.20 ? 367 LEU A CD1 1 
ATOM   2882 C  CD2 . LEU A 1 368 ? 37.529  51.905 26.387 1.00 18.75 ? 367 LEU A CD2 1 
ATOM   2883 N  N   . SER A 1 369 ? 38.840  47.700 23.324 1.00 16.72 ? 368 SER A N   1 
ATOM   2884 C  CA  . SER A 1 369 ? 39.390  46.368 23.230 1.00 15.82 ? 368 SER A CA  1 
ATOM   2885 C  C   . SER A 1 369 ? 40.188  45.945 24.464 1.00 15.82 ? 368 SER A C   1 
ATOM   2886 O  O   . SER A 1 369 ? 41.000  46.724 24.986 1.00 16.38 ? 368 SER A O   1 
ATOM   2887 C  CB  . SER A 1 369 ? 40.300  46.342 22.012 1.00 15.43 ? 368 SER A CB  1 
ATOM   2888 O  OG  . SER A 1 369 ? 40.852  45.061 21.795 1.00 15.99 ? 368 SER A OG  1 
ATOM   2889 N  N   . LEU A 1 370 ? 39.955  44.710 24.919 1.00 15.25 ? 369 LEU A N   1 
ATOM   2890 C  CA  . LEU A 1 370 ? 40.775  44.081 25.949 1.00 14.62 ? 369 LEU A CA  1 
ATOM   2891 C  C   . LEU A 1 370 ? 41.769  43.111 25.309 1.00 14.93 ? 369 LEU A C   1 
ATOM   2892 O  O   . LEU A 1 370 ? 42.445  42.328 25.978 1.00 14.97 ? 369 LEU A O   1 
ATOM   2893 C  CB  . LEU A 1 370 ? 39.905  43.372 26.986 1.00 14.43 ? 369 LEU A CB  1 
ATOM   2894 C  CG  . LEU A 1 370 ? 39.039  44.231 27.928 1.00 13.55 ? 369 LEU A CG  1 
ATOM   2895 C  CD1 . LEU A 1 370 ? 38.222  43.353 28.852 1.00 8.90  ? 369 LEU A CD1 1 
ATOM   2896 C  CD2 . LEU A 1 370 ? 39.834  45.271 28.709 1.00 9.52  ? 369 LEU A CD2 1 
ATOM   2897 N  N   . TYR A 1 371 ? 41.866  43.198 23.994 1.00 15.34 ? 370 TYR A N   1 
ATOM   2898 C  CA  . TYR A 1 371 ? 42.784  42.377 23.232 1.00 15.68 ? 370 TYR A CA  1 
ATOM   2899 C  C   . TYR A 1 371 ? 44.182  43.003 23.254 1.00 16.05 ? 370 TYR A C   1 
ATOM   2900 O  O   . TYR A 1 371 ? 44.341  44.228 23.238 1.00 15.65 ? 370 TYR A O   1 
ATOM   2901 C  CB  . TYR A 1 371 ? 42.253  42.177 21.792 1.00 15.69 ? 370 TYR A CB  1 
ATOM   2902 C  CG  . TYR A 1 371 ? 42.985  41.097 21.033 1.00 15.43 ? 370 TYR A CG  1 
ATOM   2903 C  CD1 . TYR A 1 371 ? 42.601  39.750 21.133 1.00 13.81 ? 370 TYR A CD1 1 
ATOM   2904 C  CD2 . TYR A 1 371 ? 44.102  41.419 20.241 1.00 13.46 ? 370 TYR A CD2 1 
ATOM   2905 C  CE1 . TYR A 1 371 ? 43.341  38.734 20.448 1.00 15.33 ? 370 TYR A CE1 1 
ATOM   2906 C  CE2 . TYR A 1 371 ? 44.825  40.437 19.572 1.00 14.09 ? 370 TYR A CE2 1 
ATOM   2907 C  CZ  . TYR A 1 371 ? 44.449  39.108 19.669 1.00 15.84 ? 370 TYR A CZ  1 
ATOM   2908 O  OH  . TYR A 1 371 ? 45.182  38.180 18.956 1.00 17.05 ? 370 TYR A OH  1 
ATOM   2909 N  N   . ASN A 1 372 ? 45.190  42.140 23.348 1.00 17.15 ? 371 ASN A N   1 
ATOM   2910 C  CA  . ASN A 1 372 ? 46.591  42.554 23.294 1.00 17.18 ? 371 ASN A CA  1 
ATOM   2911 C  C   . ASN A 1 372 ? 47.326  41.684 22.288 1.00 17.70 ? 371 ASN A C   1 
ATOM   2912 O  O   . ASN A 1 372 ? 47.751  40.587 22.581 1.00 17.41 ? 371 ASN A O   1 
ATOM   2913 C  CB  . ASN A 1 372 ? 47.255  42.488 24.676 1.00 16.93 ? 371 ASN A CB  1 
ATOM   2914 C  CG  . ASN A 1 372 ? 48.657  43.099 24.697 1.00 15.23 ? 371 ASN A CG  1 
ATOM   2915 O  OD1 . ASN A 1 372 ? 49.345  43.164 23.688 1.00 13.51 ? 371 ASN A OD1 1 
ATOM   2916 N  ND2 . ASN A 1 372 ? 49.076  43.545 25.865 1.00 15.46 ? 371 ASN A ND2 1 
ATOM   2917 N  N   . GLU A 1 373 ? 47.445  42.216 21.088 1.00 19.20 ? 372 GLU A N   1 
ATOM   2918 C  CA  . GLU A 1 373 ? 48.102  41.570 19.990 1.00 20.92 ? 372 GLU A CA  1 
ATOM   2919 C  C   . GLU A 1 373 ? 49.524  41.149 20.372 1.00 21.59 ? 372 GLU A C   1 
ATOM   2920 O  O   . GLU A 1 373 ? 49.929  39.993 20.124 1.00 21.16 ? 372 GLU A O   1 
ATOM   2921 C  CB  . GLU A 1 373 ? 48.097  42.539 18.807 1.00 20.86 ? 372 GLU A CB  1 
ATOM   2922 C  CG  . GLU A 1 373 ? 48.138  41.880 17.432 1.00 22.19 ? 372 GLU A CG  1 
ATOM   2923 C  CD  . GLU A 1 373 ? 48.151  42.903 16.293 1.00 22.62 ? 372 GLU A CD  1 
ATOM   2924 O  OE1 . GLU A 1 373 ? 47.210  43.745 16.219 1.00 20.42 ? 372 GLU A OE1 1 
ATOM   2925 O  OE2 . GLU A 1 373 ? 49.112  42.844 15.479 1.00 25.47 ? 372 GLU A OE2 1 
ATOM   2926 N  N   . GLU A 1 374 ? 50.246  42.074 21.018 1.00 22.51 ? 373 GLU A N   1 
ATOM   2927 C  CA  . GLU A 1 374 ? 51.671  41.913 21.344 1.00 23.70 ? 373 GLU A CA  1 
ATOM   2928 C  C   . GLU A 1 374 ? 51.932  40.813 22.361 1.00 23.52 ? 373 GLU A C   1 
ATOM   2929 O  O   . GLU A 1 374 ? 52.877  40.020 22.215 1.00 24.85 ? 373 GLU A O   1 
ATOM   2930 C  CB  . GLU A 1 374 ? 52.259  43.231 21.870 1.00 24.52 ? 373 GLU A CB  1 
ATOM   2931 C  CG  . GLU A 1 374 ? 53.595  43.606 21.243 1.00 27.49 ? 373 GLU A CG  1 
ATOM   2932 C  CD  . GLU A 1 374 ? 54.624  44.080 22.264 1.00 31.36 ? 373 GLU A CD  1 
ATOM   2933 O  OE1 . GLU A 1 374 ? 55.718  43.447 22.322 1.00 30.63 ? 373 GLU A OE1 1 
ATOM   2934 O  OE2 . GLU A 1 374 ? 54.333  45.064 23.000 1.00 32.85 ? 373 GLU A OE2 1 
ATOM   2935 N  N   . LEU A 1 375 ? 51.092  40.786 23.391 1.00 23.15 ? 374 LEU A N   1 
ATOM   2936 C  CA  . LEU A 1 375 ? 51.154  39.818 24.485 1.00 21.96 ? 374 LEU A CA  1 
ATOM   2937 C  C   . LEU A 1 375 ? 50.854  38.393 24.047 1.00 21.66 ? 374 LEU A C   1 
ATOM   2938 O  O   . LEU A 1 375 ? 51.548  37.467 24.454 1.00 22.29 ? 374 LEU A O   1 
ATOM   2939 C  CB  . LEU A 1 375 ? 50.168  40.230 25.588 1.00 22.18 ? 374 LEU A CB  1 
ATOM   2940 C  CG  . LEU A 1 375 ? 50.071  39.400 26.867 1.00 21.62 ? 374 LEU A CG  1 
ATOM   2941 C  CD1 . LEU A 1 375 ? 51.313  39.544 27.737 1.00 18.54 ? 374 LEU A CD1 1 
ATOM   2942 C  CD2 . LEU A 1 375 ? 48.813  39.754 27.634 1.00 20.65 ? 374 LEU A CD2 1 
ATOM   2943 N  N   . VAL A 1 376 ? 49.818  38.213 23.235 1.00 21.05 ? 375 VAL A N   1 
ATOM   2944 C  CA  . VAL A 1 376 ? 49.422  36.873 22.759 1.00 20.33 ? 375 VAL A CA  1 
ATOM   2945 C  C   . VAL A 1 376 ? 50.344  36.328 21.645 1.00 20.27 ? 375 VAL A C   1 
ATOM   2946 O  O   . VAL A 1 376 ? 50.292  35.153 21.302 1.00 20.20 ? 375 VAL A O   1 
ATOM   2947 C  CB  . VAL A 1 376 ? 47.919  36.856 22.312 1.00 20.33 ? 375 VAL A CB  1 
ATOM   2948 C  CG1 . VAL A 1 376 ? 47.777  37.140 20.807 1.00 18.93 ? 375 VAL A CG1 1 
ATOM   2949 C  CG2 . VAL A 1 376 ? 47.247  35.525 22.695 1.00 20.75 ? 375 VAL A CG2 1 
ATOM   2950 N  N   . SER A 1 377 ? 51.193  37.192 21.096 1.00 20.58 ? 376 SER A N   1 
ATOM   2951 C  CA  . SER A 1 377 ? 52.074  36.847 19.994 1.00 20.99 ? 376 SER A CA  1 
ATOM   2952 C  C   . SER A 1 377 ? 52.741  35.486 20.155 1.00 21.56 ? 376 SER A C   1 
ATOM   2953 O  O   . SER A 1 377 ? 53.602  35.316 21.012 1.00 22.52 ? 376 SER A O   1 
ATOM   2954 C  CB  . SER A 1 377 ? 53.144  37.920 19.816 1.00 21.09 ? 376 SER A CB  1 
ATOM   2955 O  OG  . SER A 1 377 ? 54.071  37.498 18.840 1.00 21.06 ? 376 SER A OG  1 
ATOM   2956 N  N   . ASN A 1 379 ? 55.639  34.412 18.785 1.00 40.25 ? 378 ASN A N   1 
ATOM   2957 C  CA  . ASN A 1 379 ? 56.811  34.656 17.952 1.00 40.65 ? 378 ASN A CA  1 
ATOM   2958 C  C   . ASN A 1 379 ? 57.725  35.725 18.544 1.00 40.83 ? 378 ASN A C   1 
ATOM   2959 O  O   . ASN A 1 379 ? 58.890  35.834 18.195 1.00 41.49 ? 378 ASN A O   1 
ATOM   2960 C  CB  . ASN A 1 379 ? 56.390  35.050 16.535 1.00 40.47 ? 378 ASN A CB  1 
ATOM   2961 N  N   . VAL A 1 380 ? 57.166  36.515 19.470 1.00 39.85 ? 379 VAL A N   1 
ATOM   2962 C  CA  . VAL A 1 380 ? 57.922  37.577 20.123 1.00 39.19 ? 379 VAL A CA  1 
ATOM   2963 C  C   . VAL A 1 380 ? 57.548  37.694 21.597 1.00 39.37 ? 379 VAL A C   1 
ATOM   2964 O  O   . VAL A 1 380 ? 56.904  38.659 22.009 1.00 38.94 ? 379 VAL A O   1 
ATOM   2965 C  CB  . VAL A 1 380 ? 57.694  38.936 19.436 1.00 38.72 ? 379 VAL A CB  1 
ATOM   2966 N  N   . GLN A 1 381 ? 57.895  36.947 22.219 1.00 37.94 ? 380 GLN A N   1 
ATOM   2967 C  CA  . GLN A 1 381 ? 58.177  37.239 23.619 1.00 37.34 ? 380 GLN A CA  1 
ATOM   2968 C  C   . GLN A 1 381 ? 57.037  38.022 24.259 1.00 37.78 ? 380 GLN A C   1 
ATOM   2969 O  O   . GLN A 1 381 ? 56.112  37.439 24.828 1.00 35.76 ? 380 GLN A O   1 
ATOM   2970 C  CB  . GLN A 1 381 ? 59.489  38.015 23.750 1.00 36.48 ? 380 GLN A CB  1 
ATOM   2971 N  N   . GLY A 1 382 ? 57.602  38.991 24.613 1.00 35.74 ? 381 GLY A N   1 
ATOM   2972 C  CA  . GLY A 1 382 ? 56.981  40.223 25.065 1.00 34.97 ? 381 GLY A CA  1 
ATOM   2973 C  C   . GLY A 1 382 ? 56.778  40.252 26.567 1.00 33.78 ? 381 GLY A C   1 
ATOM   2974 O  O   . GLY A 1 382 ? 57.525  39.588 27.316 1.00 33.78 ? 381 GLY A O   1 
ATOM   2975 N  N   . ASP A 1 383 ? 55.780  40.981 27.031 1.00 32.63 ? 382 ASP A N   1 
ATOM   2976 C  CA  . ASP A 1 383 ? 55.484  41.082 28.455 1.00 31.16 ? 382 ASP A CA  1 
ATOM   2977 C  C   . ASP A 1 383 ? 54.884  39.785 28.987 1.00 28.83 ? 382 ASP A C   1 
ATOM   2978 O  O   . ASP A 1 383 ? 53.672  39.682 29.178 1.00 28.07 ? 382 ASP A O   1 
ATOM   2979 C  CB  . ASP A 1 383 ? 54.533  42.250 28.723 1.00 32.30 ? 382 ASP A CB  1 
ATOM   2980 C  CG  . ASP A 1 383 ? 54.029  42.275 30.153 1.00 35.11 ? 382 ASP A CG  1 
ATOM   2981 O  OD1 . ASP A 1 383 ? 54.763  41.812 31.051 1.00 36.98 ? 382 ASP A OD1 1 
ATOM   2982 O  OD2 . ASP A 1 383 ? 52.900  42.757 30.379 1.00 36.82 ? 382 ASP A OD2 1 
ATOM   2983 N  N   . TYR A 1 384 ? 55.740  38.796 29.224 1.00 24.30 ? 383 TYR A N   1 
ATOM   2984 C  CA  . TYR A 1 384 ? 55.308  37.538 29.721 1.00 21.60 ? 383 TYR A CA  1 
ATOM   2985 C  C   . TYR A 1 384 ? 56.493  36.749 30.245 1.00 20.88 ? 383 TYR A C   1 
ATOM   2986 O  O   . TYR A 1 384 ? 57.569  36.857 29.786 1.00 20.82 ? 383 TYR A O   1 
ATOM   2987 C  CB  . TYR A 1 384 ? 54.489  36.794 28.665 1.00 20.44 ? 383 TYR A CB  1 
ATOM   2988 C  CG  . TYR A 1 384 ? 53.899  35.497 29.086 1.00 18.87 ? 383 TYR A CG  1 
ATOM   2989 C  CD1 . TYR A 1 384 ? 52.810  35.449 29.881 1.00 18.49 ? 383 TYR A CD1 1 
ATOM   2990 C  CD2 . TYR A 1 384 ? 54.413  34.327 28.658 1.00 17.66 ? 383 TYR A CD2 1 
ATOM   2991 C  CE1 . TYR A 1 384 ? 52.279  34.311 30.249 1.00 16.41 ? 383 TYR A CE1 1 
ATOM   2992 C  CE2 . TYR A 1 384 ? 53.861  33.177 29.027 1.00 17.55 ? 383 TYR A CE2 1 
ATOM   2993 C  CZ  . TYR A 1 384 ? 52.784  33.178 29.820 1.00 15.99 ? 383 TYR A CZ  1 
ATOM   2994 O  OH  . TYR A 1 384 ? 52.209  32.041 30.209 1.00 15.34 ? 383 TYR A OH  1 
ATOM   2995 N  N   . GLU A 1 385 ? 56.260  35.972 31.257 1.00 19.87 ? 384 GLU A N   1 
ATOM   2996 C  CA  . GLU A 1 385 ? 57.243  35.076 31.752 1.00 19.82 ? 384 GLU A CA  1 
ATOM   2997 C  C   . GLU A 1 385 ? 56.785  33.635 31.657 1.00 19.01 ? 384 GLU A C   1 
ATOM   2998 O  O   . GLU A 1 385 ? 55.943  33.234 32.367 1.00 19.57 ? 384 GLU A O   1 
ATOM   2999 C  CB  . GLU A 1 385 ? 57.671  35.490 33.145 1.00 20.12 ? 384 GLU A CB  1 
ATOM   3000 C  CG  . GLU A 1 385 ? 58.648  34.607 33.810 1.00 20.56 ? 384 GLU A CG  1 
ATOM   3001 C  CD  . GLU A 1 385 ? 59.869  34.346 33.007 1.00 21.34 ? 384 GLU A CD  1 
ATOM   3002 O  OE1 . GLU A 1 385 ? 60.108  33.186 32.779 1.00 20.45 ? 384 GLU A OE1 1 
ATOM   3003 O  OE2 . GLU A 1 385 ? 60.558  35.297 32.627 1.00 20.98 ? 384 GLU A OE2 1 
ATOM   3004 N  N   . PRO A 1 386 ? 57.313  32.888 30.703 1.00 17.93 ? 385 PRO A N   1 
ATOM   3005 C  CA  . PRO A 1 386 ? 56.873  31.502 30.483 1.00 17.87 ? 385 PRO A CA  1 
ATOM   3006 C  C   . PRO A 1 386 ? 57.019  30.595 31.708 1.00 17.58 ? 385 PRO A C   1 
ATOM   3007 O  O   . PRO A 1 386 ? 56.294  29.629 31.851 1.00 17.10 ? 385 PRO A O   1 
ATOM   3008 C  CB  . PRO A 1 386 ? 57.791  31.007 29.354 1.00 17.79 ? 385 PRO A CB  1 
ATOM   3009 C  CG  . PRO A 1 386 ? 58.308  32.250 28.682 1.00 17.54 ? 385 PRO A CG  1 
ATOM   3010 C  CD  . PRO A 1 386 ? 58.300  33.337 29.699 1.00 17.77 ? 385 PRO A CD  1 
ATOM   3011 N  N   . THR A 1 387 ? 57.977  30.911 32.562 1.00 17.97 ? 386 THR A N   1 
ATOM   3012 C  CA  . THR A 1 387 ? 58.207  30.242 33.843 1.00 18.15 ? 386 THR A CA  1 
ATOM   3013 C  C   . THR A 1 387 ? 57.021  30.353 34.836 1.00 17.92 ? 386 THR A C   1 
ATOM   3014 O  O   . THR A 1 387 ? 56.882  29.541 35.750 1.00 18.44 ? 386 THR A O   1 
ATOM   3015 C  CB  . THR A 1 387 ? 59.565  30.742 34.409 1.00 18.23 ? 386 THR A CB  1 
ATOM   3016 O  OG1 . THR A 1 387 ? 60.592  29.790 34.059 1.00 19.32 ? 386 THR A OG1 1 
ATOM   3017 C  CG2 . THR A 1 387 ? 59.547  30.965 35.915 1.00 19.70 ? 386 THR A CG2 1 
ATOM   3018 N  N   . ASP A 1 388 ? 56.172  31.361 34.713 1.00 17.01 ? 387 ASP A N   1 
ATOM   3019 C  CA  . ASP A 1 388 ? 54.996  31.566 35.533 1.00 16.15 ? 387 ASP A CA  1 
ATOM   3020 C  C   . ASP A 1 388 ? 53.855  30.537 35.575 1.00 16.30 ? 387 ASP A C   1 
ATOM   3021 O  O   . ASP A 1 388 ? 53.561  30.052 36.575 1.00 18.01 ? 387 ASP A O   1 
ATOM   3022 C  CB  . ASP A 1 388 ? 54.441  32.988 35.404 1.00 15.70 ? 387 ASP A CB  1 
ATOM   3023 C  CG  . ASP A 1 388 ? 55.330  34.025 35.996 1.00 13.57 ? 387 ASP A CG  1 
ATOM   3024 O  OD1 . ASP A 1 388 ? 55.931  33.799 37.013 1.00 13.03 ? 387 ASP A OD1 1 
ATOM   3025 O  OD2 . ASP A 1 388 ? 55.436  35.059 35.437 1.00 13.00 ? 387 ASP A OD2 1 
ATOM   3026 N  N   . ALA A 1 389 ? 53.607  30.132 34.335 1.00 16.42 ? 388 ALA A N   1 
ATOM   3027 C  CA  . ALA A 1 389 ? 52.710  29.185 33.787 1.00 16.18 ? 388 ALA A CA  1 
ATOM   3028 C  C   . ALA A 1 389 ? 53.017  27.826 34.259 1.00 16.90 ? 388 ALA A C   1 
ATOM   3029 O  O   . ALA A 1 389 ? 52.141  27.093 34.501 1.00 16.04 ? 388 ALA A O   1 
ATOM   3030 C  CB  . ALA A 1 389 ? 52.800  29.242 32.391 1.00 16.27 ? 388 ALA A CB  1 
ATOM   3031 N  N   . THR A 1 390 ? 54.295  27.535 34.421 1.00 16.26 ? 389 THR A N   1 
ATOM   3032 C  CA  . THR A 1 390 ? 54.738  26.345 35.024 1.00 15.15 ? 389 THR A CA  1 
ATOM   3033 C  C   . THR A 1 390 ? 54.247  26.259 36.469 1.00 15.52 ? 389 THR A C   1 
ATOM   3034 O  O   . THR A 1 390 ? 53.671  25.301 36.834 1.00 14.77 ? 389 THR A O   1 
ATOM   3035 C  CB  . THR A 1 390 ? 56.164  25.855 34.688 1.00 17.44 ? 389 THR A CB  1 
ATOM   3036 O  OG1 . THR A 1 390 ? 56.817  25.360 35.822 1.00 14.25 ? 389 THR A OG1 1 
ATOM   3037 C  CG2 . THR A 1 390 ? 56.938  26.748 34.070 1.00 14.91 ? 389 THR A CG2 1 
ATOM   3038 N  N   . GLY A 1 391 ? 54.357  27.325 37.225 1.00 13.44 ? 390 GLY A N   1 
ATOM   3039 C  CA  . GLY A 1 391 ? 53.810  27.402 38.563 1.00 13.18 ? 390 GLY A CA  1 
ATOM   3040 C  C   . GLY A 1 391 ? 52.285  27.301 38.650 1.00 13.12 ? 390 GLY A C   1 
ATOM   3041 O  O   . GLY A 1 391 ? 51.776  26.660 39.503 1.00 13.43 ? 390 GLY A O   1 
ATOM   3042 N  N   . PHE A 1 392 ? 51.624  27.984 37.732 1.00 13.28 ? 391 PHE A N   1 
ATOM   3043 C  CA  . PHE A 1 392 ? 50.175  27.981 37.502 1.00 12.93 ? 391 PHE A CA  1 
ATOM   3044 C  C   . PHE A 1 392 ? 49.636  26.593 37.200 1.00 13.14 ? 391 PHE A C   1 
ATOM   3045 O  O   . PHE A 1 392 ? 48.602  26.201 37.727 1.00 14.14 ? 391 PHE A O   1 
ATOM   3046 C  CB  . PHE A 1 392 ? 49.865  28.962 36.353 1.00 12.05 ? 391 PHE A CB  1 
ATOM   3047 C  CG  . PHE A 1 392 ? 48.417  29.020 35.937 1.00 12.49 ? 391 PHE A CG  1 
ATOM   3048 C  CD1 . PHE A 1 392 ? 47.486  29.756 36.676 1.00 12.35 ? 391 PHE A CD1 1 
ATOM   3049 C  CD2 . PHE A 1 392 ? 47.989  28.387 34.757 1.00 11.68 ? 391 PHE A CD2 1 
ATOM   3050 C  CE1 . PHE A 1 392 ? 46.155  29.831 36.279 1.00 11.07 ? 391 PHE A CE1 1 
ATOM   3051 C  CE2 . PHE A 1 392 ? 46.670  28.457 34.356 1.00 9.88  ? 391 PHE A CE2 1 
ATOM   3052 C  CZ  . PHE A 1 392 ? 45.744  29.180 35.129 1.00 11.69 ? 391 PHE A CZ  1 
ATOM   3053 N  N   . ILE A 1 393 ? 50.317  25.851 36.333 1.00 13.43 ? 392 ILE A N   1 
ATOM   3054 C  CA  . ILE A 1 393 ? 49.929  24.472 36.032 1.00 13.04 ? 392 ILE A CA  1 
ATOM   3055 C  C   . ILE A 1 393 ? 50.131  23.613 37.271 1.00 12.96 ? 392 ILE A C   1 
ATOM   3056 O  O   . ILE A 1 393 ? 49.235  22.892 37.669 1.00 12.87 ? 392 ILE A O   1 
ATOM   3057 C  CB  . ILE A 1 393 ? 50.717  23.886 34.818 1.00 12.64 ? 392 ILE A CB  1 
ATOM   3058 C  CG1 . ILE A 1 393 ? 50.088  24.361 33.507 1.00 12.36 ? 392 ILE A CG1 1 
ATOM   3059 C  CG2 . ILE A 1 393 ? 50.720  22.357 34.849 1.00 12.74 ? 392 ILE A CG2 1 
ATOM   3060 C  CD1 . ILE A 1 393 ? 50.955  24.166 32.296 1.00 11.00 ? 392 ILE A CD1 1 
ATOM   3061 N  N   . ASN A 1 394 ? 51.313  23.725 37.873 1.00 12.96 ? 393 ASN A N   1 
ATOM   3062 C  CA  . ASN A 1 394 ? 51.723  22.869 38.972 1.00 13.47 ? 393 ASN A CA  1 
ATOM   3063 C  C   . ASN A 1 394 ? 50.881  23.005 40.218 1.00 13.76 ? 393 ASN A C   1 
ATOM   3064 O  O   . ASN A 1 394 ? 50.682  22.038 40.947 1.00 14.34 ? 393 ASN A O   1 
ATOM   3065 C  CB  . ASN A 1 394 ? 53.193  23.092 39.305 1.00 13.21 ? 393 ASN A CB  1 
ATOM   3066 C  CG  . ASN A 1 394 ? 54.119  22.437 38.297 1.00 13.18 ? 393 ASN A CG  1 
ATOM   3067 O  OD1 . ASN A 1 394 ? 53.690  21.625 37.488 1.00 11.45 ? 393 ASN A OD1 1 
ATOM   3068 N  ND2 . ASN A 1 394 ? 55.390  22.799 38.336 1.00 11.08 ? 393 ASN A ND2 1 
ATOM   3069 N  N   . ILE A 1 395 ? 50.390  24.202 40.488 1.00 14.39 ? 394 ILE A N   1 
ATOM   3070 C  CA  . ILE A 1 395 ? 49.492  24.309 41.614 1.00 14.60 ? 394 ILE A CA  1 
ATOM   3071 C  C   . ILE A 1 395 ? 48.033  23.990 41.259 1.00 14.54 ? 394 ILE A C   1 
ATOM   3072 O  O   . ILE A 1 395 ? 47.318  23.442 42.103 1.00 15.23 ? 394 ILE A O   1 
ATOM   3073 C  CB  . ILE A 1 395 ? 49.660  25.594 42.445 1.00 14.66 ? 394 ILE A CB  1 
ATOM   3074 C  CG1 . ILE A 1 395 ? 48.450  26.463 42.320 1.00 15.02 ? 394 ILE A CG1 1 
ATOM   3075 C  CG2 . ILE A 1 395 ? 50.978  26.282 42.203 1.00 14.36 ? 394 ILE A CG2 1 
ATOM   3076 C  CD1 . ILE A 1 395 ? 47.579  26.277 43.466 1.00 16.17 ? 394 ILE A CD1 1 
ATOM   3077 N  N   . ASN A 1 396 ? 47.596  24.260 40.028 1.00 13.78 ? 395 ASN A N   1 
ATOM   3078 C  CA  . ASN A 1 396 ? 46.286  23.740 39.602 1.00 13.52 ? 395 ASN A CA  1 
ATOM   3079 C  C   . ASN A 1 396 ? 46.203  22.199 39.682 1.00 13.73 ? 395 ASN A C   1 
ATOM   3080 O  O   . ASN A 1 396 ? 45.113  21.647 39.888 1.00 13.80 ? 395 ASN A O   1 
ATOM   3081 C  CB  . ASN A 1 396 ? 45.860  24.270 38.233 1.00 12.96 ? 395 ASN A CB  1 
ATOM   3082 C  CG  . ASN A 1 396 ? 45.046  25.548 38.329 1.00 13.77 ? 395 ASN A CG  1 
ATOM   3083 O  OD1 . ASN A 1 396 ? 43.865  25.538 38.710 1.00 14.62 ? 395 ASN A OD1 1 
ATOM   3084 N  ND2 . ASN A 1 396 ? 45.667  26.658 37.981 1.00 12.58 ? 395 ASN A ND2 1 
ATOM   3085 N  N   . SER A 1 397 ? 47.358  21.525 39.554 1.00 13.32 ? 396 SER A N   1 
ATOM   3086 C  CA  . SER A 1 397 ? 47.439  20.052 39.629 1.00 12.92 ? 396 SER A CA  1 
ATOM   3087 C  C   . SER A 1 397 ? 47.463  19.490 41.071 1.00 13.00 ? 396 SER A C   1 
ATOM   3088 O  O   . SER A 1 397 ? 47.032  18.362 41.322 1.00 12.34 ? 396 SER A O   1 
ATOM   3089 C  CB  . SER A 1 397 ? 48.647  19.530 38.847 1.00 12.69 ? 396 SER A CB  1 
ATOM   3090 O  OG  . SER A 1 397 ? 49.819  19.509 39.647 1.00 11.23 ? 396 SER A OG  1 
ATOM   3091 N  N   . LEU A 1 398 ? 47.981  20.275 42.009 1.00 13.46 ? 397 LEU A N   1 
ATOM   3092 C  CA  . LEU A 1 398 ? 48.018  19.846 43.403 1.00 13.48 ? 397 LEU A CA  1 
ATOM   3093 C  C   . LEU A 1 398 ? 46.673  19.224 43.869 1.00 13.18 ? 397 LEU A C   1 
ATOM   3094 O  O   . LEU A 1 398 ? 46.701  18.087 44.324 1.00 13.56 ? 397 LEU A O   1 
ATOM   3095 C  CB  . LEU A 1 398 ? 48.584  20.960 44.317 1.00 13.10 ? 397 LEU A CB  1 
ATOM   3096 C  CG  . LEU A 1 398 ? 48.303  21.155 45.819 1.00 14.01 ? 397 LEU A CG  1 
ATOM   3097 C  CD1 . LEU A 1 398 ? 48.198  19.860 46.620 1.00 14.28 ? 397 LEU A CD1 1 
ATOM   3098 C  CD2 . LEU A 1 398 ? 49.323  22.115 46.459 1.00 13.05 ? 397 LEU A CD2 1 
ATOM   3099 N  N   . ARG A 1 399 ? 45.538  19.918 43.722 1.00 12.83 ? 398 ARG A N   1 
ATOM   3100 C  CA  . ARG A 1 399 ? 44.184  19.322 43.971 1.00 13.29 ? 398 ARG A CA  1 
ATOM   3101 C  C   . ARG A 1 399 ? 44.134  17.831 43.596 1.00 13.34 ? 398 ARG A C   1 
ATOM   3102 O  O   . ARG A 1 399 ? 43.560  17.042 44.323 1.00 14.74 ? 398 ARG A O   1 
ATOM   3103 C  CB  . ARG A 1 399 ? 43.012  20.173 43.448 1.00 13.54 ? 398 ARG A CB  1 
ATOM   3104 C  CG  . ARG A 1 399 ? 41.715  20.064 44.304 1.00 12.97 ? 398 ARG A CG  1 
ATOM   3105 C  CD  . ARG A 1 399 ? 40.686  21.200 43.986 1.00 11.54 ? 398 ARG A CD  1 
ATOM   3106 N  NE  . ARG A 1 399 ? 40.764  21.635 42.588 1.00 8.25  ? 398 ARG A NE  1 
ATOM   3107 C  CZ  . ARG A 1 399 ? 40.100  21.095 41.569 1.00 7.29  ? 398 ARG A CZ  1 
ATOM   3108 N  NH1 . ARG A 1 399 ? 39.255  20.085 41.765 1.00 9.16  ? 398 ARG A NH1 1 
ATOM   3109 N  NH2 . ARG A 1 399 ? 40.280  21.563 40.341 1.00 4.19  ? 398 ARG A NH2 1 
ATOM   3110 N  N   . LEU A 1 400 ? 44.692  17.389 42.483 1.00 13.63 ? 399 LEU A N   1 
ATOM   3111 C  CA  . LEU A 1 400 ? 44.085  16.824 41.297 1.00 13.40 ? 399 LEU A CA  1 
ATOM   3112 C  C   . LEU A 1 400 ? 44.909  15.517 41.520 1.00 13.34 ? 399 LEU A C   1 
ATOM   3113 O  O   . LEU A 1 400 ? 44.376  14.407 41.571 1.00 12.48 ? 399 LEU A O   1 
ATOM   3114 C  CB  . LEU A 1 400 ? 44.532  17.432 39.978 1.00 12.44 ? 399 LEU A CB  1 
ATOM   3115 C  CG  . LEU A 1 400 ? 43.499  18.216 39.169 1.00 12.20 ? 399 LEU A CG  1 
ATOM   3116 C  CD1 . LEU A 1 400 ? 43.775  18.001 37.665 1.00 9.52  ? 399 LEU A CD1 1 
ATOM   3117 C  CD2 . LEU A 1 400 ? 42.038  17.889 39.546 1.00 6.01  ? 399 LEU A CD2 1 
ATOM   3118 N  N   . LYS A 1 401 ? 46.219  15.712 41.702 1.00 13.59 ? 400 LYS A N   1 
ATOM   3119 C  CA  . LYS A 1 401 ? 47.125  14.744 42.311 1.00 14.71 ? 400 LYS A CA  1 
ATOM   3120 C  C   . LYS A 1 401 ? 46.792  14.386 43.761 1.00 15.21 ? 400 LYS A C   1 
ATOM   3121 O  O   . LYS A 1 401 ? 47.071  13.269 44.183 1.00 14.84 ? 400 LYS A O   1 
ATOM   3122 C  CB  . LYS A 1 401 ? 48.567  15.261 42.297 1.00 15.03 ? 400 LYS A CB  1 
ATOM   3123 C  CG  . LYS A 1 401 ? 49.133  15.569 40.923 1.00 14.74 ? 400 LYS A CG  1 
ATOM   3124 C  CD  . LYS A 1 401 ? 50.643  15.800 41.033 1.00 14.72 ? 400 LYS A CD  1 
ATOM   3125 C  CE  . LYS A 1 401 ? 50.955  17.077 41.800 1.00 15.77 ? 400 LYS A CE  1 
ATOM   3126 N  NZ  . LYS A 1 401 ? 52.141  17.752 41.194 1.00 16.88 ? 400 LYS A NZ  1 
ATOM   3127 N  N   . GLU A 1 402 ? 46.216  15.303 44.541 1.00 15.96 ? 401 GLU A N   1 
ATOM   3128 C  CA  . GLU A 1 402 ? 45.783  14.875 45.892 1.00 16.69 ? 401 GLU A CA  1 
ATOM   3129 C  C   . GLU A 1 402 ? 44.793  13.709 45.753 1.00 17.42 ? 401 GLU A C   1 
ATOM   3130 O  O   . GLU A 1 402 ? 44.815  12.796 46.585 1.00 18.24 ? 401 GLU A O   1 
ATOM   3131 C  CB  . GLU A 1 402 ? 45.516  16.002 46.892 1.00 16.48 ? 401 GLU A CB  1 
ATOM   3132 C  CG  . GLU A 1 402 ? 46.832  16.625 47.398 1.00 15.28 ? 401 GLU A CG  1 
ATOM   3133 C  CD  . GLU A 1 402 ? 47.537  15.781 48.483 1.00 18.62 ? 401 GLU A CD  1 
ATOM   3134 O  OE1 . GLU A 1 402 ? 48.664  15.271 48.262 1.00 17.64 ? 401 GLU A OE1 1 
ATOM   3135 O  OE2 . GLU A 1 402 ? 46.961  15.631 49.583 1.00 20.40 ? 401 GLU A OE2 1 
ATOM   3136 N  N   . TYR A 1 403 ? 43.903  13.695 44.759 1.00 17.41 ? 402 TYR A N   1 
ATOM   3137 C  CA  . TYR A 1 403 ? 42.488  13.552 44.937 1.00 17.70 ? 402 TYR A CA  1 
ATOM   3138 C  C   . TYR A 1 403 ? 42.637  12.100 44.399 1.00 18.47 ? 402 TYR A C   1 
ATOM   3139 O  O   . TYR A 1 403 ? 41.876  11.210 44.737 1.00 18.95 ? 402 TYR A O   1 
ATOM   3140 C  CB  . TYR A 1 403 ? 41.553  14.249 43.935 1.00 16.98 ? 402 TYR A CB  1 
ATOM   3141 C  CG  . TYR A 1 403 ? 40.199  13.508 43.906 1.00 16.37 ? 402 TYR A CG  1 
ATOM   3142 C  CD1 . TYR A 1 403 ? 39.164  13.837 44.816 1.00 17.10 ? 402 TYR A CD1 1 
ATOM   3143 C  CD2 . TYR A 1 403 ? 39.970  12.431 43.024 1.00 14.82 ? 402 TYR A CD2 1 
ATOM   3144 C  CE1 . TYR A 1 403 ? 37.927  13.126 44.819 1.00 13.00 ? 402 TYR A CE1 1 
ATOM   3145 C  CE2 . TYR A 1 403 ? 38.750  11.735 43.021 1.00 12.98 ? 402 TYR A CE2 1 
ATOM   3146 C  CZ  . TYR A 1 403 ? 37.740  12.085 43.931 1.00 13.89 ? 402 TYR A CZ  1 
ATOM   3147 O  OH  . TYR A 1 403 ? 36.546  11.380 43.946 1.00 14.30 ? 402 TYR A OH  1 
ATOM   3148 N  N   . HIS A 1 404 ? 43.638  11.906 43.529 1.00 18.88 ? 403 HIS A N   1 
ATOM   3149 C  CA  . HIS A 1 404 ? 43.994  10.617 42.942 1.00 19.81 ? 403 HIS A CA  1 
ATOM   3150 C  C   . HIS A 1 404 ? 44.648  9.702  43.981 1.00 20.71 ? 403 HIS A C   1 
ATOM   3151 O  O   . HIS A 1 404 ? 44.237  8.565  44.150 1.00 20.48 ? 403 HIS A O   1 
ATOM   3152 C  CB  . HIS A 1 404 ? 44.911  10.829 41.715 1.00 19.59 ? 403 HIS A CB  1 
ATOM   3153 C  CG  . HIS A 1 404 ? 45.330  9.562  41.034 1.00 19.21 ? 403 HIS A CG  1 
ATOM   3154 N  ND1 . HIS A 1 404 ? 46.493  8.891  41.351 1.00 20.63 ? 403 HIS A ND1 1 
ATOM   3155 C  CD2 . HIS A 1 404 ? 44.740  8.839  40.054 1.00 19.50 ? 403 HIS A CD2 1 
ATOM   3156 C  CE1 . HIS A 1 404 ? 46.603  7.813  40.595 1.00 18.00 ? 403 HIS A CE1 1 
ATOM   3157 N  NE2 . HIS A 1 404 ? 45.547  7.754  39.806 1.00 17.36 ? 403 HIS A NE2 1 
ATOM   3158 N  N   . ARG A 1 405 ? 45.655  10.220 44.686 1.00 22.51 ? 404 ARG A N   1 
ATOM   3159 C  CA  . ARG A 1 405 ? 46.351  9.483  45.736 1.00 23.83 ? 404 ARG A CA  1 
ATOM   3160 C  C   . ARG A 1 405 ? 45.388  9.025  46.850 1.00 24.95 ? 404 ARG A C   1 
ATOM   3161 O  O   . ARG A 1 405 ? 45.576  7.962  47.447 1.00 24.82 ? 404 ARG A O   1 
ATOM   3162 C  CB  . ARG A 1 405 ? 47.478  10.342 46.312 1.00 23.24 ? 404 ARG A CB  1 
ATOM   3163 C  CG  . ARG A 1 405 ? 48.327  9.643  47.382 1.00 24.46 ? 404 ARG A CG  1 
ATOM   3164 C  CD  . ARG A 1 405 ? 49.473  10.513 47.904 1.00 25.00 ? 404 ARG A CD  1 
ATOM   3165 N  NE  . ARG A 1 405 ? 48.979  11.735 48.532 1.00 27.48 ? 404 ARG A NE  1 
ATOM   3166 C  CZ  . ARG A 1 405 ? 48.454  11.781 49.750 1.00 28.65 ? 404 ARG A CZ  1 
ATOM   3167 N  NH1 . ARG A 1 405 ? 48.354  10.683 50.478 1.00 29.91 ? 404 ARG A NH1 1 
ATOM   3168 N  NH2 . ARG A 1 405 ? 48.014  12.925 50.242 1.00 31.65 ? 404 ARG A NH2 1 
ATOM   3169 N  N   . LEU A 1 406 ? 44.360  9.835  47.104 1.00 26.29 ? 405 LEU A N   1 
ATOM   3170 C  CA  . LEU A 1 406 ? 43.488  9.664  48.262 1.00 28.00 ? 405 LEU A CA  1 
ATOM   3171 C  C   . LEU A 1 406 ? 42.177  8.944  47.964 1.00 29.46 ? 405 LEU A C   1 
ATOM   3172 O  O   . LEU A 1 406 ? 41.402  8.689  48.879 1.00 29.79 ? 405 LEU A O   1 
ATOM   3173 C  CB  . LEU A 1 406 ? 43.213  11.013 48.951 1.00 27.41 ? 405 LEU A CB  1 
ATOM   3174 C  CG  . LEU A 1 406 ? 44.366  11.603 49.771 1.00 27.33 ? 405 LEU A CG  1 
ATOM   3175 C  CD1 . LEU A 1 406 ? 43.956  12.908 50.449 1.00 25.83 ? 405 LEU A CD1 1 
ATOM   3176 C  CD2 . LEU A 1 406 ? 44.890  10.586 50.802 1.00 26.06 ? 405 LEU A CD2 1 
ATOM   3177 N  N   . GLN A 1 407 ? 41.911  8.665  46.688 1.00 31.57 ? 406 GLN A N   1 
ATOM   3178 C  CA  . GLN A 1 407 ? 40.962  7.616  46.326 1.00 33.42 ? 406 GLN A CA  1 
ATOM   3179 C  C   . GLN A 1 407 ? 41.666  6.408  45.670 1.00 34.30 ? 406 GLN A C   1 
ATOM   3180 O  O   . GLN A 1 407 ? 41.050  5.671  44.896 1.00 35.19 ? 406 GLN A O   1 
ATOM   3181 C  CB  . GLN A 1 407 ? 39.765  8.140  45.500 1.00 33.45 ? 406 GLN A CB  1 
ATOM   3182 C  CG  . GLN A 1 407 ? 40.081  8.850  44.193 1.00 34.24 ? 406 GLN A CG  1 
ATOM   3183 C  CD  . GLN A 1 407 ? 40.390  7.936  43.000 1.00 35.41 ? 406 GLN A CD  1 
ATOM   3184 O  OE1 . GLN A 1 407 ? 41.351  7.164  43.022 1.00 34.88 ? 406 GLN A OE1 1 
ATOM   3185 N  NE2 . GLN A 1 407 ? 39.605  8.077  41.924 1.00 34.45 ? 406 GLN A NE2 1 
ATOM   3186 N  N   . SER A 1 408 ? 42.936  6.187  46.015 1.00 35.10 ? 407 SER A N   1 
ATOM   3187 C  CA  . SER A 1 408 ? 43.752  5.149  45.370 1.00 35.68 ? 407 SER A CA  1 
ATOM   3188 C  C   . SER A 1 408 ? 43.695  3.840  46.128 1.00 36.10 ? 407 SER A C   1 
ATOM   3189 O  O   . SER A 1 408 ? 44.717  3.165  46.284 1.00 36.91 ? 407 SER A O   1 
ATOM   3190 C  CB  . SER A 1 408 ? 45.216  5.606  45.242 1.00 36.19 ? 407 SER A CB  1 
ATOM   3191 O  OG  . SER A 1 408 ? 45.907  4.884  44.237 1.00 36.35 ? 407 SER A OG  1 
HETATM 3192 NA NA  . NA  B 2 .   ? -6.342  51.358 36.894 1.00 13.14 ? 503 NA  A NA  1 
HETATM 3193 N  N   . ASP C 3 .   ? -0.399  33.689 20.720 1.00 25.10 ? 501 ASP A N   1 
HETATM 3194 C  CA  . ASP C 3 .   ? -0.724  32.271 20.807 1.00 24.95 ? 501 ASP A CA  1 
HETATM 3195 C  C   . ASP C 3 .   ? -1.908  32.032 21.738 1.00 25.26 ? 501 ASP A C   1 
HETATM 3196 O  O   . ASP C 3 .   ? -2.272  30.889 22.014 1.00 25.29 ? 501 ASP A O   1 
HETATM 3197 C  CB  . ASP C 3 .   ? 0.490   31.471 21.285 1.00 25.05 ? 501 ASP A CB  1 
HETATM 3198 C  CG  . ASP C 3 .   ? 1.017   31.955 22.621 1.00 24.24 ? 501 ASP A CG  1 
HETATM 3199 O  OD1 . ASP C 3 .   ? 2.082   31.467 23.054 1.00 24.84 ? 501 ASP A OD1 1 
HETATM 3200 O  OD2 . ASP C 3 .   ? 0.365   32.822 23.240 1.00 24.71 ? 501 ASP A OD2 1 
HETATM 3201 O  OXT . ASP C 3 .   ? -2.572  32.975 22.177 1.00 25.36 ? 501 ASP A OXT 1 
HETATM 3202 C  C1  . CIR D 4 .   ? 6.193   32.789 22.041 1.00 13.76 ? 502 CIR A C1  1 
HETATM 3203 O  O1  . CIR D 4 .   ? 5.596   32.241 22.991 1.00 18.96 ? 502 CIR A O1  1 
HETATM 3204 O  O2  . CIR D 4 .   ? 6.687   33.920 22.158 1.00 14.23 ? 502 CIR A O2  1 
HETATM 3205 C  C2  . CIR D 4 .   ? 6.284   32.034 20.749 1.00 11.78 ? 502 CIR A C2  1 
HETATM 3206 N  N2  . CIR D 4 .   ? 5.936   30.637 21.032 1.00 12.27 ? 502 CIR A N2  1 
HETATM 3207 C  C3  . CIR D 4 .   ? 5.300   32.595 19.727 1.00 10.76 ? 502 CIR A C3  1 
HETATM 3208 C  C4  . CIR D 4 .   ? 3.854   32.645 20.236 1.00 8.51  ? 502 CIR A C4  1 
HETATM 3209 C  C5  . CIR D 4 .   ? 3.065   33.681 19.466 1.00 9.47  ? 502 CIR A C5  1 
HETATM 3210 N  N6  . CIR D 4 .   ? 2.998   33.325 18.057 1.00 9.34  ? 502 CIR A N6  1 
HETATM 3211 C  C7  . CIR D 4 .   ? 1.851   33.001 17.448 1.00 9.83  ? 502 CIR A C7  1 
HETATM 3212 O  O7  . CIR D 4 .   ? 0.771   33.074 17.998 1.00 9.17  ? 502 CIR A O7  1 
HETATM 3213 N  N8  . CIR D 4 .   ? 1.907   32.579 16.196 1.00 10.96 ? 502 CIR A N8  1 
HETATM 3214 O  O   . HOH E 5 .   ? 19.640  45.799 29.855 1.00 11.16 ? 504 HOH A O   1 
HETATM 3215 O  O   . HOH E 5 .   ? 13.572  33.082 17.321 1.00 4.01  ? 505 HOH A O   1 
HETATM 3216 O  O   . HOH E 5 .   ? -7.039  38.760 15.956 1.00 16.83 ? 506 HOH A O   1 
HETATM 3217 O  O   . HOH E 5 .   ? 28.869  51.215 10.709 1.00 19.61 ? 507 HOH A O   1 
HETATM 3218 O  O   . HOH E 5 .   ? -5.295  40.562 21.399 1.00 13.88 ? 508 HOH A O   1 
HETATM 3219 O  O   . HOH E 5 .   ? 15.675  55.859 11.954 1.00 16.50 ? 509 HOH A O   1 
HETATM 3220 O  O   . HOH E 5 .   ? 2.167   29.638 28.842 1.00 13.99 ? 510 HOH A O   1 
HETATM 3221 O  O   . HOH E 5 .   ? -1.862  33.163 25.326 1.00 12.37 ? 511 HOH A O   1 
HETATM 3222 O  O   . HOH E 5 .   ? -11.364 36.782 32.077 1.00 12.00 ? 512 HOH A O   1 
HETATM 3223 O  O   . HOH E 5 .   ? 34.935  38.100 19.561 1.00 14.93 ? 513 HOH A O   1 
HETATM 3224 O  O   . HOH E 5 .   ? -8.789  35.961 25.268 1.00 5.41  ? 514 HOH A O   1 
HETATM 3225 O  O   . HOH E 5 .   ? 15.479  24.716 22.614 1.00 17.15 ? 515 HOH A O   1 
HETATM 3226 O  O   . HOH E 5 .   ? 45.291  22.667 43.515 1.00 11.74 ? 516 HOH A O   1 
HETATM 3227 O  O   . HOH E 5 .   ? 16.539  48.177 35.049 1.00 13.31 ? 517 HOH A O   1 
HETATM 3228 O  O   . HOH E 5 .   ? 46.825  45.146 20.590 1.00 20.96 ? 518 HOH A O   1 
HETATM 3229 O  O   . HOH E 5 .   ? -10.145 48.698 37.486 1.00 14.02 ? 519 HOH A O   1 
HETATM 3230 O  O   . HOH E 5 .   ? 24.597  38.759 21.713 1.00 9.23  ? 520 HOH A O   1 
HETATM 3231 O  O   . HOH E 5 .   ? 29.647  35.911 16.888 1.00 9.43  ? 521 HOH A O   1 
HETATM 3232 O  O   . HOH E 5 .   ? 22.808  35.298 28.432 1.00 16.46 ? 522 HOH A O   1 
HETATM 3233 O  O   . HOH E 5 .   ? 40.308  41.467 31.317 1.00 15.08 ? 523 HOH A O   1 
HETATM 3234 O  O   . HOH E 5 .   ? 25.183  35.090 36.996 1.00 12.07 ? 524 HOH A O   1 
HETATM 3235 O  O   . HOH E 5 .   ? 21.986  39.148 21.732 1.00 11.31 ? 525 HOH A O   1 
HETATM 3236 O  O   . HOH E 5 .   ? 22.506  55.902 2.801  1.00 20.82 ? 526 HOH A O   1 
HETATM 3237 O  O   . HOH E 5 .   ? 31.351  33.687 29.739 1.00 12.50 ? 527 HOH A O   1 
HETATM 3238 O  O   . HOH E 5 .   ? 42.750  27.512 40.165 1.00 5.91  ? 528 HOH A O   1 
HETATM 3239 O  O   . HOH E 5 .   ? -11.491 32.311 33.795 1.00 4.07  ? 529 HOH A O   1 
HETATM 3240 O  O   . HOH E 5 .   ? 4.398   51.105 25.022 1.00 10.21 ? 530 HOH A O   1 
HETATM 3241 O  O   . HOH E 5 .   ? 31.164  52.916 19.287 1.00 11.51 ? 531 HOH A O   1 
HETATM 3242 O  O   . HOH E 5 .   ? 53.758  36.190 33.205 1.00 8.78  ? 532 HOH A O   1 
HETATM 3243 O  O   . HOH E 5 .   ? 2.520   24.051 16.361 1.00 6.12  ? 533 HOH A O   1 
HETATM 3244 O  O   . HOH E 5 .   ? 14.859  40.938 13.227 1.00 3.54  ? 534 HOH A O   1 
HETATM 3245 O  O   . HOH E 5 .   ? 5.457   41.876 32.687 1.00 4.42  ? 535 HOH A O   1 
HETATM 3246 O  O   . HOH E 5 .   ? 35.529  38.434 27.108 1.00 8.87  ? 536 HOH A O   1 
HETATM 3247 O  O   . HOH E 5 .   ? 40.892  46.871 17.736 1.00 7.27  ? 537 HOH A O   1 
HETATM 3248 O  O   . HOH E 5 .   ? 22.934  50.561 28.491 1.00 13.68 ? 538 HOH A O   1 
HETATM 3249 O  O   . HOH E 5 .   ? 20.234  31.672 9.573  1.00 8.57  ? 539 HOH A O   1 
HETATM 3250 O  O   . HOH E 5 .   ? 53.540  42.147 25.194 1.00 31.05 ? 540 HOH A O   1 
HETATM 3251 O  O   . HOH E 5 .   ? 5.670   27.297 19.301 1.00 10.81 ? 541 HOH A O   1 
HETATM 3252 O  O   . HOH E 5 .   ? -18.540 49.939 21.504 1.00 12.23 ? 542 HOH A O   1 
HETATM 3253 O  O   . HOH E 5 .   ? 33.133  34.690 36.921 1.00 6.63  ? 543 HOH A O   1 
HETATM 3254 O  O   . HOH E 5 .   ? 12.241  27.416 1.740  1.00 17.01 ? 544 HOH A O   1 
HETATM 3255 O  O   . HOH E 5 .   ? 3.225   31.729 5.632  1.00 20.18 ? 545 HOH A O   1 
HETATM 3256 O  O   . HOH E 5 .   ? 2.566   19.357 23.248 1.00 7.34  ? 546 HOH A O   1 
HETATM 3257 O  O   . HOH E 5 .   ? -6.384  37.451 34.789 1.00 5.68  ? 547 HOH A O   1 
HETATM 3258 O  O   . HOH E 5 .   ? 18.209  36.638 -4.901 1.00 17.89 ? 548 HOH A O   1 
HETATM 3259 O  O   . HOH E 5 .   ? 33.894  34.032 29.776 1.00 18.93 ? 549 HOH A O   1 
HETATM 3260 O  O   . HOH E 5 .   ? 40.694  3.879  48.279 1.00 25.91 ? 550 HOH A O   1 
HETATM 3261 O  O   . HOH E 5 .   ? -3.989  50.569 39.201 1.00 15.78 ? 551 HOH A O   1 
HETATM 3262 O  O   . HOH E 5 .   ? -10.534 33.349 -1.014 1.00 20.42 ? 552 HOH A O   1 
HETATM 3263 O  O   . HOH E 5 .   ? 14.284  45.857 40.893 1.00 19.67 ? 553 HOH A O   1 
HETATM 3264 O  O   . HOH E 5 .   ? 7.902   54.977 16.686 1.00 18.92 ? 554 HOH A O   1 
HETATM 3265 O  O   . HOH E 5 .   ? 19.110  44.847 1.014  1.00 19.63 ? 555 HOH A O   1 
HETATM 3266 O  O   . HOH E 5 .   ? 34.966  52.482 9.850  1.00 25.96 ? 556 HOH A O   1 
HETATM 3267 O  O   . HOH E 5 .   ? 42.319  23.544 40.093 1.00 18.22 ? 557 HOH A O   1 
HETATM 3268 O  O   . HOH E 5 .   ? 17.669  32.946 14.237 1.00 13.19 ? 558 HOH A O   1 
HETATM 3269 O  O   . HOH E 5 .   ? -15.266 51.094 32.558 1.00 22.69 ? 559 HOH A O   1 
HETATM 3270 O  O   . HOH E 5 .   ? 14.840  33.038 14.520 1.00 15.46 ? 560 HOH A O   1 
HETATM 3271 O  O   . HOH E 5 .   ? 21.981  31.543 25.348 1.00 6.21  ? 561 HOH A O   1 
HETATM 3272 O  O   . HOH E 5 .   ? 24.270  53.517 22.699 1.00 12.09 ? 562 HOH A O   1 
HETATM 3273 O  O   . HOH E 5 .   ? 16.018  25.023 14.464 1.00 4.86  ? 563 HOH A O   1 
HETATM 3274 O  O   . HOH E 5 .   ? 12.416  35.575 17.290 1.00 6.79  ? 564 HOH A O   1 
HETATM 3275 O  O   . HOH E 5 .   ? 7.939   54.652 19.180 1.00 18.28 ? 565 HOH A O   1 
HETATM 3276 O  O   . HOH E 5 .   ? 8.779   28.200 30.549 1.00 21.43 ? 566 HOH A O   1 
HETATM 3277 O  O   . HOH E 5 .   ? 2.782   19.581 25.806 1.00 24.49 ? 567 HOH A O   1 
HETATM 3278 O  O   . HOH E 5 .   ? -4.165  57.011 18.537 1.00 22.56 ? 568 HOH A O   1 
HETATM 3279 O  O   . HOH E 5 .   ? 3.311   29.513 21.788 1.00 8.52  ? 569 HOH A O   1 
HETATM 3280 O  O   . HOH E 5 .   ? 28.005  33.352 17.205 1.00 18.11 ? 570 HOH A O   1 
HETATM 3281 O  O   . HOH E 5 .   ? 0.729   53.993 12.695 1.00 15.41 ? 571 HOH A O   1 
HETATM 3282 O  O   . HOH E 5 .   ? 30.041  37.585 24.151 1.00 11.91 ? 572 HOH A O   1 
HETATM 3283 O  O   . HOH E 5 .   ? 42.748  13.522 40.025 1.00 14.13 ? 573 HOH A O   1 
HETATM 3284 O  O   . HOH E 5 .   ? 11.494  45.996 8.878  1.00 10.36 ? 574 HOH A O   1 
HETATM 3285 O  O   . HOH E 5 .   ? 29.269  31.716 11.117 1.00 12.98 ? 575 HOH A O   1 
HETATM 3286 O  O   . HOH E 5 .   ? 34.520  43.883 31.350 1.00 6.72  ? 576 HOH A O   1 
HETATM 3287 O  O   . HOH E 5 .   ? 31.297  33.495 11.861 1.00 11.53 ? 577 HOH A O   1 
HETATM 3288 O  O   . HOH E 5 .   ? -24.308 27.725 9.915  1.00 39.77 ? 578 HOH A O   1 
HETATM 3289 O  O   . HOH E 5 .   ? -0.784  52.393 37.881 1.00 15.74 ? 579 HOH A O   1 
HETATM 3290 O  O   . HOH E 5 .   ? 30.869  47.683 34.120 1.00 19.00 ? 580 HOH A O   1 
HETATM 3291 O  O   . HOH E 5 .   ? 26.358  30.880 3.487  1.00 20.71 ? 581 HOH A O   1 
HETATM 3292 O  O   . HOH E 5 .   ? 33.563  53.226 19.848 1.00 14.32 ? 582 HOH A O   1 
HETATM 3293 O  O   . HOH E 5 .   ? 7.794   50.007 30.983 1.00 18.68 ? 583 HOH A O   1 
HETATM 3294 O  O   . HOH E 5 .   ? 41.823  49.576 20.619 1.00 12.81 ? 584 HOH A O   1 
HETATM 3295 O  O   . HOH E 5 .   ? 45.258  17.198 50.283 1.00 22.23 ? 585 HOH A O   1 
HETATM 3296 O  O   . HOH E 5 .   ? 49.721  32.648 21.793 1.00 11.76 ? 586 HOH A O   1 
HETATM 3297 O  O   . HOH E 5 .   ? 37.802  36.552 8.599  1.00 15.14 ? 587 HOH A O   1 
HETATM 3298 O  O   . HOH E 5 .   ? 5.085   26.738 35.134 1.00 8.07  ? 588 HOH A O   1 
HETATM 3299 O  O   . HOH E 5 .   ? -9.347  40.933 36.561 1.00 7.96  ? 589 HOH A O   1 
HETATM 3300 O  O   . HOH E 5 .   ? 16.831  38.408 21.199 1.00 20.27 ? 590 HOH A O   1 
HETATM 3301 O  O   . HOH E 5 .   ? 44.085  29.380 38.791 0.50 15.06 ? 591 HOH A O   1 
HETATM 3302 O  O   . HOH E 5 .   ? 18.404  51.815 3.161  1.00 25.34 ? 592 HOH A O   1 
HETATM 3303 O  O   . HOH E 5 .   ? 40.236  49.239 26.454 1.00 23.97 ? 593 HOH A O   1 
HETATM 3304 O  O   . HOH E 5 .   ? 18.177  48.077 30.478 1.00 12.50 ? 594 HOH A O   1 
HETATM 3305 O  O   . HOH E 5 .   ? 30.551  51.883 25.213 1.00 10.83 ? 595 HOH A O   1 
HETATM 3306 O  O   . HOH E 5 .   ? 5.843   16.337 6.288  1.00 19.35 ? 596 HOH A O   1 
HETATM 3307 O  O   . HOH E 5 .   ? 20.892  52.761 17.911 1.00 17.57 ? 597 HOH A O   1 
HETATM 3308 O  O   . HOH E 5 .   ? -8.219  52.826 34.420 1.00 24.04 ? 598 HOH A O   1 
HETATM 3309 O  O   . HOH E 5 .   ? 2.048   23.949 19.323 1.00 22.17 ? 599 HOH A O   1 
HETATM 3310 O  O   . HOH E 5 .   ? 42.644  45.501 19.464 1.00 17.33 ? 600 HOH A O   1 
HETATM 3311 O  O   . HOH E 5 .   ? 20.509  60.296 10.317 1.00 24.69 ? 601 HOH A O   1 
HETATM 3312 O  O   . HOH E 5 .   ? -12.004 49.688 39.244 1.00 32.77 ? 602 HOH A O   1 
HETATM 3313 O  O   . HOH E 5 .   ? -16.893 24.528 31.162 1.00 15.61 ? 603 HOH A O   1 
HETATM 3314 O  O   . HOH E 5 .   ? -11.462 42.125 7.196  1.00 24.76 ? 604 HOH A O   1 
HETATM 3315 O  O   . HOH E 5 .   ? 10.333  49.103 30.604 1.00 12.83 ? 605 HOH A O   1 
HETATM 3316 O  O   . HOH E 5 .   ? 31.359  32.899 37.622 1.00 11.61 ? 606 HOH A O   1 
HETATM 3317 O  O   . HOH E 5 .   ? -19.170 37.905 7.022  1.00 20.41 ? 607 HOH A O   1 
HETATM 3318 O  O   . HOH E 5 .   ? 15.732  48.345 30.815 1.00 6.39  ? 608 HOH A O   1 
HETATM 3319 O  O   . HOH E 5 .   ? 6.859   21.998 29.568 1.00 13.22 ? 609 HOH A O   1 
HETATM 3320 O  O   . HOH E 5 .   ? 4.048   40.756 18.281 1.00 17.89 ? 610 HOH A O   1 
HETATM 3321 O  O   . HOH E 5 .   ? 28.295  44.794 0.778  1.00 31.21 ? 611 HOH A O   1 
HETATM 3322 O  O   . HOH E 5 .   ? 39.417  39.128 30.225 1.00 9.33  ? 612 HOH A O   1 
HETATM 3323 O  O   . HOH E 5 .   ? -25.119 35.761 20.232 1.00 33.57 ? 613 HOH A O   1 
HETATM 3324 O  O   . HOH E 5 .   ? 59.096  35.363 38.052 1.00 24.76 ? 614 HOH A O   1 
HETATM 3325 O  O   . HOH E 5 .   ? -13.005 23.882 13.562 1.00 20.56 ? 615 HOH A O   1 
HETATM 3326 O  O   . HOH E 5 .   ? 5.131   54.639 25.724 1.00 21.55 ? 616 HOH A O   1 
HETATM 3327 O  O   . HOH E 5 .   ? 15.780  51.320 6.890  1.00 13.95 ? 617 HOH A O   1 
HETATM 3328 O  O   . HOH E 5 .   ? 10.545  49.629 33.396 1.00 20.66 ? 618 HOH A O   1 
HETATM 3329 O  O   . HOH E 5 .   ? 16.524  37.838 -2.082 1.00 16.75 ? 619 HOH A O   1 
HETATM 3330 O  O   . HOH E 5 .   ? 31.119  52.587 -2.113 1.00 24.83 ? 620 HOH A O   1 
HETATM 3331 O  O   . HOH E 5 .   ? -3.034  45.671 18.911 1.00 17.64 ? 621 HOH A O   1 
HETATM 3332 O  O   . HOH E 5 .   ? 16.601  47.257 40.603 1.00 2.00  ? 622 HOH A O   1 
HETATM 3333 O  O   . HOH E 5 .   ? 10.285  47.623 35.156 1.00 14.73 ? 623 HOH A O   1 
HETATM 3334 O  O   . HOH E 5 .   ? -2.025  43.563 19.658 1.00 9.00  ? 624 HOH A O   1 
HETATM 3335 O  O   . HOH E 5 .   ? 5.905   29.977 16.189 1.00 18.56 ? 625 HOH A O   1 
HETATM 3336 O  O   . HOH E 5 .   ? 20.166  57.787 9.768  1.00 21.12 ? 626 HOH A O   1 
HETATM 3337 O  O   . HOH E 5 .   ? -5.416  27.621 2.663  1.00 23.00 ? 627 HOH A O   1 
HETATM 3338 O  O   . HOH E 5 .   ? 14.104  49.095 28.685 1.00 13.24 ? 628 HOH A O   1 
HETATM 3339 O  O   . HOH E 5 .   ? -8.543  40.160 0.788  1.00 34.36 ? 629 HOH A O   1 
HETATM 3340 O  O   . HOH E 5 .   ? 12.617  27.166 9.772  1.00 21.11 ? 630 HOH A O   1 
HETATM 3341 O  O   . HOH E 5 .   ? 17.826  26.897 16.074 1.00 14.19 ? 631 HOH A O   1 
HETATM 3342 O  O   . HOH E 5 .   ? -0.282  28.492 18.816 1.00 13.11 ? 632 HOH A O   1 
HETATM 3343 O  O   . HOH E 5 .   ? 2.243   42.218 17.044 1.00 13.32 ? 633 HOH A O   1 
HETATM 3344 O  O   . HOH E 5 .   ? -2.362  57.077 31.632 1.00 20.57 ? 634 HOH A O   1 
HETATM 3345 O  O   . HOH E 5 .   ? 56.281  37.863 35.901 1.00 14.28 ? 635 HOH A O   1 
HETATM 3346 O  O   . HOH E 5 .   ? 18.067  30.884 7.548  1.00 28.30 ? 636 HOH A O   1 
HETATM 3347 O  O   . HOH E 5 .   ? -22.310 48.453 24.135 1.00 21.06 ? 637 HOH A O   1 
HETATM 3348 O  O   . HOH E 5 .   ? 25.636  50.621 29.300 1.00 16.33 ? 638 HOH A O   1 
HETATM 3349 O  O   . HOH E 5 .   ? 23.046  50.448 34.268 1.00 27.00 ? 639 HOH A O   1 
HETATM 3350 O  O   . HOH E 5 .   ? -21.483 29.444 16.795 1.00 35.42 ? 640 HOH A O   1 
HETATM 3351 O  O   . HOH E 5 .   ? 14.482  25.067 9.946  1.00 5.79  ? 641 HOH A O   1 
HETATM 3352 O  O   . HOH E 5 .   ? 36.156  10.914 40.983 1.00 21.02 ? 642 HOH A O   1 
HETATM 3353 O  O   . HOH E 5 .   ? 44.161  3.805  49.231 1.00 29.65 ? 643 HOH A O   1 
HETATM 3354 O  O   . HOH E 5 .   ? -22.937 42.847 31.387 1.00 16.38 ? 644 HOH A O   1 
HETATM 3355 O  O   . HOH E 5 .   ? 0.261   56.830 15.490 1.00 15.68 ? 645 HOH A O   1 
HETATM 3356 O  O   . HOH E 5 .   ? 30.102  37.472 -5.529 1.00 27.13 ? 646 HOH A O   1 
HETATM 3357 O  O   . HOH E 5 .   ? -1.179  35.181 17.657 1.00 27.86 ? 647 HOH A O   1 
HETATM 3358 O  O   . HOH E 5 .   ? 18.342  29.628 17.147 1.00 16.66 ? 648 HOH A O   1 
HETATM 3359 O  O   . HOH E 5 .   ? 27.276  52.772 37.313 1.00 19.56 ? 649 HOH A O   1 
HETATM 3360 O  O   . HOH E 5 .   ? -2.824  34.118 12.437 1.00 18.68 ? 650 HOH A O   1 
HETATM 3361 O  O   . HOH E 5 .   ? -16.058 33.736 33.121 1.00 19.33 ? 651 HOH A O   1 
HETATM 3362 O  O   . HOH E 5 .   ? 12.210  50.741 29.502 1.00 12.97 ? 652 HOH A O   1 
HETATM 3363 O  O   . HOH E 5 .   ? 22.572  29.384 23.954 1.00 13.72 ? 653 HOH A O   1 
HETATM 3364 O  O   . HOH E 5 .   ? 18.148  56.720 17.084 1.00 21.91 ? 654 HOH A O   1 
HETATM 3365 O  O   . HOH E 5 .   ? 22.131  47.673 0.719  1.00 17.64 ? 655 HOH A O   1 
HETATM 3366 O  O   . HOH E 5 .   ? 0.282   39.441 13.917 1.00 20.21 ? 656 HOH A O   1 
HETATM 3367 O  O   . HOH E 5 .   ? -7.470  31.126 18.065 1.00 24.23 ? 657 HOH A O   1 
HETATM 3368 O  O   . HOH E 5 .   ? 27.211  32.697 36.439 1.00 17.95 ? 658 HOH A O   1 
HETATM 3369 O  O   . HOH E 5 .   ? 51.739  44.320 15.528 1.00 20.18 ? 659 HOH A O   1 
HETATM 3370 O  O   . HOH E 5 .   ? -16.352 52.939 9.879  1.00 19.90 ? 660 HOH A O   1 
HETATM 3371 O  O   . HOH E 5 .   ? 4.282   18.864 29.607 1.00 15.47 ? 661 HOH A O   1 
HETATM 3372 O  O   . HOH E 5 .   ? 52.032  43.677 26.362 1.00 20.49 ? 662 HOH A O   1 
HETATM 3373 O  O   . HOH E 5 .   ? -5.776  56.662 15.903 1.00 21.57 ? 663 HOH A O   1 
HETATM 3374 O  O   . HOH E 5 .   ? -1.669  36.078 21.024 1.00 29.42 ? 664 HOH A O   1 
HETATM 3375 O  O   . HOH E 5 .   ? 23.945  33.064 23.927 1.00 14.86 ? 665 HOH A O   1 
HETATM 3376 O  O   . HOH E 5 .   ? 35.625  55.498 23.344 1.00 23.94 ? 666 HOH A O   1 
HETATM 3377 O  O   . HOH E 5 .   ? 14.144  26.262 -3.552 1.00 27.20 ? 667 HOH A O   1 
HETATM 3378 O  O   . HOH E 5 .   ? -21.865 34.264 33.524 1.00 25.87 ? 668 HOH A O   1 
HETATM 3379 O  O   . HOH E 5 .   ? 39.110  50.775 16.820 1.00 25.71 ? 669 HOH A O   1 
HETATM 3380 O  O   . HOH E 5 .   ? 16.430  25.112 -0.661 1.00 21.40 ? 670 HOH A O   1 
HETATM 3381 O  O   . HOH E 5 .   ? -16.330 23.711 13.945 1.00 36.37 ? 671 HOH A O   1 
HETATM 3382 O  O   . HOH E 5 .   ? -7.152  43.910 39.587 1.00 19.63 ? 672 HOH A O   1 
HETATM 3383 O  O   . HOH E 5 .   ? 9.457   33.248 35.360 1.00 18.92 ? 673 HOH A O   1 
HETATM 3384 O  O   . HOH E 5 .   ? -16.824 22.886 9.887  1.00 26.38 ? 674 HOH A O   1 
HETATM 3385 O  O   . HOH E 5 .   ? -0.035  14.956 9.231  1.00 22.40 ? 675 HOH A O   1 
HETATM 3386 O  O   . HOH E 5 .   ? 5.779   57.153 17.505 1.00 14.46 ? 676 HOH A O   1 
HETATM 3387 O  O   . HOH E 5 .   ? -27.754 37.308 17.284 1.00 21.70 ? 677 HOH A O   1 
HETATM 3388 O  O   . HOH E 5 .   ? 32.309  51.045 6.090  1.00 28.57 ? 678 HOH A O   1 
HETATM 3389 O  O   . HOH E 5 .   ? 27.728  57.719 2.507  1.00 17.30 ? 679 HOH A O   1 
HETATM 3390 O  O   . HOH E 5 .   ? 21.759  50.125 -4.277 1.00 19.45 ? 680 HOH A O   1 
HETATM 3391 O  O   . HOH E 5 .   ? -1.985  41.400 12.579 1.00 23.18 ? 681 HOH A O   1 
HETATM 3392 O  O   . HOH E 5 .   ? 16.238  29.659 28.892 1.00 16.74 ? 682 HOH A O   1 
HETATM 3393 O  O   . HOH E 5 .   ? 14.479  55.083 23.923 1.00 26.35 ? 683 HOH A O   1 
HETATM 3394 O  O   . HOH E 5 .   ? -23.427 40.462 30.928 1.00 24.86 ? 684 HOH A O   1 
HETATM 3395 O  O   . HOH E 5 .   ? -4.119  39.825 11.497 1.00 32.33 ? 685 HOH A O   1 
HETATM 3396 O  O   . HOH E 5 .   ? -21.135 52.523 14.424 1.00 31.67 ? 686 HOH A O   1 
HETATM 3397 O  O   . HOH E 5 .   ? -25.429 41.049 32.586 1.00 24.48 ? 687 HOH A O   1 
HETATM 3398 O  O   . HOH E 5 .   ? 13.750  55.869 11.197 1.00 25.94 ? 688 HOH A O   1 
HETATM 3399 O  O   . HOH E 5 .   ? -23.129 37.549 30.471 1.00 27.57 ? 689 HOH A O   1 
HETATM 3400 O  O   . HOH E 5 .   ? 31.801  40.375 -2.621 1.00 37.05 ? 690 HOH A O   1 
HETATM 3401 O  O   . HOH E 5 .   ? -25.385 38.847 29.884 1.00 17.69 ? 691 HOH A O   1 
HETATM 3402 O  O   . HOH E 5 .   ? 7.477   54.616 12.894 1.00 20.41 ? 692 HOH A O   1 
HETATM 3403 O  O   . HOH E 5 .   ? -20.877 28.744 30.159 1.00 23.67 ? 693 HOH A O   1 
HETATM 3404 O  O   . HOH E 5 .   ? 42.010  2.948  43.531 1.00 31.57 ? 694 HOH A O   1 
HETATM 3405 O  O   . HOH E 5 .   ? -4.729  38.598 13.851 1.00 30.93 ? 695 HOH A O   1 
HETATM 3406 O  O   . HOH E 5 .   ? 11.057  20.867 4.712  1.00 24.45 ? 696 HOH A O   1 
HETATM 3407 O  O   . HOH E 5 .   ? -11.683 57.087 16.405 1.00 4.20  ? 697 HOH A O   1 
HETATM 3408 O  O   . HOH E 5 .   ? 9.041   57.311 13.218 1.00 39.00 ? 698 HOH A O   1 
HETATM 3409 O  O   . HOH E 5 .   ? -9.435  58.039 18.634 1.00 20.76 ? 699 HOH A O   1 
HETATM 3410 O  O   . HOH E 5 .   ? 46.524  7.742  52.168 1.00 24.24 ? 700 HOH A O   1 
HETATM 3411 O  O   . HOH E 5 .   ? -21.286 50.703 28.746 1.00 36.27 ? 701 HOH A O   1 
HETATM 3412 O  O   . HOH E 5 .   ? 4.170   56.152 21.970 1.00 29.01 ? 702 HOH A O   1 
HETATM 3413 O  O   . HOH E 5 .   ? -17.976 53.973 28.863 1.00 28.47 ? 703 HOH A O   1 
HETATM 3414 O  O   . HOH E 5 .   ? -8.404  34.895 3.353  1.00 28.56 ? 704 HOH A O   1 
HETATM 3415 O  O   . HOH E 5 .   ? 6.803   14.070 7.150  1.00 16.16 ? 705 HOH A O   1 
HETATM 3416 O  O   . HOH E 5 .   ? 15.905  57.572 16.986 1.00 19.34 ? 706 HOH A O   1 
HETATM 3417 O  O   . HOH E 5 .   ? 15.730  59.360 15.012 1.00 23.96 ? 707 HOH A O   1 
HETATM 3418 O  O   . HOH E 5 .   ? 19.968  38.298 20.994 1.00 27.75 ? 708 HOH A O   1 
HETATM 3419 O  O   . HOH E 5 .   ? 3.668   54.292 28.454 1.00 32.46 ? 709 HOH A O   1 
HETATM 3420 O  O   . HOH E 5 .   ? -9.893  51.721 40.638 1.00 23.83 ? 710 HOH A O   1 
HETATM 3421 O  O   . HOH E 5 .   ? -12.248 57.468 17.805 1.00 41.72 ? 711 HOH A O   1 
HETATM 3422 O  O   . HOH E 5 .   ? -4.883  28.608 13.330 1.00 35.38 ? 712 HOH A O   1 
HETATM 3423 O  O   . HOH E 5 .   ? -19.589 39.063 30.599 1.00 26.13 ? 713 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   0   ?   ?   ?   A . n 
A 1 2   MET 2   1   ?   ?   ?   A . n 
A 1 3   SER 3   2   ?   ?   ?   A . n 
A 1 4   SER 4   3   ?   ?   ?   A . n 
A 1 5   LYS 5   4   4   LYS LYS A . n 
A 1 6   GLY 6   5   5   GLY GLY A . n 
A 1 7   SER 7   6   6   SER SER A . n 
A 1 8   VAL 8   7   7   VAL VAL A . n 
A 1 9   VAL 9   8   8   VAL VAL A . n 
A 1 10  LEU 10  9   9   LEU LEU A . n 
A 1 11  ALA 11  10  10  ALA ALA A . n 
A 1 12  TYR 12  11  11  TYR TYR A . n 
A 1 13  SER 13  12  12  SER SER A . n 
A 1 14  GLY 14  13  13  GLY GLY A . n 
A 1 15  GLY 15  14  14  GLY GLY A . n 
A 1 16  LEU 16  15  15  LEU LEU A . n 
A 1 17  ASP 17  16  16  ASP ASP A . n 
A 1 18  THR 18  17  17  THR THR A . n 
A 1 19  SER 19  18  18  SER SER A . n 
A 1 20  CYS 20  19  19  CYS CYS A . n 
A 1 21  ILE 21  20  20  ILE ILE A . n 
A 1 22  LEU 22  21  21  LEU LEU A . n 
A 1 23  VAL 23  22  22  VAL VAL A . n 
A 1 24  TRP 24  23  23  TRP TRP A . n 
A 1 25  LEU 25  24  24  LEU LEU A . n 
A 1 26  LYS 26  25  25  LYS LYS A . n 
A 1 27  GLU 27  26  26  GLU GLU A . n 
A 1 28  GLN 28  27  27  GLN GLN A . n 
A 1 29  GLY 29  28  28  GLY GLY A . n 
A 1 30  TYR 30  29  29  TYR TYR A . n 
A 1 31  ASP 31  30  30  ASP ASP A . n 
A 1 32  VAL 32  31  31  VAL VAL A . n 
A 1 33  ILE 33  32  32  ILE ILE A . n 
A 1 34  ALA 34  33  33  ALA ALA A . n 
A 1 35  TYR 35  34  34  TYR TYR A . n 
A 1 36  LEU 36  35  35  LEU LEU A . n 
A 1 37  ALA 37  36  36  ALA ALA A . n 
A 1 38  ASN 38  37  37  ASN ASN A . n 
A 1 39  ILE 39  38  38  ILE ILE A . n 
A 1 40  GLY 40  39  39  GLY GLY A . n 
A 1 41  GLN 41  40  40  GLN GLN A . n 
A 1 42  LYS 42  41  41  LYS LYS A . n 
A 1 43  GLU 43  42  42  GLU GLU A . n 
A 1 44  ASP 44  43  43  ASP ASP A . n 
A 1 45  PHE 45  44  44  PHE PHE A . n 
A 1 46  GLU 46  45  45  GLU GLU A . n 
A 1 47  GLU 47  46  46  GLU GLU A . n 
A 1 48  ALA 48  47  47  ALA ALA A . n 
A 1 49  ARG 49  48  48  ARG ARG A . n 
A 1 50  LYS 50  49  49  LYS LYS A . n 
A 1 51  LYS 51  50  50  LYS LYS A . n 
A 1 52  ALA 52  51  51  ALA ALA A . n 
A 1 53  LEU 53  52  52  LEU LEU A . n 
A 1 54  LYS 54  53  53  LYS LYS A . n 
A 1 55  LEU 55  54  54  LEU LEU A . n 
A 1 56  GLY 56  55  55  GLY GLY A . n 
A 1 57  ALA 57  56  56  ALA ALA A . n 
A 1 58  LYS 58  57  57  LYS LYS A . n 
A 1 59  LYS 59  58  58  LYS LYS A . n 
A 1 60  VAL 60  59  59  VAL VAL A . n 
A 1 61  PHE 61  60  60  PHE PHE A . n 
A 1 62  ILE 62  61  61  ILE ILE A . n 
A 1 63  GLU 63  62  62  GLU GLU A . n 
A 1 64  ASP 64  63  63  ASP ASP A . n 
A 1 65  VAL 65  64  64  VAL VAL A . n 
A 1 66  SER 66  65  65  SER SER A . n 
A 1 67  ARG 67  66  66  ARG ARG A . n 
A 1 68  GLU 68  67  67  GLU GLU A . n 
A 1 69  PHE 69  68  68  PHE PHE A . n 
A 1 70  VAL 70  69  69  VAL VAL A . n 
A 1 71  GLU 71  70  70  GLU GLU A . n 
A 1 72  GLU 72  71  71  GLU GLU A . n 
A 1 73  PHE 73  72  72  PHE PHE A . n 
A 1 74  ILE 74  73  73  ILE ILE A . n 
A 1 75  TRP 75  74  74  TRP TRP A . n 
A 1 76  PRO 76  75  75  PRO PRO A . n 
A 1 77  ALA 77  76  76  ALA ALA A . n 
A 1 78  ILE 78  77  77  ILE ILE A . n 
A 1 79  GLN 79  78  78  GLN GLN A . n 
A 1 80  SER 80  79  79  SER SER A . n 
A 1 81  SER 81  80  80  SER SER A . n 
A 1 82  ALA 82  81  81  ALA ALA A . n 
A 1 83  LEU 83  82  82  LEU LEU A . n 
A 1 84  TYR 84  83  83  TYR TYR A . n 
A 1 85  GLU 85  84  84  GLU GLU A . n 
A 1 86  ASP 86  85  85  ASP ASP A . n 
A 1 87  ARG 87  86  86  ARG ARG A . n 
A 1 88  TYR 88  87  87  TYR TYR A . n 
A 1 89  LEU 89  88  88  LEU LEU A . n 
A 1 90  LEU 90  89  89  LEU LEU A . n 
A 1 91  GLY 91  90  90  GLY GLY A . n 
A 1 92  THR 92  91  91  THR THR A . n 
A 1 93  SER 93  92  92  SER SER A . n 
A 1 94  LEU 94  93  93  LEU LEU A . n 
A 1 95  ALA 95  94  94  ALA ALA A . n 
A 1 96  ARG 96  95  95  ARG ARG A . n 
A 1 97  PRO 97  96  96  PRO PRO A . n 
A 1 98  CYS 98  97  97  CYS CYS A . n 
A 1 99  ILE 99  98  98  ILE ILE A . n 
A 1 100 ALA 100 99  99  ALA ALA A . n 
A 1 101 ARG 101 100 100 ARG ARG A . n 
A 1 102 LYS 102 101 101 LYS LYS A . n 
A 1 103 GLN 103 102 102 GLN GLN A . n 
A 1 104 VAL 104 103 103 VAL VAL A . n 
A 1 105 GLU 105 104 104 GLU GLU A . n 
A 1 106 ILE 106 105 105 ILE ILE A . n 
A 1 107 ALA 107 106 106 ALA ALA A . n 
A 1 108 GLN 108 107 107 GLN GLN A . n 
A 1 109 ARG 109 108 108 ARG ARG A . n 
A 1 110 GLU 110 109 109 GLU GLU A . n 
A 1 111 GLY 111 110 110 GLY GLY A . n 
A 1 112 ALA 112 111 111 ALA ALA A . n 
A 1 113 LYS 113 112 112 LYS LYS A . n 
A 1 114 TYR 114 113 113 TYR TYR A . n 
A 1 115 VAL 115 114 114 VAL VAL A . n 
A 1 116 SER 116 115 115 SER SER A . n 
A 1 117 HIS 117 116 116 HIS HIS A . n 
A 1 118 GLY 118 117 117 GLY GLY A . n 
A 1 119 ALA 119 118 118 ALA ALA A . n 
A 1 120 THR 120 119 119 THR THR A . n 
A 1 121 GLY 121 120 120 GLY GLY A . n 
A 1 122 LYS 122 121 121 LYS LYS A . n 
A 1 123 GLY 123 122 122 GLY GLY A . n 
A 1 124 ASN 124 123 123 ASN ASN A . n 
A 1 125 ASP 125 124 124 ASP ASP A . n 
A 1 126 GLN 126 125 125 GLN GLN A . n 
A 1 127 VAL 127 126 126 VAL VAL A . n 
A 1 128 ARG 128 127 127 ARG ARG A . n 
A 1 129 PHE 129 128 128 PHE PHE A . n 
A 1 130 GLU 130 129 129 GLU GLU A . n 
A 1 131 LEU 131 130 130 LEU LEU A . n 
A 1 132 SER 132 131 131 SER SER A . n 
A 1 133 CYS 133 132 132 CYS CYS A . n 
A 1 134 TYR 134 133 133 TYR TYR A . n 
A 1 135 SER 135 134 134 SER SER A . n 
A 1 136 LEU 136 135 135 LEU LEU A . n 
A 1 137 ALA 137 136 136 ALA ALA A . n 
A 1 138 PRO 138 137 137 PRO PRO A . n 
A 1 139 GLN 139 138 138 GLN GLN A . n 
A 1 140 ILE 140 139 139 ILE ILE A . n 
A 1 141 LYS 141 140 140 LYS LYS A . n 
A 1 142 VAL 142 141 141 VAL VAL A . n 
A 1 143 ILE 143 142 142 ILE ILE A . n 
A 1 144 ALA 144 143 143 ALA ALA A . n 
A 1 145 PRO 145 144 144 PRO PRO A . n 
A 1 146 TRP 146 145 145 TRP TRP A . n 
A 1 147 ARG 147 146 146 ARG ARG A . n 
A 1 148 MET 148 147 147 MET MET A . n 
A 1 149 PRO 149 148 148 PRO PRO A . n 
A 1 150 GLU 150 149 149 GLU GLU A . n 
A 1 151 PHE 151 150 150 PHE PHE A . n 
A 1 152 TYR 152 151 151 TYR TYR A . n 
A 1 153 ASN 153 152 152 ASN ASN A . n 
A 1 154 ARG 154 153 153 ARG ARG A . n 
A 1 155 PHE 155 154 154 PHE PHE A . n 
A 1 156 LYS 156 155 155 LYS LYS A . n 
A 1 157 GLY 157 156 ?   ?   ?   A . n 
A 1 158 ARG 158 157 157 ARG ARG A . n 
A 1 159 ASN 159 158 158 ASN ASN A . n 
A 1 160 ASP 160 159 159 ASP ASP A . n 
A 1 161 LEU 161 160 160 LEU LEU A . n 
A 1 162 MET 162 161 161 MET MET A . n 
A 1 163 GLU 163 162 162 GLU GLU A . n 
A 1 164 TYR 164 163 163 TYR TYR A . n 
A 1 165 ALA 165 164 164 ALA ALA A . n 
A 1 166 LYS 166 165 165 LYS LYS A . n 
A 1 167 GLN 167 166 166 GLN GLN A . n 
A 1 168 HIS 168 167 167 HIS HIS A . n 
A 1 169 GLY 169 168 168 GLY GLY A . n 
A 1 170 ILE 170 169 169 ILE ILE A . n 
A 1 171 PRO 171 170 170 PRO PRO A . n 
A 1 172 ILE 172 171 171 ILE ILE A . n 
A 1 173 PRO 173 172 172 PRO PRO A . n 
A 1 174 VAL 174 173 173 VAL VAL A . n 
A 1 175 THR 175 174 174 THR THR A . n 
A 1 176 PRO 176 175 175 PRO PRO A . n 
A 1 177 LYS 177 176 176 LYS LYS A . n 
A 1 178 ASN 178 177 177 ASN ASN A . n 
A 1 179 PRO 179 178 178 PRO PRO A . n 
A 1 180 TRP 180 179 179 TRP TRP A . n 
A 1 181 SER 181 180 180 SER SER A . n 
A 1 182 MET 182 181 181 MET MET A . n 
A 1 183 ASP 183 182 182 ASP ASP A . n 
A 1 184 GLU 184 183 183 GLU GLU A . n 
A 1 185 ASN 185 184 184 ASN ASN A . n 
A 1 186 LEU 186 185 185 LEU LEU A . n 
A 1 187 MET 187 186 186 MET MET A . n 
A 1 188 HIS 188 187 187 HIS HIS A . n 
A 1 189 ILE 189 188 188 ILE ILE A . n 
A 1 190 SER 190 189 189 SER SER A . n 
A 1 191 TYR 191 190 190 TYR TYR A . n 
A 1 192 GLU 192 191 191 GLU GLU A . n 
A 1 193 ALA 193 192 192 ALA ALA A . n 
A 1 194 GLY 194 193 193 GLY GLY A . n 
A 1 195 ILE 195 194 194 ILE ILE A . n 
A 1 196 LEU 196 195 195 LEU LEU A . n 
A 1 197 GLU 197 196 196 GLU GLU A . n 
A 1 198 ASN 198 197 197 ASN ASN A . n 
A 1 199 PRO 199 198 198 PRO PRO A . n 
A 1 200 LYS 200 199 199 LYS LYS A . n 
A 1 201 ASN 201 200 200 ASN ASN A . n 
A 1 202 GLN 202 201 201 GLN GLN A . n 
A 1 203 ALA 203 202 202 ALA ALA A . n 
A 1 204 PRO 204 203 203 PRO PRO A . n 
A 1 205 PRO 205 204 204 PRO PRO A . n 
A 1 206 GLY 206 205 205 GLY GLY A . n 
A 1 207 LEU 207 206 206 LEU LEU A . n 
A 1 208 TYR 208 207 207 TYR TYR A . n 
A 1 209 THR 209 208 208 THR THR A . n 
A 1 210 LYS 210 209 209 LYS LYS A . n 
A 1 211 THR 211 210 210 THR THR A . n 
A 1 212 GLN 212 211 211 GLN GLN A . n 
A 1 213 ASP 213 212 212 ASP ASP A . n 
A 1 214 PRO 214 213 213 PRO PRO A . n 
A 1 215 ALA 215 214 214 ALA ALA A . n 
A 1 216 LYS 216 215 215 LYS LYS A . n 
A 1 217 ALA 217 216 216 ALA ALA A . n 
A 1 218 PRO 218 217 217 PRO PRO A . n 
A 1 219 ASN 219 218 218 ASN ASN A . n 
A 1 220 THR 220 219 219 THR THR A . n 
A 1 221 PRO 221 220 220 PRO PRO A . n 
A 1 222 ASP 222 221 221 ASP ASP A . n 
A 1 223 ILE 223 222 222 ILE ILE A . n 
A 1 224 LEU 224 223 223 LEU LEU A . n 
A 1 225 GLU 225 224 224 GLU GLU A . n 
A 1 226 ILE 226 225 225 ILE ILE A . n 
A 1 227 GLU 227 226 226 GLU GLU A . n 
A 1 228 PHE 228 227 227 PHE PHE A . n 
A 1 229 LYS 229 228 228 LYS LYS A . n 
A 1 230 LYS 230 229 229 LYS LYS A . n 
A 1 231 GLY 231 230 230 GLY GLY A . n 
A 1 232 VAL 232 231 231 VAL VAL A . n 
A 1 233 PRO 233 232 232 PRO PRO A . n 
A 1 234 VAL 234 233 233 VAL VAL A . n 
A 1 235 LYS 235 234 234 LYS LYS A . n 
A 1 236 VAL 236 235 235 VAL VAL A . n 
A 1 237 THR 237 236 236 THR THR A . n 
A 1 238 ASN 238 237 237 ASN ASN A . n 
A 1 239 VAL 239 238 238 VAL VAL A . n 
A 1 240 LYS 240 239 239 LYS LYS A . n 
A 1 241 ASP 241 240 240 ASP ASP A . n 
A 1 242 GLY 242 241 241 GLY GLY A . n 
A 1 243 THR 243 242 242 THR THR A . n 
A 1 244 THR 244 243 243 THR THR A . n 
A 1 245 HIS 245 244 244 HIS HIS A . n 
A 1 246 GLN 246 245 245 GLN GLN A . n 
A 1 247 THR 247 246 246 THR THR A . n 
A 1 248 SER 248 247 247 SER SER A . n 
A 1 249 LEU 249 248 248 LEU LEU A . n 
A 1 250 GLU 250 249 249 GLU GLU A . n 
A 1 251 LEU 251 250 250 LEU LEU A . n 
A 1 252 PHE 252 251 251 PHE PHE A . n 
A 1 253 MET 253 252 252 MET MET A . n 
A 1 254 TYR 254 253 253 TYR TYR A . n 
A 1 255 LEU 255 254 254 LEU LEU A . n 
A 1 256 ASN 256 255 255 ASN ASN A . n 
A 1 257 GLU 257 256 256 GLU GLU A . n 
A 1 258 VAL 258 257 257 VAL VAL A . n 
A 1 259 ALA 259 258 258 ALA ALA A . n 
A 1 260 GLY 260 259 259 GLY GLY A . n 
A 1 261 LYS 261 260 260 LYS LYS A . n 
A 1 262 HIS 262 261 261 HIS HIS A . n 
A 1 263 GLY 263 262 262 GLY GLY A . n 
A 1 264 VAL 264 263 263 VAL VAL A . n 
A 1 265 GLY 265 264 264 GLY GLY A . n 
A 1 266 ARG 266 265 265 ARG ARG A . n 
A 1 267 ILE 267 266 266 ILE ILE A . n 
A 1 268 ASP 268 267 267 ASP ASP A . n 
A 1 269 ILE 269 268 268 ILE ILE A . n 
A 1 270 VAL 270 269 269 VAL VAL A . n 
A 1 271 GLU 271 270 270 GLU GLU A . n 
A 1 272 ASN 272 271 271 ASN ASN A . n 
A 1 273 ARG 273 272 272 ARG ARG A . n 
A 1 274 PHE 274 273 273 PHE PHE A . n 
A 1 275 ILE 275 274 274 ILE ILE A . n 
A 1 276 GLY 276 275 275 GLY GLY A . n 
A 1 277 MET 277 276 276 MET MET A . n 
A 1 278 LYS 278 277 277 LYS LYS A . n 
A 1 279 SER 279 278 278 SER SER A . n 
A 1 280 ARG 280 279 279 ARG ARG A . n 
A 1 281 GLY 281 280 280 GLY GLY A . n 
A 1 282 ILE 282 281 281 ILE ILE A . n 
A 1 283 TYR 283 282 282 TYR TYR A . n 
A 1 284 GLU 284 283 283 GLU GLU A . n 
A 1 285 THR 285 284 284 THR THR A . n 
A 1 286 PRO 286 285 285 PRO PRO A . n 
A 1 287 ALA 287 286 286 ALA ALA A . n 
A 1 288 GLY 288 287 287 GLY GLY A . n 
A 1 289 THR 289 288 288 THR THR A . n 
A 1 290 ILE 290 289 289 ILE ILE A . n 
A 1 291 LEU 291 290 290 LEU LEU A . n 
A 1 292 TYR 292 291 291 TYR TYR A . n 
A 1 293 HIS 293 292 292 HIS HIS A . n 
A 1 294 ALA 294 293 293 ALA ALA A . n 
A 1 295 HIS 295 294 294 HIS HIS A . n 
A 1 296 LEU 296 295 295 LEU LEU A . n 
A 1 297 ASP 297 296 296 ASP ASP A . n 
A 1 298 ILE 298 297 297 ILE ILE A . n 
A 1 299 GLU 299 298 298 GLU GLU A . n 
A 1 300 ALA 300 299 299 ALA ALA A . n 
A 1 301 PHE 301 300 300 PHE PHE A . n 
A 1 302 THR 302 301 301 THR THR A . n 
A 1 303 MET 303 302 302 MET MET A . n 
A 1 304 ASP 304 303 303 ASP ASP A . n 
A 1 305 ARG 305 304 304 ARG ARG A . n 
A 1 306 GLU 306 305 305 GLU GLU A . n 
A 1 307 VAL 307 306 306 VAL VAL A . n 
A 1 308 ARG 308 307 307 ARG ARG A . n 
A 1 309 LYS 309 308 308 LYS LYS A . n 
A 1 310 ILE 310 309 309 ILE ILE A . n 
A 1 311 LYS 311 310 310 LYS LYS A . n 
A 1 312 GLN 312 311 311 GLN GLN A . n 
A 1 313 GLY 313 312 312 GLY GLY A . n 
A 1 314 LEU 314 313 313 LEU LEU A . n 
A 1 315 GLY 315 314 314 GLY GLY A . n 
A 1 316 LEU 316 315 315 LEU LEU A . n 
A 1 317 LYS 317 316 316 LYS LYS A . n 
A 1 318 PHE 318 317 317 PHE PHE A . n 
A 1 319 ALA 319 318 318 ALA ALA A . n 
A 1 320 GLU 320 319 319 GLU GLU A . n 
A 1 321 LEU 321 320 320 LEU LEU A . n 
A 1 322 VAL 322 321 321 VAL VAL A . n 
A 1 323 TYR 323 322 322 TYR TYR A . n 
A 1 324 THR 324 323 323 THR THR A . n 
A 1 325 GLY 325 324 324 GLY GLY A . n 
A 1 326 PHE 326 325 325 PHE PHE A . n 
A 1 327 TRP 327 326 326 TRP TRP A . n 
A 1 328 HIS 328 327 327 HIS HIS A . n 
A 1 329 SER 329 328 328 SER SER A . n 
A 1 330 PRO 330 329 329 PRO PRO A . n 
A 1 331 GLU 331 330 330 GLU GLU A . n 
A 1 332 CYS 332 331 331 CYS CYS A . n 
A 1 333 GLU 333 332 332 GLU GLU A . n 
A 1 334 PHE 334 333 333 PHE PHE A . n 
A 1 335 VAL 335 334 334 VAL VAL A . n 
A 1 336 ARG 336 335 335 ARG ARG A . n 
A 1 337 HIS 337 336 336 HIS HIS A . n 
A 1 338 CYS 338 337 337 CYS CYS A . n 
A 1 339 ILE 339 338 338 ILE ILE A . n 
A 1 340 ALA 340 339 339 ALA ALA A . n 
A 1 341 LYS 341 340 340 LYS LYS A . n 
A 1 342 SER 342 341 341 SER SER A . n 
A 1 343 GLN 343 342 342 GLN GLN A . n 
A 1 344 GLU 344 343 343 GLU GLU A . n 
A 1 345 ARG 345 344 344 ARG ARG A . n 
A 1 346 VAL 346 345 345 VAL VAL A . n 
A 1 347 GLU 347 346 346 GLU GLU A . n 
A 1 348 GLY 348 347 347 GLY GLY A . n 
A 1 349 LYS 349 348 348 LYS LYS A . n 
A 1 350 VAL 350 349 349 VAL VAL A . n 
A 1 351 GLN 351 350 350 GLN GLN A . n 
A 1 352 VAL 352 351 351 VAL VAL A . n 
A 1 353 SER 353 352 352 SER SER A . n 
A 1 354 VAL 354 353 353 VAL VAL A . n 
A 1 355 LEU 355 354 354 LEU LEU A . n 
A 1 356 LYS 356 355 355 LYS LYS A . n 
A 1 357 GLY 357 356 356 GLY GLY A . n 
A 1 358 GLN 358 357 357 GLN GLN A . n 
A 1 359 VAL 359 358 358 VAL VAL A . n 
A 1 360 TYR 360 359 359 TYR TYR A . n 
A 1 361 ILE 361 360 360 ILE ILE A . n 
A 1 362 LEU 362 361 361 LEU LEU A . n 
A 1 363 GLY 363 362 362 GLY GLY A . n 
A 1 364 ARG 364 363 363 ARG ARG A . n 
A 1 365 GLU 365 364 364 GLU GLU A . n 
A 1 366 SER 366 365 365 SER SER A . n 
A 1 367 PRO 367 366 366 PRO PRO A . n 
A 1 368 LEU 368 367 367 LEU LEU A . n 
A 1 369 SER 369 368 368 SER SER A . n 
A 1 370 LEU 370 369 369 LEU LEU A . n 
A 1 371 TYR 371 370 370 TYR TYR A . n 
A 1 372 ASN 372 371 371 ASN ASN A . n 
A 1 373 GLU 373 372 372 GLU GLU A . n 
A 1 374 GLU 374 373 373 GLU GLU A . n 
A 1 375 LEU 375 374 374 LEU LEU A . n 
A 1 376 VAL 376 375 375 VAL VAL A . n 
A 1 377 SER 377 376 376 SER SER A . n 
A 1 378 MET 378 377 ?   ?   ?   A . n 
A 1 379 ASN 379 378 378 ASN ASN A . n 
A 1 380 VAL 380 379 379 VAL VAL A . n 
A 1 381 GLN 381 380 380 GLN GLN A . n 
A 1 382 GLY 382 381 381 GLY GLY A . n 
A 1 383 ASP 383 382 382 ASP ASP A . n 
A 1 384 TYR 384 383 383 TYR TYR A . n 
A 1 385 GLU 385 384 384 GLU GLU A . n 
A 1 386 PRO 386 385 385 PRO PRO A . n 
A 1 387 THR 387 386 386 THR THR A . n 
A 1 388 ASP 388 387 387 ASP ASP A . n 
A 1 389 ALA 389 388 388 ALA ALA A . n 
A 1 390 THR 390 389 389 THR THR A . n 
A 1 391 GLY 391 390 390 GLY GLY A . n 
A 1 392 PHE 392 391 391 PHE PHE A . n 
A 1 393 ILE 393 392 392 ILE ILE A . n 
A 1 394 ASN 394 393 393 ASN ASN A . n 
A 1 395 ILE 395 394 394 ILE ILE A . n 
A 1 396 ASN 396 395 395 ASN ASN A . n 
A 1 397 SER 397 396 396 SER SER A . n 
A 1 398 LEU 398 397 397 LEU LEU A . n 
A 1 399 ARG 399 398 398 ARG ARG A . n 
A 1 400 LEU 400 399 399 LEU LEU A . n 
A 1 401 LYS 401 400 400 LYS LYS A . n 
A 1 402 GLU 402 401 401 GLU GLU A . n 
A 1 403 TYR 403 402 402 TYR TYR A . n 
A 1 404 HIS 404 403 403 HIS HIS A . n 
A 1 405 ARG 405 404 404 ARG ARG A . n 
A 1 406 LEU 406 405 405 LEU LEU A . n 
A 1 407 GLN 407 406 406 GLN GLN A . n 
A 1 408 SER 408 407 407 SER SER A . n 
A 1 409 LYS 409 408 ?   ?   ?   A . n 
A 1 410 VAL 410 409 ?   ?   ?   A . n 
A 1 411 THR 411 410 ?   ?   ?   A . n 
A 1 412 ALA 412 411 ?   ?   ?   A . n 
A 1 413 LYS 413 412 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1   503 503 NA  NA  A . 
C 3 ASP 1   501 501 ASP ASP A . 
D 4 CIR 1   502 502 CIR CIR A . 
E 5 HOH 1   504 1   HOH HOH A . 
E 5 HOH 2   505 2   HOH HOH A . 
E 5 HOH 3   506 3   HOH HOH A . 
E 5 HOH 4   507 4   HOH HOH A . 
E 5 HOH 5   508 5   HOH HOH A . 
E 5 HOH 6   509 6   HOH HOH A . 
E 5 HOH 7   510 7   HOH HOH A . 
E 5 HOH 8   511 8   HOH HOH A . 
E 5 HOH 9   512 9   HOH HOH A . 
E 5 HOH 10  513 10  HOH HOH A . 
E 5 HOH 11  514 11  HOH HOH A . 
E 5 HOH 12  515 12  HOH HOH A . 
E 5 HOH 13  516 13  HOH HOH A . 
E 5 HOH 14  517 14  HOH HOH A . 
E 5 HOH 15  518 15  HOH HOH A . 
E 5 HOH 16  519 16  HOH HOH A . 
E 5 HOH 17  520 17  HOH HOH A . 
E 5 HOH 18  521 18  HOH HOH A . 
E 5 HOH 19  522 19  HOH HOH A . 
E 5 HOH 20  523 20  HOH HOH A . 
E 5 HOH 21  524 21  HOH HOH A . 
E 5 HOH 22  525 22  HOH HOH A . 
E 5 HOH 23  526 23  HOH HOH A . 
E 5 HOH 24  527 24  HOH HOH A . 
E 5 HOH 25  528 25  HOH HOH A . 
E 5 HOH 26  529 26  HOH HOH A . 
E 5 HOH 27  530 27  HOH HOH A . 
E 5 HOH 28  531 28  HOH HOH A . 
E 5 HOH 29  532 29  HOH HOH A . 
E 5 HOH 30  533 30  HOH HOH A . 
E 5 HOH 31  534 31  HOH HOH A . 
E 5 HOH 32  535 32  HOH HOH A . 
E 5 HOH 33  536 33  HOH HOH A . 
E 5 HOH 34  537 34  HOH HOH A . 
E 5 HOH 35  538 35  HOH HOH A . 
E 5 HOH 36  539 36  HOH HOH A . 
E 5 HOH 37  540 37  HOH HOH A . 
E 5 HOH 38  541 38  HOH HOH A . 
E 5 HOH 39  542 39  HOH HOH A . 
E 5 HOH 40  543 40  HOH HOH A . 
E 5 HOH 41  544 41  HOH HOH A . 
E 5 HOH 42  545 42  HOH HOH A . 
E 5 HOH 43  546 43  HOH HOH A . 
E 5 HOH 44  547 44  HOH HOH A . 
E 5 HOH 45  548 45  HOH HOH A . 
E 5 HOH 46  549 46  HOH HOH A . 
E 5 HOH 47  550 47  HOH HOH A . 
E 5 HOH 48  551 48  HOH HOH A . 
E 5 HOH 49  552 49  HOH HOH A . 
E 5 HOH 50  553 50  HOH HOH A . 
E 5 HOH 51  554 51  HOH HOH A . 
E 5 HOH 52  555 52  HOH HOH A . 
E 5 HOH 53  556 53  HOH HOH A . 
E 5 HOH 54  557 54  HOH HOH A . 
E 5 HOH 55  558 55  HOH HOH A . 
E 5 HOH 56  559 56  HOH HOH A . 
E 5 HOH 57  560 57  HOH HOH A . 
E 5 HOH 58  561 58  HOH HOH A . 
E 5 HOH 59  562 59  HOH HOH A . 
E 5 HOH 60  563 60  HOH HOH A . 
E 5 HOH 61  564 61  HOH HOH A . 
E 5 HOH 62  565 62  HOH HOH A . 
E 5 HOH 63  566 63  HOH HOH A . 
E 5 HOH 64  567 64  HOH HOH A . 
E 5 HOH 65  568 65  HOH HOH A . 
E 5 HOH 66  569 66  HOH HOH A . 
E 5 HOH 67  570 67  HOH HOH A . 
E 5 HOH 68  571 68  HOH HOH A . 
E 5 HOH 69  572 69  HOH HOH A . 
E 5 HOH 70  573 70  HOH HOH A . 
E 5 HOH 71  574 71  HOH HOH A . 
E 5 HOH 72  575 72  HOH HOH A . 
E 5 HOH 73  576 73  HOH HOH A . 
E 5 HOH 74  577 74  HOH HOH A . 
E 5 HOH 75  578 75  HOH HOH A . 
E 5 HOH 76  579 76  HOH HOH A . 
E 5 HOH 77  580 77  HOH HOH A . 
E 5 HOH 78  581 78  HOH HOH A . 
E 5 HOH 79  582 79  HOH HOH A . 
E 5 HOH 80  583 80  HOH HOH A . 
E 5 HOH 81  584 81  HOH HOH A . 
E 5 HOH 82  585 82  HOH HOH A . 
E 5 HOH 83  586 83  HOH HOH A . 
E 5 HOH 84  587 84  HOH HOH A . 
E 5 HOH 85  588 85  HOH HOH A . 
E 5 HOH 86  589 86  HOH HOH A . 
E 5 HOH 87  590 87  HOH HOH A . 
E 5 HOH 88  591 88  HOH HOH A . 
E 5 HOH 89  592 89  HOH HOH A . 
E 5 HOH 90  593 90  HOH HOH A . 
E 5 HOH 91  594 91  HOH HOH A . 
E 5 HOH 92  595 92  HOH HOH A . 
E 5 HOH 93  596 93  HOH HOH A . 
E 5 HOH 94  597 94  HOH HOH A . 
E 5 HOH 95  598 95  HOH HOH A . 
E 5 HOH 96  599 96  HOH HOH A . 
E 5 HOH 97  600 97  HOH HOH A . 
E 5 HOH 98  601 98  HOH HOH A . 
E 5 HOH 99  602 99  HOH HOH A . 
E 5 HOH 100 603 100 HOH HOH A . 
E 5 HOH 101 604 101 HOH HOH A . 
E 5 HOH 102 605 102 HOH HOH A . 
E 5 HOH 103 606 103 HOH HOH A . 
E 5 HOH 104 607 104 HOH HOH A . 
E 5 HOH 105 608 105 HOH HOH A . 
E 5 HOH 106 609 106 HOH HOH A . 
E 5 HOH 107 610 107 HOH HOH A . 
E 5 HOH 108 611 108 HOH HOH A . 
E 5 HOH 109 612 109 HOH HOH A . 
E 5 HOH 110 613 110 HOH HOH A . 
E 5 HOH 111 614 111 HOH HOH A . 
E 5 HOH 112 615 112 HOH HOH A . 
E 5 HOH 113 616 113 HOH HOH A . 
E 5 HOH 114 617 114 HOH HOH A . 
E 5 HOH 115 618 115 HOH HOH A . 
E 5 HOH 116 619 116 HOH HOH A . 
E 5 HOH 117 620 117 HOH HOH A . 
E 5 HOH 118 621 118 HOH HOH A . 
E 5 HOH 119 622 119 HOH HOH A . 
E 5 HOH 120 623 120 HOH HOH A . 
E 5 HOH 121 624 121 HOH HOH A . 
E 5 HOH 122 625 122 HOH HOH A . 
E 5 HOH 123 626 123 HOH HOH A . 
E 5 HOH 124 627 124 HOH HOH A . 
E 5 HOH 125 628 125 HOH HOH A . 
E 5 HOH 126 629 126 HOH HOH A . 
E 5 HOH 127 630 127 HOH HOH A . 
E 5 HOH 128 631 128 HOH HOH A . 
E 5 HOH 129 632 129 HOH HOH A . 
E 5 HOH 130 633 130 HOH HOH A . 
E 5 HOH 131 634 131 HOH HOH A . 
E 5 HOH 132 635 132 HOH HOH A . 
E 5 HOH 133 636 133 HOH HOH A . 
E 5 HOH 134 637 134 HOH HOH A . 
E 5 HOH 135 638 135 HOH HOH A . 
E 5 HOH 136 639 136 HOH HOH A . 
E 5 HOH 137 640 137 HOH HOH A . 
E 5 HOH 138 641 138 HOH HOH A . 
E 5 HOH 139 642 139 HOH HOH A . 
E 5 HOH 140 643 140 HOH HOH A . 
E 5 HOH 141 644 141 HOH HOH A . 
E 5 HOH 142 645 142 HOH HOH A . 
E 5 HOH 143 646 143 HOH HOH A . 
E 5 HOH 144 647 144 HOH HOH A . 
E 5 HOH 145 648 145 HOH HOH A . 
E 5 HOH 146 649 146 HOH HOH A . 
E 5 HOH 147 650 147 HOH HOH A . 
E 5 HOH 148 651 148 HOH HOH A . 
E 5 HOH 149 652 149 HOH HOH A . 
E 5 HOH 150 653 150 HOH HOH A . 
E 5 HOH 151 654 151 HOH HOH A . 
E 5 HOH 152 655 152 HOH HOH A . 
E 5 HOH 153 656 153 HOH HOH A . 
E 5 HOH 154 657 154 HOH HOH A . 
E 5 HOH 155 658 155 HOH HOH A . 
E 5 HOH 156 659 156 HOH HOH A . 
E 5 HOH 157 660 157 HOH HOH A . 
E 5 HOH 158 661 158 HOH HOH A . 
E 5 HOH 159 662 159 HOH HOH A . 
E 5 HOH 160 663 160 HOH HOH A . 
E 5 HOH 161 664 161 HOH HOH A . 
E 5 HOH 162 665 162 HOH HOH A . 
E 5 HOH 163 666 163 HOH HOH A . 
E 5 HOH 164 667 164 HOH HOH A . 
E 5 HOH 165 668 165 HOH HOH A . 
E 5 HOH 166 669 166 HOH HOH A . 
E 5 HOH 167 670 167 HOH HOH A . 
E 5 HOH 168 671 168 HOH HOH A . 
E 5 HOH 169 672 169 HOH HOH A . 
E 5 HOH 170 673 170 HOH HOH A . 
E 5 HOH 171 674 171 HOH HOH A . 
E 5 HOH 172 675 172 HOH HOH A . 
E 5 HOH 173 676 173 HOH HOH A . 
E 5 HOH 174 677 174 HOH HOH A . 
E 5 HOH 175 678 175 HOH HOH A . 
E 5 HOH 176 679 176 HOH HOH A . 
E 5 HOH 177 680 177 HOH HOH A . 
E 5 HOH 178 681 178 HOH HOH A . 
E 5 HOH 179 682 179 HOH HOH A . 
E 5 HOH 180 683 180 HOH HOH A . 
E 5 HOH 181 684 181 HOH HOH A . 
E 5 HOH 182 685 182 HOH HOH A . 
E 5 HOH 183 686 183 HOH HOH A . 
E 5 HOH 184 687 184 HOH HOH A . 
E 5 HOH 185 688 185 HOH HOH A . 
E 5 HOH 186 689 186 HOH HOH A . 
E 5 HOH 187 690 187 HOH HOH A . 
E 5 HOH 188 691 188 HOH HOH A . 
E 5 HOH 189 692 189 HOH HOH A . 
E 5 HOH 190 693 190 HOH HOH A . 
E 5 HOH 191 694 191 HOH HOH A . 
E 5 HOH 192 695 192 HOH HOH A . 
E 5 HOH 193 696 193 HOH HOH A . 
E 5 HOH 194 697 194 HOH HOH A . 
E 5 HOH 195 698 195 HOH HOH A . 
E 5 HOH 196 699 196 HOH HOH A . 
E 5 HOH 197 700 197 HOH HOH A . 
E 5 HOH 198 701 198 HOH HOH A . 
E 5 HOH 199 702 199 HOH HOH A . 
E 5 HOH 200 703 200 HOH HOH A . 
E 5 HOH 201 704 201 HOH HOH A . 
E 5 HOH 202 705 202 HOH HOH A . 
E 5 HOH 203 706 203 HOH HOH A . 
E 5 HOH 204 707 204 HOH HOH A . 
E 5 HOH 205 708 205 HOH HOH A . 
E 5 HOH 206 709 206 HOH HOH A . 
E 5 HOH 207 710 207 HOH HOH A . 
E 5 HOH 208 711 208 HOH HOH A . 
E 5 HOH 209 712 209 HOH HOH A . 
E 5 HOH 210 713 210 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 26970 ? 
1 MORE         -137  ? 
1 'SSA (A^2)'  54910 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_555  x,-y+1/2,-z+1/2 1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
-1.0000000000 0.0000000000 58.7350000000 0.0000000000 0.0000000000 -1.0000000000 77.5750000000 
3 'crystal symmetry operation' 11_555 -x+1/2,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 47.9700000000 0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 77.5750000000 
4 'crystal symmetry operation' 14_555 -x+1/2,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 47.9700000000 0.0000000000 
-1.0000000000 0.0000000000 58.7350000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     591 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-05 
2 'Structure model' 1 1 2008-02-20 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement        5.2.0019 ? 1 
MAR345 'data collection' 345DTB   ? 2 
XDS    'data reduction'  .        ? 3 
XSCALE 'data scaling'    .        ? 4 
MOLREP phasing           .        ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 697 ? ? O A HOH 711 ? ? 1.56 
2 1 O   A HOH 509 ? ? O A HOH 688 ? ? 2.07 
3 1 O   A GLU 191 ? ? O A HOH 533 ? ? 2.09 
4 1 OE1 A GLU 249 ? ? O A HOH 626 ? ? 2.14 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 C A VAL 379 ? ? N A GLN 380 ? ? 1.032 1.336 -0.304 0.023 Y 
2 1 C A GLN 380 ? ? N A GLY 381 ? ? 1.176 1.336 -0.160 0.023 Y 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA A LEU 35  ? ? CB A LEU 35  ? ? CG A LEU 35  ? ? 129.71 115.30 14.41  2.30 N 
2 1 N  A GLU 191 ? ? CA A GLU 191 ? ? C  A GLU 191 ? ? 129.38 111.00 18.38  2.70 N 
3 1 N  A ARG 272 ? ? CA A ARG 272 ? ? C  A ARG 272 ? ? 86.09  111.00 -24.91 2.70 N 
4 1 CA A GLN 380 ? ? C  A GLN 380 ? ? N  A GLY 381 ? ? 100.97 116.20 -15.23 2.00 Y 
5 1 N  A LEU 399 ? ? CA A LEU 399 ? ? C  A LEU 399 ? ? 89.34  111.00 -21.66 2.70 N 
6 1 N  A TYR 402 ? ? CA A TYR 402 ? ? C  A TYR 402 ? ? 87.46  111.00 -23.54 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 86  ? ? -140.47 -41.91  
2  1 PHE A 154 ? ? -113.26 75.30   
3  1 PRO A 172 ? ? -49.17  153.32  
4  1 THR A 174 ? ? -99.47  32.58   
5  1 PRO A 175 ? ? -49.83  164.26  
6  1 PRO A 178 ? ? -78.10  48.16   
7  1 GLU A 191 ? ? -141.34 -36.80  
8  1 ALA A 192 ? ? -96.10  -155.15 
9  1 LYS A 239 ? ? -75.56  -75.77  
10 1 SER A 365 ? ? -174.83 133.69  
11 1 GLN A 380 ? ? 47.04   -121.50 
12 1 LEU A 399 ? ? -120.66 -50.83  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 THR A 174 ? ? PRO A 175 ? ? -102.12 
2 1 ASN A 271 ? ? ARG A 272 ? ? -131.12 
3 1 ARG A 398 ? ? LEU A 399 ? ? -113.34 
4 1 GLU A 401 ? ? TYR A 402 ? ? -125.65 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLN 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              380 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   16.54 
# 
loop_
_pdbx_validate_polymer_linkage.id 
_pdbx_validate_polymer_linkage.PDB_model_num 
_pdbx_validate_polymer_linkage.auth_atom_id_1 
_pdbx_validate_polymer_linkage.auth_asym_id_1 
_pdbx_validate_polymer_linkage.auth_comp_id_1 
_pdbx_validate_polymer_linkage.auth_seq_id_1 
_pdbx_validate_polymer_linkage.PDB_ins_code_1 
_pdbx_validate_polymer_linkage.label_alt_id_1 
_pdbx_validate_polymer_linkage.auth_atom_id_2 
_pdbx_validate_polymer_linkage.auth_asym_id_2 
_pdbx_validate_polymer_linkage.auth_comp_id_2 
_pdbx_validate_polymer_linkage.auth_seq_id_2 
_pdbx_validate_polymer_linkage.PDB_ins_code_2 
_pdbx_validate_polymer_linkage.label_alt_id_2 
_pdbx_validate_polymer_linkage.dist 
1 1 C A VAL 379 ? ? N A GLN 380 ? ? 1.03 
2 1 C A GLN 380 ? ? N A GLY 381 ? ? 1.18 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 155 ? CD  ? A LYS 156 CD  
2  1 Y 1 A LYS 155 ? CE  ? A LYS 156 CE  
3  1 Y 1 A LYS 155 ? NZ  ? A LYS 156 NZ  
4  1 Y 1 A ARG 157 ? CG  ? A ARG 158 CG  
5  1 Y 1 A ARG 157 ? CD  ? A ARG 158 CD  
6  1 Y 1 A ARG 157 ? NE  ? A ARG 158 NE  
7  1 Y 1 A ARG 157 ? CZ  ? A ARG 158 CZ  
8  1 Y 1 A ARG 157 ? NH1 ? A ARG 158 NH1 
9  1 Y 1 A ARG 157 ? NH2 ? A ARG 158 NH2 
10 1 Y 1 A ASN 378 ? CG  ? A ASN 379 CG  
11 1 Y 1 A ASN 378 ? OD1 ? A ASN 379 OD1 
12 1 Y 1 A ASN 378 ? ND2 ? A ASN 379 ND2 
13 1 Y 1 A VAL 379 ? CG1 ? A VAL 380 CG1 
14 1 Y 1 A VAL 379 ? CG2 ? A VAL 380 CG2 
15 1 Y 1 A GLN 380 ? CG  ? A GLN 381 CG  
16 1 Y 1 A GLN 380 ? CD  ? A GLN 381 CD  
17 1 Y 1 A GLN 380 ? OE1 ? A GLN 381 OE1 
18 1 Y 1 A GLN 380 ? NE2 ? A GLN 381 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 0   ? A SER 1   
2  1 Y 1 A MET 1   ? A MET 2   
3  1 Y 1 A SER 2   ? A SER 3   
4  1 Y 1 A SER 3   ? A SER 4   
5  1 Y 1 A GLY 156 ? A GLY 157 
6  1 Y 1 A MET 377 ? A MET 378 
7  1 Y 1 A LYS 408 ? A LYS 409 
8  1 Y 1 A VAL 409 ? A VAL 410 
9  1 Y 1 A THR 410 ? A THR 411 
10 1 Y 1 A ALA 411 ? A ALA 412 
11 1 Y 1 A LYS 412 ? A LYS 413 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'    NA  
3 'ASPARTIC ACID' ASP 
4 CITRULLINE      CIR 
5 water           HOH 
#