data_2NZD
# 
_entry.id   2NZD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2NZD         
NDB   PD0913       
RCSB  RCSB040491   
WWPDB D_1000040491 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX5 'X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution' unspecified 
PDB 1KX3 'X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution'  unspecified 
PDB 1KX4 'X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution'  unspecified 
# 
_pdbx_database_status.entry_id                        2NZD 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-23 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ong, M.S.'      1 
'Richmond, T.J.' 2 
'Davey, C.A.'    3 
# 
_citation.id                        primary 
_citation.title                     'DNA stretching and extreme kinking in the nucleosome core' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            368 
_citation.page_first                1067 
_citation.page_last                 1074 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17379244 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.02.062 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ong, M.S.'      1 
primary 'Richmond, T.J.' 2 
primary 'Davey, C.A.'    3 
# 
_cell.length_a           105.617 
_cell.length_b           109.856 
_cell.length_c           181.217 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2NZD 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2NZD 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'DNA (145-MER)'      44749.664 1   ? ? ? ? 
2 polymer     syn 'DNA (145-MER)'      44740.648 1   ? ? ? ? 
3 polymer     man 'Histone H3'         15303.930 2   ? ? ? ? 
4 polymer     man 'Histone H4'         11263.231 2   ? ? ? ? 
5 polymer     man 'histone H2A'        12941.095 2   ? ? ? ? 
6 polymer     man 'Histone H2B'        13848.097 2   ? ? ? ? 
7 non-polymer syn 'MANGANESE (II) ION' 54.938    11  ? ? ? ? 
8 water       nat water                18.015    122 ? ? ? ? 
# 
_entity_name_com.entity_id   6 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
3 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
6 'polypeptide(L)'        no no 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DA  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DC  n 
1 76  DA  n 
1 77  DG  n 
1 78  DC  n 
1 79  DT  n 
1 80  DG  n 
1 81  DA  n 
1 82  DA  n 
1 83  DC  n 
1 84  DA  n 
1 85  DT  n 
1 86  DG  n 
1 87  DC  n 
1 88  DC  n 
1 89  DT  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DG  n 
1 94  DA  n 
1 95  DT  n 
1 96  DG  n 
1 97  DG  n 
1 98  DA  n 
1 99  DG  n 
1 100 DC  n 
1 101 DA  n 
1 102 DG  n 
1 103 DT  n 
1 104 DT  n 
1 105 DT  n 
1 106 DC  n 
1 107 DC  n 
1 108 DA  n 
1 109 DA  n 
1 110 DA  n 
1 111 DT  n 
1 112 DA  n 
1 113 DC  n 
1 114 DA  n 
1 115 DC  n 
1 116 DT  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DG  n 
1 121 DG  n 
1 122 DT  n 
1 123 DA  n 
1 124 DG  n 
1 125 DT  n 
1 126 DA  n 
1 127 DT  n 
1 128 DC  n 
1 129 DT  n 
1 130 DG  n 
1 131 DC  n 
1 132 DA  n 
1 133 DG  n 
1 134 DG  n 
1 135 DT  n 
1 136 DG  n 
1 137 DG  n 
1 138 DA  n 
1 139 DT  n 
1 140 DA  n 
1 141 DT  n 
1 142 DT  n 
1 143 DG  n 
1 144 DA  n 
1 145 DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DC  n 
2 14  DT  n 
2 15  DG  n 
2 16  DC  n 
2 17  DA  n 
2 18  DG  n 
2 19  DA  n 
2 20  DT  n 
2 21  DA  n 
2 22  DC  n 
2 23  DT  n 
2 24  DA  n 
2 25  DC  n 
2 26  DC  n 
2 27  DA  n 
2 28  DA  n 
2 29  DA  n 
2 30  DA  n 
2 31  DG  n 
2 32  DT  n 
2 33  DG  n 
2 34  DT  n 
2 35  DA  n 
2 36  DT  n 
2 37  DT  n 
2 38  DT  n 
2 39  DG  n 
2 40  DG  n 
2 41  DA  n 
2 42  DA  n 
2 43  DA  n 
2 44  DC  n 
2 45  DT  n 
2 46  DG  n 
2 47  DC  n 
2 48  DT  n 
2 49  DC  n 
2 50  DC  n 
2 51  DA  n 
2 52  DT  n 
2 53  DC  n 
2 54  DA  n 
2 55  DA  n 
2 56  DA  n 
2 57  DA  n 
2 58  DG  n 
2 59  DG  n 
2 60  DC  n 
2 61  DA  n 
2 62  DT  n 
2 63  DG  n 
2 64  DT  n 
2 65  DT  n 
2 66  DC  n 
2 67  DA  n 
2 68  DG  n 
2 69  DC  n 
2 70  DT  n 
2 71  DG  n 
2 72  DA  n 
2 73  DT  n 
2 74  DT  n 
2 75  DC  n 
2 76  DA  n 
2 77  DG  n 
2 78  DC  n 
2 79  DT  n 
2 80  DG  n 
2 81  DA  n 
2 82  DA  n 
2 83  DC  n 
2 84  DA  n 
2 85  DT  n 
2 86  DG  n 
2 87  DC  n 
2 88  DC  n 
2 89  DT  n 
2 90  DT  n 
2 91  DT  n 
2 92  DT  n 
2 93  DG  n 
2 94  DA  n 
2 95  DT  n 
2 96  DG  n 
2 97  DG  n 
2 98  DA  n 
2 99  DG  n 
2 100 DC  n 
2 101 DA  n 
2 102 DG  n 
2 103 DT  n 
2 104 DT  n 
2 105 DT  n 
2 106 DC  n 
2 107 DC  n 
2 108 DA  n 
2 109 DA  n 
2 110 DA  n 
2 111 DT  n 
2 112 DA  n 
2 113 DC  n 
2 114 DA  n 
2 115 DC  n 
2 116 DT  n 
2 117 DT  n 
2 118 DT  n 
2 119 DT  n 
2 120 DG  n 
2 121 DG  n 
2 122 DT  n 
2 123 DA  n 
2 124 DG  n 
2 125 DT  n 
2 126 DA  n 
2 127 DT  n 
2 128 DC  n 
2 129 DT  n 
2 130 DG  n 
2 131 DC  n 
2 132 DA  n 
2 133 DG  n 
2 134 DG  n 
2 135 DT  n 
2 136 DG  n 
2 137 DG  n 
2 138 DA  n 
2 139 DT  n 
2 140 DA  n 
2 141 DT  n 
2 142 DT  n 
2 143 DG  n 
2 144 DA  n 
2 145 DT  n 
3 1   ALA n 
3 2   ARG n 
3 3   THR n 
3 4   LYS n 
3 5   GLN n 
3 6   THR n 
3 7   ALA n 
3 8   ARG n 
3 9   LYS n 
3 10  SER n 
3 11  THR n 
3 12  GLY n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  PRO n 
3 17  ARG n 
3 18  LYS n 
3 19  GLN n 
3 20  LEU n 
3 21  ALA n 
3 22  THR n 
3 23  LYS n 
3 24  ALA n 
3 25  ALA n 
3 26  ARG n 
3 27  LYS n 
3 28  SER n 
3 29  ALA n 
3 30  PRO n 
3 31  ALA n 
3 32  THR n 
3 33  GLY n 
3 34  GLY n 
3 35  VAL n 
3 36  LYS n 
3 37  LYS n 
3 38  PRO n 
3 39  HIS n 
3 40  ARG n 
3 41  TYR n 
3 42  ARG n 
3 43  PRO n 
3 44  GLY n 
3 45  THR n 
3 46  VAL n 
3 47  ALA n 
3 48  LEU n 
3 49  ARG n 
3 50  GLU n 
3 51  ILE n 
3 52  ARG n 
3 53  ARG n 
3 54  TYR n 
3 55  GLN n 
3 56  LYS n 
3 57  SER n 
3 58  THR n 
3 59  GLU n 
3 60  LEU n 
3 61  LEU n 
3 62  ILE n 
3 63  ARG n 
3 64  LYS n 
3 65  LEU n 
3 66  PRO n 
3 67  PHE n 
3 68  GLN n 
3 69  ARG n 
3 70  LEU n 
3 71  VAL n 
3 72  ARG n 
3 73  GLU n 
3 74  ILE n 
3 75  ALA n 
3 76  GLN n 
3 77  ASP n 
3 78  PHE n 
3 79  LYS n 
3 80  THR n 
3 81  ASP n 
3 82  LEU n 
3 83  ARG n 
3 84  PHE n 
3 85  GLN n 
3 86  SER n 
3 87  SER n 
3 88  ALA n 
3 89  VAL n 
3 90  MET n 
3 91  ALA n 
3 92  LEU n 
3 93  GLN n 
3 94  GLU n 
3 95  ALA n 
3 96  SER n 
3 97  GLU n 
3 98  ALA n 
3 99  TYR n 
3 100 LEU n 
3 101 VAL n 
3 102 ALA n 
3 103 LEU n 
3 104 PHE n 
3 105 GLU n 
3 106 ASP n 
3 107 THR n 
3 108 ASN n 
3 109 LEU n 
3 110 CYS n 
3 111 ALA n 
3 112 ILE n 
3 113 HIS n 
3 114 ALA n 
3 115 LYS n 
3 116 ARG n 
3 117 VAL n 
3 118 THR n 
3 119 ILE n 
3 120 MET n 
3 121 PRO n 
3 122 LYS n 
3 123 ASP n 
3 124 ILE n 
3 125 GLN n 
3 126 LEU n 
3 127 ALA n 
3 128 ARG n 
3 129 ARG n 
3 130 ILE n 
3 131 ARG n 
3 132 GLY n 
3 133 GLU n 
3 134 ARG n 
3 135 ALA n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLY n 
4 7   GLY n 
4 8   LYS n 
4 9   GLY n 
4 10  LEU n 
4 11  GLY n 
4 12  LYS n 
4 13  GLY n 
4 14  GLY n 
4 15  ALA n 
4 16  LYS n 
4 17  ARG n 
4 18  HIS n 
4 19  ARG n 
4 20  LYS n 
4 21  VAL n 
4 22  LEU n 
4 23  ARG n 
4 24  ASP n 
4 25  ASN n 
4 26  ILE n 
4 27  GLN n 
4 28  GLY n 
4 29  ILE n 
4 30  THR n 
4 31  LYS n 
4 32  PRO n 
4 33  ALA n 
4 34  ILE n 
4 35  ARG n 
4 36  ARG n 
4 37  LEU n 
4 38  ALA n 
4 39  ARG n 
4 40  ARG n 
4 41  GLY n 
4 42  GLY n 
4 43  VAL n 
4 44  LYS n 
4 45  ARG n 
4 46  ILE n 
4 47  SER n 
4 48  GLY n 
4 49  LEU n 
4 50  ILE n 
4 51  TYR n 
4 52  GLU n 
4 53  GLU n 
4 54  THR n 
4 55  ARG n 
4 56  GLY n 
4 57  VAL n 
4 58  LEU n 
4 59  LYS n 
4 60  VAL n 
4 61  PHE n 
4 62  LEU n 
4 63  GLU n 
4 64  ASN n 
4 65  VAL n 
4 66  ILE n 
4 67  ARG n 
4 68  ASP n 
4 69  ALA n 
4 70  VAL n 
4 71  THR n 
4 72  TYR n 
4 73  THR n 
4 74  GLU n 
4 75  HIS n 
4 76  ALA n 
4 77  LYS n 
4 78  ARG n 
4 79  LYS n 
4 80  THR n 
4 81  VAL n 
4 82  THR n 
4 83  ALA n 
4 84  MET n 
4 85  ASP n 
4 86  VAL n 
4 87  VAL n 
4 88  TYR n 
4 89  ALA n 
4 90  LEU n 
4 91  LYS n 
4 92  ARG n 
4 93  GLN n 
4 94  GLY n 
4 95  ARG n 
4 96  THR n 
4 97  LEU n 
4 98  TYR n 
4 99  GLY n 
4 100 PHE n 
4 101 GLY n 
4 102 GLY n 
5 1   SER n 
5 2   GLY n 
5 3   ARG n 
5 4   GLY n 
5 5   LYS n 
5 6   GLN n 
5 7   GLY n 
5 8   GLY n 
5 9   LYS n 
5 10  THR n 
5 11  ARG n 
5 12  ALA n 
5 13  LYS n 
5 14  ALA n 
5 15  LYS n 
5 16  THR n 
5 17  ARG n 
5 18  SER n 
5 19  SER n 
5 20  ARG n 
5 21  ALA n 
5 22  GLY n 
5 23  LEU n 
5 24  GLN n 
5 25  PHE n 
5 26  PRO n 
5 27  VAL n 
5 28  GLY n 
5 29  ARG n 
5 30  VAL n 
5 31  HIS n 
5 32  ARG n 
5 33  LEU n 
5 34  LEU n 
5 35  ARG n 
5 36  LYS n 
5 37  GLY n 
5 38  ASN n 
5 39  TYR n 
5 40  ALA n 
5 41  GLU n 
5 42  ARG n 
5 43  VAL n 
5 44  GLY n 
5 45  ALA n 
5 46  GLY n 
5 47  ALA n 
5 48  PRO n 
5 49  VAL n 
5 50  TYR n 
5 51  LEU n 
5 52  ALA n 
5 53  ALA n 
5 54  VAL n 
5 55  LEU n 
5 56  GLU n 
5 57  TYR n 
5 58  LEU n 
5 59  THR n 
5 60  ALA n 
5 61  GLU n 
5 62  ILE n 
5 63  LEU n 
5 64  GLU n 
5 65  LEU n 
5 66  ALA n 
5 67  GLY n 
5 68  ASN n 
5 69  ALA n 
5 70  ALA n 
5 71  ARG n 
5 72  ASP n 
5 73  ASN n 
5 74  LYS n 
5 75  LYS n 
5 76  THR n 
5 77  ARG n 
5 78  ILE n 
5 79  ILE n 
5 80  PRO n 
5 81  ARG n 
5 82  HIS n 
5 83  LEU n 
5 84  GLN n 
5 85  LEU n 
5 86  ALA n 
5 87  VAL n 
5 88  ARG n 
5 89  ASN n 
5 90  ASP n 
5 91  GLU n 
5 92  GLU n 
5 93  LEU n 
5 94  ASN n 
5 95  LYS n 
5 96  LEU n 
5 97  LEU n 
5 98  GLY n 
5 99  ARG n 
5 100 VAL n 
5 101 THR n 
5 102 ILE n 
5 103 ALA n 
5 104 GLN n 
5 105 GLY n 
5 106 GLY n 
5 107 VAL n 
5 108 LEU n 
5 109 PRO n 
5 110 ASN n 
5 111 ILE n 
5 112 GLN n 
5 113 SER n 
5 114 VAL n 
5 115 LEU n 
5 116 LEU n 
5 117 PRO n 
5 118 LYS n 
5 119 LYS n 
6 1   PRO n 
6 2   GLU n 
6 3   PRO n 
6 4   ALA n 
6 5   LYS n 
6 6   SER n 
6 7   ALA n 
6 8   PRO n 
6 9   ALA n 
6 10  PRO n 
6 11  LYS n 
6 12  LYS n 
6 13  GLY n 
6 14  SER n 
6 15  LYS n 
6 16  LYS n 
6 17  ALA n 
6 18  VAL n 
6 19  THR n 
6 20  LYS n 
6 21  THR n 
6 22  GLN n 
6 23  LYS n 
6 24  LYS n 
6 25  ASP n 
6 26  GLY n 
6 27  LYS n 
6 28  LYS n 
6 29  ARG n 
6 30  ARG n 
6 31  LYS n 
6 32  THR n 
6 33  ARG n 
6 34  LYS n 
6 35  GLU n 
6 36  SER n 
6 37  TYR n 
6 38  ALA n 
6 39  ILE n 
6 40  TYR n 
6 41  VAL n 
6 42  TYR n 
6 43  LYS n 
6 44  VAL n 
6 45  LEU n 
6 46  LYS n 
6 47  GLN n 
6 48  VAL n 
6 49  HIS n 
6 50  PRO n 
6 51  ASP n 
6 52  THR n 
6 53  GLY n 
6 54  ILE n 
6 55  SER n 
6 56  SER n 
6 57  LYS n 
6 58  ALA n 
6 59  MET n 
6 60  SER n 
6 61  ILE n 
6 62  MET n 
6 63  ASN n 
6 64  SER n 
6 65  PHE n 
6 66  VAL n 
6 67  ASN n 
6 68  ASP n 
6 69  VAL n 
6 70  PHE n 
6 71  GLU n 
6 72  ARG n 
6 73  ILE n 
6 74  ALA n 
6 75  GLY n 
6 76  GLU n 
6 77  ALA n 
6 78  SER n 
6 79  ARG n 
6 80  LEU n 
6 81  ALA n 
6 82  HIS n 
6 83  TYR n 
6 84  ASN n 
6 85  LYS n 
6 86  ARG n 
6 87  SER n 
6 88  THR n 
6 89  ILE n 
6 90  THR n 
6 91  SER n 
6 92  ARG n 
6 93  GLU n 
6 94  ILE n 
6 95  GLN n 
6 96  THR n 
6 97  ALA n 
6 98  VAL n 
6 99  ARG n 
6 100 LEU n 
6 101 LEU n 
6 102 LEU n 
6 103 PRO n 
6 104 GLY n 
6 105 GLU n 
6 106 LEU n 
6 107 ALA n 
6 108 LYS n 
6 109 HIS n 
6 110 ALA n 
6 111 VAL n 
6 112 SER n 
6 113 GLU n 
6 114 GLY n 
6 115 THR n 
6 116 LYS n 
6 117 ALA n 
6 118 VAL n 
6 119 THR n 
6 120 LYS n 
6 121 TYR n 
6 122 THR n 
6 123 SER n 
6 124 ALA n 
6 125 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 GB  CAA51455     288992 3 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCGIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA     P62799 4 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
1 ? 
3 UNP Q6AZJ8_XENLA Q6AZJ8 5 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
2 ? 
4 UNP H2B11_XENLA  P02281 6 
;PEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 ? 
5 PDB 2NZD         2NZD   1 ? ? ? 
6 PDB 2NZD         2NZD   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2NZD A 1 ? 135 ? 288992 2   ? 136 ? 1   135 
2  1 2NZD E 1 ? 135 ? 288992 2   ? 136 ? 1   135 
3  2 2NZD B 1 ? 102 ? P62799 1   ? 102 ? 1   102 
4  2 2NZD F 1 ? 102 ? P62799 1   ? 102 ? 1   102 
5  3 2NZD C 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
6  3 2NZD G 1 ? 119 ? Q6AZJ8 2   ? 120 ? 1   119 
7  4 2NZD D 1 ? 125 ? P02281 1   ? 125 ? -2  122 
8  4 2NZD H 1 ? 125 ? P02281 1   ? 125 ? -2  122 
9  5 2NZD I 1 ? 145 ? 2NZD   -72 ? 72  ? -72 72  
10 6 2NZD J 1 ? 145 ? 2NZD   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2NZD ALA A 102 ? GB  288992 GLY 103 VARIANT 102 1 
1 2NZD ALA A 111 ? GB  288992 GLY 112 VARIANT 111 2 
2 2NZD ALA E 102 ? GB  288992 GLY 103 VARIANT 102 3 
2 2NZD ALA E 111 ? GB  288992 GLY 112 VARIANT 111 4 
7 2NZD THR D 32  ? UNP P02281 SER 32  VARIANT 29  5 
8 2NZD THR H 32  ? UNP P02281 SER 32  VARIANT 29  6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2NZD 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   57.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;85 mM MnCl2, 60 mM KCl, 20 mM K-Cacodylate, 4 mg/ml NCP over well with 1/2 conc., pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 MnCl2        ? ? ? 
1 2 1 KCl          ? ? ? 
1 3 1 K-Cacodylate ? ? ? 
1 4 1 HOH          ? ? ? 
1 5 2 MnCl2        ? ? ? 
1 6 2 KCl          ? ? ? 
1 7 2 K-Cacodylate ? ? ? 
1 8 2 HOH          ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           98 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-09-05 
_diffrn_detector.details                'osmic mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.542 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.542 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2NZD 
_reflns.d_resolution_high            2.650 
_reflns.d_resolution_low             50.7 
_reflns.number_obs                   56193 
_reflns.pdbx_Rmerge_I_obs            0.065 
_reflns.pdbx_netI_over_sigmaI        20.9 
_reflns.pdbx_Rsym_value              0.065 
_reflns.pdbx_redundancy              6.300 
_reflns.percent_possible_obs         91.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   61751 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.65 
_reflns_shell.d_res_low              2.79 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    27467 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_Rsym_value        0.48 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        4.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      5579 
_reflns_shell.percent_possible_all   63.90 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2NZD 
_refine.ls_d_res_high                            2.650 
_refine.ls_d_res_low                             40.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    90.620 
_refine.ls_number_reflns_obs                     56123 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.234 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_factor_R_free                       0.283 
_refine.ls_percent_reflns_R_free                 2.000 
_refine.ls_number_reflns_R_free                  1136 
_refine.B_iso_mean                               64.218 
_refine.aniso_B[1][1]                            1.870 
_refine.aniso_B[2][2]                            -1.090 
_refine.aniso_B[3][3]                            -0.780 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.921 
_refine.correlation_coeff_Fo_to_Fc_free          0.892 
_refine.pdbx_overall_ESU_R                       0.887 
_refine.pdbx_overall_ESU_R_Free                  0.367 
_refine.overall_SU_ML                            0.259 
_refine.overall_SU_B                             11.836 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     61932 
_refine.ls_R_factor_all                          0.234 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1KX3' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2NZD 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.37 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             122 
_refine_hist.number_atoms_total               12158 
_refine_hist.d_res_high                       2.650 
_refine_hist.d_res_low                        40.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         12821 0.009  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      18556 1.450  2.543  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   757   5.086  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   269   32.509 21.338 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1181  17.427 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   84    22.437 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           2113  0.074  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     7545  0.004  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            4850  0.206  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          7995  0.309  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    396   0.152  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   22    0.218  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 5     0.234  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              3872  0.727  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             6110  1.292  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              12076 1.234  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             12446 2.202  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.650 
_refine_ls_shell.d_res_low                        2.719 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               58.460 
_refine_ls_shell.number_reflns_R_work             2573 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.302 
_refine_ls_shell.R_factor_R_free                  0.364 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2632 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2NZD 
_struct.title                     'Nucleosome core particle containing 145 bp of DNA' 
_struct.pdbx_descriptor           'Histone H3, H4, H2A, H2B/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2NZD 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            
'nucleosome, chromatin, histone, DNA stretching, DNA kinking, double-helix, STRUCTURAL PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 5 ? 
F  N N 6 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 7 ? 
P  N N 7 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 7 ? 
U  N N 7 ? 
V  N N 8 ? 
W  N N 8 ? 
X  N N 8 ? 
Y  N N 8 ? 
Z  N N 8 ? 
AA N N 8 ? 
BA N N 8 ? 
CA N N 8 ? 
DA N N 8 ? 
EA N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET C 120 ? ARG C 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN D 25  ? ILE D 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR D 30  ? GLY D 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU D 49  ? ALA D 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR D 82  ? GLN D 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR E 16  ? GLY E 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY E 46  ? ASP E 72  ? GLY C 46  ASP C 72  1 ? 27 
HELX_P HELX_P12 12 ILE E 79  ? ASN E 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 13 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR F 37  ? HIS F 49  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER F 55  ? ASN F 84  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR F 90  ? LEU F 102 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO F 103 ? SER F 123 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 19 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG G 63  ? LYS G 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 21 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET G 120 ? ARG G 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP H 24  ? ILE H 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR H 30  ? GLY H 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU H 49  ? LYS H 77  ? LEU F 49  LYS F 77  1 ? 29 
HELX_P HELX_P26 26 THR H 82  ? GLN H 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR I 16  ? GLY I 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO I 26  ? LYS I 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY I 46  ? ASN I 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE I 79  ? ASN I 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR J 37  ? HIS J 49  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER J 55  ? ASN J 84  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR J 90  ? LEU J 102 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO J 103 ? SER J 123 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? U MN .   MN ? ? ? 1_555 BA HOH .   O   ? ? E MN 1001 E HOH 1012 1_555 ? ? ? ? ? ? ?               1.804 ? 
metalc2   metalc ? ? U MN .   MN ? ? ? 1_555 BA HOH .   O   ? ? E MN 1001 E HOH 1008 1_555 ? ? ? ? ? ? ?               2.460 ? 
metalc3   metalc ? ? U MN .   MN ? ? ? 1_555 G  ASP 77  OD1 ? ? E MN 1001 E ASP 77   1_555 ? ? ? ? ? ? ?               1.993 ? 
metalc4   metalc ? ? U MN .   MN ? ? ? 1_555 CA HOH .   O   ? ? E MN 1001 F HOH 117  1_555 ? ? ? ? ? ? ?               2.253 ? 
metalc5   metalc ? ? U MN .   MN ? ? ? 1_555 BA HOH .   O   ? ? E MN 1001 E HOH 1010 1_555 ? ? ? ? ? ? ?               1.878 ? 
metalc6   metalc ? ? L MN .   MN ? ? ? 1_555 A  DG  39  N7  ? ? I MN 1003 I DG  -34  1_555 ? ? ? ? ? ? ?               2.189 ? 
metalc7   metalc ? ? L MN .   MN ? ? ? 1_555 A  DG  40  O6  ? ? I MN 1003 I DG  -33  1_555 ? ? ? ? ? ? ?               2.663 ? 
metalc8   metalc ? ? M MN .   MN ? ? ? 1_555 A  DG  120 N7  ? ? I MN 1008 I DG  47   1_555 ? ? ? ? ? ? ?               2.121 ? 
metalc9   metalc ? ? N MN .   MN ? ? ? 1_555 V  HOH .   O   ? ? I MN 1009 I HOH 1013 1_555 ? ? ? ? ? ? ?               2.217 ? 
metalc10  metalc ? ? N MN .   MN ? ? ? 1_555 A  DG  133 N7  ? ? I MN 1009 I DG  60   1_555 ? ? ? ? ? ? ?               2.262 ? 
metalc11  metalc ? ? O MN .   MN ? ? ? 1_555 A  DG  99  N7  ? ? I MN 1011 I DG  26   1_555 ? ? ? ? ? ? ?               2.127 ? 
metalc12  metalc ? ? P MN .   MN ? ? ? 1_555 B  DG  133 N7  ? ? J MN 1004 J DG  60   1_555 ? ? ? ? ? ? ?               2.456 ? 
metalc13  metalc ? ? Q MN .   MN ? ? ? 1_555 B  DG  99  N7  ? ? J MN 1005 J DG  26   1_555 ? ? ? ? ? ? ?               2.335 ? 
metalc14  metalc ? ? R MN .   MN ? ? ? 1_555 B  DG  77  N7  ? ? J MN 1006 J DG  4    1_555 ? ? ? ? ? ? ?               2.582 ? 
metalc15  metalc ? ? S MN .   MN ? ? ? 1_555 W  HOH .   O   ? ? J MN 1007 J HOH 1015 1_555 ? ? ? ? ? ? ?               2.315 ? 
metalc16  metalc ? ? S MN .   MN ? ? ? 1_555 W  HOH .   O   ? ? J MN 1007 J HOH 1019 1_555 ? ? ? ? ? ? ?               2.107 ? 
metalc17  metalc ? ? S MN .   MN ? ? ? 1_555 B  DG  120 N7  ? ? J MN 1007 J DG  47   1_555 ? ? ? ? ? ? ?               2.364 ? 
metalc18  metalc ? ? T MN .   MN ? ? ? 1_555 W  HOH .   O   ? ? J MN 1010 J HOH 1012 1_555 ? ? ? ? ? ? ?               2.681 ? 
metalc19  metalc ? ? T MN .   MN ? ? ? 1_555 B  DG  40  O6  ? ? J MN 1010 J DG  -33  1_555 ? ? ? ? ? ? ?               2.332 ? 
metalc20  metalc ? ? T MN .   MN ? ? ? 1_555 B  DG  39  N7  ? ? J MN 1010 J DG  -34  1_555 ? ? ? ? ? ? ?               2.516 ? 
metalc21  metalc ? ? U MN .   MN ? ? ? 1_555 F  VAL 48  O   ? ? E MN 1001 D VAL 45   3_545 ? ? ? ? ? ? ?               2.158 ? 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B  DT  145 N3  ? ? I DA -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B  DT  145 O4  ? ? I DA -72  J DT  72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B  DA  144 N1  ? ? I DT -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B  DA  144 N6  ? ? I DT -71  J DA  71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B  DG  143 N1  ? ? I DC -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B  DG  143 O6  ? ? I DC -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B  DG  143 N2  ? ? I DC -70  J DG  70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B  DT  142 N3  ? ? I DA -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B  DT  142 O4  ? ? I DA -69  J DT  69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B  DT  141 N3  ? ? I DA -68  J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B  DT  141 O4  ? ? I DA -68  J DT  68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B  DA  140 N1  ? ? I DT -67  J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B  DA  140 N6  ? ? I DT -67  J DA  67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B  DT  139 N3  ? ? I DA -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B  DT  139 O4  ? ? I DA -66  J DT  66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B  DA  138 N6  ? ? I DT -65  J DA  65   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog17  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B  DG  137 N2  ? ? I DC -64  J DG  64   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog18  hydrog ? ? A DC 10  N4 ? ? ? 1_555 B  DG  136 O6  ? ? I DC -63  J DG  63   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog19  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B  DT  135 O4  ? ? I DA -62  J DT  62   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog20  hydrog ? ? A DC 12  N3 ? ? ? 1_555 B  DG  134 N1  ? ? I DC -61  J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B  DG  134 O6  ? ? I DC -61  J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? A DC 12  O2 ? ? ? 1_555 B  DG  134 N2  ? ? I DC -61  J DG  61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? A DC 13  N3 ? ? ? 1_555 B  DG  133 N1  ? ? I DC -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? A DC 13  N4 ? ? ? 1_555 B  DG  133 O6  ? ? I DC -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B  DG  133 N2  ? ? I DC -60  J DG  60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B  DA  132 N1  ? ? I DT -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B  DA  132 N6  ? ? I DT -59  J DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B  DC  131 N3  ? ? I DG -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? A DG 15  N2 ? ? ? 1_555 B  DC  131 O2  ? ? I DG -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? A DG 15  O6 ? ? ? 1_555 B  DC  131 N4  ? ? I DG -58  J DC  58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? A DC 16  N3 ? ? ? 1_555 B  DG  130 N1  ? ? I DC -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B  DG  130 O6  ? ? I DC -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? A DC 16  O2 ? ? ? 1_555 B  DG  130 N2  ? ? I DC -57  J DG  57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B  DT  129 N3  ? ? I DA -56  J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B  DT  129 O4  ? ? I DA -56  J DT  56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B  DC  128 N3  ? ? I DG -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? A DG 18  N2 ? ? ? 1_555 B  DC  128 O2  ? ? I DG -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? A DG 18  O6 ? ? ? 1_555 B  DC  128 N4  ? ? I DG -55  J DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B  DT  127 N3  ? ? I DA -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? A DA 19  N6 ? ? ? 1_555 B  DT  127 O4  ? ? I DA -54  J DT  54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? A DT 20  N3 ? ? ? 1_555 B  DA  126 N1  ? ? I DT -53  J DA  53   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog42  hydrog ? ? A DA 21  N1 ? ? ? 1_555 B  DT  125 N3  ? ? I DA -52  J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? A DA 21  N6 ? ? ? 1_555 B  DT  125 O4  ? ? I DA -52  J DT  52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? A DC 22  N3 ? ? ? 1_555 B  DG  124 N1  ? ? I DC -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B  DG  124 O6  ? ? I DC -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? A DC 22  O2 ? ? ? 1_555 B  DG  124 N2  ? ? I DC -51  J DG  51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B  DA  123 N1  ? ? I DT -50  J DA  50   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog48  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B  DT  122 N3  ? ? I DA -49  J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? A DA 24  N6 ? ? ? 1_555 B  DT  122 O4  ? ? I DA -49  J DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? A DC 25  N3 ? ? ? 1_555 B  DG  121 N1  ? ? I DC -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? A DC 25  N4 ? ? ? 1_555 B  DG  121 O6  ? ? I DC -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? A DC 25  O2 ? ? ? 1_555 B  DG  121 N2  ? ? I DC -48  J DG  48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? A DC 26  N3 ? ? ? 1_555 B  DG  120 N1  ? ? I DC -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? A DC 26  N4 ? ? ? 1_555 B  DG  120 O6  ? ? I DC -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B  DG  120 N2  ? ? I DC -47  J DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B  DT  119 N3  ? ? I DA -46  J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B  DT  119 O4  ? ? I DA -46  J DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? A DA 28  N1 ? ? ? 1_555 B  DT  118 N3  ? ? I DA -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? A DA 28  N6 ? ? ? 1_555 B  DT  118 O4  ? ? I DA -45  J DT  45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B  DT  117 N3  ? ? I DA -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B  DT  117 O4  ? ? I DA -44  J DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B  DT  116 N3  ? ? I DA -43  J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B  DT  116 O4  ? ? I DA -43  J DT  43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B  DC  115 O2  ? ? I DG -42  J DC  42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog65  hydrog ? ? A DT 32  N3 ? ? ? 1_555 B  DA  114 N1  ? ? I DT -41  J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? A DT 32  O4 ? ? ? 1_555 B  DA  114 N6  ? ? I DT -41  J DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B  DC  113 N3  ? ? I DG -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? A DG 33  N2 ? ? ? 1_555 B  DC  113 O2  ? ? I DG -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? A DG 33  O6 ? ? ? 1_555 B  DC  113 N4  ? ? I DG -40  J DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? A DT 34  N3 ? ? ? 1_555 B  DA  112 N1  ? ? I DT -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B  DA  112 N6  ? ? I DT -39  J DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B  DT  111 N3  ? ? I DA -38  J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B  DT  111 O4  ? ? I DA -38  J DT  38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B  DA  109 N6  ? ? I DT -37  J DA  36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog75  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B  DA  110 N1  ? ? I DT -37  J DA  37   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog76  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B  DA  108 N6  ? ? I DT -36  J DA  35   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog77  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B  DA  109 N1  ? ? I DT -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B  DA  109 N6  ? ? I DT -36  J DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B  DA  108 N1  ? ? I DT -35  J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B  DA  108 N6  ? ? I DT -35  J DA  35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B  DC  106 N4  ? ? I DG -34  J DC  33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog82  hydrog ? ? A DG 39  N1 ? ? ? 1_555 B  DC  107 N3  ? ? I DG -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B  DC  107 O2  ? ? I DG -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B  DC  107 N4  ? ? I DG -34  J DC  34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B  DC  106 N3  ? ? I DG -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B  DC  106 O2  ? ? I DG -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B  DC  106 N4  ? ? I DG -33  J DC  33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B  DT  105 N3  ? ? I DA -32  J DT  32   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog89  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B  DT  104 N3  ? ? I DA -31  J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B  DT  104 O4  ? ? I DA -31  J DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B  DT  103 N3  ? ? I DA -30  J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B  DT  103 O4  ? ? I DA -30  J DT  30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? A DC 44  N3 ? ? ? 1_555 B  DG  102 N1  ? ? I DC -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? A DC 44  N4 ? ? ? 1_555 B  DG  102 O6  ? ? I DC -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B  DG  102 N2  ? ? I DC -29  J DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B  DA  101 N1  ? ? I DT -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? A DT 45  O4 ? ? ? 1_555 B  DA  101 N6  ? ? I DT -28  J DA  28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B  DC  100 N3  ? ? I DG -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? A DG 46  N2 ? ? ? 1_555 B  DC  100 O2  ? ? I DG -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? A DG 46  O6 ? ? ? 1_555 B  DC  100 N4  ? ? I DG -27  J DC  27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? A DC 47  N3 ? ? ? 1_555 B  DG  99  N1  ? ? I DC -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? A DC 47  N4 ? ? ? 1_555 B  DG  99  O6  ? ? I DC -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? A DC 47  O2 ? ? ? 1_555 B  DG  99  N2  ? ? I DC -26  J DG  26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? A DT 48  N3 ? ? ? 1_555 B  DA  98  N1  ? ? I DT -25  J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? A DT 48  O4 ? ? ? 1_555 B  DA  98  N6  ? ? I DT -25  J DA  25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? A DC 49  N3 ? ? ? 1_555 B  DG  97  N1  ? ? I DC -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? A DC 49  N4 ? ? ? 1_555 B  DG  97  O6  ? ? I DC -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? A DC 49  O2 ? ? ? 1_555 B  DG  97  N2  ? ? I DC -24  J DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? A DC 50  O2 ? ? ? 1_555 B  DG  96  N2  ? ? I DC -23  J DG  23   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog110 hydrog ? ? A DA 51  N1 ? ? ? 1_555 B  DT  95  N3  ? ? I DA -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? A DA 51  N6 ? ? ? 1_555 B  DT  95  O4  ? ? I DA -22  J DT  22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? A DT 52  N3 ? ? ? 1_555 B  DA  94  N1  ? ? I DT -21  J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? A DT 52  O4 ? ? ? 1_555 B  DA  94  N6  ? ? I DT -21  J DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? A DC 53  N3 ? ? ? 1_555 B  DG  93  N1  ? ? I DC -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? A DC 53  N4 ? ? ? 1_555 B  DG  93  O6  ? ? I DC -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? A DC 53  O2 ? ? ? 1_555 B  DG  93  N2  ? ? I DC -20  J DG  20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? A DA 54  N1 ? ? ? 1_555 B  DT  92  N3  ? ? I DA -19  J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? A DA 54  N6 ? ? ? 1_555 B  DT  92  O4  ? ? I DA -19  J DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? A DA 55  N1 ? ? ? 1_555 B  DT  91  N3  ? ? I DA -18  J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? A DA 55  N6 ? ? ? 1_555 B  DT  91  O4  ? ? I DA -18  J DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? A DA 56  N1 ? ? ? 1_555 B  DT  90  N3  ? ? I DA -17  J DT  17   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog122 hydrog ? ? A DA 57  N1 ? ? ? 1_555 B  DT  89  N3  ? ? I DA -16  J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? A DA 57  N6 ? ? ? 1_555 B  DT  89  O4  ? ? I DA -16  J DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? A DG 58  N1 ? ? ? 1_555 B  DC  88  N3  ? ? I DG -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? A DG 58  N2 ? ? ? 1_555 B  DC  88  O2  ? ? I DG -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? A DG 58  O6 ? ? ? 1_555 B  DC  88  N4  ? ? I DG -15  J DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? A DG 59  N1 ? ? ? 1_555 B  DC  87  N3  ? ? I DG -14  J DC  14   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog128 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B  DG  86  N2  ? ? I DC -13  J DG  13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog129 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B  DT  85  N3  ? ? I DA -12  J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? A DA 61  N6 ? ? ? 1_555 B  DT  85  O4  ? ? I DA -12  J DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B  DA  84  N1  ? ? I DT -11  J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? A DT 62  O4 ? ? ? 1_555 B  DA  84  N6  ? ? I DT -11  J DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B  DC  83  N3  ? ? I DG -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B  DC  83  O2  ? ? I DG -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B  DC  83  N4  ? ? I DG -10  J DC  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B  DA  82  N1  ? ? I DT -9   J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B  DA  82  N6  ? ? I DT -9   J DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B  DA  81  N1  ? ? I DT -8   J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B  DA  81  N6  ? ? I DT -8   J DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B  DG  80  N1  ? ? I DC -7   J DG  7    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog141 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B  DT  79  N3  ? ? I DA -6   J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B  DT  79  O4  ? ? I DA -6   J DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B  DC  78  N3  ? ? I DG -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? A DG 68  N2 ? ? ? 1_555 B  DC  78  O2  ? ? I DG -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? A DG 68  O6 ? ? ? 1_555 B  DC  78  N4  ? ? I DG -5   J DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? A DC 69  N3 ? ? ? 1_555 B  DG  77  N1  ? ? I DC -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? A DC 69  N4 ? ? ? 1_555 B  DG  77  O6  ? ? I DC -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B  DG  77  N2  ? ? I DC -4   J DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? A DT 70  N3 ? ? ? 1_555 B  DA  76  N1  ? ? I DT -3   J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? A DT 70  O4 ? ? ? 1_555 B  DA  76  N6  ? ? I DT -3   J DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B  DC  75  O2  ? ? I DG -2   J DC  2    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog152 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B  DT  74  N3  ? ? I DA -1   J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B  DT  74  O4  ? ? I DA -1   J DT  1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B  DT  73  N3  ? ? I DA 0    J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B  DT  73  O4  ? ? I DA 0    J DT  0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B  DA  72  N1  ? ? I DT 1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B  DA  72  N6  ? ? I DT 1    J DA  -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? A DC 75  N3 ? ? ? 1_555 B  DG  71  N1  ? ? I DC 2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? A DC 75  N4 ? ? ? 1_555 B  DG  71  O6  ? ? I DC 2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? A DC 75  O2 ? ? ? 1_555 B  DG  71  N2  ? ? I DC 2    J DG  -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? A DA 76  N1 ? ? ? 1_555 B  DT  70  N3  ? ? I DA 3    J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? A DA 76  N6 ? ? ? 1_555 B  DT  70  O4  ? ? I DA 3    J DT  -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? A DG 77  N1 ? ? ? 1_555 B  DC  69  N3  ? ? I DG 4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? A DG 77  N2 ? ? ? 1_555 B  DC  69  O2  ? ? I DG 4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? A DG 77  O6 ? ? ? 1_555 B  DC  69  N4  ? ? I DG 4    J DC  -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? A DC 78  N3 ? ? ? 1_555 B  DG  68  N1  ? ? I DC 5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? A DC 78  N4 ? ? ? 1_555 B  DG  68  O6  ? ? I DC 5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? A DC 78  O2 ? ? ? 1_555 B  DG  68  N2  ? ? I DC 5    J DG  -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? A DT 79  N3 ? ? ? 1_555 B  DA  67  N1  ? ? I DT 6    J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? A DT 79  O4 ? ? ? 1_555 B  DA  67  N6  ? ? I DT 6    J DA  -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? A DG 80  N1 ? ? ? 1_555 B  DC  66  N3  ? ? I DG 7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? A DG 80  N2 ? ? ? 1_555 B  DC  66  O2  ? ? I DG 7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? A DG 80  O6 ? ? ? 1_555 B  DC  66  N4  ? ? I DG 7    J DC  -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? A DA 81  N1 ? ? ? 1_555 B  DT  65  N3  ? ? I DA 8    J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? A DA 81  N6 ? ? ? 1_555 B  DT  65  O4  ? ? I DA 8    J DT  -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B  DT  64  N3  ? ? I DA 9    J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B  DT  64  O4  ? ? I DA 9    J DT  -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? A DC 83  N3 ? ? ? 1_555 B  DG  63  N1  ? ? I DC 10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? A DC 83  N4 ? ? ? 1_555 B  DG  63  O6  ? ? I DC 10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? A DC 83  O2 ? ? ? 1_555 B  DG  63  N2  ? ? I DC 10   J DG  -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? A DA 84  N1 ? ? ? 1_555 B  DT  62  N3  ? ? I DA 11   J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? A DA 84  N6 ? ? ? 1_555 B  DT  62  O4  ? ? I DA 11   J DT  -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? A DT 85  N3 ? ? ? 1_555 B  DA  61  N1  ? ? I DT 12   J DA  -12  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog184 hydrog ? ? A DG 86  N1 ? ? ? 1_555 B  DC  60  N3  ? ? I DG 13   J DC  -13  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog185 hydrog ? ? A DC 87  N3 ? ? ? 1_555 B  DG  59  N1  ? ? I DC 14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? A DC 87  N4 ? ? ? 1_555 B  DG  59  O6  ? ? I DC 14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? A DC 87  O2 ? ? ? 1_555 B  DG  59  N2  ? ? I DC 14   J DG  -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B  DG  58  N1  ? ? I DC 15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B  DG  58  O6  ? ? I DC 15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B  DG  58  N2  ? ? I DC 15   J DG  -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? A DT 89  N3 ? ? ? 1_555 B  DA  57  N1  ? ? I DT 16   J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? A DT 89  O4 ? ? ? 1_555 B  DA  57  N6  ? ? I DT 16   J DA  -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B  DA  56  N1  ? ? I DT 17   J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B  DA  56  N6  ? ? I DT 17   J DA  -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? A DT 91  N3 ? ? ? 1_555 B  DA  55  N1  ? ? I DT 18   J DA  -18  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog196 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B  DA  54  N1  ? ? I DT 19   J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B  DA  54  N6  ? ? I DT 19   J DA  -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? A DG 93  N1 ? ? ? 1_555 B  DC  53  N3  ? ? I DG 20   J DC  -20  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog199 hydrog ? ? A DA 94  N1 ? ? ? 1_555 B  DT  52  N3  ? ? I DA 21   J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? A DA 94  N6 ? ? ? 1_555 B  DT  52  O4  ? ? I DA 21   J DT  -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? A DT 95  N3 ? ? ? 1_555 B  DA  51  N1  ? ? I DT 22   J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? A DT 95  O4 ? ? ? 1_555 B  DA  51  N6  ? ? I DT 22   J DA  -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? A DG 96  N1 ? ? ? 1_555 B  DC  50  N3  ? ? I DG 23   J DC  -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog204 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B  DC  49  N3  ? ? I DG 24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B  DC  49  O2  ? ? I DG 24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B  DC  49  N4  ? ? I DG 24   J DC  -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? A DA 98  N1 ? ? ? 1_555 B  DT  48  N3  ? ? I DA 25   J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? A DA 98  N6 ? ? ? 1_555 B  DT  48  O4  ? ? I DA 25   J DT  -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? A DG 99  N1 ? ? ? 1_555 B  DC  47  N3  ? ? I DG 26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? A DG 99  N2 ? ? ? 1_555 B  DC  47  O2  ? ? I DG 26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? A DG 99  O6 ? ? ? 1_555 B  DC  47  N4  ? ? I DG 26   J DC  -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? A DC 100 O2 ? ? ? 1_555 B  DG  46  N1  ? ? I DC 27   J DG  -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog213 hydrog ? ? A DA 101 N1 ? ? ? 1_555 B  DT  45  N3  ? ? I DA 28   J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? A DA 101 N6 ? ? ? 1_555 B  DT  45  O4  ? ? I DA 28   J DT  -28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? A DG 102 N1 ? ? ? 1_555 B  DC  44  N3  ? ? I DG 29   J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? A DG 102 N2 ? ? ? 1_555 B  DC  44  O2  ? ? I DG 29   J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? A DG 102 O6 ? ? ? 1_555 B  DC  44  N4  ? ? I DG 29   J DC  -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? A DT 103 N3 ? ? ? 1_555 B  DA  43  N1  ? ? I DT 30   J DA  -30  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog219 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B  DA  42  N1  ? ? I DT 31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B  DA  42  N6  ? ? I DT 31   J DA  -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B  DA  41  N1  ? ? I DT 32   J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? A DT 105 O4 ? ? ? 1_555 B  DA  41  N6  ? ? I DT 32   J DA  -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? A DC 106 N3 ? ? ? 1_555 B  DG  40  N1  ? ? I DC 33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? A DC 106 N4 ? ? ? 1_555 B  DG  40  O6  ? ? I DC 33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? A DC 106 O2 ? ? ? 1_555 B  DG  40  N2  ? ? I DC 33   J DG  -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? A DC 107 N3 ? ? ? 1_555 B  DG  39  N1  ? ? I DC 34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? A DC 107 N4 ? ? ? 1_555 B  DG  39  O6  ? ? I DC 34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B  DG  39  N2  ? ? I DC 34   J DG  -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? A DA 108 N1 ? ? ? 1_555 B  DT  38  N3  ? ? I DA 35   J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? A DA 108 N6 ? ? ? 1_555 B  DT  38  O4  ? ? I DA 35   J DT  -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B  DT  37  N3  ? ? I DA 36   J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B  DT  37  O4  ? ? I DA 36   J DT  -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B  DT  36  N3  ? ? I DA 37   J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B  DT  36  O4  ? ? I DA 37   J DT  -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? A DT 111 N3 ? ? ? 1_555 B  DA  35  N1  ? ? I DT 38   J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? A DT 111 O4 ? ? ? 1_555 B  DA  35  N6  ? ? I DT 38   J DA  -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? A DA 112 N1 ? ? ? 1_555 B  DT  34  N3  ? ? I DA 39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? A DA 112 N6 ? ? ? 1_555 B  DT  34  O4  ? ? I DA 39   J DT  -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? A DC 113 N3 ? ? ? 1_555 B  DG  33  N1  ? ? I DC 40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? A DC 113 N4 ? ? ? 1_555 B  DG  33  O6  ? ? I DC 40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? A DC 113 O2 ? ? ? 1_555 B  DG  33  N2  ? ? I DC 40   J DG  -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? A DA 114 N1 ? ? ? 1_555 B  DT  32  N3  ? ? I DA 41   J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? A DA 114 N6 ? ? ? 1_555 B  DT  32  O4  ? ? I DA 41   J DT  -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? A DC 115 N3 ? ? ? 1_555 B  DG  31  N1  ? ? I DC 42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? A DC 115 N4 ? ? ? 1_555 B  DG  31  O6  ? ? I DC 42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? A DC 115 O2 ? ? ? 1_555 B  DG  31  N2  ? ? I DC 42   J DG  -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? A DT 116 N3 ? ? ? 1_555 B  DA  30  N1  ? ? I DT 43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? A DT 116 O4 ? ? ? 1_555 B  DA  30  N6  ? ? I DT 43   J DA  -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B  DA  29  N1  ? ? I DT 44   J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B  DA  29  N6  ? ? I DT 44   J DA  -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B  DA  28  N1  ? ? I DT 45   J DA  -45  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog252 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B  DA  27  N1  ? ? I DT 46   J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B  DA  27  N6  ? ? I DT 46   J DA  -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? A DG 120 O6 ? ? ? 1_555 B  DC  25  N4  ? ? I DG 47   J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog255 hydrog ? ? A DG 120 N1 ? ? ? 1_555 B  DC  26  N3  ? ? I DG 47   J DC  -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog256 hydrog ? ? A DG 121 O6 ? ? ? 1_555 B  DA  24  N6  ? ? I DG 48   J DA  -49  1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ?     ? 
hydrog257 hydrog ? ? A DG 121 N1 ? ? ? 1_555 B  DC  25  O2  ? ? I DG 48   J DC  -48  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog258 hydrog ? ? A DA 123 N1 ? ? ? 1_555 B  DT  23  N3  ? ? I DA 50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? A DA 123 N6 ? ? ? 1_555 B  DT  23  O4  ? ? I DA 50   J DT  -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? A DG 124 N1 ? ? ? 1_555 B  DC  22  O2  ? ? I DG 51   J DC  -51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog261 hydrog ? ? A DT 125 N3 ? ? ? 1_555 B  DA  21  N1  ? ? I DT 52   J DA  -52  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog262 hydrog ? ? A DA 126 N1 ? ? ? 1_555 B  DT  20  N3  ? ? I DA 53   J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B  DT  20  O4  ? ? I DA 53   J DT  -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? A DT 127 N3 ? ? ? 1_555 B  DA  19  N1  ? ? I DT 54   J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? A DT 127 O4 ? ? ? 1_555 B  DA  19  N6  ? ? I DT 54   J DA  -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? A DC 128 N3 ? ? ? 1_555 B  DG  18  N1  ? ? I DC 55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? A DC 128 N4 ? ? ? 1_555 B  DG  18  O6  ? ? I DC 55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? A DC 128 O2 ? ? ? 1_555 B  DG  18  N2  ? ? I DC 55   J DG  -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? A DT 129 N3 ? ? ? 1_555 B  DA  17  N1  ? ? I DT 56   J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? A DT 129 O4 ? ? ? 1_555 B  DA  17  N6  ? ? I DT 56   J DA  -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? A DG 130 N1 ? ? ? 1_555 B  DC  16  N3  ? ? I DG 57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? A DG 130 N2 ? ? ? 1_555 B  DC  16  O2  ? ? I DG 57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? A DG 130 O6 ? ? ? 1_555 B  DC  16  N4  ? ? I DG 57   J DC  -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? A DC 131 N3 ? ? ? 1_555 B  DG  15  N1  ? ? I DC 58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? A DC 131 N4 ? ? ? 1_555 B  DG  15  O6  ? ? I DC 58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? A DC 131 O2 ? ? ? 1_555 B  DG  15  N2  ? ? I DC 58   J DG  -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? A DA 132 N1 ? ? ? 1_555 B  DT  14  N3  ? ? I DA 59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? A DA 132 N6 ? ? ? 1_555 B  DT  14  O4  ? ? I DA 59   J DT  -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? A DG 133 N1 ? ? ? 1_555 B  DC  13  N3  ? ? I DG 60   J DC  -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog280 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B  DC  12  N3  ? ? I DG 61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? A DG 134 N2 ? ? ? 1_555 B  DC  12  O2  ? ? I DG 61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? A DG 134 O6 ? ? ? 1_555 B  DC  12  N4  ? ? I DG 61   J DC  -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? A DT 135 N3 ? ? ? 1_555 B  DA  11  N1  ? ? I DT 62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? A DT 135 O4 ? ? ? 1_555 B  DA  11  N6  ? ? I DT 62   J DA  -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? A DG 136 N1 ? ? ? 1_555 B  DC  10  N3  ? ? I DG 63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? A DG 136 N2 ? ? ? 1_555 B  DC  10  O2  ? ? I DG 63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? A DG 136 O6 ? ? ? 1_555 B  DC  10  N4  ? ? I DG 63   J DC  -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B  DC  9   N3  ? ? I DG 64   J DC  -64  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog289 hydrog ? ? A DA 138 N1 ? ? ? 1_555 B  DT  8   N3  ? ? I DA 65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? A DA 138 N6 ? ? ? 1_555 B  DT  8   O4  ? ? I DA 65   J DT  -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? A DT 139 N3 ? ? ? 1_555 B  DA  7   N1  ? ? I DT 66   J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? A DT 139 O4 ? ? ? 1_555 B  DA  7   N6  ? ? I DT 66   J DA  -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? A DA 140 N1 ? ? ? 1_555 B  DT  6   N3  ? ? I DA 67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? A DA 140 N6 ? ? ? 1_555 B  DT  6   O4  ? ? I DA 67   J DT  -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? A DT 141 N3 ? ? ? 1_555 B  DA  5   N1  ? ? I DT 68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? A DT 141 O4 ? ? ? 1_555 B  DA  5   N6  ? ? I DT 68   J DA  -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B  DA  4   N1  ? ? I DT 69   J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B  DA  4   N6  ? ? I DT 69   J DA  -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? A DG 143 N1 ? ? ? 1_555 B  DC  3   N3  ? ? I DG 70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? A DG 143 N2 ? ? ? 1_555 B  DC  3   O2  ? ? I DG 70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? A DG 143 O6 ? ? ? 1_555 B  DC  3   N4  ? ? I DG 70   J DC  -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? A DA 144 N1 ? ? ? 1_555 B  DT  2   N3  ? ? I DA 71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? A DA 144 N6 ? ? ? 1_555 B  DT  2   O4  ? ? I DA 71   J DT  -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? A DT 145 N3 ? ? ? 1_555 B  DA  1   N1  ? ? I DT 72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? A DT 145 O4 ? ? ? 1_555 B  DA  1   N6  ? ? I DT 72   J DA  -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
A 2 THR D 80  ? VAL D 81  ? THR B 80  VAL B 81  
B 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
B 2 ARG D 45  ? ILE D 46  ? ARG B 45  ILE B 46  
C 1 THR D 96  ? TYR D 98  ? THR B 96  TYR B 98  
C 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
D 1 ARG E 42  ? VAL E 43  ? ARG C 42  VAL C 43  
D 2 THR F 88  ? ILE F 89  ? THR D 85  ILE D 86  
E 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
E 2 GLY F 53  ? ILE F 54  ? GLY D 50  ILE D 51  
F 1 VAL E 100 ? ILE E 102 ? VAL C 100 ILE C 102 
F 2 THR H 96  ? TYR H 98  ? THR F 96  TYR F 98  
G 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
G 2 THR H 80  ? VAL H 81  ? THR F 80  VAL F 81  
H 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
H 2 ARG H 45  ? ILE H 46  ? ARG F 45  ILE F 46  
I 1 ARG I 42  ? VAL I 43  ? ARG G 42  VAL G 43  
I 2 THR J 88  ? ILE J 89  ? THR H 85  ILE H 86  
J 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
J 2 GLY J 53  ? ILE J 54  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG C 83  ? N ARG A 83  O VAL D 81  ? O VAL B 81  
B 1 2 N ILE C 119 ? N ILE A 119 O ARG D 45  ? O ARG B 45  
C 1 2 N TYR D 98  ? N TYR B 98  O THR I 101 ? O THR G 101 
D 1 2 N ARG E 42  ? N ARG C 42  O ILE F 89  ? O ILE D 86  
E 1 2 N ILE E 78  ? N ILE C 78  O GLY F 53  ? O GLY D 50  
F 1 2 N THR E 101 ? N THR C 101 O TYR H 98  ? O TYR F 98  
G 1 2 N ARG G 83  ? N ARG E 83  O VAL H 81  ? O VAL F 81  
H 1 2 N ILE G 119 ? N ILE E 119 O ARG H 45  ? O ARG F 45  
I 1 2 N ARG I 42  ? N ARG G 42  O ILE J 89  ? O ILE H 86  
J 1 2 N ILE I 78  ? N ILE G 78  O GLY J 53  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN E 1001' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 1003' 
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 1004' 
AC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 1005' 
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN J 1006' 
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 1007' 
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN I 1008' 
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 1009' 
AC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 1010' 
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN I 1011' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 VAL F  48  ? VAL D 45   . ? 3_545 ? 
2  AC1 6 ASP G  77  ? ASP E 77   . ? 1_555 ? 
3  AC1 6 HOH BA .   ? HOH E 1008 . ? 1_555 ? 
4  AC1 6 HOH BA .   ? HOH E 1010 . ? 1_555 ? 
5  AC1 6 HOH BA .   ? HOH E 1012 . ? 1_555 ? 
6  AC1 6 HOH CA .   ? HOH F 117  . ? 1_555 ? 
7  AC2 2 DG  A  39  ? DG  I -34  . ? 1_555 ? 
8  AC2 2 DG  A  40  ? DG  I -33  . ? 1_555 ? 
9  AC3 2 DG  B  133 ? DG  J 60   . ? 1_555 ? 
10 AC3 2 DG  B  134 ? DG  J 61   . ? 1_555 ? 
11 AC4 1 DG  B  99  ? DG  J 26   . ? 1_555 ? 
12 AC5 1 DG  B  77  ? DG  J 4    . ? 1_555 ? 
13 AC6 3 DG  B  120 ? DG  J 47   . ? 1_555 ? 
14 AC6 3 HOH W  .   ? HOH J 1015 . ? 1_555 ? 
15 AC6 3 HOH W  .   ? HOH J 1019 . ? 1_555 ? 
16 AC7 1 DG  A  120 ? DG  I 47   . ? 1_555 ? 
17 AC8 2 DG  A  133 ? DG  I 60   . ? 1_555 ? 
18 AC8 2 HOH V  .   ? HOH I 1013 . ? 1_555 ? 
19 AC9 3 DG  B  39  ? DG  J -34  . ? 1_555 ? 
20 AC9 3 DG  B  40  ? DG  J -33  . ? 1_555 ? 
21 AC9 3 HOH W  .   ? HOH J 1012 . ? 1_555 ? 
22 BC1 2 DA  A  98  ? DA  I 25   . ? 1_555 ? 
23 BC1 2 DG  A  99  ? DG  I 26   . ? 1_555 ? 
# 
_atom_sites.entry_id                    2NZD 
_atom_sites.fract_transf_matrix[1][1]   0.009468 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009103 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005518 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1 1   ? 1.049   0.294   95.128 1.00 136.46 ? -72  DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1 1   ? 2.145   0.612   94.276 1.00 136.92 ? -72  DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1 1   ? 3.343   -0.281  94.562 1.00 137.13 ? -72  DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1 1   ? 2.911   -1.671  94.624 1.00 137.42 ? -72  DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1 1   ? 4.470   -0.215  93.521 1.00 137.04 ? -72  DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1 1   ? 5.757   0.051   94.143 1.00 136.41 ? -72  DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1 1   ? 4.382   -1.584  92.855 1.00 137.39 ? -72  DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1 1   ? 3.916   -2.453  94.013 1.00 137.54 ? -72  DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1 1   ? 3.413   -3.748  93.556 1.00 137.61 ? -72  DA  I N9    1 
ATOM   10    C  C8    . DA  A  1 1   ? 2.235   -3.999  92.902 1.00 137.73 ? -72  DA  I C8    1 
ATOM   11    N  N7    . DA  A  1 1   ? 2.052   -5.264  92.597 1.00 137.86 ? -72  DA  I N7    1 
ATOM   12    C  C5    . DA  A  1 1   ? 3.194   -5.885  93.077 1.00 137.70 ? -72  DA  I C5    1 
ATOM   13    C  C6    . DA  A  1 1   ? 3.615   -7.233  93.071 1.00 137.54 ? -72  DA  I C6    1 
ATOM   14    N  N6    . DA  A  1 1   ? 2.892   -8.222  92.536 1.00 137.44 ? -72  DA  I N6    1 
ATOM   15    N  N1    . DA  A  1 1   ? 4.810   -7.522  93.637 1.00 137.56 ? -72  DA  I N1    1 
ATOM   16    C  C2    . DA  A  1 1   ? 5.528   -6.526  94.178 1.00 137.61 ? -72  DA  I C2    1 
ATOM   17    N  N3    . DA  A  1 1   ? 5.238   -5.224  94.239 1.00 137.52 ? -72  DA  I N3    1 
ATOM   18    C  C4    . DA  A  1 1   ? 4.046   -4.966  93.669 1.00 137.55 ? -72  DA  I C4    1 
ATOM   19    P  P     . DT  A  1 2   ? 7.198   -0.495  93.648 1.00 135.92 ? -71  DT  I P     1 
ATOM   20    O  OP1   . DT  A  1 2   ? 8.189   0.588   93.848 1.00 136.06 ? -71  DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1 2   ? 7.106   -1.119  92.306 1.00 135.79 ? -71  DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1 2   ? 7.481   -1.646  94.724 1.00 134.76 ? -71  DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1 2   ? 8.738   -1.722  95.392 1.00 132.99 ? -71  DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1 2   ? 9.625   -2.759  94.728 1.00 131.83 ? -71  DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1 2   ? 8.813   -3.856  94.233 1.00 131.69 ? -71  DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1 2   ? 10.443  -2.250  93.542 1.00 131.10 ? -71  DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1 2   ? 11.845  -2.410  93.868 1.00 130.17 ? -71  DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1 2   ? 9.911   -3.024  92.328 1.00 131.08 ? -71  DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1 2   ? 9.293   -4.266  92.967 1.00 131.07 ? -71  DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1 2   ? 8.173   -4.947  92.204 1.00 130.90 ? -71  DT  I N1    1 
ATOM   31    C  C2    . DT  A  1 2   ? 8.163   -6.331  92.123 1.00 130.73 ? -71  DT  I C2    1 
ATOM   32    O  O2    . DT  A  1 2   ? 9.010   -7.044  92.629 1.00 130.70 ? -71  DT  I O2    1 
ATOM   33    N  N3    . DT  A  1 2   ? 7.109   -6.865  91.418 1.00 130.60 ? -71  DT  I N3    1 
ATOM   34    C  C4    . DT  A  1 2   ? 6.080   -6.177  90.798 1.00 130.72 ? -71  DT  I C4    1 
ATOM   35    O  O4    . DT  A  1 2   ? 5.181   -6.754  90.192 1.00 130.68 ? -71  DT  I O4    1 
ATOM   36    C  C5    . DT  A  1 2   ? 6.144   -4.738  90.920 1.00 130.76 ? -71  DT  I C5    1 
ATOM   37    C  C7    . DT  A  1 2   ? 5.088   -3.880  90.286 1.00 130.89 ? -71  DT  I C7    1 
ATOM   38    C  C6    . DT  A  1 2   ? 7.168   -4.201  91.606 1.00 130.80 ? -71  DT  I C6    1 
ATOM   39    P  P     . DC  A  1 3   ? 12.883  -3.493  93.283 1.00 129.69 ? -70  DC  I P     1 
ATOM   40    O  OP1   . DC  A  1 3   ? 14.194  -3.170  93.890 1.00 129.75 ? -70  DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1 3   ? 12.756  -3.518  91.806 1.00 129.72 ? -70  DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1 3   ? 12.416  -4.915  93.863 1.00 128.20 ? -70  DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1 3   ? 13.394  -5.939  94.146 1.00 125.74 ? -70  DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1 3   ? 13.414  -7.075  93.123 1.00 123.88 ? -70  DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1 3   ? 12.147  -7.171  92.409 1.00 123.75 ? -70  DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1 3   ? 14.498  -7.014  92.043 1.00 122.10 ? -70  DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1 3   ? 15.081  -8.312  91.905 1.00 119.34 ? -70  DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1 3   ? 13.718  -6.629  90.786 1.00 122.46 ? -70  DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1 3   ? 12.427  -7.408  91.040 1.00 122.77 ? -70  DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1 3   ? 11.227  -7.050  90.187 1.00 122.48 ? -70  DC  I N1    1 
ATOM   51    C  C2    . DC  A  1 3   ? 10.431  -8.079  89.647 1.00 122.08 ? -70  DC  I C2    1 
ATOM   52    O  O2    . DC  A  1 3   ? 10.716  -9.264  89.870 1.00 121.70 ? -70  DC  I O2    1 
ATOM   53    N  N3    . DC  A  1 3   ? 9.355   -7.740  88.887 1.00 122.01 ? -70  DC  I N3    1 
ATOM   54    C  C4    . DC  A  1 3   ? 9.063   -6.453  88.662 1.00 122.11 ? -70  DC  I C4    1 
ATOM   55    N  N4    . DC  A  1 3   ? 7.995   -6.176  87.908 1.00 122.11 ? -70  DC  I N4    1 
ATOM   56    C  C5    . DC  A  1 3   ? 9.855   -5.394  89.200 1.00 121.92 ? -70  DC  I C5    1 
ATOM   57    C  C6    . DC  A  1 3   ? 10.912  -5.736  89.949 1.00 122.12 ? -70  DC  I C6    1 
ATOM   58    P  P     . DA  A  1 4   ? 16.476  -8.516  91.145 1.00 117.41 ? -69  DA  I P     1 
ATOM   59    O  OP1   . DA  A  1 4   ? 17.515  -7.976  92.042 1.00 117.62 ? -69  DA  I OP1   1 
ATOM   60    O  OP2   . DA  A  1 4   ? 16.360  -7.968  89.773 1.00 117.34 ? -69  DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A  1 4   ? 16.686  -10.108 91.041 1.00 115.12 ? -69  DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A  1 4   ? 15.601  -11.053 91.037 1.00 111.40 ? -69  DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A  1 4   ? 15.205  -11.559 89.647 1.00 108.10 ? -69  DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A  1 4   ? 14.130  -10.752 89.093 1.00 107.04 ? -69  DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A  1 4   ? 16.280  -11.618 88.560 1.00 106.23 ? -69  DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A  1 4   ? 16.137  -12.858 87.879 1.00 104.33 ? -69  DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A  1 4   ? 15.917  -10.453 87.639 1.00 106.00 ? -69  DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A  1 4   ? 14.395  -10.526 87.720 1.00 105.35 ? -69  DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A  1 4   ? 13.624  -9.354  87.293 1.00 104.81 ? -69  DA  I N9    1 
ATOM   70    C  C8    . DA  A  1 4   ? 13.943  -8.029  87.426 1.00 104.51 ? -69  DA  I C8    1 
ATOM   71    N  N7    . DA  A  1 4   ? 13.032  -7.210  86.953 1.00 104.52 ? -69  DA  I N7    1 
ATOM   72    C  C5    . DA  A  1 4   ? 12.041  -8.058  86.484 1.00 104.63 ? -69  DA  I C5    1 
ATOM   73    C  C6    . DA  A  1 4   ? 10.795  -7.823  85.861 1.00 104.67 ? -69  DA  I C6    1 
ATOM   74    N  N6    . DA  A  1 4   ? 10.331  -6.598  85.599 1.00 104.57 ? -69  DA  I N6    1 
ATOM   75    N  N1    . DA  A  1 4   ? 10.042  -8.891  85.513 1.00 104.42 ? -69  DA  I N1    1 
ATOM   76    C  C2    . DA  A  1 4   ? 10.511  -10.117 85.773 1.00 104.26 ? -69  DA  I C2    1 
ATOM   77    N  N3    . DA  A  1 4   ? 11.660  -10.464 86.350 1.00 104.00 ? -69  DA  I N3    1 
ATOM   78    C  C4    . DA  A  1 4   ? 12.388  -9.382  86.685 1.00 104.49 ? -69  DA  I C4    1 
ATOM   79    P  P     . DA  A  1 5   ? 17.379  -13.620 87.214 1.00 103.14 ? -68  DA  I P     1 
ATOM   80    O  OP1   . DA  A  1 5   ? 17.745  -14.740 88.110 1.00 103.23 ? -68  DA  I OP1   1 
ATOM   81    O  OP2   . DA  A  1 5   ? 18.394  -12.603 86.845 1.00 103.77 ? -68  DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A  1 5   ? 16.769  -14.237 85.862 1.00 101.09 ? -68  DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A  1 5   ? 15.763  -15.275 85.909 1.00 97.46  ? -68  DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A  1 5   ? 14.789  -15.221 84.730 1.00 94.35  ? -68  DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A  1 5   ? 14.052  -13.969 84.681 1.00 93.43  ? -68  DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A  1 5   ? 15.418  -15.405 83.352 1.00 92.32  ? -68  DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A  1 5   ? 14.615  -16.294 82.604 1.00 89.93  ? -68  DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A  1 5   ? 15.394  -14.011 82.741 1.00 92.08  ? -68  DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A  1 5   ? 14.166  -13.394 83.396 1.00 92.25  ? -68  DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A  1 5   ? 14.268  -11.946 83.541 1.00 92.24  ? -68  DA  I N9    1 
ATOM   91    C  C8    . DA  A  1 5   ? 15.323  -11.238 84.050 1.00 92.28  ? -68  DA  I C8    1 
ATOM   92    N  N7    . DA  A  1 5   ? 15.136  -9.938  84.054 1.00 92.57  ? -68  DA  I N7    1 
ATOM   93    C  C5    . DA  A  1 5   ? 13.873  -9.782  83.509 1.00 92.16  ? -68  DA  I C5    1 
ATOM   94    C  C6    . DA  A  1 5   ? 13.088  -8.643  83.238 1.00 91.98  ? -68  DA  I C6    1 
ATOM   95    N  N6    . DA  A  1 5   ? 13.490  -7.397  83.500 1.00 92.05  ? -68  DA  I N6    1 
ATOM   96    N  N1    . DA  A  1 5   ? 11.870  -8.834  82.691 1.00 91.99  ? -68  DA  I N1    1 
ATOM   97    C  C2    . DA  A  1 5   ? 11.466  -10.087 82.435 1.00 92.17  ? -68  DA  I C2    1 
ATOM   98    N  N3    . DA  A  1 5   ? 12.113  -11.234 82.643 1.00 92.00  ? -68  DA  I N3    1 
ATOM   99    C  C4    . DA  A  1 5   ? 13.323  -11.011 83.187 1.00 92.17  ? -68  DA  I C4    1 
ATOM   100   P  P     . DT  A  1 6   ? 15.236  -17.368 81.591 1.00 87.79  ? -67  DT  I P     1 
ATOM   101   O  OP1   . DT  A  1 6   ? 14.756  -18.697 82.032 1.00 87.37  ? -67  DT  I OP1   1 
ATOM   102   O  OP2   . DT  A  1 6   ? 16.684  -17.101 81.415 1.00 87.65  ? -67  DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A  1 6   ? 14.523  -17.001 80.200 1.00 86.61  ? -67  DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A  1 6   ? 13.130  -16.690 80.092 1.00 83.32  ? -67  DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A  1 6   ? 12.893  -15.561 79.096 1.00 81.53  ? -67  DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A  1 6   ? 12.986  -14.266 79.757 1.00 80.49  ? -67  DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A  1 6   ? 13.855  -15.489 77.897 1.00 80.78  ? -67  DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A  1 6   ? 13.138  -15.172 76.706 1.00 79.65  ? -67  DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A  1 6   ? 14.738  -14.299 78.258 1.00 80.71  ? -67  DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A  1 6   ? 13.605  -13.431 78.800 1.00 79.98  ? -67  DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A  1 6   ? 13.954  -12.063 79.310 1.00 79.47  ? -67  DT  I N1    1 
ATOM   112   C  C2    . DT  A  1 6   ? 12.997  -11.071 79.177 1.00 79.42  ? -67  DT  I C2    1 
ATOM   113   O  O2    . DT  A  1 6   ? 11.890  -11.252 78.690 1.00 78.86  ? -67  DT  I O2    1 
ATOM   114   N  N3    . DT  A  1 6   ? 13.387  -9.840  79.650 1.00 79.81  ? -67  DT  I N3    1 
ATOM   115   C  C4    . DT  A  1 6   ? 14.605  -9.509  80.221 1.00 79.75  ? -67  DT  I C4    1 
ATOM   116   O  O4    . DT  A  1 6   ? 14.825  -8.364  80.608 1.00 79.63  ? -67  DT  I O4    1 
ATOM   117   C  C5    . DT  A  1 6   ? 15.566  -10.594 80.322 1.00 79.33  ? -67  DT  I C5    1 
ATOM   118   C  C7    . DT  A  1 6   ? 16.928  -10.382 80.917 1.00 79.27  ? -67  DT  I C7    1 
ATOM   119   C  C6    . DT  A  1 6   ? 15.197  -11.800 79.863 1.00 79.34  ? -67  DT  I C6    1 
ATOM   120   P  P     . DA  A  1 7   ? 12.782  -16.246 75.575 1.00 78.34  ? -66  DA  I P     1 
ATOM   121   O  OP1   . DA  A  1 7   ? 12.080  -17.388 76.209 1.00 78.81  ? -66  DA  I OP1   1 
ATOM   122   O  OP2   . DA  A  1 7   ? 13.987  -16.459 74.740 1.00 77.93  ? -66  DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A  1 7   ? 11.700  -15.431 74.738 1.00 76.74  ? -66  DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A  1 7   ? 10.495  -15.073 75.400 1.00 75.11  ? -66  DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A  1 7   ? 9.968   -13.709 74.969 1.00 74.07  ? -66  DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A  1 7   ? 10.643  -12.630 75.669 1.00 73.13  ? -66  DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A  1 7   ? 10.057  -13.394 73.480 1.00 73.08  ? -66  DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A  1 7   ? 8.810   -12.788 73.160 1.00 72.87  ? -66  DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A  1 7   ? 11.266  -12.463 73.416 1.00 72.70  ? -66  DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A  1 7   ? 11.118  -11.693 74.729 1.00 72.48  ? -66  DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A  1 7   ? 12.347  -11.099 75.267 1.00 72.38  ? -66  DA  I N9    1 
ATOM   132   C  C8    . DA  A  1 7   ? 13.509  -11.753 75.565 1.00 72.07  ? -66  DA  I C8    1 
ATOM   133   N  N7    . DA  A  1 7   ? 14.447  -10.963 76.041 1.00 72.45  ? -66  DA  I N7    1 
ATOM   134   C  C5    . DA  A  1 7   ? 13.870  -9.704  76.061 1.00 72.11  ? -66  DA  I C5    1 
ATOM   135   C  C6    . DA  A  1 7   ? 14.347  -8.433  76.462 1.00 71.97  ? -66  DA  I C6    1 
ATOM   136   N  N6    . DA  A  1 7   ? 15.576  -8.230  76.942 1.00 72.14  ? -66  DA  I N6    1 
ATOM   137   N  N1    . DA  A  1 7   ? 13.514  -7.372  76.356 1.00 71.87  ? -66  DA  I N1    1 
ATOM   138   C  C2    . DA  A  1 7   ? 12.278  -7.572  75.876 1.00 71.94  ? -66  DA  I C2    1 
ATOM   139   N  N3    . DA  A  1 7   ? 11.712  -8.717  75.477 1.00 72.37  ? -66  DA  I N3    1 
ATOM   140   C  C4    . DA  A  1 7   ? 12.567  -9.765  75.589 1.00 72.53  ? -66  DA  I C4    1 
ATOM   141   P  P     . DT  A  1 8   ? 8.467   -12.101 71.757 1.00 72.46  ? -65  DT  I P     1 
ATOM   142   O  OP1   . DT  A  1 8   ? 7.007   -11.867 71.751 1.00 72.39  ? -65  DT  I OP1   1 
ATOM   143   O  OP2   . DT  A  1 8   ? 9.130   -12.852 70.672 1.00 71.52  ? -65  DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A  1 8   ? 9.152   -10.682 71.915 1.00 73.88  ? -65  DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A  1 8   ? 8.525   -9.747  72.785 1.00 76.46  ? -65  DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A  1 8   ? 8.772   -8.345  72.278 1.00 77.96  ? -65  DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A  1 8   ? 10.052  -7.887  72.770 1.00 77.35  ? -65  DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A  1 8   ? 8.818   -8.216  70.759 1.00 79.45  ? -65  DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A  1 8   ? 8.084   -7.036  70.442 1.00 82.93  ? -65  DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A  1 8   ? 10.319  -8.182  70.439 1.00 78.12  ? -65  DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A  1 8   ? 10.902  -7.543  71.693 1.00 76.03  ? -65  DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A  1 8   ? 12.298  -7.913  72.100 1.00 74.99  ? -65  DT  I N1    1 
ATOM   153   C  C2    . DT  A  1 8   ? 13.085  -6.899  72.611 1.00 74.94  ? -65  DT  I C2    1 
ATOM   154   O  O2    . DT  A  1 8   ? 12.701  -5.741  72.718 1.00 74.74  ? -65  DT  I O2    1 
ATOM   155   N  N3    . DT  A  1 8   ? 14.350  -7.289  72.992 1.00 75.19  ? -65  DT  I N3    1 
ATOM   156   C  C4    . DT  A  1 8   ? 14.896  -8.563  72.921 1.00 75.19  ? -65  DT  I C4    1 
ATOM   157   O  O4    . DT  A  1 8   ? 16.043  -8.802  73.284 1.00 74.58  ? -65  DT  I O4    1 
ATOM   158   C  C5    . DT  A  1 8   ? 14.018  -9.582  72.384 1.00 75.23  ? -65  DT  I C5    1 
ATOM   159   C  C7    . DT  A  1 8   ? 14.511  -11.000 72.259 1.00 74.98  ? -65  DT  I C7    1 
ATOM   160   C  C6    . DT  A  1 8   ? 12.772  -9.213  72.010 1.00 74.89  ? -65  DT  I C6    1 
ATOM   161   P  P     . DC  A  1 9   ? 8.039   -6.348  68.995 1.00 85.79  ? -64  DC  I P     1 
ATOM   162   O  OP1   . DC  A  1 9   ? 6.736   -5.642  68.881 1.00 85.81  ? -64  DC  I OP1   1 
ATOM   163   O  OP2   . DC  A  1 9   ? 8.472   -7.300  67.943 1.00 84.90  ? -64  DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A  1 9   ? 9.175   -5.257  69.212 1.00 86.77  ? -64  DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A  1 9   ? 9.061   -4.378  70.322 1.00 88.74  ? -64  DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A  1 9   ? 9.949   -3.191  70.056 1.00 90.21  ? -64  DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A  1 9   ? 11.288  -3.489  70.524 1.00 89.88  ? -64  DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A  1 9   ? 10.024  -2.852  68.575 1.00 91.47  ? -64  DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A  1 9   ? 9.576   -1.494  68.414 1.00 95.27  ? -64  DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A  1 9   ? 11.478  -3.135  68.172 1.00 90.12  ? -64  DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A  1 9   ? 12.235  -3.372  69.485 1.00 88.82  ? -64  DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A  1 9   ? 13.130  -4.594  69.571 1.00 88.26  ? -64  DC  I N1    1 
ATOM   173   C  C2    . DC  A  1 9   ? 14.394  -4.506  70.193 1.00 87.74  ? -64  DC  I C2    1 
ATOM   174   O  O2    . DC  A  1 9   ? 14.791  -3.433  70.659 1.00 87.81  ? -64  DC  I O2    1 
ATOM   175   N  N3    . DC  A  1 9   ? 15.179  -5.610  70.267 1.00 87.38  ? -64  DC  I N3    1 
ATOM   176   C  C4    . DC  A  1 9   ? 14.762  -6.769  69.760 1.00 87.73  ? -64  DC  I C4    1 
ATOM   177   N  N4    . DC  A  1 9   ? 15.579  -7.822  69.866 1.00 87.72  ? -64  DC  I N4    1 
ATOM   178   C  C5    . DC  A  1 9   ? 13.485  -6.891  69.130 1.00 87.83  ? -64  DC  I C5    1 
ATOM   179   C  C6    . DC  A  1 9   ? 12.713  -5.795  69.063 1.00 88.07  ? -64  DC  I C6    1 
ATOM   180   P  P     . DC  A  1 10  ? 9.123   -0.853  67.006 1.00 97.57  ? -63  DC  I P     1 
ATOM   181   O  OP1   . DC  A  1 10  ? 8.149   0.233   67.280 1.00 97.31  ? -63  DC  I OP1   1 
ATOM   182   O  OP2   . DC  A  1 10  ? 8.758   -1.926  66.049 1.00 96.96  ? -63  DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A  1 10  ? 10.513  -0.201  66.558 1.00 98.61  ? -63  DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A  1 10  ? 11.257  0.525   67.531 1.00 101.97 ? -63  DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A  1 10  ? 12.711  0.647   67.129 1.00 104.56 ? -63  DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A  1 10  ? 13.491  -0.483  67.594 1.00 104.54 ? -63  DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A  1 10  ? 12.937  0.739   65.622 1.00 106.85 ? -63  DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A  1 10  ? 13.754  1.875   65.363 1.00 110.13 ? -63  DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A  1 10  ? 13.656  -0.564  65.299 1.00 106.23 ? -63  DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A  1 10  ? 14.448  -0.728  66.592 1.00 105.00 ? -63  DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A  1 10  ? 15.074  -2.063  66.775 1.00 104.85 ? -63  DC  I N1    1 
ATOM   192   C  C2    . DC  A  1 10  ? 16.313  -2.163  67.438 1.00 104.96 ? -63  DC  I C2    1 
ATOM   193   O  O2    . DC  A  1 10  ? 16.872  -1.144  67.873 1.00 104.72 ? -63  DC  I O2    1 
ATOM   194   N  N3    . DC  A  1 10  ? 16.873  -3.395  67.586 1.00 104.76 ? -63  DC  I N3    1 
ATOM   195   C  C4    . DC  A  1 10  ? 16.241  -4.473  67.103 1.00 104.73 ? -63  DC  I C4    1 
ATOM   196   N  N4    . DC  A  1 10  ? 16.823  -5.662  67.273 1.00 104.74 ? -63  DC  I N4    1 
ATOM   197   C  C5    . DC  A  1 10  ? 14.984  -4.388  66.425 1.00 104.57 ? -63  DC  I C5    1 
ATOM   198   C  C6    . DC  A  1 10  ? 14.443  -3.175  66.282 1.00 104.48 ? -63  DC  I C6    1 
ATOM   199   P  P     . DA  A  1 11  ? 13.521  2.814   64.088 1.00 112.16 ? -62  DA  I P     1 
ATOM   200   O  OP1   . DA  A  1 11  ? 12.084  3.200   64.025 1.00 111.44 ? -62  DA  I OP1   1 
ATOM   201   O  OP2   . DA  A  1 11  ? 14.154  2.122   62.940 1.00 111.89 ? -62  DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A  1 11  ? 14.403  4.106   64.456 1.00 112.89 ? -62  DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A  1 11  ? 15.384  4.065   65.501 1.00 114.53 ? -62  DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A  1 11  ? 16.767  3.763   64.949 1.00 115.91 ? -62  DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A  1 11  ? 17.166  2.405   65.288 1.00 115.87 ? -62  DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A  1 11  ? 16.957  3.931   63.440 1.00 117.03 ? -62  DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A  1 11  ? 18.016  4.879   63.194 1.00 119.07 ? -62  DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A  1 11  ? 17.228  2.504   62.959 1.00 116.58 ? -62  DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A  1 11  ? 17.869  1.867   64.185 1.00 115.94 ? -62  DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A  1 11  ? 17.778  0.408   64.174 1.00 115.89 ? -62  DA  I N9    1 
ATOM   211   C  C8    . DA  A  1 11  ? 16.691  -0.346  63.822 1.00 115.76 ? -62  DA  I C8    1 
ATOM   212   N  N7    . DA  A  1 11  ? 16.885  -1.641  63.898 1.00 115.68 ? -62  DA  I N7    1 
ATOM   213   C  C5    . DA  A  1 11  ? 18.198  -1.751  64.323 1.00 115.63 ? -62  DA  I C5    1 
ATOM   214   C  C6    . DA  A  1 11  ? 19.018  -2.869  64.596 1.00 115.70 ? -62  DA  I C6    1 
ATOM   215   N  N6    . DA  A  1 11  ? 18.596  -4.130  64.468 1.00 115.66 ? -62  DA  I N6    1 
ATOM   216   N  N1    . DA  A  1 11  ? 20.290  -2.640  65.002 1.00 115.71 ? -62  DA  I N1    1 
ATOM   217   C  C2    . DA  A  1 11  ? 20.705  -1.368  65.129 1.00 115.87 ? -62  DA  I C2    1 
ATOM   218   N  N3    . DA  A  1 11  ? 20.027  -0.235  64.900 1.00 115.82 ? -62  DA  I N3    1 
ATOM   219   C  C4    . DA  A  1 11  ? 18.767  -0.497  64.497 1.00 115.79 ? -62  DA  I C4    1 
ATOM   220   P  P     . DC  A  1 12  ? 19.160  4.755   62.067 1.00 120.54 ? -61  DC  I P     1 
ATOM   221   O  OP1   . DC  A  1 12  ? 19.864  6.054   62.054 1.00 120.58 ? -61  DC  I OP1   1 
ATOM   222   O  OP2   . DC  A  1 12  ? 18.528  4.267   60.822 1.00 120.26 ? -61  DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A  1 12  ? 20.183  3.633   62.611 1.00 121.56 ? -61  DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A  1 12  ? 21.342  3.956   63.403 1.00 122.67 ? -61  DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A  1 12  ? 22.471  2.954   63.185 1.00 123.70 ? -61  DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A  1 12  ? 21.969  1.593   63.319 1.00 123.83 ? -61  DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A  1 12  ? 23.168  3.017   61.822 1.00 124.50 ? -61  DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A  1 12  ? 24.599  2.857   61.990 1.00 126.20 ? -61  DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A  1 12  ? 22.518  1.851   61.081 1.00 124.21 ? -61  DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A  1 12  ? 22.447  0.837   62.219 1.00 123.76 ? -61  DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A  1 12  ? 21.586  -0.379  61.931 1.00 123.60 ? -61  DC  I N1    1 
ATOM   232   C  C2    . DC  A  1 12  ? 22.108  -1.680  62.107 1.00 123.26 ? -61  DC  I C2    1 
ATOM   233   O  O2    . DC  A  1 12  ? 23.270  -1.833  62.511 1.00 123.04 ? -61  DC  I O2    1 
ATOM   234   N  N3    . DC  A  1 12  ? 21.310  -2.752  61.833 1.00 123.11 ? -61  DC  I N3    1 
ATOM   235   C  C4    . DC  A  1 12  ? 20.056  -2.564  61.398 1.00 123.26 ? -61  DC  I C4    1 
ATOM   236   N  N4    . DC  A  1 12  ? 19.305  -3.639  61.140 1.00 123.11 ? -61  DC  I N4    1 
ATOM   237   C  C5    . DC  A  1 12  ? 19.511  -1.256  61.206 1.00 123.18 ? -61  DC  I C5    1 
ATOM   238   C  C6    . DC  A  1 12  ? 20.301  -0.209  61.480 1.00 123.42 ? -61  DC  I C6    1 
ATOM   239   P  P     . DC  A  1 13  ? 25.636  2.420   60.828 1.00 127.13 ? -60  DC  I P     1 
ATOM   240   O  OP1   . DC  A  1 13  ? 26.983  2.872   61.244 1.00 127.54 ? -60  DC  I OP1   1 
ATOM   241   O  OP2   . DC  A  1 13  ? 25.101  2.861   59.518 1.00 126.95 ? -60  DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A  1 13  ? 25.623  0.817   60.887 1.00 127.36 ? -60  DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A  1 13  ? 26.770  0.081   61.313 1.00 127.72 ? -60  DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A  1 13  ? 27.005  -1.125  60.417 1.00 128.20 ? -60  DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A  1 13  ? 25.803  -1.946  60.366 1.00 128.50 ? -60  DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A  1 13  ? 27.388  -0.820  58.964 1.00 128.30 ? -60  DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A  1 13  ? 28.459  -1.696  58.571 1.00 128.11 ? -60  DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A  1 13  ? 26.094  -1.118  58.212 1.00 128.64 ? -60  DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A  1 13  ? 25.562  -2.301  59.016 1.00 128.91 ? -60  DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A  1 13  ? 24.103  -2.604  58.781 1.00 129.12 ? -60  DC  I N1    1 
ATOM   251   C  C2    . DC  A  1 13  ? 23.660  -3.932  58.613 1.00 129.14 ? -60  DC  I C2    1 
ATOM   252   O  O2    . DC  A  1 13  ? 24.468  -4.871  58.663 1.00 129.09 ? -60  DC  I O2    1 
ATOM   253   N  N3    . DC  A  1 13  ? 22.333  -4.156  58.400 1.00 129.05 ? -60  DC  I N3    1 
ATOM   254   C  C4    . DC  A  1 13  ? 21.472  -3.132  58.349 1.00 129.02 ? -60  DC  I C4    1 
ATOM   255   N  N4    . DC  A  1 13  ? 20.180  -3.396  58.141 1.00 129.01 ? -60  DC  I N4    1 
ATOM   256   C  C5    . DC  A  1 13  ? 21.898  -1.781  58.513 1.00 129.18 ? -60  DC  I C5    1 
ATOM   257   C  C6    . DC  A  1 13  ? 23.204  -1.570  58.723 1.00 129.30 ? -60  DC  I C6    1 
ATOM   258   P  P     . DT  A  1 14  ? 29.085  -1.817  57.092 1.00 127.76 ? -59  DT  I P     1 
ATOM   259   O  OP1   . DT  A  1 14  ? 30.467  -1.289  57.158 1.00 127.99 ? -59  DT  I OP1   1 
ATOM   260   O  OP2   . DT  A  1 14  ? 28.152  -1.263  56.080 1.00 127.59 ? -59  DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A  1 14  ? 29.137  -3.415  56.921 1.00 127.34 ? -59  DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A  1 14  ? 30.163  -4.084  56.166 1.00 126.49 ? -59  DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A  1 14  ? 29.722  -5.472  55.701 1.00 125.95 ? -59  DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A  1 14  ? 28.297  -5.686  55.919 1.00 126.11 ? -59  DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A  1 14  ? 29.947  -5.765  54.222 1.00 125.45 ? -59  DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A  1 14  ? 30.238  -7.156  54.053 1.00 124.71 ? -59  DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A  1 14  ? 28.601  -5.389  53.611 1.00 125.74 ? -59  DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A  1 14  ? 27.636  -5.896  54.682 1.00 126.04 ? -59  DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A  1 14  ? 26.258  -5.245  54.669 1.00 126.31 ? -59  DT  I N1    1 
ATOM   270   C  C2    . DT  A  1 14  ? 25.131  -6.031  54.874 1.00 126.35 ? -59  DT  I C2    1 
ATOM   271   O  O2    . DT  A  1 14  ? 25.165  -7.235  55.078 1.00 126.25 ? -59  DT  I O2    1 
ATOM   272   N  N3    . DT  A  1 14  ? 23.934  -5.346  54.832 1.00 126.29 ? -59  DT  I N3    1 
ATOM   273   C  C4    . DT  A  1 14  ? 23.745  -3.991  54.612 1.00 126.12 ? -59  DT  I C4    1 
ATOM   274   O  O4    . DT  A  1 14  ? 22.624  -3.491  54.599 1.00 126.14 ? -59  DT  I O4    1 
ATOM   275   C  C5    . DT  A  1 14  ? 24.953  -3.222  54.401 1.00 126.13 ? -59  DT  I C5    1 
ATOM   276   C  C7    . DT  A  1 14  ? 24.885  -1.742  54.150 1.00 126.04 ? -59  DT  I C7    1 
ATOM   277   C  C6    . DT  A  1 14  ? 26.129  -3.877  54.440 1.00 126.29 ? -59  DT  I C6    1 
ATOM   278   P  P     . DG  A  1 15  ? 30.692  -7.779  52.643 1.00 123.84 ? -58  DG  I P     1 
ATOM   279   O  OP1   . DG  A  1 15  ? 31.950  -8.527  52.872 1.00 123.61 ? -58  DG  I OP1   1 
ATOM   280   O  OP2   . DG  A  1 15  ? 30.639  -6.719  51.605 1.00 123.89 ? -58  DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A  1 15  ? 29.517  -8.809  52.311 1.00 122.51 ? -58  DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A  1 15  ? 29.345  -10.020 53.036 1.00 121.11 ? -58  DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A  1 15  ? 28.077  -10.711 52.562 1.00 120.34 ? -58  DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A  1 15  ? 26.937  -9.818  52.681 1.00 120.20 ? -58  DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A  1 15  ? 28.087  -11.180 51.110 1.00 119.84 ? -58  DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A  1 15  ? 27.471  -12.462 51.035 1.00 119.10 ? -58  DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A  1 15  ? 27.283  -10.112 50.366 1.00 119.79 ? -58  DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A  1 15  ? 26.279  -9.683  51.432 1.00 119.57 ? -58  DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A  1 15  ? 25.807  -8.301  51.309 1.00 119.49 ? -58  DG  I N9    1 
ATOM   290   C  C8    . DG  A  1 15  ? 26.580  -7.165  51.242 1.00 119.31 ? -58  DG  I C8    1 
ATOM   291   N  N7    . DG  A  1 15  ? 25.886  -6.065  51.139 1.00 119.24 ? -58  DG  I N7    1 
ATOM   292   C  C5    . DG  A  1 15  ? 24.565  -6.492  51.141 1.00 119.26 ? -58  DG  I C5    1 
ATOM   293   C  C6    . DG  A  1 15  ? 23.362  -5.745  51.056 1.00 119.18 ? -58  DG  I C6    1 
ATOM   294   O  O6    . DG  A  1 15  ? 23.222  -4.520  50.961 1.00 119.23 ? -58  DG  I O6    1 
ATOM   295   N  N1    . DG  A  1 15  ? 22.235  -6.562  51.089 1.00 119.21 ? -58  DG  I N1    1 
ATOM   296   C  C2    . DG  A  1 15  ? 22.267  -7.932  51.195 1.00 119.26 ? -58  DG  I C2    1 
ATOM   297   N  N2    . DG  A  1 15  ? 21.082  -8.555  51.212 1.00 119.30 ? -58  DG  I N2    1 
ATOM   298   N  N3    . DG  A  1 15  ? 23.386  -8.644  51.278 1.00 119.38 ? -58  DG  I N3    1 
ATOM   299   C  C4    . DG  A  1 15  ? 24.498  -7.865  51.246 1.00 119.41 ? -58  DG  I C4    1 
ATOM   300   P  P     . DC  A  1 16  ? 27.546  -13.337 49.697 1.00 118.60 ? -57  DC  I P     1 
ATOM   301   O  OP1   . DC  A  1 16  ? 27.413  -14.760 50.082 1.00 118.37 ? -57  DC  I OP1   1 
ATOM   302   O  OP2   . DC  A  1 16  ? 28.716  -12.875 48.914 1.00 118.67 ? -57  DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A  1 16  ? 26.241  -12.884 48.887 1.00 117.85 ? -57  DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A  1 16  ? 24.929  -12.949 49.451 1.00 116.10 ? -57  DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A  1 16  ? 23.917  -12.260 48.546 1.00 114.63 ? -57  DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A  1 16  ? 23.903  -10.827 48.777 1.00 114.41 ? -57  DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A  1 16  ? 24.153  -12.438 47.046 1.00 113.47 ? -57  DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A  1 16  ? 22.978  -12.944 46.444 1.00 111.85 ? -57  DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A  1 16  ? 24.485  -11.041 46.536 1.00 113.64 ? -57  DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A  1 16  ? 23.687  -10.206 47.527 1.00 113.94 ? -57  DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A  1 16  ? 24.045  -8.752  47.601 1.00 113.99 ? -57  DC  I N1    1 
ATOM   312   C  C2    . DC  A  1 16  ? 23.008  -7.839  47.822 1.00 114.05 ? -57  DC  I C2    1 
ATOM   313   O  O2    . DC  A  1 16  ? 21.855  -8.267  47.947 1.00 114.17 ? -57  DC  I O2    1 
ATOM   314   N  N3    . DC  A  1 16  ? 23.293  -6.514  47.894 1.00 113.94 ? -57  DC  I N3    1 
ATOM   315   C  C4    . DC  A  1 16  ? 24.551  -6.095  47.753 1.00 113.83 ? -57  DC  I C4    1 
ATOM   316   N  N4    . DC  A  1 16  ? 24.768  -4.779  47.833 1.00 113.95 ? -57  DC  I N4    1 
ATOM   317   C  C5    . DC  A  1 16  ? 25.630  -7.007  47.525 1.00 113.82 ? -57  DC  I C5    1 
ATOM   318   C  C6    . DC  A  1 16  ? 25.336  -8.314  47.459 1.00 113.76 ? -57  DC  I C6    1 
ATOM   319   P  P     . DA  A  1 17  ? 22.976  -14.472 45.999 1.00 110.64 ? -56  DA  I P     1 
ATOM   320   O  OP1   . DA  A  1 17  ? 23.335  -15.270 47.197 1.00 110.86 ? -56  DA  I OP1   1 
ATOM   321   O  OP2   . DA  A  1 17  ? 23.774  -14.563 44.754 1.00 110.18 ? -56  DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A  1 17  ? 21.453  -14.777 45.634 1.00 108.96 ? -56  DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A  1 17  ? 20.451  -14.785 46.646 1.00 106.95 ? -56  DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A  1 17  ? 19.370  -13.761 46.330 1.00 105.41 ? -56  DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A  1 17  ? 19.953  -12.438 46.196 1.00 104.94 ? -56  DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A  1 17  ? 18.606  -13.996 45.035 1.00 104.41 ? -56  DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A  1 17  ? 17.271  -13.548 45.202 1.00 103.27 ? -56  DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A  1 17  ? 19.360  -13.127 44.032 1.00 104.39 ? -56  DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A  1 17  ? 19.681  -11.916 44.907 1.00 104.20 ? -56  DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A  1 17  ? 20.830  -11.104 44.500 1.00 104.06 ? -56  DA  I N9    1 
ATOM   331   C  C8    . DA  A  1 17  ? 21.981  -11.522 43.888 1.00 103.98 ? -56  DA  I C8    1 
ATOM   332   N  N7    . DA  A  1 17  ? 22.839  -10.559 43.650 1.00 103.84 ? -56  DA  I N7    1 
ATOM   333   C  C5    . DA  A  1 17  ? 22.210  -9.434  44.146 1.00 103.75 ? -56  DA  I C5    1 
ATOM   334   C  C6    . DA  A  1 17  ? 22.593  -8.083  44.202 1.00 103.86 ? -56  DA  I C6    1 
ATOM   335   N  N6    . DA  A  1 17  ? 23.762  -7.644  43.732 1.00 103.94 ? -56  DA  I N6    1 
ATOM   336   N  N1    . DA  A  1 17  ? 21.735  -7.199  44.758 1.00 103.88 ? -56  DA  I N1    1 
ATOM   337   C  C2    . DA  A  1 17  ? 20.564  -7.644  45.229 1.00 103.75 ? -56  DA  I C2    1 
ATOM   338   N  N3    . DA  A  1 17  ? 20.096  -8.891  45.233 1.00 103.75 ? -56  DA  I N3    1 
ATOM   339   C  C4    . DA  A  1 17  ? 20.972  -9.746  44.672 1.00 103.82 ? -56  DA  I C4    1 
ATOM   340   P  P     . DG  A  1 18  ? 16.034  -14.472 44.777 1.00 102.61 ? -55  DG  I P     1 
ATOM   341   O  OP1   . DG  A  1 18  ? 15.404  -14.940 46.036 1.00 102.43 ? -55  DG  I OP1   1 
ATOM   342   O  OP2   . DG  A  1 18  ? 16.515  -15.438 43.756 1.00 102.48 ? -55  DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A  1 18  ? 15.013  -13.480 44.043 1.00 100.05 ? -55  DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A  1 18  ? 14.697  -12.240 44.635 1.00 96.69  ? -55  DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A  1 18  ? 15.278  -11.109 43.810 1.00 94.04  ? -55  DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A  1 18  ? 16.669  -11.299 43.456 1.00 93.44  ? -55  DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A  1 18  ? 14.590  -10.866 42.476 1.00 92.55  ? -55  DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A  1 18  ? 13.816  -9.709  42.661 1.00 91.06  ? -55  DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A  1 18  ? 15.745  -10.607 41.507 1.00 92.26  ? -55  DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A  1 18  ? 16.857  -10.287 42.496 1.00 92.45  ? -55  DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A  1 18  ? 18.219  -10.222 41.948 1.00 92.38  ? -55  DG  I N9    1 
ATOM   352   C  C8    . DG  A  1 18  ? 18.979  -11.234 41.404 1.00 92.18  ? -55  DG  I C8    1 
ATOM   353   N  N7    . DG  A  1 18  ? 20.154  -10.848 40.994 1.00 91.95  ? -55  DG  I N7    1 
ATOM   354   C  C5    . DG  A  1 18  ? 20.178  -9.486  41.276 1.00 92.24  ? -55  DG  I C5    1 
ATOM   355   C  C6    . DG  A  1 18  ? 21.194  -8.516  41.053 1.00 92.21  ? -55  DG  I C6    1 
ATOM   356   O  O6    . DG  A  1 18  ? 22.313  -8.675  40.550 1.00 92.14  ? -55  DG  I O6    1 
ATOM   357   N  N1    . DG  A  1 18  ? 20.815  -7.244  41.484 1.00 92.17  ? -55  DG  I N1    1 
ATOM   358   C  C2    . DG  A  1 18  ? 19.600  -6.941  42.059 1.00 92.27  ? -55  DG  I C2    1 
ATOM   359   N  N2    . DG  A  1 18  ? 19.415  -5.659  42.411 1.00 92.16  ? -55  DG  I N2    1 
ATOM   360   N  N3    . DG  A  1 18  ? 18.638  -7.838  42.272 1.00 92.19  ? -55  DG  I N3    1 
ATOM   361   C  C4    . DG  A  1 18  ? 18.994  -9.086  41.862 1.00 92.18  ? -55  DG  I C4    1 
ATOM   362   P  P     . DA  A  1 19  ? 12.514  -9.387  41.805 1.00 89.54  ? -54  DA  I P     1 
ATOM   363   O  OP1   . DA  A  1 19  ? 11.358  -9.648  42.694 1.00 89.20  ? -54  DA  I OP1   1 
ATOM   364   O  OP2   . DA  A  1 19  ? 12.610  -10.025 40.472 1.00 89.49  ? -54  DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A  1 19  ? 12.676  -7.823  41.534 1.00 90.11  ? -54  DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A  1 19  ? 13.305  -6.959  42.475 1.00 90.94  ? -54  DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A  1 19  ? 14.002  -5.790  41.794 1.00 91.77  ? -54  DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A  1 19  ? 15.373  -6.168  41.501 1.00 91.90  ? -54  DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A  1 19  ? 13.388  -5.306  40.478 1.00 92.20  ? -54  DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A  1 19  ? 13.402  -3.880  40.380 1.00 93.21  ? -54  DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A  1 19  ? 14.327  -5.929  39.455 1.00 92.66  ? -54  DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A  1 19  ? 15.653  -5.754  40.184 1.00 92.76  ? -54  DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A  1 19  ? 16.749  -6.530  39.613 1.00 92.79  ? -54  DA  I N9    1 
ATOM   374   C  C8    . DA  A  1 19  ? 16.789  -7.876  39.388 1.00 92.81  ? -54  DA  I C8    1 
ATOM   375   N  N7    . DA  A  1 19  ? 17.908  -8.291  38.849 1.00 92.90  ? -54  DA  I N7    1 
ATOM   376   C  C5    . DA  A  1 19  ? 18.655  -7.133  38.710 1.00 93.07  ? -54  DA  I C5    1 
ATOM   377   C  C6    . DA  A  1 19  ? 19.948  -6.884  38.199 1.00 92.77  ? -54  DA  I C6    1 
ATOM   378   N  N6    . DA  A  1 19  ? 20.743  -7.844  37.718 1.00 92.87  ? -54  DA  I N6    1 
ATOM   379   N  N1    . DA  A  1 19  ? 20.396  -5.608  38.202 1.00 92.78  ? -54  DA  I N1    1 
ATOM   380   C  C2    . DA  A  1 19  ? 19.604  -4.641  38.690 1.00 92.95  ? -54  DA  I C2    1 
ATOM   381   N  N3    . DA  A  1 19  ? 18.370  -4.749  39.189 1.00 93.33  ? -54  DA  I N3    1 
ATOM   382   C  C4    . DA  A  1 19  ? 17.952  -6.033  39.172 1.00 93.18  ? -54  DA  I C4    1 
ATOM   383   P  P     . DT  A  1 20  ? 12.440  -3.135  39.337 1.00 94.72  ? -53  DT  I P     1 
ATOM   384   O  OP1   . DT  A  1 20  ? 11.138  -2.921  40.011 1.00 95.03  ? -53  DT  I OP1   1 
ATOM   385   O  OP2   . DT  A  1 20  ? 12.484  -3.890  38.069 1.00 94.44  ? -53  DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A  1 20  ? 13.105  -1.705  39.061 1.00 95.54  ? -53  DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A  1 20  ? 14.390  -1.379  39.566 1.00 98.31  ? -53  DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A  1 20  ? 15.467  -1.372  38.484 1.00 100.49 ? -53  DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A  1 20  ? 15.992  -2.706  38.235 1.00 100.19 ? -53  DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A  1 20  ? 15.072  -0.800  37.111 1.00 101.90 ? -53  DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A  1 20  ? 15.638  0.523   36.924 1.00 104.22 ? -53  DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A  1 20  ? 15.622  -1.829  36.120 1.00 101.22 ? -53  DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A  1 20  ? 16.616  -2.610  36.973 1.00 100.28 ? -53  DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A  1 20  ? 16.952  -3.960  36.424 1.00 100.07 ? -53  DT  I N1    1 
ATOM   395   C  C2    . DT  A  1 20  ? 18.207  -4.169  35.885 1.00 99.93  ? -53  DT  I C2    1 
ATOM   396   O  O2    . DT  A  1 20  ? 19.075  -3.316  35.836 1.00 100.08 ? -53  DT  I O2    1 
ATOM   397   N  N3    . DT  A  1 20  ? 18.420  -5.436  35.404 1.00 99.75  ? -53  DT  I N3    1 
ATOM   398   C  C4    . DT  A  1 20  ? 17.524  -6.491  35.399 1.00 100.08 ? -53  DT  I C4    1 
ATOM   399   O  O4    . DT  A  1 20  ? 17.819  -7.589  34.943 1.00 100.09 ? -53  DT  I O4    1 
ATOM   400   C  C5    . DT  A  1 20  ? 16.224  -6.210  35.968 1.00 100.33 ? -53  DT  I C5    1 
ATOM   401   C  C7    . DT  A  1 20  ? 15.165  -7.275  36.020 1.00 100.12 ? -53  DT  I C7    1 
ATOM   402   C  C6    . DT  A  1 20  ? 16.005  -4.972  36.444 1.00 100.40 ? -53  DT  I C6    1 
ATOM   403   P  P     . DA  A  1 21  ? 15.596  1.341   35.537 1.00 105.50 ? -52  DA  I P     1 
ATOM   404   O  OP1   . DA  A  1 21  ? 15.854  2.767   35.838 1.00 105.15 ? -52  DA  I OP1   1 
ATOM   405   O  OP2   . DA  A  1 21  ? 14.379  0.961   34.784 1.00 105.08 ? -52  DA  I OP2   1 
ATOM   406   O  "O5'" . DA  A  1 21  ? 16.859  0.750   34.755 1.00 108.02 ? -52  DA  I "O5'" 1 
ATOM   407   C  "C5'" . DA  A  1 21  ? 18.178  0.892   35.282 1.00 111.51 ? -52  DA  I "C5'" 1 
ATOM   408   C  "C4'" . DA  A  1 21  ? 19.224  0.577   34.224 1.00 114.26 ? -52  DA  I "C4'" 1 
ATOM   409   O  "O4'" . DA  A  1 21  ? 19.384  -0.857  34.095 1.00 114.70 ? -52  DA  I "O4'" 1 
ATOM   410   C  "C3'" . DA  A  1 21  ? 18.903  1.110   32.829 1.00 115.91 ? -52  DA  I "C3'" 1 
ATOM   411   O  "O3'" . DA  A  1 21  ? 19.917  2.040   32.445 1.00 118.52 ? -52  DA  I "O3'" 1 
ATOM   412   C  "C2'" . DA  A  1 21  ? 18.855  -0.129  31.931 1.00 115.50 ? -52  DA  I "C2'" 1 
ATOM   413   C  "C1'" . DA  A  1 21  ? 19.602  -1.183  32.740 1.00 115.08 ? -52  DA  I "C1'" 1 
ATOM   414   N  N9    . DA  A  1 21  ? 19.121  -2.549  32.531 1.00 115.05 ? -52  DA  I N9    1 
ATOM   415   C  C8    . DA  A  1 21  ? 17.875  -3.033  32.824 1.00 115.19 ? -52  DA  I C8    1 
ATOM   416   N  N7    . DA  A  1 21  ? 17.713  -4.303  32.539 1.00 115.19 ? -52  DA  I N7    1 
ATOM   417   C  C5    . DA  A  1 21  ? 18.937  -4.685  32.020 1.00 114.91 ? -52  DA  I C5    1 
ATOM   418   C  C6    . DA  A  1 21  ? 19.419  -5.918  31.526 1.00 115.14 ? -52  DA  I C6    1 
ATOM   419   N  N6    . DA  A  1 21  ? 18.687  -7.037  31.473 1.00 115.02 ? -52  DA  I N6    1 
ATOM   420   N  N1    . DA  A  1 21  ? 20.695  -5.961  31.079 1.00 115.34 ? -52  DA  I N1    1 
ATOM   421   C  C2    . DA  A  1 21  ? 21.433  -4.839  31.125 1.00 115.27 ? -52  DA  I C2    1 
ATOM   422   N  N3    . DA  A  1 21  ? 21.089  -3.628  31.572 1.00 114.97 ? -52  DA  I N3    1 
ATOM   423   C  C4    . DA  A  1 21  ? 19.818  -3.615  32.010 1.00 114.82 ? -52  DA  I C4    1 
ATOM   424   P  P     . DC  A  1 22  ? 19.738  3.029   31.197 1.00 120.62 ? -51  DC  I P     1 
ATOM   425   O  OP1   . DC  A  1 22  ? 20.498  4.266   31.477 1.00 120.53 ? -51  DC  I OP1   1 
ATOM   426   O  OP2   . DC  A  1 22  ? 18.302  3.124   30.830 1.00 120.68 ? -51  DC  I OP2   1 
ATOM   427   O  "O5'" . DC  A  1 22  ? 20.526  2.217   30.072 1.00 122.11 ? -51  DC  I "O5'" 1 
ATOM   428   C  "C5'" . DC  A  1 22  ? 19.848  1.724   28.940 1.00 124.62 ? -51  DC  I "C5'" 1 
ATOM   429   C  "C4'" . DC  A  1 22  ? 20.833  0.961   28.082 1.00 126.37 ? -51  DC  I "C4'" 1 
ATOM   430   O  "O4'" . DC  A  1 22  ? 20.880  -0.422  28.518 1.00 126.68 ? -51  DC  I "O4'" 1 
ATOM   431   C  "C3'" . DC  A  1 22  ? 20.463  0.977   26.603 1.00 127.50 ? -51  DC  I "C3'" 1 
ATOM   432   O  "O3'" . DC  A  1 22  ? 21.592  1.463   25.850 1.00 129.08 ? -51  DC  I "O3'" 1 
ATOM   433   C  "C2'" . DC  A  1 22  ? 20.044  -0.464  26.322 1.00 127.33 ? -51  DC  I "C2'" 1 
ATOM   434   C  "C1'" . DC  A  1 22  ? 20.758  -1.272  27.399 1.00 126.98 ? -51  DC  I "C1'" 1 
ATOM   435   N  N1    . DC  A  1 22  ? 20.007  -2.524  27.763 1.00 127.10 ? -51  DC  I N1    1 
ATOM   436   C  C2    . DC  A  1 22  ? 20.608  -3.785  27.573 1.00 127.01 ? -51  DC  I C2    1 
ATOM   437   O  O2    . DC  A  1 22  ? 21.758  -3.856  27.121 1.00 127.01 ? -51  DC  I O2    1 
ATOM   438   N  N3    . DC  A  1 22  ? 19.906  -4.905  27.898 1.00 126.80 ? -51  DC  I N3    1 
ATOM   439   C  C4    . DC  A  1 22  ? 18.663  -4.799  28.384 1.00 126.90 ? -51  DC  I C4    1 
ATOM   440   N  N4    . DC  A  1 22  ? 18.016  -5.926  28.687 1.00 126.88 ? -51  DC  I N4    1 
ATOM   441   C  C5    . DC  A  1 22  ? 18.028  -3.532  28.581 1.00 126.85 ? -51  DC  I C5    1 
ATOM   442   C  C6    . DC  A  1 22  ? 18.728  -2.435  28.259 1.00 126.95 ? -51  DC  I C6    1 
ATOM   443   P  P     . DT  A  1 23  ? 22.043  0.927   24.406 1.00 130.15 ? -50  DT  I P     1 
ATOM   444   O  OP1   . DT  A  1 23  ? 23.098  1.846   23.922 1.00 130.33 ? -50  DT  I OP1   1 
ATOM   445   O  OP2   . DT  A  1 23  ? 20.834  0.723   23.569 1.00 130.04 ? -50  DT  I OP2   1 
ATOM   446   O  "O5'" . DT  A  1 23  ? 22.700  -0.498  24.770 1.00 130.71 ? -50  DT  I "O5'" 1 
ATOM   447   C  "C5'" . DT  A  1 23  ? 23.894  -1.008  24.159 1.00 131.26 ? -50  DT  I "C5'" 1 
ATOM   448   C  "C4'" . DT  A  1 23  ? 23.562  -2.106  23.162 1.00 131.73 ? -50  DT  I "C4'" 1 
ATOM   449   O  "O4'" . DT  A  1 23  ? 22.618  -3.045  23.750 1.00 132.13 ? -50  DT  I "O4'" 1 
ATOM   450   C  "C3'" . DT  A  1 23  ? 22.929  -1.580  21.877 1.00 131.99 ? -50  DT  I "C3'" 1 
ATOM   451   O  "O3'" . DT  A  1 23  ? 23.666  -2.007  20.731 1.00 131.87 ? -50  DT  I "O3'" 1 
ATOM   452   C  "C2'" . DT  A  1 23  ? 21.503  -2.133  21.893 1.00 132.40 ? -50  DT  I "C2'" 1 
ATOM   453   C  "C1'" . DT  A  1 23  ? 21.577  -3.332  22.831 1.00 132.55 ? -50  DT  I "C1'" 1 
ATOM   454   N  N1    . DT  A  1 23  ? 20.272  -3.604  23.554 1.00 132.69 ? -50  DT  I N1    1 
ATOM   455   C  C2    . DT  A  1 23  ? 20.038  -4.841  24.135 1.00 132.89 ? -50  DT  I C2    1 
ATOM   456   O  O2    . DT  A  1 23  ? 20.834  -5.765  24.117 1.00 132.93 ? -50  DT  I O2    1 
ATOM   457   N  N3    . DT  A  1 23  ? 18.814  -4.963  24.757 1.00 133.03 ? -50  DT  I N3    1 
ATOM   458   C  C4    . DT  A  1 23  ? 17.819  -4.001  24.857 1.00 132.78 ? -50  DT  I C4    1 
ATOM   459   O  O4    . DT  A  1 23  ? 16.758  -4.220  25.437 1.00 132.70 ? -50  DT  I O4    1 
ATOM   460   C  C5    . DT  A  1 23  ? 18.120  -2.737  24.225 1.00 132.79 ? -50  DT  I C5    1 
ATOM   461   C  C7    . DT  A  1 23  ? 17.131  -1.607  24.255 1.00 132.83 ? -50  DT  I C7    1 
ATOM   462   C  C6    . DT  A  1 23  ? 19.308  -2.607  23.616 1.00 132.69 ? -50  DT  I C6    1 
ATOM   463   P  P     . DA  A  1 24  ? 23.136  -1.739  19.235 1.00 131.68 ? -49  DA  I P     1 
ATOM   464   O  OP1   . DA  A  1 24  ? 24.333  -1.642  18.373 1.00 132.21 ? -49  DA  I OP1   1 
ATOM   465   O  OP2   . DA  A  1 24  ? 22.155  -0.626  19.236 1.00 131.46 ? -49  DA  I OP2   1 
ATOM   466   O  "O5'" . DA  A  1 24  ? 22.360  -3.094  18.877 1.00 130.85 ? -49  DA  I "O5'" 1 
ATOM   467   C  "C5'" . DA  A  1 24  ? 23.020  -4.367  18.929 1.00 129.53 ? -49  DA  I "C5'" 1 
ATOM   468   C  "C4'" . DA  A  1 24  ? 22.061  -5.496  18.578 1.00 128.56 ? -49  DA  I "C4'" 1 
ATOM   469   O  "O4'" . DA  A  1 24  ? 21.075  -5.668  19.634 1.00 128.61 ? -49  DA  I "O4'" 1 
ATOM   470   C  "C3'" . DA  A  1 24  ? 21.277  -5.301  17.281 1.00 127.82 ? -49  DA  I "C3'" 1 
ATOM   471   O  "O3'" . DA  A  1 24  ? 21.306  -6.504  16.529 1.00 126.71 ? -49  DA  I "O3'" 1 
ATOM   472   C  "C2'" . DA  A  1 24  ? 19.862  -4.978  17.753 1.00 128.07 ? -49  DA  I "C2'" 1 
ATOM   473   C  "C1'" . DA  A  1 24  ? 19.783  -5.762  19.061 1.00 128.22 ? -49  DA  I "C1'" 1 
ATOM   474   N  N9    . DA  A  1 24  ? 18.752  -5.284  19.997 1.00 128.23 ? -49  DA  I N9    1 
ATOM   475   C  C8    . DA  A  1 24  ? 18.380  -3.986  20.243 1.00 128.09 ? -49  DA  I C8    1 
ATOM   476   N  N7    . DA  A  1 24  ? 17.418  -3.861  21.128 1.00 128.13 ? -49  DA  I N7    1 
ATOM   477   C  C5    . DA  A  1 24  ? 17.132  -5.167  21.492 1.00 128.16 ? -49  DA  I C5    1 
ATOM   478   C  C6    . DA  A  1 24  ? 16.200  -5.725  22.399 1.00 128.03 ? -49  DA  I C6    1 
ATOM   479   N  N6    . DA  A  1 24  ? 15.354  -4.997  23.133 1.00 128.01 ? -49  DA  I N6    1 
ATOM   480   N  N1    . DA  A  1 24  ? 16.171  -7.070  22.527 1.00 128.04 ? -49  DA  I N1    1 
ATOM   481   C  C2    . DA  A  1 24  ? 17.015  -7.808  21.790 1.00 128.03 ? -49  DA  I C2    1 
ATOM   482   N  N3    . DA  A  1 24  ? 17.934  -7.401  20.912 1.00 127.97 ? -49  DA  I N3    1 
ATOM   483   C  C4    . DA  A  1 24  ? 17.943  -6.058  20.803 1.00 128.14 ? -49  DA  I C4    1 
ATOM   484   P  P     . DC  A  1 25  ? 21.086  -6.520  14.940 1.00 125.73 ? -48  DC  I P     1 
ATOM   485   O  OP1   . DC  A  1 25  ? 22.395  -6.838  14.331 1.00 125.79 ? -48  DC  I OP1   1 
ATOM   486   O  OP2   . DC  A  1 25  ? 20.354  -5.297  14.532 1.00 125.34 ? -48  DC  I OP2   1 
ATOM   487   O  "O5'" . DC  A  1 25  ? 20.120  -7.775  14.713 1.00 124.23 ? -48  DC  I "O5'" 1 
ATOM   488   C  "C5'" . DC  A  1 25  ? 20.088  -8.866  15.631 1.00 122.21 ? -48  DC  I "C5'" 1 
ATOM   489   C  "C4'" . DC  A  1 25  ? 18.653  -9.272  15.925 1.00 120.72 ? -48  DC  I "C4'" 1 
ATOM   490   O  "O4'" . DC  A  1 25  ? 18.090  -8.448  16.982 1.00 120.21 ? -48  DC  I "O4'" 1 
ATOM   491   C  "C3'" . DC  A  1 25  ? 17.691  -9.154  14.740 1.00 119.68 ? -48  DC  I "C3'" 1 
ATOM   492   O  "O3'" . DC  A  1 25  ? 17.072  -10.413 14.502 1.00 118.47 ? -48  DC  I "O3'" 1 
ATOM   493   C  "C2'" . DC  A  1 25  ? 16.677  -8.111  15.208 1.00 119.75 ? -48  DC  I "C2'" 1 
ATOM   494   C  "C1'" . DC  A  1 25  ? 16.710  -8.351  16.711 1.00 119.50 ? -48  DC  I "C1'" 1 
ATOM   495   N  N1    . DC  A  1 25  ? 16.034  -7.298  17.545 1.00 119.33 ? -48  DC  I N1    1 
ATOM   496   C  C2    . DC  A  1 25  ? 15.052  -7.675  18.483 1.00 119.20 ? -48  DC  I C2    1 
ATOM   497   O  O2    . DC  A  1 25  ? 14.756  -8.870  18.621 1.00 118.98 ? -48  DC  I O2    1 
ATOM   498   N  N3    . DC  A  1 25  ? 14.446  -6.709  19.226 1.00 119.17 ? -48  DC  I N3    1 
ATOM   499   C  C4    . DC  A  1 25  ? 14.778  -5.424  19.064 1.00 119.23 ? -48  DC  I C4    1 
ATOM   500   N  N4    . DC  A  1 25  ? 14.153  -4.515  19.817 1.00 119.11 ? -48  DC  I N4    1 
ATOM   501   C  C5    . DC  A  1 25  ? 15.769  -5.017  18.118 1.00 119.30 ? -48  DC  I C5    1 
ATOM   502   C  C6    . DC  A  1 25  ? 16.363  -5.976  17.389 1.00 119.33 ? -48  DC  I C6    1 
ATOM   503   P  P     . DC  A  1 26  ? 16.314  -10.727 13.126 1.00 117.18 ? -47  DC  I P     1 
ATOM   504   O  OP1   . DC  A  1 26  ? 17.307  -11.399 12.266 1.00 117.33 ? -47  DC  I OP1   1 
ATOM   505   O  OP2   . DC  A  1 26  ? 15.636  -9.501  12.648 1.00 116.98 ? -47  DC  I OP2   1 
ATOM   506   O  "O5'" . DC  A  1 26  ? 15.185  -11.802 13.515 1.00 116.71 ? -47  DC  I "O5'" 1 
ATOM   507   C  "C5'" . DC  A  1 26  ? 14.637  -11.913 14.835 1.00 115.47 ? -47  DC  I "C5'" 1 
ATOM   508   C  "C4'" . DC  A  1 26  ? 13.153  -11.581 14.862 1.00 114.53 ? -47  DC  I "C4'" 1 
ATOM   509   O  "O4'" . DC  A  1 26  ? 12.928  -10.402 15.675 1.00 114.52 ? -47  DC  I "O4'" 1 
ATOM   510   C  "C3'" . DC  A  1 26  ? 12.516  -11.289 13.507 1.00 113.89 ? -47  DC  I "C3'" 1 
ATOM   511   O  "O3'" . DC  A  1 26  ? 11.333  -12.062 13.372 1.00 113.22 ? -47  DC  I "O3'" 1 
ATOM   512   C  "C2'" . DC  A  1 26  ? 12.230  -9.792  13.533 1.00 114.03 ? -47  DC  I "C2'" 1 
ATOM   513   C  "C1'" . DC  A  1 26  ? 11.998  -9.563  15.022 1.00 114.54 ? -47  DC  I "C1'" 1 
ATOM   514   N  N1    . DC  A  1 26  ? 12.183  -8.151  15.516 1.00 114.72 ? -47  DC  I N1    1 
ATOM   515   C  C2    . DC  A  1 26  ? 11.829  -7.828  16.839 1.00 114.78 ? -47  DC  I C2    1 
ATOM   516   O  O2    . DC  A  1 26  ? 11.369  -8.707  17.577 1.00 114.83 ? -47  DC  I O2    1 
ATOM   517   N  N3    . DC  A  1 26  ? 11.997  -6.552  17.283 1.00 114.70 ? -47  DC  I N3    1 
ATOM   518   C  C4    . DC  A  1 26  ? 12.497  -5.622  16.465 1.00 114.66 ? -47  DC  I C4    1 
ATOM   519   N  N4    . DC  A  1 26  ? 12.645  -4.384  16.940 1.00 114.63 ? -47  DC  I N4    1 
ATOM   520   C  C5    . DC  A  1 26  ? 12.865  -5.924  15.117 1.00 114.76 ? -47  DC  I C5    1 
ATOM   521   C  C6    . DC  A  1 26  ? 12.694  -7.184  14.691 1.00 114.68 ? -47  DC  I C6    1 
ATOM   522   P  P     . DA  A  1 27  ? 11.357  -13.371 12.447 1.00 112.67 ? -46  DA  I P     1 
ATOM   523   O  OP1   . DA  A  1 27  ? 12.724  -13.942 12.500 1.00 112.48 ? -46  DA  I OP1   1 
ATOM   524   O  OP2   . DA  A  1 27  ? 10.742  -12.991 11.156 1.00 112.25 ? -46  DA  I OP2   1 
ATOM   525   O  "O5'" . DA  A  1 27  ? 10.360  -14.407 13.156 1.00 112.06 ? -46  DA  I "O5'" 1 
ATOM   526   C  "C5'" . DA  A  1 27  ? 10.195  -14.462 14.582 1.00 110.89 ? -46  DA  I "C5'" 1 
ATOM   527   C  "C4'" . DA  A  1 27  ? 8.805   -14.004 15.019 1.00 109.49 ? -46  DA  I "C4'" 1 
ATOM   528   O  "O4'" . DA  A  1 27  ? 8.777   -12.562 15.181 1.00 109.50 ? -46  DA  I "O4'" 1 
ATOM   529   C  "C3'" . DA  A  1 27  ? 7.635   -14.328 14.094 1.00 108.36 ? -46  DA  I "C3'" 1 
ATOM   530   O  "O3'" . DA  A  1 27  ? 6.513   -14.601 14.908 1.00 106.79 ? -46  DA  I "O3'" 1 
ATOM   531   C  "C2'" . DA  A  1 27  ? 7.440   -13.031 13.312 1.00 108.85 ? -46  DA  I "C2'" 1 
ATOM   532   C  "C1'" . DA  A  1 27  ? 7.748   -11.998 14.390 1.00 109.46 ? -46  DA  I "C1'" 1 
ATOM   533   N  N9    . DA  A  1 27  ? 8.244   -10.708 13.918 1.00 109.70 ? -46  DA  I N9    1 
ATOM   534   C  C8    . DA  A  1 27  ? 8.681   -10.378 12.664 1.00 109.81 ? -46  DA  I C8    1 
ATOM   535   N  N7    . DA  A  1 27  ? 9.077   -9.133  12.554 1.00 109.80 ? -46  DA  I N7    1 
ATOM   536   C  C5    . DA  A  1 27  ? 8.892   -8.610  13.820 1.00 109.56 ? -46  DA  I C5    1 
ATOM   537   C  C6    . DA  A  1 27  ? 9.123   -7.334  14.370 1.00 109.53 ? -46  DA  I C6    1 
ATOM   538   N  N6    . DA  A  1 27  ? 9.609   -6.312  13.668 1.00 109.72 ? -46  DA  I N6    1 
ATOM   539   N  N1    . DA  A  1 27  ? 8.833   -7.138  15.672 1.00 109.67 ? -46  DA  I N1    1 
ATOM   540   C  C2    . DA  A  1 27  ? 8.341   -8.159  16.381 1.00 109.83 ? -46  DA  I C2    1 
ATOM   541   N  N3    . DA  A  1 27  ? 8.081   -9.402  15.975 1.00 109.99 ? -46  DA  I N3    1 
ATOM   542   C  C4    . DA  A  1 27  ? 8.383   -9.567  14.674 1.00 109.74 ? -46  DA  I C4    1 
ATOM   543   P  P     . DA  A  1 28  ? 5.241   -15.436 14.405 1.00 105.61 ? -45  DA  I P     1 
ATOM   544   O  OP1   . DA  A  1 28  ? 5.321   -16.761 15.059 1.00 105.72 ? -45  DA  I OP1   1 
ATOM   545   O  OP2   . DA  A  1 28  ? 5.110   -15.327 12.932 1.00 105.71 ? -45  DA  I OP2   1 
ATOM   546   O  "O5'" . DA  A  1 28  ? 4.027   -14.631 15.059 1.00 103.73 ? -45  DA  I "O5'" 1 
ATOM   547   C  "C5'" . DA  A  1 28  ? 4.090   -14.295 16.447 1.00 101.16 ? -45  DA  I "C5'" 1 
ATOM   548   C  "C4'" . DA  A  1 28  ? 3.690   -12.851 16.691 1.00 98.72  ? -45  DA  I "C4'" 1 
ATOM   549   O  "O4'" . DA  A  1 28  ? 4.574   -11.947 15.976 1.00 98.28  ? -45  DA  I "O4'" 1 
ATOM   550   C  "C3'" . DA  A  1 28  ? 2.273   -12.515 16.238 1.00 97.31  ? -45  DA  I "C3'" 1 
ATOM   551   O  "O3'" . DA  A  1 28  ? 1.631   -11.775 17.246 1.00 95.26  ? -45  DA  I "O3'" 1 
ATOM   552   C  "C2'" . DA  A  1 28  ? 2.492   -11.644 15.012 1.00 97.52  ? -45  DA  I "C2'" 1 
ATOM   553   C  "C1'" . DA  A  1 28  ? 3.775   -10.931 15.415 1.00 97.92  ? -45  DA  I "C1'" 1 
ATOM   554   N  N9    . DA  A  1 28  ? 4.443   -10.255 14.303 1.00 98.07  ? -45  DA  I N9    1 
ATOM   555   C  C8    . DA  A  1 28  ? 4.685   -10.743 13.046 1.00 98.02  ? -45  DA  I C8    1 
ATOM   556   N  N7    . DA  A  1 28  ? 5.292   -9.893  12.253 1.00 98.08  ? -45  DA  I N7    1 
ATOM   557   C  C5    . DA  A  1 28  ? 5.455   -8.764  13.039 1.00 98.30  ? -45  DA  I C5    1 
ATOM   558   C  C6    . DA  A  1 28  ? 6.031   -7.497  12.793 1.00 98.09  ? -45  DA  I C6    1 
ATOM   559   N  N6    . DA  A  1 28  ? 6.577   -7.154  11.623 1.00 97.91  ? -45  DA  I N6    1 
ATOM   560   N  N1    . DA  A  1 28  ? 6.034   -6.591  13.800 1.00 98.17  ? -45  DA  I N1    1 
ATOM   561   C  C2    . DA  A  1 28  ? 5.497   -6.931  14.979 1.00 98.04  ? -45  DA  I C2    1 
ATOM   562   N  N3    . DA  A  1 28  ? 4.925   -8.085  15.326 1.00 98.28  ? -45  DA  I N3    1 
ATOM   563   C  C4    . DA  A  1 28  ? 4.934   -8.968  14.307 1.00 98.37  ? -45  DA  I C4    1 
ATOM   564   P  P     . DA  A  1 29  ? 0.416   -12.402 18.061 1.00 93.18  ? -44  DA  I P     1 
ATOM   565   O  OP1   . DA  A  1 29  ? 0.996   -13.265 19.113 1.00 93.18  ? -44  DA  I OP1   1 
ATOM   566   O  OP2   . DA  A  1 29  ? -0.599  -12.887 17.095 1.00 92.87  ? -44  DA  I OP2   1 
ATOM   567   O  "O5'" . DA  A  1 29  ? -0.204  -11.119 18.755 1.00 92.15  ? -44  DA  I "O5'" 1 
ATOM   568   C  "C5'" . DA  A  1 29  ? -0.528  -10.064 17.900 1.00 90.91  ? -44  DA  I "C5'" 1 
ATOM   569   C  "C4'" . DA  A  1 29  ? 0.235   -8.820  18.283 1.00 89.64  ? -44  DA  I "C4'" 1 
ATOM   570   O  "O4'" . DA  A  1 29  ? 1.336   -8.590  17.371 1.00 89.40  ? -44  DA  I "O4'" 1 
ATOM   571   C  "C3'" . DA  A  1 29  ? -0.681  -7.620  18.178 1.00 89.52  ? -44  DA  I "C3'" 1 
ATOM   572   O  "O3'" . DA  A  1 29  ? -0.494  -6.742  19.266 1.00 88.63  ? -44  DA  I "O3'" 1 
ATOM   573   C  "C2'" . DA  A  1 29  ? -0.325  -6.987  16.841 1.00 90.11  ? -44  DA  I "C2'" 1 
ATOM   574   C  "C1'" . DA  A  1 29  ? 1.120   -7.410  16.614 1.00 90.65  ? -44  DA  I "C1'" 1 
ATOM   575   N  N9    . DA  A  1 29  ? 1.399   -7.641  15.194 1.00 91.10  ? -44  DA  I N9    1 
ATOM   576   C  C8    . DA  A  1 29  ? 1.014   -8.728  14.462 1.00 91.12  ? -44  DA  I C8    1 
ATOM   577   N  N7    . DA  A  1 29  ? 1.389   -8.690  13.207 1.00 91.35  ? -44  DA  I N7    1 
ATOM   578   C  C5    . DA  A  1 29  ? 2.055   -7.487  13.102 1.00 91.21  ? -44  DA  I C5    1 
ATOM   579   C  C6    . DA  A  1 29  ? 2.692   -6.864  12.016 1.00 90.97  ? -44  DA  I C6    1 
ATOM   580   N  N6    . DA  A  1 29  ? 2.732   -7.424  10.809 1.00 91.03  ? -44  DA  I N6    1 
ATOM   581   N  N1    . DA  A  1 29  ? 3.271   -5.659  12.215 1.00 90.94  ? -44  DA  I N1    1 
ATOM   582   C  C2    . DA  A  1 29  ? 3.211   -5.121  13.440 1.00 91.08  ? -44  DA  I C2    1 
ATOM   583   N  N3    . DA  A  1 29  ? 2.643   -5.619  14.543 1.00 91.27  ? -44  DA  I N3    1 
ATOM   584   C  C4    . DA  A  1 29  ? 2.072   -6.817  14.310 1.00 91.25  ? -44  DA  I C4    1 
ATOM   585   P  P     . DA  A  1 30  ? -1.782  -5.999  19.833 1.00 87.86  ? -43  DA  I P     1 
ATOM   586   O  OP1   . DA  A  1 30  ? -1.493  -5.649  21.240 1.00 88.30  ? -43  DA  I OP1   1 
ATOM   587   O  OP2   . DA  A  1 30  ? -2.977  -6.804  19.489 1.00 88.53  ? -43  DA  I OP2   1 
ATOM   588   O  "O5'" . DA  A  1 30  ? -1.878  -4.682  18.945 1.00 88.03  ? -43  DA  I "O5'" 1 
ATOM   589   C  "C5'" . DA  A  1 30  ? -0.820  -3.731  18.931 1.00 88.59  ? -43  DA  I "C5'" 1 
ATOM   590   C  "C4'" . DA  A  1 30  ? -0.966  -2.810  17.735 1.00 88.70  ? -43  DA  I "C4'" 1 
ATOM   591   O  "O4'" . DA  A  1 30  ? -0.475  -3.501  16.560 1.00 88.19  ? -43  DA  I "O4'" 1 
ATOM   592   C  "C3'" . DA  A  1 30  ? -2.406  -2.381  17.445 1.00 88.97  ? -43  DA  I "C3'" 1 
ATOM   593   O  "O3'" . DA  A  1 30  ? -2.535  -0.970  17.644 1.00 90.49  ? -43  DA  I "O3'" 1 
ATOM   594   C  "C2'" . DA  A  1 30  ? -2.656  -2.838  16.006 1.00 88.47  ? -43  DA  I "C2'" 1 
ATOM   595   C  "C1'" . DA  A  1 30  ? -1.266  -3.148  15.447 1.00 88.02  ? -43  DA  I "C1'" 1 
ATOM   596   N  N9    . DA  A  1 30  ? -1.205  -4.225  14.445 1.00 87.96  ? -43  DA  I N9    1 
ATOM   597   C  C8    . DA  A  1 30  ? -1.753  -5.476  14.528 1.00 87.91  ? -43  DA  I C8    1 
ATOM   598   N  N7    . DA  A  1 30  ? -1.535  -6.241  13.487 1.00 87.76  ? -43  DA  I N7    1 
ATOM   599   C  C5    . DA  A  1 30  ? -0.794  -5.433  12.648 1.00 87.86  ? -43  DA  I C5    1 
ATOM   600   C  C6    . DA  A  1 30  ? -0.250  -5.649  11.369 1.00 87.72  ? -43  DA  I C6    1 
ATOM   601   N  N6    . DA  A  1 30  ? -0.376  -6.800  10.703 1.00 87.79  ? -43  DA  I N6    1 
ATOM   602   N  N1    . DA  A  1 30  ? 0.442   -4.641  10.804 1.00 87.67  ? -43  DA  I N1    1 
ATOM   603   C  C2    . DA  A  1 30  ? 0.575   -3.488  11.470 1.00 87.66  ? -43  DA  I C2    1 
ATOM   604   N  N3    . DA  A  1 30  ? 0.103   -3.166  12.671 1.00 87.76  ? -43  DA  I N3    1 
ATOM   605   C  C4    . DA  A  1 30  ? -0.577  -4.191  13.218 1.00 87.93  ? -43  DA  I C4    1 
ATOM   606   P  P     . DG  A  1 31  ? -3.905  -0.167  17.418 1.00 92.27  ? -42  DG  I P     1 
ATOM   607   O  OP1   . DG  A  1 31  ? -4.153  0.671   18.609 1.00 92.22  ? -42  DG  I OP1   1 
ATOM   608   O  OP2   . DG  A  1 31  ? -4.937  -1.115  16.954 1.00 92.60  ? -42  DG  I OP2   1 
ATOM   609   O  "O5'" . DG  A  1 31  ? -3.581  0.813   16.199 1.00 95.24  ? -42  DG  I "O5'" 1 
ATOM   610   C  "C5'" . DG  A  1 31  ? -2.227  1.134   15.857 1.00 99.29  ? -42  DG  I "C5'" 1 
ATOM   611   C  "C4'" . DG  A  1 31  ? -2.019  1.238   14.352 1.00 101.91 ? -42  DG  I "C4'" 1 
ATOM   612   O  "O4'" . DG  A  1 31  ? -1.835  -0.066  13.750 1.00 102.84 ? -42  DG  I "O4'" 1 
ATOM   613   C  "C3'" . DG  A  1 31  ? -3.171  1.880   13.590 1.00 103.13 ? -42  DG  I "C3'" 1 
ATOM   614   O  "O3'" . DG  A  1 31  ? -2.799  3.206   13.256 1.00 104.43 ? -42  DG  I "O3'" 1 
ATOM   615   C  "C2'" . DG  A  1 31  ? -3.365  1.007   12.351 1.00 103.30 ? -42  DG  I "C2'" 1 
ATOM   616   C  "C1'" . DG  A  1 31  ? -2.195  0.035   12.392 1.00 103.73 ? -42  DG  I "C1'" 1 
ATOM   617   N  N9    . DG  A  1 31  ? -2.564  -1.291  11.927 1.00 103.90 ? -42  DG  I N9    1 
ATOM   618   C  C8    . DG  A  1 31  ? -3.198  -2.252  12.670 1.00 104.13 ? -42  DG  I C8    1 
ATOM   619   N  N7    . DG  A  1 31  ? -3.418  -3.358  12.021 1.00 104.48 ? -42  DG  I N7    1 
ATOM   620   C  C5    . DG  A  1 31  ? -2.905  -3.111  10.753 1.00 104.47 ? -42  DG  I C5    1 
ATOM   621   C  C6    . DG  A  1 31  ? -2.868  -3.952  9.609  1.00 104.17 ? -42  DG  I C6    1 
ATOM   622   O  O6    . DG  A  1 31  ? -3.293  -5.111  9.503  1.00 103.99 ? -42  DG  I O6    1 
ATOM   623   N  N1    . DG  A  1 31  ? -2.263  -3.326  8.516  1.00 104.19 ? -42  DG  I N1    1 
ATOM   624   C  C2    . DG  A  1 31  ? -1.755  -2.043  8.531  1.00 104.32 ? -42  DG  I C2    1 
ATOM   625   N  N2    . DG  A  1 31  ? -1.207  -1.613  7.382  1.00 104.24 ? -42  DG  I N2    1 
ATOM   626   N  N3    . DG  A  1 31  ? -1.786  -1.244  9.599  1.00 104.37 ? -42  DG  I N3    1 
ATOM   627   C  C4    . DG  A  1 31  ? -2.373  -1.838  10.675 1.00 104.32 ? -42  DG  I C4    1 
ATOM   628   P  P     . DT  A  1 32  ? -3.911  4.307   12.932 1.00 105.46 ? -41  DT  I P     1 
ATOM   629   O  OP1   . DT  A  1 32  ? -3.395  5.594   13.445 1.00 105.33 ? -41  DT  I OP1   1 
ATOM   630   O  OP2   . DT  A  1 32  ? -5.240  3.834   13.374 1.00 105.53 ? -41  DT  I OP2   1 
ATOM   631   O  "O5'" . DT  A  1 32  ? -3.926  4.297   11.332 1.00 107.34 ? -41  DT  I "O5'" 1 
ATOM   632   C  "C5'" . DT  A  1 32  ? -2.700  4.233   10.597 1.00 110.07 ? -41  DT  I "C5'" 1 
ATOM   633   C  "C4'" . DT  A  1 32  ? -2.930  3.920   9.129  1.00 111.98 ? -41  DT  I "C4'" 1 
ATOM   634   O  "O4'" . DT  A  1 32  ? -2.972  2.485   8.933  1.00 112.28 ? -41  DT  I "O4'" 1 
ATOM   635   C  "C3'" . DT  A  1 32  ? -4.221  4.487   8.540  1.00 113.16 ? -41  DT  I "C3'" 1 
ATOM   636   O  "O3'" . DT  A  1 32  ? -3.912  5.384   7.472  1.00 114.76 ? -41  DT  I "O3'" 1 
ATOM   637   C  "C2'" . DT  A  1 32  ? -4.996  3.259   8.062  1.00 113.03 ? -41  DT  I "C2'" 1 
ATOM   638   C  "C1'" . DT  A  1 32  ? -3.906  2.206   7.916  1.00 113.03 ? -41  DT  I "C1'" 1 
ATOM   639   N  N1    . DT  A  1 32  ? -4.403  0.818   8.102  1.00 113.22 ? -41  DT  I N1    1 
ATOM   640   C  C2    . DT  A  1 32  ? -4.260  -0.104  7.084  1.00 113.61 ? -41  DT  I C2    1 
ATOM   641   O  O2    . DT  A  1 32  ? -3.737  0.143   6.008  1.00 113.87 ? -41  DT  I O2    1 
ATOM   642   N  N3    . DT  A  1 32  ? -4.764  -1.350  7.375  1.00 113.76 ? -41  DT  I N3    1 
ATOM   643   C  C4    . DT  A  1 32  ? -5.377  -1.758  8.550  1.00 113.53 ? -41  DT  I C4    1 
ATOM   644   O  O4    . DT  A  1 32  ? -5.789  -2.903  8.703  1.00 113.38 ? -41  DT  I O4    1 
ATOM   645   C  C5    . DT  A  1 32  ? -5.496  -0.743  9.574  1.00 113.63 ? -41  DT  I C5    1 
ATOM   646   C  C7    . DT  A  1 32  ? -6.141  -1.047  10.896 1.00 113.44 ? -41  DT  I C7    1 
ATOM   647   C  C6    . DT  A  1 32  ? -5.010  0.475   9.298  1.00 113.47 ? -41  DT  I C6    1 
ATOM   648   P  P     . DG  A  1 33  ? -5.051  6.264   6.767  1.00 116.05 ? -40  DG  I P     1 
ATOM   649   O  OP1   . DG  A  1 33  ? -4.399  7.478   6.233  1.00 116.10 ? -40  DG  I OP1   1 
ATOM   650   O  OP2   . DG  A  1 33  ? -6.199  6.403   7.690  1.00 116.05 ? -40  DG  I OP2   1 
ATOM   651   O  "O5'" . DG  A  1 33  ? -5.525  5.326   5.556  1.00 118.07 ? -40  DG  I "O5'" 1 
ATOM   652   C  "C5'" . DG  A  1 33  ? -4.615  4.821   4.571  1.00 120.55 ? -40  DG  I "C5'" 1 
ATOM   653   C  "C4'" . DG  A  1 33  ? -5.335  3.925   3.574  1.00 122.62 ? -40  DG  I "C4'" 1 
ATOM   654   O  "O4'" . DG  A  1 33  ? -5.461  2.590   4.134  1.00 123.41 ? -40  DG  I "O4'" 1 
ATOM   655   C  "C3'" . DG  A  1 33  ? -6.750  4.369   3.191  1.00 123.79 ? -40  DG  I "C3'" 1 
ATOM   656   O  "O3'" . DG  A  1 33  ? -6.925  4.350   1.768  1.00 124.87 ? -40  DG  I "O3'" 1 
ATOM   657   C  "C2'" . DG  A  1 33  ? -7.655  3.355   3.892  1.00 124.21 ? -40  DG  I "C2'" 1 
ATOM   658   C  "C1'" . DG  A  1 33  ? -6.771  2.113   3.888  1.00 124.43 ? -40  DG  I "C1'" 1 
ATOM   659   N  N9    . DG  A  1 33  ? -7.147  1.101   4.884  1.00 124.74 ? -40  DG  I N9    1 
ATOM   660   C  C8    . DG  A  1 33  ? -7.283  1.271   6.244  1.00 124.66 ? -40  DG  I C8    1 
ATOM   661   N  N7    . DG  A  1 33  ? -7.631  0.184   6.876  1.00 124.60 ? -40  DG  I N7    1 
ATOM   662   C  C5    . DG  A  1 33  ? -7.736  -0.774  5.876  1.00 124.67 ? -40  DG  I C5    1 
ATOM   663   C  C6    . DG  A  1 33  ? -8.082  -2.149  5.951  1.00 124.65 ? -40  DG  I C6    1 
ATOM   664   O  O6    . DG  A  1 33  ? -8.374  -2.811  6.955  1.00 124.71 ? -40  DG  I O6    1 
ATOM   665   N  N1    . DG  A  1 33  ? -8.073  -2.768  4.701  1.00 124.57 ? -40  DG  I N1    1 
ATOM   666   C  C2    . DG  A  1 33  ? -7.764  -2.134  3.522  1.00 124.55 ? -40  DG  I C2    1 
ATOM   667   N  N2    . DG  A  1 33  ? -7.806  -2.883  2.412  1.00 124.65 ? -40  DG  I N2    1 
ATOM   668   N  N3    . DG  A  1 33  ? -7.441  -0.849  3.434  1.00 124.74 ? -40  DG  I N3    1 
ATOM   669   C  C4    . DG  A  1 33  ? -7.444  -0.227  4.644  1.00 124.76 ? -40  DG  I C4    1 
ATOM   670   P  P     . DT  A  1 34  ? -8.143  5.122   1.057  1.00 125.73 ? -39  DT  I P     1 
ATOM   671   O  OP1   . DT  A  1 34  ? -7.844  5.148   -0.392 1.00 125.62 ? -39  DT  I OP1   1 
ATOM   672   O  OP2   . DT  A  1 34  ? -8.394  6.394   1.776  1.00 125.57 ? -39  DT  I OP2   1 
ATOM   673   O  "O5'" . DT  A  1 34  ? -9.393  4.155   1.326  1.00 125.80 ? -39  DT  I "O5'" 1 
ATOM   674   C  "C5'" . DT  A  1 34  ? -10.369 3.918   0.315  1.00 125.73 ? -39  DT  I "C5'" 1 
ATOM   675   C  "C4'" . DT  A  1 34  ? -10.154 2.576   -0.374 1.00 125.77 ? -39  DT  I "C4'" 1 
ATOM   676   O  "O4'" . DT  A  1 34  ? -9.619  1.584   0.546  1.00 126.19 ? -39  DT  I "O4'" 1 
ATOM   677   C  "C3'" . DT  A  1 34  ? -11.435 1.987   -0.953 1.00 125.58 ? -39  DT  I "C3'" 1 
ATOM   678   O  "O3'" . DT  A  1 34  ? -11.213 1.415   -2.236 1.00 124.66 ? -39  DT  I "O3'" 1 
ATOM   679   C  "C2'" . DT  A  1 34  ? -11.844 0.913   0.047  1.00 126.06 ? -39  DT  I "C2'" 1 
ATOM   680   C  "C1'" . DT  A  1 34  ? -10.538 0.518   0.729  1.00 126.49 ? -39  DT  I "C1'" 1 
ATOM   681   N  N1    . DT  A  1 34  ? -10.760 0.230   2.195  1.00 126.76 ? -39  DT  I N1    1 
ATOM   682   C  C2    . DT  A  1 34  ? -10.697 -1.076  2.658  1.00 126.67 ? -39  DT  I C2    1 
ATOM   683   O  O2    . DT  A  1 34  ? -10.452 -2.045  1.958  1.00 126.63 ? -39  DT  I O2    1 
ATOM   684   N  N3    . DT  A  1 34  ? -10.926 -1.215  4.006  1.00 126.74 ? -39  DT  I N3    1 
ATOM   685   C  C4    . DT  A  1 34  ? -11.215 -0.209  4.917  1.00 126.79 ? -39  DT  I C4    1 
ATOM   686   O  O4    . DT  A  1 34  ? -11.403 -0.460  6.103  1.00 126.80 ? -39  DT  I O4    1 
ATOM   687   C  C5    . DT  A  1 34  ? -11.277 1.132   4.373  1.00 126.74 ? -39  DT  I C5    1 
ATOM   688   C  C7    . DT  A  1 34  ? -11.580 2.318   5.246  1.00 126.53 ? -39  DT  I C7    1 
ATOM   689   C  C6    . DT  A  1 34  ? -11.053 1.279   3.058  1.00 126.83 ? -39  DT  I C6    1 
ATOM   690   P  P     . DA  A  1 35  ? -12.453 1.161   -3.219 1.00 123.82 ? -38  DA  I P     1 
ATOM   691   O  OP1   . DA  A  1 35  ? -11.904 1.115   -4.593 1.00 124.32 ? -38  DA  I OP1   1 
ATOM   692   O  OP2   . DA  A  1 35  ? -13.535 2.117   -2.886 1.00 123.60 ? -38  DA  I OP2   1 
ATOM   693   O  "O5'" . DA  A  1 35  ? -12.972 -0.293  -2.808 1.00 123.10 ? -38  DA  I "O5'" 1 
ATOM   694   C  "C5'" . DA  A  1 35  ? -12.192 -1.471  -3.024 1.00 121.98 ? -38  DA  I "C5'" 1 
ATOM   695   C  "C4'" . DA  A  1 35  ? -12.913 -2.677  -2.441 1.00 121.06 ? -38  DA  I "C4'" 1 
ATOM   696   O  "O4'" . DA  A  1 35  ? -12.879 -2.625  -0.986 1.00 120.73 ? -38  DA  I "O4'" 1 
ATOM   697   C  "C3'" . DA  A  1 35  ? -14.393 -2.788  -2.816 1.00 120.34 ? -38  DA  I "C3'" 1 
ATOM   698   O  "O3'" . DA  A  1 35  ? -14.721 -4.157  -3.078 1.00 119.27 ? -38  DA  I "O3'" 1 
ATOM   699   C  "C2'" . DA  A  1 35  ? -15.100 -2.251  -1.570 1.00 120.39 ? -38  DA  I "C2'" 1 
ATOM   700   C  "C1'" . DA  A  1 35  ? -14.193 -2.871  -0.514 1.00 120.59 ? -38  DA  I "C1'" 1 
ATOM   701   N  N9    . DA  A  1 35  ? -14.375 -2.398  0.864  1.00 120.57 ? -38  DA  I N9    1 
ATOM   702   C  C8    . DA  A  1 35  ? -14.262 -1.122  1.350  1.00 120.50 ? -38  DA  I C8    1 
ATOM   703   N  N7    . DA  A  1 35  ? -14.483 -1.012  2.639  1.00 120.28 ? -38  DA  I N7    1 
ATOM   704   C  C5    . DA  A  1 35  ? -14.760 -2.310  3.027  1.00 120.29 ? -38  DA  I C5    1 
ATOM   705   C  C6    . DA  A  1 35  ? -15.077 -2.878  4.274  1.00 120.24 ? -38  DA  I C6    1 
ATOM   706   N  N6    . DA  A  1 35  ? -15.166 -2.160  5.392  1.00 120.39 ? -38  DA  I N6    1 
ATOM   707   N  N1    . DA  A  1 35  ? -15.297 -4.211  4.328  1.00 120.44 ? -38  DA  I N1    1 
ATOM   708   C  C2    . DA  A  1 35  ? -15.210 -4.934  3.202  1.00 120.42 ? -38  DA  I C2    1 
ATOM   709   N  N3    . DA  A  1 35  ? -14.915 -4.513  1.971  1.00 120.42 ? -38  DA  I N3    1 
ATOM   710   C  C4    . DA  A  1 35  ? -14.700 -3.180  1.951  1.00 120.47 ? -38  DA  I C4    1 
ATOM   711   P  P     . DT  A  1 36  ? -16.210 -4.610  -3.469 1.00 118.63 ? -37  DT  I P     1 
ATOM   712   O  OP1   . DT  A  1 36  ? -16.079 -5.845  -4.277 1.00 118.42 ? -37  DT  I OP1   1 
ATOM   713   O  OP2   . DT  A  1 36  ? -16.949 -3.437  -4.000 1.00 118.60 ? -37  DT  I OP2   1 
ATOM   714   O  "O5'" . DT  A  1 36  ? -16.879 -4.976  -2.061 1.00 117.67 ? -37  DT  I "O5'" 1 
ATOM   715   C  "C5'" . DT  A  1 36  ? -16.690 -6.263  -1.477 1.00 116.02 ? -37  DT  I "C5'" 1 
ATOM   716   C  "C4'" . DT  A  1 36  ? -17.715 -6.537  -0.388 1.00 114.46 ? -37  DT  I "C4'" 1 
ATOM   717   O  "O4'" . DT  A  1 36  ? -17.538 -5.605  0.715  1.00 114.57 ? -37  DT  I "O4'" 1 
ATOM   718   C  "C3'" . DT  A  1 36  ? -19.180 -6.447  -0.821 1.00 113.03 ? -37  DT  I "C3'" 1 
ATOM   719   O  "O3'" . DT  A  1 36  ? -19.789 -7.719  -0.516 1.00 110.27 ? -37  DT  I "O3'" 1 
ATOM   720   C  "C2'" . DT  A  1 36  ? -19.723 -5.247  -0.028 1.00 113.59 ? -37  DT  I "C2'" 1 
ATOM   721   C  "C1'" . DT  A  1 36  ? -18.815 -5.240  1.205  1.00 114.07 ? -37  DT  I "C1'" 1 
ATOM   722   N  N1    . DT  A  1 36  ? -18.700 -3.950  2.002  1.00 113.98 ? -37  DT  I N1    1 
ATOM   723   C  C2    . DT  A  1 36  ? -18.995 -3.945  3.361  1.00 113.81 ? -37  DT  I C2    1 
ATOM   724   O  O2    . DT  A  1 36  ? -19.364 -4.920  3.993  1.00 113.85 ? -37  DT  I O2    1 
ATOM   725   N  N3    . DT  A  1 36  ? -18.846 -2.729  3.984  1.00 113.58 ? -37  DT  I N3    1 
ATOM   726   C  C4    . DT  A  1 36  ? -18.437 -1.538  3.411  1.00 113.87 ? -37  DT  I C4    1 
ATOM   727   O  O4    . DT  A  1 36  ? -18.339 -0.505  4.068  1.00 113.72 ? -37  DT  I O4    1 
ATOM   728   C  C5    . DT  A  1 36  ? -18.142 -1.605  1.995  1.00 114.05 ? -37  DT  I C5    1 
ATOM   729   C  C7    . DT  A  1 36  ? -17.693 -0.382  1.249  1.00 113.96 ? -37  DT  I C7    1 
ATOM   730   C  C6    . DT  A  1 36  ? -18.283 -2.788  1.370  1.00 114.10 ? -37  DT  I C6    1 
ATOM   731   P  P     . DT  A  1 37  ? -21.357 -8.065  -0.631 1.00 108.79 ? -36  DT  I P     1 
ATOM   732   O  OP1   . DT  A  1 37  ? -21.460 -9.434  -1.191 1.00 108.54 ? -36  DT  I OP1   1 
ATOM   733   O  OP2   . DT  A  1 37  ? -22.095 -6.941  -1.259 1.00 108.70 ? -36  DT  I OP2   1 
ATOM   734   O  "O5'" . DT  A  1 37  ? -21.807 -8.137  0.905  1.00 106.02 ? -36  DT  I "O5'" 1 
ATOM   735   C  "C5'" . DT  A  1 37  ? -21.111 -9.008  1.799  1.00 101.48 ? -36  DT  I "C5'" 1 
ATOM   736   C  "C4'" . DT  A  1 37  ? -21.552 -8.798  3.235  1.00 97.93  ? -36  DT  I "C4'" 1 
ATOM   737   O  "O4'" . DT  A  1 37  ? -21.310 -7.435  3.659  1.00 97.63  ? -36  DT  I "O4'" 1 
ATOM   738   C  "C3'" . DT  A  1 37  ? -23.026 -9.065  3.497  1.00 95.42  ? -36  DT  I "C3'" 1 
ATOM   739   O  "O3'" . DT  A  1 37  ? -23.042 -9.992  4.548  1.00 91.70  ? -36  DT  I "O3'" 1 
ATOM   740   C  "C2'" . DT  A  1 37  ? -23.621 -7.713  3.892  1.00 95.54  ? -36  DT  I "C2'" 1 
ATOM   741   C  "C1'" . DT  A  1 37  ? -22.401 -6.976  4.432  1.00 96.45  ? -36  DT  I "C1'" 1 
ATOM   742   N  N1    . DT  A  1 37  ? -22.426 -5.475  4.339  1.00 96.29  ? -36  DT  I N1    1 
ATOM   743   C  C2    . DT  A  1 37  ? -22.437 -4.714  5.494  1.00 96.31  ? -36  DT  I C2    1 
ATOM   744   O  O2    . DT  A  1 37  ? -22.446 -5.176  6.620  1.00 96.70  ? -36  DT  I O2    1 
ATOM   745   N  N3    . DT  A  1 37  ? -22.448 -3.359  5.291  1.00 96.21  ? -36  DT  I N3    1 
ATOM   746   C  C4    . DT  A  1 37  ? -22.445 -2.691  4.080  1.00 96.49  ? -36  DT  I C4    1 
ATOM   747   O  O4    . DT  A  1 37  ? -22.457 -1.463  4.028  1.00 95.97  ? -36  DT  I O4    1 
ATOM   748   C  C5    . DT  A  1 37  ? -22.427 -3.545  2.905  1.00 96.73  ? -36  DT  I C5    1 
ATOM   749   C  C7    . DT  A  1 37  ? -22.420 -2.969  1.515  1.00 96.58  ? -36  DT  I C7    1 
ATOM   750   C  C6    . DT  A  1 37  ? -22.418 -4.873  3.093  1.00 96.38  ? -36  DT  I C6    1 
ATOM   751   P  P     . DT  A  1 38  ? -24.369 -10.765 4.958  1.00 89.07  ? -35  DT  I P     1 
ATOM   752   O  OP1   . DT  A  1 38  ? -23.946 -12.113 5.424  1.00 88.09  ? -35  DT  I OP1   1 
ATOM   753   O  OP2   . DT  A  1 38  ? -25.369 -10.592 3.879  1.00 88.68  ? -35  DT  I OP2   1 
ATOM   754   O  "O5'" . DT  A  1 38  ? -24.891 -9.890  6.197  1.00 86.56  ? -35  DT  I "O5'" 1 
ATOM   755   C  "C5'" . DT  A  1 38  ? -24.090 -9.735  7.374  1.00 81.31  ? -35  DT  I "C5'" 1 
ATOM   756   C  "C4'" . DT  A  1 38  ? -24.680 -8.721  8.339  1.00 77.13  ? -35  DT  I "C4'" 1 
ATOM   757   O  "O4'" . DT  A  1 38  ? -24.487 -7.385  7.821  1.00 75.96  ? -35  DT  I "O4'" 1 
ATOM   758   C  "C3'" . DT  A  1 38  ? -26.172 -8.868  8.625  1.00 75.15  ? -35  DT  I "C3'" 1 
ATOM   759   O  "O3'" . DT  A  1 38  ? -26.382 -8.902  10.027 1.00 72.44  ? -35  DT  I "O3'" 1 
ATOM   760   C  "C2'" . DT  A  1 38  ? -26.780 -7.597  8.045  1.00 75.25  ? -35  DT  I "C2'" 1 
ATOM   761   C  "C1'" . DT  A  1 38  ? -25.617 -6.623  8.174  1.00 76.42  ? -35  DT  I "C1'" 1 
ATOM   762   N  N1    . DT  A  1 38  ? -25.700 -5.439  7.261  1.00 76.98  ? -35  DT  I N1    1 
ATOM   763   C  C2    . DT  A  1 38  ? -25.555 -4.150  7.755  1.00 76.88  ? -35  DT  I C2    1 
ATOM   764   O  O2    . DT  A  1 38  ? -25.356 -3.883  8.927  1.00 76.69  ? -35  DT  I O2    1 
ATOM   765   N  N3    . DT  A  1 38  ? -25.659 -3.164  6.799  1.00 76.85  ? -35  DT  I N3    1 
ATOM   766   C  C4    . DT  A  1 38  ? -25.884 -3.331  5.439  1.00 76.60  ? -35  DT  I C4    1 
ATOM   767   O  O4    . DT  A  1 38  ? -25.959 -2.383  4.669  1.00 76.49  ? -35  DT  I O4    1 
ATOM   768   C  C5    . DT  A  1 38  ? -26.027 -4.697  4.994  1.00 77.06  ? -35  DT  I C5    1 
ATOM   769   C  C7    . DT  A  1 38  ? -26.277 -5.029  3.551  1.00 77.22  ? -35  DT  I C7    1 
ATOM   770   C  C6    . DT  A  1 38  ? -25.929 -5.666  5.913  1.00 77.31  ? -35  DT  I C6    1 
ATOM   771   P  P     . DG  A  1 39  ? -26.613 -10.241 10.878 1.00 69.29  ? -34  DG  I P     1 
ATOM   772   O  OP1   . DG  A  1 39  ? -25.657 -11.285 10.454 1.00 68.03  ? -34  DG  I OP1   1 
ATOM   773   O  OP2   . DG  A  1 39  ? -28.070 -10.504 10.908 1.00 68.63  ? -34  DG  I OP2   1 
ATOM   774   O  "O5'" . DG  A  1 39  ? -26.199 -9.734  12.335 1.00 68.09  ? -34  DG  I "O5'" 1 
ATOM   775   C  "C5'" . DG  A  1 39  ? -25.115 -8.832  12.504 1.00 66.30  ? -34  DG  I "C5'" 1 
ATOM   776   C  "C4'" . DG  A  1 39  ? -25.351 -7.796  13.595 1.00 65.50  ? -34  DG  I "C4'" 1 
ATOM   777   O  "O4'" . DG  A  1 39  ? -25.851 -6.566  13.024 1.00 66.35  ? -34  DG  I "O4'" 1 
ATOM   778   C  "C3'" . DG  A  1 39  ? -26.334 -8.096  14.713 1.00 64.85  ? -34  DG  I "C3'" 1 
ATOM   779   O  "O3'" . DG  A  1 39  ? -25.862 -7.412  15.872 1.00 63.06  ? -34  DG  I "O3'" 1 
ATOM   780   C  "C2'" . DG  A  1 39  ? -27.656 -7.524  14.205 1.00 65.63  ? -34  DG  I "C2'" 1 
ATOM   781   C  "C1'" . DG  A  1 39  ? -27.188 -6.315  13.408 1.00 67.72  ? -34  DG  I "C1'" 1 
ATOM   782   N  N9    . DG  A  1 39  ? -27.867 -6.098  12.136 1.00 68.90  ? -34  DG  I N9    1 
ATOM   783   C  C8    . DG  A  1 39  ? -28.448 -7.044  11.320 1.00 68.99  ? -34  DG  I C8    1 
ATOM   784   N  N7    . DG  A  1 39  ? -28.960 -6.550  10.233 1.00 69.11  ? -34  DG  I N7    1 
ATOM   785   C  C5    . DG  A  1 39  ? -28.687 -5.193  10.321 1.00 68.92  ? -34  DG  I C5    1 
ATOM   786   C  C6    . DG  A  1 39  ? -28.995 -4.150  9.423  1.00 68.42  ? -34  DG  I C6    1 
ATOM   787   O  O6    . DG  A  1 39  ? -29.590 -4.227  8.343  1.00 68.69  ? -34  DG  I O6    1 
ATOM   788   N  N1    . DG  A  1 39  ? -28.545 -2.922  9.892  1.00 68.74  ? -34  DG  I N1    1 
ATOM   789   C  C2    . DG  A  1 39  ? -27.870 -2.720  11.074 1.00 68.55  ? -34  DG  I C2    1 
ATOM   790   N  N2    . DG  A  1 39  ? -27.519 -1.461  11.350 1.00 68.58  ? -34  DG  I N2    1 
ATOM   791   N  N3    . DG  A  1 39  ? -27.570 -3.685  11.928 1.00 68.84  ? -34  DG  I N3    1 
ATOM   792   C  C4    . DG  A  1 39  ? -28.010 -4.894  11.485 1.00 69.22  ? -34  DG  I C4    1 
ATOM   793   P  P     . DG  A  1 40  ? -26.587 -7.563  17.285 1.00 62.38  ? -33  DG  I P     1 
ATOM   794   O  OP1   . DG  A  1 40  ? -25.541 -7.427  18.312 1.00 63.42  ? -33  DG  I OP1   1 
ATOM   795   O  OP2   . DG  A  1 40  ? -27.432 -8.779  17.254 1.00 63.65  ? -33  DG  I OP2   1 
ATOM   796   O  "O5'" . DG  A  1 40  ? -27.581 -6.318  17.376 1.00 62.41  ? -33  DG  I "O5'" 1 
ATOM   797   C  "C5'" . DG  A  1 40  ? -27.131 -4.963  17.307 1.00 63.69  ? -33  DG  I "C5'" 1 
ATOM   798   C  "C4'" . DG  A  1 40  ? -28.299 -4.039  16.993 1.00 65.00  ? -33  DG  I "C4'" 1 
ATOM   799   O  "O4'" . DG  A  1 40  ? -28.806 -4.342  15.679 1.00 66.11  ? -33  DG  I "O4'" 1 
ATOM   800   C  "C3'" . DG  A  1 40  ? -29.517 -4.164  17.903 1.00 66.79  ? -33  DG  I "C3'" 1 
ATOM   801   O  "O3'" . DG  A  1 40  ? -29.979 -2.874  18.200 1.00 68.57  ? -33  DG  I "O3'" 1 
ATOM   802   C  "C2'" . DG  A  1 40  ? -30.551 -4.928  17.081 1.00 67.17  ? -33  DG  I "C2'" 1 
ATOM   803   C  "C1'" . DG  A  1 40  ? -30.219 -4.327  15.730 1.00 68.58  ? -33  DG  I "C1'" 1 
ATOM   804   N  N9    . DG  A  1 40  ? -30.735 -4.944  14.505 1.00 69.53  ? -33  DG  I N9    1 
ATOM   805   C  C8    . DG  A  1 40  ? -31.083 -6.247  14.202 1.00 69.68  ? -33  DG  I C8    1 
ATOM   806   N  N7    . DG  A  1 40  ? -31.489 -6.405  12.964 1.00 69.34  ? -33  DG  I N7    1 
ATOM   807   C  C5    . DG  A  1 40  ? -31.394 -5.128  12.416 1.00 69.71  ? -33  DG  I C5    1 
ATOM   808   C  C6    . DG  A  1 40  ? -31.691 -4.637  11.115 1.00 69.51  ? -33  DG  I C6    1 
ATOM   809   O  O6    . DG  A  1 40  ? -32.109 -5.272  10.135 1.00 69.58  ? -33  DG  I O6    1 
ATOM   810   N  N1    . DG  A  1 40  ? -31.446 -3.263  10.999 1.00 69.41  ? -33  DG  I N1    1 
ATOM   811   C  C2    . DG  A  1 40  ? -30.975 -2.454  12.018 1.00 69.79  ? -33  DG  I C2    1 
ATOM   812   N  N2    . DG  A  1 40  ? -30.791 -1.150  11.764 1.00 69.47  ? -33  DG  I N2    1 
ATOM   813   N  N3    . DG  A  1 40  ? -30.698 -2.896  13.236 1.00 70.10  ? -33  DG  I N3    1 
ATOM   814   C  C4    . DG  A  1 40  ? -30.932 -4.230  13.356 1.00 69.94  ? -33  DG  I C4    1 
ATOM   815   P  P     . DA  A  1 41  ? -29.777 -2.256  19.657 1.00 70.48  ? -32  DA  I P     1 
ATOM   816   O  OP1   . DA  A  1 41  ? -28.392 -2.530  20.106 1.00 69.82  ? -32  DA  I OP1   1 
ATOM   817   O  OP2   . DA  A  1 41  ? -30.946 -2.647  20.476 1.00 70.09  ? -32  DA  I OP2   1 
ATOM   818   O  "O5'" . DA  A  1 41  ? -29.909 -0.686  19.387 1.00 72.95  ? -32  DA  I "O5'" 1 
ATOM   819   C  "C5'" . DA  A  1 41  ? -29.238 -0.036  18.309 1.00 75.72  ? -32  DA  I "C5'" 1 
ATOM   820   C  "C4'" . DA  A  1 41  ? -30.115 1.075   17.756 1.00 78.33  ? -32  DA  I "C4'" 1 
ATOM   821   O  "O4'" . DA  A  1 41  ? -30.809 0.650   16.556 1.00 79.11  ? -32  DA  I "O4'" 1 
ATOM   822   C  "C3'" . DA  A  1 41  ? -31.204 1.598   18.685 1.00 79.69  ? -32  DA  I "C3'" 1 
ATOM   823   O  "O3'" . DA  A  1 41  ? -31.181 3.017   18.522 1.00 82.47  ? -32  DA  I "O3'" 1 
ATOM   824   C  "C2'" . DA  A  1 41  ? -32.476 0.882   18.220 1.00 79.04  ? -32  DA  I "C2'" 1 
ATOM   825   C  "C1'" . DA  A  1 41  ? -32.214 0.640   16.738 1.00 79.87  ? -32  DA  I "C1'" 1 
ATOM   826   N  N9    . DA  A  1 41  ? -32.704 -0.632  16.189 1.00 80.24  ? -32  DA  I N9    1 
ATOM   827   C  C8    . DA  A  1 41  ? -32.821 -1.840  16.830 1.00 80.48  ? -32  DA  I C8    1 
ATOM   828   N  N7    . DA  A  1 41  ? -33.282 -2.814  16.077 1.00 80.51  ? -32  DA  I N7    1 
ATOM   829   C  C5    . DA  A  1 41  ? -33.474 -2.211  14.846 1.00 80.46  ? -32  DA  I C5    1 
ATOM   830   C  C6    . DA  A  1 41  ? -33.946 -2.705  13.610 1.00 80.21  ? -32  DA  I C6    1 
ATOM   831   N  N6    . DA  A  1 41  ? -34.320 -3.970  13.414 1.00 80.24  ? -32  DA  I N6    1 
ATOM   832   N  N1    . DA  A  1 41  ? -34.020 -1.842  12.574 1.00 80.59  ? -32  DA  I N1    1 
ATOM   833   C  C2    . DA  A  1 41  ? -33.649 -0.562  12.767 1.00 80.73  ? -32  DA  I C2    1 
ATOM   834   N  N3    . DA  A  1 41  ? -33.188 0.019   13.879 1.00 80.61  ? -32  DA  I N3    1 
ATOM   835   C  C4    . DA  A  1 41  ? -33.123 -0.867  14.895 1.00 80.42  ? -32  DA  I C4    1 
ATOM   836   P  P     . DA  A  1 42  ? -32.411 4.008   18.785 1.00 84.24  ? -31  DA  I P     1 
ATOM   837   O  OP1   . DA  A  1 42  ? -31.827 5.367   18.834 1.00 84.67  ? -31  DA  I OP1   1 
ATOM   838   O  OP2   . DA  A  1 42  ? -33.259 3.511   19.898 1.00 83.78  ? -31  DA  I OP2   1 
ATOM   839   O  "O5'" . DA  A  1 42  ? -33.253 3.838   17.441 1.00 84.58  ? -31  DA  I "O5'" 1 
ATOM   840   C  "C5'" . DA  A  1 42  ? -33.144 4.741   16.366 1.00 85.54  ? -31  DA  I "C5'" 1 
ATOM   841   C  "C4'" . DA  A  1 42  ? -34.448 4.647   15.606 1.00 87.17  ? -31  DA  I "C4'" 1 
ATOM   842   O  "O4'" . DA  A  1 42  ? -34.676 3.276   15.168 1.00 87.44  ? -31  DA  I "O4'" 1 
ATOM   843   C  "C3'" . DA  A  1 42  ? -35.670 5.054   16.421 1.00 87.94  ? -31  DA  I "C3'" 1 
ATOM   844   O  "O3'" . DA  A  1 42  ? -36.364 6.050   15.679 1.00 90.08  ? -31  DA  I "O3'" 1 
ATOM   845   C  "C2'" . DA  A  1 42  ? -36.479 3.762   16.585 1.00 87.34  ? -31  DA  I "C2'" 1 
ATOM   846   C  "C1'" . DA  A  1 42  ? -36.026 2.916   15.398 1.00 87.07  ? -31  DA  I "C1'" 1 
ATOM   847   N  N9    . DA  A  1 42  ? -36.125 1.468   15.617 1.00 87.02  ? -31  DA  I N9    1 
ATOM   848   C  C8    . DA  A  1 42  ? -35.843 0.790   16.770 1.00 86.88  ? -31  DA  I C8    1 
ATOM   849   N  N7    . DA  A  1 42  ? -36.019 -0.507  16.684 1.00 87.12  ? -31  DA  I N7    1 
ATOM   850   C  C5    . DA  A  1 42  ? -36.450 -0.708  15.385 1.00 87.06  ? -31  DA  I C5    1 
ATOM   851   C  C6    . DA  A  1 42  ? -36.815 -1.873  14.663 1.00 86.92  ? -31  DA  I C6    1 
ATOM   852   N  N6    . DA  A  1 42  ? -36.799 -3.111  15.167 1.00 86.65  ? -31  DA  I N6    1 
ATOM   853   N  N1    . DA  A  1 42  ? -37.196 -1.722  13.379 1.00 86.90  ? -31  DA  I N1    1 
ATOM   854   C  C2    . DA  A  1 42  ? -37.213 -0.488  12.861 1.00 86.97  ? -31  DA  I C2    1 
ATOM   855   N  N3    . DA  A  1 42  ? -36.895 0.674   13.435 1.00 87.03  ? -31  DA  I N3    1 
ATOM   856   C  C4    . DA  A  1 42  ? -36.518 0.501   14.713 1.00 87.09  ? -31  DA  I C4    1 
ATOM   857   P  P     . DA  A  1 43  ? -37.592 6.886   16.281 1.00 91.85  ? -30  DA  I P     1 
ATOM   858   O  OP1   . DA  A  1 43  ? -37.066 8.247   16.564 1.00 91.39  ? -30  DA  I OP1   1 
ATOM   859   O  OP2   . DA  A  1 43  ? -38.265 6.104   17.354 1.00 91.81  ? -30  DA  I OP2   1 
ATOM   860   O  "O5'" . DA  A  1 43  ? -38.619 6.923   15.050 1.00 91.69  ? -30  DA  I "O5'" 1 
ATOM   861   C  "C5'" . DA  A  1 43  ? -38.620 5.866   14.088 1.00 91.76  ? -30  DA  I "C5'" 1 
ATOM   862   C  "C4'" . DA  A  1 43  ? -39.957 5.150   13.933 1.00 91.77  ? -30  DA  I "C4'" 1 
ATOM   863   O  "O4'" . DA  A  1 43  ? -39.742 3.728   14.128 1.00 91.73  ? -30  DA  I "O4'" 1 
ATOM   864   C  "C3'" . DA  A  1 43  ? -41.114 5.529   14.859 1.00 91.84  ? -30  DA  I "C3'" 1 
ATOM   865   O  "O3'" . DA  A  1 43  ? -42.320 5.555   14.078 1.00 92.27  ? -30  DA  I "O3'" 1 
ATOM   866   C  "C2'" . DA  A  1 43  ? -41.122 4.379   15.869 1.00 91.70  ? -30  DA  I "C2'" 1 
ATOM   867   C  "C1'" . DA  A  1 43  ? -40.772 3.215   14.946 1.00 91.74  ? -30  DA  I "C1'" 1 
ATOM   868   N  N9    . DA  A  1 43  ? -40.309 1.969   15.575 1.00 92.03  ? -30  DA  I N9    1 
ATOM   869   C  C8    . DA  A  1 43  ? -39.531 1.808   16.694 1.00 91.79  ? -30  DA  I C8    1 
ATOM   870   N  N7    . DA  A  1 43  ? -39.281 0.557   17.001 1.00 91.45  ? -30  DA  I N7    1 
ATOM   871   C  C5    . DA  A  1 43  ? -39.934 -0.164  16.014 1.00 91.76  ? -30  DA  I C5    1 
ATOM   872   C  C6    . DA  A  1 43  ? -40.069 -1.550  15.757 1.00 91.68  ? -30  DA  I C6    1 
ATOM   873   N  N6    . DA  A  1 43  ? -39.524 -2.503  16.512 1.00 91.80  ? -30  DA  I N6    1 
ATOM   874   N  N1    . DA  A  1 43  ? -40.794 -1.935  14.684 1.00 91.79  ? -30  DA  I N1    1 
ATOM   875   C  C2    . DA  A  1 43  ? -41.351 -0.990  13.914 1.00 91.86  ? -30  DA  I C2    1 
ATOM   876   N  N3    . DA  A  1 43  ? -41.298 0.338   14.053 1.00 91.81  ? -30  DA  I N3    1 
ATOM   877   C  C4    . DA  A  1 43  ? -40.569 0.692   15.128 1.00 91.89  ? -30  DA  I C4    1 
ATOM   878   P  P     . DC  A  1 44  ? -43.656 6.316   14.545 1.00 92.25  ? -29  DC  I P     1 
ATOM   879   O  OP1   . DC  A  1 44  ? -43.726 7.582   13.781 1.00 92.68  ? -29  DC  I OP1   1 
ATOM   880   O  OP2   . DC  A  1 44  ? -43.694 6.359   16.020 1.00 92.37  ? -29  DC  I OP2   1 
ATOM   881   O  "O5'" . DC  A  1 44  ? -44.855 5.347   14.109 1.00 92.14  ? -29  DC  I "O5'" 1 
ATOM   882   C  "C5'" . DC  A  1 44  ? -44.839 4.613   12.897 1.00 93.13  ? -29  DC  I "C5'" 1 
ATOM   883   C  "C4'" . DC  A  1 44  ? -45.461 3.240   13.097 1.00 94.06  ? -29  DC  I "C4'" 1 
ATOM   884   O  "O4'" . DC  A  1 44  ? -44.509 2.375   13.771 1.00 94.43  ? -29  DC  I "O4'" 1 
ATOM   885   C  "C3'" . DC  A  1 44  ? -46.744 3.197   13.934 1.00 94.34  ? -29  DC  I "C3'" 1 
ATOM   886   O  "O3'" . DC  A  1 44  ? -47.781 2.489   13.240 1.00 95.15  ? -29  DC  I "O3'" 1 
ATOM   887   C  "C2'" . DC  A  1 44  ? -46.318 2.446   15.191 1.00 94.24  ? -29  DC  I "C2'" 1 
ATOM   888   C  "C1'" . DC  A  1 44  ? -45.251 1.525   14.614 1.00 94.07  ? -29  DC  I "C1'" 1 
ATOM   889   N  N1    . DC  A  1 44  ? -44.391 0.855   15.650 1.00 94.17  ? -29  DC  I N1    1 
ATOM   890   C  C2    . DC  A  1 44  ? -44.337 -0.551  15.699 1.00 94.14  ? -29  DC  I C2    1 
ATOM   891   O  O2    . DC  A  1 44  ? -44.981 -1.221  14.880 1.00 94.08  ? -29  DC  I O2    1 
ATOM   892   N  N3    . DC  A  1 44  ? -43.570 -1.148  16.650 1.00 93.85  ? -29  DC  I N3    1 
ATOM   893   C  C4    . DC  A  1 44  ? -42.883 -0.413  17.526 1.00 93.88  ? -29  DC  I C4    1 
ATOM   894   N  N4    . DC  A  1 44  ? -42.143 -1.058  18.435 1.00 93.82  ? -29  DC  I N4    1 
ATOM   895   C  C5    . DC  A  1 44  ? -42.925 1.016   17.500 1.00 94.11  ? -29  DC  I C5    1 
ATOM   896   C  C6    . DC  A  1 44  ? -43.684 1.599   16.560 1.00 94.32  ? -29  DC  I C6    1 
ATOM   897   P  P     . DT  A  1 45  ? -49.294 2.412   13.789 1.00 96.12  ? -28  DT  I P     1 
ATOM   898   O  OP1   . DT  A  1 45  ? -50.199 2.284   12.622 1.00 95.84  ? -28  DT  I OP1   1 
ATOM   899   O  OP2   . DT  A  1 45  ? -49.511 3.508   14.762 1.00 95.94  ? -28  DT  I OP2   1 
ATOM   900   O  "O5'" . DT  A  1 45  ? -49.323 1.035   14.598 1.00 95.52  ? -28  DT  I "O5'" 1 
ATOM   901   C  "C5'" . DT  A  1 45  ? -49.637 -0.185  13.930 1.00 94.72  ? -28  DT  I "C5'" 1 
ATOM   902   C  "C4'" . DT  A  1 45  ? -49.728 -1.315  14.934 1.00 93.89  ? -28  DT  I "C4'" 1 
ATOM   903   O  "O4'" . DT  A  1 45  ? -48.517 -1.350  15.741 1.00 93.62  ? -28  DT  I "O4'" 1 
ATOM   904   C  "C3'" . DT  A  1 45  ? -50.886 -1.199  15.921 1.00 93.40  ? -28  DT  I "C3'" 1 
ATOM   905   O  "O3'" . DT  A  1 45  ? -51.472 -2.477  16.064 1.00 93.50  ? -28  DT  I "O3'" 1 
ATOM   906   C  "C2'" . DT  A  1 45  ? -50.212 -0.751  17.218 1.00 92.87  ? -28  DT  I "C2'" 1 
ATOM   907   C  "C1'" . DT  A  1 45  ? -48.900 -1.522  17.094 1.00 91.75  ? -28  DT  I "C1'" 1 
ATOM   908   N  N1    . DT  A  1 45  ? -47.781 -1.131  18.025 1.00 91.05  ? -28  DT  I N1    1 
ATOM   909   C  C2    . DT  A  1 45  ? -47.055 -2.140  18.625 1.00 90.53  ? -28  DT  I C2    1 
ATOM   910   O  O2    . DT  A  1 45  ? -47.277 -3.321  18.435 1.00 90.18  ? -28  DT  I O2    1 
ATOM   911   N  N3    . DT  A  1 45  ? -46.050 -1.712  19.460 1.00 90.55  ? -28  DT  I N3    1 
ATOM   912   C  C4    . DT  A  1 45  ? -45.703 -0.402  19.753 1.00 90.70  ? -28  DT  I C4    1 
ATOM   913   O  O4    . DT  A  1 45  ? -44.783 -0.135  20.522 1.00 90.45  ? -28  DT  I O4    1 
ATOM   914   C  C5    . DT  A  1 45  ? -46.503 0.611   19.092 1.00 90.45  ? -28  DT  I C5    1 
ATOM   915   C  C7    . DT  A  1 45  ? -46.238 2.074   19.318 1.00 90.46  ? -28  DT  I C7    1 
ATOM   916   C  C6    . DT  A  1 45  ? -47.487 0.202   18.272 1.00 90.64  ? -28  DT  I C6    1 
ATOM   917   P  P     . DG  A  1 46  ? -52.925 -2.749  15.473 1.00 93.49  ? -27  DG  I P     1 
ATOM   918   O  OP1   . DG  A  1 46  ? -52.877 -2.404  14.031 1.00 93.64  ? -27  DG  I OP1   1 
ATOM   919   O  OP2   . DG  A  1 46  ? -53.897 -2.108  16.386 1.00 92.92  ? -27  DG  I OP2   1 
ATOM   920   O  "O5'" . DG  A  1 46  ? -53.120 -4.328  15.631 1.00 93.26  ? -27  DG  I "O5'" 1 
ATOM   921   C  "C5'" . DG  A  1 46  ? -52.123 -5.241  15.191 1.00 93.07  ? -27  DG  I "C5'" 1 
ATOM   922   C  "C4'" . DG  A  1 46  ? -51.960 -6.396  16.168 1.00 93.08  ? -27  DG  I "C4'" 1 
ATOM   923   O  "O4'" . DG  A  1 46  ? -50.945 -6.089  17.159 1.00 93.41  ? -27  DG  I "O4'" 1 
ATOM   924   C  "C3'" . DG  A  1 46  ? -53.202 -6.812  16.950 1.00 93.05  ? -27  DG  I "C3'" 1 
ATOM   925   O  "O3'" . DG  A  1 46  ? -53.235 -8.239  16.937 1.00 93.15  ? -27  DG  I "O3'" 1 
ATOM   926   C  "C2'" . DG  A  1 46  ? -52.989 -6.211  18.343 1.00 92.86  ? -27  DG  I "C2'" 1 
ATOM   927   C  "C1'" . DG  A  1 46  ? -51.466 -6.174  18.475 1.00 93.01  ? -27  DG  I "C1'" 1 
ATOM   928   N  N9    . DG  A  1 46  ? -50.901 -5.034  19.208 1.00 92.96  ? -27  DG  I N9    1 
ATOM   929   C  C8    . DG  A  1 46  ? -51.271 -3.711  19.103 1.00 92.98  ? -27  DG  I C8    1 
ATOM   930   N  N7    . DG  A  1 46  ? -50.585 -2.907  19.867 1.00 93.03  ? -27  DG  I N7    1 
ATOM   931   C  C5    . DG  A  1 46  ? -49.688 -3.743  20.521 1.00 93.09  ? -27  DG  I C5    1 
ATOM   932   C  C6    . DG  A  1 46  ? -48.681 -3.439  21.477 1.00 92.78  ? -27  DG  I C6    1 
ATOM   933   O  O6    . DG  A  1 46  ? -48.369 -2.339  21.949 1.00 92.73  ? -27  DG  I O6    1 
ATOM   934   N  N1    . DG  A  1 46  ? -47.997 -4.576  21.895 1.00 92.81  ? -27  DG  I N1    1 
ATOM   935   C  C2    . DG  A  1 46  ? -48.252 -5.852  21.443 1.00 92.93  ? -27  DG  I C2    1 
ATOM   936   N  N2    . DG  A  1 46  ? -47.487 -6.824  21.958 1.00 92.94  ? -27  DG  I N2    1 
ATOM   937   N  N3    . DG  A  1 46  ? -49.189 -6.154  20.546 1.00 92.84  ? -27  DG  I N3    1 
ATOM   938   C  C4    . DG  A  1 46  ? -49.869 -5.056  20.124 1.00 92.88  ? -27  DG  I C4    1 
ATOM   939   P  P     . DC  A  1 47  ? -54.421 -9.109  17.580 1.00 93.61  ? -26  DC  I P     1 
ATOM   940   O  OP1   . DC  A  1 47  ? -54.502 -10.380 16.817 1.00 92.88  ? -26  DC  I OP1   1 
ATOM   941   O  OP2   . DC  A  1 47  ? -55.623 -8.263  17.794 1.00 93.31  ? -26  DC  I OP2   1 
ATOM   942   O  "O5'" . DC  A  1 47  ? -53.850 -9.430  19.035 1.00 92.90  ? -26  DC  I "O5'" 1 
ATOM   943   C  "C5'" . DC  A  1 47  ? -52.547 -9.977  19.228 1.00 91.17  ? -26  DC  I "C5'" 1 
ATOM   944   C  "C4'" . DC  A  1 47  ? -52.279 -10.066 20.717 1.00 89.50  ? -26  DC  I "C4'" 1 
ATOM   945   O  "O4'" . DC  A  1 47  ? -51.980 -8.747  21.234 1.00 89.41  ? -26  DC  I "O4'" 1 
ATOM   946   C  "C3'" . DC  A  1 47  ? -53.461 -10.568 21.530 1.00 88.49  ? -26  DC  I "C3'" 1 
ATOM   947   O  "O3'" . DC  A  1 47  ? -52.965 -11.499 22.474 1.00 87.80  ? -26  DC  I "O3'" 1 
ATOM   948   C  "C2'" . DC  A  1 47  ? -54.047 -9.314  22.179 1.00 88.29  ? -26  DC  I "C2'" 1 
ATOM   949   C  "C1'" . DC  A  1 47  ? -52.797 -8.457  22.350 1.00 88.33  ? -26  DC  I "C1'" 1 
ATOM   950   N  N1    . DC  A  1 47  ? -52.976 -6.962  22.410 1.00 87.92  ? -26  DC  I N1    1 
ATOM   951   C  C2    . DC  A  1 47  ? -51.902 -6.174  22.855 1.00 88.16  ? -26  DC  I C2    1 
ATOM   952   O  O2    . DC  A  1 47  ? -50.840 -6.719  23.191 1.00 88.03  ? -26  DC  I O2    1 
ATOM   953   N  N3    . DC  A  1 47  ? -52.052 -4.823  22.907 1.00 88.14  ? -26  DC  I N3    1 
ATOM   954   C  C4    . DC  A  1 47  ? -53.203 -4.258  22.539 1.00 87.91  ? -26  DC  I C4    1 
ATOM   955   N  N4    . DC  A  1 47  ? -53.296 -2.929  22.615 1.00 87.75  ? -26  DC  I N4    1 
ATOM   956   C  C5    . DC  A  1 47  ? -54.305 -5.039  22.081 1.00 87.84  ? -26  DC  I C5    1 
ATOM   957   C  C6    . DC  A  1 47  ? -54.149 -6.368  22.033 1.00 87.72  ? -26  DC  I C6    1 
ATOM   958   P  P     . DT  A  1 48  ? -53.312 -13.048 22.298 1.00 86.67  ? -25  DT  I P     1 
ATOM   959   O  OP1   . DT  A  1 48  ? -52.323 -13.648 21.365 1.00 86.39  ? -25  DT  I OP1   1 
ATOM   960   O  OP2   . DT  A  1 48  ? -54.767 -13.145 22.043 1.00 86.84  ? -25  DT  I OP2   1 
ATOM   961   O  "O5'" . DT  A  1 48  ? -53.065 -13.636 23.756 1.00 85.42  ? -25  DT  I "O5'" 1 
ATOM   962   C  "C5'" . DT  A  1 48  ? -52.906 -12.731 24.822 1.00 83.08  ? -25  DT  I "C5'" 1 
ATOM   963   C  "C4'" . DT  A  1 48  ? -51.441 -12.587 25.218 1.00 80.68  ? -25  DT  I "C4'" 1 
ATOM   964   O  "O4'" . DT  A  1 48  ? -51.033 -11.198 25.201 1.00 80.79  ? -25  DT  I "O4'" 1 
ATOM   965   C  "C3'" . DT  A  1 48  ? -51.173 -12.996 26.655 1.00 78.71  ? -25  DT  I "C3'" 1 
ATOM   966   O  "O3'" . DT  A  1 48  ? -49.775 -13.209 26.872 1.00 74.78  ? -25  DT  I "O3'" 1 
ATOM   967   C  "C2'" . DT  A  1 48  ? -51.702 -11.778 27.406 1.00 79.36  ? -25  DT  I "C2'" 1 
ATOM   968   C  "C1'" . DT  A  1 48  ? -51.225 -10.647 26.499 1.00 81.05  ? -25  DT  I "C1'" 1 
ATOM   969   N  N1    . DT  A  1 48  ? -52.147 -9.482  26.383 1.00 81.03  ? -25  DT  I N1    1 
ATOM   970   C  C2    . DT  A  1 48  ? -51.637 -8.225  26.618 1.00 81.83  ? -25  DT  I C2    1 
ATOM   971   O  O2    . DT  A  1 48  ? -50.479 -8.006  26.934 1.00 82.31  ? -25  DT  I O2    1 
ATOM   972   N  N3    . DT  A  1 48  ? -52.539 -7.204  26.477 1.00 82.22  ? -25  DT  I N3    1 
ATOM   973   C  C4    . DT  A  1 48  ? -53.872 -7.298  26.128 1.00 82.03  ? -25  DT  I C4    1 
ATOM   974   O  O4    . DT  A  1 48  ? -54.571 -6.287  26.032 1.00 81.75  ? -25  DT  I O4    1 
ATOM   975   C  C5    . DT  A  1 48  ? -54.347 -8.652  25.890 1.00 82.37  ? -25  DT  I C5    1 
ATOM   976   C  C7    . DT  A  1 48  ? -55.774 -8.929  25.500 1.00 81.96  ? -25  DT  I C7    1 
ATOM   977   C  C6    . DT  A  1 48  ? -53.470 -9.659  26.028 1.00 81.54  ? -25  DT  I C6    1 
ATOM   978   P  P     . DC  A  1 49  ? -49.305 -14.040 28.153 1.00 71.12  ? -24  DC  I P     1 
ATOM   979   O  OP1   . DC  A  1 49  ? -47.905 -14.466 27.918 1.00 70.18  ? -24  DC  I OP1   1 
ATOM   980   O  OP2   . DC  A  1 49  ? -50.391 -14.993 28.494 1.00 70.46  ? -24  DC  I OP2   1 
ATOM   981   O  "O5'" . DC  A  1 49  ? -49.319 -12.980 29.333 1.00 69.30  ? -24  DC  I "O5'" 1 
ATOM   982   C  "C5'" . DC  A  1 49  ? -48.375 -11.940 29.358 1.00 67.25  ? -24  DC  I "C5'" 1 
ATOM   983   C  "C4'" . DC  A  1 49  ? -48.823 -10.934 30.387 1.00 65.52  ? -24  DC  I "C4'" 1 
ATOM   984   O  "O4'" . DC  A  1 49  ? -50.046 -10.305 29.942 1.00 66.71  ? -24  DC  I "O4'" 1 
ATOM   985   C  "C3'" . DC  A  1 49  ? -49.169 -11.500 31.756 1.00 63.80  ? -24  DC  I "C3'" 1 
ATOM   986   O  "O3'" . DC  A  1 49  ? -48.851 -10.497 32.666 1.00 59.82  ? -24  DC  I "O3'" 1 
ATOM   987   C  "C2'" . DC  A  1 49  ? -50.679 -11.629 31.717 1.00 65.54  ? -24  DC  I "C2'" 1 
ATOM   988   C  "C1'" . DC  A  1 49  ? -50.936 -10.292 31.037 1.00 68.27  ? -24  DC  I "C1'" 1 
ATOM   989   N  N1    . DC  A  1 49  ? -52.315 -10.028 30.542 1.00 69.43  ? -24  DC  I N1    1 
ATOM   990   C  C2    . DC  A  1 49  ? -52.736 -8.694  30.396 1.00 70.23  ? -24  DC  I C2    1 
ATOM   991   O  O2    . DC  A  1 49  ? -51.969 -7.761  30.690 1.00 70.07  ? -24  DC  I O2    1 
ATOM   992   N  N3    . DC  A  1 49  ? -54.001 -8.470  29.944 1.00 70.97  ? -24  DC  I N3    1 
ATOM   993   C  C4    . DC  A  1 49  ? -54.806 -9.503  29.635 1.00 70.66  ? -24  DC  I C4    1 
ATOM   994   N  N4    . DC  A  1 49  ? -56.039 -9.229  29.190 1.00 70.34  ? -24  DC  I N4    1 
ATOM   995   C  C5    . DC  A  1 49  ? -54.388 -10.866 29.774 1.00 70.41  ? -24  DC  I C5    1 
ATOM   996   C  C6    . DC  A  1 49  ? -53.148 -11.074 30.230 1.00 69.88  ? -24  DC  I C6    1 
ATOM   997   P  P     . DC  A  1 50  ? -47.754 -10.771 33.759 1.00 54.54  ? -23  DC  I P     1 
ATOM   998   O  OP1   . DC  A  1 50  ? -46.494 -11.029 33.041 1.00 54.63  ? -23  DC  I OP1   1 
ATOM   999   O  OP2   . DC  A  1 50  ? -48.340 -11.757 34.698 1.00 55.25  ? -23  DC  I OP2   1 
ATOM   1000  O  "O5'" . DC  A  1 50  ? -47.701 -9.393  34.548 1.00 53.27  ? -23  DC  I "O5'" 1 
ATOM   1001  C  "C5'" . DC  A  1 50  ? -47.244 -8.203  33.925 1.00 52.71  ? -23  DC  I "C5'" 1 
ATOM   1002  C  "C4'" . DC  A  1 50  ? -48.033 -7.020  34.449 1.00 52.26  ? -23  DC  I "C4'" 1 
ATOM   1003  O  "O4'" . DC  A  1 50  ? -49.349 -7.053  33.862 1.00 53.02  ? -23  DC  I "O4'" 1 
ATOM   1004  C  "C3'" . DC  A  1 50  ? -48.264 -7.008  35.951 1.00 52.27  ? -23  DC  I "C3'" 1 
ATOM   1005  O  "O3'" . DC  A  1 50  ? -47.846 -5.764  36.432 1.00 53.26  ? -23  DC  I "O3'" 1 
ATOM   1006  C  "C2'" . DC  A  1 50  ? -49.759 -7.224  36.174 1.00 51.40  ? -23  DC  I "C2'" 1 
ATOM   1007  C  "C1'" . DC  A  1 50  ? -50.338 -6.817  34.838 1.00 53.08  ? -23  DC  I "C1'" 1 
ATOM   1008  N  N1    . DC  A  1 50  ? -51.483 -7.610  34.371 1.00 53.87  ? -23  DC  I N1    1 
ATOM   1009  C  C2    . DC  A  1 50  ? -52.603 -6.950  33.818 1.00 54.04  ? -23  DC  I C2    1 
ATOM   1010  O  O2    . DC  A  1 50  ? -52.621 -5.710  33.763 1.00 53.79  ? -23  DC  I O2    1 
ATOM   1011  N  N3    . DC  A  1 50  ? -53.641 -7.703  33.365 1.00 53.39  ? -23  DC  I N3    1 
ATOM   1012  C  C4    . DC  A  1 50  ? -53.577 -9.034  33.445 1.00 53.97  ? -23  DC  I C4    1 
ATOM   1013  N  N4    . DC  A  1 50  ? -54.614 -9.750  32.996 1.00 54.40  ? -23  DC  I N4    1 
ATOM   1014  C  C5    . DC  A  1 50  ? -52.442 -9.709  33.994 1.00 54.22  ? -23  DC  I C5    1 
ATOM   1015  C  C6    . DC  A  1 50  ? -51.418 -8.972  34.433 1.00 53.39  ? -23  DC  I C6    1 
ATOM   1016  P  P     . DA  A  1 51  ? -47.668 -5.569  37.995 1.00 53.81  ? -22  DA  I P     1 
ATOM   1017  O  OP1   . DA  A  1 51  ? -46.339 -4.953  38.160 1.00 54.82  ? -22  DA  I OP1   1 
ATOM   1018  O  OP2   . DA  A  1 51  ? -48.041 -6.803  38.708 1.00 54.49  ? -22  DA  I OP2   1 
ATOM   1019  O  "O5'" . DA  A  1 51  ? -48.801 -4.515  38.345 1.00 56.52  ? -22  DA  I "O5'" 1 
ATOM   1020  C  "C5'" . DA  A  1 51  ? -48.905 -3.354  37.533 1.00 59.73  ? -22  DA  I "C5'" 1 
ATOM   1021  C  "C4'" . DA  A  1 51  ? -50.085 -2.503  37.955 1.00 62.42  ? -22  DA  I "C4'" 1 
ATOM   1022  O  "O4'" . DA  A  1 51  ? -51.292 -3.094  37.445 1.00 63.63  ? -22  DA  I "O4'" 1 
ATOM   1023  C  "C3'" . DA  A  1 51  ? -50.299 -2.347  39.451 1.00 64.43  ? -22  DA  I "C3'" 1 
ATOM   1024  O  "O3'" . DA  A  1 51  ? -50.625 -0.986  39.657 1.00 67.70  ? -22  DA  I "O3'" 1 
ATOM   1025  C  "C2'" . DA  A  1 51  ? -51.433 -3.320  39.775 1.00 64.08  ? -22  DA  I "C2'" 1 
ATOM   1026  C  "C1'" . DA  A  1 51  ? -52.218 -3.325  38.479 1.00 64.67  ? -22  DA  I "C1'" 1 
ATOM   1027  N  N9    . DA  A  1 51  ? -52.745 -4.613  38.101 1.00 65.20  ? -22  DA  I N9    1 
ATOM   1028  C  C8    . DA  A  1 51  ? -52.147 -5.824  38.303 1.00 65.94  ? -22  DA  I C8    1 
ATOM   1029  N  N7    . DA  A  1 51  ? -52.836 -6.835  37.837 1.00 66.39  ? -22  DA  I N7    1 
ATOM   1030  C  C5    . DA  A  1 51  ? -53.952 -6.240  37.275 1.00 66.28  ? -22  DA  I C5    1 
ATOM   1031  C  C6    . DA  A  1 51  ? -55.078 -6.775  36.615 1.00 65.91  ? -22  DA  I C6    1 
ATOM   1032  N  N6    . DA  A  1 51  ? -55.244 -8.088  36.407 1.00 65.63  ? -22  DA  I N6    1 
ATOM   1033  N  N1    . DA  A  1 51  ? -56.020 -5.901  36.182 1.00 65.66  ? -22  DA  I N1    1 
ATOM   1034  C  C2    . DA  A  1 51  ? -55.852 -4.587  36.393 1.00 65.66  ? -22  DA  I C2    1 
ATOM   1035  N  N3    . DA  A  1 51  ? -54.835 -3.969  37.000 1.00 66.02  ? -22  DA  I N3    1 
ATOM   1036  C  C4    . DA  A  1 51  ? -53.911 -4.861  37.422 1.00 66.09  ? -22  DA  I C4    1 
ATOM   1037  P  P     . DT  A  1 52  ? -51.334 -0.487  40.996 1.00 71.37  ? -21  DT  I P     1 
ATOM   1038  O  OP1   . DT  A  1 52  ? -51.082 0.968   41.068 1.00 71.71  ? -21  DT  I OP1   1 
ATOM   1039  O  OP2   . DT  A  1 52  ? -51.005 -1.389  42.127 1.00 69.90  ? -21  DT  I OP2   1 
ATOM   1040  O  "O5'" . DT  A  1 52  ? -52.885 -0.721  40.677 1.00 73.79  ? -21  DT  I "O5'" 1 
ATOM   1041  C  "C5'" . DT  A  1 52  ? -53.631 0.170   39.863 1.00 75.22  ? -21  DT  I "C5'" 1 
ATOM   1042  C  "C4'" . DT  A  1 52  ? -55.090 -0.195  40.016 1.00 76.95  ? -21  DT  I "C4'" 1 
ATOM   1043  O  "O4'" . DT  A  1 52  ? -55.258 -1.560  39.578 1.00 77.25  ? -21  DT  I "O4'" 1 
ATOM   1044  C  "C3'" . DT  A  1 52  ? -55.603 -0.150  41.453 1.00 77.80  ? -21  DT  I "C3'" 1 
ATOM   1045  O  "O3'" . DT  A  1 52  ? -56.659 0.800   41.545 1.00 79.63  ? -21  DT  I "O3'" 1 
ATOM   1046  C  "C2'" . DT  A  1 52  ? -56.081 -1.570  41.754 1.00 77.46  ? -21  DT  I "C2'" 1 
ATOM   1047  C  "C1'" . DT  A  1 52  ? -56.280 -2.130  40.356 1.00 77.92  ? -21  DT  I "C1'" 1 
ATOM   1048  N  N1    . DT  A  1 52  ? -56.153 -3.593  40.226 1.00 77.79  ? -21  DT  I N1    1 
ATOM   1049  C  C2    . DT  A  1 52  ? -57.082 -4.255  39.449 1.00 78.58  ? -21  DT  I C2    1 
ATOM   1050  O  O2    . DT  A  1 52  ? -57.996 -3.689  38.876 1.00 78.84  ? -21  DT  I O2    1 
ATOM   1051  N  N3    . DT  A  1 52  ? -56.902 -5.618  39.363 1.00 79.02  ? -21  DT  I N3    1 
ATOM   1052  C  C4    . DT  A  1 52  ? -55.897 -6.365  39.972 1.00 78.93  ? -21  DT  I C4    1 
ATOM   1053  O  O4    . DT  A  1 52  ? -55.811 -7.586  39.836 1.00 78.87  ? -21  DT  I O4    1 
ATOM   1054  C  C5    . DT  A  1 52  ? -54.956 -5.604  40.771 1.00 78.50  ? -21  DT  I C5    1 
ATOM   1055  C  C7    . DT  A  1 52  ? -53.831 -6.301  41.477 1.00 78.59  ? -21  DT  I C7    1 
ATOM   1056  C  C6    . DT  A  1 52  ? -55.123 -4.272  40.855 1.00 78.07  ? -21  DT  I C6    1 
ATOM   1057  P  P     . DC  A  1 53  ? -57.294 1.210   42.963 1.00 80.94  ? -20  DC  I P     1 
ATOM   1058  O  OP1   . DC  A  1 53  ? -57.734 2.609   42.844 1.00 81.03  ? -20  DC  I OP1   1 
ATOM   1059  O  OP2   . DC  A  1 53  ? -56.371 0.841   44.059 1.00 80.92  ? -20  DC  I OP2   1 
ATOM   1060  O  "O5'" . DC  A  1 53  ? -58.565 0.241   43.075 1.00 82.38  ? -20  DC  I "O5'" 1 
ATOM   1061  C  "C5'" . DC  A  1 53  ? -59.509 0.153   42.012 1.00 84.68  ? -20  DC  I "C5'" 1 
ATOM   1062  C  "C4'" . DC  A  1 53  ? -60.496 -0.975  42.248 1.00 86.26  ? -20  DC  I "C4'" 1 
ATOM   1063  O  "O4'" . DC  A  1 53  ? -59.850 -2.247  41.982 1.00 86.29  ? -20  DC  I "O4'" 1 
ATOM   1064  C  "C3'" . DC  A  1 53  ? -61.049 -1.052  43.672 1.00 87.66  ? -20  DC  I "C3'" 1 
ATOM   1065  O  "O3'" . DC  A  1 53  ? -62.460 -1.238  43.648 1.00 89.83  ? -20  DC  I "O3'" 1 
ATOM   1066  C  "C2'" . DC  A  1 53  ? -60.346 -2.267  44.270 1.00 87.02  ? -20  DC  I "C2'" 1 
ATOM   1067  C  "C1'" . DC  A  1 53  ? -60.193 -3.135  43.028 1.00 86.47  ? -20  DC  I "C1'" 1 
ATOM   1068  N  N1    . DC  A  1 53  ? -59.170 -4.219  43.187 1.00 86.21  ? -20  DC  I N1    1 
ATOM   1069  C  C2    . DC  A  1 53  ? -59.447 -5.490  42.670 1.00 85.92  ? -20  DC  I C2    1 
ATOM   1070  O  O2    . DC  A  1 53  ? -60.518 -5.683  42.082 1.00 85.64  ? -20  DC  I O2    1 
ATOM   1071  N  N3    . DC  A  1 53  ? -58.524 -6.474  42.830 1.00 86.01  ? -20  DC  I N3    1 
ATOM   1072  C  C4    . DC  A  1 53  ? -57.376 -6.220  43.471 1.00 86.15  ? -20  DC  I C4    1 
ATOM   1073  N  N4    . DC  A  1 53  ? -56.502 -7.222  43.596 1.00 86.22  ? -20  DC  I N4    1 
ATOM   1074  C  C5    . DC  A  1 53  ? -57.073 -4.933  44.012 1.00 85.65  ? -20  DC  I C5    1 
ATOM   1075  C  C6    . DC  A  1 53  ? -57.992 -3.975  43.847 1.00 85.98  ? -20  DC  I C6    1 
ATOM   1076  P  P     . DA  A  1 54  ? -63.352 -0.921  44.943 1.00 91.61  ? -19  DA  I P     1 
ATOM   1077  O  OP1   . DA  A  1 54  ? -63.549 0.552   44.979 1.00 91.44  ? -19  DA  I OP1   1 
ATOM   1078  O  OP2   . DA  A  1 54  ? -62.773 -1.600  46.123 1.00 91.38  ? -19  DA  I OP2   1 
ATOM   1079  O  "O5'" . DA  A  1 54  ? -64.731 -1.672  44.626 1.00 92.55  ? -19  DA  I "O5'" 1 
ATOM   1080  C  "C5'" . DA  A  1 54  ? -64.913 -2.438  43.429 1.00 95.29  ? -19  DA  I "C5'" 1 
ATOM   1081  C  "C4'" . DA  A  1 54  ? -65.809 -3.646  43.671 1.00 97.27  ? -19  DA  I "C4'" 1 
ATOM   1082  O  "O4'" . DA  A  1 54  ? -65.036 -4.872  43.572 1.00 97.38  ? -19  DA  I "O4'" 1 
ATOM   1083  C  "C3'" . DA  A  1 54  ? -66.510 -3.700  45.030 1.00 98.30  ? -19  DA  I "C3'" 1 
ATOM   1084  O  "O3'" . DA  A  1 54  ? -67.792 -4.309  44.881 1.00 99.84  ? -19  DA  I "O3'" 1 
ATOM   1085  C  "C2'" . DA  A  1 54  ? -65.566 -4.544  45.881 1.00 98.03  ? -19  DA  I "C2'" 1 
ATOM   1086  C  "C1'" . DA  A  1 54  ? -64.900 -5.461  44.855 1.00 98.01  ? -19  DA  I "C1'" 1 
ATOM   1087  N  N9    . DA  A  1 54  ? -63.485 -5.698  45.150 1.00 98.10  ? -19  DA  I N9    1 
ATOM   1088  C  C8    . DA  A  1 54  ? -62.605 -4.848  45.771 1.00 98.05  ? -19  DA  I C8    1 
ATOM   1089  N  N7    . DA  A  1 54  ? -61.394 -5.331  45.914 1.00 98.02  ? -19  DA  I N7    1 
ATOM   1090  C  C5    . DA  A  1 54  ? -61.488 -6.593  45.348 1.00 98.26  ? -19  DA  I C5    1 
ATOM   1091  C  C6    . DA  A  1 54  ? -60.544 -7.628  45.176 1.00 98.17  ? -19  DA  I C6    1 
ATOM   1092  N  N6    . DA  A  1 54  ? -59.276 -7.523  45.586 1.00 98.10  ? -19  DA  I N6    1 
ATOM   1093  N  N1    . DA  A  1 54  ? -60.957 -8.768  44.568 1.00 97.93  ? -19  DA  I N1    1 
ATOM   1094  C  C2    . DA  A  1 54  ? -62.231 -8.870  44.159 1.00 97.85  ? -19  DA  I C2    1 
ATOM   1095  N  N3    . DA  A  1 54  ? -63.208 -7.966  44.266 1.00 98.09  ? -19  DA  I N3    1 
ATOM   1096  C  C4    . DA  A  1 54  ? -62.768 -6.841  44.873 1.00 98.19  ? -19  DA  I C4    1 
ATOM   1097  P  P     . DA  A  1 55  ? -68.785 -4.577  46.112 1.00 100.99 ? -18  DA  I P     1 
ATOM   1098  O  OP1   . DA  A  1 55  ? -70.154 -4.385  45.586 1.00 100.79 ? -18  DA  I OP1   1 
ATOM   1099  O  OP2   . DA  A  1 55  ? -68.332 -3.807  47.298 1.00 100.46 ? -18  DA  I OP2   1 
ATOM   1100  O  "O5'" . DA  A  1 55  ? -68.567 -6.137  46.411 1.00 101.61 ? -18  DA  I "O5'" 1 
ATOM   1101  C  "C5'" . DA  A  1 55  ? -68.768 -7.104  45.375 1.00 102.86 ? -18  DA  I "C5'" 1 
ATOM   1102  C  "C4'" . DA  A  1 55  ? -68.241 -8.468  45.785 1.00 103.86 ? -18  DA  I "C4'" 1 
ATOM   1103  O  "O4'" . DA  A  1 55  ? -66.811 -8.389  46.020 1.00 104.42 ? -18  DA  I "O4'" 1 
ATOM   1104  C  "C3'" . DA  A  1 55  ? -68.844 -9.042  47.063 1.00 104.60 ? -18  DA  I "C3'" 1 
ATOM   1105  O  "O3'" . DA  A  1 55  ? -69.040 -10.448 46.899 1.00 105.48 ? -18  DA  I "O3'" 1 
ATOM   1106  C  "C2'" . DA  A  1 55  ? -67.787 -8.721  48.121 1.00 104.63 ? -18  DA  I "C2'" 1 
ATOM   1107  C  "C1'" . DA  A  1 55  ? -66.511 -8.901  47.305 1.00 104.38 ? -18  DA  I "C1'" 1 
ATOM   1108  N  N9    . DA  A  1 55  ? -65.322 -8.227  47.839 1.00 104.40 ? -18  DA  I N9    1 
ATOM   1109  C  C8    . DA  A  1 55  ? -65.241 -6.985  48.414 1.00 104.20 ? -18  DA  I C8    1 
ATOM   1110  N  N7    . DA  A  1 55  ? -64.030 -6.650  48.797 1.00 104.15 ? -18  DA  I N7    1 
ATOM   1111  C  C5    . DA  A  1 55  ? -63.257 -7.749  48.451 1.00 104.36 ? -18  DA  I C5    1 
ATOM   1112  C  C6    . DA  A  1 55  ? -61.875 -8.033  48.586 1.00 104.19 ? -18  DA  I C6    1 
ATOM   1113  N  N6    . DA  A  1 55  ? -60.992 -7.194  49.133 1.00 104.08 ? -18  DA  I N6    1 
ATOM   1114  N  N1    . DA  A  1 55  ? -61.432 -9.229  48.135 1.00 104.17 ? -18  DA  I N1    1 
ATOM   1115  C  C2    . DA  A  1 55  ? -62.309 -10.082 47.581 1.00 104.13 ? -18  DA  I C2    1 
ATOM   1116  N  N3    . DA  A  1 55  ? -63.622 -9.930  47.398 1.00 104.03 ? -18  DA  I N3    1 
ATOM   1117  C  C4    . DA  A  1 55  ? -64.039 -8.731  47.858 1.00 104.36 ? -18  DA  I C4    1 
ATOM   1118  P  P     . DA  A  1 56  ? -69.929 -11.319 47.918 1.00 106.33 ? -17  DA  I P     1 
ATOM   1119  O  OP1   . DA  A  1 56  ? -71.118 -11.787 47.170 1.00 106.28 ? -17  DA  I OP1   1 
ATOM   1120  O  OP2   . DA  A  1 56  ? -70.087 -10.579 49.196 1.00 105.87 ? -17  DA  I OP2   1 
ATOM   1121  O  "O5'" . DA  A  1 56  ? -69.010 -12.590 48.220 1.00 105.48 ? -17  DA  I "O5'" 1 
ATOM   1122  C  "C5'" . DA  A  1 56  ? -68.264 -13.231 47.186 1.00 104.91 ? -17  DA  I "C5'" 1 
ATOM   1123  C  "C4'" . DA  A  1 56  ? -67.018 -13.867 47.777 1.00 104.47 ? -17  DA  I "C4'" 1 
ATOM   1124  O  "O4'" . DA  A  1 56  ? -66.039 -12.831 48.066 1.00 104.54 ? -17  DA  I "O4'" 1 
ATOM   1125  C  "C3'" . DA  A  1 56  ? -67.277 -14.623 49.083 1.00 103.89 ? -17  DA  I "C3'" 1 
ATOM   1126  O  "O3'" . DA  A  1 56  ? -66.918 -16.008 48.930 1.00 102.19 ? -17  DA  I "O3'" 1 
ATOM   1127  C  "C2'" . DA  A  1 56  ? -66.453 -13.876 50.135 1.00 104.21 ? -17  DA  I "C2'" 1 
ATOM   1128  C  "C1'" . DA  A  1 56  ? -65.425 -13.110 49.307 1.00 104.61 ? -17  DA  I "C1'" 1 
ATOM   1129  N  N9    . DA  A  1 56  ? -64.983 -11.871 49.956 1.00 104.80 ? -17  DA  I N9    1 
ATOM   1130  C  C8    . DA  A  1 56  ? -65.748 -10.796 50.327 1.00 104.82 ? -17  DA  I C8    1 
ATOM   1131  N  N7    . DA  A  1 56  ? -65.070 -9.827  50.902 1.00 104.81 ? -17  DA  I N7    1 
ATOM   1132  C  C5    . DA  A  1 56  ? -63.766 -10.298 50.916 1.00 104.98 ? -17  DA  I C5    1 
ATOM   1133  C  C6    . DA  A  1 56  ? -62.548 -9.752  51.392 1.00 104.80 ? -17  DA  I C6    1 
ATOM   1134  N  N6    . DA  A  1 56  ? -62.443 -8.552  51.973 1.00 104.69 ? -17  DA  I N6    1 
ATOM   1135  N  N1    . DA  A  1 56  ? -61.425 -10.493 51.246 1.00 104.82 ? -17  DA  I N1    1 
ATOM   1136  C  C2    . DA  A  1 56  ? -61.506 -11.698 50.666 1.00 104.67 ? -17  DA  I C2    1 
ATOM   1137  N  N3    . DA  A  1 56  ? -62.587 -12.315 50.185 1.00 104.84 ? -17  DA  I N3    1 
ATOM   1138  C  C4    . DA  A  1 56  ? -63.695 -11.559 50.340 1.00 105.03 ? -17  DA  I C4    1 
ATOM   1139  P  P     . DA  A  1 57  ? -67.041 -17.094 50.111 1.00 101.00 ? -16  DA  I P     1 
ATOM   1140  O  OP1   . DA  A  1 57  ? -67.137 -18.428 49.467 1.00 101.13 ? -16  DA  I OP1   1 
ATOM   1141  O  OP2   . DA  A  1 57  ? -68.076 -16.664 51.080 1.00 101.12 ? -16  DA  I OP2   1 
ATOM   1142  O  "O5'" . DA  A  1 57  ? -65.616 -16.992 50.835 1.00 98.49  ? -16  DA  I "O5'" 1 
ATOM   1143  C  "C5'" . DA  A  1 57  ? -64.430 -17.053 50.032 1.00 94.70  ? -16  DA  I "C5'" 1 
ATOM   1144  C  "C4'" . DA  A  1 57  ? -63.159 -16.920 50.851 1.00 91.34  ? -16  DA  I "C4'" 1 
ATOM   1145  O  "O4'" . DA  A  1 57  ? -62.924 -15.534 51.224 1.00 90.25  ? -16  DA  I "O4'" 1 
ATOM   1146  C  "C3'" . DA  A  1 57  ? -63.137 -17.735 52.136 1.00 89.45  ? -16  DA  I "C3'" 1 
ATOM   1147  O  "O3'" . DA  A  1 57  ? -61.911 -18.426 52.125 1.00 87.65  ? -16  DA  I "O3'" 1 
ATOM   1148  C  "C2'" . DA  A  1 57  ? -63.198 -16.673 53.235 1.00 89.23  ? -16  DA  I "C2'" 1 
ATOM   1149  C  "C1'" . DA  A  1 57  ? -62.483 -15.504 52.563 1.00 89.39  ? -16  DA  I "C1'" 1 
ATOM   1150  N  N9    . DA  A  1 57  ? -62.727 -14.175 53.137 1.00 89.46  ? -16  DA  I N9    1 
ATOM   1151  C  C8    . DA  A  1 57  ? -63.930 -13.573 53.395 1.00 89.08  ? -16  DA  I C8    1 
ATOM   1152  N  N7    . DA  A  1 57  ? -63.818 -12.374 53.920 1.00 89.13  ? -16  DA  I N7    1 
ATOM   1153  C  C5    . DA  A  1 57  ? -62.452 -12.160 54.015 1.00 89.08  ? -16  DA  I C5    1 
ATOM   1154  C  C6    . DA  A  1 57  ? -61.668 -11.074 54.484 1.00 89.10  ? -16  DA  I C6    1 
ATOM   1155  N  N6    . DA  A  1 57  ? -62.166 -9.938  54.975 1.00 88.77  ? -16  DA  I N6    1 
ATOM   1156  N  N1    . DA  A  1 57  ? -60.322 -11.201 54.435 1.00 89.25  ? -16  DA  I N1    1 
ATOM   1157  C  C2    . DA  A  1 57  ? -59.794 -12.331 53.945 1.00 89.14  ? -16  DA  I C2    1 
ATOM   1158  N  N3    . DA  A  1 57  ? -60.423 -13.410 53.475 1.00 89.12  ? -16  DA  I N3    1 
ATOM   1159  C  C4    . DA  A  1 57  ? -61.764 -13.266 53.537 1.00 89.43  ? -16  DA  I C4    1 
ATOM   1160  P  P     . DG  A  1 58  ? -61.718 -19.933 52.620 1.00 85.82  ? -15  DG  I P     1 
ATOM   1161  O  OP1   . DG  A  1 58  ? -61.304 -20.727 51.441 1.00 85.30  ? -15  DG  I OP1   1 
ATOM   1162  O  OP2   . DG  A  1 58  ? -62.854 -20.319 53.490 1.00 85.36  ? -15  DG  I OP2   1 
ATOM   1163  O  "O5'" . DG  A  1 58  ? -60.440 -19.802 53.569 1.00 85.17  ? -15  DG  I "O5'" 1 
ATOM   1164  C  "C5'" . DG  A  1 58  ? -59.416 -18.853 53.261 1.00 82.89  ? -15  DG  I "C5'" 1 
ATOM   1165  C  "C4'" . DG  A  1 58  ? -58.691 -18.369 54.504 1.00 80.69  ? -15  DG  I "C4'" 1 
ATOM   1166  O  "O4'" . DG  A  1 58  ? -59.282 -17.134 54.975 1.00 80.30  ? -15  DG  I "O4'" 1 
ATOM   1167  C  "C3'" . DG  A  1 58  ? -58.646 -19.292 55.717 1.00 79.33  ? -15  DG  I "C3'" 1 
ATOM   1168  O  "O3'" . DG  A  1 58  ? -57.362 -19.072 56.234 1.00 77.12  ? -15  DG  I "O3'" 1 
ATOM   1169  C  "C2'" . DG  A  1 58  ? -59.711 -18.715 56.642 1.00 79.86  ? -15  DG  I "C2'" 1 
ATOM   1170  C  "C1'" . DG  A  1 58  ? -59.543 -17.223 56.360 1.00 81.38  ? -15  DG  I "C1'" 1 
ATOM   1171  N  N9    . DG  A  1 58  ? -60.712 -16.385 56.592 1.00 81.78  ? -15  DG  I N9    1 
ATOM   1172  C  C8    . DG  A  1 58  ? -62.029 -16.785 56.568 1.00 81.94  ? -15  DG  I C8    1 
ATOM   1173  N  N7    . DG  A  1 58  ? -62.868 -15.817 56.796 1.00 82.06  ? -15  DG  I N7    1 
ATOM   1174  C  C5    . DG  A  1 58  ? -62.057 -14.703 56.976 1.00 81.89  ? -15  DG  I C5    1 
ATOM   1175  C  C6    . DG  A  1 58  ? -62.414 -13.361 57.254 1.00 82.05  ? -15  DG  I C6    1 
ATOM   1176  O  O6    . DG  A  1 58  ? -63.554 -12.900 57.394 1.00 82.11  ? -15  DG  I O6    1 
ATOM   1177  N  N1    . DG  A  1 58  ? -61.303 -12.522 57.371 1.00 82.03  ? -15  DG  I N1    1 
ATOM   1178  C  C2    . DG  A  1 58  ? -60.002 -12.938 57.232 1.00 81.74  ? -15  DG  I C2    1 
ATOM   1179  N  N2    . DG  A  1 58  ? -59.081 -11.979 57.377 1.00 81.67  ? -15  DG  I N2    1 
ATOM   1180  N  N3    . DG  A  1 58  ? -59.646 -14.197 56.968 1.00 81.87  ? -15  DG  I N3    1 
ATOM   1181  C  C4    . DG  A  1 58  ? -60.723 -15.027 56.852 1.00 81.80  ? -15  DG  I C4    1 
ATOM   1182  P  P     . DG  A  1 59  ? -56.538 -20.153 57.042 1.00 74.35  ? -14  DG  I P     1 
ATOM   1183  O  OP1   . DG  A  1 59  ? -56.252 -21.297 56.153 1.00 75.31  ? -14  DG  I OP1   1 
ATOM   1184  O  OP2   . DG  A  1 59  ? -57.215 -20.373 58.331 1.00 75.27  ? -14  DG  I OP2   1 
ATOM   1185  O  "O5'" . DG  A  1 59  ? -55.193 -19.350 57.301 1.00 73.15  ? -14  DG  I "O5'" 1 
ATOM   1186  C  "C5'" . DG  A  1 59  ? -54.733 -18.423 56.321 1.00 71.31  ? -14  DG  I "C5'" 1 
ATOM   1187  C  "C4'" . DG  A  1 59  ? -54.127 -17.190 56.976 1.00 70.16  ? -14  DG  I "C4'" 1 
ATOM   1188  O  "O4'" . DG  A  1 59  ? -55.188 -16.353 57.496 1.00 70.31  ? -14  DG  I "O4'" 1 
ATOM   1189  C  "C3'" . DG  A  1 59  ? -53.172 -17.403 58.154 1.00 68.70  ? -14  DG  I "C3'" 1 
ATOM   1190  O  "O3'" . DG  A  1 59  ? -52.186 -16.347 58.196 1.00 65.60  ? -14  DG  I "O3'" 1 
ATOM   1191  C  "C2'" . DG  A  1 59  ? -54.120 -17.339 59.346 1.00 69.42  ? -14  DG  I "C2'" 1 
ATOM   1192  C  "C1'" . DG  A  1 59  ? -55.060 -16.228 58.900 1.00 71.58  ? -14  DG  I "C1'" 1 
ATOM   1193  N  N9    . DG  A  1 59  ? -56.422 -16.326 59.389 1.00 72.39  ? -14  DG  I N9    1 
ATOM   1194  C  C8    . DG  A  1 59  ? -57.216 -17.453 59.391 1.00 72.71  ? -14  DG  I C8    1 
ATOM   1195  N  N7    . DG  A  1 59  ? -58.412 -17.244 59.868 1.00 72.97  ? -14  DG  I N7    1 
ATOM   1196  C  C5    . DG  A  1 59  ? -58.407 -15.889 60.193 1.00 72.85  ? -14  DG  I C5    1 
ATOM   1197  C  C6    . DG  A  1 59  ? -59.431 -15.092 60.750 1.00 72.67  ? -14  DG  I C6    1 
ATOM   1198  O  O6    . DG  A  1 59  ? -60.571 -15.465 61.060 1.00 72.52  ? -14  DG  I O6    1 
ATOM   1199  N  N1    . DG  A  1 59  ? -59.031 -13.763 60.931 1.00 72.40  ? -14  DG  I N1    1 
ATOM   1200  C  C2    . DG  A  1 59  ? -57.785 -13.275 60.605 1.00 72.33  ? -14  DG  I C2    1 
ATOM   1201  N  N2    . DG  A  1 59  ? -57.567 -11.976 60.844 1.00 72.32  ? -14  DG  I N2    1 
ATOM   1202  N  N3    . DG  A  1 59  ? -56.815 -14.014 60.078 1.00 72.34  ? -14  DG  I N3    1 
ATOM   1203  C  C4    . DG  A  1 59  ? -57.193 -15.305 59.900 1.00 72.49  ? -14  DG  I C4    1 
ATOM   1204  P  P     . DC  A  1 60  ? -50.888 -16.381 59.139 1.00 63.08  ? -13  DC  I P     1 
ATOM   1205  O  OP1   . DC  A  1 60  ? -49.745 -16.070 58.250 1.00 64.17  ? -13  DC  I OP1   1 
ATOM   1206  O  OP2   . DC  A  1 60  ? -50.885 -17.609 59.962 1.00 61.66  ? -13  DC  I OP2   1 
ATOM   1207  O  "O5'" . DC  A  1 60  ? -51.117 -15.154 60.142 1.00 62.70  ? -13  DC  I "O5'" 1 
ATOM   1208  C  "C5'" . DC  A  1 60  ? -51.286 -13.845 59.642 1.00 61.76  ? -13  DC  I "C5'" 1 
ATOM   1209  C  "C4'" . DC  A  1 60  ? -51.779 -12.883 60.714 1.00 62.26  ? -13  DC  I "C4'" 1 
ATOM   1210  O  "O4'" . DC  A  1 60  ? -53.104 -13.220 61.189 1.00 62.71  ? -13  DC  I "O4'" 1 
ATOM   1211  C  "C3'" . DC  A  1 60  ? -50.946 -12.746 61.972 1.00 61.83  ? -13  DC  I "C3'" 1 
ATOM   1212  O  "O3'" . DC  A  1 60  ? -51.026 -11.400 62.333 1.00 61.33  ? -13  DC  I "O3'" 1 
ATOM   1213  C  "C2'" . DC  A  1 60  ? -51.672 -13.621 62.989 1.00 62.63  ? -13  DC  I "C2'" 1 
ATOM   1214  C  "C1'" . DC  A  1 60  ? -53.121 -13.376 62.593 1.00 63.32  ? -13  DC  I "C1'" 1 
ATOM   1215  N  N1    . DC  A  1 60  ? -54.110 -14.484 62.827 1.00 64.26  ? -13  DC  I N1    1 
ATOM   1216  C  C2    . DC  A  1 60  ? -55.386 -14.190 63.353 1.00 64.17  ? -13  DC  I C2    1 
ATOM   1217  O  O2    . DC  A  1 60  ? -55.667 -13.017 63.646 1.00 64.34  ? -13  DC  I O2    1 
ATOM   1218  N  N3    . DC  A  1 60  ? -56.277 -15.206 63.524 1.00 63.28  ? -13  DC  I N3    1 
ATOM   1219  C  C4    . DC  A  1 60  ? -55.939 -16.455 63.190 1.00 63.81  ? -13  DC  I C4    1 
ATOM   1220  N  N4    . DC  A  1 60  ? -56.829 -17.433 63.369 1.00 64.32  ? -13  DC  I N4    1 
ATOM   1221  C  C5    . DC  A  1 60  ? -54.657 -16.774 62.657 1.00 64.21  ? -13  DC  I C5    1 
ATOM   1222  C  C6    . DC  A  1 60  ? -53.787 -15.770 62.482 1.00 64.10  ? -13  DC  I C6    1 
ATOM   1223  P  P     . DA  A  1 61  ? -49.766 -10.658 62.937 1.00 61.88  ? -12  DA  I P     1 
ATOM   1224  O  OP1   . DA  A  1 61  ? -49.153 -9.799  61.904 1.00 61.84  ? -12  DA  I OP1   1 
ATOM   1225  O  OP2   . DA  A  1 61  ? -48.985 -11.654 63.691 1.00 63.48  ? -12  DA  I OP2   1 
ATOM   1226  O  "O5'" . DA  A  1 61  ? -50.394 -9.712  64.037 1.00 64.39  ? -12  DA  I "O5'" 1 
ATOM   1227  C  "C5'" . DA  A  1 61  ? -51.315 -8.673  63.727 1.00 66.21  ? -12  DA  I "C5'" 1 
ATOM   1228  C  "C4'" . DA  A  1 61  ? -52.139 -8.438  64.976 1.00 67.37  ? -12  DA  I "C4'" 1 
ATOM   1229  O  "O4'" . DA  A  1 61  ? -52.915 -9.630  65.267 1.00 66.97  ? -12  DA  I "O4'" 1 
ATOM   1230  C  "C3'" . DA  A  1 61  ? -51.302 -8.158  66.216 1.00 67.94  ? -12  DA  I "C3'" 1 
ATOM   1231  O  "O3'" . DA  A  1 61  ? -51.817 -6.975  66.768 1.00 70.53  ? -12  DA  I "O3'" 1 
ATOM   1232  C  "C2'" . DA  A  1 61  ? -51.475 -9.384  67.121 1.00 67.35  ? -12  DA  I "C2'" 1 
ATOM   1233  C  "C1'" . DA  A  1 61  ? -52.778 -9.997  66.624 1.00 67.47  ? -12  DA  I "C1'" 1 
ATOM   1234  N  N9    . DA  A  1 61  ? -52.885 -11.454 66.622 1.00 67.64  ? -12  DA  I N9    1 
ATOM   1235  C  C8    . DA  A  1 61  ? -51.902 -12.388 66.436 1.00 68.23  ? -12  DA  I C8    1 
ATOM   1236  N  N7    . DA  A  1 61  ? -52.331 -13.633 66.463 1.00 68.19  ? -12  DA  I N7    1 
ATOM   1237  C  C5    . DA  A  1 61  ? -53.692 -13.507 66.670 1.00 67.88  ? -12  DA  I C5    1 
ATOM   1238  C  C6    . DA  A  1 61  ? -54.732 -14.450 66.798 1.00 67.81  ? -12  DA  I C6    1 
ATOM   1239  N  N6    . DA  A  1 61  ? -54.555 -15.768 66.728 1.00 67.88  ? -12  DA  I N6    1 
ATOM   1240  N  N1    . DA  A  1 61  ? -55.982 -13.991 66.998 1.00 68.02  ? -12  DA  I N1    1 
ATOM   1241  C  C2    . DA  A  1 61  ? -56.187 -12.667 67.062 1.00 68.28  ? -12  DA  I C2    1 
ATOM   1242  N  N3    . DA  A  1 61  ? -55.293 -11.683 66.957 1.00 68.14  ? -12  DA  I N3    1 
ATOM   1243  C  C4    . DA  A  1 61  ? -54.050 -12.173 66.763 1.00 68.04  ? -12  DA  I C4    1 
ATOM   1244  P  P     . DT  A  1 62  ? -51.153 -6.304  68.051 1.00 72.92  ? -11  DT  I P     1 
ATOM   1245  O  OP1   . DT  A  1 62  ? -51.613 -4.896  68.074 1.00 73.50  ? -11  DT  I OP1   1 
ATOM   1246  O  OP2   . DT  A  1 62  ? -49.698 -6.614  68.080 1.00 72.89  ? -11  DT  I OP2   1 
ATOM   1247  O  "O5'" . DT  A  1 62  ? -51.859 -7.098  69.246 1.00 73.46  ? -11  DT  I "O5'" 1 
ATOM   1248  C  "C5'" . DT  A  1 62  ? -53.252 -6.978  69.451 1.00 74.78  ? -11  DT  I "C5'" 1 
ATOM   1249  C  "C4'" . DT  A  1 62  ? -53.724 -7.926  70.537 1.00 76.18  ? -11  DT  I "C4'" 1 
ATOM   1250  O  "O4'" . DT  A  1 62  ? -53.885 -9.238  69.957 1.00 75.59  ? -11  DT  I "O4'" 1 
ATOM   1251  C  "C3'" . DT  A  1 62  ? -52.801 -8.133  71.736 1.00 77.05  ? -11  DT  I "C3'" 1 
ATOM   1252  O  "O3'" . DT  A  1 62  ? -53.146 -7.206  72.758 1.00 80.61  ? -11  DT  I "O3'" 1 
ATOM   1253  C  "C2'" . DT  A  1 62  ? -53.132 -9.559  72.172 1.00 76.32  ? -11  DT  I "C2'" 1 
ATOM   1254  C  "C1'" . DT  A  1 62  ? -53.946 -10.151 71.021 1.00 75.13  ? -11  DT  I "C1'" 1 
ATOM   1255  N  N1    . DT  A  1 62  ? -53.430 -11.459 70.547 1.00 75.19  ? -11  DT  I N1    1 
ATOM   1256  C  C2    . DT  A  1 62  ? -54.305 -12.520 70.416 1.00 75.05  ? -11  DT  I C2    1 
ATOM   1257  O  O2    . DT  A  1 62  ? -55.494 -12.464 70.662 1.00 75.09  ? -11  DT  I O2    1 
ATOM   1258  N  N3    . DT  A  1 62  ? -53.729 -13.683 69.976 1.00 75.23  ? -11  DT  I N3    1 
ATOM   1259  C  C4    . DT  A  1 62  ? -52.399 -13.891 69.673 1.00 74.85  ? -11  DT  I C4    1 
ATOM   1260  O  O4    . DT  A  1 62  ? -52.007 -14.979 69.290 1.00 74.99  ? -11  DT  I O4    1 
ATOM   1261  C  C5    . DT  A  1 62  ? -51.529 -12.751 69.823 1.00 75.12  ? -11  DT  I C5    1 
ATOM   1262  C  C7    . DT  A  1 62  ? -50.066 -12.861 69.508 1.00 74.91  ? -11  DT  I C7    1 
ATOM   1263  C  C6    . DT  A  1 62  ? -52.080 -11.601 70.248 1.00 75.54  ? -11  DT  I C6    1 
ATOM   1264  P  P     . DG  A  1 63  ? -52.227 -6.883  74.041 1.00 84.50  ? -10  DG  I P     1 
ATOM   1265  O  OP1   . DG  A  1 63  ? -51.803 -5.470  73.879 1.00 83.02  ? -10  DG  I OP1   1 
ATOM   1266  O  OP2   . DG  A  1 63  ? -51.219 -7.948  74.253 1.00 84.35  ? -10  DG  I OP2   1 
ATOM   1267  O  "O5'" . DG  A  1 63  ? -53.232 -7.003  75.293 1.00 86.60  ? -10  DG  I "O5'" 1 
ATOM   1268  C  "C5'" . DG  A  1 63  ? -54.209 -8.054  75.392 1.00 88.57  ? -10  DG  I "C5'" 1 
ATOM   1269  C  "C4'" . DG  A  1 63  ? -54.114 -8.927  76.647 1.00 90.05  ? -10  DG  I "C4'" 1 
ATOM   1270  O  "O4'" . DG  A  1 63  ? -53.897 -10.303 76.230 1.00 90.59  ? -10  DG  I "O4'" 1 
ATOM   1271  C  "C3'" . DG  A  1 63  ? -53.041 -8.653  77.713 1.00 91.14  ? -10  DG  I "C3'" 1 
ATOM   1272  O  "O3'" . DG  A  1 63  ? -53.607 -8.893  79.049 1.00 92.39  ? -10  DG  I "O3'" 1 
ATOM   1273  C  "C2'" . DG  A  1 63  ? -51.908 -9.601  77.306 1.00 90.86  ? -10  DG  I "C2'" 1 
ATOM   1274  C  "C1'" . DG  A  1 63  ? -52.672 -10.804 76.753 1.00 90.29  ? -10  DG  I "C1'" 1 
ATOM   1275  N  N9    . DG  A  1 63  ? -51.974 -11.549 75.696 1.00 90.30  ? -10  DG  I N9    1 
ATOM   1276  C  C8    . DG  A  1 63  ? -51.088 -11.046 74.768 1.00 89.75  ? -10  DG  I C8    1 
ATOM   1277  N  N7    . DG  A  1 63  ? -50.628 -11.944 73.946 1.00 89.56  ? -10  DG  I N7    1 
ATOM   1278  C  C5    . DG  A  1 63  ? -51.242 -13.121 74.348 1.00 89.79  ? -10  DG  I C5    1 
ATOM   1279  C  C6    . DG  A  1 63  ? -51.130 -14.434 73.824 1.00 89.95  ? -10  DG  I C6    1 
ATOM   1280  O  O6    . DG  A  1 63  ? -50.441 -14.822 72.872 1.00 89.99  ? -10  DG  I O6    1 
ATOM   1281  N  N1    . DG  A  1 63  ? -51.926 -15.346 74.518 1.00 89.97  ? -10  DG  I N1    1 
ATOM   1282  C  C2    . DG  A  1 63  ? -52.727 -15.030 75.586 1.00 89.61  ? -10  DG  I C2    1 
ATOM   1283  N  N2    . DG  A  1 63  ? -53.412 -16.044 76.123 1.00 89.70  ? -10  DG  I N2    1 
ATOM   1284  N  N3    . DG  A  1 63  ? -52.843 -13.805 76.087 1.00 89.74  ? -10  DG  I N3    1 
ATOM   1285  C  C4    . DG  A  1 63  ? -52.077 -12.899 75.423 1.00 89.93  ? -10  DG  I C4    1 
ATOM   1286  P  P     . DT  A  1 64  ? -52.856 -9.451  80.370 1.00 92.43  ? -9   DT  I P     1 
ATOM   1287  O  OP1   . DT  A  1 64  ? -53.728 -9.129  81.525 1.00 92.66  ? -9   DT  I OP1   1 
ATOM   1288  O  OP2   . DT  A  1 64  ? -51.445 -8.986  80.368 1.00 91.83  ? -9   DT  I OP2   1 
ATOM   1289  O  "O5'" . DT  A  1 64  ? -52.897 -11.040 80.178 1.00 91.82  ? -9   DT  I "O5'" 1 
ATOM   1290  C  "C5'" . DT  A  1 64  ? -54.145 -11.740 80.009 1.00 91.36  ? -9   DT  I "C5'" 1 
ATOM   1291  C  "C4'" . DT  A  1 64  ? -54.040 -13.174 80.513 1.00 91.15  ? -9   DT  I "C4'" 1 
ATOM   1292  O  "O4'" . DT  A  1 64  ? -53.400 -14.037 79.527 1.00 90.37  ? -9   DT  I "O4'" 1 
ATOM   1293  C  "C3'" . DT  A  1 64  ? -53.231 -13.329 81.798 1.00 91.14  ? -9   DT  I "C3'" 1 
ATOM   1294  O  "O3'" . DT  A  1 64  ? -53.855 -14.276 82.672 1.00 91.15  ? -9   DT  I "O3'" 1 
ATOM   1295  C  "C2'" . DT  A  1 64  ? -51.860 -13.805 81.304 1.00 90.89  ? -9   DT  I "C2'" 1 
ATOM   1296  C  "C1'" . DT  A  1 64  ? -52.212 -14.605 80.054 1.00 89.23  ? -9   DT  I "C1'" 1 
ATOM   1297  N  N1    . DT  A  1 64  ? -51.124 -14.627 79.002 1.00 88.80  ? -9   DT  I N1    1 
ATOM   1298  C  C2    . DT  A  1 64  ? -50.896 -15.803 78.316 1.00 88.31  ? -9   DT  I C2    1 
ATOM   1299  O  O2    . DT  A  1 64  ? -51.524 -16.831 78.508 1.00 87.93  ? -9   DT  I O2    1 
ATOM   1300  N  N3    . DT  A  1 64  ? -49.890 -15.729 77.381 1.00 88.41  ? -9   DT  I N3    1 
ATOM   1301  C  C4    . DT  A  1 64  ? -49.100 -14.636 77.062 1.00 88.28  ? -9   DT  I C4    1 
ATOM   1302  O  O4    . DT  A  1 64  ? -48.227 -14.697 76.201 1.00 88.05  ? -9   DT  I O4    1 
ATOM   1303  C  C5    . DT  A  1 64  ? -49.383 -13.438 77.816 1.00 88.13  ? -9   DT  I C5    1 
ATOM   1304  C  C7    . DT  A  1 64  ? -48.598 -12.182 77.569 1.00 88.22  ? -9   DT  I C7    1 
ATOM   1305  C  C6    . DT  A  1 64  ? -50.365 -13.491 78.735 1.00 88.47  ? -9   DT  I C6    1 
ATOM   1306  P  P     . DT  A  1 65  ? -53.222 -14.612 84.111 1.00 91.23  ? -8   DT  I P     1 
ATOM   1307  O  OP1   . DT  A  1 65  ? -54.362 -14.793 85.036 1.00 92.12  ? -8   DT  I OP1   1 
ATOM   1308  O  OP2   . DT  A  1 65  ? -52.118 -13.672 84.438 1.00 90.41  ? -8   DT  I OP2   1 
ATOM   1309  O  "O5'" . DT  A  1 65  ? -52.544 -16.035 83.874 1.00 90.48  ? -8   DT  I "O5'" 1 
ATOM   1310  C  "C5'" . DT  A  1 65  ? -53.243 -17.082 83.213 1.00 88.46  ? -8   DT  I "C5'" 1 
ATOM   1311  C  "C4'" . DT  A  1 65  ? -52.263 -18.208 82.955 1.00 86.86  ? -8   DT  I "C4'" 1 
ATOM   1312  O  "O4'" . DT  A  1 65  ? -51.380 -17.862 81.853 1.00 87.16  ? -8   DT  I "O4'" 1 
ATOM   1313  C  "C3'" . DT  A  1 65  ? -51.359 -18.514 84.144 1.00 85.33  ? -8   DT  I "C3'" 1 
ATOM   1314  O  "O3'" . DT  A  1 65  ? -51.417 -19.913 84.413 1.00 82.38  ? -8   DT  I "O3'" 1 
ATOM   1315  C  "C2'" . DT  A  1 65  ? -49.970 -18.030 83.704 1.00 86.01  ? -8   DT  I "C2'" 1 
ATOM   1316  C  "C1'" . DT  A  1 65  ? -50.062 -18.238 82.197 1.00 86.44  ? -8   DT  I "C1'" 1 
ATOM   1317  N  N1    . DT  A  1 65  ? -49.109 -17.464 81.336 1.00 86.34  ? -8   DT  I N1    1 
ATOM   1318  C  C2    . DT  A  1 65  ? -48.575 -18.100 80.232 1.00 86.16  ? -8   DT  I C2    1 
ATOM   1319  O  O2    . DT  A  1 65  ? -48.825 -19.255 79.931 1.00 86.27  ? -8   DT  I O2    1 
ATOM   1320  N  N3    . DT  A  1 65  ? -47.722 -17.328 79.483 1.00 86.09  ? -8   DT  I N3    1 
ATOM   1321  C  C4    . DT  A  1 65  ? -47.356 -16.013 79.715 1.00 86.19  ? -8   DT  I C4    1 
ATOM   1322  O  O4    . DT  A  1 65  ? -46.581 -15.420 78.972 1.00 85.89  ? -8   DT  I O4    1 
ATOM   1323  C  C5    . DT  A  1 65  ? -47.954 -15.401 80.884 1.00 86.54  ? -8   DT  I C5    1 
ATOM   1324  C  C7    . DT  A  1 65  ? -47.635 -13.974 81.241 1.00 86.37  ? -8   DT  I C7    1 
ATOM   1325  C  C6    . DT  A  1 65  ? -48.795 -16.145 81.628 1.00 86.48  ? -8   DT  I C6    1 
ATOM   1326  P  P     . DC  A  1 66  ? -50.888 -20.485 85.808 1.00 80.01  ? -7   DC  I P     1 
ATOM   1327  O  OP1   . DC  A  1 66  ? -51.907 -21.414 86.348 1.00 79.75  ? -7   DC  I OP1   1 
ATOM   1328  O  OP2   . DC  A  1 66  ? -50.379 -19.347 86.609 1.00 79.18  ? -7   DC  I OP2   1 
ATOM   1329  O  "O5'" . DC  A  1 66  ? -49.604 -21.337 85.375 1.00 78.71  ? -7   DC  I "O5'" 1 
ATOM   1330  C  "C5'" . DC  A  1 66  ? -49.649 -22.447 84.470 1.00 75.16  ? -7   DC  I "C5'" 1 
ATOM   1331  C  "C4'" . DC  A  1 66  ? -48.261 -22.621 83.879 1.00 72.76  ? -7   DC  I "C4'" 1 
ATOM   1332  O  "O4'" . DC  A  1 66  ? -47.821 -21.355 83.314 1.00 73.24  ? -7   DC  I "O4'" 1 
ATOM   1333  C  "C3'" . DC  A  1 66  ? -47.190 -23.007 84.894 1.00 70.87  ? -7   DC  I "C3'" 1 
ATOM   1334  O  "O3'" . DC  A  1 66  ? -46.455 -24.108 84.408 1.00 67.28  ? -7   DC  I "O3'" 1 
ATOM   1335  C  "C2'" . DC  A  1 66  ? -46.319 -21.760 85.032 1.00 71.62  ? -7   DC  I "C2'" 1 
ATOM   1336  C  "C1'" . DC  A  1 66  ? -46.457 -21.179 83.629 1.00 72.87  ? -7   DC  I "C1'" 1 
ATOM   1337  N  N1    . DC  A  1 66  ? -46.039 -19.744 83.471 1.00 72.97  ? -7   DC  I N1    1 
ATOM   1338  C  C2    . DC  A  1 66  ? -45.649 -19.249 82.210 1.00 72.78  ? -7   DC  I C2    1 
ATOM   1339  O  O2    . DC  A  1 66  ? -45.661 -19.990 81.222 1.00 73.06  ? -7   DC  I O2    1 
ATOM   1340  N  N3    . DC  A  1 66  ? -45.265 -17.954 82.094 1.00 72.47  ? -7   DC  I N3    1 
ATOM   1341  C  C4    . DC  A  1 66  ? -45.253 -17.164 83.170 1.00 73.26  ? -7   DC  I C4    1 
ATOM   1342  N  N4    . DC  A  1 66  ? -44.867 -15.887 83.023 1.00 73.32  ? -7   DC  I N4    1 
ATOM   1343  C  C5    . DC  A  1 66  ? -45.640 -17.648 84.460 1.00 73.38  ? -7   DC  I C5    1 
ATOM   1344  C  C6    . DC  A  1 66  ? -46.021 -18.925 84.564 1.00 73.05  ? -7   DC  I C6    1 
ATOM   1345  P  P     . DA  A  1 67  ? -46.665 -25.523 85.110 1.00 65.87  ? -6   DA  I P     1 
ATOM   1346  O  OP1   . DA  A  1 67  ? -48.111 -25.684 85.385 1.00 65.48  ? -6   DA  I OP1   1 
ATOM   1347  O  OP2   . DA  A  1 67  ? -45.714 -25.587 86.235 1.00 67.48  ? -6   DA  I OP2   1 
ATOM   1348  O  "O5'" . DA  A  1 67  ? -46.152 -26.592 84.017 1.00 64.43  ? -6   DA  I "O5'" 1 
ATOM   1349  C  "C5'" . DA  A  1 67  ? -46.527 -26.519 82.622 1.00 61.80  ? -6   DA  I "C5'" 1 
ATOM   1350  C  "C4'" . DA  A  1 67  ? -45.352 -26.591 81.639 1.00 59.90  ? -6   DA  I "C4'" 1 
ATOM   1351  O  "O4'" . DA  A  1 67  ? -44.681 -25.309 81.478 1.00 58.30  ? -6   DA  I "O4'" 1 
ATOM   1352  C  "C3'" . DA  A  1 67  ? -44.252 -27.600 81.946 1.00 58.73  ? -6   DA  I "C3'" 1 
ATOM   1353  O  "O3'" . DA  A  1 67  ? -43.922 -28.262 80.754 1.00 57.72  ? -6   DA  I "O3'" 1 
ATOM   1354  C  "C2'" . DA  A  1 67  ? -43.099 -26.757 82.495 1.00 58.35  ? -6   DA  I "C2'" 1 
ATOM   1355  C  "C1'" . DA  A  1 67  ? -43.311 -25.392 81.839 1.00 57.71  ? -6   DA  I "C1'" 1 
ATOM   1356  N  N9    . DA  A  1 67  ? -43.048 -24.209 82.662 1.00 57.11  ? -6   DA  I N9    1 
ATOM   1357  C  C8    . DA  A  1 67  ? -43.252 -24.038 84.001 1.00 56.84  ? -6   DA  I C8    1 
ATOM   1358  N  N7    . DA  A  1 67  ? -42.939 -22.839 84.438 1.00 56.88  ? -6   DA  I N7    1 
ATOM   1359  C  C5    . DA  A  1 67  ? -42.507 -22.164 83.314 1.00 57.38  ? -6   DA  I C5    1 
ATOM   1360  C  C6    . DA  A  1 67  ? -42.030 -20.843 83.092 1.00 57.64  ? -6   DA  I C6    1 
ATOM   1361  N  N6    . DA  A  1 67  ? -41.902 -19.912 84.043 1.00 57.05  ? -6   DA  I N6    1 
ATOM   1362  N  N1    . DA  A  1 67  ? -41.685 -20.500 81.828 1.00 57.35  ? -6   DA  I N1    1 
ATOM   1363  C  C2    . DA  A  1 67  ? -41.801 -21.420 80.859 1.00 57.20  ? -6   DA  I C2    1 
ATOM   1364  N  N3    . DA  A  1 67  ? -42.227 -22.687 80.947 1.00 57.00  ? -6   DA  I N3    1 
ATOM   1365  C  C4    . DA  A  1 67  ? -42.572 -23.001 82.209 1.00 57.49  ? -6   DA  I C4    1 
ATOM   1366  P  P     . DG  A  1 68  ? -42.961 -29.538 80.759 1.00 60.43  ? -5   DG  I P     1 
ATOM   1367  O  OP1   . DG  A  1 68  ? -43.382 -30.382 79.620 1.00 60.07  ? -5   DG  I OP1   1 
ATOM   1368  O  OP2   . DG  A  1 68  ? -42.855 -30.146 82.100 1.00 60.06  ? -5   DG  I OP2   1 
ATOM   1369  O  "O5'" . DG  A  1 68  ? -41.531 -28.878 80.464 1.00 60.26  ? -5   DG  I "O5'" 1 
ATOM   1370  C  "C5'" . DG  A  1 68  ? -41.245 -28.277 79.199 1.00 59.18  ? -5   DG  I "C5'" 1 
ATOM   1371  C  "C4'" . DG  A  1 68  ? -40.024 -27.385 79.297 1.00 58.44  ? -5   DG  I "C4'" 1 
ATOM   1372  O  "O4'" . DG  A  1 68  ? -40.296 -26.267 80.192 1.00 57.33  ? -5   DG  I "O4'" 1 
ATOM   1373  C  "C3'" . DG  A  1 68  ? -38.769 -28.085 79.823 1.00 58.43  ? -5   DG  I "C3'" 1 
ATOM   1374  O  "O3'" . DG  A  1 68  ? -37.610 -27.648 79.121 1.00 58.76  ? -5   DG  I "O3'" 1 
ATOM   1375  C  "C2'" . DG  A  1 68  ? -38.674 -27.523 81.238 1.00 58.76  ? -5   DG  I "C2'" 1 
ATOM   1376  C  "C1'" . DG  A  1 68  ? -39.132 -26.090 80.969 1.00 59.11  ? -5   DG  I "C1'" 1 
ATOM   1377  N  N9    . DG  A  1 68  ? -39.377 -25.293 82.172 1.00 59.40  ? -5   DG  I N9    1 
ATOM   1378  C  C8    . DG  A  1 68  ? -39.902 -25.728 83.366 1.00 59.68  ? -5   DG  I C8    1 
ATOM   1379  N  N7    . DG  A  1 68  ? -40.008 -24.800 84.278 1.00 59.49  ? -5   DG  I N7    1 
ATOM   1380  C  C5    . DG  A  1 68  ? -39.502 -23.676 83.658 1.00 59.59  ? -5   DG  I C5    1 
ATOM   1381  C  C6    . DG  A  1 68  ? -39.356 -22.365 84.164 1.00 59.91  ? -5   DG  I C6    1 
ATOM   1382  O  O6    . DG  A  1 68  ? -39.659 -21.947 85.292 1.00 59.78  ? -5   DG  I O6    1 
ATOM   1383  N  N1    . DG  A  1 68  ? -38.799 -21.502 83.214 1.00 60.12  ? -5   DG  I N1    1 
ATOM   1384  C  C2    . DG  A  1 68  ? -38.431 -21.874 81.937 1.00 59.76  ? -5   DG  I C2    1 
ATOM   1385  N  N2    . DG  A  1 68  ? -37.911 -20.912 81.161 1.00 59.27  ? -5   DG  I N2    1 
ATOM   1386  N  N3    . DG  A  1 68  ? -38.566 -23.109 81.459 1.00 59.85  ? -5   DG  I N3    1 
ATOM   1387  C  C4    . DG  A  1 68  ? -39.105 -23.958 82.366 1.00 59.42  ? -5   DG  I C4    1 
ATOM   1388  P  P     . DC  A  1 69  ? -36.942 -28.359 77.856 1.00 56.86  ? -4   DC  I P     1 
ATOM   1389  O  OP1   . DC  A  1 69  ? -38.013 -28.670 76.880 1.00 57.73  ? -4   DC  I OP1   1 
ATOM   1390  O  OP2   . DC  A  1 69  ? -36.006 -29.410 78.330 1.00 56.88  ? -4   DC  I OP2   1 
ATOM   1391  O  "O5'" . DC  A  1 69  ? -36.093 -27.143 77.289 1.00 53.20  ? -4   DC  I "O5'" 1 
ATOM   1392  C  "C5'" . DC  A  1 69  ? -36.781 -26.012 76.798 1.00 49.50  ? -4   DC  I "C5'" 1 
ATOM   1393  C  "C4'" . DC  A  1 69  ? -35.968 -24.781 77.104 1.00 47.38  ? -4   DC  I "C4'" 1 
ATOM   1394  O  "O4'" . DC  A  1 69  ? -36.270 -24.329 78.448 1.00 46.85  ? -4   DC  I "O4'" 1 
ATOM   1395  C  "C3'" . DC  A  1 69  ? -34.465 -25.008 77.048 1.00 46.07  ? -4   DC  I "C3'" 1 
ATOM   1396  O  "O3'" . DC  A  1 69  ? -33.862 -23.958 76.305 1.00 44.67  ? -4   DC  I "O3'" 1 
ATOM   1397  C  "C2'" . DC  A  1 69  ? -34.036 -24.970 78.504 1.00 45.66  ? -4   DC  I "C2'" 1 
ATOM   1398  C  "C1'" . DC  A  1 69  ? -35.063 -24.012 79.093 1.00 46.27  ? -4   DC  I "C1'" 1 
ATOM   1399  N  N1    . DC  A  1 69  ? -35.302 -24.153 80.563 1.00 46.31  ? -4   DC  I N1    1 
ATOM   1400  C  C2    . DC  A  1 69  ? -35.264 -23.008 81.359 1.00 46.22  ? -4   DC  I C2    1 
ATOM   1401  O  O2    . DC  A  1 69  ? -35.036 -21.917 80.831 1.00 47.15  ? -4   DC  I O2    1 
ATOM   1402  N  N3    . DC  A  1 69  ? -35.486 -23.130 82.685 1.00 46.81  ? -4   DC  I N3    1 
ATOM   1403  C  C4    . DC  A  1 69  ? -35.734 -24.336 83.218 1.00 47.21  ? -4   DC  I C4    1 
ATOM   1404  N  N4    . DC  A  1 69  ? -35.953 -24.415 84.542 1.00 46.73  ? -4   DC  I N4    1 
ATOM   1405  C  C5    . DC  A  1 69  ? -35.764 -25.519 82.423 1.00 46.46  ? -4   DC  I C5    1 
ATOM   1406  C  C6    . DC  A  1 69  ? -35.555 -25.379 81.114 1.00 45.91  ? -4   DC  I C6    1 
ATOM   1407  P  P     . DT  A  1 70  ? -32.337 -24.054 75.830 1.00 41.49  ? -3   DT  I P     1 
ATOM   1408  O  OP1   . DT  A  1 70  ? -32.359 -23.809 74.379 1.00 40.88  ? -3   DT  I OP1   1 
ATOM   1409  O  OP2   . DT  A  1 70  ? -31.652 -25.266 76.342 1.00 39.81  ? -3   DT  I OP2   1 
ATOM   1410  O  "O5'" . DT  A  1 70  ? -31.764 -22.800 76.630 1.00 41.49  ? -3   DT  I "O5'" 1 
ATOM   1411  C  "C5'" . DT  A  1 70  ? -32.389 -21.541 76.503 1.00 42.25  ? -3   DT  I "C5'" 1 
ATOM   1412  C  "C4'" . DT  A  1 70  ? -31.776 -20.557 77.472 1.00 43.75  ? -3   DT  I "C4'" 1 
ATOM   1413  O  "O4'" . DT  A  1 70  ? -32.112 -20.883 78.843 1.00 45.82  ? -3   DT  I "O4'" 1 
ATOM   1414  C  "C3'" . DT  A  1 70  ? -30.270 -20.488 77.449 1.00 45.12  ? -3   DT  I "C3'" 1 
ATOM   1415  O  "O3'" . DT  A  1 70  ? -30.027 -19.131 77.484 1.00 47.23  ? -3   DT  I "O3'" 1 
ATOM   1416  C  "C2'" . DT  A  1 70  ? -29.784 -21.184 78.720 1.00 44.42  ? -3   DT  I "C2'" 1 
ATOM   1417  C  "C1'" . DT  A  1 70  ? -30.955 -20.974 79.661 1.00 46.79  ? -3   DT  I "C1'" 1 
ATOM   1418  N  N1    . DT  A  1 70  ? -31.257 -22.062 80.676 1.00 47.72  ? -3   DT  I N1    1 
ATOM   1419  C  C2    . DT  A  1 70  ? -31.532 -21.713 81.993 1.00 47.68  ? -3   DT  I C2    1 
ATOM   1420  O  O2    . DT  A  1 70  ? -31.523 -20.569 82.417 1.00 48.16  ? -3   DT  I O2    1 
ATOM   1421  N  N3    . DT  A  1 70  ? -31.818 -22.765 82.819 1.00 47.66  ? -3   DT  I N3    1 
ATOM   1422  C  C4    . DT  A  1 70  ? -31.865 -24.098 82.463 1.00 47.57  ? -3   DT  I C4    1 
ATOM   1423  O  O4    . DT  A  1 70  ? -32.140 -24.975 83.268 1.00 48.46  ? -3   DT  I O4    1 
ATOM   1424  C  C5    . DT  A  1 70  ? -31.570 -24.398 81.089 1.00 47.38  ? -3   DT  I C5    1 
ATOM   1425  C  C7    . DT  A  1 70  ? -31.595 -25.818 80.612 1.00 47.37  ? -3   DT  I C7    1 
ATOM   1426  C  C6    . DT  A  1 70  ? -31.288 -23.383 80.266 1.00 47.34  ? -3   DT  I C6    1 
ATOM   1427  P  P     . DG  A  1 71  ? -28.567 -18.539 77.277 1.00 48.05  ? -2   DG  I P     1 
ATOM   1428  O  OP1   . DG  A  1 71  ? -28.835 -17.253 76.583 1.00 48.40  ? -2   DG  I OP1   1 
ATOM   1429  O  OP2   . DG  A  1 71  ? -27.622 -19.585 76.795 1.00 44.82  ? -2   DG  I OP2   1 
ATOM   1430  O  "O5'" . DG  A  1 71  ? -28.132 -18.221 78.777 1.00 50.09  ? -2   DG  I "O5'" 1 
ATOM   1431  C  "C5'" . DG  A  1 71  ? -28.710 -17.151 79.535 1.00 52.95  ? -2   DG  I "C5'" 1 
ATOM   1432  C  "C4'" . DG  A  1 71  ? -28.097 -17.170 80.922 1.00 54.58  ? -2   DG  I "C4'" 1 
ATOM   1433  O  "O4'" . DG  A  1 71  ? -28.458 -18.413 81.572 1.00 54.82  ? -2   DG  I "O4'" 1 
ATOM   1434  C  "C3'" . DG  A  1 71  ? -26.572 -17.134 80.946 1.00 56.33  ? -2   DG  I "C3'" 1 
ATOM   1435  O  "O3'" . DG  A  1 71  ? -26.209 -16.425 82.081 1.00 59.85  ? -2   DG  I "O3'" 1 
ATOM   1436  C  "C2'" . DG  A  1 71  ? -26.166 -18.595 81.104 1.00 55.45  ? -2   DG  I "C2'" 1 
ATOM   1437  C  "C1'" . DG  A  1 71  ? -27.281 -19.058 82.023 1.00 54.96  ? -2   DG  I "C1'" 1 
ATOM   1438  N  N9    . DG  A  1 71  ? -27.496 -20.495 82.017 1.00 54.90  ? -2   DG  I N9    1 
ATOM   1439  C  C8    . DG  A  1 71  ? -27.239 -21.384 81.000 1.00 54.85  ? -2   DG  I C8    1 
ATOM   1440  N  N7    . DG  A  1 71  ? -27.530 -22.617 81.295 1.00 54.69  ? -2   DG  I N7    1 
ATOM   1441  C  C5    . DG  A  1 71  ? -28.007 -22.534 82.596 1.00 54.96  ? -2   DG  I C5    1 
ATOM   1442  C  C6    . DG  A  1 71  ? -28.471 -23.549 83.454 1.00 54.90  ? -2   DG  I C6    1 
ATOM   1443  O  O6    . DG  A  1 71  ? -28.549 -24.753 83.199 1.00 55.20  ? -2   DG  I O6    1 
ATOM   1444  N  N1    . DG  A  1 71  ? -28.863 -23.060 84.702 1.00 54.71  ? -2   DG  I N1    1 
ATOM   1445  C  C2    . DG  A  1 71  ? -28.809 -21.736 85.067 1.00 54.99  ? -2   DG  I C2    1 
ATOM   1446  N  N2    . DG  A  1 71  ? -29.225 -21.438 86.304 1.00 55.01  ? -2   DG  I N2    1 
ATOM   1447  N  N3    . DG  A  1 71  ? -28.373 -20.765 84.272 1.00 55.30  ? -2   DG  I N3    1 
ATOM   1448  C  C4    . DG  A  1 71  ? -27.993 -21.237 83.057 1.00 55.12  ? -2   DG  I C4    1 
ATOM   1449  P  P     . DA  A  1 72  ? -24.738 -15.839 82.301 1.00 62.69  ? -1   DA  I P     1 
ATOM   1450  O  OP1   . DA  A  1 72  ? -24.715 -14.558 81.556 1.00 62.66  ? -1   DA  I OP1   1 
ATOM   1451  O  OP2   . DA  A  1 72  ? -23.712 -16.894 82.075 1.00 61.40  ? -1   DA  I OP2   1 
ATOM   1452  O  "O5'" . DA  A  1 72  ? -24.769 -15.518 83.873 1.00 62.93  ? -1   DA  I "O5'" 1 
ATOM   1453  C  "C5'" . DA  A  1 72  ? -25.988 -15.674 84.634 1.00 64.57  ? -1   DA  I "C5'" 1 
ATOM   1454  C  "C4'" . DA  A  1 72  ? -25.741 -16.352 85.976 1.00 65.34  ? -1   DA  I "C4'" 1 
ATOM   1455  O  "O4'" . DA  A  1 72  ? -26.095 -17.757 85.915 1.00 64.00  ? -1   DA  I "O4'" 1 
ATOM   1456  C  "C3'" . DA  A  1 72  ? -24.293 -16.299 86.460 1.00 67.08  ? -1   DA  I "C3'" 1 
ATOM   1457  O  "O3'" . DA  A  1 72  ? -24.264 -15.858 87.814 1.00 70.34  ? -1   DA  I "O3'" 1 
ATOM   1458  C  "C2'" . DA  A  1 72  ? -23.763 -17.726 86.282 1.00 64.98  ? -1   DA  I "C2'" 1 
ATOM   1459  C  "C1'" . DA  A  1 72  ? -25.037 -18.547 86.433 1.00 62.23  ? -1   DA  I "C1'" 1 
ATOM   1460  N  N9    . DA  A  1 72  ? -25.020 -19.823 85.714 1.00 61.85  ? -1   DA  I N9    1 
ATOM   1461  C  C8    . DA  A  1 72  ? -24.688 -20.054 84.402 1.00 60.70  ? -1   DA  I C8    1 
ATOM   1462  N  N7    . DA  A  1 72  ? -24.789 -21.308 84.048 1.00 60.11  ? -1   DA  I N7    1 
ATOM   1463  C  C5    . DA  A  1 72  ? -25.223 -21.949 85.196 1.00 60.32  ? -1   DA  I C5    1 
ATOM   1464  C  C6    . DA  A  1 72  ? -25.519 -23.293 85.488 1.00 60.40  ? -1   DA  I C6    1 
ATOM   1465  N  N6    . DA  A  1 72  ? -25.418 -24.290 84.606 1.00 60.45  ? -1   DA  I N6    1 
ATOM   1466  N  N1    . DA  A  1 72  ? -25.919 -23.585 86.739 1.00 60.53  ? -1   DA  I N1    1 
ATOM   1467  C  C2    . DA  A  1 72  ? -26.025 -22.604 87.638 1.00 60.67  ? -1   DA  I C2    1 
ATOM   1468  N  N3    . DA  A  1 72  ? -25.781 -21.304 87.490 1.00 60.48  ? -1   DA  I N3    1 
ATOM   1469  C  C4    . DA  A  1 72  ? -25.372 -21.047 86.235 1.00 61.17  ? -1   DA  I C4    1 
ATOM   1470  P  P     . DA  A  1 73  ? -22.859 -15.516 88.507 1.00 72.99  ? 0    DA  I P     1 
ATOM   1471  O  OP1   . DA  A  1 73  ? -23.117 -14.424 89.471 1.00 73.03  ? 0    DA  I OP1   1 
ATOM   1472  O  OP2   . DA  A  1 73  ? -21.799 -15.385 87.470 1.00 72.13  ? 0    DA  I OP2   1 
ATOM   1473  O  "O5'" . DA  A  1 73  ? -22.564 -16.849 89.330 1.00 73.10  ? 0    DA  I "O5'" 1 
ATOM   1474  C  "C5'" . DA  A  1 73  ? -23.488 -17.315 90.285 1.00 73.92  ? 0    DA  I "C5'" 1 
ATOM   1475  C  "C4'" . DA  A  1 73  ? -23.014 -18.679 90.722 1.00 75.21  ? 0    DA  I "C4'" 1 
ATOM   1476  O  "O4'" . DA  A  1 73  ? -23.277 -19.608 89.648 1.00 75.56  ? 0    DA  I "O4'" 1 
ATOM   1477  C  "C3'" . DA  A  1 73  ? -21.514 -18.768 90.995 1.00 75.91  ? 0    DA  I "C3'" 1 
ATOM   1478  O  "O3'" . DA  A  1 73  ? -21.309 -18.979 92.397 1.00 77.38  ? 0    DA  I "O3'" 1 
ATOM   1479  C  "C2'" . DA  A  1 73  ? -21.026 -19.934 90.124 1.00 75.50  ? 0    DA  I "C2'" 1 
ATOM   1480  C  "C1'" . DA  A  1 73  ? -22.318 -20.637 89.732 1.00 75.10  ? 0    DA  I "C1'" 1 
ATOM   1481  N  N9    . DA  A  1 73  ? -22.259 -21.328 88.446 1.00 75.01  ? 0    DA  I N9    1 
ATOM   1482  C  C8    . DA  A  1 73  ? -21.987 -20.784 87.215 1.00 75.29  ? 0    DA  I C8    1 
ATOM   1483  N  N7    . DA  A  1 73  ? -22.004 -21.654 86.229 1.00 75.15  ? 0    DA  I N7    1 
ATOM   1484  C  C5    . DA  A  1 73  ? -22.315 -22.846 86.860 1.00 74.72  ? 0    DA  I C5    1 
ATOM   1485  C  C6    . DA  A  1 73  ? -22.487 -24.156 86.376 1.00 74.73  ? 0    DA  I C6    1 
ATOM   1486  N  N6    . DA  A  1 73  ? -22.363 -24.470 85.091 1.00 74.89  ? 0    DA  I N6    1 
ATOM   1487  N  N1    . DA  A  1 73  ? -22.796 -25.131 87.262 1.00 75.24  ? 0    DA  I N1    1 
ATOM   1488  C  C2    . DA  A  1 73  ? -22.926 -24.808 88.560 1.00 75.27  ? 0    DA  I C2    1 
ATOM   1489  N  N3    . DA  A  1 73  ? -22.788 -23.607 89.132 1.00 75.00  ? 0    DA  I N3    1 
ATOM   1490  C  C4    . DA  A  1 73  ? -22.479 -22.665 88.222 1.00 74.69  ? 0    DA  I C4    1 
ATOM   1491  P  P     . DT  A  1 74  ? -19.859 -19.196 93.072 1.00 78.98  ? 1    DT  I P     1 
ATOM   1492  O  OP1   . DT  A  1 74  ? -20.049 -18.816 94.493 1.00 79.10  ? 1    DT  I OP1   1 
ATOM   1493  O  OP2   . DT  A  1 74  ? -18.803 -18.544 92.250 1.00 77.56  ? 1    DT  I OP2   1 
ATOM   1494  O  "O5'" . DT  A  1 74  ? -19.645 -20.785 93.023 1.00 76.85  ? 1    DT  I "O5'" 1 
ATOM   1495  C  "C5'" . DT  A  1 74  ? -20.597 -21.604 93.680 1.00 76.04  ? 1    DT  I "C5'" 1 
ATOM   1496  C  "C4'" . DT  A  1 74  ? -20.205 -23.049 93.521 1.00 76.17  ? 1    DT  I "C4'" 1 
ATOM   1497  O  "O4'" . DT  A  1 74  ? -20.448 -23.440 92.153 1.00 76.06  ? 1    DT  I "O4'" 1 
ATOM   1498  C  "C3'" . DT  A  1 74  ? -18.729 -23.312 93.793 1.00 76.77  ? 1    DT  I "C3'" 1 
ATOM   1499  O  "O3'" . DT  A  1 74  ? -18.618 -24.302 94.799 1.00 78.46  ? 1    DT  I "O3'" 1 
ATOM   1500  C  "C2'" . DT  A  1 74  ? -18.148 -23.770 92.454 1.00 76.05  ? 1    DT  I "C2'" 1 
ATOM   1501  C  "C1'" . DT  A  1 74  ? -19.386 -24.267 91.718 1.00 74.68  ? 1    DT  I "C1'" 1 
ATOM   1502  N  N1    . DT  A  1 74  ? -19.299 -24.235 90.215 1.00 73.34  ? 1    DT  I N1    1 
ATOM   1503  C  C2    . DT  A  1 74  ? -19.499 -25.401 89.519 1.00 72.92  ? 1    DT  I C2    1 
ATOM   1504  O  O2    . DT  A  1 74  ? -19.743 -26.467 90.057 1.00 72.53  ? 1    DT  I O2    1 
ATOM   1505  N  N3    . DT  A  1 74  ? -19.398 -25.270 88.155 1.00 73.03  ? 1    DT  I N3    1 
ATOM   1506  C  C4    . DT  A  1 74  ? -19.128 -24.119 87.432 1.00 73.36  ? 1    DT  I C4    1 
ATOM   1507  O  O4    . DT  A  1 74  ? -19.063 -24.113 86.204 1.00 73.30  ? 1    DT  I O4    1 
ATOM   1508  C  C5    . DT  A  1 74  ? -18.927 -22.933 88.230 1.00 73.00  ? 1    DT  I C5    1 
ATOM   1509  C  C7    . DT  A  1 74  ? -18.616 -21.612 87.584 1.00 73.14  ? 1    DT  I C7    1 
ATOM   1510  C  C6    . DT  A  1 74  ? -19.022 -23.051 89.561 1.00 72.96  ? 1    DT  I C6    1 
ATOM   1511  P  P     . DC  A  1 75  ? -17.191 -24.699 95.424 1.00 80.56  ? 2    DC  I P     1 
ATOM   1512  O  OP1   . DC  A  1 75  ? -17.469 -25.302 96.750 1.00 80.45  ? 2    DC  I OP1   1 
ATOM   1513  O  OP2   . DC  A  1 75  ? -16.247 -23.557 95.282 1.00 79.05  ? 2    DC  I OP2   1 
ATOM   1514  O  "O5'" . DC  A  1 75  ? -16.715 -25.890 94.466 1.00 80.11  ? 2    DC  I "O5'" 1 
ATOM   1515  C  "C5'" . DC  A  1 75  ? -17.533 -27.059 94.306 1.00 80.32  ? 2    DC  I "C5'" 1 
ATOM   1516  C  "C4'" . DC  A  1 75  ? -16.914 -27.992 93.283 1.00 80.27  ? 2    DC  I "C4'" 1 
ATOM   1517  O  "O4'" . DC  A  1 75  ? -17.134 -27.510 91.928 1.00 80.06  ? 2    DC  I "O4'" 1 
ATOM   1518  C  "C3'" . DC  A  1 75  ? -15.405 -28.113 93.447 1.00 80.39  ? 2    DC  I "C3'" 1 
ATOM   1519  O  "O3'" . DC  A  1 75  ? -15.066 -29.470 93.536 1.00 80.57  ? 2    DC  I "O3'" 1 
ATOM   1520  C  "C2'" . DC  A  1 75  ? -14.812 -27.482 92.189 1.00 80.14  ? 2    DC  I "C2'" 1 
ATOM   1521  C  "C1'" . DC  A  1 75  ? -15.940 -27.704 91.189 1.00 79.57  ? 2    DC  I "C1'" 1 
ATOM   1522  N  N1    . DC  A  1 75  ? -15.894 -26.797 89.987 1.00 79.07  ? 2    DC  I N1    1 
ATOM   1523  C  C2    . DC  A  1 75  ? -16.119 -27.333 88.709 1.00 78.96  ? 2    DC  I C2    1 
ATOM   1524  O  O2    . DC  A  1 75  ? -16.354 -28.544 88.587 1.00 78.83  ? 2    DC  I O2    1 
ATOM   1525  N  N3    . DC  A  1 75  ? -16.073 -26.501 87.633 1.00 78.87  ? 2    DC  I N3    1 
ATOM   1526  C  C4    . DC  A  1 75  ? -15.815 -25.198 87.797 1.00 79.04  ? 2    DC  I C4    1 
ATOM   1527  N  N4    . DC  A  1 75  ? -15.779 -24.423 86.708 1.00 79.17  ? 2    DC  I N4    1 
ATOM   1528  C  C5    . DC  A  1 75  ? -15.581 -24.631 89.085 1.00 78.76  ? 2    DC  I C5    1 
ATOM   1529  C  C6    . DC  A  1 75  ? -15.631 -25.460 90.137 1.00 79.03  ? 2    DC  I C6    1 
ATOM   1530  P  P     . DA  A  1 76  ? -13.867 -29.904 94.493 1.00 79.92  ? 3    DA  I P     1 
ATOM   1531  O  OP1   . DA  A  1 76  ? -14.433 -29.977 95.864 1.00 79.84  ? 3    DA  I OP1   1 
ATOM   1532  O  OP2   . DA  A  1 76  ? -12.676 -29.056 94.202 1.00 78.30  ? 3    DA  I OP2   1 
ATOM   1533  O  "O5'" . DA  A  1 76  ? -13.606 -31.399 93.983 1.00 78.83  ? 3    DA  I "O5'" 1 
ATOM   1534  C  "C5'" . DA  A  1 76  ? -14.701 -32.287 93.724 1.00 77.78  ? 3    DA  I "C5'" 1 
ATOM   1535  C  "C4'" . DA  A  1 76  ? -14.421 -33.114 92.475 1.00 77.67  ? 3    DA  I "C4'" 1 
ATOM   1536  O  "O4'" . DA  A  1 76  ? -14.423 -32.281 91.279 1.00 78.00  ? 3    DA  I "O4'" 1 
ATOM   1537  C  "C3'" . DA  A  1 76  ? -13.077 -33.840 92.462 1.00 76.99  ? 3    DA  I "C3'" 1 
ATOM   1538  O  "O3'" . DA  A  1 76  ? -13.294 -35.142 91.902 1.00 75.61  ? 3    DA  I "O3'" 1 
ATOM   1539  C  "C2'" . DA  A  1 76  ? -12.176 -32.928 91.614 1.00 76.99  ? 3    DA  I "C2'" 1 
ATOM   1540  C  "C1'" . DA  A  1 76  ? -13.178 -32.370 90.602 1.00 77.25  ? 3    DA  I "C1'" 1 
ATOM   1541  N  N9    . DA  A  1 76  ? -12.875 -31.053 90.044 1.00 77.32  ? 3    DA  I N9    1 
ATOM   1542  C  C8    . DA  A  1 76  ? -12.312 -29.978 90.675 1.00 77.21  ? 3    DA  I C8    1 
ATOM   1543  N  N7    . DA  A  1 76  ? -12.174 -28.919 89.907 1.00 77.40  ? 3    DA  I N7    1 
ATOM   1544  C  C5    . DA  A  1 76  ? -12.682 -29.319 88.685 1.00 77.43  ? 3    DA  I C5    1 
ATOM   1545  C  C6    . DA  A  1 76  ? -12.827 -28.660 87.446 1.00 77.14  ? 3    DA  I C6    1 
ATOM   1546  N  N6    . DA  A  1 76  ? -12.454 -27.398 87.229 1.00 77.16  ? 3    DA  I N6    1 
ATOM   1547  N  N1    . DA  A  1 76  ? -13.382 -29.349 86.425 1.00 77.11  ? 3    DA  I N1    1 
ATOM   1548  C  C2    . DA  A  1 76  ? -13.760 -30.620 86.628 1.00 77.11  ? 3    DA  I C2    1 
ATOM   1549  N  N3    . DA  A  1 76  ? -13.677 -31.348 87.742 1.00 77.36  ? 3    DA  I N3    1 
ATOM   1550  C  C4    . DA  A  1 76  ? -13.124 -30.634 88.749 1.00 77.92  ? 3    DA  I C4    1 
ATOM   1551  P  P     . DG  A  1 77  ? -12.100 -36.188 91.665 1.00 74.83  ? 4    DG  I P     1 
ATOM   1552  O  OP1   . DG  A  1 77  ? -12.688 -37.539 91.860 1.00 74.72  ? 4    DG  I OP1   1 
ATOM   1553  O  OP2   . DG  A  1 77  ? -10.901 -35.727 92.408 1.00 73.57  ? 4    DG  I OP2   1 
ATOM   1554  O  "O5'" . DG  A  1 77  ? -11.749 -36.055 90.118 1.00 72.43  ? 4    DG  I "O5'" 1 
ATOM   1555  C  "C5'" . DG  A  1 77  ? -12.784 -36.038 89.142 1.00 70.19  ? 4    DG  I "C5'" 1 
ATOM   1556  C  "C4'" . DG  A  1 77  ? -12.177 -35.816 87.770 1.00 67.70  ? 4    DG  I "C4'" 1 
ATOM   1557  O  "O4'" . DG  A  1 77  ? -11.820 -34.432 87.554 1.00 65.99  ? 4    DG  I "O4'" 1 
ATOM   1558  C  "C3'" . DG  A  1 77  ? -10.906 -36.601 87.518 1.00 66.84  ? 4    DG  I "C3'" 1 
ATOM   1559  O  "O3'" . DG  A  1 77  ? -11.095 -37.102 86.238 1.00 67.20  ? 4    DG  I "O3'" 1 
ATOM   1560  C  "C2'" . DG  A  1 77  ? -9.777  -35.569 87.607 1.00 65.87  ? 4    DG  I "C2'" 1 
ATOM   1561  C  "C1'" . DG  A  1 77  ? -10.490 -34.338 87.069 1.00 64.86  ? 4    DG  I "C1'" 1 
ATOM   1562  N  N9    . DG  A  1 77  ? -10.019 -33.018 87.490 1.00 64.36  ? 4    DG  I N9    1 
ATOM   1563  C  C8    . DG  A  1 77  ? -9.491  -32.625 88.695 1.00 63.96  ? 4    DG  I C8    1 
ATOM   1564  N  N7    . DG  A  1 77  ? -9.202  -31.350 88.747 1.00 64.12  ? 4    DG  I N7    1 
ATOM   1565  C  C5    . DG  A  1 77  ? -9.576  -30.856 87.503 1.00 64.02  ? 4    DG  I C5    1 
ATOM   1566  C  C6    . DG  A  1 77  ? -9.512  -29.543 86.966 1.00 63.80  ? 4    DG  I C6    1 
ATOM   1567  O  O6    . DG  A  1 77  ? -9.100  -28.504 87.489 1.00 63.47  ? 4    DG  I O6    1 
ATOM   1568  N  N1    . DG  A  1 77  ? -9.992  -29.500 85.661 1.00 64.30  ? 4    DG  I N1    1 
ATOM   1569  C  C2    . DG  A  1 77  ? -10.487 -30.585 84.965 1.00 64.06  ? 4    DG  I C2    1 
ATOM   1570  N  N2    . DG  A  1 77  ? -10.917 -30.351 83.718 1.00 63.98  ? 4    DG  I N2    1 
ATOM   1571  N  N3    . DG  A  1 77  ? -10.556 -31.815 85.458 1.00 63.19  ? 4    DG  I N3    1 
ATOM   1572  C  C4    . DG  A  1 77  ? -10.086 -31.876 86.724 1.00 63.84  ? 4    DG  I C4    1 
ATOM   1573  P  P     . DC  A  1 78  ? -10.222 -38.310 85.700 1.00 68.54  ? 5    DC  I P     1 
ATOM   1574  O  OP1   . DC  A  1 78  ? -11.209 -39.335 85.275 1.00 69.16  ? 5    DC  I OP1   1 
ATOM   1575  O  OP2   . DC  A  1 78  ? -9.142  -38.606 86.673 1.00 68.37  ? 5    DC  I OP2   1 
ATOM   1576  O  "O5'" . DC  A  1 78  ? -9.491  -37.713 84.401 1.00 67.97  ? 5    DC  I "O5'" 1 
ATOM   1577  C  "C5'" . DC  A  1 78  ? -10.159 -36.824 83.486 1.00 65.93  ? 5    DC  I "C5'" 1 
ATOM   1578  C  "C4'" . DC  A  1 78  ? -9.158  -35.870 82.857 1.00 64.54  ? 5    DC  I "C4'" 1 
ATOM   1579  O  "O4'" . DC  A  1 78  ? -8.815  -34.858 83.834 1.00 64.31  ? 5    DC  I "O4'" 1 
ATOM   1580  C  "C3'" . DC  A  1 78  ? -7.815  -36.478 82.420 1.00 63.64  ? 5    DC  I "C3'" 1 
ATOM   1581  O  "O3'" . DC  A  1 78  ? -7.494  -36.036 81.118 1.00 62.29  ? 5    DC  I "O3'" 1 
ATOM   1582  C  "C2'" . DC  A  1 78  ? -6.789  -35.911 83.404 1.00 63.69  ? 5    DC  I "C2'" 1 
ATOM   1583  C  "C1'" . DC  A  1 78  ? -7.439  -34.562 83.662 1.00 63.68  ? 5    DC  I "C1'" 1 
ATOM   1584  N  N1    . DC  A  1 78  ? -6.984  -33.804 84.853 1.00 63.47  ? 5    DC  I N1    1 
ATOM   1585  C  C2    . DC  A  1 78  ? -7.109  -32.408 84.830 1.00 63.07  ? 5    DC  I C2    1 
ATOM   1586  O  O2    . DC  A  1 78  ? -7.586  -31.853 83.823 1.00 63.45  ? 5    DC  I O2    1 
ATOM   1587  N  N3    . DC  A  1 78  ? -6.709  -31.705 85.918 1.00 62.64  ? 5    DC  I N3    1 
ATOM   1588  C  C4    . DC  A  1 78  ? -6.210  -32.340 86.979 1.00 63.33  ? 5    DC  I C4    1 
ATOM   1589  N  N4    . DC  A  1 78  ? -5.834  -31.606 88.030 1.00 63.16  ? 5    DC  I N4    1 
ATOM   1590  C  C5    . DC  A  1 78  ? -6.076  -33.763 87.015 1.00 63.66  ? 5    DC  I C5    1 
ATOM   1591  C  C6    . DC  A  1 78  ? -6.477  -34.452 85.942 1.00 63.51  ? 5    DC  I C6    1 
ATOM   1592  P  P     . DT  A  1 79  ? -7.429  -37.014 79.853 1.00 62.11  ? 6    DT  I P     1 
ATOM   1593  O  OP1   . DT  A  1 79  ? -8.375  -38.133 80.082 1.00 62.06  ? 6    DT  I OP1   1 
ATOM   1594  O  OP2   . DT  A  1 79  ? -5.979  -37.260 79.589 1.00 59.02  ? 6    DT  I OP2   1 
ATOM   1595  O  "O5'" . DT  A  1 79  ? -8.115  -36.163 78.664 1.00 58.22  ? 6    DT  I "O5'" 1 
ATOM   1596  C  "C5'" . DT  A  1 79  ? -8.877  -34.994 78.932 1.00 54.30  ? 6    DT  I "C5'" 1 
ATOM   1597  C  "C4'" . DT  A  1 79  ? -8.204  -33.717 78.451 1.00 51.79  ? 6    DT  I "C4'" 1 
ATOM   1598  O  "O4'" . DT  A  1 79  ? -7.537  -33.023 79.537 1.00 50.10  ? 6    DT  I "O4'" 1 
ATOM   1599  C  "C3'" . DT  A  1 79  ? -7.149  -33.836 77.357 1.00 51.03  ? 6    DT  I "C3'" 1 
ATOM   1600  O  "O3'" . DT  A  1 79  ? -7.235  -32.636 76.654 1.00 49.70  ? 6    DT  I "O3'" 1 
ATOM   1601  C  "C2'" . DT  A  1 79  ? -5.844  -33.843 78.132 1.00 50.48  ? 6    DT  I "C2'" 1 
ATOM   1602  C  "C1'" . DT  A  1 79  ? -6.197  -32.775 79.154 1.00 52.02  ? 6    DT  I "C1'" 1 
ATOM   1603  N  N1    . DT  A  1 79  ? -5.330  -32.721 80.363 1.00 52.91  ? 6    DT  I N1    1 
ATOM   1604  C  C2    . DT  A  1 79  ? -5.126  -31.494 80.945 1.00 52.73  ? 6    DT  I C2    1 
ATOM   1605  O  O2    . DT  A  1 79  ? -5.608  -30.463 80.519 1.00 53.29  ? 6    DT  I O2    1 
ATOM   1606  N  N3    . DT  A  1 79  ? -4.330  -31.513 82.052 1.00 52.58  ? 6    DT  I N3    1 
ATOM   1607  C  C4    . DT  A  1 79  ? -3.726  -32.606 82.637 1.00 53.20  ? 6    DT  I C4    1 
ATOM   1608  O  O4    . DT  A  1 79  ? -3.021  -32.482 83.645 1.00 53.68  ? 6    DT  I O4    1 
ATOM   1609  C  C5    . DT  A  1 79  ? -3.988  -33.873 81.984 1.00 53.51  ? 6    DT  I C5    1 
ATOM   1610  C  C7    . DT  A  1 79  ? -3.405  -35.157 82.506 1.00 53.16  ? 6    DT  I C7    1 
ATOM   1611  C  C6    . DT  A  1 79  ? -4.766  -33.866 80.892 1.00 53.32  ? 6    DT  I C6    1 
ATOM   1612  P  P     . DG  A  1 80  ? -7.015  -32.467 75.091 1.00 47.65  ? 7    DG  I P     1 
ATOM   1613  O  OP1   . DG  A  1 80  ? -8.353  -32.056 74.600 1.00 47.72  ? 7    DG  I OP1   1 
ATOM   1614  O  OP2   . DG  A  1 80  ? -6.268  -33.607 74.516 1.00 46.50  ? 7    DG  I OP2   1 
ATOM   1615  O  "O5'" . DG  A  1 80  ? -5.991  -31.236 75.046 1.00 44.98  ? 7    DG  I "O5'" 1 
ATOM   1616  C  "C5'" . DG  A  1 80  ? -6.312  -29.973 75.567 1.00 40.34  ? 7    DG  I "C5'" 1 
ATOM   1617  C  "C4'" . DG  A  1 80  ? -5.043  -29.198 75.853 1.00 39.04  ? 7    DG  I "C4'" 1 
ATOM   1618  O  "O4'" . DG  A  1 80  ? -4.407  -29.726 77.039 1.00 39.38  ? 7    DG  I "O4'" 1 
ATOM   1619  C  "C3'" . DG  A  1 80  ? -3.960  -29.147 74.780 1.00 38.12  ? 7    DG  I "C3'" 1 
ATOM   1620  O  "O3'" . DG  A  1 80  ? -3.437  -27.845 74.826 1.00 35.64  ? 7    DG  I "O3'" 1 
ATOM   1621  C  "C2'" . DG  A  1 80  ? -2.935  -30.156 75.280 1.00 39.27  ? 7    DG  I "C2'" 1 
ATOM   1622  C  "C1'" . DG  A  1 80  ? -3.035  -29.937 76.781 1.00 41.60  ? 7    DG  I "C1'" 1 
ATOM   1623  N  N9    . DG  A  1 80  ? -2.636  -31.053 77.632 1.00 42.18  ? 7    DG  I N9    1 
ATOM   1624  C  C8    . DG  A  1 80  ? -2.778  -32.399 77.402 1.00 42.32  ? 7    DG  I C8    1 
ATOM   1625  N  N7    . DG  A  1 80  ? -2.336  -33.144 78.363 1.00 41.95  ? 7    DG  I N7    1 
ATOM   1626  C  C5    . DG  A  1 80  ? -1.870  -32.232 79.302 1.00 43.20  ? 7    DG  I C5    1 
ATOM   1627  C  C6    . DG  A  1 80  ? -1.269  -32.433 80.575 1.00 43.20  ? 7    DG  I C6    1 
ATOM   1628  O  O6    . DG  A  1 80  ? -1.029  -33.507 81.154 1.00 43.20  ? 7    DG  I O6    1 
ATOM   1629  N  N1    . DG  A  1 80  ? -0.946  -31.225 81.195 1.00 42.86  ? 7    DG  I N1    1 
ATOM   1630  C  C2    . DG  A  1 80  ? -1.170  -29.968 80.671 1.00 42.36  ? 7    DG  I C2    1 
ATOM   1631  N  N2    . DG  A  1 80  ? -0.798  -28.910 81.416 1.00 42.06  ? 7    DG  I N2    1 
ATOM   1632  N  N3    . DG  A  1 80  ? -1.728  -29.777 79.486 1.00 42.81  ? 7    DG  I N3    1 
ATOM   1633  C  C4    . DG  A  1 80  ? -2.055  -30.940 78.866 1.00 42.82  ? 7    DG  I C4    1 
ATOM   1634  P  P     . DA  A  1 81  ? -2.451  -27.234 73.741 1.00 34.84  ? 8    DA  I P     1 
ATOM   1635  O  OP1   . DA  A  1 81  ? -3.257  -26.475 72.772 1.00 36.92  ? 8    DA  I OP1   1 
ATOM   1636  O  OP2   . DA  A  1 81  ? -1.446  -28.193 73.273 1.00 34.58  ? 8    DA  I OP2   1 
ATOM   1637  O  "O5'" . DA  A  1 81  ? -1.634  -26.190 74.620 1.00 35.17  ? 8    DA  I "O5'" 1 
ATOM   1638  C  "C5'" . DA  A  1 81  ? -2.196  -25.570 75.761 1.00 35.74  ? 8    DA  I "C5'" 1 
ATOM   1639  C  "C4'" . DA  A  1 81  ? -1.091  -24.872 76.534 1.00 36.76  ? 8    DA  I "C4'" 1 
ATOM   1640  O  "O4'" . DA  A  1 81  ? -0.546  -25.766 77.530 1.00 36.86  ? 8    DA  I "O4'" 1 
ATOM   1641  C  "C3'" . DA  A  1 81  ? 0.093   -24.374 75.699 1.00 37.02  ? 8    DA  I "C3'" 1 
ATOM   1642  O  "O3'" . DA  A  1 81  ? 0.579   -23.188 76.269 1.00 38.02  ? 8    DA  I "O3'" 1 
ATOM   1643  C  "C2'" . DA  A  1 81  ? 1.124   -25.477 75.823 1.00 38.17  ? 8    DA  I "C2'" 1 
ATOM   1644  C  "C1'" . DA  A  1 81  ? 0.791   -26.094 77.175 1.00 40.05  ? 8    DA  I "C1'" 1 
ATOM   1645  N  N9    . DA  A  1 81  ? 0.882   -27.552 77.150 1.00 40.78  ? 8    DA  I N9    1 
ATOM   1646  C  C8    . DA  A  1 81  ? 0.541   -28.376 76.129 1.00 40.42  ? 8    DA  I C8    1 
ATOM   1647  N  N7    . DA  A  1 81  ? 0.722   -29.634 76.401 1.00 40.97  ? 8    DA  I N7    1 
ATOM   1648  C  C5    . DA  A  1 81  ? 1.222   -29.634 77.682 1.00 41.13  ? 8    DA  I C5    1 
ATOM   1649  C  C6    . DA  A  1 81  ? 1.626   -30.672 78.541 1.00 40.68  ? 8    DA  I C6    1 
ATOM   1650  N  N6    . DA  A  1 81  ? 1.572   -31.965 78.229 1.00 39.76  ? 8    DA  I N6    1 
ATOM   1651  N  N1    . DA  A  1 81  ? 2.077   -30.315 79.754 1.00 41.24  ? 8    DA  I N1    1 
ATOM   1652  C  C2    . DA  A  1 81  ? 2.124   -29.020 80.102 1.00 40.95  ? 8    DA  I C2    1 
ATOM   1653  N  N3    . DA  A  1 81  ? 1.776   -27.960 79.382 1.00 41.04  ? 8    DA  I N3    1 
ATOM   1654  C  C4    . DA  A  1 81  ? 1.327   -28.351 78.168 1.00 41.31  ? 8    DA  I C4    1 
ATOM   1655  P  P     . DA  A  1 82  ? 1.785   -22.337 75.660 1.00 38.48  ? 9    DA  I P     1 
ATOM   1656  O  OP1   . DA  A  1 82  ? 1.439   -20.936 76.012 1.00 39.19  ? 9    DA  I OP1   1 
ATOM   1657  O  OP2   . DA  A  1 82  ? 2.033   -22.761 74.287 1.00 38.32  ? 9    DA  I OP2   1 
ATOM   1658  O  "O5'" . DA  A  1 82  ? 3.092   -22.753 76.480 1.00 40.38  ? 9    DA  I "O5'" 1 
ATOM   1659  C  "C5'" . DA  A  1 82  ? 3.069   -22.692 77.927 1.00 40.36  ? 9    DA  I "C5'" 1 
ATOM   1660  C  "C4'" . DA  A  1 82  ? 4.312   -23.294 78.556 1.00 40.21  ? 9    DA  I "C4'" 1 
ATOM   1661  O  "O4'" . DA  A  1 82  ? 4.141   -24.715 78.534 1.00 41.72  ? 9    DA  I "O4'" 1 
ATOM   1662  C  "C3'" . DA  A  1 82  ? 5.652   -23.027 77.879 1.00 40.29  ? 9    DA  I "C3'" 1 
ATOM   1663  O  "O3'" . DA  A  1 82  ? 6.500   -22.479 78.862 1.00 42.14  ? 9    DA  I "O3'" 1 
ATOM   1664  C  "C2'" . DA  A  1 82  ? 6.163   -24.387 77.406 1.00 39.64  ? 9    DA  I "C2'" 1 
ATOM   1665  C  "C1'" . DA  A  1 82  ? 5.378   -25.347 78.274 1.00 42.34  ? 9    DA  I "C1'" 1 
ATOM   1666  N  N9    . DA  A  1 82  ? 5.066   -26.638 77.661 1.00 43.07  ? 9    DA  I N9    1 
ATOM   1667  C  C8    . DA  A  1 82  ? 4.557   -26.852 76.412 1.00 43.84  ? 9    DA  I C8    1 
ATOM   1668  N  N7    . DA  A  1 82  ? 4.365   -28.115 76.122 1.00 44.25  ? 9    DA  I N7    1 
ATOM   1669  C  C5    . DA  A  1 82  ? 4.758   -28.774 77.271 1.00 43.54  ? 9    DA  I C5    1 
ATOM   1670  C  C6    . DA  A  1 82  ? 4.800   -30.134 77.610 1.00 43.45  ? 9    DA  I C6    1 
ATOM   1671  N  N6    . DA  A  1 82  ? 4.423   -31.105 76.775 1.00 43.92  ? 9    DA  I N6    1 
ATOM   1672  N  N1    . DA  A  1 82  ? 5.243   -30.470 78.833 1.00 42.88  ? 9    DA  I N1    1 
ATOM   1673  C  C2    . DA  A  1 82  ? 5.639   -29.511 79.664 1.00 43.26  ? 9    DA  I C2    1 
ATOM   1674  N  N3    . DA  A  1 82  ? 5.654   -28.195 79.454 1.00 44.57  ? 9    DA  I N3    1 
ATOM   1675  C  C4    . DA  A  1 82  ? 5.196   -27.885 78.225 1.00 43.54  ? 9    DA  I C4    1 
ATOM   1676  P  P     . DC  A  1 83  ? 7.998   -21.992 78.582 1.00 43.28  ? 10   DC  I P     1 
ATOM   1677  O  OP1   . DC  A  1 83  ? 8.293   -21.068 79.702 1.00 44.37  ? 10   DC  I OP1   1 
ATOM   1678  O  OP2   . DC  A  1 83  ? 8.156   -21.600 77.160 1.00 42.93  ? 10   DC  I OP2   1 
ATOM   1679  O  "O5'" . DC  A  1 83  ? 8.895   -23.299 78.708 1.00 45.50  ? 10   DC  I "O5'" 1 
ATOM   1680  C  "C5'" . DC  A  1 83  ? 9.004   -23.970 79.929 1.00 48.77  ? 10   DC  I "C5'" 1 
ATOM   1681  C  "C4'" . DC  A  1 83  ? 9.904   -25.167 79.725 1.00 51.39  ? 10   DC  I "C4'" 1 
ATOM   1682  O  "O4'" . DC  A  1 83  ? 9.149   -26.250 79.140 1.00 51.34  ? 10   DC  I "O4'" 1 
ATOM   1683  C  "C3'" . DC  A  1 83  ? 11.090  -24.931 78.809 1.00 53.13  ? 10   DC  I "C3'" 1 
ATOM   1684  O  "O3'" . DC  A  1 83  ? 12.214  -25.405 79.502 1.00 57.82  ? 10   DC  I "O3'" 1 
ATOM   1685  C  "C2'" . DC  A  1 83  ? 10.798  -25.809 77.601 1.00 52.52  ? 10   DC  I "C2'" 1 
ATOM   1686  C  "C1'" . DC  A  1 83  ? 9.984   -26.915 78.247 1.00 51.65  ? 10   DC  I "C1'" 1 
ATOM   1687  N  N1    . DC  A  1 83  ? 9.104   -27.627 77.322 1.00 52.07  ? 10   DC  I N1    1 
ATOM   1688  C  C2    . DC  A  1 83  ? 8.741   -28.941 77.617 1.00 52.06  ? 10   DC  I C2    1 
ATOM   1689  O  O2    . DC  A  1 83  ? 9.160   -29.460 78.651 1.00 52.31  ? 10   DC  I O2    1 
ATOM   1690  N  N3    . DC  A  1 83  ? 7.936   -29.604 76.756 1.00 52.38  ? 10   DC  I N3    1 
ATOM   1691  C  C4    . DC  A  1 83  ? 7.514   -28.994 75.644 1.00 52.22  ? 10   DC  I C4    1 
ATOM   1692  N  N4    . DC  A  1 83  ? 6.723   -29.687 74.829 1.00 52.32  ? 10   DC  I N4    1 
ATOM   1693  C  C5    . DC  A  1 83  ? 7.865   -27.648 75.318 1.00 51.95  ? 10   DC  I C5    1 
ATOM   1694  C  C6    . DC  A  1 83  ? 8.655   -27.006 76.183 1.00 52.42  ? 10   DC  I C6    1 
ATOM   1695  P  P     . DA  A  1 84  ? 13.707  -24.989 79.113 1.00 61.37  ? 11   DA  I P     1 
ATOM   1696  O  OP1   . DA  A  1 84  ? 14.073  -23.877 80.024 1.00 60.85  ? 11   DA  I OP1   1 
ATOM   1697  O  OP2   . DA  A  1 84  ? 13.844  -24.824 77.648 1.00 60.46  ? 11   DA  I OP2   1 
ATOM   1698  O  "O5'" . DA  A  1 84  ? 14.517  -26.314 79.514 1.00 64.86  ? 11   DA  I "O5'" 1 
ATOM   1699  C  "C5'" . DA  A  1 84  ? 14.085  -27.143 80.602 1.00 69.21  ? 11   DA  I "C5'" 1 
ATOM   1700  C  "C4'" . DA  A  1 84  ? 14.516  -28.579 80.367 1.00 72.55  ? 11   DA  I "C4'" 1 
ATOM   1701  O  "O4'" . DA  A  1 84  ? 13.490  -29.272 79.604 1.00 73.86  ? 11   DA  I "O4'" 1 
ATOM   1702  C  "C3'" . DA  A  1 84  ? 15.831  -28.705 79.600 1.00 74.62  ? 11   DA  I "C3'" 1 
ATOM   1703  O  "O3'" . DA  A  1 84  ? 16.703  -29.687 80.176 1.00 78.00  ? 11   DA  I "O3'" 1 
ATOM   1704  C  "C2'" . DA  A  1 84  ? 15.387  -29.111 78.207 1.00 75.00  ? 11   DA  I "C2'" 1 
ATOM   1705  C  "C1'" . DA  A  1 84  ? 14.044  -29.806 78.414 1.00 75.23  ? 11   DA  I "C1'" 1 
ATOM   1706  N  N9    . DA  A  1 84  ? 13.235  -29.593 77.207 1.00 75.52  ? 11   DA  I N9    1 
ATOM   1707  C  C8    . DA  A  1 84  ? 13.070  -28.406 76.535 1.00 75.58  ? 11   DA  I C8    1 
ATOM   1708  N  N7    . DA  A  1 84  ? 12.338  -28.481 75.453 1.00 75.42  ? 11   DA  I N7    1 
ATOM   1709  C  C5    . DA  A  1 84  ? 11.997  -29.822 75.398 1.00 75.92  ? 11   DA  I C5    1 
ATOM   1710  C  C6    . DA  A  1 84  ? 11.220  -30.561 74.475 1.00 75.63  ? 11   DA  I C6    1 
ATOM   1711  N  N6    . DA  A  1 84  ? 10.633  -30.000 73.410 1.00 75.22  ? 11   DA  I N6    1 
ATOM   1712  N  N1    . DA  A  1 84  ? 11.074  -31.893 74.699 1.00 75.51  ? 11   DA  I N1    1 
ATOM   1713  C  C2    . DA  A  1 84  ? 11.661  -32.449 75.775 1.00 75.45  ? 11   DA  I C2    1 
ATOM   1714  N  N3    . DA  A  1 84  ? 12.417  -31.854 76.710 1.00 75.96  ? 11   DA  I N3    1 
ATOM   1715  C  C4    . DA  A  1 84  ? 12.549  -30.530 76.464 1.00 75.98  ? 11   DA  I C4    1 
ATOM   1716  P  P     . DT  A  1 85  ? 18.235  -29.902 79.707 1.00 80.09  ? 12   DT  I P     1 
ATOM   1717  O  OP1   . DT  A  1 85  ? 19.056  -29.891 80.941 1.00 80.08  ? 12   DT  I OP1   1 
ATOM   1718  O  OP2   . DT  A  1 85  ? 18.577  -28.964 78.603 1.00 79.82  ? 12   DT  I OP2   1 
ATOM   1719  O  "O5'" . DT  A  1 85  ? 18.230  -31.382 79.088 1.00 81.77  ? 12   DT  I "O5'" 1 
ATOM   1720  C  "C5'" . DT  A  1 85  ? 17.260  -32.373 79.444 1.00 85.12  ? 12   DT  I "C5'" 1 
ATOM   1721  C  "C4'" . DT  A  1 85  ? 17.025  -33.309 78.276 1.00 87.64  ? 12   DT  I "C4'" 1 
ATOM   1722  O  "O4'" . DT  A  1 85  ? 15.954  -32.768 77.462 1.00 88.85  ? 12   DT  I "O4'" 1 
ATOM   1723  C  "C3'" . DT  A  1 85  ? 18.239  -33.458 77.356 1.00 89.39  ? 12   DT  I "C3'" 1 
ATOM   1724  O  "O3'" . DT  A  1 85  ? 18.786  -34.780 77.354 1.00 91.04  ? 12   DT  I "O3'" 1 
ATOM   1725  C  "C2'" . DT  A  1 85  ? 17.751  -33.058 75.965 1.00 89.29  ? 12   DT  I "C2'" 1 
ATOM   1726  C  "C1'" . DT  A  1 85  ? 16.234  -33.022 76.097 1.00 89.76  ? 12   DT  I "C1'" 1 
ATOM   1727  N  N1    . DT  A  1 85  ? 15.608  -31.998 75.176 1.00 89.91  ? 12   DT  I N1    1 
ATOM   1728  C  C2    . DT  A  1 85  ? 14.694  -32.418 74.225 1.00 90.11  ? 12   DT  I C2    1 
ATOM   1729  O  O2    . DT  A  1 85  ? 14.342  -33.579 74.094 1.00 90.21  ? 12   DT  I O2    1 
ATOM   1730  N  N3    . DT  A  1 85  ? 14.189  -31.415 73.427 1.00 90.08  ? 12   DT  I N3    1 
ATOM   1731  C  C4    . DT  A  1 85  ? 14.504  -30.068 73.472 1.00 90.25  ? 12   DT  I C4    1 
ATOM   1732  O  O4    . DT  A  1 85  ? 13.986  -29.267 72.698 1.00 90.37  ? 12   DT  I O4    1 
ATOM   1733  C  C5    . DT  A  1 85  ? 15.473  -29.688 74.484 1.00 90.36  ? 12   DT  I C5    1 
ATOM   1734  C  C7    . DT  A  1 85  ? 15.913  -28.258 74.649 1.00 90.00  ? 12   DT  I C7    1 
ATOM   1735  C  C6    . DT  A  1 85  ? 15.971  -30.661 75.267 1.00 90.03  ? 12   DT  I C6    1 
ATOM   1736  P  P     . DG  A  1 86  ? 20.289  -35.031 76.824 1.00 92.04  ? 13   DG  I P     1 
ATOM   1737  O  OP1   . DG  A  1 86  ? 21.029  -35.695 77.923 1.00 92.56  ? 13   DG  I OP1   1 
ATOM   1738  O  OP2   . DG  A  1 86  ? 20.835  -33.776 76.244 1.00 91.71  ? 13   DG  I OP2   1 
ATOM   1739  O  "O5'" . DG  A  1 86  ? 20.095  -36.071 75.619 1.00 90.94  ? 13   DG  I "O5'" 1 
ATOM   1740  C  "C5'" . DG  A  1 86  ? 19.098  -37.093 75.624 1.00 89.58  ? 13   DG  I "C5'" 1 
ATOM   1741  C  "C4'" . DG  A  1 86  ? 18.806  -37.540 74.197 1.00 89.04  ? 13   DG  I "C4'" 1 
ATOM   1742  O  "O4'" . DG  A  1 86  ? 17.900  -36.604 73.553 1.00 89.94  ? 13   DG  I "O4'" 1 
ATOM   1743  C  "C3'" . DG  A  1 86  ? 20.016  -37.683 73.269 1.00 87.93  ? 13   DG  I "C3'" 1 
ATOM   1744  O  "O3'" . DG  A  1 86  ? 19.928  -38.962 72.604 1.00 84.65  ? 13   DG  I "O3'" 1 
ATOM   1745  C  "C2'" . DG  A  1 86  ? 19.931  -36.443 72.358 1.00 89.21  ? 13   DG  I "C2'" 1 
ATOM   1746  C  "C1'" . DG  A  1 86  ? 18.428  -36.136 72.318 1.00 90.56  ? 13   DG  I "C1'" 1 
ATOM   1747  N  N9    . DG  A  1 86  ? 18.039  -34.719 72.159 1.00 90.83  ? 13   DG  I N9    1 
ATOM   1748  C  C8    . DG  A  1 86  ? 18.492  -33.660 72.910 1.00 91.10  ? 13   DG  I C8    1 
ATOM   1749  N  N7    . DG  A  1 86  ? 17.983  -32.501 72.584 1.00 91.26  ? 13   DG  I N7    1 
ATOM   1750  C  C5    . DG  A  1 86  ? 17.123  -32.797 71.541 1.00 90.92  ? 13   DG  I C5    1 
ATOM   1751  C  C6    . DG  A  1 86  ? 16.298  -31.921 70.788 1.00 90.81  ? 13   DG  I C6    1 
ATOM   1752  O  O6    . DG  A  1 86  ? 16.183  -30.693 70.922 1.00 90.49  ? 13   DG  I O6    1 
ATOM   1753  N  N1    . DG  A  1 86  ? 15.577  -32.611 69.805 1.00 91.00  ? 13   DG  I N1    1 
ATOM   1754  C  C2    . DG  A  1 86  ? 15.655  -33.978 69.592 1.00 90.84  ? 13   DG  I C2    1 
ATOM   1755  N  N2    . DG  A  1 86  ? 14.892  -34.472 68.612 1.00 90.72  ? 13   DG  I N2    1 
ATOM   1756  N  N3    . DG  A  1 86  ? 16.422  -34.809 70.297 1.00 90.82  ? 13   DG  I N3    1 
ATOM   1757  C  C4    . DG  A  1 86  ? 17.137  -34.157 71.261 1.00 91.08  ? 13   DG  I C4    1 
ATOM   1758  P  P     . DC  A  1 87  ? 20.813  -39.403 71.337 1.00 82.79  ? 14   DC  I P     1 
ATOM   1759  O  OP1   . DC  A  1 87  ? 20.721  -40.883 71.235 1.00 82.00  ? 14   DC  I OP1   1 
ATOM   1760  O  OP2   . DC  A  1 87  ? 22.131  -38.738 71.417 1.00 82.35  ? 14   DC  I OP2   1 
ATOM   1761  O  "O5'" . DC  A  1 87  ? 20.048  -38.730 70.091 1.00 82.29  ? 14   DC  I "O5'" 1 
ATOM   1762  C  "C5'" . DC  A  1 87  ? 19.217  -39.482 69.179 1.00 79.98  ? 14   DC  I "C5'" 1 
ATOM   1763  C  "C4'" . DC  A  1 87  ? 18.967  -38.727 67.876 1.00 77.97  ? 14   DC  I "C4'" 1 
ATOM   1764  O  "O4'" . DC  A  1 87  ? 18.533  -37.375 68.180 1.00 77.47  ? 14   DC  I "O4'" 1 
ATOM   1765  C  "C3'" . DC  A  1 87  ? 20.170  -38.603 66.933 1.00 76.47  ? 14   DC  I "C3'" 1 
ATOM   1766  O  "O3'" . DC  A  1 87  ? 19.813  -38.896 65.572 1.00 74.67  ? 14   DC  I "O3'" 1 
ATOM   1767  C  "C2'" . DC  A  1 87  ? 20.576  -37.142 67.082 1.00 76.36  ? 14   DC  I "C2'" 1 
ATOM   1768  C  "C1'" . DC  A  1 87  ? 19.204  -36.518 67.298 1.00 76.81  ? 14   DC  I "C1'" 1 
ATOM   1769  N  N1    . DC  A  1 87  ? 19.191  -35.160 67.886 1.00 77.38  ? 14   DC  I N1    1 
ATOM   1770  C  C2    . DC  A  1 87  ? 18.355  -34.208 67.284 1.00 77.78  ? 14   DC  I C2    1 
ATOM   1771  O  O2    . DC  A  1 87  ? 17.670  -34.544 66.297 1.00 77.76  ? 14   DC  I O2    1 
ATOM   1772  N  N3    . DC  A  1 87  ? 18.328  -32.951 67.809 1.00 77.21  ? 14   DC  I N3    1 
ATOM   1773  C  C4    . DC  A  1 87  ? 19.087  -32.641 68.866 1.00 76.94  ? 14   DC  I C4    1 
ATOM   1774  N  N4    . DC  A  1 87  ? 19.015  -31.390 69.327 1.00 76.93  ? 14   DC  I N4    1 
ATOM   1775  C  C5    . DC  A  1 87  ? 19.945  -33.601 69.493 1.00 77.29  ? 14   DC  I C5    1 
ATOM   1776  C  C6    . DC  A  1 87  ? 19.963  -34.839 68.977 1.00 77.53  ? 14   DC  I C6    1 
ATOM   1777  P  P     . DC  A  1 88  ? 19.652  -40.396 65.028 1.00 73.46  ? 15   DC  I P     1 
ATOM   1778  O  OP1   . DC  A  1 88  ? 19.267  -41.240 66.184 1.00 72.93  ? 15   DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A  1 88  ? 20.840  -40.739 64.220 1.00 72.50  ? 15   DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A  1 88  ? 18.405  -40.274 64.027 1.00 73.01  ? 15   DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A  1 88  ? 17.075  -40.095 64.570 1.00 71.49  ? 15   DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A  1 88  ? 16.164  -39.257 63.679 1.00 70.34  ? 15   DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A  1 88  ? 16.664  -37.900 63.594 1.00 69.74  ? 15   DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A  1 88  ? 15.991  -39.737 62.234 1.00 69.93  ? 15   DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A  1 88  ? 14.620  -39.549 61.840 1.00 67.90  ? 15   DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A  1 88  ? 16.968  -38.872 61.437 1.00 69.60  ? 15   DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A  1 88  ? 16.956  -37.577 62.248 1.00 70.40  ? 15   DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A  1 88  ? 18.232  -36.797 62.242 1.00 70.89  ? 15   DC  I N1    1 
ATOM   1789  C  C2    . DC  A  1 88  ? 18.173  -35.423 62.491 1.00 70.69  ? 15   DC  I C2    1 
ATOM   1790  O  O2    . DC  A  1 88  ? 17.082  -34.889 62.706 1.00 70.53  ? 15   DC  I O2    1 
ATOM   1791  N  N3    . DC  A  1 88  ? 19.324  -34.716 62.492 1.00 70.99  ? 15   DC  I N3    1 
ATOM   1792  C  C4    . DC  A  1 88  ? 20.484  -35.318 62.249 1.00 70.54  ? 15   DC  I C4    1 
ATOM   1793  N  N4    . DC  A  1 88  ? 21.578  -34.557 62.254 1.00 70.96  ? 15   DC  I N4    1 
ATOM   1794  C  C5    . DC  A  1 88  ? 20.577  -36.713 61.987 1.00 70.37  ? 15   DC  I C5    1 
ATOM   1795  C  C6    . DC  A  1 88  ? 19.434  -37.404 61.999 1.00 70.92  ? 15   DC  I C6    1 
ATOM   1796  P  P     . DT  A  1 89  ? 14.087  -39.873 60.365 1.00 66.79  ? 16   DT  I P     1 
ATOM   1797  O  OP1   . DT  A  1 89  ? 12.730  -40.455 60.519 1.00 66.09  ? 16   DT  I OP1   1 
ATOM   1798  O  OP2   . DT  A  1 89  ? 15.150  -40.514 59.555 1.00 66.55  ? 16   DT  I OP2   1 
ATOM   1799  O  "O5'" . DT  A  1 89  ? 13.972  -38.429 59.697 1.00 65.20  ? 16   DT  I "O5'" 1 
ATOM   1800  C  "C5'" . DT  A  1 89  ? 13.129  -37.421 60.224 1.00 61.20  ? 16   DT  I "C5'" 1 
ATOM   1801  C  "C4'" . DT  A  1 89  ? 13.318  -36.205 59.352 1.00 58.19  ? 16   DT  I "C4'" 1 
ATOM   1802  O  "O4'" . DT  A  1 89  ? 14.680  -35.736 59.462 1.00 57.77  ? 16   DT  I "O4'" 1 
ATOM   1803  C  "C3'" . DT  A  1 89  ? 13.085  -36.454 57.869 1.00 56.63  ? 16   DT  I "C3'" 1 
ATOM   1804  O  "O3'" . DT  A  1 89  ? 12.335  -35.357 57.415 1.00 52.30  ? 16   DT  I "O3'" 1 
ATOM   1805  C  "C2'" . DT  A  1 89  ? 14.493  -36.479 57.273 1.00 57.86  ? 16   DT  I "C2'" 1 
ATOM   1806  C  "C1'" . DT  A  1 89  ? 15.172  -35.461 58.172 1.00 59.74  ? 16   DT  I "C1'" 1 
ATOM   1807  N  N1    . DT  A  1 89  ? 16.650  -35.508 58.272 1.00 60.78  ? 16   DT  I N1    1 
ATOM   1808  C  C2    . DT  A  1 89  ? 17.314  -34.304 58.257 1.00 61.64  ? 16   DT  I C2    1 
ATOM   1809  O  O2    . DT  A  1 89  ? 16.751  -33.236 58.144 1.00 62.14  ? 16   DT  I O2    1 
ATOM   1810  N  N3    . DT  A  1 89  ? 18.676  -34.392 58.369 1.00 62.55  ? 16   DT  I N3    1 
ATOM   1811  C  C4    . DT  A  1 89  ? 19.433  -35.544 58.511 1.00 61.70  ? 16   DT  I C4    1 
ATOM   1812  O  O4    . DT  A  1 89  ? 20.659  -35.492 58.606 1.00 61.72  ? 16   DT  I O4    1 
ATOM   1813  C  C5    . DT  A  1 89  ? 18.680  -36.780 58.526 1.00 61.48  ? 16   DT  I C5    1 
ATOM   1814  C  C7    . DT  A  1 89  ? 19.386  -38.100 58.663 1.00 61.29  ? 16   DT  I C7    1 
ATOM   1815  C  C6    . DT  A  1 89  ? 17.341  -36.703 58.411 1.00 61.12  ? 16   DT  I C6    1 
ATOM   1816  P  P     . DT  A  1 90  ? 11.614  -35.319 56.000 1.00 48.81  ? 17   DT  I P     1 
ATOM   1817  O  OP1   . DT  A  1 90  ? 10.185  -35.529 56.298 1.00 48.88  ? 17   DT  I OP1   1 
ATOM   1818  O  OP2   . DT  A  1 90  ? 12.358  -36.135 55.017 1.00 46.98  ? 17   DT  I OP2   1 
ATOM   1819  O  "O5'" . DT  A  1 90  ? 11.781  -33.788 55.558 1.00 50.78  ? 17   DT  I "O5'" 1 
ATOM   1820  C  "C5'" . DT  A  1 90  ? 11.636  -32.744 56.514 1.00 49.15  ? 17   DT  I "C5'" 1 
ATOM   1821  C  "C4'" . DT  A  1 90  ? 12.675  -31.669 56.317 1.00 50.49  ? 17   DT  I "C4'" 1 
ATOM   1822  O  "O4'" . DT  A  1 90  ? 14.011  -32.198 56.443 1.00 51.83  ? 17   DT  I "O4'" 1 
ATOM   1823  C  "C3'" . DT  A  1 90  ? 12.623  -30.977 54.968 1.00 50.47  ? 17   DT  I "C3'" 1 
ATOM   1824  O  "O3'" . DT  A  1 90  ? 12.344  -29.623 55.169 1.00 48.15  ? 17   DT  I "O3'" 1 
ATOM   1825  C  "C2'" . DT  A  1 90  ? 14.008  -31.171 54.355 1.00 51.35  ? 17   DT  I "C2'" 1 
ATOM   1826  C  "C1'" . DT  A  1 90  ? 14.861  -31.506 55.555 1.00 54.66  ? 17   DT  I "C1'" 1 
ATOM   1827  N  N1    . DT  A  1 90  ? 15.982  -32.437 55.243 1.00 57.17  ? 17   DT  I N1    1 
ATOM   1828  C  C2    . DT  A  1 90  ? 17.297  -32.002 55.306 1.00 57.15  ? 17   DT  I C2    1 
ATOM   1829  O  O2    . DT  A  1 90  ? 17.628  -30.867 55.592 1.00 57.44  ? 17   DT  I O2    1 
ATOM   1830  N  N3    . DT  A  1 90  ? 18.228  -32.967 55.011 1.00 57.15  ? 17   DT  I N3    1 
ATOM   1831  C  C4    . DT  A  1 90  ? 17.988  -34.283 54.671 1.00 56.83  ? 17   DT  I C4    1 
ATOM   1832  O  O4    . DT  A  1 90  ? 18.896  -35.068 54.431 1.00 58.09  ? 17   DT  I O4    1 
ATOM   1833  C  C5    . DT  A  1 90  ? 16.606  -34.679 54.617 1.00 57.13  ? 17   DT  I C5    1 
ATOM   1834  C  C7    . DT  A  1 90  ? 16.234  -36.082 54.256 1.00 56.34  ? 17   DT  I C7    1 
ATOM   1835  C  C6    . DT  A  1 90  ? 15.681  -33.754 54.904 1.00 57.70  ? 17   DT  I C6    1 
ATOM   1836  P  P     . DT  A  1 91  ? 12.118  -28.702 53.893 1.00 48.73  ? 18   DT  I P     1 
ATOM   1837  O  OP1   . DT  A  1 91  ? 11.070  -27.770 54.344 1.00 50.48  ? 18   DT  I OP1   1 
ATOM   1838  O  OP2   . DT  A  1 91  ? 11.904  -29.485 52.657 1.00 46.78  ? 18   DT  I OP2   1 
ATOM   1839  O  "O5'" . DT  A  1 91  ? 13.505  -27.946 53.689 1.00 51.09  ? 18   DT  I "O5'" 1 
ATOM   1840  C  "C5'" . DT  A  1 91  ? 14.159  -27.275 54.760 1.00 56.72  ? 18   DT  I "C5'" 1 
ATOM   1841  C  "C4'" . DT  A  1 91  ? 15.540  -26.822 54.331 1.00 61.17  ? 18   DT  I "C4'" 1 
ATOM   1842  O  "O4'" . DT  A  1 91  ? 16.425  -27.956 54.160 1.00 62.85  ? 18   DT  I "O4'" 1 
ATOM   1843  C  "C3'" . DT  A  1 91  ? 15.584  -26.063 53.011 1.00 64.24  ? 18   DT  I "C3'" 1 
ATOM   1844  O  "O3'" . DT  A  1 91  ? 16.419  -24.924 53.176 1.00 66.65  ? 18   DT  I "O3'" 1 
ATOM   1845  C  "C2'" . DT  A  1 91  ? 16.162  -27.067 52.006 1.00 64.28  ? 18   DT  I "C2'" 1 
ATOM   1846  C  "C1'" . DT  A  1 91  ? 17.077  -27.880 52.907 1.00 65.78  ? 18   DT  I "C1'" 1 
ATOM   1847  N  N1    . DT  A  1 91  ? 17.320  -29.287 52.498 1.00 67.09  ? 18   DT  I N1    1 
ATOM   1848  C  C2    . DT  A  1 91  ? 18.545  -29.862 52.776 1.00 68.11  ? 18   DT  I C2    1 
ATOM   1849  O  O2    . DT  A  1 91  ? 19.461  -29.279 53.324 1.00 68.47  ? 18   DT  I O2    1 
ATOM   1850  N  N3    . DT  A  1 91  ? 18.679  -31.169 52.384 1.00 68.98  ? 18   DT  I N3    1 
ATOM   1851  C  C4    . DT  A  1 91  ? 17.725  -31.944 51.760 1.00 67.85  ? 18   DT  I C4    1 
ATOM   1852  O  O4    . DT  A  1 91  ? 17.947  -33.100 51.458 1.00 67.79  ? 18   DT  I O4    1 
ATOM   1853  C  C5    . DT  A  1 91  ? 16.463  -31.298 51.499 1.00 68.29  ? 18   DT  I C5    1 
ATOM   1854  C  C7    . DT  A  1 91  ? 15.356  -32.053 50.828 1.00 67.92  ? 18   DT  I C7    1 
ATOM   1855  C  C6    . DT  A  1 91  ? 16.321  -30.017 51.877 1.00 68.05  ? 18   DT  I C6    1 
ATOM   1856  P  P     . DT  A  1 92  ? 16.504  -23.815 52.037 1.00 68.09  ? 19   DT  I P     1 
ATOM   1857  O  OP1   . DT  A  1 92  ? 16.657  -22.525 52.746 1.00 68.82  ? 19   DT  I OP1   1 
ATOM   1858  O  OP2   . DT  A  1 92  ? 15.394  -24.023 51.090 1.00 68.53  ? 19   DT  I OP2   1 
ATOM   1859  O  "O5'" . DT  A  1 92  ? 17.835  -24.160 51.238 1.00 71.40  ? 19   DT  I "O5'" 1 
ATOM   1860  C  "C5'" . DT  A  1 92  ? 19.072  -24.153 51.930 1.00 77.84  ? 19   DT  I "C5'" 1 
ATOM   1861  C  "C4'" . DT  A  1 92  ? 20.143  -24.816 51.092 1.00 82.33  ? 19   DT  I "C4'" 1 
ATOM   1862  O  "O4'" . DT  A  1 92  ? 19.865  -26.234 50.970 1.00 84.17  ? 19   DT  I "O4'" 1 
ATOM   1863  C  "C3'" . DT  A  1 92  ? 20.262  -24.274 49.670 1.00 84.75  ? 19   DT  I "C3'" 1 
ATOM   1864  O  "O3'" . DT  A  1 92  ? 21.620  -23.989 49.415 1.00 87.94  ? 19   DT  I "O3'" 1 
ATOM   1865  C  "C2'" . DT  A  1 92  ? 19.781  -25.417 48.786 1.00 84.91  ? 19   DT  I "C2'" 1 
ATOM   1866  C  "C1'" . DT  A  1 92  ? 20.200  -26.603 49.649 1.00 86.46  ? 19   DT  I "C1'" 1 
ATOM   1867  N  N1    . DT  A  1 92  ? 19.569  -27.914 49.306 1.00 87.24  ? 19   DT  I N1    1 
ATOM   1868  C  C2    . DT  A  1 92  ? 20.338  -29.059 49.392 1.00 87.82  ? 19   DT  I C2    1 
ATOM   1869  O  O2    . DT  A  1 92  ? 21.506  -29.055 49.737 1.00 88.00  ? 19   DT  I O2    1 
ATOM   1870  N  N3    . DT  A  1 92  ? 19.686  -30.221 49.059 1.00 87.98  ? 19   DT  I N3    1 
ATOM   1871  C  C4    . DT  A  1 92  ? 18.367  -30.353 48.655 1.00 87.77  ? 19   DT  I C4    1 
ATOM   1872  O  O4    . DT  A  1 92  ? 17.881  -31.447 48.371 1.00 87.57  ? 19   DT  I O4    1 
ATOM   1873  C  C5    . DT  A  1 92  ? 17.618  -29.113 48.585 1.00 87.94  ? 19   DT  I C5    1 
ATOM   1874  C  C7    . DT  A  1 92  ? 16.177  -29.105 48.161 1.00 87.86  ? 19   DT  I C7    1 
ATOM   1875  C  C6    . DT  A  1 92  ? 18.244  -27.972 48.911 1.00 87.63  ? 19   DT  I C6    1 
ATOM   1876  P  P     . DG  A  1 93  ? 22.051  -22.694 48.589 1.00 90.38  ? 20   DG  I P     1 
ATOM   1877  O  OP1   . DG  A  1 93  ? 22.703  -21.798 49.565 1.00 89.86  ? 20   DG  I OP1   1 
ATOM   1878  O  OP2   . DG  A  1 93  ? 20.919  -22.237 47.742 1.00 89.80  ? 20   DG  I OP2   1 
ATOM   1879  O  "O5'" . DG  A  1 93  ? 23.158  -23.255 47.578 1.00 93.80  ? 20   DG  I "O5'" 1 
ATOM   1880  C  "C5'" . DG  A  1 93  ? 24.251  -24.073 48.013 1.00 97.76  ? 20   DG  I "C5'" 1 
ATOM   1881  C  "C4'" . DG  A  1 93  ? 24.651  -25.061 46.925 1.00 100.63 ? 20   DG  I "C4'" 1 
ATOM   1882  O  "O4'" . DG  A  1 93  ? 23.773  -26.220 46.953 1.00 101.59 ? 20   DG  I "O4'" 1 
ATOM   1883  C  "C3'" . DG  A  1 93  ? 24.605  -24.541 45.487 1.00 101.94 ? 20   DG  I "C3'" 1 
ATOM   1884  O  "O3'" . DG  A  1 93  ? 25.722  -25.086 44.799 1.00 103.42 ? 20   DG  I "O3'" 1 
ATOM   1885  C  "C2'" . DG  A  1 93  ? 23.288  -25.118 44.978 1.00 102.55 ? 20   DG  I "C2'" 1 
ATOM   1886  C  "C1'" . DG  A  1 93  ? 23.342  -26.493 45.633 1.00 103.30 ? 20   DG  I "C1'" 1 
ATOM   1887  N  N9    . DG  A  1 93  ? 22.078  -27.241 45.641 1.00 103.85 ? 20   DG  I N9    1 
ATOM   1888  C  C8    . DG  A  1 93  ? 20.802  -26.736 45.759 1.00 104.02 ? 20   DG  I C8    1 
ATOM   1889  N  N7    . DG  A  1 93  ? 19.867  -27.646 45.729 1.00 104.03 ? 20   DG  I N7    1 
ATOM   1890  C  C5    . DG  A  1 93  ? 20.559  -28.840 45.582 1.00 104.16 ? 20   DG  I C5    1 
ATOM   1891  C  C6    . DG  A  1 93  ? 20.079  -30.177 45.489 1.00 104.12 ? 20   DG  I C6    1 
ATOM   1892  O  O6    . DG  A  1 93  ? 18.905  -30.574 45.521 1.00 104.09 ? 20   DG  I O6    1 
ATOM   1893  N  N1    . DG  A  1 93  ? 21.114  -31.106 45.344 1.00 103.89 ? 20   DG  I N1    1 
ATOM   1894  C  C2    . DG  A  1 93  ? 22.452  -30.776 45.292 1.00 103.98 ? 20   DG  I C2    1 
ATOM   1895  N  N2    . DG  A  1 93  ? 23.310  -31.796 45.147 1.00 104.00 ? 20   DG  I N2    1 
ATOM   1896  N  N3    . DG  A  1 93  ? 22.915  -29.531 45.381 1.00 104.18 ? 20   DG  I N3    1 
ATOM   1897  C  C4    . DG  A  1 93  ? 21.921  -28.610 45.525 1.00 104.12 ? 20   DG  I C4    1 
ATOM   1898  P  P     . DA  A  1 94  ? 26.099  -24.761 43.271 1.00 104.58 ? 21   DA  I P     1 
ATOM   1899  O  OP1   . DA  A  1 94  ? 26.790  -23.451 43.278 1.00 104.26 ? 21   DA  I OP1   1 
ATOM   1900  O  OP2   . DA  A  1 94  ? 24.934  -24.956 42.373 1.00 103.82 ? 21   DA  I OP2   1 
ATOM   1901  O  "O5'" . DA  A  1 94  ? 27.146  -25.941 42.948 1.00 105.64 ? 21   DA  I "O5'" 1 
ATOM   1902  C  "C5'" . DA  A  1 94  ? 27.197  -27.177 43.701 1.00 106.86 ? 21   DA  I "C5'" 1 
ATOM   1903  C  "C4'" . DA  A  1 94  ? 27.038  -28.441 42.857 1.00 107.86 ? 21   DA  I "C4'" 1 
ATOM   1904  O  "O4'" . DA  A  1 94  ? 25.731  -29.033 43.110 1.00 108.16 ? 21   DA  I "O4'" 1 
ATOM   1905  C  "C3'" . DA  A  1 94  ? 27.132  -28.286 41.334 1.00 108.92 ? 21   DA  I "C3'" 1 
ATOM   1906  O  "O3'" . DA  A  1 94  ? 27.803  -29.413 40.725 1.00 110.09 ? 21   DA  I "O3'" 1 
ATOM   1907  C  "C2'" . DA  A  1 94  ? 25.662  -28.228 40.928 1.00 108.81 ? 21   DA  I "C2'" 1 
ATOM   1908  C  "C1'" . DA  A  1 94  ? 25.117  -29.304 41.860 1.00 108.73 ? 21   DA  I "C1'" 1 
ATOM   1909  N  N9    . DA  A  1 94  ? 23.653  -29.342 41.954 1.00 108.81 ? 21   DA  I N9    1 
ATOM   1910  C  C8    . DA  A  1 94  ? 22.806  -28.293 42.194 1.00 108.67 ? 21   DA  I C8    1 
ATOM   1911  N  N7    . DA  A  1 94  ? 21.539  -28.627 42.213 1.00 108.66 ? 21   DA  I N7    1 
ATOM   1912  C  C5    . DA  A  1 94  ? 21.551  -29.989 41.963 1.00 108.62 ? 21   DA  I C5    1 
ATOM   1913  C  C6    . DA  A  1 94  ? 20.521  -30.946 41.855 1.00 108.65 ? 21   DA  I C6    1 
ATOM   1914  N  N6    . DA  A  1 94  ? 19.230  -30.638 41.996 1.00 108.67 ? 21   DA  I N6    1 
ATOM   1915  N  N1    . DA  A  1 94  ? 20.863  -32.230 41.598 1.00 108.70 ? 21   DA  I N1    1 
ATOM   1916  C  C2    . DA  A  1 94  ? 22.161  -32.534 41.458 1.00 108.71 ? 21   DA  I C2    1 
ATOM   1917  N  N3    . DA  A  1 94  ? 23.217  -31.721 41.540 1.00 108.86 ? 21   DA  I N3    1 
ATOM   1918  C  C4    . DA  A  1 94  ? 22.844  -30.449 41.796 1.00 108.81 ? 21   DA  I C4    1 
ATOM   1919  P  P     . DT  A  1 95  ? 28.261  -29.428 39.180 1.00 110.90 ? 22   DT  I P     1 
ATOM   1920  O  OP1   . DT  A  1 95  ? 29.662  -29.908 39.158 1.00 111.20 ? 22   DT  I OP1   1 
ATOM   1921  O  OP2   . DT  A  1 95  ? 27.919  -28.125 38.562 1.00 110.76 ? 22   DT  I OP2   1 
ATOM   1922  O  "O5'" . DT  A  1 95  ? 27.327  -30.528 38.486 1.00 111.27 ? 22   DT  I "O5'" 1 
ATOM   1923  C  "C5'" . DT  A  1 95  ? 27.353  -31.903 38.879 1.00 112.39 ? 22   DT  I "C5'" 1 
ATOM   1924  C  "C4'" . DT  A  1 95  ? 26.281  -32.701 38.149 1.00 113.16 ? 22   DT  I "C4'" 1 
ATOM   1925  O  "O4'" . DT  A  1 95  ? 24.941  -32.269 38.522 1.00 113.66 ? 22   DT  I "O4'" 1 
ATOM   1926  C  "C3'" . DT  A  1 95  ? 26.330  -32.627 36.622 1.00 113.26 ? 22   DT  I "C3'" 1 
ATOM   1927  O  "O3'" . DT  A  1 95  ? 26.431  -33.945 36.110 1.00 112.68 ? 22   DT  I "O3'" 1 
ATOM   1928  C  "C2'" . DT  A  1 95  ? 24.998  -31.986 36.223 1.00 113.55 ? 22   DT  I "C2'" 1 
ATOM   1929  C  "C1'" . DT  A  1 95  ? 24.112  -32.424 37.384 1.00 114.07 ? 22   DT  I "C1'" 1 
ATOM   1930  N  N1    . DT  A  1 95  ? 22.837  -31.642 37.545 1.00 114.30 ? 22   DT  I N1    1 
ATOM   1931  C  C2    . DT  A  1 95  ? 21.620  -32.306 37.668 1.00 114.33 ? 22   DT  I C2    1 
ATOM   1932  O  O2    . DT  A  1 95  ? 21.487  -33.522 37.655 1.00 114.25 ? 22   DT  I O2    1 
ATOM   1933  N  N3    . DT  A  1 95  ? 20.534  -31.473 37.809 1.00 114.25 ? 22   DT  I N3    1 
ATOM   1934  C  C4    . DT  A  1 95  ? 20.536  -30.085 37.838 1.00 114.39 ? 22   DT  I C4    1 
ATOM   1935  O  O4    . DT  A  1 95  ? 19.502  -29.437 37.970 1.00 114.39 ? 22   DT  I O4    1 
ATOM   1936  C  C5    . DT  A  1 95  ? 21.834  -29.457 37.703 1.00 114.51 ? 22   DT  I C5    1 
ATOM   1937  C  C7    . DT  A  1 95  ? 21.978  -27.961 37.716 1.00 114.31 ? 22   DT  I C7    1 
ATOM   1938  C  C6    . DT  A  1 95  ? 22.902  -30.257 37.566 1.00 114.53 ? 22   DT  I C6    1 
ATOM   1939  P  P     . DG  A  1 96  ? 27.061  -34.213 34.665 1.00 111.98 ? 23   DG  I P     1 
ATOM   1940  O  OP1   . DG  A  1 96  ? 28.525  -34.025 34.811 1.00 112.19 ? 23   DG  I OP1   1 
ATOM   1941  O  OP2   . DG  A  1 96  ? 26.301  -33.447 33.641 1.00 111.18 ? 23   DG  I OP2   1 
ATOM   1942  O  "O5'" . DG  A  1 96  ? 26.738  -35.775 34.487 1.00 110.73 ? 23   DG  I "O5'" 1 
ATOM   1943  C  "C5'" . DG  A  1 96  ? 26.247  -36.290 33.255 1.00 108.54 ? 23   DG  I "C5'" 1 
ATOM   1944  C  "C4'" . DG  A  1 96  ? 24.967  -37.086 33.452 1.00 106.62 ? 23   DG  I "C4'" 1 
ATOM   1945  O  "O4'" . DG  A  1 96  ? 23.931  -36.267 34.060 1.00 105.88 ? 23   DG  I "O4'" 1 
ATOM   1946  C  "C3'" . DG  A  1 96  ? 24.359  -37.598 32.155 1.00 105.72 ? 23   DG  I "C3'" 1 
ATOM   1947  O  "O3'" . DG  A  1 96  ? 23.714  -38.847 32.393 1.00 104.68 ? 23   DG  I "O3'" 1 
ATOM   1948  C  "C2'" . DG  A  1 96  ? 23.376  -36.484 31.796 1.00 105.24 ? 23   DG  I "C2'" 1 
ATOM   1949  C  "C1'" . DG  A  1 96  ? 22.826  -36.146 33.177 1.00 104.60 ? 23   DG  I "C1'" 1 
ATOM   1950  N  N9    . DG  A  1 96  ? 22.238  -34.808 33.307 1.00 104.17 ? 23   DG  I N9    1 
ATOM   1951  C  C8    . DG  A  1 96  ? 22.745  -33.609 32.857 1.00 104.04 ? 23   DG  I C8    1 
ATOM   1952  N  N7    . DG  A  1 96  ? 21.990  -32.579 33.129 1.00 104.03 ? 23   DG  I N7    1 
ATOM   1953  C  C5    . DG  A  1 96  ? 20.908  -33.126 33.810 1.00 104.28 ? 23   DG  I C5    1 
ATOM   1954  C  C6    . DG  A  1 96  ? 19.755  -32.503 34.365 1.00 104.13 ? 23   DG  I C6    1 
ATOM   1955  O  O6    . DG  A  1 96  ? 19.455  -31.301 34.364 1.00 103.93 ? 23   DG  I O6    1 
ATOM   1956  N  N1    . DG  A  1 96  ? 18.902  -33.428 34.970 1.00 103.95 ? 23   DG  I N1    1 
ATOM   1957  C  C2    . DG  A  1 96  ? 19.137  -34.783 35.031 1.00 104.02 ? 23   DG  I C2    1 
ATOM   1958  N  N2    . DG  A  1 96  ? 18.214  -35.526 35.647 1.00 104.11 ? 23   DG  I N2    1 
ATOM   1959  N  N3    . DG  A  1 96  ? 20.207  -35.379 34.521 1.00 104.17 ? 23   DG  I N3    1 
ATOM   1960  C  C4    . DG  A  1 96  ? 21.049  -34.497 33.925 1.00 104.24 ? 23   DG  I C4    1 
ATOM   1961  P  P     . DG  A  1 97  ? 22.879  -39.560 31.228 1.00 104.28 ? 24   DG  I P     1 
ATOM   1962  O  OP1   . DG  A  1 97  ? 22.632  -40.967 31.632 1.00 103.68 ? 24   DG  I OP1   1 
ATOM   1963  O  OP2   . DG  A  1 97  ? 23.530  -39.247 29.929 1.00 103.86 ? 24   DG  I OP2   1 
ATOM   1964  O  "O5'" . DG  A  1 97  ? 21.488  -38.777 31.286 1.00 102.66 ? 24   DG  I "O5'" 1 
ATOM   1965  C  "C5'" . DG  A  1 97  ? 20.523  -39.166 32.252 1.00 100.61 ? 24   DG  I "C5'" 1 
ATOM   1966  C  "C4'" . DG  A  1 97  ? 19.165  -38.595 31.898 1.00 98.53  ? 24   DG  I "C4'" 1 
ATOM   1967  O  "O4'" . DG  A  1 97  ? 19.260  -37.157 31.921 1.00 98.36  ? 24   DG  I "O4'" 1 
ATOM   1968  C  "C3'" . DG  A  1 97  ? 18.609  -38.945 30.520 1.00 96.93  ? 24   DG  I "C3'" 1 
ATOM   1969  O  "O3'" . DG  A  1 97  ? 17.225  -39.160 30.680 1.00 94.84  ? 24   DG  I "O3'" 1 
ATOM   1970  C  "C2'" . DG  A  1 97  ? 18.875  -37.692 29.688 1.00 97.11  ? 24   DG  I "C2'" 1 
ATOM   1971  C  "C1'" . DG  A  1 97  ? 18.626  -36.651 30.769 1.00 97.91  ? 24   DG  I "C1'" 1 
ATOM   1972  N  N9    . DG  A  1 97  ? 19.175  -35.317 30.591 1.00 97.86  ? 24   DG  I N9    1 
ATOM   1973  C  C8    . DG  A  1 97  ? 20.373  -34.949 30.028 1.00 98.08  ? 24   DG  I C8    1 
ATOM   1974  N  N7    . DG  A  1 97  ? 20.575  -33.658 30.042 1.00 98.13  ? 24   DG  I N7    1 
ATOM   1975  C  C5    . DG  A  1 97  ? 19.443  -33.147 30.666 1.00 98.05  ? 24   DG  I C5    1 
ATOM   1976  C  C6    . DG  A  1 97  ? 19.088  -31.810 30.971 1.00 97.97  ? 24   DG  I C6    1 
ATOM   1977  O  O6    . DG  A  1 97  ? 19.736  -30.784 30.735 1.00 98.05  ? 24   DG  I O6    1 
ATOM   1978  N  N1    . DG  A  1 97  ? 17.846  -31.725 31.605 1.00 97.93  ? 24   DG  I N1    1 
ATOM   1979  C  C2    . DG  A  1 97  ? 17.049  -32.806 31.914 1.00 97.95  ? 24   DG  I C2    1 
ATOM   1980  N  N2    . DG  A  1 97  ? 15.890  -32.548 32.530 1.00 97.92  ? 24   DG  I N2    1 
ATOM   1981  N  N3    . DG  A  1 97  ? 17.370  -34.062 31.635 1.00 97.94  ? 24   DG  I N3    1 
ATOM   1982  C  C4    . DG  A  1 97  ? 18.575  -34.157 31.014 1.00 97.95  ? 24   DG  I C4    1 
ATOM   1983  P  P     . DA  A  1 98  ? 16.501  -40.352 29.909 1.00 93.44  ? 25   DA  I P     1 
ATOM   1984  O  OP1   . DA  A  1 98  ? 17.099  -41.613 30.404 1.00 92.85  ? 25   DA  I OP1   1 
ATOM   1985  O  OP2   . DA  A  1 98  ? 16.485  -39.999 28.467 1.00 93.13  ? 25   DA  I OP2   1 
ATOM   1986  O  "O5'" . DA  A  1 98  ? 14.982  -40.286 30.406 1.00 92.24  ? 25   DA  I "O5'" 1 
ATOM   1987  C  "C5'" . DA  A  1 98  ? 14.618  -39.728 31.670 1.00 90.21  ? 25   DA  I "C5'" 1 
ATOM   1988  C  "C4'" . DA  A  1 98  ? 13.356  -38.891 31.528 1.00 88.54  ? 25   DA  I "C4'" 1 
ATOM   1989  O  "O4'" . DA  A  1 98  ? 13.696  -37.539 31.126 1.00 88.38  ? 25   DA  I "O4'" 1 
ATOM   1990  C  "C3'" . DA  A  1 98  ? 12.329  -39.382 30.507 1.00 87.32  ? 25   DA  I "C3'" 1 
ATOM   1991  O  "O3'" . DA  A  1 98  ? 11.025  -39.211 31.111 1.00 85.15  ? 25   DA  I "O3'" 1 
ATOM   1992  C  "C2'" . DA  A  1 98  ? 12.617  -38.527 29.262 1.00 87.03  ? 25   DA  I "C2'" 1 
ATOM   1993  C  "C1'" . DA  A  1 98  ? 13.138  -37.221 29.859 1.00 88.01  ? 25   DA  I "C1'" 1 
ATOM   1994  N  N9    . DA  A  1 98  ? 14.207  -36.522 29.140 1.00 88.29  ? 25   DA  I N9    1 
ATOM   1995  C  C8    . DA  A  1 98  ? 15.172  -37.038 28.315 1.00 88.27  ? 25   DA  I C8    1 
ATOM   1996  N  N7    . DA  A  1 98  ? 16.006  -36.137 27.841 1.00 88.07  ? 25   DA  I N7    1 
ATOM   1997  C  C5    . DA  A  1 98  ? 15.573  -34.949 28.401 1.00 88.10  ? 25   DA  I C5    1 
ATOM   1998  C  C6    . DA  A  1 98  ? 16.029  -33.610 28.311 1.00 88.30  ? 25   DA  I C6    1 
ATOM   1999  N  N6    . DA  A  1 98  ? 17.076  -33.224 27.574 1.00 88.38  ? 25   DA  I N6    1 
ATOM   2000  N  N1    . DA  A  1 98  ? 15.361  -32.659 29.005 1.00 88.21  ? 25   DA  I N1    1 
ATOM   2001  C  C2    . DA  A  1 98  ? 14.306  -33.024 29.744 1.00 88.17  ? 25   DA  I C2    1 
ATOM   2002  N  N3    . DA  A  1 98  ? 13.790  -34.243 29.905 1.00 88.32  ? 25   DA  I N3    1 
ATOM   2003  C  C4    . DA  A  1 98  ? 14.470  -35.171 29.205 1.00 88.26  ? 25   DA  I C4    1 
ATOM   2004  P  P     . DG  A  1 99  ? 9.611   -39.335 30.350 1.00 83.69  ? 26   DG  I P     1 
ATOM   2005  O  OP1   . DG  A  1 99  ? 8.613   -39.701 31.388 1.00 83.46  ? 26   DG  I OP1   1 
ATOM   2006  O  OP2   . DG  A  1 99  ? 9.757   -40.151 29.117 1.00 83.26  ? 26   DG  I OP2   1 
ATOM   2007  O  "O5'" . DG  A  1 99  ? 9.327   -37.844 29.857 1.00 80.54  ? 26   DG  I "O5'" 1 
ATOM   2008  C  "C5'" . DG  A  1 99  ? 9.153   -36.794 30.789 1.00 76.56  ? 26   DG  I "C5'" 1 
ATOM   2009  C  "C4'" . DG  A  1 99  ? 8.851   -35.509 30.045 1.00 74.09  ? 26   DG  I "C4'" 1 
ATOM   2010  O  "O4'" . DG  A  1 99  ? 10.028  -35.111 29.305 1.00 73.27  ? 26   DG  I "O4'" 1 
ATOM   2011  C  "C3'" . DG  A  1 99  ? 7.725   -35.587 29.023 1.00 72.08  ? 26   DG  I "C3'" 1 
ATOM   2012  O  "O3'" . DG  A  1 99  ? 7.116   -34.332 28.991 1.00 69.19  ? 26   DG  I "O3'" 1 
ATOM   2013  C  "C2'" . DG  A  1 99  ? 8.487   -35.808 27.724 1.00 73.24  ? 26   DG  I "C2'" 1 
ATOM   2014  C  "C1'" . DG  A  1 99  ? 9.648   -34.855 27.975 1.00 74.92  ? 26   DG  I "C1'" 1 
ATOM   2015  N  N9    . DG  A  1 99  ? 10.838  -34.996 27.134 1.00 75.69  ? 26   DG  I N9    1 
ATOM   2016  C  C8    . DG  A  1 99  ? 11.264  -36.087 26.414 1.00 75.64  ? 26   DG  I C8    1 
ATOM   2017  N  N7    . DG  A  1 99  ? 12.379  -35.871 25.772 1.00 75.66  ? 26   DG  I N7    1 
ATOM   2018  C  C5    . DG  A  1 99  ? 12.720  -34.561 26.085 1.00 75.88  ? 26   DG  I C5    1 
ATOM   2019  C  C6    . DG  A  1 99  ? 13.832  -33.763 25.689 1.00 75.98  ? 26   DG  I C6    1 
ATOM   2020  O  O6    . DG  A  1 99  ? 14.778  -34.069 24.949 1.00 75.75  ? 26   DG  I O6    1 
ATOM   2021  N  N1    . DG  A  1 99  ? 13.785  -32.476 26.235 1.00 76.06  ? 26   DG  I N1    1 
ATOM   2022  C  C2    . DG  A  1 99  ? 12.783  -32.018 27.069 1.00 75.96  ? 26   DG  I C2    1 
ATOM   2023  N  N2    . DG  A  1 99  ? 12.883  -30.756 27.516 1.00 75.74  ? 26   DG  I N2    1 
ATOM   2024  N  N3    . DG  A  1 99  ? 11.750  -32.759 27.450 1.00 76.27  ? 26   DG  I N3    1 
ATOM   2025  C  C4    . DG  A  1 99  ? 11.777  -34.011 26.921 1.00 75.90  ? 26   DG  I C4    1 
ATOM   2026  P  P     . DC  A  1 100 ? 5.557   -34.111 29.164 1.00 66.11  ? 27   DC  I P     1 
ATOM   2027  O  OP1   . DC  A  1 100 ? 5.211   -34.551 30.514 1.00 68.30  ? 27   DC  I OP1   1 
ATOM   2028  O  OP2   . DC  A  1 100 ? 4.815   -34.660 28.026 1.00 67.26  ? 27   DC  I OP2   1 
ATOM   2029  O  "O5'" . DC  A  1 100 ? 5.459   -32.532 29.015 1.00 69.85  ? 27   DC  I "O5'" 1 
ATOM   2030  C  "C5'" . DC  A  1 100 ? 6.217   -31.666 29.872 1.00 73.04  ? 27   DC  I "C5'" 1 
ATOM   2031  C  "C4'" . DC  A  1 100 ? 6.968   -30.597 29.095 1.00 74.87  ? 27   DC  I "C4'" 1 
ATOM   2032  O  "O4'" . DC  A  1 100 ? 8.004   -31.196 28.276 1.00 74.39  ? 27   DC  I "O4'" 1 
ATOM   2033  C  "C3'" . DC  A  1 100 ? 6.100   -29.737 28.178 1.00 76.20  ? 27   DC  I "C3'" 1 
ATOM   2034  O  "O3'" . DC  A  1 100 ? 6.241   -28.381 28.581 1.00 78.50  ? 27   DC  I "O3'" 1 
ATOM   2035  C  "C2'" . DC  A  1 100 ? 6.654   -29.979 26.777 1.00 75.84  ? 27   DC  I "C2'" 1 
ATOM   2036  C  "C1'" . DC  A  1 100 ? 8.055   -30.527 27.036 1.00 75.38  ? 27   DC  I "C1'" 1 
ATOM   2037  N  N1    . DC  A  1 100 ? 8.539   -31.520 26.028 1.00 75.26  ? 27   DC  I N1    1 
ATOM   2038  C  C2    . DC  A  1 100 ? 9.766   -31.320 25.363 1.00 75.39  ? 27   DC  I C2    1 
ATOM   2039  O  O2    . DC  A  1 100 ? 10.452  -30.314 25.601 1.00 74.84  ? 27   DC  I O2    1 
ATOM   2040  N  N3    . DC  A  1 100 ? 10.173  -32.256 24.461 1.00 75.96  ? 27   DC  I N3    1 
ATOM   2041  C  C4    . DC  A  1 100 ? 9.418   -33.338 24.220 1.00 75.69  ? 27   DC  I C4    1 
ATOM   2042  N  N4    . DC  A  1 100 ? 9.854   -34.230 23.326 1.00 75.30  ? 27   DC  I N4    1 
ATOM   2043  C  C5    . DC  A  1 100 ? 8.172   -33.552 24.884 1.00 75.50  ? 27   DC  I C5    1 
ATOM   2044  C  C6    . DC  A  1 100 ? 7.781   -32.631 25.773 1.00 75.13  ? 27   DC  I C6    1 
ATOM   2045  P  P     . DA  A  1 101 ? 5.237   -27.225 28.111 1.00 79.63  ? 28   DA  I P     1 
ATOM   2046  O  OP1   . DA  A  1 101 ? 5.314   -26.140 29.116 1.00 78.79  ? 28   DA  I OP1   1 
ATOM   2047  O  OP2   . DA  A  1 101 ? 3.933   -27.827 27.749 1.00 79.40  ? 28   DA  I OP2   1 
ATOM   2048  O  "O5'" . DA  A  1 101 ? 5.912   -26.751 26.738 1.00 81.72  ? 28   DA  I "O5'" 1 
ATOM   2049  C  "C5'" . DA  A  1 101 ? 7.246   -26.229 26.662 1.00 82.62  ? 28   DA  I "C5'" 1 
ATOM   2050  C  "C4'" . DA  A  1 101 ? 7.736   -26.219 25.219 1.00 83.22  ? 28   DA  I "C4'" 1 
ATOM   2051  O  "O4'" . DA  A  1 101 ? 7.966   -27.580 24.777 1.00 83.27  ? 28   DA  I "O4'" 1 
ATOM   2052  C  "C3'" . DA  A  1 101 ? 6.785   -25.613 24.185 1.00 84.02  ? 28   DA  I "C3'" 1 
ATOM   2053  O  "O3'" . DA  A  1 101 ? 7.543   -24.869 23.223 1.00 86.26  ? 28   DA  I "O3'" 1 
ATOM   2054  C  "C2'" . DA  A  1 101 ? 6.154   -26.845 23.543 1.00 83.46  ? 28   DA  I "C2'" 1 
ATOM   2055  C  "C1'" . DA  A  1 101 ? 7.410   -27.704 23.485 1.00 83.52  ? 28   DA  I "C1'" 1 
ATOM   2056  N  N9    . DA  A  1 101 ? 7.248   -29.115 23.116 1.00 83.54  ? 28   DA  I N9    1 
ATOM   2057  C  C8    . DA  A  1 101 ? 6.249   -29.986 23.470 1.00 83.56  ? 28   DA  I C8    1 
ATOM   2058  N  N7    . DA  A  1 101 ? 6.389   -31.194 22.977 1.00 83.63  ? 28   DA  I N7    1 
ATOM   2059  C  C5    . DA  A  1 101 ? 7.566   -31.105 22.240 1.00 83.83  ? 28   DA  I C5    1 
ATOM   2060  C  C6    . DA  A  1 101 ? 8.281   -32.038 21.456 1.00 83.63  ? 28   DA  I C6    1 
ATOM   2061  N  N6    . DA  A  1 101 ? 7.879   -33.301 21.291 1.00 83.66  ? 28   DA  I N6    1 
ATOM   2062  N  N1    . DA  A  1 101 ? 9.417   -31.630 20.847 1.00 83.50  ? 28   DA  I N1    1 
ATOM   2063  C  C2    . DA  A  1 101 ? 9.822   -30.365 21.012 1.00 83.37  ? 28   DA  I C2    1 
ATOM   2064  N  N3    . DA  A  1 101 ? 9.237   -29.400 21.718 1.00 83.30  ? 28   DA  I N3    1 
ATOM   2065  C  C4    . DA  A  1 101 ? 8.107   -29.834 22.313 1.00 83.39  ? 28   DA  I C4    1 
ATOM   2066  P  P     . DG  A  1 102 ? 7.188   -23.357 22.812 1.00 87.03  ? 29   DG  I P     1 
ATOM   2067  O  OP1   . DG  A  1 102 ? 7.459   -22.520 24.007 1.00 86.30  ? 29   DG  I OP1   1 
ATOM   2068  O  OP2   . DG  A  1 102 ? 5.852   -23.345 22.170 1.00 86.42  ? 29   DG  I OP2   1 
ATOM   2069  O  "O5'" . DG  A  1 102 ? 8.228   -23.013 21.639 1.00 88.57  ? 29   DG  I "O5'" 1 
ATOM   2070  C  "C5'" . DG  A  1 102 ? 9.566   -23.520 21.572 1.00 91.18  ? 29   DG  I "C5'" 1 
ATOM   2071  C  "C4'" . DG  A  1 102 ? 10.020  -23.778 20.136 1.00 93.32  ? 29   DG  I "C4'" 1 
ATOM   2072  O  "O4'" . DG  A  1 102 ? 9.961   -25.195 19.838 1.00 93.47  ? 29   DG  I "O4'" 1 
ATOM   2073  C  "C3'" . DG  A  1 102 ? 9.225   -23.118 19.012 1.00 95.34  ? 29   DG  I "C3'" 1 
ATOM   2074  O  "O3'" . DG  A  1 102 ? 10.111  -22.807 17.949 1.00 98.69  ? 29   DG  I "O3'" 1 
ATOM   2075  C  "C2'" . DG  A  1 102 ? 8.242   -24.202 18.584 1.00 94.64  ? 29   DG  I "C2'" 1 
ATOM   2076  C  "C1'" . DG  A  1 102 ? 9.130   -25.433 18.717 1.00 94.01  ? 29   DG  I "C1'" 1 
ATOM   2077  N  N9    . DG  A  1 102 ? 8.393   -26.681 18.919 1.00 94.08  ? 29   DG  I N9    1 
ATOM   2078  C  C8    . DG  A  1 102 ? 7.280   -26.875 19.707 1.00 94.07  ? 29   DG  I C8    1 
ATOM   2079  N  N7    . DG  A  1 102 ? 6.827   -28.095 19.689 1.00 93.95  ? 29   DG  I N7    1 
ATOM   2080  C  C5    . DG  A  1 102 ? 7.698   -28.759 18.838 1.00 93.99  ? 29   DG  I C5    1 
ATOM   2081  C  C6    . DG  A  1 102 ? 7.710   -30.115 18.434 1.00 94.00  ? 29   DG  I C6    1 
ATOM   2082  O  O6    . DG  A  1 102 ? 6.924   -31.011 18.772 1.00 94.06  ? 29   DG  I O6    1 
ATOM   2083  N  N1    . DG  A  1 102 ? 8.763   -30.391 17.558 1.00 94.09  ? 29   DG  I N1    1 
ATOM   2084  C  C2    . DG  A  1 102 ? 9.687   -29.465 17.124 1.00 93.99  ? 29   DG  I C2    1 
ATOM   2085  N  N2    . DG  A  1 102 ? 10.630  -29.908 16.283 1.00 93.88  ? 29   DG  I N2    1 
ATOM   2086  N  N3    . DG  A  1 102 ? 9.685   -28.189 17.495 1.00 93.98  ? 29   DG  I N3    1 
ATOM   2087  C  C4    . DG  A  1 102 ? 8.667   -27.906 18.352 1.00 93.97  ? 29   DG  I C4    1 
ATOM   2088  P  P     . DT  A  1 103 ? 9.675   -21.832 16.754 1.00 101.52 ? 30   DT  I P     1 
ATOM   2089  O  OP1   . DT  A  1 103 ? 10.806  -20.885 16.596 1.00 101.82 ? 30   DT  I OP1   1 
ATOM   2090  O  OP2   . DT  A  1 103 ? 8.302   -21.316 17.009 1.00 101.39 ? 30   DT  I OP2   1 
ATOM   2091  O  "O5'" . DT  A  1 103 ? 9.605   -22.804 15.479 1.00 102.06 ? 30   DT  I "O5'" 1 
ATOM   2092  C  "C5'" . DT  A  1 103 ? 10.797  -23.369 14.938 1.00 103.92 ? 30   DT  I "C5'" 1 
ATOM   2093  C  "C4'" . DT  A  1 103 ? 10.488  -24.465 13.933 1.00 105.57 ? 30   DT  I "C4'" 1 
ATOM   2094  O  "O4'" . DT  A  1 103 ? 9.832   -25.579 14.595 1.00 105.96 ? 30   DT  I "O4'" 1 
ATOM   2095  C  "C3'" . DT  A  1 103 ? 9.573   -24.049 12.783 1.00 106.80 ? 30   DT  I "C3'" 1 
ATOM   2096  O  "O3'" . DT  A  1 103 ? 10.199  -24.402 11.552 1.00 108.96 ? 30   DT  I "O3'" 1 
ATOM   2097  C  "C2'" . DT  A  1 103 ? 8.291   -24.845 13.028 1.00 106.47 ? 30   DT  I "C2'" 1 
ATOM   2098  C  "C1'" . DT  A  1 103 ? 8.836   -26.084 13.729 1.00 105.82 ? 30   DT  I "C1'" 1 
ATOM   2099  N  N1    . DT  A  1 103 ? 7.824   -26.905 14.497 1.00 105.66 ? 30   DT  I N1    1 
ATOM   2100  C  C2    . DT  A  1 103 ? 7.831   -28.281 14.359 1.00 105.55 ? 30   DT  I C2    1 
ATOM   2101  O  O2    . DT  A  1 103 ? 8.613   -28.887 13.655 1.00 105.88 ? 30   DT  I O2    1 
ATOM   2102  N  N3    . DT  A  1 103 ? 6.879   -28.952 15.085 1.00 105.60 ? 30   DT  I N3    1 
ATOM   2103  C  C4    . DT  A  1 103 ? 5.932   -28.399 15.923 1.00 105.66 ? 30   DT  I C4    1 
ATOM   2104  O  O4    . DT  A  1 103 ? 5.129   -29.102 16.526 1.00 105.77 ? 30   DT  I O4    1 
ATOM   2105  C  C5    . DT  A  1 103 ? 5.963   -26.956 16.034 1.00 105.84 ? 30   DT  I C5    1 
ATOM   2106  C  C7    . DT  A  1 103 ? 4.980   -26.236 16.917 1.00 105.70 ? 30   DT  I C7    1 
ATOM   2107  C  C6    . DT  A  1 103 ? 6.895   -26.288 15.325 1.00 105.89 ? 30   DT  I C6    1 
ATOM   2108  P  P     . DT  A  1 104 ? 9.655   -23.917 10.120 1.00 110.72 ? 31   DT  I P     1 
ATOM   2109  O  OP1   . DT  A  1 104 ? 10.847  -23.508 9.346  1.00 110.85 ? 31   DT  I OP1   1 
ATOM   2110  O  OP2   . DT  A  1 104 ? 8.532   -22.961 10.301 1.00 110.38 ? 31   DT  I OP2   1 
ATOM   2111  O  "O5'" . DT  A  1 104 ? 9.072   -25.269 9.484  1.00 111.55 ? 31   DT  I "O5'" 1 
ATOM   2112  C  "C5'" . DT  A  1 104 ? 9.880   -26.456 9.428  1.00 113.15 ? 31   DT  I "C5'" 1 
ATOM   2113  C  "C4'" . DT  A  1 104 ? 9.109   -27.658 8.896  1.00 114.29 ? 31   DT  I "C4'" 1 
ATOM   2114  O  "O4'" . DT  A  1 104 ? 8.287   -28.235 9.950  1.00 114.09 ? 31   DT  I "O4'" 1 
ATOM   2115  C  "C3'" . DT  A  1 104 ? 8.174   -27.377 7.719  1.00 115.26 ? 31   DT  I "C3'" 1 
ATOM   2116  O  "O3'" . DT  A  1 104 ? 8.317   -28.391 6.725  1.00 117.03 ? 31   DT  I "O3'" 1 
ATOM   2117  C  "C2'" . DT  A  1 104 ? 6.788   -27.417 8.358  1.00 114.86 ? 31   DT  I "C2'" 1 
ATOM   2118  C  "C1'" . DT  A  1 104 ? 6.979   -28.460 9.457  1.00 114.09 ? 31   DT  I "C1'" 1 
ATOM   2119  N  N1    . DT  A  1 104 ? 5.957   -28.387 10.575 1.00 113.95 ? 31   DT  I N1    1 
ATOM   2120  C  C2    . DT  A  1 104 ? 5.413   -29.548 11.106 1.00 113.66 ? 31   DT  I C2    1 
ATOM   2121  O  O2    . DT  A  1 104 ? 5.702   -30.673 10.742 1.00 113.63 ? 31   DT  I O2    1 
ATOM   2122  N  N3    . DT  A  1 104 ? 4.496   -29.350 12.107 1.00 113.55 ? 31   DT  I N3    1 
ATOM   2123  C  C4    . DT  A  1 104 ? 4.068   -28.140 12.623 1.00 113.69 ? 31   DT  I C4    1 
ATOM   2124  O  O4    . DT  A  1 104 ? 3.238   -28.097 13.524 1.00 113.79 ? 31   DT  I O4    1 
ATOM   2125  C  C5    . DT  A  1 104 ? 4.665   -26.961 12.027 1.00 113.56 ? 31   DT  I C5    1 
ATOM   2126  C  C7    . DT  A  1 104 ? 4.302   -25.575 12.483 1.00 113.68 ? 31   DT  I C7    1 
ATOM   2127  C  C6    . DT  A  1 104 ? 5.564   -27.145 11.052 1.00 113.70 ? 31   DT  I C6    1 
ATOM   2128  P  P     . DT  A  1 105 ? 7.761   -28.187 5.233  1.00 118.25 ? 32   DT  I P     1 
ATOM   2129  O  OP1   . DT  A  1 105 ? 8.739   -27.309 4.551  1.00 118.50 ? 32   DT  I OP1   1 
ATOM   2130  O  OP2   . DT  A  1 105 ? 6.334   -27.780 5.288  1.00 117.98 ? 32   DT  I OP2   1 
ATOM   2131  O  "O5'" . DT  A  1 105 ? 7.817   -29.660 4.588  1.00 118.52 ? 32   DT  I "O5'" 1 
ATOM   2132  C  "C5'" . DT  A  1 105 ? 7.860   -30.843 5.397  1.00 119.00 ? 32   DT  I "C5'" 1 
ATOM   2133  C  "C4'" . DT  A  1 105 ? 6.479   -31.395 5.733  1.00 119.27 ? 32   DT  I "C4'" 1 
ATOM   2134  O  "O4'" . DT  A  1 105 ? 5.878   -30.703 6.865  1.00 119.77 ? 32   DT  I "O4'" 1 
ATOM   2135  C  "C3'" . DT  A  1 105 ? 5.423   -31.351 4.624  1.00 118.96 ? 32   DT  I "C3'" 1 
ATOM   2136  O  "O3'" . DT  A  1 105 ? 5.286   -32.642 4.017  1.00 117.59 ? 32   DT  I "O3'" 1 
ATOM   2137  C  "C2'" . DT  A  1 105 ? 4.139   -30.921 5.348  1.00 119.77 ? 32   DT  I "C2'" 1 
ATOM   2138  C  "C1'" . DT  A  1 105 ? 4.510   -31.065 6.823  1.00 120.35 ? 32   DT  I "C1'" 1 
ATOM   2139  N  N1    . DT  A  1 105 ? 3.639   -30.283 7.799  1.00 120.56 ? 32   DT  I N1    1 
ATOM   2140  C  C2    . DT  A  1 105 ? 2.911   -30.970 8.763  1.00 120.68 ? 32   DT  I C2    1 
ATOM   2141  O  O2    . DT  A  1 105 ? 2.925   -32.182 8.893  1.00 120.81 ? 32   DT  I O2    1 
ATOM   2142  N  N3    . DT  A  1 105 ? 2.150   -30.180 9.593  1.00 120.58 ? 32   DT  I N3    1 
ATOM   2143  C  C4    . DT  A  1 105 ? 2.033   -28.800 9.566  1.00 120.59 ? 32   DT  I C4    1 
ATOM   2144  O  O4    . DT  A  1 105 ? 1.315   -28.201 10.366 1.00 120.45 ? 32   DT  I O4    1 
ATOM   2145  C  C5    . DT  A  1 105 ? 2.811   -28.137 8.536  1.00 120.78 ? 32   DT  I C5    1 
ATOM   2146  C  C7    . DT  A  1 105 ? 2.784   -26.640 8.385  1.00 120.70 ? 32   DT  I C7    1 
ATOM   2147  C  C6    . DT  A  1 105 ? 3.560   -28.900 7.717  1.00 120.70 ? 32   DT  I C6    1 
ATOM   2148  P  P     . DC  A  1 106 ? 4.233   -32.922 2.831  1.00 116.79 ? 33   DC  I P     1 
ATOM   2149  O  OP1   . DC  A  1 106 ? 4.689   -34.146 2.135  1.00 116.90 ? 33   DC  I OP1   1 
ATOM   2150  O  OP2   . DC  A  1 106 ? 4.034   -31.665 2.068  1.00 116.30 ? 33   DC  I OP2   1 
ATOM   2151  O  "O5'" . DC  A  1 106 ? 2.858   -33.252 3.588  1.00 115.30 ? 33   DC  I "O5'" 1 
ATOM   2152  C  "C5'" . DC  A  1 106 ? 2.517   -34.581 3.996  1.00 112.87 ? 33   DC  I "C5'" 1 
ATOM   2153  C  "C4'" . DC  A  1 106 ? 1.052   -34.655 4.398  1.00 111.18 ? 33   DC  I "C4'" 1 
ATOM   2154  O  "O4'" . DC  A  1 106 ? 0.727   -33.574 5.312  1.00 111.25 ? 33   DC  I "O4'" 1 
ATOM   2155  C  "C3'" . DC  A  1 106 ? 0.048   -34.536 3.254  1.00 109.71 ? 33   DC  I "C3'" 1 
ATOM   2156  O  "O3'" . DC  A  1 106 ? -1.009  -35.460 3.460  1.00 107.00 ? 33   DC  I "O3'" 1 
ATOM   2157  C  "C2'" . DC  A  1 106 ? -0.462  -33.100 3.349  1.00 110.19 ? 33   DC  I "C2'" 1 
ATOM   2158  C  "C1'" . DC  A  1 106 ? -0.446  -32.917 4.863  1.00 110.70 ? 33   DC  I "C1'" 1 
ATOM   2159  N  N1    . DC  A  1 106 ? -0.403  -31.510 5.364  1.00 110.66 ? 33   DC  I N1    1 
ATOM   2160  C  C2    . DC  A  1 106 ? -0.943  -31.229 6.629  1.00 110.65 ? 33   DC  I C2    1 
ATOM   2161  O  O2    . DC  A  1 106 ? -1.449  -32.145 7.295  1.00 110.37 ? 33   DC  I O2    1 
ATOM   2162  N  N3    . DC  A  1 106 ? -0.897  -29.948 7.085  1.00 110.67 ? 33   DC  I N3    1 
ATOM   2163  C  C4    . DC  A  1 106 ? -0.345  -28.981 6.341  1.00 110.61 ? 33   DC  I C4    1 
ATOM   2164  N  N4    . DC  A  1 106 ? -0.325  -27.736 6.835  1.00 110.26 ? 33   DC  I N4    1 
ATOM   2165  C  C5    . DC  A  1 106 ? 0.212   -29.254 5.052  1.00 110.71 ? 33   DC  I C5    1 
ATOM   2166  C  C6    . DC  A  1 106 ? 0.165   -30.518 4.610  1.00 110.69 ? 33   DC  I C6    1 
ATOM   2167  P  P     . DC  A  1 107 ? -1.493  -36.333 2.222  1.00 104.88 ? 34   DC  I P     1 
ATOM   2168  O  OP1   . DC  A  1 107 ? -0.375  -37.251 1.897  1.00 104.39 ? 34   DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A  1 107 ? -2.021  -35.389 1.211  1.00 104.45 ? 34   DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A  1 107 ? -2.745  -37.179 2.756  1.00 103.02 ? 34   DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A  1 107 ? -2.812  -37.715 4.077  1.00 99.68  ? 34   DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A  1 107 ? -4.038  -37.187 4.805  1.00 97.22  ? 34   DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A  1 107 ? -3.826  -35.797 5.155  1.00 96.71  ? 34   DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A  1 107 ? -5.361  -37.211 4.033  1.00 95.68  ? 34   DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A  1 107 ? -6.396  -37.706 4.875  1.00 93.89  ? 34   DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A  1 107 ? -5.606  -35.747 3.678  1.00 95.50  ? 34   DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A  1 107 ? -5.048  -35.121 4.947  1.00 95.75  ? 34   DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A  1 107 ? -4.784  -33.655 4.922  1.00 95.62  ? 34   DC  I N1    1 
ATOM   2179  C  C2    . DC  A  1 107 ? -5.064  -32.896 6.069  1.00 95.47  ? 34   DC  I C2    1 
ATOM   2180  O  O2    . DC  A  1 107 ? -5.533  -33.449 7.072  1.00 95.40  ? 34   DC  I O2    1 
ATOM   2181  N  N3    . DC  A  1 107 ? -4.819  -31.564 6.048  1.00 95.05  ? 34   DC  I N3    1 
ATOM   2182  C  C4    . DC  A  1 107 ? -4.316  -31.003 4.950  1.00 95.25  ? 34   DC  I C4    1 
ATOM   2183  N  N4    . DC  A  1 107 ? -4.091  -29.690 4.971  1.00 95.36  ? 34   DC  I N4    1 
ATOM   2184  C  C5    . DC  A  1 107 ? -4.020  -31.757 3.777  1.00 95.37  ? 34   DC  I C5    1 
ATOM   2185  C  C6    . DC  A  1 107 ? -4.266  -33.069 3.805  1.00 95.35  ? 34   DC  I C6    1 
ATOM   2186  P  P     . DA  A  1 108 ? -6.844  -39.237 4.767  1.00 92.92  ? 35   DA  I P     1 
ATOM   2187  O  OP1   . DA  A  1 108 ? -5.635  -40.069 4.991  1.00 92.65  ? 35   DA  I OP1   1 
ATOM   2188  O  OP2   . DA  A  1 108 ? -7.637  -39.339 3.519  1.00 92.44  ? 35   DA  I OP2   1 
ATOM   2189  O  "O5'" . DA  A  1 108 ? -7.859  -39.482 5.987  1.00 91.50  ? 35   DA  I "O5'" 1 
ATOM   2190  C  "C5'" . DA  A  1 108 ? -7.403  -39.398 7.345  1.00 89.20  ? 35   DA  I "C5'" 1 
ATOM   2191  C  "C4'" . DA  A  1 108 ? -8.143  -38.342 8.162  1.00 86.81  ? 35   DA  I "C4'" 1 
ATOM   2192  O  "O4'" . DA  A  1 108 ? -7.951  -37.013 7.615  1.00 85.87  ? 35   DA  I "O4'" 1 
ATOM   2193  C  "C3'" . DA  A  1 108 ? -9.653  -38.512 8.263  1.00 85.88  ? 35   DA  I "C3'" 1 
ATOM   2194  O  "O3'" . DA  A  1 108 ? -10.015 -38.173 9.595  1.00 84.48  ? 35   DA  I "O3'" 1 
ATOM   2195  C  "C2'" . DA  A  1 108 ? -10.201 -37.518 7.236  1.00 85.33  ? 35   DA  I "C2'" 1 
ATOM   2196  C  "C1'" . DA  A  1 108 ? -9.203  -36.385 7.419  1.00 85.51  ? 35   DA  I "C1'" 1 
ATOM   2197  N  N9    . DA  A  1 108 ? -9.025  -35.500 6.278  1.00 85.61  ? 35   DA  I N9    1 
ATOM   2198  C  C8    . DA  A  1 108 ? -8.999  -35.845 4.955  1.00 85.70  ? 35   DA  I C8    1 
ATOM   2199  N  N7    . DA  A  1 108 ? -8.797  -34.831 4.149  1.00 85.53  ? 35   DA  I N7    1 
ATOM   2200  C  C5    . DA  A  1 108 ? -8.672  -33.750 5.004  1.00 85.44  ? 35   DA  I C5    1 
ATOM   2201  C  C6    . DA  A  1 108 ? -8.439  -32.377 4.779  1.00 85.76  ? 35   DA  I C6    1 
ATOM   2202  N  N6    . DA  A  1 108 ? -8.292  -31.845 3.558  1.00 85.65  ? 35   DA  I N6    1 
ATOM   2203  N  N1    . DA  A  1 108 ? -8.375  -31.563 5.858  1.00 85.62  ? 35   DA  I N1    1 
ATOM   2204  C  C2    . DA  A  1 108 ? -8.525  -32.088 7.077  1.00 85.39  ? 35   DA  I C2    1 
ATOM   2205  N  N3    . DA  A  1 108 ? -8.739  -33.360 7.409  1.00 85.51  ? 35   DA  I N3    1 
ATOM   2206  C  C4    . DA  A  1 108 ? -8.805  -34.145 6.321  1.00 85.33  ? 35   DA  I C4    1 
ATOM   2207  P  P     . DA  A  1 109 ? -11.467 -38.482 10.200 1.00 82.83  ? 36   DA  I P     1 
ATOM   2208  O  OP1   . DA  A  1 109 ? -11.189 -39.258 11.430 1.00 82.76  ? 36   DA  I OP1   1 
ATOM   2209  O  OP2   . DA  A  1 109 ? -12.360 -39.042 9.161  1.00 82.97  ? 36   DA  I OP2   1 
ATOM   2210  O  "O5'" . DA  A  1 109 ? -12.051 -37.023 10.545 1.00 82.16  ? 36   DA  I "O5'" 1 
ATOM   2211  C  "C5'" . DA  A  1 109 ? -11.187 -35.918 10.875 1.00 80.24  ? 36   DA  I "C5'" 1 
ATOM   2212  C  "C4'" . DA  A  1 109 ? -11.888 -34.564 10.905 1.00 79.00  ? 36   DA  I "C4'" 1 
ATOM   2213  O  "O4'" . DA  A  1 109 ? -11.483 -33.795 9.745  1.00 78.60  ? 36   DA  I "O4'" 1 
ATOM   2214  C  "C3'" . DA  A  1 109 ? -13.417 -34.536 10.915 1.00 79.03  ? 36   DA  I "C3'" 1 
ATOM   2215  O  "O3'" . DA  A  1 109 ? -13.850 -33.449 11.727 1.00 80.01  ? 36   DA  I "O3'" 1 
ATOM   2216  C  "C2'" . DA  A  1 109 ? -13.751 -34.270 9.456  1.00 78.91  ? 36   DA  I "C2'" 1 
ATOM   2217  C  "C1'" . DA  A  1 109 ? -12.634 -33.301 9.087  1.00 78.75  ? 36   DA  I "C1'" 1 
ATOM   2218  N  N9    . DA  A  1 109 ? -12.400 -33.205 7.644  1.00 78.68  ? 36   DA  I N9    1 
ATOM   2219  C  C8    . DA  A  1 109 ? -12.505 -34.221 6.738  1.00 78.64  ? 36   DA  I C8    1 
ATOM   2220  N  N7    . DA  A  1 109 ? -12.240 -33.871 5.507  1.00 78.73  ? 36   DA  I N7    1 
ATOM   2221  C  C5    . DA  A  1 109 ? -11.942 -32.525 5.606  1.00 78.90  ? 36   DA  I C5    1 
ATOM   2222  C  C6    . DA  A  1 109 ? -11.572 -31.565 4.641  1.00 78.79  ? 36   DA  I C6    1 
ATOM   2223  N  N6    . DA  A  1 109 ? -11.447 -31.858 3.341  1.00 78.75  ? 36   DA  I N6    1 
ATOM   2224  N  N1    . DA  A  1 109 ? -11.338 -30.301 5.059  1.00 78.57  ? 36   DA  I N1    1 
ATOM   2225  C  C2    . DA  A  1 109 ? -11.457 -30.020 6.360  1.00 78.52  ? 36   DA  I C2    1 
ATOM   2226  N  N3    . DA  A  1 109 ? -11.799 -30.839 7.354  1.00 79.07  ? 36   DA  I N3    1 
ATOM   2227  C  C4    . DA  A  1 109 ? -12.030 -32.093 6.914  1.00 78.87  ? 36   DA  I C4    1 
ATOM   2228  P  P     . DA  A  1 110 ? -15.370 -33.186 12.201 1.00 80.86  ? 37   DA  I P     1 
ATOM   2229  O  OP1   . DA  A  1 110 ? -15.492 -33.768 13.557 1.00 80.08  ? 37   DA  I OP1   1 
ATOM   2230  O  OP2   . DA  A  1 110 ? -16.350 -33.593 11.157 1.00 80.08  ? 37   DA  I OP2   1 
ATOM   2231  O  "O5'" . DA  A  1 110 ? -15.387 -31.579 12.290 1.00 80.59  ? 37   DA  I "O5'" 1 
ATOM   2232  C  "C5'" . DA  A  1 110 ? -14.189 -30.773 12.190 1.00 80.03  ? 37   DA  I "C5'" 1 
ATOM   2233  C  "C4'" . DA  A  1 110 ? -14.449 -29.381 11.608 1.00 80.01  ? 37   DA  I "C4'" 1 
ATOM   2234  O  "O4'" . DA  A  1 110 ? -13.954 -29.330 10.237 1.00 80.54  ? 37   DA  I "O4'" 1 
ATOM   2235  C  "C3'" . DA  A  1 110 ? -15.907 -28.915 11.554 1.00 79.04  ? 37   DA  I "C3'" 1 
ATOM   2236  O  "O3'" . DA  A  1 110 ? -16.057 -27.509 11.703 1.00 77.28  ? 37   DA  I "O3'" 1 
ATOM   2237  C  "C2'" . DA  A  1 110 ? -16.301 -29.312 10.145 1.00 80.44  ? 37   DA  I "C2'" 1 
ATOM   2238  C  "C1'" . DA  A  1 110 ? -15.024 -29.049 9.352  1.00 81.50  ? 37   DA  I "C1'" 1 
ATOM   2239  N  N9    . DA  A  1 110 ? -14.973 -29.878 8.145  1.00 81.54  ? 37   DA  I N9    1 
ATOM   2240  C  C8    . DA  A  1 110 ? -15.200 -31.224 8.052  1.00 81.62  ? 37   DA  I C8    1 
ATOM   2241  N  N7    . DA  A  1 110 ? -15.107 -31.706 6.838  1.00 81.68  ? 37   DA  I N7    1 
ATOM   2242  C  C5    . DA  A  1 110 ? -14.814 -30.592 6.076  1.00 81.96  ? 37   DA  I C5    1 
ATOM   2243  C  C6    . DA  A  1 110 ? -14.585 -30.421 4.696  1.00 81.99  ? 37   DA  I C6    1 
ATOM   2244  N  N6    . DA  A  1 110 ? -14.634 -31.437 3.838  1.00 82.00  ? 37   DA  I N6    1 
ATOM   2245  N  N1    . DA  A  1 110 ? -14.304 -29.176 4.230  1.00 82.04  ? 37   DA  I N1    1 
ATOM   2246  C  C2    . DA  A  1 110 ? -14.256 -28.159 5.109  1.00 82.03  ? 37   DA  I C2    1 
ATOM   2247  N  N3    . DA  A  1 110 ? -14.456 -28.199 6.435  1.00 82.38  ? 37   DA  I N3    1 
ATOM   2248  C  C4    . DA  A  1 110 ? -14.732 -29.453 6.861  1.00 81.98  ? 37   DA  I C4    1 
ATOM   2249  P  P     . DT  A  1 111 ? -17.512 -26.843 11.830 1.00 76.68  ? 38   DT  I P     1 
ATOM   2250  O  OP1   . DT  A  1 111 ? -17.655 -26.305 13.192 1.00 77.06  ? 38   DT  I OP1   1 
ATOM   2251  O  OP2   . DT  A  1 111 ? -18.551 -27.760 11.322 1.00 76.54  ? 38   DT  I OP2   1 
ATOM   2252  O  "O5'" . DT  A  1 111 ? -17.419 -25.613 10.829 1.00 78.63  ? 38   DT  I "O5'" 1 
ATOM   2253  C  "C5'" . DT  A  1 111 ? -16.150 -25.054 10.514 1.00 81.71  ? 38   DT  I "C5'" 1 
ATOM   2254  C  "C4'" . DT  A  1 111 ? -16.161 -24.364 9.159  1.00 83.68  ? 38   DT  I "C4'" 1 
ATOM   2255  O  "O4'" . DT  A  1 111 ? -16.006 -25.329 8.086  1.00 83.88  ? 38   DT  I "O4'" 1 
ATOM   2256  C  "C3'" . DT  A  1 111 ? -17.419 -23.561 8.846  1.00 84.86  ? 38   DT  I "C3'" 1 
ATOM   2257  O  "O3'" . DT  A  1 111 ? -17.003 -22.317 8.327  1.00 86.74  ? 38   DT  I "O3'" 1 
ATOM   2258  C  "C2'" . DT  A  1 111 ? -18.155 -24.407 7.807  1.00 84.96  ? 38   DT  I "C2'" 1 
ATOM   2259  C  "C1'" . DT  A  1 111 ? -17.016 -25.144 7.111  1.00 84.72  ? 38   DT  I "C1'" 1 
ATOM   2260  N  N1    . DT  A  1 111 ? -17.352 -26.499 6.518  1.00 85.18  ? 38   DT  I N1    1 
ATOM   2261  C  C2    . DT  A  1 111 ? -17.197 -26.694 5.156  1.00 85.06  ? 38   DT  I C2    1 
ATOM   2262  O  O2    . DT  A  1 111 ? -16.814 -25.832 4.384  1.00 85.11  ? 38   DT  I O2    1 
ATOM   2263  N  N3    . DT  A  1 111 ? -17.511 -27.957 4.716  1.00 84.99  ? 38   DT  I N3    1 
ATOM   2264  C  C4    . DT  A  1 111 ? -17.950 -29.029 5.470  1.00 84.94  ? 38   DT  I C4    1 
ATOM   2265  O  O4    . DT  A  1 111 ? -18.204 -30.123 4.969  1.00 84.77  ? 38   DT  I O4    1 
ATOM   2266  C  C5    . DT  A  1 111 ? -18.096 -28.763 6.881  1.00 85.12  ? 38   DT  I C5    1 
ATOM   2267  C  C7    . DT  A  1 111 ? -18.577 -29.849 7.799  1.00 85.21  ? 38   DT  I C7    1 
ATOM   2268  C  C6    . DT  A  1 111 ? -17.793 -27.534 7.332  1.00 85.11  ? 38   DT  I C6    1 
ATOM   2269  P  P     . DA  A  1 112 ? -17.986 -21.076 8.147  1.00 88.18  ? 39   DA  I P     1 
ATOM   2270  O  OP1   . DA  A  1 112 ? -17.102 -19.891 8.169  1.00 88.18  ? 39   DA  I OP1   1 
ATOM   2271  O  OP2   . DA  A  1 112 ? -19.133 -21.176 9.079  1.00 87.79  ? 39   DA  I OP2   1 
ATOM   2272  O  "O5'" . DA  A  1 112 ? -18.572 -21.283 6.672  1.00 90.32  ? 39   DA  I "O5'" 1 
ATOM   2273  C  "C5'" . DA  A  1 112 ? -17.729 -21.236 5.524  1.00 93.72  ? 39   DA  I "C5'" 1 
ATOM   2274  C  "C4'" . DA  A  1 112 ? -18.525 -21.502 4.254  1.00 96.48  ? 39   DA  I "C4'" 1 
ATOM   2275  O  "O4'" . DA  A  1 112 ? -18.588 -22.928 3.989  1.00 96.88  ? 39   DA  I "O4'" 1 
ATOM   2276  C  "C3'" . DA  A  1 112 ? -19.974 -21.012 4.254  1.00 97.85  ? 39   DA  I "C3'" 1 
ATOM   2277  O  "O3'" . DA  A  1 112 ? -20.195 -20.240 3.075  1.00 100.53 ? 39   DA  I "O3'" 1 
ATOM   2278  C  "C2'" . DA  A  1 112 ? -20.801 -22.298 4.263  1.00 97.36  ? 39   DA  I "C2'" 1 
ATOM   2279  C  "C1'" . DA  A  1 112 ? -19.874 -23.223 3.483  1.00 97.14  ? 39   DA  I "C1'" 1 
ATOM   2280  N  N9    . DA  A  1 112 ? -20.104 -24.658 3.635  1.00 97.12  ? 39   DA  I N9    1 
ATOM   2281  C  C8    . DA  A  1 112 ? -20.252 -25.358 4.800  1.00 97.25  ? 39   DA  I C8    1 
ATOM   2282  N  N7    . DA  A  1 112 ? -20.434 -26.646 4.631  1.00 97.20  ? 39   DA  I N7    1 
ATOM   2283  C  C5    . DA  A  1 112 ? -20.398 -26.808 3.261  1.00 97.19  ? 39   DA  I C5    1 
ATOM   2284  C  C6    . DA  A  1 112 ? -20.529 -27.944 2.432  1.00 97.32  ? 39   DA  I C6    1 
ATOM   2285  N  N6    . DA  A  1 112 ? -20.730 -29.176 2.906  1.00 97.18  ? 39   DA  I N6    1 
ATOM   2286  N  N1    . DA  A  1 112 ? -20.446 -27.762 1.091  1.00 97.34  ? 39   DA  I N1    1 
ATOM   2287  C  C2    . DA  A  1 112 ? -20.243 -26.524 0.616  1.00 97.29  ? 39   DA  I C2    1 
ATOM   2288  N  N3    . DA  A  1 112 ? -20.101 -25.383 1.300  1.00 97.41  ? 39   DA  I N3    1 
ATOM   2289  C  C4    . DA  A  1 112 ? -20.192 -25.592 2.628  1.00 97.25  ? 39   DA  I C4    1 
ATOM   2290  P  P     . DC  A  1 113 ? -20.914 -18.807 3.112  1.00 102.89 ? 40   DC  I P     1 
ATOM   2291  O  OP1   . DC  A  1 113 ? -20.384 -18.042 1.959  1.00 102.86 ? 40   DC  I OP1   1 
ATOM   2292  O  OP2   . DC  A  1 113 ? -20.775 -18.224 4.467  1.00 103.28 ? 40   DC  I OP2   1 
ATOM   2293  O  "O5'" . DC  A  1 113 ? -22.467 -19.175 2.918  1.00 103.72 ? 40   DC  I "O5'" 1 
ATOM   2294  C  "C5'" . DC  A  1 113 ? -23.108 -19.122 1.645  1.00 105.88 ? 40   DC  I "C5'" 1 
ATOM   2295  C  "C4'" . DC  A  1 113 ? -22.932 -20.404 0.849  1.00 107.47 ? 40   DC  I "C4'" 1 
ATOM   2296  O  "O4'" . DC  A  1 113 ? -22.898 -21.556 1.719  1.00 107.63 ? 40   DC  I "O4'" 1 
ATOM   2297  C  "C3'" . DC  A  1 113 ? -24.088 -20.739 -0.080 1.00 109.01 ? 40   DC  I "C3'" 1 
ATOM   2298  O  "O3'" . DC  A  1 113 ? -23.937 -20.069 -1.333 1.00 111.36 ? 40   DC  I "O3'" 1 
ATOM   2299  C  "C2'" . DC  A  1 113 ? -24.009 -22.259 -0.228 1.00 108.13 ? 40   DC  I "C2'" 1 
ATOM   2300  C  "C1'" . DC  A  1 113 ? -23.046 -22.686 0.880  1.00 107.19 ? 40   DC  I "C1'" 1 
ATOM   2301  N  N1    . DC  A  1 113 ? -23.470 -23.906 1.677  1.00 106.85 ? 40   DC  I N1    1 
ATOM   2302  C  C2    . DC  A  1 113 ? -23.425 -25.184 1.085  1.00 106.22 ? 40   DC  I C2    1 
ATOM   2303  O  O2    . DC  A  1 113 ? -23.053 -25.311 -0.083 1.00 106.42 ? 40   DC  I O2    1 
ATOM   2304  N  N3    . DC  A  1 113 ? -23.795 -26.269 1.805  1.00 105.94 ? 40   DC  I N3    1 
ATOM   2305  C  C4    . DC  A  1 113 ? -24.198 -26.126 3.067  1.00 106.29 ? 40   DC  I C4    1 
ATOM   2306  N  N4    . DC  A  1 113 ? -24.551 -27.233 3.722  1.00 106.40 ? 40   DC  I N4    1 
ATOM   2307  C  C5    . DC  A  1 113 ? -24.254 -24.844 3.701  1.00 106.43 ? 40   DC  I C5    1 
ATOM   2308  C  C6    . DC  A  1 113 ? -23.885 -23.774 2.978  1.00 106.61 ? 40   DC  I C6    1 
ATOM   2309  P  P     . DA  A  1 114 ? -25.220 -19.465 -2.087 1.00 113.32 ? 41   DA  I P     1 
ATOM   2310  O  OP1   . DA  A  1 114 ? -24.717 -18.803 -3.312 1.00 112.97 ? 41   DA  I OP1   1 
ATOM   2311  O  OP2   . DA  A  1 114 ? -26.025 -18.684 -1.116 1.00 112.70 ? 41   DA  I OP2   1 
ATOM   2312  O  "O5'" . DA  A  1 114 ? -26.073 -20.770 -2.475 1.00 114.19 ? 41   DA  I "O5'" 1 
ATOM   2313  C  "C5'" . DA  A  1 114 ? -25.608 -21.691 -3.470 1.00 116.11 ? 41   DA  I "C5'" 1 
ATOM   2314  C  "C4'" . DA  A  1 114 ? -26.382 -23.004 -3.436 1.00 117.49 ? 41   DA  I "C4'" 1 
ATOM   2315  O  "O4'" . DA  A  1 114 ? -26.099 -23.722 -2.200 1.00 117.82 ? 41   DA  I "O4'" 1 
ATOM   2316  C  "C3'" . DA  A  1 114 ? -27.908 -22.868 -3.533 1.00 118.25 ? 41   DA  I "C3'" 1 
ATOM   2317  O  "O3'" . DA  A  1 114 ? -28.458 -23.728 -4.552 1.00 119.08 ? 41   DA  I "O3'" 1 
ATOM   2318  C  "C2'" . DA  A  1 114 ? -28.372 -23.284 -2.141 1.00 118.27 ? 41   DA  I "C2'" 1 
ATOM   2319  C  "C1'" . DA  A  1 114 ? -27.309 -24.320 -1.788 1.00 118.17 ? 41   DA  I "C1'" 1 
ATOM   2320  N  N9    . DA  A  1 114 ? -27.338 -24.686 -0.370 1.00 118.18 ? 41   DA  I N9    1 
ATOM   2321  C  C8    . DA  A  1 114 ? -27.363 -23.838 0.707  1.00 118.13 ? 41   DA  I C8    1 
ATOM   2322  N  N7    . DA  A  1 114 ? -27.418 -24.448 1.867  1.00 118.12 ? 41   DA  I N7    1 
ATOM   2323  C  C5    . DA  A  1 114 ? -27.438 -25.792 1.531  1.00 118.27 ? 41   DA  I C5    1 
ATOM   2324  C  C6    . DA  A  1 114 ? -27.493 -26.969 2.311  1.00 118.23 ? 41   DA  I C6    1 
ATOM   2325  N  N6    . DA  A  1 114 ? -27.536 -26.948 3.646  1.00 118.16 ? 41   DA  I N6    1 
ATOM   2326  N  N1    . DA  A  1 114 ? -27.502 -28.164 1.669  1.00 118.17 ? 41   DA  I N1    1 
ATOM   2327  C  C2    . DA  A  1 114 ? -27.463 -28.180 0.329  1.00 118.07 ? 41   DA  I C2    1 
ATOM   2328  N  N3    . DA  A  1 114 ? -27.402 -27.140 -0.508 1.00 118.18 ? 41   DA  I N3    1 
ATOM   2329  C  C4    . DA  A  1 114 ? -27.395 -25.962 0.156  1.00 118.25 ? 41   DA  I C4    1 
ATOM   2330  P  P     . DC  A  1 115 ? -29.931 -23.504 -5.167 1.00 119.42 ? 42   DC  I P     1 
ATOM   2331  O  OP1   . DC  A  1 115 ? -29.804 -22.424 -6.174 1.00 118.95 ? 42   DC  I OP1   1 
ATOM   2332  O  OP2   . DC  A  1 115 ? -30.912 -23.374 -4.058 1.00 119.21 ? 42   DC  I OP2   1 
ATOM   2333  O  "O5'" . DC  A  1 115 ? -30.257 -24.886 -5.925 1.00 119.23 ? 42   DC  I "O5'" 1 
ATOM   2334  C  "C5'" . DC  A  1 115 ? -29.761 -26.165 -5.480 1.00 118.52 ? 42   DC  I "C5'" 1 
ATOM   2335  C  "C4'" . DC  A  1 115 ? -30.712 -26.931 -4.560 1.00 117.93 ? 42   DC  I "C4'" 1 
ATOM   2336  O  "O4'" . DC  A  1 115 ? -30.304 -26.751 -3.176 1.00 117.71 ? 42   DC  I "O4'" 1 
ATOM   2337  C  "C3'" . DC  A  1 115 ? -32.212 -26.593 -4.614 1.00 117.40 ? 42   DC  I "C3'" 1 
ATOM   2338  O  "O3'" . DC  A  1 115 ? -32.938 -27.712 -5.206 1.00 116.95 ? 42   DC  I "O3'" 1 
ATOM   2339  C  "C2'" . DC  A  1 115 ? -32.571 -26.250 -3.162 1.00 117.43 ? 42   DC  I "C2'" 1 
ATOM   2340  C  "C1'" . DC  A  1 115 ? -31.454 -26.938 -2.376 1.00 117.46 ? 42   DC  I "C1'" 1 
ATOM   2341  N  N1    . DC  A  1 115 ? -31.233 -26.447 -0.947 1.00 117.43 ? 42   DC  I N1    1 
ATOM   2342  C  C2    . DC  A  1 115 ? -31.035 -27.369 0.110  1.00 117.36 ? 42   DC  I C2    1 
ATOM   2343  O  O2    . DC  A  1 115 ? -31.028 -28.589 -0.109 1.00 117.31 ? 42   DC  I O2    1 
ATOM   2344  N  N3    . DC  A  1 115 ? -30.847 -26.896 1.374  1.00 117.16 ? 42   DC  I N3    1 
ATOM   2345  C  C4    . DC  A  1 115 ? -30.850 -25.582 1.613  1.00 117.11 ? 42   DC  I C4    1 
ATOM   2346  N  N4    . DC  A  1 115 ? -30.656 -25.177 2.870  1.00 117.09 ? 42   DC  I N4    1 
ATOM   2347  C  C5    . DC  A  1 115 ? -31.048 -24.629 0.567  1.00 117.25 ? 42   DC  I C5    1 
ATOM   2348  C  C6    . DC  A  1 115 ? -31.232 -25.099 -0.678 1.00 117.40 ? 42   DC  I C6    1 
ATOM   2349  P  P     . DT  A  1 116 ? -34.198 -28.527 -4.606 1.00 116.20 ? 43   DT  I P     1 
ATOM   2350  O  OP1   . DT  A  1 116 ? -34.615 -29.481 -5.657 1.00 116.23 ? 43   DT  I OP1   1 
ATOM   2351  O  OP2   . DT  A  1 116 ? -35.198 -27.582 -4.054 1.00 115.77 ? 43   DT  I OP2   1 
ATOM   2352  O  "O5'" . DT  A  1 116 ? -33.567 -29.366 -3.396 1.00 115.91 ? 43   DT  I "O5'" 1 
ATOM   2353  C  "C5'" . DT  A  1 116 ? -33.406 -30.790 -3.477 1.00 114.94 ? 43   DT  I "C5'" 1 
ATOM   2354  C  "C4'" . DT  A  1 116 ? -34.222 -31.506 -2.408 1.00 113.76 ? 43   DT  I "C4'" 1 
ATOM   2355  O  "O4'" . DT  A  1 116 ? -33.909 -30.968 -1.092 1.00 113.82 ? 43   DT  I "O4'" 1 
ATOM   2356  C  "C3'" . DT  A  1 116 ? -35.740 -31.414 -2.560 1.00 112.74 ? 43   DT  I "C3'" 1 
ATOM   2357  O  "O3'" . DT  A  1 116 ? -36.288 -32.718 -2.343 1.00 111.18 ? 43   DT  I "O3'" 1 
ATOM   2358  C  "C2'" . DT  A  1 116 ? -36.148 -30.387 -1.503 1.00 113.08 ? 43   DT  I "C2'" 1 
ATOM   2359  C  "C1'" . DT  A  1 116 ? -35.103 -30.612 -0.412 1.00 113.54 ? 43   DT  I "C1'" 1 
ATOM   2360  N  N1    . DT  A  1 116 ? -34.835 -29.421 0.489  1.00 113.65 ? 43   DT  I N1    1 
ATOM   2361  C  C2    . DT  A  1 116 ? -34.568 -29.611 1.840  1.00 113.38 ? 43   DT  I C2    1 
ATOM   2362  O  O2    . DT  A  1 116 ? -34.530 -30.702 2.389  1.00 113.14 ? 43   DT  I O2    1 
ATOM   2363  N  N3    . DT  A  1 116 ? -34.339 -28.450 2.542  1.00 113.28 ? 43   DT  I N3    1 
ATOM   2364  C  C4    . DT  A  1 116 ? -34.345 -27.152 2.053  1.00 113.33 ? 43   DT  I C4    1 
ATOM   2365  O  O4    . DT  A  1 116 ? -34.125 -26.181 2.770  1.00 113.32 ? 43   DT  I O4    1 
ATOM   2366  C  C5    . DT  A  1 116 ? -34.630 -27.021 0.643  1.00 113.37 ? 43   DT  I C5    1 
ATOM   2367  C  C7    . DT  A  1 116 ? -34.673 -25.671 -0.013 1.00 113.40 ? 43   DT  I C7    1 
ATOM   2368  C  C6    . DT  A  1 116 ? -34.855 -28.144 -0.056 1.00 113.57 ? 43   DT  I C6    1 
ATOM   2369  P  P     . DT  A  1 117 ? -37.783 -33.010 -1.829 1.00 110.17 ? 44   DT  I P     1 
ATOM   2370  O  OP1   . DT  A  1 117 ? -38.145 -34.356 -2.338 1.00 110.05 ? 44   DT  I OP1   1 
ATOM   2371  O  OP2   . DT  A  1 117 ? -38.666 -31.854 -2.114 1.00 109.83 ? 44   DT  I OP2   1 
ATOM   2372  O  "O5'" . DT  A  1 117 ? -37.586 -33.095 -0.246 1.00 108.08 ? 44   DT  I "O5'" 1 
ATOM   2373  C  "C5'" . DT  A  1 117 ? -36.656 -34.033 0.289  1.00 105.00 ? 44   DT  I "C5'" 1 
ATOM   2374  C  "C4'" . DT  A  1 117 ? -36.895 -34.208 1.774  1.00 102.43 ? 44   DT  I "C4'" 1 
ATOM   2375  O  "O4'" . DT  A  1 117 ? -36.626 -32.955 2.446  1.00 101.59 ? 44   DT  I "O4'" 1 
ATOM   2376  C  "C3'" . DT  A  1 117 ? -38.317 -34.611 2.149  1.00 100.95 ? 44   DT  I "C3'" 1 
ATOM   2377  O  "O3'" . DT  A  1 117 ? -38.208 -35.677 3.084  1.00 98.99  ? 44   DT  I "O3'" 1 
ATOM   2378  C  "C2'" . DT  A  1 117 ? -38.941 -33.331 2.712  1.00 100.75 ? 44   DT  I "C2'" 1 
ATOM   2379  C  "C1'" . DT  A  1 117 ? -37.722 -32.602 3.264  1.00 100.99 ? 44   DT  I "C1'" 1 
ATOM   2380  N  N1    . DT  A  1 117 ? -37.810 -31.110 3.277  1.00 100.86 ? 44   DT  I N1    1 
ATOM   2381  C  C2    . DT  A  1 117 ? -37.581 -30.433 4.465  1.00 100.85 ? 44   DT  I C2    1 
ATOM   2382  O  O2    . DT  A  1 117 ? -37.319 -30.975 5.528  1.00 100.84 ? 44   DT  I O2    1 
ATOM   2383  N  N3    . DT  A  1 117 ? -37.673 -29.069 4.365  1.00 100.53 ? 44   DT  I N3    1 
ATOM   2384  C  C4    . DT  A  1 117 ? -37.960 -28.333 3.232  1.00 100.68 ? 44   DT  I C4    1 
ATOM   2385  O  O4    . DT  A  1 117 ? -38.022 -27.113 3.265  1.00 100.89 ? 44   DT  I O4    1 
ATOM   2386  C  C5    . DT  A  1 117 ? -38.184 -29.093 2.025  1.00 100.80 ? 44   DT  I C5    1 
ATOM   2387  C  C7    . DT  A  1 117 ? -38.506 -28.398 0.733  1.00 100.73 ? 44   DT  I C7    1 
ATOM   2388  C  C6    . DT  A  1 117 ? -38.096 -30.429 2.105  1.00 100.86 ? 44   DT  I C6    1 
ATOM   2389  P  P     . DT  A  1 118 ? -39.450 -36.310 3.871  1.00 98.25  ? 45   DT  I P     1 
ATOM   2390  O  OP1   . DT  A  1 118 ? -39.142 -37.748 4.047  1.00 97.96  ? 45   DT  I OP1   1 
ATOM   2391  O  OP2   . DT  A  1 118 ? -40.730 -35.895 3.248  1.00 98.29  ? 45   DT  I OP2   1 
ATOM   2392  O  "O5'" . DT  A  1 118 ? -39.373 -35.569 5.286  1.00 97.26  ? 45   DT  I "O5'" 1 
ATOM   2393  C  "C5'" . DT  A  1 118 ? -38.302 -35.815 6.204  1.00 95.99  ? 45   DT  I "C5'" 1 
ATOM   2394  C  "C4'" . DT  A  1 118 ? -38.483 -34.960 7.443  1.00 94.68  ? 45   DT  I "C4'" 1 
ATOM   2395  O  "O4'" . DT  A  1 118 ? -38.242 -33.575 7.083  1.00 94.93  ? 45   DT  I "O4'" 1 
ATOM   2396  C  "C3'" . DT  A  1 118 ? -39.906 -34.944 7.985  1.00 93.31  ? 45   DT  I "C3'" 1 
ATOM   2397  O  "O3'" . DT  A  1 118 ? -40.266 -36.100 8.775  1.00 90.99  ? 45   DT  I "O3'" 1 
ATOM   2398  C  "C2'" . DT  A  1 118 ? -39.937 -33.627 8.740  1.00 93.99  ? 45   DT  I "C2'" 1 
ATOM   2399  C  "C1'" . DT  A  1 118 ? -39.031 -32.730 7.904  1.00 95.39  ? 45   DT  I "C1'" 1 
ATOM   2400  N  N1    . DT  A  1 118 ? -39.806 -31.730 7.085  1.00 95.73  ? 45   DT  I N1    1 
ATOM   2401  C  C2    . DT  A  1 118 ? -39.702 -30.378 7.368  1.00 95.76  ? 45   DT  I C2    1 
ATOM   2402  O  O2    . DT  A  1 118 ? -38.999 -29.927 8.249  1.00 96.01  ? 45   DT  I O2    1 
ATOM   2403  N  N3    . DT  A  1 118 ? -40.455 -29.553 6.568  1.00 95.94  ? 45   DT  I N3    1 
ATOM   2404  C  C4    . DT  A  1 118 ? -41.293 -29.936 5.533  1.00 96.15  ? 45   DT  I C4    1 
ATOM   2405  O  O4    . DT  A  1 118 ? -41.919 -29.107 4.877  1.00 95.87  ? 45   DT  I O4    1 
ATOM   2406  C  C5    . DT  A  1 118 ? -41.364 -31.368 5.289  1.00 96.31  ? 45   DT  I C5    1 
ATOM   2407  C  C7    . DT  A  1 118 ? -42.227 -31.949 4.205  1.00 96.09  ? 45   DT  I C7    1 
ATOM   2408  C  C6    . DT  A  1 118 ? -40.628 -32.176 6.065  1.00 96.11  ? 45   DT  I C6    1 
ATOM   2409  P  P     . DT  A  1 119 ? -39.664 -36.561 10.189 1.00 88.89  ? 46   DT  I P     1 
ATOM   2410  O  OP1   . DT  A  1 119 ? -38.276 -37.041 9.964  1.00 88.28  ? 46   DT  I OP1   1 
ATOM   2411  O  OP2   . DT  A  1 119 ? -40.675 -37.444 10.811 1.00 88.37  ? 46   DT  I OP2   1 
ATOM   2412  O  "O5'" . DT  A  1 119 ? -39.671 -35.247 11.101 1.00 88.77  ? 46   DT  I "O5'" 1 
ATOM   2413  C  "C5'" . DT  A  1 119 ? -38.455 -34.639 11.542 1.00 86.89  ? 46   DT  I "C5'" 1 
ATOM   2414  C  "C4'" . DT  A  1 119 ? -38.743 -33.418 12.391 1.00 84.72  ? 46   DT  I "C4'" 1 
ATOM   2415  O  "O4'" . DT  A  1 119 ? -39.278 -32.329 11.599 1.00 84.35  ? 46   DT  I "O4'" 1 
ATOM   2416  C  "C3'" . DT  A  1 119 ? -39.723 -33.673 13.520 1.00 83.51  ? 46   DT  I "C3'" 1 
ATOM   2417  O  "O3'" . DT  A  1 119 ? -39.000 -33.293 14.662 1.00 81.85  ? 46   DT  I "O3'" 1 
ATOM   2418  C  "C2'" . DT  A  1 119 ? -40.928 -32.776 13.207 1.00 84.06  ? 46   DT  I "C2'" 1 
ATOM   2419  C  "C1'" . DT  A  1 119 ? -40.347 -31.709 12.284 1.00 84.81  ? 46   DT  I "C1'" 1 
ATOM   2420  N  N1    . DT  A  1 119 ? -41.266 -31.095 11.243 1.00 85.04  ? 46   DT  I N1    1 
ATOM   2421  C  C2    . DT  A  1 119 ? -41.470 -29.729 11.215 1.00 85.14  ? 46   DT  I C2    1 
ATOM   2422  O  O2    . DT  A  1 119 ? -40.979 -28.944 11.998 1.00 85.57  ? 46   DT  I O2    1 
ATOM   2423  N  N3    . DT  A  1 119 ? -42.303 -29.284 10.223 1.00 85.75  ? 46   DT  I N3    1 
ATOM   2424  C  C4    . DT  A  1 119 ? -42.951 -30.030 9.251  1.00 85.65  ? 46   DT  I C4    1 
ATOM   2425  O  O4    . DT  A  1 119 ? -43.679 -29.500 8.406  1.00 85.19  ? 46   DT  I O4    1 
ATOM   2426  C  C5    . DT  A  1 119 ? -42.695 -31.453 9.325  1.00 85.57  ? 46   DT  I C5    1 
ATOM   2427  C  C7    . DT  A  1 119 ? -43.322 -32.405 8.349  1.00 85.38  ? 46   DT  I C7    1 
ATOM   2428  C  C6    . DT  A  1 119 ? -41.885 -31.899 10.300 1.00 85.58  ? 46   DT  I C6    1 
ATOM   2429  P  P     . DG  A  1 120 ? -39.417 -33.658 16.158 1.00 80.44  ? 47   DG  I P     1 
ATOM   2430  O  OP1   . DG  A  1 120 ? -38.255 -34.302 16.821 1.00 78.77  ? 47   DG  I OP1   1 
ATOM   2431  O  OP2   . DG  A  1 120 ? -40.764 -34.282 16.143 1.00 80.06  ? 47   DG  I OP2   1 
ATOM   2432  O  "O5'" . DG  A  1 120 ? -39.597 -32.198 16.773 1.00 78.10  ? 47   DG  I "O5'" 1 
ATOM   2433  C  "C5'" . DG  A  1 120 ? -38.557 -31.243 16.700 1.00 75.02  ? 47   DG  I "C5'" 1 
ATOM   2434  C  "C4'" . DG  A  1 120 ? -39.125 -29.886 17.049 1.00 73.29  ? 47   DG  I "C4'" 1 
ATOM   2435  O  "O4'" . DG  A  1 120 ? -40.109 -29.560 16.048 1.00 74.46  ? 47   DG  I "O4'" 1 
ATOM   2436  C  "C3'" . DG  A  1 120 ? -39.844 -29.789 18.389 1.00 72.05  ? 47   DG  I "C3'" 1 
ATOM   2437  O  "O3'" . DG  A  1 120 ? -39.562 -28.531 18.985 1.00 68.33  ? 47   DG  I "O3'" 1 
ATOM   2438  C  "C2'" . DG  A  1 120 ? -41.323 -29.934 18.030 1.00 73.51  ? 47   DG  I "C2'" 1 
ATOM   2439  C  "C1'" . DG  A  1 120 ? -41.380 -29.343 16.630 1.00 76.39  ? 47   DG  I "C1'" 1 
ATOM   2440  N  N9    . DG  A  1 120 ? -42.384 -29.969 15.766 1.00 77.35  ? 47   DG  I N9    1 
ATOM   2441  C  C8    . DG  A  1 120 ? -42.764 -31.291 15.768 1.00 77.69  ? 47   DG  I C8    1 
ATOM   2442  N  N7    . DG  A  1 120 ? -43.680 -31.567 14.886 1.00 78.10  ? 47   DG  I N7    1 
ATOM   2443  C  C5    . DG  A  1 120 ? -43.924 -30.359 14.255 1.00 77.59  ? 47   DG  I C5    1 
ATOM   2444  C  C6    . DG  A  1 120 ? -44.820 -30.057 13.205 1.00 77.46  ? 47   DG  I C6    1 
ATOM   2445  O  O6    . DG  A  1 120 ? -45.593 -30.838 12.636 1.00 77.63  ? 47   DG  I O6    1 
ATOM   2446  N  N1    . DG  A  1 120 ? -44.768 -28.710 12.836 1.00 77.29  ? 47   DG  I N1    1 
ATOM   2447  C  C2    . DG  A  1 120 ? -43.940 -27.776 13.423 1.00 77.67  ? 47   DG  I C2    1 
ATOM   2448  N  N2    . DG  A  1 120 ? -44.014 -26.522 12.963 1.00 77.54  ? 47   DG  I N2    1 
ATOM   2449  N  N3    . DG  A  1 120 ? -43.090 -28.051 14.408 1.00 78.36  ? 47   DG  I N3    1 
ATOM   2450  C  C4    . DG  A  1 120 ? -43.134 -29.362 14.778 1.00 77.77  ? 47   DG  I C4    1 
ATOM   2451  P  P     . DG  A  1 121 ? -40.199 -28.092 20.382 1.00 65.25  ? 48   DG  I P     1 
ATOM   2452  O  OP1   . DG  A  1 121 ? -39.076 -27.589 21.188 1.00 65.35  ? 48   DG  I OP1   1 
ATOM   2453  O  OP2   . DG  A  1 121 ? -41.098 -29.145 20.888 1.00 65.40  ? 48   DG  I OP2   1 
ATOM   2454  O  "O5'" . DG  A  1 121 ? -41.174 -26.886 20.040 1.00 67.21  ? 48   DG  I "O5'" 1 
ATOM   2455  C  "C5'" . DG  A  1 121 ? -40.724 -25.751 19.347 1.00 71.08  ? 48   DG  I "C5'" 1 
ATOM   2456  C  "C4'" . DG  A  1 121 ? -41.930 -24.954 18.901 1.00 74.37  ? 48   DG  I "C4'" 1 
ATOM   2457  O  "O4'" . DG  A  1 121 ? -42.671 -25.710 17.909 1.00 76.33  ? 48   DG  I "O4'" 1 
ATOM   2458  C  "C3'" . DG  A  1 121 ? -42.916 -24.634 20.016 1.00 75.32  ? 48   DG  I "C3'" 1 
ATOM   2459  O  "O3'" . DG  A  1 121 ? -43.221 -23.266 19.956 1.00 75.20  ? 48   DG  I "O3'" 1 
ATOM   2460  C  "C2'" . DG  A  1 121 ? -44.129 -25.513 19.707 1.00 76.80  ? 48   DG  I "C2'" 1 
ATOM   2461  C  "C1'" . DG  A  1 121 ? -44.045 -25.583 18.192 1.00 78.42  ? 48   DG  I "C1'" 1 
ATOM   2462  N  N9    . DG  A  1 121 ? -44.752 -26.702 17.581 1.00 79.15  ? 48   DG  I N9    1 
ATOM   2463  C  C8    . DG  A  1 121 ? -44.783 -28.020 17.968 1.00 79.34  ? 48   DG  I C8    1 
ATOM   2464  N  N7    . DG  A  1 121 ? -45.519 -28.770 17.192 1.00 79.59  ? 48   DG  I N7    1 
ATOM   2465  C  C5    . DG  A  1 121 ? -46.004 -27.894 16.229 1.00 79.58  ? 48   DG  I C5    1 
ATOM   2466  C  C6    . DG  A  1 121 ? -46.859 -28.118 15.120 1.00 79.39  ? 48   DG  I C6    1 
ATOM   2467  O  O6    . DG  A  1 121 ? -47.375 -29.186 14.750 1.00 79.51  ? 48   DG  I O6    1 
ATOM   2468  N  N1    . DG  A  1 121 ? -47.094 -26.942 14.399 1.00 79.48  ? 48   DG  I N1    1 
ATOM   2469  C  C2    . DG  A  1 121 ? -46.578 -25.698 14.711 1.00 79.62  ? 48   DG  I C2    1 
ATOM   2470  N  N2    . DG  A  1 121 ? -46.908 -24.670 13.912 1.00 79.45  ? 48   DG  I N2    1 
ATOM   2471  N  N3    . DG  A  1 121 ? -45.781 -25.478 15.749 1.00 80.00  ? 48   DG  I N3    1 
ATOM   2472  C  C4    . DG  A  1 121 ? -45.538 -26.615 16.458 1.00 79.96  ? 48   DG  I C4    1 
ATOM   2473  P  P     . DT  A  1 122 ? -44.334 -22.667 20.922 1.00 76.72  ? 49   DT  I P     1 
ATOM   2474  O  OP1   . DT  A  1 122 ? -43.889 -21.314 21.328 1.00 76.27  ? 49   DT  I OP1   1 
ATOM   2475  O  OP2   . DT  A  1 122 ? -44.722 -23.672 21.939 1.00 77.03  ? 49   DT  I OP2   1 
ATOM   2476  O  "O5'" . DT  A  1 122 ? -45.589 -22.577 19.938 1.00 79.02  ? 49   DT  I "O5'" 1 
ATOM   2477  C  "C5'" . DT  A  1 122 ? -45.653 -21.626 18.883 1.00 81.58  ? 49   DT  I "C5'" 1 
ATOM   2478  C  "C4'" . DT  A  1 122 ? -47.042 -21.659 18.281 1.00 83.48  ? 49   DT  I "C4'" 1 
ATOM   2479  O  "O4'" . DT  A  1 122 ? -47.308 -23.013 17.855 1.00 83.52  ? 49   DT  I "O4'" 1 
ATOM   2480  C  "C3'" . DT  A  1 122 ? -48.163 -21.269 19.239 1.00 84.87  ? 49   DT  I "C3'" 1 
ATOM   2481  O  "O3'" . DT  A  1 122 ? -48.883 -20.169 18.669 1.00 87.72  ? 49   DT  I "O3'" 1 
ATOM   2482  C  "C2'" . DT  A  1 122 ? -49.016 -22.531 19.393 1.00 84.22  ? 49   DT  I "C2'" 1 
ATOM   2483  C  "C1'" . DT  A  1 122 ? -48.629 -23.373 18.182 1.00 84.32  ? 49   DT  I "C1'" 1 
ATOM   2484  N  N1    . DT  A  1 122 ? -48.636 -24.863 18.384 1.00 84.58  ? 49   DT  I N1    1 
ATOM   2485  C  C2    . DT  A  1 122 ? -49.122 -25.687 17.385 1.00 84.50  ? 49   DT  I C2    1 
ATOM   2486  O  O2    . DT  A  1 122 ? -49.567 -25.274 16.330 1.00 84.81  ? 49   DT  I O2    1 
ATOM   2487  N  N3    . DT  A  1 122 ? -49.080 -27.030 17.667 1.00 84.01  ? 49   DT  I N3    1 
ATOM   2488  C  C4    . DT  A  1 122 ? -48.602 -27.623 18.821 1.00 84.38  ? 49   DT  I C4    1 
ATOM   2489  O  O4    . DT  A  1 122 ? -48.609 -28.843 18.970 1.00 84.62  ? 49   DT  I O4    1 
ATOM   2490  C  C5    . DT  A  1 122 ? -48.100 -26.707 19.823 1.00 84.45  ? 49   DT  I C5    1 
ATOM   2491  C  C7    . DT  A  1 122 ? -47.551 -27.202 21.130 1.00 84.81  ? 49   DT  I C7    1 
ATOM   2492  C  C6    . DT  A  1 122 ? -48.141 -25.396 19.559 1.00 84.69  ? 49   DT  I C6    1 
ATOM   2493  P  P     . DA  A  1 123 ? -49.908 -19.242 19.496 1.00 89.58  ? 50   DA  I P     1 
ATOM   2494  O  OP1   . DA  A  1 123 ? -49.472 -17.842 19.281 1.00 89.43  ? 50   DA  I OP1   1 
ATOM   2495  O  OP2   . DA  A  1 123 ? -50.092 -19.767 20.870 1.00 88.12  ? 50   DA  I OP2   1 
ATOM   2496  O  "O5'" . DA  A  1 123 ? -51.288 -19.454 18.717 1.00 91.38  ? 50   DA  I "O5'" 1 
ATOM   2497  C  "C5'" . DA  A  1 123 ? -51.344 -20.112 17.454 1.00 94.72  ? 50   DA  I "C5'" 1 
ATOM   2498  C  "C4'" . DA  A  1 123 ? -52.576 -20.993 17.393 1.00 97.32  ? 50   DA  I "C4'" 1 
ATOM   2499  O  "O4'" . DA  A  1 123 ? -52.192 -22.390 17.428 1.00 97.70  ? 50   DA  I "O4'" 1 
ATOM   2500  C  "C3'" . DA  A  1 123 ? -53.544 -20.802 18.557 1.00 99.25  ? 50   DA  I "C3'" 1 
ATOM   2501  O  "O3'" . DA  A  1 123 ? -54.850 -20.640 18.049 1.00 102.52 ? 50   DA  I "O3'" 1 
ATOM   2502  C  "C2'" . DA  A  1 123 ? -53.417 -22.097 19.348 1.00 99.10  ? 50   DA  I "C2'" 1 
ATOM   2503  C  "C1'" . DA  A  1 123 ? -53.176 -23.052 18.189 1.00 98.69  ? 50   DA  I "C1'" 1 
ATOM   2504  N  N9    . DA  A  1 123 ? -52.725 -24.399 18.538 1.00 98.94  ? 50   DA  I N9    1 
ATOM   2505  C  C8    . DA  A  1 123 ? -51.992 -24.801 19.625 1.00 99.10  ? 50   DA  I C8    1 
ATOM   2506  N  N7    . DA  A  1 123 ? -51.747 -26.092 19.652 1.00 99.06  ? 50   DA  I N7    1 
ATOM   2507  C  C5    . DA  A  1 123 ? -52.360 -26.566 18.504 1.00 98.78  ? 50   DA  I C5    1 
ATOM   2508  C  C6    . DA  A  1 123 ? -52.472 -27.852 17.940 1.00 98.69  ? 50   DA  I C6    1 
ATOM   2509  N  N6    . DA  A  1 123 ? -51.942 -28.942 18.490 1.00 98.95  ? 50   DA  I N6    1 
ATOM   2510  N  N1    . DA  A  1 123 ? -53.155 -27.983 16.784 1.00 98.96  ? 50   DA  I N1    1 
ATOM   2511  C  C2    . DA  A  1 123 ? -53.696 -26.895 16.218 1.00 98.95  ? 50   DA  I C2    1 
ATOM   2512  N  N3    . DA  A  1 123 ? -53.656 -25.635 16.651 1.00 98.95  ? 50   DA  I N3    1 
ATOM   2513  C  C4    . DA  A  1 123 ? -52.968 -25.538 17.807 1.00 98.87  ? 50   DA  I C4    1 
ATOM   2514  P  P     . DG  A  1 124 ? -55.913 -19.674 18.765 1.00 105.62 ? 51   DG  I P     1 
ATOM   2515  O  OP1   . DG  A  1 124 ? -55.744 -18.319 18.185 1.00 105.06 ? 51   DG  I OP1   1 
ATOM   2516  O  OP2   . DG  A  1 124 ? -55.856 -19.873 20.235 1.00 105.07 ? 51   DG  I OP2   1 
ATOM   2517  O  "O5'" . DG  A  1 124 ? -57.296 -20.291 18.254 1.00 106.72 ? 51   DG  I "O5'" 1 
ATOM   2518  C  "C5'" . DG  A  1 124 ? -57.437 -20.659 16.885 1.00 109.09 ? 51   DG  I "C5'" 1 
ATOM   2519  C  "C4'" . DG  A  1 124 ? -58.083 -22.022 16.767 1.00 110.58 ? 51   DG  I "C4'" 1 
ATOM   2520  O  "O4'" . DG  A  1 124 ? -57.139 -23.060 17.113 1.00 110.40 ? 51   DG  I "O4'" 1 
ATOM   2521  C  "C3'" . DG  A  1 124 ? -59.270 -22.208 17.699 1.00 112.12 ? 51   DG  I "C3'" 1 
ATOM   2522  O  "O3'" . DG  A  1 124 ? -60.468 -22.123 16.910 1.00 114.33 ? 51   DG  I "O3'" 1 
ATOM   2523  C  "C2'" . DG  A  1 124 ? -59.039 -23.570 18.363 1.00 111.47 ? 51   DG  I "C2'" 1 
ATOM   2524  C  "C1'" . DG  A  1 124 ? -57.857 -24.163 17.608 1.00 110.80 ? 51   DG  I "C1'" 1 
ATOM   2525  N  N9    . DG  A  1 124 ? -56.952 -24.918 18.467 1.00 110.85 ? 51   DG  I N9    1 
ATOM   2526  C  C8    . DG  A  1 124 ? -56.135 -24.389 19.435 1.00 110.97 ? 51   DG  I C8    1 
ATOM   2527  N  N7    . DG  A  1 124 ? -55.415 -25.273 20.065 1.00 111.02 ? 51   DG  I N7    1 
ATOM   2528  C  C5    . DG  A  1 124 ? -55.779 -26.476 19.486 1.00 110.86 ? 51   DG  I C5    1 
ATOM   2529  C  C6    . DG  A  1 124 ? -55.318 -27.784 19.773 1.00 110.80 ? 51   DG  I C6    1 
ATOM   2530  O  O6    . DG  A  1 124 ? -54.480 -28.122 20.624 1.00 110.72 ? 51   DG  I O6    1 
ATOM   2531  N  N1    . DG  A  1 124 ? -55.936 -28.739 18.959 1.00 110.93 ? 51   DG  I N1    1 
ATOM   2532  C  C2    . DG  A  1 124 ? -56.877 -28.449 17.989 1.00 110.97 ? 51   DG  I C2    1 
ATOM   2533  N  N2    . DG  A  1 124 ? -57.365 -29.489 17.298 1.00 110.87 ? 51   DG  I N2    1 
ATOM   2534  N  N3    . DG  A  1 124 ? -57.314 -27.221 17.710 1.00 110.90 ? 51   DG  I N3    1 
ATOM   2535  C  C4    . DG  A  1 124 ? -56.725 -26.280 18.495 1.00 110.97 ? 51   DG  I C4    1 
ATOM   2536  P  P     . DT  A  1 125 ? -61.923 -21.922 17.562 1.00 115.81 ? 52   DT  I P     1 
ATOM   2537  O  OP1   . DT  A  1 125 ? -62.849 -21.533 16.469 1.00 115.77 ? 52   DT  I OP1   1 
ATOM   2538  O  OP2   . DT  A  1 125 ? -61.788 -21.043 18.752 1.00 115.76 ? 52   DT  I OP2   1 
ATOM   2539  O  "O5'" . DT  A  1 125 ? -62.294 -23.407 18.052 1.00 116.25 ? 52   DT  I "O5'" 1 
ATOM   2540  C  "C5'" . DT  A  1 125 ? -62.156 -24.526 17.154 1.00 117.25 ? 52   DT  I "C5'" 1 
ATOM   2541  C  "C4'" . DT  A  1 125 ? -62.217 -25.859 17.877 1.00 117.73 ? 52   DT  I "C4'" 1 
ATOM   2542  O  "O4'" . DT  A  1 125 ? -60.910 -26.287 18.344 1.00 117.92 ? 52   DT  I "O4'" 1 
ATOM   2543  C  "C3'" . DT  A  1 125 ? -63.122 -25.874 19.106 1.00 118.10 ? 52   DT  I "C3'" 1 
ATOM   2544  O  "O3'" . DT  A  1 125 ? -64.252 -26.695 18.834 1.00 118.49 ? 52   DT  I "O3'" 1 
ATOM   2545  C  "C2'" . DT  A  1 125 ? -62.230 -26.448 20.203 1.00 118.24 ? 52   DT  I "C2'" 1 
ATOM   2546  C  "C1'" . DT  A  1 125 ? -61.175 -27.191 19.396 1.00 118.54 ? 52   DT  I "C1'" 1 
ATOM   2547  N  N1    . DT  A  1 125 ? -59.961 -27.533 20.224 1.00 118.84 ? 52   DT  I N1    1 
ATOM   2548  C  C2    . DT  A  1 125 ? -59.430 -28.821 20.234 1.00 118.68 ? 52   DT  I C2    1 
ATOM   2549  O  O2    . DT  A  1 125 ? -59.860 -29.758 19.582 1.00 118.60 ? 52   DT  I O2    1 
ATOM   2550  N  N3    . DT  A  1 125 ? -58.334 -28.977 21.053 1.00 118.75 ? 52   DT  I N3    1 
ATOM   2551  C  C4    . DT  A  1 125 ? -57.733 -28.010 21.854 1.00 119.00 ? 52   DT  I C4    1 
ATOM   2552  O  O4    . DT  A  1 125 ? -56.750 -28.260 22.550 1.00 119.02 ? 52   DT  I O4    1 
ATOM   2553  C  C5    . DT  A  1 125 ? -58.339 -26.692 21.806 1.00 119.00 ? 52   DT  I C5    1 
ATOM   2554  C  C7    . DT  A  1 125 ? -57.798 -25.545 22.618 1.00 118.67 ? 52   DT  I C7    1 
ATOM   2555  C  C6    . DT  A  1 125 ? -59.406 -26.529 21.008 1.00 119.13 ? 52   DT  I C6    1 
ATOM   2556  P  P     . DA  A  1 126 ? -65.261 -27.204 19.976 1.00 118.65 ? 53   DA  I P     1 
ATOM   2557  O  OP1   . DA  A  1 126 ? -66.544 -27.512 19.310 1.00 118.89 ? 53   DA  I OP1   1 
ATOM   2558  O  OP2   . DA  A  1 126 ? -65.240 -26.237 21.100 1.00 118.43 ? 53   DA  I OP2   1 
ATOM   2559  O  "O5'" . DA  A  1 126 ? -64.613 -28.590 20.454 1.00 118.70 ? 53   DA  I "O5'" 1 
ATOM   2560  C  "C5'" . DA  A  1 126 ? -64.129 -29.551 19.499 1.00 118.83 ? 53   DA  I "C5'" 1 
ATOM   2561  C  "C4'" . DA  A  1 126 ? -63.852 -30.899 20.147 1.00 118.97 ? 53   DA  I "C4'" 1 
ATOM   2562  O  "O4'" . DA  A  1 126 ? -62.492 -30.962 20.658 1.00 118.86 ? 53   DA  I "O4'" 1 
ATOM   2563  C  "C3'" . DA  A  1 126 ? -64.780 -31.229 21.312 1.00 119.08 ? 53   DA  I "C3'" 1 
ATOM   2564  O  "O3'" . DA  A  1 126 ? -65.259 -32.570 21.153 1.00 118.82 ? 53   DA  I "O3'" 1 
ATOM   2565  C  "C2'" . DA  A  1 126 ? -63.901 -31.009 22.547 1.00 119.23 ? 53   DA  I "C2'" 1 
ATOM   2566  C  "C1'" . DA  A  1 126 ? -62.498 -31.312 22.029 1.00 119.26 ? 53   DA  I "C1'" 1 
ATOM   2567  N  N9    . DA  A  1 126 ? -61.470 -30.553 22.743 1.00 119.36 ? 53   DA  I N9    1 
ATOM   2568  C  C8    . DA  A  1 126 ? -61.473 -29.203 22.972 1.00 119.51 ? 53   DA  I C8    1 
ATOM   2569  N  N7    . DA  A  1 126 ? -60.438 -28.766 23.648 1.00 119.61 ? 53   DA  I N7    1 
ATOM   2570  C  C5    . DA  A  1 126 ? -59.699 -29.911 23.886 1.00 119.58 ? 53   DA  I C5    1 
ATOM   2571  C  C6    . DA  A  1 126 ? -58.477 -30.117 24.559 1.00 119.38 ? 53   DA  I C6    1 
ATOM   2572  N  N6    . DA  A  1 126 ? -57.789 -29.119 25.124 1.00 119.33 ? 53   DA  I N6    1 
ATOM   2573  N  N1    . DA  A  1 126 ? -57.998 -31.382 24.628 1.00 119.41 ? 53   DA  I N1    1 
ATOM   2574  C  C2    . DA  A  1 126 ? -58.702 -32.370 24.055 1.00 119.45 ? 53   DA  I C2    1 
ATOM   2575  N  N3    . DA  A  1 126 ? -59.863 -32.298 23.394 1.00 119.52 ? 53   DA  I N3    1 
ATOM   2576  C  C4    . DA  A  1 126 ? -60.317 -31.027 23.340 1.00 119.61 ? 53   DA  I C4    1 
ATOM   2577  P  P     . DT  A  1 127 ? -65.828 -33.444 22.375 1.00 118.69 ? 54   DT  I P     1 
ATOM   2578  O  OP1   . DT  A  1 127 ? -66.528 -34.615 21.794 1.00 118.35 ? 54   DT  I OP1   1 
ATOM   2579  O  OP2   . DT  A  1 127 ? -66.529 -32.556 23.341 1.00 118.30 ? 54   DT  I OP2   1 
ATOM   2580  O  "O5'" . DT  A  1 127 ? -64.476 -33.949 23.063 1.00 117.64 ? 54   DT  I "O5'" 1 
ATOM   2581  C  "C5'" . DT  A  1 127 ? -63.553 -34.784 22.357 1.00 115.78 ? 54   DT  I "C5'" 1 
ATOM   2582  C  "C4'" . DT  A  1 127 ? -62.758 -35.588 23.366 1.00 114.25 ? 54   DT  I "C4'" 1 
ATOM   2583  O  "O4'" . DT  A  1 127 ? -61.746 -34.738 23.959 1.00 114.04 ? 54   DT  I "O4'" 1 
ATOM   2584  C  "C3'" . DT  A  1 127 ? -63.609 -36.130 24.510 1.00 113.34 ? 54   DT  I "C3'" 1 
ATOM   2585  O  "O3'" . DT  A  1 127 ? -63.372 -37.534 24.625 1.00 111.64 ? 54   DT  I "O3'" 1 
ATOM   2586  C  "C2'" . DT  A  1 127 ? -63.198 -35.311 25.737 1.00 113.40 ? 54   DT  I "C2'" 1 
ATOM   2587  C  "C1'" . DT  A  1 127 ? -61.801 -34.820 25.371 1.00 113.68 ? 54   DT  I "C1'" 1 
ATOM   2588  N  N1    . DT  A  1 127 ? -61.433 -33.474 25.943 1.00 113.69 ? 54   DT  I N1    1 
ATOM   2589  C  C2    . DT  A  1 127 ? -60.189 -33.297 26.530 1.00 113.51 ? 54   DT  I C2    1 
ATOM   2590  O  O2    . DT  A  1 127 ? -59.342 -34.172 26.624 1.00 113.45 ? 54   DT  I O2    1 
ATOM   2591  N  N3    . DT  A  1 127 ? -59.960 -32.029 27.008 1.00 113.39 ? 54   DT  I N3    1 
ATOM   2592  C  C4    . DT  A  1 127 ? -60.825 -30.947 26.965 1.00 113.52 ? 54   DT  I C4    1 
ATOM   2593  O  O4    . DT  A  1 127 ? -60.508 -29.857 27.430 1.00 113.50 ? 54   DT  I O4    1 
ATOM   2594  C  C5    . DT  A  1 127 ? -62.110 -31.197 26.342 1.00 113.56 ? 54   DT  I C5    1 
ATOM   2595  C  C7    . DT  A  1 127 ? -63.142 -30.110 26.231 1.00 113.38 ? 54   DT  I C7    1 
ATOM   2596  C  C6    . DT  A  1 127 ? -62.345 -32.430 25.867 1.00 113.60 ? 54   DT  I C6    1 
ATOM   2597  P  P     . DC  A  1 128 ? -63.902 -38.407 25.859 1.00 110.37 ? 55   DC  I P     1 
ATOM   2598  O  OP1   . DC  A  1 128 ? -64.105 -39.793 25.366 1.00 110.16 ? 55   DC  I OP1   1 
ATOM   2599  O  OP2   . DC  A  1 128 ? -64.995 -37.673 26.546 1.00 109.74 ? 55   DC  I OP2   1 
ATOM   2600  O  "O5'" . DC  A  1 128 ? -62.624 -38.397 26.824 1.00 108.86 ? 55   DC  I "O5'" 1 
ATOM   2601  C  "C5'" . DC  A  1 128 ? -61.289 -38.498 26.294 1.00 105.61 ? 55   DC  I "C5'" 1 
ATOM   2602  C  "C4'" . DC  A  1 128 ? -60.264 -38.190 27.371 1.00 102.88 ? 55   DC  I "C4'" 1 
ATOM   2603  O  "O4'" . DC  A  1 128 ? -60.292 -36.779 27.704 1.00 102.65 ? 55   DC  I "O4'" 1 
ATOM   2604  C  "C3'" . DC  A  1 128 ? -60.524 -38.933 28.677 1.00 100.92 ? 55   DC  I "C3'" 1 
ATOM   2605  O  "O3'" . DC  A  1 128 ? -59.388 -39.717 29.015 1.00 97.33  ? 55   DC  I "O3'" 1 
ATOM   2606  C  "C2'" . DC  A  1 128 ? -60.839 -37.851 29.713 1.00 101.32 ? 55   DC  I "C2'" 1 
ATOM   2607  C  "C1'" . DC  A  1 128 ? -60.141 -36.642 29.106 1.00 102.38 ? 55   DC  I "C1'" 1 
ATOM   2608  N  N1    . DC  A  1 128 ? -60.679 -35.310 29.544 1.00 102.46 ? 55   DC  I N1    1 
ATOM   2609  C  C2    . DC  A  1 128 ? -60.004 -34.533 30.510 1.00 102.61 ? 55   DC  I C2    1 
ATOM   2610  O  O2    . DC  A  1 128 ? -58.952 -34.932 31.029 1.00 102.35 ? 55   DC  I O2    1 
ATOM   2611  N  N3    . DC  A  1 128 ? -60.536 -33.331 30.860 1.00 102.93 ? 55   DC  I N3    1 
ATOM   2612  C  C4    . DC  A  1 128 ? -61.675 -32.902 30.297 1.00 102.68 ? 55   DC  I C4    1 
ATOM   2613  N  N4    . DC  A  1 128 ? -62.159 -31.714 30.672 1.00 102.39 ? 55   DC  I N4    1 
ATOM   2614  C  C5    . DC  A  1 128 ? -62.370 -33.674 29.319 1.00 102.65 ? 55   DC  I C5    1 
ATOM   2615  C  C6    . DC  A  1 128 ? -61.839 -34.855 28.982 1.00 102.60 ? 55   DC  I C6    1 
ATOM   2616  P  P     . DT  A  1 129 ? -59.585 -40.942 30.016 1.00 94.50  ? 56   DT  I P     1 
ATOM   2617  O  OP1   . DT  A  1 129 ? -58.668 -42.029 29.598 1.00 94.22  ? 56   DT  I OP1   1 
ATOM   2618  O  OP2   . DT  A  1 129 ? -61.043 -41.184 30.144 1.00 94.42  ? 56   DT  I OP2   1 
ATOM   2619  O  "O5'" . DT  A  1 129 ? -59.086 -40.321 31.404 1.00 91.79  ? 56   DT  I "O5'" 1 
ATOM   2620  C  "C5'" . DT  A  1 129 ? -57.692 -40.100 31.629 1.00 86.57  ? 56   DT  I "C5'" 1 
ATOM   2621  C  "C4'" . DT  A  1 129 ? -57.413 -39.538 33.013 1.00 82.18  ? 56   DT  I "C4'" 1 
ATOM   2622  O  "O4'" . DT  A  1 129 ? -57.996 -38.216 33.115 1.00 81.52  ? 56   DT  I "O4'" 1 
ATOM   2623  C  "C3'" . DT  A  1 129 ? -57.951 -40.331 34.200 1.00 79.18  ? 56   DT  I "C3'" 1 
ATOM   2624  O  "O3'" . DT  A  1 129 ? -56.983 -40.306 35.220 1.00 74.61  ? 56   DT  I "O3'" 1 
ATOM   2625  C  "C2'" . DT  A  1 129 ? -59.173 -39.532 34.639 1.00 80.06  ? 56   DT  I "C2'" 1 
ATOM   2626  C  "C1'" . DT  A  1 129 ? -58.675 -38.121 34.349 1.00 81.27  ? 56   DT  I "C1'" 1 
ATOM   2627  N  N1    . DT  A  1 129 ? -59.715 -37.075 34.173 1.00 81.69  ? 56   DT  I N1    1 
ATOM   2628  C  C2    . DT  A  1 129 ? -59.504 -35.833 34.732 1.00 82.16  ? 56   DT  I C2    1 
ATOM   2629  O  O2    . DT  A  1 129 ? -58.510 -35.544 35.387 1.00 81.70  ? 56   DT  I O2    1 
ATOM   2630  N  N3    . DT  A  1 129 ? -60.524 -34.934 34.493 1.00 82.53  ? 56   DT  I N3    1 
ATOM   2631  C  C4    . DT  A  1 129 ? -61.691 -35.144 33.771 1.00 81.52  ? 56   DT  I C4    1 
ATOM   2632  O  O4    . DT  A  1 129 ? -62.532 -34.263 33.633 1.00 81.17  ? 56   DT  I O4    1 
ATOM   2633  C  C5    . DT  A  1 129 ? -61.838 -36.464 33.211 1.00 81.55  ? 56   DT  I C5    1 
ATOM   2634  C  C7    . DT  A  1 129 ? -63.046 -36.838 32.406 1.00 81.67  ? 56   DT  I C7    1 
ATOM   2635  C  C6    . DT  A  1 129 ? -60.855 -37.346 33.433 1.00 82.12  ? 56   DT  I C6    1 
ATOM   2636  P  P     . DG  A  1 130 ? -55.925 -41.489 35.368 1.00 71.56  ? 57   DG  I P     1 
ATOM   2637  O  OP1   . DG  A  1 130 ? -55.285 -41.743 34.059 1.00 71.02  ? 57   DG  I OP1   1 
ATOM   2638  O  OP2   . DG  A  1 130 ? -56.561 -42.590 36.119 1.00 70.85  ? 57   DG  I OP2   1 
ATOM   2639  O  "O5'" . DG  A  1 130 ? -54.864 -40.805 36.338 1.00 69.40  ? 57   DG  I "O5'" 1 
ATOM   2640  C  "C5'" . DG  A  1 130 ? -54.204 -39.599 35.975 1.00 65.58  ? 57   DG  I "C5'" 1 
ATOM   2641  C  "C4'" . DG  A  1 130 ? -53.901 -38.758 37.200 1.00 63.05  ? 57   DG  I "C4'" 1 
ATOM   2642  O  "O4'" . DG  A  1 130 ? -55.000 -37.853 37.440 1.00 61.69  ? 57   DG  I "O4'" 1 
ATOM   2643  C  "C3'" . DG  A  1 130 ? -53.633 -39.469 38.526 1.00 62.01  ? 57   DG  I "C3'" 1 
ATOM   2644  O  "O3'" . DG  A  1 130 ? -52.524 -38.787 39.096 1.00 60.73  ? 57   DG  I "O3'" 1 
ATOM   2645  C  "C2'" . DG  A  1 130 ? -54.946 -39.323 39.301 1.00 61.75  ? 57   DG  I "C2'" 1 
ATOM   2646  C  "C1'" . DG  A  1 130 ? -55.581 -38.069 38.709 1.00 62.33  ? 57   DG  I "C1'" 1 
ATOM   2647  N  N9    . DG  A  1 130 ? -57.007 -38.145 38.421 1.00 62.75  ? 57   DG  I N9    1 
ATOM   2648  C  C8    . DG  A  1 130 ? -57.736 -39.261 38.066 1.00 63.01  ? 57   DG  I C8    1 
ATOM   2649  N  N7    . DG  A  1 130 ? -58.999 -39.023 37.843 1.00 62.64  ? 57   DG  I N7    1 
ATOM   2650  C  C5    . DG  A  1 130 ? -59.108 -37.657 38.035 1.00 62.68  ? 57   DG  I C5    1 
ATOM   2651  C  C6    . DG  A  1 130 ? -60.243 -36.823 37.926 1.00 62.94  ? 57   DG  I C6    1 
ATOM   2652  O  O6    . DG  A  1 130 ? -61.398 -37.157 37.622 1.00 62.96  ? 57   DG  I O6    1 
ATOM   2653  N  N1    . DG  A  1 130 ? -59.942 -35.488 38.208 1.00 62.49  ? 57   DG  I N1    1 
ATOM   2654  C  C2    . DG  A  1 130 ? -58.697 -35.027 38.554 1.00 62.40  ? 57   DG  I C2    1 
ATOM   2655  N  N2    . DG  A  1 130 ? -58.601 -33.714 38.782 1.00 62.24  ? 57   DG  I N2    1 
ATOM   2656  N  N3    . DG  A  1 130 ? -57.620 -35.803 38.657 1.00 62.86  ? 57   DG  I N3    1 
ATOM   2657  C  C4    . DG  A  1 130 ? -57.897 -37.101 38.391 1.00 62.61  ? 57   DG  I C4    1 
ATOM   2658  P  P     . DC  A  1 131 ? -51.921 -38.983 40.562 1.00 61.67  ? 58   DC  I P     1 
ATOM   2659  O  OP1   . DC  A  1 131 ? -50.522 -38.482 40.525 1.00 60.81  ? 58   DC  I OP1   1 
ATOM   2660  O  OP2   . DC  A  1 131 ? -52.136 -40.377 41.008 1.00 62.38  ? 58   DC  I OP2   1 
ATOM   2661  O  "O5'" . DC  A  1 131 ? -52.844 -38.023 41.448 1.00 59.35  ? 58   DC  I "O5'" 1 
ATOM   2662  C  "C5'" . DC  A  1 131 ? -52.989 -36.659 41.111 1.00 59.30  ? 58   DC  I "C5'" 1 
ATOM   2663  C  "C4'" . DC  A  1 131 ? -53.926 -35.925 42.055 1.00 59.92  ? 58   DC  I "C4'" 1 
ATOM   2664  O  "O4'" . DC  A  1 131 ? -55.301 -36.034 41.614 1.00 60.31  ? 58   DC  I "O4'" 1 
ATOM   2665  C  "C3'" . DC  A  1 131 ? -53.941 -36.364 43.510 1.00 60.98  ? 58   DC  I "C3'" 1 
ATOM   2666  O  "O3'" . DC  A  1 131 ? -54.169 -35.185 44.282 1.00 63.78  ? 58   DC  I "O3'" 1 
ATOM   2667  C  "C2'" . DC  A  1 131 ? -55.135 -37.308 43.568 1.00 60.60  ? 58   DC  I "C2'" 1 
ATOM   2668  C  "C1'" . DC  A  1 131 ? -56.099 -36.524 42.681 1.00 61.58  ? 58   DC  I "C1'" 1 
ATOM   2669  N  N1    . DC  A  1 131 ? -57.312 -37.261 42.138 1.00 61.69  ? 58   DC  I N1    1 
ATOM   2670  C  C2    . DC  A  1 131 ? -58.462 -36.528 41.787 1.00 61.52  ? 58   DC  I C2    1 
ATOM   2671  O  O2    . DC  A  1 131 ? -58.481 -35.307 41.923 1.00 61.97  ? 58   DC  I O2    1 
ATOM   2672  N  N3    . DC  A  1 131 ? -59.552 -37.165 41.296 1.00 62.03  ? 58   DC  I N3    1 
ATOM   2673  C  C4    . DC  A  1 131 ? -59.536 -38.491 41.151 1.00 62.13  ? 58   DC  I C4    1 
ATOM   2674  N  N4    . DC  A  1 131 ? -60.644 -39.063 40.661 1.00 61.82  ? 58   DC  I N4    1 
ATOM   2675  C  C5    . DC  A  1 131 ? -58.380 -39.267 41.501 1.00 62.08  ? 58   DC  I C5    1 
ATOM   2676  C  C6    . DC  A  1 131 ? -57.302 -38.623 41.982 1.00 61.75  ? 58   DC  I C6    1 
ATOM   2677  P  P     . DA  A  1 132 ? -53.094 -34.665 45.357 1.00 65.18  ? 59   DA  I P     1 
ATOM   2678  O  OP1   . DA  A  1 132 ? -51.777 -34.528 44.693 1.00 64.25  ? 59   DA  I OP1   1 
ATOM   2679  O  OP2   . DA  A  1 132 ? -53.212 -35.543 46.546 1.00 63.92  ? 59   DA  I OP2   1 
ATOM   2680  O  "O5'" . DA  A  1 132 ? -53.670 -33.215 45.726 1.00 65.44  ? 59   DA  I "O5'" 1 
ATOM   2681  C  "C5'" . DA  A  1 132 ? -54.083 -32.314 44.715 1.00 67.63  ? 59   DA  I "C5'" 1 
ATOM   2682  C  "C4'" . DA  A  1 132 ? -55.231 -31.409 45.161 1.00 69.94  ? 59   DA  I "C4'" 1 
ATOM   2683  O  "O4'" . DA  A  1 132 ? -56.526 -32.044 45.001 1.00 70.68  ? 59   DA  I "O4'" 1 
ATOM   2684  C  "C3'" . DA  A  1 132 ? -55.259 -30.899 46.599 1.00 71.41  ? 59   DA  I "C3'" 1 
ATOM   2685  O  "O3'" . DA  A  1 132 ? -55.925 -29.637 46.569 1.00 72.81  ? 59   DA  I "O3'" 1 
ATOM   2686  C  "C2'" . DA  A  1 132 ? -56.088 -31.955 47.334 1.00 71.20  ? 59   DA  I "C2'" 1 
ATOM   2687  C  "C1'" . DA  A  1 132 ? -57.097 -32.372 46.263 1.00 71.01  ? 59   DA  I "C1'" 1 
ATOM   2688  N  N9    . DA  A  1 132 ? -57.378 -33.800 46.140 1.00 71.07  ? 59   DA  I N9    1 
ATOM   2689  C  C8    . DA  A  1 132 ? -56.561 -34.856 46.438 1.00 71.11  ? 59   DA  I C8    1 
ATOM   2690  N  N7    . DA  A  1 132 ? -57.091 -36.023 46.184 1.00 70.88  ? 59   DA  I N7    1 
ATOM   2691  C  C5    . DA  A  1 132 ? -58.333 -35.707 45.668 1.00 70.61  ? 59   DA  I C5    1 
ATOM   2692  C  C6    . DA  A  1 132 ? -59.394 -36.497 45.201 1.00 70.47  ? 59   DA  I C6    1 
ATOM   2693  N  N6    . DA  A  1 132 ? -59.354 -37.827 45.179 1.00 70.97  ? 59   DA  I N6    1 
ATOM   2694  N  N1    . DA  A  1 132 ? -60.503 -35.872 44.757 1.00 70.93  ? 59   DA  I N1    1 
ATOM   2695  C  C2    . DA  A  1 132 ? -60.555 -34.535 44.778 1.00 71.03  ? 59   DA  I C2    1 
ATOM   2696  N  N3    . DA  A  1 132 ? -59.619 -33.681 45.196 1.00 71.44  ? 59   DA  I N3    1 
ATOM   2697  C  C4    . DA  A  1 132 ? -58.526 -34.342 45.631 1.00 71.00  ? 59   DA  I C4    1 
ATOM   2698  P  P     . DG  A  1 133 ? -55.975 -28.646 47.822 1.00 73.97  ? 60   DG  I P     1 
ATOM   2699  O  OP1   . DG  A  1 133 ? -55.522 -27.319 47.337 1.00 73.90  ? 60   DG  I OP1   1 
ATOM   2700  O  OP2   . DG  A  1 133 ? -55.333 -29.295 49.001 1.00 71.87  ? 60   DG  I OP2   1 
ATOM   2701  O  "O5'" . DG  A  1 133 ? -57.550 -28.552 48.066 1.00 74.00  ? 60   DG  I "O5'" 1 
ATOM   2702  C  "C5'" . DG  A  1 133 ? -58.049 -29.312 49.136 1.00 76.00  ? 60   DG  I "C5'" 1 
ATOM   2703  C  "C4'" . DG  A  1 133 ? -59.473 -29.784 48.947 1.00 76.98  ? 60   DG  I "C4'" 1 
ATOM   2704  O  "O4'" . DG  A  1 133 ? -59.530 -31.125 48.389 1.00 76.52  ? 60   DG  I "O4'" 1 
ATOM   2705  C  "C3'" . DG  A  1 133 ? -60.144 -29.852 50.305 1.00 78.00  ? 60   DG  I "C3'" 1 
ATOM   2706  O  "O3'" . DG  A  1 133 ? -61.414 -29.246 50.245 1.00 80.36  ? 60   DG  I "O3'" 1 
ATOM   2707  C  "C2'" . DG  A  1 133 ? -60.214 -31.339 50.629 1.00 77.02  ? 60   DG  I "C2'" 1 
ATOM   2708  C  "C1'" . DG  A  1 133 ? -60.241 -31.991 49.254 1.00 75.37  ? 60   DG  I "C1'" 1 
ATOM   2709  N  N9    . DG  A  1 133 ? -59.630 -33.323 49.266 1.00 74.99  ? 60   DG  I N9    1 
ATOM   2710  C  C8    . DG  A  1 133 ? -58.390 -33.690 49.747 1.00 75.15  ? 60   DG  I C8    1 
ATOM   2711  N  N7    . DG  A  1 133 ? -58.111 -34.961 49.629 1.00 74.56  ? 60   DG  I N7    1 
ATOM   2712  C  C5    . DG  A  1 133 ? -59.253 -35.478 49.033 1.00 74.91  ? 60   DG  I C5    1 
ATOM   2713  C  C6    . DG  A  1 133 ? -59.557 -36.810 48.652 1.00 74.92  ? 60   DG  I C6    1 
ATOM   2714  O  O6    . DG  A  1 133 ? -58.841 -37.815 48.779 1.00 74.72  ? 60   DG  I O6    1 
ATOM   2715  N  N1    . DG  A  1 133 ? -60.831 -36.910 48.079 1.00 74.84  ? 60   DG  I N1    1 
ATOM   2716  C  C2    . DG  A  1 133 ? -61.695 -35.846 47.897 1.00 74.87  ? 60   DG  I C2    1 
ATOM   2717  N  N2    . DG  A  1 133 ? -62.883 -36.101 47.330 1.00 74.77  ? 60   DG  I N2    1 
ATOM   2718  N  N3    . DG  A  1 133 ? -61.416 -34.598 48.253 1.00 74.90  ? 60   DG  I N3    1 
ATOM   2719  C  C4    . DG  A  1 133 ? -60.189 -34.485 48.807 1.00 74.66  ? 60   DG  I C4    1 
ATOM   2720  P  P     . DG  A  1 134 ? -62.107 -28.773 51.604 1.00 82.53  ? 61   DG  I P     1 
ATOM   2721  O  OP1   . DG  A  1 134 ? -62.832 -27.511 51.304 1.00 82.53  ? 61   DG  I OP1   1 
ATOM   2722  O  OP2   . DG  A  1 134 ? -61.108 -28.812 52.703 1.00 82.17  ? 61   DG  I OP2   1 
ATOM   2723  O  "O5'" . DG  A  1 134 ? -63.150 -29.959 51.863 1.00 82.64  ? 61   DG  I "O5'" 1 
ATOM   2724  C  "C5'" . DG  A  1 134 ? -64.297 -30.100 51.037 1.00 84.43  ? 61   DG  I "C5'" 1 
ATOM   2725  C  "C4'" . DG  A  1 134 ? -64.887 -31.475 51.253 1.00 85.64  ? 61   DG  I "C4'" 1 
ATOM   2726  O  "O4'" . DG  A  1 134 ? -63.976 -32.453 50.709 1.00 85.79  ? 61   DG  I "O4'" 1 
ATOM   2727  C  "C3'" . DG  A  1 134 ? -65.004 -31.853 52.722 1.00 86.73  ? 61   DG  I "C3'" 1 
ATOM   2728  O  "O3'" . DG  A  1 134 ? -66.298 -31.532 53.234 1.00 88.60  ? 61   DG  I "O3'" 1 
ATOM   2729  C  "C2'" . DG  A  1 134 ? -64.757 -33.358 52.731 1.00 86.19  ? 61   DG  I "C2'" 1 
ATOM   2730  C  "C1'" . DG  A  1 134 ? -64.254 -33.681 51.338 1.00 85.01  ? 61   DG  I "C1'" 1 
ATOM   2731  N  N9    . DG  A  1 134 ? -63.051 -34.483 51.443 1.00 84.58  ? 61   DG  I N9    1 
ATOM   2732  C  C8    . DG  A  1 134 ? -61.795 -34.070 51.802 1.00 84.55  ? 61   DG  I C8    1 
ATOM   2733  N  N7    . DG  A  1 134 ? -60.916 -35.032 51.825 1.00 84.61  ? 61   DG  I N7    1 
ATOM   2734  C  C5    . DG  A  1 134 ? -61.646 -36.155 51.464 1.00 84.49  ? 61   DG  I C5    1 
ATOM   2735  C  C6    . DG  A  1 134 ? -61.237 -37.499 51.314 1.00 84.49  ? 61   DG  I C6    1 
ATOM   2736  O  O6    . DG  A  1 134 ? -60.104 -37.969 51.474 1.00 84.61  ? 61   DG  I O6    1 
ATOM   2737  N  N1    . DG  A  1 134 ? -62.293 -38.326 50.931 1.00 84.54  ? 61   DG  I N1    1 
ATOM   2738  C  C2    . DG  A  1 134 ? -63.588 -37.903 50.728 1.00 84.60  ? 61   DG  I C2    1 
ATOM   2739  N  N2    . DG  A  1 134 ? -64.478 -38.836 50.371 1.00 84.57  ? 61   DG  I N2    1 
ATOM   2740  N  N3    . DG  A  1 134 ? -63.985 -36.646 50.868 1.00 84.51  ? 61   DG  I N3    1 
ATOM   2741  C  C4    . DG  A  1 134 ? -62.964 -35.833 51.234 1.00 84.54  ? 61   DG  I C4    1 
ATOM   2742  P  P     . DT  A  1 135 ? -66.751 -32.042 54.689 1.00 90.25  ? 62   DT  I P     1 
ATOM   2743  O  OP1   . DT  A  1 135 ? -68.011 -31.346 55.054 1.00 90.23  ? 62   DT  I OP1   1 
ATOM   2744  O  OP2   . DT  A  1 135 ? -65.571 -31.985 55.589 1.00 89.80  ? 62   DT  I OP2   1 
ATOM   2745  O  "O5'" . DT  A  1 135 ? -67.070 -33.583 54.429 1.00 90.25  ? 62   DT  I "O5'" 1 
ATOM   2746  C  "C5'" . DT  A  1 135 ? -68.151 -34.049 53.629 1.00 90.75  ? 62   DT  I "C5'" 1 
ATOM   2747  C  "C4'" . DT  A  1 135 ? -68.345 -35.487 54.062 1.00 91.44  ? 62   DT  I "C4'" 1 
ATOM   2748  O  "O4'" . DT  A  1 135 ? -67.181 -36.260 53.666 1.00 91.05  ? 62   DT  I "O4'" 1 
ATOM   2749  C  "C3'" . DT  A  1 135 ? -68.444 -35.578 55.584 1.00 92.18  ? 62   DT  I "C3'" 1 
ATOM   2750  O  "O3'" . DT  A  1 135 ? -69.666 -36.227 56.002 1.00 93.37  ? 62   DT  I "O3'" 1 
ATOM   2751  C  "C2'" . DT  A  1 135 ? -67.151 -36.278 56.016 1.00 91.54  ? 62   DT  I "C2'" 1 
ATOM   2752  C  "C1'" . DT  A  1 135 ? -66.687 -37.006 54.762 1.00 91.01  ? 62   DT  I "C1'" 1 
ATOM   2753  N  N1    . DT  A  1 135 ? -65.185 -37.127 54.705 1.00 90.89  ? 62   DT  I N1    1 
ATOM   2754  C  C2    . DT  A  1 135 ? -64.575 -38.342 54.427 1.00 90.53  ? 62   DT  I C2    1 
ATOM   2755  O  O2    . DT  A  1 135 ? -65.163 -39.381 54.199 1.00 90.74  ? 62   DT  I O2    1 
ATOM   2756  N  N3    . DT  A  1 135 ? -63.206 -38.313 54.418 1.00 90.35  ? 62   DT  I N3    1 
ATOM   2757  C  C4    . DT  A  1 135 ? -62.395 -37.218 54.654 1.00 90.83  ? 62   DT  I C4    1 
ATOM   2758  O  O4    . DT  A  1 135 ? -61.173 -37.317 54.614 1.00 91.03  ? 62   DT  I O4    1 
ATOM   2759  C  C5    . DT  A  1 135 ? -63.084 -35.978 54.945 1.00 90.66  ? 62   DT  I C5    1 
ATOM   2760  C  C7    . DT  A  1 135 ? -62.330 -34.711 55.226 1.00 90.55  ? 62   DT  I C7    1 
ATOM   2761  C  C6    . DT  A  1 135 ? -64.423 -35.999 54.958 1.00 90.87  ? 62   DT  I C6    1 
ATOM   2762  P  P     . DG  A  1 136 ? -69.740 -37.128 57.332 1.00 94.00  ? 63   DG  I P     1 
ATOM   2763  O  OP1   . DG  A  1 136 ? -71.140 -37.580 57.503 1.00 94.17  ? 63   DG  I OP1   1 
ATOM   2764  O  OP2   . DG  A  1 136 ? -69.049 -36.449 58.459 1.00 93.42  ? 63   DG  I OP2   1 
ATOM   2765  O  "O5'" . DG  A  1 136 ? -68.838 -38.363 56.862 1.00 93.54  ? 63   DG  I "O5'" 1 
ATOM   2766  C  "C5'" . DG  A  1 136 ? -69.412 -39.519 56.278 1.00 92.68  ? 63   DG  I "C5'" 1 
ATOM   2767  C  "C4'" . DG  A  1 136 ? -69.022 -40.686 57.162 1.00 92.14  ? 63   DG  I "C4'" 1 
ATOM   2768  O  "O4'" . DG  A  1 136 ? -67.585 -40.859 57.089 1.00 91.51  ? 63   DG  I "O4'" 1 
ATOM   2769  C  "C3'" . DG  A  1 136 ? -69.364 -40.491 58.640 1.00 91.95  ? 63   DG  I "C3'" 1 
ATOM   2770  O  "O3'" . DG  A  1 136 ? -69.936 -41.704 59.143 1.00 92.14  ? 63   DG  I "O3'" 1 
ATOM   2771  C  "C2'" . DG  A  1 136 ? -68.033 -40.082 59.281 1.00 91.28  ? 63   DG  I "C2'" 1 
ATOM   2772  C  "C1'" . DG  A  1 136 ? -67.012 -40.771 58.378 1.00 90.53  ? 63   DG  I "C1'" 1 
ATOM   2773  N  N9    . DG  A  1 136 ? -65.735 -40.068 58.249 1.00 90.28  ? 63   DG  I N9    1 
ATOM   2774  C  C8    . DG  A  1 136 ? -65.487 -38.726 58.433 1.00 90.10  ? 63   DG  I C8    1 
ATOM   2775  N  N7    . DG  A  1 136 ? -64.238 -38.398 58.254 1.00 90.04  ? 63   DG  I N7    1 
ATOM   2776  C  C5    . DG  A  1 136 ? -63.617 -39.597 57.924 1.00 89.90  ? 63   DG  I C5    1 
ATOM   2777  C  C6    . DG  A  1 136 ? -62.263 -39.872 57.612 1.00 89.93  ? 63   DG  I C6    1 
ATOM   2778  O  O6    . DG  A  1 136 ? -61.318 -39.074 57.568 1.00 90.10  ? 63   DG  I O6    1 
ATOM   2779  N  N1    . DG  A  1 136 ? -62.045 -41.222 57.340 1.00 89.87  ? 63   DG  I N1    1 
ATOM   2780  C  C2    . DG  A  1 136 ? -63.024 -42.189 57.364 1.00 90.04  ? 63   DG  I C2    1 
ATOM   2781  N  N2    . DG  A  1 136 ? -62.639 -43.439 57.076 1.00 90.09  ? 63   DG  I N2    1 
ATOM   2782  N  N3    . DG  A  1 136 ? -64.298 -41.948 57.649 1.00 89.96  ? 63   DG  I N3    1 
ATOM   2783  C  C4    . DG  A  1 136 ? -64.524 -40.635 57.919 1.00 90.06  ? 63   DG  I C4    1 
ATOM   2784  P  P     . DG  A  1 137 ? -69.857 -42.159 60.681 1.00 92.20  ? 64   DG  I P     1 
ATOM   2785  O  OP1   . DG  A  1 137 ? -70.902 -43.192 60.870 1.00 91.85  ? 64   DG  I OP1   1 
ATOM   2786  O  OP2   . DG  A  1 137 ? -69.790 -40.973 61.574 1.00 91.70  ? 64   DG  I OP2   1 
ATOM   2787  O  "O5'" . DG  A  1 137 ? -68.432 -42.867 60.717 1.00 91.04  ? 64   DG  I "O5'" 1 
ATOM   2788  C  "C5'" . DG  A  1 137 ? -68.229 -44.094 60.034 1.00 89.52  ? 64   DG  I "C5'" 1 
ATOM   2789  C  "C4'" . DG  A  1 137 ? -67.019 -44.727 60.669 1.00 88.37  ? 64   DG  I "C4'" 1 
ATOM   2790  O  "O4'" . DG  A  1 137 ? -65.882 -43.853 60.442 1.00 87.19  ? 64   DG  I "O4'" 1 
ATOM   2791  C  "C3'" . DG  A  1 137 ? -67.169 -44.894 62.177 1.00 87.67  ? 64   DG  I "C3'" 1 
ATOM   2792  O  "O3'" . DG  A  1 137 ? -66.891 -46.255 62.467 1.00 88.49  ? 64   DG  I "O3'" 1 
ATOM   2793  C  "C2'" . DG  A  1 137 ? -66.171 -43.901 62.781 1.00 86.95  ? 64   DG  I "C2'" 1 
ATOM   2794  C  "C1'" . DG  A  1 137 ? -65.184 -43.631 61.648 1.00 85.23  ? 64   DG  I "C1'" 1 
ATOM   2795  N  N9    . DG  A  1 137 ? -64.645 -42.269 61.602 1.00 84.62  ? 64   DG  I N9    1 
ATOM   2796  C  C8    . DG  A  1 137 ? -65.281 -41.088 61.922 1.00 84.27  ? 64   DG  I C8    1 
ATOM   2797  N  N7    . DG  A  1 137 ? -64.537 -40.026 61.769 1.00 83.80  ? 64   DG  I N7    1 
ATOM   2798  C  C5    . DG  A  1 137 ? -63.330 -40.538 61.312 1.00 84.03  ? 64   DG  I C5    1 
ATOM   2799  C  C6    . DG  A  1 137 ? -62.128 -39.874 60.972 1.00 84.53  ? 64   DG  I C6    1 
ATOM   2800  O  O6    . DG  A  1 137 ? -61.902 -38.653 61.011 1.00 84.54  ? 64   DG  I O6    1 
ATOM   2801  N  N1    . DG  A  1 137 ? -61.135 -40.767 60.550 1.00 84.23  ? 64   DG  I N1    1 
ATOM   2802  C  C2    . DG  A  1 137 ? -61.287 -42.130 60.474 1.00 83.89  ? 64   DG  I C2    1 
ATOM   2803  N  N2    . DG  A  1 137 ? -60.234 -42.835 60.053 1.00 83.91  ? 64   DG  I N2    1 
ATOM   2804  N  N3    . DG  A  1 137 ? -62.403 -42.760 60.797 1.00 84.09  ? 64   DG  I N3    1 
ATOM   2805  C  C4    . DG  A  1 137 ? -63.379 -41.911 61.203 1.00 84.05  ? 64   DG  I C4    1 
ATOM   2806  P  P     . DA  A  1 138 ? -66.556 -46.804 63.938 1.00 89.05  ? 65   DA  I P     1 
ATOM   2807  O  OP1   . DA  A  1 138 ? -67.177 -48.147 64.067 1.00 90.00  ? 65   DA  I OP1   1 
ATOM   2808  O  OP2   . DA  A  1 138 ? -66.876 -45.742 64.927 1.00 88.76  ? 65   DA  I OP2   1 
ATOM   2809  O  "O5'" . DA  A  1 138 ? -64.978 -47.048 63.860 1.00 86.78  ? 65   DA  I "O5'" 1 
ATOM   2810  C  "C5'" . DA  A  1 138 ? -64.492 -47.956 62.886 1.00 83.84  ? 65   DA  I "C5'" 1 
ATOM   2811  C  "C4'" . DA  A  1 138 ? -62.982 -47.970 62.913 1.00 82.38  ? 65   DA  I "C4'" 1 
ATOM   2812  O  "O4'" . DA  A  1 138 ? -62.467 -46.640 62.638 1.00 81.42  ? 65   DA  I "O4'" 1 
ATOM   2813  C  "C3'" . DA  A  1 138 ? -62.395 -48.410 64.244 1.00 81.48  ? 65   DA  I "C3'" 1 
ATOM   2814  O  "O3'" . DA  A  1 138 ? -61.385 -49.361 63.941 1.00 81.21  ? 65   DA  I "O3'" 1 
ATOM   2815  C  "C2'" . DA  A  1 138 ? -61.876 -47.108 64.859 1.00 81.62  ? 65   DA  I "C2'" 1 
ATOM   2816  C  "C1'" . DA  A  1 138 ? -61.548 -46.248 63.641 1.00 80.58  ? 65   DA  I "C1'" 1 
ATOM   2817  N  N9    . DA  A  1 138 ? -61.712 -44.802 63.838 1.00 80.39  ? 65   DA  I N9    1 
ATOM   2818  C  C8    . DA  A  1 138 ? -62.878 -44.147 64.129 1.00 80.03  ? 65   DA  I C8    1 
ATOM   2819  N  N7    . DA  A  1 138 ? -62.756 -42.845 64.235 1.00 80.06  ? 65   DA  I N7    1 
ATOM   2820  C  C5    . DA  A  1 138 ? -61.413 -42.618 63.990 1.00 79.90  ? 65   DA  I C5    1 
ATOM   2821  C  C6    . DA  A  1 138 ? -60.638 -41.437 63.959 1.00 79.69  ? 65   DA  I C6    1 
ATOM   2822  N  N6    . DA  A  1 138 ? -61.134 -40.217 64.180 1.00 79.48  ? 65   DA  I N6    1 
ATOM   2823  N  N1    . DA  A  1 138 ? -59.323 -41.559 63.684 1.00 79.82  ? 65   DA  I N1    1 
ATOM   2824  C  C2    . DA  A  1 138 ? -58.819 -42.779 63.452 1.00 79.77  ? 65   DA  I C2    1 
ATOM   2825  N  N3    . DA  A  1 138 ? -59.445 -43.958 63.462 1.00 79.80  ? 65   DA  I N3    1 
ATOM   2826  C  C4    . DA  A  1 138 ? -60.753 -43.813 63.742 1.00 80.02  ? 65   DA  I C4    1 
ATOM   2827  P  P     . DT  A  1 139 ? -60.374 -49.941 65.038 1.00 81.26  ? 66   DT  I P     1 
ATOM   2828  O  OP1   . DT  A  1 139 ? -59.669 -51.120 64.475 1.00 81.90  ? 66   DT  I OP1   1 
ATOM   2829  O  OP2   . DT  A  1 139 ? -61.061 -50.018 66.350 1.00 80.45  ? 66   DT  I OP2   1 
ATOM   2830  O  "O5'" . DT  A  1 139 ? -59.325 -48.751 65.097 1.00 79.54  ? 66   DT  I "O5'" 1 
ATOM   2831  C  "C5'" . DT  A  1 139 ? -58.333 -48.617 64.106 1.00 76.06  ? 66   DT  I "C5'" 1 
ATOM   2832  C  "C4'" . DT  A  1 139 ? -57.238 -47.758 64.700 1.00 74.03  ? 66   DT  I "C4'" 1 
ATOM   2833  O  "O4'" . DT  A  1 139 ? -57.742 -46.415 64.907 1.00 72.98  ? 66   DT  I "O4'" 1 
ATOM   2834  C  "C3'" . DT  A  1 139 ? -56.686 -48.207 66.052 1.00 72.87  ? 66   DT  I "C3'" 1 
ATOM   2835  O  "O3'" . DT  A  1 139 ? -55.288 -48.091 65.905 1.00 72.59  ? 66   DT  I "O3'" 1 
ATOM   2836  C  "C2'" . DT  A  1 139 ? -57.279 -47.196 67.044 1.00 71.45  ? 66   DT  I "C2'" 1 
ATOM   2837  C  "C1'" . DT  A  1 139 ? -57.301 -45.953 66.162 1.00 70.09  ? 66   DT  I "C1'" 1 
ATOM   2838  N  N1    . DT  A  1 139 ? -58.210 -44.848 66.525 1.00 68.94  ? 66   DT  I N1    1 
ATOM   2839  C  C2    . DT  A  1 139 ? -57.723 -43.562 66.425 1.00 68.87  ? 66   DT  I C2    1 
ATOM   2840  O  O2    . DT  A  1 139 ? -56.587 -43.290 66.070 1.00 68.39  ? 66   DT  I O2    1 
ATOM   2841  N  N3    . DT  A  1 139 ? -58.630 -42.584 66.762 1.00 69.43  ? 66   DT  I N3    1 
ATOM   2842  C  C4    . DT  A  1 139 ? -59.938 -42.763 67.175 1.00 68.91  ? 66   DT  I C4    1 
ATOM   2843  O  O4    . DT  A  1 139 ? -60.652 -41.806 67.448 1.00 68.48  ? 66   DT  I O4    1 
ATOM   2844  C  C5    . DT  A  1 139 ? -60.382 -44.142 67.251 1.00 68.74  ? 66   DT  I C5    1 
ATOM   2845  C  C7    . DT  A  1 139 ? -61.779 -44.481 67.683 1.00 69.07  ? 66   DT  I C7    1 
ATOM   2846  C  C6    . DT  A  1 139 ? -59.511 -45.105 66.919 1.00 68.70  ? 66   DT  I C6    1 
ATOM   2847  P  P     . DA  A  1 140 ? -54.222 -48.443 67.040 1.00 72.94  ? 67   DA  I P     1 
ATOM   2848  O  OP1   . DA  A  1 140 ? -53.843 -49.869 66.854 1.00 72.10  ? 67   DA  I OP1   1 
ATOM   2849  O  OP2   . DA  A  1 140 ? -54.725 -47.957 68.353 1.00 71.42  ? 67   DA  I OP2   1 
ATOM   2850  O  "O5'" . DA  A  1 140 ? -52.990 -47.517 66.600 1.00 71.03  ? 67   DA  I "O5'" 1 
ATOM   2851  C  "C5'" . DA  A  1 140 ? -53.243 -46.363 65.795 1.00 69.66  ? 67   DA  I "C5'" 1 
ATOM   2852  C  "C4'" . DA  A  1 140 ? -52.465 -45.139 66.254 1.00 67.76  ? 67   DA  I "C4'" 1 
ATOM   2853  O  "O4'" . DA  A  1 140 ? -53.353 -44.095 66.740 1.00 66.60  ? 67   DA  I "O4'" 1 
ATOM   2854  C  "C3'" . DA  A  1 140 ? -51.441 -45.352 67.356 1.00 67.02  ? 67   DA  I "C3'" 1 
ATOM   2855  O  "O3'" . DA  A  1 140 ? -50.303 -44.554 66.990 1.00 67.29  ? 67   DA  I "O3'" 1 
ATOM   2856  C  "C2'" . DA  A  1 140 ? -52.194 -44.910 68.617 1.00 65.16  ? 67   DA  I "C2'" 1 
ATOM   2857  C  "C1'" . DA  A  1 140 ? -53.098 -43.796 68.097 1.00 63.54  ? 67   DA  I "C1'" 1 
ATOM   2858  N  N9    . DA  A  1 140 ? -54.426 -43.649 68.685 1.00 62.71  ? 67   DA  I N9    1 
ATOM   2859  C  C8    . DA  A  1 140 ? -55.337 -44.629 68.968 1.00 62.23  ? 67   DA  I C8    1 
ATOM   2860  N  N7    . DA  A  1 140 ? -56.469 -44.182 69.467 1.00 62.20  ? 67   DA  I N7    1 
ATOM   2861  C  C5    . DA  A  1 140 ? -56.297 -42.811 69.497 1.00 62.11  ? 67   DA  I C5    1 
ATOM   2862  C  C6    . DA  A  1 140 ? -57.125 -41.749 69.909 1.00 61.92  ? 67   DA  I C6    1 
ATOM   2863  N  N6    . DA  A  1 140 ? -58.352 -41.912 70.390 1.00 61.99  ? 67   DA  I N6    1 
ATOM   2864  N  N1    . DA  A  1 140 ? -56.644 -40.491 69.811 1.00 62.59  ? 67   DA  I N1    1 
ATOM   2865  C  C2    . DA  A  1 140 ? -55.412 -40.299 69.323 1.00 62.22  ? 67   DA  I C2    1 
ATOM   2866  N  N3    . DA  A  1 140 ? -54.544 -41.219 68.898 1.00 62.42  ? 67   DA  I N3    1 
ATOM   2867  C  C4    . DA  A  1 140 ? -55.045 -42.465 69.013 1.00 62.54  ? 67   DA  I C4    1 
ATOM   2868  P  P     . DT  A  1 141 ? -48.954 -44.507 67.849 1.00 67.64  ? 68   DT  I P     1 
ATOM   2869  O  OP1   . DT  A  1 141 ? -47.816 -44.423 66.901 1.00 68.29  ? 68   DT  I OP1   1 
ATOM   2870  O  OP2   . DT  A  1 141 ? -48.993 -45.561 68.895 1.00 66.59  ? 68   DT  I OP2   1 
ATOM   2871  O  "O5'" . DT  A  1 141 ? -49.117 -43.089 68.568 1.00 66.75  ? 68   DT  I "O5'" 1 
ATOM   2872  C  "C5'" . DT  A  1 141 ? -49.254 -41.911 67.791 1.00 65.04  ? 68   DT  I "C5'" 1 
ATOM   2873  C  "C4'" . DT  A  1 141 ? -49.552 -40.726 68.692 1.00 64.59  ? 68   DT  I "C4'" 1 
ATOM   2874  O  "O4'" . DT  A  1 141 ? -50.897 -40.845 69.214 1.00 64.04  ? 68   DT  I "O4'" 1 
ATOM   2875  C  "C3'" . DT  A  1 141 ? -48.628 -40.541 69.903 1.00 64.17  ? 68   DT  I "C3'" 1 
ATOM   2876  O  "O3'" . DT  A  1 141 ? -48.089 -39.208 69.860 1.00 63.84  ? 68   DT  I "O3'" 1 
ATOM   2877  C  "C2'" . DT  A  1 141 ? -49.536 -40.784 71.113 1.00 63.97  ? 68   DT  I "C2'" 1 
ATOM   2878  C  "C1'" . DT  A  1 141 ? -50.897 -40.370 70.547 1.00 63.81  ? 68   DT  I "C1'" 1 
ATOM   2879  N  N1    . DT  A  1 141 ? -52.109 -40.919 71.246 1.00 62.97  ? 68   DT  I N1    1 
ATOM   2880  C  C2    . DT  A  1 141 ? -53.096 -40.053 71.699 1.00 63.45  ? 68   DT  I C2    1 
ATOM   2881  O  O2    . DT  A  1 141 ? -53.061 -38.836 71.578 1.00 64.01  ? 68   DT  I O2    1 
ATOM   2882  N  N3    . DT  A  1 141 ? -54.160 -40.665 72.316 1.00 63.02  ? 68   DT  I N3    1 
ATOM   2883  C  C4    . DT  A  1 141 ? -54.327 -42.022 72.520 1.00 63.35  ? 68   DT  I C4    1 
ATOM   2884  O  O4    . DT  A  1 141 ? -55.322 -42.459 73.081 1.00 63.62  ? 68   DT  I O4    1 
ATOM   2885  C  C5    . DT  A  1 141 ? -53.263 -42.871 72.026 1.00 63.26  ? 68   DT  I C5    1 
ATOM   2886  C  C7    . DT  A  1 141 ? -53.328 -44.361 72.179 1.00 63.40  ? 68   DT  I C7    1 
ATOM   2887  C  C6    . DT  A  1 141 ? -52.224 -42.287 71.417 1.00 62.74  ? 68   DT  I C6    1 
ATOM   2888  P  P     . DT  A  1 142 ? -47.131 -38.620 71.010 1.00 63.41  ? 69   DT  I P     1 
ATOM   2889  O  OP1   . DT  A  1 142 ? -46.340 -37.516 70.438 1.00 62.65  ? 69   DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A  1 142 ? -46.471 -39.750 71.714 1.00 63.92  ? 69   DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A  1 142 ? -48.181 -37.963 72.003 1.00 62.03  ? 69   DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A  1 142 ? -48.773 -36.744 71.632 1.00 59.91  ? 69   DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A  1 142 ? -49.547 -36.256 72.826 1.00 59.04  ? 69   DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A  1 142 ? -50.486 -37.277 73.206 1.00 58.85  ? 69   DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A  1 142 ? -48.709 -36.008 74.066 1.00 58.68  ? 69   DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A  1 142 ? -49.106 -34.727 74.505 1.00 59.02  ? 69   DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A  1 142 ? -49.072 -37.143 75.030 1.00 57.83  ? 69   DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A  1 142 ? -50.516 -37.388 74.612 1.00 57.10  ? 69   DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A  1 142 ? -51.168 -38.721 74.847 1.00 56.82  ? 69   DT  I N1    1 
ATOM   2900  C  C2    . DT  A  1 142 ? -52.489 -38.714 75.245 1.00 56.10  ? 69   DT  I C2    1 
ATOM   2901  O  O2    . DT  A  1 142 ? -53.128 -37.699 75.449 1.00 56.51  ? 69   DT  I O2    1 
ATOM   2902  N  N3    . DT  A  1 142 ? -53.043 -39.949 75.419 1.00 55.38  ? 69   DT  I N3    1 
ATOM   2903  C  C4    . DT  A  1 142 ? -52.436 -41.166 75.225 1.00 55.93  ? 69   DT  I C4    1 
ATOM   2904  O  O4    . DT  A  1 142 ? -53.061 -42.199 75.411 1.00 56.84  ? 69   DT  I O4    1 
ATOM   2905  C  C5    . DT  A  1 142 ? -51.057 -41.122 74.800 1.00 55.93  ? 69   DT  I C5    1 
ATOM   2906  C  C7    . DT  A  1 142 ? -50.284 -42.388 74.555 1.00 56.17  ? 69   DT  I C7    1 
ATOM   2907  C  C6    . DT  A  1 142 ? -50.498 -39.915 74.622 1.00 56.09  ? 69   DT  I C6    1 
ATOM   2908  P  P     . DG  A  1 143 ? -48.207 -33.906 75.528 1.00 58.08  ? 70   DG  I P     1 
ATOM   2909  O  OP1   . DG  A  1 143 ? -48.198 -32.479 75.121 1.00 56.86  ? 70   DG  I OP1   1 
ATOM   2910  O  OP2   . DG  A  1 143 ? -46.946 -34.652 75.726 1.00 57.39  ? 70   DG  I OP2   1 
ATOM   2911  O  "O5'" . DG  A  1 143 ? -49.133 -34.011 76.813 1.00 59.12  ? 70   DG  I "O5'" 1 
ATOM   2912  C  "C5'" . DG  A  1 143 ? -50.478 -33.547 76.623 1.00 62.95  ? 70   DG  I "C5'" 1 
ATOM   2913  C  "C4'" . DG  A  1 143 ? -51.377 -33.817 77.818 1.00 65.79  ? 70   DG  I "C4'" 1 
ATOM   2914  O  "O4'" . DG  A  1 143 ? -51.899 -35.171 77.808 1.00 65.14  ? 70   DG  I "O4'" 1 
ATOM   2915  C  "C3'" . DG  A  1 143 ? -50.712 -33.662 79.176 1.00 67.85  ? 70   DG  I "C3'" 1 
ATOM   2916  O  "O3'" . DG  A  1 143 ? -51.719 -33.203 80.045 1.00 72.47  ? 70   DG  I "O3'" 1 
ATOM   2917  C  "C2'" . DG  A  1 143 ? -50.265 -35.084 79.501 1.00 66.10  ? 70   DG  I "C2'" 1 
ATOM   2918  C  "C1'" . DG  A  1 143 ? -51.521 -35.793 79.021 1.00 64.76  ? 70   DG  I "C1'" 1 
ATOM   2919  N  N9    . DG  A  1 143 ? -51.411 -37.224 78.794 1.00 64.46  ? 70   DG  I N9    1 
ATOM   2920  C  C8    . DG  A  1 143 ? -50.341 -37.960 78.347 1.00 64.40  ? 70   DG  I C8    1 
ATOM   2921  N  N7    . DG  A  1 143 ? -50.600 -39.239 78.253 1.00 64.57  ? 70   DG  I N7    1 
ATOM   2922  C  C5    . DG  A  1 143 ? -51.928 -39.351 78.663 1.00 64.52  ? 70   DG  I C5    1 
ATOM   2923  C  C6    . DG  A  1 143 ? -52.775 -40.488 78.776 1.00 64.36  ? 70   DG  I C6    1 
ATOM   2924  O  O6    . DG  A  1 143 ? -52.499 -41.677 78.528 1.00 64.20  ? 70   DG  I O6    1 
ATOM   2925  N  N1    . DG  A  1 143 ? -54.052 -40.134 79.238 1.00 64.29  ? 70   DG  I N1    1 
ATOM   2926  C  C2    . DG  A  1 143 ? -54.454 -38.848 79.550 1.00 64.36  ? 70   DG  I C2    1 
ATOM   2927  N  N2    . DG  A  1 143 ? -55.709 -38.681 79.980 1.00 64.43  ? 70   DG  I N2    1 
ATOM   2928  N  N3    . DG  A  1 143 ? -53.677 -37.781 79.445 1.00 64.32  ? 70   DG  I N3    1 
ATOM   2929  C  C4    . DG  A  1 143 ? -52.435 -38.110 78.998 1.00 64.56  ? 70   DG  I C4    1 
ATOM   2930  P  P     . DA  A  1 144 ? -51.352 -32.228 81.253 1.00 76.92  ? 71   DA  I P     1 
ATOM   2931  O  OP1   . DA  A  1 144 ? -51.585 -30.854 80.749 1.00 77.27  ? 71   DA  I OP1   1 
ATOM   2932  O  OP2   . DA  A  1 144 ? -50.042 -32.673 81.814 1.00 75.75  ? 71   DA  I OP2   1 
ATOM   2933  O  "O5'" . DA  A  1 144 ? -52.500 -32.537 82.330 1.00 76.82  ? 71   DA  I "O5'" 1 
ATOM   2934  C  "C5'" . DA  A  1 144 ? -53.882 -32.566 81.921 1.00 76.56  ? 71   DA  I "C5'" 1 
ATOM   2935  C  "C4'" . DA  A  1 144 ? -54.676 -33.530 82.789 1.00 75.44  ? 71   DA  I "C4'" 1 
ATOM   2936  O  "O4'" . DA  A  1 144 ? -54.550 -34.878 82.270 1.00 73.82  ? 71   DA  I "O4'" 1 
ATOM   2937  C  "C3'" . DA  A  1 144 ? -54.196 -33.563 84.234 1.00 75.80  ? 71   DA  I "C3'" 1 
ATOM   2938  O  "O3'" . DA  A  1 144 ? -55.264 -33.201 85.121 1.00 79.39  ? 71   DA  I "O3'" 1 
ATOM   2939  C  "C2'" . DA  A  1 144 ? -53.686 -34.986 84.444 1.00 73.55  ? 71   DA  I "C2'" 1 
ATOM   2940  C  "C1'" . DA  A  1 144 ? -54.338 -35.788 83.325 1.00 70.49  ? 71   DA  I "C1'" 1 
ATOM   2941  N  N9    . DA  A  1 144 ? -53.474 -36.881 82.877 1.00 69.23  ? 71   DA  I N9    1 
ATOM   2942  C  C8    . DA  A  1 144 ? -52.191 -36.782 82.415 1.00 68.63  ? 71   DA  I C8    1 
ATOM   2943  N  N7    . DA  A  1 144 ? -51.636 -37.927 82.091 1.00 68.03  ? 71   DA  I N7    1 
ATOM   2944  C  C5    . DA  A  1 144 ? -52.625 -38.846 82.367 1.00 68.14  ? 71   DA  I C5    1 
ATOM   2945  C  C6    . DA  A  1 144 ? -52.671 -40.248 82.244 1.00 68.42  ? 71   DA  I C6    1 
ATOM   2946  N  N6    . DA  A  1 144 ? -51.649 -40.976 81.789 1.00 68.73  ? 71   DA  I N6    1 
ATOM   2947  N  N1    . DA  A  1 144 ? -53.810 -40.876 82.604 1.00 68.69  ? 71   DA  I N1    1 
ATOM   2948  C  C2    . DA  A  1 144 ? -54.839 -40.143 83.059 1.00 68.88  ? 71   DA  I C2    1 
ATOM   2949  N  N3    . DA  A  1 144 ? -54.911 -38.816 83.219 1.00 69.04  ? 71   DA  I N3    1 
ATOM   2950  C  C4    . DA  A  1 144 ? -53.763 -38.220 82.852 1.00 68.55  ? 71   DA  I C4    1 
ATOM   2951  P  P     . DT  A  1 145 ? -55.014 -32.943 86.695 1.00 81.19  ? 72   DT  I P     1 
ATOM   2952  O  OP1   . DT  A  1 145 ? -56.011 -31.925 87.111 1.00 80.73  ? 72   DT  I OP1   1 
ATOM   2953  O  OP2   . DT  A  1 145 ? -53.569 -32.691 86.929 1.00 80.32  ? 72   DT  I OP2   1 
ATOM   2954  O  "O5'" . DT  A  1 145 ? -55.355 -34.379 87.348 1.00 81.52  ? 72   DT  I "O5'" 1 
ATOM   2955  C  "C5'" . DT  A  1 145 ? -56.535 -35.113 86.982 1.00 82.53  ? 72   DT  I "C5'" 1 
ATOM   2956  C  "C4'" . DT  A  1 145 ? -56.505 -36.573 87.424 1.00 83.21  ? 72   DT  I "C4'" 1 
ATOM   2957  O  "O4'" . DT  A  1 145 ? -55.617 -37.351 86.576 1.00 83.24  ? 72   DT  I "O4'" 1 
ATOM   2958  C  "C3'" . DT  A  1 145 ? -56.058 -36.850 88.861 1.00 83.82  ? 72   DT  I "C3'" 1 
ATOM   2959  O  "O3'" . DT  A  1 145 ? -57.018 -37.678 89.506 1.00 84.61  ? 72   DT  I "O3'" 1 
ATOM   2960  C  "C2'" . DT  A  1 145 ? -54.734 -37.593 88.702 1.00 83.38  ? 72   DT  I "C2'" 1 
ATOM   2961  C  "C1'" . DT  A  1 145 ? -54.972 -38.316 87.381 1.00 82.74  ? 72   DT  I "C1'" 1 
ATOM   2962  N  N1    . DT  A  1 145 ? -53.712 -38.799 86.722 1.00 82.36  ? 72   DT  I N1    1 
ATOM   2963  C  C2    . DT  A  1 145 ? -53.578 -40.138 86.385 1.00 82.18  ? 72   DT  I C2    1 
ATOM   2964  O  O2    . DT  A  1 145 ? -54.440 -40.981 86.580 1.00 82.38  ? 72   DT  I O2    1 
ATOM   2965  N  N3    . DT  A  1 145 ? -52.379 -40.461 85.795 1.00 81.55  ? 72   DT  I N3    1 
ATOM   2966  C  C4    . DT  A  1 145 ? -51.326 -39.604 85.518 1.00 82.01  ? 72   DT  I C4    1 
ATOM   2967  O  O4    . DT  A  1 145 ? -50.290 -39.993 84.993 1.00 82.14  ? 72   DT  I O4    1 
ATOM   2968  C  C5    . DT  A  1 145 ? -51.529 -38.224 85.899 1.00 82.04  ? 72   DT  I C5    1 
ATOM   2969  C  C7    . DT  A  1 145 ? -50.462 -37.199 85.655 1.00 82.31  ? 72   DT  I C7    1 
ATOM   2970  C  C6    . DT  A  1 145 ? -52.693 -37.893 86.473 1.00 82.18  ? 72   DT  I C6    1 
ATOM   2971  O  "O5'" . DA  B  2 1   ? -49.302 -50.421 83.394 1.00 98.99  ? -72  DA  J "O5'" 1 
ATOM   2972  C  "C5'" . DA  B  2 1   ? -50.701 -50.566 83.120 1.00 99.21  ? -72  DA  J "C5'" 1 
ATOM   2973  C  "C4'" . DA  B  2 1   ? -51.560 -50.082 84.283 1.00 98.75  ? -72  DA  J "C4'" 1 
ATOM   2974  O  "O4'" . DA  B  2 1   ? -50.826 -49.100 85.049 1.00 97.67  ? -72  DA  J "O4'" 1 
ATOM   2975  C  "C3'" . DA  B  2 1   ? -52.864 -49.406 83.877 1.00 98.66  ? -72  DA  J "C3'" 1 
ATOM   2976  O  "O3'" . DA  B  2 1   ? -53.914 -50.352 83.979 1.00 100.12 ? -72  DA  J "O3'" 1 
ATOM   2977  C  "C2'" . DA  B  2 1   ? -53.061 -48.265 84.871 1.00 97.53  ? -72  DA  J "C2'" 1 
ATOM   2978  C  "C1'" . DA  B  2 1   ? -51.680 -48.059 85.480 1.00 96.30  ? -72  DA  J "C1'" 1 
ATOM   2979  N  N9    . DA  B  2 1   ? -51.007 -46.797 85.164 1.00 95.85  ? -72  DA  J N9    1 
ATOM   2980  C  C8    . DA  B  2 1   ? -49.748 -46.674 84.642 1.00 95.47  ? -72  DA  J C8    1 
ATOM   2981  N  N7    . DA  B  2 1   ? -49.359 -45.435 84.472 1.00 95.40  ? -72  DA  J N7    1 
ATOM   2982  C  C5    . DA  B  2 1   ? -50.435 -44.689 84.917 1.00 95.20  ? -72  DA  J C5    1 
ATOM   2983  C  C6    . DA  B  2 1   ? -50.646 -43.300 84.996 1.00 95.30  ? -72  DA  J C6    1 
ATOM   2984  N  N6    . DA  B  2 1   ? -49.734 -42.408 84.601 1.00 95.32  ? -72  DA  J N6    1 
ATOM   2985  N  N1    . DA  B  2 1   ? -51.827 -42.870 85.487 1.00 95.44  ? -72  DA  J N1    1 
ATOM   2986  C  C2    . DA  B  2 1   ? -52.735 -43.777 85.878 1.00 95.55  ? -72  DA  J C2    1 
ATOM   2987  N  N3    . DA  B  2 1   ? -52.649 -45.109 85.849 1.00 95.25  ? -72  DA  J N3    1 
ATOM   2988  C  C4    . DA  B  2 1   ? -51.463 -45.508 85.354 1.00 95.29  ? -72  DA  J C4    1 
ATOM   2989  P  P     . DT  B  2 2   ? -55.341 -50.105 83.286 1.00 101.26 ? -71  DT  J P     1 
ATOM   2990  O  OP1   . DT  B  2 2   ? -56.004 -51.431 83.182 1.00 101.08 ? -71  DT  J OP1   1 
ATOM   2991  O  OP2   . DT  B  2 2   ? -55.143 -49.312 82.050 1.00 101.09 ? -71  DT  J OP2   1 
ATOM   2992  O  "O5'" . DT  B  2 2   ? -56.081 -49.188 84.372 1.00 99.16  ? -71  DT  J "O5'" 1 
ATOM   2993  C  "C5'" . DT  B  2 2   ? -57.478 -49.316 84.589 1.00 97.96  ? -71  DT  J "C5'" 1 
ATOM   2994  C  "C4'" . DT  B  2 2   ? -58.168 -48.045 84.147 1.00 96.50  ? -71  DT  J "C4'" 1 
ATOM   2995  O  "O4'" . DT  B  2 2   ? -57.237 -46.939 84.304 1.00 95.63  ? -71  DT  J "O4'" 1 
ATOM   2996  C  "C3'" . DT  B  2 2   ? -58.620 -48.038 82.686 1.00 96.06  ? -71  DT  J "C3'" 1 
ATOM   2997  O  "O3'" . DT  B  2 2   ? -59.976 -47.566 82.450 1.00 95.89  ? -71  DT  J "O3'" 1 
ATOM   2998  C  "C2'" . DT  B  2 2   ? -57.595 -47.131 82.006 1.00 95.72  ? -71  DT  J "C2'" 1 
ATOM   2999  C  "C1'" . DT  B  2 2   ? -57.227 -46.158 83.126 1.00 94.63  ? -71  DT  J "C1'" 1 
ATOM   3000  N  N1    . DT  B  2 2   ? -55.901 -45.420 82.954 1.00 94.09  ? -71  DT  J N1    1 
ATOM   3001  C  C2    . DT  B  2 2   ? -55.815 -44.065 83.251 1.00 93.51  ? -71  DT  J C2    1 
ATOM   3002  O  O2    . DT  B  2 2   ? -56.737 -43.377 83.664 1.00 93.55  ? -71  DT  J O2    1 
ATOM   3003  N  N3    . DT  B  2 2   ? -54.574 -43.518 83.051 1.00 93.07  ? -71  DT  J N3    1 
ATOM   3004  C  C4    . DT  B  2 2   ? -53.435 -44.154 82.593 1.00 93.59  ? -71  DT  J C4    1 
ATOM   3005  O  O4    . DT  B  2 2   ? -52.370 -43.563 82.447 1.00 93.70  ? -71  DT  J O4    1 
ATOM   3006  C  C5    . DT  B  2 2   ? -53.585 -45.556 82.301 1.00 93.48  ? -71  DT  J C5    1 
ATOM   3007  C  C7    . DT  B  2 2   ? -52.413 -46.344 81.792 1.00 93.77  ? -71  DT  J C7    1 
ATOM   3008  C  C6    . DT  B  2 2   ? -54.791 -46.110 82.491 1.00 93.61  ? -71  DT  J C6    1 
ATOM   3009  P  P     . DC  B  2 3   ? -60.923 -46.718 83.445 1.00 95.92  ? -70  DC  J P     1 
ATOM   3010  O  OP1   . DC  B  2 3   ? -60.212 -46.398 84.709 1.00 96.23  ? -70  DC  J OP1   1 
ATOM   3011  O  OP2   . DC  B  2 3   ? -62.217 -47.436 83.498 1.00 95.76  ? -70  DC  J OP2   1 
ATOM   3012  O  "O5'" . DC  B  2 3   ? -61.184 -45.358 82.628 1.00 95.06  ? -70  DC  J "O5'" 1 
ATOM   3013  C  "C5'" . DC  B  2 3   ? -61.362 -44.078 83.269 1.00 93.52  ? -70  DC  J "C5'" 1 
ATOM   3014  C  "C4'" . DC  B  2 3   ? -61.002 -42.932 82.328 1.00 92.35  ? -70  DC  J "C4'" 1 
ATOM   3015  O  "O4'" . DC  B  2 3   ? -59.562 -42.864 82.113 1.00 91.76  ? -70  DC  J "O4'" 1 
ATOM   3016  C  "C3'" . DC  B  2 3   ? -61.618 -43.027 80.930 1.00 91.97  ? -70  DC  J "C3'" 1 
ATOM   3017  O  "O3'" . DC  B  2 3   ? -62.097 -41.768 80.531 1.00 91.93  ? -70  DC  J "O3'" 1 
ATOM   3018  C  "C2'" . DC  B  2 3   ? -60.449 -43.439 80.048 1.00 91.69  ? -70  DC  J "C2'" 1 
ATOM   3019  C  "C1'" . DC  B  2 3   ? -59.345 -42.640 80.732 1.00 90.33  ? -70  DC  J "C1'" 1 
ATOM   3020  N  N1    . DC  B  2 3   ? -57.948 -42.995 80.298 1.00 89.53  ? -70  DC  J N1    1 
ATOM   3021  C  C2    . DC  B  2 3   ? -56.967 -41.991 80.218 1.00 88.86  ? -70  DC  J C2    1 
ATOM   3022  O  O2    . DC  B  2 3   ? -57.260 -40.828 80.522 1.00 88.86  ? -70  DC  J O2    1 
ATOM   3023  N  N3    . DC  B  2 3   ? -55.712 -42.326 79.816 1.00 88.10  ? -70  DC  J N3    1 
ATOM   3024  C  C4    . DC  B  2 3   ? -55.424 -43.592 79.494 1.00 88.91  ? -70  DC  J C4    1 
ATOM   3025  N  N4    . DC  B  2 3   ? -54.179 -43.879 79.101 1.00 89.00  ? -70  DC  J N4    1 
ATOM   3026  C  C5    . DC  B  2 3   ? -56.404 -44.628 79.560 1.00 88.98  ? -70  DC  J C5    1 
ATOM   3027  C  C6    . DC  B  2 3   ? -57.638 -44.285 79.959 1.00 89.25  ? -70  DC  J C6    1 
ATOM   3028  P  P     . DA  B  2 4   ? -63.655 -41.464 80.747 1.00 92.83  ? -69  DA  J P     1 
ATOM   3029  O  OP1   . DA  B  2 4   ? -63.895 -41.416 82.222 1.00 92.92  ? -69  DA  J OP1   1 
ATOM   3030  O  OP2   . DA  B  2 4   ? -64.398 -42.432 79.879 1.00 93.30  ? -69  DA  J OP2   1 
ATOM   3031  O  "O5'" . DA  B  2 4   ? -63.874 -39.993 80.140 1.00 90.72  ? -69  DA  J "O5'" 1 
ATOM   3032  C  "C5'" . DA  B  2 4   ? -63.190 -38.864 80.707 1.00 87.78  ? -69  DA  J "C5'" 1 
ATOM   3033  C  "C4'" . DA  B  2 4   ? -62.206 -38.253 79.718 1.00 84.78  ? -69  DA  J "C4'" 1 
ATOM   3034  O  "O4'" . DA  B  2 4   ? -61.073 -39.134 79.456 1.00 83.10  ? -69  DA  J "O4'" 1 
ATOM   3035  C  "C3'" . DA  B  2 4   ? -62.795 -37.921 78.349 1.00 83.49  ? -69  DA  J "C3'" 1 
ATOM   3036  O  "O3'" . DA  B  2 4   ? -62.462 -36.578 78.069 1.00 83.35  ? -69  DA  J "O3'" 1 
ATOM   3037  C  "C2'" . DA  B  2 4   ? -62.057 -38.872 77.405 1.00 82.73  ? -69  DA  J "C2'" 1 
ATOM   3038  C  "C1'" . DA  B  2 4   ? -60.709 -38.893 78.114 1.00 81.01  ? -69  DA  J "C1'" 1 
ATOM   3039  N  N9    . DA  B  2 4   ? -59.695 -39.848 77.658 1.00 80.54  ? -69  DA  J N9    1 
ATOM   3040  C  C8    . DA  B  2 4   ? -59.814 -41.196 77.456 1.00 80.18  ? -69  DA  J C8    1 
ATOM   3041  N  N7    . DA  B  2 4   ? -58.706 -41.773 77.049 1.00 79.99  ? -69  DA  J N7    1 
ATOM   3042  C  C5    . DA  B  2 4   ? -57.795 -40.730 76.975 1.00 79.69  ? -69  DA  J C5    1 
ATOM   3043  C  C6    . DA  B  2 4   ? -56.437 -40.663 76.605 1.00 79.45  ? -69  DA  J C6    1 
ATOM   3044  N  N6    . DA  B  2 4   ? -55.722 -41.722 76.224 1.00 79.77  ? -69  DA  J N6    1 
ATOM   3045  N  N1    . DA  B  2 4   ? -55.824 -39.463 76.642 1.00 79.78  ? -69  DA  J N1    1 
ATOM   3046  C  C2    . DA  B  2 4   ? -56.522 -38.387 77.021 1.00 80.22  ? -69  DA  J C2    1 
ATOM   3047  N  N3    . DA  B  2 4   ? -57.801 -38.324 77.391 1.00 80.35  ? -69  DA  J N3    1 
ATOM   3048  C  C4    . DA  B  2 4   ? -58.388 -39.538 77.346 1.00 80.27  ? -69  DA  J C4    1 
ATOM   3049  P  P     . DA  B  2 5   ? -63.559 -35.504 77.621 1.00 83.40  ? -68  DA  J P     1 
ATOM   3050  O  OP1   . DA  B  2 5   ? -64.032 -34.794 78.835 1.00 83.10  ? -68  DA  J OP1   1 
ATOM   3051  O  OP2   . DA  B  2 5   ? -64.507 -36.174 76.700 1.00 83.17  ? -68  DA  J OP2   1 
ATOM   3052  O  "O5'" . DA  B  2 5   ? -62.701 -34.467 76.757 1.00 82.38  ? -68  DA  J "O5'" 1 
ATOM   3053  C  "C5'" . DA  B  2 5   ? -61.468 -33.952 77.268 1.00 79.99  ? -68  DA  J "C5'" 1 
ATOM   3054  C  "C4'" . DA  B  2 5   ? -60.370 -33.955 76.211 1.00 77.88  ? -68  DA  J "C4'" 1 
ATOM   3055  O  "O4'" . DA  B  2 5   ? -59.780 -35.264 76.013 1.00 77.02  ? -68  DA  J "O4'" 1 
ATOM   3056  C  "C3'" . DA  B  2 5   ? -60.790 -33.454 74.836 1.00 76.45  ? -68  DA  J "C3'" 1 
ATOM   3057  O  "O3'" . DA  B  2 5   ? -60.037 -32.267 74.656 1.00 75.94  ? -68  DA  J "O3'" 1 
ATOM   3058  C  "C2'" . DA  B  2 5   ? -60.427 -34.583 73.867 1.00 75.47  ? -68  DA  J "C2'" 1 
ATOM   3059  C  "C1'" . DA  B  2 5   ? -59.398 -35.385 74.661 1.00 74.82  ? -68  DA  J "C1'" 1 
ATOM   3060  N  N9    . DA  B  2 5   ? -59.327 -36.822 74.391 1.00 74.46  ? -68  DA  J N9    1 
ATOM   3061  C  C8    . DA  B  2 5   ? -60.330 -37.746 74.524 1.00 74.17  ? -68  DA  J C8    1 
ATOM   3062  N  N7    . DA  B  2 5   ? -59.971 -38.974 74.225 1.00 73.96  ? -68  DA  J N7    1 
ATOM   3063  C  C5    . DA  B  2 5   ? -58.642 -38.847 73.873 1.00 73.53  ? -68  DA  J C5    1 
ATOM   3064  C  C6    . DA  B  2 5   ? -57.682 -39.784 73.447 1.00 73.82  ? -68  DA  J C6    1 
ATOM   3065  N  N6    . DA  B  2 5   ? -57.944 -41.083 73.306 1.00 73.62  ? -68  DA  J N6    1 
ATOM   3066  N  N1    . DA  B  2 5   ? -56.436 -39.331 73.167 1.00 74.23  ? -68  DA  J N1    1 
ATOM   3067  C  C2    . DA  B  2 5   ? -56.172 -38.024 73.306 1.00 73.85  ? -68  DA  J C2    1 
ATOM   3068  N  N3    . DA  B  2 5   ? -56.997 -37.050 73.695 1.00 73.46  ? -68  DA  J N3    1 
ATOM   3069  C  C4    . DA  B  2 5   ? -58.224 -37.531 73.970 1.00 73.73  ? -68  DA  J C4    1 
ATOM   3070  P  P     . DT  B  2 6   ? -60.338 -31.235 73.475 1.00 75.16  ? -67  DT  J P     1 
ATOM   3071  O  OP1   . DT  B  2 6   ? -59.809 -29.913 73.915 1.00 73.84  ? -67  DT  J OP1   1 
ATOM   3072  O  OP2   . DT  B  2 6   ? -61.746 -31.405 73.049 1.00 74.58  ? -67  DT  J OP2   1 
ATOM   3073  O  "O5'" . DT  B  2 6   ? -59.440 -31.818 72.285 1.00 73.62  ? -67  DT  J "O5'" 1 
ATOM   3074  C  "C5'" . DT  B  2 6   ? -58.019 -31.932 72.433 1.00 71.78  ? -67  DT  J "C5'" 1 
ATOM   3075  C  "C4'" . DT  B  2 6   ? -57.427 -32.722 71.281 1.00 70.33  ? -67  DT  J "C4'" 1 
ATOM   3076  O  "O4'" . DT  B  2 6   ? -57.679 -34.146 71.464 1.00 70.50  ? -67  DT  J "O4'" 1 
ATOM   3077  C  "C3'" . DT  B  2 6   ? -57.948 -32.356 69.886 1.00 69.01  ? -67  DT  J "C3'" 1 
ATOM   3078  O  "O3'" . DT  B  2 6   ? -56.828 -32.281 69.031 1.00 68.14  ? -67  DT  J "O3'" 1 
ATOM   3079  C  "C2'" . DT  B  2 6   ? -58.804 -33.566 69.519 1.00 69.22  ? -67  DT  J "C2'" 1 
ATOM   3080  C  "C1'" . DT  B  2 6   ? -57.984 -34.670 70.189 1.00 69.09  ? -67  DT  J "C1'" 1 
ATOM   3081  N  N1    . DT  B  2 6   ? -58.603 -36.032 70.308 1.00 68.84  ? -67  DT  J N1    1 
ATOM   3082  C  C2    . DT  B  2 6   ? -57.765 -37.130 70.222 1.00 69.02  ? -67  DT  J C2    1 
ATOM   3083  O  O2    . DT  B  2 6   ? -56.556 -37.053 70.066 1.00 69.30  ? -67  DT  J O2    1 
ATOM   3084  N  N3    . DT  B  2 6   ? -58.393 -38.345 70.326 1.00 68.75  ? -67  DT  J N3    1 
ATOM   3085  C  C4    . DT  B  2 6   ? -59.746 -38.578 70.500 1.00 68.99  ? -67  DT  J C4    1 
ATOM   3086  O  O4    . DT  B  2 6   ? -60.198 -39.716 70.586 1.00 69.25  ? -67  DT  J O4    1 
ATOM   3087  C  C5    . DT  B  2 6   ? -60.573 -37.398 70.575 1.00 69.11  ? -67  DT  J C5    1 
ATOM   3088  C  C7    . DT  B  2 6   ? -62.057 -37.534 70.763 1.00 69.16  ? -67  DT  J C7    1 
ATOM   3089  C  C6    . DT  B  2 6   ? -59.970 -36.195 70.480 1.00 69.24  ? -67  DT  J C6    1 
ATOM   3090  P  P     . DA  B  2 7   ? -56.600 -31.168 67.911 1.00 65.96  ? -66  DA  J P     1 
ATOM   3091  O  OP1   . DA  B  2 7   ? -56.149 -29.937 68.600 1.00 65.21  ? -66  DA  J OP1   1 
ATOM   3092  O  OP2   . DA  B  2 7   ? -57.765 -31.156 67.002 1.00 65.49  ? -66  DA  J OP2   1 
ATOM   3093  O  "O5'" . DA  B  2 7   ? -55.389 -31.829 67.105 1.00 64.13  ? -66  DA  J "O5'" 1 
ATOM   3094  C  "C5'" . DA  B  2 7   ? -54.317 -32.386 67.831 1.00 62.32  ? -66  DA  J "C5'" 1 
ATOM   3095  C  "C4'" . DA  B  2 7   ? -53.781 -33.675 67.230 1.00 61.75  ? -66  DA  J "C4'" 1 
ATOM   3096  O  "O4'" . DA  B  2 7   ? -54.623 -34.816 67.532 1.00 60.83  ? -66  DA  J "O4'" 1 
ATOM   3097  C  "C3'" . DA  B  2 7   ? -53.570 -33.684 65.725 1.00 61.71  ? -66  DA  J "C3'" 1 
ATOM   3098  O  "O3'" . DA  B  2 7   ? -52.256 -34.175 65.559 1.00 63.09  ? -66  DA  J "O3'" 1 
ATOM   3099  C  "C2'" . DA  B  2 7   ? -54.633 -34.653 65.206 1.00 60.39  ? -66  DA  J "C2'" 1 
ATOM   3100  C  "C1'" . DA  B  2 7   ? -54.808 -35.614 66.378 1.00 58.85  ? -66  DA  J "C1'" 1 
ATOM   3101  N  N9    . DA  B  2 7   ? -56.150 -36.178 66.506 1.00 58.27  ? -66  DA  J N9    1 
ATOM   3102  C  C8    . DA  B  2 7   ? -57.296 -35.436 66.638 1.00 58.44  ? -66  DA  J C8    1 
ATOM   3103  N  N7    . DA  B  2 7   ? -58.391 -36.147 66.751 1.00 58.19  ? -66  DA  J N7    1 
ATOM   3104  C  C5    . DA  B  2 7   ? -57.933 -37.446 66.699 1.00 57.80  ? -66  DA  J C5    1 
ATOM   3105  C  C6    . DA  B  2 7   ? -58.624 -38.670 66.769 1.00 58.04  ? -66  DA  J C6    1 
ATOM   3106  N  N6    . DA  B  2 7   ? -59.951 -38.726 66.915 1.00 57.98  ? -66  DA  J N6    1 
ATOM   3107  N  N1    . DA  B  2 7   ? -57.899 -39.810 66.682 1.00 57.87  ? -66  DA  J N1    1 
ATOM   3108  C  C2    . DA  B  2 7   ? -56.570 -39.707 66.531 1.00 57.75  ? -66  DA  J C2    1 
ATOM   3109  N  N3    . DA  B  2 7   ? -55.814 -38.604 66.461 1.00 57.30  ? -66  DA  J N3    1 
ATOM   3110  C  C4    . DA  B  2 7   ? -56.557 -37.492 66.551 1.00 57.11  ? -66  DA  J C4    1 
ATOM   3111  P  P     . DT  B  2 8   ? -51.569 -34.356 64.130 1.00 64.06  ? -65  DT  J P     1 
ATOM   3112  O  OP1   . DT  B  2 8   ? -50.114 -34.479 64.384 1.00 64.18  ? -65  DT  J OP1   1 
ATOM   3113  O  OP2   . DT  B  2 8   ? -52.135 -33.364 63.188 1.00 63.46  ? -65  DT  J OP2   1 
ATOM   3114  O  "O5'" . DT  B  2 8   ? -52.046 -35.804 63.679 1.00 64.39  ? -65  DT  J "O5'" 1 
ATOM   3115  C  "C5'" . DT  B  2 8   ? -51.495 -36.920 64.374 1.00 64.68  ? -65  DT  J "C5'" 1 
ATOM   3116  C  "C4'" . DT  B  2 8   ? -51.879 -38.187 63.658 1.00 64.45  ? -65  DT  J "C4'" 1 
ATOM   3117  O  "O4'" . DT  B  2 8   ? -53.270 -38.475 63.924 1.00 63.23  ? -65  DT  J "O4'" 1 
ATOM   3118  C  "C3'" . DT  B  2 8   ? -51.741 -38.089 62.147 1.00 65.59  ? -65  DT  J "C3'" 1 
ATOM   3119  O  "O3'" . DT  B  2 8   ? -51.144 -39.316 61.756 1.00 68.92  ? -65  DT  J "O3'" 1 
ATOM   3120  C  "C2'" . DT  B  2 8   ? -53.183 -37.903 61.661 1.00 63.98  ? -65  DT  J "C2'" 1 
ATOM   3121  C  "C1'" . DT  B  2 8   ? -53.927 -38.731 62.703 1.00 62.38  ? -65  DT  J "C1'" 1 
ATOM   3122  N  N1    . DT  B  2 8   ? -55.392 -38.473 62.902 1.00 61.96  ? -65  DT  J N1    1 
ATOM   3123  C  C2    . DT  B  2 8   ? -56.220 -39.569 63.115 1.00 61.35  ? -65  DT  J C2    1 
ATOM   3124  O  O2    . DT  B  2 8   ? -55.817 -40.719 63.136 1.00 61.38  ? -65  DT  J O2    1 
ATOM   3125  N  N3    . DT  B  2 8   ? -57.549 -39.276 63.298 1.00 60.13  ? -65  DT  J N3    1 
ATOM   3126  C  C4    . DT  B  2 8   ? -58.120 -38.017 63.296 1.00 61.17  ? -65  DT  J C4    1 
ATOM   3127  O  O4    . DT  B  2 8   ? -59.320 -37.859 63.470 1.00 61.33  ? -65  DT  J O4    1 
ATOM   3128  C  C5    . DT  B  2 8   ? -57.209 -36.912 63.070 1.00 61.52  ? -65  DT  J C5    1 
ATOM   3129  C  C7    . DT  B  2 8   ? -57.727 -35.503 63.045 1.00 61.67  ? -65  DT  J C7    1 
ATOM   3130  C  C6    . DT  B  2 8   ? -55.900 -37.183 62.888 1.00 61.64  ? -65  DT  J C6    1 
ATOM   3131  P  P     . DC  B  2 9   ? -50.584 -39.618 60.285 1.00 71.70  ? -64  DC  J P     1 
ATOM   3132  O  OP1   . DC  B  2 9   ? -49.189 -40.092 60.476 1.00 72.23  ? -64  DC  J OP1   1 
ATOM   3133  O  OP2   . DC  B  2 9   ? -50.868 -38.465 59.385 1.00 70.68  ? -64  DC  J OP2   1 
ATOM   3134  O  "O5'" . DC  B  2 9   ? -51.476 -40.875 59.857 1.00 70.58  ? -64  DC  J "O5'" 1 
ATOM   3135  C  "C5'" . DC  B  2 9   ? -51.692 -41.901 60.828 1.00 71.13  ? -64  DC  J "C5'" 1 
ATOM   3136  C  "C4'" . DC  B  2 9   ? -52.635 -42.970 60.303 1.00 71.84  ? -64  DC  J "C4'" 1 
ATOM   3137  O  "O4'" . DC  B  2 9   ? -54.012 -42.700 60.684 1.00 71.16  ? -64  DC  J "O4'" 1 
ATOM   3138  C  "C3'" . DC  B  2 9   ? -52.604 -43.128 58.787 1.00 72.04  ? -64  DC  J "C3'" 1 
ATOM   3139  O  "O3'" . DC  B  2 9   ? -52.428 -44.503 58.445 1.00 72.98  ? -64  DC  J "O3'" 1 
ATOM   3140  C  "C2'" . DC  B  2 9   ? -53.934 -42.544 58.314 1.00 70.96  ? -64  DC  J "C2'" 1 
ATOM   3141  C  "C1'" . DC  B  2 9   ? -54.833 -42.668 59.541 1.00 70.16  ? -64  DC  J "C1'" 1 
ATOM   3142  N  N1    . DC  B  2 9   ? -55.782 -41.527 59.682 1.00 69.92  ? -64  DC  J N1    1 
ATOM   3143  C  C2    . DC  B  2 9   ? -57.125 -41.800 59.961 1.00 69.70  ? -64  DC  J C2    1 
ATOM   3144  O  O2    . DC  B  2 9   ? -57.475 -42.983 60.086 1.00 69.61  ? -64  DC  J O2    1 
ATOM   3145  N  N3    . DC  B  2 9   ? -57.992 -40.757 60.085 1.00 69.13  ? -64  DC  J N3    1 
ATOM   3146  C  C4    . DC  B  2 9   ? -57.560 -39.501 59.938 1.00 69.11  ? -64  DC  J C4    1 
ATOM   3147  N  N4    . DC  B  2 9   ? -58.445 -38.509 60.064 1.00 69.45  ? -64  DC  J N4    1 
ATOM   3148  C  C5    . DC  B  2 9   ? -56.198 -39.203 59.651 1.00 69.01  ? -64  DC  J C5    1 
ATOM   3149  C  C6    . DC  B  2 9   ? -55.353 -40.235 59.533 1.00 69.59  ? -64  DC  J C6    1 
ATOM   3150  P  P     . DC  B  2 10  ? -52.239 -44.897 56.906 1.00 74.43  ? -63  DC  J P     1 
ATOM   3151  O  OP1   . DC  B  2 10  ? -51.448 -46.152 56.835 1.00 75.12  ? -63  DC  J OP1   1 
ATOM   3152  O  OP2   . DC  B  2 10  ? -51.823 -43.683 56.149 1.00 72.92  ? -63  DC  J OP2   1 
ATOM   3153  O  "O5'" . DC  B  2 10  ? -53.731 -45.265 56.487 1.00 72.72  ? -63  DC  J "O5'" 1 
ATOM   3154  C  "C5'" . DC  B  2 10  ? -54.416 -46.296 57.163 1.00 70.78  ? -63  DC  J "C5'" 1 
ATOM   3155  C  "C4'" . DC  B  2 10  ? -55.822 -46.338 56.616 1.00 70.34  ? -63  DC  J "C4'" 1 
ATOM   3156  O  "O4'" . DC  B  2 10  ? -56.542 -45.163 57.066 1.00 69.90  ? -63  DC  J "O4'" 1 
ATOM   3157  C  "C3'" . DC  B  2 10  ? -55.916 -46.346 55.089 1.00 69.36  ? -63  DC  J "C3'" 1 
ATOM   3158  O  "O3'" . DC  B  2 10  ? -56.796 -47.381 54.752 1.00 69.11  ? -63  DC  J "O3'" 1 
ATOM   3159  C  "C2'" . DC  B  2 10  ? -56.523 -44.992 54.730 1.00 68.45  ? -63  DC  J "C2'" 1 
ATOM   3160  C  "C1'" . DC  B  2 10  ? -57.322 -44.685 55.991 1.00 68.09  ? -63  DC  J "C1'" 1 
ATOM   3161  N  N1    . DC  B  2 10  ? -57.649 -43.230 56.219 1.00 67.75  ? -63  DC  J N1    1 
ATOM   3162  C  C2    . DC  B  2 10  ? -58.939 -42.909 56.653 1.00 67.19  ? -63  DC  J C2    1 
ATOM   3163  O  O2    . DC  B  2 10  ? -59.753 -43.825 56.836 1.00 67.04  ? -63  DC  J O2    1 
ATOM   3164  N  N3    . DC  B  2 10  ? -59.259 -41.606 56.856 1.00 66.70  ? -63  DC  J N3    1 
ATOM   3165  C  C4    . DC  B  2 10  ? -58.355 -40.656 56.650 1.00 66.59  ? -63  DC  J C4    1 
ATOM   3166  N  N4    . DC  B  2 10  ? -58.734 -39.399 56.875 1.00 67.00  ? -63  DC  J N4    1 
ATOM   3167  C  C5    . DC  B  2 10  ? -57.032 -40.953 56.209 1.00 66.71  ? -63  DC  J C5    1 
ATOM   3168  C  C6    . DC  B  2 10  ? -56.726 -42.240 56.009 1.00 67.08  ? -63  DC  J C6    1 
ATOM   3169  P  P     . DA  B  2 11  ? -56.723 -48.236 53.400 1.00 68.49  ? -62  DA  J P     1 
ATOM   3170  O  OP1   . DA  B  2 11  ? -56.513 -49.654 53.804 1.00 68.08  ? -62  DA  J OP1   1 
ATOM   3171  O  OP2   . DA  B  2 11  ? -55.886 -47.575 52.374 1.00 67.12  ? -62  DA  J OP2   1 
ATOM   3172  O  "O5'" . DA  B  2 11  ? -58.236 -48.095 52.950 1.00 66.82  ? -62  DA  J "O5'" 1 
ATOM   3173  C  "C5'" . DA  B  2 11  ? -59.234 -48.462 53.885 1.00 64.82  ? -62  DA  J "C5'" 1 
ATOM   3174  C  "C4'" . DA  B  2 11  ? -60.539 -47.916 53.382 1.00 63.45  ? -62  DA  J "C4'" 1 
ATOM   3175  O  "O4'" . DA  B  2 11  ? -60.593 -46.539 53.794 1.00 61.72  ? -62  DA  J "O4'" 1 
ATOM   3176  C  "C3'" . DA  B  2 11  ? -60.652 -47.949 51.858 1.00 63.28  ? -62  DA  J "C3'" 1 
ATOM   3177  O  "O3'" . DA  B  2 11  ? -61.803 -48.738 51.509 1.00 64.14  ? -62  DA  J "O3'" 1 
ATOM   3178  C  "C2'" . DA  B  2 11  ? -60.712 -46.472 51.456 1.00 62.02  ? -62  DA  J "C2'" 1 
ATOM   3179  C  "C1'" . DA  B  2 11  ? -61.141 -45.782 52.746 1.00 60.82  ? -62  DA  J "C1'" 1 
ATOM   3180  N  N9    . DA  B  2 11  ? -60.655 -44.419 52.926 1.00 60.40  ? -62  DA  J N9    1 
ATOM   3181  C  C8    . DA  B  2 11  ? -59.377 -43.946 52.780 1.00 60.09  ? -62  DA  J C8    1 
ATOM   3182  N  N7    . DA  B  2 11  ? -59.264 -42.660 53.023 1.00 59.84  ? -62  DA  J N7    1 
ATOM   3183  C  C5    . DA  B  2 11  ? -60.546 -42.260 53.360 1.00 59.82  ? -62  DA  J C5    1 
ATOM   3184  C  C6    . DA  B  2 11  ? -61.107 -41.009 53.727 1.00 60.46  ? -62  DA  J C6    1 
ATOM   3185  N  N6    . DA  B  2 11  ? -60.410 -39.868 53.826 1.00 59.93  ? -62  DA  J N6    1 
ATOM   3186  N  N1    . DA  B  2 11  ? -62.435 -40.974 53.998 1.00 60.42  ? -62  DA  J N1    1 
ATOM   3187  C  C2    . DA  B  2 11  ? -63.146 -42.112 53.899 1.00 60.20  ? -62  DA  J C2    1 
ATOM   3188  N  N3    . DA  B  2 11  ? -62.737 -43.336 53.568 1.00 59.26  ? -62  DA  J N3    1 
ATOM   3189  C  C4    . DA  B  2 11  ? -61.417 -43.340 53.308 1.00 60.14  ? -62  DA  J C4    1 
ATOM   3190  P  P     . DC  B  2 12  ? -62.279 -49.032 50.005 1.00 65.17  ? -61  DC  J P     1 
ATOM   3191  O  OP1   . DC  B  2 12  ? -63.264 -50.128 50.082 1.00 66.12  ? -61  DC  J OP1   1 
ATOM   3192  O  OP2   . DC  B  2 12  ? -61.110 -49.184 49.112 1.00 65.07  ? -61  DC  J OP2   1 
ATOM   3193  O  "O5'" . DC  B  2 12  ? -63.088 -47.709 49.640 1.00 64.94  ? -61  DC  J "O5'" 1 
ATOM   3194  C  "C5'" . DC  B  2 12  ? -64.120 -47.373 50.550 1.00 67.01  ? -61  DC  J "C5'" 1 
ATOM   3195  C  "C4'" . DC  B  2 12  ? -64.803 -46.062 50.224 1.00 68.07  ? -61  DC  J "C4'" 1 
ATOM   3196  O  "O4'" . DC  B  2 12  ? -63.968 -44.969 50.667 1.00 67.82  ? -61  DC  J "O4'" 1 
ATOM   3197  C  "C3'" . DC  B  2 12  ? -65.075 -45.837 48.744 1.00 69.00  ? -61  DC  J "C3'" 1 
ATOM   3198  O  "O3'" . DC  B  2 12  ? -66.467 -45.532 48.555 1.00 70.91  ? -61  DC  J "O3'" 1 
ATOM   3199  C  "C2'" . DC  B  2 12  ? -64.150 -44.673 48.380 1.00 67.90  ? -61  DC  J "C2'" 1 
ATOM   3200  C  "C1'" . DC  B  2 12  ? -64.067 -43.942 49.712 1.00 66.67  ? -61  DC  J "C1'" 1 
ATOM   3201  N  N1    . DC  B  2 12  ? -62.879 -43.054 49.856 1.00 65.99  ? -61  DC  J N1    1 
ATOM   3202  C  C2    . DC  B  2 12  ? -63.026 -41.774 50.410 1.00 65.22  ? -61  DC  J C2    1 
ATOM   3203  O  O2    . DC  B  2 12  ? -64.149 -41.399 50.776 1.00 64.88  ? -61  DC  J O2    1 
ATOM   3204  N  N3    . DC  B  2 12  ? -61.923 -40.986 50.525 1.00 64.84  ? -61  DC  J N3    1 
ATOM   3205  C  C4    . DC  B  2 12  ? -60.734 -41.436 50.119 1.00 65.07  ? -61  DC  J C4    1 
ATOM   3206  N  N4    . DC  B  2 12  ? -59.666 -40.646 50.243 1.00 65.22  ? -61  DC  J N4    1 
ATOM   3207  C  C5    . DC  B  2 12  ? -60.576 -42.735 49.557 1.00 65.18  ? -61  DC  J C5    1 
ATOM   3208  C  C6    . DC  B  2 12  ? -61.658 -43.504 49.444 1.00 64.96  ? -61  DC  J C6    1 
ATOM   3209  P  P     . DC  B  2 13  ? -67.054 -45.350 47.067 1.00 72.53  ? -60  DC  J P     1 
ATOM   3210  O  OP1   . DC  B  2 13  ? -68.383 -46.006 47.055 1.00 71.96  ? -60  DC  J OP1   1 
ATOM   3211  O  OP2   . DC  B  2 13  ? -66.002 -45.722 46.076 1.00 70.66  ? -60  DC  J OP2   1 
ATOM   3212  O  "O5'" . DC  B  2 13  ? -67.261 -43.764 46.956 1.00 72.61  ? -60  DC  J "O5'" 1 
ATOM   3213  C  "C5'" . DC  B  2 13  ? -68.025 -43.025 47.919 1.00 73.57  ? -60  DC  J "C5'" 1 
ATOM   3214  C  "C4'" . DC  B  2 13  ? -68.049 -41.550 47.545 1.00 73.75  ? -60  DC  J "C4'" 1 
ATOM   3215  O  "O4'" . DC  B  2 13  ? -66.795 -40.902 47.900 1.00 73.11  ? -60  DC  J "O4'" 1 
ATOM   3216  C  "C3'" . DC  B  2 13  ? -68.248 -41.296 46.056 1.00 74.07  ? -60  DC  J "C3'" 1 
ATOM   3217  O  "O3'" . DC  B  2 13  ? -69.191 -40.248 45.896 1.00 75.56  ? -60  DC  J "O3'" 1 
ATOM   3218  C  "C2'" . DC  B  2 13  ? -66.864 -40.887 45.547 1.00 73.55  ? -60  DC  J "C2'" 1 
ATOM   3219  C  "C1'" . DC  B  2 13  ? -66.259 -40.219 46.779 1.00 72.45  ? -60  DC  J "C1'" 1 
ATOM   3220  N  N1    . DC  B  2 13  ? -64.754 -40.259 46.835 1.00 71.70  ? -60  DC  J N1    1 
ATOM   3221  C  C2    . DC  B  2 13  ? -64.012 -39.105 47.160 1.00 71.25  ? -60  DC  J C2    1 
ATOM   3222  O  O2    . DC  B  2 13  ? -64.590 -38.041 47.406 1.00 71.63  ? -60  DC  J O2    1 
ATOM   3223  N  N3    . DC  B  2 13  ? -62.657 -39.175 47.208 1.00 71.45  ? -60  DC  J N3    1 
ATOM   3224  C  C4    . DC  B  2 13  ? -62.034 -40.331 46.941 1.00 72.17  ? -60  DC  J C4    1 
ATOM   3225  N  N4    . DC  B  2 13  ? -60.692 -40.367 46.994 1.00 71.31  ? -60  DC  J N4    1 
ATOM   3226  C  C5    . DC  B  2 13  ? -62.772 -41.512 46.603 1.00 72.02  ? -60  DC  J C5    1 
ATOM   3227  C  C6    . DC  B  2 13  ? -64.109 -41.432 46.564 1.00 71.60  ? -60  DC  J C6    1 
ATOM   3228  P  P     . DT  B  2 14  ? -69.929 -40.049 44.492 1.00 76.05  ? -59  DT  J P     1 
ATOM   3229  O  OP1   . DT  B  2 14  ? -71.353 -39.822 44.829 1.00 75.73  ? -59  DT  J OP1   1 
ATOM   3230  O  OP2   . DT  B  2 14  ? -69.523 -41.140 43.566 1.00 75.39  ? -59  DT  J OP2   1 
ATOM   3231  O  "O5'" . DT  B  2 14  ? -69.275 -38.708 43.915 1.00 76.67  ? -59  DT  J "O5'" 1 
ATOM   3232  C  "C5'" . DT  B  2 14  ? -69.244 -37.471 44.635 1.00 77.69  ? -59  DT  J "C5'" 1 
ATOM   3233  C  "C4'" . DT  B  2 14  ? -68.323 -36.490 43.922 1.00 78.49  ? -59  DT  J "C4'" 1 
ATOM   3234  O  "O4'" . DT  B  2 14  ? -66.933 -36.786 44.223 1.00 78.41  ? -59  DT  J "O4'" 1 
ATOM   3235  C  "C3'" . DT  B  2 14  ? -68.426 -36.485 42.397 1.00 79.35  ? -59  DT  J "C3'" 1 
ATOM   3236  O  "O3'" . DT  B  2 14  ? -68.388 -35.149 41.943 1.00 82.01  ? -59  DT  J "O3'" 1 
ATOM   3237  C  "C2'" . DT  B  2 14  ? -67.184 -37.230 41.928 1.00 78.70  ? -59  DT  J "C2'" 1 
ATOM   3238  C  "C1'" . DT  B  2 14  ? -66.206 -36.770 43.005 1.00 78.40  ? -59  DT  J "C1'" 1 
ATOM   3239  N  N1    . DT  B  2 14  ? -64.951 -37.592 43.122 1.00 78.36  ? -59  DT  J N1    1 
ATOM   3240  C  C2    . DT  B  2 14  ? -63.760 -36.961 43.448 1.00 77.84  ? -59  DT  J C2    1 
ATOM   3241  O  O2    . DT  B  2 14  ? -63.662 -35.762 43.655 1.00 77.84  ? -59  DT  J O2    1 
ATOM   3242  N  N3    . DT  B  2 14  ? -62.673 -37.795 43.525 1.00 77.17  ? -59  DT  J N3    1 
ATOM   3243  C  C4    . DT  B  2 14  ? -62.654 -39.161 43.313 1.00 77.63  ? -59  DT  J C4    1 
ATOM   3244  O  O4    . DT  B  2 14  ? -61.617 -39.802 43.410 1.00 77.53  ? -59  DT  J O4    1 
ATOM   3245  C  C5    . DT  B  2 14  ? -63.930 -39.761 42.974 1.00 78.07  ? -59  DT  J C5    1 
ATOM   3246  C  C7    . DT  B  2 14  ? -64.057 -41.235 42.722 1.00 78.00  ? -59  DT  J C7    1 
ATOM   3247  C  C6    . DT  B  2 14  ? -65.003 -38.959 42.896 1.00 78.24  ? -59  DT  J C6    1 
ATOM   3248  P  P     . DG  B  2 15  ? -69.581 -34.572 41.049 1.00 83.84  ? -58  DG  J P     1 
ATOM   3249  O  OP1   . DG  B  2 15  ? -70.786 -34.558 41.918 1.00 83.77  ? -58  DG  J OP1   1 
ATOM   3250  O  OP2   . DG  B  2 15  ? -69.585 -35.301 39.756 1.00 82.97  ? -58  DG  J OP2   1 
ATOM   3251  O  "O5'" . DG  B  2 15  ? -69.129 -33.060 40.775 1.00 83.03  ? -58  DG  J "O5'" 1 
ATOM   3252  C  "C5'" . DG  B  2 15  ? -68.912 -32.192 41.883 1.00 83.47  ? -58  DG  J "C5'" 1 
ATOM   3253  C  "C4'" . DG  B  2 15  ? -67.664 -31.360 41.664 1.00 83.39  ? -58  DG  J "C4'" 1 
ATOM   3254  O  "O4'" . DG  B  2 15  ? -66.456 -32.159 41.774 1.00 82.32  ? -58  DG  J "O4'" 1 
ATOM   3255  C  "C3'" . DG  B  2 15  ? -67.632 -30.669 40.305 1.00 83.63  ? -58  DG  J "C3'" 1 
ATOM   3256  O  "O3'" . DG  B  2 15  ? -67.435 -29.256 40.554 1.00 84.16  ? -58  DG  J "O3'" 1 
ATOM   3257  C  "C2'" . DG  B  2 15  ? -66.546 -31.431 39.528 1.00 82.67  ? -58  DG  J "C2'" 1 
ATOM   3258  C  "C1'" . DG  B  2 15  ? -65.657 -32.037 40.614 1.00 81.73  ? -58  DG  J "C1'" 1 
ATOM   3259  N  N9    . DG  B  2 15  ? -65.146 -33.380 40.337 1.00 81.59  ? -58  DG  J N9    1 
ATOM   3260  C  C8    . DG  B  2 15  ? -65.841 -34.416 39.765 1.00 81.70  ? -58  DG  J C8    1 
ATOM   3261  N  N7    . DG  B  2 15  ? -65.151 -35.517 39.650 1.00 81.84  ? -58  DG  J N7    1 
ATOM   3262  C  C5    . DG  B  2 15  ? -63.915 -35.203 40.185 1.00 81.37  ? -58  DG  J C5    1 
ATOM   3263  C  C6    . DG  B  2 15  ? -62.760 -36.010 40.330 1.00 81.26  ? -58  DG  J C6    1 
ATOM   3264  O  O6    . DG  B  2 15  ? -62.605 -37.192 40.009 1.00 81.39  ? -58  DG  J O6    1 
ATOM   3265  N  N1    . DG  B  2 15  ? -61.710 -35.320 40.925 1.00 81.60  ? -58  DG  J N1    1 
ATOM   3266  C  C2    . DG  B  2 15  ? -61.774 -34.003 41.325 1.00 81.72  ? -58  DG  J C2    1 
ATOM   3267  N  N2    . DG  B  2 15  ? -60.663 -33.497 41.879 1.00 81.40  ? -58  DG  J N2    1 
ATOM   3268  N  N3    . DG  B  2 15  ? -62.855 -33.235 41.192 1.00 81.71  ? -58  DG  J N3    1 
ATOM   3269  C  C4    . DG  B  2 15  ? -63.893 -33.894 40.617 1.00 81.51  ? -58  DG  J C4    1 
ATOM   3270  P  P     . DC  B  2 16  ? -66.540 -28.270 39.665 1.00 84.47  ? -57  DC  J P     1 
ATOM   3271  O  OP1   . DC  B  2 16  ? -66.706 -26.905 40.227 1.00 84.41  ? -57  DC  J OP1   1 
ATOM   3272  O  OP2   . DC  B  2 16  ? -66.826 -28.521 38.230 1.00 84.30  ? -57  DC  J OP2   1 
ATOM   3273  O  "O5'" . DC  B  2 16  ? -65.061 -28.787 40.000 1.00 84.28  ? -57  DC  J "O5'" 1 
ATOM   3274  C  "C5'" . DC  B  2 16  ? -64.005 -27.891 40.312 1.00 83.61  ? -57  DC  J "C5'" 1 
ATOM   3275  C  "C4'" . DC  B  2 16  ? -62.850 -28.143 39.364 1.00 83.39  ? -57  DC  J "C4'" 1 
ATOM   3276  O  "O4'" . DC  B  2 16  ? -62.678 -29.561 39.121 1.00 83.02  ? -57  DC  J "O4'" 1 
ATOM   3277  C  "C3'" . DC  B  2 16  ? -62.995 -27.524 37.980 1.00 83.49  ? -57  DC  J "C3'" 1 
ATOM   3278  O  "O3'" . DC  B  2 16  ? -61.747 -26.942 37.662 1.00 84.34  ? -57  DC  J "O3'" 1 
ATOM   3279  C  "C2'" . DC  B  2 16  ? -63.299 -28.714 37.073 1.00 82.74  ? -57  DC  J "C2'" 1 
ATOM   3280  C  "C1'" . DC  B  2 16  ? -62.396 -29.729 37.752 1.00 81.91  ? -57  DC  J "C1'" 1 
ATOM   3281  N  N1    . DC  B  2 16  ? -62.597 -31.162 37.420 1.00 82.06  ? -57  DC  J N1    1 
ATOM   3282  C  C2    . DC  B  2 16  ? -61.582 -32.064 37.777 1.00 81.69  ? -57  DC  J C2    1 
ATOM   3283  O  O2    . DC  B  2 16  ? -60.567 -31.635 38.345 1.00 81.21  ? -57  DC  J O2    1 
ATOM   3284  N  N3    . DC  B  2 16  ? -61.739 -33.382 37.482 1.00 81.20  ? -57  DC  J N3    1 
ATOM   3285  C  C4    . DC  B  2 16  ? -62.850 -33.802 36.870 1.00 81.55  ? -57  DC  J C4    1 
ATOM   3286  N  N4    . DC  B  2 16  ? -62.961 -35.108 36.608 1.00 81.36  ? -57  DC  J N4    1 
ATOM   3287  C  C5    . DC  B  2 16  ? -63.898 -32.901 36.505 1.00 81.54  ? -57  DC  J C5    1 
ATOM   3288  C  C6    . DC  B  2 16  ? -63.733 -31.602 36.795 1.00 81.82  ? -57  DC  J C6    1 
ATOM   3289  P  P     . DA  B  2 17  ? -61.529 -25.374 37.855 1.00 85.53  ? -56  DA  J P     1 
ATOM   3290  O  OP1   . DA  B  2 17  ? -62.260 -24.906 39.062 1.00 85.38  ? -56  DA  J OP1   1 
ATOM   3291  O  OP2   . DA  B  2 17  ? -61.795 -24.776 36.523 1.00 85.74  ? -56  DA  J OP2   1 
ATOM   3292  O  "O5'" . DA  B  2 17  ? -59.968 -25.249 38.162 1.00 85.36  ? -56  DA  J "O5'" 1 
ATOM   3293  C  "C5'" . DA  B  2 17  ? -59.376 -25.863 39.309 1.00 85.03  ? -56  DA  J "C5'" 1 
ATOM   3294  C  "C4'" . DA  B  2 17  ? -58.116 -26.609 38.893 1.00 84.40  ? -56  DA  J "C4'" 1 
ATOM   3295  O  "O4'" . DA  B  2 17  ? -58.459 -27.814 38.167 1.00 83.82  ? -56  DA  J "O4'" 1 
ATOM   3296  C  "C3'" . DA  B  2 17  ? -57.180 -25.872 37.946 1.00 84.50  ? -56  DA  J "C3'" 1 
ATOM   3297  O  "O3'" . DA  B  2 17  ? -55.901 -26.458 38.087 1.00 85.58  ? -56  DA  J "O3'" 1 
ATOM   3298  C  "C2'" . DA  B  2 17  ? -57.741 -26.231 36.579 1.00 83.96  ? -56  DA  J "C2'" 1 
ATOM   3299  C  "C1'" . DA  B  2 17  ? -58.004 -27.711 36.832 1.00 83.90  ? -56  DA  J "C1'" 1 
ATOM   3300  N  N9    . DA  B  2 17  ? -59.023 -28.322 35.998 1.00 83.95  ? -56  DA  J N9    1 
ATOM   3301  C  C8    . DA  B  2 17  ? -60.034 -27.705 35.316 1.00 84.10  ? -56  DA  J C8    1 
ATOM   3302  N  N7    . DA  B  2 17  ? -60.802 -28.534 34.653 1.00 84.21  ? -56  DA  J N7    1 
ATOM   3303  C  C5    . DA  B  2 17  ? -60.256 -29.774 34.925 1.00 83.88  ? -56  DA  J C5    1 
ATOM   3304  C  C6    . DA  B  2 17  ? -60.614 -31.071 34.521 1.00 83.93  ? -56  DA  J C6    1 
ATOM   3305  N  N6    . DA  B  2 17  ? -61.656 -31.304 33.720 1.00 83.94  ? -56  DA  J N6    1 
ATOM   3306  N  N1    . DA  B  2 17  ? -59.863 -32.106 34.963 1.00 83.85  ? -56  DA  J N1    1 
ATOM   3307  C  C2    . DA  B  2 17  ? -58.818 -31.847 35.765 1.00 84.11  ? -56  DA  J C2    1 
ATOM   3308  N  N3    . DA  B  2 17  ? -58.388 -30.667 36.219 1.00 83.95  ? -56  DA  J N3    1 
ATOM   3309  C  C4    . DA  B  2 17  ? -59.158 -29.666 35.756 1.00 83.95  ? -56  DA  J C4    1 
ATOM   3310  P  P     . DG  B  2 18  ? -54.578 -25.614 37.806 1.00 85.78  ? -55  DG  J P     1 
ATOM   3311  O  OP1   . DG  B  2 18  ? -53.879 -25.513 39.108 1.00 85.08  ? -55  DG  J OP1   1 
ATOM   3312  O  OP2   . DG  B  2 18  ? -54.971 -24.379 37.080 1.00 85.80  ? -55  DG  J OP2   1 
ATOM   3313  O  "O5'" . DG  B  2 18  ? -53.748 -26.550 36.808 1.00 84.76  ? -55  DG  J "O5'" 1 
ATOM   3314  C  "C5'" . DG  B  2 18  ? -53.285 -27.821 37.250 1.00 85.11  ? -55  DG  J "C5'" 1 
ATOM   3315  C  "C4'" . DG  B  2 18  ? -53.546 -28.868 36.185 1.00 85.43  ? -55  DG  J "C4'" 1 
ATOM   3316  O  "O4'" . DG  B  2 18  ? -54.934 -28.813 35.745 1.00 85.51  ? -55  DG  J "O4'" 1 
ATOM   3317  C  "C3'" . DG  B  2 18  ? -52.711 -28.717 34.911 1.00 85.60  ? -55  DG  J "C3'" 1 
ATOM   3318  O  "O3'" . DG  B  2 18  ? -52.211 -29.979 34.486 1.00 85.76  ? -55  DG  J "O3'" 1 
ATOM   3319  C  "C2'" . DG  B  2 18  ? -53.736 -28.234 33.895 1.00 85.76  ? -55  DG  J "C2'" 1 
ATOM   3320  C  "C1'" . DG  B  2 18  ? -54.879 -29.122 34.369 1.00 85.52  ? -55  DG  J "C1'" 1 
ATOM   3321  N  N9    . DG  B  2 18  ? -56.134 -28.972 33.622 1.00 85.54  ? -55  DG  J N9    1 
ATOM   3322  C  C8    . DG  B  2 18  ? -56.760 -27.805 33.249 1.00 85.40  ? -55  DG  J C8    1 
ATOM   3323  N  N7    . DG  B  2 18  ? -57.854 -27.990 32.568 1.00 85.24  ? -55  DG  J N7    1 
ATOM   3324  C  C5    . DG  B  2 18  ? -57.954 -29.368 32.474 1.00 85.21  ? -55  DG  J C5    1 
ATOM   3325  C  C6    . DG  B  2 18  ? -58.942 -30.153 31.843 1.00 85.48  ? -55  DG  J C6    1 
ATOM   3326  O  O6    . DG  B  2 18  ? -59.936 -29.737 31.236 1.00 85.59  ? -55  DG  J O6    1 
ATOM   3327  N  N1    . DG  B  2 18  ? -58.690 -31.526 31.967 1.00 85.47  ? -55  DG  J N1    1 
ATOM   3328  C  C2    . DG  B  2 18  ? -57.606 -32.065 32.628 1.00 85.17  ? -55  DG  J C2    1 
ATOM   3329  N  N2    . DG  B  2 18  ? -57.517 -33.398 32.650 1.00 85.11  ? -55  DG  J N2    1 
ATOM   3330  N  N3    . DG  B  2 18  ? -56.671 -31.335 33.225 1.00 85.01  ? -55  DG  J N3    1 
ATOM   3331  C  C4    . DG  B  2 18  ? -56.907 -29.997 33.112 1.00 85.37  ? -55  DG  J C4    1 
ATOM   3332  P  P     . DA  B  2 19  ? -50.654 -30.287 34.591 1.00 85.81  ? -54  DA  J P     1 
ATOM   3333  O  OP1   . DA  B  2 19  ? -50.441 -30.938 35.905 1.00 86.15  ? -54  DA  J OP1   1 
ATOM   3334  O  OP2   . DA  B  2 19  ? -49.918 -29.054 34.243 1.00 85.83  ? -54  DA  J OP2   1 
ATOM   3335  O  "O5'" . DA  B  2 19  ? -50.397 -31.316 33.394 1.00 85.75  ? -54  DA  J "O5'" 1 
ATOM   3336  C  "C5'" . DA  B  2 19  ? -50.310 -32.690 33.670 1.00 86.12  ? -54  DA  J "C5'" 1 
ATOM   3337  C  "C4'" . DA  B  2 19  ? -51.432 -33.433 32.982 1.00 87.20  ? -54  DA  J "C4'" 1 
ATOM   3338  O  "O4'" . DA  B  2 19  ? -52.594 -32.584 32.812 1.00 86.72  ? -54  DA  J "O4'" 1 
ATOM   3339  C  "C3'" . DA  B  2 19  ? -51.050 -33.904 31.593 1.00 88.26  ? -54  DA  J "C3'" 1 
ATOM   3340  O  "O3'" . DA  B  2 19  ? -50.932 -35.304 31.580 1.00 91.57  ? -54  DA  J "O3'" 1 
ATOM   3341  C  "C2'" . DA  B  2 19  ? -52.194 -33.447 30.693 1.00 87.57  ? -54  DA  J "C2'" 1 
ATOM   3342  C  "C1'" . DA  B  2 19  ? -53.285 -33.060 31.678 1.00 85.60  ? -54  DA  J "C1'" 1 
ATOM   3343  N  N9    . DA  B  2 19  ? -54.157 -32.016 31.140 1.00 85.15  ? -54  DA  J N9    1 
ATOM   3344  C  C8    . DA  B  2 19  ? -54.045 -30.669 31.346 1.00 84.62  ? -54  DA  J C8    1 
ATOM   3345  N  N7    . DA  B  2 19  ? -54.964 -29.961 30.735 1.00 84.37  ? -54  DA  J N7    1 
ATOM   3346  C  C5    . DA  B  2 19  ? -55.726 -30.908 30.075 1.00 84.56  ? -54  DA  J C5    1 
ATOM   3347  C  C6    . DA  B  2 19  ? -56.861 -30.798 29.248 1.00 84.78  ? -54  DA  J C6    1 
ATOM   3348  N  N6    . DA  B  2 19  ? -57.414 -29.620 28.953 1.00 84.79  ? -54  DA  J N6    1 
ATOM   3349  N  N1    . DA  B  2 19  ? -57.398 -31.933 28.743 1.00 84.46  ? -54  DA  J N1    1 
ATOM   3350  C  C2    . DA  B  2 19  ? -56.827 -33.104 29.054 1.00 84.47  ? -54  DA  J C2    1 
ATOM   3351  N  N3    . DA  B  2 19  ? -55.756 -33.335 29.816 1.00 84.37  ? -54  DA  J N3    1 
ATOM   3352  C  C4    . DA  B  2 19  ? -55.246 -32.185 30.307 1.00 84.69  ? -54  DA  J C4    1 
ATOM   3353  P  P     . DT  B  2 20  ? -50.068 -35.972 30.410 1.00 95.29  ? -53  DT  J P     1 
ATOM   3354  O  OP1   . DT  B  2 20  ? -49.575 -37.280 30.895 1.00 95.46  ? -53  DT  J OP1   1 
ATOM   3355  O  OP2   . DT  B  2 20  ? -49.104 -34.952 29.919 1.00 94.64  ? -53  DT  J OP2   1 
ATOM   3356  O  "O5'" . DT  B  2 20  ? -51.141 -36.230 29.255 1.00 96.09  ? -53  DT  J "O5'" 1 
ATOM   3357  C  "C5'" . DT  B  2 20  ? -52.282 -37.034 29.507 1.00 98.43  ? -53  DT  J "C5'" 1 
ATOM   3358  C  "C4'" . DT  B  2 20  ? -53.240 -36.953 28.334 1.00 100.06 ? -53  DT  J "C4'" 1 
ATOM   3359  O  "O4'" . DT  B  2 20  ? -53.869 -35.646 28.283 1.00 100.09 ? -53  DT  J "O4'" 1 
ATOM   3360  C  "C3'" . DT  B  2 20  ? -52.576 -37.170 26.981 1.00 101.26 ? -53  DT  J "C3'" 1 
ATOM   3361  O  "O3'" . DT  B  2 20  ? -53.230 -38.242 26.316 1.00 104.00 ? -53  DT  J "O3'" 1 
ATOM   3362  C  "C2'" . DT  B  2 20  ? -52.771 -35.839 26.262 1.00 100.82 ? -53  DT  J "C2'" 1 
ATOM   3363  C  "C1'" . DT  B  2 20  ? -54.033 -35.297 26.926 1.00 100.21 ? -53  DT  J "C1'" 1 
ATOM   3364  N  N1    . DT  B  2 20  ? -54.245 -33.804 26.799 1.00 100.15 ? -53  DT  J N1    1 
ATOM   3365  C  C2    . DT  B  2 20  ? -55.386 -33.294 26.186 1.00 100.13 ? -53  DT  J C2    1 
ATOM   3366  O  O2    . DT  B  2 20  ? -56.288 -33.972 25.716 1.00 100.07 ? -53  DT  J O2    1 
ATOM   3367  N  N3    . DT  B  2 20  ? -55.447 -31.917 26.146 1.00 100.12 ? -53  DT  J N3    1 
ATOM   3368  C  C4    . DT  B  2 20  ? -54.511 -31.015 26.636 1.00 100.11 ? -53  DT  J C4    1 
ATOM   3369  O  O4    . DT  B  2 20  ? -54.666 -29.801 26.546 1.00 99.96  ? -53  DT  J O4    1 
ATOM   3370  C  C5    . DT  B  2 20  ? -53.350 -31.608 27.262 1.00 100.12 ? -53  DT  J C5    1 
ATOM   3371  C  C7    . DT  B  2 20  ? -52.259 -30.750 27.836 1.00 99.98  ? -53  DT  J C7    1 
ATOM   3372  C  C6    . DT  B  2 20  ? -53.279 -32.948 27.309 1.00 100.35 ? -53  DT  J C6    1 
ATOM   3373  P  P     . DA  B  2 21  ? -52.457 -39.211 25.298 1.00 106.13 ? -52  DA  J P     1 
ATOM   3374  O  OP1   . DA  B  2 21  ? -52.436 -40.571 25.882 1.00 105.61 ? -52  DA  J OP1   1 
ATOM   3375  O  OP2   . DA  B  2 21  ? -51.197 -38.554 24.874 1.00 105.78 ? -52  DA  J OP2   1 
ATOM   3376  O  "O5'" . DA  B  2 21  ? -53.435 -39.229 24.032 1.00 108.32 ? -52  DA  J "O5'" 1 
ATOM   3377  C  "C5'" . DA  B  2 21  ? -54.837 -39.477 24.171 1.00 111.58 ? -52  DA  J "C5'" 1 
ATOM   3378  C  "C4'" . DA  B  2 21  ? -55.619 -38.705 23.120 1.00 113.99 ? -52  DA  J "C4'" 1 
ATOM   3379  O  "O4'" . DA  B  2 21  ? -55.671 -37.289 23.457 1.00 114.59 ? -52  DA  J "O4'" 1 
ATOM   3380  C  "C3'" . DA  B  2 21  ? -55.027 -38.795 21.714 1.00 115.07 ? -52  DA  J "C3'" 1 
ATOM   3381  O  "O3'" . DA  B  2 21  ? -56.011 -39.252 20.787 1.00 116.39 ? -52  DA  J "O3'" 1 
ATOM   3382  C  "C2'" . DA  B  2 21  ? -54.563 -37.370 21.418 1.00 115.22 ? -52  DA  J "C2'" 1 
ATOM   3383  C  "C1'" . DA  B  2 21  ? -55.518 -36.547 22.268 1.00 115.29 ? -52  DA  J "C1'" 1 
ATOM   3384  N  N9    . DA  B  2 21  ? -54.985 -35.223 22.564 1.00 115.41 ? -52  DA  J N9    1 
ATOM   3385  C  C8    . DA  B  2 21  ? -53.789 -34.941 23.163 1.00 115.51 ? -52  DA  J C8    1 
ATOM   3386  N  N7    . DA  B  2 21  ? -53.550 -33.660 23.303 1.00 115.66 ? -52  DA  J N7    1 
ATOM   3387  C  C5    . DA  B  2 21  ? -54.665 -33.056 22.747 1.00 115.70 ? -52  DA  J C5    1 
ATOM   3388  C  C6    . DA  B  2 21  ? -55.026 -31.700 22.582 1.00 115.68 ? -52  DA  J C6    1 
ATOM   3389  N  N6    . DA  B  2 21  ? -54.244 -30.690 22.989 1.00 115.64 ? -52  DA  J N6    1 
ATOM   3390  N  N1    . DA  B  2 21  ? -56.215 -31.428 21.984 1.00 115.61 ? -52  DA  J N1    1 
ATOM   3391  C  C2    . DA  B  2 21  ? -56.985 -32.450 21.575 1.00 115.56 ? -52  DA  J C2    1 
ATOM   3392  N  N3    . DA  B  2 21  ? -56.753 -33.763 21.685 1.00 115.61 ? -52  DA  J N3    1 
ATOM   3393  C  C4    . DA  B  2 21  ? -55.565 -34.004 22.282 1.00 115.63 ? -52  DA  J C4    1 
ATOM   3394  P  P     . DC  B  2 22  ? -55.658 -39.443 19.236 1.00 117.26 ? -51  DC  J P     1 
ATOM   3395  O  OP1   . DC  B  2 22  ? -56.611 -40.434 18.691 1.00 117.37 ? -51  DC  J OP1   1 
ATOM   3396  O  OP2   . DC  B  2 22  ? -54.204 -39.684 19.092 1.00 116.90 ? -51  DC  J OP2   1 
ATOM   3397  O  "O5'" . DC  B  2 22  ? -55.978 -37.993 18.636 1.00 118.24 ? -51  DC  J "O5'" 1 
ATOM   3398  C  "C5'" . DC  B  2 22  ? -57.316 -37.486 18.529 1.00 119.74 ? -51  DC  J "C5'" 1 
ATOM   3399  C  "C4'" . DC  B  2 22  ? -57.413 -36.447 17.417 1.00 121.02 ? -51  DC  J "C4'" 1 
ATOM   3400  O  "O4'" . DC  B  2 22  ? -57.061 -35.128 17.920 1.00 120.90 ? -51  DC  J "O4'" 1 
ATOM   3401  C  "C3'" . DC  B  2 22  ? -56.502 -36.693 16.215 1.00 122.18 ? -51  DC  J "C3'" 1 
ATOM   3402  O  "O3'" . DC  B  2 22  ? -57.196 -36.383 15.004 1.00 124.16 ? -51  DC  J "O3'" 1 
ATOM   3403  C  "C2'" . DC  B  2 22  ? -55.328 -35.747 16.467 1.00 121.68 ? -51  DC  J "C2'" 1 
ATOM   3404  C  "C1'" . DC  B  2 22  ? -56.038 -34.567 17.118 1.00 120.87 ? -51  DC  J "C1'" 1 
ATOM   3405  N  N1    . DC  B  2 22  ? -55.138 -33.704 17.951 1.00 120.71 ? -51  DC  J N1    1 
ATOM   3406  C  C2    . DC  B  2 22  ? -55.468 -32.351 18.178 1.00 120.64 ? -51  DC  J C2    1 
ATOM   3407  O  O2    . DC  B  2 22  ? -56.504 -31.872 17.696 1.00 120.61 ? -51  DC  J O2    1 
ATOM   3408  N  N3    . DC  B  2 22  ? -54.632 -31.591 18.935 1.00 120.35 ? -51  DC  J N3    1 
ATOM   3409  C  C4    . DC  B  2 22  ? -53.520 -32.128 19.449 1.00 120.46 ? -51  DC  J C4    1 
ATOM   3410  N  N4    . DC  B  2 22  ? -52.734 -31.340 20.188 1.00 120.59 ? -51  DC  J N4    1 
ATOM   3411  C  C5    . DC  B  2 22  ? -53.164 -33.496 19.230 1.00 120.53 ? -51  DC  J C5    1 
ATOM   3412  C  C6    . DC  B  2 22  ? -53.992 -34.238 18.484 1.00 120.49 ? -51  DC  J C6    1 
ATOM   3413  P  P     . DT  B  2 23  ? -56.628 -36.770 13.547 1.00 125.53 ? -50  DT  J P     1 
ATOM   3414  O  OP1   . DT  B  2 23  ? -57.413 -37.942 13.066 1.00 125.42 ? -50  DT  J OP1   1 
ATOM   3415  O  OP2   . DT  B  2 23  ? -55.141 -36.832 13.567 1.00 124.94 ? -50  DT  J OP2   1 
ATOM   3416  O  "O5'" . DT  B  2 23  ? -57.039 -35.481 12.676 1.00 126.17 ? -50  DT  J "O5'" 1 
ATOM   3417  C  "C5'" . DT  B  2 23  ? -58.089 -34.601 13.117 1.00 127.25 ? -50  DT  J "C5'" 1 
ATOM   3418  C  "C4'" . DT  B  2 23  ? -57.694 -33.161 12.841 1.00 128.10 ? -50  DT  J "C4'" 1 
ATOM   3419  O  "O4'" . DT  B  2 23  ? -56.858 -32.688 13.930 1.00 128.41 ? -50  DT  J "O4'" 1 
ATOM   3420  C  "C3'" . DT  B  2 23  ? -56.888 -32.978 11.550 1.00 128.49 ? -50  DT  J "C3'" 1 
ATOM   3421  O  "O3'" . DT  B  2 23  ? -57.592 -32.146 10.610 1.00 128.37 ? -50  DT  J "O3'" 1 
ATOM   3422  C  "C2'" . DT  B  2 23  ? -55.560 -32.378 12.013 1.00 128.70 ? -50  DT  J "C2'" 1 
ATOM   3423  C  "C1'" . DT  B  2 23  ? -55.895 -31.813 13.388 1.00 128.87 ? -50  DT  J "C1'" 1 
ATOM   3424  N  N1    . DT  B  2 23  ? -54.693 -31.711 14.279 1.00 129.04 ? -50  DT  J N1    1 
ATOM   3425  C  C2    . DT  B  2 23  ? -54.381 -30.491 14.851 1.00 129.17 ? -50  DT  J C2    1 
ATOM   3426  O  O2    . DT  B  2 23  ? -55.042 -29.478 14.683 1.00 129.15 ? -50  DT  J O2    1 
ATOM   3427  N  N3    . DT  B  2 23  ? -53.253 -30.503 15.642 1.00 129.27 ? -50  DT  J N3    1 
ATOM   3428  C  C4    . DT  B  2 23  ? -52.423 -31.582 15.912 1.00 129.17 ? -50  DT  J C4    1 
ATOM   3429  O  O4    . DT  B  2 23  ? -51.434 -31.473 16.635 1.00 128.99 ? -50  DT  J O4    1 
ATOM   3430  C  C5    . DT  B  2 23  ? -52.802 -32.828 15.277 1.00 129.28 ? -50  DT  J C5    1 
ATOM   3431  C  C7    . DT  B  2 23  ? -51.991 -34.077 15.482 1.00 129.17 ? -50  DT  J C7    1 
ATOM   3432  C  C6    . DT  B  2 23  ? -53.902 -32.829 14.503 1.00 129.20 ? -50  DT  J C6    1 
ATOM   3433  P  P     . DA  B  2 24  ? -56.978 -31.687 9.195  1.00 127.89 ? -49  DA  J P     1 
ATOM   3434  O  OP1   . DA  B  2 24  ? -58.122 -31.394 8.300  1.00 127.89 ? -49  DA  J OP1   1 
ATOM   3435  O  OP2   . DA  B  2 24  ? -55.922 -32.632 8.760  1.00 127.69 ? -49  DA  J OP2   1 
ATOM   3436  O  "O5'" . DA  B  2 24  ? -56.264 -30.317 9.590  1.00 127.57 ? -49  DA  J "O5'" 1 
ATOM   3437  C  "C5'" . DA  B  2 24  ? -57.034 -29.152 9.887  1.00 127.52 ? -49  DA  J "C5'" 1 
ATOM   3438  C  "C4'" . DA  B  2 24  ? -56.139 -27.934 9.769  1.00 127.33 ? -49  DA  J "C4'" 1 
ATOM   3439  O  "O4'" . DA  B  2 24  ? -55.251 -27.907 10.917 1.00 127.49 ? -49  DA  J "O4'" 1 
ATOM   3440  C  "C3'" . DA  B  2 24  ? -55.260 -27.957 8.522  1.00 127.13 ? -49  DA  J "C3'" 1 
ATOM   3441  O  "O3'" . DA  B  2 24  ? -55.292 -26.689 7.862  1.00 126.61 ? -49  DA  J "O3'" 1 
ATOM   3442  C  "C2'" . DA  B  2 24  ? -53.877 -28.345 9.047  1.00 127.32 ? -49  DA  J "C2'" 1 
ATOM   3443  C  "C1'" . DA  B  2 24  ? -53.902 -27.868 10.495 1.00 127.41 ? -49  DA  J "C1'" 1 
ATOM   3444  N  N9    . DA  B  2 24  ? -53.067 -28.701 11.362 1.00 127.39 ? -49  DA  J N9    1 
ATOM   3445  C  C8    . DA  B  2 24  ? -52.941 -30.064 11.320 1.00 127.38 ? -49  DA  J C8    1 
ATOM   3446  N  N7    . DA  B  2 24  ? -52.108 -30.552 12.206 1.00 127.40 ? -49  DA  J N7    1 
ATOM   3447  C  C5    . DA  B  2 24  ? -51.647 -29.434 12.876 1.00 127.36 ? -49  DA  J C5    1 
ATOM   3448  C  C6    . DA  B  2 24  ? -50.730 -29.275 13.936 1.00 127.38 ? -49  DA  J C6    1 
ATOM   3449  N  N6    . DA  B  2 24  ? -50.096 -30.296 14.523 1.00 127.32 ? -49  DA  J N6    1 
ATOM   3450  N  N1    . DA  B  2 24  ? -50.489 -28.018 14.371 1.00 127.46 ? -49  DA  J N1    1 
ATOM   3451  C  C2    . DA  B  2 24  ? -51.121 -26.991 13.782 1.00 127.39 ? -49  DA  J C2    1 
ATOM   3452  N  N3    . DA  B  2 24  ? -52.001 -27.019 12.780 1.00 127.29 ? -49  DA  J N3    1 
ATOM   3453  C  C4    . DA  B  2 24  ? -52.223 -28.281 12.367 1.00 127.34 ? -49  DA  J C4    1 
ATOM   3454  P  P     . DC  B  2 25  ? -54.171 -26.263 6.795  1.00 126.37 ? -48  DC  J P     1 
ATOM   3455  O  OP1   . DC  B  2 25  ? -54.685 -25.099 6.040  1.00 126.56 ? -48  DC  J OP1   1 
ATOM   3456  O  OP2   . DC  B  2 25  ? -53.681 -27.461 6.072  1.00 125.95 ? -48  DC  J OP2   1 
ATOM   3457  O  "O5'" . DC  B  2 25  ? -52.999 -25.753 7.745  1.00 125.46 ? -48  DC  J "O5'" 1 
ATOM   3458  C  "C5'" . DC  B  2 25  ? -53.202 -24.637 8.599  1.00 124.16 ? -48  DC  J "C5'" 1 
ATOM   3459  C  "C4'" . DC  B  2 25  ? -51.845 -24.069 8.940  1.00 123.11 ? -48  DC  J "C4'" 1 
ATOM   3460  O  "O4'" . DC  B  2 25  ? -51.221 -24.913 9.938  1.00 123.29 ? -48  DC  J "O4'" 1 
ATOM   3461  C  "C3'" . DC  B  2 25  ? -50.908 -24.034 7.742  1.00 122.26 ? -48  DC  J "C3'" 1 
ATOM   3462  O  "O3'" . DC  B  2 25  ? -50.317 -22.764 7.668  1.00 121.10 ? -48  DC  J "O3'" 1 
ATOM   3463  C  "C2'" . DC  B  2 25  ? -49.868 -25.117 8.011  1.00 122.70 ? -48  DC  J "C2'" 1 
ATOM   3464  C  "C1'" . DC  B  2 25  ? -49.909 -25.255 9.533  1.00 123.20 ? -48  DC  J "C1'" 1 
ATOM   3465  N  N1    . DC  B  2 25  ? -49.575 -26.631 10.062 1.00 123.20 ? -48  DC  J N1    1 
ATOM   3466  C  C2    . DC  B  2 25  ? -48.747 -26.763 11.190 1.00 123.07 ? -48  DC  J C2    1 
ATOM   3467  O  O2    . DC  B  2 25  ? -48.297 -25.750 11.738 1.00 123.06 ? -48  DC  J O2    1 
ATOM   3468  N  N3    . DC  B  2 25  ? -48.457 -28.009 11.652 1.00 123.06 ? -48  DC  J N3    1 
ATOM   3469  C  C4    . DC  B  2 25  ? -48.955 -29.088 11.039 1.00 123.13 ? -48  DC  J C4    1 
ATOM   3470  N  N4    . DC  B  2 25  ? -48.644 -30.290 11.533 1.00 123.10 ? -48  DC  J N4    1 
ATOM   3471  C  C5    . DC  B  2 25  ? -49.801 -28.982 9.894  1.00 123.10 ? -48  DC  J C5    1 
ATOM   3472  C  C6    . DC  B  2 25  ? -50.080 -27.749 9.449  1.00 123.26 ? -48  DC  J C6    1 
ATOM   3473  P  P     . DC  B  2 26  ? -50.132 -22.053 6.249  1.00 120.20 ? -47  DC  J P     1 
ATOM   3474  O  OP1   . DC  B  2 26  ? -51.221 -21.061 6.095  1.00 119.74 ? -47  DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B  2 26  ? -49.951 -23.112 5.224  1.00 120.04 ? -47  DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B  2 26  ? -48.735 -21.282 6.437  1.00 119.09 ? -47  DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B  2 26  ? -48.358 -20.722 7.702  1.00 117.32 ? -47  DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B  2 26  ? -47.083 -21.342 8.261  1.00 116.02 ? -47  DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B  2 26  ? -47.267 -22.728 8.661  1.00 115.93 ? -47  DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B  2 26  ? -45.890 -21.362 7.306  1.00 114.97 ? -47  DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B  2 26  ? -44.817 -20.592 7.850  1.00 113.54 ? -47  DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B  2 26  ? -45.537 -22.841 7.184  1.00 115.13 ? -47  DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B  2 26  ? -45.980 -23.301 8.563  1.00 115.39 ? -47  DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B  2 26  ? -46.007 -24.783 8.804  1.00 115.42 ? -47  DC  J N1    1 
ATOM   3485  C  C2    . DC  B  2 26  ? -45.602 -25.282 10.054 1.00 115.28 ? -47  DC  J C2    1 
ATOM   3486  O  O2    . DC  B  2 26  ? -45.232 -24.495 10.937 1.00 115.24 ? -47  DC  J O2    1 
ATOM   3487  N  N3    . DC  B  2 26  ? -45.627 -26.624 10.263 1.00 115.08 ? -47  DC  J N3    1 
ATOM   3488  C  C4    . DC  B  2 26  ? -46.029 -27.451 9.295  1.00 115.20 ? -47  DC  J C4    1 
ATOM   3489  N  N4    . DC  B  2 26  ? -46.042 -28.762 9.550  1.00 115.19 ? -47  DC  J N4    1 
ATOM   3490  C  C5    . DC  B  2 26  ? -46.443 -26.968 8.019  1.00 115.33 ? -47  DC  J C5    1 
ATOM   3491  C  C6    . DC  B  2 26  ? -46.413 -25.643 7.820  1.00 115.50 ? -47  DC  J C6    1 
ATOM   3492  P  P     . DA  B  2 27  ? -44.535 -19.182 7.151  1.00 112.28 ? -46  DA  J P     1 
ATOM   3493  O  OP1   . DA  B  2 27  ? -45.781 -18.389 7.290  1.00 112.36 ? -46  DA  J OP1   1 
ATOM   3494  O  OP2   . DA  B  2 27  ? -43.972 -19.499 5.817  1.00 112.31 ? -46  DA  J OP2   1 
ATOM   3495  O  "O5'" . DA  B  2 27  ? -43.365 -18.444 7.963  1.00 110.86 ? -46  DA  J "O5'" 1 
ATOM   3496  C  "C5'" . DA  B  2 27  ? -43.349 -18.325 9.382  1.00 108.23 ? -46  DA  J "C5'" 1 
ATOM   3497  C  "C4'" . DA  B  2 27  ? -42.195 -19.137 9.954  1.00 106.05 ? -46  DA  J "C4'" 1 
ATOM   3498  O  "O4'" . DA  B  2 27  ? -42.467 -20.547 9.767  1.00 104.58 ? -46  DA  J "O4'" 1 
ATOM   3499  C  "C3'" . DA  B  2 27  ? -40.809 -18.884 9.356  1.00 105.25 ? -46  DA  J "C3'" 1 
ATOM   3500  O  "O3'" . DA  B  2 27  ? -39.897 -18.875 10.445 1.00 105.39 ? -46  DA  J "O3'" 1 
ATOM   3501  C  "C2'" . DA  B  2 27  ? -40.603 -20.092 8.446  1.00 104.77 ? -46  DA  J "C2'" 1 
ATOM   3502  C  "C1'" . DA  B  2 27  ? -41.320 -21.175 9.243  1.00 104.16 ? -46  DA  J "C1'" 1 
ATOM   3503  N  N9    . DA  B  2 27  ? -41.785 -22.351 8.510  1.00 104.01 ? -46  DA  J N9    1 
ATOM   3504  C  C8    . DA  B  2 27  ? -42.131 -22.453 7.191  1.00 103.90 ? -46  DA  J C8    1 
ATOM   3505  N  N7    . DA  B  2 27  ? -42.522 -23.655 6.837  1.00 103.76 ? -46  DA  J N7    1 
ATOM   3506  C  C5    . DA  B  2 27  ? -42.438 -24.396 8.003  1.00 103.96 ? -46  DA  J C5    1 
ATOM   3507  C  C6    . DA  B  2 27  ? -42.715 -25.750 8.314  1.00 104.01 ? -46  DA  J C6    1 
ATOM   3508  N  N6    . DA  B  2 27  ? -43.160 -26.651 7.435  1.00 103.95 ? -46  DA  J N6    1 
ATOM   3509  N  N1    . DA  B  2 27  ? -42.518 -26.159 9.583  1.00 103.94 ? -46  DA  J N1    1 
ATOM   3510  C  C2    . DA  B  2 27  ? -42.077 -25.275 10.485 1.00 103.97 ? -46  DA  J C2    1 
ATOM   3511  N  N3    . DA  B  2 27  ? -41.782 -23.987 10.314 1.00 104.06 ? -46  DA  J N3    1 
ATOM   3512  C  C4    . DA  B  2 27  ? -41.986 -23.604 9.042  1.00 104.04 ? -46  DA  J C4    1 
ATOM   3513  P  P     . DA  B  2 28  ? -38.378 -18.345 10.414 1.00 105.29 ? -45  DA  J P     1 
ATOM   3514  O  OP1   . DA  B  2 28  ? -38.389 -16.865 10.510 1.00 105.57 ? -45  DA  J OP1   1 
ATOM   3515  O  OP2   . DA  B  2 28  ? -37.637 -19.020 9.320  1.00 105.02 ? -45  DA  J OP2   1 
ATOM   3516  O  "O5'" . DA  B  2 28  ? -37.832 -18.894 11.818 1.00 103.64 ? -45  DA  J "O5'" 1 
ATOM   3517  C  "C5'" . DA  B  2 28  ? -38.618 -19.794 12.607 1.00 100.97 ? -45  DA  J "C5'" 1 
ATOM   3518  C  "C4'" . DA  B  2 28  ? -38.134 -21.223 12.432 1.00 99.20  ? -45  DA  J "C4'" 1 
ATOM   3519  O  "O4'" . DA  B  2 28  ? -38.793 -21.893 11.325 1.00 98.93  ? -45  DA  J "O4'" 1 
ATOM   3520  C  "C3'" . DA  B  2 28  ? -36.643 -21.360 12.146 1.00 98.03  ? -45  DA  J "C3'" 1 
ATOM   3521  O  "O3'" . DA  B  2 28  ? -36.160 -22.358 12.994 1.00 96.83  ? -45  DA  J "O3'" 1 
ATOM   3522  C  "C2'" . DA  B  2 28  ? -36.581 -21.837 10.706 1.00 98.05  ? -45  DA  J "C2'" 1 
ATOM   3523  C  "C1'" . DA  B  2 28  ? -37.812 -22.722 10.743 1.00 98.65  ? -45  DA  J "C1'" 1 
ATOM   3524  N  N9    . DA  B  2 28  ? -38.223 -23.228 9.443  1.00 98.75  ? -45  DA  J N9    1 
ATOM   3525  C  C8    . DA  B  2 28  ? -38.267 -22.554 8.255  1.00 98.84  ? -45  DA  J C8    1 
ATOM   3526  N  N7    . DA  B  2 28  ? -38.678 -23.288 7.252  1.00 98.97  ? -45  DA  J N7    1 
ATOM   3527  C  C5    . DA  B  2 28  ? -38.910 -24.529 7.822  1.00 99.01  ? -45  DA  J C5    1 
ATOM   3528  C  C6    . DA  B  2 28  ? -39.360 -25.760 7.294  1.00 98.96  ? -45  DA  J C6    1 
ATOM   3529  N  N6    . DA  B  2 28  ? -39.665 -25.939 6.004  1.00 98.79  ? -45  DA  J N6    1 
ATOM   3530  N  N1    . DA  B  2 28  ? -39.479 -26.808 8.142  1.00 98.84  ? -45  DA  J N1    1 
ATOM   3531  C  C2    . DA  B  2 28  ? -39.167 -26.636 9.432  1.00 98.75  ? -45  DA  J C2    1 
ATOM   3532  N  N3    . DA  B  2 28  ? -38.738 -25.529 10.039 1.00 98.81  ? -45  DA  J N3    1 
ATOM   3533  C  C4    . DA  B  2 28  ? -38.632 -24.507 9.174  1.00 98.76  ? -45  DA  J C4    1 
ATOM   3534  P  P     . DA  B  2 29  ? -35.148 -21.970 14.154 1.00 95.38  ? -44  DA  J P     1 
ATOM   3535  O  OP1   . DA  B  2 29  ? -35.308 -22.960 15.246 1.00 95.47  ? -44  DA  J OP1   1 
ATOM   3536  O  OP2   . DA  B  2 29  ? -35.348 -20.531 14.453 1.00 95.20  ? -44  DA  J OP2   1 
ATOM   3537  O  "O5'" . DA  B  2 29  ? -33.732 -22.188 13.431 1.00 94.01  ? -44  DA  J "O5'" 1 
ATOM   3538  C  "C5'" . DA  B  2 29  ? -33.452 -23.374 12.676 1.00 92.39  ? -44  DA  J "C5'" 1 
ATOM   3539  C  "C4'" . DA  B  2 29  ? -33.962 -24.668 13.320 1.00 90.93  ? -44  DA  J "C4'" 1 
ATOM   3540  O  "O4'" . DA  B  2 29  ? -35.130 -25.171 12.623 1.00 90.43  ? -44  DA  J "O4'" 1 
ATOM   3541  C  "C3'" . DA  B  2 29  ? -33.008 -25.847 13.276 1.00 90.63  ? -44  DA  J "C3'" 1 
ATOM   3542  O  "O3'" . DA  B  2 29  ? -33.396 -26.861 14.204 1.00 90.55  ? -44  DA  J "O3'" 1 
ATOM   3543  C  "C2'" . DA  B  2 29  ? -33.225 -26.326 11.851 1.00 90.20  ? -44  DA  J "C2'" 1 
ATOM   3544  C  "C1'" . DA  B  2 29  ? -34.731 -26.174 11.699 1.00 89.94  ? -44  DA  J "C1'" 1 
ATOM   3545  N  N9    . DA  B  2 29  ? -35.071 -25.767 10.339 1.00 89.84  ? -44  DA  J N9    1 
ATOM   3546  C  C8    . DA  B  2 29  ? -34.980 -24.513 9.806  1.00 89.57  ? -44  DA  J C8    1 
ATOM   3547  N  N7    . DA  B  2 29  ? -35.351 -24.432 8.556  1.00 89.62  ? -44  DA  J N7    1 
ATOM   3548  C  C5    . DA  B  2 29  ? -35.696 -25.732 8.242  1.00 89.66  ? -44  DA  J C5    1 
ATOM   3549  C  C6    . DA  B  2 29  ? -36.170 -26.320 7.058  1.00 89.62  ? -44  DA  J C6    1 
ATOM   3550  N  N6    . DA  B  2 29  ? -36.378 -25.623 5.941  1.00 89.62  ? -44  DA  J N6    1 
ATOM   3551  N  N1    . DA  B  2 29  ? -36.422 -27.645 7.066  1.00 89.62  ? -44  DA  J N1    1 
ATOM   3552  C  C2    . DA  B  2 29  ? -36.215 -28.335 8.194  1.00 89.71  ? -44  DA  J C2    1 
ATOM   3553  N  N3    . DA  B  2 29  ? -35.774 -27.895 9.370  1.00 89.76  ? -44  DA  J N3    1 
ATOM   3554  C  C4    . DA  B  2 29  ? -35.531 -26.572 9.326  1.00 89.74  ? -44  DA  J C4    1 
ATOM   3555  P  P     . DA  B  2 30  ? -32.489 -28.172 14.370 1.00 90.33  ? -43  DA  J P     1 
ATOM   3556  O  OP1   . DA  B  2 30  ? -32.926 -28.871 15.599 1.00 90.25  ? -43  DA  J OP1   1 
ATOM   3557  O  OP2   . DA  B  2 30  ? -31.077 -27.747 14.179 1.00 89.50  ? -43  DA  J OP2   1 
ATOM   3558  O  "O5'" . DA  B  2 30  ? -32.907 -29.071 13.122 1.00 90.28  ? -43  DA  J "O5'" 1 
ATOM   3559  C  "C5'" . DA  B  2 30  ? -33.571 -30.310 13.269 1.00 90.63  ? -43  DA  J "C5'" 1 
ATOM   3560  C  "C4'" . DA  B  2 30  ? -33.274 -31.121 12.028 1.00 91.10  ? -43  DA  J "C4'" 1 
ATOM   3561  O  "O4'" . DA  B  2 30  ? -33.607 -30.326 10.858 1.00 91.34  ? -43  DA  J "O4'" 1 
ATOM   3562  C  "C3'" . DA  B  2 30  ? -31.807 -31.513 11.881 1.00 91.44  ? -43  DA  J "C3'" 1 
ATOM   3563  O  "O3'" . DA  B  2 30  ? -31.733 -32.868 11.472 1.00 92.23  ? -43  DA  J "O3'" 1 
ATOM   3564  C  "C2'" . DA  B  2 30  ? -31.293 -30.559 10.805 1.00 91.36  ? -43  DA  J "C2'" 1 
ATOM   3565  C  "C1'" . DA  B  2 30  ? -32.533 -30.378 9.941  1.00 91.48  ? -43  DA  J "C1'" 1 
ATOM   3566  N  N9    . DA  B  2 30  ? -32.522 -29.173 9.106  1.00 91.50  ? -43  DA  J N9    1 
ATOM   3567  C  C8    . DA  B  2 30  ? -32.071 -27.929 9.445  1.00 91.51  ? -43  DA  J C8    1 
ATOM   3568  N  N7    . DA  B  2 30  ? -32.183 -27.027 8.503  1.00 91.26  ? -43  DA  J N7    1 
ATOM   3569  C  C5    . DA  B  2 30  ? -32.741 -27.732 7.456  1.00 91.39  ? -43  DA  J C5    1 
ATOM   3570  C  C6    . DA  B  2 30  ? -33.110 -27.352 6.150  1.00 91.36  ? -43  DA  J C6    1 
ATOM   3571  N  N6    . DA  B  2 30  ? -32.956 -26.114 5.678  1.00 91.45  ? -43  DA  J N6    1 
ATOM   3572  N  N1    . DA  B  2 30  ? -33.640 -28.294 5.341  1.00 91.54  ? -43  DA  J N1    1 
ATOM   3573  C  C2    . DA  B  2 30  ? -33.793 -29.538 5.814  1.00 91.68  ? -43  DA  J C2    1 
ATOM   3574  N  N3    . DA  B  2 30  ? -33.486 -30.014 7.023  1.00 91.93  ? -43  DA  J N3    1 
ATOM   3575  C  C4    . DA  B  2 30  ? -32.957 -29.054 7.805  1.00 91.68  ? -43  DA  J C4    1 
ATOM   3576  P  P     . DG  B  2 31  ? -30.347 -33.659 11.345 1.00 93.23  ? -42  DG  J P     1 
ATOM   3577  O  OP1   . DG  B  2 31  ? -30.157 -34.402 12.609 1.00 93.40  ? -42  DG  J OP1   1 
ATOM   3578  O  OP2   . DG  B  2 31  ? -29.280 -32.758 10.853 1.00 93.11  ? -42  DG  J OP2   1 
ATOM   3579  O  "O5'" . DG  B  2 31  ? -30.643 -34.697 10.157 1.00 95.65  ? -42  DG  J "O5'" 1 
ATOM   3580  C  "C5'" . DG  B  2 31  ? -31.880 -34.696 9.410  1.00 97.51  ? -42  DG  J "C5'" 1 
ATOM   3581  C  "C4'" . DG  B  2 31  ? -31.665 -34.684 7.902  1.00 98.55  ? -42  DG  J "C4'" 1 
ATOM   3582  O  "O4'" . DG  B  2 31  ? -31.764 -33.325 7.405  1.00 98.97  ? -42  DG  J "O4'" 1 
ATOM   3583  C  "C3'" . DG  B  2 31  ? -30.315 -35.211 7.424  1.00 99.74  ? -42  DG  J "C3'" 1 
ATOM   3584  O  "O3'" . DG  B  2 31  ? -30.505 -36.105 6.336  1.00 101.49 ? -42  DG  J "O3'" 1 
ATOM   3585  C  "C2'" . DG  B  2 31  ? -29.552 -33.956 6.997  1.00 99.52  ? -42  DG  J "C2'" 1 
ATOM   3586  C  "C1'" . DG  B  2 31  ? -30.687 -33.057 6.529  1.00 99.29  ? -42  DG  J "C1'" 1 
ATOM   3587  N  N9    . DG  B  2 31  ? -30.380 -31.628 6.559  1.00 99.31  ? -42  DG  J N9    1 
ATOM   3588  C  C8    . DG  B  2 31  ? -29.915 -30.893 7.622  1.00 99.26  ? -42  DG  J C8    1 
ATOM   3589  N  N7    . DG  B  2 31  ? -29.736 -29.631 7.356  1.00 99.01  ? -42  DG  J N7    1 
ATOM   3590  C  C5    . DG  B  2 31  ? -30.103 -29.515 6.023  1.00 99.38  ? -42  DG  J C5    1 
ATOM   3591  C  C6    . DG  B  2 31  ? -30.117 -28.380 5.168  1.00 99.51  ? -42  DG  J C6    1 
ATOM   3592  O  O6    . DG  B  2 31  ? -29.800 -27.209 5.430  1.00 99.38  ? -42  DG  J O6    1 
ATOM   3593  N  N1    . DG  B  2 31  ? -30.558 -28.697 3.883  1.00 99.47  ? -42  DG  J N1    1 
ATOM   3594  C  C2    . DG  B  2 31  ? -30.942 -29.953 3.473  1.00 99.41  ? -42  DG  J C2    1 
ATOM   3595  N  N2    . DG  B  2 31  ? -31.334 -30.066 2.193  1.00 99.44  ? -42  DG  J N2    1 
ATOM   3596  N  N3    . DG  B  2 31  ? -30.931 -31.023 4.260  1.00 99.42  ? -42  DG  J N3    1 
ATOM   3597  C  C4    . DG  B  2 31  ? -30.503 -30.735 5.518  1.00 99.44  ? -42  DG  J C4    1 
ATOM   3598  P  P     . DT  B  2 32  ? -29.438 -37.265 6.065  1.00 102.87 ? -41  DT  J P     1 
ATOM   3599  O  OP1   . DT  B  2 32  ? -29.982 -38.495 6.682  1.00 102.79 ? -41  DT  J OP1   1 
ATOM   3600  O  OP2   . DT  B  2 32  ? -28.099 -36.768 6.455  1.00 102.30 ? -41  DT  J OP2   1 
ATOM   3601  O  "O5'" . DT  B  2 32  ? -29.436 -37.440 4.470  1.00 104.29 ? -41  DT  J "O5'" 1 
ATOM   3602  C  "C5'" . DT  B  2 32  ? -30.437 -36.848 3.639  1.00 106.57 ? -41  DT  J "C5'" 1 
ATOM   3603  C  "C4'" . DT  B  2 32  ? -29.863 -36.171 2.399  1.00 108.25 ? -41  DT  J "C4'" 1 
ATOM   3604  O  "O4'" . DT  B  2 32  ? -29.836 -34.731 2.609  1.00 108.33 ? -41  DT  J "O4'" 1 
ATOM   3605  C  "C3'" . DT  B  2 32  ? -28.451 -36.605 1.979  1.00 109.26 ? -41  DT  J "C3'" 1 
ATOM   3606  O  "O3'" . DT  B  2 32  ? -28.477 -37.225 0.666  1.00 110.56 ? -41  DT  J "O3'" 1 
ATOM   3607  C  "C2'" . DT  B  2 32  ? -27.634 -35.316 2.058  1.00 109.27 ? -41  DT  J "C2'" 1 
ATOM   3608  C  "C1'" . DT  B  2 32  ? -28.687 -34.213 1.974  1.00 109.31 ? -41  DT  J "C1'" 1 
ATOM   3609  N  N1    . DT  B  2 32  ? -28.241 -32.921 2.616  1.00 109.48 ? -41  DT  J N1    1 
ATOM   3610  C  C2    . DT  B  2 32  ? -28.595 -31.700 2.060  1.00 109.46 ? -41  DT  J C2    1 
ATOM   3611  O  O2    . DT  B  2 32  ? -29.282 -31.558 1.066  1.00 109.67 ? -41  DT  J O2    1 
ATOM   3612  N  N3    . DT  B  2 32  ? -28.119 -30.603 2.728  1.00 109.39 ? -41  DT  J N3    1 
ATOM   3613  C  C4    . DT  B  2 32  ? -27.335 -30.591 3.866  1.00 109.53 ? -41  DT  J C4    1 
ATOM   3614  O  O4    . DT  B  2 32  ? -26.968 -29.535 4.370  1.00 109.45 ? -41  DT  J O4    1 
ATOM   3615  C  C5    . DT  B  2 32  ? -26.984 -31.893 4.398  1.00 109.83 ? -41  DT  J C5    1 
ATOM   3616  C  C7    . DT  B  2 32  ? -26.131 -32.026 5.632  1.00 109.60 ? -41  DT  J C7    1 
ATOM   3617  C  C6    . DT  B  2 32  ? -27.449 -32.977 3.755  1.00 109.67 ? -41  DT  J C6    1 
ATOM   3618  P  P     . DG  B  2 33  ? -27.309 -37.163 -0.443 1.00 111.65 ? -40  DG  J P     1 
ATOM   3619  O  OP1   . DG  B  2 33  ? -27.419 -38.400 -1.245 1.00 111.45 ? -40  DG  J OP1   1 
ATOM   3620  O  OP2   . DG  B  2 33  ? -25.998 -36.835 0.165  1.00 111.40 ? -40  DG  J OP2   1 
ATOM   3621  O  "O5'" . DG  B  2 33  ? -27.785 -35.905 -1.320 1.00 113.20 ? -40  DG  J "O5'" 1 
ATOM   3622  C  "C5'" . DG  B  2 33  ? -27.502 -35.808 -2.723 1.00 115.27 ? -40  DG  J "C5'" 1 
ATOM   3623  C  "C4'" . DG  B  2 33  ? -26.400 -34.798 -3.005 1.00 116.83 ? -40  DG  J "C4'" 1 
ATOM   3624  O  "O4'" . DG  B  2 33  ? -26.384 -33.788 -1.959 1.00 117.24 ? -40  DG  J "O4'" 1 
ATOM   3625  C  "C3'" . DG  B  2 33  ? -24.989 -35.397 -3.071 1.00 117.87 ? -40  DG  J "C3'" 1 
ATOM   3626  O  "O3'" . DG  B  2 33  ? -24.437 -35.290 -4.418 1.00 118.88 ? -40  DG  J "O3'" 1 
ATOM   3627  C  "C2'" . DG  B  2 33  ? -24.210 -34.672 -1.966 1.00 117.78 ? -40  DG  J "C2'" 1 
ATOM   3628  C  "C1'" . DG  B  2 33  ? -25.042 -33.418 -1.718 1.00 117.50 ? -40  DG  J "C1'" 1 
ATOM   3629  N  N9    . DG  B  2 33  ? -24.878 -32.865 -0.369 1.00 117.50 ? -40  DG  J N9    1 
ATOM   3630  C  C8    . DG  B  2 33  ? -24.830 -33.557 0.820  1.00 117.50 ? -40  DG  J C8    1 
ATOM   3631  N  N7    . DG  B  2 33  ? -24.661 -32.797 1.865  1.00 117.46 ? -40  DG  J N7    1 
ATOM   3632  C  C5    . DG  B  2 33  ? -24.586 -31.514 1.339  1.00 117.44 ? -40  DG  J C5    1 
ATOM   3633  C  C6    . DG  B  2 33  ? -24.407 -30.266 1.990  1.00 117.51 ? -40  DG  J C6    1 
ATOM   3634  O  O6    . DG  B  2 33  ? -24.273 -30.042 3.201  1.00 117.47 ? -40  DG  J O6    1 
ATOM   3635  N  N1    . DG  B  2 33  ? -24.387 -29.204 1.089  1.00 117.41 ? -40  DG  J N1    1 
ATOM   3636  C  C2    . DG  B  2 33  ? -24.523 -29.334 -0.272 1.00 117.32 ? -40  DG  J C2    1 
ATOM   3637  N  N2    . DG  B  2 33  ? -24.482 -28.201 -0.981 1.00 117.47 ? -40  DG  J N2    1 
ATOM   3638  N  N3    . DG  B  2 33  ? -24.692 -30.492 -0.893 1.00 117.30 ? -40  DG  J N3    1 
ATOM   3639  C  C4    . DG  B  2 33  ? -24.714 -31.539 -0.033 1.00 117.33 ? -40  DG  J C4    1 
ATOM   3640  P  P     . DT  B  2 34  ? -23.139 -34.445 -4.874 1.00 119.58 ? -39  DT  J P     1 
ATOM   3641  O  OP1   . DT  B  2 34  ? -22.934 -34.753 -6.308 1.00 119.57 ? -39  DT  J OP1   1 
ATOM   3642  O  OP2   . DT  B  2 34  ? -22.014 -34.687 -3.936 1.00 119.28 ? -39  DT  J OP2   1 
ATOM   3643  O  "O5'" . DT  B  2 34  ? -23.629 -32.923 -4.708 1.00 119.58 ? -39  DT  J "O5'" 1 
ATOM   3644  C  "C5'" . DT  B  2 34  ? -23.636 -31.989 -5.792 1.00 119.61 ? -39  DT  J "C5'" 1 
ATOM   3645  C  "C4'" . DT  B  2 34  ? -22.546 -30.948 -5.601 1.00 119.58 ? -39  DT  J "C4'" 1 
ATOM   3646  O  "O4'" . DT  B  2 34  ? -22.449 -30.624 -4.188 1.00 119.59 ? -39  DT  J "O4'" 1 
ATOM   3647  C  "C3'" . DT  B  2 34  ? -21.147 -31.381 -6.055 1.00 119.69 ? -39  DT  J "C3'" 1 
ATOM   3648  O  "O3'" . DT  B  2 34  ? -20.558 -30.347 -6.900 1.00 119.89 ? -39  DT  J "O3'" 1 
ATOM   3649  C  "C2'" . DT  B  2 34  ? -20.424 -31.668 -4.738 1.00 119.45 ? -39  DT  J "C2'" 1 
ATOM   3650  C  "C1'" . DT  B  2 34  ? -21.086 -30.654 -3.810 1.00 119.59 ? -39  DT  J "C1'" 1 
ATOM   3651  N  N1    . DT  B  2 34  ? -20.928 -30.907 -2.322 1.00 119.71 ? -39  DT  J N1    1 
ATOM   3652  C  C2    . DT  B  2 34  ? -20.959 -29.830 -1.453 1.00 119.46 ? -39  DT  J C2    1 
ATOM   3653  O  O2    . DT  B  2 34  ? -21.118 -28.676 -1.810 1.00 119.28 ? -39  DT  J O2    1 
ATOM   3654  N  N3    . DT  B  2 34  ? -20.797 -30.158 -0.127 1.00 119.52 ? -39  DT  J N3    1 
ATOM   3655  C  C4    . DT  B  2 34  ? -20.607 -31.420 0.414  1.00 119.50 ? -39  DT  J C4    1 
ATOM   3656  O  O4    . DT  B  2 34  ? -20.472 -31.591 1.622  1.00 119.44 ? -39  DT  J O4    1 
ATOM   3657  C  C5    . DT  B  2 34  ? -20.580 -32.505 -0.541 1.00 119.48 ? -39  DT  J C5    1 
ATOM   3658  C  C7    . DT  B  2 34  ? -20.383 -33.926 -0.089 1.00 119.39 ? -39  DT  J C7    1 
ATOM   3659  C  C6    . DT  B  2 34  ? -20.738 -32.198 -1.841 1.00 119.79 ? -39  DT  J C6    1 
ATOM   3660  P  P     . DA  B  2 35  ? -19.072 -29.722 -6.803 1.00 119.79 ? -38  DA  J P     1 
ATOM   3661  O  OP1   . DA  B  2 35  ? -18.750 -29.165 -8.136 1.00 119.88 ? -38  DA  J OP1   1 
ATOM   3662  O  OP2   . DA  B  2 35  ? -18.137 -30.711 -6.211 1.00 119.57 ? -38  DA  J OP2   1 
ATOM   3663  O  "O5'" . DA  B  2 35  ? -19.285 -28.507 -5.776 1.00 118.99 ? -38  DA  J "O5'" 1 
ATOM   3664  C  "C5'" . DA  B  2 35  ? -19.075 -27.148 -6.168 1.00 118.00 ? -38  DA  J "C5'" 1 
ATOM   3665  C  "C4'" . DA  B  2 35  ? -17.941 -26.521 -5.371 1.00 117.35 ? -38  DA  J "C4'" 1 
ATOM   3666  O  "O4'" . DA  B  2 35  ? -18.057 -26.910 -3.977 1.00 117.13 ? -38  DA  J "O4'" 1 
ATOM   3667  C  "C3'" . DA  B  2 35  ? -16.526 -26.913 -5.804 1.00 116.95 ? -38  DA  J "C3'" 1 
ATOM   3668  O  "O3'" . DA  B  2 35  ? -15.678 -25.743 -5.796 1.00 116.14 ? -38  DA  J "O3'" 1 
ATOM   3669  C  "C2'" . DA  B  2 35  ? -16.136 -27.976 -4.773 1.00 116.81 ? -38  DA  J "C2'" 1 
ATOM   3670  C  "C1'" . DA  B  2 35  ? -16.810 -27.408 -3.529 1.00 117.03 ? -38  DA  J "C1'" 1 
ATOM   3671  N  N9    . DA  B  2 35  ? -17.015 -28.345 -2.416 1.00 117.15 ? -38  DA  J N9    1 
ATOM   3672  C  C8    . DA  B  2 35  ? -17.182 -29.705 -2.470 1.00 116.98 ? -38  DA  J C8    1 
ATOM   3673  N  N7    . DA  B  2 35  ? -17.346 -30.275 -1.298 1.00 116.79 ? -38  DA  J N7    1 
ATOM   3674  C  C5    . DA  B  2 35  ? -17.283 -29.214 -0.411 1.00 116.98 ? -38  DA  J C5    1 
ATOM   3675  C  C6    . DA  B  2 35  ? -17.383 -29.144 0.994  1.00 116.90 ? -38  DA  J C6    1 
ATOM   3676  N  N6    . DA  B  2 35  ? -17.581 -30.218 1.762  1.00 116.87 ? -38  DA  J N6    1 
ATOM   3677  N  N1    . DA  B  2 35  ? -17.274 -27.928 1.577  1.00 116.87 ? -38  DA  J N1    1 
ATOM   3678  C  C2    . DA  B  2 35  ? -17.076 -26.850 0.803  1.00 116.84 ? -38  DA  J C2    1 
ATOM   3679  N  N3    . DA  B  2 35  ? -16.967 -26.790 -0.525 1.00 116.84 ? -38  DA  J N3    1 
ATOM   3680  C  C4    . DA  B  2 35  ? -17.078 -28.016 -1.078 1.00 117.08 ? -38  DA  J C4    1 
ATOM   3681  P  P     . DT  B  2 36  ? -14.070 -25.784 -5.684 1.00 115.60 ? -37  DT  J P     1 
ATOM   3682  O  OP1   . DT  B  2 36  ? -13.535 -24.618 -6.419 1.00 115.63 ? -37  DT  J OP1   1 
ATOM   3683  O  OP2   . DT  B  2 36  ? -13.564 -27.141 -6.001 1.00 115.31 ? -37  DT  J OP2   1 
ATOM   3684  O  "O5'" . DT  B  2 36  ? -13.830 -25.531 -4.125 1.00 114.83 ? -37  DT  J "O5'" 1 
ATOM   3685  C  "C5'" . DT  B  2 36  ? -14.329 -24.357 -3.481 1.00 113.12 ? -37  DT  J "C5'" 1 
ATOM   3686  C  "C4'" . DT  B  2 36  ? -13.828 -24.269 -2.044 1.00 111.73 ? -37  DT  J "C4'" 1 
ATOM   3687  O  "O4'" . DT  B  2 36  ? -14.290 -25.419 -1.276 1.00 111.35 ? -37  DT  J "O4'" 1 
ATOM   3688  C  "C3'" . DT  B  2 36  ? -12.305 -24.205 -1.904 1.00 110.68 ? -37  DT  J "C3'" 1 
ATOM   3689  O  "O3'" . DT  B  2 36  ? -11.937 -22.977 -1.244 1.00 109.37 ? -37  DT  J "O3'" 1 
ATOM   3690  C  "C2'" . DT  B  2 36  ? -11.944 -25.469 -1.114 1.00 110.67 ? -37  DT  J "C2'" 1 
ATOM   3691  C  "C1'" . DT  B  2 36  ? -13.254 -25.859 -0.421 1.00 110.48 ? -37  DT  J "C1'" 1 
ATOM   3692  N  N1    . DT  B  2 36  ? -13.426 -27.338 -0.102 1.00 110.07 ? -37  DT  J N1    1 
ATOM   3693  C  C2    . DT  B  2 36  ? -13.820 -27.730 1.167  1.00 110.01 ? -37  DT  J C2    1 
ATOM   3694  O  O2    . DT  B  2 36  ? -14.055 -26.959 2.082  1.00 110.04 ? -37  DT  J O2    1 
ATOM   3695  N  N3    . DT  B  2 36  ? -13.943 -29.085 1.344  1.00 109.84 ? -37  DT  J N3    1 
ATOM   3696  C  C4    . DT  B  2 36  ? -13.714 -30.080 0.412  1.00 109.89 ? -37  DT  J C4    1 
ATOM   3697  O  O4    . DT  B  2 36  ? -13.857 -31.268 0.689  1.00 109.75 ? -37  DT  J O4    1 
ATOM   3698  C  C5    . DT  B  2 36  ? -13.301 -29.612 -0.892 1.00 110.02 ? -37  DT  J C5    1 
ATOM   3699  C  C7    . DT  B  2 36  ? -13.019 -30.582 -2.004 1.00 110.18 ? -37  DT  J C7    1 
ATOM   3700  C  C6    . DT  B  2 36  ? -13.182 -28.288 -1.080 1.00 110.09 ? -37  DT  J C6    1 
ATOM   3701  P  P     . DT  B  2 37  ? -10.433 -22.399 -1.172 1.00 108.31 ? -36  DT  J P     1 
ATOM   3702  O  OP1   . DT  B  2 37  ? -10.473 -20.952 -1.494 1.00 107.65 ? -36  DT  J OP1   1 
ATOM   3703  O  OP2   . DT  B  2 37  ? -9.516  -23.307 -1.901 1.00 107.53 ? -36  DT  J OP2   1 
ATOM   3704  O  "O5'" . DT  B  2 37  ? -10.121 -22.516 0.392  1.00 107.14 ? -36  DT  J "O5'" 1 
ATOM   3705  C  "C5'" . DT  B  2 37  ? -11.098 -22.052 1.334  1.00 104.73 ? -36  DT  J "C5'" 1 
ATOM   3706  C  "C4'" . DT  B  2 37  ? -10.939 -22.696 2.699  1.00 102.41 ? -36  DT  J "C4'" 1 
ATOM   3707  O  "O4'" . DT  B  2 37  ? -11.244 -24.113 2.641  1.00 102.07 ? -36  DT  J "O4'" 1 
ATOM   3708  C  "C3'" . DT  B  2 37  ? -9.535  -22.558 3.264  1.00 100.49 ? -36  DT  J "C3'" 1 
ATOM   3709  O  "O3'" . DT  B  2 37  ? -9.658  -21.846 4.477  1.00 97.71  ? -36  DT  J "O3'" 1 
ATOM   3710  C  "C2'" . DT  B  2 37  ? -9.025  -23.992 3.432  1.00 101.13 ? -36  DT  J "C2'" 1 
ATOM   3711  C  "C1'" . DT  B  2 37  ? -10.307 -24.824 3.418  1.00 102.19 ? -36  DT  J "C1'" 1 
ATOM   3712  N  N1    . DT  B  2 37  ? -10.175 -26.210 2.844  1.00 102.48 ? -36  DT  J N1    1 
ATOM   3713  C  C2    . DT  B  2 37  ? -10.554 -27.303 3.607  1.00 102.68 ? -36  DT  J C2    1 
ATOM   3714  O  O2    . DT  B  2 37  ? -10.992 -27.215 4.740  1.00 102.92 ? -36  DT  J O2    1 
ATOM   3715  N  N3    . DT  B  2 37  ? -10.401 -28.526 2.997  1.00 102.37 ? -36  DT  J N3    1 
ATOM   3716  C  C4    . DT  B  2 37  ? -9.916  -28.765 1.722  1.00 102.59 ? -36  DT  J C4    1 
ATOM   3717  O  O4    . DT  B  2 37  ? -9.817  -29.902 1.268  1.00 102.53 ? -36  DT  J O4    1 
ATOM   3718  C  C5    . DT  B  2 37  ? -9.537  -27.583 0.973  1.00 102.96 ? -36  DT  J C5    1 
ATOM   3719  C  C7    . DT  B  2 37  ? -8.991  -27.705 -0.423 1.00 102.98 ? -36  DT  J C7    1 
ATOM   3720  C  C6    . DT  B  2 37  ? -9.684  -26.382 1.560  1.00 102.71 ? -36  DT  J C6    1 
ATOM   3721  P  P     . DT  B  2 38  ? -8.394  -21.153 5.163  1.00 95.76  ? -35  DT  J P     1 
ATOM   3722  O  OP1   . DT  B  2 38  ? -8.847  -19.853 5.705  1.00 95.15  ? -35  DT  J OP1   1 
ATOM   3723  O  OP2   . DT  B  2 38  ? -7.234  -21.248 4.247  1.00 95.35  ? -35  DT  J OP2   1 
ATOM   3724  O  "O5'" . DT  B  2 38  ? -8.094  -22.138 6.382  1.00 94.57  ? -35  DT  J "O5'" 1 
ATOM   3725  C  "C5'" . DT  B  2 38  ? -9.158  -22.610 7.227  1.00 92.07  ? -35  DT  J "C5'" 1 
ATOM   3726  C  "C4'" . DT  B  2 38  ? -8.700  -23.766 8.109  1.00 89.86  ? -35  DT  J "C4'" 1 
ATOM   3727  O  "O4'" . DT  B  2 38  ? -8.875  -25.033 7.415  1.00 89.03  ? -35  DT  J "O4'" 1 
ATOM   3728  C  "C3'" . DT  B  2 38  ? -7.234  -23.722 8.566  1.00 88.02  ? -35  DT  J "C3'" 1 
ATOM   3729  O  "O3'" . DT  B  2 38  ? -7.121  -24.081 9.938  1.00 85.08  ? -35  DT  J "O3'" 1 
ATOM   3730  C  "C2'" . DT  B  2 38  ? -6.575  -24.776 7.684  1.00 88.43  ? -35  DT  J "C2'" 1 
ATOM   3731  C  "C1'" . DT  B  2 38  ? -7.705  -25.797 7.628  1.00 88.84  ? -35  DT  J "C1'" 1 
ATOM   3732  N  N1    . DT  B  2 38  ? -7.597  -26.811 6.550  1.00 88.99  ? -35  DT  J N1    1 
ATOM   3733  C  C2    . DT  B  2 38  ? -8.086  -28.078 6.790  1.00 88.93  ? -35  DT  J C2    1 
ATOM   3734  O  O2    . DT  B  2 38  ? -8.599  -28.412 7.844  1.00 88.75  ? -35  DT  J O2    1 
ATOM   3735  N  N3    . DT  B  2 38  ? -7.952  -28.946 5.733  1.00 89.04  ? -35  DT  J N3    1 
ATOM   3736  C  C4    . DT  B  2 38  ? -7.391  -28.678 4.494  1.00 89.03  ? -35  DT  J C4    1 
ATOM   3737  O  O4    . DT  B  2 38  ? -7.325  -29.543 3.625  1.00 88.85  ? -35  DT  J O4    1 
ATOM   3738  C  C5    . DT  B  2 38  ? -6.899  -27.326 4.313  1.00 88.90  ? -35  DT  J C5    1 
ATOM   3739  C  C7    . DT  B  2 38  ? -6.264  -26.884 3.028  1.00 88.92  ? -35  DT  J C7    1 
ATOM   3740  C  C6    . DT  B  2 38  ? -7.027  -26.471 5.334  1.00 89.01  ? -35  DT  J C6    1 
ATOM   3741  P  P     . DG  B  2 39  ? -7.207  -23.015 11.121 1.00 82.67  ? -34  DG  J P     1 
ATOM   3742  O  OP1   . DG  B  2 39  ? -8.195  -21.972 10.765 1.00 83.44  ? -34  DG  J OP1   1 
ATOM   3743  O  OP2   . DG  B  2 39  ? -5.817  -22.635 11.447 1.00 82.10  ? -34  DG  J OP2   1 
ATOM   3744  O  "O5'" . DG  B  2 39  ? -7.827  -23.860 12.327 1.00 80.90  ? -34  DG  J "O5'" 1 
ATOM   3745  C  "C5'" . DG  B  2 39  ? -8.916  -24.743 12.105 1.00 79.31  ? -34  DG  J "C5'" 1 
ATOM   3746  C  "C4'" . DG  B  2 39  ? -8.741  -26.069 12.841 1.00 78.96  ? -34  DG  J "C4'" 1 
ATOM   3747  O  "O4'" . DG  B  2 39  ? -8.174  -27.076 11.973 1.00 78.82  ? -34  DG  J "O4'" 1 
ATOM   3748  C  "C3'" . DG  B  2 39  ? -7.829  -26.133 14.063 1.00 78.28  ? -34  DG  J "C3'" 1 
ATOM   3749  O  "O3'" . DG  B  2 39  ? -8.242  -27.253 14.852 1.00 76.69  ? -34  DG  J "O3'" 1 
ATOM   3750  C  "C2'" . DG  B  2 39  ? -6.457  -26.368 13.448 1.00 78.66  ? -34  DG  J "C2'" 1 
ATOM   3751  C  "C1'" . DG  B  2 39  ? -6.849  -27.374 12.379 1.00 79.56  ? -34  DG  J "C1'" 1 
ATOM   3752  N  N9    . DG  B  2 39  ? -6.083  -27.283 11.156 1.00 80.02  ? -34  DG  J N9    1 
ATOM   3753  C  C8    . DG  B  2 39  ? -5.455  -26.181 10.631 1.00 79.99  ? -34  DG  J C8    1 
ATOM   3754  N  N7    . DG  B  2 39  ? -4.866  -26.421 9.497  1.00 79.90  ? -34  DG  J N7    1 
ATOM   3755  C  C5    . DG  B  2 39  ? -5.133  -27.763 9.263  1.00 79.99  ? -34  DG  J C5    1 
ATOM   3756  C  C6    . DG  B  2 39  ? -4.750  -28.585 8.186  1.00 80.06  ? -34  DG  J C6    1 
ATOM   3757  O  O6    . DG  B  2 39  ? -4.080  -28.252 7.204  1.00 80.10  ? -34  DG  J O6    1 
ATOM   3758  N  N1    . DG  B  2 39  ? -5.220  -29.895 8.332  1.00 80.14  ? -34  DG  J N1    1 
ATOM   3759  C  C2    . DG  B  2 39  ? -5.976  -30.345 9.393  1.00 79.83  ? -34  DG  J C2    1 
ATOM   3760  N  N2    . DG  B  2 39  ? -6.339  -31.632 9.369  1.00 80.00  ? -34  DG  J N2    1 
ATOM   3761  N  N3    . DG  B  2 39  ? -6.346  -29.585 10.413 1.00 79.71  ? -34  DG  J N3    1 
ATOM   3762  C  C4    . DG  B  2 39  ? -5.886  -28.312 10.275 1.00 80.09  ? -34  DG  J C4    1 
ATOM   3763  P  P     . DG  B  2 40  ? -7.723  -27.528 16.337 1.00 74.90  ? -33  DG  J P     1 
ATOM   3764  O  OP1   . DG  B  2 40  ? -8.871  -28.051 17.100 1.00 74.95  ? -33  DG  J OP1   1 
ATOM   3765  O  OP2   . DG  B  2 40  ? -6.943  -26.364 16.812 1.00 74.17  ? -33  DG  J OP2   1 
ATOM   3766  O  "O5'" . DG  B  2 40  ? -6.711  -28.729 16.120 1.00 75.44  ? -33  DG  J "O5'" 1 
ATOM   3767  C  "C5'" . DG  B  2 40  ? -7.189  -30.051 16.019 1.00 77.01  ? -33  DG  J "C5'" 1 
ATOM   3768  C  "C4'" . DG  B  2 40  ? -6.033  -30.920 15.575 1.00 78.56  ? -33  DG  J "C4'" 1 
ATOM   3769  O  "O4'" . DG  B  2 40  ? -5.445  -30.322 14.397 1.00 79.44  ? -33  DG  J "O4'" 1 
ATOM   3770  C  "C3'" . DG  B  2 40  ? -4.893  -31.032 16.581 1.00 79.19  ? -33  DG  J "C3'" 1 
ATOM   3771  O  "O3'" . DG  B  2 40  ? -4.412  -32.351 16.571 1.00 80.17  ? -33  DG  J "O3'" 1 
ATOM   3772  C  "C2'" . DG  B  2 40  ? -3.829  -30.078 16.056 1.00 79.53  ? -33  DG  J "C2'" 1 
ATOM   3773  C  "C1'" . DG  B  2 40  ? -4.045  -30.318 14.571 1.00 80.00  ? -33  DG  J "C1'" 1 
ATOM   3774  N  N9    . DG  B  2 40  ? -3.420  -29.382 13.637 1.00 80.13  ? -33  DG  J N9    1 
ATOM   3775  C  C8    . DG  B  2 40  ? -2.999  -28.087 13.830 1.00 80.05  ? -33  DG  J C8    1 
ATOM   3776  N  N7    . DG  B  2 40  ? -2.470  -27.559 12.762 1.00 79.97  ? -33  DG  J N7    1 
ATOM   3777  C  C5    . DG  B  2 40  ? -2.551  -28.567 11.808 1.00 80.08  ? -33  DG  J C5    1 
ATOM   3778  C  C6    . DG  B  2 40  ? -2.142  -28.600 10.454 1.00 79.89  ? -33  DG  J C6    1 
ATOM   3779  O  O6    . DG  B  2 40  ? -1.609  -27.696 9.806  1.00 79.94  ? -33  DG  J O6    1 
ATOM   3780  N  N1    . DG  B  2 40  ? -2.409  -29.830 9.848  1.00 80.11  ? -33  DG  J N1    1 
ATOM   3781  C  C2    . DG  B  2 40  ? -2.999  -30.906 10.478 1.00 80.11  ? -33  DG  J C2    1 
ATOM   3782  N  N2    . DG  B  2 40  ? -3.191  -32.020 9.760  1.00 79.98  ? -33  DG  J N2    1 
ATOM   3783  N  N3    . DG  B  2 40  ? -3.387  -30.887 11.742 1.00 80.12  ? -33  DG  J N3    1 
ATOM   3784  C  C4    . DG  B  2 40  ? -3.131  -29.694 12.336 1.00 80.07  ? -33  DG  J C4    1 
ATOM   3785  P  P     . DA  B  2 41  ? -4.656  -33.274 17.847 1.00 81.40  ? -32  DA  J P     1 
ATOM   3786  O  OP1   . DA  B  2 41  ? -6.118  -33.400 18.051 1.00 80.26  ? -32  DA  J OP1   1 
ATOM   3787  O  OP2   . DA  B  2 41  ? -3.781  -32.775 18.934 1.00 80.71  ? -32  DA  J OP2   1 
ATOM   3788  O  "O5'" . DA  B  2 41  ? -4.063  -34.679 17.362 1.00 83.17  ? -32  DA  J "O5'" 1 
ATOM   3789  C  "C5'" . DA  B  2 41  ? -4.727  -35.470 16.377 1.00 85.75  ? -32  DA  J "C5'" 1 
ATOM   3790  C  "C4'" . DA  B  2 41  ? -3.706  -36.207 15.526 1.00 88.01  ? -32  DA  J "C4'" 1 
ATOM   3791  O  "O4'" . DA  B  2 41  ? -3.125  -35.277 14.582 1.00 88.14  ? -32  DA  J "O4'" 1 
ATOM   3792  C  "C3'" . DA  B  2 41  ? -2.544  -36.843 16.288 1.00 89.78  ? -32  DA  J "C3'" 1 
ATOM   3793  O  "O3'" . DA  B  2 41  ? -2.457  -38.235 15.908 1.00 93.07  ? -32  DA  J "O3'" 1 
ATOM   3794  C  "C2'" . DA  B  2 41  ? -1.335  -35.961 15.949 1.00 88.90  ? -32  DA  J "C2'" 1 
ATOM   3795  C  "C1'" . DA  B  2 41  ? -1.715  -35.293 14.633 1.00 88.17  ? -32  DA  J "C1'" 1 
ATOM   3796  N  N9    . DA  B  2 41  ? -1.274  -33.904 14.472 1.00 87.90  ? -32  DA  J N9    1 
ATOM   3797  C  C8    . DA  B  2 41  ? -1.240  -32.928 15.429 1.00 88.23  ? -32  DA  J C8    1 
ATOM   3798  N  N7    . DA  B  2 41  ? -0.810  -31.761 15.007 1.00 88.13  ? -32  DA  J N7    1 
ATOM   3799  C  C5    . DA  B  2 41  ? -0.543  -31.981 13.670 1.00 88.15  ? -32  DA  J C5    1 
ATOM   3800  C  C6    . DA  B  2 41  ? -0.059  -31.130 12.650 1.00 88.12  ? -32  DA  J C6    1 
ATOM   3801  N  N6    . DA  B  2 41  ? 0.248   -29.848 12.854 1.00 88.07  ? -32  DA  J N6    1 
ATOM   3802  N  N1    . DA  B  2 41  ? 0.094   -31.650 11.412 1.00 88.10  ? -32  DA  J N1    1 
ATOM   3803  C  C2    . DA  B  2 41  ? -0.218  -32.943 11.217 1.00 88.40  ? -32  DA  J C2    1 
ATOM   3804  N  N3    . DA  B  2 41  ? -0.682  -33.841 12.095 1.00 88.34  ? -32  DA  J N3    1 
ATOM   3805  C  C4    . DA  B  2 41  ? -0.827  -33.294 13.319 1.00 88.06  ? -32  DA  J C4    1 
ATOM   3806  P  P     . DA  B  2 42  ? -1.109  -39.094 15.724 1.00 95.45  ? -31  DA  J P     1 
ATOM   3807  O  OP1   . DA  B  2 42  ? -1.497  -40.517 15.867 1.00 95.35  ? -31  DA  J OP1   1 
ATOM   3808  O  OP2   . DA  B  2 42  ? -0.010  -38.547 16.558 1.00 94.44  ? -31  DA  J OP2   1 
ATOM   3809  O  "O5'" . DA  B  2 42  ? -0.790  -38.798 14.180 1.00 97.35  ? -31  DA  J "O5'" 1 
ATOM   3810  C  "C5'" . DA  B  2 42  ? -0.039  -39.708 13.383 1.00 99.89  ? -31  DA  J "C5'" 1 
ATOM   3811  C  "C4'" . DA  B  2 42  ? 1.362   -39.172 13.172 1.00 101.70 ? -31  DA  J "C4'" 1 
ATOM   3812  O  "O4'" . DA  B  2 42  ? 1.310   -37.729 13.057 1.00 101.59 ? -31  DA  J "O4'" 1 
ATOM   3813  C  "C3'" . DA  B  2 42  ? 2.309   -39.449 14.338 1.00 103.38 ? -31  DA  J "C3'" 1 
ATOM   3814  O  "O3'" . DA  B  2 42  ? 3.107   -40.659 14.174 1.00 106.01 ? -31  DA  J "O3'" 1 
ATOM   3815  C  "C2'" . DA  B  2 42  ? 3.154   -38.179 14.456 1.00 102.95 ? -31  DA  J "C2'" 1 
ATOM   3816  C  "C1'" . DA  B  2 42  ? 2.583   -37.232 13.400 1.00 101.96 ? -31  DA  J "C1'" 1 
ATOM   3817  N  N9    . DA  B  2 42  ? 2.487   -35.857 13.887 1.00 101.84 ? -31  DA  J N9    1 
ATOM   3818  C  C8    . DA  B  2 42  ? 1.939   -35.441 15.069 1.00 101.84 ? -31  DA  J C8    1 
ATOM   3819  N  N7    . DA  B  2 42  ? 1.999   -34.146 15.265 1.00 101.79 ? -31  DA  J N7    1 
ATOM   3820  C  C5    . DA  B  2 42  ? 2.638   -33.677 14.133 1.00 101.62 ? -31  DA  J C5    1 
ATOM   3821  C  C6    . DA  B  2 42  ? 3.010   -32.379 13.728 1.00 101.66 ? -31  DA  J C6    1 
ATOM   3822  N  N6    . DA  B  2 42  ? 2.769   -31.288 14.461 1.00 101.75 ? -31  DA  J N6    1 
ATOM   3823  N  N1    . DA  B  2 42  ? 3.638   -32.246 12.539 1.00 101.66 ? -31  DA  J N1    1 
ATOM   3824  C  C2    . DA  B  2 42  ? 3.876   -33.344 11.808 1.00 101.69 ? -31  DA  J C2    1 
ATOM   3825  N  N3    . DA  B  2 42  ? 3.576   -34.614 12.085 1.00 101.75 ? -31  DA  J N3    1 
ATOM   3826  C  C4    . DA  B  2 42  ? 2.952   -34.716 13.273 1.00 101.66 ? -31  DA  J C4    1 
ATOM   3827  P  P     . DA  B  2 43  ? 4.052   -41.031 12.918 1.00 107.69 ? -30  DA  J P     1 
ATOM   3828  O  OP1   . DA  B  2 43  ? 3.233   -41.859 12.000 1.00 107.32 ? -30  DA  J OP1   1 
ATOM   3829  O  OP2   . DA  B  2 43  ? 5.310   -41.571 13.483 1.00 107.71 ? -30  DA  J OP2   1 
ATOM   3830  O  "O5'" . DA  B  2 43  ? 4.418   -39.642 12.201 1.00 108.09 ? -30  DA  J "O5'" 1 
ATOM   3831  C  "C5'" . DA  B  2 43  ? 5.287   -39.573 11.076 1.00 109.26 ? -30  DA  J "C5'" 1 
ATOM   3832  C  "C4'" . DA  B  2 43  ? 6.479   -38.664 11.349 1.00 110.05 ? -30  DA  J "C4'" 1 
ATOM   3833  O  "O4'" . DA  B  2 43  ? 6.086   -37.474 12.093 1.00 110.37 ? -30  DA  J "O4'" 1 
ATOM   3834  C  "C3'" . DA  B  2 43  ? 7.604   -39.306 12.159 1.00 110.41 ? -30  DA  J "C3'" 1 
ATOM   3835  O  "O3'" . DA  B  2 43  ? 8.857   -39.004 11.534 1.00 110.57 ? -30  DA  J "O3'" 1 
ATOM   3836  C  "C2'" . DA  B  2 43  ? 7.463   -38.628 13.522 1.00 110.56 ? -30  DA  J "C2'" 1 
ATOM   3837  C  "C1'" . DA  B  2 43  ? 7.095   -37.226 13.054 1.00 110.47 ? -30  DA  J "C1'" 1 
ATOM   3838  N  N9    . DA  B  2 43  ? 6.643   -36.301 14.102 1.00 110.58 ? -30  DA  J N9    1 
ATOM   3839  C  C8    . DA  B  2 43  ? 6.041   -36.614 15.292 1.00 110.51 ? -30  DA  J C8    1 
ATOM   3840  N  N7    . DA  B  2 43  ? 5.750   -35.576 16.040 1.00 110.30 ? -30  DA  J N7    1 
ATOM   3841  C  C5    . DA  B  2 43  ? 6.196   -34.502 15.294 1.00 110.18 ? -30  DA  J C5    1 
ATOM   3842  C  C6    . DA  B  2 43  ? 6.181   -33.114 15.534 1.00 110.27 ? -30  DA  J C6    1 
ATOM   3843  N  N6    . DA  B  2 43  ? 5.673   -32.585 16.647 1.00 110.62 ? -30  DA  J N6    1 
ATOM   3844  N  N1    . DA  B  2 43  ? 6.704   -32.293 14.596 1.00 110.30 ? -30  DA  J N1    1 
ATOM   3845  C  C2    . DA  B  2 43  ? 7.213   -32.842 13.484 1.00 110.40 ? -30  DA  J C2    1 
ATOM   3846  N  N3    . DA  B  2 43  ? 7.282   -34.134 13.145 1.00 110.38 ? -30  DA  J N3    1 
ATOM   3847  C  C4    . DA  B  2 43  ? 6.754   -34.924 14.100 1.00 110.38 ? -30  DA  J C4    1 
ATOM   3848  P  P     . DC  B  2 44  ? 10.250  -39.642 12.012 1.00 110.92 ? -29  DC  J P     1 
ATOM   3849  O  OP1   . DC  B  2 44  ? 10.928  -40.163 10.801 1.00 110.87 ? -29  DC  J OP1   1 
ATOM   3850  O  OP2   . DC  B  2 44  ? 10.015  -40.548 13.164 1.00 110.48 ? -29  DC  J OP2   1 
ATOM   3851  O  "O5'" . DC  B  2 44  ? 11.055  -38.364 12.547 1.00 110.68 ? -29  DC  J "O5'" 1 
ATOM   3852  C  "C5'" . DC  B  2 44  ? 11.790  -37.532 11.649 1.00 110.41 ? -29  DC  J "C5'" 1 
ATOM   3853  C  "C4'" . DC  B  2 44  ? 12.177  -36.224 12.316 1.00 110.41 ? -29  DC  J "C4'" 1 
ATOM   3854  O  "O4'" . DC  B  2 44  ? 11.092  -35.765 13.163 1.00 110.34 ? -29  DC  J "O4'" 1 
ATOM   3855  C  "C3'" . DC  B  2 44  ? 13.423  -36.262 13.209 1.00 110.45 ? -29  DC  J "C3'" 1 
ATOM   3856  O  "O3'" . DC  B  2 44  ? 14.376  -35.306 12.717 1.00 110.35 ? -29  DC  J "O3'" 1 
ATOM   3857  C  "C2'" . DC  B  2 44  ? 12.900  -35.892 14.602 1.00 110.35 ? -29  DC  J "C2'" 1 
ATOM   3858  C  "C1'" . DC  B  2 44  ? 11.679  -35.055 14.231 1.00 110.05 ? -29  DC  J "C1'" 1 
ATOM   3859  N  N1    . DC  B  2 44  ? 10.666  -34.834 15.314 1.00 109.86 ? -29  DC  J N1    1 
ATOM   3860  C  C2    . DC  B  2 44  ? 10.337  -33.521 15.695 1.00 109.88 ? -29  DC  J C2    1 
ATOM   3861  O  O2    . DC  B  2 44  ? 10.882  -32.560 15.141 1.00 110.04 ? -29  DC  J O2    1 
ATOM   3862  N  N3    . DC  B  2 44  ? 9.417   -33.328 16.675 1.00 109.77 ? -29  DC  J N3    1 
ATOM   3863  C  C4    . DC  B  2 44  ? 8.838   -34.375 17.264 1.00 109.84 ? -29  DC  J C4    1 
ATOM   3864  N  N4    . DC  B  2 44  ? 7.941   -34.126 18.220 1.00 109.79 ? -29  DC  J N4    1 
ATOM   3865  C  C5    . DC  B  2 44  ? 9.150   -35.720 16.892 1.00 110.07 ? -29  DC  J C5    1 
ATOM   3866  C  C6    . DC  B  2 44  ? 10.059  -35.899 15.923 1.00 110.10 ? -29  DC  J C6    1 
ATOM   3867  P  P     . DT  B  2 45  ? 15.913  -35.284 13.177 1.00 110.02 ? -28  DT  J P     1 
ATOM   3868  O  OP1   . DT  B  2 45  ? 16.657  -34.540 12.137 1.00 109.81 ? -28  DT  J OP1   1 
ATOM   3869  O  OP2   . DT  B  2 45  ? 16.308  -36.660 13.550 1.00 110.15 ? -28  DT  J OP2   1 
ATOM   3870  O  "O5'" . DT  B  2 45  ? 15.914  -34.417 14.520 1.00 109.82 ? -28  DT  J "O5'" 1 
ATOM   3871  C  "C5'" . DT  B  2 45  ? 15.725  -33.006 14.464 1.00 109.13 ? -28  DT  J "C5'" 1 
ATOM   3872  C  "C4'" . DT  B  2 45  ? 15.444  -32.435 15.844 1.00 108.40 ? -28  DT  J "C4'" 1 
ATOM   3873  O  "O4'" . DT  B  2 45  ? 14.214  -32.989 16.380 1.00 108.30 ? -28  DT  J "O4'" 1 
ATOM   3874  C  "C3'" . DT  B  2 45  ? 16.513  -32.706 16.904 1.00 107.33 ? -28  DT  J "C3'" 1 
ATOM   3875  O  "O3'" . DT  B  2 45  ? 17.015  -31.472 17.390 1.00 105.56 ? -28  DT  J "O3'" 1 
ATOM   3876  C  "C2'" . DT  B  2 45  ? 15.768  -33.466 17.999 1.00 107.77 ? -28  DT  J "C2'" 1 
ATOM   3877  C  "C1'" . DT  B  2 45  ? 14.364  -32.913 17.778 1.00 108.41 ? -28  DT  J "C1'" 1 
ATOM   3878  N  N1    . DT  B  2 45  ? 13.236  -33.634 18.438 1.00 108.70 ? -28  DT  J N1    1 
ATOM   3879  C  C2    . DT  B  2 45  ? 12.213  -32.893 19.013 1.00 108.74 ? -28  DT  J C2    1 
ATOM   3880  O  O2    . DT  B  2 45  ? 12.172  -31.669 19.023 1.00 108.60 ? -28  DT  J O2    1 
ATOM   3881  N  N3    . DT  B  2 45  ? 11.222  -33.653 19.588 1.00 108.56 ? -28  DT  J N3    1 
ATOM   3882  C  C4    . DT  B  2 45  ? 11.156  -35.035 19.645 1.00 108.51 ? -28  DT  J C4    1 
ATOM   3883  O  O4    . DT  B  2 45  ? 10.218  -35.604 20.189 1.00 108.75 ? -28  DT  J O4    1 
ATOM   3884  C  C5    . DT  B  2 45  ? 12.253  -35.747 19.026 1.00 108.54 ? -28  DT  J C5    1 
ATOM   3885  C  C7    . DT  B  2 45  ? 12.306  -37.248 19.019 1.00 108.47 ? -28  DT  J C7    1 
ATOM   3886  C  C6    . DT  B  2 45  ? 13.225  -35.020 18.458 1.00 108.77 ? -28  DT  J C6    1 
ATOM   3887  P  P     . DG  B  2 46  ? 18.584  -31.302 17.622 1.00 104.21 ? -27  DG  J P     1 
ATOM   3888  O  OP1   . DG  B  2 46  ? 19.224  -31.415 16.294 1.00 104.37 ? -27  DG  J OP1   1 
ATOM   3889  O  OP2   . DG  B  2 46  ? 18.976  -32.204 18.725 1.00 104.04 ? -27  DG  J OP2   1 
ATOM   3890  O  "O5'" . DG  B  2 46  ? 18.743  -29.798 18.148 1.00 103.81 ? -27  DG  J "O5'" 1 
ATOM   3891  C  "C5'" . DG  B  2 46  ? 18.146  -28.711 17.430 1.00 103.18 ? -27  DG  J "C5'" 1 
ATOM   3892  C  "C4'" . DG  B  2 46  ? 17.347  -27.780 18.339 1.00 102.37 ? -27  DG  J "C4'" 1 
ATOM   3893  O  "O4'" . DG  B  2 46  ? 16.176  -28.448 18.888 1.00 102.49 ? -27  DG  J "O4'" 1 
ATOM   3894  C  "C3'" . DG  B  2 46  ? 18.084  -27.200 19.544 1.00 101.82 ? -27  DG  J "C3'" 1 
ATOM   3895  O  "O3'" . DG  B  2 46  ? 17.572  -25.889 19.799 1.00 101.07 ? -27  DG  J "O3'" 1 
ATOM   3896  C  "C2'" . DG  B  2 46  ? 17.716  -28.182 20.652 1.00 101.99 ? -27  DG  J "C2'" 1 
ATOM   3897  C  "C1'" . DG  B  2 46  ? 16.256  -28.480 20.308 1.00 102.52 ? -27  DG  J "C1'" 1 
ATOM   3898  N  N9    . DG  B  2 46  ? 15.722  -29.767 20.773 1.00 102.51 ? -27  DG  J N9    1 
ATOM   3899  C  C8    . DG  B  2 46  ? 16.177  -31.023 20.443 1.00 102.46 ? -27  DG  J C8    1 
ATOM   3900  N  N7    . DG  B  2 46  ? 15.504  -31.993 20.995 1.00 102.30 ? -27  DG  J N7    1 
ATOM   3901  C  C5    . DG  B  2 46  ? 14.529  -31.345 21.738 1.00 102.50 ? -27  DG  J C5    1 
ATOM   3902  C  C6    . DG  B  2 46  ? 13.495  -31.877 22.556 1.00 102.58 ? -27  DG  J C6    1 
ATOM   3903  O  O6    . DG  B  2 46  ? 13.229  -33.064 22.786 1.00 102.51 ? -27  DG  J O6    1 
ATOM   3904  N  N1    . DG  B  2 46  ? 12.714  -30.880 23.141 1.00 102.55 ? -27  DG  J N1    1 
ATOM   3905  C  C2    . DG  B  2 46  ? 12.909  -29.530 22.957 1.00 102.47 ? -27  DG  J C2    1 
ATOM   3906  N  N2    . DG  B  2 46  ? 12.056  -28.725 23.602 1.00 102.47 ? -27  DG  J N2    1 
ATOM   3907  N  N3    . DG  B  2 46  ? 13.873  -29.015 22.194 1.00 102.61 ? -27  DG  J N3    1 
ATOM   3908  C  C4    . DG  B  2 46  ? 14.647  -29.974 21.612 1.00 102.55 ? -27  DG  J C4    1 
ATOM   3909  P  P     . DC  B  2 47  ? 18.371  -24.779 20.639 1.00 100.44 ? -26  DC  J P     1 
ATOM   3910  O  OP1   . DC  B  2 47  ? 17.877  -23.452 20.202 1.00 100.20 ? -26  DC  J OP1   1 
ATOM   3911  O  OP2   . DC  B  2 47  ? 19.818  -25.087 20.595 1.00 100.54 ? -26  DC  J OP2   1 
ATOM   3912  O  "O5'" . DC  B  2 47  ? 17.901  -25.032 22.147 1.00 100.58 ? -26  DC  J "O5'" 1 
ATOM   3913  C  "C5'" . DC  B  2 47  ? 16.531  -24.943 22.558 1.00 99.87  ? -26  DC  J "C5'" 1 
ATOM   3914  C  "C4'" . DC  B  2 47  ? 16.337  -25.527 23.953 1.00 99.27  ? -26  DC  J "C4'" 1 
ATOM   3915  O  "O4'" . DC  B  2 47  ? 16.097  -26.960 23.861 1.00 99.64  ? -26  DC  J "O4'" 1 
ATOM   3916  C  "C3'" . DC  B  2 47  ? 17.509  -25.384 24.923 1.00 98.58  ? -26  DC  J "C3'" 1 
ATOM   3917  O  "O3'" . DC  B  2 47  ? 17.006  -25.091 26.217 1.00 97.55  ? -26  DC  J "O3'" 1 
ATOM   3918  C  "C2'" . DC  B  2 47  ? 18.138  -26.775 24.896 1.00 99.01  ? -26  DC  J "C2'" 1 
ATOM   3919  C  "C1'" . DC  B  2 47  ? 16.856  -27.596 24.870 1.00 99.71  ? -26  DC  J "C1'" 1 
ATOM   3920  N  N1    . DC  B  2 47  ? 16.964  -29.058 24.562 1.00 100.00 ? -26  DC  J N1    1 
ATOM   3921  C  C2    . DC  B  2 47  ? 16.136  -29.974 25.239 1.00 100.27 ? -26  DC  J C2    1 
ATOM   3922  O  O2    . DC  B  2 47  ? 15.331  -29.567 26.087 1.00 100.22 ? -26  DC  J O2    1 
ATOM   3923  N  N3    . DC  B  2 47  ? 16.237  -31.297 24.944 1.00 100.24 ? -26  DC  J N3    1 
ATOM   3924  C  C4    . DC  B  2 47  ? 17.114  -31.707 24.020 1.00 100.37 ? -26  DC  J C4    1 
ATOM   3925  N  N4    . DC  B  2 47  ? 17.184  -33.017 23.753 1.00 100.36 ? -26  DC  J N4    1 
ATOM   3926  C  C5    . DC  B  2 47  ? 17.963  -30.793 23.323 1.00 100.33 ? -26  DC  J C5    1 
ATOM   3927  C  C6    . DC  B  2 47  ? 17.853  -29.496 23.623 1.00 100.05 ? -26  DC  J C6    1 
ATOM   3928  P  P     . DT  B  2 48  ? 17.153  -23.640 26.870 1.00 97.41  ? -25  DT  J P     1 
ATOM   3929  O  OP1   . DT  B  2 48  ? 16.676  -22.643 25.872 1.00 97.03  ? -25  DT  J OP1   1 
ATOM   3930  O  OP2   . DT  B  2 48  ? 18.515  -23.544 27.460 1.00 96.99  ? -25  DT  J OP2   1 
ATOM   3931  O  "O5'" . DT  B  2 48  ? 16.112  -23.700 28.093 1.00 95.60  ? -25  DT  J "O5'" 1 
ATOM   3932  C  "C5'" . DT  B  2 48  ? 14.712  -23.456 27.878 1.00 92.07  ? -25  DT  J "C5'" 1 
ATOM   3933  C  "C4'" . DT  B  2 48  ? 13.813  -24.281 28.789 1.00 89.02  ? -25  DT  J "C4'" 1 
ATOM   3934  O  "O4'" . DT  B  2 48  ? 14.037  -25.699 28.590 1.00 88.39  ? -25  DT  J "O4'" 1 
ATOM   3935  C  "C3'" . DT  B  2 48  ? 13.971  -24.069 30.289 1.00 87.07  ? -25  DT  J "C3'" 1 
ATOM   3936  O  "O3'" . DT  B  2 48  ? 12.684  -24.281 30.844 1.00 83.71  ? -25  DT  J "O3'" 1 
ATOM   3937  C  "C2'" . DT  B  2 48  ? 14.932  -25.180 30.696 1.00 87.02  ? -25  DT  J "C2'" 1 
ATOM   3938  C  "C1'" . DT  B  2 48  ? 14.360  -26.296 29.832 1.00 88.36  ? -25  DT  J "C1'" 1 
ATOM   3939  N  N1    . DT  B  2 48  ? 15.246  -27.434 29.512 1.00 88.52  ? -25  DT  J N1    1 
ATOM   3940  C  C2    . DT  B  2 48  ? 14.750  -28.719 29.665 1.00 88.91  ? -25  DT  J C2    1 
ATOM   3941  O  O2    . DT  B  2 48  ? 13.625  -28.968 30.077 1.00 89.27  ? -25  DT  J O2    1 
ATOM   3942  N  N3    . DT  B  2 48  ? 15.633  -29.719 29.328 1.00 88.93  ? -25  DT  J N3    1 
ATOM   3943  C  C4    . DT  B  2 48  ? 16.925  -29.554 28.852 1.00 89.05  ? -25  DT  J C4    1 
ATOM   3944  O  O4    . DT  B  2 48  ? 17.631  -30.518 28.570 1.00 89.26  ? -25  DT  J O4    1 
ATOM   3945  C  C5    . DT  B  2 48  ? 17.376  -28.179 28.707 1.00 89.15  ? -25  DT  J C5    1 
ATOM   3946  C  C7    . DT  B  2 48  ? 18.759  -27.866 28.205 1.00 88.71  ? -25  DT  J C7    1 
ATOM   3947  C  C6    . DT  B  2 48  ? 16.521  -27.195 29.034 1.00 88.61  ? -25  DT  J C6    1 
ATOM   3948  P  P     . DC  B  2 49  ? 12.273  -23.748 32.291 1.00 80.37  ? -24  DC  J P     1 
ATOM   3949  O  OP1   . DC  B  2 49  ? 11.289  -22.670 32.038 1.00 80.15  ? -24  DC  J OP1   1 
ATOM   3950  O  OP2   . DC  B  2 49  ? 13.498  -23.506 33.101 1.00 79.04  ? -24  DC  J OP2   1 
ATOM   3951  O  "O5'" . DC  B  2 49  ? 11.485  -24.995 32.939 1.00 78.48  ? -24  DC  J "O5'" 1 
ATOM   3952  C  "C5'" . DC  B  2 49  ? 11.490  -26.332 32.388 1.00 73.75  ? -24  DC  J "C5'" 1 
ATOM   3953  C  "C4'" . DC  B  2 49  ? 11.667  -27.421 33.442 1.00 70.44  ? -24  DC  J "C4'" 1 
ATOM   3954  O  "O4'" . DC  B  2 49  ? 12.796  -28.247 33.068 1.00 70.40  ? -24  DC  J "O4'" 1 
ATOM   3955  C  "C3'" . DC  B  2 49  ? 11.955  -26.999 34.890 1.00 67.89  ? -24  DC  J "C3'" 1 
ATOM   3956  O  "O3'" . DC  B  2 49  ? 11.619  -28.041 35.802 1.00 63.22  ? -24  DC  J "O3'" 1 
ATOM   3957  C  "C2'" . DC  B  2 49  ? 13.467  -26.865 34.888 1.00 68.92  ? -24  DC  J "C2'" 1 
ATOM   3958  C  "C1'" . DC  B  2 49  ? 13.796  -28.118 34.074 1.00 71.42  ? -24  DC  J "C1'" 1 
ATOM   3959  N  N1    . DC  B  2 49  ? 15.140  -28.139 33.431 1.00 72.22  ? -24  DC  J N1    1 
ATOM   3960  C  C2    . DC  B  2 49  ? 15.585  -29.328 32.836 1.00 72.90  ? -24  DC  J C2    1 
ATOM   3961  O  O2    . DC  B  2 49  ? 14.861  -30.331 32.852 1.00 73.41  ? -24  DC  J O2    1 
ATOM   3962  N  N3    . DC  B  2 49  ? 16.808  -29.343 32.238 1.00 73.41  ? -24  DC  J N3    1 
ATOM   3963  C  C4    . DC  B  2 49  ? 17.566  -28.242 32.234 1.00 72.68  ? -24  DC  J C4    1 
ATOM   3964  N  N4    . DC  B  2 49  ? 18.760  -28.317 31.642 1.00 72.64  ? -24  DC  J N4    1 
ATOM   3965  C  C5    . DC  B  2 49  ? 17.133  -27.017 32.838 1.00 73.09  ? -24  DC  J C5    1 
ATOM   3966  C  C6    . DC  B  2 49  ? 15.926  -27.013 33.420 1.00 72.81  ? -24  DC  J C6    1 
ATOM   3967  P  P     . DC  B  2 50  ? 10.152  -28.283 36.374 1.00 58.82  ? -23  DC  J P     1 
ATOM   3968  O  OP1   . DC  B  2 50  ? 9.156   -27.985 35.312 1.00 57.67  ? -23  DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B  2 50  ? 10.091  -27.630 37.703 1.00 58.85  ? -23  DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B  2 50  ? 10.200  -29.845 36.667 1.00 57.64  ? -23  DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B  2 50  ? 9.571   -30.762 35.790 1.00 57.20  ? -23  DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B  2 50  ? 10.246  -32.103 35.946 1.00 56.54  ? -23  DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B  2 50  ? 11.594  -31.991 35.434 1.00 57.14  ? -23  DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B  2 50  ? 10.336  -32.509 37.412 1.00 56.11  ? -23  DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B  2 50  ? 9.832   -33.814 37.606 1.00 52.24  ? -23  DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B  2 50  ? 11.814  -32.367 37.781 1.00 57.54  ? -23  DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B  2 50  ? 12.495  -32.445 36.421 1.00 60.29  ? -23  DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B  2 50  ? 13.769  -31.668 36.341 1.00 61.76  ? -23  DC  J N1    1 
ATOM   3979  C  C2    . DC  B  2 50  ? 14.905  -32.288 35.775 1.00 62.74  ? -23  DC  J C2    1 
ATOM   3980  O  O2    . DC  B  2 50  ? 14.823  -33.449 35.338 1.00 63.20  ? -23  DC  J O2    1 
ATOM   3981  N  N3    . DC  B  2 50  ? 16.069  -31.586 35.705 1.00 62.67  ? -23  DC  J N3    1 
ATOM   3982  C  C4    . DC  B  2 50  ? 16.119  -30.336 36.171 1.00 62.38  ? -23  DC  J C4    1 
ATOM   3983  N  N4    . DC  B  2 50  ? 17.290  -29.703 36.072 1.00 62.86  ? -23  DC  J N4    1 
ATOM   3984  C  C5    . DC  B  2 50  ? 14.984  -29.690 36.766 1.00 62.46  ? -23  DC  J C5    1 
ATOM   3985  C  C6    . DC  B  2 50  ? 13.836  -30.386 36.827 1.00 61.89  ? -23  DC  J C6    1 
ATOM   3986  P  P     . DA  B  2 51  ? 9.670   -34.394 39.079 1.00 51.67  ? -22  DA  J P     1 
ATOM   3987  O  OP1   . DA  B  2 51  ? 8.371   -35.104 39.160 1.00 50.17  ? -22  DA  J OP1   1 
ATOM   3988  O  OP2   . DA  B  2 51  ? 10.052  -33.364 40.078 1.00 50.78  ? -22  DA  J OP2   1 
ATOM   3989  O  "O5'" . DA  B  2 51  ? 10.836  -35.481 39.129 1.00 56.41  ? -22  DA  J "O5'" 1 
ATOM   3990  C  "C5'" . DA  B  2 51  ? 11.182  -36.271 37.989 1.00 60.69  ? -22  DA  J "C5'" 1 
ATOM   3991  C  "C4'" . DA  B  2 51  ? 12.355  -37.182 38.314 1.00 63.51  ? -22  DA  J "C4'" 1 
ATOM   3992  O  "O4'" . DA  B  2 51  ? 13.599  -36.451 38.222 1.00 64.82  ? -22  DA  J "O4'" 1 
ATOM   3993  C  "C3'" . DA  B  2 51  ? 12.361  -37.794 39.703 1.00 65.40  ? -22  DA  J "C3'" 1 
ATOM   3994  O  "O3'" . DA  B  2 51  ? 12.840  -39.131 39.586 1.00 67.79  ? -22  DA  J "O3'" 1 
ATOM   3995  C  "C2'" . DA  B  2 51  ? 13.286  -36.877 40.504 1.00 64.81  ? -22  DA  J "C2'" 1 
ATOM   3996  C  "C1'" . DA  B  2 51  ? 14.279  -36.419 39.454 1.00 65.72  ? -22  DA  J "C1'" 1 
ATOM   3997  N  N9    . DA  B  2 51  ? 14.680  -35.028 39.561 1.00 66.32  ? -22  DA  J N9    1 
ATOM   3998  C  C8    . DA  B  2 51  ? 13.914  -33.992 40.013 1.00 66.52  ? -22  DA  J C8    1 
ATOM   3999  N  N7    . DA  B  2 51  ? 14.518  -32.834 39.970 1.00 66.95  ? -22  DA  J N7    1 
ATOM   4000  C  C5    . DA  B  2 51  ? 15.762  -33.128 39.444 1.00 66.86  ? -22  DA  J C5    1 
ATOM   4001  C  C6    . DA  B  2 51  ? 16.880  -32.317 39.156 1.00 66.75  ? -22  DA  J C6    1 
ATOM   4002  N  N6    . DA  B  2 51  ? 16.896  -30.998 39.373 1.00 66.35  ? -22  DA  J N6    1 
ATOM   4003  N  N1    . DA  B  2 51  ? 17.976  -32.920 38.638 1.00 66.65  ? -22  DA  J N1    1 
ATOM   4004  C  C2    . DA  B  2 51  ? 17.948  -34.250 38.430 1.00 66.60  ? -22  DA  J C2    1 
ATOM   4005  N  N3    . DA  B  2 51  ? 16.959  -35.117 38.666 1.00 66.42  ? -22  DA  J N3    1 
ATOM   4006  C  C4    . DA  B  2 51  ? 15.883  -34.483 39.179 1.00 66.69  ? -22  DA  J C4    1 
ATOM   4007  P  P     . DT  B  2 52  ? 13.288  -39.981 40.865 1.00 69.97  ? -21  DT  J P     1 
ATOM   4008  O  OP1   . DT  B  2 52  ? 13.273  -41.402 40.457 1.00 71.20  ? -21  DT  J OP1   1 
ATOM   4009  O  OP2   . DT  B  2 52  ? 12.506  -39.537 42.039 1.00 69.75  ? -21  DT  J OP2   1 
ATOM   4010  O  "O5'" . DT  B  2 52  ? 14.811  -39.564 41.098 1.00 71.50  ? -21  DT  J "O5'" 1 
ATOM   4011  C  "C5'" . DT  B  2 52  ? 15.770  -39.828 40.092 1.00 73.87  ? -21  DT  J "C5'" 1 
ATOM   4012  C  "C4'" . DT  B  2 52  ? 17.118  -39.413 40.619 1.00 76.45  ? -21  DT  J "C4'" 1 
ATOM   4013  O  "O4'" . DT  B  2 52  ? 17.255  -37.976 40.509 1.00 76.38  ? -21  DT  J "O4'" 1 
ATOM   4014  C  "C3'" . DT  B  2 52  ? 17.309  -39.770 42.086 1.00 78.44  ? -21  DT  J "C3'" 1 
ATOM   4015  O  "O3'" . DT  B  2 52  ? 18.426  -40.632 42.214 1.00 83.36  ? -21  DT  J "O3'" 1 
ATOM   4016  C  "C2'" . DT  B  2 52  ? 17.594  -38.437 42.756 1.00 77.94  ? -21  DT  J "C2'" 1 
ATOM   4017  C  "C1'" . DT  B  2 52  ? 18.012  -37.532 41.605 1.00 76.72  ? -21  DT  J "C1'" 1 
ATOM   4018  N  N1    . DT  B  2 52  ? 17.758  -36.078 41.890 1.00 76.85  ? -21  DT  J N1    1 
ATOM   4019  C  C2    . DT  B  2 52  ? 18.679  -35.118 41.503 1.00 76.96  ? -21  DT  J C2    1 
ATOM   4020  O  O2    . DT  B  2 52  ? 19.711  -35.369 40.902 1.00 77.24  ? -21  DT  J O2    1 
ATOM   4021  N  N3    . DT  B  2 52  ? 18.341  -33.824 41.836 1.00 76.70  ? -21  DT  J N3    1 
ATOM   4022  C  C4    . DT  B  2 52  ? 17.202  -33.404 42.514 1.00 76.71  ? -21  DT  J C4    1 
ATOM   4023  O  O4    . DT  B  2 52  ? 16.977  -32.228 42.770 1.00 76.92  ? -21  DT  J O4    1 
ATOM   4024  C  C5    . DT  B  2 52  ? 16.285  -34.446 42.900 1.00 76.95  ? -21  DT  J C5    1 
ATOM   4025  C  C7    . DT  B  2 52  ? 15.020  -34.105 43.637 1.00 76.52  ? -21  DT  J C7    1 
ATOM   4026  C  C6    . DT  B  2 52  ? 16.607  -35.712 42.574 1.00 77.16  ? -21  DT  J C6    1 
ATOM   4027  P  P     . DC  B  2 53  ? 18.611  -41.629 43.456 1.00 86.17  ? -20  DC  J P     1 
ATOM   4028  O  OP1   . DC  B  2 53  ? 18.808  -42.981 42.882 1.00 85.16  ? -20  DC  J OP1   1 
ATOM   4029  O  OP2   . DC  B  2 53  ? 17.511  -41.394 44.428 1.00 85.60  ? -20  DC  J OP2   1 
ATOM   4030  O  "O5'" . DC  B  2 53  ? 19.973  -41.107 44.125 1.00 87.81  ? -20  DC  J "O5'" 1 
ATOM   4031  C  "C5'" . DC  B  2 53  ? 21.165  -40.934 43.374 1.00 92.16  ? -20  DC  J "C5'" 1 
ATOM   4032  C  "C4'" . DC  B  2 53  ? 22.038  -39.839 43.970 1.00 96.35  ? -20  DC  J "C4'" 1 
ATOM   4033  O  "O4'" . DC  B  2 53  ? 21.427  -38.558 43.669 1.00 96.83  ? -20  DC  J "O4'" 1 
ATOM   4034  C  "C3'" . DC  B  2 53  ? 22.247  -39.846 45.495 1.00 99.00  ? -20  DC  J "C3'" 1 
ATOM   4035  O  "O3'" . DC  B  2 53  ? 23.422  -40.642 45.903 1.00 102.47 ? -20  DC  J "O3'" 1 
ATOM   4036  C  "C2'" . DC  B  2 53  ? 22.350  -38.359 45.845 1.00 98.31  ? -20  DC  J "C2'" 1 
ATOM   4037  C  "C1'" . DC  B  2 53  ? 21.881  -37.602 44.604 1.00 97.67  ? -20  DC  J "C1'" 1 
ATOM   4038  N  N1    . DC  B  2 53  ? 20.791  -36.622 44.928 1.00 97.74  ? -20  DC  J N1    1 
ATOM   4039  C  C2    . DC  B  2 53  ? 21.042  -35.242 44.874 1.00 97.86  ? -20  DC  J C2    1 
ATOM   4040  O  O2    . DC  B  2 53  ? 22.159  -34.825 44.546 1.00 98.25  ? -20  DC  J O2    1 
ATOM   4041  N  N3    . DC  B  2 53  ? 20.041  -34.379 45.179 1.00 98.06  ? -20  DC  J N3    1 
ATOM   4042  C  C4    . DC  B  2 53  ? 18.838  -34.833 45.534 1.00 97.88  ? -20  DC  J C4    1 
ATOM   4043  N  N4    . DC  B  2 53  ? 17.888  -33.934 45.823 1.00 97.77  ? -20  DC  J N4    1 
ATOM   4044  C  C5    . DC  B  2 53  ? 18.562  -36.234 45.604 1.00 98.10  ? -20  DC  J C5    1 
ATOM   4045  C  C6    . DC  B  2 53  ? 19.556  -37.078 45.300 1.00 97.88  ? -20  DC  J C6    1 
ATOM   4046  P  P     . DA  B  2 54  ? 24.628  -40.193 46.895 1.00 104.44 ? -19  DA  J P     1 
ATOM   4047  O  OP1   . DA  B  2 54  ? 25.454  -41.405 47.078 1.00 104.00 ? -19  DA  J OP1   1 
ATOM   4048  O  OP2   . DA  B  2 54  ? 24.070  -39.526 48.097 1.00 104.21 ? -19  DA  J OP2   1 
ATOM   4049  O  "O5'" . DA  B  2 54  ? 25.460  -39.093 46.065 1.00 105.29 ? -19  DA  J "O5'" 1 
ATOM   4050  C  "C5'" . DA  B  2 54  ? 26.796  -38.741 46.429 1.00 107.71 ? -19  DA  J "C5'" 1 
ATOM   4051  C  "C4'" . DA  B  2 54  ? 26.896  -37.415 47.168 1.00 109.77 ? -19  DA  J "C4'" 1 
ATOM   4052  O  "O4'" . DA  B  2 54  ? 25.708  -36.598 46.968 1.00 110.67 ? -19  DA  J "O4'" 1 
ATOM   4053  C  "C3'" . DA  B  2 54  ? 27.115  -37.490 48.682 1.00 110.69 ? -19  DA  J "C3'" 1 
ATOM   4054  O  "O3'" . DA  B  2 54  ? 28.251  -36.684 49.036 1.00 111.61 ? -19  DA  J "O3'" 1 
ATOM   4055  C  "C2'" . DA  B  2 54  ? 25.825  -36.908 49.259 1.00 111.08 ? -19  DA  J "C2'" 1 
ATOM   4056  C  "C1'" . DA  B  2 54  ? 25.441  -35.909 48.173 1.00 111.51 ? -19  DA  J "C1'" 1 
ATOM   4057  N  N9    . DA  B  2 54  ? 24.041  -35.486 48.192 1.00 111.68 ? -19  DA  J N9    1 
ATOM   4058  C  C8    . DA  B  2 54  ? 22.945  -36.300 48.175 1.00 111.84 ? -19  DA  J C8    1 
ATOM   4059  N  N7    . DA  B  2 54  ? 21.799  -35.669 48.192 1.00 111.87 ? -19  DA  J N7    1 
ATOM   4060  C  C5    . DA  B  2 54  ? 22.168  -34.339 48.228 1.00 111.96 ? -19  DA  J C5    1 
ATOM   4061  C  C6    . DA  B  2 54  ? 21.407  -33.153 48.263 1.00 111.88 ? -19  DA  J C6    1 
ATOM   4062  N  N6    . DA  B  2 54  ? 20.072  -33.157 48.267 1.00 111.70 ? -19  DA  J N6    1 
ATOM   4063  N  N1    . DA  B  2 54  ? 22.074  -31.973 48.292 1.00 111.94 ? -19  DA  J N1    1 
ATOM   4064  C  C2    . DA  B  2 54  ? 23.418  -31.987 48.292 1.00 111.87 ? -19  DA  J C2    1 
ATOM   4065  N  N3    . DA  B  2 54  ? 24.236  -33.044 48.259 1.00 112.07 ? -19  DA  J N3    1 
ATOM   4066  C  C4    . DA  B  2 54  ? 23.546  -34.202 48.228 1.00 111.94 ? -19  DA  J C4    1 
ATOM   4067  P  P     . DA  B  2 55  ? 28.954  -36.747 50.479 1.00 112.28 ? -18  DA  J P     1 
ATOM   4068  O  OP1   . DA  B  2 55  ? 30.407  -36.913 50.241 1.00 112.37 ? -18  DA  J OP1   1 
ATOM   4069  O  OP2   . DA  B  2 55  ? 28.216  -37.725 51.318 1.00 112.35 ? -18  DA  J OP2   1 
ATOM   4070  O  "O5'" . DA  B  2 55  ? 28.717  -35.294 51.105 1.00 112.46 ? -18  DA  J "O5'" 1 
ATOM   4071  C  "C5'" . DA  B  2 55  ? 29.319  -34.127 50.540 1.00 113.34 ? -18  DA  J "C5'" 1 
ATOM   4072  C  "C4'" . DA  B  2 55  ? 28.654  -32.869 51.079 1.00 114.00 ? -18  DA  J "C4'" 1 
ATOM   4073  O  "O4'" . DA  B  2 55  ? 27.216  -32.948 50.881 1.00 114.16 ? -18  DA  J "O4'" 1 
ATOM   4074  C  "C3'" . DA  B  2 55  ? 28.871  -32.597 52.567 1.00 114.52 ? -18  DA  J "C3'" 1 
ATOM   4075  O  "O3'" . DA  B  2 55  ? 29.080  -31.194 52.780 1.00 114.79 ? -18  DA  J "O3'" 1 
ATOM   4076  C  "C2'" . DA  B  2 55  ? 27.570  -33.090 53.201 1.00 114.76 ? -18  DA  J "C2'" 1 
ATOM   4077  C  "C1'" . DA  B  2 55  ? 26.539  -32.781 52.114 1.00 114.84 ? -18  DA  J "C1'" 1 
ATOM   4078  N  N9    . DA  B  2 55  ? 25.342  -33.633 52.146 1.00 114.99 ? -18  DA  J N9    1 
ATOM   4079  C  C8    . DA  B  2 55  ? 25.293  -34.976 52.407 1.00 115.11 ? -18  DA  J C8    1 
ATOM   4080  N  N7    . DA  B  2 55  ? 24.088  -35.491 52.372 1.00 115.22 ? -18  DA  J N7    1 
ATOM   4081  C  C5    . DA  B  2 55  ? 23.277  -34.412 52.065 1.00 115.30 ? -18  DA  J C5    1 
ATOM   4082  C  C6    . DA  B  2 55  ? 21.878  -34.293 51.882 1.00 115.13 ? -18  DA  J C6    1 
ATOM   4083  N  N6    . DA  B  2 55  ? 21.033  -35.322 51.991 1.00 114.90 ? -18  DA  J N6    1 
ATOM   4084  N  N1    . DA  B  2 55  ? 21.378  -33.074 51.584 1.00 114.99 ? -18  DA  J N1    1 
ATOM   4085  C  C2    . DA  B  2 55  ? 22.228  -32.043 51.482 1.00 115.07 ? -18  DA  J C2    1 
ATOM   4086  N  N3    . DA  B  2 55  ? 23.557  -32.032 51.626 1.00 115.08 ? -18  DA  J N3    1 
ATOM   4087  C  C4    . DA  B  2 55  ? 24.031  -33.258 51.922 1.00 115.19 ? -18  DA  J C4    1 
ATOM   4088  P  P     . DA  B  2 56  ? 29.692  -30.592 54.139 1.00 114.80 ? -17  DA  J P     1 
ATOM   4089  O  OP1   . DA  B  2 56  ? 31.007  -30.003 53.803 1.00 114.79 ? -17  DA  J OP1   1 
ATOM   4090  O  OP2   . DA  B  2 56  ? 29.563  -31.594 55.225 1.00 114.17 ? -17  DA  J OP2   1 
ATOM   4091  O  "O5'" . DA  B  2 56  ? 28.704  -29.380 54.491 1.00 114.99 ? -17  DA  J "O5'" 1 
ATOM   4092  C  "C5'" . DA  B  2 56  ? 28.180  -28.473 53.500 1.00 114.23 ? -17  DA  J "C5'" 1 
ATOM   4093  C  "C4'" . DA  B  2 56  ? 26.808  -27.934 53.911 1.00 113.69 ? -17  DA  J "C4'" 1 
ATOM   4094  O  "O4'" . DA  B  2 56  ? 25.789  -28.965 53.771 1.00 113.86 ? -17  DA  J "O4'" 1 
ATOM   4095  C  "C3'" . DA  B  2 56  ? 26.657  -27.433 55.350 1.00 112.79 ? -17  DA  J "C3'" 1 
ATOM   4096  O  "O3'" . DA  B  2 56  ? 25.661  -26.420 55.401 1.00 111.10 ? -17  DA  J "O3'" 1 
ATOM   4097  C  "C2'" . DA  B  2 56  ? 26.150  -28.679 56.067 1.00 113.30 ? -17  DA  J "C2'" 1 
ATOM   4098  C  "C1'" . DA  B  2 56  ? 25.142  -29.153 55.021 1.00 114.09 ? -17  DA  J "C1'" 1 
ATOM   4099  N  N9    . DA  B  2 56  ? 24.688  -30.540 55.161 1.00 114.28 ? -17  DA  J N9    1 
ATOM   4100  C  C8    . DA  B  2 56  ? 25.448  -31.649 55.417 1.00 114.36 ? -17  DA  J C8    1 
ATOM   4101  N  N7    . DA  B  2 56  ? 24.763  -32.767 55.486 1.00 114.40 ? -17  DA  J N7    1 
ATOM   4102  C  C5    . DA  B  2 56  ? 23.456  -32.363 55.264 1.00 114.54 ? -17  DA  J C5    1 
ATOM   4103  C  C6    . DA  B  2 56  ? 22.232  -33.068 55.210 1.00 114.33 ? -17  DA  J C6    1 
ATOM   4104  N  N6    . DA  B  2 56  ? 22.135  -34.386 55.386 1.00 114.41 ? -17  DA  J N6    1 
ATOM   4105  N  N1    . DA  B  2 56  ? 21.103  -32.368 54.971 1.00 114.30 ? -17  DA  J N1    1 
ATOM   4106  C  C2    . DA  B  2 56  ? 21.195  -31.045 54.798 1.00 114.19 ? -17  DA  J C2    1 
ATOM   4107  N  N3    . DA  B  2 56  ? 22.281  -30.272 54.821 1.00 114.36 ? -17  DA  J N3    1 
ATOM   4108  C  C4    . DA  B  2 56  ? 23.391  -30.995 55.061 1.00 114.42 ? -17  DA  J C4    1 
ATOM   4109  P  P     . DA  B  2 57  ? 25.942  -24.968 56.011 1.00 109.68 ? -16  DA  J P     1 
ATOM   4110  O  OP1   . DA  B  2 57  ? 26.072  -24.041 54.861 1.00 109.35 ? -16  DA  J OP1   1 
ATOM   4111  O  OP2   . DA  B  2 57  ? 27.042  -25.085 56.997 1.00 109.78 ? -16  DA  J OP2   1 
ATOM   4112  O  "O5'" . DA  B  2 57  ? 24.604  -24.640 56.840 1.00 107.59 ? -16  DA  J "O5'" 1 
ATOM   4113  C  "C5'" . DA  B  2 57  ? 23.295  -24.657 56.238 1.00 104.28 ? -16  DA  J "C5'" 1 
ATOM   4114  C  "C4'" . DA  B  2 57  ? 22.200  -25.175 57.173 1.00 101.69 ? -16  DA  J "C4'" 1 
ATOM   4115  O  "O4'" . DA  B  2 57  ? 22.128  -26.627 57.080 1.00 101.76 ? -16  DA  J "O4'" 1 
ATOM   4116  C  "C3'" . DA  B  2 57  ? 22.319  -24.872 58.674 1.00 99.51  ? -16  DA  J "C3'" 1 
ATOM   4117  O  "O3'" . DA  B  2 57  ? 21.034  -24.620 59.239 1.00 95.48  ? -16  DA  J "O3'" 1 
ATOM   4118  C  "C2'" . DA  B  2 57  ? 22.848  -26.190 59.240 1.00 100.41 ? -16  DA  J "C2'" 1 
ATOM   4119  C  "C1'" . DA  B  2 57  ? 22.019  -27.151 58.392 1.00 101.70 ? -16  DA  J "C1'" 1 
ATOM   4120  N  N9    . DA  B  2 57  ? 22.413  -28.562 58.374 1.00 102.01 ? -16  DA  J N9    1 
ATOM   4121  C  C8    . DA  B  2 57  ? 23.672  -29.087 58.264 1.00 102.20 ? -16  DA  J C8    1 
ATOM   4122  N  N7    . DA  B  2 57  ? 23.715  -30.399 58.263 1.00 102.34 ? -16  DA  J N7    1 
ATOM   4123  C  C5    . DA  B  2 57  ? 22.384  -30.767 58.383 1.00 102.39 ? -16  DA  J C5    1 
ATOM   4124  C  C6    . DA  B  2 57  ? 21.738  -32.023 58.444 1.00 102.04 ? -16  DA  J C6    1 
ATOM   4125  N  N6    . DA  B  2 57  ? 22.385  -33.189 58.391 1.00 101.89 ? -16  DA  J N6    1 
ATOM   4126  N  N1    . DA  B  2 57  ? 20.391  -32.038 58.564 1.00 102.21 ? -16  DA  J N1    1 
ATOM   4127  C  C2    . DA  B  2 57  ? 19.726  -30.873 58.616 1.00 102.11 ? -16  DA  J C2    1 
ATOM   4128  N  N3    . DA  B  2 57  ? 20.221  -29.634 58.570 1.00 102.18 ? -16  DA  J N3    1 
ATOM   4129  C  C4    . DA  B  2 57  ? 21.567  -29.647 58.451 1.00 102.38 ? -16  DA  J C4    1 
ATOM   4130  P  P     . DG  B  2 58  ? 20.366  -23.171 59.336 1.00 91.83  ? -15  DG  J P     1 
ATOM   4131  O  OP1   . DG  B  2 58  ? 20.081  -22.698 57.962 1.00 91.75  ? -15  DG  J OP1   1 
ATOM   4132  O  OP2   . DG  B  2 58  ? 21.208  -22.361 60.239 1.00 91.78  ? -15  DG  J OP2   1 
ATOM   4133  O  "O5'" . DG  B  2 58  ? 18.987  -23.481 60.105 1.00 90.09  ? -15  DG  J "O5'" 1 
ATOM   4134  C  "C5'" . DG  B  2 58  ? 17.930  -24.259 59.506 1.00 86.78  ? -15  DG  J "C5'" 1 
ATOM   4135  C  "C4'" . DG  B  2 58  ? 17.149  -25.137 60.486 1.00 84.11  ? -15  DG  J "C4'" 1 
ATOM   4136  O  "O4'" . DG  B  2 58  ? 17.710  -26.479 60.517 1.00 84.35  ? -15  DG  J "O4'" 1 
ATOM   4137  C  "C3'" . DG  B  2 58  ? 17.069  -24.703 61.948 1.00 81.80  ? -15  DG  J "C3'" 1 
ATOM   4138  O  "O3'" . DG  B  2 58  ? 15.783  -25.013 62.434 1.00 76.72  ? -15  DG  J "O3'" 1 
ATOM   4139  C  "C2'" . DG  B  2 58  ? 18.097  -25.584 62.657 1.00 83.57  ? -15  DG  J "C2'" 1 
ATOM   4140  C  "C1'" . DG  B  2 58  ? 18.018  -26.871 61.845 1.00 85.58  ? -15  DG  J "C1'" 1 
ATOM   4141  N  N9    . DG  B  2 58  ? 19.240  -27.686 61.812 1.00 86.32  ? -15  DG  J N9    1 
ATOM   4142  C  C8    . DG  B  2 58  ? 20.545  -27.250 61.740 1.00 86.68  ? -15  DG  J C8    1 
ATOM   4143  N  N7    . DG  B  2 58  ? 21.431  -28.211 61.717 1.00 86.74  ? -15  DG  J N7    1 
ATOM   4144  C  C5    . DG  B  2 58  ? 20.667  -29.369 61.775 1.00 86.84  ? -15  DG  J C5    1 
ATOM   4145  C  C6    . DG  B  2 58  ? 21.070  -30.732 61.779 1.00 86.53  ? -15  DG  J C6    1 
ATOM   4146  O  O6    . DG  B  2 58  ? 22.219  -31.181 61.727 1.00 86.37  ? -15  DG  J O6    1 
ATOM   4147  N  N1    . DG  B  2 58  ? 19.985  -31.608 61.849 1.00 86.29  ? -15  DG  J N1    1 
ATOM   4148  C  C2    . DG  B  2 58  ? 18.669  -31.204 61.902 1.00 86.37  ? -15  DG  J C2    1 
ATOM   4149  N  N2    . DG  B  2 58  ? 17.748  -32.170 61.960 1.00 86.45  ? -15  DG  J N2    1 
ATOM   4150  N  N3    . DG  B  2 58  ? 18.274  -29.936 61.899 1.00 86.58  ? -15  DG  J N3    1 
ATOM   4151  C  C4    . DG  B  2 58  ? 19.319  -29.066 61.832 1.00 86.86  ? -15  DG  J C4    1 
ATOM   4152  P  P     . DG  B  2 59  ? 14.643  -23.907 62.582 1.00 72.67  ? -14  DG  J P     1 
ATOM   4153  O  OP1   . DG  B  2 59  ? 14.783  -22.945 61.464 1.00 73.23  ? -14  DG  J OP1   1 
ATOM   4154  O  OP2   . DG  B  2 59  ? 14.636  -23.444 63.993 1.00 72.01  ? -14  DG  J OP2   1 
ATOM   4155  O  "O5'" . DG  B  2 59  ? 13.313  -24.760 62.344 1.00 68.72  ? -14  DG  J "O5'" 1 
ATOM   4156  C  "C5'" . DG  B  2 59  ? 13.193  -25.599 61.202 1.00 63.38  ? -14  DG  J "C5'" 1 
ATOM   4157  C  "C4'" . DG  B  2 59  ? 12.861  -27.034 61.591 1.00 59.24  ? -14  DG  J "C4'" 1 
ATOM   4158  O  "O4'" . DG  B  2 59  ? 13.997  -27.638 62.256 1.00 58.79  ? -14  DG  J "O4'" 1 
ATOM   4159  C  "C3'" . DG  B  2 59  ? 11.645  -27.216 62.503 1.00 55.97  ? -14  DG  J "C3'" 1 
ATOM   4160  O  "O3'" . DG  B  2 59  ? 10.769  -28.216 61.976 1.00 50.58  ? -14  DG  J "O3'" 1 
ATOM   4161  C  "C2'" . DG  B  2 59  ? 12.261  -27.644 63.823 1.00 57.02  ? -14  DG  J "C2'" 1 
ATOM   4162  C  "C1'" . DG  B  2 59  ? 13.513  -28.369 63.358 1.00 60.48  ? -14  DG  J "C1'" 1 
ATOM   4163  N  N9    . DG  B  2 59  ? 14.474  -28.417 64.451 1.00 61.28  ? -14  DG  J N9    1 
ATOM   4164  C  C8    . DG  B  2 59  ? 14.917  -27.359 65.203 1.00 61.75  ? -14  DG  J C8    1 
ATOM   4165  N  N7    . DG  B  2 59  ? 15.754  -27.695 66.135 1.00 61.66  ? -14  DG  J N7    1 
ATOM   4166  C  C5    . DG  B  2 59  ? 15.870  -29.066 66.006 1.00 61.76  ? -14  DG  J C5    1 
ATOM   4167  C  C6    . DG  B  2 59  ? 16.642  -29.989 66.756 1.00 61.92  ? -14  DG  J C6    1 
ATOM   4168  O  O6    . DG  B  2 59  ? 17.398  -29.758 67.713 1.00 62.01  ? -14  DG  J O6    1 
ATOM   4169  N  N1    . DG  B  2 59  ? 16.479  -31.298 66.299 1.00 62.07  ? -14  DG  J N1    1 
ATOM   4170  C  C2    . DG  B  2 59  ? 15.665  -31.666 65.245 1.00 62.02  ? -14  DG  J C2    1 
ATOM   4171  N  N2    . DG  B  2 59  ? 15.623  -32.971 64.942 1.00 61.58  ? -14  DG  J N2    1 
ATOM   4172  N  N3    . DG  B  2 59  ? 14.935  -30.805 64.539 1.00 62.63  ? -14  DG  J N3    1 
ATOM   4173  C  C4    . DG  B  2 59  ? 15.084  -29.527 64.975 1.00 61.78  ? -14  DG  J C4    1 
ATOM   4174  P  P     . DC  B  2 60  ? 9.329   -28.536 62.608 1.00 48.42  ? -13  DC  J P     1 
ATOM   4175  O  OP1   . DC  B  2 60  ? 8.428   -28.703 61.438 1.00 47.74  ? -13  DC  J OP1   1 
ATOM   4176  O  OP2   . DC  B  2 60  ? 9.023   -27.560 63.674 1.00 45.93  ? -13  DC  J OP2   1 
ATOM   4177  O  "O5'" . DC  B  2 60  ? 9.479   -29.974 63.290 1.00 45.99  ? -13  DC  J "O5'" 1 
ATOM   4178  C  "C5'" . DC  B  2 60  ? 9.719   -31.062 62.411 1.00 46.56  ? -13  DC  J "C5'" 1 
ATOM   4179  C  "C4'" . DC  B  2 60  ? 10.033  -32.352 63.135 1.00 48.38  ? -13  DC  J "C4'" 1 
ATOM   4180  O  "O4'" . DC  B  2 60  ? 11.243  -32.193 63.923 1.00 48.61  ? -13  DC  J "O4'" 1 
ATOM   4181  C  "C3'" . DC  B  2 60  ? 8.917   -32.832 64.062 1.00 49.21  ? -13  DC  J "C3'" 1 
ATOM   4182  O  "O3'" . DC  B  2 60  ? 8.676   -34.197 63.807 1.00 49.26  ? -13  DC  J "O3'" 1 
ATOM   4183  C  "C2'" . DC  B  2 60  ? 9.461   -32.606 65.464 1.00 49.77  ? -13  DC  J "C2'" 1 
ATOM   4184  C  "C1'" . DC  B  2 60  ? 10.978  -32.570 65.256 1.00 50.80  ? -13  DC  J "C1'" 1 
ATOM   4185  N  N1    . DC  B  2 60  ? 11.681  -31.618 66.156 1.00 51.15  ? -13  DC  J N1    1 
ATOM   4186  C  C2    . DC  B  2 60  ? 12.692  -32.086 67.016 1.00 52.41  ? -13  DC  J C2    1 
ATOM   4187  O  O2    . DC  B  2 60  ? 12.967  -33.293 67.004 1.00 52.69  ? -13  DC  J O2    1 
ATOM   4188  N  N3    . DC  B  2 60  ? 13.330  -31.204 67.836 1.00 51.93  ? -13  DC  J N3    1 
ATOM   4189  C  C4    . DC  B  2 60  ? 12.975  -29.914 67.800 1.00 51.93  ? -13  DC  J C4    1 
ATOM   4190  N  N4    . DC  B  2 60  ? 13.593  -29.049 68.599 1.00 51.96  ? -13  DC  J N4    1 
ATOM   4191  C  C5    . DC  B  2 60  ? 11.951  -29.423 66.938 1.00 52.51  ? -13  DC  J C5    1 
ATOM   4192  C  C6    . DC  B  2 60  ? 11.334  -30.303 66.140 1.00 51.62  ? -13  DC  J C6    1 
ATOM   4193  P  P     . DA  B  2 61  ? 7.502   -35.015 64.509 1.00 48.79  ? -12  DA  J P     1 
ATOM   4194  O  OP1   . DA  B  2 61  ? 6.948   -35.937 63.498 1.00 50.76  ? -12  DA  J OP1   1 
ATOM   4195  O  OP2   . DA  B  2 61  ? 6.624   -34.160 65.335 1.00 50.26  ? -12  DA  J OP2   1 
ATOM   4196  O  "O5'" . DA  B  2 61  ? 8.336   -35.833 65.581 1.00 49.76  ? -12  DA  J "O5'" 1 
ATOM   4197  C  "C5'" . DA  B  2 61  ? 9.344   -36.765 65.265 1.00 49.51  ? -12  DA  J "C5'" 1 
ATOM   4198  C  "C4'" . DA  B  2 61  ? 9.753   -37.402 66.579 1.00 50.99  ? -12  DA  J "C4'" 1 
ATOM   4199  O  "O4'" . DA  B  2 61  ? 10.552  -36.516 67.407 1.00 51.75  ? -12  DA  J "O4'" 1 
ATOM   4200  C  "C3'" . DA  B  2 61  ? 8.589   -37.817 67.463 1.00 51.53  ? -12  DA  J "C3'" 1 
ATOM   4201  O  "O3'" . DA  B  2 61  ? 8.965   -39.041 67.990 1.00 51.46  ? -12  DA  J "O3'" 1 
ATOM   4202  C  "C2'" . DA  B  2 61  ? 8.505   -36.766 68.572 1.00 51.51  ? -12  DA  J "C2'" 1 
ATOM   4203  C  "C1'" . DA  B  2 61  ? 9.944   -36.291 68.672 1.00 53.55  ? -12  DA  J "C1'" 1 
ATOM   4204  N  N9    . DA  B  2 61  ? 10.099  -34.869 68.948 1.00 53.96  ? -12  DA  J N9    1 
ATOM   4205  C  C8    . DA  B  2 61  ? 9.343   -33.850 68.463 1.00 54.55  ? -12  DA  J C8    1 
ATOM   4206  N  N7    . DA  B  2 61  ? 9.717   -32.668 68.856 1.00 54.65  ? -12  DA  J N7    1 
ATOM   4207  C  C5    . DA  B  2 61  ? 10.800  -32.924 69.662 1.00 54.90  ? -12  DA  J C5    1 
ATOM   4208  C  C6    . DA  B  2 61  ? 11.655  -32.076 70.395 1.00 55.01  ? -12  DA  J C6    1 
ATOM   4209  N  N6    . DA  B  2 61  ? 11.526  -30.748 70.420 1.00 54.63  ? -12  DA  J N6    1 
ATOM   4210  N  N1    . DA  B  2 61  ? 12.651  -32.650 71.110 1.00 55.38  ? -12  DA  J N1    1 
ATOM   4211  C  C2    . DA  B  2 61  ? 12.775  -33.990 71.095 1.00 55.39  ? -12  DA  J C2    1 
ATOM   4212  N  N3    . DA  B  2 61  ? 12.035  -34.888 70.433 1.00 55.73  ? -12  DA  J N3    1 
ATOM   4213  C  C4    . DA  B  2 61  ? 11.056  -34.279 69.728 1.00 55.11  ? -12  DA  J C4    1 
ATOM   4214  P  P     . DT  B  2 62  ? 7.918   -39.956 68.739 1.00 51.89  ? -11  DT  J P     1 
ATOM   4215  O  OP1   . DT  B  2 62  ? 8.325   -41.303 68.266 1.00 54.24  ? -11  DT  J OP1   1 
ATOM   4216  O  OP2   . DT  B  2 62  ? 6.521   -39.481 68.585 1.00 49.92  ? -11  DT  J OP2   1 
ATOM   4217  O  "O5'" . DT  B  2 62  ? 8.319   -39.770 70.274 1.00 51.41  ? -11  DT  J "O5'" 1 
ATOM   4218  C  "C5'" . DT  B  2 62  ? 9.677   -39.765 70.655 1.00 52.60  ? -11  DT  J "C5'" 1 
ATOM   4219  C  "C4'" . DT  B  2 62  ? 9.844   -39.320 72.095 1.00 53.94  ? -11  DT  J "C4'" 1 
ATOM   4220  O  "O4'" . DT  B  2 62  ? 10.118  -37.902 72.101 1.00 54.50  ? -11  DT  J "O4'" 1 
ATOM   4221  C  "C3'" . DT  B  2 62  ? 8.640   -39.548 73.011 1.00 54.48  ? -11  DT  J "C3'" 1 
ATOM   4222  O  "O3'" . DT  B  2 62  ? 8.999   -40.461 74.024 1.00 54.97  ? -11  DT  J "O3'" 1 
ATOM   4223  C  "C2'" . DT  B  2 62  ? 8.340   -38.191 73.625 1.00 55.13  ? -11  DT  J "C2'" 1 
ATOM   4224  C  "C1'" . DT  B  2 62  ? 9.558   -37.349 73.265 1.00 56.19  ? -11  DT  J "C1'" 1 
ATOM   4225  N  N1    . DT  B  2 62  ? 9.225   -35.910 73.007 1.00 56.77  ? -11  DT  J N1    1 
ATOM   4226  C  C2    . DT  B  2 62  ? 10.057  -34.971 73.572 1.00 57.76  ? -11  DT  J C2    1 
ATOM   4227  O  O2    . DT  B  2 62  ? 11.022  -35.275 74.248 1.00 57.59  ? -11  DT  J O2    1 
ATOM   4228  N  N3    . DT  B  2 62  ? 9.711   -33.658 73.311 1.00 59.02  ? -11  DT  J N3    1 
ATOM   4229  C  C4    . DT  B  2 62  ? 8.630   -33.208 72.564 1.00 57.55  ? -11  DT  J C4    1 
ATOM   4230  O  O4    . DT  B  2 62  ? 8.425   -32.015 72.409 1.00 56.57  ? -11  DT  J O4    1 
ATOM   4231  C  C5    . DT  B  2 62  ? 7.787   -34.244 71.992 1.00 57.31  ? -11  DT  J C5    1 
ATOM   4232  C  C7    . DT  B  2 62  ? 6.589   -33.878 71.162 1.00 56.39  ? -11  DT  J C7    1 
ATOM   4233  C  C6    . DT  B  2 62  ? 8.125   -35.529 72.238 1.00 56.85  ? -11  DT  J C6    1 
ATOM   4234  P  P     . DG  B  2 63  ? 7.960   -41.011 75.103 1.00 54.68  ? -10  DG  J P     1 
ATOM   4235  O  OP1   . DG  B  2 63  ? 8.379   -42.401 75.414 1.00 55.98  ? -10  DG  J OP1   1 
ATOM   4236  O  OP2   . DG  B  2 63  ? 6.569   -40.711 74.669 1.00 53.53  ? -10  DG  J OP2   1 
ATOM   4237  O  "O5'" . DG  B  2 63  ? 8.314   -40.148 76.393 1.00 54.27  ? -10  DG  J "O5'" 1 
ATOM   4238  C  "C5'" . DG  B  2 63  ? 9.680   -39.974 76.808 1.00 54.37  ? -10  DG  J "C5'" 1 
ATOM   4239  C  "C4'" . DG  B  2 63  ? 9.756   -39.247 78.149 1.00 54.76  ? -10  DG  J "C4'" 1 
ATOM   4240  O  "O4'" . DG  B  2 63  ? 9.633   -37.801 78.002 1.00 54.53  ? -10  DG  J "O4'" 1 
ATOM   4241  C  "C3'" . DG  B  2 63  ? 8.670   -39.626 79.144 1.00 55.35  ? -10  DG  J "C3'" 1 
ATOM   4242  O  "O3'" . DG  B  2 63  ? 9.275   -39.639 80.423 1.00 57.57  ? -10  DG  J "O3'" 1 
ATOM   4243  C  "C2'" . DG  B  2 63  ? 7.595   -38.545 78.959 1.00 54.18  ? -10  DG  J "C2'" 1 
ATOM   4244  C  "C1'" . DG  B  2 63  ? 8.407   -37.319 78.542 1.00 53.27  ? -10  DG  J "C1'" 1 
ATOM   4245  N  N9    . DG  B  2 63  ? 7.810   -36.446 77.519 1.00 52.92  ? -10  DG  J N9    1 
ATOM   4246  C  C8    . DG  B  2 63  ? 7.036   -36.803 76.439 1.00 52.29  ? -10  DG  J C8    1 
ATOM   4247  N  N7    . DG  B  2 63  ? 6.673   -35.805 75.692 1.00 51.80  ? -10  DG  J N7    1 
ATOM   4248  C  C5    . DG  B  2 63  ? 7.245   -34.693 76.314 1.00 53.18  ? -10  DG  J C5    1 
ATOM   4249  C  C6    . DG  B  2 63  ? 7.214   -33.300 75.980 1.00 53.01  ? -10  DG  J C6    1 
ATOM   4250  O  O6    . DG  B  2 63  ? 6.658   -32.728 75.034 1.00 52.86  ? -10  DG  J O6    1 
ATOM   4251  N  N1    . DG  B  2 63  ? 7.926   -32.521 76.882 1.00 52.71  ? -10  DG  J N1    1 
ATOM   4252  C  C2    . DG  B  2 63  ? 8.592   -33.015 77.973 1.00 52.46  ? -10  DG  J C2    1 
ATOM   4253  N  N2    . DG  B  2 63  ? 9.224   -32.121 78.730 1.00 52.64  ? -10  DG  J N2    1 
ATOM   4254  N  N3    . DG  B  2 63  ? 8.636   -34.295 78.299 1.00 52.83  ? -10  DG  J N3    1 
ATOM   4255  C  C4    . DG  B  2 63  ? 7.944   -35.079 77.436 1.00 52.89  ? -10  DG  J C4    1 
ATOM   4256  P  P     . DT  B  2 64  ? 8.428   -39.909 81.757 1.00 61.29  ? -9   DT  J P     1 
ATOM   4257  O  OP1   . DT  B  2 64  ? 9.311   -40.701 82.642 1.00 62.47  ? -9   DT  J OP1   1 
ATOM   4258  O  OP2   . DT  B  2 64  ? 7.057   -40.398 81.428 1.00 59.77  ? -9   DT  J OP2   1 
ATOM   4259  O  "O5'" . DT  B  2 64  ? 8.355   -38.435 82.378 1.00 61.67  ? -9   DT  J "O5'" 1 
ATOM   4260  C  "C5'" . DT  B  2 64  ? 9.547   -37.622 82.356 1.00 62.25  ? -9   DT  J "C5'" 1 
ATOM   4261  C  "C4'" . DT  B  2 64  ? 9.298   -36.273 83.014 1.00 62.67  ? -9   DT  J "C4'" 1 
ATOM   4262  O  "O4'" . DT  B  2 64  ? 8.730   -35.324 82.066 1.00 62.06  ? -9   DT  J "O4'" 1 
ATOM   4263  C  "C3'" . DT  B  2 64  ? 8.330   -36.322 84.186 1.00 62.64  ? -9   DT  J "C3'" 1 
ATOM   4264  O  "O3'" . DT  B  2 64  ? 8.850   -35.499 85.245 1.00 64.12  ? -9   DT  J "O3'" 1 
ATOM   4265  C  "C2'" . DT  B  2 64  ? 7.011   -35.819 83.586 1.00 61.89  ? -9   DT  J "C2'" 1 
ATOM   4266  C  "C1'" . DT  B  2 64  ? 7.481   -34.831 82.523 1.00 60.35  ? -9   DT  J "C1'" 1 
ATOM   4267  N  N1    . DT  B  2 64  ? 6.579   -34.596 81.306 1.00 60.29  ? -9   DT  J N1    1 
ATOM   4268  C  C2    . DT  B  2 64  ? 6.530   -33.322 80.736 1.00 59.93  ? -9   DT  J C2    1 
ATOM   4269  O  O2    . DT  B  2 64  ? 7.139   -32.346 81.137 1.00 59.30  ? -9   DT  J O2    1 
ATOM   4270  N  N3    . DT  B  2 64  ? 5.716   -33.199 79.643 1.00 59.91  ? -9   DT  J N3    1 
ATOM   4271  C  C4    . DT  B  2 64  ? 4.955   -34.175 79.048 1.00 59.47  ? -9   DT  J C4    1 
ATOM   4272  O  O4    . DT  B  2 64  ? 4.277   -33.893 78.068 1.00 58.84  ? -9   DT  J O4    1 
ATOM   4273  C  C5    . DT  B  2 64  ? 5.040   -35.492 79.666 1.00 59.54  ? -9   DT  J C5    1 
ATOM   4274  C  C7    . DT  B  2 64  ? 4.261   -36.661 79.127 1.00 58.91  ? -9   DT  J C7    1 
ATOM   4275  C  C6    . DT  B  2 64  ? 5.838   -35.631 80.746 1.00 59.77  ? -9   DT  J C6    1 
ATOM   4276  P  P     . DT  B  2 65  ? 8.243   -35.547 86.737 1.00 64.01  ? -8   DT  J P     1 
ATOM   4277  O  OP1   . DT  B  2 65  ? 9.417   -35.391 87.623 1.00 64.19  ? -8   DT  J OP1   1 
ATOM   4278  O  OP2   . DT  B  2 65  ? 7.335   -36.717 86.875 1.00 63.69  ? -8   DT  J OP2   1 
ATOM   4279  O  "O5'" . DT  B  2 65  ? 7.314   -34.238 86.815 1.00 63.22  ? -8   DT  J "O5'" 1 
ATOM   4280  C  "C5'" . DT  B  2 65  ? 7.902   -32.928 86.726 1.00 63.32  ? -8   DT  J "C5'" 1 
ATOM   4281  C  "C4'" . DT  B  2 65  ? 6.874   -31.863 86.395 1.00 62.64  ? -8   DT  J "C4'" 1 
ATOM   4282  O  "O4'" . DT  B  2 65  ? 6.235   -32.170 85.133 1.00 63.83  ? -8   DT  J "O4'" 1 
ATOM   4283  C  "C3'" . DT  B  2 65  ? 5.736   -31.751 87.399 1.00 62.14  ? -8   DT  J "C3'" 1 
ATOM   4284  O  "O3'" . DT  B  2 65  ? 5.916   -30.539 88.129 1.00 60.93  ? -8   DT  J "O3'" 1 
ATOM   4285  C  "C2'" . DT  B  2 65  ? 4.434   -31.816 86.575 1.00 62.37  ? -8   DT  J "C2'" 1 
ATOM   4286  C  "C1'" . DT  B  2 65  ? 4.926   -31.635 85.145 1.00 62.59  ? -8   DT  J "C1'" 1 
ATOM   4287  N  N1    . DT  B  2 65  ? 4.165   -32.276 84.009 1.00 62.85  ? -8   DT  J N1    1 
ATOM   4288  C  C2    . DT  B  2 65  ? 3.806   -31.484 82.928 1.00 62.32  ? -8   DT  J C2    1 
ATOM   4289  O  O2    . DT  B  2 65  ? 4.039   -30.299 82.854 1.00 61.91  ? -8   DT  J O2    1 
ATOM   4290  N  N3    . DT  B  2 65  ? 3.144   -32.122 81.913 1.00 62.18  ? -8   DT  J N3    1 
ATOM   4291  C  C4    . DT  B  2 65  ? 2.807   -33.458 81.847 1.00 62.56  ? -8   DT  J C4    1 
ATOM   4292  O  O4    . DT  B  2 65  ? 2.202   -33.919 80.878 1.00 62.10  ? -8   DT  J O4    1 
ATOM   4293  C  C5    . DT  B  2 65  ? 3.219   -34.247 82.999 1.00 62.82  ? -8   DT  J C5    1 
ATOM   4294  C  C7    . DT  B  2 65  ? 2.912   -35.715 83.050 1.00 62.35  ? -8   DT  J C7    1 
ATOM   4295  C  C6    . DT  B  2 65  ? 3.873   -33.633 84.010 1.00 62.76  ? -8   DT  J C6    1 
ATOM   4296  P  P     . DC  B  2 66  ? 5.016   -30.252 89.418 1.00 60.80  ? -7   DC  J P     1 
ATOM   4297  O  OP1   . DC  B  2 66  ? 5.771   -29.324 90.294 1.00 59.79  ? -7   DC  J OP1   1 
ATOM   4298  O  OP2   . DC  B  2 66  ? 4.457   -31.530 89.910 1.00 59.67  ? -7   DC  J OP2   1 
ATOM   4299  O  "O5'" . DC  B  2 66  ? 3.734   -29.495 88.815 1.00 61.02  ? -7   DC  J "O5'" 1 
ATOM   4300  C  "C5'" . DC  B  2 66  ? 3.818   -28.221 88.178 1.00 58.09  ? -7   DC  J "C5'" 1 
ATOM   4301  C  "C4'" . DC  B  2 66  ? 2.494   -27.936 87.502 1.00 55.81  ? -7   DC  J "C4'" 1 
ATOM   4302  O  "O4'" . DC  B  2 66  ? 2.201   -29.023 86.603 1.00 55.45  ? -7   DC  J "O4'" 1 
ATOM   4303  C  "C3'" . DC  B  2 66  ? 1.267   -27.851 88.406 1.00 54.67  ? -7   DC  J "C3'" 1 
ATOM   4304  O  "O3'" . DC  B  2 66  ? 0.538   -26.709 88.031 1.00 52.96  ? -7   DC  J "O3'" 1 
ATOM   4305  C  "C2'" . DC  B  2 66  ? 0.457   -29.097 88.065 1.00 55.58  ? -7   DC  J "C2'" 1 
ATOM   4306  C  "C1'" . DC  B  2 66  ? 0.800   -29.169 86.591 1.00 55.10  ? -7   DC  J "C1'" 1 
ATOM   4307  N  N1    . DC  B  2 66  ? 0.565   -30.418 85.854 1.00 55.17  ? -7   DC  J N1    1 
ATOM   4308  C  C2    . DC  B  2 66  ? 0.337   -30.304 84.481 1.00 55.03  ? -7   DC  J C2    1 
ATOM   4309  O  O2    . DC  B  2 66  ? 0.313   -29.180 83.974 1.00 54.66  ? -7   DC  J O2    1 
ATOM   4310  N  N3    . DC  B  2 66  ? 0.144   -31.431 83.751 1.00 56.00  ? -7   DC  J N3    1 
ATOM   4311  C  C4    . DC  B  2 66  ? 0.177   -32.626 84.343 1.00 55.12  ? -7   DC  J C4    1 
ATOM   4312  N  N4    . DC  B  2 66  ? -0.019  -33.703 83.577 1.00 54.47  ? -7   DC  J N4    1 
ATOM   4313  C  C5    . DC  B  2 66  ? 0.412   -32.753 85.748 1.00 54.84  ? -7   DC  J C5    1 
ATOM   4314  C  C6    . DC  B  2 66  ? 0.609   -31.640 86.465 1.00 54.53  ? -7   DC  J C6    1 
ATOM   4315  P  P     . DA  B  2 67  ? 0.700   -25.342 88.840 1.00 51.77  ? -6   DA  J P     1 
ATOM   4316  O  OP1   . DA  B  2 67  ? 2.155   -25.061 88.985 1.00 50.49  ? -6   DA  J OP1   1 
ATOM   4317  O  OP2   . DA  B  2 67  ? -0.246  -25.474 89.974 1.00 50.51  ? -6   DA  J OP2   1 
ATOM   4318  O  "O5'" . DA  B  2 67  ? 0.117   -24.218 87.876 1.00 50.56  ? -6   DA  J "O5'" 1 
ATOM   4319  C  "C5'" . DA  B  2 67  ? 0.823   -23.874 86.691 1.00 49.55  ? -6   DA  J "C5'" 1 
ATOM   4320  C  "C4'" . DA  B  2 67  ? -0.187  -23.577 85.605 1.00 48.21  ? -6   DA  J "C4'" 1 
ATOM   4321  O  "O4'" . DA  B  2 67  ? -0.807  -24.803 85.135 1.00 47.85  ? -6   DA  J "O4'" 1 
ATOM   4322  C  "C3'" . DA  B  2 67  ? -1.328  -22.676 86.049 1.00 46.91  ? -6   DA  J "C3'" 1 
ATOM   4323  O  "O3'" . DA  B  2 67  ? -1.549  -21.761 84.971 1.00 44.97  ? -6   DA  J "O3'" 1 
ATOM   4324  C  "C2'" . DA  B  2 67  ? -2.466  -23.671 86.349 1.00 47.18  ? -6   DA  J "C2'" 1 
ATOM   4325  C  "C1'" . DA  B  2 67  ? -2.208  -24.784 85.337 1.00 48.00  ? -6   DA  J "C1'" 1 
ATOM   4326  N  N9    . DA  B  2 67  ? -2.445  -26.171 85.709 1.00 48.70  ? -6   DA  J N9    1 
ATOM   4327  C  C8    . DA  B  2 67  ? -2.222  -26.782 86.913 1.00 48.91  ? -6   DA  J C8    1 
ATOM   4328  N  N7    . DA  B  2 67  ? -2.467  -28.076 86.917 1.00 49.03  ? -6   DA  J N7    1 
ATOM   4329  C  C5    . DA  B  2 67  ? -2.867  -28.328 85.617 1.00 48.69  ? -6   DA  J C5    1 
ATOM   4330  C  C6    . DA  B  2 67  ? -3.280  -29.493 84.957 1.00 48.14  ? -6   DA  J C6    1 
ATOM   4331  N  N6    . DA  B  2 67  ? -3.358  -30.673 85.561 1.00 48.62  ? -6   DA  J N6    1 
ATOM   4332  N  N1    . DA  B  2 67  ? -3.615  -29.406 83.651 1.00 48.31  ? -6   DA  J N1    1 
ATOM   4333  C  C2    . DA  B  2 67  ? -3.544  -28.229 83.039 1.00 48.12  ? -6   DA  J C2    1 
ATOM   4334  N  N3    . DA  B  2 67  ? -3.175  -27.062 83.561 1.00 49.18  ? -6   DA  J N3    1 
ATOM   4335  C  C4    . DA  B  2 67  ? -2.849  -27.174 84.858 1.00 48.99  ? -6   DA  J C4    1 
ATOM   4336  P  P     . DG  B  2 68  ? -2.629  -20.585 85.051 1.00 45.00  ? -5   DG  J P     1 
ATOM   4337  O  OP1   . DG  B  2 68  ? -2.096  -19.457 84.262 1.00 42.74  ? -5   DG  J OP1   1 
ATOM   4338  O  OP2   . DG  B  2 68  ? -3.012  -20.414 86.474 1.00 45.70  ? -5   DG  J OP2   1 
ATOM   4339  O  "O5'" . DG  B  2 68  ? -3.959  -21.193 84.383 1.00 44.12  ? -5   DG  J "O5'" 1 
ATOM   4340  C  "C5'" . DG  B  2 68  ? -4.005  -21.689 83.051 1.00 43.90  ? -5   DG  J "C5'" 1 
ATOM   4341  C  "C4'" . DG  B  2 68  ? -5.239  -22.545 82.864 1.00 44.29  ? -5   DG  J "C4'" 1 
ATOM   4342  O  "O4'" . DG  B  2 68  ? -5.092  -23.718 83.668 1.00 44.56  ? -5   DG  J "O4'" 1 
ATOM   4343  C  "C3'" . DG  B  2 68  ? -6.563  -21.960 83.338 1.00 46.16  ? -5   DG  J "C3'" 1 
ATOM   4344  O  "O3'" . DG  B  2 68  ? -7.531  -22.278 82.383 1.00 45.78  ? -5   DG  J "O3'" 1 
ATOM   4345  C  "C2'" . DG  B  2 68  ? -6.868  -22.691 84.643 1.00 46.68  ? -5   DG  J "C2'" 1 
ATOM   4346  C  "C1'" . DG  B  2 68  ? -6.353  -24.039 84.191 1.00 48.20  ? -5   DG  J "C1'" 1 
ATOM   4347  N  N9    . DG  B  2 68  ? -6.144  -25.062 85.206 1.00 49.57  ? -5   DG  J N9    1 
ATOM   4348  C  C8    . DG  B  2 68  ? -5.686  -24.911 86.499 1.00 49.68  ? -5   DG  J C8    1 
ATOM   4349  N  N7    . DG  B  2 68  ? -5.579  -26.043 87.138 1.00 50.05  ? -5   DG  J N7    1 
ATOM   4350  C  C5    . DG  B  2 68  ? -5.989  -26.994 86.211 1.00 49.78  ? -5   DG  J C5    1 
ATOM   4351  C  C6    . DG  B  2 68  ? -6.091  -28.399 86.324 1.00 48.68  ? -5   DG  J C6    1 
ATOM   4352  O  O6    . DG  B  2 68  ? -5.834  -29.092 87.292 1.00 49.17  ? -5   DG  J O6    1 
ATOM   4353  N  N1    . DG  B  2 68  ? -6.540  -29.013 85.161 1.00 49.18  ? -5   DG  J N1    1 
ATOM   4354  C  C2    . DG  B  2 68  ? -6.862  -28.334 84.006 1.00 49.75  ? -5   DG  J C2    1 
ATOM   4355  N  N2    . DG  B  2 68  ? -7.274  -29.096 82.986 1.00 49.31  ? -5   DG  J N2    1 
ATOM   4356  N  N3    . DG  B  2 68  ? -6.768  -27.006 83.872 1.00 50.20  ? -5   DG  J N3    1 
ATOM   4357  C  C4    . DG  B  2 68  ? -6.330  -26.407 85.012 1.00 49.76  ? -5   DG  J C4    1 
ATOM   4358  P  P     . DC  B  2 69  ? -8.051  -21.157 81.364 1.00 47.76  ? -4   DC  J P     1 
ATOM   4359  O  OP1   . DC  B  2 69  ? -6.866  -20.499 80.722 1.00 44.26  ? -4   DC  J OP1   1 
ATOM   4360  O  OP2   . DC  B  2 69  ? -9.113  -20.369 82.060 1.00 44.73  ? -4   DC  J OP2   1 
ATOM   4361  O  "O5'" . DC  B  2 69  ? -8.813  -22.105 80.323 1.00 44.48  ? -4   DC  J "O5'" 1 
ATOM   4362  C  "C5'" . DC  B  2 69  ? -8.063  -23.009 79.544 1.00 43.01  ? -4   DC  J "C5'" 1 
ATOM   4363  C  "C4'" . DC  B  2 69  ? -8.841  -24.289 79.383 1.00 42.28  ? -4   DC  J "C4'" 1 
ATOM   4364  O  "O4'" . DC  B  2 69  ? -8.685  -25.101 80.583 1.00 42.88  ? -4   DC  J "O4'" 1 
ATOM   4365  C  "C3'" . DC  B  2 69  ? -10.328 -24.056 79.170 1.00 40.97  ? -4   DC  J "C3'" 1 
ATOM   4366  O  "O3'" . DC  B  2 69  ? -10.758 -24.897 78.138 1.00 39.25  ? -4   DC  J "O3'" 1 
ATOM   4367  C  "C2'" . DC  B  2 69  ? -10.943 -24.501 80.489 1.00 42.27  ? -4   DC  J "C2'" 1 
ATOM   4368  C  "C1'" . DC  B  2 69  ? -9.956  -25.544 80.993 1.00 43.14  ? -4   DC  J "C1'" 1 
ATOM   4369  N  N1    . DC  B  2 69  ? -9.950  -25.662 82.469 1.00 43.59  ? -4   DC  J N1    1 
ATOM   4370  C  C2    . DC  B  2 69  ? -9.957  -26.934 83.049 1.00 43.58  ? -4   DC  J C2    1 
ATOM   4371  O  O2    . DC  B  2 69  ? -9.968  -27.941 82.335 1.00 41.67  ? -4   DC  J O2    1 
ATOM   4372  N  N3    . DC  B  2 69  ? -9.949  -27.008 84.401 1.00 45.00  ? -4   DC  J N3    1 
ATOM   4373  C  C4    . DC  B  2 69  ? -9.946  -25.890 85.143 1.00 43.81  ? -4   DC  J C4    1 
ATOM   4374  N  N4    . DC  B  2 69  ? -9.946  -26.027 86.472 1.00 43.25  ? -4   DC  J N4    1 
ATOM   4375  C  C5    . DC  B  2 69  ? -9.948  -24.588 84.564 1.00 42.29  ? -4   DC  J C5    1 
ATOM   4376  C  C6    . DC  B  2 69  ? -9.950  -24.528 83.239 1.00 42.80  ? -4   DC  J C6    1 
ATOM   4377  P  P     . DT  B  2 70  ? -12.177 -24.757 77.407 1.00 35.87  ? -3   DT  J P     1 
ATOM   4378  O  OP1   . DT  B  2 70  ? -11.831 -24.553 75.984 1.00 35.99  ? -3   DT  J OP1   1 
ATOM   4379  O  OP2   . DT  B  2 70  ? -13.066 -23.805 78.109 1.00 36.30  ? -3   DT  J OP2   1 
ATOM   4380  O  "O5'" . DT  B  2 70  ? -12.789 -26.210 77.620 1.00 35.07  ? -3   DT  J "O5'" 1 
ATOM   4381  C  "C5'" . DT  B  2 70  ? -11.964 -27.354 77.563 1.00 36.86  ? -3   DT  J "C5'" 1 
ATOM   4382  C  "C4'" . DT  B  2 70  ? -12.680 -28.519 78.198 1.00 39.90  ? -3   DT  J "C4'" 1 
ATOM   4383  O  "O4'" . DT  B  2 70  ? -12.583 -28.391 79.630 1.00 42.06  ? -3   DT  J "O4'" 1 
ATOM   4384  C  "C3'" . DT  B  2 70  ? -14.175 -28.588 77.902 1.00 42.50  ? -3   DT  J "C3'" 1 
ATOM   4385  O  "O3'" . DT  B  2 70  ? -14.473 -29.918 77.515 1.00 44.94  ? -3   DT  J "O3'" 1 
ATOM   4386  C  "C2'" . DT  B  2 70  ? -14.889 -28.169 79.197 1.00 41.55  ? -3   DT  J "C2'" 1 
ATOM   4387  C  "C1'" . DT  B  2 70  ? -13.850 -28.522 80.245 1.00 43.24  ? -3   DT  J "C1'" 1 
ATOM   4388  N  N1    . DT  B  2 70  ? -13.833 -27.704 81.485 1.00 43.27  ? -3   DT  J N1    1 
ATOM   4389  C  C2    . DT  B  2 70  ? -13.816 -28.373 82.689 1.00 43.93  ? -3   DT  J C2    1 
ATOM   4390  O  O2    . DT  B  2 70  ? -13.837 -29.597 82.765 1.00 43.84  ? -3   DT  J O2    1 
ATOM   4391  N  N3    . DT  B  2 70  ? -13.785 -27.545 83.792 1.00 44.35  ? -3   DT  J N3    1 
ATOM   4392  C  C4    . DT  B  2 70  ? -13.767 -26.146 83.800 1.00 44.94  ? -3   DT  J C4    1 
ATOM   4393  O  O4    . DT  B  2 70  ? -13.752 -25.466 84.833 1.00 44.85  ? -3   DT  J O4    1 
ATOM   4394  C  C5    . DT  B  2 70  ? -13.783 -25.517 82.503 1.00 44.74  ? -3   DT  J C5    1 
ATOM   4395  C  C7    . DT  B  2 70  ? -13.770 -24.009 82.395 1.00 43.49  ? -3   DT  J C7    1 
ATOM   4396  C  C6    . DT  B  2 70  ? -13.813 -26.326 81.426 1.00 44.44  ? -3   DT  J C6    1 
ATOM   4397  P  P     . DG  B  2 71  ? -15.927 -30.279 76.964 1.00 46.88  ? -2   DG  J P     1 
ATOM   4398  O  OP1   . DG  B  2 71  ? -15.758 -31.211 75.831 1.00 45.57  ? -2   DG  J OP1   1 
ATOM   4399  O  OP2   . DG  B  2 71  ? -16.731 -29.022 76.845 1.00 46.10  ? -2   DG  J OP2   1 
ATOM   4400  O  "O5'" . DG  B  2 71  ? -16.535 -31.061 78.201 1.00 48.31  ? -2   DG  J "O5'" 1 
ATOM   4401  C  "C5'" . DG  B  2 71  ? -15.891 -32.164 78.817 1.00 51.49  ? -2   DG  J "C5'" 1 
ATOM   4402  C  "C4'" . DG  B  2 71  ? -16.770 -32.515 79.996 1.00 53.44  ? -2   DG  J "C4'" 1 
ATOM   4403  O  "O4'" . DG  B  2 71  ? -16.612 -31.511 81.021 1.00 53.89  ? -2   DG  J "O4'" 1 
ATOM   4404  C  "C3'" . DG  B  2 71  ? -18.247 -32.511 79.629 1.00 54.99  ? -2   DG  J "C3'" 1 
ATOM   4405  O  "O3'" . DG  B  2 71  ? -18.727 -33.800 79.949 1.00 57.89  ? -2   DG  J "O3'" 1 
ATOM   4406  C  "C2'" . DG  B  2 71  ? -18.867 -31.333 80.388 1.00 53.86  ? -2   DG  J "C2'" 1 
ATOM   4407  C  "C1'" . DG  B  2 71  ? -17.862 -31.079 81.491 1.00 53.79  ? -2   DG  J "C1'" 1 
ATOM   4408  N  N9    . DG  B  2 71  ? -17.698 -29.674 81.838 1.00 54.17  ? -2   DG  J N9    1 
ATOM   4409  C  C8    . DG  B  2 71  ? -17.802 -28.580 81.017 1.00 53.97  ? -2   DG  J C8    1 
ATOM   4410  N  N7    . DG  B  2 71  ? -17.591 -27.450 81.635 1.00 53.83  ? -2   DG  J N7    1 
ATOM   4411  C  C5    . DG  B  2 71  ? -17.331 -27.811 82.949 1.00 53.93  ? -2   DG  J C5    1 
ATOM   4412  C  C6    . DG  B  2 71  ? -17.039 -27.019 84.086 1.00 54.00  ? -2   DG  J C6    1 
ATOM   4413  O  O6    . DG  B  2 71  ? -16.949 -25.788 84.150 1.00 54.16  ? -2   DG  J O6    1 
ATOM   4414  N  N1    . DG  B  2 71  ? -16.849 -27.791 85.236 1.00 54.05  ? -2   DG  J N1    1 
ATOM   4415  C  C2    . DG  B  2 71  ? -16.934 -29.164 85.268 1.00 54.00  ? -2   DG  J C2    1 
ATOM   4416  N  N2    . DG  B  2 71  ? -16.726 -29.772 86.437 1.00 54.00  ? -2   DG  J N2    1 
ATOM   4417  N  N3    . DG  B  2 71  ? -17.203 -29.913 84.213 1.00 54.87  ? -2   DG  J N3    1 
ATOM   4418  C  C4    . DG  B  2 71  ? -17.390 -29.177 83.087 1.00 54.33  ? -2   DG  J C4    1 
ATOM   4419  P  P     . DA  B  2 72  ? -20.202 -34.129 80.475 1.00 61.16  ? -1   DA  J P     1 
ATOM   4420  O  OP1   . DA  B  2 72  ? -20.353 -35.575 80.147 1.00 60.29  ? -1   DA  J OP1   1 
ATOM   4421  O  OP2   . DA  B  2 72  ? -21.208 -33.092 80.091 1.00 59.58  ? -1   DA  J OP2   1 
ATOM   4422  O  "O5'" . DA  B  2 72  ? -20.048 -33.918 82.052 1.00 60.19  ? -1   DA  J "O5'" 1 
ATOM   4423  C  "C5'" . DA  B  2 72  ? -19.527 -34.909 82.920 1.00 58.56  ? -1   DA  J "C5'" 1 
ATOM   4424  C  "C4'" . DA  B  2 72  ? -19.990 -34.536 84.311 1.00 57.55  ? -1   DA  J "C4'" 1 
ATOM   4425  O  "O4'" . DA  B  2 72  ? -19.645 -33.155 84.576 1.00 55.56  ? -1   DA  J "O4'" 1 
ATOM   4426  C  "C3'" . DA  B  2 72  ? -21.499 -34.634 84.496 1.00 58.35  ? -1   DA  J "C3'" 1 
ATOM   4427  O  "O3'" . DA  B  2 72  ? -21.727 -35.306 85.712 1.00 61.93  ? -1   DA  J "O3'" 1 
ATOM   4428  C  "C2'" . DA  B  2 72  ? -21.988 -33.190 84.540 1.00 55.76  ? -1   DA  J "C2'" 1 
ATOM   4429  C  "C1'" . DA  B  2 72  ? -20.767 -32.483 85.106 1.00 52.88  ? -1   DA  J "C1'" 1 
ATOM   4430  N  N9    . DA  B  2 72  ? -20.663 -31.078 84.735 1.00 52.12  ? -1   DA  J N9    1 
ATOM   4431  C  C8    . DA  B  2 72  ? -20.850 -30.524 83.504 1.00 50.89  ? -1   DA  J C8    1 
ATOM   4432  N  N7    . DA  B  2 72  ? -20.682 -29.230 83.483 1.00 49.85  ? -1   DA  J N7    1 
ATOM   4433  C  C5    . DA  B  2 72  ? -20.363 -28.903 84.776 1.00 50.19  ? -1   DA  J C5    1 
ATOM   4434  C  C6    . DA  B  2 72  ? -20.073 -27.679 85.402 1.00 51.03  ? -1   DA  J C6    1 
ATOM   4435  N  N6    . DA  B  2 72  ? -20.054 -26.506 84.768 1.00 51.12  ? -1   DA  J N6    1 
ATOM   4436  N  N1    . DA  B  2 72  ? -19.795 -27.706 86.728 1.00 52.02  ? -1   DA  J N1    1 
ATOM   4437  C  C2    . DA  B  2 72  ? -19.813 -28.882 87.386 1.00 51.57  ? -1   DA  J C2    1 
ATOM   4438  N  N3    . DA  B  2 72  ? -20.077 -30.098 86.899 1.00 50.96  ? -1   DA  J N3    1 
ATOM   4439  C  C4    . DA  B  2 72  ? -20.343 -30.034 85.573 1.00 51.83  ? -1   DA  J C4    1 
ATOM   4440  P  P     . DT  B  2 73  ? -23.181 -35.791 86.165 1.00 64.70  ? 0    DT  J P     1 
ATOM   4441  O  OP1   . DT  B  2 73  ? -22.900 -37.014 86.947 1.00 65.57  ? 0    DT  J OP1   1 
ATOM   4442  O  OP2   . DT  B  2 73  ? -24.127 -35.825 85.022 1.00 63.24  ? 0    DT  J OP2   1 
ATOM   4443  O  "O5'" . DT  B  2 73  ? -23.633 -34.633 87.173 1.00 65.32  ? 0    DT  J "O5'" 1 
ATOM   4444  C  "C5'" . DT  B  2 73  ? -22.749 -34.247 88.215 1.00 67.64  ? 0    DT  J "C5'" 1 
ATOM   4445  C  "C4'" . DT  B  2 73  ? -23.353 -33.110 89.013 1.00 69.89  ? 0    DT  J "C4'" 1 
ATOM   4446  O  "O4'" . DT  B  2 73  ? -22.943 -31.847 88.437 1.00 70.03  ? 0    DT  J "O4'" 1 
ATOM   4447  C  "C3'" . DT  B  2 73  ? -24.883 -33.101 89.058 1.00 71.25  ? 0    DT  J "C3'" 1 
ATOM   4448  O  "O3'" . DT  B  2 73  ? -25.304 -33.180 90.429 1.00 72.99  ? 0    DT  J "O3'" 1 
ATOM   4449  C  "C2'" . DT  B  2 73  ? -25.272 -31.792 88.360 1.00 70.73  ? 0    DT  J "C2'" 1 
ATOM   4450  C  "C1'" . DT  B  2 73  ? -24.016 -30.937 88.533 1.00 69.97  ? 0    DT  J "C1'" 1 
ATOM   4451  N  N1    . DT  B  2 73  ? -23.836 -29.843 87.514 1.00 69.33  ? 0    DT  J N1    1 
ATOM   4452  C  C2    . DT  B  2 73  ? -23.544 -28.548 87.923 1.00 69.76  ? 0    DT  J C2    1 
ATOM   4453  O  O2    . DT  B  2 73  ? -23.411 -28.189 89.081 1.00 69.96  ? 0    DT  J O2    1 
ATOM   4454  N  N3    . DT  B  2 73  ? -23.407 -27.643 86.908 1.00 69.45  ? 0    DT  J N3    1 
ATOM   4455  C  C4    . DT  B  2 73  ? -23.528 -27.882 85.555 1.00 69.86  ? 0    DT  J C4    1 
ATOM   4456  O  O4    . DT  B  2 73  ? -23.384 -26.983 84.735 1.00 69.88  ? 0    DT  J O4    1 
ATOM   4457  C  C5    . DT  B  2 73  ? -23.832 -29.246 85.189 1.00 69.76  ? 0    DT  J C5    1 
ATOM   4458  C  C7    . DT  B  2 73  ? -24.000 -29.635 83.745 1.00 69.98  ? 0    DT  J C7    1 
ATOM   4459  C  C6    . DT  B  2 73  ? -23.965 -30.145 86.174 1.00 69.06  ? 0    DT  J C6    1 
ATOM   4460  P  P     . DT  B  2 74  ? -26.841 -33.334 90.869 1.00 74.85  ? 1    DT  J P     1 
ATOM   4461  O  OP1   . DT  B  2 74  ? -26.845 -34.103 92.133 1.00 75.02  ? 1    DT  J OP1   1 
ATOM   4462  O  OP2   . DT  B  2 74  ? -27.620 -33.824 89.710 1.00 73.87  ? 1    DT  J OP2   1 
ATOM   4463  O  "O5'" . DT  B  2 74  ? -27.289 -31.823 91.191 1.00 74.68  ? 1    DT  J "O5'" 1 
ATOM   4464  C  "C5'" . DT  B  2 74  ? -26.383 -30.950 91.881 1.00 75.48  ? 1    DT  J "C5'" 1 
ATOM   4465  C  "C4'" . DT  B  2 74  ? -26.935 -29.550 92.152 1.00 76.32  ? 1    DT  J "C4'" 1 
ATOM   4466  O  "O4'" . DT  B  2 74  ? -26.501 -28.572 91.160 1.00 76.02  ? 1    DT  J "O4'" 1 
ATOM   4467  C  "C3'" . DT  B  2 74  ? -28.448 -29.401 92.229 1.00 76.94  ? 1    DT  J "C3'" 1 
ATOM   4468  O  "O3'" . DT  B  2 74  ? -28.694 -28.479 93.279 1.00 79.23  ? 1    DT  J "O3'" 1 
ATOM   4469  C  "C2'" . DT  B  2 74  ? -28.815 -28.820 90.866 1.00 75.84  ? 1    DT  J "C2'" 1 
ATOM   4470  C  "C1'" . DT  B  2 74  ? -27.617 -27.913 90.592 1.00 74.10  ? 1    DT  J "C1'" 1 
ATOM   4471  N  N1    . DT  B  2 74  ? -27.335 -27.637 89.137 1.00 73.09  ? 1    DT  J N1    1 
ATOM   4472  C  C2    . DT  B  2 74  ? -26.943 -26.369 88.742 1.00 72.73  ? 1    DT  J C2    1 
ATOM   4473  O  O2    . DT  B  2 74  ? -26.801 -25.418 89.494 1.00 72.31  ? 1    DT  J O2    1 
ATOM   4474  N  N3    . DT  B  2 74  ? -26.717 -26.241 87.393 1.00 73.03  ? 1    DT  J N3    1 
ATOM   4475  C  C4    . DT  B  2 74  ? -26.828 -27.218 86.415 1.00 72.85  ? 1    DT  J C4    1 
ATOM   4476  O  O4    . DT  B  2 74  ? -26.594 -26.994 85.232 1.00 72.58  ? 1    DT  J O4    1 
ATOM   4477  C  C5    . DT  B  2 74  ? -27.237 -28.512 86.889 1.00 72.46  ? 1    DT  J C5    1 
ATOM   4478  C  C7    . DT  B  2 74  ? -27.397 -29.648 85.919 1.00 72.91  ? 1    DT  J C7    1 
ATOM   4479  C  C6    . DT  B  2 74  ? -27.465 -28.655 88.207 1.00 72.56  ? 1    DT  J C6    1 
ATOM   4480  P  P     . DC  B  2 75  ? -30.138 -28.267 93.937 1.00 80.98  ? 2    DC  J P     1 
ATOM   4481  O  OP1   . DC  B  2 75  ? -29.911 -28.082 95.397 1.00 80.12  ? 2    DC  J OP1   1 
ATOM   4482  O  OP2   . DC  B  2 75  ? -31.080 -29.289 93.396 1.00 79.25  ? 2    DC  J OP2   1 
ATOM   4483  O  "O5'" . DC  B  2 75  ? -30.559 -26.841 93.347 1.00 81.85  ? 2    DC  J "O5'" 1 
ATOM   4484  C  "C5'" . DC  B  2 75  ? -29.679 -25.709 93.499 1.00 83.07  ? 2    DC  J "C5'" 1 
ATOM   4485  C  "C4'" . DC  B  2 75  ? -30.171 -24.534 92.667 1.00 83.62  ? 2    DC  J "C4'" 1 
ATOM   4486  O  "O4'" . DC  B  2 75  ? -29.718 -24.657 91.285 1.00 83.79  ? 2    DC  J "O4'" 1 
ATOM   4487  C  "C3'" . DC  B  2 75  ? -31.693 -24.411 92.613 1.00 83.82  ? 2    DC  J "C3'" 1 
ATOM   4488  O  "O3'" . DC  B  2 75  ? -32.096 -23.076 92.884 1.00 84.42  ? 2    DC  J "O3'" 1 
ATOM   4489  C  "C2'" . DC  B  2 75  ? -32.055 -24.835 91.190 1.00 83.49  ? 2    DC  J "C2'" 1 
ATOM   4490  C  "C1'" . DC  B  2 75  ? -30.806 -24.428 90.406 1.00 82.63  ? 2    DC  J "C1'" 1 
ATOM   4491  N  N1    . DC  B  2 75  ? -30.617 -25.179 89.110 1.00 81.75  ? 2    DC  J N1    1 
ATOM   4492  C  C2    . DC  B  2 75  ? -30.134 -24.528 87.958 1.00 81.54  ? 2    DC  J C2    1 
ATOM   4493  O  O2    . DC  B  2 75  ? -29.847 -23.326 87.998 1.00 81.11  ? 2    DC  J O2    1 
ATOM   4494  N  N3    . DC  B  2 75  ? -29.990 -25.249 86.811 1.00 81.75  ? 2    DC  J N3    1 
ATOM   4495  C  C4    . DC  B  2 75  ? -30.309 -26.553 86.788 1.00 81.76  ? 2    DC  J C4    1 
ATOM   4496  N  N4    . DC  B  2 75  ? -30.152 -27.228 85.647 1.00 81.82  ? 2    DC  J N4    1 
ATOM   4497  C  C5    . DC  B  2 75  ? -30.802 -27.233 87.940 1.00 81.33  ? 2    DC  J C5    1 
ATOM   4498  C  C6    . DC  B  2 75  ? -30.936 -26.511 89.059 1.00 81.73  ? 2    DC  J C6    1 
ATOM   4499  P  P     . DA  B  2 76  ? -33.451 -22.804 93.696 1.00 84.26  ? 3    DA  J P     1 
ATOM   4500  O  OP1   . DA  B  2 76  ? -33.183 -23.219 95.095 1.00 84.56  ? 3    DA  J OP1   1 
ATOM   4501  O  OP2   . DA  B  2 76  ? -34.596 -23.394 92.951 1.00 83.41  ? 3    DA  J OP2   1 
ATOM   4502  O  "O5'" . DA  B  2 76  ? -33.566 -21.211 93.646 1.00 82.79  ? 3    DA  J "O5'" 1 
ATOM   4503  C  "C5'" . DA  B  2 76  ? -32.425 -20.410 93.334 1.00 82.58  ? 3    DA  J "C5'" 1 
ATOM   4504  C  "C4'" . DA  B  2 76  ? -32.717 -19.473 92.166 1.00 81.89  ? 3    DA  J "C4'" 1 
ATOM   4505  O  "O4'" . DA  B  2 76  ? -32.498 -20.116 90.878 1.00 81.67  ? 3    DA  J "O4'" 1 
ATOM   4506  C  "C3'" . DA  B  2 76  ? -34.141 -18.951 92.090 1.00 81.55  ? 3    DA  J "C3'" 1 
ATOM   4507  O  "O3'" . DA  B  2 76  ? -34.037 -17.687 91.520 1.00 81.57  ? 3    DA  J "O3'" 1 
ATOM   4508  C  "C2'" . DA  B  2 76  ? -34.820 -19.916 91.123 1.00 81.46  ? 3    DA  J "C2'" 1 
ATOM   4509  C  "C1'" . DA  B  2 76  ? -33.692 -20.098 90.111 1.00 80.68  ? 3    DA  J "C1'" 1 
ATOM   4510  N  N9    . DA  B  2 76  ? -33.710 -21.318 89.306 1.00 80.25  ? 3    DA  J N9    1 
ATOM   4511  C  C8    . DA  B  2 76  ? -34.171 -22.555 89.650 1.00 79.95  ? 3    DA  J C8    1 
ATOM   4512  N  N7    . DA  B  2 76  ? -34.032 -23.455 88.705 1.00 79.77  ? 3    DA  J N7    1 
ATOM   4513  C  C5    . DA  B  2 76  ? -33.437 -22.762 87.670 1.00 79.83  ? 3    DA  J C5    1 
ATOM   4514  C  C6    . DA  B  2 76  ? -33.019 -23.140 86.375 1.00 80.17  ? 3    DA  J C6    1 
ATOM   4515  N  N6    . DA  B  2 76  ? -33.151 -24.374 85.890 1.00 80.03  ? 3    DA  J N6    1 
ATOM   4516  N  N1    . DA  B  2 76  ? -32.459 -22.194 85.584 1.00 80.49  ? 3    DA  J N1    1 
ATOM   4517  C  C2    . DA  B  2 76  ? -32.325 -20.946 86.064 1.00 80.11  ? 3    DA  J C2    1 
ATOM   4518  N  N3    . DA  B  2 76  ? -32.676 -20.476 87.263 1.00 80.02  ? 3    DA  J N3    1 
ATOM   4519  C  C4    . DA  B  2 76  ? -33.231 -21.441 88.024 1.00 80.09  ? 3    DA  J C4    1 
ATOM   4520  P  P     . DG  B  2 77  ? -34.885 -16.469 92.092 1.00 81.91  ? 4    DG  J P     1 
ATOM   4521  O  OP1   . DG  B  2 77  ? -34.160 -15.985 93.289 1.00 81.41  ? 4    DG  J OP1   1 
ATOM   4522  O  OP2   . DG  B  2 77  ? -36.306 -16.904 92.166 1.00 81.31  ? 4    DG  J OP2   1 
ATOM   4523  O  "O5'" . DG  B  2 77  ? -34.734 -15.370 90.924 1.00 81.06  ? 4    DG  J "O5'" 1 
ATOM   4524  C  "C5'" . DG  B  2 77  ? -33.715 -15.497 89.889 1.00 78.91  ? 4    DG  J "C5'" 1 
ATOM   4525  C  "C4'" . DG  B  2 77  ? -34.246 -15.531 88.449 1.00 76.58  ? 4    DG  J "C4'" 1 
ATOM   4526  O  "O4'" . DG  B  2 77  ? -34.403 -16.895 87.961 1.00 74.93  ? 4    DG  J "O4'" 1 
ATOM   4527  C  "C3'" . DG  B  2 77  ? -35.596 -14.876 88.176 1.00 75.93  ? 4    DG  J "C3'" 1 
ATOM   4528  O  "O3'" . DG  B  2 77  ? -35.540 -14.354 86.881 1.00 76.76  ? 4    DG  J "O3'" 1 
ATOM   4529  C  "C2'" . DG  B  2 77  ? -36.545 -16.067 88.189 1.00 74.74  ? 4    DG  J "C2'" 1 
ATOM   4530  C  "C1'" . DG  B  2 77  ? -35.685 -17.024 87.381 1.00 72.93  ? 4    DG  J "C1'" 1 
ATOM   4531  N  N9    . DG  B  2 77  ? -36.081 -18.425 87.408 1.00 72.51  ? 4    DG  J N9    1 
ATOM   4532  C  C8    . DG  B  2 77  ? -36.659 -19.107 88.445 1.00 72.15  ? 4    DG  J C8    1 
ATOM   4533  N  N7    . DG  B  2 77  ? -36.888 -20.362 88.184 1.00 72.05  ? 4    DG  J N7    1 
ATOM   4534  C  C5    . DG  B  2 77  ? -36.436 -20.532 86.884 1.00 72.11  ? 4    DG  J C5    1 
ATOM   4535  C  C6    . DG  B  2 77  ? -36.431 -21.683 86.057 1.00 72.26  ? 4    DG  J C6    1 
ATOM   4536  O  O6    . DG  B  2 77  ? -36.834 -22.829 86.306 1.00 72.41  ? 4    DG  J O6    1 
ATOM   4537  N  N1    . DG  B  2 77  ? -35.886 -21.425 84.805 1.00 72.27  ? 4    DG  J N1    1 
ATOM   4538  C  C2    . DG  B  2 77  ? -35.401 -20.216 84.386 1.00 72.40  ? 4    DG  J C2    1 
ATOM   4539  N  N2    . DG  B  2 77  ? -34.916 -20.197 83.137 1.00 72.14  ? 4    DG  J N2    1 
ATOM   4540  N  N3    . DG  B  2 77  ? -35.396 -19.119 85.147 1.00 72.96  ? 4    DG  J N3    1 
ATOM   4541  C  C4    . DG  B  2 77  ? -35.931 -19.346 86.386 1.00 72.91  ? 4    DG  J C4    1 
ATOM   4542  P  P     . DC  B  2 78  ? -35.584 -12.786 86.610 1.00 78.75  ? 5    DC  J P     1 
ATOM   4543  O  OP1   . DC  B  2 78  ? -34.308 -12.188 87.093 1.00 78.18  ? 5    DC  J OP1   1 
ATOM   4544  O  OP2   . DC  B  2 78  ? -36.913 -12.297 87.047 1.00 77.87  ? 5    DC  J OP2   1 
ATOM   4545  O  "O5'" . DC  B  2 78  ? -35.570 -12.716 85.013 1.00 78.42  ? 5    DC  J "O5'" 1 
ATOM   4546  C  "C5'" . DC  B  2 78  ? -34.512 -13.354 84.279 1.00 78.60  ? 5    DC  J "C5'" 1 
ATOM   4547  C  "C4'" . DC  B  2 78  ? -35.075 -14.065 83.061 1.00 77.90  ? 5    DC  J "C4'" 1 
ATOM   4548  O  "O4'" . DC  B  2 78  ? -35.599 -15.366 83.442 1.00 77.61  ? 5    DC  J "O4'" 1 
ATOM   4549  C  "C3'" . DC  B  2 78  ? -36.214 -13.290 82.393 1.00 77.61  ? 5    DC  J "C3'" 1 
ATOM   4550  O  "O3'" . DC  B  2 78  ? -36.056 -13.021 80.970 1.00 76.74  ? 5    DC  J "O3'" 1 
ATOM   4551  C  "C2'" . DC  B  2 78  ? -37.439 -14.158 82.674 1.00 77.80  ? 5    DC  J "C2'" 1 
ATOM   4552  C  "C1'" . DC  B  2 78  ? -36.840 -15.555 82.805 1.00 78.09  ? 5    DC  J "C1'" 1 
ATOM   4553  N  N1    . DC  B  2 78  ? -37.660 -16.526 83.611 1.00 78.37  ? 5    DC  J N1    1 
ATOM   4554  C  C2    . DC  B  2 78  ? -37.877 -17.843 83.147 1.00 78.61  ? 5    DC  J C2    1 
ATOM   4555  O  O2    . DC  B  2 78  ? -37.390 -18.216 82.071 1.00 78.52  ? 5    DC  J O2    1 
ATOM   4556  N  N3    . DC  B  2 78  ? -38.625 -18.695 83.897 1.00 78.26  ? 5    DC  J N3    1 
ATOM   4557  C  C4    . DC  B  2 78  ? -39.142 -18.281 85.058 1.00 78.48  ? 5    DC  J C4    1 
ATOM   4558  N  N4    . DC  B  2 78  ? -39.868 -19.149 85.770 1.00 78.51  ? 5    DC  J N4    1 
ATOM   4559  C  C5    . DC  B  2 78  ? -38.936 -16.954 85.546 1.00 78.57  ? 5    DC  J C5    1 
ATOM   4560  C  C6    . DC  B  2 78  ? -38.200 -16.121 84.801 1.00 78.19  ? 5    DC  J C6    1 
ATOM   4561  P  P     . DT  B  2 79  ? -34.769 -13.311 80.040 1.00 74.25  ? 6    DT  J P     1 
ATOM   4562  O  OP1   . DT  B  2 79  ? -33.543 -13.575 80.828 1.00 74.68  ? 6    DT  J OP1   1 
ATOM   4563  O  OP2   . DT  B  2 79  ? -34.763 -12.251 79.008 1.00 73.52  ? 6    DT  J OP2   1 
ATOM   4564  O  "O5'" . DT  B  2 79  ? -35.219 -14.679 79.362 1.00 72.09  ? 6    DT  J "O5'" 1 
ATOM   4565  C  "C5'" . DT  B  2 79  ? -35.846 -14.546 78.120 1.00 68.04  ? 6    DT  J "C5'" 1 
ATOM   4566  C  "C4'" . DT  B  2 79  ? -36.789 -15.675 77.793 1.00 64.79  ? 6    DT  J "C4'" 1 
ATOM   4567  O  "O4'" . DT  B  2 79  ? -37.445 -16.258 78.941 1.00 64.27  ? 6    DT  J "O4'" 1 
ATOM   4568  C  "C3'" . DT  B  2 79  ? -37.884 -15.116 76.913 1.00 63.20  ? 6    DT  J "C3'" 1 
ATOM   4569  O  "O3'" . DT  B  2 79  ? -37.938 -15.939 75.800 1.00 60.96  ? 6    DT  J "O3'" 1 
ATOM   4570  C  "C2'" . DT  B  2 79  ? -39.142 -15.230 77.759 1.00 63.67  ? 6    DT  J "C2'" 1 
ATOM   4571  C  "C1'" . DT  B  2 79  ? -38.803 -16.445 78.598 1.00 65.61  ? 6    DT  J "C1'" 1 
ATOM   4572  N  N1    . DT  B  2 79  ? -39.604 -16.585 79.850 1.00 66.49  ? 6    DT  J N1    1 
ATOM   4573  C  C2    . DT  B  2 79  ? -40.036 -17.838 80.232 1.00 66.65  ? 6    DT  J C2    1 
ATOM   4574  O  O2    . DT  B  2 79  ? -39.810 -18.851 79.602 1.00 66.99  ? 6    DT  J O2    1 
ATOM   4575  N  N3    . DT  B  2 79  ? -40.752 -17.868 81.403 1.00 67.38  ? 6    DT  J N3    1 
ATOM   4576  C  C4    . DT  B  2 79  ? -41.075 -16.794 82.218 1.00 66.97  ? 6    DT  J C4    1 
ATOM   4577  O  O4    . DT  B  2 79  ? -41.728 -16.953 83.248 1.00 67.12  ? 6    DT  J O4    1 
ATOM   4578  C  C5    . DT  B  2 79  ? -40.596 -15.506 81.761 1.00 66.66  ? 6    DT  J C5    1 
ATOM   4579  C  C7    . DT  B  2 79  ? -40.872 -14.251 82.531 1.00 66.55  ? 6    DT  J C7    1 
ATOM   4580  C  C6    . DT  B  2 79  ? -39.895 -15.467 80.618 1.00 66.90  ? 6    DT  J C6    1 
ATOM   4581  P  P     . DG  B  2 80  ? -37.130 -15.603 74.470 1.00 57.25  ? 7    DG  J P     1 
ATOM   4582  O  OP1   . DG  B  2 80  ? -35.665 -15.511 74.664 1.00 58.16  ? 7    DG  J OP1   1 
ATOM   4583  O  OP2   . DG  B  2 80  ? -37.913 -14.606 73.720 1.00 56.51  ? 7    DG  J OP2   1 
ATOM   4584  O  "O5'" . DG  B  2 80  ? -37.360 -17.010 73.837 1.00 56.35  ? 7    DG  J "O5'" 1 
ATOM   4585  C  "C5'" . DG  B  2 80  ? -38.640 -17.142 73.414 1.00 53.30  ? 7    DG  J "C5'" 1 
ATOM   4586  C  "C4'" . DG  B  2 80  ? -39.166 -18.503 73.741 1.00 50.89  ? 7    DG  J "C4'" 1 
ATOM   4587  O  "O4'" . DG  B  2 80  ? -39.751 -18.477 75.051 1.00 50.16  ? 7    DG  J "O4'" 1 
ATOM   4588  C  "C3'" . DG  B  2 80  ? -40.320 -18.689 72.785 1.00 49.19  ? 7    DG  J "C3'" 1 
ATOM   4589  O  "O3'" . DG  B  2 80  ? -40.654 -20.020 72.702 1.00 46.10  ? 7    DG  J "O3'" 1 
ATOM   4590  C  "C2'" . DG  B  2 80  ? -41.421 -17.862 73.427 1.00 49.68  ? 7    DG  J "C2'" 1 
ATOM   4591  C  "C1'" . DG  B  2 80  ? -41.167 -18.284 74.867 1.00 51.95  ? 7    DG  J "C1'" 1 
ATOM   4592  N  N9    . DG  B  2 80  ? -41.689 -17.363 75.863 1.00 51.65  ? 7    DG  J N9    1 
ATOM   4593  C  C8    . DG  B  2 80  ? -41.562 -15.995 75.922 1.00 51.68  ? 7    DG  J C8    1 
ATOM   4594  N  N7    . DG  B  2 80  ? -42.142 -15.480 76.973 1.00 51.99  ? 7    DG  J N7    1 
ATOM   4595  C  C5    . DG  B  2 80  ? -42.679 -16.585 77.628 1.00 52.09  ? 7    DG  J C5    1 
ATOM   4596  C  C6    . DG  B  2 80  ? -43.417 -16.656 78.824 1.00 52.38  ? 7    DG  J C6    1 
ATOM   4597  O  O6    . DG  B  2 80  ? -43.736 -15.693 79.551 1.00 52.65  ? 7    DG  J O6    1 
ATOM   4598  N  N1    . DG  B  2 80  ? -43.774 -17.977 79.137 1.00 51.62  ? 7    DG  J N1    1 
ATOM   4599  C  C2    . DG  B  2 80  ? -43.442 -19.080 78.383 1.00 51.63  ? 7    DG  J C2    1 
ATOM   4600  N  N2    . DG  B  2 80  ? -43.849 -20.269 78.823 1.00 51.56  ? 7    DG  J N2    1 
ATOM   4601  N  N3    . DG  B  2 80  ? -42.748 -19.023 77.260 1.00 51.65  ? 7    DG  J N3    1 
ATOM   4602  C  C4    . DG  B  2 80  ? -42.407 -17.750 76.955 1.00 51.56  ? 7    DG  J C4    1 
ATOM   4603  P  P     . DA  B  2 81  ? -41.342 -20.379 71.336 1.00 44.31  ? 8    DA  J P     1 
ATOM   4604  O  OP1   . DA  B  2 81  ? -40.338 -20.887 70.377 1.00 44.16  ? 8    DA  J OP1   1 
ATOM   4605  O  OP2   . DA  B  2 81  ? -42.200 -19.247 70.962 1.00 44.42  ? 8    DA  J OP2   1 
ATOM   4606  O  "O5'" . DA  B  2 81  ? -42.310 -21.540 71.811 1.00 44.32  ? 8    DA  J "O5'" 1 
ATOM   4607  C  "C5'" . DA  B  2 81  ? -41.922 -22.537 72.720 1.00 45.43  ? 8    DA  J "C5'" 1 
ATOM   4608  C  "C4'" . DA  B  2 81  ? -43.185 -23.289 73.103 1.00 47.68  ? 8    DA  J "C4'" 1 
ATOM   4609  O  "O4'" . DA  B  2 81  ? -43.874 -22.604 74.183 1.00 48.99  ? 8    DA  J "O4'" 1 
ATOM   4610  C  "C3'" . DA  B  2 81  ? -44.231 -23.455 72.000 1.00 48.14  ? 8    DA  J "C3'" 1 
ATOM   4611  O  "O3'" . DA  B  2 81  ? -44.820 -24.687 72.254 1.00 50.00  ? 8    DA  J "O3'" 1 
ATOM   4612  C  "C2'" . DA  B  2 81  ? -45.227 -22.322 72.219 1.00 48.60  ? 8    DA  J "C2'" 1 
ATOM   4613  C  "C1'" . DA  B  2 81  ? -45.105 -22.071 73.722 1.00 49.88  ? 8    DA  J "C1'" 1 
ATOM   4614  N  N9    . DA  B  2 81  ? -45.163 -20.673 74.122 1.00 50.01  ? 8    DA  J N9    1 
ATOM   4615  C  C8    . DA  B  2 81  ? -44.710 -19.574 73.453 1.00 50.60  ? 8    DA  J C8    1 
ATOM   4616  N  N7    . DA  B  2 81  ? -44.926 -18.439 74.088 1.00 51.30  ? 8    DA  J N7    1 
ATOM   4617  C  C5    . DA  B  2 81  ? -45.565 -18.830 75.251 1.00 51.01  ? 8    DA  J C5    1 
ATOM   4618  C  C6    . DA  B  2 81  ? -46.057 -18.119 76.358 1.00 50.40  ? 8    DA  J C6    1 
ATOM   4619  N  N6    . DA  B  2 81  ? -45.973 -16.796 76.479 1.00 50.48  ? 8    DA  J N6    1 
ATOM   4620  N  N1    . DA  B  2 81  ? -46.635 -18.820 77.351 1.00 50.31  ? 8    DA  J N1    1 
ATOM   4621  C  C2    . DA  B  2 81  ? -46.715 -20.148 77.256 1.00 50.51  ? 8    DA  J C2    1 
ATOM   4622  N  N3    . DA  B  2 81  ? -46.292 -20.930 76.268 1.00 51.09  ? 8    DA  J N3    1 
ATOM   4623  C  C4    . DA  B  2 81  ? -45.719 -20.203 75.289 1.00 51.11  ? 8    DA  J C4    1 
ATOM   4624  P  P     . DA  B  2 82  ? -45.965 -25.345 71.374 1.00 49.98  ? 9    DA  J P     1 
ATOM   4625  O  OP1   . DA  B  2 82  ? -45.651 -26.800 71.364 1.00 48.62  ? 9    DA  J OP1   1 
ATOM   4626  O  OP2   . DA  B  2 82  ? -46.199 -24.600 70.126 1.00 52.13  ? 9    DA  J OP2   1 
ATOM   4627  O  "O5'" . DA  B  2 82  ? -47.245 -24.955 72.240 1.00 51.79  ? 9    DA  J "O5'" 1 
ATOM   4628  C  "C5'" . DA  B  2 82  ? -47.637 -25.641 73.425 1.00 52.71  ? 9    DA  J "C5'" 1 
ATOM   4629  C  "C4'" . DA  B  2 82  ? -48.871 -24.958 73.983 1.00 53.88  ? 9    DA  J "C4'" 1 
ATOM   4630  O  "O4'" . DA  B  2 82  ? -48.537 -23.570 74.227 1.00 53.00  ? 9    DA  J "O4'" 1 
ATOM   4631  C  "C3'" . DA  B  2 82  ? -50.098 -24.958 73.070 1.00 55.52  ? 9    DA  J "C3'" 1 
ATOM   4632  O  "O3'" . DA  B  2 82  ? -51.223 -25.508 73.749 1.00 58.48  ? 9    DA  J "O3'" 1 
ATOM   4633  C  "C2'" . DA  B  2 82  ? -50.332 -23.482 72.754 1.00 54.69  ? 9    DA  J "C2'" 1 
ATOM   4634  C  "C1'" . DA  B  2 82  ? -49.664 -22.795 73.936 1.00 54.42  ? 9    DA  J "C1'" 1 
ATOM   4635  N  N9    . DA  B  2 82  ? -49.244 -21.424 73.680 1.00 54.94  ? 9    DA  J N9    1 
ATOM   4636  C  C8    . DA  B  2 82  ? -48.694 -20.905 72.534 1.00 54.93  ? 9    DA  J C8    1 
ATOM   4637  N  N7    . DA  B  2 82  ? -48.435 -19.621 72.618 1.00 55.18  ? 9    DA  J N7    1 
ATOM   4638  C  C5    . DA  B  2 82  ? -48.842 -19.269 73.899 1.00 55.08  ? 9    DA  J C5    1 
ATOM   4639  C  C6    . DA  B  2 82  ? -48.848 -18.050 74.616 1.00 55.15  ? 9    DA  J C6    1 
ATOM   4640  N  N6    . DA  B  2 82  ? -48.400 -16.881 74.140 1.00 54.75  ? 9    DA  J N6    1 
ATOM   4641  N  N1    . DA  B  2 82  ? -49.334 -18.074 75.878 1.00 55.32  ? 9    DA  J N1    1 
ATOM   4642  C  C2    . DA  B  2 82  ? -49.790 -19.223 76.395 1.00 54.92  ? 9    DA  J C2    1 
ATOM   4643  N  N3    . DA  B  2 82  ? -49.837 -20.421 75.814 1.00 55.19  ? 9    DA  J N3    1 
ATOM   4644  C  C4    . DA  B  2 82  ? -49.347 -20.375 74.563 1.00 55.06  ? 9    DA  J C4    1 
ATOM   4645  P  P     . DC  B  2 83  ? -52.526 -26.042 72.979 1.00 60.61  ? 10   DC  J P     1 
ATOM   4646  O  OP1   . DC  B  2 83  ? -52.771 -27.402 73.508 1.00 59.76  ? 10   DC  J OP1   1 
ATOM   4647  O  OP2   . DC  B  2 83  ? -52.392 -25.823 71.522 1.00 59.64  ? 10   DC  J OP2   1 
ATOM   4648  O  "O5'" . DC  B  2 83  ? -53.692 -25.061 73.452 1.00 62.27  ? 10   DC  J "O5'" 1 
ATOM   4649  C  "C5'" . DC  B  2 83  ? -53.569 -24.292 74.618 1.00 66.38  ? 10   DC  J "C5'" 1 
ATOM   4650  C  "C4'" . DC  B  2 83  ? -54.314 -22.976 74.508 1.00 70.44  ? 10   DC  J "C4'" 1 
ATOM   4651  O  "O4'" . DC  B  2 83  ? -53.348 -21.934 74.291 1.00 71.24  ? 10   DC  J "O4'" 1 
ATOM   4652  C  "C3'" . DC  B  2 83  ? -55.287 -22.784 73.355 1.00 72.93  ? 10   DC  J "C3'" 1 
ATOM   4653  O  "O3'" . DC  B  2 83  ? -56.564 -23.251 73.762 1.00 78.94  ? 10   DC  J "O3'" 1 
ATOM   4654  C  "C2'" . DC  B  2 83  ? -55.281 -21.268 73.142 1.00 71.85  ? 10   DC  J "C2'" 1 
ATOM   4655  C  "C1'" . DC  B  2 83  ? -54.062 -20.779 73.924 1.00 70.22  ? 10   DC  J "C1'" 1 
ATOM   4656  N  N1    . DC  B  2 83  ? -53.120 -19.861 73.195 1.00 69.48  ? 10   DC  J N1    1 
ATOM   4657  C  C2    . DC  B  2 83  ? -52.828 -18.602 73.751 1.00 69.66  ? 10   DC  J C2    1 
ATOM   4658  O  O2    . DC  B  2 83  ? -53.349 -18.255 74.818 1.00 69.07  ? 10   DC  J O2    1 
ATOM   4659  N  N3    . DC  B  2 83  ? -51.969 -17.776 73.095 1.00 70.08  ? 10   DC  J N3    1 
ATOM   4660  C  C4    . DC  B  2 83  ? -51.411 -18.160 71.946 1.00 69.42  ? 10   DC  J C4    1 
ATOM   4661  N  N4    . DC  B  2 83  ? -50.583 -17.292 71.367 1.00 69.03  ? 10   DC  J N4    1 
ATOM   4662  C  C5    . DC  B  2 83  ? -51.683 -19.440 71.363 1.00 68.88  ? 10   DC  J C5    1 
ATOM   4663  C  C6    . DC  B  2 83  ? -52.531 -20.250 72.016 1.00 68.92  ? 10   DC  J C6    1 
ATOM   4664  P  P     . DA  B  2 84  ? -57.831 -23.311 72.773 1.00 84.05  ? 11   DA  J P     1 
ATOM   4665  O  OP1   . DA  B  2 84  ? -58.521 -24.609 72.967 1.00 83.49  ? 11   DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B  2 84  ? -57.427 -22.942 71.397 1.00 84.19  ? 11   DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B  2 84  ? -58.708 -22.112 73.366 1.00 87.18  ? 11   DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B  2 84  ? -60.085 -22.003 73.024 1.00 92.73  ? 11   DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B  2 84  ? -60.457 -20.562 72.713 1.00 96.51  ? 11   DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B  2 84  ? -59.265 -19.755 72.512 1.00 97.57  ? 11   DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B  2 84  ? -61.309 -20.392 71.457 1.00 98.61  ? 11   DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B  2 84  ? -62.377 -19.459 71.705 1.00 100.54 ? 11   DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B  2 84  ? -60.311 -19.897 70.407 1.00 98.81  ? 11   DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B  2 84  ? -59.325 -19.096 71.258 1.00 98.96  ? 11   DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B  2 84  ? -57.962 -18.991 70.714 1.00 99.47  ? 11   DA  J N9    1 
ATOM   4676  C  C8    . DA  B  2 84  ? -57.111 -20.025 70.416 1.00 99.40  ? 11   DA  J C8    1 
ATOM   4677  N  N7    . DA  B  2 84  ? -55.941 -19.654 69.950 1.00 99.21  ? 11   DA  J N7    1 
ATOM   4678  C  C5    . DA  B  2 84  ? -56.025 -18.272 69.939 1.00 99.39  ? 11   DA  J C5    1 
ATOM   4679  C  C6    . DA  B  2 84  ? -55.105 -17.275 69.549 1.00 99.21  ? 11   DA  J C6    1 
ATOM   4680  N  N6    . DA  B  2 84  ? -53.886 -17.565 69.085 1.00 99.08  ? 11   DA  J N6    1 
ATOM   4681  N  N1    . DA  B  2 84  ? -55.489 -15.980 69.653 1.00 99.25  ? 11   DA  J N1    1 
ATOM   4682  C  C2    . DA  B  2 84  ? -56.718 -15.703 70.121 1.00 99.27  ? 11   DA  J C2    1 
ATOM   4683  N  N3    . DA  B  2 84  ? -57.669 -16.554 70.519 1.00 99.37  ? 11   DA  J N3    1 
ATOM   4684  C  C4    . DA  B  2 84  ? -57.260 -17.838 70.405 1.00 99.53  ? 11   DA  J C4    1 
ATOM   4685  P  P     . DT  B  2 85  ? -63.673 -19.410 70.757 1.00 102.10 ? 12   DT  J P     1 
ATOM   4686  O  OP1   . DT  B  2 85  ? -64.863 -19.137 71.598 1.00 102.24 ? 12   DT  J OP1   1 
ATOM   4687  O  OP2   . DT  B  2 85  ? -63.656 -20.606 69.878 1.00 101.76 ? 12   DT  J OP2   1 
ATOM   4688  O  "O5'" . DT  B  2 85  ? -63.386 -18.120 69.857 1.00 102.66 ? 12   DT  J "O5'" 1 
ATOM   4689  C  "C5'" . DT  B  2 85  ? -63.120 -16.846 70.443 1.00 104.06 ? 12   DT  J "C5'" 1 
ATOM   4690  C  "C4'" . DT  B  2 85  ? -62.876 -15.809 69.358 1.00 105.62 ? 12   DT  J "C4'" 1 
ATOM   4691  O  "O4'" . DT  B  2 85  ? -61.470 -15.788 69.003 1.00 105.80 ? 12   DT  J "O4'" 1 
ATOM   4692  C  "C3'" . DT  B  2 85  ? -63.639 -16.022 68.046 1.00 106.49 ? 12   DT  J "C3'" 1 
ATOM   4693  O  "O3'" . DT  B  2 85  ? -64.186 -14.784 67.568 1.00 107.55 ? 12   DT  J "O3'" 1 
ATOM   4694  C  "C2'" . DT  B  2 85  ? -62.581 -16.588 67.104 1.00 106.22 ? 12   DT  J "C2'" 1 
ATOM   4695  C  "C1'" . DT  B  2 85  ? -61.355 -15.826 67.595 1.00 106.27 ? 12   DT  J "C1'" 1 
ATOM   4696  N  N1    . DT  B  2 85  ? -60.027 -16.423 67.230 1.00 106.52 ? 12   DT  J N1    1 
ATOM   4697  C  C2    . DT  B  2 85  ? -58.905 -15.613 67.269 1.00 106.40 ? 12   DT  J C2    1 
ATOM   4698  O  O2    . DT  B  2 85  ? -58.935 -14.433 67.582 1.00 106.43 ? 12   DT  J O2    1 
ATOM   4699  N  N3    . DT  B  2 85  ? -57.732 -16.243 66.923 1.00 106.29 ? 12   DT  J N3    1 
ATOM   4700  C  C4    . DT  B  2 85  ? -57.572 -17.570 66.550 1.00 106.38 ? 12   DT  J C4    1 
ATOM   4701  O  O4    . DT  B  2 85  ? -56.470 -18.024 66.255 1.00 106.27 ? 12   DT  J O4    1 
ATOM   4702  C  C5    . DT  B  2 85  ? -58.786 -18.366 66.531 1.00 106.50 ? 12   DT  J C5    1 
ATOM   4703  C  C7    . DT  B  2 85  ? -58.758 -19.820 66.148 1.00 106.28 ? 12   DT  J C7    1 
ATOM   4704  C  C6    . DT  B  2 85  ? -59.937 -17.760 66.869 1.00 106.56 ? 12   DT  J C6    1 
ATOM   4705  P  P     . DG  B  2 86  ? -65.775 -14.566 67.551 1.00 108.09 ? 13   DG  J P     1 
ATOM   4706  O  OP1   . DG  B  2 86  ? -66.293 -14.907 68.900 1.00 108.00 ? 13   DG  J OP1   1 
ATOM   4707  O  OP2   . DG  B  2 86  ? -66.291 -15.287 66.361 1.00 107.64 ? 13   DG  J OP2   1 
ATOM   4708  O  "O5'" . DG  B  2 86  ? -65.964 -12.990 67.313 1.00 107.82 ? 13   DG  J "O5'" 1 
ATOM   4709  C  "C5'" . DG  B  2 86  ? -65.246 -12.009 68.070 1.00 108.47 ? 13   DG  J "C5'" 1 
ATOM   4710  C  "C4'" . DG  B  2 86  ? -64.402 -11.125 67.157 1.00 109.10 ? 13   DG  J "C4'" 1 
ATOM   4711  O  "O4'" . DG  B  2 86  ? -63.363 -11.912 66.512 1.00 109.50 ? 13   DG  J "O4'" 1 
ATOM   4712  C  "C3'" . DG  B  2 86  ? -65.123 -10.439 65.997 1.00 109.19 ? 13   DG  J "C3'" 1 
ATOM   4713  O  "O3'" . DG  B  2 86  ? -64.414 -9.256  65.636 1.00 108.78 ? 13   DG  J "O3'" 1 
ATOM   4714  C  "C2'" . DG  B  2 86  ? -65.009 -11.473 64.880 1.00 109.52 ? 13   DG  J "C2'" 1 
ATOM   4715  C  "C1'" . DG  B  2 86  ? -63.571 -11.940 65.106 1.00 109.50 ? 13   DG  J "C1'" 1 
ATOM   4716  N  N9    . DG  B  2 86  ? -63.237 -13.285 64.642 1.00 109.45 ? 13   DG  J N9    1 
ATOM   4717  C  C8    . DG  B  2 86  ? -64.076 -14.329 64.319 1.00 109.44 ? 13   DG  J C8    1 
ATOM   4718  N  N7    . DG  B  2 86  ? -63.451 -15.411 63.943 1.00 109.29 ? 13   DG  J N7    1 
ATOM   4719  C  C5    . DG  B  2 86  ? -62.107 -15.060 64.025 1.00 109.67 ? 13   DG  J C5    1 
ATOM   4720  C  C6    . DG  B  2 86  ? -60.937 -15.821 63.750 1.00 109.73 ? 13   DG  J C6    1 
ATOM   4721  O  O6    . DG  B  2 86  ? -60.866 -16.999 63.353 1.00 109.46 ? 13   DG  J O6    1 
ATOM   4722  N  N1    . DG  B  2 86  ? -59.770 -15.072 63.964 1.00 109.44 ? 13   DG  J N1    1 
ATOM   4723  C  C2    . DG  B  2 86  ? -59.741 -13.761 64.397 1.00 109.34 ? 13   DG  J C2    1 
ATOM   4724  N  N2    . DG  B  2 86  ? -58.539 -13.193 64.554 1.00 109.43 ? 13   DG  J N2    1 
ATOM   4725  N  N3    . DG  B  2 86  ? -60.825 -13.045 64.662 1.00 109.44 ? 13   DG  J N3    1 
ATOM   4726  C  C4    . DG  B  2 86  ? -61.964 -13.755 64.456 1.00 109.53 ? 13   DG  J C4    1 
ATOM   4727  P  P     . DC  B  2 87  ? -65.115 -7.821  65.678 1.00 108.23 ? 14   DC  J P     1 
ATOM   4728  O  OP1   . DC  B  2 87  ? -65.281 -7.489  67.119 1.00 108.53 ? 14   DC  J OP1   1 
ATOM   4729  O  OP2   . DC  B  2 87  ? -66.269 -7.863  64.744 1.00 107.90 ? 14   DC  J OP2   1 
ATOM   4730  O  "O5'" . DC  B  2 87  ? -64.028 -6.824  65.040 1.00 106.58 ? 14   DC  J "O5'" 1 
ATOM   4731  C  "C5'" . DC  B  2 87  ? -62.914 -6.355  65.813 1.00 103.89 ? 14   DC  J "C5'" 1 
ATOM   4732  C  "C4'" . DC  B  2 87  ? -61.615 -6.476  65.031 1.00 101.86 ? 14   DC  J "C4'" 1 
ATOM   4733  O  "O4'" . DC  B  2 87  ? -61.454 -7.832  64.546 1.00 101.31 ? 14   DC  J "O4'" 1 
ATOM   4734  C  "C3'" . DC  B  2 87  ? -61.518 -5.554  63.819 1.00 100.60 ? 14   DC  J "C3'" 1 
ATOM   4735  O  "O3'" . DC  B  2 87  ? -60.316 -4.792  63.919 1.00 99.11  ? 14   DC  J "O3'" 1 
ATOM   4736  C  "C2'" . DC  B  2 87  ? -61.546 -6.485  62.607 1.00 100.48 ? 14   DC  J "C2'" 1 
ATOM   4737  C  "C1'" . DC  B  2 87  ? -61.073 -7.817  63.187 1.00 101.01 ? 14   DC  J "C1'" 1 
ATOM   4738  N  N1    . DC  B  2 87  ? -61.621 -9.057  62.512 1.00 101.13 ? 14   DC  J N1    1 
ATOM   4739  C  C2    . DC  B  2 87  ? -60.789 -10.175 62.287 1.00 101.06 ? 14   DC  J C2    1 
ATOM   4740  O  O2    . DC  B  2 87  ? -59.602 -10.155 62.640 1.00 101.14 ? 14   DC  J O2    1 
ATOM   4741  N  N3    . DC  B  2 87  ? -61.307 -11.272 61.678 1.00 100.76 ? 14   DC  J N3    1 
ATOM   4742  C  C4    . DC  B  2 87  ? -62.585 -11.290 61.300 1.00 100.79 ? 14   DC  J C4    1 
ATOM   4743  N  N4    . DC  B  2 87  ? -63.040 -12.395 60.707 1.00 101.00 ? 14   DC  J N4    1 
ATOM   4744  C  C5    . DC  B  2 87  ? -63.451 -10.178 61.514 1.00 100.99 ? 14   DC  J C5    1 
ATOM   4745  C  C6    . DC  B  2 87  ? -62.932 -9.098  62.117 1.00 101.24 ? 14   DC  J C6    1 
ATOM   4746  P  P     . DC  B  2 88  ? -60.038 -3.520  62.980 1.00 98.47  ? 15   DC  J P     1 
ATOM   4747  O  OP1   . DC  B  2 88  ? -59.137 -2.582  63.694 1.00 97.74  ? 15   DC  J OP1   1 
ATOM   4748  O  OP2   . DC  B  2 88  ? -61.326 -3.047  62.409 1.00 98.17  ? 15   DC  J OP2   1 
ATOM   4749  O  "O5'" . DC  B  2 88  ? -59.212 -4.187  61.792 1.00 96.77  ? 15   DC  J "O5'" 1 
ATOM   4750  C  "C5'" . DC  B  2 88  ? -58.107 -5.036  62.070 1.00 94.22  ? 15   DC  J "C5'" 1 
ATOM   4751  C  "C4'" . DC  B  2 88  ? -57.686 -5.735  60.794 1.00 92.12  ? 15   DC  J "C4'" 1 
ATOM   4752  O  "O4'" . DC  B  2 88  ? -58.592 -6.822  60.486 1.00 91.34  ? 15   DC  J "O4'" 1 
ATOM   4753  C  "C3'" . DC  B  2 88  ? -57.686 -4.829  59.569 1.00 91.00  ? 15   DC  J "C3'" 1 
ATOM   4754  O  "O3'" . DC  B  2 88  ? -56.473 -5.042  58.889 1.00 89.15  ? 15   DC  J "O3'" 1 
ATOM   4755  C  "C2'" . DC  B  2 88  ? -58.886 -5.307  58.755 1.00 90.80  ? 15   DC  J "C2'" 1 
ATOM   4756  C  "C1'" . DC  B  2 88  ? -58.866 -6.786  59.103 1.00 91.28  ? 15   DC  J "C1'" 1 
ATOM   4757  N  N1    . DC  B  2 88  ? -60.130 -7.527  58.851 1.00 91.33  ? 15   DC  J N1    1 
ATOM   4758  C  C2    . DC  B  2 88  ? -60.069 -8.911  58.611 1.00 91.55  ? 15   DC  J C2    1 
ATOM   4759  O  O2    . DC  B  2 88  ? -58.977 -9.492  58.604 1.00 91.34  ? 15   DC  J O2    1 
ATOM   4760  N  N3    . DC  B  2 88  ? -61.225 -9.590  58.388 1.00 91.99  ? 15   DC  J N3    1 
ATOM   4761  C  C4    . DC  B  2 88  ? -62.394 -8.939  58.399 1.00 91.69  ? 15   DC  J C4    1 
ATOM   4762  N  N4    . DC  B  2 88  ? -63.492 -9.660  58.169 1.00 91.51  ? 15   DC  J N4    1 
ATOM   4763  C  C5    . DC  B  2 88  ? -62.483 -7.531  58.642 1.00 91.45  ? 15   DC  J C5    1 
ATOM   4764  C  C6    . DC  B  2 88  ? -61.336 -6.873  58.864 1.00 91.52  ? 15   DC  J C6    1 
ATOM   4765  P  P     . DT  B  2 89  ? -55.799 -3.907  57.993 1.00 87.38  ? 16   DT  J P     1 
ATOM   4766  O  OP1   . DT  B  2 89  ? -55.152 -2.906  58.878 1.00 87.13  ? 16   DT  J OP1   1 
ATOM   4767  O  OP2   . DT  B  2 89  ? -56.779 -3.478  56.970 1.00 87.21  ? 16   DT  J OP2   1 
ATOM   4768  O  "O5'" . DT  B  2 89  ? -54.671 -4.777  57.263 1.00 85.43  ? 16   DT  J "O5'" 1 
ATOM   4769  C  "C5'" . DT  B  2 89  ? -53.946 -5.792  57.963 1.00 81.32  ? 16   DT  J "C5'" 1 
ATOM   4770  C  "C4'" . DT  B  2 89  ? -53.945 -7.095  57.182 1.00 78.34  ? 16   DT  J "C4'" 1 
ATOM   4771  O  "O4'" . DT  B  2 89  ? -55.293 -7.622  57.100 1.00 78.08  ? 16   DT  J "O4'" 1 
ATOM   4772  C  "C3'" . DT  B  2 89  ? -53.431 -6.991  55.747 1.00 76.20  ? 16   DT  J "C3'" 1 
ATOM   4773  O  "O3'" . DT  B  2 89  ? -52.428 -7.961  55.533 1.00 72.47  ? 16   DT  J "O3'" 1 
ATOM   4774  C  "C2'" . DT  B  2 89  ? -54.650 -7.270  54.878 1.00 76.40  ? 16   DT  J "C2'" 1 
ATOM   4775  C  "C1'" . DT  B  2 89  ? -55.526 -8.104  55.795 1.00 77.74  ? 16   DT  J "C1'" 1 
ATOM   4776  N  N1    . DT  B  2 89  ? -56.979 -7.975  55.488 1.00 78.40  ? 16   DT  J N1    1 
ATOM   4777  C  C2    . DT  B  2 89  ? -57.695 -9.117  55.190 1.00 78.37  ? 16   DT  J C2    1 
ATOM   4778  O  O2    . DT  B  2 89  ? -57.207 -10.232 55.165 1.00 78.53  ? 16   DT  J O2    1 
ATOM   4779  N  N3    . DT  B  2 89  ? -59.022 -8.907  54.916 1.00 78.58  ? 16   DT  J N3    1 
ATOM   4780  C  C4    . DT  B  2 89  ? -59.697 -7.700  54.912 1.00 78.67  ? 16   DT  J C4    1 
ATOM   4781  O  O4    . DT  B  2 89  ? -60.898 -7.655  54.649 1.00 78.78  ? 16   DT  J O4    1 
ATOM   4782  C  C5    . DT  B  2 89  ? -58.891 -6.533  55.233 1.00 78.56  ? 16   DT  J C5    1 
ATOM   4783  C  C7    . DT  B  2 89  ? -59.485 -5.156  55.261 1.00 78.12  ? 16   DT  J C7    1 
ATOM   4784  C  C6    . DT  B  2 89  ? -57.590 -6.725  55.502 1.00 78.53  ? 16   DT  J C6    1 
ATOM   4785  P  P     . DT  B  2 90  ? -51.593 -8.018  54.176 1.00 69.32  ? 17   DT  J P     1 
ATOM   4786  O  OP1   . DT  B  2 90  ? -50.245 -8.417  54.611 1.00 69.66  ? 17   DT  J OP1   1 
ATOM   4787  O  OP2   . DT  B  2 90  ? -51.770 -6.801  53.358 1.00 68.62  ? 17   DT  J OP2   1 
ATOM   4788  O  "O5'" . DT  B  2 90  ? -52.287 -9.210  53.375 1.00 67.96  ? 17   DT  J "O5'" 1 
ATOM   4789  C  "C5'" . DT  B  2 90  ? -52.181 -10.524 53.881 1.00 67.16  ? 17   DT  J "C5'" 1 
ATOM   4790  C  "C4'" . DT  B  2 90  ? -53.067 -11.489 53.120 1.00 67.01  ? 17   DT  J "C4'" 1 
ATOM   4791  O  "O4'" . DT  B  2 90  ? -54.466 -11.102 53.200 1.00 67.24  ? 17   DT  J "O4'" 1 
ATOM   4792  C  "C3'" . DT  B  2 90  ? -52.756 -11.719 51.645 1.00 66.22  ? 17   DT  J "C3'" 1 
ATOM   4793  O  "O3'" . DT  B  2 90  ? -52.903 -13.109 51.421 1.00 65.66  ? 17   DT  J "O3'" 1 
ATOM   4794  C  "C2'" . DT  B  2 90  ? -53.842 -10.914 50.956 1.00 65.61  ? 17   DT  J "C2'" 1 
ATOM   4795  C  "C1'" . DT  B  2 90  ? -55.014 -11.149 51.902 1.00 66.66  ? 17   DT  J "C1'" 1 
ATOM   4796  N  N1    . DT  B  2 90  ? -56.123 -10.156 51.825 1.00 66.31  ? 17   DT  J N1    1 
ATOM   4797  C  C2    . DT  B  2 90  ? -57.425 -10.602 51.680 1.00 66.33  ? 17   DT  J C2    1 
ATOM   4798  O  O2    . DT  B  2 90  ? -57.757 -11.775 51.606 1.00 66.17  ? 17   DT  J O2    1 
ATOM   4799  N  N3    . DT  B  2 90  ? -58.352 -9.596  51.617 1.00 66.87  ? 17   DT  J N3    1 
ATOM   4800  C  C4    . DT  B  2 90  ? -58.135 -8.228  51.688 1.00 67.13  ? 17   DT  J C4    1 
ATOM   4801  O  O4    . DT  B  2 90  ? -59.068 -7.422  51.623 1.00 67.06  ? 17   DT  J O4    1 
ATOM   4802  C  C5    . DT  B  2 90  ? -56.748 -7.833  51.840 1.00 66.78  ? 17   DT  J C5    1 
ATOM   4803  C  C7    . DT  B  2 90  ? -56.353 -6.384  51.922 1.00 66.43  ? 17   DT  J C7    1 
ATOM   4804  C  C6    . DT  B  2 90  ? -55.829 -8.808  51.900 1.00 66.50  ? 17   DT  J C6    1 
ATOM   4805  P  P     . DT  B  2 91  ? -52.233 -13.867 50.191 1.00 65.73  ? 18   DT  J P     1 
ATOM   4806  O  OP1   . DT  B  2 91  ? -51.461 -15.027 50.683 1.00 66.08  ? 18   DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B  2 91  ? -51.634 -12.876 49.281 1.00 65.07  ? 18   DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B  2 91  ? -53.532 -14.474 49.508 1.00 68.04  ? 18   DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B  2 91  ? -54.358 -15.390 50.234 1.00 69.37  ? 18   DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B  2 91  ? -55.706 -15.502 49.553 1.00 70.54  ? 18   DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B  2 91  ? -56.358 -14.214 49.643 1.00 71.05  ? 18   DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B  2 91  ? -55.632 -15.843 48.067 1.00 70.94  ? 18   DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B  2 91  ? -56.399 -17.014 47.794 1.00 71.88  ? 18   DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B  2 91  ? -56.155 -14.595 47.347 1.00 71.16  ? 18   DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B  2 91  ? -57.024 -13.955 48.422 1.00 72.31  ? 18   DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B  2 91  ? -57.278 -12.463 48.353 1.00 72.68  ? 18   DT  J N1    1 
ATOM   4817  C  C2    . DT  B  2 91  ? -58.583 -12.000 48.354 1.00 73.23  ? 18   DT  J C2    1 
ATOM   4818  O  O2    . DT  B  2 91  ? -59.555 -12.737 48.384 1.00 73.70  ? 18   DT  J O2    1 
ATOM   4819  N  N3    . DT  B  2 91  ? -58.717 -10.631 48.316 1.00 72.79  ? 18   DT  J N3    1 
ATOM   4820  C  C4    . DT  B  2 91  ? -57.695 -9.701  48.284 1.00 72.76  ? 18   DT  J C4    1 
ATOM   4821  O  O4    . DT  B  2 91  ? -57.897 -8.496  48.254 1.00 73.38  ? 18   DT  J O4    1 
ATOM   4822  C  C5    . DT  B  2 91  ? -56.366 -10.242 48.288 1.00 72.92  ? 18   DT  J C5    1 
ATOM   4823  C  C7    . DT  B  2 91  ? -55.192 -9.313  48.245 1.00 73.16  ? 18   DT  J C7    1 
ATOM   4824  C  C6    . DT  B  2 91  ? -56.219 -11.574 48.329 1.00 72.96  ? 18   DT  J C6    1 
ATOM   4825  P  P     . DT  B  2 92  ? -56.310 -17.718 46.355 1.00 72.67  ? 19   DT  J P     1 
ATOM   4826  O  OP1   . DT  B  2 92  ? -56.514 -19.177 46.504 1.00 72.00  ? 19   DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B  2 92  ? -55.084 -17.230 45.682 1.00 72.56  ? 19   DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B  2 92  ? -57.582 -17.085 45.616 1.00 75.16  ? 19   DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B  2 92  ? -58.899 -17.274 46.133 1.00 78.71  ? 19   DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B  2 92  ? -59.903 -16.414 45.384 1.00 81.74  ? 19   DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B  2 92  ? -59.651 -15.012 45.638 1.00 81.96  ? 19   DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B  2 92  ? -59.909 -16.571 43.868 1.00 84.09  ? 19   DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B  2 92  ? -61.261 -16.673 43.435 1.00 87.96  ? 19   DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B  2 92  ? -59.266 -15.281 43.372 1.00 83.80  ? 19   DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B  2 92  ? -59.780 -14.306 44.423 1.00 83.68  ? 19   DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B  2 92  ? -59.070 -12.984 44.586 1.00 84.30  ? 19   DT  J N1    1 
ATOM   4837  C  C2    . DT  B  2 92  ? -59.842 -11.851 44.740 1.00 84.45  ? 19   DT  J C2    1 
ATOM   4838  O  O2    . DT  B  2 92  ? -61.059 -11.877 44.729 1.00 84.74  ? 19   DT  J O2    1 
ATOM   4839  N  N3    . DT  B  2 92  ? -59.140 -10.679 44.906 1.00 84.37  ? 19   DT  J N3    1 
ATOM   4840  C  C4    . DT  B  2 92  ? -57.763 -10.523 44.939 1.00 84.24  ? 19   DT  J C4    1 
ATOM   4841  O  O4    . DT  B  2 92  ? -57.233 -9.427  45.090 1.00 84.00  ? 19   DT  J O4    1 
ATOM   4842  C  C5    . DT  B  2 92  ? -57.004 -11.741 44.775 1.00 84.53  ? 19   DT  J C5    1 
ATOM   4843  C  C7    . DT  B  2 92  ? -55.503 -11.698 44.788 1.00 84.34  ? 19   DT  J C7    1 
ATOM   4844  C  C6    . DT  B  2 92  ? -57.683 -12.896 44.615 1.00 84.66  ? 19   DT  J C6    1 
ATOM   4845  P  P     . DG  B  2 93  ? -61.735 -17.689 42.289 1.00 90.73  ? 20   DG  J P     1 
ATOM   4846  O  OP1   . DG  B  2 93  ? -62.910 -18.416 42.829 1.00 90.63  ? 20   DG  J OP1   1 
ATOM   4847  O  OP2   . DG  B  2 93  ? -60.569 -18.441 41.765 1.00 90.23  ? 20   DG  J OP2   1 
ATOM   4848  O  "O5'" . DG  B  2 93  ? -62.219 -16.699 41.130 1.00 92.01  ? 20   DG  J "O5'" 1 
ATOM   4849  C  "C5'" . DG  B  2 93  ? -63.433 -15.990 41.285 1.00 94.92  ? 20   DG  J "C5'" 1 
ATOM   4850  C  "C4'" . DG  B  2 93  ? -63.326 -14.623 40.642 1.00 97.28  ? 20   DG  J "C4'" 1 
ATOM   4851  O  "O4'" . DG  B  2 93  ? -62.251 -13.862 41.252 1.00 98.14  ? 20   DG  J "O4'" 1 
ATOM   4852  C  "C3'" . DG  B  2 93  ? -63.023 -14.639 39.145 1.00 98.61  ? 20   DG  J "C3'" 1 
ATOM   4853  O  "O3'" . DG  B  2 93  ? -63.858 -13.685 38.508 1.00 100.31 ? 20   DG  J "O3'" 1 
ATOM   4854  C  "C2'" . DG  B  2 93  ? -61.565 -14.204 39.076 1.00 98.72  ? 20   DG  J "C2'" 1 
ATOM   4855  C  "C1'" . DG  B  2 93  ? -61.601 -13.177 40.201 1.00 98.57  ? 20   DG  J "C1'" 1 
ATOM   4856  N  N9    . DG  B  2 93  ? -60.305 -12.653 40.627 1.00 98.55  ? 20   DG  J N9    1 
ATOM   4857  C  C8    . DG  B  2 93  ? -59.133 -13.340 40.821 1.00 98.39  ? 20   DG  J C8    1 
ATOM   4858  N  N7    . DG  B  2 93  ? -58.146 -12.582 41.205 1.00 98.43  ? 20   DG  J N7    1 
ATOM   4859  C  C5    . DG  B  2 93  ? -58.694 -11.310 41.264 1.00 98.41  ? 20   DG  J C5    1 
ATOM   4860  C  C6    . DG  B  2 93  ? -58.101 -10.070 41.617 1.00 98.55  ? 20   DG  J C6    1 
ATOM   4861  O  O6    . DG  B  2 93  ? -56.929 -9.850  41.959 1.00 98.52  ? 20   DG  J O6    1 
ATOM   4862  N  N1    . DG  B  2 93  ? -59.015 -9.016  41.547 1.00 98.49  ? 20   DG  J N1    1 
ATOM   4863  C  C2    . DG  B  2 93  ? -60.338 -9.152  41.178 1.00 98.53  ? 20   DG  J C2    1 
ATOM   4864  N  N2    . DG  B  2 93  ? -61.075 -8.034  41.162 1.00 98.50  ? 20   DG  J N2    1 
ATOM   4865  N  N3    . DG  B  2 93  ? -60.904 -10.308 40.846 1.00 98.36  ? 20   DG  J N3    1 
ATOM   4866  C  C4    . DG  B  2 93  ? -60.025 -11.339 40.910 1.00 98.38  ? 20   DG  J C4    1 
ATOM   4867  P  P     . DA  B  2 94  ? -64.467 -13.980 37.059 1.00 101.40 ? 21   DA  J P     1 
ATOM   4868  O  OP1   . DA  B  2 94  ? -65.110 -15.317 37.121 1.00 101.03 ? 21   DA  J OP1   1 
ATOM   4869  O  OP2   . DA  B  2 94  ? -63.406 -13.708 36.059 1.00 100.70 ? 21   DA  J OP2   1 
ATOM   4870  O  "O5'" . DA  B  2 94  ? -65.607 -12.859 36.901 1.00 101.45 ? 21   DA  J "O5'" 1 
ATOM   4871  C  "C5'" . DA  B  2 94  ? -65.828 -11.847 37.895 1.00 101.36 ? 21   DA  J "C5'" 1 
ATOM   4872  C  "C4'" . DA  B  2 94  ? -65.320 -10.488 37.438 1.00 101.16 ? 21   DA  J "C4'" 1 
ATOM   4873  O  "O4'" . DA  B  2 94  ? -64.005 -10.243 37.997 1.00 101.03 ? 21   DA  J "O4'" 1 
ATOM   4874  C  "C3'" . DA  B  2 94  ? -65.176 -10.281 35.926 1.00 101.34 ? 21   DA  J "C3'" 1 
ATOM   4875  O  "O3'" . DA  B  2 94  ? -65.701 -8.994  35.583 1.00 101.60 ? 21   DA  J "O3'" 1 
ATOM   4876  C  "C2'" . DA  B  2 94  ? -63.667 -10.342 35.700 1.00 100.94 ? 21   DA  J "C2'" 1 
ATOM   4877  C  "C1'" . DA  B  2 94  ? -63.180 -9.690  36.988 1.00 100.53 ? 21   DA  J "C1'" 1 
ATOM   4878  N  N9    . DA  B  2 94  ? -61.771 -9.932  37.301 1.00 100.37 ? 21   DA  J N9    1 
ATOM   4879  C  C8    . DA  B  2 94  ? -61.109 -11.130 37.268 1.00 100.26 ? 21   DA  J C8    1 
ATOM   4880  N  N7    . DA  B  2 94  ? -59.845 -11.053 37.599 1.00 100.12 ? 21   DA  J N7    1 
ATOM   4881  C  C5    . DA  B  2 94  ? -59.658 -9.709  37.869 1.00 100.07 ? 21   DA  J C5    1 
ATOM   4882  C  C6    . DA  B  2 94  ? -58.527 -8.974  38.279 1.00 100.01 ? 21   DA  J C6    1 
ATOM   4883  N  N6    . DA  B  2 94  ? -57.331 -9.528  38.489 1.00 100.08 ? 21   DA  J N6    1 
ATOM   4884  N  N1    . DA  B  2 94  ? -58.675 -7.644  38.468 1.00 100.25 ? 21   DA  J N1    1 
ATOM   4885  C  C2    . DA  B  2 94  ? -59.879 -7.087  38.255 1.00 100.43 ? 21   DA  J C2    1 
ATOM   4886  N  N3    . DA  B  2 94  ? -61.016 -7.676  37.871 1.00 100.29 ? 21   DA  J N3    1 
ATOM   4887  C  C4    . DA  B  2 94  ? -60.836 -9.000  37.693 1.00 100.16 ? 21   DA  J C4    1 
ATOM   4888  P  P     . DT  B  2 95  ? -66.069 -8.556  34.087 1.00 100.44 ? 22   DT  J P     1 
ATOM   4889  O  OP1   . DT  B  2 95  ? -67.434 -7.993  34.162 1.00 100.33 ? 22   DT  J OP1   1 
ATOM   4890  O  OP2   . DT  B  2 95  ? -65.742 -9.652  33.146 1.00 99.94  ? 22   DT  J OP2   1 
ATOM   4891  O  "O5'" . DT  B  2 95  ? -65.037 -7.378  33.802 1.00 99.49  ? 22   DT  J "O5'" 1 
ATOM   4892  C  "C5'" . DT  B  2 95  ? -65.136 -6.153  34.499 1.00 98.53  ? 22   DT  J "C5'" 1 
ATOM   4893  C  "C4'" . DT  B  2 95  ? -63.954 -5.286  34.110 1.00 98.30  ? 22   DT  J "C4'" 1 
ATOM   4894  O  "O4'" . DT  B  2 95  ? -62.731 -5.846  34.654 1.00 98.19  ? 22   DT  J "O4'" 1 
ATOM   4895  C  "C3'" . DT  B  2 95  ? -63.702 -5.123  32.609 1.00 98.03  ? 22   DT  J "C3'" 1 
ATOM   4896  O  "O3'" . DT  B  2 95  ? -63.389 -3.750  32.390 1.00 97.78  ? 22   DT  J "O3'" 1 
ATOM   4897  C  "C2'" . DT  B  2 95  ? -62.486 -6.015  32.352 1.00 97.88  ? 22   DT  J "C2'" 1 
ATOM   4898  C  "C1'" . DT  B  2 95  ? -61.734 -5.760  33.656 1.00 97.66  ? 22   DT  J "C1'" 1 
ATOM   4899  N  N1    . DT  B  2 95  ? -60.607 -6.684  34.003 1.00 97.47  ? 22   DT  J N1    1 
ATOM   4900  C  C2    . DT  B  2 95  ? -59.438 -6.139  34.495 1.00 97.12  ? 22   DT  J C2    1 
ATOM   4901  O  O2    . DT  B  2 95  ? -59.268 -4.946  34.653 1.00 97.22  ? 22   DT  J O2    1 
ATOM   4902  N  N3    . DT  B  2 95  ? -58.457 -7.050  34.796 1.00 97.02  ? 22   DT  J N3    1 
ATOM   4903  C  C4    . DT  B  2 95  ? -58.522 -8.428  34.665 1.00 97.40  ? 22   DT  J C4    1 
ATOM   4904  O  O4    . DT  B  2 95  ? -57.572 -9.150  34.968 1.00 97.32  ? 22   DT  J O4    1 
ATOM   4905  C  C5    . DT  B  2 95  ? -59.778 -8.938  34.149 1.00 97.51  ? 22   DT  J C5    1 
ATOM   4906  C  C7    . DT  B  2 95  ? -59.993 -10.413 33.952 1.00 97.27  ? 22   DT  J C7    1 
ATOM   4907  C  C6    . DT  B  2 95  ? -60.746 -8.053  33.851 1.00 97.56  ? 22   DT  J C6    1 
ATOM   4908  P  P     . DG  B  2 96  ? -63.731 -2.968  31.038 1.00 96.48  ? 23   DG  J P     1 
ATOM   4909  O  OP1   . DG  B  2 96  ? -65.168 -3.191  30.754 1.00 96.90  ? 23   DG  J OP1   1 
ATOM   4910  O  OP2   . DG  B  2 96  ? -62.707 -3.301  30.014 1.00 95.51  ? 23   DG  J OP2   1 
ATOM   4911  O  "O5'" . DG  B  2 96  ? -63.549 -1.453  31.530 1.00 95.00  ? 23   DG  J "O5'" 1 
ATOM   4912  C  "C5'" . DG  B  2 96  ? -62.807 -0.527  30.767 1.00 93.93  ? 23   DG  J "C5'" 1 
ATOM   4913  C  "C4'" . DG  B  2 96  ? -61.386 -0.399  31.284 1.00 92.99  ? 23   DG  J "C4'" 1 
ATOM   4914  O  "O4'" . DG  B  2 96  ? -60.859 -1.689  31.680 1.00 93.41  ? 23   DG  J "O4'" 1 
ATOM   4915  C  "C3'" . DG  B  2 96  ? -60.423 0.162   30.245 1.00 92.31  ? 23   DG  J "C3'" 1 
ATOM   4916  O  "O3'" . DG  B  2 96  ? -60.046 1.492   30.654 1.00 89.99  ? 23   DG  J "O3'" 1 
ATOM   4917  C  "C2'" . DG  B  2 96  ? -59.275 -0.857  30.180 1.00 92.75  ? 23   DG  J "C2'" 1 
ATOM   4918  C  "C1'" . DG  B  2 96  ? -59.474 -1.726  31.412 1.00 93.44  ? 23   DG  J "C1'" 1 
ATOM   4919  N  N9    . DG  B  2 96  ? -59.061 -3.125  31.256 1.00 93.65  ? 23   DG  J N9    1 
ATOM   4920  C  C8    . DG  B  2 96  ? -59.734 -4.137  30.605 1.00 93.67  ? 23   DG  J C8    1 
ATOM   4921  N  N7    . DG  B  2 96  ? -59.122 -5.289  30.634 1.00 93.53  ? 23   DG  J N7    1 
ATOM   4922  C  C5    . DG  B  2 96  ? -57.961 -5.031  31.356 1.00 93.81  ? 23   DG  J C5    1 
ATOM   4923  C  C6    . DG  B  2 96  ? -56.894 -5.894  31.729 1.00 93.74  ? 23   DG  J C6    1 
ATOM   4924  O  O6    . DG  B  2 96  ? -56.759 -7.100  31.474 1.00 93.74  ? 23   DG  J O6    1 
ATOM   4925  N  N1    . DG  B  2 96  ? -55.904 -5.231  32.458 1.00 93.55  ? 23   DG  J N1    1 
ATOM   4926  C  C2    . DG  B  2 96  ? -55.936 -3.898  32.796 1.00 93.59  ? 23   DG  J C2    1 
ATOM   4927  N  N2    . DG  B  2 96  ? -54.896 -3.428  33.500 1.00 93.45  ? 23   DG  J N2    1 
ATOM   4928  N  N3    . DG  B  2 96  ? -56.931 -3.080  32.462 1.00 94.07  ? 23   DG  J N3    1 
ATOM   4929  C  C4    . DG  B  2 96  ? -57.908 -3.705  31.745 1.00 93.92  ? 23   DG  J C4    1 
ATOM   4930  P  P     . DG  B  2 97  ? -58.781 2.271   30.051 1.00 88.59  ? 24   DG  J P     1 
ATOM   4931  O  OP1   . DG  B  2 97  ? -59.001 3.725   30.233 1.00 88.44  ? 24   DG  J OP1   1 
ATOM   4932  O  OP2   . DG  B  2 97  ? -58.455 1.715   28.712 1.00 87.33  ? 24   DG  J OP2   1 
ATOM   4933  O  "O5'" . DG  B  2 97  ? -57.646 1.831   31.089 1.00 87.09  ? 24   DG  J "O5'" 1 
ATOM   4934  C  "C5'" . DG  B  2 97  ? -56.334 2.352   30.990 1.00 84.01  ? 24   DG  J "C5'" 1 
ATOM   4935  C  "C4'" . DG  B  2 97  ? -55.352 1.276   30.568 1.00 81.35  ? 24   DG  J "C4'" 1 
ATOM   4936  O  "O4'" . DG  B  2 97  ? -55.998 -0.005  30.356 1.00 80.94  ? 24   DG  J "O4'" 1 
ATOM   4937  C  "C3'" . DG  B  2 97  ? -54.631 1.588   29.262 1.00 79.94  ? 24   DG  J "C3'" 1 
ATOM   4938  O  "O3'" . DG  B  2 97  ? -53.253 1.615   29.548 1.00 79.20  ? 24   DG  J "O3'" 1 
ATOM   4939  C  "C2'" . DG  B  2 97  ? -54.991 0.437   28.331 1.00 79.76  ? 24   DG  J "C2'" 1 
ATOM   4940  C  "C1'" . DG  B  2 97  ? -55.190 -0.633  29.389 1.00 79.93  ? 24   DG  J "C1'" 1 
ATOM   4941  N  N9    . DG  B  2 97  ? -55.781 -1.883  28.940 1.00 79.70  ? 24   DG  J N9    1 
ATOM   4942  C  C8    . DG  B  2 97  ? -56.910 -2.083  28.186 1.00 79.69  ? 24   DG  J C8    1 
ATOM   4943  N  N7    . DG  B  2 97  ? -57.163 -3.342  27.955 1.00 79.65  ? 24   DG  J N7    1 
ATOM   4944  C  C5    . DG  B  2 97  ? -56.129 -4.014  28.596 1.00 79.84  ? 24   DG  J C5    1 
ATOM   4945  C  C6    . DG  B  2 97  ? -55.858 -5.400  28.700 1.00 79.85  ? 24   DG  J C6    1 
ATOM   4946  O  O6    . DG  B  2 97  ? -56.517 -6.340  28.229 1.00 79.72  ? 24   DG  J O6    1 
ATOM   4947  N  N1    . DG  B  2 97  ? -54.700 -5.651  29.444 1.00 79.59  ? 24   DG  J N1    1 
ATOM   4948  C  C2    . DG  B  2 97  ? -53.903 -4.687  30.019 1.00 79.44  ? 24   DG  J C2    1 
ATOM   4949  N  N2    . DG  B  2 97  ? -52.836 -5.110  30.707 1.00 79.49  ? 24   DG  J N2    1 
ATOM   4950  N  N3    . DG  B  2 97  ? -54.145 -3.390  29.929 1.00 79.71  ? 24   DG  J N3    1 
ATOM   4951  C  C4    . DG  B  2 97  ? -55.268 -3.128  29.207 1.00 80.07  ? 24   DG  J C4    1 
ATOM   4952  P  P     . DA  B  2 98  ? -52.533 3.035   29.575 1.00 78.45  ? 25   DA  J P     1 
ATOM   4953  O  OP1   . DA  B  2 98  ? -53.353 3.910   30.452 1.00 77.74  ? 25   DA  J OP1   1 
ATOM   4954  O  OP2   . DA  B  2 98  ? -52.278 3.353   28.152 1.00 78.66  ? 25   DA  J OP2   1 
ATOM   4955  O  "O5'" . DA  B  2 98  ? -51.081 2.833   30.221 1.00 77.78  ? 25   DA  J "O5'" 1 
ATOM   4956  C  "C5'" . DA  B  2 98  ? -50.875 2.242   31.497 1.00 77.02  ? 25   DA  J "C5'" 1 
ATOM   4957  C  "C4'" . DA  B  2 98  ? -49.858 1.111   31.406 1.00 76.45  ? 25   DA  J "C4'" 1 
ATOM   4958  O  "O4'" . DA  B  2 98  ? -50.419 -0.027  30.702 1.00 75.80  ? 25   DA  J "O4'" 1 
ATOM   4959  C  "C3'" . DA  B  2 98  ? -48.555 1.434   30.684 1.00 76.12  ? 25   DA  J "C3'" 1 
ATOM   4960  O  "O3'" . DA  B  2 98  ? -47.509 0.906   31.483 1.00 75.51  ? 25   DA  J "O3'" 1 
ATOM   4961  C  "C2'" . DA  B  2 98  ? -48.714 0.776   29.305 1.00 75.78  ? 25   DA  J "C2'" 1 
ATOM   4962  C  "C1'" . DA  B  2 98  ? -49.596 -0.427  29.623 1.00 75.46  ? 25   DA  J "C1'" 1 
ATOM   4963  N  N9    . DA  B  2 98  ? -50.531 -0.915  28.603 1.00 75.26  ? 25   DA  J N9    1 
ATOM   4964  C  C8    . DA  B  2 98  ? -51.354 -0.201  27.778 1.00 75.04  ? 25   DA  J C8    1 
ATOM   4965  N  N7    . DA  B  2 98  ? -52.104 -0.944  26.993 1.00 74.92  ? 25   DA  J N7    1 
ATOM   4966  C  C5    . DA  B  2 98  ? -51.770 -2.244  27.332 1.00 75.15  ? 25   DA  J C5    1 
ATOM   4967  C  C6    . DA  B  2 98  ? -52.206 -3.516  26.878 1.00 75.10  ? 25   DA  J C6    1 
ATOM   4968  N  N6    . DA  B  2 98  ? -53.122 -3.704  25.926 1.00 75.48  ? 25   DA  J N6    1 
ATOM   4969  N  N1    . DA  B  2 98  ? -51.657 -4.619  27.432 1.00 74.90  ? 25   DA  J N1    1 
ATOM   4970  C  C2    . DA  B  2 98  ? -50.734 -4.464  28.387 1.00 75.26  ? 25   DA  J C2    1 
ATOM   4971  N  N3    . DA  B  2 98  ? -50.244 -3.329  28.901 1.00 75.84  ? 25   DA  J N3    1 
ATOM   4972  C  C4    . DA  B  2 98  ? -50.804 -2.241  28.327 1.00 75.79  ? 25   DA  J C4    1 
ATOM   4973  P  P     . DG  B  2 99  ? -45.987 0.976   31.015 1.00 76.62  ? 26   DG  J P     1 
ATOM   4974  O  OP1   . DG  B  2 99  ? -45.091 0.796   32.184 1.00 76.59  ? 26   DG  J OP1   1 
ATOM   4975  O  OP2   . DG  B  2 99  ? -45.795 2.162   30.143 1.00 77.15  ? 26   DG  J OP2   1 
ATOM   4976  O  "O5'" . DG  B  2 99  ? -45.929 -0.329  30.110 1.00 74.42  ? 26   DG  J "O5'" 1 
ATOM   4977  C  "C5'" . DG  B  2 99  ? -45.486 -1.543  30.684 1.00 71.94  ? 26   DG  J "C5'" 1 
ATOM   4978  C  "C4'" . DG  B  2 99  ? -45.180 -2.524  29.576 1.00 69.60  ? 26   DG  J "C4'" 1 
ATOM   4979  O  "O4'" . DG  B  2 99  ? -46.323 -2.600  28.689 1.00 68.91  ? 26   DG  J "O4'" 1 
ATOM   4980  C  "C3'" . DG  B  2 99  ? -43.997 -2.135  28.700 1.00 67.79  ? 26   DG  J "C3'" 1 
ATOM   4981  O  "O3'" . DG  B  2 99  ? -43.388 -3.314  28.286 1.00 66.50  ? 26   DG  J "O3'" 1 
ATOM   4982  C  "C2'" . DG  B  2 99  ? -44.660 -1.518  27.490 1.00 67.55  ? 26   DG  J "C2'" 1 
ATOM   4983  C  "C1'" . DG  B  2 99  ? -45.843 -2.466  27.371 1.00 68.35  ? 26   DG  J "C1'" 1 
ATOM   4984  N  N9    . DG  B  2 99  ? -46.915 -1.978  26.514 1.00 68.66  ? 26   DG  J N9    1 
ATOM   4985  C  C8    . DG  B  2 99  ? -47.121 -0.679  26.114 1.00 68.76  ? 26   DG  J C8    1 
ATOM   4986  N  N7    . DG  B  2 99  ? -48.153 -0.528  25.344 1.00 69.18  ? 26   DG  J N7    1 
ATOM   4987  C  C5    . DG  B  2 99  ? -48.667 -1.814  25.220 1.00 68.98  ? 26   DG  J C5    1 
ATOM   4988  C  C6    . DG  B  2 99  ? -49.800 -2.265  24.497 1.00 68.49  ? 26   DG  J C6    1 
ATOM   4989  O  O6    . DG  B  2 99  ? -50.577 -1.591  23.805 1.00 68.21  ? 26   DG  J O6    1 
ATOM   4990  N  N1    . DG  B  2 99  ? -49.971 -3.643  24.628 1.00 68.72  ? 26   DG  J N1    1 
ATOM   4991  C  C2    . DG  B  2 99  ? -49.151 -4.475  25.371 1.00 68.72  ? 26   DG  J C2    1 
ATOM   4992  N  N2    . DG  B  2 99  ? -49.478 -5.775  25.384 1.00 68.45  ? 26   DG  J N2    1 
ATOM   4993  N  N3    . DG  B  2 99  ? -48.091 -4.060  26.059 1.00 68.10  ? 26   DG  J N3    1 
ATOM   4994  C  C4    . DG  B  2 99  ? -47.914 -2.722  25.937 1.00 68.61  ? 26   DG  J C4    1 
ATOM   4995  P  P     . DC  B  2 100 ? -41.955 -3.743  28.804 1.00 63.86  ? 27   DC  J P     1 
ATOM   4996  O  OP1   . DC  B  2 100 ? -41.851 -3.353  30.222 1.00 63.72  ? 27   DC  J OP1   1 
ATOM   4997  O  OP2   . DC  B  2 100 ? -40.968 -3.314  27.793 1.00 62.46  ? 27   DC  J OP2   1 
ATOM   4998  O  "O5'" . DC  B  2 100 ? -42.054 -5.334  28.706 1.00 65.68  ? 27   DC  J "O5'" 1 
ATOM   4999  C  "C5'" . DC  B  2 100 ? -43.284 -6.006  28.935 1.00 66.84  ? 27   DC  J "C5'" 1 
ATOM   5000  C  "C4'" . DC  B  2 100 ? -43.506 -7.185  27.989 1.00 68.20  ? 27   DC  J "C4'" 1 
ATOM   5001  O  "O4'" . DC  B  2 100 ? -44.451 -6.840  26.948 1.00 67.78  ? 27   DC  J "O4'" 1 
ATOM   5002  C  "C3'" . DC  B  2 100 ? -42.301 -7.753  27.252 1.00 68.84  ? 27   DC  J "C3'" 1 
ATOM   5003  O  "O3'" . DC  B  2 100 ? -42.516 -9.159  27.121 1.00 69.71  ? 27   DC  J "O3'" 1 
ATOM   5004  C  "C2'" . DC  B  2 100 ? -42.331 -6.989  25.928 1.00 68.31  ? 27   DC  J "C2'" 1 
ATOM   5005  C  "C1'" . DC  B  2 100 ? -43.831 -6.845  25.680 1.00 68.52  ? 27   DC  J "C1'" 1 
ATOM   5006  N  N1    . DC  B  2 100 ? -44.301 -5.584  25.030 1.00 69.36  ? 27   DC  J N1    1 
ATOM   5007  C  C2    . DC  B  2 100 ? -45.582 -5.543  24.435 1.00 69.62  ? 27   DC  J C2    1 
ATOM   5008  O  O2    . DC  B  2 100 ? -46.321 -6.545  24.419 1.00 69.29  ? 27   DC  J O2    1 
ATOM   5009  N  N3    . DC  B  2 100 ? -45.991 -4.382  23.872 1.00 69.48  ? 27   DC  J N3    1 
ATOM   5010  C  C4    . DC  B  2 100 ? -45.201 -3.310  23.886 1.00 69.21  ? 27   DC  J C4    1 
ATOM   5011  N  N4    . DC  B  2 100 ? -45.675 -2.202  23.311 1.00 69.38  ? 27   DC  J N4    1 
ATOM   5012  C  C5    . DC  B  2 100 ? -43.905 -3.327  24.488 1.00 68.90  ? 27   DC  J C5    1 
ATOM   5013  C  C6    . DC  B  2 100 ? -43.507 -4.469  25.050 1.00 68.74  ? 27   DC  J C6    1 
ATOM   5014  P  P     . DA  B  2 101 ? -41.507 -10.120 26.331 1.00 71.59  ? 28   DA  J P     1 
ATOM   5015  O  OP1   . DA  B  2 101 ? -41.689 -11.492 26.865 1.00 72.40  ? 28   DA  J OP1   1 
ATOM   5016  O  OP2   . DA  B  2 101 ? -40.172 -9.486  26.324 1.00 71.50  ? 28   DA  J OP2   1 
ATOM   5017  O  "O5'" . DA  B  2 101 ? -42.058 -10.125 24.833 1.00 71.93  ? 28   DA  J "O5'" 1 
ATOM   5018  C  "C5'" . DA  B  2 101 ? -43.325 -10.704 24.528 1.00 72.87  ? 28   DA  J "C5'" 1 
ATOM   5019  C  "C4'" . DA  B  2 101 ? -43.676 -10.513 23.064 1.00 73.54  ? 28   DA  J "C4'" 1 
ATOM   5020  O  "O4'" . DA  B  2 101 ? -43.903 -9.115  22.776 1.00 74.01  ? 28   DA  J "O4'" 1 
ATOM   5021  C  "C3'" . DA  B  2 101 ? -42.623 -10.949 22.053 1.00 74.84  ? 28   DA  J "C3'" 1 
ATOM   5022  O  "O3'" . DA  B  2 101 ? -43.355 -11.408 20.951 1.00 76.61  ? 28   DA  J "O3'" 1 
ATOM   5023  C  "C2'" . DA  B  2 101 ? -41.888 -9.659  21.697 1.00 74.36  ? 28   DA  J "C2'" 1 
ATOM   5024  C  "C1'" . DA  B  2 101 ? -43.087 -8.722  21.686 1.00 74.57  ? 28   DA  J "C1'" 1 
ATOM   5025  N  N9    . DA  B  2 101 ? -42.799 -7.296  21.805 1.00 74.95  ? 28   DA  J N9    1 
ATOM   5026  C  C8    . DA  B  2 101 ? -41.807 -6.667  22.507 1.00 74.81  ? 28   DA  J C8    1 
ATOM   5027  N  N7    . DA  B  2 101 ? -41.823 -5.362  22.409 1.00 74.40  ? 28   DA  J N7    1 
ATOM   5028  C  C5    . DA  B  2 101 ? -42.909 -5.120  21.585 1.00 75.01  ? 28   DA  J C5    1 
ATOM   5029  C  C6    . DA  B  2 101 ? -43.482 -3.936  21.079 1.00 74.83  ? 28   DA  J C6    1 
ATOM   5030  N  N6    . DA  B  2 101 ? -43.007 -2.720  21.351 1.00 74.94  ? 28   DA  J N6    1 
ATOM   5031  N  N1    . DA  B  2 101 ? -44.567 -4.047  20.281 1.00 75.04  ? 28   DA  J N1    1 
ATOM   5032  C  C2    . DA  B  2 101 ? -45.059 -5.264  19.993 1.00 74.80  ? 28   DA  J C2    1 
ATOM   5033  N  N3    . DA  B  2 101 ? -44.607 -6.447  20.402 1.00 75.20  ? 28   DA  J N3    1 
ATOM   5034  C  C4    . DA  B  2 101 ? -43.526 -6.299  21.204 1.00 75.38  ? 28   DA  J C4    1 
ATOM   5035  P  P     . DG  B  2 102 ? -42.737 -12.390 19.867 1.00 78.27  ? 29   DG  J P     1 
ATOM   5036  O  OP1   . DG  B  2 102 ? -43.337 -13.712 20.170 1.00 77.45  ? 29   DG  J OP1   1 
ATOM   5037  O  OP2   . DG  B  2 102 ? -41.265 -12.196 19.764 1.00 77.25  ? 29   DG  J OP2   1 
ATOM   5038  O  "O5'" . DG  B  2 102 ? -43.354 -11.805 18.512 1.00 78.94  ? 29   DG  J "O5'" 1 
ATOM   5039  C  "C5'" . DG  B  2 102 ? -44.732 -11.929 18.184 1.00 80.42  ? 29   DG  J "C5'" 1 
ATOM   5040  C  "C4'" . DG  B  2 102 ? -45.000 -11.086 16.954 1.00 81.96  ? 29   DG  J "C4'" 1 
ATOM   5041  O  "O4'" . DG  B  2 102 ? -44.839 -9.698  17.344 1.00 81.66  ? 29   DG  J "O4'" 1 
ATOM   5042  C  "C3'" . DG  B  2 102 ? -44.046 -11.335 15.779 1.00 83.19  ? 29   DG  J "C3'" 1 
ATOM   5043  O  "O3'" . DG  B  2 102 ? -44.749 -11.435 14.506 1.00 85.32  ? 29   DG  J "O3'" 1 
ATOM   5044  C  "C2'" . DG  B  2 102 ? -43.074 -10.152 15.835 1.00 82.00  ? 29   DG  J "C2'" 1 
ATOM   5045  C  "C1'" . DG  B  2 102 ? -43.920 -9.059  16.477 1.00 81.63  ? 29   DG  J "C1'" 1 
ATOM   5046  N  N9    . DG  B  2 102 ? -43.135 -8.067  17.218 1.00 81.69  ? 29   DG  J N9    1 
ATOM   5047  C  C8    . DG  B  2 102 ? -42.174 -8.298  18.173 1.00 81.54  ? 29   DG  J C8    1 
ATOM   5048  N  N7    . DG  B  2 102 ? -41.643 -7.214  18.659 1.00 81.31  ? 29   DG  J N7    1 
ATOM   5049  C  C5    . DG  B  2 102 ? -42.287 -6.189  17.986 1.00 81.43  ? 29   DG  J C5    1 
ATOM   5050  C  C6    . DG  B  2 102 ? -42.124 -4.783  18.087 1.00 81.55  ? 29   DG  J C6    1 
ATOM   5051  O  O6    . DG  B  2 102 ? -41.354 -4.143  18.820 1.00 81.59  ? 29   DG  J O6    1 
ATOM   5052  N  N1    . DG  B  2 102 ? -42.978 -4.103  17.221 1.00 81.42  ? 29   DG  J N1    1 
ATOM   5053  C  C2    . DG  B  2 102 ? -43.874 -4.708  16.365 1.00 81.40  ? 29   DG  J C2    1 
ATOM   5054  N  N2    . DG  B  2 102 ? -44.621 -3.897  15.606 1.00 81.63  ? 29   DG  J N2    1 
ATOM   5055  N  N3    . DG  B  2 102 ? -44.034 -6.018  16.259 1.00 81.30  ? 29   DG  J N3    1 
ATOM   5056  C  C4    . DG  B  2 102 ? -43.209 -6.698  17.095 1.00 81.56  ? 29   DG  J C4    1 
ATOM   5057  P  P     . DT  B  2 103 ? -44.049 -11.966 13.146 1.00 86.39  ? 30   DT  J P     1 
ATOM   5058  O  OP1   . DT  B  2 103 ? -44.997 -12.912 12.531 1.00 86.18  ? 30   DT  J OP1   1 
ATOM   5059  O  OP2   . DT  B  2 103 ? -42.661 -12.405 13.431 1.00 86.33  ? 30   DT  J OP2   1 
ATOM   5060  O  "O5'" . DT  B  2 103 ? -43.934 -10.674 12.207 1.00 87.41  ? 30   DT  J "O5'" 1 
ATOM   5061  C  "C5'" . DT  B  2 103 ? -44.842 -9.576  12.309 1.00 89.61  ? 30   DT  J "C5'" 1 
ATOM   5062  C  "C4'" . DT  B  2 103 ? -44.328 -8.314  11.617 1.00 91.43  ? 30   DT  J "C4'" 1 
ATOM   5063  O  "O4'" . DT  B  2 103 ? -43.732 -7.387  12.568 1.00 91.35  ? 30   DT  J "O4'" 1 
ATOM   5064  C  "C3'" . DT  B  2 103 ? -43.289 -8.500  10.513 1.00 92.70  ? 30   DT  J "C3'" 1 
ATOM   5065  O  "O3'" . DT  B  2 103 ? -43.633 -7.653  9.431  1.00 95.02  ? 30   DT  J "O3'" 1 
ATOM   5066  C  "C2'" . DT  B  2 103 ? -41.988 -8.040  11.162 1.00 92.21  ? 30   DT  J "C2'" 1 
ATOM   5067  C  "C1'" . DT  B  2 103 ? -42.489 -6.924  12.072 1.00 91.37  ? 30   DT  J "C1'" 1 
ATOM   5068  N  N1    . DT  B  2 103 ? -41.610 -6.606  13.249 1.00 91.36  ? 30   DT  J N1    1 
ATOM   5069  C  C2    . DT  B  2 103 ? -41.474 -5.291  13.661 1.00 91.14  ? 30   DT  J C2    1 
ATOM   5070  O  O2    . DT  B  2 103 ? -42.013 -4.336  13.129 1.00 90.91  ? 30   DT  J O2    1 
ATOM   5071  N  N3    . DT  B  2 103 ? -40.657 -5.122  14.750 1.00 91.46  ? 30   DT  J N3    1 
ATOM   5072  C  C4    . DT  B  2 103 ? -39.981 -6.100  15.456 1.00 91.17  ? 30   DT  J C4    1 
ATOM   5073  O  O4    . DT  B  2 103 ? -39.277 -5.817  16.419 1.00 91.28  ? 30   DT  J O4    1 
ATOM   5074  C  C5    . DT  B  2 103 ? -40.164 -7.451  14.981 1.00 90.97  ? 30   DT  J C5    1 
ATOM   5075  C  C7    . DT  B  2 103 ? -39.481 -8.600  15.660 1.00 91.02  ? 30   DT  J C7    1 
ATOM   5076  C  C6    . DT  B  2 103 ? -40.961 -7.636  13.918 1.00 91.12  ? 30   DT  J C6    1 
ATOM   5077  P  P     . DT  B  2 104 ? -43.287 -8.024  7.918  1.00 96.53  ? 31   DT  J P     1 
ATOM   5078  O  OP1   . DT  B  2 104 ? -44.577 -8.340  7.267  1.00 96.65  ? 31   DT  J OP1   1 
ATOM   5079  O  OP2   . DT  B  2 104 ? -42.158 -8.988  7.884  1.00 96.55  ? 31   DT  J OP2   1 
ATOM   5080  O  "O5'" . DT  B  2 104 ? -42.742 -6.636  7.347  1.00 98.02  ? 31   DT  J "O5'" 1 
ATOM   5081  C  "C5'" . DT  B  2 104 ? -43.359 -5.405  7.713  1.00 100.31 ? 31   DT  J "C5'" 1 
ATOM   5082  C  "C4'" . DT  B  2 104 ? -42.319 -4.304  7.820  1.00 101.96 ? 31   DT  J "C4'" 1 
ATOM   5083  O  "O4'" . DT  B  2 104 ? -41.663 -4.345  9.116  1.00 102.54 ? 31   DT  J "O4'" 1 
ATOM   5084  C  "C3'" . DT  B  2 104 ? -41.208 -4.359  6.774  1.00 102.63 ? 31   DT  J "C3'" 1 
ATOM   5085  O  "O3'" . DT  B  2 104 ? -41.188 -3.108  6.101  1.00 103.17 ? 31   DT  J "O3'" 1 
ATOM   5086  C  "C2'" . DT  B  2 104 ? -39.937 -4.612  7.588  1.00 102.68 ? 31   DT  J "C2'" 1 
ATOM   5087  C  "C1'" . DT  B  2 104 ? -40.306 -3.997  8.934  1.00 103.16 ? 31   DT  J "C1'" 1 
ATOM   5088  N  N1    . DT  B  2 104 ? -39.502 -4.478  10.114 1.00 103.57 ? 31   DT  J N1    1 
ATOM   5089  C  C2    . DT  B  2 104 ? -39.034 -3.565  11.048 1.00 103.60 ? 31   DT  J C2    1 
ATOM   5090  O  O2    . DT  B  2 104 ? -39.232 -2.365  10.977 1.00 103.50 ? 31   DT  J O2    1 
ATOM   5091  N  N3    . DT  B  2 104 ? -38.313 -4.118  12.083 1.00 103.53 ? 31   DT  J N3    1 
ATOM   5092  C  C4    . DT  B  2 104 ? -38.020 -5.462  12.276 1.00 103.49 ? 31   DT  J C4    1 
ATOM   5093  O  O4    . DT  B  2 104 ? -37.366 -5.862  13.237 1.00 103.52 ? 31   DT  J O4    1 
ATOM   5094  C  C5    . DT  B  2 104 ? -38.539 -6.360  11.270 1.00 103.42 ? 31   DT  J C5    1 
ATOM   5095  C  C7    . DT  B  2 104 ? -38.290 -7.837  11.359 1.00 103.55 ? 31   DT  J C7    1 
ATOM   5096  C  C6    . DT  B  2 104 ? -39.242 -5.833  10.257 1.00 103.64 ? 31   DT  J C6    1 
ATOM   5097  P  P     . DT  B  2 105 ? -40.381 -2.872  4.736  1.00 103.33 ? 32   DT  J P     1 
ATOM   5098  O  OP1   . DT  B  2 105 ? -41.382 -2.938  3.646  1.00 103.15 ? 32   DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B  2 105 ? -39.168 -3.732  4.689  1.00 102.72 ? 32   DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B  2 105 ? -39.910 -1.353  4.904  1.00 102.52 ? 32   DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B  2 105 ? -40.152 -0.630  6.121  1.00 101.67 ? 32   DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B  2 105 ? -38.856 -0.086  6.704  1.00 100.83 ? 32   DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B  2 105 ? -38.347 -0.990  7.725  1.00 100.66 ? 32   DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B  2 105 ? -37.732 0.093   5.682  1.00 100.20 ? 32   DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B  2 105 ? -37.140 1.393   5.791  1.00 98.57  ? 32   DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B  2 105 ? -36.757 -1.029  6.039  1.00 100.70 ? 32   DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B  2 105 ? -36.948 -1.102  7.552  1.00 100.57 ? 32   DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B  2 105 ? -36.439 -2.333  8.261  1.00 100.34 ? 32   DT  J N1    1 
ATOM   5109  C  C2    . DT  B  2 105 ? -35.965 -2.191  9.552  1.00 100.28 ? 32   DT  J C2    1 
ATOM   5110  O  O2    . DT  B  2 105 ? -35.932 -1.124  10.134 1.00 100.24 ? 32   DT  J O2    1 
ATOM   5111  N  N3    . DT  B  2 105 ? -35.523 -3.348  10.146 1.00 100.08 ? 32   DT  J N3    1 
ATOM   5112  C  C4    . DT  B  2 105 ? -35.509 -4.612  9.587  1.00 100.28 ? 32   DT  J C4    1 
ATOM   5113  O  O4    . DT  B  2 105 ? -35.091 -5.581  10.217 1.00 100.18 ? 32   DT  J O4    1 
ATOM   5114  C  C5    . DT  B  2 105 ? -36.020 -4.697  8.229  1.00 100.30 ? 32   DT  J C5    1 
ATOM   5115  C  C7    . DT  B  2 105 ? -36.066 -6.007  7.491  1.00 100.45 ? 32   DT  J C7    1 
ATOM   5116  C  C6    . DT  B  2 105 ? -36.458 -3.570  7.644  1.00 100.15 ? 32   DT  J C6    1 
ATOM   5117  P  P     . DC  B  2 106 ? -36.932 2.308   4.490  1.00 97.14  ? 33   DC  J P     1 
ATOM   5118  O  OP1   . DC  B  2 106 ? -37.915 3.406   4.584  1.00 96.75  ? 33   DC  J OP1   1 
ATOM   5119  O  OP2   . DC  B  2 106 ? -36.901 1.434   3.290  1.00 96.65  ? 33   DC  J OP2   1 
ATOM   5120  O  "O5'" . DC  B  2 106 ? -35.465 2.917   4.697  1.00 96.21  ? 33   DC  J "O5'" 1 
ATOM   5121  C  "C5'" . DC  B  2 106 ? -35.080 3.494   5.945  1.00 95.07  ? 33   DC  J "C5'" 1 
ATOM   5122  C  "C4'" . DC  B  2 106 ? -33.734 2.963   6.414  1.00 94.30  ? 33   DC  J "C4'" 1 
ATOM   5123  O  "O4'" . DC  B  2 106 ? -33.831 1.589   6.869  1.00 94.38  ? 33   DC  J "O4'" 1 
ATOM   5124  C  "C3'" . DC  B  2 106 ? -32.611 2.951   5.377  1.00 93.78  ? 33   DC  J "C3'" 1 
ATOM   5125  O  "O3'" . DC  B  2 106 ? -31.470 3.541   5.978  1.00 93.10  ? 33   DC  J "O3'" 1 
ATOM   5126  C  "C2'" . DC  B  2 106 ? -32.371 1.470   5.088  1.00 93.68  ? 33   DC  J "C2'" 1 
ATOM   5127  C  "C1'" . DC  B  2 106 ? -32.612 0.959   6.502  1.00 93.74  ? 33   DC  J "C1'" 1 
ATOM   5128  N  N1    . DC  B  2 106 ? -32.694 -0.532  6.718  1.00 93.50  ? 33   DC  J N1    1 
ATOM   5129  C  C2    . DC  B  2 106 ? -31.939 -1.110  7.753  1.00 93.00  ? 33   DC  J C2    1 
ATOM   5130  O  O2    . DC  B  2 106 ? -31.213 -0.393  8.451  1.00 92.52  ? 33   DC  J O2    1 
ATOM   5131  N  N3    . DC  B  2 106 ? -32.024 -2.450  7.956  1.00 93.09  ? 33   DC  J N3    1 
ATOM   5132  C  C4    . DC  B  2 106 ? -32.818 -3.200  7.182  1.00 93.35  ? 33   DC  J C4    1 
ATOM   5133  N  N4    . DC  B  2 106 ? -32.866 -4.514  7.418  1.00 93.12  ? 33   DC  J N4    1 
ATOM   5134  C  C5    . DC  B  2 106 ? -33.594 -2.634  6.126  1.00 93.08  ? 33   DC  J C5    1 
ATOM   5135  C  C6    . DC  B  2 106 ? -33.504 -1.311  5.937  1.00 93.26  ? 33   DC  J C6    1 
ATOM   5136  P  P     . DC  B  2 107 ? -31.000 4.967   5.451  1.00 92.32  ? 34   DC  J P     1 
ATOM   5137  O  OP1   . DC  B  2 107 ? -32.123 5.912   5.698  1.00 91.59  ? 34   DC  J OP1   1 
ATOM   5138  O  OP2   . DC  B  2 107 ? -30.426 4.716   4.105  1.00 91.76  ? 34   DC  J OP2   1 
ATOM   5139  O  "O5'" . DC  B  2 107 ? -29.758 5.399   6.360  1.00 92.25  ? 34   DC  J "O5'" 1 
ATOM   5140  C  "C5'" . DC  B  2 107 ? -29.802 5.465   7.787  1.00 91.32  ? 34   DC  J "C5'" 1 
ATOM   5141  C  "C4'" . DC  B  2 107 ? -28.577 4.765   8.356  1.00 90.10  ? 34   DC  J "C4'" 1 
ATOM   5142  O  "O4'" . DC  B  2 107 ? -28.812 3.337   8.336  1.00 90.12  ? 34   DC  J "O4'" 1 
ATOM   5143  C  "C3'" . DC  B  2 107 ? -27.266 4.971   7.592  1.00 89.37  ? 34   DC  J "C3'" 1 
ATOM   5144  O  "O3'" . DC  B  2 107 ? -26.212 5.108   8.521  1.00 88.67  ? 34   DC  J "O3'" 1 
ATOM   5145  C  "C2'" . DC  B  2 107 ? -27.093 3.693   6.777  1.00 89.23  ? 34   DC  J "C2'" 1 
ATOM   5146  C  "C1'" . DC  B  2 107 ? -27.658 2.718   7.799  1.00 90.15  ? 34   DC  J "C1'" 1 
ATOM   5147  N  N1    . DC  B  2 107 ? -28.014 1.352   7.316  1.00 90.14  ? 34   DC  J N1    1 
ATOM   5148  C  C2    . DC  B  2 107 ? -27.933 0.304   8.239  1.00 90.01  ? 34   DC  J C2    1 
ATOM   5149  O  O2    . DC  B  2 107 ? -27.573 0.551   9.400  1.00 89.87  ? 34   DC  J O2    1 
ATOM   5150  N  N3    . DC  B  2 107 ? -28.247 -0.949  7.830  1.00 89.83  ? 34   DC  J N3    1 
ATOM   5151  C  C4    . DC  B  2 107 ? -28.632 -1.165  6.573  1.00 89.91  ? 34   DC  J C4    1 
ATOM   5152  N  N4    . DC  B  2 107 ? -28.934 -2.415  6.228  1.00 89.94  ? 34   DC  J N4    1 
ATOM   5153  C  C5    . DC  B  2 107 ? -28.725 -0.109  5.617  1.00 90.12  ? 34   DC  J C5    1 
ATOM   5154  C  C6    . DC  B  2 107 ? -28.411 1.126   6.028  1.00 90.15  ? 34   DC  J C6    1 
ATOM   5155  P  P     . DA  B  2 108 ? -25.605 6.548   8.867  1.00 88.84  ? 35   DA  J P     1 
ATOM   5156  O  OP1   . DA  B  2 108 ? -26.692 7.558   8.793  1.00 87.97  ? 35   DA  J OP1   1 
ATOM   5157  O  OP2   . DA  B  2 108 ? -24.378 6.692   8.039  1.00 88.05  ? 35   DA  J OP2   1 
ATOM   5158  O  "O5'" . DA  B  2 108 ? -25.134 6.417   10.397 1.00 87.54  ? 35   DA  J "O5'" 1 
ATOM   5159  C  "C5'" . DA  B  2 108 ? -25.901 5.694   11.378 1.00 86.24  ? 35   DA  J "C5'" 1 
ATOM   5160  C  "C4'" . DA  B  2 108 ? -25.061 4.665   12.134 1.00 84.57  ? 35   DA  J "C4'" 1 
ATOM   5161  O  "O4'" . DA  B  2 108 ? -24.974 3.443   11.353 1.00 83.40  ? 35   DA  J "O4'" 1 
ATOM   5162  C  "C3'" . DA  B  2 108 ? -23.620 5.068   12.476 1.00 83.69  ? 35   DA  J "C3'" 1 
ATOM   5163  O  "O3'" . DA  B  2 108 ? -23.285 4.631   13.807 1.00 83.31  ? 35   DA  J "O3'" 1 
ATOM   5164  C  "C2'" . DA  B  2 108 ? -22.799 4.373   11.388 1.00 83.35  ? 35   DA  J "C2'" 1 
ATOM   5165  C  "C1'" . DA  B  2 108 ? -23.615 3.114   11.123 1.00 83.09  ? 35   DA  J "C1'" 1 
ATOM   5166  N  N9    . DA  B  2 108 ? -23.515 2.592   9.768  1.00 82.69  ? 35   DA  J N9    1 
ATOM   5167  C  C8    . DA  B  2 108 ? -22.973 3.202   8.673  1.00 82.89  ? 35   DA  J C8    1 
ATOM   5168  N  N7    . DA  B  2 108 ? -23.038 2.483   7.579  1.00 82.82  ? 35   DA  J N7    1 
ATOM   5169  C  C5    . DA  B  2 108 ? -23.665 1.320   7.986  1.00 83.00  ? 35   DA  J C5    1 
ATOM   5170  C  C6    . DA  B  2 108 ? -24.041 0.147   7.300  1.00 83.00  ? 35   DA  J C6    1 
ATOM   5171  N  N6    . DA  B  2 108 ? -23.810 -0.045  6.000  1.00 82.87  ? 35   DA  J N6    1 
ATOM   5172  N  N1    . DA  B  2 108 ? -24.654 -0.833  8.001  1.00 83.01  ? 35   DA  J N1    1 
ATOM   5173  C  C2    . DA  B  2 108 ? -24.876 -0.644  9.308  1.00 83.10  ? 35   DA  J C2    1 
ATOM   5174  N  N3    . DA  B  2 108 ? -24.580 0.419   10.056 1.00 83.19  ? 35   DA  J N3    1 
ATOM   5175  C  C4    . DA  B  2 108 ? -23.968 1.372   9.333  1.00 82.98  ? 35   DA  J C4    1 
ATOM   5176  P  P     . DA  B  2 109 ? -21.788 4.623   14.398 1.00 83.18  ? 36   DA  J P     1 
ATOM   5177  O  OP1   . DA  B  2 109 ? -21.927 4.835   15.854 1.00 82.66  ? 36   DA  J OP1   1 
ATOM   5178  O  OP2   . DA  B  2 109 ? -20.920 5.509   13.582 1.00 83.25  ? 36   DA  J OP2   1 
ATOM   5179  O  "O5'" . DA  B  2 109 ? -21.270 3.128   14.168 1.00 82.48  ? 36   DA  J "O5'" 1 
ATOM   5180  C  "C5'" . DA  B  2 109 ? -21.986 2.027   14.731 1.00 82.10  ? 36   DA  J "C5'" 1 
ATOM   5181  C  "C4'" . DA  B  2 109 ? -21.511 0.724   14.119 1.00 81.47  ? 36   DA  J "C4'" 1 
ATOM   5182  O  "O4'" . DA  B  2 109 ? -21.752 0.752   12.684 1.00 81.34  ? 36   DA  J "O4'" 1 
ATOM   5183  C  "C3'" . DA  B  2 109 ? -20.019 0.442   14.312 1.00 80.80  ? 36   DA  J "C3'" 1 
ATOM   5184  O  "O3'" . DA  B  2 109 ? -19.831 -0.913  14.667 1.00 80.15  ? 36   DA  J "O3'" 1 
ATOM   5185  C  "C2'" . DA  B  2 109 ? -19.455 0.668   12.918 1.00 81.75  ? 36   DA  J "C2'" 1 
ATOM   5186  C  "C1'" . DA  B  2 109 ? -20.628 0.124   12.118 1.00 82.48  ? 36   DA  J "C1'" 1 
ATOM   5187  N  N9    . DA  B  2 109 ? -20.504 0.251   10.668 1.00 82.87  ? 36   DA  J N9    1 
ATOM   5188  C  C8    . DA  B  2 109 ? -19.897 1.241   9.942  1.00 83.26  ? 36   DA  J C8    1 
ATOM   5189  N  N7    . DA  B  2 109 ? -19.930 1.048   8.644  1.00 82.85  ? 36   DA  J N7    1 
ATOM   5190  C  C5    . DA  B  2 109 ? -20.596 -0.155  8.516  1.00 82.97  ? 36   DA  J C5    1 
ATOM   5191  C  C6    . DA  B  2 109 ? -20.963 -0.925  7.397  1.00 83.14  ? 36   DA  J C6    1 
ATOM   5192  N  N6    . DA  B  2 109 ? -20.694 -0.556  6.140  1.00 83.37  ? 36   DA  J N6    1 
ATOM   5193  N  N1    . DA  B  2 109 ? -21.623 -2.089  7.612  1.00 83.14  ? 36   DA  J N1    1 
ATOM   5194  C  C2    . DA  B  2 109 ? -21.899 -2.455  8.870  1.00 83.21  ? 36   DA  J C2    1 
ATOM   5195  N  N3    . DA  B  2 109 ? -21.604 -1.810  10.000 1.00 83.35  ? 36   DA  J N3    1 
ATOM   5196  C  C4    . DA  B  2 109 ? -20.953 -0.661  9.750  1.00 82.98  ? 36   DA  J C4    1 
ATOM   5197  P  P     . DA  B  2 110 ? -18.488 -1.446  15.355 1.00 79.16  ? 37   DA  J P     1 
ATOM   5198  O  OP1   . DA  B  2 110 ? -18.774 -1.368  16.804 1.00 79.26  ? 37   DA  J OP1   1 
ATOM   5199  O  OP2   . DA  B  2 110 ? -17.309 -0.791  14.753 1.00 78.03  ? 37   DA  J OP2   1 
ATOM   5200  O  "O5'" . DA  B  2 110 ? -18.379 -2.984  14.926 1.00 79.36  ? 37   DA  J "O5'" 1 
ATOM   5201  C  "C5'" . DA  B  2 110 ? -19.474 -3.873  15.084 1.00 79.45  ? 37   DA  J "C5'" 1 
ATOM   5202  C  "C4'" . DA  B  2 110 ? -19.582 -4.825  13.908 1.00 79.73  ? 37   DA  J "C4'" 1 
ATOM   5203  O  "O4'" . DA  B  2 110 ? -20.173 -4.124  12.786 1.00 80.06  ? 37   DA  J "O4'" 1 
ATOM   5204  C  "C3'" . DA  B  2 110 ? -18.267 -5.387  13.389 1.00 79.31  ? 37   DA  J "C3'" 1 
ATOM   5205  O  "O3'" . DA  B  2 110 ? -17.958 -6.552  14.107 1.00 79.14  ? 37   DA  J "O3'" 1 
ATOM   5206  C  "C2'" . DA  B  2 110 ? -18.643 -5.733  11.957 1.00 80.26  ? 37   DA  J "C2'" 1 
ATOM   5207  C  "C1'" . DA  B  2 110 ? -19.621 -4.630  11.585 1.00 81.42  ? 37   DA  J "C1'" 1 
ATOM   5208  N  N9    . DA  B  2 110 ? -18.992 -3.564  10.801 1.00 82.03  ? 37   DA  J N9    1 
ATOM   5209  C  C8    . DA  B  2 110 ? -18.464 -2.385  11.258 1.00 82.26  ? 37   DA  J C8    1 
ATOM   5210  N  N7    . DA  B  2 110 ? -17.968 -1.616  10.317 1.00 82.32  ? 37   DA  J N7    1 
ATOM   5211  C  C5    . DA  B  2 110 ? -18.180 -2.350  9.159  1.00 82.29  ? 37   DA  J C5    1 
ATOM   5212  C  C6    . DA  B  2 110 ? -17.882 -2.094  7.806  1.00 81.99  ? 37   DA  J C6    1 
ATOM   5213  N  N6    . DA  B  2 110 ? -17.281 -0.973  7.396  1.00 82.12  ? 37   DA  J N6    1 
ATOM   5214  N  N1    . DA  B  2 110 ? -18.222 -3.031  6.893  1.00 81.99  ? 37   DA  J N1    1 
ATOM   5215  C  C2    . DA  B  2 110 ? -18.827 -4.154  7.303  1.00 82.04  ? 37   DA  J C2    1 
ATOM   5216  N  N3    . DA  B  2 110 ? -19.160 -4.506  8.544  1.00 82.24  ? 37   DA  J N3    1 
ATOM   5217  C  C4    . DA  B  2 110 ? -18.805 -3.554  9.434  1.00 82.24  ? 37   DA  J C4    1 
ATOM   5218  P  P     . DT  B  2 111 ? -16.585 -7.354  13.937 1.00 79.37  ? 38   DT  J P     1 
ATOM   5219  O  OP1   . DT  B  2 111 ? -16.599 -8.468  14.904 1.00 79.80  ? 38   DT  J OP1   1 
ATOM   5220  O  OP2   . DT  B  2 111 ? -15.477 -6.386  13.996 1.00 79.51  ? 38   DT  J OP2   1 
ATOM   5221  O  "O5'" . DT  B  2 111 ? -16.652 -7.972  12.464 1.00 82.29  ? 38   DT  J "O5'" 1 
ATOM   5222  C  "C5'" . DT  B  2 111 ? -17.642 -8.923  12.072 1.00 86.44  ? 38   DT  J "C5'" 1 
ATOM   5223  C  "C4'" . DT  B  2 111 ? -17.481 -9.295  10.604 1.00 89.91  ? 38   DT  J "C4'" 1 
ATOM   5224  O  "O4'" . DT  B  2 111 ? -17.558 -8.109  9.768  1.00 90.32  ? 38   DT  J "O4'" 1 
ATOM   5225  C  "C3'" . DT  B  2 111 ? -16.157 -9.983  10.275 1.00 92.20  ? 38   DT  J "C3'" 1 
ATOM   5226  O  "O3'" . DT  B  2 111 ? -16.355 -11.143 9.459  1.00 95.67  ? 38   DT  J "O3'" 1 
ATOM   5227  C  "C2'" . DT  B  2 111 ? -15.346 -8.915  9.550  1.00 91.70  ? 38   DT  J "C2'" 1 
ATOM   5228  C  "C1'" . DT  B  2 111 ? -16.427 -8.048  8.915  1.00 91.37  ? 38   DT  J "C1'" 1 
ATOM   5229  N  N1    . DT  B  2 111 ? -15.964 -6.624  8.732  1.00 91.47  ? 38   DT  J N1    1 
ATOM   5230  C  C2    . DT  B  2 111 ? -15.802 -6.097  7.462  1.00 91.13  ? 38   DT  J C2    1 
ATOM   5231  O  O2    . DT  B  2 111 ? -16.017 -6.708  6.434  1.00 91.72  ? 38   DT  J O2    1 
ATOM   5232  N  N3    . DT  B  2 111 ? -15.368 -4.800  7.424  1.00 90.89  ? 38   DT  J N3    1 
ATOM   5233  C  C4    . DT  B  2 111 ? -15.078 -3.987  8.504  1.00 91.53  ? 38   DT  J C4    1 
ATOM   5234  O  O4    . DT  B  2 111 ? -14.693 -2.833  8.354  1.00 91.69  ? 38   DT  J O4    1 
ATOM   5235  C  C5    . DT  B  2 111 ? -15.259 -4.590  9.808  1.00 91.86  ? 38   DT  J C5    1 
ATOM   5236  C  C7    . DT  B  2 111 ? -14.983 -3.819  11.068 1.00 91.33  ? 38   DT  J C7    1 
ATOM   5237  C  C6    . DT  B  2 111 ? -15.683 -5.861  9.852  1.00 91.86  ? 38   DT  J C6    1 
ATOM   5238  P  P     . DA  B  2 112 ? -15.166 -12.206 9.238  1.00 98.53  ? 39   DA  J P     1 
ATOM   5239  O  OP1   . DA  B  2 112 ? -15.785 -13.536 9.002  1.00 98.43  ? 39   DA  J OP1   1 
ATOM   5240  O  OP2   . DA  B  2 112 ? -14.169 -12.056 10.324 1.00 97.70  ? 39   DA  J OP2   1 
ATOM   5241  O  "O5'" . DA  B  2 112 ? -14.477 -11.670 7.886  1.00 100.60 ? 39   DA  J "O5'" 1 
ATOM   5242  C  "C5'" . DA  B  2 112 ? -15.249 -11.339 6.724  1.00 103.16 ? 39   DA  J "C5'" 1 
ATOM   5243  C  "C4'" . DA  B  2 112 ? -14.413 -10.784 5.571  1.00 105.40 ? 39   DA  J "C4'" 1 
ATOM   5244  O  "O4'" . DA  B  2 112 ? -14.283 -9.340  5.675  1.00 105.68 ? 39   DA  J "O4'" 1 
ATOM   5245  C  "C3'" . DA  B  2 112 ? -12.996 -11.332 5.393  1.00 106.62 ? 39   DA  J "C3'" 1 
ATOM   5246  O  "O3'" . DA  B  2 112 ? -12.842 -11.709 4.020  1.00 108.68 ? 39   DA  J "O3'" 1 
ATOM   5247  C  "C2'" . DA  B  2 112 ? -12.104 -10.151 5.782  1.00 106.28 ? 39   DA  J "C2'" 1 
ATOM   5248  C  "C1'" . DA  B  2 112 ? -12.961 -8.961  5.361  1.00 106.19 ? 39   DA  J "C1'" 1 
ATOM   5249  N  N9    . DA  B  2 112 ? -12.702 -7.698  6.052  1.00 106.45 ? 39   DA  J N9    1 
ATOM   5250  C  C8    . DA  B  2 112 ? -12.746 -7.474  7.404  1.00 106.62 ? 39   DA  J C8    1 
ATOM   5251  N  N7    . DA  B  2 112 ? -12.485 -6.236  7.756  1.00 106.48 ? 39   DA  J N7    1 
ATOM   5252  C  C5    . DA  B  2 112 ? -12.255 -5.594  6.552  1.00 106.56 ? 39   DA  J C5    1 
ATOM   5253  C  C6    . DA  B  2 112 ? -11.922 -4.259  6.232  1.00 106.41 ? 39   DA  J C6    1 
ATOM   5254  N  N6    . DA  B  2 112 ? -11.761 -3.305  7.149  1.00 106.40 ? 39   DA  J N6    1 
ATOM   5255  N  N1    . DA  B  2 112 ? -11.759 -3.934  4.930  1.00 106.46 ? 39   DA  J N1    1 
ATOM   5256  C  C2    . DA  B  2 112 ? -11.919 -4.894  4.009  1.00 106.44 ? 39   DA  J C2    1 
ATOM   5257  N  N3    . DA  B  2 112 ? -12.229 -6.181  4.188  1.00 106.42 ? 39   DA  J N3    1 
ATOM   5258  C  C4    . DA  B  2 112 ? -12.387 -6.477  5.491  1.00 106.45 ? 39   DA  J C4    1 
ATOM   5259  P  P     . DC  B  2 113 ? -11.756 -12.776 3.499  1.00 110.58 ? 40   DC  J P     1 
ATOM   5260  O  OP1   . DC  B  2 113 ? -12.516 -13.914 2.929  1.00 110.25 ? 40   DC  J OP1   1 
ATOM   5261  O  OP2   . DC  B  2 113 ? -10.732 -13.026 4.546  1.00 109.73 ? 40   DC  J OP2   1 
ATOM   5262  O  "O5'" . DC  B  2 113 ? -11.051 -11.987 2.291  1.00 111.34 ? 40   DC  J "O5'" 1 
ATOM   5263  C  "C5'" . DC  B  2 113 ? -11.360 -10.621 1.980  1.00 112.26 ? 40   DC  J "C5'" 1 
ATOM   5264  C  "C4'" . DC  B  2 113 ? -10.115 -9.761  1.799  1.00 113.31 ? 40   DC  J "C4'" 1 
ATOM   5265  O  "O4'" . DC  B  2 113 ? -10.207 -8.602  2.666  1.00 113.08 ? 40   DC  J "O4'" 1 
ATOM   5266  C  "C3'" . DC  B  2 113 ? -8.761  -10.422 2.090  1.00 114.26 ? 40   DC  J "C3'" 1 
ATOM   5267  O  "O3'" . DC  B  2 113 ? -8.025  -10.575 0.856  1.00 116.23 ? 40   DC  J "O3'" 1 
ATOM   5268  C  "C2'" . DC  B  2 113 ? -8.068  -9.487  3.084  1.00 113.55 ? 40   DC  J "C2'" 1 
ATOM   5269  C  "C1'" . DC  B  2 113 ? -8.905  -8.213  3.042  1.00 112.78 ? 40   DC  J "C1'" 1 
ATOM   5270  N  N1    . DC  B  2 113 ? -8.945  -7.497  4.359  1.00 112.54 ? 40   DC  J N1    1 
ATOM   5271  C  C2    . DC  B  2 113 ? -8.809  -6.100  4.407  1.00 112.20 ? 40   DC  J C2    1 
ATOM   5272  O  O2    . DC  B  2 113 ? -8.668  -5.449  3.367  1.00 112.17 ? 40   DC  J O2    1 
ATOM   5273  N  N3    . DC  B  2 113 ? -8.843  -5.481  5.612  1.00 112.06 ? 40   DC  J N3    1 
ATOM   5274  C  C4    . DC  B  2 113 ? -8.996  -6.195  6.727  1.00 112.20 ? 40   DC  J C4    1 
ATOM   5275  N  N4    . DC  B  2 113 ? -9.022  -5.528  7.880  1.00 112.42 ? 40   DC  J N4    1 
ATOM   5276  C  C5    . DC  B  2 113 ? -9.135  -7.615  6.710  1.00 112.15 ? 40   DC  J C5    1 
ATOM   5277  C  C6    . DC  B  2 113 ? -9.102  -8.215  5.516  1.00 112.28 ? 40   DC  J C6    1 
ATOM   5278  P  P     . DA  B  2 114 ? -6.468  -10.980 0.745  1.00 117.50 ? 41   DA  J P     1 
ATOM   5279  O  OP1   . DA  B  2 114 ? -6.314  -11.723 -0.525 1.00 117.65 ? 41   DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B  2 114 ? -5.989  -11.603 2.003  1.00 117.55 ? 41   DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B  2 114 ? -5.762  -9.547  0.618  1.00 118.11 ? 41   DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B  2 114 ? -6.029  -8.666  -0.484 1.00 118.81 ? 41   DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B  2 114 ? -5.074  -7.480  -0.478 1.00 119.30 ? 41   DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B  2 114 ? -5.448  -6.578  0.594  1.00 119.25 ? 41   DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B  2 114 ? -3.598  -7.814  -0.251 1.00 119.83 ? 41   DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B  2 114 ? -2.756  -6.942  -1.002 1.00 120.34 ? 41   DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B  2 114 ? -3.420  -7.573  1.243  1.00 119.91 ? 41   DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B  2 114 ? -4.337  -6.374  1.445  1.00 120.04 ? 41   DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B  2 114 ? -4.797  -6.229  2.824  1.00 120.35 ? 41   DA  J N9    1 
ATOM   5290  C  C8    . DA  B  2 114 ? -5.302  -7.209  3.642  1.00 120.24 ? 41   DA  J C8    1 
ATOM   5291  N  N7    . DA  B  2 114 ? -5.632  -6.782  4.838  1.00 120.24 ? 41   DA  J N7    1 
ATOM   5292  C  C5    . DA  B  2 114 ? -5.318  -5.431  4.802  1.00 120.34 ? 41   DA  J C5    1 
ATOM   5293  C  C6    . DA  B  2 114 ? -5.429  -4.402  5.760  1.00 120.17 ? 41   DA  J C6    1 
ATOM   5294  N  N6    . DA  B  2 114 ? -5.913  -4.613  6.984  1.00 120.10 ? 41   DA  J N6    1 
ATOM   5295  N  N1    . DA  B  2 114 ? -5.029  -3.156  5.410  1.00 120.18 ? 41   DA  J N1    1 
ATOM   5296  C  C2    . DA  B  2 114 ? -4.542  -2.951  4.176  1.00 120.24 ? 41   DA  J C2    1 
ATOM   5297  N  N3    . DA  B  2 114 ? -4.391  -3.838  3.187  1.00 120.30 ? 41   DA  J N3    1 
ATOM   5298  C  C4    . DA  B  2 114 ? -4.800  -5.069  3.568  1.00 120.46 ? 41   DA  J C4    1 
ATOM   5299  P  P     . DC  B  2 115 ? -1.238  -7.334  -1.343 1.00 120.53 ? 42   DC  J P     1 
ATOM   5300  O  OP1   . DC  B  2 115 ? -1.261  -8.169  -2.564 1.00 120.52 ? 42   DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B  2 115 ? -0.568  -7.850  -0.123 1.00 120.55 ? 42   DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B  2 115 ? -0.621  -5.902  -1.707 1.00 120.51 ? 42   DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B  2 115 ? 0.630   -5.505  -1.171 1.00 120.86 ? 42   DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B  2 115 ? 0.447   -4.460  -0.085 1.00 120.80 ? 42   DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B  2 115 ? -0.476  -4.919  0.940  1.00 121.22 ? 42   DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B  2 115 ? 1.740   -4.102  0.639  1.00 120.51 ? 42   DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B  2 115 ? 1.923   -2.696  0.585  1.00 119.51 ? 42   DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B  2 115 ? 1.511   -4.600  2.064  1.00 121.09 ? 42   DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B  2 115 ? 0.001   -4.437  2.183  1.00 121.71 ? 42   DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B  2 115 ? -0.619  -5.161  3.362  1.00 122.01 ? 42   DC  J N1    1 
ATOM   5311  C  C2    . DC  B  2 115 ? -1.089  -4.435  4.482  1.00 122.17 ? 42   DC  J C2    1 
ATOM   5312  O  O2    . DC  B  2 115 ? -1.008  -3.198  4.519  1.00 122.11 ? 42   DC  J O2    1 
ATOM   5313  N  N3    . DC  B  2 115 ? -1.638  -5.118  5.521  1.00 122.23 ? 42   DC  J N3    1 
ATOM   5314  C  C4    . DC  B  2 115 ? -1.726  -6.453  5.479  1.00 122.11 ? 42   DC  J C4    1 
ATOM   5315  N  N4    . DC  B  2 115 ? -2.275  -7.073  6.529  1.00 122.03 ? 42   DC  J N4    1 
ATOM   5316  C  C5    . DC  B  2 115 ? -1.256  -7.208  4.361  1.00 122.08 ? 42   DC  J C5    1 
ATOM   5317  C  C6    . DC  B  2 115 ? -0.715  -6.529  3.340  1.00 121.99 ? 42   DC  J C6    1 
ATOM   5318  P  P     . DT  B  2 116 ? 3.203   -1.981  1.227  1.00 118.85 ? 43   DT  J P     1 
ATOM   5319  O  OP1   . DT  B  2 116 ? 3.456   -0.764  0.415  1.00 118.66 ? 43   DT  J OP1   1 
ATOM   5320  O  OP2   . DT  B  2 116 ? 4.275   -2.987  1.436  1.00 118.40 ? 43   DT  J OP2   1 
ATOM   5321  O  "O5'" . DT  B  2 116 ? 2.676   -1.551  2.675  1.00 117.90 ? 43   DT  J "O5'" 1 
ATOM   5322  C  "C5'" . DT  B  2 116 ? 2.027   -0.291  2.885  1.00 116.46 ? 43   DT  J "C5'" 1 
ATOM   5323  C  "C4'" . DT  B  2 116 ? 2.409   0.317   4.230  1.00 114.93 ? 43   DT  J "C4'" 1 
ATOM   5324  O  "O4'" . DT  B  2 116 ? 1.788   -0.417  5.322  1.00 114.58 ? 43   DT  J "O4'" 1 
ATOM   5325  C  "C3'" . DT  B  2 116 ? 3.904   0.343   4.528  1.00 113.88 ? 43   DT  J "C3'" 1 
ATOM   5326  O  "O3'" . DT  B  2 116 ? 4.212   1.577   5.155  1.00 112.44 ? 43   DT  J "O3'" 1 
ATOM   5327  C  "C2'" . DT  B  2 116 ? 4.109   -0.845  5.467  1.00 114.01 ? 43   DT  J "C2'" 1 
ATOM   5328  C  "C1'" . DT  B  2 116 ? 2.775   -0.917  6.206  1.00 114.07 ? 43   DT  J "C1'" 1 
ATOM   5329  N  N1    . DT  B  2 116 ? 2.392   -2.299  6.685  1.00 114.09 ? 43   DT  J N1    1 
ATOM   5330  C  C2    . DT  B  2 116 ? 1.872   -2.444  7.960  1.00 113.95 ? 43   DT  J C2    1 
ATOM   5331  O  O2    . DT  B  2 116 ? 1.693   -1.513  8.732  1.00 113.73 ? 43   DT  J O2    1 
ATOM   5332  N  N3    . DT  B  2 116 ? 1.557   -3.741  8.300  1.00 113.99 ? 43   DT  J N3    1 
ATOM   5333  C  C4    . DT  B  2 116 ? 1.702   -4.881  7.524  1.00 113.84 ? 43   DT  J C4    1 
ATOM   5334  O  O4    . DT  B  2 116 ? 1.385   -5.995  7.929  1.00 113.77 ? 43   DT  J O4    1 
ATOM   5335  C  C5    . DT  B  2 116 ? 2.249   -4.664  6.208  1.00 113.77 ? 43   DT  J C5    1 
ATOM   5336  C  C7    . DT  B  2 116 ? 2.454   -5.825  5.281  1.00 113.74 ? 43   DT  J C7    1 
ATOM   5337  C  C6    . DT  B  2 116 ? 2.563   -3.404  5.857  1.00 113.94 ? 43   DT  J C6    1 
ATOM   5338  P  P     . DT  B  2 117 ? 5.725   2.048   5.406  1.00 111.34 ? 44   DT  J P     1 
ATOM   5339  O  OP1   . DT  B  2 117 ? 5.975   3.163   4.463  1.00 111.09 ? 44   DT  J OP1   1 
ATOM   5340  O  OP2   . DT  B  2 117 ? 6.616   0.858   5.414  1.00 110.64 ? 44   DT  J OP2   1 
ATOM   5341  O  "O5'" . DT  B  2 117 ? 5.683   2.642   6.901  1.00 109.97 ? 44   DT  J "O5'" 1 
ATOM   5342  C  "C5'" . DT  B  2 117 ? 4.434   2.953   7.557  1.00 107.26 ? 44   DT  J "C5'" 1 
ATOM   5343  C  "C4'" . DT  B  2 117 ? 4.302   2.312   8.935  1.00 104.97 ? 44   DT  J "C4'" 1 
ATOM   5344  O  "O4'" . DT  B  2 117 ? 4.035   0.891   8.810  1.00 104.33 ? 44   DT  J "O4'" 1 
ATOM   5345  C  "C3'" . DT  B  2 117 ? 5.532   2.423   9.838  1.00 103.76 ? 44   DT  J "C3'" 1 
ATOM   5346  O  "O3'" . DT  B  2 117 ? 5.292   3.419   10.840 1.00 102.42 ? 44   DT  J "O3'" 1 
ATOM   5347  C  "C2'" . DT  B  2 117 ? 5.714   1.016   10.414 1.00 103.42 ? 44   DT  J "C2'" 1 
ATOM   5348  C  "C1'" . DT  B  2 117 ? 4.429   0.292   10.024 1.00 103.72 ? 44   DT  J "C1'" 1 
ATOM   5349  N  N1    . DT  B  2 117 ? 4.564   -1.214  9.894  1.00 103.64 ? 44   DT  J N1    1 
ATOM   5350  C  C2    . DT  B  2 117 ? 3.968   -2.035  10.843 1.00 103.76 ? 44   DT  J C2    1 
ATOM   5351  O  O2    . DT  B  2 117 ? 3.318   -1.624  11.793 1.00 103.71 ? 44   DT  J O2    1 
ATOM   5352  N  N3    . DT  B  2 117 ? 4.151   -3.384  10.645 1.00 103.62 ? 44   DT  J N3    1 
ATOM   5353  C  C4    . DT  B  2 117 ? 4.856   -3.989  9.621  1.00 103.43 ? 44   DT  J C4    1 
ATOM   5354  O  O4    . DT  B  2 117 ? 4.961   -5.206  9.533  1.00 103.47 ? 44   DT  J O4    1 
ATOM   5355  C  C5    . DT  B  2 117 ? 5.458   -3.089  8.671  1.00 103.55 ? 44   DT  J C5    1 
ATOM   5356  C  C7    . DT  B  2 117 ? 6.248   -3.641  7.521  1.00 103.68 ? 44   DT  J C7    1 
ATOM   5357  C  C6    . DT  B  2 117 ? 5.286   -1.766  8.847  1.00 103.66 ? 44   DT  J C6    1 
ATOM   5358  P  P     . DT  B  2 118 ? 6.328   3.752   12.028 1.00 101.73 ? 45   DT  J P     1 
ATOM   5359  O  OP1   . DT  B  2 118 ? 6.050   5.129   12.495 1.00 101.36 ? 45   DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B  2 118 ? 7.703   3.357   11.642 1.00 101.27 ? 45   DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B  2 118 ? 5.863   2.750   13.182 1.00 100.61 ? 45   DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B  2 118 ? 4.524   2.782   13.685 1.00 97.73  ? 45   DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B  2 118 ? 4.351   1.751   14.786 1.00 95.11  ? 45   DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B  2 118 ? 4.449   0.412   14.233 1.00 94.52  ? 45   DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B  2 118 ? 5.376   1.834   15.912 1.00 93.49  ? 45   DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B  2 118 ? 4.649   1.785   17.119 1.00 90.92  ? 45   DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B  2 118 ? 6.264   0.604   15.711 1.00 93.66  ? 45   DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B  2 118 ? 5.286   -0.369  15.058 1.00 94.29  ? 45   DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B  2 118 ? 5.898   -1.464  14.232 1.00 94.30  ? 45   DT  J N1    1 
ATOM   5370  C  C2    . DT  B  2 118 ? 5.670   -2.778  14.598 1.00 94.48  ? 45   DT  J C2    1 
ATOM   5371  O  O2    . DT  B  2 118 ? 5.002   -3.105  15.562 1.00 94.53  ? 45   DT  J O2    1 
ATOM   5372  N  N3    . DT  B  2 118 ? 6.261   -3.716  13.788 1.00 94.59  ? 45   DT  J N3    1 
ATOM   5373  C  C4    . DT  B  2 118 ? 7.037   -3.476  12.666 1.00 94.51  ? 45   DT  J C4    1 
ATOM   5374  O  O4    . DT  B  2 118 ? 7.516   -4.397  12.010 1.00 94.52  ? 45   DT  J O4    1 
ATOM   5375  C  C5    . DT  B  2 118 ? 7.239   -2.081  12.331 1.00 94.42  ? 45   DT  J C5    1 
ATOM   5376  C  C7    . DT  B  2 118 ? 8.068   -1.689  11.139 1.00 94.46  ? 45   DT  J C7    1 
ATOM   5377  C  C6    . DT  B  2 118 ? 6.667   -1.158  13.120 1.00 94.33  ? 45   DT  J C6    1 
ATOM   5378  P  P     . DT  B  2 119 ? 5.272   2.188   18.534 1.00 88.74  ? 46   DT  J P     1 
ATOM   5379  O  OP1   . DT  B  2 119 ? 4.493   3.359   18.995 1.00 88.87  ? 46   DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B  2 119 ? 6.748   2.251   18.453 1.00 88.02  ? 46   DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B  2 119 ? 4.889   0.918   19.429 1.00 88.05  ? 46   DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B  2 119 ? 4.162   -0.192  18.889 1.00 86.49  ? 46   DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B  2 119 ? 4.529   -1.497  19.575 1.00 85.42  ? 46   DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B  2 119 ? 5.166   -2.405  18.639 1.00 85.30  ? 46   DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B  2 119 ? 5.476   -1.389  20.765 1.00 84.63  ? 46   DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B  2 119 ? 5.005   -2.240  21.780 1.00 82.49  ? 46   DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B  2 119 ? 6.801   -1.915  20.226 1.00 85.41  ? 46   DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B  2 119 ? 6.324   -2.956  19.223 1.00 86.40  ? 46   DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B  2 119 ? 7.297   -3.218  18.131 1.00 87.36  ? 46   DT  J N1    1 
ATOM   5390  C  C2    . DT  B  2 119 ? 7.564   -4.520  17.744 1.00 87.64  ? 46   DT  J C2    1 
ATOM   5391  O  O2    . DT  B  2 119 ? 7.049   -5.498  18.248 1.00 87.43  ? 46   DT  J O2    1 
ATOM   5392  N  N3    . DT  B  2 119 ? 8.479   -4.638  16.724 1.00 88.13  ? 46   DT  J N3    1 
ATOM   5393  C  C4    . DT  B  2 119 ? 9.136   -3.610  16.065 1.00 87.36  ? 46   DT  J C4    1 
ATOM   5394  O  O4    . DT  B  2 119 ? 9.932   -3.848  15.164 1.00 87.08  ? 46   DT  J O4    1 
ATOM   5395  C  C5    . DT  B  2 119 ? 8.812   -2.269  16.517 1.00 87.45  ? 46   DT  J C5    1 
ATOM   5396  C  C7    . DT  B  2 119 ? 9.444   -1.051  15.906 1.00 87.41  ? 46   DT  J C7    1 
ATOM   5397  C  C6    . DT  B  2 119 ? 7.921   -2.144  17.511 1.00 87.52  ? 46   DT  J C6    1 
ATOM   5398  P  P     . DG  B  2 120 ? 4.769   -1.719  23.263 1.00 79.96  ? 47   DG  J P     1 
ATOM   5399  O  OP1   . DG  B  2 120 ? 3.631   -0.772  23.196 1.00 79.59  ? 47   DG  J OP1   1 
ATOM   5400  O  OP2   . DG  B  2 120 ? 6.077   -1.373  23.866 1.00 78.64  ? 47   DG  J OP2   1 
ATOM   5401  O  "O5'" . DG  B  2 120 ? 4.291   -3.046  24.004 1.00 79.05  ? 47   DG  J "O5'" 1 
ATOM   5402  C  "C5'" . DG  B  2 120 ? 3.536   -4.010  23.281 1.00 78.14  ? 47   DG  J "C5'" 1 
ATOM   5403  C  "C4'" . DG  B  2 120 ? 4.080   -5.404  23.521 1.00 76.89  ? 47   DG  J "C4'" 1 
ATOM   5404  O  "O4'" . DG  B  2 120 ? 5.164   -5.673  22.608 1.00 77.70  ? 47   DG  J "O4'" 1 
ATOM   5405  C  "C3'" . DG  B  2 120 ? 4.599   -5.677  24.924 1.00 76.12  ? 47   DG  J "C3'" 1 
ATOM   5406  O  "O3'" . DG  B  2 120 ? 3.864   -6.812  25.405 1.00 73.62  ? 47   DG  J "O3'" 1 
ATOM   5407  C  "C2'" . DG  B  2 120 ? 6.117   -5.845  24.766 1.00 77.06  ? 47   DG  J "C2'" 1 
ATOM   5408  C  "C1'" . DG  B  2 120 ? 6.329   -6.091  23.279 1.00 78.72  ? 47   DG  J "C1'" 1 
ATOM   5409  N  N9    . DG  B  2 120 ? 7.416   -5.344  22.644 1.00 79.24  ? 47   DG  J N9    1 
ATOM   5410  C  C8    . DG  B  2 120 ? 7.790   -4.045  22.881 1.00 79.41  ? 47   DG  J C8    1 
ATOM   5411  N  N7    . DG  B  2 120 ? 8.786   -3.650  22.140 1.00 79.77  ? 47   DG  J N7    1 
ATOM   5412  C  C5    . DG  B  2 120 ? 9.087   -4.748  21.349 1.00 79.62  ? 47   DG  J C5    1 
ATOM   5413  C  C6    . DG  B  2 120 ? 10.076  -4.915  20.343 1.00 79.74  ? 47   DG  J C6    1 
ATOM   5414  O  O6    . DG  B  2 120 ? 10.916  -4.092  19.952 1.00 79.49  ? 47   DG  J O6    1 
ATOM   5415  N  N1    . DG  B  2 120 ? 10.047  -6.194  19.778 1.00 79.60  ? 47   DG  J N1    1 
ATOM   5416  C  C2    . DG  B  2 120 ? 9.162   -7.181  20.149 1.00 79.39  ? 47   DG  J C2    1 
ATOM   5417  N  N2    . DG  B  2 120 ? 9.265   -8.349  19.508 1.00 79.36  ? 47   DG  J N2    1 
ATOM   5418  N  N3    . DG  B  2 120 ? 8.233   -7.033  21.085 1.00 79.25  ? 47   DG  J N3    1 
ATOM   5419  C  C4    . DG  B  2 120 ? 8.246   -5.797  21.642 1.00 79.32  ? 47   DG  J C4    1 
ATOM   5420  P  P     . DG  B  2 121 ? 4.481   -7.999  26.272 1.00 72.42  ? 48   DG  J P     1 
ATOM   5421  O  OP1   . DG  B  2 121 ? 3.319   -8.719  26.840 1.00 71.24  ? 48   DG  J OP1   1 
ATOM   5422  O  OP2   . DG  B  2 121 ? 5.556   -7.477  27.143 1.00 71.31  ? 48   DG  J OP2   1 
ATOM   5423  O  "O5'" . DG  B  2 121 ? 5.183   -8.905  25.156 1.00 74.08  ? 48   DG  J "O5'" 1 
ATOM   5424  C  "C5'" . DG  B  2 121 ? 5.417   -10.285 25.357 1.00 75.73  ? 48   DG  J "C5'" 1 
ATOM   5425  C  "C4'" . DG  B  2 121 ? 6.729   -10.739 24.737 1.00 77.56  ? 48   DG  J "C4'" 1 
ATOM   5426  O  "O4'" . DG  B  2 121 ? 7.423   -9.672  24.042 1.00 77.90  ? 48   DG  J "O4'" 1 
ATOM   5427  C  "C3'" . DG  B  2 121 ? 7.730   -11.300 25.737 1.00 78.40  ? 48   DG  J "C3'" 1 
ATOM   5428  O  "O3'" . DG  B  2 121 ? 8.109   -12.554 25.266 1.00 80.14  ? 48   DG  J "O3'" 1 
ATOM   5429  C  "C2'" . DG  B  2 121 ? 8.905   -10.335 25.694 1.00 78.28  ? 48   DG  J "C2'" 1 
ATOM   5430  C  "C1'" . DG  B  2 121 ? 8.798   -9.880  24.249 1.00 79.67  ? 48   DG  J "C1'" 1 
ATOM   5431  N  N9    . DG  B  2 121 ? 9.538   -8.668  23.938 1.00 80.37  ? 48   DG  J N9    1 
ATOM   5432  C  C8    . DG  B  2 121 ? 9.388   -7.406  24.466 1.00 80.72  ? 48   DG  J C8    1 
ATOM   5433  N  N7    . DG  B  2 121 ? 10.216  -6.530  23.970 1.00 80.64  ? 48   DG  J N7    1 
ATOM   5434  C  C5    . DG  B  2 121 ? 10.963  -7.258  23.052 1.00 81.00  ? 48   DG  J C5    1 
ATOM   5435  C  C6    . DG  B  2 121 ? 12.023  -6.860  22.198 1.00 80.91  ? 48   DG  J C6    1 
ATOM   5436  O  O6    . DG  B  2 121 ? 12.527  -5.734  22.081 1.00 80.92  ? 48   DG  J O6    1 
ATOM   5437  N  N1    . DG  B  2 121 ? 12.503  -7.916  21.420 1.00 80.58  ? 48   DG  J N1    1 
ATOM   5438  C  C2    . DG  B  2 121 ? 12.025  -9.205  21.468 1.00 80.71  ? 48   DG  J C2    1 
ATOM   5439  N  N2    . DG  B  2 121 ? 12.607  -10.103 20.662 1.00 80.67  ? 48   DG  J N2    1 
ATOM   5440  N  N3    . DG  B  2 121 ? 11.037  -9.591  22.263 1.00 81.31  ? 48   DG  J N3    1 
ATOM   5441  C  C4    . DG  B  2 121 ? 10.557  -8.573  23.024 1.00 81.09  ? 48   DG  J C4    1 
ATOM   5442  P  P     . DT  B  2 122 ? 8.641   -13.656 26.279 1.00 83.37  ? 49   DT  J P     1 
ATOM   5443  O  OP1   . DT  B  2 122 ? 7.924   -14.907 25.941 1.00 83.21  ? 49   DT  J OP1   1 
ATOM   5444  O  OP2   . DT  B  2 122 ? 8.580   -13.109 27.650 1.00 83.06  ? 49   DT  J OP2   1 
ATOM   5445  O  "O5'" . DT  B  2 122 ? 10.199  -13.789 25.908 1.00 85.47  ? 49   DT  J "O5'" 1 
ATOM   5446  C  "C5'" . DT  B  2 122 ? 10.667  -14.269 24.633 1.00 88.08  ? 49   DT  J "C5'" 1 
ATOM   5447  C  "C4'" . DT  B  2 122 ? 12.159  -14.021 24.423 1.00 90.56  ? 49   DT  J "C4'" 1 
ATOM   5448  O  "O4'" . DT  B  2 122 ? 12.370  -12.621 24.102 1.00 90.73  ? 49   DT  J "O4'" 1 
ATOM   5449  C  "C3'" . DT  B  2 122 ? 13.096  -14.329 25.602 1.00 92.70  ? 49   DT  J "C3'" 1 
ATOM   5450  O  "O3'" . DT  B  2 122 ? 14.332  -14.882 25.160 1.00 96.27  ? 49   DT  J "O3'" 1 
ATOM   5451  C  "C2'" . DT  B  2 122 ? 13.385  -12.942 26.171 1.00 91.96  ? 49   DT  J "C2'" 1 
ATOM   5452  C  "C1'" . DT  B  2 122 ? 13.460  -12.149 24.867 1.00 91.49  ? 49   DT  J "C1'" 1 
ATOM   5453  N  N1    . DT  B  2 122 ? 13.417  -10.643 24.983 1.00 91.65  ? 49   DT  J N1    1 
ATOM   5454  C  C2    . DT  B  2 122 ? 14.183  -9.868  24.124 1.00 91.66  ? 49   DT  J C2    1 
ATOM   5455  O  O2    . DT  B  2 122 ? 14.906  -10.322 23.256 1.00 91.78  ? 49   DT  J O2    1 
ATOM   5456  N  N3    . DT  B  2 122 ? 14.078  -8.512  24.310 1.00 91.46  ? 49   DT  J N3    1 
ATOM   5457  C  C4    . DT  B  2 122 ? 13.309  -7.853  25.248 1.00 91.61  ? 49   DT  J C4    1 
ATOM   5458  O  O4    . DT  B  2 122 ? 13.300  -6.626  25.317 1.00 91.69  ? 49   DT  J O4    1 
ATOM   5459  C  C5    . DT  B  2 122 ? 12.529  -8.712  26.116 1.00 91.84  ? 49   DT  J C5    1 
ATOM   5460  C  C7    . DT  B  2 122 ? 11.639  -8.140  27.185 1.00 91.80  ? 49   DT  J C7    1 
ATOM   5461  C  C6    . DT  B  2 122 ? 12.622  -10.041 25.943 1.00 91.76  ? 49   DT  J C6    1 
ATOM   5462  P  P     . DA  B  2 123 ? 14.601  -16.417 24.767 1.00 98.91  ? 50   DA  J P     1 
ATOM   5463  O  OP1   . DA  B  2 123 ? 13.374  -17.038 24.216 1.00 98.75  ? 50   DA  J OP1   1 
ATOM   5464  O  OP2   . DA  B  2 123 ? 15.316  -17.031 25.908 1.00 98.60  ? 50   DA  J OP2   1 
ATOM   5465  O  "O5'" . DA  B  2 123 ? 15.662  -16.292 23.571 1.00 101.70 ? 50   DA  J "O5'" 1 
ATOM   5466  C  "C5'" . DA  B  2 123 ? 15.974  -15.025 22.971 1.00 105.83 ? 50   DA  J "C5'" 1 
ATOM   5467  C  "C4'" . DA  B  2 123 ? 17.397  -14.559 23.265 1.00 109.19 ? 50   DA  J "C4'" 1 
ATOM   5468  O  "O4'" . DA  B  2 123 ? 17.379  -13.140 23.567 1.00 109.26 ? 50   DA  J "O4'" 1 
ATOM   5469  C  "C3'" . DA  B  2 123 ? 18.150  -15.245 24.410 1.00 111.61 ? 50   DA  J "C3'" 1 
ATOM   5470  O  "O3'" . DA  B  2 123 ? 19.365  -15.835 23.878 1.00 115.20 ? 50   DA  J "O3'" 1 
ATOM   5471  C  "C2'" . DA  B  2 123 ? 18.378  -14.138 25.445 1.00 110.73 ? 50   DA  J "C2'" 1 
ATOM   5472  C  "C1'" . DA  B  2 123 ? 18.251  -12.850 24.638 1.00 109.99 ? 50   DA  J "C1'" 1 
ATOM   5473  N  N9    . DA  B  2 123 ? 17.650  -11.735 25.366 1.00 110.09 ? 50   DA  J N9    1 
ATOM   5474  C  C8    . DA  B  2 123 ? 16.754  -11.817 26.397 1.00 110.27 ? 50   DA  J C8    1 
ATOM   5475  N  N7    . DA  B  2 123 ? 16.363  -10.655 26.863 1.00 110.36 ? 50   DA  J N7    1 
ATOM   5476  C  C5    . DA  B  2 123 ? 17.044  -9.742  26.081 1.00 110.13 ? 50   DA  J C5    1 
ATOM   5477  C  C6    . DA  B  2 123 ? 17.060  -8.331  26.069 1.00 110.03 ? 50   DA  J C6    1 
ATOM   5478  N  N6    . DA  B  2 123 ? 16.340  -7.592  26.914 1.00 110.06 ? 50   DA  J N6    1 
ATOM   5479  N  N1    . DA  B  2 123 ? 17.851  -7.712  25.165 1.00 110.04 ? 50   DA  J N1    1 
ATOM   5480  C  C2    . DA  B  2 123 ? 18.577  -8.465  24.328 1.00 110.13 ? 50   DA  J C2    1 
ATOM   5481  N  N3    . DA  B  2 123 ? 18.636  -9.796  24.237 1.00 110.27 ? 50   DA  J N3    1 
ATOM   5482  C  C4    . DA  B  2 123 ? 17.840  -10.386 25.149 1.00 110.15 ? 50   DA  J C4    1 
ATOM   5483  P  P     . DG  B  2 124 ? 20.607  -16.353 24.760 1.00 117.91 ? 51   DG  J P     1 
ATOM   5484  O  OP1   . DG  B  2 124 ? 21.248  -17.479 24.040 1.00 117.90 ? 51   DG  J OP1   1 
ATOM   5485  O  OP2   . DG  B  2 124 ? 20.178  -16.534 26.168 1.00 117.84 ? 51   DG  J OP2   1 
ATOM   5486  O  "O5'" . DG  B  2 124 ? 21.580  -15.086 24.711 1.00 119.89 ? 51   DG  J "O5'" 1 
ATOM   5487  C  "C5'" . DG  B  2 124 ? 22.276  -14.713 23.517 1.00 122.54 ? 51   DG  J "C5'" 1 
ATOM   5488  C  "C4'" . DG  B  2 124 ? 23.220  -13.568 23.840 1.00 124.61 ? 51   DG  J "C4'" 1 
ATOM   5489  O  "O4'" . DG  B  2 124 ? 22.429  -12.402 24.192 1.00 124.93 ? 51   DG  J "O4'" 1 
ATOM   5490  C  "C3'" . DG  B  2 124 ? 24.150  -13.843 25.026 1.00 125.95 ? 51   DG  J "C3'" 1 
ATOM   5491  O  "O3'" . DG  B  2 124 ? 25.495  -13.436 24.744 1.00 127.58 ? 51   DG  J "O3'" 1 
ATOM   5492  C  "C2'" . DG  B  2 124 ? 23.530  -13.037 26.166 1.00 125.85 ? 51   DG  J "C2'" 1 
ATOM   5493  C  "C1'" . DG  B  2 124 ? 22.914  -11.870 25.408 1.00 125.81 ? 51   DG  J "C1'" 1 
ATOM   5494  N  N9    . DG  B  2 124 ? 21.821  -11.264 26.153 1.00 125.85 ? 51   DG  J N9    1 
ATOM   5495  C  C8    . DG  B  2 124 ? 20.783  -11.917 26.768 1.00 125.98 ? 51   DG  J C8    1 
ATOM   5496  N  N7    . DG  B  2 124 ? 19.953  -11.117 27.375 1.00 126.08 ? 51   DG  J N7    1 
ATOM   5497  C  C5    . DG  B  2 124 ? 20.480  -9.852  27.150 1.00 126.06 ? 51   DG  J C5    1 
ATOM   5498  C  C6    . DG  B  2 124 ? 20.011  -8.580  27.567 1.00 126.06 ? 51   DG  J C6    1 
ATOM   5499  O  O6    . DG  B  2 124 ? 19.005  -8.323  28.243 1.00 126.07 ? 51   DG  J O6    1 
ATOM   5500  N  N1    . DG  B  2 124 ? 20.841  -7.545  27.132 1.00 125.98 ? 51   DG  J N1    1 
ATOM   5501  C  C2    . DG  B  2 124 ? 21.983  -7.723  26.381 1.00 126.00 ? 51   DG  J C2    1 
ATOM   5502  N  N2    . DG  B  2 124 ? 22.658  -6.612  26.049 1.00 125.96 ? 51   DG  J N2    1 
ATOM   5503  N  N3    . DG  B  2 124 ? 22.433  -8.910  25.984 1.00 126.03 ? 51   DG  J N3    1 
ATOM   5504  C  C4    . DG  B  2 124 ? 21.635  -9.926  26.402 1.00 125.95 ? 51   DG  J C4    1 
ATOM   5505  P  P     . DT  B  2 125 ? 26.685  -13.567 25.823 1.00 129.04 ? 52   DT  J P     1 
ATOM   5506  O  OP1   . DT  B  2 125 ? 27.952  -13.560 25.053 1.00 129.28 ? 52   DT  J OP1   1 
ATOM   5507  O  OP2   . DT  B  2 125 ? 26.403  -14.697 26.746 1.00 128.92 ? 52   DT  J OP2   1 
ATOM   5508  O  "O5'" . DT  B  2 125 ? 26.587  -12.206 26.668 1.00 128.84 ? 52   DT  J "O5'" 1 
ATOM   5509  C  "C5'" . DT  B  2 125 ? 26.724  -10.929 26.034 1.00 129.04 ? 52   DT  J "C5'" 1 
ATOM   5510  C  "C4'" . DT  B  2 125 ? 26.545  -9.799  27.034 1.00 129.03 ? 52   DT  J "C4'" 1 
ATOM   5511  O  "O4'" . DT  B  2 125 ? 25.151  -9.693  27.413 1.00 129.19 ? 52   DT  J "O4'" 1 
ATOM   5512  C  "C3'" . DT  B  2 125 ? 27.331  -9.941  28.339 1.00 128.97 ? 52   DT  J "C3'" 1 
ATOM   5513  O  "O3'" . DT  B  2 125 ? 28.359  -8.942  28.361 1.00 128.93 ? 52   DT  J "O3'" 1 
ATOM   5514  C  "C2'" . DT  B  2 125 ? 26.283  -9.783  29.450 1.00 128.88 ? 52   DT  J "C2'" 1 
ATOM   5515  C  "C1'" . DT  B  2 125 ? 25.111  -9.142  28.712 1.00 129.03 ? 52   DT  J "C1'" 1 
ATOM   5516  N  N1    . DT  B  2 125 ? 23.742  -9.355  29.317 1.00 129.15 ? 52   DT  J N1    1 
ATOM   5517  C  C2    . DT  B  2 125 ? 22.958  -8.251  29.632 1.00 129.12 ? 52   DT  J C2    1 
ATOM   5518  O  O2    . DT  B  2 125 ? 23.311  -7.095  29.463 1.00 128.91 ? 52   DT  J O2    1 
ATOM   5519  N  N3    . DT  B  2 125 ? 21.729  -8.551  30.178 1.00 129.03 ? 52   DT  J N3    1 
ATOM   5520  C  C4    . DT  B  2 125 ? 21.206  -9.811  30.428 1.00 128.96 ? 52   DT  J C4    1 
ATOM   5521  O  O4    . DT  B  2 125 ? 20.087  -9.957  30.912 1.00 128.86 ? 52   DT  J O4    1 
ATOM   5522  C  C5    . DT  B  2 125 ? 22.067  -10.920 30.069 1.00 129.03 ? 52   DT  J C5    1 
ATOM   5523  C  C7    . DT  B  2 125 ? 21.628  -12.341 30.284 1.00 129.01 ? 52   DT  J C7    1 
ATOM   5524  C  C6    . DT  B  2 125 ? 23.272  -10.642 29.539 1.00 129.21 ? 52   DT  J C6    1 
ATOM   5525  P  P     . DA  B  2 126 ? 29.390  -8.726  29.575 1.00 128.95 ? 53   DA  J P     1 
ATOM   5526  O  OP1   . DA  B  2 126 ? 30.663  -8.222  29.011 1.00 129.06 ? 53   DA  J OP1   1 
ATOM   5527  O  OP2   . DA  B  2 126 ? 29.407  -9.935  30.431 1.00 128.79 ? 53   DA  J OP2   1 
ATOM   5528  O  "O5'" . DA  B  2 126 ? 28.703  -7.532  30.388 1.00 128.35 ? 53   DA  J "O5'" 1 
ATOM   5529  C  "C5'" . DA  B  2 126 ? 28.444  -6.265  29.766 1.00 127.47 ? 53   DA  J "C5'" 1 
ATOM   5530  C  "C4'" . DA  B  2 126 ? 27.918  -5.259  30.779 1.00 126.90 ? 53   DA  J "C4'" 1 
ATOM   5531  O  "O4'" . DA  B  2 126 ? 26.485  -5.411  30.976 1.00 126.78 ? 53   DA  J "O4'" 1 
ATOM   5532  C  "C3'" . DA  B  2 126 ? 28.555  -5.362  32.159 1.00 126.34 ? 53   DA  J "C3'" 1 
ATOM   5533  O  "O3'" . DA  B  2 126 ? 28.909  -4.070  32.599 1.00 125.88 ? 53   DA  J "O3'" 1 
ATOM   5534  C  "C2'" . DA  B  2 126 ? 27.463  -5.960  33.038 1.00 126.35 ? 53   DA  J "C2'" 1 
ATOM   5535  C  "C1'" . DA  B  2 126 ? 26.191  -5.474  32.359 1.00 126.47 ? 53   DA  J "C1'" 1 
ATOM   5536  N  N9    . DA  B  2 126 ? 25.078  -6.393  32.597 1.00 126.48 ? 53   DA  J N9    1 
ATOM   5537  C  C8    . DA  B  2 126 ? 25.011  -7.707  32.217 1.00 126.44 ? 53   DA  J C8    1 
ATOM   5538  N  N7    . DA  B  2 126 ? 23.903  -8.312  32.569 1.00 126.33 ? 53   DA  J N7    1 
ATOM   5539  C  C5    . DA  B  2 126 ? 23.194  -7.327  33.230 1.00 126.32 ? 53   DA  J C5    1 
ATOM   5540  C  C6    . DA  B  2 126 ? 21.929  -7.334  33.847 1.00 126.34 ? 53   DA  J C6    1 
ATOM   5541  N  N6    . DA  B  2 126 ? 21.155  -8.420  33.877 1.00 126.36 ? 53   DA  J N6    1 
ATOM   5542  N  N1    . DA  B  2 126 ? 21.495  -6.191  34.427 1.00 126.40 ? 53   DA  J N1    1 
ATOM   5543  C  C2    . DA  B  2 126 ? 22.284  -5.108  34.383 1.00 126.33 ? 53   DA  J C2    1 
ATOM   5544  N  N3    . DA  B  2 126 ? 23.496  -4.983  33.834 1.00 126.35 ? 53   DA  J N3    1 
ATOM   5545  C  C4    . DA  B  2 126 ? 23.899  -6.137  33.265 1.00 126.31 ? 53   DA  J C4    1 
ATOM   5546  P  P     . DT  B  2 127 ? 29.867  -3.867  33.865 1.00 125.35 ? 54   DT  J P     1 
ATOM   5547  O  OP1   . DT  B  2 127 ? 31.011  -3.043  33.412 1.00 125.45 ? 54   DT  J OP1   1 
ATOM   5548  O  OP2   . DT  B  2 127 ? 30.095  -5.178  34.522 1.00 125.01 ? 54   DT  J OP2   1 
ATOM   5549  O  "O5'" . DT  B  2 127 ? 28.969  -2.986  34.853 1.00 124.37 ? 54   DT  J "O5'" 1 
ATOM   5550  C  "C5'" . DT  B  2 127 ? 28.513  -1.689  34.477 1.00 122.28 ? 54   DT  J "C5'" 1 
ATOM   5551  C  "C4'" . DT  B  2 127 ? 27.446  -1.239  35.454 1.00 120.69 ? 54   DT  J "C4'" 1 
ATOM   5552  O  "O4'" . DT  B  2 127 ? 26.353  -2.195  35.442 1.00 120.36 ? 54   DT  J "O4'" 1 
ATOM   5553  C  "C3'" . DT  B  2 127 ? 27.928  -1.130  36.903 1.00 119.50 ? 54   DT  J "C3'" 1 
ATOM   5554  O  "O3'" . DT  B  2 127 ? 27.665  0.210   37.368 1.00 117.57 ? 54   DT  J "O3'" 1 
ATOM   5555  C  "C2'" . DT  B  2 127 ? 27.169  -2.244  37.630 1.00 119.70 ? 54   DT  J "C2'" 1 
ATOM   5556  C  "C1'" . DT  B  2 127 ? 25.916  -2.389  36.772 1.00 120.31 ? 54   DT  J "C1'" 1 
ATOM   5557  N  N1    . DT  B  2 127 ? 25.215  -3.718  36.903 1.00 120.55 ? 54   DT  J N1    1 
ATOM   5558  C  C2    . DT  B  2 127 ? 23.838  -3.761  37.099 1.00 120.59 ? 54   DT  J C2    1 
ATOM   5559  O  O2    . DT  B  2 127 ? 23.115  -2.777  37.179 1.00 120.38 ? 54   DT  J O2    1 
ATOM   5560  N  N3    . DT  B  2 127 ? 23.321  -5.031  37.212 1.00 120.59 ? 54   DT  J N3    1 
ATOM   5561  C  C4    . DT  B  2 127 ? 24.007  -6.234  37.143 1.00 120.35 ? 54   DT  J C4    1 
ATOM   5562  O  O4    . DT  B  2 127 ? 23.426  -7.309  37.251 1.00 120.19 ? 54   DT  J O4    1 
ATOM   5563  C  C5    . DT  B  2 127 ? 25.436  -6.121  36.937 1.00 120.42 ? 54   DT  J C5    1 
ATOM   5564  C  C7    . DT  B  2 127 ? 26.304  -7.344  36.843 1.00 120.39 ? 54   DT  J C7    1 
ATOM   5565  C  C6    . DT  B  2 127 ? 25.960  -4.888  36.829 1.00 120.46 ? 54   DT  J C6    1 
ATOM   5566  P  P     . DC  B  2 128 ? 27.304  0.628   38.877 1.00 115.87 ? 55   DC  J P     1 
ATOM   5567  O  OP1   . DC  B  2 128 ? 27.407  2.104   38.970 1.00 115.87 ? 55   DC  J OP1   1 
ATOM   5568  O  OP2   . DC  B  2 128 ? 28.086  -0.215  39.814 1.00 115.85 ? 55   DC  J OP2   1 
ATOM   5569  O  "O5'" . DC  B  2 128 ? 25.758  0.225   38.989 1.00 113.94 ? 55   DC  J "O5'" 1 
ATOM   5570  C  "C5'" . DC  B  2 128 ? 24.734  1.062   38.444 1.00 110.39 ? 55   DC  J "C5'" 1 
ATOM   5571  C  "C4'" . DC  B  2 128 ? 23.429  0.912   39.216 1.00 107.43 ? 55   DC  J "C4'" 1 
ATOM   5572  O  "O4'" . DC  B  2 128 ? 22.993  -0.475  39.214 1.00 106.82 ? 55   DC  J "O4'" 1 
ATOM   5573  C  "C3'" . DC  B  2 128 ? 23.472  1.343   40.679 1.00 105.55 ? 55   DC  J "C3'" 1 
ATOM   5574  O  "O3'" . DC  B  2 128 ? 22.299  2.133   40.908 1.00 102.71 ? 55   DC  J "O3'" 1 
ATOM   5575  C  "C2'" . DC  B  2 128 ? 23.536  0.022   41.458 1.00 105.36 ? 55   DC  J "C2'" 1 
ATOM   5576  C  "C1'" . DC  B  2 128 ? 22.793  -0.945  40.538 1.00 105.98 ? 55   DC  J "C1'" 1 
ATOM   5577  N  N1    . DC  B  2 128 ? 23.216  -2.399  40.574 1.00 105.88 ? 55   DC  J N1    1 
ATOM   5578  C  C2    . DC  B  2 128 ? 22.290  -3.416  40.900 1.00 105.80 ? 55   DC  J C2    1 
ATOM   5579  O  O2    . DC  B  2 128 ? 21.116  -3.143  41.182 1.00 105.89 ? 55   DC  J O2    1 
ATOM   5580  N  N3    . DC  B  2 128 ? 22.704  -4.709  40.908 1.00 105.60 ? 55   DC  J N3    1 
ATOM   5581  C  C4    . DC  B  2 128 ? 23.967  -5.014  40.603 1.00 105.71 ? 55   DC  J C4    1 
ATOM   5582  N  N4    . DC  B  2 128 ? 24.315  -6.303  40.624 1.00 105.70 ? 55   DC  J N4    1 
ATOM   5583  C  C5    . DC  B  2 128 ? 24.924  -4.008  40.265 1.00 105.98 ? 55   DC  J C5    1 
ATOM   5584  C  C6    . DC  B  2 128 ? 24.508  -2.732  40.261 1.00 105.92 ? 55   DC  J C6    1 
ATOM   5585  P  P     . DT  B  2 129 ? 21.712  2.484   42.355 1.00 100.42 ? 56   DT  J P     1 
ATOM   5586  O  OP1   . DT  B  2 129 ? 20.785  3.630   42.187 1.00 100.36 ? 56   DT  J OP1   1 
ATOM   5587  O  OP2   . DT  B  2 129 ? 22.825  2.568   43.333 1.00 100.01 ? 56   DT  J OP2   1 
ATOM   5588  O  "O5'" . DT  B  2 129 ? 20.857  1.167   42.675 1.00 97.99  ? 56   DT  J "O5'" 1 
ATOM   5589  C  "C5'" . DT  B  2 129 ? 19.427  1.178   42.652 1.00 92.94  ? 56   DT  J "C5'" 1 
ATOM   5590  C  "C4'" . DT  B  2 129 ? 18.837  0.292   43.744 1.00 89.04  ? 56   DT  J "C4'" 1 
ATOM   5591  O  "O4'" . DT  B  2 129 ? 19.488  -1.005  43.745 1.00 88.62  ? 56   DT  J "O4'" 1 
ATOM   5592  C  "C3'" . DT  B  2 129 ? 18.914  0.777   45.188 1.00 85.62  ? 56   DT  J "C3'" 1 
ATOM   5593  O  "O3'" . DT  B  2 129 ? 17.713  0.346   45.807 1.00 80.31  ? 56   DT  J "O3'" 1 
ATOM   5594  C  "C2'" . DT  B  2 129 ? 20.123  0.018   45.736 1.00 86.77  ? 56   DT  J "C2'" 1 
ATOM   5595  C  "C1'" . DT  B  2 129 ? 19.890  -1.330  45.060 1.00 88.93  ? 56   DT  J "C1'" 1 
ATOM   5596  N  N1    . DT  B  2 129 ? 21.031  -2.294  44.924 1.00 89.35  ? 56   DT  J N1    1 
ATOM   5597  C  C2    . DT  B  2 129 ? 20.786  -3.640  45.131 1.00 89.86  ? 56   DT  J C2    1 
ATOM   5598  O  O2    . DT  B  2 129 ? 19.703  -4.095  45.448 1.00 90.23  ? 56   DT  J O2    1 
ATOM   5599  N  N3    . DT  B  2 129 ? 21.870  -4.460  44.970 1.00 90.17  ? 56   DT  J N3    1 
ATOM   5600  C  C4    . DT  B  2 129 ? 23.152  -4.083  44.617 1.00 90.14  ? 56   DT  J C4    1 
ATOM   5601  O  O4    . DT  B  2 129 ? 24.061  -4.905  44.495 1.00 90.22  ? 56   DT  J O4    1 
ATOM   5602  C  C5    . DT  B  2 129 ? 23.339  -2.666  44.404 1.00 89.94  ? 56   DT  J C5    1 
ATOM   5603  C  C7    . DT  B  2 129 ? 24.687  -2.137  44.019 1.00 90.13  ? 56   DT  J C7    1 
ATOM   5604  C  C6    . DT  B  2 129 ? 22.287  -1.851  44.559 1.00 89.54  ? 56   DT  J C6    1 
ATOM   5605  P  P     . DG  B  2 130 ? 16.826  1.301   46.724 1.00 76.38  ? 57   DG  J P     1 
ATOM   5606  O  OP1   . DG  B  2 130 ? 16.284  2.380   45.873 1.00 76.49  ? 57   DG  J OP1   1 
ATOM   5607  O  OP2   . DG  B  2 130 ? 17.636  1.593   47.926 1.00 76.33  ? 57   DG  J OP2   1 
ATOM   5608  O  "O5'" . DG  B  2 130 ? 15.579  0.419   47.183 1.00 73.16  ? 57   DG  J "O5'" 1 
ATOM   5609  C  "C5'" . DG  B  2 130 ? 15.080  -0.634  46.368 1.00 68.96  ? 57   DG  J "C5'" 1 
ATOM   5610  C  "C4'" . DG  B  2 130 ? 14.725  -1.841  47.220 1.00 65.55  ? 57   DG  J "C4'" 1 
ATOM   5611  O  "O4'" . DG  B  2 130 ? 15.878  -2.697  47.291 1.00 64.50  ? 57   DG  J "O4'" 1 
ATOM   5612  C  "C3'" . DG  B  2 130 ? 14.303  -1.590  48.672 1.00 64.24  ? 57   DG  J "C3'" 1 
ATOM   5613  O  "O3'" . DG  B  2 130 ? 13.271  -2.522  49.019 1.00 61.29  ? 57   DG  J "O3'" 1 
ATOM   5614  C  "C2'" . DG  B  2 130 ? 15.573  -1.815  49.484 1.00 63.82  ? 57   DG  J "C2'" 1 
ATOM   5615  C  "C1'" . DG  B  2 130 ? 16.313  -2.829  48.629 1.00 65.59  ? 57   DG  J "C1'" 1 
ATOM   5616  N  N9    . DG  B  2 130 ? 17.751  -2.628  48.624 1.00 66.44  ? 57   DG  J N9    1 
ATOM   5617  C  C8    . DG  B  2 130 ? 18.447  -1.439  48.688 1.00 66.56  ? 57   DG  J C8    1 
ATOM   5618  N  N7    . DG  B  2 130 ? 19.740  -1.594  48.660 1.00 66.50  ? 57   DG  J N7    1 
ATOM   5619  C  C5    . DG  B  2 130 ? 19.910  -2.968  48.569 1.00 66.66  ? 57   DG  J C5    1 
ATOM   5620  C  C6    . DG  B  2 130 ? 21.094  -3.735  48.509 1.00 66.41  ? 57   DG  J C6    1 
ATOM   5621  O  O6    . DG  B  2 130 ? 22.257  -3.307  48.513 1.00 66.82  ? 57   DG  J O6    1 
ATOM   5622  N  N1    . DG  B  2 130 ? 20.825  -5.105  48.427 1.00 66.13  ? 57   DG  J N1    1 
ATOM   5623  C  C2    . DG  B  2 130 ? 19.555  -5.649  48.408 1.00 66.51  ? 57   DG  J C2    1 
ATOM   5624  N  N2    . DG  B  2 130 ? 19.442  -6.984  48.331 1.00 66.56  ? 57   DG  J N2    1 
ATOM   5625  N  N3    . DG  B  2 130 ? 18.441  -4.935  48.460 1.00 66.39  ? 57   DG  J N3    1 
ATOM   5626  C  C4    . DG  B  2 130 ? 18.695  -3.614  48.543 1.00 66.47  ? 57   DG  J C4    1 
ATOM   5627  P  P     . DC  B  2 131 ? 12.473  -2.500  50.404 1.00 58.51  ? 58   DC  J P     1 
ATOM   5628  O  OP1   . DC  B  2 131 ? 11.056  -2.789  50.079 1.00 59.49  ? 58   DC  J OP1   1 
ATOM   5629  O  OP2   . DC  B  2 131 ? 12.806  -1.283  51.168 1.00 58.68  ? 58   DC  J OP2   1 
ATOM   5630  O  "O5'" . DC  B  2 131 ? 13.106  -3.752  51.177 1.00 58.93  ? 58   DC  J "O5'" 1 
ATOM   5631  C  "C5'" . DC  B  2 131 ? 13.218  -5.021  50.575 1.00 58.08  ? 58   DC  J "C5'" 1 
ATOM   5632  C  "C4'" . DC  B  2 131 ? 14.202  -5.888  51.337 1.00 60.74  ? 58   DC  J "C4'" 1 
ATOM   5633  O  "O4'" . DC  B  2 131 ? 15.552  -5.448  51.035 1.00 61.21  ? 58   DC  J "O4'" 1 
ATOM   5634  C  "C3'" . DC  B  2 131 ? 14.094  -5.921  52.868 1.00 61.03  ? 58   DC  J "C3'" 1 
ATOM   5635  O  "O3'" . DC  B  2 131 ? 14.206  -7.253  53.372 1.00 61.32  ? 58   DC  J "O3'" 1 
ATOM   5636  C  "C2'" . DC  B  2 131 ? 15.312  -5.120  53.303 1.00 61.68  ? 58   DC  J "C2'" 1 
ATOM   5637  C  "C1'" . DC  B  2 131 ? 16.302  -5.552  52.225 1.00 62.51  ? 58   DC  J "C1'" 1 
ATOM   5638  N  N1    . DC  B  2 131 ? 17.534  -4.710  52.080 1.00 63.21  ? 58   DC  J N1    1 
ATOM   5639  C  C2    . DC  B  2 131 ? 18.760  -5.289  51.694 1.00 63.11  ? 58   DC  J C2    1 
ATOM   5640  O  O2    . DC  B  2 131 ? 18.856  -6.503  51.464 1.00 62.94  ? 58   DC  J O2    1 
ATOM   5641  N  N3    . DC  B  2 131 ? 19.836  -4.475  51.562 1.00 63.47  ? 58   DC  J N3    1 
ATOM   5642  C  C4    . DC  B  2 131 ? 19.735  -3.168  51.806 1.00 62.98  ? 58   DC  J C4    1 
ATOM   5643  N  N4    . DC  B  2 131 ? 20.833  -2.433  51.665 1.00 63.36  ? 58   DC  J N4    1 
ATOM   5644  C  C5    . DC  B  2 131 ? 18.512  -2.555  52.200 1.00 63.33  ? 58   DC  J C5    1 
ATOM   5645  C  C6    . DC  B  2 131 ? 17.452  -3.362  52.319 1.00 63.79  ? 58   DC  J C6    1 
ATOM   5646  P  P     . DA  B  2 132 ? 12.936  -8.114  53.843 1.00 62.53  ? 59   DA  J P     1 
ATOM   5647  O  OP1   . DA  B  2 132 ? 12.023  -8.209  52.672 1.00 61.86  ? 59   DA  J OP1   1 
ATOM   5648  O  OP2   . DA  B  2 132 ? 12.472  -7.602  55.153 1.00 59.86  ? 59   DA  J OP2   1 
ATOM   5649  O  "O5'" . DA  B  2 132 ? 13.561  -9.561  54.081 1.00 63.80  ? 59   DA  J "O5'" 1 
ATOM   5650  C  "C5'" . DA  B  2 132 ? 14.021  -10.289 52.947 1.00 67.93  ? 59   DA  J "C5'" 1 
ATOM   5651  C  "C4'" . DA  B  2 132 ? 15.296  -11.053 53.256 1.00 71.06  ? 59   DA  J "C4'" 1 
ATOM   5652  O  "O4'" . DA  B  2 132 ? 16.440  -10.172 53.334 1.00 71.49  ? 59   DA  J "O4'" 1 
ATOM   5653  C  "C3'" . DA  B  2 132 ? 15.303  -11.823 54.569 1.00 73.56  ? 59   DA  J "C3'" 1 
ATOM   5654  O  "O3'" . DA  B  2 132 ? 16.046  -13.005 54.356 1.00 77.78  ? 59   DA  J "O3'" 1 
ATOM   5655  C  "C2'" . DA  B  2 132 ? 16.008  -10.888 55.547 1.00 72.50  ? 59   DA  J "C2'" 1 
ATOM   5656  C  "C1'" . DA  B  2 132 ? 17.031  -10.242 54.622 1.00 71.70  ? 59   DA  J "C1'" 1 
ATOM   5657  N  N9    . DA  B  2 132 ? 17.396  -8.871  54.946 1.00 71.10  ? 59   DA  J N9    1 
ATOM   5658  C  C8    . DA  B  2 132 ? 16.580  -7.883  55.407 1.00 71.22  ? 59   DA  J C8    1 
ATOM   5659  N  N7    . DA  B  2 132 ? 17.188  -6.739  55.581 1.00 71.34  ? 59   DA  J N7    1 
ATOM   5660  C  C5    . DA  B  2 132 ? 18.490  -6.998  55.194 1.00 71.52  ? 59   DA  J C5    1 
ATOM   5661  C  C6    . DA  B  2 132 ? 19.648  -6.194  55.145 1.00 71.63  ? 59   DA  J C6    1 
ATOM   5662  N  N6    . DA  B  2 132 ? 19.655  -4.909  55.506 1.00 71.64  ? 59   DA  J N6    1 
ATOM   5663  N  N1    . DA  B  2 132 ? 20.798  -6.758  54.716 1.00 71.42  ? 59   DA  J N1    1 
ATOM   5664  C  C2    . DA  B  2 132 ? 20.786  -8.048  54.358 1.00 71.35  ? 59   DA  J C2    1 
ATOM   5665  N  N3    . DA  B  2 132 ? 19.761  -8.899  54.361 1.00 71.32  ? 59   DA  J N3    1 
ATOM   5666  C  C4    . DA  B  2 132 ? 18.635  -8.309  54.800 1.00 71.08  ? 59   DA  J C4    1 
ATOM   5667  P  P     . DG  B  2 133 ? 15.820  -14.266 55.307 1.00 81.11  ? 60   DG  J P     1 
ATOM   5668  O  OP1   . DG  B  2 133 ? 16.022  -15.469 54.458 1.00 80.95  ? 60   DG  J OP1   1 
ATOM   5669  O  OP2   . DG  B  2 133 ? 14.545  -14.053 56.043 1.00 80.21  ? 60   DG  J OP2   1 
ATOM   5670  O  "O5'" . DG  B  2 133 ? 17.043  -14.142 56.340 1.00 81.72  ? 60   DG  J "O5'" 1 
ATOM   5671  C  "C5'" . DG  B  2 133 ? 18.371  -14.037 55.818 1.00 83.99  ? 60   DG  J "C5'" 1 
ATOM   5672  C  "C4'" . DG  B  2 133 ? 19.375  -13.640 56.888 1.00 86.41  ? 60   DG  J "C4'" 1 
ATOM   5673  O  "O4'" . DG  B  2 133 ? 19.479  -12.190 56.935 1.00 86.19  ? 60   DG  J "O4'" 1 
ATOM   5674  C  "C3'" . DG  B  2 133 ? 19.090  -14.122 58.318 1.00 88.04  ? 60   DG  J "C3'" 1 
ATOM   5675  O  "O3'" . DG  B  2 133 ? 20.265  -14.830 58.817 1.00 90.70  ? 60   DG  J "O3'" 1 
ATOM   5676  C  "C2'" . DG  B  2 133 ? 18.726  -12.831 59.063 1.00 87.13  ? 60   DG  J "C2'" 1 
ATOM   5677  C  "C1'" . DG  B  2 133 ? 19.490  -11.761 58.280 1.00 86.22  ? 60   DG  J "C1'" 1 
ATOM   5678  N  N9    . DG  B  2 133 ? 18.911  -10.414 58.353 1.00 86.24  ? 60   DG  J N9    1 
ATOM   5679  C  C8    . DG  B  2 133 ? 17.580  -10.099 58.508 1.00 86.13  ? 60   DG  J C8    1 
ATOM   5680  N  N7    . DG  B  2 133 ? 17.333  -8.820  58.547 1.00 86.00  ? 60   DG  J N7    1 
ATOM   5681  C  C5    . DG  B  2 133 ? 18.584  -8.236  58.409 1.00 86.05  ? 60   DG  J C5    1 
ATOM   5682  C  C6    . DG  B  2 133 ? 18.942  -6.863  58.378 1.00 86.03  ? 60   DG  J C6    1 
ATOM   5683  O  O6    . DG  B  2 133 ? 18.196  -5.874  58.468 1.00 85.85  ? 60   DG  J O6    1 
ATOM   5684  N  N1    . DG  B  2 133 ? 20.318  -6.687  58.225 1.00 85.88  ? 60   DG  J N1    1 
ATOM   5685  C  C2    . DG  B  2 133 ? 21.229  -7.713  58.116 1.00 85.94  ? 60   DG  J C2    1 
ATOM   5686  N  N2    . DG  B  2 133 ? 22.509  -7.342  57.974 1.00 86.14  ? 60   DG  J N2    1 
ATOM   5687  N  N3    . DG  B  2 133 ? 20.907  -9.004  58.142 1.00 85.65  ? 60   DG  J N3    1 
ATOM   5688  C  C4    . DG  B  2 133 ? 19.569  -9.199  58.284 1.00 86.01  ? 60   DG  J C4    1 
ATOM   5689  P  P     . DG  B  2 134 ? 20.545  -15.264 60.345 1.00 92.53  ? 61   DG  J P     1 
ATOM   5690  O  OP1   . DG  B  2 134 ? 21.257  -16.561 60.300 1.00 92.62  ? 61   DG  J OP1   1 
ATOM   5691  O  OP2   . DG  B  2 134 ? 19.283  -15.182 61.115 1.00 92.50  ? 61   DG  J OP2   1 
ATOM   5692  O  "O5'" . DG  B  2 134 ? 21.564  -14.134 60.864 1.00 94.06  ? 61   DG  J "O5'" 1 
ATOM   5693  C  "C5'" . DG  B  2 134 ? 22.845  -13.945 60.232 1.00 97.84  ? 61   DG  J "C5'" 1 
ATOM   5694  C  "C4'" . DG  B  2 134 ? 23.717  -12.875 60.885 1.00 101.05 ? 61   DG  J "C4'" 1 
ATOM   5695  O  "O4'" . DG  B  2 134 ? 23.305  -11.558 60.415 1.00 101.51 ? 61   DG  J "O4'" 1 
ATOM   5696  C  "C3'" . DG  B  2 134 ? 23.726  -12.827 62.416 1.00 103.20 ? 61   DG  J "C3'" 1 
ATOM   5697  O  "O3'" . DG  B  2 134 ? 25.019  -13.218 62.929 1.00 106.93 ? 61   DG  J "O3'" 1 
ATOM   5698  C  "C2'" . DG  B  2 134 ? 23.382  -11.379 62.781 1.00 102.50 ? 61   DG  J "C2'" 1 
ATOM   5699  C  "C1'" . DG  B  2 134 ? 23.262  -10.609 61.467 1.00 101.54 ? 61   DG  J "C1'" 1 
ATOM   5700  N  N9    . DG  B  2 134 ? 22.002  -9.858  61.403 1.00 101.45 ? 61   DG  J N9    1 
ATOM   5701  C  C8    . DG  B  2 134 ? 20.762  -10.407 61.177 1.00 101.21 ? 61   DG  J C8    1 
ATOM   5702  N  N7    . DG  B  2 134 ? 19.788  -9.545  61.177 1.00 101.16 ? 61   DG  J N7    1 
ATOM   5703  C  C5    . DG  B  2 134 ? 20.413  -8.332  61.421 1.00 101.25 ? 61   DG  J C5    1 
ATOM   5704  C  C6    . DG  B  2 134 ? 19.847  -7.037  61.535 1.00 101.12 ? 61   DG  J C6    1 
ATOM   5705  O  O6    . DG  B  2 134 ? 18.658  -6.710  61.433 1.00 101.14 ? 61   DG  J O6    1 
ATOM   5706  N  N1    . DG  B  2 134 ? 20.808  -6.063  61.791 1.00 101.27 ? 61   DG  J N1    1 
ATOM   5707  C  C2    . DG  B  2 134 ? 22.153  -6.307  61.925 1.00 101.30 ? 61   DG  J C2    1 
ATOM   5708  N  N2    . DG  B  2 134 ? 22.901  -5.219  62.173 1.00 101.20 ? 61   DG  J N2    1 
ATOM   5709  N  N3    . DG  B  2 134 ? 22.704  -7.524  61.825 1.00 101.35 ? 61   DG  J N3    1 
ATOM   5710  C  C4    . DG  B  2 134 ? 21.780  -8.497  61.568 1.00 101.48 ? 61   DG  J C4    1 
ATOM   5711  P  P     . DT  B  2 135 ? 25.292  -13.458 64.501 1.00 110.21 ? 62   DT  J P     1 
ATOM   5712  O  OP1   . DT  B  2 135 ? 26.642  -14.060 64.658 1.00 109.70 ? 62   DT  J OP1   1 
ATOM   5713  O  OP2   . DT  B  2 135 ? 24.110  -14.171 65.044 1.00 109.90 ? 62   DT  J OP2   1 
ATOM   5714  O  "O5'" . DT  B  2 135 ? 25.317  -11.976 65.124 1.00 111.47 ? 62   DT  J "O5'" 1 
ATOM   5715  C  "C5'" . DT  B  2 135 ? 26.403  -11.093 64.850 1.00 113.77 ? 62   DT  J "C5'" 1 
ATOM   5716  C  "C4'" . DT  B  2 135 ? 26.112  -9.665  65.278 1.00 115.76 ? 62   DT  J "C4'" 1 
ATOM   5717  O  "O4'" . DT  B  2 135 ? 25.014  -9.095  64.525 1.00 115.95 ? 62   DT  J "O4'" 1 
ATOM   5718  C  "C3'" . DT  B  2 135 ? 25.655  -9.450  66.712 1.00 117.15 ? 62   DT  J "C3'" 1 
ATOM   5719  O  "O3'" . DT  B  2 135 ? 26.750  -9.592  67.620 1.00 119.45 ? 62   DT  J "O3'" 1 
ATOM   5720  C  "C2'" . DT  B  2 135 ? 25.170  -8.006  66.630 1.00 116.83 ? 62   DT  J "C2'" 1 
ATOM   5721  C  "C1'" . DT  B  2 135 ? 24.659  -7.895  65.195 1.00 116.32 ? 62   DT  J "C1'" 1 
ATOM   5722  N  N1    . DT  B  2 135 ? 23.181  -7.648  65.141 1.00 116.20 ? 62   DT  J N1    1 
ATOM   5723  C  C2    . DT  B  2 135 ? 22.704  -6.356  65.292 1.00 116.03 ? 62   DT  J C2    1 
ATOM   5724  O  O2    . DT  B  2 135 ? 23.414  -5.381  65.461 1.00 116.13 ? 62   DT  J O2    1 
ATOM   5725  N  N3    . DT  B  2 135 ? 21.337  -6.240  65.230 1.00 116.10 ? 62   DT  J N3    1 
ATOM   5726  C  C4    . DT  B  2 135 ? 20.423  -7.264  65.043 1.00 116.14 ? 62   DT  J C4    1 
ATOM   5727  O  O4    . DT  B  2 135 ? 19.217  -7.047  65.004 1.00 116.30 ? 62   DT  J O4    1 
ATOM   5728  C  C5    . DT  B  2 135 ? 20.984  -8.589  64.897 1.00 115.99 ? 62   DT  J C5    1 
ATOM   5729  C  C7    . DT  B  2 135 ? 20.101  -9.787  64.690 1.00 116.03 ? 62   DT  J C7    1 
ATOM   5730  C  C6    . DT  B  2 135 ? 22.317  -8.713  64.956 1.00 116.18 ? 62   DT  J C6    1 
ATOM   5731  P  P     . DG  B  2 136 ? 26.533  -9.701  69.211 1.00 121.05 ? 63   DG  J P     1 
ATOM   5732  O  OP1   . DG  B  2 136 ? 27.797  -10.223 69.779 1.00 121.10 ? 63   DG  J OP1   1 
ATOM   5733  O  OP2   . DG  B  2 136 ? 25.261  -10.416 69.488 1.00 120.96 ? 63   DG  J OP2   1 
ATOM   5734  O  "O5'" . DG  B  2 136 ? 26.323  -8.180  69.671 1.00 122.00 ? 63   DG  J "O5'" 1 
ATOM   5735  C  "C5'" . DG  B  2 136 ? 27.294  -7.148  69.449 1.00 123.54 ? 63   DG  J "C5'" 1 
ATOM   5736  C  "C4'" . DG  B  2 136 ? 26.692  -5.793  69.797 1.00 124.61 ? 63   DG  J "C4'" 1 
ATOM   5737  O  "O4'" . DG  B  2 136 ? 25.395  -5.674  69.156 1.00 124.87 ? 63   DG  J "O4'" 1 
ATOM   5738  C  "C3'" . DG  B  2 136 ? 26.425  -5.539  71.281 1.00 125.34 ? 63   DG  J "C3'" 1 
ATOM   5739  O  "O3'" . DG  B  2 136 ? 26.500  -4.130  71.573 1.00 126.28 ? 63   DG  J "O3'" 1 
ATOM   5740  C  "C2'" . DG  B  2 136 ? 25.001  -6.070  71.448 1.00 125.20 ? 63   DG  J "C2'" 1 
ATOM   5741  C  "C1'" . DG  B  2 136 ? 24.379  -5.583  70.143 1.00 125.26 ? 63   DG  J "C1'" 1 
ATOM   5742  N  N9    . DG  B  2 136 ? 23.205  -6.334  69.694 1.00 125.44 ? 63   DG  J N9    1 
ATOM   5743  C  C8    . DG  B  2 136 ? 23.025  -7.702  69.689 1.00 125.16 ? 63   DG  J C8    1 
ATOM   5744  N  N7    . DG  B  2 136 ? 21.863  -8.067  69.224 1.00 125.04 ? 63   DG  J N7    1 
ATOM   5745  C  C5    . DG  B  2 136 ? 21.233  -6.868  68.896 1.00 125.34 ? 63   DG  J C5    1 
ATOM   5746  C  C6    . DG  B  2 136 ? 19.946  -6.619  68.347 1.00 125.32 ? 63   DG  J C6    1 
ATOM   5747  O  O6    . DG  B  2 136 ? 19.085  -7.449  68.030 1.00 125.34 ? 63   DG  J O6    1 
ATOM   5748  N  N1    . DG  B  2 136 ? 19.687  -5.254  68.169 1.00 125.22 ? 63   DG  J N1    1 
ATOM   5749  C  C2    . DG  B  2 136 ? 20.564  -4.241  68.484 1.00 125.17 ? 63   DG  J C2    1 
ATOM   5750  N  N2    . DG  B  2 136 ? 20.137  -2.990  68.244 1.00 125.14 ? 63   DG  J N2    1 
ATOM   5751  N  N3    . DG  B  2 136 ? 21.775  -4.457  69.000 1.00 125.28 ? 63   DG  J N3    1 
ATOM   5752  C  C4    . DG  B  2 136 ? 22.045  -5.787  69.180 1.00 125.52 ? 63   DG  J C4    1 
ATOM   5753  P  P     . DG  B  2 137 ? 26.626  -3.572  73.078 1.00 126.63 ? 64   DG  J P     1 
ATOM   5754  O  OP1   . DG  B  2 137 ? 28.080  -3.468  73.341 1.00 126.64 ? 64   DG  J OP1   1 
ATOM   5755  O  OP2   . DG  B  2 137 ? 25.779  -4.398  73.975 1.00 126.47 ? 64   DG  J OP2   1 
ATOM   5756  O  "O5'" . DG  B  2 137 ? 26.004  -2.085  73.050 1.00 125.81 ? 64   DG  J "O5'" 1 
ATOM   5757  C  "C5'" . DG  B  2 137 ? 25.021  -1.654  72.101 1.00 124.60 ? 64   DG  J "C5'" 1 
ATOM   5758  C  "C4'" . DG  B  2 137 ? 23.609  -1.577  72.677 1.00 123.98 ? 64   DG  J "C4'" 1 
ATOM   5759  O  "O4'" . DG  B  2 137 ? 22.842  -2.727  72.226 1.00 123.66 ? 64   DG  J "O4'" 1 
ATOM   5760  C  "C3'" . DG  B  2 137 ? 23.445  -1.544  74.203 1.00 123.32 ? 64   DG  J "C3'" 1 
ATOM   5761  O  "O3'" . DG  B  2 137 ? 22.534  -0.499  74.588 1.00 122.96 ? 64   DG  J "O3'" 1 
ATOM   5762  C  "C2'" . DG  B  2 137 ? 22.874  -2.922  74.540 1.00 123.03 ? 64   DG  J "C2'" 1 
ATOM   5763  C  "C1'" . DG  B  2 137 ? 22.019  -3.153  73.295 1.00 122.54 ? 64   DG  J "C1'" 1 
ATOM   5764  N  N9    . DG  B  2 137 ? 21.542  -4.519  73.043 1.00 122.27 ? 64   DG  J N9    1 
ATOM   5765  C  C8    . DG  B  2 137 ? 22.133  -5.712  73.394 1.00 122.08 ? 64   DG  J C8    1 
ATOM   5766  N  N7    . DG  B  2 137 ? 21.457  -6.764  73.019 1.00 121.98 ? 64   DG  J N7    1 
ATOM   5767  C  C5    . DG  B  2 137 ? 20.345  -6.238  72.379 1.00 121.91 ? 64   DG  J C5    1 
ATOM   5768  C  C6    . DG  B  2 137 ? 19.253  -6.895  71.763 1.00 121.95 ? 64   DG  J C6    1 
ATOM   5769  O  O6    . DG  B  2 137 ? 19.064  -8.114  71.666 1.00 122.10 ? 64   DG  J O6    1 
ATOM   5770  N  N1    . DG  B  2 137 ? 18.330  -5.991  71.225 1.00 121.90 ? 64   DG  J N1    1 
ATOM   5771  C  C2    . DG  B  2 137 ? 18.458  -4.619  71.278 1.00 121.93 ? 64   DG  J C2    1 
ATOM   5772  N  N2    . DG  B  2 137 ? 17.485  -3.893  70.715 1.00 121.98 ? 64   DG  J N2    1 
ATOM   5773  N  N3    . DG  B  2 137 ? 19.476  -3.993  71.856 1.00 121.94 ? 64   DG  J N3    1 
ATOM   5774  C  C4    . DG  B  2 137 ? 20.381  -4.859  72.384 1.00 122.05 ? 64   DG  J C4    1 
ATOM   5775  P  P     . DA  B  2 138 ? 22.851  0.349   75.907 1.00 122.61 ? 65   DA  J P     1 
ATOM   5776  O  OP1   . DA  B  2 138 ? 24.093  1.102   75.617 1.00 122.60 ? 65   DA  J OP1   1 
ATOM   5777  O  OP2   . DA  B  2 138 ? 22.775  -0.587  77.056 1.00 122.44 ? 65   DA  J OP2   1 
ATOM   5778  O  "O5'" . DA  B  2 138 ? 21.661  1.403   76.094 1.00 121.43 ? 65   DA  J "O5'" 1 
ATOM   5779  C  "C5'" . DA  B  2 138 ? 21.191  2.249   75.044 1.00 119.58 ? 65   DA  J "C5'" 1 
ATOM   5780  C  "C4'" . DA  B  2 138 ? 19.689  2.063   74.921 1.00 117.99 ? 65   DA  J "C4'" 1 
ATOM   5781  O  "O4'" . DA  B  2 138 ? 19.437  0.739   74.372 1.00 118.05 ? 65   DA  J "O4'" 1 
ATOM   5782  C  "C3'" . DA  B  2 138 ? 18.920  2.120   76.245 1.00 116.76 ? 65   DA  J "C3'" 1 
ATOM   5783  O  "O3'" . DA  B  2 138 ? 17.705  2.872   76.080 1.00 114.82 ? 65   DA  J "O3'" 1 
ATOM   5784  C  "C2'" . DA  B  2 138 ? 18.685  0.641   76.556 1.00 117.02 ? 65   DA  J "C2'" 1 
ATOM   5785  C  "C1'" . DA  B  2 138 ? 18.421  0.135   75.146 1.00 117.50 ? 65   DA  J "C1'" 1 
ATOM   5786  N  N9    . DA  B  2 138 ? 18.420  -1.322  75.019 1.00 117.48 ? 65   DA  J N9    1 
ATOM   5787  C  C8    . DA  B  2 138 ? 19.407  -2.196  75.383 1.00 117.52 ? 65   DA  J C8    1 
ATOM   5788  N  N7    . DA  B  2 138 ? 19.116  -3.456  75.153 1.00 117.47 ? 65   DA  J N7    1 
ATOM   5789  C  C5    . DA  B  2 138 ? 17.846  -3.409  74.604 1.00 117.52 ? 65   DA  J C5    1 
ATOM   5790  C  C6    . DA  B  2 138 ? 16.966  -4.416  74.142 1.00 117.42 ? 65   DA  J C6    1 
ATOM   5791  N  N6    . DA  B  2 138 ? 17.261  -5.720  74.164 1.00 117.34 ? 65   DA  J N6    1 
ATOM   5792  N  N1    . DA  B  2 138 ? 15.769  -4.027  73.647 1.00 117.42 ? 65   DA  J N1    1 
ATOM   5793  C  C2    . DA  B  2 138 ? 15.472  -2.717  73.624 1.00 117.53 ? 65   DA  J C2    1 
ATOM   5794  N  N3    . DA  B  2 138 ? 16.213  -1.683  74.031 1.00 117.46 ? 65   DA  J N3    1 
ATOM   5795  C  C4    . DA  B  2 138 ? 17.399  -2.099  74.515 1.00 117.52 ? 65   DA  J C4    1 
ATOM   5796  P  P     . DT  B  2 139 ? 16.342  2.576   76.885 1.00 113.07 ? 66   DT  J P     1 
ATOM   5797  O  OP1   . DT  B  2 139 ? 15.620  3.859   77.054 1.00 113.49 ? 66   DT  J OP1   1 
ATOM   5798  O  OP2   . DT  B  2 139 ? 16.641  1.756   78.083 1.00 112.87 ? 66   DT  J OP2   1 
ATOM   5799  O  "O5'" . DT  B  2 139 ? 15.524  1.678   75.844 1.00 110.86 ? 66   DT  J "O5'" 1 
ATOM   5800  C  "C5'" . DT  B  2 139 ? 14.429  2.233   75.111 1.00 107.51 ? 66   DT  J "C5'" 1 
ATOM   5801  C  "C4'" . DT  B  2 139 ? 13.201  1.330   75.165 1.00 104.78 ? 66   DT  J "C4'" 1 
ATOM   5802  O  "O4'" . DT  B  2 139 ? 13.584  -0.073  75.208 1.00 103.46 ? 66   DT  J "O4'" 1 
ATOM   5803  C  "C3'" . DT  B  2 139 ? 12.260  1.515   76.355 1.00 103.14 ? 66   DT  J "C3'" 1 
ATOM   5804  O  "O3'" . DT  B  2 139 ? 10.928  1.380   75.843 1.00 101.14 ? 66   DT  J "O3'" 1 
ATOM   5805  C  "C2'" . DT  B  2 139 ? 12.680  0.391   77.311 1.00 102.20 ? 66   DT  J "C2'" 1 
ATOM   5806  C  "C1'" . DT  B  2 139 ? 12.893  -0.706  76.273 1.00 101.50 ? 66   DT  J "C1'" 1 
ATOM   5807  N  N1    . DT  B  2 139 ? 13.668  -1.936  76.650 1.00 100.82 ? 66   DT  J N1    1 
ATOM   5808  C  C2    . DT  B  2 139 ? 13.153  -3.155  76.242 1.00 100.25 ? 66   DT  J C2    1 
ATOM   5809  O  O2    . DT  B  2 139 ? 12.104  -3.277  75.626 1.00 99.81  ? 66   DT  J O2    1 
ATOM   5810  N  N3    . DT  B  2 139 ? 13.914  -4.241  76.596 1.00 100.05 ? 66   DT  J N3    1 
ATOM   5811  C  C4    . DT  B  2 139 ? 15.111  -4.234  77.289 1.00 100.29 ? 66   DT  J C4    1 
ATOM   5812  O  O4    . DT  B  2 139 ? 15.698  -5.280  77.543 1.00 100.28 ? 66   DT  J O4    1 
ATOM   5813  C  C5    . DT  B  2 139 ? 15.601  -2.926  77.679 1.00 100.18 ? 66   DT  J C5    1 
ATOM   5814  C  C7    . DT  B  2 139 ? 16.890  -2.786  78.437 1.00 100.19 ? 66   DT  J C7    1 
ATOM   5815  C  C6    . DT  B  2 139 ? 14.869  -1.851  77.340 1.00 100.36 ? 66   DT  J C6    1 
ATOM   5816  P  P     . DA  B  2 140 ? 9.640   1.300   76.787 1.00 99.85  ? 67   DA  J P     1 
ATOM   5817  O  OP1   . DA  B  2 140 ? 8.450   1.523   75.928 1.00 99.83  ? 67   DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B  2 140 ? 9.850   2.120   78.002 1.00 100.11 ? 67   DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B  2 140 ? 9.680   -0.209  77.279 1.00 97.30  ? 67   DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B  2 140 ? 8.477   -0.791  77.702 1.00 93.60  ? 67   DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B  2 140 ? 8.077   -1.882  76.725 1.00 90.50  ? 67   DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B  2 140 ? 9.160   -2.825  76.499 1.00 89.88  ? 67   DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B  2 140 ? 6.945   -2.733  77.251 1.00 87.96  ? 67   DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B  2 140 ? 6.240   -3.310  76.186 1.00 84.20  ? 67   DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B  2 140 ? 7.681   -3.777  78.080 1.00 88.20  ? 67   DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B  2 140 ? 8.970   -3.983  77.294 1.00 88.11  ? 67   DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B  2 140 ? 10.149  -4.161  78.138 1.00 87.81  ? 67   DA  J N9    1 
ATOM   5828  C  C8    . DA  B  2 140 ? 10.899  -3.177  78.720 1.00 87.64  ? 67   DA  J C8    1 
ATOM   5829  N  N7    . DA  B  2 140 ? 11.912  -3.630  79.421 1.00 87.58  ? 67   DA  J N7    1 
ATOM   5830  C  C5    . DA  B  2 140 ? 11.820  -5.004  79.298 1.00 87.42  ? 67   DA  J C5    1 
ATOM   5831  C  C6    . DA  B  2 140 ? 12.601  -6.063  79.808 1.00 87.82  ? 67   DA  J C6    1 
ATOM   5832  N  N6    . DA  B  2 140 ? 13.674  -5.867  80.579 1.00 87.78  ? 67   DA  J N6    1 
ATOM   5833  N  N1    . DA  B  2 140 ? 12.243  -7.330  79.493 1.00 87.66  ? 67   DA  J N1    1 
ATOM   5834  C  C2    . DA  B  2 140 ? 11.170  -7.518  78.718 1.00 87.42  ? 67   DA  J C2    1 
ATOM   5835  N  N3    . DA  B  2 140 ? 10.358  -6.603  78.186 1.00 87.47  ? 67   DA  J N3    1 
ATOM   5836  C  C4    . DA  B  2 140 ? 10.739  -5.353  78.509 1.00 87.54  ? 67   DA  J C4    1 
ATOM   5837  P  P     . DT  B  2 141 ? 4.699   -3.612  76.461 1.00 83.03  ? 68   DT  J P     1 
ATOM   5838  O  OP1   . DT  B  2 141 ? 3.992   -3.578  75.162 1.00 83.39  ? 68   DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B  2 141 ? 4.251   -2.732  77.572 1.00 81.91  ? 68   DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B  2 141 ? 4.713   -5.140  76.965 1.00 80.03  ? 68   DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B  2 141 ? 5.471   -6.145  76.273 1.00 75.17  ? 68   DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B  2 141 ? 5.650   -7.386  77.128 1.00 72.37  ? 68   DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B  2 141 ? 6.894   -7.354  77.877 1.00 71.28  ? 68   DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B  2 141 ? 4.532   -7.634  78.140 1.00 70.35  ? 68   DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B  2 141 ? 4.029   -8.940  77.879 1.00 67.59  ? 68   DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B  2 141 ? 5.209   -7.501  79.505 1.00 70.45  ? 68   DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B  2 141 ? 6.647   -7.886  79.166 1.00 71.76  ? 68   DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B  2 141 ? 7.730   -7.387  80.088 1.00 72.27  ? 68   DT  J N1    1 
ATOM   5849  C  C2    . DT  B  2 141 ? 8.679   -8.284  80.543 1.00 72.02  ? 68   DT  J C2    1 
ATOM   5850  O  O2    . DT  B  2 141 ? 8.693   -9.460  80.250 1.00 72.24  ? 68   DT  J O2    1 
ATOM   5851  N  N3    . DT  B  2 141 ? 9.639   -7.759  81.368 1.00 72.09  ? 68   DT  J N3    1 
ATOM   5852  C  C4    . DT  B  2 141 ? 9.759   -6.445  81.782 1.00 72.73  ? 68   DT  J C4    1 
ATOM   5853  O  O4    . DT  B  2 141 ? 10.681  -6.102  82.521 1.00 72.47  ? 68   DT  J O4    1 
ATOM   5854  C  C5    . DT  B  2 141 ? 8.733   -5.540  81.279 1.00 72.80  ? 68   DT  J C5    1 
ATOM   5855  C  C7    . DT  B  2 141 ? 8.734   -4.084  81.651 1.00 72.18  ? 68   DT  J C7    1 
ATOM   5856  C  C6    . DT  B  2 141 ? 7.784   -6.052  80.470 1.00 72.60  ? 68   DT  J C6    1 
ATOM   5857  P  P     . DT  B  2 142 ? 2.629   -9.505  78.435 1.00 65.84  ? 69   DT  J P     1 
ATOM   5858  O  OP1   . DT  B  2 142 ? 1.959   -10.188 77.307 1.00 65.94  ? 69   DT  J OP1   1 
ATOM   5859  O  OP2   . DT  B  2 142 ? 1.916   -8.459  79.200 1.00 65.34  ? 69   DT  J OP2   1 
ATOM   5860  O  "O5'" . DT  B  2 142 ? 3.140   -10.633 79.446 1.00 64.32  ? 69   DT  J "O5'" 1 
ATOM   5861  C  "C5'" . DT  B  2 142 ? 4.315   -11.359 79.067 1.00 63.02  ? 69   DT  J "C5'" 1 
ATOM   5862  C  "C4'" . DT  B  2 142 ? 4.835   -12.253 80.181 1.00 62.25  ? 69   DT  J "C4'" 1 
ATOM   5863  O  "O4'" . DT  B  2 142 ? 5.891   -11.571 80.897 1.00 61.76  ? 69   DT  J "O4'" 1 
ATOM   5864  C  "C3'" . DT  B  2 142 ? 3.806   -12.716 81.212 1.00 60.99  ? 69   DT  J "C3'" 1 
ATOM   5865  O  "O3'" . DT  B  2 142 ? 3.997   -14.113 81.456 1.00 59.16  ? 69   DT  J "O3'" 1 
ATOM   5866  C  "C2'" . DT  B  2 142 ? 4.100   -11.841 82.425 1.00 61.44  ? 69   DT  J "C2'" 1 
ATOM   5867  C  "C1'" . DT  B  2 142 ? 5.596   -11.557 82.278 1.00 62.94  ? 69   DT  J "C1'" 1 
ATOM   5868  N  N1    . DT  B  2 142 ? 6.073   -10.242 82.873 1.00 63.82  ? 69   DT  J N1    1 
ATOM   5869  C  C2    . DT  B  2 142 ? 7.322   -10.197 83.476 1.00 63.78  ? 69   DT  J C2    1 
ATOM   5870  O  O2    . DT  B  2 142 ? 8.075   -11.159 83.553 1.00 63.59  ? 69   DT  J O2    1 
ATOM   5871  N  N3    . DT  B  2 142 ? 7.663   -8.966  83.991 1.00 63.92  ? 69   DT  J N3    1 
ATOM   5872  C  C4    . DT  B  2 142 ? 6.910   -7.805  83.962 1.00 63.63  ? 69   DT  J C4    1 
ATOM   5873  O  O4    . DT  B  2 142 ? 7.329   -6.765  84.452 1.00 64.09  ? 69   DT  J O4    1 
ATOM   5874  C  C5    . DT  B  2 142 ? 5.618   -7.908  83.318 1.00 63.93  ? 69   DT  J C5    1 
ATOM   5875  C  C7    . DT  B  2 142 ? 4.705   -6.715  83.229 1.00 63.53  ? 69   DT  J C7    1 
ATOM   5876  C  C6    . DT  B  2 142 ? 5.269   -9.104  82.811 1.00 63.87  ? 69   DT  J C6    1 
ATOM   5877  P  P     . DG  B  2 143 ? 2.881   -15.037 82.135 1.00 57.53  ? 70   DG  J P     1 
ATOM   5878  O  OP1   . DG  B  2 143 ? 2.607   -16.145 81.203 1.00 58.50  ? 70   DG  J OP1   1 
ATOM   5879  O  OP2   . DG  B  2 143 ? 1.774   -14.206 82.655 1.00 56.31  ? 70   DG  J OP2   1 
ATOM   5880  O  "O5'" . DG  B  2 143 ? 3.640   -15.694 83.366 1.00 59.01  ? 70   DG  J "O5'" 1 
ATOM   5881  C  "C5'" . DG  B  2 143 ? 5.073   -15.826 83.453 1.00 61.78  ? 70   DG  J "C5'" 1 
ATOM   5882  C  "C4'" . DG  B  2 143 ? 5.531   -15.770 84.915 1.00 63.67  ? 70   DG  J "C4'" 1 
ATOM   5883  O  "O4'" . DG  B  2 143 ? 5.874   -14.411 85.284 1.00 64.32  ? 70   DG  J "O4'" 1 
ATOM   5884  C  "C3'" . DG  B  2 143 ? 4.499   -16.181 85.970 1.00 64.81  ? 70   DG  J "C3'" 1 
ATOM   5885  O  "O3'" . DG  B  2 143 ? 5.171   -16.692 87.090 1.00 67.09  ? 70   DG  J "O3'" 1 
ATOM   5886  C  "C2'" . DG  B  2 143 ? 3.827   -14.866 86.333 1.00 64.10  ? 70   DG  J "C2'" 1 
ATOM   5887  C  "C1'" . DG  B  2 143 ? 5.095   -14.036 86.406 1.00 64.51  ? 70   DG  J "C1'" 1 
ATOM   5888  N  N9    . DG  B  2 143 ? 4.887   -12.598 86.401 1.00 64.68  ? 70   DG  J N9    1 
ATOM   5889  C  C8    . DG  B  2 143 ? 3.800   -11.868 85.978 1.00 64.84  ? 70   DG  J C8    1 
ATOM   5890  N  N7    . DG  B  2 143 ? 3.945   -10.580 86.125 1.00 64.51  ? 70   DG  J N7    1 
ATOM   5891  C  C5    . DG  B  2 143 ? 5.207   -10.464 86.682 1.00 64.50  ? 70   DG  J C5    1 
ATOM   5892  C  C6    . DG  B  2 143 ? 5.917   -9.317  87.075 1.00 64.50  ? 70   DG  J C6    1 
ATOM   5893  O  O6    . DG  B  2 143 ? 5.531   -8.148  86.979 1.00 65.23  ? 70   DG  J O6    1 
ATOM   5894  N  N1    . DG  B  2 143 ? 7.171   -9.630  87.610 1.00 64.39  ? 70   DG  J N1    1 
ATOM   5895  C  C2    . DG  B  2 143 ? 7.667   -10.913 87.745 1.00 64.77  ? 70   DG  J C2    1 
ATOM   5896  N  N2    . DG  B  2 143 ? 8.888   -11.055 88.279 1.00 64.72  ? 70   DG  J N2    1 
ATOM   5897  N  N3    . DG  B  2 143 ? 7.008   -12.005 87.374 1.00 64.75  ? 70   DG  J N3    1 
ATOM   5898  C  C4    . DG  B  2 143 ? 5.795   -11.695 86.859 1.00 64.66  ? 70   DG  J C4    1 
ATOM   5899  P  P     . DA  B  2 144 ? 4.455   -17.684 88.126 1.00 69.35  ? 71   DA  J P     1 
ATOM   5900  O  OP1   . DA  B  2 144 ? 4.498   -19.033 87.513 1.00 68.56  ? 71   DA  J OP1   1 
ATOM   5901  O  OP2   . DA  B  2 144 ? 3.165   -17.093 88.580 1.00 67.64  ? 71   DA  J OP2   1 
ATOM   5902  O  "O5'" . DA  B  2 144 ? 5.508   -17.655 89.338 1.00 69.65  ? 71   DA  J "O5'" 1 
ATOM   5903  C  "C5'" . DA  B  2 144 ? 6.925   -17.869 89.137 1.00 70.36  ? 71   DA  J "C5'" 1 
ATOM   5904  C  "C4'" . DA  B  2 144 ? 7.728   -17.163 90.230 1.00 71.13  ? 71   DA  J "C4'" 1 
ATOM   5905  O  "O4'" . DA  B  2 144 ? 7.733   -15.726 89.987 1.00 70.04  ? 71   DA  J "O4'" 1 
ATOM   5906  C  "C3'" . DA  B  2 144 ? 7.196   -17.347 91.655 1.00 71.69  ? 71   DA  J "C3'" 1 
ATOM   5907  O  "O3'" . DA  B  2 144 ? 8.245   -17.390 92.628 1.00 74.67  ? 71   DA  J "O3'" 1 
ATOM   5908  C  "C2'" . DA  B  2 144 ? 6.351   -16.099 91.857 1.00 70.78  ? 71   DA  J "C2'" 1 
ATOM   5909  C  "C1'" . DA  B  2 144 ? 7.182   -15.060 91.106 1.00 69.48  ? 71   DA  J "C1'" 1 
ATOM   5910  N  N9    . DA  B  2 144 ? 6.358   -13.911 90.731 1.00 68.80  ? 71   DA  J N9    1 
ATOM   5911  C  C8    . DA  B  2 144 ? 5.102   -13.939 90.194 1.00 68.65  ? 71   DA  J C8    1 
ATOM   5912  N  N7    . DA  B  2 144 ? 4.580   -12.760 89.980 1.00 67.86  ? 71   DA  J N7    1 
ATOM   5913  C  C5    . DA  B  2 144 ? 5.562   -11.898 90.417 1.00 68.08  ? 71   DA  J C5    1 
ATOM   5914  C  C6    . DA  B  2 144 ? 5.626   -10.498 90.460 1.00 68.84  ? 71   DA  J C6    1 
ATOM   5915  N  N6    . DA  B  2 144 ? 4.624   -9.722  90.032 1.00 69.40  ? 71   DA  J N6    1 
ATOM   5916  N  N1    . DA  B  2 144 ? 6.747   -9.928  90.955 1.00 68.83  ? 71   DA  J N1    1 
ATOM   5917  C  C2    . DA  B  2 144 ? 7.741   -10.716 91.381 1.00 68.86  ? 71   DA  J C2    1 
ATOM   5918  N  N3    . DA  B  2 144 ? 7.791   -12.049 91.387 1.00 69.20  ? 71   DA  J N3    1 
ATOM   5919  C  C4    . DA  B  2 144 ? 6.661   -12.583 90.891 1.00 68.32  ? 71   DA  J C4    1 
ATOM   5920  P  P     . DT  B  2 145 ? 7.986   -17.837 94.161 1.00 76.66  ? 72   DT  J P     1 
ATOM   5921  O  OP1   . DT  B  2 145 ? 9.178   -18.625 94.561 1.00 75.21  ? 72   DT  J OP1   1 
ATOM   5922  O  OP2   . DT  B  2 145 ? 6.620   -18.425 94.268 1.00 75.54  ? 72   DT  J OP2   1 
ATOM   5923  O  "O5'" . DT  B  2 145 ? 7.954   -16.453 94.976 1.00 76.49  ? 72   DT  J "O5'" 1 
ATOM   5924  C  "C5'" . DT  B  2 145 ? 9.046   -15.523 94.994 1.00 77.68  ? 72   DT  J "C5'" 1 
ATOM   5925  C  "C4'" . DT  B  2 145 ? 8.578   -14.198 95.586 1.00 79.01  ? 72   DT  J "C4'" 1 
ATOM   5926  O  "O4'" . DT  B  2 145 ? 7.754   -13.465 94.630 1.00 79.11  ? 72   DT  J "O4'" 1 
ATOM   5927  C  "C3'" . DT  B  2 145 ? 7.728   -14.318 96.858 1.00 79.84  ? 72   DT  J "C3'" 1 
ATOM   5928  O  "O3'" . DT  B  2 145 ? 8.190   -13.428 97.878 1.00 80.78  ? 72   DT  J "O3'" 1 
ATOM   5929  C  "C2'" . DT  B  2 145 ? 6.328   -13.919 96.398 1.00 79.57  ? 72   DT  J "C2'" 1 
ATOM   5930  C  "C1'" . DT  B  2 145 ? 6.684   -12.880 95.339 1.00 79.09  ? 72   DT  J "C1'" 1 
ATOM   5931  N  N1    . DT  B  2 145 ? 5.516   -12.485 94.474 1.00 79.10  ? 72   DT  J N1    1 
ATOM   5932  C  C2    . DT  B  2 145 ? 5.246   -11.142 94.252 1.00 79.23  ? 72   DT  J C2    1 
ATOM   5933  O  O2    . DT  B  2 145 ? 5.914   -10.225 94.692 1.00 79.08  ? 72   DT  J O2    1 
ATOM   5934  N  N3    . DT  B  2 145 ? 4.142   -10.892 93.470 1.00 79.42  ? 72   DT  J N3    1 
ATOM   5935  C  C4    . DT  B  2 145 ? 3.282   -11.821 92.909 1.00 79.10  ? 72   DT  J C4    1 
ATOM   5936  O  O4    . DT  B  2 145 ? 2.325   -11.472 92.224 1.00 79.18  ? 72   DT  J O4    1 
ATOM   5937  C  C5    . DT  B  2 145 ? 3.609   -13.207 93.182 1.00 79.01  ? 72   DT  J C5    1 
ATOM   5938  C  C7    . DT  B  2 145 ? 2.769   -14.324 92.633 1.00 79.05  ? 72   DT  J C7    1 
ATOM   5939  C  C6    . DT  B  2 145 ? 4.690   -13.464 93.941 1.00 79.08  ? 72   DT  J C6    1 
ATOM   5940  N  N     . PRO C  3 38  ? -60.569 -29.062 80.748 1.00 75.38  ? 38   PRO A N     1 
ATOM   5941  C  CA    . PRO C  3 38  ? -59.830 -28.231 79.790 1.00 75.20  ? 38   PRO A CA    1 
ATOM   5942  C  C     . PRO C  3 38  ? -58.535 -28.918 79.330 1.00 74.93  ? 38   PRO A C     1 
ATOM   5943  O  O     . PRO C  3 38  ? -57.903 -29.641 80.124 1.00 74.97  ? 38   PRO A O     1 
ATOM   5944  C  CB    . PRO C  3 38  ? -59.510 -26.962 80.599 1.00 75.19  ? 38   PRO A CB    1 
ATOM   5945  C  CG    . PRO C  3 38  ? -59.536 -27.414 82.075 1.00 75.29  ? 38   PRO A CG    1 
ATOM   5946  C  CD    . PRO C  3 38  ? -60.151 -28.808 82.141 1.00 75.37  ? 38   PRO A CD    1 
ATOM   5947  N  N     . HIS C  3 39  ? -58.144 -28.696 78.070 1.00 74.15  ? 39   HIS A N     1 
ATOM   5948  C  CA    . HIS C  3 39  ? -56.998 -29.419 77.497 1.00 73.26  ? 39   HIS A CA    1 
ATOM   5949  C  C     . HIS C  3 39  ? -55.815 -28.561 77.085 1.00 72.00  ? 39   HIS A C     1 
ATOM   5950  O  O     . HIS C  3 39  ? -55.984 -27.502 76.467 1.00 72.25  ? 39   HIS A O     1 
ATOM   5951  C  CB    . HIS C  3 39  ? -57.405 -30.288 76.313 1.00 73.68  ? 39   HIS A CB    1 
ATOM   5952  C  CG    . HIS C  3 39  ? -56.360 -31.293 75.944 1.00 74.85  ? 39   HIS A CG    1 
ATOM   5953  N  ND1   . HIS C  3 39  ? -55.535 -31.142 74.850 1.00 75.46  ? 39   HIS A ND1   1 
ATOM   5954  C  CD2   . HIS C  3 39  ? -55.977 -32.442 76.552 1.00 75.56  ? 39   HIS A CD2   1 
ATOM   5955  C  CE1   . HIS C  3 39  ? -54.709 -32.171 74.783 1.00 76.07  ? 39   HIS A CE1   1 
ATOM   5956  N  NE2   . HIS C  3 39  ? -54.956 -32.974 75.803 1.00 76.40  ? 39   HIS A NE2   1 
ATOM   5957  N  N     . ARG C  3 40  ? -54.617 -29.052 77.399 1.00 70.08  ? 40   ARG A N     1 
ATOM   5958  C  CA    . ARG C  3 40  ? -53.393 -28.306 77.130 1.00 68.18  ? 40   ARG A CA    1 
ATOM   5959  C  C     . ARG C  3 40  ? -52.184 -29.186 76.764 1.00 66.65  ? 40   ARG A C     1 
ATOM   5960  O  O     . ARG C  3 40  ? -51.695 -29.990 77.582 1.00 66.17  ? 40   ARG A O     1 
ATOM   5961  C  CB    . ARG C  3 40  ? -53.066 -27.379 78.304 1.00 68.23  ? 40   ARG A CB    1 
ATOM   5962  C  CG    . ARG C  3 40  ? -52.379 -26.115 77.868 1.00 68.57  ? 40   ARG A CG    1 
ATOM   5963  C  CD    . ARG C  3 40  ? -52.033 -25.228 79.032 1.00 69.48  ? 40   ARG A CD    1 
ATOM   5964  N  NE    . ARG C  3 40  ? -51.014 -24.249 78.668 1.00 69.89  ? 40   ARG A NE    1 
ATOM   5965  C  CZ    . ARG C  3 40  ? -51.245 -23.149 77.956 1.00 71.11  ? 40   ARG A CZ    1 
ATOM   5966  N  NH1   . ARG C  3 40  ? -52.468 -22.866 77.508 1.00 71.72  ? 40   ARG A NH1   1 
ATOM   5967  N  NH2   . ARG C  3 40  ? -50.244 -22.323 77.687 1.00 71.16  ? 40   ARG A NH2   1 
ATOM   5968  N  N     . TYR C  3 41  ? -51.722 -29.019 75.521 1.00 64.61  ? 41   TYR A N     1 
ATOM   5969  C  CA    . TYR C  3 41  ? -50.511 -29.682 75.030 1.00 62.41  ? 41   TYR A CA    1 
ATOM   5970  C  C     . TYR C  3 41  ? -49.282 -29.013 75.618 1.00 61.25  ? 41   TYR A C     1 
ATOM   5971  O  O     . TYR C  3 41  ? -49.250 -27.795 75.777 1.00 60.85  ? 41   TYR A O     1 
ATOM   5972  C  CB    . TYR C  3 41  ? -50.447 -29.655 73.499 1.00 61.90  ? 41   TYR A CB    1 
ATOM   5973  C  CG    . TYR C  3 41  ? -51.330 -30.670 72.831 1.00 60.71  ? 41   TYR A CG    1 
ATOM   5974  C  CD1   . TYR C  3 41  ? -52.401 -30.276 72.024 1.00 60.72  ? 41   TYR A CD1   1 
ATOM   5975  C  CD2   . TYR C  3 41  ? -51.107 -32.028 73.011 1.00 60.72  ? 41   TYR A CD2   1 
ATOM   5976  C  CE1   . TYR C  3 41  ? -53.227 -31.219 71.403 1.00 59.91  ? 41   TYR A CE1   1 
ATOM   5977  C  CE2   . TYR C  3 41  ? -51.924 -32.980 72.402 1.00 61.44  ? 41   TYR A CE2   1 
ATOM   5978  C  CZ    . TYR C  3 41  ? -52.981 -32.569 71.601 1.00 60.49  ? 41   TYR A CZ    1 
ATOM   5979  O  OH    . TYR C  3 41  ? -53.777 -33.521 71.018 1.00 59.98  ? 41   TYR A OH    1 
ATOM   5980  N  N     . ARG C  3 42  ? -48.277 -29.815 75.944 1.00 60.22  ? 42   ARG A N     1 
ATOM   5981  C  CA    . ARG C  3 42  ? -47.058 -29.300 76.565 1.00 59.84  ? 42   ARG A CA    1 
ATOM   5982  C  C     . ARG C  3 42  ? -46.207 -28.508 75.557 1.00 59.00  ? 42   ARG A C     1 
ATOM   5983  O  O     . ARG C  3 42  ? -46.356 -28.691 74.340 1.00 58.72  ? 42   ARG A O     1 
ATOM   5984  C  CB    . ARG C  3 42  ? -46.258 -30.443 77.206 1.00 60.00  ? 42   ARG A CB    1 
ATOM   5985  C  CG    . ARG C  3 42  ? -47.137 -31.474 77.905 1.00 61.83  ? 42   ARG A CG    1 
ATOM   5986  C  CD    . ARG C  3 42  ? -46.638 -31.864 79.267 1.00 65.08  ? 42   ARG A CD    1 
ATOM   5987  N  NE    . ARG C  3 42  ? -45.394 -32.622 79.198 1.00 69.27  ? 42   ARG A NE    1 
ATOM   5988  C  CZ    . ARG C  3 42  ? -44.591 -32.834 80.237 1.00 71.13  ? 42   ARG A CZ    1 
ATOM   5989  N  NH1   . ARG C  3 42  ? -44.893 -32.334 81.431 1.00 71.33  ? 42   ARG A NH1   1 
ATOM   5990  N  NH2   . ARG C  3 42  ? -43.471 -33.532 80.079 1.00 72.78  ? 42   ARG A NH2   1 
ATOM   5991  N  N     . PRO C  3 43  ? -45.332 -27.612 76.053 1.00 58.10  ? 43   PRO A N     1 
ATOM   5992  C  CA    . PRO C  3 43  ? -44.447 -26.840 75.174 1.00 57.53  ? 43   PRO A CA    1 
ATOM   5993  C  C     . PRO C  3 43  ? -43.569 -27.733 74.304 1.00 56.76  ? 43   PRO A C     1 
ATOM   5994  O  O     . PRO C  3 43  ? -42.934 -28.655 74.819 1.00 55.97  ? 43   PRO A O     1 
ATOM   5995  C  CB    . PRO C  3 43  ? -43.580 -26.054 76.156 1.00 57.39  ? 43   PRO A CB    1 
ATOM   5996  C  CG    . PRO C  3 43  ? -44.423 -25.932 77.359 1.00 57.98  ? 43   PRO A CG    1 
ATOM   5997  C  CD    . PRO C  3 43  ? -45.133 -27.248 77.463 1.00 58.07  ? 43   PRO A CD    1 
ATOM   5998  N  N     . GLY C  3 44  ? -43.569 -27.465 72.995 1.00 56.05  ? 44   GLY A N     1 
ATOM   5999  C  CA    . GLY C  3 44  ? -42.731 -28.200 72.043 1.00 55.39  ? 44   GLY A CA    1 
ATOM   6000  C  C     . GLY C  3 44  ? -43.460 -29.333 71.351 1.00 54.74  ? 44   GLY A C     1 
ATOM   6001  O  O     . GLY C  3 44  ? -43.045 -29.804 70.295 1.00 55.30  ? 44   GLY A O     1 
ATOM   6002  N  N     . THR C  3 45  ? -44.548 -29.775 71.964 1.00 53.93  ? 45   THR A N     1 
ATOM   6003  C  CA    . THR C  3 45  ? -45.353 -30.871 71.462 1.00 52.65  ? 45   THR A CA    1 
ATOM   6004  C  C     . THR C  3 45  ? -45.993 -30.497 70.136 1.00 51.79  ? 45   THR A C     1 
ATOM   6005  O  O     . THR C  3 45  ? -46.018 -31.309 69.202 1.00 51.55  ? 45   THR A O     1 
ATOM   6006  C  CB    . THR C  3 45  ? -46.433 -31.260 72.503 1.00 52.79  ? 45   THR A CB    1 
ATOM   6007  O  OG1   . THR C  3 45  ? -45.827 -32.065 73.524 1.00 53.12  ? 45   THR A OG1   1 
ATOM   6008  C  CG2   . THR C  3 45  ? -47.575 -32.040 71.866 1.00 52.12  ? 45   THR A CG2   1 
ATOM   6009  N  N     . VAL C  3 46  ? -46.514 -29.274 70.077 1.00 50.51  ? 46   VAL A N     1 
ATOM   6010  C  CA    . VAL C  3 46  ? -47.107 -28.727 68.867 1.00 49.74  ? 46   VAL A CA    1 
ATOM   6011  C  C     . VAL C  3 46  ? -46.005 -28.307 67.902 1.00 49.15  ? 46   VAL A C     1 
ATOM   6012  O  O     . VAL C  3 46  ? -46.168 -28.416 66.685 1.00 48.93  ? 46   VAL A O     1 
ATOM   6013  C  CB    . VAL C  3 46  ? -47.981 -27.498 69.180 1.00 49.72  ? 46   VAL A CB    1 
ATOM   6014  C  CG1   . VAL C  3 46  ? -48.883 -27.143 67.984 1.00 49.46  ? 46   VAL A CG1   1 
ATOM   6015  C  CG2   . VAL C  3 46  ? -48.806 -27.764 70.401 1.00 49.89  ? 46   VAL A CG2   1 
ATOM   6016  N  N     . ALA C  3 47  ? -44.893 -27.817 68.458 1.00 48.31  ? 47   ALA A N     1 
ATOM   6017  C  CA    . ALA C  3 47  ? -43.717 -27.481 67.676 1.00 47.53  ? 47   ALA A CA    1 
ATOM   6018  C  C     . ALA C  3 47  ? -43.300 -28.685 66.824 1.00 47.25  ? 47   ALA A C     1 
ATOM   6019  O  O     . ALA C  3 47  ? -43.196 -28.570 65.598 1.00 46.81  ? 47   ALA A O     1 
ATOM   6020  C  CB    . ALA C  3 47  ? -42.581 -27.017 68.569 1.00 47.38  ? 47   ALA A CB    1 
ATOM   6021  N  N     . LEU C  3 48  ? -43.089 -29.831 67.468 1.00 46.63  ? 48   LEU A N     1 
ATOM   6022  C  CA    . LEU C  3 48  ? -42.763 -31.054 66.749 1.00 47.03  ? 48   LEU A CA    1 
ATOM   6023  C  C     . LEU C  3 48  ? -43.837 -31.389 65.720 1.00 47.05  ? 48   LEU A C     1 
ATOM   6024  O  O     . LEU C  3 48  ? -43.533 -31.686 64.570 1.00 47.30  ? 48   LEU A O     1 
ATOM   6025  C  CB    . LEU C  3 48  ? -42.584 -32.225 67.717 1.00 46.99  ? 48   LEU A CB    1 
ATOM   6026  C  CG    . LEU C  3 48  ? -41.194 -32.663 68.175 1.00 47.35  ? 48   LEU A CG    1 
ATOM   6027  C  CD1   . LEU C  3 48  ? -40.116 -31.626 67.912 1.00 48.43  ? 48   LEU A CD1   1 
ATOM   6028  C  CD2   . LEU C  3 48  ? -41.256 -32.984 69.634 1.00 47.84  ? 48   LEU A CD2   1 
ATOM   6029  N  N     . ARG C  3 49  ? -45.093 -31.321 66.138 1.00 47.09  ? 49   ARG A N     1 
ATOM   6030  C  CA    . ARG C  3 49  ? -46.217 -31.644 65.283 1.00 47.34  ? 49   ARG A CA    1 
ATOM   6031  C  C     . ARG C  3 49  ? -46.134 -30.801 64.019 1.00 47.40  ? 49   ARG A C     1 
ATOM   6032  O  O     . ARG C  3 49  ? -46.435 -31.279 62.912 1.00 47.61  ? 49   ARG A O     1 
ATOM   6033  C  CB    . ARG C  3 49  ? -47.510 -31.381 66.044 1.00 47.40  ? 49   ARG A CB    1 
ATOM   6034  C  CG    . ARG C  3 49  ? -48.768 -31.526 65.249 1.00 48.95  ? 49   ARG A CG    1 
ATOM   6035  C  CD    . ARG C  3 49  ? -49.881 -32.132 66.101 1.00 51.16  ? 49   ARG A CD    1 
ATOM   6036  N  NE    . ARG C  3 49  ? -50.555 -31.141 66.925 1.00 52.71  ? 49   ARG A NE    1 
ATOM   6037  C  CZ    . ARG C  3 49  ? -50.576 -31.158 68.253 1.00 53.00  ? 49   ARG A CZ    1 
ATOM   6038  N  NH1   . ARG C  3 49  ? -49.977 -32.142 68.931 1.00 50.97  ? 49   ARG A NH1   1 
ATOM   6039  N  NH2   . ARG C  3 49  ? -51.215 -30.187 68.894 1.00 53.05  ? 49   ARG A NH2   1 
ATOM   6040  N  N     . GLU C  3 50  ? -45.685 -29.559 64.195 1.00 47.05  ? 50   GLU A N     1 
ATOM   6041  C  CA    . GLU C  3 50  ? -45.555 -28.614 63.102 1.00 46.99  ? 50   GLU A CA    1 
ATOM   6042  C  C     . GLU C  3 50  ? -44.359 -28.910 62.178 1.00 46.61  ? 50   GLU A C     1 
ATOM   6043  O  O     . GLU C  3 50  ? -44.516 -28.970 60.956 1.00 46.44  ? 50   GLU A O     1 
ATOM   6044  C  CB    . GLU C  3 50  ? -45.480 -27.203 63.661 1.00 47.20  ? 50   GLU A CB    1 
ATOM   6045  C  CG    . GLU C  3 50  ? -46.830 -26.590 63.910 1.00 48.56  ? 50   GLU A CG    1 
ATOM   6046  C  CD    . GLU C  3 50  ? -46.749 -25.208 64.539 1.00 50.86  ? 50   GLU A CD    1 
ATOM   6047  O  OE1   . GLU C  3 50  ? -45.698 -24.535 64.407 1.00 51.45  ? 50   GLU A OE1   1 
ATOM   6048  O  OE2   . GLU C  3 50  ? -47.754 -24.792 65.169 1.00 52.48  ? 50   GLU A OE2   1 
ATOM   6049  N  N     . ILE C  3 51  ? -43.176 -29.090 62.763 1.00 46.28  ? 51   ILE A N     1 
ATOM   6050  C  CA    . ILE C  3 51  ? -41.992 -29.495 62.016 1.00 45.87  ? 51   ILE A CA    1 
ATOM   6051  C  C     . ILE C  3 51  ? -42.394 -30.562 61.025 1.00 45.93  ? 51   ILE A C     1 
ATOM   6052  O  O     . ILE C  3 51  ? -42.193 -30.396 59.823 1.00 46.24  ? 51   ILE A O     1 
ATOM   6053  C  CB    . ILE C  3 51  ? -40.858 -30.011 62.942 1.00 45.81  ? 51   ILE A CB    1 
ATOM   6054  C  CG1   . ILE C  3 51  ? -40.205 -28.837 63.668 1.00 45.97  ? 51   ILE A CG1   1 
ATOM   6055  C  CG2   . ILE C  3 51  ? -39.784 -30.740 62.143 1.00 45.27  ? 51   ILE A CG2   1 
ATOM   6056  C  CD1   . ILE C  3 51  ? -39.538 -29.198 64.972 1.00 46.25  ? 51   ILE A CD1   1 
ATOM   6057  N  N     . ARG C  3 52  ? -43.004 -31.627 61.540 1.00 45.88  ? 52   ARG A N     1 
ATOM   6058  C  CA    . ARG C  3 52  ? -43.479 -32.757 60.742 1.00 45.93  ? 52   ARG A CA    1 
ATOM   6059  C  C     . ARG C  3 52  ? -44.400 -32.348 59.585 1.00 45.68  ? 52   ARG A C     1 
ATOM   6060  O  O     . ARG C  3 52  ? -44.214 -32.790 58.451 1.00 45.67  ? 52   ARG A O     1 
ATOM   6061  C  CB    . ARG C  3 52  ? -44.153 -33.798 61.649 1.00 46.05  ? 52   ARG A CB    1 
ATOM   6062  C  CG    . ARG C  3 52  ? -43.242 -34.308 62.753 1.00 46.73  ? 52   ARG A CG    1 
ATOM   6063  C  CD    . ARG C  3 52  ? -43.639 -35.669 63.277 1.00 49.14  ? 52   ARG A CD    1 
ATOM   6064  N  NE    . ARG C  3 52  ? -42.456 -36.393 63.748 1.00 50.80  ? 52   ARG A NE    1 
ATOM   6065  C  CZ    . ARG C  3 52  ? -42.128 -36.599 65.025 1.00 50.87  ? 52   ARG A CZ    1 
ATOM   6066  N  NH1   . ARG C  3 52  ? -42.904 -36.170 66.012 1.00 48.39  ? 52   ARG A NH1   1 
ATOM   6067  N  NH2   . ARG C  3 52  ? -41.009 -37.261 65.308 1.00 52.18  ? 52   ARG A NH2   1 
ATOM   6068  N  N     . ARG C  3 53  ? -45.375 -31.497 59.879 1.00 45.73  ? 53   ARG A N     1 
ATOM   6069  C  CA    . ARG C  3 53  ? -46.327 -31.002 58.880 1.00 45.96  ? 53   ARG A CA    1 
ATOM   6070  C  C     . ARG C  3 53  ? -45.670 -30.191 57.754 1.00 45.42  ? 53   ARG A C     1 
ATOM   6071  O  O     . ARG C  3 53  ? -45.914 -30.457 56.580 1.00 45.10  ? 53   ARG A O     1 
ATOM   6072  C  CB    . ARG C  3 53  ? -47.418 -30.171 59.562 1.00 46.32  ? 53   ARG A CB    1 
ATOM   6073  C  CG    . ARG C  3 53  ? -48.504 -29.685 58.638 1.00 48.95  ? 53   ARG A CG    1 
ATOM   6074  C  CD    . ARG C  3 53  ? -49.125 -28.428 59.194 1.00 53.43  ? 53   ARG A CD    1 
ATOM   6075  N  NE    . ARG C  3 53  ? -50.217 -27.923 58.364 1.00 58.79  ? 53   ARG A NE    1 
ATOM   6076  C  CZ    . ARG C  3 53  ? -50.846 -26.764 58.574 1.00 61.48  ? 53   ARG A CZ    1 
ATOM   6077  N  NH1   . ARG C  3 53  ? -50.488 -25.987 59.594 1.00 62.88  ? 53   ARG A NH1   1 
ATOM   6078  N  NH2   . ARG C  3 53  ? -51.831 -26.374 57.766 1.00 61.46  ? 53   ARG A NH2   1 
ATOM   6079  N  N     . TYR C  3 54  ? -44.843 -29.205 58.111 1.00 44.96  ? 54   TYR A N     1 
ATOM   6080  C  CA    . TYR C  3 54  ? -44.213 -28.348 57.104 1.00 44.16  ? 54   TYR A CA    1 
ATOM   6081  C  C     . TYR C  3 54  ? -43.082 -29.021 56.310 1.00 44.06  ? 54   TYR A C     1 
ATOM   6082  O  O     . TYR C  3 54  ? -42.773 -28.601 55.189 1.00 44.45  ? 54   TYR A O     1 
ATOM   6083  C  CB    . TYR C  3 54  ? -43.800 -27.009 57.715 1.00 43.89  ? 54   TYR A CB    1 
ATOM   6084  C  CG    . TYR C  3 54  ? -45.010 -26.222 58.145 1.00 43.68  ? 54   TYR A CG    1 
ATOM   6085  C  CD1   . TYR C  3 54  ? -45.258 -25.948 59.483 1.00 43.84  ? 54   TYR A CD1   1 
ATOM   6086  C  CD2   . TYR C  3 54  ? -45.939 -25.794 57.208 1.00 44.30  ? 54   TYR A CD2   1 
ATOM   6087  C  CE1   . TYR C  3 54  ? -46.397 -25.246 59.875 1.00 43.92  ? 54   TYR A CE1   1 
ATOM   6088  C  CE2   . TYR C  3 54  ? -47.076 -25.101 57.586 1.00 44.79  ? 54   TYR A CE2   1 
ATOM   6089  C  CZ    . TYR C  3 54  ? -47.306 -24.834 58.919 1.00 43.88  ? 54   TYR A CZ    1 
ATOM   6090  O  OH    . TYR C  3 54  ? -48.443 -24.139 59.269 1.00 43.00  ? 54   TYR A OH    1 
ATOM   6091  N  N     . GLN C  3 55  ? -42.484 -30.066 56.875 1.00 43.50  ? 55   GLN A N     1 
ATOM   6092  C  CA    . GLN C  3 55  ? -41.498 -30.859 56.147 1.00 43.14  ? 55   GLN A CA    1 
ATOM   6093  C  C     . GLN C  3 55  ? -42.141 -31.853 55.173 1.00 43.84  ? 55   GLN A C     1 
ATOM   6094  O  O     . GLN C  3 55  ? -41.497 -32.305 54.224 1.00 43.68  ? 55   GLN A O     1 
ATOM   6095  C  CB    . GLN C  3 55  ? -40.550 -31.560 57.113 1.00 42.56  ? 55   GLN A CB    1 
ATOM   6096  C  CG    . GLN C  3 55  ? -39.600 -30.600 57.799 1.00 40.58  ? 55   GLN A CG    1 
ATOM   6097  C  CD    . GLN C  3 55  ? -38.566 -31.293 58.657 1.00 38.51  ? 55   GLN A CD    1 
ATOM   6098  O  OE1   . GLN C  3 55  ? -38.624 -32.504 58.883 1.00 39.03  ? 55   GLN A OE1   1 
ATOM   6099  N  NE2   . GLN C  3 55  ? -37.621 -30.525 59.154 1.00 36.60  ? 55   GLN A NE2   1 
ATOM   6100  N  N     . LYS C  3 56  ? -43.407 -32.192 55.408 1.00 44.67  ? 56   LYS A N     1 
ATOM   6101  C  CA    . LYS C  3 56  ? -44.158 -33.027 54.485 1.00 45.85  ? 56   LYS A CA    1 
ATOM   6102  C  C     . LYS C  3 56  ? -44.546 -32.243 53.246 1.00 45.82  ? 56   LYS A C     1 
ATOM   6103  O  O     . LYS C  3 56  ? -44.597 -32.792 52.148 1.00 46.37  ? 56   LYS A O     1 
ATOM   6104  C  CB    . LYS C  3 56  ? -45.414 -33.591 55.151 1.00 46.36  ? 56   LYS A CB    1 
ATOM   6105  C  CG    . LYS C  3 56  ? -45.277 -35.041 55.582 1.00 50.09  ? 56   LYS A CG    1 
ATOM   6106  C  CD    . LYS C  3 56  ? -46.119 -35.360 56.831 1.00 54.98  ? 56   LYS A CD    1 
ATOM   6107  C  CE    . LYS C  3 56  ? -45.612 -36.648 57.534 1.00 57.11  ? 56   LYS A CE    1 
ATOM   6108  N  NZ    . LYS C  3 56  ? -46.109 -36.778 58.957 1.00 57.64  ? 56   LYS A NZ    1 
ATOM   6109  N  N     . SER C  3 57  ? -44.824 -30.961 53.426 1.00 45.65  ? 57   SER A N     1 
ATOM   6110  C  CA    . SER C  3 57  ? -45.441 -30.171 52.382 1.00 45.78  ? 57   SER A CA    1 
ATOM   6111  C  C     . SER C  3 57  ? -44.453 -29.214 51.724 1.00 46.16  ? 57   SER A C     1 
ATOM   6112  O  O     . SER C  3 57  ? -43.309 -29.068 52.178 1.00 46.20  ? 57   SER A O     1 
ATOM   6113  C  CB    . SER C  3 57  ? -46.616 -29.389 52.949 1.00 45.61  ? 57   SER A CB    1 
ATOM   6114  O  OG    . SER C  3 57  ? -46.143 -28.350 53.772 1.00 45.78  ? 57   SER A OG    1 
ATOM   6115  N  N     . THR C  3 58  ? -44.926 -28.543 50.670 1.00 46.12  ? 58   THR A N     1 
ATOM   6116  C  CA    . THR C  3 58  ? -44.081 -27.748 49.798 1.00 45.78  ? 58   THR A CA    1 
ATOM   6117  C  C     . THR C  3 58  ? -44.593 -26.318 49.572 1.00 45.96  ? 58   THR A C     1 
ATOM   6118  O  O     . THR C  3 58  ? -43.897 -25.510 48.960 1.00 45.77  ? 58   THR A O     1 
ATOM   6119  C  CB    . THR C  3 58  ? -43.945 -28.436 48.437 1.00 45.78  ? 58   THR A CB    1 
ATOM   6120  O  OG1   . THR C  3 58  ? -45.220 -28.453 47.798 1.00 45.78  ? 58   THR A OG1   1 
ATOM   6121  C  CG2   . THR C  3 58  ? -43.476 -29.862 48.598 1.00 45.50  ? 58   THR A CG2   1 
ATOM   6122  N  N     . GLU C  3 59  ? -45.798 -26.006 50.055 1.00 46.34  ? 59   GLU A N     1 
ATOM   6123  C  CA    . GLU C  3 59  ? -46.388 -24.670 49.864 1.00 46.98  ? 59   GLU A CA    1 
ATOM   6124  C  C     . GLU C  3 59  ? -45.522 -23.526 50.391 1.00 46.88  ? 59   GLU A C     1 
ATOM   6125  O  O     . GLU C  3 59  ? -44.712 -23.704 51.309 1.00 46.63  ? 59   GLU A O     1 
ATOM   6126  C  CB    . GLU C  3 59  ? -47.817 -24.545 50.438 1.00 47.15  ? 59   GLU A CB    1 
ATOM   6127  C  CG    . GLU C  3 59  ? -48.346 -25.684 51.303 1.00 50.58  ? 59   GLU A CG    1 
ATOM   6128  C  CD    . GLU C  3 59  ? -47.683 -25.783 52.676 1.00 54.93  ? 59   GLU A CD    1 
ATOM   6129  O  OE1   . GLU C  3 59  ? -48.380 -25.592 53.708 1.00 54.78  ? 59   GLU A OE1   1 
ATOM   6130  O  OE2   . GLU C  3 59  ? -46.462 -26.075 52.717 1.00 57.37  ? 59   GLU A OE2   1 
ATOM   6131  N  N     . LEU C  3 60  ? -45.692 -22.353 49.789 1.00 47.02  ? 60   LEU A N     1 
ATOM   6132  C  CA    . LEU C  3 60  ? -44.992 -21.175 50.254 1.00 47.13  ? 60   LEU A CA    1 
ATOM   6133  C  C     . LEU C  3 60  ? -45.625 -20.774 51.563 1.00 47.10  ? 60   LEU A C     1 
ATOM   6134  O  O     . LEU C  3 60  ? -46.833 -20.890 51.725 1.00 47.66  ? 60   LEU A O     1 
ATOM   6135  C  CB    . LEU C  3 60  ? -45.068 -20.054 49.228 1.00 47.35  ? 60   LEU A CB    1 
ATOM   6136  C  CG    . LEU C  3 60  ? -44.376 -20.338 47.896 1.00 47.74  ? 60   LEU A CG    1 
ATOM   6137  C  CD1   . LEU C  3 60  ? -44.639 -19.216 46.917 1.00 47.99  ? 60   LEU A CD1   1 
ATOM   6138  C  CD2   . LEU C  3 60  ? -42.879 -20.556 48.082 1.00 49.19  ? 60   LEU A CD2   1 
ATOM   6139  N  N     . LEU C  3 61  ? -44.807 -20.332 52.504 1.00 46.88  ? 61   LEU A N     1 
ATOM   6140  C  CA    . LEU C  3 61  ? -45.259 -20.189 53.867 1.00 46.73  ? 61   LEU A CA    1 
ATOM   6141  C  C     . LEU C  3 61  ? -45.335 -18.731 54.276 1.00 47.25  ? 61   LEU A C     1 
ATOM   6142  O  O     . LEU C  3 61  ? -45.725 -18.416 55.403 1.00 47.28  ? 61   LEU A O     1 
ATOM   6143  C  CB    . LEU C  3 61  ? -44.362 -20.988 54.803 1.00 46.52  ? 61   LEU A CB    1 
ATOM   6144  C  CG    . LEU C  3 61  ? -44.206 -22.467 54.452 1.00 45.83  ? 61   LEU A CG    1 
ATOM   6145  C  CD1   . LEU C  3 61  ? -43.208 -23.165 55.359 1.00 45.16  ? 61   LEU A CD1   1 
ATOM   6146  C  CD2   . LEU C  3 61  ? -45.542 -23.152 54.518 1.00 46.19  ? 61   LEU A CD2   1 
ATOM   6147  N  N     . ILE C  3 62  ? -44.963 -17.847 53.351 1.00 47.47  ? 62   ILE A N     1 
ATOM   6148  C  CA    . ILE C  3 62  ? -45.234 -16.418 53.482 1.00 47.68  ? 62   ILE A CA    1 
ATOM   6149  C  C     . ILE C  3 62  ? -46.456 -16.079 52.622 1.00 48.09  ? 62   ILE A C     1 
ATOM   6150  O  O     . ILE C  3 62  ? -46.599 -16.598 51.507 1.00 47.98  ? 62   ILE A O     1 
ATOM   6151  C  CB    . ILE C  3 62  ? -44.028 -15.574 53.023 1.00 47.36  ? 62   ILE A CB    1 
ATOM   6152  C  CG1   . ILE C  3 62  ? -42.801 -15.896 53.864 1.00 47.03  ? 62   ILE A CG1   1 
ATOM   6153  C  CG2   . ILE C  3 62  ? -44.342 -14.085 53.094 1.00 47.14  ? 62   ILE A CG2   1 
ATOM   6154  C  CD1   . ILE C  3 62  ? -41.490 -15.441 53.243 1.00 46.62  ? 62   ILE A CD1   1 
ATOM   6155  N  N     . ARG C  3 63  ? -47.337 -15.227 53.140 1.00 48.61  ? 63   ARG A N     1 
ATOM   6156  C  CA    . ARG C  3 63  ? -48.499 -14.770 52.370 1.00 49.44  ? 63   ARG A CA    1 
ATOM   6157  C  C     . ARG C  3 63  ? -48.031 -13.895 51.204 1.00 49.48  ? 63   ARG A C     1 
ATOM   6158  O  O     . ARG C  3 63  ? -47.187 -13.015 51.378 1.00 49.90  ? 63   ARG A O     1 
ATOM   6159  C  CB    . ARG C  3 63  ? -49.494 -13.998 53.252 1.00 50.08  ? 63   ARG A CB    1 
ATOM   6160  C  CG    . ARG C  3 63  ? -49.944 -14.699 54.548 1.00 50.88  ? 63   ARG A CG    1 
ATOM   6161  C  CD    . ARG C  3 63  ? -51.133 -15.643 54.350 1.00 55.05  ? 63   ARG A CD    1 
ATOM   6162  N  NE    . ARG C  3 63  ? -52.414 -14.964 54.104 1.00 58.64  ? 63   ARG A NE    1 
ATOM   6163  C  CZ    . ARG C  3 63  ? -53.119 -14.264 55.005 1.00 59.90  ? 63   ARG A CZ    1 
ATOM   6164  N  NH1   . ARG C  3 63  ? -52.689 -14.089 56.253 1.00 59.79  ? 63   ARG A NH1   1 
ATOM   6165  N  NH2   . ARG C  3 63  ? -54.272 -13.715 54.642 1.00 61.22  ? 63   ARG A NH2   1 
ATOM   6166  N  N     . LYS C  3 64  ? -48.591 -14.135 50.023 1.00 49.56  ? 64   LYS A N     1 
ATOM   6167  C  CA    . LYS C  3 64  ? -48.072 -13.579 48.767 1.00 49.49  ? 64   LYS A CA    1 
ATOM   6168  C  C     . LYS C  3 64  ? -48.039 -12.048 48.642 1.00 49.17  ? 64   LYS A C     1 
ATOM   6169  O  O     . LYS C  3 64  ? -47.044 -11.487 48.180 1.00 49.16  ? 64   LYS A O     1 
ATOM   6170  C  CB    . LYS C  3 64  ? -48.805 -14.200 47.578 1.00 49.66  ? 64   LYS A CB    1 
ATOM   6171  C  CG    . LYS C  3 64  ? -48.413 -15.654 47.304 1.00 51.22  ? 64   LYS A CG    1 
ATOM   6172  C  CD    . LYS C  3 64  ? -49.005 -16.120 45.983 1.00 53.67  ? 64   LYS A CD    1 
ATOM   6173  C  CE    . LYS C  3 64  ? -48.524 -17.522 45.624 1.00 55.78  ? 64   LYS A CE    1 
ATOM   6174  N  NZ    . LYS C  3 64  ? -48.716 -17.816 44.157 1.00 54.89  ? 64   LYS A NZ    1 
ATOM   6175  N  N     . LEU C  3 65  ? -49.121 -11.386 49.052 1.00 48.84  ? 65   LEU A N     1 
ATOM   6176  C  CA    . LEU C  3 65  ? -49.252 -9.932  48.912 1.00 48.18  ? 65   LEU A CA    1 
ATOM   6177  C  C     . LEU C  3 65  ? -48.266 -9.142  49.772 1.00 47.58  ? 65   LEU A C     1 
ATOM   6178  O  O     . LEU C  3 65  ? -47.641 -8.211  49.269 1.00 47.35  ? 65   LEU A O     1 
ATOM   6179  C  CB    . LEU C  3 65  ? -50.695 -9.476  49.188 1.00 48.52  ? 65   LEU A CB    1 
ATOM   6180  C  CG    . LEU C  3 65  ? -50.990 -7.963  49.222 1.00 48.62  ? 65   LEU A CG    1 
ATOM   6181  C  CD1   . LEU C  3 65  ? -51.105 -7.360  47.815 1.00 48.32  ? 65   LEU A CD1   1 
ATOM   6182  C  CD2   . LEU C  3 65  ? -52.245 -7.676  50.035 1.00 48.03  ? 65   LEU A CD2   1 
ATOM   6183  N  N     . PRO C  3 66  ? -48.141 -9.489  51.072 1.00 47.15  ? 66   PRO A N     1 
ATOM   6184  C  CA    . PRO C  3 66  ? -47.129 -8.807  51.892 1.00 46.82  ? 66   PRO A CA    1 
ATOM   6185  C  C     . PRO C  3 66  ? -45.733 -9.045  51.342 1.00 46.68  ? 66   PRO A C     1 
ATOM   6186  O  O     . PRO C  3 66  ? -44.901 -8.134  51.353 1.00 46.58  ? 66   PRO A O     1 
ATOM   6187  C  CB    . PRO C  3 66  ? -47.257 -9.443  53.273 1.00 46.77  ? 66   PRO A CB    1 
ATOM   6188  C  CG    . PRO C  3 66  ? -48.323 -10.470 53.182 1.00 47.57  ? 66   PRO A CG    1 
ATOM   6189  C  CD    . PRO C  3 66  ? -48.927 -10.478 51.828 1.00 47.24  ? 66   PRO A CD    1 
ATOM   6190  N  N     . PHE C  3 67  ? -45.482 -10.258 50.849 1.00 46.53  ? 67   PHE A N     1 
ATOM   6191  C  CA    . PHE C  3 67  ? -44.212 -10.545 50.218 1.00 45.96  ? 67   PHE A CA    1 
ATOM   6192  C  C     . PHE C  3 67  ? -44.001 -9.682  48.980 1.00 46.08  ? 67   PHE A C     1 
ATOM   6193  O  O     . PHE C  3 67  ? -42.903 -9.160  48.756 1.00 46.11  ? 67   PHE A O     1 
ATOM   6194  C  CB    . PHE C  3 67  ? -44.084 -12.016 49.848 1.00 45.85  ? 67   PHE A CB    1 
ATOM   6195  C  CG    . PHE C  3 67  ? -42.750 -12.351 49.251 1.00 45.21  ? 67   PHE A CG    1 
ATOM   6196  C  CD1   . PHE C  3 67  ? -41.641 -12.527 50.067 1.00 44.15  ? 67   PHE A CD1   1 
ATOM   6197  C  CD2   . PHE C  3 67  ? -42.594 -12.441 47.876 1.00 44.59  ? 67   PHE A CD2   1 
ATOM   6198  C  CE1   . PHE C  3 67  ? -40.407 -12.791 49.525 1.00 44.42  ? 67   PHE A CE1   1 
ATOM   6199  C  CE2   . PHE C  3 67  ? -41.367 -12.714 47.323 1.00 45.04  ? 67   PHE A CE2   1 
ATOM   6200  C  CZ    . PHE C  3 67  ? -40.266 -12.890 48.150 1.00 45.65  ? 67   PHE A CZ    1 
ATOM   6201  N  N     . GLN C  3 68  ? -45.052 -9.537  48.179 1.00 46.12  ? 68   GLN A N     1 
ATOM   6202  C  CA    . GLN C  3 68  ? -44.952 -8.801  46.925 1.00 46.33  ? 68   GLN A CA    1 
ATOM   6203  C  C     . GLN C  3 68  ? -44.630 -7.330  47.178 1.00 45.86  ? 68   GLN A C     1 
ATOM   6204  O  O     . GLN C  3 68  ? -43.763 -6.758  46.516 1.00 46.00  ? 68   GLN A O     1 
ATOM   6205  C  CB    . GLN C  3 68  ? -46.229 -8.943  46.099 1.00 46.45  ? 68   GLN A CB    1 
ATOM   6206  C  CG    . GLN C  3 68  ? -45.974 -8.799  44.615 1.00 49.48  ? 68   GLN A CG    1 
ATOM   6207  C  CD    . GLN C  3 68  ? -47.245 -8.687  43.776 1.00 53.26  ? 68   GLN A CD    1 
ATOM   6208  O  OE1   . GLN C  3 68  ? -48.202 -7.985  44.145 1.00 55.34  ? 68   GLN A OE1   1 
ATOM   6209  N  NE2   . GLN C  3 68  ? -47.246 -9.357  42.619 1.00 53.23  ? 68   GLN A NE2   1 
ATOM   6210  N  N     . ARG C  3 69  ? -45.319 -6.731  48.143 1.00 45.07  ? 69   ARG A N     1 
ATOM   6211  C  CA    . ARG C  3 69  ? -45.124 -5.328  48.463 1.00 44.75  ? 69   ARG A CA    1 
ATOM   6212  C  C     . ARG C  3 69  ? -43.671 -5.021  48.780 1.00 44.92  ? 69   ARG A C     1 
ATOM   6213  O  O     . ARG C  3 69  ? -43.113 -4.041  48.270 1.00 45.13  ? 69   ARG A O     1 
ATOM   6214  C  CB    . ARG C  3 69  ? -45.975 -4.924  49.660 1.00 44.64  ? 69   ARG A CB    1 
ATOM   6215  C  CG    . ARG C  3 69  ? -47.360 -4.445  49.328 1.00 43.81  ? 69   ARG A CG    1 
ATOM   6216  C  CD    . ARG C  3 69  ? -47.876 -3.566  50.467 1.00 42.65  ? 69   ARG A CD    1 
ATOM   6217  N  NE    . ARG C  3 69  ? -47.833 -4.254  51.751 1.00 40.09  ? 69   ARG A NE    1 
ATOM   6218  C  CZ    . ARG C  3 69  ? -48.812 -5.019  52.216 1.00 41.44  ? 69   ARG A CZ    1 
ATOM   6219  N  NH1   . ARG C  3 69  ? -49.927 -5.185  51.503 1.00 41.55  ? 69   ARG A NH1   1 
ATOM   6220  N  NH2   . ARG C  3 69  ? -48.684 -5.618  53.396 1.00 41.32  ? 69   ARG A NH2   1 
ATOM   6221  N  N     . LEU C  3 70  ? -43.078 -5.859  49.635 1.00 44.78  ? 70   LEU A N     1 
ATOM   6222  C  CA    . LEU C  3 70  ? -41.686 -5.723  50.048 1.00 44.21  ? 70   LEU A CA    1 
ATOM   6223  C  C     . LEU C  3 70  ? -40.750 -5.816  48.852 1.00 43.95  ? 70   LEU A C     1 
ATOM   6224  O  O     . LEU C  3 70  ? -39.838 -5.005  48.705 1.00 44.02  ? 70   LEU A O     1 
ATOM   6225  C  CB    . LEU C  3 70  ? -41.335 -6.784  51.088 1.00 44.33  ? 70   LEU A CB    1 
ATOM   6226  C  CG    . LEU C  3 70  ? -39.900 -6.807  51.611 1.00 43.81  ? 70   LEU A CG    1 
ATOM   6227  C  CD1   . LEU C  3 70  ? -39.622 -5.640  52.544 1.00 43.40  ? 70   LEU A CD1   1 
ATOM   6228  C  CD2   . LEU C  3 70  ? -39.659 -8.115  52.311 1.00 43.27  ? 70   LEU A CD2   1 
ATOM   6229  N  N     . VAL C  3 71  ? -40.990 -6.790  47.988 1.00 43.72  ? 71   VAL A N     1 
ATOM   6230  C  CA    . VAL C  3 71  ? -40.251 -6.898  46.733 1.00 43.81  ? 71   VAL A CA    1 
ATOM   6231  C  C     . VAL C  3 71  ? -40.284 -5.564  45.961 1.00 43.98  ? 71   VAL A C     1 
ATOM   6232  O  O     . VAL C  3 71  ? -39.239 -5.061  45.512 1.00 44.05  ? 71   VAL A O     1 
ATOM   6233  C  CB    . VAL C  3 71  ? -40.796 -8.072  45.882 1.00 43.73  ? 71   VAL A CB    1 
ATOM   6234  C  CG1   . VAL C  3 71  ? -40.252 -8.033  44.493 1.00 44.17  ? 71   VAL A CG1   1 
ATOM   6235  C  CG2   . VAL C  3 71  ? -40.454 -9.408  46.534 1.00 43.78  ? 71   VAL A CG2   1 
ATOM   6236  N  N     . ARG C  3 72  ? -41.473 -4.973  45.845 1.00 44.05  ? 72   ARG A N     1 
ATOM   6237  C  CA    . ARG C  3 72  ? -41.637 -3.705  45.124 1.00 44.39  ? 72   ARG A CA    1 
ATOM   6238  C  C     . ARG C  3 72  ? -40.882 -2.555  45.798 1.00 44.54  ? 72   ARG A C     1 
ATOM   6239  O  O     . ARG C  3 72  ? -40.241 -1.747  45.127 1.00 44.53  ? 72   ARG A O     1 
ATOM   6240  C  CB    . ARG C  3 72  ? -43.120 -3.369  44.935 1.00 44.05  ? 72   ARG A CB    1 
ATOM   6241  C  CG    . ARG C  3 72  ? -43.735 -4.031  43.704 1.00 44.62  ? 72   ARG A CG    1 
ATOM   6242  C  CD    . ARG C  3 72  ? -45.271 -3.985  43.686 1.00 44.90  ? 72   ARG A CD    1 
ATOM   6243  N  NE    . ARG C  3 72  ? -45.863 -5.159  43.029 1.00 45.47  ? 72   ARG A NE    1 
ATOM   6244  C  CZ    . ARG C  3 72  ? -45.871 -5.364  41.708 1.00 45.39  ? 72   ARG A CZ    1 
ATOM   6245  N  NH1   . ARG C  3 72  ? -45.320 -4.480  40.882 1.00 45.55  ? 72   ARG A NH1   1 
ATOM   6246  N  NH2   . ARG C  3 72  ? -46.417 -6.462  41.207 1.00 44.51  ? 72   ARG A NH2   1 
ATOM   6247  N  N     . GLU C  3 73  ? -40.937 -2.515  47.124 1.00 44.56  ? 73   GLU A N     1 
ATOM   6248  C  CA    . GLU C  3 73  ? -40.297 -1.467  47.895 1.00 45.64  ? 73   GLU A CA    1 
ATOM   6249  C  C     . GLU C  3 73  ? -38.779 -1.504  47.715 1.00 45.14  ? 73   GLU A C     1 
ATOM   6250  O  O     . GLU C  3 73  ? -38.137 -0.473  47.527 1.00 45.38  ? 73   GLU A O     1 
ATOM   6251  C  CB    . GLU C  3 73  ? -40.689 -1.609  49.362 1.00 45.21  ? 73   GLU A CB    1 
ATOM   6252  C  CG    . GLU C  3 73  ? -40.120 -0.574  50.299 1.00 47.18  ? 73   GLU A CG    1 
ATOM   6253  C  CD    . GLU C  3 73  ? -40.389 -0.927  51.765 1.00 48.73  ? 73   GLU A CD    1 
ATOM   6254  O  OE1   . GLU C  3 73  ? -41.559 -0.800  52.198 1.00 53.04  ? 73   GLU A OE1   1 
ATOM   6255  O  OE2   . GLU C  3 73  ? -39.440 -1.347  52.485 1.00 52.95  ? 73   GLU A OE2   1 
ATOM   6256  N  N     . ILE C  3 74  ? -38.206 -2.697  47.760 1.00 45.01  ? 74   ILE A N     1 
ATOM   6257  C  CA    . ILE C  3 74  ? -36.772 -2.850  47.609 1.00 44.19  ? 74   ILE A CA    1 
ATOM   6258  C  C     . ILE C  3 74  ? -36.377 -2.456  46.186 1.00 44.86  ? 74   ILE A C     1 
ATOM   6259  O  O     . ILE C  3 74  ? -35.409 -1.721  45.988 1.00 44.79  ? 74   ILE A O     1 
ATOM   6260  C  CB    . ILE C  3 74  ? -36.331 -4.283  47.982 1.00 43.74  ? 74   ILE A CB    1 
ATOM   6261  C  CG1   . ILE C  3 74  ? -36.346 -4.451  49.500 1.00 42.14  ? 74   ILE A CG1   1 
ATOM   6262  C  CG2   . ILE C  3 74  ? -34.956 -4.579  47.446 1.00 42.84  ? 74   ILE A CG2   1 
ATOM   6263  C  CD1   . ILE C  3 74  ? -36.639 -5.867  49.985 1.00 41.80  ? 74   ILE A CD1   1 
ATOM   6264  N  N     . ALA C  3 75  ? -37.155 -2.908  45.201 1.00 45.68  ? 75   ALA A N     1 
ATOM   6265  C  CA    . ALA C  3 75  ? -36.880 -2.589  43.795 1.00 46.24  ? 75   ALA A CA    1 
ATOM   6266  C  C     . ALA C  3 75  ? -36.940 -1.094  43.488 1.00 46.91  ? 75   ALA A C     1 
ATOM   6267  O  O     . ALA C  3 75  ? -36.136 -0.592  42.705 1.00 46.95  ? 75   ALA A O     1 
ATOM   6268  C  CB    . ALA C  3 75  ? -37.810 -3.349  42.893 1.00 45.90  ? 75   ALA A CB    1 
ATOM   6269  N  N     . GLN C  3 76  ? -37.884 -0.387  44.113 1.00 48.15  ? 76   GLN A N     1 
ATOM   6270  C  CA    . GLN C  3 76  ? -38.083 1.059   43.895 1.00 49.57  ? 76   GLN A CA    1 
ATOM   6271  C  C     . GLN C  3 76  ? -36.824 1.915   44.143 1.00 50.13  ? 76   GLN A C     1 
ATOM   6272  O  O     . GLN C  3 76  ? -36.680 2.996   43.560 1.00 49.99  ? 76   GLN A O     1 
ATOM   6273  C  CB    . GLN C  3 76  ? -39.270 1.556   44.733 1.00 49.85  ? 76   GLN A CB    1 
ATOM   6274  C  CG    . GLN C  3 76  ? -39.758 2.989   44.440 1.00 52.10  ? 76   GLN A CG    1 
ATOM   6275  C  CD    . GLN C  3 76  ? -40.505 3.138   43.107 1.00 54.38  ? 76   GLN A CD    1 
ATOM   6276  O  OE1   . GLN C  3 76  ? -40.953 2.156   42.503 1.00 56.03  ? 76   GLN A OE1   1 
ATOM   6277  N  NE2   . GLN C  3 76  ? -40.637 4.377   42.649 1.00 53.96  ? 76   GLN A NE2   1 
ATOM   6278  N  N     . ASP C  3 77  ? -35.915 1.423   44.993 1.00 50.89  ? 77   ASP A N     1 
ATOM   6279  C  CA    . ASP C  3 77  ? -34.620 2.074   45.224 1.00 51.61  ? 77   ASP A CA    1 
ATOM   6280  C  C     . ASP C  3 77  ? -33.666 1.924   44.046 1.00 51.68  ? 77   ASP A C     1 
ATOM   6281  O  O     . ASP C  3 77  ? -32.733 2.702   43.892 1.00 52.15  ? 77   ASP A O     1 
ATOM   6282  C  CB    . ASP C  3 77  ? -33.954 1.534   46.488 1.00 52.09  ? 77   ASP A CB    1 
ATOM   6283  C  CG    . ASP C  3 77  ? -34.629 2.023   47.766 1.00 54.40  ? 77   ASP A CG    1 
ATOM   6284  O  OD1   . ASP C  3 77  ? -34.944 1.173   48.633 1.00 56.54  ? 77   ASP A OD1   1 
ATOM   6285  O  OD2   . ASP C  3 77  ? -34.849 3.251   47.907 1.00 55.96  ? 77   ASP A OD2   1 
ATOM   6286  N  N     . PHE C  3 78  ? -33.891 0.928   43.207 1.00 51.65  ? 78   PHE A N     1 
ATOM   6287  C  CA    . PHE C  3 78  ? -32.976 0.683   42.118 1.00 51.63  ? 78   PHE A CA    1 
ATOM   6288  C  C     . PHE C  3 78  ? -33.470 1.296   40.813 1.00 51.88  ? 78   PHE A C     1 
ATOM   6289  O  O     . PHE C  3 78  ? -32.690 1.862   40.057 1.00 52.01  ? 78   PHE A O     1 
ATOM   6290  C  CB    . PHE C  3 78  ? -32.694 -0.813  41.990 1.00 51.43  ? 78   PHE A CB    1 
ATOM   6291  C  CG    . PHE C  3 78  ? -32.103 -1.427  43.232 1.00 50.95  ? 78   PHE A CG    1 
ATOM   6292  C  CD1   . PHE C  3 78  ? -32.682 -2.556  43.808 1.00 50.16  ? 78   PHE A CD1   1 
ATOM   6293  C  CD2   . PHE C  3 78  ? -30.966 -0.874  43.832 1.00 50.94  ? 78   PHE A CD2   1 
ATOM   6294  C  CE1   . PHE C  3 78  ? -32.137 -3.126  44.962 1.00 50.12  ? 78   PHE A CE1   1 
ATOM   6295  C  CE2   . PHE C  3 78  ? -30.409 -1.440  44.991 1.00 50.34  ? 78   PHE A CE2   1 
ATOM   6296  C  CZ    . PHE C  3 78  ? -30.998 -2.562  45.557 1.00 50.35  ? 78   PHE A CZ    1 
ATOM   6297  N  N     . LYS C  3 79  ? -34.763 1.167   40.546 1.00 52.36  ? 79   LYS A N     1 
ATOM   6298  C  CA    . LYS C  3 79  ? -35.384 1.803   39.389 1.00 52.77  ? 79   LYS A CA    1 
ATOM   6299  C  C     . LYS C  3 79  ? -36.845 2.088   39.669 1.00 52.87  ? 79   LYS A C     1 
ATOM   6300  O  O     . LYS C  3 79  ? -37.557 1.267   40.270 1.00 53.08  ? 79   LYS A O     1 
ATOM   6301  C  CB    . LYS C  3 79  ? -35.266 0.949   38.135 1.00 52.80  ? 79   LYS A CB    1 
ATOM   6302  C  CG    . LYS C  3 79  ? -35.547 1.732   36.868 1.00 54.94  ? 79   LYS A CG    1 
ATOM   6303  C  CD    . LYS C  3 79  ? -35.698 0.821   35.660 1.00 58.88  ? 79   LYS A CD    1 
ATOM   6304  C  CE    . LYS C  3 79  ? -36.147 1.605   34.416 1.00 61.18  ? 79   LYS A CE    1 
ATOM   6305  N  NZ    . LYS C  3 79  ? -36.089 0.767   33.162 1.00 62.65  ? 79   LYS A NZ    1 
ATOM   6306  N  N     . THR C  3 80  ? -37.286 3.258   39.219 1.00 52.89  ? 80   THR A N     1 
ATOM   6307  C  CA    . THR C  3 80  ? -38.651 3.708   39.450 1.00 52.53  ? 80   THR A CA    1 
ATOM   6308  C  C     . THR C  3 80  ? -39.613 3.186   38.382 1.00 52.30  ? 80   THR A C     1 
ATOM   6309  O  O     . THR C  3 80  ? -39.197 2.718   37.319 1.00 51.83  ? 80   THR A O     1 
ATOM   6310  C  CB    . THR C  3 80  ? -38.723 5.258   39.564 1.00 52.74  ? 80   THR A CB    1 
ATOM   6311  O  OG1   . THR C  3 80  ? -38.482 5.861   38.283 1.00 52.44  ? 80   THR A OG1   1 
ATOM   6312  C  CG2   . THR C  3 80  ? -37.699 5.777   40.576 1.00 52.32  ? 80   THR A CG2   1 
ATOM   6313  N  N     . ASP C  3 81  ? -40.903 3.276   38.692 1.00 52.47  ? 81   ASP A N     1 
ATOM   6314  C  CA    . ASP C  3 81  ? -41.984 2.756   37.850 1.00 52.76  ? 81   ASP A CA    1 
ATOM   6315  C  C     . ASP C  3 81  ? -41.681 1.372   37.263 1.00 52.02  ? 81   ASP A C     1 
ATOM   6316  O  O     . ASP C  3 81  ? -41.658 1.195   36.051 1.00 52.26  ? 81   ASP A O     1 
ATOM   6317  C  CB    . ASP C  3 81  ? -42.368 3.758   36.743 1.00 53.13  ? 81   ASP A CB    1 
ATOM   6318  C  CG    . ASP C  3 81  ? -43.704 3.407   36.067 1.00 55.55  ? 81   ASP A CG    1 
ATOM   6319  O  OD1   . ASP C  3 81  ? -44.708 3.157   36.780 1.00 57.19  ? 81   ASP A OD1   1 
ATOM   6320  O  OD2   . ASP C  3 81  ? -43.752 3.376   34.813 1.00 59.07  ? 81   ASP A OD2   1 
ATOM   6321  N  N     . LEU C  3 82  ? -41.428 0.397   38.122 1.00 51.03  ? 82   LEU A N     1 
ATOM   6322  C  CA    . LEU C  3 82  ? -41.245 -0.955  37.634 1.00 50.46  ? 82   LEU A CA    1 
ATOM   6323  C  C     . LEU C  3 82  ? -42.546 -1.711  37.744 1.00 50.27  ? 82   LEU A C     1 
ATOM   6324  O  O     . LEU C  3 82  ? -43.331 -1.468  38.654 1.00 50.30  ? 82   LEU A O     1 
ATOM   6325  C  CB    . LEU C  3 82  ? -40.139 -1.695  38.392 1.00 50.24  ? 82   LEU A CB    1 
ATOM   6326  C  CG    . LEU C  3 82  ? -38.681 -1.366  38.047 1.00 49.39  ? 82   LEU A CG    1 
ATOM   6327  C  CD1   . LEU C  3 82  ? -37.743 -2.165  38.946 1.00 48.32  ? 82   LEU A CD1   1 
ATOM   6328  C  CD2   . LEU C  3 82  ? -38.374 -1.622  36.593 1.00 47.31  ? 82   LEU A CD2   1 
ATOM   6329  N  N     . ARG C  3 83  ? -42.775 -2.603  36.789 1.00 49.99  ? 83   ARG A N     1 
ATOM   6330  C  CA    . ARG C  3 83  ? -43.829 -3.597  36.892 1.00 49.98  ? 83   ARG A CA    1 
ATOM   6331  C  C     . ARG C  3 83  ? -43.164 -4.977  37.031 1.00 49.50  ? 83   ARG A C     1 
ATOM   6332  O  O     . ARG C  3 83  ? -41.947 -5.116  36.816 1.00 49.22  ? 83   ARG A O     1 
ATOM   6333  C  CB    . ARG C  3 83  ? -44.740 -3.549  35.665 1.00 50.35  ? 83   ARG A CB    1 
ATOM   6334  C  CG    . ARG C  3 83  ? -45.370 -2.201  35.404 1.00 51.50  ? 83   ARG A CG    1 
ATOM   6335  C  CD    . ARG C  3 83  ? -46.240 -2.247  34.156 1.00 53.90  ? 83   ARG A CD    1 
ATOM   6336  N  NE    . ARG C  3 83  ? -47.670 -2.310  34.469 1.00 56.14  ? 83   ARG A NE    1 
ATOM   6337  C  CZ    . ARG C  3 83  ? -48.617 -2.709  33.620 1.00 56.79  ? 83   ARG A CZ    1 
ATOM   6338  N  NH1   . ARG C  3 83  ? -48.300 -3.097  32.389 1.00 57.97  ? 83   ARG A NH1   1 
ATOM   6339  N  NH2   . ARG C  3 83  ? -49.890 -2.731  34.002 1.00 56.97  ? 83   ARG A NH2   1 
ATOM   6340  N  N     . PHE C  3 84  ? -43.956 -5.992  37.371 1.00 48.65  ? 84   PHE A N     1 
ATOM   6341  C  CA    . PHE C  3 84  ? -43.405 -7.298  37.710 1.00 47.89  ? 84   PHE A CA    1 
ATOM   6342  C  C     . PHE C  3 84  ? -44.203 -8.415  37.097 1.00 47.20  ? 84   PHE A C     1 
ATOM   6343  O  O     . PHE C  3 84  ? -45.383 -8.552  37.397 1.00 47.27  ? 84   PHE A O     1 
ATOM   6344  C  CB    . PHE C  3 84  ? -43.430 -7.493  39.225 1.00 47.94  ? 84   PHE A CB    1 
ATOM   6345  C  CG    . PHE C  3 84  ? -42.171 -7.075  39.923 1.00 48.56  ? 84   PHE A CG    1 
ATOM   6346  C  CD1   . PHE C  3 84  ? -42.084 -5.837  40.546 1.00 48.88  ? 84   PHE A CD1   1 
ATOM   6347  C  CD2   . PHE C  3 84  ? -41.083 -7.940  40.002 1.00 49.14  ? 84   PHE A CD2   1 
ATOM   6348  C  CE1   . PHE C  3 84  ? -40.922 -5.455  41.209 1.00 48.73  ? 84   PHE A CE1   1 
ATOM   6349  C  CE2   . PHE C  3 84  ? -39.914 -7.567  40.668 1.00 48.56  ? 84   PHE A CE2   1 
ATOM   6350  C  CZ    . PHE C  3 84  ? -39.836 -6.328  41.270 1.00 48.58  ? 84   PHE A CZ    1 
ATOM   6351  N  N     . GLN C  3 85  ? -43.565 -9.232  36.265 1.00 46.59  ? 85   GLN A N     1 
ATOM   6352  C  CA    . GLN C  3 85  ? -44.177 -10.495 35.840 1.00 46.12  ? 85   GLN A CA    1 
ATOM   6353  C  C     . GLN C  3 85  ? -44.547 -11.272 37.087 1.00 46.03  ? 85   GLN A C     1 
ATOM   6354  O  O     . GLN C  3 85  ? -43.765 -11.345 38.030 1.00 46.08  ? 85   GLN A O     1 
ATOM   6355  C  CB    . GLN C  3 85  ? -43.217 -11.326 34.997 1.00 45.96  ? 85   GLN A CB    1 
ATOM   6356  C  CG    . GLN C  3 85  ? -43.347 -11.115 33.513 1.00 46.11  ? 85   GLN A CG    1 
ATOM   6357  C  CD    . GLN C  3 85  ? -42.419 -12.001 32.703 1.00 47.73  ? 85   GLN A CD    1 
ATOM   6358  O  OE1   . GLN C  3 85  ? -41.930 -13.038 33.178 1.00 47.82  ? 85   GLN A OE1   1 
ATOM   6359  N  NE2   . GLN C  3 85  ? -42.172 -11.599 31.462 1.00 48.31  ? 85   GLN A NE2   1 
ATOM   6360  N  N     . SER C  3 86  ? -45.750 -11.835 37.091 1.00 45.91  ? 86   SER A N     1 
ATOM   6361  C  CA    . SER C  3 86  ? -46.273 -12.592 38.225 1.00 45.35  ? 86   SER A CA    1 
ATOM   6362  C  C     . SER C  3 86  ? -45.384 -13.772 38.610 1.00 44.54  ? 86   SER A C     1 
ATOM   6363  O  O     . SER C  3 86  ? -45.226 -14.078 39.784 1.00 44.38  ? 86   SER A O     1 
ATOM   6364  C  CB    . SER C  3 86  ? -47.673 -13.096 37.904 1.00 45.40  ? 86   SER A CB    1 
ATOM   6365  O  OG    . SER C  3 86  ? -48.267 -13.634 39.071 1.00 48.02  ? 86   SER A OG    1 
ATOM   6366  N  N     . SER C  3 87  ? -44.815 -14.438 37.618 1.00 43.95  ? 87   SER A N     1 
ATOM   6367  C  CA    . SER C  3 87  ? -43.905 -15.537 37.875 1.00 43.83  ? 87   SER A CA    1 
ATOM   6368  C  C     . SER C  3 87  ? -42.540 -15.047 38.372 1.00 43.55  ? 87   SER A C     1 
ATOM   6369  O  O     . SER C  3 87  ? -41.795 -15.806 38.993 1.00 43.40  ? 87   SER A O     1 
ATOM   6370  C  CB    . SER C  3 87  ? -43.713 -16.344 36.609 1.00 43.73  ? 87   SER A CB    1 
ATOM   6371  O  OG    . SER C  3 87  ? -43.125 -15.519 35.635 1.00 44.65  ? 87   SER A OG    1 
ATOM   6372  N  N     . ALA C  3 88  ? -42.219 -13.786 38.078 1.00 43.14  ? 88   ALA A N     1 
ATOM   6373  C  CA    . ALA C  3 88  ? -40.998 -13.146 38.564 1.00 42.68  ? 88   ALA A CA    1 
ATOM   6374  C  C     . ALA C  3 88  ? -41.001 -13.036 40.072 1.00 42.42  ? 88   ALA A C     1 
ATOM   6375  O  O     . ALA C  3 88  ? -39.964 -13.217 40.711 1.00 42.63  ? 88   ALA A O     1 
ATOM   6376  C  CB    . ALA C  3 88  ? -40.838 -11.773 37.949 1.00 42.78  ? 88   ALA A CB    1 
ATOM   6377  N  N     . VAL C  3 89  ? -42.167 -12.726 40.627 1.00 42.23  ? 89   VAL A N     1 
ATOM   6378  C  CA    . VAL C  3 89  ? -42.358 -12.629 42.064 1.00 42.36  ? 89   VAL A CA    1 
ATOM   6379  C  C     . VAL C  3 89  ? -42.417 -14.034 42.657 1.00 42.78  ? 89   VAL A C     1 
ATOM   6380  O  O     . VAL C  3 89  ? -41.870 -14.278 43.722 1.00 42.80  ? 89   VAL A O     1 
ATOM   6381  C  CB    . VAL C  3 89  ? -43.635 -11.841 42.430 1.00 41.96  ? 89   VAL A CB    1 
ATOM   6382  C  CG1   . VAL C  3 89  ? -43.607 -11.462 43.887 1.00 42.06  ? 89   VAL A CG1   1 
ATOM   6383  C  CG2   . VAL C  3 89  ? -43.717 -10.581 41.632 1.00 42.51  ? 89   VAL A CG2   1 
ATOM   6384  N  N     . MET C  3 90  ? -43.079 -14.955 41.958 1.00 43.37  ? 90   MET A N     1 
ATOM   6385  C  CA    . MET C  3 90  ? -43.077 -16.361 42.338 1.00 44.05  ? 90   MET A CA    1 
ATOM   6386  C  C     . MET C  3 90  ? -41.651 -16.884 42.506 1.00 43.25  ? 90   MET A C     1 
ATOM   6387  O  O     . MET C  3 90  ? -41.316 -17.403 43.559 1.00 43.37  ? 90   MET A O     1 
ATOM   6388  C  CB    . MET C  3 90  ? -43.846 -17.198 41.320 1.00 44.83  ? 90   MET A CB    1 
ATOM   6389  C  CG    . MET C  3 90  ? -45.347 -17.115 41.506 1.00 49.61  ? 90   MET A CG    1 
ATOM   6390  S  SD    . MET C  3 90  ? -45.758 -17.360 43.253 1.00 60.01  ? 90   MET A SD    1 
ATOM   6391  C  CE    . MET C  3 90  ? -45.526 -19.150 43.368 1.00 59.80  ? 90   MET A CE    1 
ATOM   6392  N  N     . ALA C  3 91  ? -40.821 -16.718 41.475 1.00 42.36  ? 91   ALA A N     1 
ATOM   6393  C  CA    . ALA C  3 91  ? -39.415 -17.074 41.522 1.00 41.48  ? 91   ALA A CA    1 
ATOM   6394  C  C     . ALA C  3 91  ? -38.734 -16.497 42.776 1.00 41.53  ? 91   ALA A C     1 
ATOM   6395  O  O     . ALA C  3 91  ? -38.103 -17.233 43.550 1.00 41.45  ? 91   ALA A O     1 
ATOM   6396  C  CB    . ALA C  3 91  ? -38.715 -16.603 40.260 1.00 41.00  ? 91   ALA A CB    1 
ATOM   6397  N  N     . LEU C  3 92  ? -38.878 -15.196 43.003 1.00 40.84  ? 92   LEU A N     1 
ATOM   6398  C  CA    . LEU C  3 92  ? -38.242 -14.599 44.162 1.00 40.83  ? 92   LEU A CA    1 
ATOM   6399  C  C     . LEU C  3 92  ? -38.758 -15.212 45.451 1.00 40.65  ? 92   LEU A C     1 
ATOM   6400  O  O     . LEU C  3 92  ? -37.980 -15.423 46.392 1.00 41.21  ? 92   LEU A O     1 
ATOM   6401  C  CB    . LEU C  3 92  ? -38.441 -13.090 44.201 1.00 41.04  ? 92   LEU A CB    1 
ATOM   6402  C  CG    . LEU C  3 92  ? -37.646 -12.276 43.193 1.00 41.55  ? 92   LEU A CG    1 
ATOM   6403  C  CD1   . LEU C  3 92  ? -38.310 -10.914 42.995 1.00 42.03  ? 92   LEU A CD1   1 
ATOM   6404  C  CD2   . LEU C  3 92  ? -36.205 -12.124 43.659 1.00 42.14  ? 92   LEU A CD2   1 
ATOM   6405  N  N     . GLN C  3 93  ? -40.052 -15.513 45.505 1.00 39.48  ? 93   GLN A N     1 
ATOM   6406  C  CA    . GLN C  3 93  ? -40.565 -16.101 46.715 1.00 38.87  ? 93   GLN A CA    1 
ATOM   6407  C  C     . GLN C  3 93  ? -39.952 -17.480 46.934 1.00 38.19  ? 93   GLN A C     1 
ATOM   6408  O  O     . GLN C  3 93  ? -39.397 -17.751 48.003 1.00 38.17  ? 93   GLN A O     1 
ATOM   6409  C  CB    . GLN C  3 93  ? -42.097 -16.106 46.788 1.00 38.73  ? 93   GLN A CB    1 
ATOM   6410  C  CG    . GLN C  3 93  ? -42.578 -16.225 48.249 1.00 39.52  ? 93   GLN A CG    1 
ATOM   6411  C  CD    . GLN C  3 93  ? -44.036 -15.877 48.468 1.00 40.15  ? 93   GLN A CD    1 
ATOM   6412  O  OE1   . GLN C  3 93  ? -44.641 -15.130 47.699 1.00 42.81  ? 93   GLN A OE1   1 
ATOM   6413  N  NE2   . GLN C  3 93  ? -44.605 -16.411 49.535 1.00 39.14  ? 93   GLN A NE2   1 
ATOM   6414  N  N     . GLU C  3 94  ? -40.005 -18.324 45.914 1.00 37.33  ? 94   GLU A N     1 
ATOM   6415  C  CA    . GLU C  3 94  ? -39.445 -19.660 46.009 1.00 37.12  ? 94   GLU A CA    1 
ATOM   6416  C  C     . GLU C  3 94  ? -37.988 -19.629 46.469 1.00 36.59  ? 94   GLU A C     1 
ATOM   6417  O  O     . GLU C  3 94  ? -37.616 -20.370 47.364 1.00 36.42  ? 94   GLU A O     1 
ATOM   6418  C  CB    . GLU C  3 94  ? -39.559 -20.385 44.675 1.00 37.66  ? 94   GLU A CB    1 
ATOM   6419  C  CG    . GLU C  3 94  ? -40.993 -20.642 44.208 1.00 39.45  ? 94   GLU A CG    1 
ATOM   6420  C  CD    . GLU C  3 94  ? -41.647 -21.877 44.826 1.00 42.38  ? 94   GLU A CD    1 
ATOM   6421  O  OE1   . GLU C  3 94  ? -42.883 -22.023 44.653 1.00 45.72  ? 94   GLU A OE1   1 
ATOM   6422  O  OE2   . GLU C  3 94  ? -40.952 -22.709 45.448 1.00 41.47  ? 94   GLU A OE2   1 
ATOM   6423  N  N     . ALA C  3 95  ? -37.183 -18.744 45.883 1.00 36.13  ? 95   ALA A N     1 
ATOM   6424  C  CA    . ALA C  3 95  ? -35.761 -18.650 46.201 1.00 35.69  ? 95   ALA A CA    1 
ATOM   6425  C  C     . ALA C  3 95  ? -35.498 -18.146 47.619 1.00 36.21  ? 95   ALA A C     1 
ATOM   6426  O  O     . ALA C  3 95  ? -34.587 -18.645 48.307 1.00 36.04  ? 95   ALA A O     1 
ATOM   6427  C  CB    . ALA C  3 95  ? -35.062 -17.777 45.208 1.00 35.33  ? 95   ALA A CB    1 
ATOM   6428  N  N     . SER C  3 96  ? -36.286 -17.156 48.046 1.00 35.93  ? 96   SER A N     1 
ATOM   6429  C  CA    . SER C  3 96  ? -36.143 -16.591 49.371 1.00 36.09  ? 96   SER A CA    1 
ATOM   6430  C  C     . SER C  3 96  ? -36.501 -17.604 50.428 1.00 36.26  ? 96   SER A C     1 
ATOM   6431  O  O     . SER C  3 96  ? -35.832 -17.694 51.450 1.00 36.91  ? 96   SER A O     1 
ATOM   6432  C  CB    . SER C  3 96  ? -37.031 -15.364 49.533 1.00 36.01  ? 96   SER A CB    1 
ATOM   6433  O  OG    . SER C  3 96  ? -36.674 -14.381 48.589 1.00 36.88  ? 96   SER A OG    1 
ATOM   6434  N  N     . GLU C  3 97  ? -37.568 -18.361 50.196 1.00 36.29  ? 97   GLU A N     1 
ATOM   6435  C  CA    . GLU C  3 97  ? -38.008 -19.337 51.184 1.00 36.40  ? 97   GLU A CA    1 
ATOM   6436  C  C     . GLU C  3 97  ? -37.036 -20.520 51.240 1.00 35.05  ? 97   GLU A C     1 
ATOM   6437  O  O     . GLU C  3 97  ? -36.644 -20.957 52.311 1.00 35.16  ? 97   GLU A O     1 
ATOM   6438  C  CB    . GLU C  3 97  ? -39.454 -19.757 50.930 1.00 36.09  ? 97   GLU A CB    1 
ATOM   6439  C  CG    . GLU C  3 97  ? -40.464 -18.633 51.224 1.00 37.96  ? 97   GLU A CG    1 
ATOM   6440  C  CD    . GLU C  3 97  ? -41.907 -19.140 51.373 1.00 39.34  ? 97   GLU A CD    1 
ATOM   6441  O  OE1   . GLU C  3 97  ? -42.097 -20.364 51.590 1.00 44.40  ? 97   GLU A OE1   1 
ATOM   6442  O  OE2   . GLU C  3 97  ? -42.859 -18.322 51.277 1.00 43.16  ? 97   GLU A OE2   1 
ATOM   6443  N  N     . ALA C  3 98  ? -36.604 -20.999 50.085 1.00 34.09  ? 98   ALA A N     1 
ATOM   6444  C  CA    . ALA C  3 98  ? -35.535 -21.986 50.032 1.00 32.88  ? 98   ALA A CA    1 
ATOM   6445  C  C     . ALA C  3 98  ? -34.325 -21.502 50.820 1.00 32.38  ? 98   ALA A C     1 
ATOM   6446  O  O     . ALA C  3 98  ? -33.741 -22.257 51.599 1.00 32.35  ? 98   ALA A O     1 
ATOM   6447  C  CB    . ALA C  3 98  ? -35.148 -22.253 48.610 1.00 32.68  ? 98   ALA A CB    1 
ATOM   6448  N  N     . TYR C  3 99  ? -33.956 -20.237 50.635 1.00 31.86  ? 99   TYR A N     1 
ATOM   6449  C  CA    . TYR C  3 99  ? -32.773 -19.715 51.292 1.00 31.19  ? 99   TYR A CA    1 
ATOM   6450  C  C     . TYR C  3 99  ? -32.982 -19.658 52.789 1.00 31.18  ? 99   TYR A C     1 
ATOM   6451  O  O     . TYR C  3 99  ? -32.096 -20.075 53.545 1.00 31.53  ? 99   TYR A O     1 
ATOM   6452  C  CB    . TYR C  3 99  ? -32.379 -18.356 50.740 1.00 31.17  ? 99   TYR A CB    1 
ATOM   6453  C  CG    . TYR C  3 99  ? -31.422 -17.575 51.613 1.00 31.62  ? 99   TYR A CG    1 
ATOM   6454  C  CD1   . TYR C  3 99  ? -30.035 -17.770 51.531 1.00 31.01  ? 99   TYR A CD1   1 
ATOM   6455  C  CD2   . TYR C  3 99  ? -31.898 -16.627 52.509 1.00 30.79  ? 99   TYR A CD2   1 
ATOM   6456  C  CE1   . TYR C  3 99  ? -29.152 -17.044 52.326 1.00 29.37  ? 99   TYR A CE1   1 
ATOM   6457  C  CE2   . TYR C  3 99  ? -31.034 -15.897 53.297 1.00 31.00  ? 99   TYR A CE2   1 
ATOM   6458  C  CZ    . TYR C  3 99  ? -29.662 -16.105 53.206 1.00 32.03  ? 99   TYR A CZ    1 
ATOM   6459  O  OH    . TYR C  3 99  ? -28.813 -15.354 54.018 1.00 33.53  ? 99   TYR A OH    1 
ATOM   6460  N  N     . LEU C  3 100 ? -34.143 -19.173 53.229 1.00 30.48  ? 100  LEU A N     1 
ATOM   6461  C  CA    . LEU C  3 100 ? -34.350 -19.004 54.664 1.00 30.31  ? 100  LEU A CA    1 
ATOM   6462  C  C     . LEU C  3 100 ? -34.495 -20.335 55.380 1.00 30.20  ? 100  LEU A C     1 
ATOM   6463  O  O     . LEU C  3 100 ? -33.987 -20.511 56.481 1.00 30.54  ? 100  LEU A O     1 
ATOM   6464  C  CB    . LEU C  3 100 ? -35.527 -18.081 54.981 1.00 30.21  ? 100  LEU A CB    1 
ATOM   6465  C  CG    . LEU C  3 100 ? -35.408 -16.594 54.648 1.00 29.20  ? 100  LEU A CG    1 
ATOM   6466  C  CD1   . LEU C  3 100 ? -36.771 -15.922 54.830 1.00 29.02  ? 100  LEU A CD1   1 
ATOM   6467  C  CD2   . LEU C  3 100 ? -34.355 -15.905 55.484 1.00 27.51  ? 100  LEU A CD2   1 
ATOM   6468  N  N     . VAL C  3 101 ? -35.160 -21.284 54.748 1.00 30.07  ? 101  VAL A N     1 
ATOM   6469  C  CA    . VAL C  3 101 ? -35.301 -22.606 55.336 1.00 30.48  ? 101  VAL A CA    1 
ATOM   6470  C  C     . VAL C  3 101 ? -33.939 -23.259 55.514 1.00 30.74  ? 101  VAL A C     1 
ATOM   6471  O  O     . VAL C  3 101 ? -33.705 -23.941 56.499 1.00 31.08  ? 101  VAL A O     1 
ATOM   6472  C  CB    . VAL C  3 101 ? -36.176 -23.517 54.460 1.00 30.56  ? 101  VAL A CB    1 
ATOM   6473  C  CG1   . VAL C  3 101 ? -36.093 -24.941 54.947 1.00 30.07  ? 101  VAL A CG1   1 
ATOM   6474  C  CG2   . VAL C  3 101 ? -37.629 -23.012 54.446 1.00 30.41  ? 101  VAL A CG2   1 
ATOM   6475  N  N     . ALA C  3 102 ? -33.031 -23.052 54.567 1.00 31.07  ? 102  ALA A N     1 
ATOM   6476  C  CA    . ALA C  3 102 ? -31.717 -23.694 54.659 1.00 31.36  ? 102  ALA A CA    1 
ATOM   6477  C  C     . ALA C  3 102 ? -30.863 -23.015 55.732 1.00 31.64  ? 102  ALA A C     1 
ATOM   6478  O  O     . ALA C  3 102 ? -30.067 -23.658 56.426 1.00 32.35  ? 102  ALA A O     1 
ATOM   6479  C  CB    . ALA C  3 102 ? -31.011 -23.700 53.319 1.00 30.58  ? 102  ALA A CB    1 
ATOM   6480  N  N     . LEU C  3 103 ? -31.043 -21.717 55.894 1.00 31.84  ? 103  LEU A N     1 
ATOM   6481  C  CA    . LEU C  3 103 ? -30.269 -21.005 56.886 1.00 32.19  ? 103  LEU A CA    1 
ATOM   6482  C  C     . LEU C  3 103 ? -30.781 -21.360 58.290 1.00 32.61  ? 103  LEU A C     1 
ATOM   6483  O  O     . LEU C  3 103 ? -30.004 -21.432 59.253 1.00 32.57  ? 103  LEU A O     1 
ATOM   6484  C  CB    . LEU C  3 103 ? -30.332 -19.508 56.602 1.00 32.22  ? 103  LEU A CB    1 
ATOM   6485  C  CG    . LEU C  3 103 ? -29.750 -18.508 57.595 1.00 32.04  ? 103  LEU A CG    1 
ATOM   6486  C  CD1   . LEU C  3 103 ? -28.211 -18.544 57.585 1.00 30.99  ? 103  LEU A CD1   1 
ATOM   6487  C  CD2   . LEU C  3 103 ? -30.304 -17.119 57.241 1.00 32.19  ? 103  LEU A CD2   1 
ATOM   6488  N  N     . PHE C  3 104 ? -32.087 -21.587 58.408 1.00 32.59  ? 104  PHE A N     1 
ATOM   6489  C  CA    . PHE C  3 104 ? -32.634 -22.107 59.662 1.00 32.80  ? 104  PHE A CA    1 
ATOM   6490  C  C     . PHE C  3 104 ? -32.074 -23.492 60.026 1.00 33.52  ? 104  PHE A C     1 
ATOM   6491  O  O     . PHE C  3 104 ? -32.025 -23.848 61.199 1.00 33.59  ? 104  PHE A O     1 
ATOM   6492  C  CB    . PHE C  3 104 ? -34.168 -22.136 59.643 1.00 31.86  ? 104  PHE A CB    1 
ATOM   6493  C  CG    . PHE C  3 104 ? -34.815 -20.802 59.954 1.00 29.98  ? 104  PHE A CG    1 
ATOM   6494  C  CD1   . PHE C  3 104 ? -35.717 -20.225 59.063 1.00 28.36  ? 104  PHE A CD1   1 
ATOM   6495  C  CD2   . PHE C  3 104 ? -34.559 -20.152 61.133 1.00 26.96  ? 104  PHE A CD2   1 
ATOM   6496  C  CE1   . PHE C  3 104 ? -36.327 -19.023 59.351 1.00 27.25  ? 104  PHE A CE1   1 
ATOM   6497  C  CE2   . PHE C  3 104 ? -35.161 -18.936 61.418 1.00 27.93  ? 104  PHE A CE2   1 
ATOM   6498  C  CZ    . PHE C  3 104 ? -36.044 -18.372 60.522 1.00 27.96  ? 104  PHE A CZ    1 
ATOM   6499  N  N     . GLU C  3 105 ? -31.665 -24.274 59.029 1.00 34.29  ? 105  GLU A N     1 
ATOM   6500  C  CA    . GLU C  3 105 ? -31.049 -25.569 59.309 1.00 35.59  ? 105  GLU A CA    1 
ATOM   6501  C  C     . GLU C  3 105 ? -29.674 -25.333 59.901 1.00 35.48  ? 105  GLU A C     1 
ATOM   6502  O  O     . GLU C  3 105 ? -29.338 -25.905 60.930 1.00 36.34  ? 105  GLU A O     1 
ATOM   6503  C  CB    . GLU C  3 105 ? -30.957 -26.461 58.059 1.00 34.90  ? 105  GLU A CB    1 
ATOM   6504  C  CG    . GLU C  3 105 ? -32.311 -26.976 57.565 1.00 37.09  ? 105  GLU A CG    1 
ATOM   6505  C  CD    . GLU C  3 105 ? -32.295 -27.515 56.112 1.00 37.64  ? 105  GLU A CD    1 
ATOM   6506  O  OE1   . GLU C  3 105 ? -31.247 -28.068 55.695 1.00 39.85  ? 105  GLU A OE1   1 
ATOM   6507  O  OE2   . GLU C  3 105 ? -33.345 -27.402 55.402 1.00 38.21  ? 105  GLU A OE2   1 
ATOM   6508  N  N     . ASP C  3 106 ? -28.875 -24.484 59.268 1.00 35.45  ? 106  ASP A N     1 
ATOM   6509  C  CA    . ASP C  3 106 ? -27.540 -24.222 59.781 1.00 35.59  ? 106  ASP A CA    1 
ATOM   6510  C  C     . ASP C  3 106 ? -27.612 -23.526 61.133 1.00 35.05  ? 106  ASP A C     1 
ATOM   6511  O  O     . ASP C  3 106 ? -26.809 -23.801 62.028 1.00 34.87  ? 106  ASP A O     1 
ATOM   6512  C  CB    . ASP C  3 106 ? -26.751 -23.379 58.797 1.00 36.15  ? 106  ASP A CB    1 
ATOM   6513  C  CG    . ASP C  3 106 ? -26.675 -24.010 57.421 1.00 39.10  ? 106  ASP A CG    1 
ATOM   6514  O  OD1   . ASP C  3 106 ? -27.031 -25.220 57.305 1.00 42.33  ? 106  ASP A OD1   1 
ATOM   6515  O  OD2   . ASP C  3 106 ? -26.254 -23.298 56.463 1.00 40.40  ? 106  ASP A OD2   1 
ATOM   6516  N  N     . THR C  3 107 ? -28.588 -22.634 61.269 1.00 34.20  ? 107  THR A N     1 
ATOM   6517  C  CA    . THR C  3 107 ? -28.795 -21.907 62.494 1.00 33.91  ? 107  THR A CA    1 
ATOM   6518  C  C     . THR C  3 107 ? -29.022 -22.909 63.606 1.00 33.24  ? 107  THR A C     1 
ATOM   6519  O  O     . THR C  3 107 ? -28.332 -22.873 64.621 1.00 33.35  ? 107  THR A O     1 
ATOM   6520  C  CB    . THR C  3 107 ? -29.991 -20.924 62.368 1.00 34.51  ? 107  THR A CB    1 
ATOM   6521  O  OG1   . THR C  3 107 ? -29.616 -19.824 61.523 1.00 35.83  ? 107  THR A OG1   1 
ATOM   6522  C  CG2   . THR C  3 107 ? -30.399 -20.384 63.717 1.00 33.62  ? 107  THR A CG2   1 
ATOM   6523  N  N     . ASN C  3 108 ? -29.966 -23.822 63.381 1.00 32.37  ? 108  ASN A N     1 
ATOM   6524  C  CA    . ASN C  3 108 ? -30.304 -24.865 64.322 1.00 31.25  ? 108  ASN A CA    1 
ATOM   6525  C  C     . ASN C  3 108 ? -29.126 -25.718 64.699 1.00 31.11  ? 108  ASN A C     1 
ATOM   6526  O  O     . ASN C  3 108 ? -28.997 -26.096 65.851 1.00 31.13  ? 108  ASN A O     1 
ATOM   6527  C  CB    . ASN C  3 108 ? -31.375 -25.761 63.754 1.00 31.29  ? 108  ASN A CB    1 
ATOM   6528  C  CG    . ASN C  3 108 ? -32.204 -26.406 64.823 1.00 31.07  ? 108  ASN A CG    1 
ATOM   6529  O  OD1   . ASN C  3 108 ? -32.402 -25.839 65.893 1.00 33.42  ? 108  ASN A OD1   1 
ATOM   6530  N  ND2   . ASN C  3 108 ? -32.719 -27.584 64.536 1.00 31.65  ? 108  ASN A ND2   1 
ATOM   6531  N  N     . LEU C  3 109 ? -28.254 -26.009 63.743 1.00 31.03  ? 109  LEU A N     1 
ATOM   6532  C  CA    . LEU C  3 109 ? -27.040 -26.742 64.069 1.00 31.70  ? 109  LEU A CA    1 
ATOM   6533  C  C     . LEU C  3 109 ? -26.135 -25.964 65.023 1.00 32.29  ? 109  LEU A C     1 
ATOM   6534  O  O     . LEU C  3 109 ? -25.571 -26.545 65.955 1.00 33.47  ? 109  LEU A O     1 
ATOM   6535  C  CB    . LEU C  3 109 ? -26.288 -27.184 62.815 1.00 31.44  ? 109  LEU A CB    1 
ATOM   6536  C  CG    . LEU C  3 109 ? -27.036 -28.238 61.992 1.00 30.45  ? 109  LEU A CG    1 
ATOM   6537  C  CD1   . LEU C  3 109 ? -26.418 -28.376 60.619 1.00 29.61  ? 109  LEU A CD1   1 
ATOM   6538  C  CD2   . LEU C  3 109 ? -27.058 -29.572 62.720 1.00 27.32  ? 109  LEU A CD2   1 
ATOM   6539  N  N     . CYS C  3 110 ? -26.036 -24.656 64.833 1.00 32.42  ? 110  CYS A N     1 
ATOM   6540  C  CA    . CYS C  3 110 ? -25.207 -23.834 65.699 1.00 32.81  ? 110  CYS A CA    1 
ATOM   6541  C  C     . CYS C  3 110 ? -25.785 -23.730 67.107 1.00 33.27  ? 110  CYS A C     1 
ATOM   6542  O  O     . CYS C  3 110 ? -25.058 -23.700 68.099 1.00 33.51  ? 110  CYS A O     1 
ATOM   6543  C  CB    . CYS C  3 110 ? -25.026 -22.458 65.079 1.00 32.75  ? 110  CYS A CB    1 
ATOM   6544  S  SG    . CYS C  3 110 ? -24.274 -22.529 63.452 1.00 33.76  ? 110  CYS A SG    1 
ATOM   6545  N  N     . ALA C  3 111 ? -27.108 -23.685 67.184 1.00 33.86  ? 111  ALA A N     1 
ATOM   6546  C  CA    . ALA C  3 111 ? -27.805 -23.710 68.447 1.00 33.78  ? 111  ALA A CA    1 
ATOM   6547  C  C     . ALA C  3 111 ? -27.421 -24.975 69.201 1.00 34.16  ? 111  ALA A C     1 
ATOM   6548  O  O     . ALA C  3 111 ? -27.098 -24.923 70.390 1.00 34.40  ? 111  ALA A O     1 
ATOM   6549  C  CB    . ALA C  3 111 ? -29.293 -23.675 68.199 1.00 34.00  ? 111  ALA A CB    1 
ATOM   6550  N  N     . ILE C  3 112 ? -27.452 -26.111 68.504 1.00 34.09  ? 112  ILE A N     1 
ATOM   6551  C  CA    . ILE C  3 112 ? -27.229 -27.417 69.137 1.00 33.89  ? 112  ILE A CA    1 
ATOM   6552  C  C     . ILE C  3 112 ? -25.740 -27.621 69.458 1.00 34.58  ? 112  ILE A C     1 
ATOM   6553  O  O     . ILE C  3 112 ? -25.372 -28.411 70.344 1.00 34.73  ? 112  ILE A O     1 
ATOM   6554  C  CB    . ILE C  3 112 ? -27.765 -28.549 68.248 1.00 33.70  ? 112  ILE A CB    1 
ATOM   6555  C  CG1   . ILE C  3 112 ? -29.283 -28.468 68.152 1.00 32.88  ? 112  ILE A CG1   1 
ATOM   6556  C  CG2   . ILE C  3 112 ? -27.322 -29.918 68.756 1.00 33.59  ? 112  ILE A CG2   1 
ATOM   6557  C  CD1   . ILE C  3 112 ? -29.867 -29.315 67.045 1.00 32.44  ? 112  ILE A CD1   1 
ATOM   6558  N  N     . HIS C  3 113 ? -24.882 -26.898 68.734 1.00 34.50  ? 113  HIS A N     1 
ATOM   6559  C  CA    . HIS C  3 113 ? -23.461 -26.879 69.049 1.00 34.11  ? 113  HIS A CA    1 
ATOM   6560  C  C     . HIS C  3 113 ? -23.202 -26.206 70.403 1.00 34.21  ? 113  HIS A C     1 
ATOM   6561  O  O     . HIS C  3 113 ? -22.255 -26.535 71.097 1.00 34.20  ? 113  HIS A O     1 
ATOM   6562  C  CB    . HIS C  3 113 ? -22.701 -26.158 67.951 1.00 33.70  ? 113  HIS A CB    1 
ATOM   6563  C  CG    . HIS C  3 113 ? -21.216 -26.315 68.039 1.00 32.69  ? 113  HIS A CG    1 
ATOM   6564  N  ND1   . HIS C  3 113 ? -20.571 -27.487 67.699 1.00 31.20  ? 113  HIS A ND1   1 
ATOM   6565  C  CD2   . HIS C  3 113 ? -20.250 -25.441 68.406 1.00 29.81  ? 113  HIS A CD2   1 
ATOM   6566  C  CE1   . HIS C  3 113 ? -19.269 -27.325 67.858 1.00 30.89  ? 113  HIS A CE1   1 
ATOM   6567  N  NE2   . HIS C  3 113 ? -19.048 -26.095 68.288 1.00 28.71  ? 113  HIS A NE2   1 
ATOM   6568  N  N     . ALA C  3 114 ? -24.041 -25.251 70.769 1.00 34.57  ? 114  ALA A N     1 
ATOM   6569  C  CA    . ALA C  3 114 ? -23.904 -24.596 72.070 1.00 35.14  ? 114  ALA A CA    1 
ATOM   6570  C  C     . ALA C  3 114 ? -24.798 -25.274 73.111 1.00 35.39  ? 114  ALA A C     1 
ATOM   6571  O  O     . ALA C  3 114 ? -25.064 -24.722 74.173 1.00 35.51  ? 114  ALA A O     1 
ATOM   6572  C  CB    . ALA C  3 114 ? -24.230 -23.125 71.954 1.00 34.80  ? 114  ALA A CB    1 
ATOM   6573  N  N     . LYS C  3 115 ? -25.271 -26.475 72.789 1.00 36.05  ? 115  LYS A N     1 
ATOM   6574  C  CA    . LYS C  3 115 ? -26.035 -27.292 73.742 1.00 36.47  ? 115  LYS A CA    1 
ATOM   6575  C  C     . LYS C  3 115 ? -27.354 -26.649 74.136 1.00 35.89  ? 115  LYS A C     1 
ATOM   6576  O  O     . LYS C  3 115 ? -27.845 -26.896 75.226 1.00 35.70  ? 115  LYS A O     1 
ATOM   6577  C  CB    . LYS C  3 115 ? -25.191 -27.621 74.979 1.00 36.43  ? 115  LYS A CB    1 
ATOM   6578  C  CG    . LYS C  3 115 ? -23.976 -28.471 74.636 1.00 39.46  ? 115  LYS A CG    1 
ATOM   6579  C  CD    . LYS C  3 115 ? -23.066 -28.682 75.817 1.00 44.54  ? 115  LYS A CD    1 
ATOM   6580  C  CE    . LYS C  3 115 ? -21.923 -29.637 75.439 1.00 48.53  ? 115  LYS A CE    1 
ATOM   6581  N  NZ    . LYS C  3 115 ? -21.081 -30.034 76.638 1.00 51.53  ? 115  LYS A NZ    1 
ATOM   6582  N  N     . ARG C  3 116 ? -27.895 -25.815 73.243 1.00 35.64  ? 116  ARG A N     1 
ATOM   6583  C  CA    . ARG C  3 116 ? -29.230 -25.223 73.378 1.00 35.28  ? 116  ARG A CA    1 
ATOM   6584  C  C     . ARG C  3 116 ? -30.160 -25.889 72.369 1.00 35.14  ? 116  ARG A C     1 
ATOM   6585  O  O     . ARG C  3 116 ? -29.713 -26.641 71.516 1.00 35.23  ? 116  ARG A O     1 
ATOM   6586  C  CB    . ARG C  3 116 ? -29.202 -23.710 73.108 1.00 35.52  ? 116  ARG A CB    1 
ATOM   6587  C  CG    . ARG C  3 116 ? -28.366 -22.868 74.075 1.00 35.66  ? 116  ARG A CG    1 
ATOM   6588  C  CD    . ARG C  3 116 ? -28.424 -21.386 73.718 1.00 35.12  ? 116  ARG A CD    1 
ATOM   6589  N  NE    . ARG C  3 116 ? -27.367 -20.975 72.790 1.00 35.61  ? 116  ARG A NE    1 
ATOM   6590  C  CZ    . ARG C  3 116 ? -27.532 -20.753 71.478 1.00 36.03  ? 116  ARG A CZ    1 
ATOM   6591  N  NH1   . ARG C  3 116 ? -28.716 -20.902 70.883 1.00 33.70  ? 116  ARG A NH1   1 
ATOM   6592  N  NH2   . ARG C  3 116 ? -26.494 -20.383 70.739 1.00 36.00  ? 116  ARG A NH2   1 
ATOM   6593  N  N     . VAL C  3 117 ? -31.451 -25.608 72.480 1.00 35.17  ? 117  VAL A N     1 
ATOM   6594  C  CA    . VAL C  3 117 ? -32.471 -26.085 71.545 1.00 35.07  ? 117  VAL A CA    1 
ATOM   6595  C  C     . VAL C  3 117 ? -33.263 -24.873 71.026 1.00 35.49  ? 117  VAL A C     1 
ATOM   6596  O  O     . VAL C  3 117 ? -34.155 -24.994 70.187 1.00 35.66  ? 117  VAL A O     1 
ATOM   6597  C  CB    . VAL C  3 117 ? -33.434 -27.110 72.215 1.00 35.24  ? 117  VAL A CB    1 
ATOM   6598  C  CG1   . VAL C  3 117 ? -32.710 -28.387 72.594 1.00 33.85  ? 117  VAL A CG1   1 
ATOM   6599  C  CG2   . VAL C  3 117 ? -34.109 -26.511 73.457 1.00 35.14  ? 117  VAL A CG2   1 
ATOM   6600  N  N     . THR C  3 118 ? -32.924 -23.699 71.540 1.00 35.95  ? 118  THR A N     1 
ATOM   6601  C  CA    . THR C  3 118 ? -33.558 -22.464 71.127 1.00 36.57  ? 118  THR A CA    1 
ATOM   6602  C  C     . THR C  3 118 ? -32.614 -21.719 70.188 1.00 36.78  ? 118  THR A C     1 
ATOM   6603  O  O     . THR C  3 118 ? -31.471 -21.422 70.559 1.00 36.52  ? 118  THR A O     1 
ATOM   6604  C  CB    . THR C  3 118 ? -33.842 -21.550 72.335 1.00 36.61  ? 118  THR A CB    1 
ATOM   6605  O  OG1   . THR C  3 118 ? -34.324 -22.332 73.434 1.00 37.61  ? 118  THR A OG1   1 
ATOM   6606  C  CG2   . THR C  3 118 ? -34.869 -20.462 71.966 1.00 37.41  ? 118  THR A CG2   1 
ATOM   6607  N  N     . ILE C  3 119 ? -33.093 -21.406 68.982 1.00 36.80  ? 119  ILE A N     1 
ATOM   6608  C  CA    . ILE C  3 119 ? -32.288 -20.630 68.041 1.00 36.80  ? 119  ILE A CA    1 
ATOM   6609  C  C     . ILE C  3 119 ? -32.302 -19.149 68.419 1.00 37.12  ? 119  ILE A C     1 
ATOM   6610  O  O     . ILE C  3 119 ? -33.296 -18.644 68.935 1.00 36.93  ? 119  ILE A O     1 
ATOM   6611  C  CB    . ILE C  3 119 ? -32.713 -20.845 66.587 1.00 36.50  ? 119  ILE A CB    1 
ATOM   6612  C  CG1   . ILE C  3 119 ? -34.125 -20.310 66.344 1.00 35.91  ? 119  ILE A CG1   1 
ATOM   6613  C  CG2   . ILE C  3 119 ? -32.577 -22.330 66.205 1.00 35.98  ? 119  ILE A CG2   1 
ATOM   6614  C  CD1   . ILE C  3 119 ? -34.380 -19.955 64.909 1.00 34.80  ? 119  ILE A CD1   1 
ATOM   6615  N  N     . MET C  3 120 ? -31.179 -18.479 68.170 1.00 37.51  ? 120  MET A N     1 
ATOM   6616  C  CA    . MET C  3 120 ? -30.933 -17.114 68.618 1.00 37.81  ? 120  MET A CA    1 
ATOM   6617  C  C     . MET C  3 120 ? -30.150 -16.391 67.543 1.00 37.53  ? 120  MET A C     1 
ATOM   6618  O  O     . MET C  3 120 ? -29.538 -17.043 66.712 1.00 37.67  ? 120  MET A O     1 
ATOM   6619  C  CB    . MET C  3 120 ? -30.112 -17.132 69.894 1.00 37.58  ? 120  MET A CB    1 
ATOM   6620  C  CG    . MET C  3 120 ? -30.859 -17.674 71.079 1.00 38.27  ? 120  MET A CG    1 
ATOM   6621  S  SD    . MET C  3 120 ? -29.964 -17.435 72.623 1.00 39.98  ? 120  MET A SD    1 
ATOM   6622  C  CE    . MET C  3 120 ? -30.906 -18.558 73.681 1.00 38.53  ? 120  MET A CE    1 
ATOM   6623  N  N     . PRO C  3 121 ? -30.167 -15.042 67.547 1.00 37.40  ? 121  PRO A N     1 
ATOM   6624  C  CA    . PRO C  3 121 ? -29.490 -14.263 66.526 1.00 36.79  ? 121  PRO A CA    1 
ATOM   6625  C  C     . PRO C  3 121 ? -27.999 -14.558 66.395 1.00 36.76  ? 121  PRO A C     1 
ATOM   6626  O  O     . PRO C  3 121 ? -27.455 -14.491 65.278 1.00 36.70  ? 121  PRO A O     1 
ATOM   6627  C  CB    . PRO C  3 121 ? -29.721 -12.823 66.989 1.00 37.04  ? 121  PRO A CB    1 
ATOM   6628  C  CG    . PRO C  3 121 ? -31.022 -12.887 67.713 1.00 36.84  ? 121  PRO A CG    1 
ATOM   6629  C  CD    . PRO C  3 121 ? -30.877 -14.158 68.497 1.00 37.76  ? 121  PRO A CD    1 
ATOM   6630  N  N     . LYS C  3 122 ? -27.332 -14.896 67.498 1.00 36.18  ? 122  LYS A N     1 
ATOM   6631  C  CA    . LYS C  3 122 ? -25.911 -15.230 67.386 1.00 35.57  ? 122  LYS A CA    1 
ATOM   6632  C  C     . LYS C  3 122 ? -25.675 -16.509 66.577 1.00 34.93  ? 122  LYS A C     1 
ATOM   6633  O  O     . LYS C  3 122 ? -24.594 -16.696 66.027 1.00 35.15  ? 122  LYS A O     1 
ATOM   6634  C  CB    . LYS C  3 122 ? -25.204 -15.267 68.737 1.00 35.08  ? 122  LYS A CB    1 
ATOM   6635  C  CG    . LYS C  3 122 ? -25.820 -16.167 69.739 1.00 36.94  ? 122  LYS A CG    1 
ATOM   6636  C  CD    . LYS C  3 122 ? -25.048 -16.130 71.038 1.00 37.87  ? 122  LYS A CD    1 
ATOM   6637  C  CE    . LYS C  3 122 ? -26.002 -16.166 72.199 1.00 39.17  ? 122  LYS A CE    1 
ATOM   6638  N  NZ    . LYS C  3 122 ? -25.263 -15.988 73.472 1.00 42.90  ? 122  LYS A NZ    1 
ATOM   6639  N  N     . ASP C  3 123 ? -26.700 -17.353 66.482 1.00 34.11  ? 123  ASP A N     1 
ATOM   6640  C  CA    . ASP C  3 123 ? -26.647 -18.566 65.684 1.00 33.40  ? 123  ASP A CA    1 
ATOM   6641  C  C     . ASP C  3 123 ? -26.776 -18.239 64.216 1.00 33.11  ? 123  ASP A C     1 
ATOM   6642  O  O     . ASP C  3 123 ? -26.050 -18.787 63.391 1.00 33.74  ? 123  ASP A O     1 
ATOM   6643  C  CB    . ASP C  3 123 ? -27.765 -19.531 66.079 1.00 33.43  ? 123  ASP A CB    1 
ATOM   6644  C  CG    . ASP C  3 123 ? -27.720 -19.910 67.532 1.00 34.27  ? 123  ASP A CG    1 
ATOM   6645  O  OD1   . ASP C  3 123 ? -26.612 -20.218 68.011 1.00 37.63  ? 123  ASP A OD1   1 
ATOM   6646  O  OD2   . ASP C  3 123 ? -28.780 -19.905 68.204 1.00 34.62  ? 123  ASP A OD2   1 
ATOM   6647  N  N     . ILE C  3 124 ? -27.718 -17.367 63.874 1.00 32.58  ? 124  ILE A N     1 
ATOM   6648  C  CA    . ILE C  3 124 ? -27.849 -16.907 62.485 1.00 31.54  ? 124  ILE A CA    1 
ATOM   6649  C  C     . ILE C  3 124 ? -26.549 -16.197 62.097 1.00 30.87  ? 124  ILE A C     1 
ATOM   6650  O  O     . ILE C  3 124 ? -26.042 -16.374 61.016 1.00 29.79  ? 124  ILE A O     1 
ATOM   6651  C  CB    . ILE C  3 124 ? -29.077 -15.952 62.288 1.00 31.18  ? 124  ILE A CB    1 
ATOM   6652  C  CG1   . ILE C  3 124 ? -30.376 -16.681 62.592 1.00 30.82  ? 124  ILE A CG1   1 
ATOM   6653  C  CG2   . ILE C  3 124 ? -29.146 -15.434 60.866 1.00 30.80  ? 124  ILE A CG2   1 
ATOM   6654  C  CD1   . ILE C  3 124 ? -31.624 -15.835 62.427 1.00 31.69  ? 124  ILE A CD1   1 
ATOM   6655  N  N     . GLN C  3 125 ? -26.014 -15.411 63.021 1.00 31.28  ? 125  GLN A N     1 
ATOM   6656  C  CA    . GLN C  3 125 ? -24.821 -14.622 62.773 1.00 31.62  ? 125  GLN A CA    1 
ATOM   6657  C  C     . GLN C  3 125 ? -23.677 -15.551 62.418 1.00 30.91  ? 125  GLN A C     1 
ATOM   6658  O  O     . GLN C  3 125 ? -23.031 -15.380 61.385 1.00 30.90  ? 125  GLN A O     1 
ATOM   6659  C  CB    . GLN C  3 125 ? -24.500 -13.738 63.985 1.00 32.07  ? 125  GLN A CB    1 
ATOM   6660  C  CG    . GLN C  3 125 ? -25.185 -12.358 63.918 1.00 35.26  ? 125  GLN A CG    1 
ATOM   6661  C  CD    . GLN C  3 125 ? -25.446 -11.737 65.287 1.00 40.00  ? 125  GLN A CD    1 
ATOM   6662  O  OE1   . GLN C  3 125 ? -24.621 -11.841 66.211 1.00 41.73  ? 125  GLN A OE1   1 
ATOM   6663  N  NE2   . GLN C  3 125 ? -26.608 -11.092 65.427 1.00 39.70  ? 125  GLN A NE2   1 
ATOM   6664  N  N     . LEU C  3 126 ? -23.490 -16.576 63.248 1.00 30.26  ? 126  LEU A N     1 
ATOM   6665  C  CA    . LEU C  3 126 ? -22.450 -17.573 63.044 1.00 29.10  ? 126  LEU A CA    1 
ATOM   6666  C  C     . LEU C  3 126 ? -22.602 -18.295 61.719 1.00 28.73  ? 126  LEU A C     1 
ATOM   6667  O  O     . LEU C  3 126 ? -21.611 -18.478 61.002 1.00 28.13  ? 126  LEU A O     1 
ATOM   6668  C  CB    . LEU C  3 126 ? -22.435 -18.585 64.182 1.00 28.47  ? 126  LEU A CB    1 
ATOM   6669  C  CG    . LEU C  3 126 ? -21.219 -19.510 64.139 1.00 28.81  ? 126  LEU A CG    1 
ATOM   6670  C  CD1   . LEU C  3 126 ? -19.903 -18.746 64.374 1.00 25.89  ? 126  LEU A CD1   1 
ATOM   6671  C  CD2   . LEU C  3 126 ? -21.384 -20.674 65.122 1.00 28.80  ? 126  LEU A CD2   1 
ATOM   6672  N  N     . ALA C  3 127 ? -23.830 -18.710 61.396 1.00 28.17  ? 127  ALA A N     1 
ATOM   6673  C  CA    . ALA C  3 127 ? -24.044 -19.457 60.169 1.00 28.28  ? 127  ALA A CA    1 
ATOM   6674  C  C     . ALA C  3 127 ? -23.679 -18.627 58.954 1.00 28.53  ? 127  ALA A C     1 
ATOM   6675  O  O     . ALA C  3 127 ? -22.989 -19.095 58.062 1.00 28.31  ? 127  ALA A O     1 
ATOM   6676  C  CB    . ALA C  3 127 ? -25.452 -20.003 60.080 1.00 27.89  ? 127  ALA A CB    1 
ATOM   6677  N  N     . ARG C  3 128 ? -24.094 -17.370 58.948 1.00 29.85  ? 128  ARG A N     1 
ATOM   6678  C  CA    . ARG C  3 128 ? -23.821 -16.484 57.819 1.00 30.62  ? 128  ARG A CA    1 
ATOM   6679  C  C     . ARG C  3 128 ? -22.344 -16.170 57.714 1.00 31.18  ? 128  ARG A C     1 
ATOM   6680  O  O     . ARG C  3 128 ? -21.796 -16.151 56.621 1.00 31.03  ? 128  ARG A O     1 
ATOM   6681  C  CB    . ARG C  3 128 ? -24.645 -15.198 57.915 1.00 30.36  ? 128  ARG A CB    1 
ATOM   6682  C  CG    . ARG C  3 128 ? -26.124 -15.459 57.779 1.00 29.61  ? 128  ARG A CG    1 
ATOM   6683  C  CD    . ARG C  3 128 ? -26.928 -14.187 57.566 1.00 30.51  ? 128  ARG A CD    1 
ATOM   6684  N  NE    . ARG C  3 128 ? -26.619 -13.565 56.283 1.00 28.44  ? 128  ARG A NE    1 
ATOM   6685  C  CZ    . ARG C  3 128 ? -26.268 -12.298 56.149 1.00 28.38  ? 128  ARG A CZ    1 
ATOM   6686  N  NH1   . ARG C  3 128 ? -26.211 -11.504 57.216 1.00 28.00  ? 128  ARG A NH1   1 
ATOM   6687  N  NH2   . ARG C  3 128 ? -25.987 -11.822 54.945 1.00 29.50  ? 128  ARG A NH2   1 
ATOM   6688  N  N     . ARG C  3 129 ? -21.702 -15.932 58.851 1.00 32.42  ? 129  ARG A N     1 
ATOM   6689  C  CA    . ARG C  3 129 ? -20.268 -15.619 58.857 1.00 34.14  ? 129  ARG A CA    1 
ATOM   6690  C  C     . ARG C  3 129 ? -19.455 -16.764 58.234 1.00 34.48  ? 129  ARG A C     1 
ATOM   6691  O  O     . ARG C  3 129 ? -18.538 -16.542 57.421 1.00 34.25  ? 129  ARG A O     1 
ATOM   6692  C  CB    . ARG C  3 129 ? -19.790 -15.213 60.258 1.00 33.66  ? 129  ARG A CB    1 
ATOM   6693  C  CG    . ARG C  3 129 ? -18.298 -15.341 60.521 1.00 38.03  ? 129  ARG A CG    1 
ATOM   6694  C  CD    . ARG C  3 129 ? -17.349 -14.629 59.511 1.00 43.36  ? 129  ARG A CD    1 
ATOM   6695  N  NE    . ARG C  3 129 ? -15.968 -15.117 59.656 1.00 47.33  ? 129  ARG A NE    1 
ATOM   6696  C  CZ    . ARG C  3 129 ? -15.479 -16.243 59.104 1.00 48.33  ? 129  ARG A CZ    1 
ATOM   6697  N  NH1   . ARG C  3 129 ? -16.235 -17.024 58.334 1.00 45.72  ? 129  ARG A NH1   1 
ATOM   6698  N  NH2   . ARG C  3 129 ? -14.212 -16.589 59.324 1.00 48.32  ? 129  ARG A NH2   1 
ATOM   6699  N  N     . ILE C  3 130 ? -19.844 -17.985 58.577 1.00 35.20  ? 130  ILE A N     1 
ATOM   6700  C  CA    . ILE C  3 130 ? -19.175 -19.176 58.091 1.00 35.82  ? 130  ILE A CA    1 
ATOM   6701  C  C     . ILE C  3 130 ? -19.528 -19.464 56.641 1.00 36.57  ? 130  ILE A C     1 
ATOM   6702  O  O     . ILE C  3 130 ? -18.699 -19.958 55.891 1.00 37.11  ? 130  ILE A O     1 
ATOM   6703  C  CB    . ILE C  3 130 ? -19.450 -20.371 59.017 1.00 35.89  ? 130  ILE A CB    1 
ATOM   6704  C  CG1   . ILE C  3 130 ? -18.705 -20.158 60.329 1.00 34.99  ? 130  ILE A CG1   1 
ATOM   6705  C  CG2   . ILE C  3 130 ? -19.027 -21.702 58.379 1.00 36.61  ? 130  ILE A CG2   1 
ATOM   6706  C  CD1   . ILE C  3 130 ? -19.092 -21.122 61.383 1.00 35.43  ? 130  ILE A CD1   1 
ATOM   6707  N  N     . ARG C  3 131 ? -20.744 -19.140 56.227 1.00 37.72  ? 131  ARG A N     1 
ATOM   6708  C  CA    . ARG C  3 131 ? -21.099 -19.272 54.812 1.00 38.19  ? 131  ARG A CA    1 
ATOM   6709  C  C     . ARG C  3 131 ? -20.396 -18.237 53.940 1.00 39.33  ? 131  ARG A C     1 
ATOM   6710  O  O     . ARG C  3 131 ? -20.464 -18.308 52.718 1.00 39.38  ? 131  ARG A O     1 
ATOM   6711  C  CB    . ARG C  3 131 ? -22.598 -19.157 54.607 1.00 37.49  ? 131  ARG A CB    1 
ATOM   6712  C  CG    . ARG C  3 131 ? -23.412 -20.291 55.122 1.00 35.30  ? 131  ARG A CG    1 
ATOM   6713  C  CD    . ARG C  3 131 ? -24.824 -19.824 55.042 1.00 34.95  ? 131  ARG A CD    1 
ATOM   6714  N  NE    . ARG C  3 131 ? -25.803 -20.895 55.036 1.00 35.48  ? 131  ARG A NE    1 
ATOM   6715  C  CZ    . ARG C  3 131 ? -26.999 -20.807 54.456 1.00 33.33  ? 131  ARG A CZ    1 
ATOM   6716  N  NH1   . ARG C  3 131 ? -27.351 -19.707 53.812 1.00 31.51  ? 131  ARG A NH1   1 
ATOM   6717  N  NH2   . ARG C  3 131 ? -27.841 -21.828 54.517 1.00 32.67  ? 131  ARG A NH2   1 
ATOM   6718  N  N     . GLY C  3 132 ? -19.728 -17.268 54.559 1.00 41.13  ? 132  GLY A N     1 
ATOM   6719  C  CA    . GLY C  3 132 ? -19.054 -16.216 53.790 1.00 43.34  ? 132  GLY A CA    1 
ATOM   6720  C  C     . GLY C  3 132 ? -19.965 -15.080 53.346 1.00 44.84  ? 132  GLY A C     1 
ATOM   6721  O  O     . GLY C  3 132 ? -19.563 -14.251 52.528 1.00 45.63  ? 132  GLY A O     1 
ATOM   6722  N  N     . GLU C  3 133 ? -21.178 -15.028 53.892 1.00 45.84  ? 133  GLU A N     1 
ATOM   6723  C  CA    . GLU C  3 133 ? -22.120 -13.948 53.608 1.00 47.13  ? 133  GLU A CA    1 
ATOM   6724  C  C     . GLU C  3 133 ? -21.797 -12.700 54.445 1.00 48.77  ? 133  GLU A C     1 
ATOM   6725  O  O     . GLU C  3 133 ? -22.118 -11.577 54.051 1.00 49.03  ? 133  GLU A O     1 
ATOM   6726  C  CB    . GLU C  3 133 ? -23.573 -14.420 53.824 1.00 46.78  ? 133  GLU A CB    1 
ATOM   6727  C  CG    . GLU C  3 133 ? -23.937 -15.663 52.975 1.00 46.52  ? 133  GLU A CG    1 
ATOM   6728  C  CD    . GLU C  3 133 ? -25.320 -16.285 53.265 1.00 46.22  ? 133  GLU A CD    1 
ATOM   6729  O  OE1   . GLU C  3 133 ? -26.227 -15.595 53.789 1.00 42.22  ? 133  GLU A OE1   1 
ATOM   6730  O  OE2   . GLU C  3 133 ? -25.493 -17.484 52.938 1.00 44.26  ? 133  GLU A OE2   1 
ATOM   6731  N  N     . ARG C  3 134 ? -21.166 -12.907 55.604 1.00 50.72  ? 134  ARG A N     1 
ATOM   6732  C  CA    . ARG C  3 134 ? -20.705 -11.809 56.473 1.00 51.97  ? 134  ARG A CA    1 
ATOM   6733  C  C     . ARG C  3 134 ? -19.212 -11.547 56.237 1.00 52.66  ? 134  ARG A C     1 
ATOM   6734  O  O     . ARG C  3 134 ? -18.750 -10.397 56.259 1.00 53.20  ? 134  ARG A O     1 
ATOM   6735  C  CB    . ARG C  3 134 ? -20.920 -12.150 57.954 1.00 52.19  ? 134  ARG A CB    1 
ATOM   6736  C  CG    . ARG C  3 134 ? -22.258 -11.717 58.543 1.00 52.92  ? 134  ARG A CG    1 
ATOM   6737  C  CD    . ARG C  3 134 ? -22.399 -12.176 60.015 1.00 51.72  ? 134  ARG A CD    1 
ATOM   6738  N  NE    . ARG C  3 134 ? -21.983 -11.484 61.463 0.00 68.08  ? 134  ARG A NE    1 
ATOM   6739  C  CZ    . ARG C  3 134 ? -20.976 -10.603 61.599 0.00 70.05  ? 134  ARG A CZ    1 
ATOM   6740  N  NH1   . ARG C  3 134 ? -20.543 -9.905  60.558 0.00 70.94  ? 134  ARG A NH1   1 
ATOM   6741  N  NH2   . ARG C  3 134 ? -20.383 -10.417 62.782 0.00 70.58  ? 134  ARG A NH2   1 
ATOM   6742  N  N     . VAL D  4 21  ? -54.726 1.775   60.650 1.00 78.08  ? 21   VAL B N     1 
ATOM   6743  C  CA    . VAL D  4 21  ? -53.545 1.077   61.251 1.00 77.88  ? 21   VAL B CA    1 
ATOM   6744  C  C     . VAL D  4 21  ? -52.439 0.863   60.202 1.00 77.45  ? 21   VAL B C     1 
ATOM   6745  O  O     . VAL D  4 21  ? -52.409 -0.174  59.521 1.00 77.56  ? 21   VAL B O     1 
ATOM   6746  C  CB    . VAL D  4 21  ? -53.935 -0.304  61.883 1.00 78.04  ? 21   VAL B CB    1 
ATOM   6747  C  CG1   . VAL D  4 21  ? -53.062 -0.603  63.114 1.00 78.14  ? 21   VAL B CG1   1 
ATOM   6748  C  CG2   . VAL D  4 21  ? -55.428 -0.352  62.249 1.00 78.47  ? 21   VAL B CG2   1 
ATOM   6749  N  N     . LEU D  4 22  ? -51.535 1.838   60.070 1.00 76.66  ? 22   LEU B N     1 
ATOM   6750  C  CA    . LEU D  4 22  ? -50.376 1.711   59.160 1.00 75.85  ? 22   LEU B CA    1 
ATOM   6751  C  C     . LEU D  4 22  ? -49.448 0.547   59.545 1.00 74.89  ? 22   LEU B C     1 
ATOM   6752  O  O     . LEU D  4 22  ? -49.611 -0.054  60.613 1.00 75.16  ? 22   LEU B O     1 
ATOM   6753  C  CB    . LEU D  4 22  ? -49.580 3.023   59.085 1.00 76.01  ? 22   LEU B CB    1 
ATOM   6754  C  CG    . LEU D  4 22  ? -49.314 3.921   60.308 1.00 76.59  ? 22   LEU B CG    1 
ATOM   6755  C  CD1   . LEU D  4 22  ? -48.980 3.166   61.617 1.00 76.27  ? 22   LEU B CD1   1 
ATOM   6756  C  CD2   . LEU D  4 22  ? -48.211 4.933   59.957 1.00 76.27  ? 22   LEU B CD2   1 
ATOM   6757  N  N     . ARG D  4 23  ? -48.484 0.227   58.679 1.00 73.41  ? 23   ARG B N     1 
ATOM   6758  C  CA    . ARG D  4 23  ? -47.507 -0.835  58.972 1.00 71.78  ? 23   ARG B CA    1 
ATOM   6759  C  C     . ARG D  4 23  ? -46.404 -0.920  57.915 1.00 70.22  ? 23   ARG B C     1 
ATOM   6760  O  O     . ARG D  4 23  ? -46.671 -0.835  56.714 1.00 69.90  ? 23   ARG B O     1 
ATOM   6761  C  CB    . ARG D  4 23  ? -48.193 -2.204  59.154 1.00 71.92  ? 23   ARG B CB    1 
ATOM   6762  C  CG    . ARG D  4 23  ? -47.246 -3.323  59.615 1.00 73.03  ? 23   ARG B CG    1 
ATOM   6763  C  CD    . ARG D  4 23  ? -47.936 -4.434  60.426 1.00 74.21  ? 23   ARG B CD    1 
ATOM   6764  N  NE    . ARG D  4 23  ? -48.721 -5.454  59.697 1.00 75.53  ? 23   ARG B NE    1 
ATOM   6765  C  CZ    . ARG D  4 23  ? -48.722 -5.716  58.382 1.00 76.41  ? 23   ARG B CZ    1 
ATOM   6766  N  NH1   . ARG D  4 23  ? -47.956 -5.048  57.517 1.00 76.57  ? 23   ARG B NH1   1 
ATOM   6767  N  NH2   . ARG D  4 23  ? -49.512 -6.683  57.923 1.00 75.50  ? 23   ARG B NH2   1 
ATOM   6768  N  N     . ASP D  4 24  ? -45.170 -1.095  58.387 1.00 68.30  ? 24   ASP B N     1 
ATOM   6769  C  CA    . ASP D  4 24  ? -43.993 -1.251  57.533 1.00 66.35  ? 24   ASP B CA    1 
ATOM   6770  C  C     . ASP D  4 24  ? -44.109 -2.516  56.685 1.00 64.43  ? 24   ASP B C     1 
ATOM   6771  O  O     . ASP D  4 24  ? -44.666 -3.528  57.142 1.00 64.20  ? 24   ASP B O     1 
ATOM   6772  C  CB    . ASP D  4 24  ? -42.742 -1.338  58.404 1.00 66.83  ? 24   ASP B CB    1 
ATOM   6773  C  CG    . ASP D  4 24  ? -41.690 -0.312  58.032 1.00 67.88  ? 24   ASP B CG    1 
ATOM   6774  O  OD1   . ASP D  4 24  ? -41.368 -0.168  56.827 1.00 69.55  ? 24   ASP B OD1   1 
ATOM   6775  O  OD2   . ASP D  4 24  ? -41.179 0.348   58.963 1.00 69.14  ? 24   ASP B OD2   1 
ATOM   6776  N  N     . ASN D  4 25  ? -43.595 -2.457  55.456 1.00 61.98  ? 25   ASN B N     1 
ATOM   6777  C  CA    . ASN D  4 25  ? -43.719 -3.585  54.528 1.00 59.80  ? 25   ASN B CA    1 
ATOM   6778  C  C     . ASN D  4 25  ? -42.996 -4.832  55.014 1.00 58.49  ? 25   ASN B C     1 
ATOM   6779  O  O     . ASN D  4 25  ? -43.554 -5.930  54.974 1.00 58.11  ? 25   ASN B O     1 
ATOM   6780  C  CB    . ASN D  4 25  ? -43.234 -3.209  53.133 1.00 59.70  ? 25   ASN B CB    1 
ATOM   6781  C  CG    . ASN D  4 25  ? -44.278 -2.450  52.336 1.00 59.29  ? 25   ASN B CG    1 
ATOM   6782  O  OD1   . ASN D  4 25  ? -45.468 -2.746  52.408 1.00 58.04  ? 25   ASN B OD1   1 
ATOM   6783  N  ND2   . ASN D  4 25  ? -43.830 -1.475  51.554 1.00 58.78  ? 25   ASN B ND2   1 
ATOM   6784  N  N     . ILE D  4 26  ? -41.767 -4.650  55.496 1.00 56.79  ? 26   ILE B N     1 
ATOM   6785  C  CA    . ILE D  4 26  ? -40.971 -5.751  56.014 1.00 55.23  ? 26   ILE B CA    1 
ATOM   6786  C  C     . ILE D  4 26  ? -41.671 -6.456  57.178 1.00 54.42  ? 26   ILE B C     1 
ATOM   6787  O  O     . ILE D  4 26  ? -41.457 -7.641  57.412 1.00 54.47  ? 26   ILE B O     1 
ATOM   6788  C  CB    . ILE D  4 26  ? -39.540 -5.297  56.398 1.00 55.19  ? 26   ILE B CB    1 
ATOM   6789  C  CG1   . ILE D  4 26  ? -38.653 -6.492  56.746 1.00 54.28  ? 26   ILE B CG1   1 
ATOM   6790  C  CG2   . ILE D  4 26  ? -39.563 -4.334  57.572 1.00 55.31  ? 26   ILE B CG2   1 
ATOM   6791  C  CD1   . ILE D  4 26  ? -38.445 -7.454  55.638 1.00 52.95  ? 26   ILE B CD1   1 
ATOM   6792  N  N     . GLN D  4 27  ? -42.532 -5.731  57.881 1.00 53.41  ? 27   GLN B N     1 
ATOM   6793  C  CA    . GLN D  4 27  ? -43.251 -6.283  59.030 1.00 52.31  ? 27   GLN B CA    1 
ATOM   6794  C  C     . GLN D  4 27  ? -44.429 -7.126  58.579 1.00 51.50  ? 27   GLN B C     1 
ATOM   6795  O  O     . GLN D  4 27  ? -45.033 -7.845  59.375 1.00 51.47  ? 27   GLN B O     1 
ATOM   6796  C  CB    . GLN D  4 27  ? -43.713 -5.166  59.963 1.00 52.34  ? 27   GLN B CB    1 
ATOM   6797  C  CG    . GLN D  4 27  ? -42.581 -4.293  60.488 1.00 52.08  ? 27   GLN B CG    1 
ATOM   6798  C  CD    . GLN D  4 27  ? -41.751 -4.979  61.543 1.00 52.92  ? 27   GLN B CD    1 
ATOM   6799  O  OE1   . GLN D  4 27  ? -42.223 -5.879  62.237 1.00 53.18  ? 27   GLN B OE1   1 
ATOM   6800  N  NE2   . GLN D  4 27  ? -40.498 -4.558  61.673 1.00 54.77  ? 27   GLN B NE2   1 
ATOM   6801  N  N     . GLY D  4 28  ? -44.743 -7.038  57.290 1.00 50.59  ? 28   GLY B N     1 
ATOM   6802  C  CA    . GLY D  4 28  ? -45.762 -7.880  56.684 1.00 49.19  ? 28   GLY B CA    1 
ATOM   6803  C  C     . GLY D  4 28  ? -45.254 -9.304  56.626 1.00 48.56  ? 28   GLY B C     1 
ATOM   6804  O  O     . GLY D  4 28  ? -46.043 -10.252 56.500 1.00 48.42  ? 28   GLY B O     1 
ATOM   6805  N  N     . ILE D  4 29  ? -43.925 -9.445  56.691 1.00 47.41  ? 29   ILE B N     1 
ATOM   6806  C  CA    . ILE D  4 29  ? -43.296 -10.740 56.946 1.00 46.06  ? 29   ILE B CA    1 
ATOM   6807  C  C     . ILE D  4 29  ? -43.444 -10.968 58.453 1.00 45.37  ? 29   ILE B C     1 
ATOM   6808  O  O     . ILE D  4 29  ? -42.667 -10.451 59.269 1.00 44.73  ? 29   ILE B O     1 
ATOM   6809  C  CB    . ILE D  4 29  ? -41.798 -10.804 56.473 1.00 46.03  ? 29   ILE B CB    1 
ATOM   6810  C  CG1   . ILE D  4 29  ? -41.611 -10.202 55.064 1.00 44.95  ? 29   ILE B CG1   1 
ATOM   6811  C  CG2   . ILE D  4 29  ? -41.253 -12.230 56.563 1.00 45.34  ? 29   ILE B CG2   1 
ATOM   6812  C  CD1   . ILE D  4 29  ? -42.112 -11.051 53.920 1.00 43.20  ? 29   ILE B CD1   1 
ATOM   6813  N  N     . THR D  4 30  ? -44.474 -11.732 58.797 1.00 44.63  ? 30   THR B N     1 
ATOM   6814  C  CA    . THR D  4 30  ? -44.983 -11.816 60.162 1.00 44.24  ? 30   THR B CA    1 
ATOM   6815  C  C     . THR D  4 30  ? -44.259 -12.885 60.957 1.00 43.98  ? 30   THR B C     1 
ATOM   6816  O  O     . THR D  4 30  ? -43.547 -13.707 60.394 1.00 44.28  ? 30   THR B O     1 
ATOM   6817  C  CB    . THR D  4 30  ? -46.499 -12.161 60.168 1.00 44.29  ? 30   THR B CB    1 
ATOM   6818  O  OG1   . THR D  4 30  ? -46.698 -13.440 59.549 1.00 44.30  ? 30   THR B OG1   1 
ATOM   6819  C  CG2   . THR D  4 30  ? -47.310 -11.122 59.417 1.00 43.16  ? 30   THR B CG2   1 
ATOM   6820  N  N     . LYS D  4 31  ? -44.464 -12.878 62.268 1.00 43.63  ? 31   LYS B N     1 
ATOM   6821  C  CA    . LYS D  4 31  ? -43.943 -13.911 63.144 1.00 43.55  ? 31   LYS B CA    1 
ATOM   6822  C  C     . LYS D  4 31  ? -44.428 -15.320 62.769 1.00 43.08  ? 31   LYS B C     1 
ATOM   6823  O  O     . LYS D  4 31  ? -43.615 -16.223 62.614 1.00 43.26  ? 31   LYS B O     1 
ATOM   6824  C  CB    . LYS D  4 31  ? -44.241 -13.569 64.609 1.00 43.41  ? 31   LYS B CB    1 
ATOM   6825  C  CG    . LYS D  4 31  ? -44.218 -14.757 65.569 1.00 44.26  ? 31   LYS B CG    1 
ATOM   6826  C  CD    . LYS D  4 31  ? -44.555 -14.322 66.994 1.00 44.90  ? 31   LYS B CD    1 
ATOM   6827  C  CE    . LYS D  4 31  ? -44.687 -15.521 67.922 1.00 47.00  ? 31   LYS B CE    1 
ATOM   6828  N  NZ    . LYS D  4 31  ? -44.560 -15.106 69.354 1.00 47.10  ? 31   LYS B NZ    1 
ATOM   6829  N  N     . PRO D  4 32  ? -45.747 -15.523 62.602 1.00 43.04  ? 32   PRO B N     1 
ATOM   6830  C  CA    . PRO D  4 32  ? -46.140 -16.907 62.267 1.00 42.43  ? 32   PRO B CA    1 
ATOM   6831  C  C     . PRO D  4 32  ? -45.587 -17.368 60.923 1.00 41.93  ? 32   PRO B C     1 
ATOM   6832  O  O     . PRO D  4 32  ? -45.434 -18.569 60.712 1.00 42.27  ? 32   PRO B O     1 
ATOM   6833  C  CB    . PRO D  4 32  ? -47.667 -16.830 62.187 1.00 42.79  ? 32   PRO B CB    1 
ATOM   6834  C  CG    . PRO D  4 32  ? -48.032 -15.539 62.931 1.00 43.43  ? 32   PRO B CG    1 
ATOM   6835  C  CD    . PRO D  4 32  ? -46.911 -14.614 62.672 1.00 42.73  ? 32   PRO B CD    1 
ATOM   6836  N  N     . ALA D  4 33  ? -45.308 -16.425 60.016 1.00 41.06  ? 33   ALA B N     1 
ATOM   6837  C  CA    . ALA D  4 33  ? -44.720 -16.761 58.716 1.00 39.95  ? 33   ALA B CA    1 
ATOM   6838  C  C     . ALA D  4 33  ? -43.260 -17.158 58.878 1.00 39.60  ? 33   ALA B C     1 
ATOM   6839  O  O     . ALA D  4 33  ? -42.831 -18.184 58.342 1.00 39.64  ? 33   ALA B O     1 
ATOM   6840  C  CB    . ALA D  4 33  ? -44.861 -15.636 57.748 1.00 39.71  ? 33   ALA B CB    1 
ATOM   6841  N  N     . ILE D  4 34  ? -42.508 -16.362 59.635 1.00 38.71  ? 34   ILE B N     1 
ATOM   6842  C  CA    . ILE D  4 34  ? -41.145 -16.732 59.985 1.00 38.32  ? 34   ILE B CA    1 
ATOM   6843  C  C     . ILE D  4 34  ? -41.136 -18.032 60.804 1.00 38.78  ? 34   ILE B C     1 
ATOM   6844  O  O     . ILE D  4 34  ? -40.243 -18.862 60.646 1.00 39.40  ? 34   ILE B O     1 
ATOM   6845  C  CB    . ILE D  4 34  ? -40.392 -15.580 60.709 1.00 38.04  ? 34   ILE B CB    1 
ATOM   6846  C  CG1   . ILE D  4 34  ? -40.343 -14.332 59.816 1.00 36.90  ? 34   ILE B CG1   1 
ATOM   6847  C  CG2   . ILE D  4 34  ? -38.979 -16.014 61.096 1.00 37.07  ? 34   ILE B CG2   1 
ATOM   6848  C  CD1   . ILE D  4 34  ? -40.143 -13.034 60.549 1.00 33.42  ? 34   ILE B CD1   1 
ATOM   6849  N  N     . ARG D  4 35  ? -42.144 -18.234 61.641 1.00 38.82  ? 35   ARG B N     1 
ATOM   6850  C  CA    . ARG D  4 35  ? -42.209 -19.445 62.465 1.00 39.79  ? 35   ARG B CA    1 
ATOM   6851  C  C     . ARG D  4 35  ? -42.350 -20.716 61.605 1.00 39.13  ? 35   ARG B C     1 
ATOM   6852  O  O     . ARG D  4 35  ? -41.653 -21.707 61.834 1.00 39.06  ? 35   ARG B O     1 
ATOM   6853  C  CB    . ARG D  4 35  ? -43.317 -19.326 63.515 1.00 39.47  ? 35   ARG B CB    1 
ATOM   6854  C  CG    . ARG D  4 35  ? -43.468 -20.526 64.448 1.00 41.95  ? 35   ARG B CG    1 
ATOM   6855  C  CD    . ARG D  4 35  ? -44.463 -20.236 65.568 1.00 42.22  ? 35   ARG B CD    1 
ATOM   6856  N  NE    . ARG D  4 35  ? -43.867 -19.458 66.656 1.00 48.30  ? 35   ARG B NE    1 
ATOM   6857  C  CZ    . ARG D  4 35  ? -43.775 -19.880 67.923 1.00 50.76  ? 35   ARG B CZ    1 
ATOM   6858  N  NH1   . ARG D  4 35  ? -44.256 -21.071 68.281 1.00 51.73  ? 35   ARG B NH1   1 
ATOM   6859  N  NH2   . ARG D  4 35  ? -43.226 -19.102 68.849 1.00 51.55  ? 35   ARG B NH2   1 
ATOM   6860  N  N     . ARG D  4 36  ? -43.228 -20.670 60.608 1.00 38.71  ? 36   ARG B N     1 
ATOM   6861  C  CA    . ARG D  4 36  ? -43.372 -21.762 59.657 1.00 38.07  ? 36   ARG B CA    1 
ATOM   6862  C  C     . ARG D  4 36  ? -42.053 -22.075 58.934 1.00 37.63  ? 36   ARG B C     1 
ATOM   6863  O  O     . ARG D  4 36  ? -41.669 -23.244 58.777 1.00 37.14  ? 36   ARG B O     1 
ATOM   6864  C  CB    . ARG D  4 36  ? -44.457 -21.419 58.638 1.00 38.31  ? 36   ARG B CB    1 
ATOM   6865  C  CG    . ARG D  4 36  ? -45.884 -21.581 59.171 1.00 38.89  ? 36   ARG B CG    1 
ATOM   6866  C  CD    . ARG D  4 36  ? -46.926 -21.465 58.043 1.00 38.23  ? 36   ARG B CD    1 
ATOM   6867  N  NE    . ARG D  4 36  ? -47.029 -20.118 57.462 1.00 37.54  ? 36   ARG B NE    1 
ATOM   6868  C  CZ    . ARG D  4 36  ? -47.691 -19.108 58.020 1.00 37.52  ? 36   ARG B CZ    1 
ATOM   6869  N  NH1   . ARG D  4 36  ? -48.294 -19.268 59.188 1.00 38.17  ? 36   ARG B NH1   1 
ATOM   6870  N  NH2   . ARG D  4 36  ? -47.743 -17.930 57.418 1.00 37.60  ? 36   ARG B NH2   1 
ATOM   6871  N  N     . LEU D  4 37  ? -41.355 -21.025 58.502 1.00 36.92  ? 37   LEU B N     1 
ATOM   6872  C  CA    . LEU D  4 37  ? -40.111 -21.196 57.766 1.00 35.88  ? 37   LEU B CA    1 
ATOM   6873  C  C     . LEU D  4 37  ? -39.099 -21.942 58.620 1.00 35.42  ? 37   LEU B C     1 
ATOM   6874  O  O     . LEU D  4 37  ? -38.555 -22.945 58.200 1.00 35.73  ? 37   LEU B O     1 
ATOM   6875  C  CB    . LEU D  4 37  ? -39.572 -19.851 57.285 1.00 35.69  ? 37   LEU B CB    1 
ATOM   6876  C  CG    . LEU D  4 37  ? -40.262 -19.294 56.030 1.00 35.16  ? 37   LEU B CG    1 
ATOM   6877  C  CD1   . LEU D  4 37  ? -39.964 -17.804 55.851 1.00 34.34  ? 37   LEU B CD1   1 
ATOM   6878  C  CD2   . LEU D  4 37  ? -39.877 -20.059 54.785 1.00 33.17  ? 37   LEU B CD2   1 
ATOM   6879  N  N     . ALA D  4 38  ? -38.887 -21.477 59.838 1.00 34.98  ? 38   ALA B N     1 
ATOM   6880  C  CA    . ALA D  4 38  ? -38.033 -22.176 60.774 1.00 34.65  ? 38   ALA B CA    1 
ATOM   6881  C  C     . ALA D  4 38  ? -38.491 -23.620 60.971 1.00 34.79  ? 38   ALA B C     1 
ATOM   6882  O  O     . ALA D  4 38  ? -37.677 -24.538 61.094 1.00 34.95  ? 38   ALA B O     1 
ATOM   6883  C  CB    . ALA D  4 38  ? -38.022 -21.440 62.092 1.00 34.68  ? 38   ALA B CB    1 
ATOM   6884  N  N     . ARG D  4 39  ? -39.805 -23.819 60.991 1.00 34.71  ? 39   ARG B N     1 
ATOM   6885  C  CA    . ARG D  4 39  ? -40.364 -25.127 61.248 1.00 34.33  ? 39   ARG B CA    1 
ATOM   6886  C  C     . ARG D  4 39  ? -39.970 -26.079 60.136 1.00 34.07  ? 39   ARG B C     1 
ATOM   6887  O  O     . ARG D  4 39  ? -39.525 -27.171 60.406 1.00 33.74  ? 39   ARG B O     1 
ATOM   6888  C  CB    . ARG D  4 39  ? -41.881 -25.034 61.407 1.00 34.88  ? 39   ARG B CB    1 
ATOM   6889  C  CG    . ARG D  4 39  ? -42.346 -24.271 62.648 1.00 35.25  ? 39   ARG B CG    1 
ATOM   6890  C  CD    . ARG D  4 39  ? -42.364 -25.172 63.878 1.00 38.55  ? 39   ARG B CD    1 
ATOM   6891  N  NE    . ARG D  4 39  ? -42.913 -24.507 65.053 1.00 41.33  ? 39   ARG B NE    1 
ATOM   6892  C  CZ    . ARG D  4 39  ? -42.194 -24.168 66.117 1.00 43.73  ? 39   ARG B CZ    1 
ATOM   6893  N  NH1   . ARG D  4 39  ? -40.899 -24.441 66.150 1.00 44.71  ? 39   ARG B NH1   1 
ATOM   6894  N  NH2   . ARG D  4 39  ? -42.763 -23.561 67.152 1.00 44.98  ? 39   ARG B NH2   1 
ATOM   6895  N  N     . ARG D  4 40  ? -40.093 -25.650 58.883 1.00 34.41  ? 40   ARG B N     1 
ATOM   6896  C  CA    . ARG D  4 40  ? -39.626 -26.458 57.752 1.00 34.33  ? 40   ARG B CA    1 
ATOM   6897  C  C     . ARG D  4 40  ? -38.122 -26.715 57.817 1.00 34.32  ? 40   ARG B C     1 
ATOM   6898  O  O     . ARG D  4 40  ? -37.657 -27.758 57.390 1.00 34.40  ? 40   ARG B O     1 
ATOM   6899  C  CB    . ARG D  4 40  ? -40.026 -25.831 56.415 1.00 34.45  ? 40   ARG B CB    1 
ATOM   6900  C  CG    . ARG D  4 40  ? -39.621 -26.655 55.188 1.00 34.76  ? 40   ARG B CG    1 
ATOM   6901  C  CD    . ARG D  4 40  ? -40.288 -26.167 53.911 1.00 34.33  ? 40   ARG B CD    1 
ATOM   6902  N  NE    . ARG D  4 40  ? -41.700 -26.513 53.901 1.00 34.61  ? 40   ARG B NE    1 
ATOM   6903  C  CZ    . ARG D  4 40  ? -42.617 -25.935 53.129 1.00 34.87  ? 40   ARG B CZ    1 
ATOM   6904  N  NH1   . ARG D  4 40  ? -42.270 -24.970 52.293 1.00 31.96  ? 40   ARG B NH1   1 
ATOM   6905  N  NH2   . ARG D  4 40  ? -43.892 -26.324 53.200 1.00 34.50  ? 40   ARG B NH2   1 
ATOM   6906  N  N     . GLY D  4 41  ? -37.365 -25.767 58.360 1.00 34.49  ? 41   GLY B N     1 
ATOM   6907  C  CA    . GLY D  4 41  ? -35.965 -26.026 58.703 1.00 34.95  ? 41   GLY B CA    1 
ATOM   6908  C  C     . GLY D  4 41  ? -35.720 -26.852 59.969 1.00 35.18  ? 41   GLY B C     1 
ATOM   6909  O  O     . GLY D  4 41  ? -34.582 -26.944 60.437 1.00 35.54  ? 41   GLY B O     1 
ATOM   6910  N  N     . GLY D  4 42  ? -36.774 -27.439 60.532 1.00 35.08  ? 42   GLY B N     1 
ATOM   6911  C  CA    . GLY D  4 42  ? -36.663 -28.347 61.680 1.00 35.32  ? 42   GLY B CA    1 
ATOM   6912  C  C     . GLY D  4 42  ? -36.336 -27.747 63.037 1.00 35.55  ? 42   GLY B C     1 
ATOM   6913  O  O     . GLY D  4 42  ? -35.659 -28.376 63.832 1.00 36.00  ? 42   GLY B O     1 
ATOM   6914  N  N     . VAL D  4 43  ? -36.830 -26.544 63.310 1.00 35.71  ? 43   VAL B N     1 
ATOM   6915  C  CA    . VAL D  4 43  ? -36.496 -25.808 64.527 1.00 36.02  ? 43   VAL B CA    1 
ATOM   6916  C  C     . VAL D  4 43  ? -37.597 -25.939 65.569 1.00 36.80  ? 43   VAL B C     1 
ATOM   6917  O  O     . VAL D  4 43  ? -38.756 -25.681 65.276 1.00 37.39  ? 43   VAL B O     1 
ATOM   6918  C  CB    . VAL D  4 43  ? -36.283 -24.287 64.235 1.00 35.95  ? 43   VAL B CB    1 
ATOM   6919  C  CG1   . VAL D  4 43  ? -36.042 -23.539 65.514 1.00 34.64  ? 43   VAL B CG1   1 
ATOM   6920  C  CG2   . VAL D  4 43  ? -35.112 -24.066 63.269 1.00 34.94  ? 43   VAL B CG2   1 
ATOM   6921  N  N     . LYS D  4 44  ? -37.229 -26.298 66.794 1.00 37.61  ? 44   LYS B N     1 
ATOM   6922  C  CA    . LYS D  4 44  ? -38.203 -26.562 67.839 1.00 38.34  ? 44   LYS B CA    1 
ATOM   6923  C  C     . LYS D  4 44  ? -38.582 -25.345 68.647 1.00 38.46  ? 44   LYS B C     1 
ATOM   6924  O  O     . LYS D  4 44  ? -39.750 -25.098 68.870 1.00 39.11  ? 44   LYS B O     1 
ATOM   6925  C  CB    . LYS D  4 44  ? -37.707 -27.663 68.769 1.00 38.91  ? 44   LYS B CB    1 
ATOM   6926  C  CG    . LYS D  4 44  ? -38.733 -28.093 69.805 1.00 40.79  ? 44   LYS B CG    1 
ATOM   6927  C  CD    . LYS D  4 44  ? -38.386 -29.450 70.367 1.00 44.99  ? 44   LYS B CD    1 
ATOM   6928  C  CE    . LYS D  4 44  ? -39.007 -29.655 71.743 1.00 47.24  ? 44   LYS B CE    1 
ATOM   6929  N  NZ    . LYS D  4 44  ? -38.637 -30.998 72.286 1.00 48.14  ? 44   LYS B NZ    1 
ATOM   6930  N  N     . ARG D  4 45  ? -37.590 -24.587 69.089 1.00 39.10  ? 45   ARG B N     1 
ATOM   6931  C  CA    . ARG D  4 45  ? -37.816 -23.450 69.961 1.00 39.24  ? 45   ARG B CA    1 
ATOM   6932  C  C     . ARG D  4 45  ? -37.144 -22.220 69.381 1.00 39.23  ? 45   ARG B C     1 
ATOM   6933  O  O     . ARG D  4 45  ? -36.038 -22.324 68.823 1.00 38.91  ? 45   ARG B O     1 
ATOM   6934  C  CB    . ARG D  4 45  ? -37.247 -23.773 71.337 1.00 39.83  ? 45   ARG B CB    1 
ATOM   6935  C  CG    . ARG D  4 45  ? -37.807 -22.946 72.459 1.00 41.24  ? 45   ARG B CG    1 
ATOM   6936  C  CD    . ARG D  4 45  ? -37.490 -23.604 73.789 1.00 44.40  ? 45   ARG B CD    1 
ATOM   6937  N  NE    . ARG D  4 45  ? -38.129 -22.892 74.889 1.00 46.62  ? 45   ARG B NE    1 
ATOM   6938  C  CZ    . ARG D  4 45  ? -37.669 -21.758 75.409 1.00 47.50  ? 45   ARG B CZ    1 
ATOM   6939  N  NH1   . ARG D  4 45  ? -36.556 -21.198 74.943 1.00 46.56  ? 45   ARG B NH1   1 
ATOM   6940  N  NH2   . ARG D  4 45  ? -38.325 -21.186 76.407 1.00 49.59  ? 45   ARG B NH2   1 
ATOM   6941  N  N     . ILE D  4 46  ? -37.800 -21.062 69.535 1.00 39.28  ? 46   ILE B N     1 
ATOM   6942  C  CA    . ILE D  4 46  ? -37.405 -19.812 68.853 1.00 39.23  ? 46   ILE B CA    1 
ATOM   6943  C  C     . ILE D  4 46  ? -37.364 -18.589 69.777 1.00 39.81  ? 46   ILE B C     1 
ATOM   6944  O  O     . ILE D  4 46  ? -38.379 -18.216 70.371 1.00 40.23  ? 46   ILE B O     1 
ATOM   6945  C  CB    . ILE D  4 46  ? -38.353 -19.519 67.679 1.00 38.68  ? 46   ILE B CB    1 
ATOM   6946  C  CG1   . ILE D  4 46  ? -38.302 -20.656 66.662 1.00 38.87  ? 46   ILE B CG1   1 
ATOM   6947  C  CG2   . ILE D  4 46  ? -38.012 -18.202 67.022 1.00 38.12  ? 46   ILE B CG2   1 
ATOM   6948  C  CD1   . ILE D  4 46  ? -39.342 -20.563 65.556 1.00 39.47  ? 46   ILE B CD1   1 
ATOM   6949  N  N     . SER D  4 47  ? -36.197 -17.961 69.889 1.00 40.15  ? 47   SER B N     1 
ATOM   6950  C  CA    . SER D  4 47  ? -36.048 -16.732 70.675 1.00 40.27  ? 47   SER B CA    1 
ATOM   6951  C  C     . SER D  4 47  ? -36.768 -15.575 70.013 1.00 40.35  ? 47   SER B C     1 
ATOM   6952  O  O     . SER D  4 47  ? -36.815 -15.496 68.780 1.00 40.53  ? 47   SER B O     1 
ATOM   6953  C  CB    . SER D  4 47  ? -34.580 -16.349 70.812 1.00 40.34  ? 47   SER B CB    1 
ATOM   6954  O  OG    . SER D  4 47  ? -34.421 -14.954 70.548 1.00 41.97  ? 47   SER B OG    1 
ATOM   6955  N  N     . GLY D  4 48  ? -37.274 -14.654 70.831 1.00 40.19  ? 48   GLY B N     1 
ATOM   6956  C  CA    . GLY D  4 48  ? -38.108 -13.556 70.355 1.00 40.08  ? 48   GLY B CA    1 
ATOM   6957  C  C     . GLY D  4 48  ? -37.381 -12.594 69.443 1.00 40.55  ? 48   GLY B C     1 
ATOM   6958  O  O     . GLY D  4 48  ? -38.005 -11.943 68.592 1.00 40.12  ? 48   GLY B O     1 
ATOM   6959  N  N     . LEU D  4 49  ? -36.059 -12.509 69.604 1.00 40.75  ? 49   LEU B N     1 
ATOM   6960  C  CA    . LEU D  4 49  ? -35.257 -11.600 68.785 1.00 41.29  ? 49   LEU B CA    1 
ATOM   6961  C  C     . LEU D  4 49  ? -34.974 -12.103 67.351 1.00 41.23  ? 49   LEU B C     1 
ATOM   6962  O  O     . LEU D  4 49  ? -34.442 -11.362 66.530 1.00 41.67  ? 49   LEU B O     1 
ATOM   6963  C  CB    . LEU D  4 49  ? -33.950 -11.245 69.497 1.00 41.60  ? 49   LEU B CB    1 
ATOM   6964  C  CG    . LEU D  4 49  ? -34.007 -10.283 70.697 1.00 42.83  ? 49   LEU B CG    1 
ATOM   6965  C  CD1   . LEU D  4 49  ? -32.733 -10.383 71.544 1.00 42.13  ? 49   LEU B CD1   1 
ATOM   6966  C  CD2   . LEU D  4 49  ? -34.246 -8.841  70.240 1.00 43.36  ? 49   LEU B CD2   1 
ATOM   6967  N  N     . ILE D  4 50  ? -35.334 -13.347 67.052 1.00 41.01  ? 50   ILE B N     1 
ATOM   6968  C  CA    . ILE D  4 50  ? -35.048 -13.939 65.748 1.00 40.94  ? 50   ILE B CA    1 
ATOM   6969  C  C     . ILE D  4 50  ? -35.852 -13.297 64.639 1.00 41.11  ? 50   ILE B C     1 
ATOM   6970  O  O     . ILE D  4 50  ? -35.392 -13.216 63.500 1.00 41.33  ? 50   ILE B O     1 
ATOM   6971  C  CB    . ILE D  4 50  ? -35.296 -15.470 65.739 1.00 40.61  ? 50   ILE B CB    1 
ATOM   6972  C  CG1   . ILE D  4 50  ? -34.127 -16.216 66.399 1.00 41.12  ? 50   ILE B CG1   1 
ATOM   6973  C  CG2   . ILE D  4 50  ? -35.508 -15.971 64.343 1.00 39.96  ? 50   ILE B CG2   1 
ATOM   6974  C  CD1   . ILE D  4 50  ? -32.810 -16.204 65.599 1.00 40.62  ? 50   ILE B CD1   1 
ATOM   6975  N  N     . TYR D  4 51  ? -37.050 -12.829 64.968 1.00 41.19  ? 51   TYR B N     1 
ATOM   6976  C  CA    . TYR D  4 51  ? -37.926 -12.289 63.940 1.00 41.01  ? 51   TYR B CA    1 
ATOM   6977  C  C     . TYR D  4 51  ? -37.335 -11.033 63.300 1.00 41.29  ? 51   TYR B C     1 
ATOM   6978  O  O     . TYR D  4 51  ? -37.240 -10.960 62.071 1.00 41.96  ? 51   TYR B O     1 
ATOM   6979  C  CB    . TYR D  4 51  ? -39.355 -12.136 64.456 1.00 40.45  ? 51   TYR B CB    1 
ATOM   6980  C  CG    . TYR D  4 51  ? -39.832 -13.385 65.168 1.00 39.95  ? 51   TYR B CG    1 
ATOM   6981  C  CD1   . TYR D  4 51  ? -40.248 -14.511 64.453 1.00 39.43  ? 51   TYR B CD1   1 
ATOM   6982  C  CD2   . TYR D  4 51  ? -39.836 -13.456 66.561 1.00 40.25  ? 51   TYR B CD2   1 
ATOM   6983  C  CE1   . TYR D  4 51  ? -40.672 -15.678 65.109 1.00 38.29  ? 51   TYR B CE1   1 
ATOM   6984  C  CE2   . TYR D  4 51  ? -40.255 -14.615 67.233 1.00 39.14  ? 51   TYR B CE2   1 
ATOM   6985  C  CZ    . TYR D  4 51  ? -40.670 -15.721 66.501 1.00 39.69  ? 51   TYR B CZ    1 
ATOM   6986  O  OH    . TYR D  4 51  ? -41.090 -16.861 67.170 1.00 40.25  ? 51   TYR B OH    1 
ATOM   6987  N  N     . GLU D  4 52  ? -36.874 -10.075 64.095 1.00 41.21  ? 52   GLU B N     1 
ATOM   6988  C  CA    . GLU D  4 52  ? -36.172 -8.941  63.489 1.00 41.92  ? 52   GLU B CA    1 
ATOM   6989  C  C     . GLU D  4 52  ? -34.879 -9.343  62.766 1.00 41.39  ? 52   GLU B C     1 
ATOM   6990  O  O     . GLU D  4 52  ? -34.618 -8.853  61.663 1.00 41.75  ? 52   GLU B O     1 
ATOM   6991  C  CB    . GLU D  4 52  ? -35.961 -7.771  64.461 1.00 42.08  ? 52   GLU B CB    1 
ATOM   6992  C  CG    . GLU D  4 52  ? -37.274 -7.001  64.762 1.00 45.38  ? 52   GLU B CG    1 
ATOM   6993  C  CD    . GLU D  4 52  ? -37.878 -6.303  63.528 1.00 48.10  ? 52   GLU B CD    1 
ATOM   6994  O  OE1   . GLU D  4 52  ? -37.202 -5.393  62.987 1.00 50.83  ? 52   GLU B OE1   1 
ATOM   6995  O  OE2   . GLU D  4 52  ? -39.017 -6.644  63.114 1.00 45.37  ? 52   GLU B OE2   1 
ATOM   6996  N  N     . GLU D  4 53  ? -34.088 -10.248 63.337 1.00 40.81  ? 53   GLU B N     1 
ATOM   6997  C  CA    . GLU D  4 53  ? -32.889 -10.722 62.617 1.00 40.24  ? 53   GLU B CA    1 
ATOM   6998  C  C     . GLU D  4 53  ? -33.219 -11.387 61.267 1.00 39.39  ? 53   GLU B C     1 
ATOM   6999  O  O     . GLU D  4 53  ? -32.506 -11.177 60.279 1.00 39.39  ? 53   GLU B O     1 
ATOM   7000  C  CB    . GLU D  4 53  ? -32.028 -11.637 63.482 1.00 40.57  ? 53   GLU B CB    1 
ATOM   7001  C  CG    . GLU D  4 53  ? -30.568 -11.749 63.012 1.00 42.04  ? 53   GLU B CG    1 
ATOM   7002  C  CD    . GLU D  4 53  ? -29.655 -10.639 63.538 1.00 44.42  ? 53   GLU B CD    1 
ATOM   7003  O  OE1   . GLU D  4 53  ? -29.988 -10.012 64.571 1.00 45.55  ? 53   GLU B OE1   1 
ATOM   7004  O  OE2   . GLU D  4 53  ? -28.584 -10.403 62.923 1.00 45.48  ? 53   GLU B OE2   1 
ATOM   7005  N  N     . THR D  4 54  ? -34.303 -12.159 61.213 1.00 38.09  ? 54   THR B N     1 
ATOM   7006  C  CA    . THR D  4 54  ? -34.691 -12.812 59.969 1.00 37.36  ? 54   THR B CA    1 
ATOM   7007  C  C     . THR D  4 54  ? -35.092 -11.794 58.911 1.00 36.64  ? 54   THR B C     1 
ATOM   7008  O  O     . THR D  4 54  ? -34.724 -11.935 57.725 1.00 36.60  ? 54   THR B O     1 
ATOM   7009  C  CB    . THR D  4 54  ? -35.836 -13.799 60.169 1.00 37.41  ? 54   THR B CB    1 
ATOM   7010  O  OG1   . THR D  4 54  ? -35.502 -14.705 61.214 1.00 38.88  ? 54   THR B OG1   1 
ATOM   7011  C  CG2   . THR D  4 54  ? -36.093 -14.611 58.913 1.00 38.36  ? 54   THR B CG2   1 
ATOM   7012  N  N     . ARG D  4 55  ? -35.838 -10.771 59.328 1.00 35.59  ? 55   ARG B N     1 
ATOM   7013  C  CA    . ARG D  4 55  ? -36.299 -9.731  58.384 1.00 34.50  ? 55   ARG B CA    1 
ATOM   7014  C  C     . ARG D  4 55  ? -35.118 -8.997  57.787 1.00 33.54  ? 55   ARG B C     1 
ATOM   7015  O  O     . ARG D  4 55  ? -35.088 -8.731  56.585 1.00 33.44  ? 55   ARG B O     1 
ATOM   7016  C  CB    . ARG D  4 55  ? -37.278 -8.760  59.045 1.00 34.62  ? 55   ARG B CB    1 
ATOM   7017  C  CG    . ARG D  4 55  ? -38.549 -9.446  59.501 1.00 34.01  ? 55   ARG B CG    1 
ATOM   7018  C  CD    . ARG D  4 55  ? -39.544 -8.474  60.093 1.00 33.75  ? 55   ARG B CD    1 
ATOM   7019  N  NE    . ARG D  4 55  ? -40.716 -9.210  60.543 1.00 32.26  ? 55   ARG B NE    1 
ATOM   7020  C  CZ    . ARG D  4 55  ? -41.076 -9.334  61.806 1.00 31.26  ? 55   ARG B CZ    1 
ATOM   7021  N  NH1   . ARG D  4 55  ? -40.383 -8.733  62.747 1.00 31.43  ? 55   ARG B NH1   1 
ATOM   7022  N  NH2   . ARG D  4 55  ? -42.143 -10.050 62.121 1.00 32.58  ? 55   ARG B NH2   1 
ATOM   7023  N  N     . GLY D  4 56  ? -34.121 -8.721  58.621 1.00 32.53  ? 56   GLY B N     1 
ATOM   7024  C  CA    . GLY D  4 56  ? -32.873 -8.144  58.143 1.00 32.01  ? 56   GLY B CA    1 
ATOM   7025  C  C     . GLY D  4 56  ? -32.167 -8.980  57.098 1.00 31.31  ? 56   GLY B C     1 
ATOM   7026  O  O     . GLY D  4 56  ? -31.673 -8.457  56.093 1.00 31.80  ? 56   GLY B O     1 
ATOM   7027  N  N     . VAL D  4 57  ? -32.129 -10.286 57.337 1.00 31.03  ? 57   VAL B N     1 
ATOM   7028  C  CA    . VAL D  4 57  ? -31.444 -11.226 56.450 1.00 30.53  ? 57   VAL B CA    1 
ATOM   7029  C  C     . VAL D  4 57  ? -32.183 -11.353 55.136 1.00 30.18  ? 57   VAL B C     1 
ATOM   7030  O  O     . VAL D  4 57  ? -31.560 -11.402 54.070 1.00 29.97  ? 57   VAL B O     1 
ATOM   7031  C  CB    . VAL D  4 57  ? -31.267 -12.591 57.118 1.00 30.49  ? 57   VAL B CB    1 
ATOM   7032  C  CG1   . VAL D  4 57  ? -30.868 -13.623 56.109 1.00 31.11  ? 57   VAL B CG1   1 
ATOM   7033  C  CG2   . VAL D  4 57  ? -30.208 -12.503 58.201 1.00 30.88  ? 57   VAL B CG2   1 
ATOM   7034  N  N     . LEU D  4 58  ? -33.513 -11.379 55.210 1.00 29.88  ? 58   LEU B N     1 
ATOM   7035  C  CA    . LEU D  4 58  ? -34.332 -11.389 54.011 1.00 29.62  ? 58   LEU B CA    1 
ATOM   7036  C  C     . LEU D  4 58  ? -34.138 -10.109 53.213 1.00 30.18  ? 58   LEU B C     1 
ATOM   7037  O  O     . LEU D  4 58  ? -33.998 -10.145 51.993 1.00 30.06  ? 58   LEU B O     1 
ATOM   7038  C  CB    . LEU D  4 58  ? -35.788 -11.541 54.383 1.00 29.33  ? 58   LEU B CB    1 
ATOM   7039  C  CG    . LEU D  4 58  ? -36.768 -11.599 53.225 1.00 29.17  ? 58   LEU B CG    1 
ATOM   7040  C  CD1   . LEU D  4 58  ? -36.356 -12.655 52.219 1.00 27.98  ? 58   LEU B CD1   1 
ATOM   7041  C  CD2   . LEU D  4 58  ? -38.168 -11.856 53.770 1.00 30.22  ? 58   LEU B CD2   1 
ATOM   7042  N  N     . LYS D  4 59  ? -34.114 -8.971  53.898 1.00 31.01  ? 59   LYS B N     1 
ATOM   7043  C  CA    . LYS D  4 59  ? -33.892 -7.712  53.200 1.00 31.96  ? 59   LYS B CA    1 
ATOM   7044  C  C     . LYS D  4 59  ? -32.577 -7.750  52.430 1.00 31.33  ? 59   LYS B C     1 
ATOM   7045  O  O     . LYS D  4 59  ? -32.529 -7.314  51.284 1.00 31.32  ? 59   LYS B O     1 
ATOM   7046  C  CB    . LYS D  4 59  ? -33.969 -6.506  54.147 1.00 32.52  ? 59   LYS B CB    1 
ATOM   7047  C  CG    . LYS D  4 59  ? -34.265 -5.169  53.451 1.00 33.03  ? 59   LYS B CG    1 
ATOM   7048  C  CD    . LYS D  4 59  ? -34.431 -4.023  54.474 1.00 34.31  ? 59   LYS B CD    1 
ATOM   7049  C  CE    . LYS D  4 59  ? -34.135 -2.619  53.862 1.00 37.33  ? 59   LYS B CE    1 
ATOM   7050  N  NZ    . LYS D  4 59  ? -32.653 -2.260  53.944 1.00 39.39  ? 59   LYS B NZ    1 
ATOM   7051  N  N     . VAL D  4 60  ? -31.519 -8.285  53.038 1.00 31.12  ? 60   VAL B N     1 
ATOM   7052  C  CA    . VAL D  4 60  ? -30.224 -8.349  52.343 1.00 30.95  ? 60   VAL B CA    1 
ATOM   7053  C  C     . VAL D  4 60  ? -30.262 -9.374  51.205 1.00 30.93  ? 60   VAL B C     1 
ATOM   7054  O  O     . VAL D  4 60  ? -29.792 -9.092  50.107 1.00 31.82  ? 60   VAL B O     1 
ATOM   7055  C  CB    . VAL D  4 60  ? -29.058 -8.620  53.306 1.00 30.85  ? 60   VAL B CB    1 
ATOM   7056  C  CG1   . VAL D  4 60  ? -27.791 -8.954  52.542 1.00 30.39  ? 60   VAL B CG1   1 
ATOM   7057  C  CG2   . VAL D  4 60  ? -28.835 -7.433  54.187 1.00 31.34  ? 60   VAL B CG2   1 
ATOM   7058  N  N     . PHE D  4 61  ? -30.832 -10.547 51.444 1.00 30.65  ? 61   PHE B N     1 
ATOM   7059  C  CA    . PHE D  4 61  ? -31.028 -11.501 50.355 1.00 31.08  ? 61   PHE B CA    1 
ATOM   7060  C  C     . PHE D  4 61  ? -31.706 -10.815 49.161 1.00 31.49  ? 61   PHE B C     1 
ATOM   7061  O  O     . PHE D  4 61  ? -31.129 -10.737 48.066 1.00 32.18  ? 61   PHE B O     1 
ATOM   7062  C  CB    . PHE D  4 61  ? -31.847 -12.723 50.807 1.00 30.61  ? 61   PHE B CB    1 
ATOM   7063  C  CG    . PHE D  4 61  ? -31.968 -13.778 49.757 1.00 31.35  ? 61   PHE B CG    1 
ATOM   7064  C  CD1   . PHE D  4 61  ? -30.900 -14.664 49.507 1.00 30.64  ? 61   PHE B CD1   1 
ATOM   7065  C  CD2   . PHE D  4 61  ? -33.132 -13.886 48.984 1.00 31.19  ? 61   PHE B CD2   1 
ATOM   7066  C  CE1   . PHE D  4 61  ? -30.995 -15.632 48.513 1.00 27.94  ? 61   PHE B CE1   1 
ATOM   7067  C  CE2   . PHE D  4 61  ? -33.235 -14.865 47.971 1.00 29.53  ? 61   PHE B CE2   1 
ATOM   7068  C  CZ    . PHE D  4 61  ? -32.172 -15.734 47.742 1.00 29.35  ? 61   PHE B CZ    1 
ATOM   7069  N  N     . LEU D  4 62  ? -32.905 -10.279 49.385 1.00 31.53  ? 62   LEU B N     1 
ATOM   7070  C  CA    . LEU D  4 62  ? -33.667 -9.665  48.309 1.00 31.90  ? 62   LEU B CA    1 
ATOM   7071  C  C     . LEU D  4 62  ? -32.961 -8.493  47.633 1.00 32.64  ? 62   LEU B C     1 
ATOM   7072  O  O     . LEU D  4 62  ? -33.047 -8.370  46.414 1.00 33.21  ? 62   LEU B O     1 
ATOM   7073  C  CB    . LEU D  4 62  ? -35.062 -9.261  48.775 1.00 31.72  ? 62   LEU B CB    1 
ATOM   7074  C  CG    . LEU D  4 62  ? -35.984 -10.433 49.105 1.00 31.66  ? 62   LEU B CG    1 
ATOM   7075  C  CD1   . LEU D  4 62  ? -37.227 -9.959  49.808 1.00 30.44  ? 62   LEU B CD1   1 
ATOM   7076  C  CD2   . LEU D  4 62  ? -36.325 -11.237 47.859 1.00 30.97  ? 62   LEU B CD2   1 
ATOM   7077  N  N     . GLU D  4 63  ? -32.269 -7.640  48.395 1.00 32.75  ? 63   GLU B N     1 
ATOM   7078  C  CA    . GLU D  4 63  ? -31.575 -6.504  47.792 1.00 33.60  ? 63   GLU B CA    1 
ATOM   7079  C  C     . GLU D  4 63  ? -30.568 -6.968  46.766 1.00 33.33  ? 63   GLU B C     1 
ATOM   7080  O  O     . GLU D  4 63  ? -30.561 -6.473  45.645 1.00 33.19  ? 63   GLU B O     1 
ATOM   7081  C  CB    . GLU D  4 63  ? -30.877 -5.631  48.830 1.00 34.31  ? 63   GLU B CB    1 
ATOM   7082  C  CG    . GLU D  4 63  ? -31.802 -4.707  49.582 1.00 38.04  ? 63   GLU B CG    1 
ATOM   7083  C  CD    . GLU D  4 63  ? -31.185 -4.129  50.851 1.00 43.56  ? 63   GLU B CD    1 
ATOM   7084  O  OE1   . GLU D  4 63  ? -30.078 -4.560  51.250 1.00 45.82  ? 63   GLU B OE1   1 
ATOM   7085  O  OE2   . GLU D  4 63  ? -31.821 -3.232  51.456 1.00 46.61  ? 63   GLU B OE2   1 
ATOM   7086  N  N     . ASN D  4 64  ? -29.732 -7.935  47.140 1.00 33.30  ? 64   ASN B N     1 
ATOM   7087  C  CA    . ASN D  4 64  ? -28.725 -8.459  46.212 1.00 33.01  ? 64   ASN B CA    1 
ATOM   7088  C  C     . ASN D  4 64  ? -29.322 -9.068  44.963 1.00 32.47  ? 64   ASN B C     1 
ATOM   7089  O  O     . ASN D  4 64  ? -28.798 -8.874  43.879 1.00 32.46  ? 64   ASN B O     1 
ATOM   7090  C  CB    . ASN D  4 64  ? -27.809 -9.469  46.897 1.00 33.55  ? 64   ASN B CB    1 
ATOM   7091  C  CG    . ASN D  4 64  ? -26.922 -8.830  47.935 1.00 33.89  ? 64   ASN B CG    1 
ATOM   7092  O  OD1   . ASN D  4 64  ? -26.279 -7.831  47.667 1.00 36.61  ? 64   ASN B OD1   1 
ATOM   7093  N  ND2   . ASN D  4 64  ? -26.880 -9.403  49.120 1.00 34.13  ? 64   ASN B ND2   1 
ATOM   7094  N  N     . VAL D  4 65  ? -30.419 -9.805  45.112 1.00 32.14  ? 65   VAL B N     1 
ATOM   7095  C  CA    . VAL D  4 65  ? -31.037 -10.472 43.970 1.00 31.83  ? 65   VAL B CA    1 
ATOM   7096  C  C     . VAL D  4 65  ? -31.761 -9.465  43.052 1.00 31.54  ? 65   VAL B C     1 
ATOM   7097  O  O     . VAL D  4 65  ? -31.533 -9.436  41.839 1.00 30.70  ? 65   VAL B O     1 
ATOM   7098  C  CB    . VAL D  4 65  ? -31.960 -11.603 44.434 1.00 31.94  ? 65   VAL B CB    1 
ATOM   7099  C  CG1   . VAL D  4 65  ? -32.718 -12.196 43.266 1.00 32.64  ? 65   VAL B CG1   1 
ATOM   7100  C  CG2   . VAL D  4 65  ? -31.147 -12.696 45.132 1.00 32.85  ? 65   VAL B CG2   1 
ATOM   7101  N  N     . ILE D  4 66  ? -32.603 -8.623  43.638 1.00 31.65  ? 66   ILE B N     1 
ATOM   7102  C  CA    . ILE D  4 66  ? -33.320 -7.629  42.866 1.00 32.38  ? 66   ILE B CA    1 
ATOM   7103  C  C     . ILE D  4 66  ? -32.366 -6.618  42.236 1.00 32.54  ? 66   ILE B C     1 
ATOM   7104  O  O     . ILE D  4 66  ? -32.577 -6.202  41.102 1.00 31.99  ? 66   ILE B O     1 
ATOM   7105  C  CB    . ILE D  4 66  ? -34.391 -6.932  43.697 1.00 32.81  ? 66   ILE B CB    1 
ATOM   7106  C  CG1   . ILE D  4 66  ? -35.435 -7.952  44.162 1.00 33.26  ? 66   ILE B CG1   1 
ATOM   7107  C  CG2   . ILE D  4 66  ? -35.063 -5.829  42.891 1.00 32.75  ? 66   ILE B CG2   1 
ATOM   7108  C  CD1   . ILE D  4 66  ? -36.176 -7.507  45.403 1.00 32.34  ? 66   ILE B CD1   1 
ATOM   7109  N  N     . ARG D  4 67  ? -31.299 -6.252  42.935 1.00 32.83  ? 67   ARG B N     1 
ATOM   7110  C  CA    . ARG D  4 67  ? -30.367 -5.302  42.350 1.00 34.22  ? 67   ARG B CA    1 
ATOM   7111  C  C     . ARG D  4 67  ? -29.946 -5.833  41.009 1.00 33.93  ? 67   ARG B C     1 
ATOM   7112  O  O     . ARG D  4 67  ? -29.994 -5.105  40.024 1.00 34.82  ? 67   ARG B O     1 
ATOM   7113  C  CB    . ARG D  4 67  ? -29.142 -5.032  43.234 1.00 33.96  ? 67   ARG B CB    1 
ATOM   7114  C  CG    . ARG D  4 67  ? -28.155 -4.019  42.632 1.00 35.87  ? 67   ARG B CG    1 
ATOM   7115  C  CD    . ARG D  4 67  ? -26.866 -3.863  43.473 1.00 37.22  ? 67   ARG B CD    1 
ATOM   7116  N  NE    . ARG D  4 67  ? -27.092 -3.089  44.708 1.00 44.82  ? 67   ARG B NE    1 
ATOM   7117  C  CZ    . ARG D  4 67  ? -27.170 -3.619  45.933 1.00 46.22  ? 67   ARG B CZ    1 
ATOM   7118  N  NH1   . ARG D  4 67  ? -27.031 -4.936  46.108 1.00 46.72  ? 67   ARG B NH1   1 
ATOM   7119  N  NH2   . ARG D  4 67  ? -27.382 -2.833  46.985 1.00 45.17  ? 67   ARG B NH2   1 
ATOM   7120  N  N     . ASP D  4 68  ? -29.566 -7.110  40.963 1.00 33.98  ? 68   ASP B N     1 
ATOM   7121  C  CA    . ASP D  4 68  ? -29.093 -7.729  39.727 1.00 33.43  ? 68   ASP B CA    1 
ATOM   7122  C  C     . ASP D  4 68  ? -30.185 -7.923  38.669 1.00 32.45  ? 68   ASP B C     1 
ATOM   7123  O  O     . ASP D  4 68  ? -29.945 -7.683  37.499 1.00 31.52  ? 68   ASP B O     1 
ATOM   7124  C  CB    . ASP D  4 68  ? -28.343 -9.023  40.032 1.00 34.10  ? 68   ASP B CB    1 
ATOM   7125  C  CG    . ASP D  4 68  ? -26.905 -8.767  40.503 1.00 37.52  ? 68   ASP B CG    1 
ATOM   7126  O  OD1   . ASP D  4 68  ? -26.534 -7.588  40.763 1.00 39.76  ? 68   ASP B OD1   1 
ATOM   7127  O  OD2   . ASP D  4 68  ? -26.129 -9.748  40.611 1.00 40.92  ? 68   ASP B OD2   1 
ATOM   7128  N  N     . ALA D  4 69  ? -31.376 -8.363  39.083 1.00 32.06  ? 69   ALA B N     1 
ATOM   7129  C  CA    . ALA D  4 69  ? -32.497 -8.586  38.155 1.00 31.51  ? 69   ALA B CA    1 
ATOM   7130  C  C     . ALA D  4 69  ? -32.837 -7.279  37.443 1.00 31.49  ? 69   ALA B C     1 
ATOM   7131  O  O     . ALA D  4 69  ? -32.814 -7.188  36.213 1.00 30.85  ? 69   ALA B O     1 
ATOM   7132  C  CB    . ALA D  4 69  ? -33.704 -9.102  38.900 1.00 31.10  ? 69   ALA B CB    1 
ATOM   7133  N  N     . VAL D  4 70  ? -33.128 -6.261  38.248 1.00 31.39  ? 70   VAL B N     1 
ATOM   7134  C  CA    . VAL D  4 70  ? -33.314 -4.903  37.771 1.00 31.00  ? 70   VAL B CA    1 
ATOM   7135  C  C     . VAL D  4 70  ? -32.221 -4.491  36.794 1.00 31.11  ? 70   VAL B C     1 
ATOM   7136  O  O     . VAL D  4 70  ? -32.539 -4.047  35.703 1.00 31.83  ? 70   VAL B O     1 
ATOM   7137  C  CB    . VAL D  4 70  ? -33.446 -3.954  38.943 1.00 30.79  ? 70   VAL B CB    1 
ATOM   7138  C  CG1   . VAL D  4 70  ? -33.536 -2.516  38.493 1.00 31.29  ? 70   VAL B CG1   1 
ATOM   7139  C  CG2   . VAL D  4 70  ? -34.677 -4.334  39.716 1.00 30.68  ? 70   VAL B CG2   1 
ATOM   7140  N  N     . THR D  4 71  ? -30.949 -4.654  37.154 1.00 31.08  ? 71   THR B N     1 
ATOM   7141  C  CA    . THR D  4 71  ? -29.861 -4.409  36.208 1.00 31.18  ? 71   THR B CA    1 
ATOM   7142  C  C     . THR D  4 71  ? -30.101 -5.114  34.871 1.00 32.57  ? 71   THR B C     1 
ATOM   7143  O  O     . THR D  4 71  ? -29.924 -4.494  33.821 1.00 33.15  ? 71   THR B O     1 
ATOM   7144  C  CB    . THR D  4 71  ? -28.518 -4.869  36.767 1.00 30.95  ? 71   THR B CB    1 
ATOM   7145  O  OG1   . THR D  4 71  ? -28.205 -4.105  37.930 1.00 30.49  ? 71   THR B OG1   1 
ATOM   7146  C  CG2   . THR D  4 71  ? -27.405 -4.717  35.743 1.00 29.37  ? 71   THR B CG2   1 
ATOM   7147  N  N     . TYR D  4 72  ? -30.477 -6.400  34.906 1.00 33.72  ? 72   TYR B N     1 
ATOM   7148  C  CA    . TYR D  4 72  ? -30.841 -7.143  33.680 1.00 34.96  ? 72   TYR B CA    1 
ATOM   7149  C  C     . TYR D  4 72  ? -32.025 -6.472  32.953 1.00 35.83  ? 72   TYR B C     1 
ATOM   7150  O  O     . TYR D  4 72  ? -31.966 -6.293  31.734 1.00 36.01  ? 72   TYR B O     1 
ATOM   7151  C  CB    . TYR D  4 72  ? -31.156 -8.625  33.945 1.00 34.58  ? 72   TYR B CB    1 
ATOM   7152  C  CG    . TYR D  4 72  ? -29.953 -9.524  34.138 1.00 34.97  ? 72   TYR B CG    1 
ATOM   7153  C  CD1   . TYR D  4 72  ? -29.813 -10.305 35.283 1.00 34.97  ? 72   TYR B CD1   1 
ATOM   7154  C  CD2   . TYR D  4 72  ? -28.968 -9.615  33.166 1.00 35.73  ? 72   TYR B CD2   1 
ATOM   7155  C  CE1   . TYR D  4 72  ? -28.703 -11.140 35.459 1.00 34.38  ? 72   TYR B CE1   1 
ATOM   7156  C  CE2   . TYR D  4 72  ? -27.869 -10.437 33.333 1.00 36.18  ? 72   TYR B CE2   1 
ATOM   7157  C  CZ    . TYR D  4 72  ? -27.738 -11.194 34.480 1.00 35.43  ? 72   TYR B CZ    1 
ATOM   7158  O  OH    . TYR D  4 72  ? -26.619 -11.991 34.625 1.00 35.39  ? 72   TYR B OH    1 
ATOM   7159  N  N     . THR D  4 73  ? -33.069 -6.088  33.700 1.00 36.35  ? 73   THR B N     1 
ATOM   7160  C  CA    . THR D  4 73  ? -34.237 -5.416  33.131 1.00 37.04  ? 73   THR B CA    1 
ATOM   7161  C  C     . THR D  4 73  ? -33.845 -4.165  32.338 1.00 38.71  ? 73   THR B C     1 
ATOM   7162  O  O     . THR D  4 73  ? -34.118 -4.080  31.134 1.00 38.65  ? 73   THR B O     1 
ATOM   7163  C  CB    . THR D  4 73  ? -35.256 -5.021  34.198 1.00 36.55  ? 73   THR B CB    1 
ATOM   7164  O  OG1   . THR D  4 73  ? -35.557 -6.152  35.027 1.00 35.42  ? 73   THR B OG1   1 
ATOM   7165  C  CG2   . THR D  4 73  ? -36.537 -4.526  33.535 1.00 36.50  ? 73   THR B CG2   1 
ATOM   7166  N  N     . GLU D  4 74  ? -33.203 -3.211  33.015 1.00 40.36  ? 74   GLU B N     1 
ATOM   7167  C  CA    . GLU D  4 74  ? -32.709 -1.990  32.386 1.00 42.73  ? 74   GLU B CA    1 
ATOM   7168  C  C     . GLU D  4 74  ? -31.907 -2.260  31.126 1.00 42.59  ? 74   GLU B C     1 
ATOM   7169  O  O     . GLU D  4 74  ? -32.090 -1.581  30.111 1.00 43.12  ? 74   GLU B O     1 
ATOM   7170  C  CB    . GLU D  4 74  ? -31.860 -1.150  33.355 1.00 42.77  ? 74   GLU B CB    1 
ATOM   7171  C  CG    . GLU D  4 74  ? -32.696 -0.166  34.182 1.00 45.47  ? 74   GLU B CG    1 
ATOM   7172  C  CD    . GLU D  4 74  ? -31.858 0.773   35.052 1.00 46.36  ? 74   GLU B CD    1 
ATOM   7173  O  OE1   . GLU D  4 74  ? -32.142 2.001   35.018 1.00 51.99  ? 74   GLU B OE1   1 
ATOM   7174  O  OE2   . GLU D  4 74  ? -30.939 0.299   35.780 1.00 49.44  ? 74   GLU B OE2   1 
ATOM   7175  N  N     . HIS D  4 75  ? -31.023 -3.249  31.172 1.00 42.56  ? 75   HIS B N     1 
ATOM   7176  C  CA    . HIS D  4 75  ? -30.209 -3.523  30.003 1.00 42.26  ? 75   HIS B CA    1 
ATOM   7177  C  C     . HIS D  4 75  ? -31.069 -3.831  28.778 1.00 42.49  ? 75   HIS B C     1 
ATOM   7178  O  O     . HIS D  4 75  ? -30.741 -3.441  27.667 1.00 42.06  ? 75   HIS B O     1 
ATOM   7179  C  CB    . HIS D  4 75  ? -29.247 -4.667  30.260 1.00 41.88  ? 75   HIS B CB    1 
ATOM   7180  C  CG    . HIS D  4 75  ? -28.307 -4.890  29.131 1.00 40.98  ? 75   HIS B CG    1 
ATOM   7181  N  ND1   . HIS D  4 75  ? -27.126 -4.195  29.006 1.00 40.84  ? 75   HIS B ND1   1 
ATOM   7182  C  CD2   . HIS D  4 75  ? -28.399 -5.681  28.038 1.00 40.77  ? 75   HIS B CD2   1 
ATOM   7183  C  CE1   . HIS D  4 75  ? -26.515 -4.571  27.895 1.00 41.71  ? 75   HIS B CE1   1 
ATOM   7184  N  NE2   . HIS D  4 75  ? -27.267 -5.473  27.289 1.00 40.54  ? 75   HIS B NE2   1 
ATOM   7185  N  N     . ALA D  4 76  ? -32.171 -4.531  29.015 1.00 43.28  ? 76   ALA B N     1 
ATOM   7186  C  CA    . ALA D  4 76  ? -33.053 -5.025  27.975 1.00 44.29  ? 76   ALA B CA    1 
ATOM   7187  C  C     . ALA D  4 76  ? -34.014 -3.921  27.512 1.00 45.30  ? 76   ALA B C     1 
ATOM   7188  O  O     . ALA D  4 76  ? -34.736 -4.086  26.520 1.00 45.56  ? 76   ALA B O     1 
ATOM   7189  C  CB    . ALA D  4 76  ? -33.826 -6.238  28.497 1.00 43.70  ? 76   ALA B CB    1 
ATOM   7190  N  N     . LYS D  4 77  ? -34.008 -2.800  28.240 1.00 46.05  ? 77   LYS B N     1 
ATOM   7191  C  CA    . LYS D  4 77  ? -34.849 -1.633  27.950 1.00 46.79  ? 77   LYS B CA    1 
ATOM   7192  C  C     . LYS D  4 77  ? -36.331 -1.928  28.192 1.00 46.96  ? 77   LYS B C     1 
ATOM   7193  O  O     . LYS D  4 77  ? -37.182 -1.529  27.397 1.00 47.55  ? 77   LYS B O     1 
ATOM   7194  C  CB    . LYS D  4 77  ? -34.624 -1.131  26.518 1.00 47.30  ? 77   LYS B CB    1 
ATOM   7195  C  CG    . LYS D  4 77  ? -33.168 -0.766  26.182 1.00 48.75  ? 77   LYS B CG    1 
ATOM   7196  C  CD    . LYS D  4 77  ? -32.895 -0.952  24.677 1.00 50.79  ? 77   LYS B CD    1 
ATOM   7197  C  CE    . LYS D  4 77  ? -31.461 -0.532  24.306 1.00 51.16  ? 77   LYS B CE    1 
ATOM   7198  N  NZ    . LYS D  4 77  ? -31.337 -0.190  22.841 1.00 52.57  ? 77   LYS B NZ    1 
ATOM   7199  N  N     . ARG D  4 78  ? -36.634 -2.628  29.285 1.00 46.50  ? 78   ARG B N     1 
ATOM   7200  C  CA    . ARG D  4 78  ? -38.011 -2.939  29.655 1.00 46.01  ? 78   ARG B CA    1 
ATOM   7201  C  C     . ARG D  4 78  ? -38.357 -2.231  30.953 1.00 45.81  ? 78   ARG B C     1 
ATOM   7202  O  O     . ARG D  4 78  ? -37.469 -1.744  31.637 1.00 45.89  ? 78   ARG B O     1 
ATOM   7203  C  CB    . ARG D  4 78  ? -38.195 -4.451  29.816 1.00 45.96  ? 78   ARG B CB    1 
ATOM   7204  C  CG    . ARG D  4 78  ? -37.974 -5.259  28.544 1.00 46.45  ? 78   ARG B CG    1 
ATOM   7205  C  CD    . ARG D  4 78  ? -38.382 -6.745  28.707 1.00 46.10  ? 78   ARG B CD    1 
ATOM   7206  N  NE    . ARG D  4 78  ? -37.235 -7.626  28.971 1.00 46.37  ? 78   ARG B NE    1 
ATOM   7207  C  CZ    . ARG D  4 78  ? -36.679 -7.828  30.173 1.00 47.25  ? 78   ARG B CZ    1 
ATOM   7208  N  NH1   . ARG D  4 78  ? -37.145 -7.218  31.266 1.00 46.68  ? 78   ARG B NH1   1 
ATOM   7209  N  NH2   . ARG D  4 78  ? -35.648 -8.657  30.292 1.00 47.11  ? 78   ARG B NH2   1 
ATOM   7210  N  N     . LYS D  4 79  ? -39.642 -2.162  31.286 1.00 45.73  ? 79   LYS B N     1 
ATOM   7211  C  CA    . LYS D  4 79  ? -40.088 -1.625  32.577 1.00 46.02  ? 79   LYS B CA    1 
ATOM   7212  C  C     . LYS D  4 79  ? -40.688 -2.726  33.469 1.00 45.27  ? 79   LYS B C     1 
ATOM   7213  O  O     . LYS D  4 79  ? -41.160 -2.461  34.588 1.00 44.78  ? 79   LYS B O     1 
ATOM   7214  C  CB    . LYS D  4 79  ? -41.109 -0.504  32.361 1.00 46.82  ? 79   LYS B CB    1 
ATOM   7215  C  CG    . LYS D  4 79  ? -40.527 0.758   31.712 1.00 50.39  ? 79   LYS B CG    1 
ATOM   7216  C  CD    . LYS D  4 79  ? -41.641 1.661   31.187 1.00 55.97  ? 79   LYS B CD    1 
ATOM   7217  C  CE    . LYS D  4 79  ? -41.134 2.566   30.050 1.00 58.78  ? 79   LYS B CE    1 
ATOM   7218  N  NZ    . LYS D  4 79  ? -42.038 3.752   29.828 1.00 60.50  ? 79   LYS B NZ    1 
ATOM   7219  N  N     . THR D  4 80  ? -40.670 -3.959  32.957 1.00 44.40  ? 80   THR B N     1 
ATOM   7220  C  CA    . THR D  4 80  ? -41.142 -5.130  33.691 1.00 43.72  ? 80   THR B CA    1 
ATOM   7221  C  C     . THR D  4 80  ? -39.959 -6.053  33.955 1.00 42.58  ? 80   THR B C     1 
ATOM   7222  O  O     . THR D  4 80  ? -39.251 -6.454  33.028 1.00 42.35  ? 80   THR B O     1 
ATOM   7223  C  CB    . THR D  4 80  ? -42.202 -5.894  32.875 1.00 44.07  ? 80   THR B CB    1 
ATOM   7224  O  OG1   . THR D  4 80  ? -42.966 -4.963  32.098 1.00 46.22  ? 80   THR B OG1   1 
ATOM   7225  C  CG2   . THR D  4 80  ? -43.132 -6.690  33.770 1.00 43.88  ? 80   THR B CG2   1 
ATOM   7226  N  N     . VAL D  4 81  ? -39.727 -6.342  35.228 1.00 41.52  ? 81   VAL B N     1 
ATOM   7227  C  CA    . VAL D  4 81  ? -38.798 -7.393  35.650 1.00 40.74  ? 81   VAL B CA    1 
ATOM   7228  C  C     . VAL D  4 81  ? -39.402 -8.741  35.232 1.00 40.26  ? 81   VAL B C     1 
ATOM   7229  O  O     . VAL D  4 81  ? -40.521 -9.084  35.642 1.00 40.17  ? 81   VAL B O     1 
ATOM   7230  C  CB    . VAL D  4 81  ? -38.607 -7.367  37.192 1.00 40.72  ? 81   VAL B CB    1 
ATOM   7231  C  CG1   . VAL D  4 81  ? -37.719 -8.515  37.672 1.00 41.39  ? 81   VAL B CG1   1 
ATOM   7232  C  CG2   . VAL D  4 81  ? -38.036 -6.020  37.647 1.00 40.70  ? 81   VAL B CG2   1 
ATOM   7233  N  N     . THR D  4 82  ? -38.684 -9.500  34.413 1.00 39.27  ? 82   THR B N     1 
ATOM   7234  C  CA    . THR D  4 82  ? -39.184 -10.810 34.009 1.00 38.98  ? 82   THR B CA    1 
ATOM   7235  C  C     . THR D  4 82  ? -38.651 -11.971 34.863 1.00 38.63  ? 82   THR B C     1 
ATOM   7236  O  O     . THR D  4 82  ? -37.551 -11.919 35.407 1.00 38.47  ? 82   THR B O     1 
ATOM   7237  C  CB    . THR D  4 82  ? -38.873 -11.108 32.547 1.00 38.76  ? 82   THR B CB    1 
ATOM   7238  O  OG1   . THR D  4 82  ? -37.476 -11.363 32.405 1.00 38.99  ? 82   THR B OG1   1 
ATOM   7239  C  CG2   . THR D  4 82  ? -39.272 -9.938  31.665 1.00 39.44  ? 82   THR B CG2   1 
ATOM   7240  N  N     . ALA D  4 83  ? -39.451 -13.022 34.967 1.00 38.38  ? 83   ALA B N     1 
ATOM   7241  C  CA    . ALA D  4 83  ? -39.018 -14.275 35.572 1.00 38.00  ? 83   ALA B CA    1 
ATOM   7242  C  C     . ALA D  4 83  ? -37.586 -14.616 35.178 1.00 37.66  ? 83   ALA B C     1 
ATOM   7243  O  O     . ALA D  4 83  ? -36.812 -14.995 36.034 1.00 37.79  ? 83   ALA B O     1 
ATOM   7244  C  CB    . ALA D  4 83  ? -39.953 -15.404 35.177 1.00 37.88  ? 83   ALA B CB    1 
ATOM   7245  N  N     . MET D  4 84  ? -37.244 -14.468 33.895 1.00 37.56  ? 84   MET B N     1 
ATOM   7246  C  CA    . MET D  4 84  ? -35.889 -14.706 33.416 1.00 37.45  ? 84   MET B CA    1 
ATOM   7247  C  C     . MET D  4 84  ? -34.887 -13.785 34.095 1.00 37.42  ? 84   MET B C     1 
ATOM   7248  O  O     . MET D  4 84  ? -33.828 -14.256 34.516 1.00 37.64  ? 84   MET B O     1 
ATOM   7249  C  CB    . MET D  4 84  ? -35.767 -14.538 31.900 1.00 37.80  ? 84   MET B CB    1 
ATOM   7250  C  CG    . MET D  4 84  ? -36.140 -15.761 31.065 1.00 40.11  ? 84   MET B CG    1 
ATOM   7251  S  SD    . MET D  4 84  ? -35.825 -17.367 31.851 1.00 47.49  ? 84   MET B SD    1 
ATOM   7252  C  CE    . MET D  4 84  ? -34.059 -17.562 31.547 1.00 44.46  ? 84   MET B CE    1 
ATOM   7253  N  N     . ASP D  4 85  ? -35.209 -12.488 34.211 1.00 36.55  ? 85   ASP B N     1 
ATOM   7254  C  CA    . ASP D  4 85  ? -34.299 -11.553 34.874 1.00 36.05  ? 85   ASP B CA    1 
ATOM   7255  C  C     . ASP D  4 85  ? -33.930 -12.105 36.244 1.00 35.02  ? 85   ASP B C     1 
ATOM   7256  O  O     . ASP D  4 85  ? -32.753 -12.091 36.626 1.00 35.58  ? 85   ASP B O     1 
ATOM   7257  C  CB    . ASP D  4 85  ? -34.904 -10.152 35.054 1.00 36.52  ? 85   ASP B CB    1 
ATOM   7258  C  CG    . ASP D  4 85  ? -35.065 -9.390  33.753 1.00 39.24  ? 85   ASP B CG    1 
ATOM   7259  O  OD1   . ASP D  4 85  ? -34.223 -9.543  32.824 1.00 41.55  ? 85   ASP B OD1   1 
ATOM   7260  O  OD2   . ASP D  4 85  ? -36.051 -8.608  33.674 1.00 42.18  ? 85   ASP B OD2   1 
ATOM   7261  N  N     . VAL D  4 86  ? -34.936 -12.582 36.977 1.00 33.04  ? 86   VAL B N     1 
ATOM   7262  C  CA    . VAL D  4 86  ? -34.720 -13.094 38.312 1.00 32.09  ? 86   VAL B CA    1 
ATOM   7263  C  C     . VAL D  4 86  ? -33.937 -14.398 38.255 1.00 32.08  ? 86   VAL B C     1 
ATOM   7264  O  O     . VAL D  4 86  ? -32.964 -14.562 38.992 1.00 32.33  ? 86   VAL B O     1 
ATOM   7265  C  CB    . VAL D  4 86  ? -36.029 -13.296 39.061 1.00 31.94  ? 86   VAL B CB    1 
ATOM   7266  C  CG1   . VAL D  4 86  ? -35.796 -14.011 40.376 1.00 30.40  ? 86   VAL B CG1   1 
ATOM   7267  C  CG2   . VAL D  4 86  ? -36.700 -11.945 39.305 1.00 32.80  ? 86   VAL B CG2   1 
ATOM   7268  N  N     . VAL D  4 87  ? -34.338 -15.300 37.359 1.00 31.14  ? 87   VAL B N     1 
ATOM   7269  C  CA    . VAL D  4 87  ? -33.622 -16.545 37.161 1.00 30.53  ? 87   VAL B CA    1 
ATOM   7270  C  C     . VAL D  4 87  ? -32.142 -16.300 36.896 1.00 30.64  ? 87   VAL B C     1 
ATOM   7271  O  O     . VAL D  4 87  ? -31.301 -16.966 37.480 1.00 30.55  ? 87   VAL B O     1 
ATOM   7272  C  CB    . VAL D  4 87  ? -34.257 -17.418 36.054 1.00 30.20  ? 87   VAL B CB    1 
ATOM   7273  C  CG1   . VAL D  4 87  ? -33.364 -18.598 35.703 1.00 28.61  ? 87   VAL B CG1   1 
ATOM   7274  C  CG2   . VAL D  4 87  ? -35.610 -17.905 36.503 1.00 29.42  ? 87   VAL B CG2   1 
ATOM   7275  N  N     . TYR D  4 88  ? -31.818 -15.343 36.044 1.00 31.26  ? 88   TYR B N     1 
ATOM   7276  C  CA    . TYR D  4 88  ? -30.418 -15.051 35.776 1.00 32.30  ? 88   TYR B CA    1 
ATOM   7277  C  C     . TYR D  4 88  ? -29.713 -14.402 36.962 1.00 32.40  ? 88   TYR B C     1 
ATOM   7278  O  O     . TYR D  4 88  ? -28.518 -14.636 37.171 1.00 32.35  ? 88   TYR B O     1 
ATOM   7279  C  CB    . TYR D  4 88  ? -30.262 -14.127 34.603 1.00 33.30  ? 88   TYR B CB    1 
ATOM   7280  C  CG    . TYR D  4 88  ? -30.783 -14.643 33.301 1.00 34.96  ? 88   TYR B CG    1 
ATOM   7281  C  CD1   . TYR D  4 88  ? -31.678 -13.883 32.555 1.00 35.25  ? 88   TYR B CD1   1 
ATOM   7282  C  CD2   . TYR D  4 88  ? -30.366 -15.875 32.795 1.00 36.06  ? 88   TYR B CD2   1 
ATOM   7283  C  CE1   . TYR D  4 88  ? -32.152 -14.334 31.349 1.00 36.69  ? 88   TYR B CE1   1 
ATOM   7284  C  CE2   . TYR D  4 88  ? -30.830 -16.336 31.579 1.00 36.25  ? 88   TYR B CE2   1 
ATOM   7285  C  CZ    . TYR D  4 88  ? -31.723 -15.552 30.862 1.00 36.11  ? 88   TYR B CZ    1 
ATOM   7286  O  OH    . TYR D  4 88  ? -32.206 -15.985 29.655 1.00 36.75  ? 88   TYR B OH    1 
ATOM   7287  N  N     . ALA D  4 89  ? -30.435 -13.587 37.731 1.00 31.95  ? 89   ALA B N     1 
ATOM   7288  C  CA    . ALA D  4 89  ? -29.836 -12.961 38.912 1.00 31.90  ? 89   ALA B CA    1 
ATOM   7289  C  C     . ALA D  4 89  ? -29.429 -14.047 39.893 1.00 31.87  ? 89   ALA B C     1 
ATOM   7290  O  O     . ALA D  4 89  ? -28.285 -14.085 40.351 1.00 32.00  ? 89   ALA B O     1 
ATOM   7291  C  CB    . ALA D  4 89  ? -30.801 -11.983 39.560 1.00 31.67  ? 89   ALA B CB    1 
ATOM   7292  N  N     . LEU D  4 90  ? -30.375 -14.941 40.181 1.00 31.78  ? 90   LEU B N     1 
ATOM   7293  C  CA    . LEU D  4 90  ? -30.160 -16.078 41.063 1.00 31.97  ? 90   LEU B CA    1 
ATOM   7294  C  C     . LEU D  4 90  ? -28.984 -16.947 40.622 1.00 32.34  ? 90   LEU B C     1 
ATOM   7295  O  O     . LEU D  4 90  ? -28.170 -17.349 41.453 1.00 32.89  ? 90   LEU B O     1 
ATOM   7296  C  CB    . LEU D  4 90  ? -31.438 -16.921 41.180 1.00 31.58  ? 90   LEU B CB    1 
ATOM   7297  C  CG    . LEU D  4 90  ? -32.541 -16.264 42.015 1.00 31.02  ? 90   LEU B CG    1 
ATOM   7298  C  CD1   . LEU D  4 90  ? -33.926 -16.848 41.735 1.00 29.90  ? 90   LEU B CD1   1 
ATOM   7299  C  CD2   . LEU D  4 90  ? -32.201 -16.359 43.500 1.00 30.45  ? 90   LEU B CD2   1 
ATOM   7300  N  N     . LYS D  4 91  ? -28.884 -17.226 39.326 1.00 32.47  ? 91   LYS B N     1 
ATOM   7301  C  CA    . LYS D  4 91  ? -27.781 -18.018 38.831 1.00 33.09  ? 91   LYS B CA    1 
ATOM   7302  C  C     . LYS D  4 91  ? -26.427 -17.392 39.184 1.00 33.54  ? 91   LYS B C     1 
ATOM   7303  O  O     . LYS D  4 91  ? -25.526 -18.097 39.642 1.00 34.00  ? 91   LYS B O     1 
ATOM   7304  C  CB    . LYS D  4 91  ? -27.907 -18.272 37.330 1.00 33.35  ? 91   LYS B CB    1 
ATOM   7305  C  CG    . LYS D  4 91  ? -26.721 -19.060 36.753 1.00 34.82  ? 91   LYS B CG    1 
ATOM   7306  C  CD    . LYS D  4 91  ? -27.147 -20.107 35.726 1.00 37.46  ? 91   LYS B CD    1 
ATOM   7307  C  CE    . LYS D  4 91  ? -27.334 -19.511 34.340 1.00 41.99  ? 91   LYS B CE    1 
ATOM   7308  N  NZ    . LYS D  4 91  ? -28.008 -20.482 33.399 1.00 44.85  ? 91   LYS B NZ    1 
ATOM   7309  N  N     . ARG D  4 92  ? -26.281 -16.080 39.008 1.00 33.71  ? 92   ARG B N     1 
ATOM   7310  C  CA    . ARG D  4 92  ? -24.987 -15.455 39.276 1.00 34.25  ? 92   ARG B CA    1 
ATOM   7311  C  C     . ARG D  4 92  ? -24.728 -15.206 40.757 1.00 34.41  ? 92   ARG B C     1 
ATOM   7312  O  O     . ARG D  4 92  ? -23.589 -14.965 41.136 1.00 34.76  ? 92   ARG B O     1 
ATOM   7313  C  CB    . ARG D  4 92  ? -24.726 -14.194 38.427 1.00 33.96  ? 92   ARG B CB    1 
ATOM   7314  C  CG    . ARG D  4 92  ? -25.591 -12.975 38.759 1.00 34.23  ? 92   ARG B CG    1 
ATOM   7315  C  CD    . ARG D  4 92  ? -25.178 -11.752 37.906 1.00 34.53  ? 92   ARG B CD    1 
ATOM   7316  N  NE    . ARG D  4 92  ? -23.722 -11.572 37.910 1.00 33.68  ? 92   ARG B NE    1 
ATOM   7317  C  CZ    . ARG D  4 92  ? -23.032 -11.129 38.960 1.00 32.79  ? 92   ARG B CZ    1 
ATOM   7318  N  NH1   . ARG D  4 92  ? -23.668 -10.790 40.083 1.00 32.14  ? 92   ARG B NH1   1 
ATOM   7319  N  NH2   . ARG D  4 92  ? -21.710 -11.025 38.889 1.00 30.78  ? 92   ARG B NH2   1 
ATOM   7320  N  N     . GLN D  4 93  ? -25.757 -15.294 41.597 1.00 34.76  ? 93   GLN B N     1 
ATOM   7321  C  CA    . GLN D  4 93  ? -25.541 -15.222 43.048 1.00 35.24  ? 93   GLN B CA    1 
ATOM   7322  C  C     . GLN D  4 93  ? -25.161 -16.576 43.628 1.00 35.26  ? 93   GLN B C     1 
ATOM   7323  O  O     . GLN D  4 93  ? -25.086 -16.737 44.845 1.00 35.21  ? 93   GLN B O     1 
ATOM   7324  C  CB    . GLN D  4 93  ? -26.781 -14.681 43.781 1.00 35.82  ? 93   GLN B CB    1 
ATOM   7325  C  CG    . GLN D  4 93  ? -27.210 -13.254 43.400 1.00 36.79  ? 93   GLN B CG    1 
ATOM   7326  C  CD    . GLN D  4 93  ? -26.303 -12.179 43.962 1.00 39.16  ? 93   GLN B CD    1 
ATOM   7327  O  OE1   . GLN D  4 93  ? -25.488 -12.423 44.864 1.00 39.46  ? 93   GLN B OE1   1 
ATOM   7328  N  NE2   . GLN D  4 93  ? -26.436 -10.972 43.427 1.00 40.48  ? 93   GLN B NE2   1 
ATOM   7329  N  N     . GLY D  4 94  ? -24.917 -17.548 42.746 1.00 35.77  ? 94   GLY B N     1 
ATOM   7330  C  CA    . GLY D  4 94  ? -24.715 -18.946 43.120 1.00 34.84  ? 94   GLY B CA    1 
ATOM   7331  C  C     . GLY D  4 94  ? -25.935 -19.594 43.751 1.00 34.58  ? 94   GLY B C     1 
ATOM   7332  O  O     . GLY D  4 94  ? -25.800 -20.499 44.574 1.00 34.44  ? 94   GLY B O     1 
ATOM   7333  N  N     . ARG D  4 95  ? -27.128 -19.118 43.397 1.00 34.27  ? 95   ARG B N     1 
ATOM   7334  C  CA    . ARG D  4 95  ? -28.360 -19.675 43.959 1.00 33.86  ? 95   ARG B CA    1 
ATOM   7335  C  C     . ARG D  4 95  ? -29.338 -20.055 42.839 1.00 33.10  ? 95   ARG B C     1 
ATOM   7336  O  O     . ARG D  4 95  ? -30.492 -19.666 42.864 1.00 33.58  ? 95   ARG B O     1 
ATOM   7337  C  CB    . ARG D  4 95  ? -29.028 -18.699 44.950 1.00 34.23  ? 95   ARG B CB    1 
ATOM   7338  C  CG    . ARG D  4 95  ? -28.120 -18.023 46.006 1.00 35.64  ? 95   ARG B CG    1 
ATOM   7339  C  CD    . ARG D  4 95  ? -28.273 -18.594 47.428 1.00 38.46  ? 95   ARG B CD    1 
ATOM   7340  N  NE    . ARG D  4 95  ? -29.517 -19.355 47.588 1.00 40.99  ? 95   ARG B NE    1 
ATOM   7341  C  CZ    . ARG D  4 95  ? -29.658 -20.420 48.381 1.00 41.21  ? 95   ARG B CZ    1 
ATOM   7342  N  NH1   . ARG D  4 95  ? -28.636 -20.853 49.125 1.00 41.69  ? 95   ARG B NH1   1 
ATOM   7343  N  NH2   . ARG D  4 95  ? -30.831 -21.044 48.441 1.00 38.33  ? 95   ARG B NH2   1 
ATOM   7344  N  N     . THR D  4 96  ? -28.855 -20.808 41.860 1.00 32.62  ? 96   THR B N     1 
ATOM   7345  C  CA    . THR D  4 96  ? -29.647 -21.349 40.736 1.00 32.08  ? 96   THR B CA    1 
ATOM   7346  C  C     . THR D  4 96  ? -31.031 -21.894 41.075 1.00 32.31  ? 96   THR B C     1 
ATOM   7347  O  O     . THR D  4 96  ? -31.162 -22.718 41.980 1.00 32.10  ? 96   THR B O     1 
ATOM   7348  C  CB    . THR D  4 96  ? -28.872 -22.490 40.101 1.00 31.74  ? 96   THR B CB    1 
ATOM   7349  O  OG1   . THR D  4 96  ? -27.596 -21.990 39.705 1.00 31.01  ? 96   THR B OG1   1 
ATOM   7350  C  CG2   . THR D  4 96  ? -29.606 -23.063 38.913 1.00 30.26  ? 96   THR B CG2   1 
ATOM   7351  N  N     . LEU D  4 97  ? -32.051 -21.445 40.335 1.00 32.90  ? 97   LEU B N     1 
ATOM   7352  C  CA    . LEU D  4 97  ? -33.434 -21.892 40.548 1.00 33.70  ? 97   LEU B CA    1 
ATOM   7353  C  C     . LEU D  4 97  ? -33.966 -22.624 39.323 1.00 34.18  ? 97   LEU B C     1 
ATOM   7354  O  O     . LEU D  4 97  ? -33.802 -22.154 38.217 1.00 34.75  ? 97   LEU B O     1 
ATOM   7355  C  CB    . LEU D  4 97  ? -34.344 -20.713 40.916 1.00 33.68  ? 97   LEU B CB    1 
ATOM   7356  C  CG    . LEU D  4 97  ? -35.870 -20.884 41.073 1.00 33.70  ? 97   LEU B CG    1 
ATOM   7357  C  CD1   . LEU D  4 97  ? -36.278 -21.732 42.273 1.00 34.38  ? 97   LEU B CD1   1 
ATOM   7358  C  CD2   . LEU D  4 97  ? -36.511 -19.526 41.189 1.00 33.92  ? 97   LEU B CD2   1 
ATOM   7359  N  N     . TYR D  4 98  ? -34.584 -23.784 39.537 1.00 34.87  ? 98   TYR B N     1 
ATOM   7360  C  CA    . TYR D  4 98  ? -35.197 -24.579 38.470 1.00 35.06  ? 98   TYR B CA    1 
ATOM   7361  C  C     . TYR D  4 98  ? -36.693 -24.434 38.539 1.00 35.72  ? 98   TYR B C     1 
ATOM   7362  O  O     . TYR D  4 98  ? -37.277 -24.518 39.614 1.00 35.56  ? 98   TYR B O     1 
ATOM   7363  C  CB    . TYR D  4 98  ? -34.914 -26.064 38.684 1.00 34.93  ? 98   TYR B CB    1 
ATOM   7364  C  CG    . TYR D  4 98  ? -33.572 -26.566 38.245 1.00 33.79  ? 98   TYR B CG    1 
ATOM   7365  C  CD1   . TYR D  4 98  ? -32.573 -25.694 37.809 1.00 34.44  ? 98   TYR B CD1   1 
ATOM   7366  C  CD2   . TYR D  4 98  ? -33.290 -27.910 38.309 1.00 32.50  ? 98   TYR B CD2   1 
ATOM   7367  C  CE1   . TYR D  4 98  ? -31.335 -26.169 37.414 1.00 35.19  ? 98   TYR B CE1   1 
ATOM   7368  C  CE2   . TYR D  4 98  ? -32.064 -28.401 37.925 1.00 33.80  ? 98   TYR B CE2   1 
ATOM   7369  C  CZ    . TYR D  4 98  ? -31.092 -27.532 37.480 1.00 35.23  ? 98   TYR B CZ    1 
ATOM   7370  O  OH    . TYR D  4 98  ? -29.878 -28.036 37.107 1.00 34.60  ? 98   TYR B OH    1 
ATOM   7371  N  N     . GLY D  4 99  ? -37.324 -24.248 37.390 1.00 36.84  ? 99   GLY B N     1 
ATOM   7372  C  CA    . GLY D  4 99  ? -38.778 -24.191 37.342 1.00 37.77  ? 99   GLY B CA    1 
ATOM   7373  C  C     . GLY D  4 99  ? -39.383 -22.981 36.684 1.00 38.73  ? 99   GLY B C     1 
ATOM   7374  O  O     . GLY D  4 99  ? -40.586 -22.951 36.475 1.00 39.37  ? 99   GLY B O     1 
ATOM   7375  N  N     . PHE D  4 100 ? -38.573 -21.989 36.330 1.00 39.68  ? 100  PHE B N     1 
ATOM   7376  C  CA    . PHE D  4 100 ? -39.132 -20.733 35.834 1.00 40.57  ? 100  PHE B CA    1 
ATOM   7377  C  C     . PHE D  4 100 ? -38.589 -20.249 34.488 1.00 42.08  ? 100  PHE B C     1 
ATOM   7378  O  O     . PHE D  4 100 ? -38.752 -19.080 34.136 1.00 42.52  ? 100  PHE B O     1 
ATOM   7379  C  CB    . PHE D  4 100 ? -39.002 -19.640 36.893 1.00 39.85  ? 100  PHE B CB    1 
ATOM   7380  C  CG    . PHE D  4 100 ? -39.817 -19.895 38.128 1.00 38.73  ? 100  PHE B CG    1 
ATOM   7381  C  CD1   . PHE D  4 100 ? -39.295 -20.626 39.181 1.00 37.45  ? 100  PHE B CD1   1 
ATOM   7382  C  CD2   . PHE D  4 100 ? -41.103 -19.390 38.241 1.00 37.96  ? 100  PHE B CD2   1 
ATOM   7383  C  CE1   . PHE D  4 100 ? -40.040 -20.861 40.318 1.00 38.04  ? 100  PHE B CE1   1 
ATOM   7384  C  CE2   . PHE D  4 100 ? -41.861 -19.608 39.388 1.00 37.76  ? 100  PHE B CE2   1 
ATOM   7385  C  CZ    . PHE D  4 100 ? -41.332 -20.349 40.427 1.00 38.23  ? 100  PHE B CZ    1 
ATOM   7386  N  N     . GLY D  4 101 ? -37.974 -21.139 33.722 1.00 43.36  ? 101  GLY B N     1 
ATOM   7387  C  CA    . GLY D  4 101 ? -37.511 -20.779 32.394 1.00 45.50  ? 101  GLY B CA    1 
ATOM   7388  C  C     . GLY D  4 101 ? -36.009 -20.897 32.324 1.00 47.46  ? 101  GLY B C     1 
ATOM   7389  O  O     . GLY D  4 101 ? -35.352 -21.144 33.343 1.00 47.84  ? 101  GLY B O     1 
ATOM   7390  N  N     . GLY D  4 102 ? -35.454 -20.722 31.122 1.00 48.87  ? 102  GLY B N     1 
ATOM   7391  C  CA    . GLY D  4 102 ? -34.018 -20.945 30.900 1.00 49.94  ? 102  GLY B CA    1 
ATOM   7392  C  C     . GLY D  4 102 ? -33.614 -22.389 31.174 1.00 50.35  ? 102  GLY B C     1 
ATOM   7393  O  O     . GLY D  4 102 ? -32.498 -22.644 31.648 1.00 50.66  ? 102  GLY B O     1 
ATOM   7394  O  OXT   . GLY D  4 102 ? -34.394 -23.326 30.927 1.00 50.32  ? 102  GLY B OXT   1 
ATOM   7395  N  N     . ALA E  5 14  ? -0.125  8.240   12.937 1.00 63.34  ? 14   ALA C N     1 
ATOM   7396  C  CA    . ALA E  5 14  ? -0.635  6.960   13.517 1.00 63.48  ? 14   ALA C CA    1 
ATOM   7397  C  C     . ALA E  5 14  ? -0.585  6.920   15.057 1.00 63.29  ? 14   ALA C C     1 
ATOM   7398  O  O     . ALA E  5 14  ? 0.473   6.651   15.654 1.00 63.56  ? 14   ALA C O     1 
ATOM   7399  C  CB    . ALA E  5 14  ? 0.122   5.766   12.929 1.00 63.43  ? 14   ALA C CB    1 
ATOM   7400  N  N     . LYS E  5 15  ? -1.729  7.169   15.693 1.00 62.32  ? 15   LYS C N     1 
ATOM   7401  C  CA    . LYS E  5 15  ? -1.815  7.086   17.152 1.00 61.71  ? 15   LYS C CA    1 
ATOM   7402  C  C     . LYS E  5 15  ? -2.466  5.773   17.584 1.00 60.21  ? 15   LYS C C     1 
ATOM   7403  O  O     . LYS E  5 15  ? -3.438  5.329   16.962 1.00 60.22  ? 15   LYS C O     1 
ATOM   7404  C  CB    . LYS E  5 15  ? -2.558  8.304   17.723 1.00 62.04  ? 15   LYS C CB    1 
ATOM   7405  C  CG    . LYS E  5 15  ? -1.822  9.625   17.434 1.00 62.91  ? 15   LYS C CG    1 
ATOM   7406  C  CD    . LYS E  5 15  ? -2.496  10.849  18.054 1.00 63.19  ? 15   LYS C CD    1 
ATOM   7407  C  CE    . LYS E  5 15  ? -1.820  12.155  17.556 1.00 64.26  ? 15   LYS C CE    1 
ATOM   7408  N  NZ    . LYS E  5 15  ? -2.349  13.399  18.213 1.00 64.49  ? 15   LYS C NZ    1 
ATOM   7409  N  N     . THR E  5 16  ? -1.922  5.147   18.632 1.00 58.24  ? 16   THR C N     1 
ATOM   7410  C  CA    . THR E  5 16  ? -2.523  3.934   19.177 1.00 56.11  ? 16   THR C CA    1 
ATOM   7411  C  C     . THR E  5 16  ? -3.933  4.255   19.631 1.00 55.09  ? 16   THR C C     1 
ATOM   7412  O  O     . THR E  5 16  ? -4.251  5.403   19.961 1.00 54.69  ? 16   THR C O     1 
ATOM   7413  C  CB    . THR E  5 16  ? -1.760  3.333   20.382 1.00 56.10  ? 16   THR C CB    1 
ATOM   7414  O  OG1   . THR E  5 16  ? -1.910  4.175   21.534 1.00 56.10  ? 16   THR C OG1   1 
ATOM   7415  C  CG2   . THR E  5 16  ? -0.288  3.099   20.070 1.00 55.30  ? 16   THR C CG2   1 
ATOM   7416  N  N     . ARG E  5 17  ? -4.782  3.235   19.639 1.00 53.76  ? 17   ARG C N     1 
ATOM   7417  C  CA    . ARG E  5 17  ? -6.147  3.399   20.100 1.00 52.63  ? 17   ARG C CA    1 
ATOM   7418  C  C     . ARG E  5 17  ? -6.172  3.698   21.587 1.00 51.90  ? 17   ARG C C     1 
ATOM   7419  O  O     . ARG E  5 17  ? -7.105  4.326   22.088 1.00 51.51  ? 17   ARG C O     1 
ATOM   7420  C  CB    . ARG E  5 17  ? -6.940  2.146   19.802 1.00 52.81  ? 17   ARG C CB    1 
ATOM   7421  C  CG    . ARG E  5 17  ? -6.995  1.818   18.349 1.00 51.80  ? 17   ARG C CG    1 
ATOM   7422  C  CD    . ARG E  5 17  ? -8.306  1.179   18.059 1.00 50.15  ? 17   ARG C CD    1 
ATOM   7423  N  NE    . ARG E  5 17  ? -8.182  -0.267  17.984 1.00 48.02  ? 17   ARG C NE    1 
ATOM   7424  C  CZ    . ARG E  5 17  ? -9.147  -1.111  18.321 1.00 45.84  ? 17   ARG C CZ    1 
ATOM   7425  N  NH1   . ARG E  5 17  ? -10.314 -0.657  18.784 1.00 44.46  ? 17   ARG C NH1   1 
ATOM   7426  N  NH2   . ARG E  5 17  ? -8.922  -2.409  18.210 1.00 44.20  ? 17   ARG C NH2   1 
ATOM   7427  N  N     . SER E  5 18  ? -5.128  3.246   22.278 1.00 51.42  ? 18   SER C N     1 
ATOM   7428  C  CA    . SER E  5 18  ? -4.919  3.552   23.687 1.00 51.08  ? 18   SER C CA    1 
ATOM   7429  C  C     . SER E  5 18  ? -4.830  5.062   23.895 1.00 51.06  ? 18   SER C C     1 
ATOM   7430  O  O     . SER E  5 18  ? -5.617  5.615   24.666 1.00 51.47  ? 18   SER C O     1 
ATOM   7431  C  CB    . SER E  5 18  ? -3.668  2.848   24.220 1.00 51.02  ? 18   SER C CB    1 
ATOM   7432  O  OG    . SER E  5 18  ? -3.728  1.459   23.981 1.00 50.56  ? 18   SER C OG    1 
ATOM   7433  N  N     . SER E  5 19  ? -3.908  5.733   23.198 1.00 50.52  ? 19   SER C N     1 
ATOM   7434  C  CA    . SER E  5 19  ? -3.831  7.192   23.302 1.00 50.50  ? 19   SER C CA    1 
ATOM   7435  C  C     . SER E  5 19  ? -5.078  7.925   22.791 1.00 50.00  ? 19   SER C C     1 
ATOM   7436  O  O     . SER E  5 19  ? -5.464  8.938   23.367 1.00 49.97  ? 19   SER C O     1 
ATOM   7437  C  CB    . SER E  5 19  ? -2.536  7.774   22.713 1.00 50.38  ? 19   SER C CB    1 
ATOM   7438  O  OG    . SER E  5 19  ? -2.275  7.273   21.423 1.00 51.81  ? 19   SER C OG    1 
ATOM   7439  N  N     . ARG E  5 20  ? -5.726  7.412   21.751 1.00 49.56  ? 20   ARG C N     1 
ATOM   7440  C  CA    . ARG E  5 20  ? -6.975  8.017   21.301 1.00 49.77  ? 20   ARG C CA    1 
ATOM   7441  C  C     . ARG E  5 20  ? -7.952  8.096   22.454 1.00 48.94  ? 20   ARG C C     1 
ATOM   7442  O  O     . ARG E  5 20  ? -8.728  9.055   22.549 1.00 49.00  ? 20   ARG C O     1 
ATOM   7443  C  CB    . ARG E  5 20  ? -7.618  7.236   20.158 1.00 49.74  ? 20   ARG C CB    1 
ATOM   7444  C  CG    . ARG E  5 20  ? -6.879  7.263   18.825 1.00 51.31  ? 20   ARG C CG    1 
ATOM   7445  C  CD    . ARG E  5 20  ? -7.790  6.717   17.715 1.00 52.12  ? 20   ARG C CD    1 
ATOM   7446  N  NE    . ARG E  5 20  ? -7.067  6.207   16.540 1.00 57.89  ? 20   ARG C NE    1 
ATOM   7447  C  CZ    . ARG E  5 20  ? -6.684  6.958   15.498 1.00 60.81  ? 20   ARG C CZ    1 
ATOM   7448  N  NH1   . ARG E  5 20  ? -6.924  8.276   15.475 1.00 61.19  ? 20   ARG C NH1   1 
ATOM   7449  N  NH2   . ARG E  5 20  ? -6.056  6.393   14.468 1.00 61.50  ? 20   ARG C NH2   1 
ATOM   7450  N  N     . ALA E  5 21  ? -7.915  7.081   23.326 1.00 48.39  ? 21   ALA C N     1 
ATOM   7451  C  CA    . ALA E  5 21  ? -8.751  7.049   24.542 1.00 47.46  ? 21   ALA C CA    1 
ATOM   7452  C  C     . ALA E  5 21  ? -7.981  7.521   25.775 1.00 46.71  ? 21   ALA C C     1 
ATOM   7453  O  O     . ALA E  5 21  ? -8.549  7.701   26.852 1.00 46.71  ? 21   ALA C O     1 
ATOM   7454  C  CB    . ALA E  5 21  ? -9.296  5.673   24.768 1.00 47.67  ? 21   ALA C CB    1 
ATOM   7455  N  N     . GLY E  5 22  ? -6.683  7.732   25.610 1.00 45.77  ? 22   GLY C N     1 
ATOM   7456  C  CA    . GLY E  5 22  ? -5.874  8.302   26.673 1.00 44.97  ? 22   GLY C CA    1 
ATOM   7457  C  C     . GLY E  5 22  ? -5.762  7.330   27.822 1.00 44.09  ? 22   GLY C C     1 
ATOM   7458  O  O     . GLY E  5 22  ? -6.141  7.648   28.957 1.00 43.45  ? 22   GLY C O     1 
ATOM   7459  N  N     . LEU E  5 23  ? -5.238  6.147   27.488 1.00 43.37  ? 23   LEU C N     1 
ATOM   7460  C  CA    . LEU E  5 23  ? -5.102  5.020   28.394 1.00 42.29  ? 23   LEU C CA    1 
ATOM   7461  C  C     . LEU E  5 23  ? -3.720  4.412   28.252 1.00 42.28  ? 23   LEU C C     1 
ATOM   7462  O  O     . LEU E  5 23  ? -3.092  4.499   27.197 1.00 41.90  ? 23   LEU C O     1 
ATOM   7463  C  CB    . LEU E  5 23  ? -6.162  3.961   28.095 1.00 41.87  ? 23   LEU C CB    1 
ATOM   7464  C  CG    . LEU E  5 23  ? -7.643  4.338   28.217 1.00 40.86  ? 23   LEU C CG    1 
ATOM   7465  C  CD1   . LEU E  5 23  ? -8.522  3.182   27.791 1.00 40.62  ? 23   LEU C CD1   1 
ATOM   7466  C  CD2   . LEU E  5 23  ? -8.007  4.768   29.619 1.00 38.54  ? 23   LEU C CD2   1 
ATOM   7467  N  N     . GLN E  5 24  ? -3.251  3.813   29.338 1.00 42.64  ? 24   GLN C N     1 
ATOM   7468  C  CA    . GLN E  5 24  ? -1.980  3.110   29.370 1.00 42.93  ? 24   GLN C CA    1 
ATOM   7469  C  C     . GLN E  5 24  ? -2.242  1.661   28.996 1.00 43.05  ? 24   GLN C C     1 
ATOM   7470  O  O     . GLN E  5 24  ? -1.431  1.029   28.310 1.00 43.26  ? 24   GLN C O     1 
ATOM   7471  C  CB    . GLN E  5 24  ? -1.374  3.163   30.771 1.00 42.98  ? 24   GLN C CB    1 
ATOM   7472  C  CG    . GLN E  5 24  ? -1.446  4.516   31.438 1.00 43.58  ? 24   GLN C CG    1 
ATOM   7473  C  CD    . GLN E  5 24  ? -0.573  5.542   30.740 1.00 45.93  ? 24   GLN C CD    1 
ATOM   7474  O  OE1   . GLN E  5 24  ? 0.566   5.254   30.354 1.00 46.42  ? 24   GLN C OE1   1 
ATOM   7475  N  NE2   . GLN E  5 24  ? -1.105  6.749   30.573 1.00 45.70  ? 24   GLN C NE2   1 
ATOM   7476  N  N     . PHE E  5 25  ? -3.383  1.140   29.443 1.00 42.73  ? 25   PHE C N     1 
ATOM   7477  C  CA    . PHE E  5 25  ? -3.764  -0.245  29.135 1.00 42.97  ? 25   PHE C CA    1 
ATOM   7478  C  C     . PHE E  5 25  ? -4.039  -0.477  27.648 1.00 43.35  ? 25   PHE C C     1 
ATOM   7479  O  O     . PHE E  5 25  ? -4.717  0.331   27.017 1.00 43.98  ? 25   PHE C O     1 
ATOM   7480  C  CB    . PHE E  5 25  ? -4.912  -0.724  30.037 1.00 42.20  ? 25   PHE C CB    1 
ATOM   7481  C  CG    . PHE E  5 25  ? -4.436  -1.438  31.264 1.00 40.84  ? 25   PHE C CG    1 
ATOM   7482  C  CD1   . PHE E  5 25  ? -3.518  -0.848  32.112 1.00 39.39  ? 25   PHE C CD1   1 
ATOM   7483  C  CD2   . PHE E  5 25  ? -4.876  -2.720  31.556 1.00 41.46  ? 25   PHE C CD2   1 
ATOM   7484  C  CE1   . PHE E  5 25  ? -3.049  -1.519  33.241 1.00 40.10  ? 25   PHE C CE1   1 
ATOM   7485  C  CE2   . PHE E  5 25  ? -4.427  -3.398  32.703 1.00 39.54  ? 25   PHE C CE2   1 
ATOM   7486  C  CZ    . PHE E  5 25  ? -3.514  -2.794  33.538 1.00 40.14  ? 25   PHE C CZ    1 
ATOM   7487  N  N     . PRO E  5 26  ? -3.489  -1.572  27.086 1.00 43.57  ? 26   PRO C N     1 
ATOM   7488  C  CA    . PRO E  5 26  ? -3.449  -1.802  25.631 1.00 43.79  ? 26   PRO C CA    1 
ATOM   7489  C  C     . PRO E  5 26  ? -4.783  -2.155  24.995 1.00 43.86  ? 26   PRO C C     1 
ATOM   7490  O  O     . PRO E  5 26  ? -5.167  -3.325  24.990 1.00 44.31  ? 26   PRO C O     1 
ATOM   7491  C  CB    . PRO E  5 26  ? -2.459  -2.963  25.483 1.00 43.79  ? 26   PRO C CB    1 
ATOM   7492  C  CG    . PRO E  5 26  ? -2.512  -3.669  26.780 1.00 44.03  ? 26   PRO C CG    1 
ATOM   7493  C  CD    . PRO E  5 26  ? -2.845  -2.665  27.835 1.00 43.46  ? 26   PRO C CD    1 
ATOM   7494  N  N     . VAL E  5 27  ? -5.469  -1.149  24.458 1.00 43.93  ? 27   VAL C N     1 
ATOM   7495  C  CA    . VAL E  5 27  ? -6.749  -1.343  23.773 1.00 43.84  ? 27   VAL C CA    1 
ATOM   7496  C  C     . VAL E  5 27  ? -6.633  -2.413  22.696 1.00 44.54  ? 27   VAL C C     1 
ATOM   7497  O  O     . VAL E  5 27  ? -7.387  -3.391  22.707 1.00 45.49  ? 27   VAL C O     1 
ATOM   7498  C  CB    . VAL E  5 27  ? -7.268  -0.043  23.145 1.00 43.38  ? 27   VAL C CB    1 
ATOM   7499  C  CG1   . VAL E  5 27  ? -8.440  -0.320  22.260 1.00 43.10  ? 27   VAL C CG1   1 
ATOM   7500  C  CG2   . VAL E  5 27  ? -7.660  0.931   24.220 1.00 42.46  ? 27   VAL C CG2   1 
ATOM   7501  N  N     . GLY E  5 28  ? -5.678  -2.250  21.782 1.00 44.70  ? 28   GLY C N     1 
ATOM   7502  C  CA    . GLY E  5 28  ? -5.459  -3.238  20.730 1.00 44.49  ? 28   GLY C CA    1 
ATOM   7503  C  C     . GLY E  5 28  ? -5.463  -4.650  21.287 1.00 44.45  ? 28   GLY C C     1 
ATOM   7504  O  O     . GLY E  5 28  ? -6.196  -5.512  20.817 1.00 44.72  ? 28   GLY C O     1 
ATOM   7505  N  N     . ARG E  5 29  ? -4.648  -4.868  22.309 1.00 44.33  ? 29   ARG C N     1 
ATOM   7506  C  CA    . ARG E  5 29  ? -4.487  -6.172  22.935 1.00 43.96  ? 29   ARG C CA    1 
ATOM   7507  C  C     . ARG E  5 29  ? -5.822  -6.717  23.446 1.00 44.04  ? 29   ARG C C     1 
ATOM   7508  O  O     . ARG E  5 29  ? -6.139  -7.882  23.235 1.00 43.93  ? 29   ARG C O     1 
ATOM   7509  C  CB    . ARG E  5 29  ? -3.501  -6.054  24.096 1.00 43.71  ? 29   ARG C CB    1 
ATOM   7510  C  CG    . ARG E  5 29  ? -3.345  -7.303  24.914 1.00 42.88  ? 29   ARG C CG    1 
ATOM   7511  C  CD    . ARG E  5 29  ? -1.945  -7.809  24.813 1.00 43.40  ? 29   ARG C CD    1 
ATOM   7512  N  NE    . ARG E  5 29  ? -1.233  -7.640  26.070 1.00 43.47  ? 29   ARG C NE    1 
ATOM   7513  C  CZ    . ARG E  5 29  ? 0.092   -7.677  26.204 1.00 45.65  ? 29   ARG C CZ    1 
ATOM   7514  N  NH1   . ARG E  5 29  ? 0.894   -7.840  25.151 1.00 45.54  ? 29   ARG C NH1   1 
ATOM   7515  N  NH2   . ARG E  5 29  ? 0.623   -7.537  27.409 1.00 46.24  ? 29   ARG C NH2   1 
ATOM   7516  N  N     . VAL E  5 30  ? -6.587  -5.868  24.128 1.00 44.04  ? 30   VAL C N     1 
ATOM   7517  C  CA    . VAL E  5 30  ? -7.835  -6.270  24.771 1.00 44.06  ? 30   VAL C CA    1 
ATOM   7518  C  C     . VAL E  5 30  ? -8.874  -6.606  23.698 1.00 44.69  ? 30   VAL C C     1 
ATOM   7519  O  O     . VAL E  5 30  ? -9.706  -7.511  23.877 1.00 44.45  ? 30   VAL C O     1 
ATOM   7520  C  CB    . VAL E  5 30  ? -8.380  -5.155  25.697 1.00 43.75  ? 30   VAL C CB    1 
ATOM   7521  C  CG1   . VAL E  5 30  ? -9.803  -5.450  26.143 1.00 43.45  ? 30   VAL C CG1   1 
ATOM   7522  C  CG2   . VAL E  5 30  ? -7.494  -4.980  26.885 1.00 43.26  ? 30   VAL C CG2   1 
ATOM   7523  N  N     . HIS E  5 31  ? -8.822  -5.868  22.588 1.00 45.01  ? 31   HIS C N     1 
ATOM   7524  C  CA    . HIS E  5 31  ? -9.715  -6.126  21.472 1.00 45.41  ? 31   HIS C CA    1 
ATOM   7525  C  C     . HIS E  5 31  ? -9.453  -7.510  20.938 1.00 45.42  ? 31   HIS C C     1 
ATOM   7526  O  O     . HIS E  5 31  ? -10.383 -8.233  20.585 1.00 45.22  ? 31   HIS C O     1 
ATOM   7527  C  CB    . HIS E  5 31  ? -9.491  -5.132  20.347 1.00 45.69  ? 31   HIS C CB    1 
ATOM   7528  C  CG    . HIS E  5 31  ? -10.691 -4.935  19.476 1.00 46.82  ? 31   HIS C CG    1 
ATOM   7529  N  ND1   . HIS E  5 31  ? -11.700 -5.869  19.378 1.00 49.59  ? 31   HIS C ND1   1 
ATOM   7530  C  CD2   . HIS E  5 31  ? -11.038 -3.920  18.655 1.00 46.65  ? 31   HIS C CD2   1 
ATOM   7531  C  CE1   . HIS E  5 31  ? -12.628 -5.425  18.550 1.00 49.70  ? 31   HIS C CE1   1 
ATOM   7532  N  NE2   . HIS E  5 31  ? -12.245 -4.248  18.091 1.00 49.06  ? 31   HIS C NE2   1 
ATOM   7533  N  N     . ARG E  5 32  ? -8.174  -7.864  20.886 1.00 45.40  ? 32   ARG C N     1 
ATOM   7534  C  CA    . ARG E  5 32  ? -7.736  -9.108  20.291 1.00 45.76  ? 32   ARG C CA    1 
ATOM   7535  C  C     . ARG E  5 32  ? -8.223  -10.284 21.118 1.00 45.97  ? 32   ARG C C     1 
ATOM   7536  O  O     . ARG E  5 32  ? -8.808  -11.226 20.579 1.00 46.59  ? 32   ARG C O     1 
ATOM   7537  C  CB    . ARG E  5 32  ? -6.221  -9.136  20.221 1.00 45.69  ? 32   ARG C CB    1 
ATOM   7538  C  CG    . ARG E  5 32  ? -5.698  -9.969  19.111 1.00 46.06  ? 32   ARG C CG    1 
ATOM   7539  C  CD    . ARG E  5 32  ? -4.206  -9.954  19.118 1.00 46.33  ? 32   ARG C CD    1 
ATOM   7540  N  NE    . ARG E  5 32  ? -3.706  -10.889 20.110 1.00 47.13  ? 32   ARG C NE    1 
ATOM   7541  C  CZ    . ARG E  5 32  ? -2.861  -10.574 21.082 1.00 48.19  ? 32   ARG C CZ    1 
ATOM   7542  N  NH1   . ARG E  5 32  ? -2.385  -9.338  21.205 1.00 48.08  ? 32   ARG C NH1   1 
ATOM   7543  N  NH2   . ARG E  5 32  ? -2.475  -11.516 21.924 1.00 48.87  ? 32   ARG C NH2   1 
ATOM   7544  N  N     . LEU E  5 33  ? -7.982  -10.199 22.427 1.00 45.53  ? 33   LEU C N     1 
ATOM   7545  C  CA    . LEU E  5 33  ? -8.362  -11.208 23.389 1.00 44.96  ? 33   LEU C CA    1 
ATOM   7546  C  C     . LEU E  5 33  ? -9.883  -11.382 23.527 1.00 45.37  ? 33   LEU C C     1 
ATOM   7547  O  O     . LEU E  5 33  ? -10.330 -12.405 24.034 1.00 45.82  ? 33   LEU C O     1 
ATOM   7548  C  CB    . LEU E  5 33  ? -7.740  -10.889 24.755 1.00 44.55  ? 33   LEU C CB    1 
ATOM   7549  C  CG    . LEU E  5 33  ? -6.220  -10.700 24.847 1.00 43.54  ? 33   LEU C CG    1 
ATOM   7550  C  CD1   . LEU E  5 33  ? -5.867  -10.028 26.145 1.00 43.38  ? 33   LEU C CD1   1 
ATOM   7551  C  CD2   . LEU E  5 33  ? -5.436  -11.985 24.716 1.00 40.93  ? 33   LEU C CD2   1 
ATOM   7552  N  N     . LEU E  5 34  ? -10.678 -10.405 23.094 1.00 45.35  ? 34   LEU C N     1 
ATOM   7553  C  CA    . LEU E  5 34  ? -12.129 -10.571 23.138 1.00 45.94  ? 34   LEU C CA    1 
ATOM   7554  C  C     . LEU E  5 34  ? -12.610 -11.449 21.987 1.00 46.85  ? 34   LEU C C     1 
ATOM   7555  O  O     . LEU E  5 34  ? -13.626 -12.155 22.082 1.00 46.84  ? 34   LEU C O     1 
ATOM   7556  C  CB    . LEU E  5 34  ? -12.851 -9.225  23.124 1.00 45.44  ? 34   LEU C CB    1 
ATOM   7557  C  CG    . LEU E  5 34  ? -13.031 -8.486  24.457 1.00 44.99  ? 34   LEU C CG    1 
ATOM   7558  C  CD1   . LEU E  5 34  ? -13.738 -7.147  24.254 1.00 42.98  ? 34   LEU C CD1   1 
ATOM   7559  C  CD2   . LEU E  5 34  ? -13.788 -9.326  25.486 1.00 44.46  ? 34   LEU C CD2   1 
ATOM   7560  N  N     . ARG E  5 35  ? -11.861 -11.387 20.895 1.00 47.97  ? 35   ARG C N     1 
ATOM   7561  C  CA    . ARG E  5 35  ? -12.138 -12.164 19.709 1.00 48.79  ? 35   ARG C CA    1 
ATOM   7562  C  C     . ARG E  5 35  ? -11.686 -13.594 19.968 1.00 49.38  ? 35   ARG C C     1 
ATOM   7563  O  O     . ARG E  5 35  ? -12.478 -14.529 19.829 1.00 49.78  ? 35   ARG C O     1 
ATOM   7564  C  CB    . ARG E  5 35  ? -11.388 -11.586 18.512 1.00 49.00  ? 35   ARG C CB    1 
ATOM   7565  C  CG    . ARG E  5 35  ? -11.693 -10.134 18.205 1.00 49.74  ? 35   ARG C CG    1 
ATOM   7566  C  CD    . ARG E  5 35  ? -11.200 -9.786  16.805 1.00 51.98  ? 35   ARG C CD    1 
ATOM   7567  N  NE    . ARG E  5 35  ? -11.361 -8.370  16.461 1.00 54.39  ? 35   ARG C NE    1 
ATOM   7568  C  CZ    . ARG E  5 35  ? -12.527 -7.754  16.250 1.00 55.51  ? 35   ARG C CZ    1 
ATOM   7569  N  NH1   . ARG E  5 35  ? -13.689 -8.401  16.374 1.00 55.22  ? 35   ARG C NH1   1 
ATOM   7570  N  NH2   . ARG E  5 35  ? -12.531 -6.465  15.926 1.00 55.95  ? 35   ARG C NH2   1 
ATOM   7571  N  N     . LYS E  5 36  ? -10.431 -13.754 20.384 1.00 49.52  ? 36   LYS C N     1 
ATOM   7572  C  CA    . LYS E  5 36  ? -9.833  -15.073 20.506 1.00 50.38  ? 36   LYS C CA    1 
ATOM   7573  C  C     . LYS E  5 36  ? -10.485 -15.864 21.651 1.00 49.91  ? 36   LYS C C     1 
ATOM   7574  O  O     . LYS E  5 36  ? -10.381 -17.095 21.721 1.00 49.98  ? 36   LYS C O     1 
ATOM   7575  C  CB    . LYS E  5 36  ? -8.307  -14.957 20.670 1.00 50.15  ? 36   LYS C CB    1 
ATOM   7576  C  CG    . LYS E  5 36  ? -7.736  -15.416 22.026 1.00 51.72  ? 36   LYS C CG    1 
ATOM   7577  C  CD    . LYS E  5 36  ? -6.310  -14.885 22.293 1.00 52.68  ? 36   LYS C CD    1 
ATOM   7578  C  CE    . LYS E  5 36  ? -5.277  -15.329 21.226 1.00 56.89  ? 36   LYS C CE    1 
ATOM   7579  N  NZ    . LYS E  5 36  ? -3.887  -15.422 21.799 1.00 58.24  ? 36   LYS C NZ    1 
ATOM   7580  N  N     . GLY E  5 37  ? -11.180 -15.146 22.523 1.00 49.51  ? 37   GLY C N     1 
ATOM   7581  C  CA    . GLY E  5 37  ? -11.755 -15.729 23.724 1.00 48.90  ? 37   GLY C CA    1 
ATOM   7582  C  C     . GLY E  5 37  ? -13.122 -16.350 23.527 1.00 48.56  ? 37   GLY C C     1 
ATOM   7583  O  O     . GLY E  5 37  ? -13.616 -17.037 24.428 1.00 48.97  ? 37   GLY C O     1 
ATOM   7584  N  N     . ASN E  5 38  ? -13.725 -16.118 22.358 1.00 47.93  ? 38   ASN C N     1 
ATOM   7585  C  CA    . ASN E  5 38  ? -15.033 -16.692 21.997 1.00 47.40  ? 38   ASN C CA    1 
ATOM   7586  C  C     . ASN E  5 38  ? -16.138 -16.210 22.873 1.00 46.25  ? 38   ASN C C     1 
ATOM   7587  O  O     . ASN E  5 38  ? -16.839 -17.022 23.469 1.00 46.28  ? 38   ASN C O     1 
ATOM   7588  C  CB    . ASN E  5 38  ? -15.027 -18.224 22.087 1.00 48.26  ? 38   ASN C CB    1 
ATOM   7589  C  CG    . ASN E  5 38  ? -14.322 -18.873 20.920 1.00 50.41  ? 38   ASN C CG    1 
ATOM   7590  O  OD1   . ASN E  5 38  ? -13.288 -19.529 21.097 1.00 51.66  ? 38   ASN C OD1   1 
ATOM   7591  N  ND2   . ASN E  5 38  ? -14.874 -18.691 19.707 1.00 52.31  ? 38   ASN C ND2   1 
ATOM   7592  N  N     . TYR E  5 39  ? -16.315 -14.899 22.961 1.00 45.02  ? 39   TYR C N     1 
ATOM   7593  C  CA    . TYR E  5 39  ? -17.341 -14.382 23.853 1.00 43.70  ? 39   TYR C CA    1 
ATOM   7594  C  C     . TYR E  5 39  ? -18.651 -14.046 23.161 1.00 44.15  ? 39   TYR C C     1 
ATOM   7595  O  O     . TYR E  5 39  ? -19.704 -14.175 23.774 1.00 44.16  ? 39   TYR C O     1 
ATOM   7596  C  CB    . TYR E  5 39  ? -16.821 -13.202 24.656 1.00 42.17  ? 39   TYR C CB    1 
ATOM   7597  C  CG    . TYR E  5 39  ? -15.678 -13.542 25.586 1.00 39.67  ? 39   TYR C CG    1 
ATOM   7598  C  CD1   . TYR E  5 39  ? -14.382 -13.156 25.279 1.00 37.76  ? 39   TYR C CD1   1 
ATOM   7599  C  CD2   . TYR E  5 39  ? -15.893 -14.221 26.775 1.00 36.93  ? 39   TYR C CD2   1 
ATOM   7600  C  CE1   . TYR E  5 39  ? -13.333 -13.445 26.118 1.00 37.18  ? 39   TYR C CE1   1 
ATOM   7601  C  CE2   . TYR E  5 39  ? -14.839 -14.515 27.627 1.00 36.40  ? 39   TYR C CE2   1 
ATOM   7602  C  CZ    . TYR E  5 39  ? -13.567 -14.120 27.284 1.00 37.36  ? 39   TYR C CZ    1 
ATOM   7603  O  OH    . TYR E  5 39  ? -12.509 -14.384 28.095 1.00 38.40  ? 39   TYR C OH    1 
ATOM   7604  N  N     . ALA E  5 40  ? -18.575 -13.621 21.897 1.00 44.78  ? 40   ALA C N     1 
ATOM   7605  C  CA    . ALA E  5 40  ? -19.748 -13.386 21.037 1.00 45.58  ? 40   ALA C CA    1 
ATOM   7606  C  C     . ALA E  5 40  ? -19.318 -13.323 19.570 1.00 46.51  ? 40   ALA C C     1 
ATOM   7607  O  O     . ALA E  5 40  ? -18.116 -13.326 19.278 1.00 46.22  ? 40   ALA C O     1 
ATOM   7608  C  CB    . ALA E  5 40  ? -20.479 -12.118 21.434 1.00 45.38  ? 40   ALA C CB    1 
ATOM   7609  N  N     . GLU E  5 41  ? -20.280 -13.287 18.641 1.00 47.71  ? 41   GLU C N     1 
ATOM   7610  C  CA    . GLU E  5 41  ? -19.908 -13.327 17.226 1.00 49.13  ? 41   GLU C CA    1 
ATOM   7611  C  C     . GLU E  5 41  ? -19.154 -12.059 16.852 1.00 48.89  ? 41   GLU C C     1 
ATOM   7612  O  O     . GLU E  5 41  ? -18.133 -12.124 16.180 1.00 49.19  ? 41   GLU C O     1 
ATOM   7613  C  CB    . GLU E  5 41  ? -21.106 -13.561 16.282 1.00 49.65  ? 41   GLU C CB    1 
ATOM   7614  C  CG    . GLU E  5 41  ? -21.787 -14.964 16.346 1.00 54.53  ? 41   GLU C CG    1 
ATOM   7615  C  CD    . GLU E  5 41  ? -20.817 -16.189 16.267 1.00 59.78  ? 41   GLU C CD    1 
ATOM   7616  O  OE1   . GLU E  5 41  ? -19.908 -16.212 15.390 1.00 61.55  ? 41   GLU C OE1   1 
ATOM   7617  O  OE2   . GLU E  5 41  ? -20.990 -17.142 17.077 1.00 59.61  ? 41   GLU C OE2   1 
ATOM   7618  N  N     . ARG E  5 42  ? -19.651 -10.912 17.310 1.00 48.95  ? 42   ARG C N     1 
ATOM   7619  C  CA    . ARG E  5 42  ? -19.042 -9.615  17.001 1.00 48.56  ? 42   ARG C CA    1 
ATOM   7620  C  C     . ARG E  5 42  ? -18.586 -8.885  18.266 1.00 47.94  ? 42   ARG C C     1 
ATOM   7621  O  O     . ARG E  5 42  ? -19.277 -8.903  19.282 1.00 47.73  ? 42   ARG C O     1 
ATOM   7622  C  CB    . ARG E  5 42  ? -20.033 -8.731  16.233 1.00 48.80  ? 42   ARG C CB    1 
ATOM   7623  C  CG    . ARG E  5 42  ? -20.683 -9.399  15.051 1.00 50.08  ? 42   ARG C CG    1 
ATOM   7624  C  CD    . ARG E  5 42  ? -21.433 -8.411  14.183 1.00 53.26  ? 42   ARG C CD    1 
ATOM   7625  N  NE    . ARG E  5 42  ? -21.232 -8.733  12.768 1.00 55.92  ? 42   ARG C NE    1 
ATOM   7626  C  CZ    . ARG E  5 42  ? -21.695 -8.012  11.748 1.00 57.36  ? 42   ARG C CZ    1 
ATOM   7627  N  NH1   . ARG E  5 42  ? -22.406 -6.910  11.965 1.00 58.38  ? 42   ARG C NH1   1 
ATOM   7628  N  NH2   . ARG E  5 42  ? -21.441 -8.394  10.503 1.00 57.84  ? 42   ARG C NH2   1 
ATOM   7629  N  N     . VAL E  5 43  ? -17.425 -8.241  18.194 1.00 47.45  ? 43   VAL C N     1 
ATOM   7630  C  CA    . VAL E  5 43  ? -16.982 -7.336  19.254 1.00 47.01  ? 43   VAL C CA    1 
ATOM   7631  C  C     . VAL E  5 43  ? -17.026 -5.913  18.711 1.00 47.00  ? 43   VAL C C     1 
ATOM   7632  O  O     . VAL E  5 43  ? -16.377 -5.619  17.706 1.00 47.55  ? 43   VAL C O     1 
ATOM   7633  C  CB    . VAL E  5 43  ? -15.541 -7.643  19.729 1.00 46.82  ? 43   VAL C CB    1 
ATOM   7634  C  CG1   . VAL E  5 43  ? -15.144 -6.730  20.860 1.00 45.64  ? 43   VAL C CG1   1 
ATOM   7635  C  CG2   . VAL E  5 43  ? -15.419 -9.087  20.163 1.00 46.79  ? 43   VAL C CG2   1 
ATOM   7636  N  N     . GLY E  5 44  ? -17.793 -5.044  19.366 1.00 46.46  ? 44   GLY C N     1 
ATOM   7637  C  CA    . GLY E  5 44  ? -17.835 -3.627  19.024 1.00 45.87  ? 44   GLY C CA    1 
ATOM   7638  C  C     . GLY E  5 44  ? -16.542 -2.908  19.365 1.00 45.98  ? 44   GLY C C     1 
ATOM   7639  O  O     . GLY E  5 44  ? -15.871 -3.259  20.327 1.00 46.08  ? 44   GLY C O     1 
ATOM   7640  N  N     . ALA E  5 45  ? -16.202 -1.890  18.574 1.00 46.05  ? 45   ALA C N     1 
ATOM   7641  C  CA    . ALA E  5 45  ? -14.930 -1.168  18.703 1.00 45.56  ? 45   ALA C CA    1 
ATOM   7642  C  C     . ALA E  5 45  ? -14.818 -0.357  19.996 1.00 45.29  ? 45   ALA C C     1 
ATOM   7643  O  O     . ALA E  5 45  ? -13.711 0.065   20.375 1.00 45.42  ? 45   ALA C O     1 
ATOM   7644  C  CB    . ALA E  5 45  ? -14.714 -0.264  17.501 1.00 45.55  ? 45   ALA C CB    1 
ATOM   7645  N  N     . GLY E  5 46  ? -15.960 -0.141  20.654 1.00 44.42  ? 46   GLY C N     1 
ATOM   7646  C  CA    . GLY E  5 46  ? -16.009 0.601   21.907 1.00 43.63  ? 46   GLY C CA    1 
ATOM   7647  C  C     . GLY E  5 46  ? -15.912 -0.294  23.132 1.00 43.37  ? 46   GLY C C     1 
ATOM   7648  O  O     . GLY E  5 46  ? -15.706 0.195   24.240 1.00 43.62  ? 46   GLY C O     1 
ATOM   7649  N  N     . ALA E  5 47  ? -16.057 -1.607  22.940 1.00 42.38  ? 47   ALA C N     1 
ATOM   7650  C  CA    . ALA E  5 47  ? -15.974 -2.560  24.043 1.00 40.93  ? 47   ALA C CA    1 
ATOM   7651  C  C     . ALA E  5 47  ? -14.572 -2.721  24.645 1.00 39.94  ? 47   ALA C C     1 
ATOM   7652  O  O     . ALA E  5 47  ? -14.434 -2.709  25.863 1.00 39.93  ? 47   ALA C O     1 
ATOM   7653  C  CB    . ALA E  5 47  ? -16.532 -3.900  23.630 1.00 41.53  ? 47   ALA C CB    1 
ATOM   7654  N  N     . PRO E  5 48  ? -13.530 -2.880  23.814 1.00 38.72  ? 48   PRO C N     1 
ATOM   7655  C  CA    . PRO E  5 48  ? -12.202 -2.967  24.418 1.00 38.15  ? 48   PRO C CA    1 
ATOM   7656  C  C     . PRO E  5 48  ? -11.720 -1.658  25.028 1.00 38.06  ? 48   PRO C C     1 
ATOM   7657  O  O     . PRO E  5 48  ? -10.807 -1.659  25.865 1.00 37.77  ? 48   PRO C O     1 
ATOM   7658  C  CB    . PRO E  5 48  ? -11.297 -3.352  23.251 1.00 38.11  ? 48   PRO C CB    1 
ATOM   7659  C  CG    . PRO E  5 48  ? -12.028 -2.995  22.042 1.00 38.57  ? 48   PRO C CG    1 
ATOM   7660  C  CD    . PRO E  5 48  ? -13.487 -3.034  22.354 1.00 38.78  ? 48   PRO C CD    1 
ATOM   7661  N  N     . VAL E  5 49  ? -12.325 -0.548  24.611 1.00 37.71  ? 49   VAL C N     1 
ATOM   7662  C  CA    . VAL E  5 49  ? -11.934 0.749   25.117 1.00 36.67  ? 49   VAL C CA    1 
ATOM   7663  C  C     . VAL E  5 49  ? -12.459 0.841   26.535 1.00 36.26  ? 49   VAL C C     1 
ATOM   7664  O  O     . VAL E  5 49  ? -11.691 1.117   27.463 1.00 36.60  ? 49   VAL C O     1 
ATOM   7665  C  CB    . VAL E  5 49  ? -12.449 1.890   24.212 1.00 37.35  ? 49   VAL C CB    1 
ATOM   7666  C  CG1   . VAL E  5 49  ? -12.166 3.260   24.827 1.00 36.85  ? 49   VAL C CG1   1 
ATOM   7667  C  CG2   . VAL E  5 49  ? -11.821 1.784   22.809 1.00 36.61  ? 49   VAL C CG2   1 
ATOM   7668  N  N     . TYR E  5 50  ? -13.749 0.567   26.714 1.00 34.99  ? 50   TYR C N     1 
ATOM   7669  C  CA    . TYR E  5 50  ? -14.357 0.546   28.048 1.00 34.39  ? 50   TYR C CA    1 
ATOM   7670  C  C     . TYR E  5 50  ? -13.695 -0.484  28.969 1.00 34.48  ? 50   TYR C C     1 
ATOM   7671  O  O     . TYR E  5 50  ? -13.427 -0.210  30.137 1.00 34.93  ? 50   TYR C O     1 
ATOM   7672  C  CB    . TYR E  5 50  ? -15.831 0.227   27.926 1.00 33.71  ? 50   TYR C CB    1 
ATOM   7673  C  CG    . TYR E  5 50  ? -16.710 0.664   29.063 1.00 32.56  ? 50   TYR C CG    1 
ATOM   7674  C  CD1   . TYR E  5 50  ? -17.761 1.561   28.840 1.00 34.37  ? 50   TYR C CD1   1 
ATOM   7675  C  CD2   . TYR E  5 50  ? -16.548 0.163   30.331 1.00 30.63  ? 50   TYR C CD2   1 
ATOM   7676  C  CE1   . TYR E  5 50  ? -18.624 1.959   29.868 1.00 32.43  ? 50   TYR C CE1   1 
ATOM   7677  C  CE2   . TYR E  5 50  ? -17.393 0.553   31.369 1.00 31.94  ? 50   TYR C CE2   1 
ATOM   7678  C  CZ    . TYR E  5 50  ? -18.430 1.444   31.131 1.00 33.50  ? 50   TYR C CZ    1 
ATOM   7679  O  OH    . TYR E  5 50  ? -19.267 1.830   32.162 1.00 34.61  ? 50   TYR C OH    1 
ATOM   7680  N  N     . LEU E  5 51  ? -13.430 -1.670  28.435 1.00 34.30  ? 51   LEU C N     1 
ATOM   7681  C  CA    . LEU E  5 51  ? -12.763 -2.712  29.205 1.00 33.70  ? 51   LEU C CA    1 
ATOM   7682  C  C     . LEU E  5 51  ? -11.341 -2.341  29.612 1.00 33.20  ? 51   LEU C C     1 
ATOM   7683  O  O     . LEU E  5 51  ? -10.973 -2.533  30.767 1.00 33.55  ? 51   LEU C O     1 
ATOM   7684  C  CB    . LEU E  5 51  ? -12.781 -4.054  28.468 1.00 33.36  ? 51   LEU C CB    1 
ATOM   7685  C  CG    . LEU E  5 51  ? -12.388 -5.303  29.256 1.00 33.18  ? 51   LEU C CG    1 
ATOM   7686  C  CD1   . LEU E  5 51  ? -13.159 -5.430  30.566 1.00 31.74  ? 51   LEU C CD1   1 
ATOM   7687  C  CD2   . LEU E  5 51  ? -12.593 -6.530  28.381 1.00 33.41  ? 51   LEU C CD2   1 
ATOM   7688  N  N     . ALA E  5 52  ? -10.541 -1.816  28.689 1.00 32.93  ? 52   ALA C N     1 
ATOM   7689  C  CA    . ALA E  5 52  ? -9.158  -1.419  29.037 1.00 32.36  ? 52   ALA C CA    1 
ATOM   7690  C  C     . ALA E  5 52  ? -9.148  -0.353  30.124 1.00 32.32  ? 52   ALA C C     1 
ATOM   7691  O  O     . ALA E  5 52  ? -8.231  -0.295  30.948 1.00 32.35  ? 52   ALA C O     1 
ATOM   7692  C  CB    . ALA E  5 52  ? -8.412  -0.934  27.831 1.00 32.30  ? 52   ALA C CB    1 
ATOM   7693  N  N     . ALA E  5 53  ? -10.188 0.473   30.134 1.00 32.30  ? 53   ALA C N     1 
ATOM   7694  C  CA    . ALA E  5 53  ? -10.339 1.493   31.151 1.00 32.59  ? 53   ALA C CA    1 
ATOM   7695  C  C     . ALA E  5 53  ? -10.647 0.871   32.492 1.00 32.65  ? 53   ALA C C     1 
ATOM   7696  O  O     . ALA E  5 53  ? -9.927  1.117   33.456 1.00 33.61  ? 53   ALA C O     1 
ATOM   7697  C  CB    . ALA E  5 53  ? -11.433 2.506   30.761 1.00 32.93  ? 53   ALA C CB    1 
ATOM   7698  N  N     . VAL E  5 54  ? -11.721 0.083   32.568 1.00 32.43  ? 54   VAL C N     1 
ATOM   7699  C  CA    . VAL E  5 54  ? -12.077 -0.585  33.819 1.00 31.93  ? 54   VAL C CA    1 
ATOM   7700  C  C     . VAL E  5 54  ? -10.856 -1.316  34.380 1.00 31.97  ? 54   VAL C C     1 
ATOM   7701  O  O     . VAL E  5 54  ? -10.552 -1.194  35.571 1.00 31.75  ? 54   VAL C O     1 
ATOM   7702  C  CB    . VAL E  5 54  ? -13.255 -1.559  33.644 1.00 31.94  ? 54   VAL C CB    1 
ATOM   7703  C  CG1   . VAL E  5 54  ? -13.480 -2.347  34.905 1.00 30.60  ? 54   VAL C CG1   1 
ATOM   7704  C  CG2   . VAL E  5 54  ? -14.535 -0.786  33.278 1.00 32.12  ? 54   VAL C CG2   1 
ATOM   7705  N  N     . LEU E  5 55  ? -10.146 -2.040  33.519 1.00 31.73  ? 55   LEU C N     1 
ATOM   7706  C  CA    . LEU E  5 55  ? -8.981  -2.783  33.949 1.00 32.74  ? 55   LEU C CA    1 
ATOM   7707  C  C     . LEU E  5 55  ? -7.931  -1.882  34.565 1.00 33.29  ? 55   LEU C C     1 
ATOM   7708  O  O     . LEU E  5 55  ? -7.321  -2.244  35.564 1.00 33.29  ? 55   LEU C O     1 
ATOM   7709  C  CB    . LEU E  5 55  ? -8.384  -3.598  32.801 1.00 32.99  ? 55   LEU C CB    1 
ATOM   7710  C  CG    . LEU E  5 55  ? -9.226  -4.773  32.268 1.00 34.35  ? 55   LEU C CG    1 
ATOM   7711  C  CD1   . LEU E  5 55  ? -8.435  -5.471  31.201 1.00 37.10  ? 55   LEU C CD1   1 
ATOM   7712  C  CD2   . LEU E  5 55  ? -9.638  -5.772  33.336 1.00 33.44  ? 55   LEU C CD2   1 
ATOM   7713  N  N     . GLU E  5 56  ? -7.748  -0.693  33.988 1.00 33.96  ? 56   GLU C N     1 
ATOM   7714  C  CA    . GLU E  5 56  ? -6.769  0.285   34.475 1.00 33.92  ? 56   GLU C CA    1 
ATOM   7715  C  C     . GLU E  5 56  ? -7.247  0.951   35.751 1.00 33.29  ? 56   GLU C C     1 
ATOM   7716  O  O     . GLU E  5 56  ? -6.461  1.202   36.663 1.00 33.61  ? 56   GLU C O     1 
ATOM   7717  C  CB    . GLU E  5 56  ? -6.535  1.341   33.413 1.00 34.52  ? 56   GLU C CB    1 
ATOM   7718  C  CG    . GLU E  5 56  ? -5.274  2.141   33.555 1.00 36.81  ? 56   GLU C CG    1 
ATOM   7719  C  CD    . GLU E  5 56  ? -5.126  3.138   32.401 1.00 40.83  ? 56   GLU C CD    1 
ATOM   7720  O  OE1   . GLU E  5 56  ? -4.871  2.703   31.252 1.00 43.08  ? 56   GLU C OE1   1 
ATOM   7721  O  OE2   . GLU E  5 56  ? -5.274  4.356   32.630 1.00 42.25  ? 56   GLU C OE2   1 
ATOM   7722  N  N     . TYR E  5 57  ? -8.528  1.261   35.826 1.00 32.78  ? 57   TYR C N     1 
ATOM   7723  C  CA    . TYR E  5 57  ? -9.035  1.860   37.041 1.00 32.86  ? 57   TYR C CA    1 
ATOM   7724  C  C     . TYR E  5 57  ? -8.735  0.900   38.181 1.00 32.90  ? 57   TYR C C     1 
ATOM   7725  O  O     . TYR E  5 57  ? -8.074  1.265   39.144 1.00 33.16  ? 57   TYR C O     1 
ATOM   7726  C  CB    . TYR E  5 57  ? -10.528 2.118   36.925 1.00 33.55  ? 57   TYR C CB    1 
ATOM   7727  C  CG    . TYR E  5 57  ? -11.196 2.341   38.254 1.00 34.84  ? 57   TYR C CG    1 
ATOM   7728  C  CD1   . TYR E  5 57  ? -10.899 3.470   39.032 1.00 36.41  ? 57   TYR C CD1   1 
ATOM   7729  C  CD2   . TYR E  5 57  ? -12.115 1.422   38.750 1.00 35.28  ? 57   TYR C CD2   1 
ATOM   7730  C  CE1   . TYR E  5 57  ? -11.515 3.668   40.279 1.00 37.20  ? 57   TYR C CE1   1 
ATOM   7731  C  CE2   . TYR E  5 57  ? -12.740 1.613   39.983 1.00 35.55  ? 57   TYR C CE2   1 
ATOM   7732  C  CZ    . TYR E  5 57  ? -12.438 2.732   40.744 1.00 36.89  ? 57   TYR C CZ    1 
ATOM   7733  O  OH    . TYR E  5 57  ? -13.063 2.919   41.974 1.00 37.66  ? 57   TYR C OH    1 
ATOM   7734  N  N     . LEU E  5 58  ? -9.184  -0.350  38.027 1.00 32.45  ? 58   LEU C N     1 
ATOM   7735  C  CA    . LEU E  5 58  ? -9.011  -1.379  39.027 1.00 31.12  ? 58   LEU C CA    1 
ATOM   7736  C  C     . LEU E  5 58  ? -7.581  -1.582  39.453 1.00 30.91  ? 58   LEU C C     1 
ATOM   7737  O  O     . LEU E  5 58  ? -7.315  -1.679  40.658 1.00 31.86  ? 58   LEU C O     1 
ATOM   7738  C  CB    . LEU E  5 58  ? -9.624  -2.690  38.561 1.00 30.88  ? 58   LEU C CB    1 
ATOM   7739  C  CG    . LEU E  5 58  ? -11.140 -2.692  38.774 1.00 29.94  ? 58   LEU C CG    1 
ATOM   7740  C  CD1   . LEU E  5 58  ? -11.774 -3.957  38.221 1.00 26.41  ? 58   LEU C CD1   1 
ATOM   7741  C  CD2   . LEU E  5 58  ? -11.506 -2.461  40.264 1.00 26.12  ? 58   LEU C CD2   1 
ATOM   7742  N  N     . THR E  5 59  ? -6.644  -1.625  38.514 1.00 29.79  ? 59   THR C N     1 
ATOM   7743  C  CA    . THR E  5 59  ? -5.265  -1.860  38.945 1.00 28.85  ? 59   THR C CA    1 
ATOM   7744  C  C     . THR E  5 59  ? -4.639  -0.618  39.621 1.00 29.00  ? 59   THR C C     1 
ATOM   7745  O  O     . THR E  5 59  ? -3.762  -0.725  40.496 1.00 29.39  ? 59   THR C O     1 
ATOM   7746  C  CB    . THR E  5 59  ? -4.350  -2.496  37.849 1.00 28.37  ? 59   THR C CB    1 
ATOM   7747  O  OG1   . THR E  5 59  ? -3.261  -1.634  37.537 1.00 27.18  ? 59   THR C OG1   1 
ATOM   7748  C  CG2   . THR E  5 59  ? -5.106  -2.862  36.617 1.00 26.11  ? 59   THR C CG2   1 
ATOM   7749  N  N     . ALA E  5 60  ? -5.106  0.563   39.253 1.00 28.36  ? 60   ALA C N     1 
ATOM   7750  C  CA    . ALA E  5 60  ? -4.668  1.770   39.966 1.00 28.20  ? 60   ALA C CA    1 
ATOM   7751  C  C     . ALA E  5 60  ? -5.199  1.779   41.406 1.00 28.04  ? 60   ALA C C     1 
ATOM   7752  O  O     . ALA E  5 60  ? -4.470  2.103   42.351 1.00 27.90  ? 60   ALA C O     1 
ATOM   7753  C  CB    . ALA E  5 60  ? -5.098  3.018   39.217 1.00 27.86  ? 60   ALA C CB    1 
ATOM   7754  N  N     . GLU E  5 61  ? -6.462  1.408   41.573 1.00 27.99  ? 61   GLU C N     1 
ATOM   7755  C  CA    . GLU E  5 61  ? -7.053  1.287   42.900 1.00 28.57  ? 61   GLU C CA    1 
ATOM   7756  C  C     . GLU E  5 61  ? -6.234  0.395   43.817 1.00 28.52  ? 61   GLU C C     1 
ATOM   7757  O  O     . GLU E  5 61  ? -5.921  0.785   44.934 1.00 28.50  ? 61   GLU C O     1 
ATOM   7758  C  CB    . GLU E  5 61  ? -8.471  0.748   42.801 1.00 28.62  ? 61   GLU C CB    1 
ATOM   7759  C  CG    . GLU E  5 61  ? -9.220  0.799   44.103 1.00 32.63  ? 61   GLU C CG    1 
ATOM   7760  C  CD    . GLU E  5 61  ? -9.460  2.238   44.598 1.00 39.98  ? 61   GLU C CD    1 
ATOM   7761  O  OE1   . GLU E  5 61  ? -9.687  3.159   43.751 1.00 43.87  ? 61   GLU C OE1   1 
ATOM   7762  O  OE2   . GLU E  5 61  ? -9.428  2.441   45.840 1.00 41.19  ? 61   GLU C OE2   1 
ATOM   7763  N  N     . ILE E  5 62  ? -5.876  -0.805  43.348 1.00 28.80  ? 62   ILE C N     1 
ATOM   7764  C  CA    . ILE E  5 62  ? -5.111  -1.728  44.181 1.00 29.02  ? 62   ILE C CA    1 
ATOM   7765  C  C     . ILE E  5 62  ? -3.669  -1.293  44.387 1.00 28.74  ? 62   ILE C C     1 
ATOM   7766  O  O     . ILE E  5 62  ? -3.157  -1.407  45.503 1.00 29.15  ? 62   ILE C O     1 
ATOM   7767  C  CB    . ILE E  5 62  ? -5.144  -3.159  43.642 1.00 29.74  ? 62   ILE C CB    1 
ATOM   7768  C  CG1   . ILE E  5 62  ? -4.476  -4.109  44.608 1.00 30.63  ? 62   ILE C CG1   1 
ATOM   7769  C  CG2   . ILE E  5 62  ? -4.393  -3.263  42.327 1.00 31.45  ? 62   ILE C CG2   1 
ATOM   7770  C  CD1   . ILE E  5 62  ? -5.116  -5.472  44.548 1.00 38.21  ? 62   ILE C CD1   1 
ATOM   7771  N  N     . LEU E  5 63  ? -3.009  -0.810  43.332 1.00 28.10  ? 63   LEU C N     1 
ATOM   7772  C  CA    . LEU E  5 63  ? -1.647  -0.329  43.480 1.00 28.55  ? 63   LEU C CA    1 
ATOM   7773  C  C     . LEU E  5 63  ? -1.554  0.904   44.387 1.00 29.41  ? 63   LEU C C     1 
ATOM   7774  O  O     . LEU E  5 63  ? -0.586  1.066   45.128 1.00 29.98  ? 63   LEU C O     1 
ATOM   7775  C  CB    . LEU E  5 63  ? -0.992  -0.062  42.134 1.00 27.96  ? 63   LEU C CB    1 
ATOM   7776  C  CG    . LEU E  5 63  ? -0.637  -1.283  41.274 1.00 25.84  ? 63   LEU C CG    1 
ATOM   7777  C  CD1   . LEU E  5 63  ? -0.080  -0.789  39.993 1.00 24.56  ? 63   LEU C CD1   1 
ATOM   7778  C  CD2   . LEU E  5 63  ? 0.313   -2.262  41.935 1.00 21.94  ? 63   LEU C CD2   1 
ATOM   7779  N  N     . GLU E  5 64  ? -2.573  1.743   44.384 1.00 30.04  ? 64   GLU C N     1 
ATOM   7780  C  CA    . GLU E  5 64  ? -2.534  2.878   45.279 1.00 31.61  ? 64   GLU C CA    1 
ATOM   7781  C  C     . GLU E  5 64  ? -2.506  2.363   46.692 1.00 31.74  ? 64   GLU C C     1 
ATOM   7782  O  O     . GLU E  5 64  ? -1.619  2.718   47.464 1.00 32.09  ? 64   GLU C O     1 
ATOM   7783  C  CB    . GLU E  5 64  ? -3.719  3.822   45.052 1.00 31.74  ? 64   GLU C CB    1 
ATOM   7784  C  CG    . GLU E  5 64  ? -3.993  4.704   46.211 1.00 34.76  ? 64   GLU C CG    1 
ATOM   7785  C  CD    . GLU E  5 64  ? -3.261  6.039   46.174 1.00 40.60  ? 64   GLU C CD    1 
ATOM   7786  O  OE1   . GLU E  5 64  ? -3.878  7.033   46.625 1.00 43.27  ? 64   GLU C OE1   1 
ATOM   7787  O  OE2   . GLU E  5 64  ? -2.086  6.113   45.732 1.00 43.07  ? 64   GLU C OE2   1 
ATOM   7788  N  N     . LEU E  5 65  ? -3.475  1.501   47.012 1.00 31.82  ? 65   LEU C N     1 
ATOM   7789  C  CA    . LEU E  5 65  ? -3.620  0.926   48.355 1.00 30.98  ? 65   LEU C CA    1 
ATOM   7790  C  C     . LEU E  5 65  ? -2.413  0.098   48.795 1.00 30.78  ? 65   LEU C C     1 
ATOM   7791  O  O     . LEU E  5 65  ? -1.984  0.198   49.947 1.00 31.05  ? 65   LEU C O     1 
ATOM   7792  C  CB    . LEU E  5 65  ? -4.905  0.090   48.439 1.00 30.66  ? 65   LEU C CB    1 
ATOM   7793  C  CG    . LEU E  5 65  ? -6.208  0.894   48.352 1.00 30.63  ? 65   LEU C CG    1 
ATOM   7794  C  CD1   . LEU E  5 65  ? -7.420  -0.014  48.142 1.00 29.12  ? 65   LEU C CD1   1 
ATOM   7795  C  CD2   . LEU E  5 65  ? -6.389  1.785   49.590 1.00 28.02  ? 65   LEU C CD2   1 
ATOM   7796  N  N     . ALA E  5 66  ? -1.875  -0.711  47.881 1.00 30.21  ? 66   ALA C N     1 
ATOM   7797  C  CA    . ALA E  5 66  ? -0.767  -1.607  48.197 1.00 30.15  ? 66   ALA C CA    1 
ATOM   7798  C  C     . ALA E  5 66  ? 0.502   -0.827  48.488 1.00 30.04  ? 66   ALA C C     1 
ATOM   7799  O  O     . ALA E  5 66  ? 1.257   -1.182  49.402 1.00 29.34  ? 66   ALA C O     1 
ATOM   7800  C  CB    . ALA E  5 66  ? -0.537  -2.600  47.071 1.00 30.27  ? 66   ALA C CB    1 
ATOM   7801  N  N     . GLY E  5 67  ? 0.720   0.230   47.695 1.00 29.93  ? 67   GLY C N     1 
ATOM   7802  C  CA    . GLY E  5 67  ? 1.735   1.233   47.964 1.00 29.62  ? 67   GLY C CA    1 
ATOM   7803  C  C     . GLY E  5 67  ? 1.665   1.800   49.373 1.00 29.99  ? 67   GLY C C     1 
ATOM   7804  O  O     . GLY E  5 67  ? 2.696   1.985   50.023 1.00 29.38  ? 67   GLY C O     1 
ATOM   7805  N  N     . ASN E  5 68  ? 0.463   2.085   49.858 1.00 30.57  ? 68   ASN C N     1 
ATOM   7806  C  CA    . ASN E  5 68  ? 0.355   2.665   51.171 1.00 32.39  ? 68   ASN C CA    1 
ATOM   7807  C  C     . ASN E  5 68  ? 0.785   1.667   52.203 1.00 33.40  ? 68   ASN C C     1 
ATOM   7808  O  O     . ASN E  5 68  ? 1.503   2.013   53.125 1.00 34.05  ? 68   ASN C O     1 
ATOM   7809  C  CB    . ASN E  5 68  ? -1.071  3.083   51.478 1.00 33.04  ? 68   ASN C CB    1 
ATOM   7810  C  CG    . ASN E  5 68  ? -1.483  4.317   50.742 1.00 34.57  ? 68   ASN C CG    1 
ATOM   7811  O  OD1   . ASN E  5 68  ? -0.680  4.937   50.031 1.00 36.58  ? 68   ASN C OD1   1 
ATOM   7812  N  ND2   . ASN E  5 68  ? -2.753  4.696   50.904 1.00 34.83  ? 68   ASN C ND2   1 
ATOM   7813  N  N     . ALA E  5 69  ? 0.323   0.425   52.055 1.00 34.34  ? 69   ALA C N     1 
ATOM   7814  C  CA    . ALA E  5 69  ? 0.692   -0.644  52.968 1.00 34.96  ? 69   ALA C CA    1 
ATOM   7815  C  C     . ALA E  5 69  ? 2.215   -0.801  53.018 1.00 35.79  ? 69   ALA C C     1 
ATOM   7816  O  O     . ALA E  5 69  ? 2.778   -1.005  54.094 1.00 35.51  ? 69   ALA C O     1 
ATOM   7817  C  CB    . ALA E  5 69  ? 0.006   -1.956  52.578 1.00 34.15  ? 69   ALA C CB    1 
ATOM   7818  N  N     . ALA E  5 70  ? 2.865   -0.687  51.857 1.00 37.09  ? 70   ALA C N     1 
ATOM   7819  C  CA    . ALA E  5 70  ? 4.308   -0.842  51.759 1.00 38.91  ? 70   ALA C CA    1 
ATOM   7820  C  C     . ALA E  5 70  ? 5.031   0.307   52.451 1.00 40.82  ? 70   ALA C C     1 
ATOM   7821  O  O     . ALA E  5 70  ? 6.100   0.101   53.028 1.00 41.56  ? 70   ALA C O     1 
ATOM   7822  C  CB    . ALA E  5 70  ? 4.723   -0.931  50.349 1.00 38.38  ? 70   ALA C CB    1 
ATOM   7823  N  N     . ARG E  5 71  ? 4.441   1.501   52.414 1.00 42.23  ? 71   ARG C N     1 
ATOM   7824  C  CA    . ARG E  5 71  ? 4.987   2.644   53.127 1.00 44.32  ? 71   ARG C CA    1 
ATOM   7825  C  C     . ARG E  5 71  ? 4.760   2.491   54.634 1.00 44.81  ? 71   ARG C C     1 
ATOM   7826  O  O     . ARG E  5 71  ? 5.676   2.729   55.421 1.00 45.25  ? 71   ARG C O     1 
ATOM   7827  C  CB    . ARG E  5 71  ? 4.413   3.966   52.591 1.00 43.93  ? 71   ARG C CB    1 
ATOM   7828  C  CG    . ARG E  5 71  ? 4.722   5.194   53.465 1.00 46.05  ? 71   ARG C CG    1 
ATOM   7829  C  CD    . ARG E  5 71  ? 4.309   6.533   52.843 1.00 47.24  ? 71   ARG C CD    1 
ATOM   7830  N  NE    . ARG E  5 71  ? 4.982   6.797   51.555 1.00 53.93  ? 71   ARG C NE    1 
ATOM   7831  C  CZ    . ARG E  5 71  ? 5.024   7.978   50.930 1.00 54.58  ? 71   ARG C CZ    1 
ATOM   7832  N  NH1   . ARG E  5 71  ? 4.436   9.053   51.460 1.00 54.60  ? 71   ARG C NH1   1 
ATOM   7833  N  NH2   . ARG E  5 71  ? 5.659   8.080   49.762 1.00 55.18  ? 71   ARG C NH2   1 
ATOM   7834  N  N     . ASP E  5 72  ? 3.558   2.076   55.031 1.00 45.83  ? 72   ASP C N     1 
ATOM   7835  C  CA    . ASP E  5 72  ? 3.239   1.813   56.432 1.00 47.19  ? 72   ASP C CA    1 
ATOM   7836  C  C     . ASP E  5 72  ? 4.143   0.730   57.061 1.00 47.82  ? 72   ASP C C     1 
ATOM   7837  O  O     . ASP E  5 72  ? 4.076   0.478   58.262 1.00 47.70  ? 72   ASP C O     1 
ATOM   7838  C  CB    . ASP E  5 72  ? 1.775   1.382   56.564 1.00 47.55  ? 72   ASP C CB    1 
ATOM   7839  C  CG    . ASP E  5 72  ? 0.779   2.498   56.231 1.00 49.94  ? 72   ASP C CG    1 
ATOM   7840  O  OD1   . ASP E  5 72  ? 1.083   3.691   56.452 1.00 52.31  ? 72   ASP C OD1   1 
ATOM   7841  O  OD2   . ASP E  5 72  ? -0.347  2.175   55.771 1.00 52.99  ? 72   ASP C OD2   1 
ATOM   7842  N  N     . ASN E  5 73  ? 4.952   0.075   56.230 1.00 48.76  ? 73   ASN C N     1 
ATOM   7843  C  CA    . ASN E  5 73  ? 5.903   -0.938  56.668 1.00 49.69  ? 73   ASN C CA    1 
ATOM   7844  C  C     . ASN E  5 73  ? 7.334   -0.541  56.335 1.00 49.60  ? 73   ASN C C     1 
ATOM   7845  O  O     . ASN E  5 73  ? 8.233   -1.381  56.350 1.00 49.72  ? 73   ASN C O     1 
ATOM   7846  C  CB    . ASN E  5 73  ? 5.600   -2.275  56.004 1.00 50.35  ? 73   ASN C CB    1 
ATOM   7847  C  CG    . ASN E  5 73  ? 4.579   -3.081  56.759 1.00 52.86  ? 73   ASN C CG    1 
ATOM   7848  O  OD1   . ASN E  5 73  ? 4.913   -3.754  57.736 1.00 56.09  ? 73   ASN C OD1   1 
ATOM   7849  N  ND2   . ASN E  5 73  ? 3.322   -3.038  56.303 1.00 54.37  ? 73   ASN C ND2   1 
ATOM   7850  N  N     . LYS E  5 74  ? 7.538   0.732   56.009 1.00 49.27  ? 74   LYS C N     1 
ATOM   7851  C  CA    . LYS E  5 74  ? 8.876   1.264   55.765 1.00 49.45  ? 74   LYS C CA    1 
ATOM   7852  C  C     . LYS E  5 74  ? 9.630   0.475   54.690 1.00 48.61  ? 74   LYS C C     1 
ATOM   7853  O  O     . LYS E  5 74  ? 10.861  0.376   54.702 1.00 48.49  ? 74   LYS C O     1 
ATOM   7854  C  CB    . LYS E  5 74  ? 9.669   1.328   57.080 1.00 50.10  ? 74   LYS C CB    1 
ATOM   7855  C  CG    . LYS E  5 74  ? 9.146   2.378   58.059 1.00 52.67  ? 74   LYS C CG    1 
ATOM   7856  C  CD    . LYS E  5 74  ? 9.381   1.960   59.511 1.00 57.11  ? 74   LYS C CD    1 
ATOM   7857  C  CE    . LYS E  5 74  ? 8.456   2.722   60.474 1.00 59.08  ? 74   LYS C CE    1 
ATOM   7858  N  NZ    . LYS E  5 74  ? 8.806   2.439   61.905 1.00 60.38  ? 74   LYS C NZ    1 
ATOM   7859  N  N     . LYS E  5 75  ? 8.864   -0.075  53.757 1.00 47.80  ? 75   LYS C N     1 
ATOM   7860  C  CA    . LYS E  5 75  ? 9.403   -0.790  52.612 1.00 46.62  ? 75   LYS C CA    1 
ATOM   7861  C  C     . LYS E  5 75  ? 9.203   0.047   51.363 1.00 45.84  ? 75   LYS C C     1 
ATOM   7862  O  O     . LYS E  5 75  ? 8.253   0.835   51.266 1.00 46.07  ? 75   LYS C O     1 
ATOM   7863  C  CB    . LYS E  5 75  ? 8.690   -2.137  52.437 1.00 46.75  ? 75   LYS C CB    1 
ATOM   7864  C  CG    . LYS E  5 75  ? 8.794   -3.095  53.618 1.00 46.57  ? 75   LYS C CG    1 
ATOM   7865  C  CD    . LYS E  5 75  ? 10.183  -3.712  53.710 1.00 48.27  ? 75   LYS C CD    1 
ATOM   7866  C  CE    . LYS E  5 75  ? 10.261  -4.720  54.840 1.00 48.09  ? 75   LYS C CE    1 
ATOM   7867  N  NZ    . LYS E  5 75  ? 9.899   -4.110  56.151 1.00 48.62  ? 75   LYS C NZ    1 
ATOM   7868  N  N     . THR E  5 76  ? 10.104  -0.136  50.409 1.00 44.90  ? 76   THR C N     1 
ATOM   7869  C  CA    . THR E  5 76  ? 10.074  0.566   49.133 1.00 44.10  ? 76   THR C CA    1 
ATOM   7870  C  C     . THR E  5 76  ? 9.499   -0.302  48.017 1.00 43.55  ? 76   THR C C     1 
ATOM   7871  O  O     . THR E  5 76  ? 9.059   0.217   46.982 1.00 44.33  ? 76   THR C O     1 
ATOM   7872  C  CB    . THR E  5 76  ? 11.498  1.069   48.772 1.00 44.13  ? 76   THR C CB    1 
ATOM   7873  O  OG1   . THR E  5 76  ? 11.612  2.447   49.147 1.00 44.23  ? 76   THR C OG1   1 
ATOM   7874  C  CG2   . THR E  5 76  ? 11.809  0.918   47.284 1.00 44.10  ? 76   THR C CG2   1 
ATOM   7875  N  N     . ARG E  5 77  ? 9.512   -1.619  48.215 1.00 42.00  ? 77   ARG C N     1 
ATOM   7876  C  CA    . ARG E  5 77  ? 8.988   -2.532  47.213 1.00 40.71  ? 77   ARG C CA    1 
ATOM   7877  C  C     . ARG E  5 77  ? 7.658   -3.173  47.631 1.00 39.31  ? 77   ARG C C     1 
ATOM   7878  O  O     . ARG E  5 77  ? 7.523   -3.673  48.742 1.00 39.48  ? 77   ARG C O     1 
ATOM   7879  C  CB    . ARG E  5 77  ? 10.020  -3.609  46.912 1.00 40.95  ? 77   ARG C CB    1 
ATOM   7880  C  CG    . ARG E  5 77  ? 9.760   -4.375  45.625 1.00 42.37  ? 77   ARG C CG    1 
ATOM   7881  C  CD    . ARG E  5 77  ? 10.918  -5.280  45.323 1.00 43.69  ? 77   ARG C CD    1 
ATOM   7882  N  NE    . ARG E  5 77  ? 12.059  -4.510  44.849 1.00 45.84  ? 77   ARG C NE    1 
ATOM   7883  C  CZ    . ARG E  5 77  ? 13.318  -4.718  45.228 1.00 46.55  ? 77   ARG C CZ    1 
ATOM   7884  N  NH1   . ARG E  5 77  ? 13.620  -5.674  46.098 1.00 46.26  ? 77   ARG C NH1   1 
ATOM   7885  N  NH2   . ARG E  5 77  ? 14.278  -3.963  44.729 1.00 47.38  ? 77   ARG C NH2   1 
ATOM   7886  N  N     . ILE E  5 78  ? 6.681   -3.147  46.733 1.00 37.35  ? 78   ILE C N     1 
ATOM   7887  C  CA    . ILE E  5 78  ? 5.425   -3.880  46.923 1.00 35.58  ? 78   ILE C CA    1 
ATOM   7888  C  C     . ILE E  5 78  ? 5.664   -5.378  46.809 1.00 34.16  ? 78   ILE C C     1 
ATOM   7889  O  O     . ILE E  5 78  ? 6.183   -5.850  45.800 1.00 34.92  ? 78   ILE C O     1 
ATOM   7890  C  CB    . ILE E  5 78  ? 4.351   -3.461  45.888 1.00 35.33  ? 78   ILE C CB    1 
ATOM   7891  C  CG1   . ILE E  5 78  ? 3.804   -2.073  46.237 1.00 35.68  ? 78   ILE C CG1   1 
ATOM   7892  C  CG2   . ILE E  5 78  ? 3.236   -4.492  45.821 1.00 34.68  ? 78   ILE C CG2   1 
ATOM   7893  C  CD1   . ILE E  5 78  ? 2.730   -1.574  45.319 1.00 36.33  ? 78   ILE C CD1   1 
ATOM   7894  N  N     . ILE E  5 79  ? 5.302   -6.113  47.847 1.00 32.12  ? 79   ILE C N     1 
ATOM   7895  C  CA    . ILE E  5 79  ? 5.335   -7.573  47.811 1.00 30.87  ? 79   ILE C CA    1 
ATOM   7896  C  C     . ILE E  5 79  ? 3.915   -8.134  47.985 1.00 30.08  ? 79   ILE C C     1 
ATOM   7897  O  O     . ILE E  5 79  ? 2.982   -7.388  48.287 1.00 30.89  ? 79   ILE C O     1 
ATOM   7898  C  CB    . ILE E  5 79  ? 6.323   -8.166  48.873 1.00 30.67  ? 79   ILE C CB    1 
ATOM   7899  C  CG1   . ILE E  5 79  ? 5.857   -7.845  50.299 1.00 30.32  ? 79   ILE C CG1   1 
ATOM   7900  C  CG2   . ILE E  5 79  ? 7.748   -7.676  48.598 1.00 29.83  ? 79   ILE C CG2   1 
ATOM   7901  C  CD1   . ILE E  5 79  ? 6.708   -8.410  51.383 1.00 30.02  ? 79   ILE C CD1   1 
ATOM   7902  N  N     . PRO E  5 80  ? 3.730   -9.443  47.766 1.00 29.00  ? 80   PRO C N     1 
ATOM   7903  C  CA    . PRO E  5 80  ? 2.393   -10.057 47.937 1.00 27.72  ? 80   PRO C CA    1 
ATOM   7904  C  C     . PRO E  5 80  ? 1.731   -9.773  49.281 1.00 26.95  ? 80   PRO C C     1 
ATOM   7905  O  O     . PRO E  5 80  ? 0.507   -9.660  49.341 1.00 26.84  ? 80   PRO C O     1 
ATOM   7906  C  CB    . PRO E  5 80  ? 2.687   -11.538 47.791 1.00 27.37  ? 80   PRO C CB    1 
ATOM   7907  C  CG    . PRO E  5 80  ? 3.848   -11.551 46.836 1.00 28.11  ? 80   PRO C CG    1 
ATOM   7908  C  CD    . PRO E  5 80  ? 4.718   -10.417 47.269 1.00 28.30  ? 80   PRO C CD    1 
ATOM   7909  N  N     . ARG E  5 81  ? 2.512   -9.637  50.351 1.00 26.21  ? 81   ARG C N     1 
ATOM   7910  C  CA    . ARG E  5 81  ? 1.912   -9.267  51.634 1.00 26.20  ? 81   ARG C CA    1 
ATOM   7911  C  C     . ARG E  5 81  ? 1.209   -7.897  51.536 1.00 25.91  ? 81   ARG C C     1 
ATOM   7912  O  O     . ARG E  5 81  ? 0.142   -7.701  52.129 1.00 26.64  ? 81   ARG C O     1 
ATOM   7913  C  CB    . ARG E  5 81  ? 2.915   -9.310  52.807 1.00 25.43  ? 81   ARG C CB    1 
ATOM   7914  C  CG    . ARG E  5 81  ? 2.505   -8.386  53.960 1.00 26.47  ? 81   ARG C CG    1 
ATOM   7915  C  CD    . ARG E  5 81  ? 2.183   -9.037  55.314 1.00 27.77  ? 81   ARG C CD    1 
ATOM   7916  N  NE    . ARG E  5 81  ? 1.061   -9.963  55.255 1.00 29.37  ? 81   ARG C NE    1 
ATOM   7917  C  CZ    . ARG E  5 81  ? 0.230   -10.238 56.264 1.00 27.36  ? 81   ARG C CZ    1 
ATOM   7918  N  NH1   . ARG E  5 81  ? 0.356   -9.659  57.447 1.00 22.80  ? 81   ARG C NH1   1 
ATOM   7919  N  NH2   . ARG E  5 81  ? -0.749  -11.105 56.065 1.00 27.05  ? 81   ARG C NH2   1 
ATOM   7920  N  N     . HIS E  5 82  ? 1.786   -6.961  50.794 1.00 24.96  ? 82   HIS C N     1 
ATOM   7921  C  CA    . HIS E  5 82  ? 1.168   -5.635  50.707 1.00 25.23  ? 82   HIS C CA    1 
ATOM   7922  C  C     . HIS E  5 82  ? -0.102  -5.642  49.866 1.00 25.72  ? 82   HIS C C     1 
ATOM   7923  O  O     . HIS E  5 82  ? -0.980  -4.783  50.058 1.00 25.54  ? 82   HIS C O     1 
ATOM   7924  C  CB    . HIS E  5 82  ? 2.121   -4.577  50.168 1.00 24.60  ? 82   HIS C CB    1 
ATOM   7925  C  CG    . HIS E  5 82  ? 3.442   -4.551  50.855 1.00 22.96  ? 82   HIS C CG    1 
ATOM   7926  N  ND1   . HIS E  5 82  ? 4.633   -4.480  50.165 1.00 20.87  ? 82   HIS C ND1   1 
ATOM   7927  C  CD2   . HIS E  5 82  ? 3.764   -4.600  52.169 1.00 23.19  ? 82   HIS C CD2   1 
ATOM   7928  C  CE1   . HIS E  5 82  ? 5.637   -4.485  51.026 1.00 23.39  ? 82   HIS C CE1   1 
ATOM   7929  N  NE2   . HIS E  5 82  ? 5.138   -4.562  52.251 1.00 24.17  ? 82   HIS C NE2   1 
ATOM   7930  N  N     . LEU E  5 83  ? -0.204  -6.591  48.934 1.00 25.54  ? 83   LEU C N     1 
ATOM   7931  C  CA    . LEU E  5 83  ? -1.429  -6.701  48.162 1.00 25.72  ? 83   LEU C CA    1 
ATOM   7932  C  C     . LEU E  5 83  ? -2.474  -7.312  49.066 1.00 25.80  ? 83   LEU C C     1 
ATOM   7933  O  O     . LEU E  5 83  ? -3.631  -6.898  49.064 1.00 25.76  ? 83   LEU C O     1 
ATOM   7934  C  CB    . LEU E  5 83  ? -1.247  -7.535  46.905 1.00 25.31  ? 83   LEU C CB    1 
ATOM   7935  C  CG    . LEU E  5 83  ? -0.148  -7.090  45.949 1.00 26.40  ? 83   LEU C CG    1 
ATOM   7936  C  CD1   . LEU E  5 83  ? 0.109   -8.127  44.853 1.00 25.39  ? 83   LEU C CD1   1 
ATOM   7937  C  CD2   . LEU E  5 83  ? -0.467  -5.734  45.326 1.00 26.69  ? 83   LEU C CD2   1 
ATOM   7938  N  N     . GLN E  5 84  ? -2.052  -8.267  49.884 1.00 25.83  ? 84   GLN C N     1 
ATOM   7939  C  CA    . GLN E  5 84  ? -3.011  -8.964  50.702 1.00 25.81  ? 84   GLN C CA    1 
ATOM   7940  C  C     . GLN E  5 84  ? -3.614  -7.963  51.662 1.00 26.04  ? 84   GLN C C     1 
ATOM   7941  O  O     . GLN E  5 84  ? -4.827  -7.871  51.761 1.00 26.21  ? 84   GLN C O     1 
ATOM   7942  C  CB    . GLN E  5 84  ? -2.361  -10.151 51.400 1.00 25.55  ? 84   GLN C CB    1 
ATOM   7943  C  CG    . GLN E  5 84  ? -3.190  -10.797 52.489 1.00 26.25  ? 84   GLN C CG    1 
ATOM   7944  C  CD    . GLN E  5 84  ? -4.408  -11.590 51.983 1.00 27.17  ? 84   GLN C CD    1 
ATOM   7945  O  OE1   . GLN E  5 84  ? -4.970  -11.320 50.920 1.00 25.30  ? 84   GLN C OE1   1 
ATOM   7946  N  NE2   . GLN E  5 84  ? -4.823  -12.571 52.775 1.00 28.14  ? 84   GLN C NE2   1 
ATOM   7947  N  N     . LEU E  5 85  ? -2.768  -7.172  52.319 1.00 26.54  ? 85   LEU C N     1 
ATOM   7948  C  CA    . LEU E  5 85  ? -3.239  -6.152  53.244 1.00 27.27  ? 85   LEU C CA    1 
ATOM   7949  C  C     . LEU E  5 85  ? -4.126  -5.123  52.551 1.00 27.70  ? 85   LEU C C     1 
ATOM   7950  O  O     . LEU E  5 85  ? -5.128  -4.678  53.107 1.00 28.35  ? 85   LEU C O     1 
ATOM   7951  C  CB    . LEU E  5 85  ? -2.053  -5.414  53.883 1.00 27.66  ? 85   LEU C CB    1 
ATOM   7952  C  CG    . LEU E  5 85  ? -1.096  -6.143  54.818 1.00 27.62  ? 85   LEU C CG    1 
ATOM   7953  C  CD1   . LEU E  5 85  ? 0.127   -5.301  55.064 1.00 22.82  ? 85   LEU C CD1   1 
ATOM   7954  C  CD2   . LEU E  5 85  ? -1.807  -6.500  56.131 1.00 27.41  ? 85   LEU C CD2   1 
ATOM   7955  N  N     . ALA E  5 86  ? -3.740  -4.729  51.342 1.00 27.90  ? 86   ALA C N     1 
ATOM   7956  C  CA    . ALA E  5 86  ? -4.495  -3.755  50.580 1.00 27.88  ? 86   ALA C CA    1 
ATOM   7957  C  C     . ALA E  5 86  ? -5.910  -4.257  50.306 1.00 28.31  ? 86   ALA C C     1 
ATOM   7958  O  O     . ALA E  5 86  ? -6.883  -3.520  50.497 1.00 28.36  ? 86   ALA C O     1 
ATOM   7959  C  CB    . ALA E  5 86  ? -3.781  -3.452  49.279 1.00 27.94  ? 86   ALA C CB    1 
ATOM   7960  N  N     . VAL E  5 87  ? -6.017  -5.517  49.873 1.00 28.31  ? 87   VAL C N     1 
ATOM   7961  C  CA    . VAL E  5 87  ? -7.294  -6.094  49.479 1.00 27.86  ? 87   VAL C CA    1 
ATOM   7962  C  C     . VAL E  5 87  ? -8.152  -6.368  50.707 1.00 28.67  ? 87   VAL C C     1 
ATOM   7963  O  O     . VAL E  5 87  ? -9.360  -6.172  50.666 1.00 28.36  ? 87   VAL C O     1 
ATOM   7964  C  CB    . VAL E  5 87  ? -7.107  -7.393  48.635 1.00 27.86  ? 87   VAL C CB    1 
ATOM   7965  C  CG1   . VAL E  5 87  ? -8.438  -8.032  48.285 1.00 26.87  ? 87   VAL C CG1   1 
ATOM   7966  C  CG2   . VAL E  5 87  ? -6.353  -7.103  47.367 1.00 27.13  ? 87   VAL C CG2   1 
ATOM   7967  N  N     . ARG E  5 88  ? -7.546  -6.827  51.800 1.00 29.34  ? 88   ARG C N     1 
ATOM   7968  C  CA    . ARG E  5 88  ? -8.370  -7.330  52.902 1.00 30.33  ? 88   ARG C CA    1 
ATOM   7969  C  C     . ARG E  5 88  ? -8.827  -6.217  53.838 1.00 31.90  ? 88   ARG C C     1 
ATOM   7970  O  O     . ARG E  5 88  ? -9.839  -6.351  54.554 1.00 32.30  ? 88   ARG C O     1 
ATOM   7971  C  CB    . ARG E  5 88  ? -7.681  -8.466  53.678 1.00 29.78  ? 88   ARG C CB    1 
ATOM   7972  C  CG    . ARG E  5 88  ? -7.269  -9.707  52.857 1.00 27.42  ? 88   ARG C CG    1 
ATOM   7973  C  CD    . ARG E  5 88  ? -8.426  -10.341 52.127 1.00 22.85  ? 88   ARG C CD    1 
ATOM   7974  N  NE    . ARG E  5 88  ? -8.025  -11.182 51.000 1.00 18.64  ? 88   ARG C NE    1 
ATOM   7975  C  CZ    . ARG E  5 88  ? -8.868  -11.558 50.031 1.00 18.34  ? 88   ARG C CZ    1 
ATOM   7976  N  NH1   . ARG E  5 88  ? -10.151 -11.158 50.038 1.00 16.62  ? 88   ARG C NH1   1 
ATOM   7977  N  NH2   . ARG E  5 88  ? -8.441  -12.330 49.045 1.00 14.64  ? 88   ARG C NH2   1 
ATOM   7978  N  N     . ASN E  5 89  ? -8.092  -5.110  53.826 1.00 33.21  ? 89   ASN C N     1 
ATOM   7979  C  CA    . ASN E  5 89  ? -8.481  -3.942  54.615 1.00 34.21  ? 89   ASN C CA    1 
ATOM   7980  C  C     . ASN E  5 89  ? -9.496  -3.048  53.903 1.00 35.02  ? 89   ASN C C     1 
ATOM   7981  O  O     . ASN E  5 89  ? -10.017 -2.111  54.495 1.00 35.35  ? 89   ASN C O     1 
ATOM   7982  C  CB    . ASN E  5 89  ? -7.249  -3.138  54.984 1.00 33.99  ? 89   ASN C CB    1 
ATOM   7983  C  CG    . ASN E  5 89  ? -6.425  -3.801  56.054 1.00 34.01  ? 89   ASN C CG    1 
ATOM   7984  O  OD1   . ASN E  5 89  ? -6.956  -4.334  57.030 1.00 35.66  ? 89   ASN C OD1   1 
ATOM   7985  N  ND2   . ASN E  5 89  ? -5.116  -3.734  55.905 1.00 34.10  ? 89   ASN C ND2   1 
ATOM   7986  N  N     . ASP E  5 90  ? -9.752  -3.331  52.625 1.00 36.11  ? 90   ASP C N     1 
ATOM   7987  C  CA    . ASP E  5 90  ? -10.704 -2.575  51.834 1.00 36.74  ? 90   ASP C CA    1 
ATOM   7988  C  C     . ASP E  5 90  ? -11.948 -3.408  51.584 1.00 36.81  ? 90   ASP C C     1 
ATOM   7989  O  O     . ASP E  5 90  ? -11.887 -4.402  50.869 1.00 36.52  ? 90   ASP C O     1 
ATOM   7990  C  CB    . ASP E  5 90  ? -10.081 -2.191  50.503 1.00 37.09  ? 90   ASP C CB    1 
ATOM   7991  C  CG    . ASP E  5 90  ? -11.000 -1.313  49.674 1.00 41.36  ? 90   ASP C CG    1 
ATOM   7992  O  OD1   . ASP E  5 90  ? -10.865 -0.067  49.789 1.00 44.74  ? 90   ASP C OD1   1 
ATOM   7993  O  OD2   . ASP E  5 90  ? -11.887 -1.857  48.942 1.00 45.22  ? 90   ASP C OD2   1 
ATOM   7994  N  N     . GLU E  5 91  ? -13.076 -2.990  52.152 1.00 37.13  ? 91   GLU C N     1 
ATOM   7995  C  CA    . GLU E  5 91  ? -14.352 -3.716  52.034 1.00 37.77  ? 91   GLU C CA    1 
ATOM   7996  C  C     . GLU E  5 91  ? -14.710 -4.216  50.650 1.00 36.81  ? 91   GLU C C     1 
ATOM   7997  O  O     . GLU E  5 91  ? -15.285 -5.282  50.517 1.00 37.00  ? 91   GLU C O     1 
ATOM   7998  C  CB    . GLU E  5 91  ? -15.508 -2.851  52.505 1.00 38.54  ? 91   GLU C CB    1 
ATOM   7999  C  CG    . GLU E  5 91  ? -16.136 -3.276  53.809 1.00 43.50  ? 91   GLU C CG    1 
ATOM   8000  C  CD    . GLU E  5 91  ? -17.410 -2.481  54.092 1.00 50.48  ? 91   GLU C CD    1 
ATOM   8001  O  OE1   . GLU E  5 91  ? -18.321 -2.492  53.212 1.00 51.61  ? 91   GLU C OE1   1 
ATOM   8002  O  OE2   . GLU E  5 91  ? -17.486 -1.843  55.182 1.00 52.09  ? 91   GLU C OE2   1 
ATOM   8003  N  N     . GLU E  5 92  ? -14.385 -3.446  49.624 1.00 36.26  ? 92   GLU C N     1 
ATOM   8004  C  CA    . GLU E  5 92  ? -14.881 -3.743  48.281 1.00 36.20  ? 92   GLU C CA    1 
ATOM   8005  C  C     . GLU E  5 92  ? -13.956 -4.628  47.426 1.00 34.92  ? 92   GLU C C     1 
ATOM   8006  O  O     . GLU E  5 92  ? -14.420 -5.523  46.720 1.00 33.96  ? 92   GLU C O     1 
ATOM   8007  C  CB    . GLU E  5 92  ? -15.293 -2.459  47.561 1.00 36.26  ? 92   GLU C CB    1 
ATOM   8008  C  CG    . GLU E  5 92  ? -16.592 -1.898  48.123 1.00 39.19  ? 92   GLU C CG    1 
ATOM   8009  C  CD    . GLU E  5 92  ? -17.143 -0.761  47.284 1.00 43.58  ? 92   GLU C CD    1 
ATOM   8010  O  OE1   . GLU E  5 92  ? -16.331 -0.140  46.560 1.00 44.68  ? 92   GLU C OE1   1 
ATOM   8011  O  OE2   . GLU E  5 92  ? -18.374 -0.491  47.350 1.00 44.86  ? 92   GLU C OE2   1 
ATOM   8012  N  N     . LEU E  5 93  ? -12.659 -4.362  47.496 1.00 33.87  ? 93   LEU C N     1 
ATOM   8013  C  CA    . LEU E  5 93  ? -11.690 -5.270  46.929 1.00 33.10  ? 93   LEU C CA    1 
ATOM   8014  C  C     . LEU E  5 93  ? -11.800 -6.640  47.609 1.00 33.27  ? 93   LEU C C     1 
ATOM   8015  O  O     . LEU E  5 93  ? -11.895 -7.681  46.941 1.00 32.93  ? 93   LEU C O     1 
ATOM   8016  C  CB    . LEU E  5 93  ? -10.297 -4.672  47.033 1.00 32.77  ? 93   LEU C CB    1 
ATOM   8017  C  CG    . LEU E  5 93  ? -10.049 -3.444  46.152 1.00 31.03  ? 93   LEU C CG    1 
ATOM   8018  C  CD1   . LEU E  5 93  ? -8.666  -2.924  46.397 1.00 30.62  ? 93   LEU C CD1   1 
ATOM   8019  C  CD2   . LEU E  5 93  ? -10.212 -3.741  44.665 1.00 28.26  ? 93   LEU C CD2   1 
ATOM   8020  N  N     . ASN E  5 94  ? -11.881 -6.637  48.934 1.00 33.41  ? 94   ASN C N     1 
ATOM   8021  C  CA    . ASN E  5 94  ? -12.153 -7.874  49.652 1.00 33.63  ? 94   ASN C CA    1 
ATOM   8022  C  C     . ASN E  5 94  ? -13.281 -8.716  49.083 1.00 33.95  ? 94   ASN C C     1 
ATOM   8023  O  O     . ASN E  5 94  ? -13.099 -9.914  48.912 1.00 34.59  ? 94   ASN C O     1 
ATOM   8024  C  CB    . ASN E  5 94  ? -12.393 -7.675  51.140 1.00 33.14  ? 94   ASN C CB    1 
ATOM   8025  C  CG    . ASN E  5 94  ? -12.406 -9.013  51.888 1.00 34.47  ? 94   ASN C CG    1 
ATOM   8026  O  OD1   . ASN E  5 94  ? -11.482 -9.839  51.740 1.00 35.14  ? 94   ASN C OD1   1 
ATOM   8027  N  ND2   . ASN E  5 94  ? -13.464 -9.254  52.654 1.00 31.71  ? 94   ASN C ND2   1 
ATOM   8028  N  N     . LYS E  5 95  ? -14.438 -8.111  48.830 1.00 33.99  ? 95   LYS C N     1 
ATOM   8029  C  CA    . LYS E  5 95  ? -15.569 -8.830  48.259 1.00 34.26  ? 95   LYS C CA    1 
ATOM   8030  C  C     . LYS E  5 95  ? -15.303 -9.215  46.812 1.00 33.50  ? 95   LYS C C     1 
ATOM   8031  O  O     . LYS E  5 95  ? -15.618 -10.329 46.394 1.00 33.25  ? 95   LYS C O     1 
ATOM   8032  C  CB    . LYS E  5 95  ? -16.834 -7.977  48.313 1.00 35.43  ? 95   LYS C CB    1 
ATOM   8033  C  CG    . LYS E  5 95  ? -18.105 -8.694  47.874 1.00 39.11  ? 95   LYS C CG    1 
ATOM   8034  C  CD    . LYS E  5 95  ? -19.301 -7.780  48.160 1.00 44.59  ? 95   LYS C CD    1 
ATOM   8035  C  CE    . LYS E  5 95  ? -20.521 -8.547  48.753 1.00 47.90  ? 95   LYS C CE    1 
ATOM   8036  N  NZ    . LYS E  5 95  ? -21.735 -7.644  49.018 1.00 46.24  ? 95   LYS C NZ    1 
ATOM   8037  N  N     . LEU E  5 96  ? -14.724 -8.298  46.037 1.00 32.48  ? 96   LEU C N     1 
ATOM   8038  C  CA    . LEU E  5 96  ? -14.484 -8.588  44.624 1.00 31.38  ? 96   LEU C CA    1 
ATOM   8039  C  C     . LEU E  5 96  ? -13.587 -9.799  44.518 1.00 30.80  ? 96   LEU C C     1 
ATOM   8040  O  O     . LEU E  5 96  ? -13.700 -10.575 43.578 1.00 31.27  ? 96   LEU C O     1 
ATOM   8041  C  CB    . LEU E  5 96  ? -13.886 -7.393  43.878 1.00 30.96  ? 96   LEU C CB    1 
ATOM   8042  C  CG    . LEU E  5 96  ? -13.369 -7.697  42.478 1.00 30.79  ? 96   LEU C CG    1 
ATOM   8043  C  CD1   . LEU E  5 96  ? -14.498 -8.001  41.524 1.00 30.79  ? 96   LEU C CD1   1 
ATOM   8044  C  CD2   . LEU E  5 96  ? -12.513 -6.592  41.948 1.00 30.72  ? 96   LEU C CD2   1 
ATOM   8045  N  N     . LEU E  5 97  ? -12.701 -9.951  45.493 1.00 30.48  ? 97   LEU C N     1 
ATOM   8046  C  CA    . LEU E  5 97  ? -11.768 -11.070 45.539 1.00 29.69  ? 97   LEU C CA    1 
ATOM   8047  C  C     . LEU E  5 97  ? -12.075 -11.911 46.753 1.00 30.22  ? 97   LEU C C     1 
ATOM   8048  O  O     . LEU E  5 97  ? -11.163 -12.367 47.440 1.00 31.06  ? 97   LEU C O     1 
ATOM   8049  C  CB    . LEU E  5 97  ? -10.337 -10.574 45.605 1.00 28.57  ? 97   LEU C CB    1 
ATOM   8050  C  CG    . LEU E  5 97  ? -9.957  -9.518  44.577 1.00 27.64  ? 97   LEU C CG    1 
ATOM   8051  C  CD1   . LEU E  5 97  ? -8.508  -9.046  44.719 1.00 24.14  ? 97   LEU C CD1   1 
ATOM   8052  C  CD2   . LEU E  5 97  ? -10.193 -10.090 43.198 1.00 27.93  ? 97   LEU C CD2   1 
ATOM   8053  N  N     . GLY E  5 98  ? -13.363 -12.107 47.022 1.00 30.30  ? 98   GLY C N     1 
ATOM   8054  C  CA    . GLY E  5 98  ? -13.796 -12.815 48.220 1.00 30.91  ? 98   GLY C CA    1 
ATOM   8055  C  C     . GLY E  5 98  ? -13.423 -14.279 48.118 1.00 31.63  ? 98   GLY C C     1 
ATOM   8056  O  O     . GLY E  5 98  ? -13.229 -14.957 49.124 1.00 31.87  ? 98   GLY C O     1 
ATOM   8057  N  N     . ARG E  5 99  ? -13.291 -14.763 46.891 1.00 31.82  ? 99   ARG C N     1 
ATOM   8058  C  CA    . ARG E  5 99  ? -12.998 -16.168 46.663 1.00 32.14  ? 99   ARG C CA    1 
ATOM   8059  C  C     . ARG E  5 99  ? -11.651 -16.361 45.970 1.00 30.97  ? 99   ARG C C     1 
ATOM   8060  O  O     . ARG E  5 99  ? -11.477 -17.279 45.183 1.00 31.58  ? 99   ARG C O     1 
ATOM   8061  C  CB    . ARG E  5 99  ? -14.173 -16.808 45.922 1.00 32.04  ? 99   ARG C CB    1 
ATOM   8062  C  CG    . ARG E  5 99  ? -15.259 -17.148 46.929 1.00 37.14  ? 99   ARG C CG    1 
ATOM   8063  C  CD    . ARG E  5 99  ? -16.648 -17.228 46.339 1.00 45.95  ? 99   ARG C CD    1 
ATOM   8064  N  NE    . ARG E  5 99  ? -17.559 -17.991 47.217 1.00 52.35  ? 99   ARG C NE    1 
ATOM   8065  C  CZ    . ARG E  5 99  ? -18.756 -18.476 46.848 1.00 55.64  ? 99   ARG C CZ    1 
ATOM   8066  N  NH1   . ARG E  5 99  ? -19.230 -18.284 45.605 1.00 55.09  ? 99   ARG C NH1   1 
ATOM   8067  N  NH2   . ARG E  5 99  ? -19.487 -19.164 47.729 1.00 56.94  ? 99   ARG C NH2   1 
ATOM   8068  N  N     . VAL E  5 100 ? -10.700 -15.479 46.271 1.00 29.64  ? 100  VAL C N     1 
ATOM   8069  C  CA    . VAL E  5 100 ? -9.375  -15.527 45.652 1.00 27.98  ? 100  VAL C CA    1 
ATOM   8070  C  C     . VAL E  5 100 ? -8.282  -15.632 46.713 1.00 27.39  ? 100  VAL C C     1 
ATOM   8071  O  O     . VAL E  5 100 ? -8.307  -14.958 47.752 1.00 26.89  ? 100  VAL C O     1 
ATOM   8072  C  CB    . VAL E  5 100 ? -9.148  -14.297 44.763 1.00 28.20  ? 100  VAL C CB    1 
ATOM   8073  C  CG1   . VAL E  5 100 ? -7.676  -14.144 44.349 1.00 28.56  ? 100  VAL C CG1   1 
ATOM   8074  C  CG2   . VAL E  5 100 ? -10.026 -14.366 43.544 1.00 27.36  ? 100  VAL C CG2   1 
ATOM   8075  N  N     . THR E  5 101 ? -7.339  -16.524 46.479 1.00 26.80  ? 101  THR C N     1 
ATOM   8076  C  CA    . THR E  5 101 ? -6.172  -16.604 47.349 1.00 26.58  ? 101  THR C CA    1 
ATOM   8077  C  C     . THR E  5 101 ? -5.021  -15.895 46.682 1.00 25.68  ? 101  THR C C     1 
ATOM   8078  O  O     . THR E  5 101 ? -4.766  -16.114 45.493 1.00 25.46  ? 101  THR C O     1 
ATOM   8079  C  CB    . THR E  5 101 ? -5.772  -18.056 47.611 1.00 26.99  ? 101  THR C CB    1 
ATOM   8080  O  OG1   . THR E  5 101 ? -6.811  -18.710 48.357 1.00 28.27  ? 101  THR C OG1   1 
ATOM   8081  C  CG2   . THR E  5 101 ? -4.449  -18.114 48.374 1.00 27.12  ? 101  THR C CG2   1 
ATOM   8082  N  N     . ILE E  5 102 ? -4.345  -15.042 47.449 1.00 25.34  ? 102  ILE C N     1 
ATOM   8083  C  CA    . ILE E  5 102 ? -3.119  -14.377 47.005 1.00 24.97  ? 102  ILE C CA    1 
ATOM   8084  C  C     . ILE E  5 102 ? -1.952  -15.138 47.608 1.00 25.11  ? 102  ILE C C     1 
ATOM   8085  O  O     . ILE E  5 102 ? -1.751  -15.129 48.824 1.00 25.11  ? 102  ILE C O     1 
ATOM   8086  C  CB    . ILE E  5 102 ? -3.080  -12.879 47.447 1.00 25.06  ? 102  ILE C CB    1 
ATOM   8087  C  CG1   . ILE E  5 102 ? -4.070  -12.068 46.639 1.00 24.80  ? 102  ILE C CG1   1 
ATOM   8088  C  CG2   . ILE E  5 102 ? -1.713  -12.265 47.237 1.00 23.64  ? 102  ILE C CG2   1 
ATOM   8089  C  CD1   . ILE E  5 102 ? -4.676  -10.940 47.390 1.00 26.06  ? 102  ILE C CD1   1 
ATOM   8090  N  N     . ALA E  5 103 ? -1.202  -15.819 46.754 1.00 25.20  ? 103  ALA C N     1 
ATOM   8091  C  CA    . ALA E  5 103 ? -0.017  -16.543 47.165 1.00 25.81  ? 103  ALA C CA    1 
ATOM   8092  C  C     . ALA E  5 103 ? 0.874   -15.627 47.985 1.00 26.81  ? 103  ALA C C     1 
ATOM   8093  O  O     . ALA E  5 103 ? 1.118   -14.503 47.586 1.00 27.65  ? 103  ALA C O     1 
ATOM   8094  C  CB    . ALA E  5 103 ? 0.713   -17.019 45.951 1.00 25.61  ? 103  ALA C CB    1 
ATOM   8095  N  N     . GLN E  5 104 ? 1.314   -16.097 49.146 1.00 27.63  ? 104  GLN C N     1 
ATOM   8096  C  CA    . GLN E  5 104 ? 2.309   -15.428 49.990 1.00 28.84  ? 104  GLN C CA    1 
ATOM   8097  C  C     . GLN E  5 104 ? 1.834   -14.085 50.550 1.00 29.21  ? 104  GLN C C     1 
ATOM   8098  O  O     . GLN E  5 104 ? 2.644   -13.190 50.854 1.00 29.53  ? 104  GLN C O     1 
ATOM   8099  C  CB    . GLN E  5 104 ? 3.668   -15.314 49.284 1.00 29.11  ? 104  GLN C CB    1 
ATOM   8100  C  CG    . GLN E  5 104 ? 4.430   -16.630 49.157 1.00 33.35  ? 104  GLN C CG    1 
ATOM   8101  C  CD    . GLN E  5 104 ? 5.128   -17.049 50.478 1.00 41.04  ? 104  GLN C CD    1 
ATOM   8102  O  OE1   . GLN E  5 104 ? 5.787   -16.214 51.139 1.00 44.81  ? 104  GLN C OE1   1 
ATOM   8103  N  NE2   . GLN E  5 104 ? 4.977   -18.332 50.869 1.00 37.69  ? 104  GLN C NE2   1 
ATOM   8104  N  N     . GLY E  5 105 ? 0.521   -13.957 50.704 1.00 28.85  ? 105  GLY C N     1 
ATOM   8105  C  CA    . GLY E  5 105 ? -0.037  -12.809 51.359 1.00 28.52  ? 105  GLY C CA    1 
ATOM   8106  C  C     . GLY E  5 105 ? -0.307  -12.973 52.843 1.00 28.95  ? 105  GLY C C     1 
ATOM   8107  O  O     . GLY E  5 105 ? -0.496  -11.959 53.561 1.00 29.58  ? 105  GLY C O     1 
ATOM   8108  N  N     . GLY E  5 106 ? -0.335  -14.218 53.332 1.00 28.16  ? 106  GLY C N     1 
ATOM   8109  C  CA    . GLY E  5 106 ? -0.682  -14.460 54.740 1.00 27.27  ? 106  GLY C CA    1 
ATOM   8110  C  C     . GLY E  5 106 ? -2.075  -13.943 55.056 1.00 27.53  ? 106  GLY C C     1 
ATOM   8111  O  O     . GLY E  5 106 ? -2.933  -13.814 54.146 1.00 27.40  ? 106  GLY C O     1 
ATOM   8112  N  N     . VAL E  5 107 ? -2.309  -13.631 56.333 1.00 27.62  ? 107  VAL C N     1 
ATOM   8113  C  CA    . VAL E  5 107 ? -3.629  -13.167 56.800 1.00 27.84  ? 107  VAL C CA    1 
ATOM   8114  C  C     . VAL E  5 107 ? -3.520  -11.862 57.579 1.00 28.63  ? 107  VAL C C     1 
ATOM   8115  O  O     . VAL E  5 107 ? -2.419  -11.422 57.878 1.00 29.03  ? 107  VAL C O     1 
ATOM   8116  C  CB    . VAL E  5 107 ? -4.348  -14.237 57.700 1.00 27.74  ? 107  VAL C CB    1 
ATOM   8117  C  CG1   . VAL E  5 107 ? -4.463  -15.569 56.980 1.00 25.97  ? 107  VAL C CG1   1 
ATOM   8118  C  CG2   . VAL E  5 107 ? -3.639  -14.395 59.045 1.00 26.40  ? 107  VAL C CG2   1 
ATOM   8119  N  N     . LEU E  5 108 ? -4.661  -11.257 57.911 1.00 29.72  ? 108  LEU C N     1 
ATOM   8120  C  CA    . LEU E  5 108 ? -4.705  -10.065 58.745 1.00 31.15  ? 108  LEU C CA    1 
ATOM   8121  C  C     . LEU E  5 108 ? -4.574  -10.434 60.210 1.00 32.84  ? 108  LEU C C     1 
ATOM   8122  O  O     . LEU E  5 108 ? -5.252  -11.352 60.671 1.00 33.21  ? 108  LEU C O     1 
ATOM   8123  C  CB    . LEU E  5 108 ? -6.030  -9.324  58.557 1.00 31.12  ? 108  LEU C CB    1 
ATOM   8124  C  CG    . LEU E  5 108 ? -6.228  -8.468  57.298 1.00 29.85  ? 108  LEU C CG    1 
ATOM   8125  C  CD1   . LEU E  5 108 ? -7.599  -7.819  57.345 1.00 26.97  ? 108  LEU C CD1   1 
ATOM   8126  C  CD2   . LEU E  5 108 ? -5.114  -7.429  57.142 1.00 26.29  ? 108  LEU C CD2   1 
ATOM   8127  N  N     . PRO E  5 109 ? -3.687  -9.734  60.959 1.00 34.36  ? 109  PRO C N     1 
ATOM   8128  C  CA    . PRO E  5 109 ? -3.703  -9.900  62.421 1.00 34.82  ? 109  PRO C CA    1 
ATOM   8129  C  C     . PRO E  5 109 ? -5.102  -9.682  62.954 1.00 35.89  ? 109  PRO C C     1 
ATOM   8130  O  O     . PRO E  5 109 ? -5.684  -8.610  62.770 1.00 35.74  ? 109  PRO C O     1 
ATOM   8131  C  CB    . PRO E  5 109 ? -2.779  -8.792  62.905 1.00 34.47  ? 109  PRO C CB    1 
ATOM   8132  C  CG    . PRO E  5 109 ? -1.786  -8.647  61.778 1.00 34.71  ? 109  PRO C CG    1 
ATOM   8133  C  CD    . PRO E  5 109 ? -2.618  -8.813  60.522 1.00 34.07  ? 109  PRO C CD    1 
ATOM   8134  N  N     . ASN E  5 110 ? -5.657  -10.732 63.543 1.00 37.26  ? 110  ASN C N     1 
ATOM   8135  C  CA    . ASN E  5 110 ? -6.914  -10.650 64.264 1.00 38.44  ? 110  ASN C CA    1 
ATOM   8136  C  C     . ASN E  5 110 ? -6.957  -11.768 65.295 1.00 38.79  ? 110  ASN C C     1 
ATOM   8137  O  O     . ASN E  5 110 ? -6.906  -12.961 64.930 1.00 39.48  ? 110  ASN C O     1 
ATOM   8138  C  CB    . ASN E  5 110 ? -8.112  -10.744 63.308 1.00 38.74  ? 110  ASN C CB    1 
ATOM   8139  C  CG    . ASN E  5 110 ? -9.438  -10.398 63.990 1.00 41.64  ? 110  ASN C CG    1 
ATOM   8140  O  OD1   . ASN E  5 110 ? -9.465  -9.949  65.141 1.00 45.72  ? 110  ASN C OD1   1 
ATOM   8141  N  ND2   . ASN E  5 110 ? -10.541 -10.619 63.289 1.00 43.01  ? 110  ASN C ND2   1 
ATOM   8142  N  N     . ILE E  5 111 ? -7.029  -11.374 66.570 1.00 38.72  ? 111  ILE C N     1 
ATOM   8143  C  CA    . ILE E  5 111 ? -7.181  -12.293 67.707 1.00 38.54  ? 111  ILE C CA    1 
ATOM   8144  C  C     . ILE E  5 111 ? -8.528  -12.059 68.398 1.00 39.67  ? 111  ILE C C     1 
ATOM   8145  O  O     . ILE E  5 111 ? -8.781  -10.965 68.876 1.00 40.27  ? 111  ILE C O     1 
ATOM   8146  C  CB    . ILE E  5 111 ? -6.075  -12.079 68.748 1.00 37.76  ? 111  ILE C CB    1 
ATOM   8147  C  CG1   . ILE E  5 111 ? -4.706  -12.150 68.085 1.00 36.21  ? 111  ILE C CG1   1 
ATOM   8148  C  CG2   . ILE E  5 111 ? -6.222  -13.083 69.917 1.00 36.80  ? 111  ILE C CG2   1 
ATOM   8149  C  CD1   . ILE E  5 111 ? -3.565  -11.903 69.019 1.00 33.50  ? 111  ILE C CD1   1 
ATOM   8150  N  N     . GLN E  5 112 ? -9.382  -13.075 68.471 1.00 40.60  ? 112  GLN C N     1 
ATOM   8151  C  CA    . GLN E  5 112 ? -10.682 -12.927 69.122 1.00 41.98  ? 112  GLN C CA    1 
ATOM   8152  C  C     . GLN E  5 112 ? -10.553 -12.431 70.560 1.00 42.87  ? 112  GLN C C     1 
ATOM   8153  O  O     . GLN E  5 112 ? -9.645  -12.844 71.262 1.00 43.18  ? 112  GLN C O     1 
ATOM   8154  C  CB    . GLN E  5 112 ? -11.447 -14.255 69.124 1.00 41.98  ? 112  GLN C CB    1 
ATOM   8155  C  CG    . GLN E  5 112 ? -11.746 -14.813 67.754 1.00 42.41  ? 112  GLN C CG    1 
ATOM   8156  C  CD    . GLN E  5 112 ? -12.490 -13.840 66.863 1.00 41.41  ? 112  GLN C CD    1 
ATOM   8157  O  OE1   . GLN E  5 112 ? -13.629 -13.432 67.151 1.00 39.50  ? 112  GLN C OE1   1 
ATOM   8158  N  NE2   . GLN E  5 112 ? -11.852 -13.474 65.757 1.00 40.93  ? 112  GLN C NE2   1 
ATOM   8159  N  N     . SER E  5 113 ? -11.488 -11.578 70.992 1.00 44.13  ? 113  SER C N     1 
ATOM   8160  C  CA    . SER E  5 113 ? -11.493 -10.966 72.336 1.00 45.03  ? 113  SER C CA    1 
ATOM   8161  C  C     . SER E  5 113 ? -11.230 -11.933 73.484 1.00 45.56  ? 113  SER C C     1 
ATOM   8162  O  O     . SER E  5 113 ? -10.302 -11.727 74.269 1.00 46.18  ? 113  SER C O     1 
ATOM   8163  C  CB    . SER E  5 113 ? -12.821 -10.236 72.593 1.00 45.21  ? 113  SER C CB    1 
ATOM   8164  O  OG    . SER E  5 113 ? -12.830 -8.941  72.008 1.00 45.68  ? 113  SER C OG    1 
ATOM   8165  N  N     . VAL E  5 114 ? -12.039 -12.989 73.558 1.00 46.10  ? 114  VAL C N     1 
ATOM   8166  C  CA    . VAL E  5 114 ? -12.047 -13.954 74.668 1.00 46.64  ? 114  VAL C CA    1 
ATOM   8167  C  C     . VAL E  5 114 ? -10.751 -14.759 74.820 1.00 47.37  ? 114  VAL C C     1 
ATOM   8168  O  O     . VAL E  5 114 ? -10.562 -15.467 75.810 1.00 47.32  ? 114  VAL C O     1 
ATOM   8169  C  CB    . VAL E  5 114 ? -13.211 -14.949 74.505 1.00 46.37  ? 114  VAL C CB    1 
ATOM   8170  C  CG1   . VAL E  5 114 ? -14.538 -14.220 74.417 1.00 47.46  ? 114  VAL C CG1   1 
ATOM   8171  C  CG2   . VAL E  5 114 ? -13.018 -15.792 73.244 1.00 46.91  ? 114  VAL C CG2   1 
ATOM   8172  N  N     . LEU E  5 115 ? -9.875  -14.670 73.828 1.00 48.37  ? 115  LEU C N     1 
ATOM   8173  C  CA    . LEU E  5 115 ? -8.598  -15.362 73.868 1.00 49.53  ? 115  LEU C CA    1 
ATOM   8174  C  C     . LEU E  5 115 ? -7.534  -14.576 74.615 1.00 51.03  ? 115  LEU C C     1 
ATOM   8175  O  O     . LEU E  5 115 ? -6.508  -15.143 74.996 1.00 51.16  ? 115  LEU C O     1 
ATOM   8176  C  CB    . LEU E  5 115 ? -8.106  -15.670 72.452 1.00 49.09  ? 115  LEU C CB    1 
ATOM   8177  C  CG    . LEU E  5 115 ? -8.940  -16.617 71.596 1.00 47.75  ? 115  LEU C CG    1 
ATOM   8178  C  CD1   . LEU E  5 115 ? -8.202  -16.931 70.325 1.00 45.63  ? 115  LEU C CD1   1 
ATOM   8179  C  CD2   . LEU E  5 115 ? -9.269  -17.891 72.356 1.00 46.92  ? 115  LEU C CD2   1 
ATOM   8180  N  N     . LEU E  5 116 ? -7.779  -13.278 74.807 1.00 52.85  ? 116  LEU C N     1 
ATOM   8181  C  CA    . LEU E  5 116 ? -6.852  -12.390 75.510 1.00 54.83  ? 116  LEU C CA    1 
ATOM   8182  C  C     . LEU E  5 116 ? -6.941  -12.606 77.016 1.00 56.54  ? 116  LEU C C     1 
ATOM   8183  O  O     . LEU E  5 116 ? -8.028  -12.880 77.526 1.00 56.52  ? 116  LEU C O     1 
ATOM   8184  C  CB    . LEU E  5 116 ? -7.163  -10.925 75.188 1.00 54.73  ? 116  LEU C CB    1 
ATOM   8185  C  CG    . LEU E  5 116 ? -7.139  -10.410 73.749 1.00 54.51  ? 116  LEU C CG    1 
ATOM   8186  C  CD1   . LEU E  5 116 ? -7.697  -8.994  73.726 1.00 54.47  ? 116  LEU C CD1   1 
ATOM   8187  C  CD2   . LEU E  5 116 ? -5.738  -10.462 73.154 1.00 52.73  ? 116  LEU C CD2   1 
ATOM   8188  N  N     . PRO E  5 117 ? -5.806  -12.457 77.734 1.00 58.69  ? 117  PRO C N     1 
ATOM   8189  C  CA    . PRO E  5 117 ? -5.699  -12.702 79.192 1.00 60.62  ? 117  PRO C CA    1 
ATOM   8190  C  C     . PRO E  5 117 ? -6.434  -11.709 80.121 1.00 62.73  ? 117  PRO C C     1 
ATOM   8191  O  O     . PRO E  5 117 ? -7.068  -10.759 79.645 1.00 62.75  ? 117  PRO C O     1 
ATOM   8192  C  CB    . PRO E  5 117 ? -4.186  -12.649 79.442 1.00 60.46  ? 117  PRO C CB    1 
ATOM   8193  C  CG    . PRO E  5 117 ? -3.652  -11.773 78.351 1.00 59.72  ? 117  PRO C CG    1 
ATOM   8194  C  CD    . PRO E  5 117 ? -4.513  -12.042 77.152 1.00 58.77  ? 117  PRO C CD    1 
ATOM   8195  N  N     . LYS E  5 118 ? -6.323  -11.954 81.436 1.00 65.38  ? 118  LYS C N     1 
ATOM   8196  C  CA    . LYS E  5 118 ? -6.959  -11.173 82.534 1.00 67.74  ? 118  LYS C CA    1 
ATOM   8197  C  C     . LYS E  5 118 ? -8.446  -10.913 82.301 1.00 69.10  ? 118  LYS C C     1 
ATOM   8198  O  O     . LYS E  5 118 ? -9.206  -11.849 82.023 1.00 69.69  ? 118  LYS C O     1 
ATOM   8199  C  CB    . LYS E  5 118 ? -6.258  -9.829  82.808 1.00 67.62  ? 118  LYS C CB    1 
ATOM   8200  C  CG    . LYS E  5 118 ? -4.809  -9.691  82.380 1.00 68.16  ? 118  LYS C CG    1 
ATOM   8201  C  CD    . LYS E  5 118 ? -4.449  -8.199  82.226 1.00 68.53  ? 118  LYS C CD    1 
ATOM   8202  C  CE    . LYS E  5 118 ? -5.409  -7.450  81.273 1.00 68.66  ? 118  LYS C CE    1 
ATOM   8203  N  NZ    . LYS E  5 118 ? -5.075  -5.996  81.138 1.00 68.40  ? 118  LYS C NZ    1 
ATOM   8204  N  N     . LYS E  5 119 ? -8.838  -9.637  82.424 1.00 70.59  ? 119  LYS C N     1 
ATOM   8205  C  CA    . LYS E  5 119 ? -10.204 -9.161  82.145 1.00 71.82  ? 119  LYS C CA    1 
ATOM   8206  C  C     . LYS E  5 119 ? -10.189 -7.791  81.446 1.00 72.16  ? 119  LYS C C     1 
ATOM   8207  O  O     . LYS E  5 119 ? -9.740  -6.783  82.015 1.00 72.52  ? 119  LYS C O     1 
ATOM   8208  C  CB    . LYS E  5 119 ? -11.074 -9.113  83.425 1.00 72.46  ? 119  LYS C CB    1 
ATOM   8209  C  CG    . LYS E  5 119 ? -10.447 -8.400  84.648 1.00 73.65  ? 119  LYS C CG    1 
ATOM   8210  C  CD    . LYS E  5 119 ? -9.577  -9.366  85.492 1.00 76.07  ? 119  LYS C CD    1 
ATOM   8211  C  CE    . LYS E  5 119 ? -8.574  -8.627  86.401 1.00 75.59  ? 119  LYS C CE    1 
ATOM   8212  N  NZ    . LYS E  5 119 ? -7.283  -9.390  86.530 1.00 76.45  ? 119  LYS C NZ    1 
ATOM   8213  N  N     . LYS F  6 31  ? 10.475  -20.102 20.176 1.00 71.72  ? 28   LYS D N     1 
ATOM   8214  C  CA    . LYS F  6 31  ? 10.676  -19.970 21.652 1.00 72.09  ? 28   LYS D CA    1 
ATOM   8215  C  C     . LYS F  6 31  ? 9.562   -19.078 22.229 1.00 72.16  ? 28   LYS D C     1 
ATOM   8216  O  O     . LYS F  6 31  ? 9.815   -17.989 22.766 1.00 71.97  ? 28   LYS D O     1 
ATOM   8217  C  CB    . LYS F  6 31  ? 12.083  -19.436 21.952 1.00 72.15  ? 28   LYS D CB    1 
ATOM   8218  C  CG    . LYS F  6 31  ? 13.216  -20.326 21.406 1.00 72.13  ? 28   LYS D CG    1 
ATOM   8219  C  CD    . LYS F  6 31  ? 13.488  -20.101 19.906 1.00 70.84  ? 28   LYS D CD    1 
ATOM   8220  C  CE    . LYS F  6 31  ? 14.017  -21.366 19.227 1.00 69.91  ? 28   LYS D CE    1 
ATOM   8221  N  NZ    . LYS F  6 31  ? 15.295  -21.857 19.817 1.00 69.20  ? 28   LYS D NZ    1 
ATOM   8222  N  N     . THR F  6 32  ? 8.342   -19.621 22.145 1.00 72.06  ? 29   THR D N     1 
ATOM   8223  C  CA    . THR F  6 32  ? 7.074   -18.881 22.036 1.00 71.88  ? 29   THR D CA    1 
ATOM   8224  C  C     . THR F  6 32  ? 6.842   -17.723 23.018 1.00 71.43  ? 29   THR D C     1 
ATOM   8225  O  O     . THR F  6 32  ? 7.258   -17.779 24.183 1.00 71.64  ? 29   THR D O     1 
ATOM   8226  C  CB    . THR F  6 32  ? 5.858   -19.858 22.024 1.00 71.92  ? 29   THR D CB    1 
ATOM   8227  O  OG1   . THR F  6 32  ? 4.777   -19.282 21.285 1.00 73.03  ? 29   THR D OG1   1 
ATOM   8228  C  CG2   . THR F  6 32  ? 5.373   -20.181 23.438 1.00 73.00  ? 29   THR D CG2   1 
ATOM   8229  N  N     . ARG F  6 33  ? 6.162   -16.689 22.519 1.00 70.59  ? 30   ARG D N     1 
ATOM   8230  C  CA    . ARG F  6 33  ? 5.937   -15.441 23.247 1.00 69.93  ? 30   ARG D CA    1 
ATOM   8231  C  C     . ARG F  6 33  ? 4.820   -15.569 24.289 1.00 68.55  ? 30   ARG D C     1 
ATOM   8232  O  O     . ARG F  6 33  ? 3.723   -16.041 23.987 1.00 68.61  ? 30   ARG D O     1 
ATOM   8233  C  CB    . ARG F  6 33  ? 5.634   -14.294 22.264 1.00 69.96  ? 30   ARG D CB    1 
ATOM   8234  C  CG    . ARG F  6 33  ? 4.274   -14.398 21.534 1.00 71.24  ? 30   ARG D CG    1 
ATOM   8235  C  CD    . ARG F  6 33  ? 3.789   -13.065 20.902 1.00 71.56  ? 30   ARG D CD    1 
ATOM   8236  N  NE    . ARG F  6 33  ? 4.598   -11.891 21.263 1.00 74.82  ? 30   ARG D NE    1 
ATOM   8237  C  CZ    . ARG F  6 33  ? 4.156   -10.630 21.299 1.00 75.71  ? 30   ARG D CZ    1 
ATOM   8238  N  NH1   . ARG F  6 33  ? 2.882   -10.348 21.030 1.00 76.33  ? 30   ARG D NH1   1 
ATOM   8239  N  NH2   . ARG F  6 33  ? 4.993   -9.645  21.626 1.00 75.57  ? 30   ARG D NH2   1 
ATOM   8240  N  N     . LYS F  6 34  ? 5.106   -15.150 25.516 1.00 66.77  ? 31   LYS D N     1 
ATOM   8241  C  CA    . LYS F  6 34  ? 4.100   -15.182 26.567 1.00 65.06  ? 31   LYS D CA    1 
ATOM   8242  C  C     . LYS F  6 34  ? 3.767   -13.783 27.083 1.00 63.49  ? 31   LYS D C     1 
ATOM   8243  O  O     . LYS F  6 34  ? 4.460   -13.235 27.951 1.00 63.60  ? 31   LYS D O     1 
ATOM   8244  C  CB    . LYS F  6 34  ? 4.517   -16.117 27.705 1.00 65.18  ? 31   LYS D CB    1 
ATOM   8245  C  CG    . LYS F  6 34  ? 6.020   -16.186 27.958 1.00 65.71  ? 31   LYS D CG    1 
ATOM   8246  C  CD    . LYS F  6 34  ? 6.358   -17.067 29.165 1.00 65.77  ? 31   LYS D CD    1 
ATOM   8247  C  CE    . LYS F  6 34  ? 7.811   -16.881 29.590 1.00 66.40  ? 31   LYS D CE    1 
ATOM   8248  N  NZ    . LYS F  6 34  ? 7.980   -17.027 31.064 1.00 66.36  ? 31   LYS D NZ    1 
ATOM   8249  N  N     . GLU F  6 35  ? 2.701   -13.214 26.523 1.00 61.18  ? 32   GLU D N     1 
ATOM   8250  C  CA    . GLU F  6 35  ? 2.153   -11.925 26.953 1.00 59.00  ? 32   GLU D CA    1 
ATOM   8251  C  C     . GLU F  6 35  ? 1.858   -11.861 28.457 1.00 57.00  ? 32   GLU D C     1 
ATOM   8252  O  O     . GLU F  6 35  ? 1.356   -12.834 29.046 1.00 56.95  ? 32   GLU D O     1 
ATOM   8253  C  CB    . GLU F  6 35  ? 0.834   -11.643 26.227 1.00 59.07  ? 32   GLU D CB    1 
ATOM   8254  C  CG    . GLU F  6 35  ? 0.904   -11.463 24.717 1.00 59.30  ? 32   GLU D CG    1 
ATOM   8255  C  CD    . GLU F  6 35  ? -0.426  -10.969 24.143 1.00 59.68  ? 32   GLU D CD    1 
ATOM   8256  O  OE1   . GLU F  6 35  ? -1.502  -11.382 24.659 1.00 59.69  ? 32   GLU D OE1   1 
ATOM   8257  O  OE2   . GLU F  6 35  ? -0.399  -10.163 23.180 1.00 59.86  ? 32   GLU D OE2   1 
ATOM   8258  N  N     . SER F  6 36  ? 2.172   -10.714 29.063 1.00 54.15  ? 33   SER D N     1 
ATOM   8259  C  CA    . SER F  6 36  ? 1.628   -10.343 30.371 1.00 51.36  ? 33   SER D CA    1 
ATOM   8260  C  C     . SER F  6 36  ? 1.157   -8.886  30.362 1.00 49.44  ? 33   SER D C     1 
ATOM   8261  O  O     . SER F  6 36  ? 1.314   -8.185  29.375 1.00 48.91  ? 33   SER D O     1 
ATOM   8262  C  CB    . SER F  6 36  ? 2.626   -10.627 31.510 1.00 51.56  ? 33   SER D CB    1 
ATOM   8263  O  OG    . SER F  6 36  ? 3.630   -9.642  31.629 1.00 51.03  ? 33   SER D OG    1 
ATOM   8264  N  N     . TYR F  6 37  ? 0.552   -8.439  31.451 1.00 47.14  ? 34   TYR D N     1 
ATOM   8265  C  CA    . TYR F  6 37  ? 0.194   -7.047  31.576 1.00 44.97  ? 34   TYR D CA    1 
ATOM   8266  C  C     . TYR F  6 37  ? 1.244   -6.234  32.346 1.00 44.02  ? 34   TYR D C     1 
ATOM   8267  O  O     . TYR F  6 37  ? 0.976   -5.115  32.739 1.00 44.04  ? 34   TYR D O     1 
ATOM   8268  C  CB    . TYR F  6 37  ? -1.145  -6.939  32.263 1.00 44.55  ? 34   TYR D CB    1 
ATOM   8269  C  CG    . TYR F  6 37  ? -2.299  -7.370  31.426 1.00 43.70  ? 34   TYR D CG    1 
ATOM   8270  C  CD1   . TYR F  6 37  ? -2.803  -8.662  31.509 1.00 44.21  ? 34   TYR D CD1   1 
ATOM   8271  C  CD2   . TYR F  6 37  ? -2.917  -6.479  30.567 1.00 43.44  ? 34   TYR D CD2   1 
ATOM   8272  C  CE1   . TYR F  6 37  ? -3.892  -9.061  30.734 1.00 44.02  ? 34   TYR D CE1   1 
ATOM   8273  C  CE2   . TYR F  6 37  ? -4.003  -6.862  29.788 1.00 43.81  ? 34   TYR D CE2   1 
ATOM   8274  C  CZ    . TYR F  6 37  ? -4.485  -8.151  29.879 1.00 44.28  ? 34   TYR D CZ    1 
ATOM   8275  O  OH    . TYR F  6 37  ? -5.565  -8.517  29.107 1.00 45.22  ? 34   TYR D OH    1 
ATOM   8276  N  N     . ALA F  6 38  ? 2.441   -6.785  32.527 1.00 43.16  ? 35   ALA D N     1 
ATOM   8277  C  CA    . ALA F  6 38  ? 3.463   -6.207  33.409 1.00 42.61  ? 35   ALA D CA    1 
ATOM   8278  C  C     . ALA F  6 38  ? 3.854   -4.754  33.105 1.00 42.51  ? 35   ALA D C     1 
ATOM   8279  O  O     . ALA F  6 38  ? 3.893   -3.917  34.005 1.00 42.33  ? 35   ALA D O     1 
ATOM   8280  C  CB    . ALA F  6 38  ? 4.700   -7.085  33.444 1.00 42.24  ? 35   ALA D CB    1 
ATOM   8281  N  N     . ILE F  6 39  ? 4.148   -4.454  31.847 1.00 42.18  ? 36   ILE D N     1 
ATOM   8282  C  CA    . ILE F  6 39  ? 4.612   -3.117  31.499 1.00 41.61  ? 36   ILE D CA    1 
ATOM   8283  C  C     . ILE F  6 39  ? 3.477   -2.111  31.707 1.00 41.52  ? 36   ILE D C     1 
ATOM   8284  O  O     . ILE F  6 39  ? 3.682   -0.967  32.141 1.00 41.34  ? 36   ILE D O     1 
ATOM   8285  C  CB    . ILE F  6 39  ? 5.196   -3.049  30.061 1.00 41.68  ? 36   ILE D CB    1 
ATOM   8286  C  CG1   . ILE F  6 39  ? 4.105   -3.183  29.005 1.00 41.58  ? 36   ILE D CG1   1 
ATOM   8287  C  CG2   . ILE F  6 39  ? 6.309   -4.098  29.867 1.00 40.84  ? 36   ILE D CG2   1 
ATOM   8288  C  CD1   . ILE F  6 39  ? 4.571   -2.777  27.637 1.00 42.86  ? 36   ILE D CD1   1 
ATOM   8289  N  N     . TYR F  6 40  ? 2.268   -2.563  31.432 1.00 40.77  ? 37   TYR D N     1 
ATOM   8290  C  CA    . TYR F  6 40  ? 1.121   -1.736  31.656 1.00 40.44  ? 37   TYR D CA    1 
ATOM   8291  C  C     . TYR F  6 40  ? 0.901   -1.497  33.139 1.00 39.83  ? 37   TYR D C     1 
ATOM   8292  O  O     . TYR F  6 40  ? 0.618   -0.376  33.550 1.00 39.83  ? 37   TYR D O     1 
ATOM   8293  C  CB    . TYR F  6 40  ? -0.073  -2.359  30.958 1.00 41.13  ? 37   TYR D CB    1 
ATOM   8294  C  CG    . TYR F  6 40  ? 0.232   -2.561  29.489 1.00 42.15  ? 37   TYR D CG    1 
ATOM   8295  C  CD1   . TYR F  6 40  ? 0.537   -3.826  28.972 1.00 43.21  ? 37   TYR D CD1   1 
ATOM   8296  C  CD2   . TYR F  6 40  ? 0.260   -1.472  28.622 1.00 41.72  ? 37   TYR D CD2   1 
ATOM   8297  C  CE1   . TYR F  6 40  ? 0.841   -3.987  27.613 1.00 43.34  ? 37   TYR D CE1   1 
ATOM   8298  C  CE2   . TYR F  6 40  ? 0.546   -1.619  27.291 1.00 41.66  ? 37   TYR D CE2   1 
ATOM   8299  C  CZ    . TYR F  6 40  ? 0.840   -2.866  26.784 1.00 42.89  ? 37   TYR D CZ    1 
ATOM   8300  O  OH    . TYR F  6 40  ? 1.125   -2.961  25.435 1.00 43.82  ? 37   TYR D OH    1 
ATOM   8301  N  N     . VAL F  6 41  ? 1.082   -2.545  33.942 1.00 39.10  ? 38   VAL D N     1 
ATOM   8302  C  CA    . VAL F  6 41  ? 0.867   -2.476  35.390 1.00 37.75  ? 38   VAL D CA    1 
ATOM   8303  C  C     . VAL F  6 41  ? 1.895   -1.543  35.984 1.00 37.60  ? 38   VAL D C     1 
ATOM   8304  O  O     . VAL F  6 41  ? 1.579   -0.713  36.811 1.00 37.32  ? 38   VAL D O     1 
ATOM   8305  C  CB    . VAL F  6 41  ? 0.948   -3.882  36.025 1.00 37.21  ? 38   VAL D CB    1 
ATOM   8306  C  CG1   . VAL F  6 41  ? 1.047   -3.817  37.542 1.00 36.66  ? 38   VAL D CG1   1 
ATOM   8307  C  CG2   . VAL F  6 41  ? -0.243  -4.683  35.622 1.00 36.35  ? 38   VAL D CG2   1 
ATOM   8308  N  N     . TYR F  6 42  ? 3.128   -1.681  35.520 1.00 38.32  ? 39   TYR D N     1 
ATOM   8309  C  CA    . TYR F  6 42  ? 4.255   -0.908  36.001 1.00 38.85  ? 39   TYR D CA    1 
ATOM   8310  C  C     . TYR F  6 42  ? 4.124   0.580   35.650 1.00 38.97  ? 39   TYR D C     1 
ATOM   8311  O  O     . TYR F  6 42  ? 4.429   1.433   36.476 1.00 39.22  ? 39   TYR D O     1 
ATOM   8312  C  CB    . TYR F  6 42  ? 5.546   -1.490  35.442 1.00 39.59  ? 39   TYR D CB    1 
ATOM   8313  C  CG    . TYR F  6 42  ? 6.776   -0.847  35.989 1.00 41.29  ? 39   TYR D CG    1 
ATOM   8314  C  CD1   . TYR F  6 42  ? 7.328   -1.271  37.193 1.00 42.47  ? 39   TYR D CD1   1 
ATOM   8315  C  CD2   . TYR F  6 42  ? 7.398   0.203   35.302 1.00 43.60  ? 39   TYR D CD2   1 
ATOM   8316  C  CE1   . TYR F  6 42  ? 8.484   -0.663  37.713 1.00 44.51  ? 39   TYR D CE1   1 
ATOM   8317  C  CE2   . TYR F  6 42  ? 8.553   0.821   35.800 1.00 44.19  ? 39   TYR D CE2   1 
ATOM   8318  C  CZ    . TYR F  6 42  ? 9.095   0.383   37.005 1.00 44.56  ? 39   TYR D CZ    1 
ATOM   8319  O  OH    . TYR F  6 42  ? 10.234  0.999   37.505 1.00 44.68  ? 39   TYR D OH    1 
ATOM   8320  N  N     . LYS F  6 43  ? 3.672   0.890   34.434 1.00 38.77  ? 40   LYS D N     1 
ATOM   8321  C  CA    . LYS F  6 43  ? 3.359   2.268   34.060 1.00 38.65  ? 40   LYS D CA    1 
ATOM   8322  C  C     . LYS F  6 43  ? 2.416   2.880   35.073 1.00 38.23  ? 40   LYS D C     1 
ATOM   8323  O  O     . LYS F  6 43  ? 2.671   3.979   35.579 1.00 38.65  ? 40   LYS D O     1 
ATOM   8324  C  CB    . LYS F  6 43  ? 2.719   2.347   32.675 1.00 38.77  ? 40   LYS D CB    1 
ATOM   8325  C  CG    . LYS F  6 43  ? 3.703   2.288   31.510 1.00 39.94  ? 40   LYS D CG    1 
ATOM   8326  C  CD    . LYS F  6 43  ? 2.987   2.060   30.164 1.00 39.87  ? 40   LYS D CD    1 
ATOM   8327  C  CE    . LYS F  6 43  ? 4.006   2.088   28.999 1.00 42.80  ? 40   LYS D CE    1 
ATOM   8328  N  NZ    . LYS F  6 43  ? 3.455   1.632   27.660 1.00 43.70  ? 40   LYS D NZ    1 
ATOM   8329  N  N     . VAL F  6 44  ? 1.336   2.160   35.381 1.00 37.32  ? 41   VAL D N     1 
ATOM   8330  C  CA    . VAL F  6 44  ? 0.285   2.669   36.251 1.00 35.99  ? 41   VAL D CA    1 
ATOM   8331  C  C     . VAL F  6 44  ? 0.841   2.811   37.657 1.00 36.01  ? 41   VAL D C     1 
ATOM   8332  O  O     . VAL F  6 44  ? 0.493   3.761   38.386 1.00 36.04  ? 41   VAL D O     1 
ATOM   8333  C  CB    . VAL F  6 44  ? -0.954  1.750   36.246 1.00 35.81  ? 41   VAL D CB    1 
ATOM   8334  C  CG1   . VAL F  6 44  ? -1.948  2.179   37.299 1.00 35.46  ? 41   VAL D CG1   1 
ATOM   8335  C  CG2   . VAL F  6 44  ? -1.615  1.730   34.871 1.00 34.81  ? 41   VAL D CG2   1 
ATOM   8336  N  N     . LEU F  6 45  ? 1.708   1.872   38.043 1.00 35.20  ? 42   LEU D N     1 
ATOM   8337  C  CA    . LEU F  6 45  ? 2.339   1.950   39.357 1.00 34.33  ? 42   LEU D CA    1 
ATOM   8338  C  C     . LEU F  6 45  ? 3.104   3.271   39.474 1.00 34.69  ? 42   LEU D C     1 
ATOM   8339  O  O     . LEU F  6 45  ? 3.147   3.874   40.555 1.00 35.02  ? 42   LEU D O     1 
ATOM   8340  C  CB    . LEU F  6 45  ? 3.286   0.766   39.603 1.00 34.27  ? 42   LEU D CB    1 
ATOM   8341  C  CG    . LEU F  6 45  ? 4.172   0.839   40.865 1.00 33.16  ? 42   LEU D CG    1 
ATOM   8342  C  CD1   . LEU F  6 45  ? 3.338   0.846   42.176 1.00 29.62  ? 42   LEU D CD1   1 
ATOM   8343  C  CD2   . LEU F  6 45  ? 5.227   -0.262  40.889 1.00 32.68  ? 42   LEU D CD2   1 
ATOM   8344  N  N     . LYS F  6 46  ? 3.697   3.713   38.365 1.00 34.26  ? 43   LYS D N     1 
ATOM   8345  C  CA    . LYS F  6 46  ? 4.582   4.874   38.393 1.00 34.70  ? 43   LYS D CA    1 
ATOM   8346  C  C     . LYS F  6 46  ? 3.812   6.170   38.564 1.00 34.32  ? 43   LYS D C     1 
ATOM   8347  O  O     . LYS F  6 46  ? 4.245   7.052   39.293 1.00 34.69  ? 43   LYS D O     1 
ATOM   8348  C  CB    . LYS F  6 46  ? 5.476   4.927   37.156 1.00 35.05  ? 43   LYS D CB    1 
ATOM   8349  C  CG    . LYS F  6 46  ? 6.694   4.024   37.256 1.00 35.82  ? 43   LYS D CG    1 
ATOM   8350  C  CD    . LYS F  6 46  ? 7.287   4.119   38.637 1.00 38.54  ? 43   LYS D CD    1 
ATOM   8351  C  CE    . LYS F  6 46  ? 8.120   2.899   38.975 1.00 39.48  ? 43   LYS D CE    1 
ATOM   8352  N  NZ    . LYS F  6 46  ? 8.578   3.001   40.386 1.00 40.48  ? 43   LYS D NZ    1 
ATOM   8353  N  N     . GLN F  6 47  ? 2.656   6.243   37.914 1.00 33.58  ? 44   GLN D N     1 
ATOM   8354  C  CA    . GLN F  6 47  ? 1.709   7.321   38.085 1.00 33.03  ? 44   GLN D CA    1 
ATOM   8355  C  C     . GLN F  6 47  ? 1.245   7.501   39.517 1.00 32.97  ? 44   GLN D C     1 
ATOM   8356  O  O     . GLN F  6 47  ? 1.125   8.637   39.959 1.00 33.39  ? 44   GLN D O     1 
ATOM   8357  C  CB    . GLN F  6 47  ? 0.473   7.119   37.205 1.00 32.72  ? 44   GLN D CB    1 
ATOM   8358  C  CG    . GLN F  6 47  ? 0.728   7.125   35.708 1.00 32.62  ? 44   GLN D CG    1 
ATOM   8359  C  CD    . GLN F  6 47  ? -0.557  6.971   34.927 1.00 34.09  ? 44   GLN D CD    1 
ATOM   8360  O  OE1   . GLN F  6 47  ? -1.428  6.150   35.277 1.00 34.71  ? 44   GLN D OE1   1 
ATOM   8361  N  NE2   . GLN F  6 47  ? -0.698  7.764   33.859 1.00 34.75  ? 44   GLN D NE2   1 
ATOM   8362  N  N     . VAL F  6 48  ? 0.968   6.415   40.248 1.00 32.98  ? 45   VAL D N     1 
ATOM   8363  C  CA    . VAL F  6 48  ? 0.366   6.563   41.595 1.00 32.76  ? 45   VAL D CA    1 
ATOM   8364  C  C     . VAL F  6 48  ? 1.360   6.631   42.751 1.00 33.03  ? 45   VAL D C     1 
ATOM   8365  O  O     . VAL F  6 48  ? 1.123   7.338   43.719 1.00 32.33  ? 45   VAL D O     1 
ATOM   8366  C  CB    . VAL F  6 48  ? -0.739  5.531   41.899 1.00 32.55  ? 45   VAL D CB    1 
ATOM   8367  C  CG1   . VAL F  6 48  ? -1.809  5.573   40.824 1.00 32.15  ? 45   VAL D CG1   1 
ATOM   8368  C  CG2   . VAL F  6 48  ? -0.156  4.127   42.063 1.00 33.41  ? 45   VAL D CG2   1 
ATOM   8369  N  N     . HIS F  6 49  ? 2.461   5.890   42.642 1.00 34.16  ? 46   HIS D N     1 
ATOM   8370  C  CA    . HIS F  6 49  ? 3.547   5.964   43.615 1.00 35.11  ? 46   HIS D CA    1 
ATOM   8371  C  C     . HIS F  6 49  ? 4.891   6.028   42.889 1.00 35.98  ? 46   HIS D C     1 
ATOM   8372  O  O     . HIS F  6 49  ? 5.560   5.010   42.725 1.00 36.14  ? 46   HIS D O     1 
ATOM   8373  C  CB    . HIS F  6 49  ? 3.522   4.784   44.570 1.00 34.84  ? 46   HIS D CB    1 
ATOM   8374  C  CG    . HIS F  6 49  ? 2.328   4.749   45.461 1.00 35.38  ? 46   HIS D CG    1 
ATOM   8375  N  ND1   . HIS F  6 49  ? 2.137   5.648   46.483 1.00 35.88  ? 46   HIS D ND1   1 
ATOM   8376  C  CD2   . HIS F  6 49  ? 1.278   3.894   45.512 1.00 36.94  ? 46   HIS D CD2   1 
ATOM   8377  C  CE1   . HIS F  6 49  ? 1.013   5.362   47.119 1.00 35.18  ? 46   HIS D CE1   1 
ATOM   8378  N  NE2   . HIS F  6 49  ? 0.471   4.304   46.548 1.00 36.84  ? 46   HIS D NE2   1 
ATOM   8379  N  N     . PRO F  6 50  ? 5.301   7.236   42.471 1.00 36.80  ? 47   PRO D N     1 
ATOM   8380  C  CA    . PRO F  6 50  ? 6.480   7.385   41.611 1.00 37.46  ? 47   PRO D CA    1 
ATOM   8381  C  C     . PRO F  6 50  ? 7.749   6.715   42.128 1.00 37.55  ? 47   PRO D C     1 
ATOM   8382  O  O     . PRO F  6 50  ? 8.612   6.400   41.329 1.00 38.19  ? 47   PRO D O     1 
ATOM   8383  C  CB    . PRO F  6 50  ? 6.687   8.907   41.554 1.00 37.31  ? 47   PRO D CB    1 
ATOM   8384  C  CG    . PRO F  6 50  ? 5.336   9.473   41.784 1.00 37.21  ? 47   PRO D CG    1 
ATOM   8385  C  CD    . PRO F  6 50  ? 4.689   8.542   42.787 1.00 36.84  ? 47   PRO D CD    1 
ATOM   8386  N  N     . ASP F  6 51  ? 7.865   6.506   43.433 1.00 37.87  ? 48   ASP D N     1 
ATOM   8387  C  CA    . ASP F  6 51  ? 9.130   6.033   44.006 1.00 38.53  ? 48   ASP D CA    1 
ATOM   8388  C  C     . ASP F  6 51  ? 9.098   4.581   44.516 1.00 38.08  ? 48   ASP D C     1 
ATOM   8389  O  O     . ASP F  6 51  ? 10.075  4.108   45.098 1.00 38.75  ? 48   ASP D O     1 
ATOM   8390  C  CB    . ASP F  6 51  ? 9.623   6.989   45.123 1.00 38.72  ? 48   ASP D CB    1 
ATOM   8391  C  CG    . ASP F  6 51  ? 10.203  8.322   44.572 1.00 41.72  ? 48   ASP D CG    1 
ATOM   8392  O  OD1   . ASP F  6 51  ? 10.652  8.366   43.392 1.00 42.70  ? 48   ASP D OD1   1 
ATOM   8393  O  OD2   . ASP F  6 51  ? 10.208  9.337   45.330 1.00 43.86  ? 48   ASP D OD2   1 
ATOM   8394  N  N     . THR F  6 52  ? 7.981   3.893   44.305 1.00 37.38  ? 49   THR D N     1 
ATOM   8395  C  CA    . THR F  6 52  ? 7.782   2.525   44.782 1.00 36.93  ? 49   THR D CA    1 
ATOM   8396  C  C     . THR F  6 52  ? 8.006   1.499   43.664 1.00 36.18  ? 49   THR D C     1 
ATOM   8397  O  O     . THR F  6 52  ? 7.543   1.687   42.539 1.00 35.86  ? 49   THR D O     1 
ATOM   8398  C  CB    . THR F  6 52  ? 6.360   2.356   45.348 1.00 37.15  ? 49   THR D CB    1 
ATOM   8399  O  OG1   . THR F  6 52  ? 5.990   3.544   46.057 1.00 39.21  ? 49   THR D OG1   1 
ATOM   8400  C  CG2   . THR F  6 52  ? 6.284   1.190   46.302 1.00 36.45  ? 49   THR D CG2   1 
ATOM   8401  N  N     . GLY F  6 53  ? 8.726   0.425   43.965 1.00 35.52  ? 50   GLY D N     1 
ATOM   8402  C  CA    . GLY F  6 53  ? 8.866   -0.668  43.005 1.00 35.09  ? 50   GLY D CA    1 
ATOM   8403  C  C     . GLY F  6 53  ? 7.917   -1.826  43.303 1.00 34.74  ? 50   GLY D C     1 
ATOM   8404  O  O     . GLY F  6 53  ? 7.266   -1.851  44.339 1.00 34.78  ? 50   GLY D O     1 
ATOM   8405  N  N     . ILE F  6 54  ? 7.857   -2.793  42.393 1.00 34.50  ? 51   ILE D N     1 
ATOM   8406  C  CA    . ILE F  6 54  ? 7.064   -4.000  42.590 1.00 33.63  ? 51   ILE D CA    1 
ATOM   8407  C  C     . ILE F  6 54  ? 7.943   -5.224  42.373 1.00 34.03  ? 51   ILE D C     1 
ATOM   8408  O  O     . ILE F  6 54  ? 8.702   -5.267  41.417 1.00 34.11  ? 51   ILE D O     1 
ATOM   8409  C  CB    . ILE F  6 54  ? 5.822   -4.026  41.659 1.00 33.61  ? 51   ILE D CB    1 
ATOM   8410  C  CG1   . ILE F  6 54  ? 4.880   -5.195  42.012 1.00 33.21  ? 51   ILE D CG1   1 
ATOM   8411  C  CG2   . ILE F  6 54  ? 6.233   -4.010  40.200 1.00 31.96  ? 51   ILE D CG2   1 
ATOM   8412  C  CD1   . ILE F  6 54  ? 3.465   -5.088  41.459 1.00 32.00  ? 51   ILE D CD1   1 
ATOM   8413  N  N     . SER F  6 55  ? 7.847   -6.203  43.280 1.00 34.25  ? 52   SER D N     1 
ATOM   8414  C  CA    . SER F  6 55  ? 8.592   -7.473  43.179 1.00 34.04  ? 52   SER D CA    1 
ATOM   8415  C  C     . SER F  6 55  ? 7.946   -8.311  42.082 1.00 33.64  ? 52   SER D C     1 
ATOM   8416  O  O     . SER F  6 55  ? 6.785   -8.068  41.740 1.00 33.37  ? 52   SER D O     1 
ATOM   8417  C  CB    . SER F  6 55  ? 8.556   -8.220  44.516 1.00 34.30  ? 52   SER D CB    1 
ATOM   8418  O  OG    . SER F  6 55  ? 7.467   -9.142  44.588 1.00 35.01  ? 52   SER D OG    1 
ATOM   8419  N  N     . SER F  6 56  ? 8.666   -9.275  41.516 1.00 33.20  ? 53   SER D N     1 
ATOM   8420  C  CA    . SER F  6 56  ? 8.084   -10.024 40.394 1.00 33.97  ? 53   SER D CA    1 
ATOM   8421  C  C     . SER F  6 56  ? 6.946   -10.953 40.822 1.00 33.87  ? 53   SER D C     1 
ATOM   8422  O  O     . SER F  6 56  ? 5.979   -11.136 40.079 1.00 33.82  ? 53   SER D O     1 
ATOM   8423  C  CB    . SER F  6 56  ? 9.126   -10.774 39.599 1.00 33.57  ? 53   SER D CB    1 
ATOM   8424  O  OG    . SER F  6 56  ? 9.869   -11.552 40.490 1.00 35.78  ? 53   SER D OG    1 
ATOM   8425  N  N     . LYS F  6 57  ? 7.045   -11.517 42.017 1.00 33.94  ? 54   LYS D N     1 
ATOM   8426  C  CA    . LYS F  6 57  ? 5.923   -12.253 42.576 1.00 34.70  ? 54   LYS D CA    1 
ATOM   8427  C  C     . LYS F  6 57  ? 4.692   -11.371 42.691 1.00 34.02  ? 54   LYS D C     1 
ATOM   8428  O  O     . LYS F  6 57  ? 3.601   -11.788 42.304 1.00 34.27  ? 54   LYS D O     1 
ATOM   8429  C  CB    . LYS F  6 57  ? 6.275   -12.878 43.927 1.00 35.25  ? 54   LYS D CB    1 
ATOM   8430  C  CG    . LYS F  6 57  ? 6.968   -14.215 43.775 1.00 38.71  ? 54   LYS D CG    1 
ATOM   8431  C  CD    . LYS F  6 57  ? 7.578   -14.700 45.095 1.00 44.32  ? 54   LYS D CD    1 
ATOM   8432  C  CE    . LYS F  6 57  ? 8.742   -15.673 44.837 1.00 45.11  ? 54   LYS D CE    1 
ATOM   8433  N  NZ    . LYS F  6 57  ? 9.650   -15.676 46.028 1.00 47.67  ? 54   LYS D NZ    1 
ATOM   8434  N  N     . ALA F  6 58  ? 4.870   -10.146 43.191 1.00 33.14  ? 55   ALA D N     1 
ATOM   8435  C  CA    . ALA F  6 58  ? 3.772   -9.195  43.268 1.00 31.97  ? 55   ALA D CA    1 
ATOM   8436  C  C     . ALA F  6 58  ? 3.285   -8.811  41.890 1.00 31.65  ? 55   ALA D C     1 
ATOM   8437  O  O     . ALA F  6 58  ? 2.111   -8.543  41.683 1.00 32.10  ? 55   ALA D O     1 
ATOM   8438  C  CB    . ALA F  6 58  ? 4.190   -7.999  44.017 1.00 32.25  ? 55   ALA D CB    1 
ATOM   8439  N  N     . MET F  6 59  ? 4.176   -8.802  40.921 1.00 31.68  ? 56   MET D N     1 
ATOM   8440  C  CA    . MET F  6 59  ? 3.760   -8.501  39.565 1.00 31.96  ? 56   MET D CA    1 
ATOM   8441  C  C     . MET F  6 59  ? 2.992   -9.685  38.970 1.00 31.96  ? 56   MET D C     1 
ATOM   8442  O  O     . MET F  6 59  ? 2.003   -9.501  38.247 1.00 31.64  ? 56   MET D O     1 
ATOM   8443  C  CB    . MET F  6 59  ? 4.965   -8.111  38.705 1.00 32.10  ? 56   MET D CB    1 
ATOM   8444  C  CG    . MET F  6 59  ? 4.621   -7.755  37.280 1.00 32.89  ? 56   MET D CG    1 
ATOM   8445  S  SD    . MET F  6 59  ? 3.442   -6.395  37.191 1.00 39.86  ? 56   MET D SD    1 
ATOM   8446  C  CE    . MET F  6 59  ? 4.588   -5.003  37.083 1.00 35.76  ? 56   MET D CE    1 
ATOM   8447  N  N     . SER F  6 60  ? 3.449   -10.895 39.293 1.00 31.99  ? 57   SER D N     1 
ATOM   8448  C  CA    . SER F  6 60  ? 2.735   -12.107 38.933 1.00 32.18  ? 57   SER D CA    1 
ATOM   8449  C  C     . SER F  6 60  ? 1.311   -12.088 39.475 1.00 32.17  ? 57   SER D C     1 
ATOM   8450  O  O     . SER F  6 60  ? 0.357   -12.357 38.726 1.00 32.09  ? 57   SER D O     1 
ATOM   8451  C  CB    . SER F  6 60  ? 3.475   -13.336 39.414 1.00 32.34  ? 57   SER D CB    1 
ATOM   8452  O  OG    . SER F  6 60  ? 2.947   -14.483 38.770 1.00 35.17  ? 57   SER D OG    1 
ATOM   8453  N  N     . ILE F  6 61  ? 1.152   -11.721 40.746 1.00 31.92  ? 58   ILE D N     1 
ATOM   8454  C  CA    . ILE F  6 61  ? -0.193  -11.557 41.303 1.00 32.21  ? 58   ILE D CA    1 
ATOM   8455  C  C     . ILE F  6 61  ? -1.037  -10.493 40.600 1.00 32.82  ? 58   ILE D C     1 
ATOM   8456  O  O     . ILE F  6 61  ? -2.249  -10.693 40.421 1.00 33.95  ? 58   ILE D O     1 
ATOM   8457  C  CB    . ILE F  6 61  ? -0.172  -11.220 42.789 1.00 32.19  ? 58   ILE D CB    1 
ATOM   8458  C  CG1   . ILE F  6 61  ? 0.405   -12.386 43.582 1.00 31.71  ? 58   ILE D CG1   1 
ATOM   8459  C  CG2   . ILE F  6 61  ? -1.587  -10.859 43.265 1.00 30.08  ? 58   ILE D CG2   1 
ATOM   8460  C  CD1   . ILE F  6 61  ? 1.023   -11.960 44.854 1.00 30.55  ? 58   ILE D CD1   1 
ATOM   8461  N  N     . MET F  6 62  ? -0.424  -9.369  40.228 1.00 32.14  ? 59   MET D N     1 
ATOM   8462  C  CA    . MET F  6 62  ? -1.145  -8.319  39.497 1.00 31.89  ? 59   MET D CA    1 
ATOM   8463  C  C     . MET F  6 62  ? -1.620  -8.783  38.134 1.00 31.30  ? 59   MET D C     1 
ATOM   8464  O  O     . MET F  6 62  ? -2.742  -8.490  37.720 1.00 30.90  ? 59   MET D O     1 
ATOM   8465  C  CB    . MET F  6 62  ? -0.281  -7.053  39.334 1.00 32.08  ? 59   MET D CB    1 
ATOM   8466  C  CG    . MET F  6 62  ? -0.222  -6.189  40.587 1.00 31.26  ? 59   MET D CG    1 
ATOM   8467  S  SD    . MET F  6 62  ? -1.875  -5.927  41.274 1.00 31.71  ? 59   MET D SD    1 
ATOM   8468  C  CE    . MET F  6 62  ? -2.739  -5.267  39.856 1.00 29.35  ? 59   MET D CE    1 
ATOM   8469  N  N     . ASN F  6 63  ? -0.761  -9.516  37.443 1.00 31.48  ? 60   ASN D N     1 
ATOM   8470  C  CA    . ASN F  6 63  ? -1.107  -10.062 36.130 1.00 31.73  ? 60   ASN D CA    1 
ATOM   8471  C  C     . ASN F  6 63  ? -2.271  -11.034 36.209 1.00 31.70  ? 60   ASN D C     1 
ATOM   8472  O  O     . ASN F  6 63  ? -3.160  -11.031 35.337 1.00 31.92  ? 60   ASN D O     1 
ATOM   8473  C  CB    . ASN F  6 63  ? 0.082   -10.766 35.494 1.00 31.84  ? 60   ASN D CB    1 
ATOM   8474  C  CG    . ASN F  6 63  ? -0.191  -11.160 34.063 1.00 33.97  ? 60   ASN D CG    1 
ATOM   8475  O  OD1   . ASN F  6 63  ? -0.832  -10.417 33.322 1.00 35.79  ? 60   ASN D OD1   1 
ATOM   8476  N  ND2   . ASN F  6 63  ? 0.278   -12.346 33.663 1.00 35.74  ? 60   ASN D ND2   1 
ATOM   8477  N  N     . SER F  6 64  ? -2.254  -11.860 37.263 1.00 31.19  ? 61   SER D N     1 
ATOM   8478  C  CA    . SER F  6 64  ? -3.293  -12.823 37.514 1.00 30.45  ? 61   SER D CA    1 
ATOM   8479  C  C     . SER F  6 64  ? -4.569  -12.056 37.739 1.00 30.02  ? 61   SER D C     1 
ATOM   8480  O  O     . SER F  6 64  ? -5.616  -12.418 37.182 1.00 29.88  ? 61   SER D O     1 
ATOM   8481  C  CB    . SER F  6 64  ? -2.982  -13.644 38.753 1.00 30.79  ? 61   SER D CB    1 
ATOM   8482  O  OG    . SER F  6 64  ? -1.963  -14.595 38.509 1.00 32.79  ? 61   SER D OG    1 
ATOM   8483  N  N     . PHE F  6 65  ? -4.471  -11.002 38.551 1.00 29.07  ? 62   PHE D N     1 
ATOM   8484  C  CA    . PHE F  6 65  ? -5.602  -10.095 38.819 1.00 28.90  ? 62   PHE D CA    1 
ATOM   8485  C  C     . PHE F  6 65  ? -6.178  -9.475  37.529 1.00 29.11  ? 62   PHE D C     1 
ATOM   8486  O  O     . PHE F  6 65  ? -7.392  -9.532  37.298 1.00 29.26  ? 62   PHE D O     1 
ATOM   8487  C  CB    . PHE F  6 65  ? -5.215  -9.026  39.866 1.00 28.43  ? 62   PHE D CB    1 
ATOM   8488  C  CG    . PHE F  6 65  ? -6.248  -7.969  40.071 1.00 27.54  ? 62   PHE D CG    1 
ATOM   8489  C  CD1   . PHE F  6 65  ? -7.437  -8.254  40.691 1.00 26.07  ? 62   PHE D CD1   1 
ATOM   8490  C  CD2   . PHE F  6 65  ? -6.016  -6.662  39.637 1.00 31.24  ? 62   PHE D CD2   1 
ATOM   8491  C  CE1   . PHE F  6 65  ? -8.391  -7.266  40.880 1.00 27.85  ? 62   PHE D CE1   1 
ATOM   8492  C  CE2   . PHE F  6 65  ? -6.975  -5.661  39.804 1.00 30.19  ? 62   PHE D CE2   1 
ATOM   8493  C  CZ    . PHE F  6 65  ? -8.170  -5.970  40.424 1.00 28.87  ? 62   PHE D CZ    1 
ATOM   8494  N  N     . VAL F  6 66  ? -5.333  -8.928  36.659 1.00 29.02  ? 63   VAL D N     1 
ATOM   8495  C  CA    . VAL F  6 66  ? -5.890  -8.342  35.425 1.00 29.05  ? 63   VAL D CA    1 
ATOM   8496  C  C     . VAL F  6 66  ? -6.595  -9.399  34.573 1.00 28.81  ? 63   VAL D C     1 
ATOM   8497  O  O     . VAL F  6 66  ? -7.705  -9.179  34.114 1.00 28.69  ? 63   VAL D O     1 
ATOM   8498  C  CB    . VAL F  6 66  ? -4.863  -7.514  34.563 1.00 28.88  ? 63   VAL D CB    1 
ATOM   8499  C  CG1   . VAL F  6 66  ? -5.601  -6.721  33.526 1.00 27.45  ? 63   VAL D CG1   1 
ATOM   8500  C  CG2   . VAL F  6 66  ? -4.019  -6.571  35.421 1.00 27.85  ? 63   VAL D CG2   1 
ATOM   8501  N  N     . ASN F  6 67  ? -5.951  -10.546 34.376 1.00 29.29  ? 64   ASN D N     1 
ATOM   8502  C  CA    . ASN F  6 67  ? -6.578  -11.652 33.628 1.00 29.44  ? 64   ASN D CA    1 
ATOM   8503  C  C     . ASN F  6 67  ? -7.870  -12.139 34.262 1.00 28.96  ? 64   ASN D C     1 
ATOM   8504  O  O     . ASN F  6 67  ? -8.839  -12.389 33.560 1.00 28.97  ? 64   ASN D O     1 
ATOM   8505  C  CB    . ASN F  6 67  ? -5.619  -12.828 33.468 1.00 29.75  ? 64   ASN D CB    1 
ATOM   8506  C  CG    . ASN F  6 67  ? -4.469  -12.515 32.536 1.00 30.99  ? 64   ASN D CG    1 
ATOM   8507  O  OD1   . ASN F  6 67  ? -4.666  -12.323 31.335 1.00 32.34  ? 64   ASN D OD1   1 
ATOM   8508  N  ND2   . ASN F  6 67  ? -3.249  -12.463 33.085 1.00 33.10  ? 64   ASN D ND2   1 
ATOM   8509  N  N     . ASP F  6 68  ? -7.878  -12.269 35.583 1.00 28.94  ? 65   ASP D N     1 
ATOM   8510  C  CA    . ASP F  6 68  ? -9.073  -12.691 36.308 1.00 29.65  ? 65   ASP D CA    1 
ATOM   8511  C  C     . ASP F  6 68  ? -10.273 -11.780 36.000 1.00 30.12  ? 65   ASP D C     1 
ATOM   8512  O  O     . ASP F  6 68  ? -11.333 -12.249 35.569 1.00 30.30  ? 65   ASP D O     1 
ATOM   8513  C  CB    . ASP F  6 68  ? -8.800  -12.766 37.814 1.00 29.29  ? 65   ASP D CB    1 
ATOM   8514  C  CG    . ASP F  6 68  ? -9.964  -13.395 38.611 1.00 31.03  ? 65   ASP D CG    1 
ATOM   8515  O  OD1   . ASP F  6 68  ? -10.711 -14.249 38.047 1.00 32.46  ? 65   ASP D OD1   1 
ATOM   8516  O  OD2   . ASP F  6 68  ? -10.138 -13.020 39.808 1.00 28.62  ? 65   ASP D OD2   1 
ATOM   8517  N  N     . VAL F  6 69  ? -10.081 -10.480 36.173 1.00 30.55  ? 66   VAL D N     1 
ATOM   8518  C  CA    . VAL F  6 69  ? -11.160 -9.510  36.040 1.00 30.94  ? 66   VAL D CA    1 
ATOM   8519  C  C     . VAL F  6 69  ? -11.618 -9.421  34.585 1.00 31.43  ? 66   VAL D C     1 
ATOM   8520  O  O     . VAL F  6 69  ? -12.826 -9.372  34.301 1.00 31.32  ? 66   VAL D O     1 
ATOM   8521  C  CB    . VAL F  6 69  ? -10.714 -8.120  36.565 1.00 30.83  ? 66   VAL D CB    1 
ATOM   8522  C  CG1   . VAL F  6 69  ? -11.807 -7.113  36.363 1.00 31.31  ? 66   VAL D CG1   1 
ATOM   8523  C  CG2   . VAL F  6 69  ? -10.365 -8.207  38.039 1.00 29.93  ? 66   VAL D CG2   1 
ATOM   8524  N  N     . PHE F  6 70  ? -10.656 -9.416  33.665 1.00 31.72  ? 67   PHE D N     1 
ATOM   8525  C  CA    . PHE F  6 70  ? -10.982 -9.477  32.256 1.00 32.70  ? 67   PHE D CA    1 
ATOM   8526  C  C     . PHE F  6 70  ? -11.968 -10.633 32.009 1.00 33.33  ? 67   PHE D C     1 
ATOM   8527  O  O     . PHE F  6 70  ? -13.094 -10.398 31.584 1.00 33.35  ? 67   PHE D O     1 
ATOM   8528  C  CB    . PHE F  6 70  ? -9.714  -9.632  31.415 1.00 33.10  ? 67   PHE D CB    1 
ATOM   8529  C  CG    . PHE F  6 70  ? -9.983  -9.945  29.972 1.00 33.76  ? 67   PHE D CG    1 
ATOM   8530  C  CD1   . PHE F  6 70  ? -10.027 -8.931  29.023 1.00 34.41  ? 67   PHE D CD1   1 
ATOM   8531  C  CD2   . PHE F  6 70  ? -10.197 -11.258 29.558 1.00 34.72  ? 67   PHE D CD2   1 
ATOM   8532  C  CE1   . PHE F  6 70  ? -10.294 -9.213  27.675 1.00 34.22  ? 67   PHE D CE1   1 
ATOM   8533  C  CE2   . PHE F  6 70  ? -10.478 -11.552 28.217 1.00 34.45  ? 67   PHE D CE2   1 
ATOM   8534  C  CZ    . PHE F  6 70  ? -10.530 -10.519 27.276 1.00 34.17  ? 67   PHE D CZ    1 
ATOM   8535  N  N     . GLU F  6 71  ? -11.550 -11.864 32.321 1.00 33.98  ? 68   GLU D N     1 
ATOM   8536  C  CA    . GLU F  6 71  ? -12.379 -13.057 32.136 1.00 35.23  ? 68   GLU D CA    1 
ATOM   8537  C  C     . GLU F  6 71  ? -13.743 -12.934 32.803 1.00 33.98  ? 68   GLU D C     1 
ATOM   8538  O  O     . GLU F  6 71  ? -14.759 -13.297 32.213 1.00 33.88  ? 68   GLU D O     1 
ATOM   8539  C  CB    . GLU F  6 71  ? -11.682 -14.300 32.682 1.00 35.50  ? 68   GLU D CB    1 
ATOM   8540  C  CG    . GLU F  6 71  ? -10.462 -14.804 31.881 1.00 38.50  ? 68   GLU D CG    1 
ATOM   8541  C  CD    . GLU F  6 71  ? -9.607  -15.781 32.713 1.00 39.28  ? 68   GLU D CD    1 
ATOM   8542  O  OE1   . GLU F  6 71  ? -10.190 -16.737 33.289 1.00 42.61  ? 68   GLU D OE1   1 
ATOM   8543  O  OE2   . GLU F  6 71  ? -8.364  -15.579 32.813 1.00 45.60  ? 68   GLU D OE2   1 
ATOM   8544  N  N     . ARG F  6 72  ? -13.791 -12.412 34.022 1.00 32.65  ? 69   ARG D N     1 
ATOM   8545  C  CA    . ARG F  6 72  ? -15.093 -12.284 34.655 1.00 31.78  ? 69   ARG D CA    1 
ATOM   8546  C  C     . ARG F  6 72  ? -15.998 -11.257 33.976 1.00 31.38  ? 69   ARG D C     1 
ATOM   8547  O  O     . ARG F  6 72  ? -17.195 -11.485 33.881 1.00 31.53  ? 69   ARG D O     1 
ATOM   8548  C  CB    . ARG F  6 72  ? -14.997 -12.024 36.152 1.00 31.34  ? 69   ARG D CB    1 
ATOM   8549  C  CG    . ARG F  6 72  ? -14.086 -12.968 36.892 1.00 31.44  ? 69   ARG D CG    1 
ATOM   8550  C  CD    . ARG F  6 72  ? -14.487 -12.975 38.338 1.00 30.87  ? 69   ARG D CD    1 
ATOM   8551  N  NE    . ARG F  6 72  ? -13.368 -12.665 39.197 1.00 27.15  ? 69   ARG D NE    1 
ATOM   8552  C  CZ    . ARG F  6 72  ? -13.514 -12.170 40.415 1.00 28.98  ? 69   ARG D CZ    1 
ATOM   8553  N  NH1   . ARG F  6 72  ? -14.723 -11.941 40.903 1.00 26.44  ? 69   ARG D NH1   1 
ATOM   8554  N  NH2   . ARG F  6 72  ? -12.447 -11.889 41.141 1.00 32.40  ? 69   ARG D NH2   1 
ATOM   8555  N  N     . ILE F  6 73  ? -15.447 -10.142 33.492 1.00 31.15  ? 70   ILE D N     1 
ATOM   8556  C  CA    . ILE F  6 73  ? -16.299 -9.137  32.834 1.00 30.76  ? 70   ILE D CA    1 
ATOM   8557  C  C     . ILE F  6 73  ? -16.770 -9.667  31.481 1.00 30.91  ? 70   ILE D C     1 
ATOM   8558  O  O     . ILE F  6 73  ? -17.974 -9.676  31.187 1.00 30.43  ? 70   ILE D O     1 
ATOM   8559  C  CB    . ILE F  6 73  ? -15.627 -7.748  32.705 1.00 30.51  ? 70   ILE D CB    1 
ATOM   8560  C  CG1   . ILE F  6 73  ? -15.398 -7.150  34.092 1.00 30.41  ? 70   ILE D CG1   1 
ATOM   8561  C  CG2   . ILE F  6 73  ? -16.499 -6.809  31.863 1.00 29.62  ? 70   ILE D CG2   1 
ATOM   8562  C  CD1   . ILE F  6 73  ? -14.411 -5.998  34.121 1.00 31.22  ? 70   ILE D CD1   1 
ATOM   8563  N  N     . ALA F  6 74  ? -15.822 -10.130 30.672 1.00 31.12  ? 71   ALA D N     1 
ATOM   8564  C  CA    . ALA F  6 74  ? -16.164 -10.733 29.377 1.00 32.03  ? 71   ALA D CA    1 
ATOM   8565  C  C     . ALA F  6 74  ? -17.237 -11.844 29.511 1.00 32.23  ? 71   ALA D C     1 
ATOM   8566  O  O     . ALA F  6 74  ? -18.198 -11.869 28.756 1.00 32.92  ? 71   ALA D O     1 
ATOM   8567  C  CB    . ALA F  6 74  ? -14.916 -11.227 28.657 1.00 31.25  ? 71   ALA D CB    1 
ATOM   8568  N  N     . GLY F  6 75  ? -17.088 -12.726 30.490 1.00 32.08  ? 72   GLY D N     1 
ATOM   8569  C  CA    . GLY F  6 75  ? -18.124 -13.694 30.796 1.00 32.43  ? 72   GLY D CA    1 
ATOM   8570  C  C     . GLY F  6 75  ? -19.479 -13.065 31.056 1.00 33.03  ? 72   GLY D C     1 
ATOM   8571  O  O     . GLY F  6 75  ? -20.442 -13.408 30.387 1.00 32.58  ? 72   GLY D O     1 
ATOM   8572  N  N     . GLU F  6 76  ? -19.580 -12.153 32.026 1.00 33.68  ? 73   GLU D N     1 
ATOM   8573  C  CA    . GLU F  6 76  ? -20.857 -11.470 32.238 1.00 34.95  ? 73   GLU D CA    1 
ATOM   8574  C  C     . GLU F  6 76  ? -21.386 -10.899 30.917 1.00 35.05  ? 73   GLU D C     1 
ATOM   8575  O  O     . GLU F  6 76  ? -22.566 -11.066 30.598 1.00 35.54  ? 73   GLU D O     1 
ATOM   8576  C  CB    . GLU F  6 76  ? -20.765 -10.368 33.284 1.00 35.05  ? 73   GLU D CB    1 
ATOM   8577  C  CG    . GLU F  6 76  ? -20.687 -10.819 34.737 1.00 39.91  ? 73   GLU D CG    1 
ATOM   8578  C  CD    . GLU F  6 76  ? -21.859 -11.721 35.188 1.00 45.97  ? 73   GLU D CD    1 
ATOM   8579  O  OE1   . GLU F  6 76  ? -22.943 -11.714 34.542 1.00 48.62  ? 73   GLU D OE1   1 
ATOM   8580  O  OE2   . GLU F  6 76  ? -21.680 -12.446 36.198 1.00 47.84  ? 73   GLU D OE2   1 
ATOM   8581  N  N     . ALA F  6 77  ? -20.512 -10.258 30.140 1.00 34.81  ? 74   ALA D N     1 
ATOM   8582  C  CA    . ALA F  6 77  ? -20.911 -9.667  28.861 1.00 35.06  ? 74   ALA D CA    1 
ATOM   8583  C  C     . ALA F  6 77  ? -21.434 -10.728 27.893 1.00 35.17  ? 74   ALA D C     1 
ATOM   8584  O  O     . ALA F  6 77  ? -22.450 -10.529 27.210 1.00 35.02  ? 74   ALA D O     1 
ATOM   8585  C  CB    . ALA F  6 77  ? -19.746 -8.898  28.229 1.00 34.73  ? 74   ALA D CB    1 
ATOM   8586  N  N     . SER F  6 78  ? -20.723 -11.849 27.848 1.00 34.99  ? 75   SER D N     1 
ATOM   8587  C  CA    . SER F  6 78  ? -21.039 -12.945 26.966 1.00 35.09  ? 75   SER D CA    1 
ATOM   8588  C  C     . SER F  6 78  ? -22.446 -13.445 27.231 1.00 35.59  ? 75   SER D C     1 
ATOM   8589  O  O     . SER F  6 78  ? -23.268 -13.508 26.310 1.00 36.12  ? 75   SER D O     1 
ATOM   8590  C  CB    . SER F  6 78  ? -20.045 -14.067 27.187 1.00 34.72  ? 75   SER D CB    1 
ATOM   8591  O  OG    . SER F  6 78  ? -20.133 -14.990 26.136 1.00 35.05  ? 75   SER D OG    1 
ATOM   8592  N  N     . ARG F  6 79  ? -22.719 -13.768 28.493 1.00 36.08  ? 76   ARG D N     1 
ATOM   8593  C  CA    . ARG F  6 79  ? -24.036 -14.218 28.938 1.00 37.22  ? 76   ARG D CA    1 
ATOM   8594  C  C     . ARG F  6 79  ? -25.083 -13.180 28.638 1.00 37.69  ? 76   ARG D C     1 
ATOM   8595  O  O     . ARG F  6 79  ? -26.111 -13.468 28.016 1.00 37.80  ? 76   ARG D O     1 
ATOM   8596  C  CB    . ARG F  6 79  ? -24.043 -14.490 30.438 1.00 37.14  ? 76   ARG D CB    1 
ATOM   8597  C  CG    . ARG F  6 79  ? -24.048 -15.942 30.818 1.00 37.48  ? 76   ARG D CG    1 
ATOM   8598  C  CD    . ARG F  6 79  ? -23.601 -16.141 32.278 1.00 37.46  ? 76   ARG D CD    1 
ATOM   8599  N  NE    . ARG F  6 79  ? -22.158 -16.369 32.293 1.00 38.12  ? 76   ARG D NE    1 
ATOM   8600  C  CZ    . ARG F  6 79  ? -21.283 -15.716 33.040 1.00 36.97  ? 76   ARG D CZ    1 
ATOM   8601  N  NH1   . ARG F  6 79  ? -21.688 -14.789 33.911 1.00 38.81  ? 76   ARG D NH1   1 
ATOM   8602  N  NH2   . ARG F  6 79  ? -20.001 -16.015 32.924 1.00 35.99  ? 76   ARG D NH2   1 
ATOM   8603  N  N     . LEU F  6 80  ? -24.806 -11.966 29.076 1.00 38.54  ? 77   LEU D N     1 
ATOM   8604  C  CA    . LEU F  6 80  ? -25.722 -10.862 28.875 1.00 39.90  ? 77   LEU D CA    1 
ATOM   8605  C  C     . LEU F  6 80  ? -26.219 -10.798 27.428 1.00 40.94  ? 77   LEU D C     1 
ATOM   8606  O  O     . LEU F  6 80  ? -27.433 -10.812 27.175 1.00 40.56  ? 77   LEU D O     1 
ATOM   8607  C  CB    . LEU F  6 80  ? -25.029 -9.570  29.265 1.00 39.78  ? 77   LEU D CB    1 
ATOM   8608  C  CG    . LEU F  6 80  ? -25.887 -8.320  29.286 1.00 40.17  ? 77   LEU D CG    1 
ATOM   8609  C  CD1   . LEU F  6 80  ? -26.933 -8.382  30.387 1.00 39.33  ? 77   LEU D CD1   1 
ATOM   8610  C  CD2   . LEU F  6 80  ? -24.940 -7.161  29.484 1.00 40.71  ? 77   LEU D CD2   1 
ATOM   8611  N  N     . ALA F  6 81  ? -25.276 -10.765 26.486 1.00 42.10  ? 78   ALA D N     1 
ATOM   8612  C  CA    . ALA F  6 81  ? -25.610 -10.713 25.074 1.00 43.63  ? 78   ALA D CA    1 
ATOM   8613  C  C     . ALA F  6 81  ? -26.481 -11.903 24.656 1.00 45.05  ? 78   ALA D C     1 
ATOM   8614  O  O     . ALA F  6 81  ? -27.476 -11.732 23.944 1.00 45.18  ? 78   ALA D O     1 
ATOM   8615  C  CB    . ALA F  6 81  ? -24.348 -10.644 24.238 1.00 43.57  ? 78   ALA D CB    1 
ATOM   8616  N  N     . HIS F  6 82  ? -26.118 -13.104 25.109 1.00 46.42  ? 79   HIS D N     1 
ATOM   8617  C  CA    . HIS F  6 82  ? -26.896 -14.286 24.762 1.00 47.62  ? 79   HIS D CA    1 
ATOM   8618  C  C     . HIS F  6 82  ? -28.308 -14.163 25.311 1.00 47.46  ? 79   HIS D C     1 
ATOM   8619  O  O     . HIS F  6 82  ? -29.263 -14.493 24.628 1.00 47.70  ? 79   HIS D O     1 
ATOM   8620  C  CB    . HIS F  6 82  ? -26.221 -15.574 25.239 1.00 48.11  ? 79   HIS D CB    1 
ATOM   8621  C  CG    . HIS F  6 82  ? -25.140 -16.071 24.319 1.00 52.36  ? 79   HIS D CG    1 
ATOM   8622  N  ND1   . HIS F  6 82  ? -25.410 -16.778 23.161 1.00 55.17  ? 79   HIS D ND1   1 
ATOM   8623  C  CD2   . HIS F  6 82  ? -23.786 -15.967 24.388 1.00 54.93  ? 79   HIS D CD2   1 
ATOM   8624  C  CE1   . HIS F  6 82  ? -24.270 -17.080 22.558 1.00 56.56  ? 79   HIS D CE1   1 
ATOM   8625  N  NE2   . HIS F  6 82  ? -23.270 -16.601 23.282 1.00 56.00  ? 79   HIS D NE2   1 
ATOM   8626  N  N     . TYR F  6 83  ? -28.447 -13.664 26.531 1.00 47.51  ? 80   TYR D N     1 
ATOM   8627  C  CA    . TYR F  6 83  ? -29.764 -13.577 27.149 1.00 47.94  ? 80   TYR D CA    1 
ATOM   8628  C  C     . TYR F  6 83  ? -30.712 -12.671 26.370 1.00 47.91  ? 80   TYR D C     1 
ATOM   8629  O  O     . TYR F  6 83  ? -31.918 -12.863 26.407 1.00 47.60  ? 80   TYR D O     1 
ATOM   8630  C  CB    . TYR F  6 83  ? -29.672 -13.110 28.603 1.00 47.99  ? 80   TYR D CB    1 
ATOM   8631  C  CG    . TYR F  6 83  ? -28.903 -14.032 29.528 1.00 48.55  ? 80   TYR D CG    1 
ATOM   8632  C  CD1   . TYR F  6 83  ? -28.448 -13.571 30.769 1.00 48.67  ? 80   TYR D CD1   1 
ATOM   8633  C  CD2   . TYR F  6 83  ? -28.621 -15.359 29.171 1.00 47.39  ? 80   TYR D CD2   1 
ATOM   8634  C  CE1   . TYR F  6 83  ? -27.745 -14.400 31.639 1.00 47.49  ? 80   TYR D CE1   1 
ATOM   8635  C  CE2   . TYR F  6 83  ? -27.910 -16.197 30.032 1.00 47.53  ? 80   TYR D CE2   1 
ATOM   8636  C  CZ    . TYR F  6 83  ? -27.474 -15.707 31.267 1.00 48.29  ? 80   TYR D CZ    1 
ATOM   8637  O  OH    . TYR F  6 83  ? -26.783 -16.526 32.144 1.00 48.67  ? 80   TYR D OH    1 
ATOM   8638  N  N     . ASN F  6 84  ? -30.149 -11.704 25.653 1.00 48.57  ? 81   ASN D N     1 
ATOM   8639  C  CA    . ASN F  6 84  ? -30.920 -10.719 24.884 1.00 48.96  ? 81   ASN D CA    1 
ATOM   8640  C  C     . ASN F  6 84  ? -30.883 -10.957 23.374 1.00 49.39  ? 81   ASN D C     1 
ATOM   8641  O  O     . ASN F  6 84  ? -31.337 -10.110 22.597 1.00 49.81  ? 81   ASN D O     1 
ATOM   8642  C  CB    . ASN F  6 84  ? -30.418 -9.311  25.183 1.00 48.74  ? 81   ASN D CB    1 
ATOM   8643  C  CG    . ASN F  6 84  ? -30.587 -8.937  26.624 1.00 48.80  ? 81   ASN D CG    1 
ATOM   8644  O  OD1   . ASN F  6 84  ? -31.616 -8.405  27.014 1.00 50.44  ? 81   ASN D OD1   1 
ATOM   8645  N  ND2   . ASN F  6 84  ? -29.575 -9.204  27.429 1.00 48.59  ? 81   ASN D ND2   1 
ATOM   8646  N  N     . LYS F  6 85  ? -30.337 -12.100 22.966 1.00 49.68  ? 82   LYS D N     1 
ATOM   8647  C  CA    . LYS F  6 85  ? -30.278 -12.497 21.551 1.00 50.17  ? 82   LYS D CA    1 
ATOM   8648  C  C     . LYS F  6 85  ? -29.416 -11.556 20.710 1.00 49.61  ? 82   LYS D C     1 
ATOM   8649  O  O     . LYS F  6 85  ? -29.747 -11.247 19.572 1.00 49.99  ? 82   LYS D O     1 
ATOM   8650  C  CB    . LYS F  6 85  ? -31.689 -12.614 20.960 1.00 50.36  ? 82   LYS D CB    1 
ATOM   8651  C  CG    . LYS F  6 85  ? -32.429 -13.824 21.436 1.00 52.49  ? 82   LYS D CG    1 
ATOM   8652  C  CD    . LYS F  6 85  ? -33.836 -13.455 21.881 1.00 56.74  ? 82   LYS D CD    1 
ATOM   8653  C  CE    . LYS F  6 85  ? -34.551 -14.677 22.472 1.00 58.69  ? 82   LYS D CE    1 
ATOM   8654  N  NZ    . LYS F  6 85  ? -34.882 -15.677 21.396 1.00 61.13  ? 82   LYS D NZ    1 
ATOM   8655  N  N     . ARG F  6 86  ? -28.309 -11.113 21.281 1.00 49.02  ? 83   ARG D N     1 
ATOM   8656  C  CA    . ARG F  6 86  ? -27.395 -10.215 20.602 1.00 48.62  ? 83   ARG D CA    1 
ATOM   8657  C  C     . ARG F  6 86  ? -26.136 -10.985 20.233 1.00 48.02  ? 83   ARG D C     1 
ATOM   8658  O  O     . ARG F  6 86  ? -25.709 -11.868 20.969 1.00 48.32  ? 83   ARG D O     1 
ATOM   8659  C  CB    . ARG F  6 86  ? -27.042 -9.041  21.519 1.00 48.87  ? 83   ARG D CB    1 
ATOM   8660  C  CG    . ARG F  6 86  ? -28.235 -8.230  22.000 1.00 50.25  ? 83   ARG D CG    1 
ATOM   8661  C  CD    . ARG F  6 86  ? -28.726 -7.310  20.907 1.00 54.03  ? 83   ARG D CD    1 
ATOM   8662  N  NE    . ARG F  6 86  ? -29.977 -6.635  21.244 1.00 56.89  ? 83   ARG D NE    1 
ATOM   8663  C  CZ    . ARG F  6 86  ? -31.112 -6.785  20.564 1.00 58.82  ? 83   ARG D CZ    1 
ATOM   8664  N  NH1   . ARG F  6 86  ? -31.140 -7.591  19.503 1.00 61.00  ? 83   ARG D NH1   1 
ATOM   8665  N  NH2   . ARG F  6 86  ? -32.216 -6.132  20.934 1.00 58.07  ? 83   ARG D NH2   1 
ATOM   8666  N  N     . SER F  6 87  ? -25.539 -10.641 19.102 1.00 46.98  ? 84   SER D N     1 
ATOM   8667  C  CA    . SER F  6 87  ? -24.386 -11.362 18.582 1.00 46.19  ? 84   SER D CA    1 
ATOM   8668  C  C     . SER F  6 87  ? -23.130 -10.510 18.687 1.00 45.57  ? 84   SER D C     1 
ATOM   8669  O  O     . SER F  6 87  ? -22.040 -10.895 18.242 1.00 44.93  ? 84   SER D O     1 
ATOM   8670  C  CB    . SER F  6 87  ? -24.646 -11.699 17.130 1.00 46.38  ? 84   SER D CB    1 
ATOM   8671  O  OG    . SER F  6 87  ? -25.090 -10.530 16.455 1.00 47.33  ? 84   SER D OG    1 
ATOM   8672  N  N     . THR F  6 88  ? -23.301 -9.352  19.310 1.00 44.97  ? 85   THR D N     1 
ATOM   8673  C  CA    . THR F  6 88  ? -22.258 -8.352  19.404 1.00 44.50  ? 85   THR D CA    1 
ATOM   8674  C  C     . THR F  6 88  ? -22.089 -7.949  20.866 1.00 43.57  ? 85   THR D C     1 
ATOM   8675  O  O     . THR F  6 88  ? -23.064 -7.732  21.583 1.00 43.56  ? 85   THR D O     1 
ATOM   8676  C  CB    . THR F  6 88  ? -22.623 -7.108  18.530 1.00 44.69  ? 85   THR D CB    1 
ATOM   8677  O  OG1   . THR F  6 88  ? -23.134 -7.552  17.267 1.00 45.86  ? 85   THR D OG1   1 
ATOM   8678  C  CG2   . THR F  6 88  ? -21.417 -6.189  18.297 1.00 44.71  ? 85   THR D CG2   1 
ATOM   8679  N  N     . ILE F  6 89  ? -20.846 -7.872  21.307 1.00 42.76  ? 86   ILE D N     1 
ATOM   8680  C  CA    . ILE F  6 89  ? -20.537 -7.304  22.608 1.00 42.10  ? 86   ILE D CA    1 
ATOM   8681  C  C     . ILE F  6 89  ? -20.067 -5.870  22.376 1.00 42.02  ? 86   ILE D C     1 
ATOM   8682  O  O     . ILE F  6 89  ? -19.047 -5.629  21.724 1.00 41.85  ? 86   ILE D O     1 
ATOM   8683  C  CB    . ILE F  6 89  ? -19.470 -8.138  23.363 1.00 41.72  ? 86   ILE D CB    1 
ATOM   8684  C  CG1   . ILE F  6 89  ? -20.100 -9.419  23.913 1.00 41.27  ? 86   ILE D CG1   1 
ATOM   8685  C  CG2   . ILE F  6 89  ? -18.859 -7.350  24.508 1.00 41.45  ? 86   ILE D CG2   1 
ATOM   8686  C  CD1   . ILE F  6 89  ? -19.091 -10.496 24.274 1.00 39.82  ? 86   ILE D CD1   1 
ATOM   8687  N  N     . THR F  6 90  ? -20.830 -4.922  22.900 1.00 41.65  ? 87   THR D N     1 
ATOM   8688  C  CA    . THR F  6 90  ? -20.494 -3.518  22.765 1.00 41.33  ? 87   THR D CA    1 
ATOM   8689  C  C     . THR F  6 90  ? -20.132 -2.922  24.123 1.00 41.14  ? 87   THR D C     1 
ATOM   8690  O  O     . THR F  6 90  ? -20.287 -3.564  25.162 1.00 41.70  ? 87   THR D O     1 
ATOM   8691  C  CB    . THR F  6 90  ? -21.669 -2.735  22.193 1.00 41.20  ? 87   THR D CB    1 
ATOM   8692  O  OG1   . THR F  6 90  ? -22.749 -2.778  23.132 1.00 42.15  ? 87   THR D OG1   1 
ATOM   8693  C  CG2   . THR F  6 90  ? -22.133 -3.348  20.881 1.00 41.39  ? 87   THR D CG2   1 
ATOM   8694  N  N     . SER F  6 91  ? -19.664 -1.680  24.104 1.00 40.71  ? 88   SER D N     1 
ATOM   8695  C  CA    . SER F  6 91  ? -19.385 -0.937  25.313 1.00 40.10  ? 88   SER D CA    1 
ATOM   8696  C  C     . SER F  6 91  ? -20.598 -0.949  26.244 1.00 39.41  ? 88   SER D C     1 
ATOM   8697  O  O     . SER F  6 91  ? -20.450 -0.924  27.469 1.00 39.37  ? 88   SER D O     1 
ATOM   8698  C  CB    . SER F  6 91  ? -18.908 0.488   24.976 1.00 40.09  ? 88   SER D CB    1 
ATOM   8699  O  OG    . SER F  6 91  ? -19.992 1.386   24.842 1.00 41.05  ? 88   SER D OG    1 
ATOM   8700  N  N     . ARG F  6 92  ? -21.791 -1.056  25.673 1.00 38.92  ? 89   ARG D N     1 
ATOM   8701  C  CA    . ARG F  6 92  ? -22.996 -1.140  26.493 1.00 39.01  ? 89   ARG D CA    1 
ATOM   8702  C  C     . ARG F  6 92  ? -23.171 -2.471  27.242 1.00 38.85  ? 89   ARG D C     1 
ATOM   8703  O  O     . ARG F  6 92  ? -23.731 -2.489  28.342 1.00 38.84  ? 89   ARG D O     1 
ATOM   8704  C  CB    . ARG F  6 92  ? -24.244 -0.801  25.686 1.00 39.21  ? 89   ARG D CB    1 
ATOM   8705  C  CG    . ARG F  6 92  ? -25.438 -0.622  26.554 1.00 39.83  ? 89   ARG D CG    1 
ATOM   8706  C  CD    . ARG F  6 92  ? -26.650 -0.157  25.796 1.00 44.38  ? 89   ARG D CD    1 
ATOM   8707  N  NE    . ARG F  6 92  ? -27.757 -0.022  26.742 1.00 46.92  ? 89   ARG D NE    1 
ATOM   8708  C  CZ    . ARG F  6 92  ? -28.638 -0.981  27.010 1.00 46.98  ? 89   ARG D CZ    1 
ATOM   8709  N  NH1   . ARG F  6 92  ? -28.578 -2.151  26.379 1.00 46.01  ? 89   ARG D NH1   1 
ATOM   8710  N  NH2   . ARG F  6 92  ? -29.583 -0.757  27.913 1.00 47.99  ? 89   ARG D NH2   1 
ATOM   8711  N  N     . GLU F  6 93  ? -22.701 -3.577  26.665 1.00 38.58  ? 90   GLU D N     1 
ATOM   8712  C  CA    . GLU F  6 93  ? -22.677 -4.858  27.405 1.00 38.33  ? 90   GLU D CA    1 
ATOM   8713  C  C     . GLU F  6 93  ? -21.592 -4.870  28.464 1.00 37.69  ? 90   GLU D C     1 
ATOM   8714  O  O     . GLU F  6 93  ? -21.825 -5.387  29.561 1.00 37.67  ? 90   GLU D O     1 
ATOM   8715  C  CB    . GLU F  6 93  ? -22.502 -6.086  26.494 1.00 38.65  ? 90   GLU D CB    1 
ATOM   8716  C  CG    . GLU F  6 93  ? -23.773 -6.576  25.822 1.00 40.15  ? 90   GLU D CG    1 
ATOM   8717  C  CD    . GLU F  6 93  ? -24.431 -5.500  24.963 1.00 43.72  ? 90   GLU D CD    1 
ATOM   8718  O  OE1   . GLU F  6 93  ? -25.675 -5.362  25.039 1.00 46.18  ? 90   GLU D OE1   1 
ATOM   8719  O  OE2   . GLU F  6 93  ? -23.702 -4.774  24.237 1.00 43.54  ? 90   GLU D OE2   1 
ATOM   8720  N  N     . ILE F  6 94  ? -20.415 -4.316  28.147 1.00 36.67  ? 91   ILE D N     1 
ATOM   8721  C  CA    . ILE F  6 94  ? -19.316 -4.242  29.126 1.00 35.80  ? 91   ILE D CA    1 
ATOM   8722  C  C     . ILE F  6 94  ? -19.751 -3.469  30.370 1.00 35.69  ? 91   ILE D C     1 
ATOM   8723  O  O     . ILE F  6 94  ? -19.396 -3.824  31.498 1.00 35.64  ? 91   ILE D O     1 
ATOM   8724  C  CB    . ILE F  6 94  ? -18.054 -3.545  28.566 1.00 35.51  ? 91   ILE D CB    1 
ATOM   8725  C  CG1   . ILE F  6 94  ? -17.529 -4.253  27.309 1.00 35.44  ? 91   ILE D CG1   1 
ATOM   8726  C  CG2   . ILE F  6 94  ? -16.971 -3.398  29.659 1.00 34.69  ? 91   ILE D CG2   1 
ATOM   8727  C  CD1   . ILE F  6 94  ? -17.092 -5.707  27.491 1.00 34.47  ? 91   ILE D CD1   1 
ATOM   8728  N  N     . GLN F  6 95  ? -20.535 -2.418  30.158 1.00 35.34  ? 92   GLN D N     1 
ATOM   8729  C  CA    . GLN F  6 95  ? -20.944 -1.566  31.255 1.00 35.04  ? 92   GLN D CA    1 
ATOM   8730  C  C     . GLN F  6 95  ? -21.908 -2.279  32.199 1.00 34.49  ? 92   GLN D C     1 
ATOM   8731  O  O     . GLN F  6 95  ? -21.828 -2.115  33.403 1.00 34.72  ? 92   GLN D O     1 
ATOM   8732  C  CB    . GLN F  6 95  ? -21.554 -0.276  30.710 1.00 35.43  ? 92   GLN D CB    1 
ATOM   8733  C  CG    . GLN F  6 95  ? -22.001 0.706   31.769 1.00 36.22  ? 92   GLN D CG    1 
ATOM   8734  C  CD    . GLN F  6 95  ? -22.409 2.018   31.186 1.00 36.86  ? 92   GLN D CD    1 
ATOM   8735  O  OE1   . GLN F  6 95  ? -23.587 2.252   30.934 1.00 38.01  ? 92   GLN D OE1   1 
ATOM   8736  N  NE2   . GLN F  6 95  ? -21.440 2.883   30.950 1.00 38.21  ? 92   GLN D NE2   1 
ATOM   8737  N  N     . THR F  6 96  ? -22.818 -3.079  31.664 1.00 33.92  ? 93   THR D N     1 
ATOM   8738  C  CA    . THR F  6 96  ? -23.761 -3.774  32.522 1.00 32.98  ? 93   THR D CA    1 
ATOM   8739  C  C     . THR F  6 96  ? -23.000 -4.820  33.311 1.00 32.79  ? 93   THR D C     1 
ATOM   8740  O  O     . THR F  6 96  ? -23.219 -4.985  34.517 1.00 32.71  ? 93   THR D O     1 
ATOM   8741  C  CB    . THR F  6 96  ? -24.870 -4.427  31.720 1.00 32.75  ? 93   THR D CB    1 
ATOM   8742  O  OG1   . THR F  6 96  ? -25.587 -3.414  31.024 1.00 32.14  ? 93   THR D OG1   1 
ATOM   8743  C  CG2   . THR F  6 96  ? -25.826 -5.175  32.627 1.00 32.71  ? 93   THR D CG2   1 
ATOM   8744  N  N     . ALA F  6 97  ? -22.097 -5.508  32.620 1.00 32.31  ? 94   ALA D N     1 
ATOM   8745  C  CA    . ALA F  6 97  ? -21.245 -6.514  33.228 1.00 31.83  ? 94   ALA D CA    1 
ATOM   8746  C  C     . ALA F  6 97  ? -20.485 -5.917  34.402 1.00 32.12  ? 94   ALA D C     1 
ATOM   8747  O  O     . ALA F  6 97  ? -20.390 -6.527  35.469 1.00 32.06  ? 94   ALA D O     1 
ATOM   8748  C  CB    . ALA F  6 97  ? -20.288 -7.063  32.201 1.00 31.63  ? 94   ALA D CB    1 
ATOM   8749  N  N     . VAL F  6 98  ? -19.957 -4.714  34.207 1.00 32.29  ? 95   VAL D N     1 
ATOM   8750  C  CA    . VAL F  6 98  ? -19.244 -4.007  35.268 1.00 32.44  ? 95   VAL D CA    1 
ATOM   8751  C  C     . VAL F  6 98  ? -20.161 -3.755  36.462 1.00 33.14  ? 95   VAL D C     1 
ATOM   8752  O  O     . VAL F  6 98  ? -19.777 -4.001  37.597 1.00 33.00  ? 95   VAL D O     1 
ATOM   8753  C  CB    . VAL F  6 98  ? -18.613 -2.714  34.732 1.00 31.88  ? 95   VAL D CB    1 
ATOM   8754  C  CG1   . VAL F  6 98  ? -18.200 -1.785  35.860 1.00 31.90  ? 95   VAL D CG1   1 
ATOM   8755  C  CG2   . VAL F  6 98  ? -17.416 -3.068  33.884 1.00 32.05  ? 95   VAL D CG2   1 
ATOM   8756  N  N     . ARG F  6 99  ? -21.378 -3.286  36.194 1.00 34.45  ? 96   ARG D N     1 
ATOM   8757  C  CA    . ARG F  6 99  ? -22.397 -3.094  37.226 1.00 35.88  ? 96   ARG D CA    1 
ATOM   8758  C  C     . ARG F  6 99  ? -22.839 -4.399  37.889 1.00 35.86  ? 96   ARG D C     1 
ATOM   8759  O  O     . ARG F  6 99  ? -23.174 -4.400  39.070 1.00 36.44  ? 96   ARG D O     1 
ATOM   8760  C  CB    . ARG F  6 99  ? -23.615 -2.393  36.645 1.00 36.54  ? 96   ARG D CB    1 
ATOM   8761  C  CG    . ARG F  6 99  ? -23.548 -0.881  36.706 1.00 40.36  ? 96   ARG D CG    1 
ATOM   8762  C  CD    . ARG F  6 99  ? -24.791 -0.242  36.082 1.00 45.22  ? 96   ARG D CD    1 
ATOM   8763  N  NE    . ARG F  6 99  ? -24.651 1.220   36.057 1.00 52.09  ? 96   ARG D NE    1 
ATOM   8764  C  CZ    . ARG F  6 99  ? -25.102 2.018   35.080 1.00 55.26  ? 96   ARG D CZ    1 
ATOM   8765  N  NH1   . ARG F  6 99  ? -25.733 1.518   34.010 1.00 55.24  ? 96   ARG D NH1   1 
ATOM   8766  N  NH2   . ARG F  6 99  ? -24.904 3.330   35.162 1.00 56.45  ? 96   ARG D NH2   1 
ATOM   8767  N  N     . LEU F  6 100 ? -22.854 -5.495  37.132 1.00 35.58  ? 97   LEU D N     1 
ATOM   8768  C  CA    . LEU F  6 100 ? -23.187 -6.811  37.687 1.00 35.27  ? 97   LEU D CA    1 
ATOM   8769  C  C     . LEU F  6 100 ? -22.071 -7.364  38.554 1.00 35.62  ? 97   LEU D C     1 
ATOM   8770  O  O     . LEU F  6 100 ? -22.330 -7.977  39.578 1.00 36.17  ? 97   LEU D O     1 
ATOM   8771  C  CB    . LEU F  6 100 ? -23.535 -7.818  36.584 1.00 34.62  ? 97   LEU D CB    1 
ATOM   8772  C  CG    . LEU F  6 100 ? -24.920 -7.686  35.935 1.00 33.22  ? 97   LEU D CG    1 
ATOM   8773  C  CD1   . LEU F  6 100 ? -25.076 -8.598  34.745 1.00 31.39  ? 97   LEU D CD1   1 
ATOM   8774  C  CD2   . LEU F  6 100 ? -26.038 -7.915  36.924 1.00 30.77  ? 97   LEU D CD2   1 
ATOM   8775  N  N     . LEU F  6 101 ? -20.833 -7.106  38.159 1.00 36.03  ? 98   LEU D N     1 
ATOM   8776  C  CA    . LEU F  6 101 ? -19.686 -7.733  38.771 1.00 36.08  ? 98   LEU D CA    1 
ATOM   8777  C  C     . LEU F  6 101 ? -19.086 -7.018  39.968 1.00 36.16  ? 98   LEU D C     1 
ATOM   8778  O  O     . LEU F  6 101 ? -18.718 -7.675  40.928 1.00 36.90  ? 98   LEU D O     1 
ATOM   8779  C  CB    . LEU F  6 101 ? -18.598 -7.974  37.728 1.00 36.29  ? 98   LEU D CB    1 
ATOM   8780  C  CG    . LEU F  6 101 ? -17.503 -8.965  38.152 1.00 37.49  ? 98   LEU D CG    1 
ATOM   8781  C  CD1   . LEU F  6 101 ? -18.046 -10.388 38.138 1.00 39.21  ? 98   LEU D CD1   1 
ATOM   8782  C  CD2   . LEU F  6 101 ? -16.291 -8.851  37.263 1.00 36.74  ? 98   LEU D CD2   1 
ATOM   8783  N  N     . LEU F  6 102 ? -18.949 -5.700  39.915 1.00 36.37  ? 99   LEU D N     1 
ATOM   8784  C  CA    . LEU F  6 102 ? -18.230 -4.963  40.958 1.00 36.63  ? 99   LEU D CA    1 
ATOM   8785  C  C     . LEU F  6 102 ? -19.147 -4.428  42.047 1.00 37.21  ? 99   LEU D C     1 
ATOM   8786  O  O     . LEU F  6 102 ? -20.261 -4.002  41.770 1.00 37.43  ? 99   LEU D O     1 
ATOM   8787  C  CB    . LEU F  6 102 ? -17.441 -3.801  40.355 1.00 36.61  ? 99   LEU D CB    1 
ATOM   8788  C  CG    . LEU F  6 102 ? -16.491 -4.021  39.180 1.00 36.90  ? 99   LEU D CG    1 
ATOM   8789  C  CD1   . LEU F  6 102 ? -15.773 -2.750  38.893 1.00 36.74  ? 99   LEU D CD1   1 
ATOM   8790  C  CD2   . LEU F  6 102 ? -15.475 -5.090  39.482 1.00 38.39  ? 99   LEU D CD2   1 
ATOM   8791  N  N     . PRO F  6 103 ? -18.684 -4.433  43.305 1.00 38.20  ? 100  PRO D N     1 
ATOM   8792  C  CA    . PRO F  6 103 ? -19.578 -3.909  44.345 1.00 38.89  ? 100  PRO D CA    1 
ATOM   8793  C  C     . PRO F  6 103 ? -19.669 -2.392  44.319 1.00 39.70  ? 100  PRO D C     1 
ATOM   8794  O  O     . PRO F  6 103 ? -18.675 -1.721  44.036 1.00 40.22  ? 100  PRO D O     1 
ATOM   8795  C  CB    . PRO F  6 103 ? -18.928 -4.361  45.654 1.00 38.47  ? 100  PRO D CB    1 
ATOM   8796  C  CG    . PRO F  6 103 ? -17.651 -5.041  45.290 1.00 38.28  ? 100  PRO D CG    1 
ATOM   8797  C  CD    . PRO F  6 103 ? -17.389 -4.889  43.843 1.00 38.11  ? 100  PRO D CD    1 
ATOM   8798  N  N     . GLY F  6 104 ? -20.866 -1.878  44.575 1.00 40.45  ? 101  GLY D N     1 
ATOM   8799  C  CA    . GLY F  6 104 ? -21.086 -0.481  44.957 1.00 41.65  ? 101  GLY D CA    1 
ATOM   8800  C  C     . GLY F  6 104 ? -20.146 0.580   44.427 1.00 42.50  ? 101  GLY D C     1 
ATOM   8801  O  O     . GLY F  6 104 ? -20.268 1.018   43.281 1.00 42.82  ? 101  GLY D O     1 
ATOM   8802  N  N     . GLU F  6 105 ? -19.194 0.986   45.255 1.00 43.08  ? 102  GLU D N     1 
ATOM   8803  C  CA    . GLU F  6 105 ? -18.376 2.153   44.940 1.00 43.77  ? 102  GLU D CA    1 
ATOM   8804  C  C     . GLU F  6 105 ? -17.392 1.960   43.811 1.00 43.53  ? 102  GLU D C     1 
ATOM   8805  O  O     . GLU F  6 105 ? -17.045 2.929   43.149 1.00 44.42  ? 102  GLU D O     1 
ATOM   8806  C  CB    . GLU F  6 105 ? -17.647 2.659   46.183 1.00 44.31  ? 102  GLU D CB    1 
ATOM   8807  C  CG    . GLU F  6 105 ? -17.332 4.150   46.171 1.00 47.28  ? 102  GLU D CG    1 
ATOM   8808  C  CD    . GLU F  6 105 ? -18.565 5.021   45.932 1.00 51.65  ? 102  GLU D CD    1 
ATOM   8809  O  OE1   . GLU F  6 105 ? -19.704 4.603   46.289 1.00 51.17  ? 102  GLU D OE1   1 
ATOM   8810  O  OE2   . GLU F  6 105 ? -18.379 6.135   45.379 1.00 54.30  ? 102  GLU D OE2   1 
ATOM   8811  N  N     . LEU F  6 106 ? -16.923 0.735   43.581 1.00 43.00  ? 103  LEU D N     1 
ATOM   8812  C  CA    . LEU F  6 106 ? -16.017 0.499   42.450 1.00 42.10  ? 103  LEU D CA    1 
ATOM   8813  C  C     . LEU F  6 106 ? -16.774 0.517   41.121 1.00 42.04  ? 103  LEU D C     1 
ATOM   8814  O  O     . LEU F  6 106 ? -16.229 0.936   40.109 1.00 41.86  ? 103  LEU D O     1 
ATOM   8815  C  CB    . LEU F  6 106 ? -15.242 -0.805  42.602 1.00 41.87  ? 103  LEU D CB    1 
ATOM   8816  C  CG    . LEU F  6 106 ? -14.167 -0.962  43.677 1.00 41.01  ? 103  LEU D CG    1 
ATOM   8817  C  CD1   . LEU F  6 106 ? -13.824 -2.451  43.812 1.00 41.12  ? 103  LEU D CD1   1 
ATOM   8818  C  CD2   . LEU F  6 106 ? -12.926 -0.158  43.359 1.00 39.19  ? 103  LEU D CD2   1 
ATOM   8819  N  N     . ALA F  6 107 ? -18.026 0.062   41.127 1.00 41.94  ? 104  ALA D N     1 
ATOM   8820  C  CA    . ALA F  6 107 ? -18.856 0.088   39.926 1.00 42.42  ? 104  ALA D CA    1 
ATOM   8821  C  C     . ALA F  6 107 ? -19.068 1.527   39.449 1.00 43.05  ? 104  ALA D C     1 
ATOM   8822  O  O     . ALA F  6 107 ? -18.817 1.855   38.287 1.00 42.82  ? 104  ALA D O     1 
ATOM   8823  C  CB    . ALA F  6 107 ? -20.183 -0.578  40.191 1.00 42.28  ? 104  ALA D CB    1 
ATOM   8824  N  N     . LYS F  6 108 ? -19.524 2.376   40.371 1.00 43.79  ? 105  LYS D N     1 
ATOM   8825  C  CA    . LYS F  6 108 ? -19.685 3.809   40.154 1.00 44.28  ? 105  LYS D CA    1 
ATOM   8826  C  C     . LYS F  6 108 ? -18.460 4.395   39.466 1.00 43.33  ? 105  LYS D C     1 
ATOM   8827  O  O     . LYS F  6 108 ? -18.568 5.054   38.427 1.00 43.62  ? 105  LYS D O     1 
ATOM   8828  C  CB    . LYS F  6 108 ? -19.933 4.500   41.494 1.00 44.22  ? 105  LYS D CB    1 
ATOM   8829  C  CG    . LYS F  6 108 ? -20.466 5.925   41.393 1.00 46.51  ? 105  LYS D CG    1 
ATOM   8830  C  CD    . LYS F  6 108 ? -20.446 6.666   42.760 1.00 46.97  ? 105  LYS D CD    1 
ATOM   8831  C  CE    . LYS F  6 108 ? -21.485 6.105   43.780 1.00 50.67  ? 105  LYS D CE    1 
ATOM   8832  N  NZ    . LYS F  6 108 ? -21.291 6.676   45.166 1.00 48.87  ? 105  LYS D NZ    1 
ATOM   8833  N  N     . HIS F  6 109 ? -17.285 4.122   40.011 1.00 42.60  ? 106  HIS D N     1 
ATOM   8834  C  CA    . HIS F  6 109 ? -16.079 4.674   39.426 1.00 42.17  ? 106  HIS D CA    1 
ATOM   8835  C  C     . HIS F  6 109 ? -15.616 4.019   38.140 1.00 41.63  ? 106  HIS D C     1 
ATOM   8836  O  O     . HIS F  6 109 ? -15.035 4.681   37.271 1.00 41.55  ? 106  HIS D O     1 
ATOM   8837  C  CB    . HIS F  6 109 ? -14.960 4.681   40.439 1.00 42.45  ? 106  HIS D CB    1 
ATOM   8838  C  CG    . HIS F  6 109 ? -15.071 5.789   41.427 1.00 44.70  ? 106  HIS D CG    1 
ATOM   8839  N  ND1   . HIS F  6 109 ? -15.344 5.568   42.759 1.00 48.15  ? 106  HIS D ND1   1 
ATOM   8840  C  CD2   . HIS F  6 109 ? -14.974 7.131   41.273 1.00 46.74  ? 106  HIS D CD2   1 
ATOM   8841  C  CE1   . HIS F  6 109 ? -15.397 6.728   43.390 1.00 49.93  ? 106  HIS D CE1   1 
ATOM   8842  N  NE2   . HIS F  6 109 ? -15.179 7.692   42.509 1.00 49.81  ? 106  HIS D NE2   1 
ATOM   8843  N  N     . ALA F  6 110 ? -15.861 2.717   38.016 1.00 41.25  ? 107  ALA D N     1 
ATOM   8844  C  CA    . ALA F  6 110 ? -15.367 1.979   36.870 1.00 40.59  ? 107  ALA D CA    1 
ATOM   8845  C  C     . ALA F  6 110 ? -16.131 2.457   35.666 1.00 40.34  ? 107  ALA D C     1 
ATOM   8846  O  O     . ALA F  6 110 ? -15.555 2.674   34.608 1.00 40.23  ? 107  ALA D O     1 
ATOM   8847  C  CB    . ALA F  6 110 ? -15.542 0.500   37.077 1.00 40.47  ? 107  ALA D CB    1 
ATOM   8848  N  N     . VAL F  6 111 ? -17.430 2.654   35.868 1.00 40.53  ? 108  VAL D N     1 
ATOM   8849  C  CA    . VAL F  6 111 ? -18.356 3.122   34.844 1.00 40.95  ? 108  VAL D CA    1 
ATOM   8850  C  C     . VAL F  6 111 ? -17.994 4.505   34.333 1.00 41.49  ? 108  VAL D C     1 
ATOM   8851  O  O     . VAL F  6 111 ? -17.953 4.718   33.122 1.00 41.63  ? 108  VAL D O     1 
ATOM   8852  C  CB    . VAL F  6 111 ? -19.809 3.089   35.353 1.00 41.01  ? 108  VAL D CB    1 
ATOM   8853  C  CG1   . VAL F  6 111 ? -20.740 3.826   34.406 1.00 39.91  ? 108  VAL D CG1   1 
ATOM   8854  C  CG2   . VAL F  6 111 ? -20.256 1.636   35.554 1.00 40.81  ? 108  VAL D CG2   1 
ATOM   8855  N  N     . SER F  6 112 ? -17.726 5.440   35.245 1.00 42.13  ? 109  SER D N     1 
ATOM   8856  C  CA    . SER F  6 112 ? -17.173 6.736   34.839 1.00 42.82  ? 109  SER D CA    1 
ATOM   8857  C  C     . SER F  6 112 ? -15.939 6.586   33.977 1.00 42.54  ? 109  SER D C     1 
ATOM   8858  O  O     . SER F  6 112 ? -15.904 7.089   32.851 1.00 42.75  ? 109  SER D O     1 
ATOM   8859  C  CB    . SER F  6 112 ? -16.845 7.614   36.033 1.00 42.86  ? 109  SER D CB    1 
ATOM   8860  O  OG    . SER F  6 112 ? -18.000 8.335   36.389 1.00 45.66  ? 109  SER D OG    1 
ATOM   8861  N  N     . GLU F  6 113 ? -14.939 5.888   34.499 1.00 42.46  ? 110  GLU D N     1 
ATOM   8862  C  CA    . GLU F  6 113 ? -13.677 5.719   33.783 1.00 42.80  ? 110  GLU D CA    1 
ATOM   8863  C  C     . GLU F  6 113 ? -13.897 5.075   32.420 1.00 42.49  ? 110  GLU D C     1 
ATOM   8864  O  O     . GLU F  6 113 ? -13.208 5.396   31.451 1.00 41.94  ? 110  GLU D O     1 
ATOM   8865  C  CB    . GLU F  6 113 ? -12.682 4.923   34.628 1.00 42.83  ? 110  GLU D CB    1 
ATOM   8866  C  CG    . GLU F  6 113 ? -11.936 5.762   35.657 1.00 44.80  ? 110  GLU D CG    1 
ATOM   8867  C  CD    . GLU F  6 113 ? -10.575 6.248   35.152 1.00 49.43  ? 110  GLU D CD    1 
ATOM   8868  O  OE1   . GLU F  6 113 ? -10.377 7.501   35.033 1.00 48.64  ? 110  GLU D OE1   1 
ATOM   8869  O  OE2   . GLU F  6 113 ? -9.708  5.367   34.870 1.00 50.55  ? 110  GLU D OE2   1 
ATOM   8870  N  N     . GLY F  6 114 ? -14.884 4.183   32.356 1.00 42.63  ? 111  GLY D N     1 
ATOM   8871  C  CA    . GLY F  6 114 ? -15.225 3.499   31.113 1.00 43.01  ? 111  GLY D CA    1 
ATOM   8872  C  C     . GLY F  6 114 ? -15.876 4.414   30.083 1.00 43.09  ? 111  GLY D C     1 
ATOM   8873  O  O     . GLY F  6 114 ? -15.461 4.444   28.913 1.00 42.38  ? 111  GLY D O     1 
ATOM   8874  N  N     . THR F  6 115 ? -16.902 5.144   30.526 1.00 43.12  ? 112  THR D N     1 
ATOM   8875  C  CA    . THR F  6 115 ? -17.591 6.111   29.680 1.00 43.89  ? 112  THR D CA    1 
ATOM   8876  C  C     . THR F  6 115 ? -16.601 7.147   29.130 1.00 44.21  ? 112  THR D C     1 
ATOM   8877  O  O     . THR F  6 115 ? -16.526 7.363   27.922 1.00 44.36  ? 112  THR D O     1 
ATOM   8878  C  CB    . THR F  6 115 ? -18.733 6.827   30.436 1.00 43.62  ? 112  THR D CB    1 
ATOM   8879  O  OG1   . THR F  6 115 ? -19.630 5.857   31.003 1.00 44.80  ? 112  THR D OG1   1 
ATOM   8880  C  CG2   . THR F  6 115 ? -19.511 7.686   29.483 1.00 43.78  ? 112  THR D CG2   1 
ATOM   8881  N  N     . LYS F  6 116 ? -15.825 7.742   30.029 1.00 44.42  ? 113  LYS D N     1 
ATOM   8882  C  CA    . LYS F  6 116 ? -14.850 8.750   29.690 1.00 45.21  ? 113  LYS D CA    1 
ATOM   8883  C  C     . LYS F  6 116 ? -13.904 8.300   28.602 1.00 45.23  ? 113  LYS D C     1 
ATOM   8884  O  O     . LYS F  6 116 ? -13.584 9.080   27.714 1.00 46.18  ? 113  LYS D O     1 
ATOM   8885  C  CB    . LYS F  6 116 ? -14.074 9.165   30.941 1.00 45.24  ? 113  LYS D CB    1 
ATOM   8886  C  CG    . LYS F  6 116 ? -12.988 10.220  30.758 1.00 45.54  ? 113  LYS D CG    1 
ATOM   8887  C  CD    . LYS F  6 116 ? -12.377 10.572  32.131 1.00 47.28  ? 113  LYS D CD    1 
ATOM   8888  C  CE    . LYS F  6 116 ? -10.984 11.221  32.022 1.00 50.89  ? 113  LYS D CE    1 
ATOM   8889  N  NZ    . LYS F  6 116 ? -10.091 10.477  31.079 1.00 53.29  ? 113  LYS D NZ    1 
ATOM   8890  N  N     . ALA F  6 117 ? -13.454 7.055   28.653 1.00 45.68  ? 114  ALA D N     1 
ATOM   8891  C  CA    . ALA F  6 117 ? -12.479 6.580   27.685 1.00 45.82  ? 114  ALA D CA    1 
ATOM   8892  C  C     . ALA F  6 117 ? -13.133 6.396   26.345 1.00 46.41  ? 114  ALA D C     1 
ATOM   8893  O  O     . ALA F  6 117 ? -12.526 6.701   25.329 1.00 46.64  ? 114  ALA D O     1 
ATOM   8894  C  CB    . ALA F  6 117 ? -11.840 5.294   28.138 1.00 45.73  ? 114  ALA D CB    1 
ATOM   8895  N  N     . VAL F  6 118 ? -14.372 5.906   26.340 1.00 47.38  ? 115  VAL D N     1 
ATOM   8896  C  CA    . VAL F  6 118 ? -15.085 5.604   25.083 1.00 48.29  ? 115  VAL D CA    1 
ATOM   8897  C  C     . VAL F  6 118 ? -15.467 6.886   24.358 1.00 48.85  ? 115  VAL D C     1 
ATOM   8898  O  O     . VAL F  6 118 ? -15.229 7.017   23.154 1.00 48.57  ? 115  VAL D O     1 
ATOM   8899  C  CB    . VAL F  6 118 ? -16.303 4.649   25.307 1.00 48.47  ? 115  VAL D CB    1 
ATOM   8900  C  CG1   . VAL F  6 118 ? -17.332 4.731   24.168 1.00 48.00  ? 115  VAL D CG1   1 
ATOM   8901  C  CG2   . VAL F  6 118 ? -15.809 3.224   25.479 1.00 47.92  ? 115  VAL D CG2   1 
ATOM   8902  N  N     . THR F  6 119 ? -16.037 7.822   25.116 1.00 49.70  ? 116  THR D N     1 
ATOM   8903  C  CA    . THR F  6 119 ? -16.236 9.202   24.685 1.00 50.54  ? 116  THR D CA    1 
ATOM   8904  C  C     . THR F  6 119 ? -14.948 9.853   24.132 1.00 51.15  ? 116  THR D C     1 
ATOM   8905  O  O     . THR F  6 119 ? -14.922 10.336  22.993 1.00 51.28  ? 116  THR D O     1 
ATOM   8906  C  CB    . THR F  6 119 ? -16.798 10.027  25.831 1.00 50.32  ? 116  THR D CB    1 
ATOM   8907  O  OG1   . THR F  6 119 ? -17.983 9.391   26.326 1.00 51.76  ? 116  THR D OG1   1 
ATOM   8908  C  CG2   . THR F  6 119 ? -17.168 11.389  25.354 1.00 51.10  ? 116  THR D CG2   1 
ATOM   8909  N  N     . LYS F  6 120 ? -13.877 9.852   24.912 1.00 51.73  ? 117  LYS D N     1 
ATOM   8910  C  CA    . LYS F  6 120 ? -12.638 10.443  24.429 1.00 52.88  ? 117  LYS D CA    1 
ATOM   8911  C  C     . LYS F  6 120 ? -12.174 9.743   23.153 1.00 53.36  ? 117  LYS D C     1 
ATOM   8912  O  O     . LYS F  6 120 ? -11.570 10.361  22.279 1.00 53.95  ? 117  LYS D O     1 
ATOM   8913  C  CB    . LYS F  6 120 ? -11.547 10.464  25.520 1.00 53.01  ? 117  LYS D CB    1 
ATOM   8914  C  CG    . LYS F  6 120 ? -10.133 10.761  24.999 1.00 53.40  ? 117  LYS D CG    1 
ATOM   8915  C  CD    . LYS F  6 120 ? -9.206  11.403  26.037 1.00 53.40  ? 117  LYS D CD    1 
ATOM   8916  C  CE    . LYS F  6 120 ? -7.847  11.738  25.383 1.00 54.59  ? 117  LYS D CE    1 
ATOM   8917  N  NZ    . LYS F  6 120 ? -7.112  12.889  26.007 1.00 54.81  ? 117  LYS D NZ    1 
ATOM   8918  N  N     . TYR F  6 121 ? -12.485 8.459   23.036 1.00 54.04  ? 118  TYR D N     1 
ATOM   8919  C  CA    . TYR F  6 121 ? -12.089 7.670   21.869 1.00 54.44  ? 118  TYR D CA    1 
ATOM   8920  C  C     . TYR F  6 121 ? -12.964 8.007   20.648 1.00 55.34  ? 118  TYR D C     1 
ATOM   8921  O  O     . TYR F  6 121 ? -12.465 8.132   19.533 1.00 54.53  ? 118  TYR D O     1 
ATOM   8922  C  CB    . TYR F  6 121 ? -12.165 6.174   22.212 1.00 53.79  ? 118  TYR D CB    1 
ATOM   8923  C  CG    . TYR F  6 121 ? -11.816 5.244   21.081 1.00 52.29  ? 118  TYR D CG    1 
ATOM   8924  C  CD1   . TYR F  6 121 ? -10.499 4.870   20.852 1.00 51.45  ? 118  TYR D CD1   1 
ATOM   8925  C  CD2   . TYR F  6 121 ? -12.805 4.726   20.252 1.00 50.98  ? 118  TYR D CD2   1 
ATOM   8926  C  CE1   . TYR F  6 121 ? -10.168 4.015   19.820 1.00 51.53  ? 118  TYR D CE1   1 
ATOM   8927  C  CE2   . TYR F  6 121 ? -12.488 3.877   19.210 1.00 50.79  ? 118  TYR D CE2   1 
ATOM   8928  C  CZ    . TYR F  6 121 ? -11.168 3.522   19.002 1.00 52.19  ? 118  TYR D CZ    1 
ATOM   8929  O  OH    . TYR F  6 121 ? -10.836 2.674   17.970 1.00 53.34  ? 118  TYR D OH    1 
ATOM   8930  N  N     . THR F  6 122 ? -14.268 8.143   20.889 1.00 56.91  ? 119  THR D N     1 
ATOM   8931  C  CA    . THR F  6 122 ? -15.255 8.458   19.862 1.00 58.75  ? 119  THR D CA    1 
ATOM   8932  C  C     . THR F  6 122 ? -14.915 9.766   19.129 1.00 60.02  ? 119  THR D C     1 
ATOM   8933  O  O     . THR F  6 122 ? -15.046 9.844   17.906 1.00 59.92  ? 119  THR D O     1 
ATOM   8934  C  CB    . THR F  6 122 ? -16.689 8.514   20.473 1.00 58.77  ? 119  THR D CB    1 
ATOM   8935  O  OG1   . THR F  6 122 ? -16.995 7.256   21.083 1.00 58.95  ? 119  THR D OG1   1 
ATOM   8936  C  CG2   . THR F  6 122 ? -17.746 8.799   19.420 1.00 58.88  ? 119  THR D CG2   1 
ATOM   8937  N  N     . SER F  6 123 ? -14.455 10.775  19.874 1.00 61.78  ? 120  SER D N     1 
ATOM   8938  C  CA    . SER F  6 123 ? -14.147 12.090  19.293 1.00 63.31  ? 120  SER D CA    1 
ATOM   8939  C  C     . SER F  6 123 ? -12.755 12.174  18.696 1.00 64.21  ? 120  SER D C     1 
ATOM   8940  O  O     . SER F  6 123 ? -12.409 13.182  18.080 1.00 64.38  ? 120  SER D O     1 
ATOM   8941  C  CB    . SER F  6 123 ? -14.283 13.192  20.338 1.00 63.31  ? 120  SER D CB    1 
ATOM   8942  O  OG    . SER F  6 123 ? -13.195 13.150  21.252 1.00 63.60  ? 120  SER D OG    1 
ATOM   8943  N  N     . ALA F  6 124 ? -11.957 11.131  18.884 1.00 65.43  ? 121  ALA D N     1 
ATOM   8944  C  CA    . ALA F  6 124 ? -10.544 11.198  18.529 1.00 67.01  ? 121  ALA D CA    1 
ATOM   8945  C  C     . ALA F  6 124 ? -10.160 10.416  17.274 1.00 68.21  ? 121  ALA D C     1 
ATOM   8946  O  O     . ALA F  6 124 ? -9.102  9.779   17.226 1.00 68.62  ? 121  ALA D O     1 
ATOM   8947  C  CB    . ALA F  6 124 ? -9.675  10.786  19.717 1.00 67.14  ? 121  ALA D CB    1 
ATOM   8948  N  N     . LYS F  6 125 ? -11.021 10.462  16.261 1.00 69.74  ? 122  LYS D N     1 
ATOM   8949  C  CA    . LYS F  6 125 ? -10.670 9.994   14.911 1.00 71.15  ? 122  LYS D CA    1 
ATOM   8950  C  C     . LYS F  6 125 ? -11.600 10.619  13.872 1.00 71.48  ? 122  LYS D C     1 
ATOM   8951  O  O     . LYS F  6 125 ? -11.210 11.587  13.206 1.00 71.75  ? 122  LYS D O     1 
ATOM   8952  C  CB    . LYS F  6 125 ? -10.690 8.458   14.801 1.00 71.19  ? 122  LYS D CB    1 
ATOM   8953  C  CG    . LYS F  6 125 ? -10.282 7.940   13.412 1.00 72.01  ? 122  LYS D CG    1 
ATOM   8954  C  CD    . LYS F  6 125 ? -10.468 6.432   13.274 1.00 72.00  ? 122  LYS D CD    1 
ATOM   8955  C  CE    . LYS F  6 125 ? -9.835  5.938   11.979 1.00 73.08  ? 122  LYS D CE    1 
ATOM   8956  N  NZ    . LYS F  6 125 ? -9.187  4.605   12.154 1.00 73.45  ? 122  LYS D NZ    1 
ATOM   8957  O  OXT   . LYS F  6 125 ? -12.748 10.170  13.688 1.00 71.89  ? 122  LYS D OXT   1 
ATOM   8958  N  N     . PRO G  3 38  ? 14.084  -21.779 87.948 1.00 60.66  ? 38   PRO E N     1 
ATOM   8959  C  CA    . PRO G  3 38  ? 13.743  -21.930 86.523 1.00 60.40  ? 38   PRO E CA    1 
ATOM   8960  C  C     . PRO G  3 38  ? 12.437  -21.221 86.150 1.00 59.99  ? 38   PRO E C     1 
ATOM   8961  O  O     . PRO G  3 38  ? 11.450  -21.282 86.896 1.00 60.24  ? 38   PRO E O     1 
ATOM   8962  C  CB    . PRO G  3 38  ? 13.610  -23.453 86.337 1.00 60.39  ? 38   PRO E CB    1 
ATOM   8963  C  CG    . PRO G  3 38  ? 13.360  -24.014 87.727 1.00 60.69  ? 38   PRO E CG    1 
ATOM   8964  C  CD    . PRO G  3 38  ? 13.620  -22.920 88.763 1.00 60.81  ? 38   PRO E CD    1 
ATOM   8965  N  N     . HIS G  3 39  ? 12.442  -20.566 84.993 1.00 59.26  ? 39   HIS E N     1 
ATOM   8966  C  CA    . HIS G  3 39  ? 11.334  -19.714 84.554 1.00 57.97  ? 39   HIS E CA    1 
ATOM   8967  C  C     . HIS G  3 39  ? 10.297  -20.447 83.685 1.00 56.75  ? 39   HIS E C     1 
ATOM   8968  O  O     . HIS G  3 39  ? 10.662  -21.211 82.775 1.00 56.70  ? 39   HIS E O     1 
ATOM   8969  C  CB    . HIS G  3 39  ? 11.897  -18.519 83.795 1.00 58.32  ? 39   HIS E CB    1 
ATOM   8970  C  CG    . HIS G  3 39  ? 10.861  -17.744 83.051 1.00 59.78  ? 39   HIS E CG    1 
ATOM   8971  N  ND1   . HIS G  3 39  ? 10.570  -17.981 81.724 1.00 60.09  ? 39   HIS E ND1   1 
ATOM   8972  C  CD2   . HIS G  3 39  ? 10.028  -16.754 83.454 1.00 60.97  ? 39   HIS E CD2   1 
ATOM   8973  C  CE1   . HIS G  3 39  ? 9.603   -17.168 81.342 1.00 60.82  ? 39   HIS E CE1   1 
ATOM   8974  N  NE2   . HIS G  3 39  ? 9.261   -16.407 82.368 1.00 61.15  ? 39   HIS E NE2   1 
ATOM   8975  N  N     . ARG G  3 40  ? 9.012   -20.193 83.963 1.00 54.66  ? 40   ARG E N     1 
ATOM   8976  C  CA    . ARG G  3 40  ? 7.908   -20.794 83.210 1.00 52.27  ? 40   ARG E CA    1 
ATOM   8977  C  C     . ARG G  3 40  ? 6.841   -19.800 82.808 1.00 50.80  ? 40   ARG E C     1 
ATOM   8978  O  O     . ARG G  3 40  ? 6.242   -19.139 83.664 1.00 50.54  ? 40   ARG E O     1 
ATOM   8979  C  CB    . ARG G  3 40  ? 7.228   -21.891 84.023 1.00 52.43  ? 40   ARG E CB    1 
ATOM   8980  C  CG    . ARG G  3 40  ? 7.817   -23.240 83.818 1.00 52.59  ? 40   ARG E CG    1 
ATOM   8981  C  CD    . ARG G  3 40  ? 6.774   -24.341 83.821 1.00 52.47  ? 40   ARG E CD    1 
ATOM   8982  N  NE    . ARG G  3 40  ? 7.335   -25.508 83.144 1.00 54.35  ? 40   ARG E NE    1 
ATOM   8983  C  CZ    . ARG G  3 40  ? 6.719   -26.226 82.213 1.00 54.45  ? 40   ARG E CZ    1 
ATOM   8984  N  NH1   . ARG G  3 40  ? 5.473   -25.948 81.847 1.00 53.28  ? 40   ARG E NH1   1 
ATOM   8985  N  NH2   . ARG G  3 40  ? 7.355   -27.259 81.671 1.00 55.57  ? 40   ARG E NH2   1 
ATOM   8986  N  N     . TYR G  3 41  ? 6.576   -19.723 81.507 1.00 48.70  ? 41   TYR E N     1 
ATOM   8987  C  CA    . TYR G  3 41  ? 5.419   -18.976 81.031 1.00 47.03  ? 41   TYR E CA    1 
ATOM   8988  C  C     . TYR G  3 41  ? 4.131   -19.773 81.279 1.00 46.48  ? 41   TYR E C     1 
ATOM   8989  O  O     . TYR G  3 41  ? 4.101   -20.989 81.144 1.00 46.35  ? 41   TYR E O     1 
ATOM   8990  C  CB    . TYR G  3 41  ? 5.572   -18.630 79.552 1.00 46.40  ? 41   TYR E CB    1 
ATOM   8991  C  CG    . TYR G  3 41  ? 6.607   -17.577 79.265 1.00 44.96  ? 41   TYR E CG    1 
ATOM   8992  C  CD1   . TYR G  3 41  ? 7.718   -17.863 78.482 1.00 43.68  ? 41   TYR E CD1   1 
ATOM   8993  C  CD2   . TYR G  3 41  ? 6.467   -16.281 79.770 1.00 45.52  ? 41   TYR E CD2   1 
ATOM   8994  C  CE1   . TYR G  3 41  ? 8.674   -16.888 78.209 1.00 44.34  ? 41   TYR E CE1   1 
ATOM   8995  C  CE2   . TYR G  3 41  ? 7.415   -15.295 79.514 1.00 44.45  ? 41   TYR E CE2   1 
ATOM   8996  C  CZ    . TYR G  3 41  ? 8.515   -15.607 78.729 1.00 45.20  ? 41   TYR E CZ    1 
ATOM   8997  O  OH    . TYR G  3 41  ? 9.455   -14.634 78.477 1.00 45.57  ? 41   TYR E OH    1 
ATOM   8998  N  N     . ARG G  3 42  ? 3.066   -19.090 81.647 1.00 45.82  ? 42   ARG E N     1 
ATOM   8999  C  CA    . ARG G  3 42  ? 1.818   -19.772 81.922 1.00 45.97  ? 42   ARG E CA    1 
ATOM   9000  C  C     . ARG G  3 42  ? 1.116   -20.285 80.648 1.00 45.26  ? 42   ARG E C     1 
ATOM   9001  O  O     . ARG G  3 42  ? 1.206   -19.655 79.591 1.00 45.47  ? 42   ARG E O     1 
ATOM   9002  C  CB    . ARG G  3 42  ? 0.917   -18.849 82.718 1.00 46.16  ? 42   ARG E CB    1 
ATOM   9003  C  CG    . ARG G  3 42  ? 1.433   -18.608 84.126 1.00 49.57  ? 42   ARG E CG    1 
ATOM   9004  C  CD    . ARG G  3 42  ? 0.787   -17.379 84.710 1.00 55.70  ? 42   ARG E CD    1 
ATOM   9005  N  NE    . ARG G  3 42  ? -0.661  -17.422 84.511 1.00 59.92  ? 42   ARG E NE    1 
ATOM   9006  C  CZ    . ARG G  3 42  ? -1.490  -16.421 84.783 1.00 62.52  ? 42   ARG E CZ    1 
ATOM   9007  N  NH1   . ARG G  3 42  ? -1.014  -15.275 85.270 1.00 63.31  ? 42   ARG E NH1   1 
ATOM   9008  N  NH2   . ARG G  3 42  ? -2.796  -16.570 84.570 1.00 63.05  ? 42   ARG E NH2   1 
ATOM   9009  N  N     . PRO G  3 43  ? 0.430   -21.442 80.738 1.00 44.42  ? 43   PRO E N     1 
ATOM   9010  C  CA    . PRO G  3 43  ? -0.267  -21.971 79.573 1.00 43.89  ? 43   PRO E CA    1 
ATOM   9011  C  C     . PRO G  3 43  ? -1.182  -20.945 78.911 1.00 43.41  ? 43   PRO E C     1 
ATOM   9012  O  O     . PRO G  3 43  ? -2.134  -20.441 79.526 1.00 43.28  ? 43   PRO E O     1 
ATOM   9013  C  CB    . PRO G  3 43  ? -1.079  -23.150 80.137 1.00 43.78  ? 43   PRO E CB    1 
ATOM   9014  C  CG    . PRO G  3 43  ? -0.969  -23.065 81.610 1.00 43.92  ? 43   PRO E CG    1 
ATOM   9015  C  CD    . PRO G  3 43  ? 0.290   -22.337 81.899 1.00 44.64  ? 43   PRO E CD    1 
ATOM   9016  N  N     . GLY G  3 44  ? -0.883  -20.645 77.654 1.00 42.71  ? 44   GLY E N     1 
ATOM   9017  C  CA    . GLY G  3 44  ? -1.671  -19.675 76.907 1.00 41.78  ? 44   GLY E CA    1 
ATOM   9018  C  C     . GLY G  3 44  ? -0.838  -18.497 76.459 1.00 40.88  ? 44   GLY E C     1 
ATOM   9019  O  O     . GLY G  3 44  ? -1.173  -17.833 75.489 1.00 41.06  ? 44   GLY E O     1 
ATOM   9020  N  N     . THR G  3 45  ? 0.264   -18.248 77.155 1.00 39.90  ? 45   THR E N     1 
ATOM   9021  C  CA    . THR G  3 45  ? 1.019   -17.037 76.915 1.00 38.67  ? 45   THR E CA    1 
ATOM   9022  C  C     . THR G  3 45  ? 1.867   -17.183 75.667 1.00 37.87  ? 45   THR E C     1 
ATOM   9023  O  O     . THR G  3 45  ? 1.807   -16.337 74.770 1.00 38.50  ? 45   THR E O     1 
ATOM   9024  C  CB    . THR G  3 45  ? 1.843   -16.609 78.165 1.00 39.13  ? 45   THR E CB    1 
ATOM   9025  O  OG1   . THR G  3 45  ? 0.947   -16.336 79.263 1.00 39.15  ? 45   THR E OG1   1 
ATOM   9026  C  CG2   . THR G  3 45  ? 2.676   -15.369 77.876 1.00 38.03  ? 45   THR E CG2   1 
ATOM   9027  N  N     . VAL G  3 46  ? 2.640   -18.255 75.594 1.00 36.49  ? 46   VAL E N     1 
ATOM   9028  C  CA    . VAL G  3 46  ? 3.460   -18.511 74.427 1.00 35.26  ? 46   VAL E CA    1 
ATOM   9029  C  C     . VAL G  3 46  ? 2.543   -18.648 73.214 1.00 34.86  ? 46   VAL E C     1 
ATOM   9030  O  O     . VAL G  3 46  ? 2.869   -18.197 72.117 1.00 34.62  ? 46   VAL E O     1 
ATOM   9031  C  CB    . VAL G  3 46  ? 4.281   -19.805 74.608 1.00 35.07  ? 46   VAL E CB    1 
ATOM   9032  C  CG1   . VAL G  3 46  ? 5.304   -19.980 73.476 1.00 35.44  ? 46   VAL E CG1   1 
ATOM   9033  C  CG2   . VAL G  3 46  ? 4.990   -19.777 75.923 1.00 35.01  ? 46   VAL E CG2   1 
ATOM   9034  N  N     . ALA G  3 47  ? 1.380   -19.257 73.428 1.00 34.38  ? 47   ALA E N     1 
ATOM   9035  C  CA    . ALA G  3 47  ? 0.419   -19.477 72.364 1.00 34.03  ? 47   ALA E CA    1 
ATOM   9036  C  C     . ALA G  3 47  ? -0.016  -18.176 71.695 1.00 33.86  ? 47   ALA E C     1 
ATOM   9037  O  O     . ALA G  3 47  ? -0.043  -18.104 70.458 1.00 34.17  ? 47   ALA E O     1 
ATOM   9038  C  CB    . ALA G  3 47  ? -0.778  -20.270 72.877 1.00 34.18  ? 47   ALA E CB    1 
ATOM   9039  N  N     . LEU G  3 48  ? -0.328  -17.152 72.493 1.00 33.33  ? 48   LEU E N     1 
ATOM   9040  C  CA    . LEU G  3 48  ? -0.663  -15.831 71.946 1.00 33.53  ? 48   LEU E CA    1 
ATOM   9041  C  C     . LEU G  3 48  ? 0.522   -15.167 71.274 1.00 33.24  ? 48   LEU E C     1 
ATOM   9042  O  O     . LEU G  3 48  ? 0.352   -14.426 70.317 1.00 33.29  ? 48   LEU E O     1 
ATOM   9043  C  CB    . LEU G  3 48  ? -1.213  -14.894 73.016 1.00 33.67  ? 48   LEU E CB    1 
ATOM   9044  C  CG    . LEU G  3 48  ? -2.523  -15.296 73.679 1.00 34.27  ? 48   LEU E CG    1 
ATOM   9045  C  CD1   . LEU G  3 48  ? -2.752  -14.408 74.883 1.00 34.53  ? 48   LEU E CD1   1 
ATOM   9046  C  CD2   . LEU G  3 48  ? -3.707  -15.236 72.685 1.00 34.66  ? 48   LEU E CD2   1 
ATOM   9047  N  N     . ARG G  3 49  ? 1.716   -15.428 71.783 1.00 33.07  ? 49   ARG E N     1 
ATOM   9048  C  CA    . ARG G  3 49  ? 2.936   -14.966 71.156 1.00 33.68  ? 49   ARG E CA    1 
ATOM   9049  C  C     . ARG G  3 49  ? 3.098   -15.612 69.799 1.00 33.83  ? 49   ARG E C     1 
ATOM   9050  O  O     . ARG G  3 49  ? 3.614   -15.005 68.869 1.00 33.91  ? 49   ARG E O     1 
ATOM   9051  C  CB    . ARG G  3 49  ? 4.128   -15.342 72.023 1.00 34.35  ? 49   ARG E CB    1 
ATOM   9052  C  CG    . ARG G  3 49  ? 5.349   -14.476 71.829 1.00 36.75  ? 49   ARG E CG    1 
ATOM   9053  C  CD    . ARG G  3 49  ? 6.672   -15.278 71.877 1.00 42.73  ? 49   ARG E CD    1 
ATOM   9054  N  NE    . ARG G  3 49  ? 7.091   -15.762 73.207 1.00 44.60  ? 49   ARG E NE    1 
ATOM   9055  C  CZ    . ARG G  3 49  ? 6.596   -15.352 74.371 1.00 45.84  ? 49   ARG E CZ    1 
ATOM   9056  N  NH1   . ARG G  3 49  ? 5.652   -14.412 74.423 1.00 45.81  ? 49   ARG E NH1   1 
ATOM   9057  N  NH2   . ARG G  3 49  ? 7.054   -15.886 75.494 1.00 46.31  ? 49   ARG E NH2   1 
ATOM   9058  N  N     . GLU G  3 50  ? 2.668   -16.861 69.677 1.00 34.13  ? 50   GLU E N     1 
ATOM   9059  C  CA    . GLU G  3 50  ? 2.755   -17.540 68.398 1.00 34.49  ? 50   GLU E CA    1 
ATOM   9060  C  C     . GLU G  3 50  ? 1.678   -17.041 67.423 1.00 33.25  ? 50   GLU E C     1 
ATOM   9061  O  O     . GLU G  3 50  ? 1.958   -16.862 66.250 1.00 33.16  ? 50   GLU E O     1 
ATOM   9062  C  CB    . GLU G  3 50  ? 2.673   -19.047 68.587 1.00 34.65  ? 50   GLU E CB    1 
ATOM   9063  C  CG    . GLU G  3 50  ? 3.927   -19.697 69.166 1.00 36.62  ? 50   GLU E CG    1 
ATOM   9064  C  CD    . GLU G  3 50  ? 3.712   -21.182 69.505 1.00 37.31  ? 50   GLU E CD    1 
ATOM   9065  O  OE1   . GLU G  3 50  ? 4.676   -21.836 69.989 1.00 41.60  ? 50   GLU E OE1   1 
ATOM   9066  O  OE2   . GLU G  3 50  ? 2.577   -21.692 69.302 1.00 40.79  ? 50   GLU E OE2   1 
ATOM   9067  N  N     . ILE G  3 51  ? 0.455   -16.813 67.906 1.00 32.26  ? 51   ILE E N     1 
ATOM   9068  C  CA    . ILE G  3 51  ? -0.582  -16.210 67.067 1.00 31.35  ? 51   ILE E CA    1 
ATOM   9069  C  C     . ILE G  3 51  ? -0.077  -14.921 66.423 1.00 31.32  ? 51   ILE E C     1 
ATOM   9070  O  O     . ILE G  3 51  ? -0.151  -14.767 65.211 1.00 30.50  ? 51   ILE E O     1 
ATOM   9071  C  CB    . ILE G  3 51  ? -1.878  -15.914 67.830 1.00 31.20  ? 51   ILE E CB    1 
ATOM   9072  C  CG1   . ILE G  3 51  ? -2.482  -17.193 68.386 1.00 31.01  ? 51   ILE E CG1   1 
ATOM   9073  C  CG2   . ILE G  3 51  ? -2.889  -15.264 66.903 1.00 30.80  ? 51   ILE E CG2   1 
ATOM   9074  C  CD1   . ILE G  3 51  ? -3.767  -16.985 69.186 1.00 31.26  ? 51   ILE E CD1   1 
ATOM   9075  N  N     . ARG G  3 52  ? 0.473   -14.019 67.231 1.00 31.65  ? 52   ARG E N     1 
ATOM   9076  C  CA    . ARG G  3 52  ? 0.980   -12.755 66.716 1.00 32.40  ? 52   ARG E CA    1 
ATOM   9077  C  C     . ARG G  3 52  ? 2.131   -13.017 65.762 1.00 32.01  ? 52   ARG E C     1 
ATOM   9078  O  O     . ARG G  3 52  ? 2.261   -12.356 64.727 1.00 32.24  ? 52   ARG E O     1 
ATOM   9079  C  CB    . ARG G  3 52  ? 1.404   -11.799 67.848 1.00 32.69  ? 52   ARG E CB    1 
ATOM   9080  C  CG    . ARG G  3 52  ? 0.242   -11.340 68.787 1.00 33.98  ? 52   ARG E CG    1 
ATOM   9081  C  CD    . ARG G  3 52  ? 0.728   -10.427 69.891 1.00 33.77  ? 52   ARG E CD    1 
ATOM   9082  N  NE    . ARG G  3 52  ? 0.148   -10.730 71.203 1.00 39.69  ? 52   ARG E NE    1 
ATOM   9083  C  CZ    . ARG G  3 52  ? -1.041  -10.287 71.636 1.00 43.03  ? 52   ARG E CZ    1 
ATOM   9084  N  NH1   . ARG G  3 52  ? -1.818  -9.541  70.854 1.00 45.60  ? 52   ARG E NH1   1 
ATOM   9085  N  NH2   . ARG G  3 52  ? -1.468  -10.593 72.856 1.00 43.62  ? 52   ARG E NH2   1 
ATOM   9086  N  N     . ARG G  3 53  ? 2.961   -13.997 66.085 1.00 31.92  ? 53   ARG E N     1 
ATOM   9087  C  CA    . ARG G  3 53  ? 4.123   -14.235 65.263 1.00 31.77  ? 53   ARG E CA    1 
ATOM   9088  C  C     . ARG G  3 53  ? 3.699   -14.747 63.898 1.00 31.81  ? 53   ARG E C     1 
ATOM   9089  O  O     . ARG G  3 53  ? 4.132   -14.202 62.876 1.00 32.00  ? 53   ARG E O     1 
ATOM   9090  C  CB    . ARG G  3 53  ? 5.083   -15.204 65.926 1.00 32.13  ? 53   ARG E CB    1 
ATOM   9091  C  CG    . ARG G  3 53  ? 6.251   -15.514 65.041 1.00 34.21  ? 53   ARG E CG    1 
ATOM   9092  C  CD    . ARG G  3 53  ? 7.133   -16.583 65.600 1.00 40.19  ? 53   ARG E CD    1 
ATOM   9093  N  NE    . ARG G  3 53  ? 8.037   -17.049 64.549 1.00 44.19  ? 53   ARG E NE    1 
ATOM   9094  C  CZ    . ARG G  3 53  ? 8.774   -18.156 64.622 1.00 46.09  ? 53   ARG E CZ    1 
ATOM   9095  N  NH1   . ARG G  3 53  ? 8.735   -18.930 65.713 1.00 44.52  ? 53   ARG E NH1   1 
ATOM   9096  N  NH2   . ARG G  3 53  ? 9.553   -18.484 63.595 1.00 46.87  ? 53   ARG E NH2   1 
ATOM   9097  N  N     . TYR G  3 54  ? 2.841   -15.777 63.877 1.00 31.06  ? 54   TYR E N     1 
ATOM   9098  C  CA    . TYR G  3 54  ? 2.398   -16.353 62.606 1.00 30.87  ? 54   TYR E CA    1 
ATOM   9099  C  C     . TYR G  3 54  ? 1.461   -15.490 61.775 1.00 30.89  ? 54   TYR E C     1 
ATOM   9100  O  O     . TYR G  3 54  ? 1.441   -15.639 60.548 1.00 30.90  ? 54   TYR E O     1 
ATOM   9101  C  CB    . TYR G  3 54  ? 1.888   -17.804 62.750 1.00 29.93  ? 54   TYR E CB    1 
ATOM   9102  C  CG    . TYR G  3 54  ? 3.014   -18.664 63.179 1.00 29.17  ? 54   TYR E CG    1 
ATOM   9103  C  CD1   . TYR G  3 54  ? 3.012   -19.285 64.429 1.00 28.18  ? 54   TYR E CD1   1 
ATOM   9104  C  CD2   . TYR G  3 54  ? 4.153   -18.775 62.382 1.00 27.36  ? 54   TYR E CD2   1 
ATOM   9105  C  CE1   . TYR G  3 54  ? 4.093   -20.013 64.846 1.00 25.52  ? 54   TYR E CE1   1 
ATOM   9106  C  CE2   . TYR G  3 54  ? 5.228   -19.511 62.797 1.00 26.32  ? 54   TYR E CE2   1 
ATOM   9107  C  CZ    . TYR G  3 54  ? 5.188   -20.127 64.020 1.00 26.56  ? 54   TYR E CZ    1 
ATOM   9108  O  OH    . TYR G  3 54  ? 6.265   -20.870 64.409 1.00 29.39  ? 54   TYR E OH    1 
ATOM   9109  N  N     . GLN G  3 55  ? 0.699   -14.616 62.428 1.00 31.31  ? 55   GLN E N     1 
ATOM   9110  C  CA    . GLN G  3 55  ? -0.258  -13.755 61.716 1.00 32.21  ? 55   GLN E CA    1 
ATOM   9111  C  C     . GLN G  3 55  ? 0.426   -12.596 61.032 1.00 33.11  ? 55   GLN E C     1 
ATOM   9112  O  O     . GLN G  3 55  ? -0.161  -11.939 60.175 1.00 33.37  ? 55   GLN E O     1 
ATOM   9113  C  CB    . GLN G  3 55  ? -1.360  -13.255 62.632 1.00 31.54  ? 55   GLN E CB    1 
ATOM   9114  C  CG    . GLN G  3 55  ? -2.458  -14.262 62.774 1.00 31.66  ? 55   GLN E CG    1 
ATOM   9115  C  CD    . GLN G  3 55  ? -3.634  -13.740 63.549 1.00 33.09  ? 55   GLN E CD    1 
ATOM   9116  O  OE1   . GLN G  3 55  ? -3.573  -12.663 64.142 1.00 32.68  ? 55   GLN E OE1   1 
ATOM   9117  N  NE2   . GLN G  3 55  ? -4.731  -14.501 63.543 1.00 32.96  ? 55   GLN E NE2   1 
ATOM   9118  N  N     . LYS G  3 56  ? 1.686   -12.393 61.396 1.00 34.29  ? 56   LYS E N     1 
ATOM   9119  C  CA    . LYS G  3 56  ? 2.526   -11.314 60.909 1.00 35.25  ? 56   LYS E CA    1 
ATOM   9120  C  C     . LYS G  3 56  ? 3.329   -11.778 59.693 1.00 35.26  ? 56   LYS E C     1 
ATOM   9121  O  O     . LYS G  3 56  ? 3.723   -10.968 58.847 1.00 35.84  ? 56   LYS E O     1 
ATOM   9122  C  CB    . LYS G  3 56  ? 3.480   -10.932 62.040 1.00 35.62  ? 56   LYS E CB    1 
ATOM   9123  C  CG    . LYS G  3 56  ? 4.039   -9.548  61.971 1.00 40.03  ? 56   LYS E CG    1 
ATOM   9124  C  CD    . LYS G  3 56  ? 4.609   -9.118  63.336 1.00 44.51  ? 56   LYS E CD    1 
ATOM   9125  C  CE    . LYS G  3 56  ? 4.974   -7.604  63.320 1.00 47.62  ? 56   LYS E CE    1 
ATOM   9126  N  NZ    . LYS G  3 56  ? 5.379   -7.068  64.670 1.00 45.65  ? 56   LYS E NZ    1 
ATOM   9127  N  N     . SER G  3 57  ? 3.597   -13.076 59.604 1.00 34.96  ? 57   SER E N     1 
ATOM   9128  C  CA    . SER G  3 57  ? 4.422   -13.582 58.510 1.00 35.02  ? 57   SER E CA    1 
ATOM   9129  C  C     . SER G  3 57  ? 3.612   -14.240 57.395 1.00 34.94  ? 57   SER E C     1 
ATOM   9130  O  O     . SER G  3 57  ? 2.412   -14.520 57.544 1.00 34.46  ? 57   SER E O     1 
ATOM   9131  C  CB    . SER G  3 57  ? 5.531   -14.501 59.030 1.00 35.06  ? 57   SER E CB    1 
ATOM   9132  O  OG    . SER G  3 57  ? 5.049   -15.392 60.023 1.00 36.27  ? 57   SER E OG    1 
ATOM   9133  N  N     . THR G  3 58  ? 4.270   -14.463 56.261 1.00 35.28  ? 58   THR E N     1 
ATOM   9134  C  CA    . THR G  3 58  ? 3.600   -15.054 55.103 1.00 35.31  ? 58   THR E CA    1 
ATOM   9135  C  C     . THR G  3 58  ? 4.243   -16.357 54.603 1.00 35.68  ? 58   THR E C     1 
ATOM   9136  O  O     . THR G  3 58  ? 3.767   -16.929 53.621 1.00 36.30  ? 58   THR E O     1 
ATOM   9137  C  CB    . THR G  3 58  ? 3.523   -14.052 53.927 1.00 35.36  ? 58   THR E CB    1 
ATOM   9138  O  OG1   . THR G  3 58  ? 4.845   -13.670 53.541 1.00 34.59  ? 58   THR E OG1   1 
ATOM   9139  C  CG2   . THR G  3 58  ? 2.721   -12.796 54.304 1.00 35.22  ? 58   THR E CG2   1 
ATOM   9140  N  N     . GLU G  3 59  ? 5.309   -16.829 55.255 1.00 35.73  ? 59   GLU E N     1 
ATOM   9141  C  CA    . GLU G  3 59  ? 5.949   -18.090 54.840 1.00 35.95  ? 59   GLU E CA    1 
ATOM   9142  C  C     . GLU G  3 59  ? 5.088   -19.305 55.089 1.00 35.27  ? 59   GLU E C     1 
ATOM   9143  O  O     . GLU G  3 59  ? 4.292   -19.334 56.031 1.00 35.09  ? 59   GLU E O     1 
ATOM   9144  C  CB    . GLU G  3 59  ? 7.343   -18.305 55.448 1.00 36.13  ? 59   GLU E CB    1 
ATOM   9145  C  CG    . GLU G  3 59  ? 7.581   -17.674 56.806 1.00 40.15  ? 59   GLU E CG    1 
ATOM   9146  C  CD    . GLU G  3 59  ? 6.930   -18.426 57.932 1.00 44.09  ? 59   GLU E CD    1 
ATOM   9147  O  OE1   . GLU G  3 59  ? 6.553   -19.583 57.696 1.00 49.34  ? 59   GLU E OE1   1 
ATOM   9148  O  OE2   . GLU G  3 59  ? 6.796   -17.879 59.051 1.00 45.18  ? 59   GLU E OE2   1 
ATOM   9149  N  N     . LEU G  3 60  ? 5.258   -20.294 54.213 1.00 34.93  ? 60   LEU E N     1 
ATOM   9150  C  CA    . LEU G  3 60  ? 4.602   -21.589 54.315 1.00 34.65  ? 60   LEU E CA    1 
ATOM   9151  C  C     . LEU G  3 60  ? 5.013   -22.299 55.589 1.00 34.62  ? 60   LEU E C     1 
ATOM   9152  O  O     . LEU G  3 60  ? 6.174   -22.224 56.019 1.00 34.84  ? 60   LEU E O     1 
ATOM   9153  C  CB    . LEU G  3 60  ? 4.935   -22.441 53.100 1.00 34.63  ? 60   LEU E CB    1 
ATOM   9154  C  CG    . LEU G  3 60  ? 4.330   -21.925 51.791 1.00 34.57  ? 60   LEU E CG    1 
ATOM   9155  C  CD1   . LEU G  3 60  ? 4.801   -22.748 50.615 1.00 34.09  ? 60   LEU E CD1   1 
ATOM   9156  C  CD2   . LEU G  3 60  ? 2.795   -21.881 51.852 1.00 33.79  ? 60   LEU E CD2   1 
ATOM   9157  N  N     . LEU G  3 61  ? 4.051   -22.957 56.207 1.00 34.15  ? 61   LEU E N     1 
ATOM   9158  C  CA    . LEU G  3 61  ? 4.223   -23.433 57.572 1.00 34.17  ? 61   LEU E CA    1 
ATOM   9159  C  C     . LEU G  3 61  ? 4.509   -24.947 57.698 1.00 34.45  ? 61   LEU E C     1 
ATOM   9160  O  O     . LEU G  3 61  ? 4.971   -25.405 58.755 1.00 34.14  ? 61   LEU E O     1 
ATOM   9161  C  CB    . LEU G  3 61  ? 3.014   -23.009 58.401 1.00 33.89  ? 61   LEU E CB    1 
ATOM   9162  C  CG    . LEU G  3 61  ? 2.799   -21.487 58.515 1.00 33.98  ? 61   LEU E CG    1 
ATOM   9163  C  CD1   . LEU G  3 61  ? 1.452   -21.100 59.175 1.00 30.34  ? 61   LEU E CD1   1 
ATOM   9164  C  CD2   . LEU G  3 61  ? 3.974   -20.841 59.252 1.00 32.25  ? 61   LEU E CD2   1 
ATOM   9165  N  N     . ILE G  3 62  ? 4.234   -25.685 56.610 1.00 34.61  ? 62   ILE E N     1 
ATOM   9166  C  CA    . ILE G  3 62  ? 4.459   -27.124 56.458 1.00 34.55  ? 62   ILE E CA    1 
ATOM   9167  C  C     . ILE G  3 62  ? 5.782   -27.278 55.738 1.00 34.54  ? 62   ILE E C     1 
ATOM   9168  O  O     . ILE G  3 62  ? 6.068   -26.502 54.838 1.00 35.04  ? 62   ILE E O     1 
ATOM   9169  C  CB    . ILE G  3 62  ? 3.353   -27.755 55.562 1.00 34.46  ? 62   ILE E CB    1 
ATOM   9170  C  CG1   . ILE G  3 62  ? 1.986   -27.657 56.238 1.00 35.46  ? 62   ILE E CG1   1 
ATOM   9171  C  CG2   . ILE G  3 62  ? 3.666   -29.205 55.190 1.00 33.41  ? 62   ILE E CG2   1 
ATOM   9172  C  CD1   . ILE G  3 62  ? 0.843   -28.342 55.476 1.00 35.31  ? 62   ILE E CD1   1 
ATOM   9173  N  N     . ARG G  3 63  ? 6.574   -28.280 56.113 1.00 34.65  ? 63   ARG E N     1 
ATOM   9174  C  CA    . ARG G  3 63  ? 7.871   -28.548 55.485 1.00 34.71  ? 63   ARG E CA    1 
ATOM   9175  C  C     . ARG G  3 63  ? 7.722   -28.981 54.025 1.00 34.50  ? 63   ARG E C     1 
ATOM   9176  O  O     . ARG G  3 63  ? 6.837   -29.774 53.690 1.00 34.21  ? 63   ARG E O     1 
ATOM   9177  C  CB    . ARG G  3 63  ? 8.634   -29.611 56.271 1.00 35.18  ? 63   ARG E CB    1 
ATOM   9178  C  CG    . ARG G  3 63  ? 8.923   -29.277 57.732 1.00 36.93  ? 63   ARG E CG    1 
ATOM   9179  C  CD    . ARG G  3 63  ? 10.172  -28.407 57.916 1.00 42.84  ? 63   ARG E CD    1 
ATOM   9180  N  NE    . ARG G  3 63  ? 9.825   -27.014 58.245 1.00 47.07  ? 63   ARG E NE    1 
ATOM   9181  C  CZ    . ARG G  3 63  ? 9.902   -25.990 57.393 1.00 48.48  ? 63   ARG E CZ    1 
ATOM   9182  N  NH1   . ARG G  3 63  ? 10.336  -26.191 56.146 1.00 49.24  ? 63   ARG E NH1   1 
ATOM   9183  N  NH2   . ARG G  3 63  ? 9.553   -24.762 57.786 1.00 47.32  ? 63   ARG E NH2   1 
ATOM   9184  N  N     . LYS G  3 64  ? 8.587   -28.463 53.153 1.00 34.45  ? 64   LYS E N     1 
ATOM   9185  C  CA    . LYS G  3 64  ? 8.385   -28.630 51.708 1.00 34.56  ? 64   LYS E CA    1 
ATOM   9186  C  C     . LYS G  3 64  ? 8.358   -30.086 51.275 1.00 33.81  ? 64   LYS E C     1 
ATOM   9187  O  O     . LYS G  3 64  ? 7.381   -30.534 50.695 1.00 34.05  ? 64   LYS E O     1 
ATOM   9188  C  CB    . LYS G  3 64  ? 9.404   -27.839 50.886 1.00 34.86  ? 64   LYS E CB    1 
ATOM   9189  C  CG    . LYS G  3 64  ? 9.147   -26.342 50.885 1.00 37.65  ? 64   LYS E CG    1 
ATOM   9190  C  CD    . LYS G  3 64  ? 9.440   -25.738 49.508 1.00 43.82  ? 64   LYS E CD    1 
ATOM   9191  C  CE    . LYS G  3 64  ? 9.840   -24.251 49.581 1.00 47.55  ? 64   LYS E CE    1 
ATOM   9192  N  NZ    . LYS G  3 64  ? 9.069   -23.453 50.609 1.00 49.31  ? 64   LYS E NZ    1 
ATOM   9193  N  N     . LEU G  3 65  ? 9.425   -30.818 51.584 1.00 33.14  ? 65   LEU E N     1 
ATOM   9194  C  CA    . LEU G  3 65  ? 9.575   -32.212 51.170 1.00 32.15  ? 65   LEU E CA    1 
ATOM   9195  C  C     . LEU G  3 65  ? 8.428   -33.135 51.588 1.00 30.98  ? 65   LEU E C     1 
ATOM   9196  O  O     . LEU G  3 65  ? 7.883   -33.837 50.741 1.00 30.73  ? 65   LEU E O     1 
ATOM   9197  C  CB    . LEU G  3 65  ? 10.900  -32.780 51.666 1.00 32.62  ? 65   LEU E CB    1 
ATOM   9198  C  CG    . LEU G  3 65  ? 11.246  -34.177 51.166 1.00 32.06  ? 65   LEU E CG    1 
ATOM   9199  C  CD1   . LEU G  3 65  ? 11.385  -34.192 49.663 1.00 32.74  ? 65   LEU E CD1   1 
ATOM   9200  C  CD2   . LEU G  3 65  ? 12.549  -34.541 51.805 1.00 33.78  ? 65   LEU E CD2   1 
ATOM   9201  N  N     . PRO G  3 66  ? 8.085   -33.169 52.885 1.00 29.87  ? 66   PRO E N     1 
ATOM   9202  C  CA    . PRO G  3 66  ? 6.947   -33.977 53.329 1.00 29.43  ? 66   PRO E CA    1 
ATOM   9203  C  C     . PRO G  3 66  ? 5.685   -33.665 52.534 1.00 29.35  ? 66   PRO E C     1 
ATOM   9204  O  O     . PRO G  3 66  ? 4.946   -34.581 52.163 1.00 28.94  ? 66   PRO E O     1 
ATOM   9205  C  CB    . PRO G  3 66  ? 6.740   -33.539 54.772 1.00 29.69  ? 66   PRO E CB    1 
ATOM   9206  C  CG    . PRO G  3 66  ? 8.070   -33.017 55.211 1.00 30.06  ? 66   PRO E CG    1 
ATOM   9207  C  CD    . PRO G  3 66  ? 8.770   -32.501 54.001 1.00 29.67  ? 66   PRO E CD    1 
ATOM   9208  N  N     . PHE G  3 67  ? 5.445   -32.377 52.270 1.00 29.26  ? 67   PHE E N     1 
ATOM   9209  C  CA    . PHE G  3 67  ? 4.255   -31.966 51.531 1.00 28.55  ? 67   PHE E CA    1 
ATOM   9210  C  C     . PHE G  3 67  ? 4.284   -32.469 50.098 1.00 28.99  ? 67   PHE E C     1 
ATOM   9211  O  O     . PHE G  3 67  ? 3.246   -32.813 49.548 1.00 28.51  ? 67   PHE E O     1 
ATOM   9212  C  CB    . PHE G  3 67  ? 4.031   -30.441 51.546 1.00 27.98  ? 67   PHE E CB    1 
ATOM   9213  C  CG    . PHE G  3 67  ? 2.780   -30.047 50.845 1.00 25.77  ? 67   PHE E CG    1 
ATOM   9214  C  CD1   . PHE G  3 67  ? 1.563   -30.169 51.477 1.00 24.99  ? 67   PHE E CD1   1 
ATOM   9215  C  CD2   . PHE G  3 67  ? 2.806   -29.674 49.526 1.00 23.11  ? 67   PHE E CD2   1 
ATOM   9216  C  CE1   . PHE G  3 67  ? 0.403   -29.880 50.810 1.00 25.28  ? 67   PHE E CE1   1 
ATOM   9217  C  CE2   . PHE G  3 67  ? 1.655   -29.409 48.861 1.00 23.28  ? 67   PHE E CE2   1 
ATOM   9218  C  CZ    . PHE G  3 67  ? 0.449   -29.494 49.503 1.00 24.49  ? 67   PHE E CZ    1 
ATOM   9219  N  N     . GLN G  3 68  ? 5.474   -32.480 49.508 1.00 29.91  ? 68   GLN E N     1 
ATOM   9220  C  CA    . GLN G  3 68  ? 5.687   -32.940 48.142 1.00 31.86  ? 68   GLN E CA    1 
ATOM   9221  C  C     . GLN G  3 68  ? 5.459   -34.452 48.010 1.00 31.72  ? 68   GLN E C     1 
ATOM   9222  O  O     . GLN G  3 68  ? 4.865   -34.918 47.028 1.00 32.32  ? 68   GLN E O     1 
ATOM   9223  C  CB    . GLN G  3 68  ? 7.101   -32.575 47.675 1.00 31.45  ? 68   GLN E CB    1 
ATOM   9224  C  CG    . GLN G  3 68  ? 7.303   -32.766 46.194 1.00 34.46  ? 68   GLN E CG    1 
ATOM   9225  C  CD    . GLN G  3 68  ? 8.594   -32.173 45.647 1.00 35.38  ? 68   GLN E CD    1 
ATOM   9226  O  OE1   . GLN G  3 68  ? 9.718   -32.482 46.115 1.00 39.36  ? 68   GLN E OE1   1 
ATOM   9227  N  NE2   . GLN G  3 68  ? 8.448   -31.349 44.610 1.00 39.18  ? 68   GLN E NE2   1 
ATOM   9228  N  N     . ARG G  3 69  ? 5.912   -35.211 49.004 1.00 31.64  ? 69   ARG E N     1 
ATOM   9229  C  CA    . ARG G  3 69  ? 5.735   -36.662 49.008 1.00 31.53  ? 69   ARG E CA    1 
ATOM   9230  C  C     . ARG G  3 69  ? 4.271   -37.017 49.113 1.00 31.19  ? 69   ARG E C     1 
ATOM   9231  O  O     . ARG G  3 69  ? 3.817   -37.955 48.462 1.00 31.03  ? 69   ARG E O     1 
ATOM   9232  C  CB    . ARG G  3 69  ? 6.432   -37.283 50.194 1.00 31.84  ? 69   ARG E CB    1 
ATOM   9233  C  CG    . ARG G  3 69  ? 7.898   -37.458 50.046 1.00 32.73  ? 69   ARG E CG    1 
ATOM   9234  C  CD    . ARG G  3 69  ? 8.355   -38.451 51.113 1.00 35.18  ? 69   ARG E CD    1 
ATOM   9235  N  NE    . ARG G  3 69  ? 9.331   -37.833 51.997 1.00 37.20  ? 69   ARG E NE    1 
ATOM   9236  C  CZ    . ARG G  3 69  ? 9.087   -37.483 53.248 1.00 37.07  ? 69   ARG E CZ    1 
ATOM   9237  N  NH1   . ARG G  3 69  ? 7.904   -37.713 53.801 1.00 37.50  ? 69   ARG E NH1   1 
ATOM   9238  N  NH2   . ARG G  3 69  ? 10.049  -36.926 53.951 1.00 38.58  ? 69   ARG E NH2   1 
ATOM   9239  N  N     . LEU G  3 70  ? 3.540   -36.269 49.941 1.00 30.49  ? 70   LEU E N     1 
ATOM   9240  C  CA    . LEU G  3 70  ? 2.110   -36.468 50.080 1.00 30.01  ? 70   LEU E CA    1 
ATOM   9241  C  C     . LEU G  3 70  ? 1.399   -36.190 48.773 1.00 30.25  ? 70   LEU E C     1 
ATOM   9242  O  O     . LEU G  3 70  ? 0.470   -36.912 48.381 1.00 30.67  ? 70   LEU E O     1 
ATOM   9243  C  CB    . LEU G  3 70  ? 1.542   -35.585 51.165 1.00 29.74  ? 70   LEU E CB    1 
ATOM   9244  C  CG    . LEU G  3 70  ? 0.022   -35.553 51.292 1.00 29.29  ? 70   LEU E CG    1 
ATOM   9245  C  CD1   . LEU G  3 70  ? -0.625  -36.968 51.441 1.00 24.95  ? 70   LEU E CD1   1 
ATOM   9246  C  CD2   . LEU G  3 70  ? -0.283  -34.666 52.476 1.00 27.03  ? 70   LEU E CD2   1 
ATOM   9247  N  N     . VAL G  3 71  ? 1.839   -35.164 48.069 1.00 30.17  ? 71   VAL E N     1 
ATOM   9248  C  CA    . VAL G  3 71  ? 1.206   -34.868 46.803 1.00 30.26  ? 71   VAL E CA    1 
ATOM   9249  C  C     . VAL G  3 71  ? 1.441   -36.010 45.820 1.00 30.64  ? 71   VAL E C     1 
ATOM   9250  O  O     . VAL G  3 71  ? 0.517   -36.441 45.136 1.00 30.50  ? 71   VAL E O     1 
ATOM   9251  C  CB    . VAL G  3 71  ? 1.627   -33.499 46.281 1.00 30.55  ? 71   VAL E CB    1 
ATOM   9252  C  CG1   . VAL G  3 71  ? 1.208   -33.297 44.817 1.00 29.55  ? 71   VAL E CG1   1 
ATOM   9253  C  CG2   . VAL G  3 71  ? 0.991   -32.439 47.186 1.00 29.90  ? 71   VAL E CG2   1 
ATOM   9254  N  N     . ARG G  3 72  ? 2.667   -36.524 45.785 1.00 30.90  ? 72   ARG E N     1 
ATOM   9255  C  CA    . ARG G  3 72  ? 2.993   -37.616 44.890 1.00 30.82  ? 72   ARG E CA    1 
ATOM   9256  C  C     . ARG G  3 72  ? 2.306   -38.925 45.278 1.00 30.60  ? 72   ARG E C     1 
ATOM   9257  O  O     . ARG G  3 72  ? 1.806   -39.631 44.425 1.00 30.82  ? 72   ARG E O     1 
ATOM   9258  C  CB    . ARG G  3 72  ? 4.479   -37.811 44.841 1.00 30.78  ? 72   ARG E CB    1 
ATOM   9259  C  CG    . ARG G  3 72  ? 5.170   -36.690 44.178 1.00 32.50  ? 72   ARG E CG    1 
ATOM   9260  C  CD    . ARG G  3 72  ? 6.617   -37.066 43.938 1.00 37.35  ? 72   ARG E CD    1 
ATOM   9261  N  NE    . ARG G  3 72  ? 7.455   -35.877 43.959 1.00 39.53  ? 72   ARG E NE    1 
ATOM   9262  C  CZ    . ARG G  3 72  ? 7.896   -35.229 42.886 1.00 39.29  ? 72   ARG E CZ    1 
ATOM   9263  N  NH1   . ARG G  3 72  ? 7.599   -35.632 41.661 1.00 36.68  ? 72   ARG E NH1   1 
ATOM   9264  N  NH2   . ARG G  3 72  ? 8.649   -34.155 43.060 1.00 43.66  ? 72   ARG E NH2   1 
ATOM   9265  N  N     . GLU G  3 73  ? 2.262   -39.250 46.556 1.00 30.32  ? 73   GLU E N     1 
ATOM   9266  C  CA    . GLU G  3 73  ? 1.553   -40.440 46.954 1.00 30.36  ? 73   GLU E CA    1 
ATOM   9267  C  C     . GLU G  3 73  ? 0.108   -40.357 46.471 1.00 30.28  ? 73   GLU E C     1 
ATOM   9268  O  O     . GLU G  3 73  ? -0.372  -41.284 45.844 1.00 30.70  ? 73   GLU E O     1 
ATOM   9269  C  CB    . GLU G  3 73  ? 1.634   -40.649 48.463 1.00 30.28  ? 73   GLU E CB    1 
ATOM   9270  C  CG    . GLU G  3 73  ? 0.855   -41.859 48.983 1.00 30.29  ? 73   GLU E CG    1 
ATOM   9271  C  CD    . GLU G  3 73  ? 0.733   -41.863 50.504 1.00 31.22  ? 73   GLU E CD    1 
ATOM   9272  O  OE1   . GLU G  3 73  ? 1.790   -41.734 51.172 1.00 32.27  ? 73   GLU E OE1   1 
ATOM   9273  O  OE2   . GLU G  3 73  ? -0.414  -41.990 51.030 1.00 32.80  ? 73   GLU E OE2   1 
ATOM   9274  N  N     . ILE G  3 74  ? -0.585  -39.258 46.753 1.00 30.19  ? 74   ILE E N     1 
ATOM   9275  C  CA    . ILE G  3 74  ? -1.989  -39.108 46.321 1.00 29.58  ? 74   ILE E CA    1 
ATOM   9276  C  C     . ILE G  3 74  ? -2.153  -39.120 44.787 1.00 30.19  ? 74   ILE E C     1 
ATOM   9277  O  O     . ILE G  3 74  ? -3.026  -39.844 44.248 1.00 30.34  ? 74   ILE E O     1 
ATOM   9278  C  CB    . ILE G  3 74  ? -2.649  -37.844 46.895 1.00 28.75  ? 74   ILE E CB    1 
ATOM   9279  C  CG1   . ILE G  3 74  ? -2.823  -37.988 48.391 1.00 28.07  ? 74   ILE E CG1   1 
ATOM   9280  C  CG2   . ILE G  3 74  ? -4.024  -37.629 46.296 1.00 28.01  ? 74   ILE E CG2   1 
ATOM   9281  C  CD1   . ILE G  3 74  ? -3.103  -36.697 49.083 1.00 28.19  ? 74   ILE E CD1   1 
ATOM   9282  N  N     . ALA G  3 75  ? -1.344  -38.325 44.087 1.00 29.63  ? 75   ALA E N     1 
ATOM   9283  C  CA    . ALA G  3 75  ? -1.439  -38.276 42.636 1.00 30.18  ? 75   ALA E CA    1 
ATOM   9284  C  C     . ALA G  3 75  ? -1.206  -39.666 42.048 1.00 30.85  ? 75   ALA E C     1 
ATOM   9285  O  O     . ALA G  3 75  ? -1.988  -40.130 41.204 1.00 30.79  ? 75   ALA E O     1 
ATOM   9286  C  CB    . ALA G  3 75  ? -0.473  -37.255 42.053 1.00 29.53  ? 75   ALA E CB    1 
ATOM   9287  N  N     . GLN G  3 76  ? -0.161  -40.336 42.535 1.00 31.57  ? 76   GLN E N     1 
ATOM   9288  C  CA    . GLN G  3 76  ? 0.179   -41.695 42.114 1.00 32.93  ? 76   GLN E CA    1 
ATOM   9289  C  C     . GLN G  3 76  ? -1.008  -42.648 42.159 1.00 33.16  ? 76   GLN E C     1 
ATOM   9290  O  O     . GLN G  3 76  ? -1.175  -43.449 41.251 1.00 33.09  ? 76   GLN E O     1 
ATOM   9291  C  CB    . GLN G  3 76  ? 1.298   -42.267 42.985 1.00 33.33  ? 76   GLN E CB    1 
ATOM   9292  C  CG    . GLN G  3 76  ? 2.183   -43.250 42.257 1.00 34.93  ? 76   GLN E CG    1 
ATOM   9293  C  CD    . GLN G  3 76  ? 3.199   -43.890 43.163 1.00 36.70  ? 76   GLN E CD    1 
ATOM   9294  O  OE1   . GLN G  3 76  ? 2.911   -44.208 44.308 1.00 38.32  ? 76   GLN E OE1   1 
ATOM   9295  N  NE2   . GLN G  3 76  ? 4.389   -44.111 42.642 1.00 38.52  ? 76   GLN E NE2   1 
ATOM   9296  N  N     . ASP G  3 77  ? -1.808  -42.564 43.219 1.00 33.61  ? 77   ASP E N     1 
ATOM   9297  C  CA    . ASP G  3 77  ? -3.003  -43.364 43.345 1.00 34.65  ? 77   ASP E CA    1 
ATOM   9298  C  C     . ASP G  3 77  ? -4.104  -43.049 42.318 1.00 35.67  ? 77   ASP E C     1 
ATOM   9299  O  O     . ASP G  3 77  ? -5.021  -43.851 42.161 1.00 36.17  ? 77   ASP E O     1 
ATOM   9300  C  CB    . ASP G  3 77  ? -3.554  -43.302 44.769 1.00 34.50  ? 77   ASP E CB    1 
ATOM   9301  C  CG    . ASP G  3 77  ? -2.655  -44.016 45.796 1.00 37.07  ? 77   ASP E CG    1 
ATOM   9302  O  OD1   . ASP G  3 77  ? -1.851  -44.915 45.422 1.00 38.38  ? 77   ASP E OD1   1 
ATOM   9303  O  OD2   . ASP G  3 77  ? -2.768  -43.693 47.007 1.00 39.79  ? 77   ASP E OD2   1 
ATOM   9304  N  N     . PHE G  3 78  ? -4.033  -41.908 41.626 1.00 36.62  ? 78   PHE E N     1 
ATOM   9305  C  CA    . PHE G  3 78  ? -4.941  -41.659 40.504 1.00 37.69  ? 78   PHE E CA    1 
ATOM   9306  C  C     . PHE G  3 78  ? -4.295  -42.107 39.212 1.00 38.33  ? 78   PHE E C     1 
ATOM   9307  O  O     . PHE G  3 78  ? -4.974  -42.591 38.322 1.00 38.55  ? 78   PHE E O     1 
ATOM   9308  C  CB    . PHE G  3 78  ? -5.336  -40.182 40.359 1.00 37.82  ? 78   PHE E CB    1 
ATOM   9309  C  CG    . PHE G  3 78  ? -6.315  -39.706 41.388 1.00 40.10  ? 78   PHE E CG    1 
ATOM   9310  C  CD1   . PHE G  3 78  ? -5.976  -38.668 42.274 1.00 42.14  ? 78   PHE E CD1   1 
ATOM   9311  C  CD2   . PHE G  3 78  ? -7.581  -40.279 41.493 1.00 41.61  ? 78   PHE E CD2   1 
ATOM   9312  C  CE1   . PHE G  3 78  ? -6.885  -38.222 43.259 1.00 41.64  ? 78   PHE E CE1   1 
ATOM   9313  C  CE2   . PHE G  3 78  ? -8.502  -39.825 42.478 1.00 42.55  ? 78   PHE E CE2   1 
ATOM   9314  C  CZ    . PHE G  3 78  ? -8.145  -38.797 43.355 1.00 40.54  ? 78   PHE E CZ    1 
ATOM   9315  N  N     . LYS G  3 79  ? -2.989  -41.916 39.088 1.00 39.42  ? 79   LYS E N     1 
ATOM   9316  C  CA    . LYS G  3 79  ? -2.326  -42.168 37.821 1.00 40.99  ? 79   LYS E CA    1 
ATOM   9317  C  C     . LYS G  3 79  ? -0.840  -42.387 38.020 1.00 41.61  ? 79   LYS E C     1 
ATOM   9318  O  O     . LYS G  3 79  ? -0.133  -41.526 38.540 1.00 42.02  ? 79   LYS E O     1 
ATOM   9319  C  CB    . LYS G  3 79  ? -2.558  -41.004 36.861 1.00 41.46  ? 79   LYS E CB    1 
ATOM   9320  C  CG    . LYS G  3 79  ? -2.746  -41.414 35.407 1.00 43.89  ? 79   LYS E CG    1 
ATOM   9321  C  CD    . LYS G  3 79  ? -1.437  -41.438 34.653 1.00 47.49  ? 79   LYS E CD    1 
ATOM   9322  C  CE    . LYS G  3 79  ? -1.527  -42.321 33.422 1.00 49.59  ? 79   LYS E CE    1 
ATOM   9323  N  NZ    . LYS G  3 79  ? -0.155  -42.694 32.962 1.00 52.11  ? 79   LYS E NZ    1 
ATOM   9324  N  N     . THR G  3 80  ? -0.370  -43.559 37.612 1.00 42.43  ? 80   THR E N     1 
ATOM   9325  C  CA    . THR G  3 80  ? 1.029   -43.903 37.772 1.00 42.94  ? 80   THR E CA    1 
ATOM   9326  C  C     . THR G  3 80  ? 1.867   -43.107 36.807 1.00 43.32  ? 80   THR E C     1 
ATOM   9327  O  O     . THR G  3 80  ? 1.366   -42.621 35.790 1.00 43.08  ? 80   THR E O     1 
ATOM   9328  C  CB    . THR G  3 80  ? 1.282   -45.390 37.512 1.00 43.24  ? 80   THR E CB    1 
ATOM   9329  O  OG1   . THR G  3 80  ? 0.522   -45.808 36.366 1.00 42.53  ? 80   THR E OG1   1 
ATOM   9330  C  CG2   . THR G  3 80  ? 0.919   -46.229 38.751 1.00 42.87  ? 80   THR E CG2   1 
ATOM   9331  N  N     . ASP G  3 81  ? 3.150   -42.987 37.147 1.00 44.11  ? 81   ASP E N     1 
ATOM   9332  C  CA    . ASP G  3 81  ? 4.171   -42.360 36.289 1.00 45.02  ? 81   ASP E CA    1 
ATOM   9333  C  C     . ASP G  3 81  ? 3.879   -40.902 35.926 1.00 44.21  ? 81   ASP E C     1 
ATOM   9334  O  O     . ASP G  3 81  ? 4.013   -40.521 34.767 1.00 45.15  ? 81   ASP E O     1 
ATOM   9335  C  CB    . ASP G  3 81  ? 4.393   -43.198 35.018 1.00 45.66  ? 81   ASP E CB    1 
ATOM   9336  C  CG    . ASP G  3 81  ? 4.480   -44.690 35.321 1.00 49.16  ? 81   ASP E CG    1 
ATOM   9337  O  OD1   . ASP G  3 81  ? 3.425   -45.383 35.215 1.00 51.13  ? 81   ASP E OD1   1 
ATOM   9338  O  OD2   . ASP G  3 81  ? 5.589   -45.150 35.710 1.00 52.84  ? 81   ASP E OD2   1 
ATOM   9339  N  N     . LEU G  3 82  ? 3.470   -40.101 36.906 1.00 42.87  ? 82   LEU E N     1 
ATOM   9340  C  CA    . LEU G  3 82  ? 3.361   -38.659 36.714 1.00 41.71  ? 82   LEU E CA    1 
ATOM   9341  C  C     . LEU G  3 82  ? 4.597   -37.928 37.229 1.00 41.12  ? 82   LEU E C     1 
ATOM   9342  O  O     . LEU G  3 82  ? 5.346   -38.443 38.050 1.00 40.89  ? 82   LEU E O     1 
ATOM   9343  C  CB    . LEU G  3 82  ? 2.127   -38.093 37.414 1.00 41.45  ? 82   LEU E CB    1 
ATOM   9344  C  CG    . LEU G  3 82  ? 0.753   -38.569 36.976 1.00 40.41  ? 82   LEU E CG    1 
ATOM   9345  C  CD1   . LEU G  3 82  ? -0.220  -38.251 38.083 1.00 38.20  ? 82   LEU E CD1   1 
ATOM   9346  C  CD2   . LEU G  3 82  ? 0.347   -37.905 35.668 1.00 40.33  ? 82   LEU E CD2   1 
ATOM   9347  N  N     . ARG G  3 83  ? 4.779   -36.715 36.733 1.00 40.69  ? 83   ARG E N     1 
ATOM   9348  C  CA    . ARG G  3 83  ? 5.816   -35.810 37.182 1.00 40.14  ? 83   ARG E CA    1 
ATOM   9349  C  C     . ARG G  3 83  ? 5.187   -34.486 37.575 1.00 39.28  ? 83   ARG E C     1 
ATOM   9350  O  O     . ARG G  3 83  ? 4.103   -34.127 37.099 1.00 39.02  ? 83   ARG E O     1 
ATOM   9351  C  CB    . ARG G  3 83  ? 6.785   -35.555 36.045 1.00 40.71  ? 83   ARG E CB    1 
ATOM   9352  C  CG    . ARG G  3 83  ? 7.621   -36.744 35.717 1.00 42.55  ? 83   ARG E CG    1 
ATOM   9353  C  CD    . ARG G  3 83  ? 8.353   -36.573 34.415 1.00 46.39  ? 83   ARG E CD    1 
ATOM   9354  N  NE    . ARG G  3 83  ? 9.586   -37.351 34.472 1.00 51.79  ? 83   ARG E NE    1 
ATOM   9355  C  CZ    . ARG G  3 83  ? 10.813  -36.848 34.340 1.00 53.60  ? 83   ARG E CZ    1 
ATOM   9356  N  NH1   . ARG G  3 83  ? 11.001  -35.544 34.086 1.00 52.70  ? 83   ARG E NH1   1 
ATOM   9357  N  NH2   . ARG G  3 83  ? 11.857  -37.667 34.433 1.00 54.27  ? 83   ARG E NH2   1 
ATOM   9358  N  N     . PHE G  3 84  ? 5.886   -33.738 38.416 1.00 38.09  ? 84   PHE E N     1 
ATOM   9359  C  CA    . PHE G  3 84  ? 5.399   -32.430 38.826 1.00 36.61  ? 84   PHE E CA    1 
ATOM   9360  C  C     . PHE G  3 84  ? 6.370   -31.299 38.580 1.00 35.96  ? 84   PHE E C     1 
ATOM   9361  O  O     . PHE G  3 84  ? 7.514   -31.357 39.016 1.00 36.07  ? 84   PHE E O     1 
ATOM   9362  C  CB    . PHE G  3 84  ? 5.070   -32.462 40.297 1.00 35.95  ? 84   PHE E CB    1 
ATOM   9363  C  CG    . PHE G  3 84  ? 3.761   -33.113 40.606 1.00 36.40  ? 84   PHE E CG    1 
ATOM   9364  C  CD1   . PHE G  3 84  ? 3.659   -34.503 40.710 1.00 34.17  ? 84   PHE E CD1   1 
ATOM   9365  C  CD2   . PHE G  3 84  ? 2.624   -32.336 40.834 1.00 36.30  ? 84   PHE E CD2   1 
ATOM   9366  C  CE1   . PHE G  3 84  ? 2.448   -35.095 41.023 1.00 32.68  ? 84   PHE E CE1   1 
ATOM   9367  C  CE2   . PHE G  3 84  ? 1.398   -32.940 41.143 1.00 34.87  ? 84   PHE E CE2   1 
ATOM   9368  C  CZ    . PHE G  3 84  ? 1.323   -34.319 41.240 1.00 33.76  ? 84   PHE E CZ    1 
ATOM   9369  N  N     . GLN G  3 85  ? 5.907   -30.256 37.899 1.00 35.20  ? 85   GLN E N     1 
ATOM   9370  C  CA    . GLN G  3 85  ? 6.604   -28.981 37.936 1.00 34.70  ? 85   GLN E CA    1 
ATOM   9371  C  C     . GLN G  3 85  ? 6.650   -28.573 39.391 1.00 34.32  ? 85   GLN E C     1 
ATOM   9372  O  O     . GLN G  3 85  ? 5.644   -28.670 40.096 1.00 34.50  ? 85   GLN E O     1 
ATOM   9373  C  CB    . GLN G  3 85  ? 5.831   -27.923 37.175 1.00 34.88  ? 85   GLN E CB    1 
ATOM   9374  C  CG    . GLN G  3 85  ? 5.885   -28.057 35.685 1.00 36.82  ? 85   GLN E CG    1 
ATOM   9375  C  CD    . GLN G  3 85  ? 5.332   -26.847 34.968 1.00 40.15  ? 85   GLN E CD    1 
ATOM   9376  O  OE1   . GLN G  3 85  ? 4.775   -25.926 35.573 1.00 40.85  ? 85   GLN E OE1   1 
ATOM   9377  N  NE2   . GLN G  3 85  ? 5.481   -26.845 33.662 1.00 43.86  ? 85   GLN E NE2   1 
ATOM   9378  N  N     . SER G  3 86  ? 7.802   -28.115 39.854 1.00 33.64  ? 86   SER E N     1 
ATOM   9379  C  CA    . SER G  3 86  ? 7.928   -27.733 41.251 1.00 33.51  ? 86   SER E CA    1 
ATOM   9380  C  C     . SER G  3 86  ? 6.981   -26.601 41.619 1.00 32.47  ? 86   SER E C     1 
ATOM   9381  O  O     . SER G  3 86  ? 6.638   -26.427 42.775 1.00 32.08  ? 86   SER E O     1 
ATOM   9382  C  CB    . SER G  3 86  ? 9.356   -27.311 41.578 1.00 33.59  ? 86   SER E CB    1 
ATOM   9383  O  OG    . SER G  3 86  ? 9.721   -26.288 40.685 1.00 35.10  ? 86   SER E OG    1 
ATOM   9384  N  N     . SER G  3 87  ? 6.574   -25.809 40.646 1.00 32.35  ? 87   SER E N     1 
ATOM   9385  C  CA    . SER G  3 87  ? 5.651   -24.722 40.962 1.00 31.69  ? 87   SER E CA    1 
ATOM   9386  C  C     . SER G  3 87  ? 4.217   -25.246 41.053 1.00 31.16  ? 87   SER E C     1 
ATOM   9387  O  O     . SER G  3 87  ? 3.397   -24.640 41.733 1.00 31.92  ? 87   SER E O     1 
ATOM   9388  C  CB    . SER G  3 87  ? 5.777   -23.563 39.988 1.00 31.06  ? 87   SER E CB    1 
ATOM   9389  O  OG    . SER G  3 87  ? 5.226   -23.919 38.746 1.00 32.10  ? 87   SER E OG    1 
ATOM   9390  N  N     . ALA G  3 88  ? 3.930   -26.387 40.420 1.00 30.23  ? 88   ALA E N     1 
ATOM   9391  C  CA    . ALA G  3 88  ? 2.665   -27.107 40.665 1.00 29.42  ? 88   ALA E CA    1 
ATOM   9392  C  C     . ALA G  3 88  ? 2.566   -27.455 42.125 1.00 29.16  ? 88   ALA E C     1 
ATOM   9393  O  O     . ALA G  3 88  ? 1.529   -27.195 42.760 1.00 29.35  ? 88   ALA E O     1 
ATOM   9394  C  CB    . ALA G  3 88  ? 2.564   -28.370 39.851 1.00 29.15  ? 88   ALA E CB    1 
ATOM   9395  N  N     . VAL G  3 89  ? 3.649   -28.019 42.663 1.00 28.21  ? 89   VAL E N     1 
ATOM   9396  C  CA    . VAL G  3 89  ? 3.629   -28.490 44.041 1.00 27.96  ? 89   VAL E CA    1 
ATOM   9397  C  C     . VAL G  3 89  ? 3.474   -27.333 44.990 1.00 28.53  ? 89   VAL E C     1 
ATOM   9398  O  O     . VAL G  3 89  ? 2.753   -27.448 45.993 1.00 28.98  ? 89   VAL E O     1 
ATOM   9399  C  CB    . VAL G  3 89  ? 4.866   -29.360 44.450 1.00 28.20  ? 89   VAL E CB    1 
ATOM   9400  C  CG1   . VAL G  3 89  ? 4.731   -29.817 45.905 1.00 26.94  ? 89   VAL E CG1   1 
ATOM   9401  C  CG2   . VAL G  3 89  ? 5.018   -30.581 43.541 1.00 25.64  ? 89   VAL E CG2   1 
ATOM   9402  N  N     . MET G  3 90  ? 4.126   -26.218 44.656 1.00 28.95  ? 90   MET E N     1 
ATOM   9403  C  CA    . MET G  3 90  ? 4.045   -24.998 45.424 1.00 29.41  ? 90   MET E CA    1 
ATOM   9404  C  C     . MET G  3 90  ? 2.635   -24.409 45.335 1.00 28.89  ? 90   MET E C     1 
ATOM   9405  O  O     . MET G  3 90  ? 2.069   -23.999 46.350 1.00 28.60  ? 90   MET E O     1 
ATOM   9406  C  CB    . MET G  3 90  ? 5.089   -23.998 44.941 1.00 30.66  ? 90   MET E CB    1 
ATOM   9407  C  CG    . MET G  3 90  ? 6.559   -24.405 45.166 1.00 35.16  ? 90   MET E CG    1 
ATOM   9408  S  SD    . MET G  3 90  ? 6.937   -24.948 46.861 1.00 47.84  ? 90   MET E SD    1 
ATOM   9409  C  CE    . MET G  3 90  ? 6.754   -23.400 47.767 1.00 45.40  ? 90   MET E CE    1 
ATOM   9410  N  N     . ALA G  3 91  ? 2.047   -24.393 44.137 1.00 28.29  ? 91   ALA E N     1 
ATOM   9411  C  CA    . ALA G  3 91  ? 0.684   -23.868 43.986 1.00 27.45  ? 91   ALA E CA    1 
ATOM   9412  C  C     . ALA G  3 91  ? -0.278  -24.644 44.895 1.00 27.21  ? 91   ALA E C     1 
ATOM   9413  O  O     . ALA G  3 91  ? -1.106  -24.037 45.577 1.00 27.71  ? 91   ALA E O     1 
ATOM   9414  C  CB    . ALA G  3 91  ? 0.243   -23.935 42.559 1.00 26.98  ? 91   ALA E CB    1 
ATOM   9415  N  N     . LEU G  3 92  ? -0.136  -25.972 44.933 1.00 26.30  ? 92   LEU E N     1 
ATOM   9416  C  CA    . LEU G  3 92  ? -0.933  -26.839 45.815 1.00 25.45  ? 92   LEU E CA    1 
ATOM   9417  C  C     . LEU G  3 92  ? -0.643  -26.534 47.257 1.00 25.25  ? 92   LEU E C     1 
ATOM   9418  O  O     . LEU G  3 92  ? -1.559  -26.509 48.070 1.00 25.69  ? 92   LEU E O     1 
ATOM   9419  C  CB    . LEU G  3 92  ? -0.645  -28.330 45.565 1.00 25.53  ? 92   LEU E CB    1 
ATOM   9420  C  CG    . LEU G  3 92  ? -1.228  -28.885 44.265 1.00 24.81  ? 92   LEU E CG    1 
ATOM   9421  C  CD1   . LEU G  3 92  ? -0.469  -30.129 43.754 1.00 24.52  ? 92   LEU E CD1   1 
ATOM   9422  C  CD2   . LEU G  3 92  ? -2.700  -29.138 44.435 1.00 21.85  ? 92   LEU E CD2   1 
ATOM   9423  N  N     . GLN G  3 93  ? 0.621   -26.290 47.592 1.00 24.59  ? 93   GLN E N     1 
ATOM   9424  C  CA    . GLN G  3 93  ? 0.917   -25.930 48.969 1.00 24.04  ? 93   GLN E CA    1 
ATOM   9425  C  C     . GLN G  3 93  ? 0.323   -24.581 49.377 1.00 24.45  ? 93   GLN E C     1 
ATOM   9426  O  O     . GLN G  3 93  ? -0.189  -24.456 50.485 1.00 24.53  ? 93   GLN E O     1 
ATOM   9427  C  CB    . GLN G  3 93  ? 2.413   -26.018 49.309 1.00 23.48  ? 93   GLN E CB    1 
ATOM   9428  C  CG    . GLN G  3 93  ? 2.630   -26.261 50.809 1.00 21.58  ? 93   GLN E CG    1 
ATOM   9429  C  CD    . GLN G  3 93  ? 4.077   -26.414 51.202 1.00 21.49  ? 93   GLN E CD    1 
ATOM   9430  O  OE1   . GLN G  3 93  ? 4.943   -26.640 50.358 1.00 21.53  ? 93   GLN E OE1   1 
ATOM   9431  N  NE2   . GLN G  3 93  ? 4.355   -26.297 52.508 1.00 21.05  ? 93   GLN E NE2   1 
ATOM   9432  N  N     . GLU G  3 94  ? 0.395   -23.570 48.509 1.00 24.85  ? 94   GLU E N     1 
ATOM   9433  C  CA    . GLU G  3 94  ? -0.196  -22.272 48.844 1.00 24.76  ? 94   GLU E CA    1 
ATOM   9434  C  C     . GLU G  3 94  ? -1.704  -22.409 48.967 1.00 24.14  ? 94   GLU E C     1 
ATOM   9435  O  O     . GLU G  3 94  ? -2.295  -21.801 49.836 1.00 23.93  ? 94   GLU E O     1 
ATOM   9436  C  CB    . GLU G  3 94  ? 0.144   -21.195 47.821 1.00 25.25  ? 94   GLU E CB    1 
ATOM   9437  C  CG    . GLU G  3 94  ? 1.623   -20.805 47.771 1.00 27.56  ? 94   GLU E CG    1 
ATOM   9438  C  CD    . GLU G  3 94  ? 2.011   -19.701 48.760 1.00 31.82  ? 94   GLU E CD    1 
ATOM   9439  O  OE1   . GLU G  3 94  ? 1.146   -19.196 49.524 1.00 30.41  ? 94   GLU E OE1   1 
ATOM   9440  O  OE2   . GLU G  3 94  ? 3.211   -19.336 48.765 1.00 35.44  ? 94   GLU E OE2   1 
ATOM   9441  N  N     . ALA G  3 95  ? -2.332  -23.243 48.145 1.00 23.14  ? 95   ALA E N     1 
ATOM   9442  C  CA    . ALA G  3 95  ? -3.782  -23.324 48.221 1.00 22.96  ? 95   ALA E CA    1 
ATOM   9443  C  C     . ALA G  3 95  ? -4.250  -24.070 49.463 1.00 23.98  ? 95   ALA E C     1 
ATOM   9444  O  O     . ALA G  3 95  ? -5.209  -23.627 50.127 1.00 23.98  ? 95   ALA E O     1 
ATOM   9445  C  CB    . ALA G  3 95  ? -4.334  -23.929 47.002 1.00 22.22  ? 95   ALA E CB    1 
ATOM   9446  N  N     . SER G  3 96  ? -3.560  -25.180 49.780 1.00 24.24  ? 96   SER E N     1 
ATOM   9447  C  CA    . SER G  3 96  ? -3.849  -26.011 50.949 1.00 24.71  ? 96   SER E CA    1 
ATOM   9448  C  C     . SER G  3 96  ? -3.692  -25.257 52.258 1.00 25.00  ? 96   SER E C     1 
ATOM   9449  O  O     . SER G  3 96  ? -4.548  -25.352 53.152 1.00 25.14  ? 96   SER E O     1 
ATOM   9450  C  CB    . SER G  3 96  ? -2.931  -27.253 50.982 1.00 25.07  ? 96   SER E CB    1 
ATOM   9451  O  OG    . SER G  3 96  ? -3.074  -28.085 49.817 1.00 26.76  ? 96   SER E OG    1 
ATOM   9452  N  N     . GLU G  3 97  ? -2.585  -24.538 52.401 1.00 25.32  ? 97   GLU E N     1 
ATOM   9453  C  CA    . GLU G  3 97  ? -2.344  -23.782 53.638 1.00 26.44  ? 97   GLU E CA    1 
ATOM   9454  C  C     . GLU G  3 97  ? -3.323  -22.612 53.787 1.00 24.86  ? 97   GLU E C     1 
ATOM   9455  O  O     . GLU G  3 97  ? -3.800  -22.329 54.893 1.00 25.02  ? 97   GLU E O     1 
ATOM   9456  C  CB    . GLU G  3 97  ? -0.875  -23.355 53.796 1.00 25.98  ? 97   GLU E CB    1 
ATOM   9457  C  CG    . GLU G  3 97  ? 0.077   -24.554 53.907 1.00 28.70  ? 97   GLU E CG    1 
ATOM   9458  C  CD    . GLU G  3 97  ? 1.507   -24.196 54.407 1.00 30.22  ? 97   GLU E CD    1 
ATOM   9459  O  OE1   . GLU G  3 97  ? 1.694   -23.098 54.994 1.00 33.42  ? 97   GLU E OE1   1 
ATOM   9460  O  OE2   . GLU G  3 97  ? 2.450   -25.031 54.210 1.00 35.43  ? 97   GLU E OE2   1 
ATOM   9461  N  N     . ALA G  3 98  ? -3.666  -21.962 52.685 1.00 23.44  ? 98   ALA E N     1 
ATOM   9462  C  CA    . ALA G  3 98  ? -4.698  -20.933 52.748 1.00 22.31  ? 98   ALA E CA    1 
ATOM   9463  C  C     . ALA G  3 98  ? -6.014  -21.549 53.138 1.00 22.63  ? 98   ALA E C     1 
ATOM   9464  O  O     . ALA G  3 98  ? -6.767  -20.941 53.908 1.00 24.07  ? 98   ALA E O     1 
ATOM   9465  C  CB    . ALA G  3 98  ? -4.829  -20.203 51.456 1.00 21.44  ? 98   ALA E CB    1 
ATOM   9466  N  N     . TYR G  3 99  ? -6.317  -22.745 52.624 1.00 22.97  ? 99   TYR E N     1 
ATOM   9467  C  CA    . TYR G  3 99  ? -7.575  -23.418 52.981 1.00 22.91  ? 99   TYR E CA    1 
ATOM   9468  C  C     . TYR G  3 99  ? -7.643  -23.800 54.477 1.00 23.52  ? 99   TYR E C     1 
ATOM   9469  O  O     . TYR G  3 99  ? -8.663  -23.564 55.129 1.00 24.15  ? 99   TYR E O     1 
ATOM   9470  C  CB    . TYR G  3 99  ? -7.861  -24.605 52.057 1.00 23.32  ? 99   TYR E CB    1 
ATOM   9471  C  CG    . TYR G  3 99  ? -8.943  -25.554 52.538 1.00 23.09  ? 99   TYR E CG    1 
ATOM   9472  C  CD1   . TYR G  3 99  ? -10.304 -25.304 52.272 1.00 24.87  ? 99   TYR E CD1   1 
ATOM   9473  C  CD2   . TYR G  3 99  ? -8.616  -26.691 53.252 1.00 20.25  ? 99   TYR E CD2   1 
ATOM   9474  C  CE1   . TYR G  3 99  ? -11.310 -26.183 52.730 1.00 24.16  ? 99   TYR E CE1   1 
ATOM   9475  C  CE2   . TYR G  3 99  ? -9.604  -27.570 53.720 1.00 22.52  ? 99   TYR E CE2   1 
ATOM   9476  C  CZ    . TYR G  3 99  ? -10.945 -27.313 53.465 1.00 23.86  ? 99   TYR E CZ    1 
ATOM   9477  O  OH    . TYR G  3 99  ? -11.908 -28.187 53.941 1.00 23.20  ? 99   TYR E OH    1 
ATOM   9478  N  N     . LEU G  3 100 ? -6.562  -24.344 55.032 1.00 23.57  ? 100  LEU E N     1 
ATOM   9479  C  CA    . LEU G  3 100 ? -6.561  -24.804 56.421 1.00 23.34  ? 100  LEU E CA    1 
ATOM   9480  C  C     . LEU G  3 100 ? -6.588  -23.685 57.447 1.00 23.58  ? 100  LEU E C     1 
ATOM   9481  O  O     . LEU G  3 100 ? -7.374  -23.744 58.410 1.00 23.90  ? 100  LEU E O     1 
ATOM   9482  C  CB    . LEU G  3 100 ? -5.368  -25.722 56.679 1.00 24.06  ? 100  LEU E CB    1 
ATOM   9483  C  CG    . LEU G  3 100 ? -5.334  -27.097 55.966 1.00 24.73  ? 100  LEU E CG    1 
ATOM   9484  C  CD1   . LEU G  3 100 ? -4.041  -27.806 56.319 1.00 20.71  ? 100  LEU E CD1   1 
ATOM   9485  C  CD2   . LEU G  3 100 ? -6.582  -27.961 56.321 1.00 23.65  ? 100  LEU E CD2   1 
ATOM   9486  N  N     . VAL G  3 101 ? -5.723  -22.675 57.264 1.00 23.35  ? 101  VAL E N     1 
ATOM   9487  C  CA    . VAL G  3 101 ? -5.794  -21.414 58.026 1.00 22.28  ? 101  VAL E CA    1 
ATOM   9488  C  C     . VAL G  3 101 ? -7.208  -20.832 57.993 1.00 22.06  ? 101  VAL E C     1 
ATOM   9489  O  O     . VAL G  3 101 ? -7.747  -20.447 59.024 1.00 21.40  ? 101  VAL E O     1 
ATOM   9490  C  CB    . VAL G  3 101 ? -4.780  -20.338 57.512 1.00 22.75  ? 101  VAL E CB    1 
ATOM   9491  C  CG1   . VAL G  3 101 ? -4.971  -19.011 58.268 1.00 21.21  ? 101  VAL E CG1   1 
ATOM   9492  C  CG2   . VAL G  3 101 ? -3.329  -20.828 57.637 1.00 20.72  ? 101  VAL E CG2   1 
ATOM   9493  N  N     . ALA G  3 102 ? -7.834  -20.784 56.823 1.00 22.41  ? 102  ALA E N     1 
ATOM   9494  C  CA    . ALA G  3 102 ? -9.205  -20.241 56.790 1.00 23.07  ? 102  ALA E CA    1 
ATOM   9495  C  C     . ALA G  3 102 ? -10.152 -21.150 57.554 1.00 23.70  ? 102  ALA E C     1 
ATOM   9496  O  O     . ALA G  3 102 ? -11.037 -20.649 58.269 1.00 24.67  ? 102  ALA E O     1 
ATOM   9497  C  CB    . ALA G  3 102 ? -9.685  -20.044 55.415 1.00 22.13  ? 102  ALA E CB    1 
ATOM   9498  N  N     . LEU G  3 103 ? -9.974  -22.477 57.419 1.00 23.95  ? 103  LEU E N     1 
ATOM   9499  C  CA    . LEU G  3 103 ? -10.836 -23.439 58.119 1.00 23.26  ? 103  LEU E CA    1 
ATOM   9500  C  C     . LEU G  3 103 ? -10.631 -23.341 59.638 1.00 23.84  ? 103  LEU E C     1 
ATOM   9501  O  O     . LEU G  3 103 ? -11.589 -23.351 60.401 1.00 23.08  ? 103  LEU E O     1 
ATOM   9502  C  CB    . LEU G  3 103 ? -10.612 -24.851 57.618 1.00 22.88  ? 103  LEU E CB    1 
ATOM   9503  C  CG    . LEU G  3 103 ? -11.392 -25.954 58.342 1.00 22.55  ? 103  LEU E CG    1 
ATOM   9504  C  CD1   . LEU G  3 103 ? -12.860 -25.875 58.038 1.00 20.95  ? 103  LEU E CD1   1 
ATOM   9505  C  CD2   . LEU G  3 103 ? -10.857 -27.325 58.007 1.00 21.38  ? 103  LEU E CD2   1 
ATOM   9506  N  N     . PHE G  3 104 ? -9.383  -23.205 60.076 1.00 24.99  ? 104  PHE E N     1 
ATOM   9507  C  CA    . PHE G  3 104 ? -9.113  -23.032 61.504 1.00 25.86  ? 104  PHE E CA    1 
ATOM   9508  C  C     . PHE G  3 104 ? -9.790  -21.798 62.090 1.00 26.85  ? 104  PHE E C     1 
ATOM   9509  O  O     . PHE G  3 104 ? -10.309 -21.853 63.219 1.00 27.19  ? 104  PHE E O     1 
ATOM   9510  C  CB    . PHE G  3 104 ? -7.619  -23.031 61.796 1.00 25.66  ? 104  PHE E CB    1 
ATOM   9511  C  CG    . PHE G  3 104 ? -7.009  -24.410 61.851 1.00 25.41  ? 104  PHE E CG    1 
ATOM   9512  C  CD1   . PHE G  3 104 ? -5.931  -24.742 61.043 1.00 24.76  ? 104  PHE E CD1   1 
ATOM   9513  C  CD2   . PHE G  3 104 ? -7.503  -25.374 62.725 1.00 25.18  ? 104  PHE E CD2   1 
ATOM   9514  C  CE1   . PHE G  3 104 ? -5.359  -26.015 61.098 1.00 24.09  ? 104  PHE E CE1   1 
ATOM   9515  C  CE2   . PHE G  3 104 ? -6.936  -26.658 62.784 1.00 25.16  ? 104  PHE E CE2   1 
ATOM   9516  C  CZ    . PHE G  3 104 ? -5.867  -26.974 61.966 1.00 24.75  ? 104  PHE E CZ    1 
ATOM   9517  N  N     . GLU G  3 105 ? -9.831  -20.708 61.323 1.00 27.39  ? 105  GLU E N     1 
ATOM   9518  C  CA    . GLU G  3 105 ? -10.552 -19.506 61.760 1.00 28.18  ? 105  GLU E CA    1 
ATOM   9519  C  C     . GLU G  3 105 ? -12.008 -19.812 61.997 1.00 27.83  ? 105  GLU E C     1 
ATOM   9520  O  O     . GLU G  3 105 ? -12.543 -19.488 63.050 1.00 28.22  ? 105  GLU E O     1 
ATOM   9521  C  CB    . GLU G  3 105 ? -10.438 -18.367 60.743 1.00 28.83  ? 105  GLU E CB    1 
ATOM   9522  C  CG    . GLU G  3 105 ? -9.059  -17.736 60.629 1.00 31.54  ? 105  GLU E CG    1 
ATOM   9523  C  CD    . GLU G  3 105 ? -8.901  -16.956 59.337 1.00 37.95  ? 105  GLU E CD    1 
ATOM   9524  O  OE1   . GLU G  3 105 ? -9.968  -16.681 58.718 1.00 41.74  ? 105  GLU E OE1   1 
ATOM   9525  O  OE2   . GLU G  3 105 ? -7.736  -16.627 58.940 1.00 37.85  ? 105  GLU E OE2   1 
ATOM   9526  N  N     . ASP G  3 106 ? -12.651 -20.450 61.023 1.00 28.41  ? 106  ASP E N     1 
ATOM   9527  C  CA    . ASP G  3 106 ? -14.073 -20.844 61.148 1.00 28.47  ? 106  ASP E CA    1 
ATOM   9528  C  C     . ASP G  3 106 ? -14.274 -21.770 62.335 1.00 27.68  ? 106  ASP E C     1 
ATOM   9529  O  O     . ASP G  3 106 ? -15.247 -21.621 63.100 1.00 27.00  ? 106  ASP E O     1 
ATOM   9530  C  CB    . ASP G  3 106 ? -14.561 -21.502 59.866 1.00 29.07  ? 106  ASP E CB    1 
ATOM   9531  C  CG    . ASP G  3 106 ? -14.632 -20.517 58.682 1.00 33.86  ? 106  ASP E CG    1 
ATOM   9532  O  OD1   . ASP G  3 106 ? -14.234 -19.338 58.873 1.00 37.35  ? 106  ASP E OD1   1 
ATOM   9533  O  OD2   . ASP G  3 106 ? -15.113 -20.908 57.561 1.00 39.12  ? 106  ASP E OD2   1 
ATOM   9534  N  N     . THR G  3 107 ? -13.315 -22.692 62.494 1.00 26.97  ? 107  THR E N     1 
ATOM   9535  C  CA    . THR G  3 107 ? -13.293 -23.678 63.565 1.00 26.52  ? 107  THR E CA    1 
ATOM   9536  C  C     . THR G  3 107 ? -13.146 -22.930 64.881 1.00 26.07  ? 107  THR E C     1 
ATOM   9537  O  O     . THR G  3 107 ? -13.862 -23.210 65.850 1.00 25.53  ? 107  THR E O     1 
ATOM   9538  C  CB    . THR G  3 107 ? -12.128 -24.676 63.362 1.00 27.07  ? 107  THR E CB    1 
ATOM   9539  O  OG1   . THR G  3 107 ? -12.349 -25.425 62.161 1.00 29.23  ? 107  THR E OG1   1 
ATOM   9540  C  CG2   . THR G  3 107 ? -11.982 -25.640 64.520 1.00 25.19  ? 107  THR E CG2   1 
ATOM   9541  N  N     . ASN G  3 108 ? -12.249 -21.946 64.906 1.00 25.48  ? 108  ASN E N     1 
ATOM   9542  C  CA    . ASN G  3 108 ? -12.095 -21.126 66.108 1.00 24.83  ? 108  ASN E CA    1 
ATOM   9543  C  C     . ASN G  3 108 ? -13.413 -20.481 66.515 1.00 24.32  ? 108  ASN E C     1 
ATOM   9544  O  O     . ASN G  3 108 ? -13.779 -20.514 67.701 1.00 23.51  ? 108  ASN E O     1 
ATOM   9545  C  CB    . ASN G  3 108 ? -11.012 -20.067 65.944 1.00 25.05  ? 108  ASN E CB    1 
ATOM   9546  C  CG    . ASN G  3 108 ? -10.434 -19.646 67.252 1.00 25.30  ? 108  ASN E CG    1 
ATOM   9547  O  OD1   . ASN G  3 108 ? -10.684 -20.267 68.271 1.00 29.62  ? 108  ASN E OD1   1 
ATOM   9548  N  ND2   . ASN G  3 108 ? -9.665  -18.595 67.245 1.00 27.62  ? 108  ASN E ND2   1 
ATOM   9549  N  N     . LEU G  3 109 ? -14.139 -19.941 65.531 1.00 23.84  ? 109  LEU E N     1 
ATOM   9550  C  CA    . LEU G  3 109 ? -15.447 -19.341 65.797 1.00 24.13  ? 109  LEU E CA    1 
ATOM   9551  C  C     . LEU G  3 109 ? -16.482 -20.343 66.330 1.00 25.09  ? 109  LEU E C     1 
ATOM   9552  O  O     . LEU G  3 109 ? -17.244 -20.037 67.235 1.00 25.54  ? 109  LEU E O     1 
ATOM   9553  C  CB    . LEU G  3 109 ? -15.986 -18.635 64.562 1.00 23.99  ? 109  LEU E CB    1 
ATOM   9554  C  CG    . LEU G  3 109 ? -15.364 -17.334 64.038 1.00 22.29  ? 109  LEU E CG    1 
ATOM   9555  C  CD1   . LEU G  3 109 ? -16.130 -16.998 62.814 1.00 22.73  ? 109  LEU E CD1   1 
ATOM   9556  C  CD2   . LEU G  3 109 ? -15.422 -16.150 65.000 1.00 19.36  ? 109  LEU E CD2   1 
ATOM   9557  N  N     . CYS G  3 110 ? -16.490 -21.563 65.818 1.00 26.67  ? 110  CYS E N     1 
ATOM   9558  C  CA    . CYS G  3 110 ? -17.425 -22.570 66.360 1.00 27.09  ? 110  CYS E CA    1 
ATOM   9559  C  C     . CYS G  3 110 ? -17.137 -22.932 67.815 1.00 27.55  ? 110  CYS E C     1 
ATOM   9560  O  O     . CYS G  3 110 ? -18.063 -23.033 68.612 1.00 28.81  ? 110  CYS E O     1 
ATOM   9561  C  CB    . CYS G  3 110 ? -17.457 -23.806 65.480 1.00 27.02  ? 110  CYS E CB    1 
ATOM   9562  S  SG    . CYS G  3 110 ? -17.964 -23.432 63.773 1.00 27.22  ? 110  CYS E SG    1 
ATOM   9563  N  N     . ALA G  3 111 ? -15.870 -23.100 68.177 1.00 27.18  ? 111  ALA E N     1 
ATOM   9564  C  CA    . ALA G  3 111 ? -15.521 -23.352 69.568 1.00 27.17  ? 111  ALA E CA    1 
ATOM   9565  C  C     . ALA G  3 111 ? -15.976 -22.202 70.501 1.00 27.81  ? 111  ALA E C     1 
ATOM   9566  O  O     . ALA G  3 111 ? -16.582 -22.435 71.544 1.00 27.51  ? 111  ALA E O     1 
ATOM   9567  C  CB    . ALA G  3 111 ? -14.028 -23.603 69.695 1.00 26.78  ? 111  ALA E CB    1 
ATOM   9568  N  N     . ILE G  3 112 ? -15.696 -20.954 70.121 1.00 28.63  ? 112  ILE E N     1 
ATOM   9569  C  CA    . ILE G  3 112 ? -16.056 -19.803 70.960 1.00 28.68  ? 112  ILE E CA    1 
ATOM   9570  C  C     . ILE G  3 112 ? -17.583 -19.730 71.153 1.00 29.93  ? 112  ILE E C     1 
ATOM   9571  O  O     . ILE G  3 112 ? -18.065 -19.391 72.228 1.00 30.06  ? 112  ILE E O     1 
ATOM   9572  C  CB    . ILE G  3 112 ? -15.454 -18.497 70.386 1.00 28.66  ? 112  ILE E CB    1 
ATOM   9573  C  CG1   . ILE G  3 112 ? -13.945 -18.471 70.625 1.00 27.18  ? 112  ILE E CG1   1 
ATOM   9574  C  CG2   . ILE G  3 112 ? -16.125 -17.235 70.944 1.00 26.96  ? 112  ILE E CG2   1 
ATOM   9575  C  CD1   . ILE G  3 112 ? -13.198 -17.739 69.535 1.00 27.23  ? 112  ILE E CD1   1 
ATOM   9576  N  N     . HIS G  3 113 ? -18.332 -20.094 70.115 1.00 31.03  ? 113  HIS E N     1 
ATOM   9577  C  CA    . HIS G  3 113 ? -19.791 -20.135 70.165 1.00 31.73  ? 113  HIS E CA    1 
ATOM   9578  C  C     . HIS G  3 113 ? -20.238 -21.161 71.206 1.00 32.82  ? 113  HIS E C     1 
ATOM   9579  O  O     . HIS G  3 113 ? -21.268 -20.992 71.862 1.00 33.30  ? 113  HIS E O     1 
ATOM   9580  C  CB    . HIS G  3 113 ? -20.317 -20.521 68.786 1.00 31.37  ? 113  HIS E CB    1 
ATOM   9581  C  CG    . HIS G  3 113 ? -21.804 -20.478 68.660 1.00 31.54  ? 113  HIS E CG    1 
ATOM   9582  N  ND1   . HIS G  3 113 ? -22.506 -19.296 68.536 1.00 31.39  ? 113  HIS E ND1   1 
ATOM   9583  C  CD2   . HIS G  3 113 ? -22.724 -21.474 68.598 1.00 31.20  ? 113  HIS E CD2   1 
ATOM   9584  C  CE1   . HIS G  3 113 ? -23.795 -19.567 68.408 1.00 31.82  ? 113  HIS E CE1   1 
ATOM   9585  N  NE2   . HIS G  3 113 ? -23.955 -20.881 68.441 1.00 30.35  ? 113  HIS E NE2   1 
ATOM   9586  N  N     . ALA G  3 114 ? -19.463 -22.233 71.345 1.00 33.68  ? 114  ALA E N     1 
ATOM   9587  C  CA    . ALA G  3 114 ? -19.764 -23.294 72.324 1.00 34.31  ? 114  ALA E CA    1 
ATOM   9588  C  C     . ALA G  3 114 ? -19.259 -22.882 73.701 1.00 35.04  ? 114  ALA E C     1 
ATOM   9589  O  O     . ALA G  3 114 ? -19.356 -23.654 74.651 1.00 35.67  ? 114  ALA E O     1 
ATOM   9590  C  CB    . ALA G  3 114 ? -19.123 -24.602 71.905 1.00 33.23  ? 114  ALA E CB    1 
ATOM   9591  N  N     . LYS G  3 115 ? -18.699 -21.671 73.792 1.00 35.70  ? 115  LYS E N     1 
ATOM   9592  C  CA    . LYS G  3 115 ? -18.177 -21.117 75.057 1.00 36.12  ? 115  LYS E CA    1 
ATOM   9593  C  C     . LYS G  3 115 ? -16.897 -21.804 75.509 1.00 35.50  ? 115  LYS E C     1 
ATOM   9594  O  O     . LYS G  3 115 ? -16.567 -21.801 76.691 1.00 35.58  ? 115  LYS E O     1 
ATOM   9595  C  CB    . LYS G  3 115 ? -19.243 -21.123 76.163 1.00 36.25  ? 115  LYS E CB    1 
ATOM   9596  C  CG    . LYS G  3 115 ? -20.398 -20.175 75.876 1.00 39.58  ? 115  LYS E CG    1 
ATOM   9597  C  CD    . LYS G  3 115 ? -21.598 -20.407 76.794 1.00 44.48  ? 115  LYS E CD    1 
ATOM   9598  C  CE    . LYS G  3 115 ? -22.498 -19.152 76.824 1.00 46.63  ? 115  LYS E CE    1 
ATOM   9599  N  NZ    . LYS G  3 115 ? -23.185 -18.956 78.152 1.00 48.70  ? 115  LYS E NZ    1 
ATOM   9600  N  N     . ARG G  3 116 ? -16.171 -22.380 74.560 1.00 34.91  ? 116  ARG E N     1 
ATOM   9601  C  CA    . ARG G  3 116 ? -14.861 -22.956 74.850 1.00 34.69  ? 116  ARG E CA    1 
ATOM   9602  C  C     . ARG G  3 116 ? -13.797 -22.064 74.229 1.00 34.55  ? 116  ARG E C     1 
ATOM   9603  O  O     . ARG G  3 116 ? -14.131 -21.101 73.539 1.00 35.39  ? 116  ARG E O     1 
ATOM   9604  C  CB    . ARG G  3 116 ? -14.760 -24.373 74.270 1.00 34.38  ? 116  ARG E CB    1 
ATOM   9605  C  CG    . ARG G  3 116 ? -15.696 -25.365 74.914 1.00 33.57  ? 116  ARG E CG    1 
ATOM   9606  C  CD    . ARG G  3 116 ? -15.612 -26.721 74.238 1.00 33.13  ? 116  ARG E CD    1 
ATOM   9607  N  NE    . ARG G  3 116 ? -16.514 -26.900 73.099 1.00 31.40  ? 116  ARG E NE    1 
ATOM   9608  C  CZ    . ARG G  3 116 ? -16.152 -26.812 71.819 1.00 32.69  ? 116  ARG E CZ    1 
ATOM   9609  N  NH1   . ARG G  3 116 ? -14.903 -26.529 71.473 1.00 34.66  ? 116  ARG E NH1   1 
ATOM   9610  N  NH2   . ARG G  3 116 ? -17.041 -27.030 70.865 1.00 33.00  ? 116  ARG E NH2   1 
ATOM   9611  N  N     . VAL G  3 117 ? -12.524 -22.380 74.463 1.00 33.95  ? 117  VAL E N     1 
ATOM   9612  C  CA    . VAL G  3 117 ? -11.407 -21.729 73.754 1.00 33.17  ? 117  VAL E CA    1 
ATOM   9613  C  C     . VAL G  3 117 ? -10.507 -22.787 73.113 1.00 33.21  ? 117  VAL E C     1 
ATOM   9614  O  O     . VAL G  3 117 ? -9.518  -22.471 72.467 1.00 33.64  ? 117  VAL E O     1 
ATOM   9615  C  CB    . VAL G  3 117 ? -10.558 -20.806 74.690 1.00 33.21  ? 117  VAL E CB    1 
ATOM   9616  C  CG1   . VAL G  3 117 ? -11.416 -19.674 75.272 1.00 32.04  ? 117  VAL E CG1   1 
ATOM   9617  C  CG2   . VAL G  3 117 ? -9.882  -21.610 75.798 1.00 31.00  ? 117  VAL E CG2   1 
ATOM   9618  N  N     . THR G  3 118 ? -10.861 -24.047 73.315 1.00 33.03  ? 118  THR E N     1 
ATOM   9619  C  CA    . THR G  3 118 ? -10.158 -25.177 72.729 1.00 32.72  ? 118  THR E CA    1 
ATOM   9620  C  C     . THR G  3 118 ? -10.916 -25.633 71.506 1.00 32.20  ? 118  THR E C     1 
ATOM   9621  O  O     . THR G  3 118 ? -12.090 -26.008 71.614 1.00 32.33  ? 118  THR E O     1 
ATOM   9622  C  CB    . THR G  3 118 ? -10.148 -26.368 73.719 1.00 32.82  ? 118  THR E CB    1 
ATOM   9623  O  OG1   . THR G  3 118 ? -9.703  -25.919 75.009 1.00 33.93  ? 118  THR E OG1   1 
ATOM   9624  C  CG2   . THR G  3 118 ? -9.243  -27.485 73.224 1.00 32.61  ? 118  THR E CG2   1 
ATOM   9625  N  N     . ILE G  3 119 ? -10.264 -25.639 70.346 1.00 31.53  ? 119  ILE E N     1 
ATOM   9626  C  CA    . ILE G  3 119 ? -10.926 -26.189 69.155 1.00 30.62  ? 119  ILE E CA    1 
ATOM   9627  C  C     . ILE G  3 119 ? -10.904 -27.712 69.184 1.00 30.67  ? 119  ILE E C     1 
ATOM   9628  O  O     . ILE G  3 119 ? -9.888  -28.320 69.533 1.00 29.69  ? 119  ILE E O     1 
ATOM   9629  C  CB    . ILE G  3 119 ? -10.350 -25.655 67.814 1.00 30.09  ? 119  ILE E CB    1 
ATOM   9630  C  CG1   . ILE G  3 119 ? -8.890  -26.067 67.627 1.00 29.05  ? 119  ILE E CG1   1 
ATOM   9631  C  CG2   . ILE G  3 119 ? -10.514 -24.164 67.740 1.00 30.32  ? 119  ILE E CG2   1 
ATOM   9632  C  CD1   . ILE G  3 119 ? -8.373  -25.977 66.221 1.00 25.05  ? 119  ILE E CD1   1 
ATOM   9633  N  N     . MET G  3 120 ? -12.035 -28.308 68.807 1.00 31.20  ? 120  MET E N     1 
ATOM   9634  C  CA    . MET G  3 120 ? -12.221 -29.767 68.783 1.00 32.19  ? 120  MET E CA    1 
ATOM   9635  C  C     . MET G  3 120 ? -12.735 -30.244 67.415 1.00 31.32  ? 120  MET E C     1 
ATOM   9636  O  O     . MET G  3 120 ? -13.210 -29.425 66.621 1.00 31.52  ? 120  MET E O     1 
ATOM   9637  C  CB    . MET G  3 120 ? -13.198 -30.187 69.886 1.00 31.71  ? 120  MET E CB    1 
ATOM   9638  C  CG    . MET G  3 120 ? -12.820 -29.718 71.300 1.00 34.34  ? 120  MET E CG    1 
ATOM   9639  S  SD    . MET G  3 120 ? -13.836 -30.387 72.665 1.00 35.89  ? 120  MET E SD    1 
ATOM   9640  C  CE    . MET G  3 120 ? -15.477 -29.986 72.109 1.00 40.07  ? 120  MET E CE    1 
ATOM   9641  N  N     . PRO G  3 121 ? -12.647 -31.570 67.128 1.00 31.03  ? 121  PRO E N     1 
ATOM   9642  C  CA    . PRO G  3 121 ? -13.196 -32.116 65.884 1.00 30.22  ? 121  PRO E CA    1 
ATOM   9643  C  C     . PRO G  3 121 ? -14.679 -31.794 65.642 1.00 29.87  ? 121  PRO E C     1 
ATOM   9644  O  O     . PRO G  3 121 ? -15.078 -31.579 64.490 1.00 29.90  ? 121  PRO E O     1 
ATOM   9645  C  CB    . PRO G  3 121 ? -12.987 -33.627 66.052 1.00 30.52  ? 121  PRO E CB    1 
ATOM   9646  C  CG    . PRO G  3 121 ? -11.825 -33.745 66.961 1.00 29.98  ? 121  PRO E CG    1 
ATOM   9647  C  CD    . PRO G  3 121 ? -12.020 -32.639 67.941 1.00 30.78  ? 121  PRO E CD    1 
ATOM   9648  N  N     . LYS G  3 122 ? -15.501 -31.745 66.687 1.00 29.25  ? 122  LYS E N     1 
ATOM   9649  C  CA    . LYS G  3 122 ? -16.900 -31.358 66.463 1.00 29.30  ? 122  LYS E CA    1 
ATOM   9650  C  C     . LYS G  3 122 ? -17.015 -29.915 65.896 1.00 28.87  ? 122  LYS E C     1 
ATOM   9651  O  O     . LYS G  3 122 ? -17.920 -29.633 65.116 1.00 28.87  ? 122  LYS E O     1 
ATOM   9652  C  CB    . LYS G  3 122 ? -17.791 -31.608 67.704 1.00 29.23  ? 122  LYS E CB    1 
ATOM   9653  C  CG    . LYS G  3 122 ? -17.527 -30.679 68.885 1.00 31.79  ? 122  LYS E CG    1 
ATOM   9654  C  CD    . LYS G  3 122 ? -17.799 -31.354 70.237 1.00 35.66  ? 122  LYS E CD    1 
ATOM   9655  C  CE    . LYS G  3 122 ? -19.192 -31.059 70.772 1.00 38.47  ? 122  LYS E CE    1 
ATOM   9656  N  NZ    . LYS G  3 122 ? -19.686 -32.164 71.653 1.00 41.59  ? 122  LYS E NZ    1 
ATOM   9657  N  N     . ASP G  3 123 ? -16.085 -29.030 66.265 1.00 28.19  ? 123  ASP E N     1 
ATOM   9658  C  CA    . ASP G  3 123 ? -15.988 -27.680 65.669 1.00 28.07  ? 123  ASP E CA    1 
ATOM   9659  C  C     . ASP G  3 123 ? -15.615 -27.716 64.178 1.00 28.02  ? 123  ASP E C     1 
ATOM   9660  O  O     . ASP G  3 123 ? -16.277 -27.068 63.377 1.00 28.68  ? 123  ASP E O     1 
ATOM   9661  C  CB    . ASP G  3 123 ? -14.997 -26.777 66.432 1.00 27.02  ? 123  ASP E CB    1 
ATOM   9662  C  CG    . ASP G  3 123 ? -15.309 -26.688 67.922 1.00 28.08  ? 123  ASP E CG    1 
ATOM   9663  O  OD1   . ASP G  3 123 ? -16.493 -26.510 68.281 1.00 29.10  ? 123  ASP E OD1   1 
ATOM   9664  O  OD2   . ASP G  3 123 ? -14.381 -26.792 68.756 1.00 27.35  ? 123  ASP E OD2   1 
ATOM   9665  N  N     . ILE G  3 124 ? -14.560 -28.442 63.808 1.00 27.50  ? 124  ILE E N     1 
ATOM   9666  C  CA    . ILE G  3 124 ? -14.166 -28.559 62.399 1.00 27.54  ? 124  ILE E CA    1 
ATOM   9667  C  C     . ILE G  3 124 ? -15.320 -29.152 61.576 1.00 27.90  ? 124  ILE E C     1 
ATOM   9668  O  O     . ILE G  3 124 ? -15.661 -28.631 60.514 1.00 27.96  ? 124  ILE E O     1 
ATOM   9669  C  CB    . ILE G  3 124 ? -12.911 -29.466 62.198 1.00 27.46  ? 124  ILE E CB    1 
ATOM   9670  C  CG1   . ILE G  3 124 ? -11.723 -28.983 63.026 1.00 27.68  ? 124  ILE E CG1   1 
ATOM   9671  C  CG2   . ILE G  3 124 ? -12.512 -29.512 60.747 1.00 26.82  ? 124  ILE E CG2   1 
ATOM   9672  C  CD1   . ILE G  3 124 ? -10.449 -29.753 62.728 1.00 27.69  ? 124  ILE E CD1   1 
ATOM   9673  N  N     . GLN G  3 125 ? -15.921 -30.229 62.076 1.00 27.90  ? 125  GLN E N     1 
ATOM   9674  C  CA    . GLN G  3 125 ? -17.095 -30.813 61.448 1.00 28.44  ? 125  GLN E CA    1 
ATOM   9675  C  C     . GLN G  3 125 ? -18.217 -29.787 61.254 1.00 28.28  ? 125  GLN E C     1 
ATOM   9676  O  O     . GLN G  3 125 ? -18.741 -29.654 60.154 1.00 29.76  ? 125  GLN E O     1 
ATOM   9677  C  CB    . GLN G  3 125 ? -17.582 -32.038 62.242 1.00 28.98  ? 125  GLN E CB    1 
ATOM   9678  C  CG    . GLN G  3 125 ? -16.692 -33.298 62.076 1.00 30.06  ? 125  GLN E CG    1 
ATOM   9679  C  CD    . GLN G  3 125 ? -16.520 -34.091 63.372 1.00 33.94  ? 125  GLN E CD    1 
ATOM   9680  O  OE1   . GLN G  3 125 ? -17.407 -34.123 64.242 1.00 36.20  ? 125  GLN E OE1   1 
ATOM   9681  N  NE2   . GLN G  3 125 ? -15.367 -34.736 63.509 1.00 34.45  ? 125  GLN E NE2   1 
ATOM   9682  N  N     . LEU G  3 126 ? -18.573 -29.033 62.280 1.00 27.74  ? 126  LEU E N     1 
ATOM   9683  C  CA    . LEU G  3 126 ? -19.646 -28.052 62.122 1.00 27.73  ? 126  LEU E CA    1 
ATOM   9684  C  C     . LEU G  3 126 ? -19.326 -26.996 61.067 1.00 28.02  ? 126  LEU E C     1 
ATOM   9685  O  O     . LEU G  3 126 ? -20.192 -26.646 60.249 1.00 28.21  ? 126  LEU E O     1 
ATOM   9686  C  CB    . LEU G  3 126 ? -19.983 -27.378 63.447 1.00 27.49  ? 126  LEU E CB    1 
ATOM   9687  C  CG    . LEU G  3 126 ? -21.024 -26.265 63.374 1.00 27.42  ? 126  LEU E CG    1 
ATOM   9688  C  CD1   . LEU G  3 126 ? -22.397 -26.811 63.064 1.00 27.79  ? 126  LEU E CD1   1 
ATOM   9689  C  CD2   . LEU G  3 126 ? -21.055 -25.458 64.658 1.00 27.54  ? 126  LEU E CD2   1 
ATOM   9690  N  N     . ALA G  3 127 ? -18.091 -26.492 61.077 1.00 28.06  ? 127  ALA E N     1 
ATOM   9691  C  CA    . ALA G  3 127 ? -17.674 -25.478 60.107 1.00 28.33  ? 127  ALA E CA    1 
ATOM   9692  C  C     . ALA G  3 127 ? -17.724 -26.016 58.688 1.00 28.98  ? 127  ALA E C     1 
ATOM   9693  O  O     . ALA G  3 127 ? -18.109 -25.295 57.757 1.00 29.19  ? 127  ALA E O     1 
ATOM   9694  C  CB    . ALA G  3 127 ? -16.299 -24.981 60.412 1.00 28.55  ? 127  ALA E CB    1 
ATOM   9695  N  N     . ARG G  3 128 ? -17.343 -27.282 58.517 1.00 29.03  ? 128  ARG E N     1 
ATOM   9696  C  CA    . ARG G  3 128 ? -17.366 -27.885 57.196 1.00 28.78  ? 128  ARG E CA    1 
ATOM   9697  C  C     . ARG G  3 128 ? -18.790 -28.177 56.728 1.00 29.59  ? 128  ARG E C     1 
ATOM   9698  O  O     . ARG G  3 128 ? -19.085 -28.032 55.527 1.00 29.28  ? 128  ARG E O     1 
ATOM   9699  C  CB    . ARG G  3 128 ? -16.464 -29.107 57.133 1.00 28.27  ? 128  ARG E CB    1 
ATOM   9700  C  CG    . ARG G  3 128 ? -14.987 -28.777 57.329 1.00 27.54  ? 128  ARG E CG    1 
ATOM   9701  C  CD    . ARG G  3 128 ? -14.133 -29.512 56.323 1.00 29.87  ? 128  ARG E CD    1 
ATOM   9702  N  NE    . ARG G  3 128 ? -14.332 -30.949 56.442 1.00 33.54  ? 128  ARG E NE    1 
ATOM   9703  C  CZ    . ARG G  3 128 ? -14.437 -31.799 55.427 1.00 35.52  ? 128  ARG E CZ    1 
ATOM   9704  N  NH1   . ARG G  3 128 ? -14.347 -31.393 54.160 1.00 33.98  ? 128  ARG E NH1   1 
ATOM   9705  N  NH2   . ARG G  3 128 ? -14.631 -33.083 55.700 1.00 39.14  ? 128  ARG E NH2   1 
ATOM   9706  N  N     . ARG G  3 129 ? -19.666 -28.579 57.660 1.00 30.31  ? 129  ARG E N     1 
ATOM   9707  C  CA    . ARG G  3 129 ? -21.089 -28.780 57.346 1.00 31.49  ? 129  ARG E CA    1 
ATOM   9708  C  C     . ARG G  3 129 ? -21.772 -27.480 56.894 1.00 31.56  ? 129  ARG E C     1 
ATOM   9709  O  O     . ARG G  3 129 ? -22.399 -27.430 55.843 1.00 30.66  ? 129  ARG E O     1 
ATOM   9710  C  CB    . ARG G  3 129 ? -21.838 -29.368 58.531 1.00 31.92  ? 129  ARG E CB    1 
ATOM   9711  C  CG    . ARG G  3 129 ? -23.284 -29.744 58.200 1.00 35.45  ? 129  ARG E CG    1 
ATOM   9712  C  CD    . ARG G  3 129 ? -23.689 -31.073 58.880 1.00 41.72  ? 129  ARG E CD    1 
ATOM   9713  N  NE    . ARG G  3 129 ? -25.119 -31.380 58.698 1.00 46.96  ? 129  ARG E NE    1 
ATOM   9714  C  CZ    . ARG G  3 129 ? -25.884 -32.014 59.597 1.00 48.06  ? 129  ARG E CZ    1 
ATOM   9715  N  NH1   . ARG G  3 129 ? -25.386 -32.394 60.771 1.00 47.91  ? 129  ARG E NH1   1 
ATOM   9716  N  NH2   . ARG G  3 129 ? -27.168 -32.234 59.339 1.00 49.44  ? 129  ARG E NH2   1 
ATOM   9717  N  N     . ILE G  3 130 ? -21.619 -26.419 57.683 1.00 32.08  ? 130  ILE E N     1 
ATOM   9718  C  CA    . ILE G  3 130 ? -22.165 -25.121 57.300 1.00 32.47  ? 130  ILE E CA    1 
ATOM   9719  C  C     . ILE G  3 130 ? -21.625 -24.594 55.957 1.00 32.60  ? 130  ILE E C     1 
ATOM   9720  O  O     . ILE G  3 130 ? -22.393 -24.031 55.175 1.00 32.76  ? 130  ILE E O     1 
ATOM   9721  C  CB    . ILE G  3 130 ? -22.015 -24.090 58.418 1.00 32.76  ? 130  ILE E CB    1 
ATOM   9722  C  CG1   . ILE G  3 130 ? -22.839 -24.542 59.639 1.00 32.62  ? 130  ILE E CG1   1 
ATOM   9723  C  CG2   . ILE G  3 130 ? -22.432 -22.688 57.930 1.00 31.70  ? 130  ILE E CG2   1 
ATOM   9724  C  CD1   . ILE G  3 130 ? -22.563 -23.732 60.893 1.00 32.73  ? 130  ILE E CD1   1 
ATOM   9725  N  N     . ARG G  3 131 ? -20.338 -24.807 55.677 1.00 32.42  ? 131  ARG E N     1 
ATOM   9726  C  CA    . ARG G  3 131 ? -19.744 -24.379 54.409 1.00 32.49  ? 131  ARG E CA    1 
ATOM   9727  C  C     . ARG G  3 131 ? -20.213 -25.227 53.247 1.00 33.94  ? 131  ARG E C     1 
ATOM   9728  O  O     . ARG G  3 131 ? -19.926 -24.917 52.086 1.00 33.94  ? 131  ARG E O     1 
ATOM   9729  C  CB    . ARG G  3 131 ? -18.240 -24.505 54.456 1.00 32.39  ? 131  ARG E CB    1 
ATOM   9730  C  CG    . ARG G  3 131 ? -17.475 -23.442 55.141 1.00 29.38  ? 131  ARG E CG    1 
ATOM   9731  C  CD    . ARG G  3 131 ? -16.113 -24.011 55.316 1.00 27.67  ? 131  ARG E CD    1 
ATOM   9732  N  NE    . ARG G  3 131 ? -15.113 -23.045 55.744 1.00 27.40  ? 131  ARG E NE    1 
ATOM   9733  C  CZ    . ARG G  3 131 ? -13.842 -23.114 55.372 1.00 27.64  ? 131  ARG E CZ    1 
ATOM   9734  N  NH1   . ARG G  3 131 ? -13.460 -24.097 54.554 1.00 27.22  ? 131  ARG E NH1   1 
ATOM   9735  N  NH2   . ARG G  3 131 ? -12.955 -22.209 55.802 1.00 27.51  ? 131  ARG E NH2   1 
ATOM   9736  N  N     . GLY G  3 132 ? -20.907 -26.318 53.554 1.00 35.50  ? 132  GLY E N     1 
ATOM   9737  C  CA    . GLY G  3 132 ? -21.456 -27.181 52.524 1.00 37.19  ? 132  GLY E CA    1 
ATOM   9738  C  C     . GLY G  3 132 ? -20.453 -28.118 51.893 1.00 38.83  ? 132  GLY E C     1 
ATOM   9739  O  O     . GLY G  3 132 ? -20.699 -28.639 50.818 1.00 39.66  ? 132  GLY E O     1 
ATOM   9740  N  N     . GLU G  3 133 ? -19.319 -28.337 52.551 1.00 40.64  ? 133  GLU E N     1 
ATOM   9741  C  CA    . GLU G  3 133 ? -18.332 -29.339 52.109 1.00 41.99  ? 133  GLU E CA    1 
ATOM   9742  C  C     . GLU G  3 133 ? -18.807 -30.746 52.495 1.00 43.27  ? 133  GLU E C     1 
ATOM   9743  O  O     . GLU G  3 133 ? -18.243 -31.758 52.069 1.00 43.44  ? 133  GLU E O     1 
ATOM   9744  C  CB    . GLU G  3 133 ? -16.941 -29.051 52.722 1.00 41.48  ? 133  GLU E CB    1 
ATOM   9745  C  CG    . GLU G  3 133 ? -16.317 -27.726 52.296 1.00 41.40  ? 133  GLU E CG    1 
ATOM   9746  C  CD    . GLU G  3 133 ? -15.041 -27.341 53.080 1.00 41.94  ? 133  GLU E CD    1 
ATOM   9747  O  OE1   . GLU G  3 133 ? -14.320 -28.242 53.571 1.00 40.51  ? 133  GLU E OE1   1 
ATOM   9748  O  OE2   . GLU G  3 133 ? -14.749 -26.122 53.189 1.00 40.58  ? 133  GLU E OE2   1 
ATOM   9749  N  N     . ARG G  3 134 ? -19.831 -30.804 53.339 1.00 45.17  ? 134  ARG E N     1 
ATOM   9750  C  CA    . ARG G  3 134 ? -20.388 -32.082 53.770 1.00 46.95  ? 134  ARG E CA    1 
ATOM   9751  C  C     . ARG G  3 134 ? -21.869 -31.907 54.104 1.00 48.03  ? 134  ARG E C     1 
ATOM   9752  O  O     . ARG G  3 134 ? -22.663 -32.845 53.941 1.00 49.91  ? 134  ARG E O     1 
ATOM   9753  C  CB    . ARG G  3 134 ? -19.594 -32.683 54.953 1.00 46.81  ? 134  ARG E CB    1 
ATOM   9754  C  CG    . ARG G  3 134 ? -20.200 -32.446 56.336 1.00 47.07  ? 134  ARG E CG    1 
ATOM   9755  C  CD    . ARG G  3 134 ? -19.189 -32.677 57.462 1.00 47.23  ? 134  ARG E CD    1 
ATOM   9756  N  NE    . ARG G  3 134 ? -19.397 -33.049 58.570 0.00 64.18  ? 134  ARG E NE    1 
ATOM   9757  C  CZ    . ARG G  3 134 ? -19.381 -34.234 59.206 0.00 66.19  ? 134  ARG E CZ    1 
ATOM   9758  N  NH1   . ARG G  3 134 ? -18.656 -35.249 58.720 0.00 68.07  ? 134  ARG E NH1   1 
ATOM   9759  N  NH2   . ARG G  3 134 ? -20.082 -34.417 60.336 0.00 64.30  ? 134  ARG E NH2   1 
ATOM   9760  N  N     . LYS H  4 16  ? 14.428  -47.776 33.368 1.00 87.90  ? 16   LYS F N     1 
ATOM   9761  C  CA    . LYS H  4 16  ? 14.362  -47.341 34.799 1.00 88.02  ? 16   LYS F CA    1 
ATOM   9762  C  C     . LYS H  4 16  ? 14.384  -48.532 35.759 1.00 87.86  ? 16   LYS F C     1 
ATOM   9763  O  O     . LYS H  4 16  ? 13.628  -49.503 35.581 1.00 88.01  ? 16   LYS F O     1 
ATOM   9764  C  CB    . LYS H  4 16  ? 13.124  -46.460 35.063 1.00 88.13  ? 16   LYS F CB    1 
ATOM   9765  C  CG    . LYS H  4 16  ? 11.786  -47.076 34.657 1.00 88.54  ? 16   LYS F CG    1 
ATOM   9766  C  CD    . LYS H  4 16  ? 10.620  -46.410 35.368 1.00 89.68  ? 16   LYS F CD    1 
ATOM   9767  C  CE    . LYS H  4 16  ? 9.314   -47.123 35.038 1.00 90.73  ? 16   LYS F CE    1 
ATOM   9768  N  NZ    . LYS H  4 16  ? 8.184   -46.705 35.922 1.00 90.95  ? 16   LYS F NZ    1 
ATOM   9769  N  N     . ARG H  4 17  ? 15.257  -48.452 36.766 1.00 87.35  ? 17   ARG F N     1 
ATOM   9770  C  CA    . ARG H  4 17  ? 15.390  -49.510 37.775 1.00 86.79  ? 17   ARG F CA    1 
ATOM   9771  C  C     . ARG H  4 17  ? 15.019  -49.052 39.191 1.00 85.92  ? 17   ARG F C     1 
ATOM   9772  O  O     . ARG H  4 17  ? 15.796  -48.352 39.865 1.00 85.80  ? 17   ARG F O     1 
ATOM   9773  C  CB    . ARG H  4 17  ? 16.798  -50.107 37.761 1.00 87.07  ? 17   ARG F CB    1 
ATOM   9774  C  CG    . ARG H  4 17  ? 16.992  -51.250 36.778 1.00 88.51  ? 17   ARG F CG    1 
ATOM   9775  C  CD    . ARG H  4 17  ? 18.482  -51.553 36.645 1.00 90.73  ? 17   ARG F CD    1 
ATOM   9776  N  NE    . ARG H  4 17  ? 18.755  -52.835 35.998 1.00 92.32  ? 17   ARG F NE    1 
ATOM   9777  C  CZ    . ARG H  4 17  ? 19.976  -53.274 35.692 1.00 93.33  ? 17   ARG F CZ    1 
ATOM   9778  N  NH1   . ARG H  4 17  ? 21.046  -52.531 35.968 1.00 93.63  ? 17   ARG F NH1   1 
ATOM   9779  N  NH2   . ARG H  4 17  ? 20.130  -54.458 35.105 1.00 93.37  ? 17   ARG F NH2   1 
ATOM   9780  N  N     . HIS H  4 18  ? 13.819  -49.456 39.614 1.00 84.68  ? 18   HIS F N     1 
ATOM   9781  C  CA    . HIS H  4 18  ? 13.294  -49.246 40.975 1.00 83.47  ? 18   HIS F CA    1 
ATOM   9782  C  C     . HIS H  4 18  ? 12.835  -47.813 41.258 1.00 81.87  ? 18   HIS F C     1 
ATOM   9783  O  O     . HIS H  4 18  ? 13.509  -46.840 40.909 1.00 81.83  ? 18   HIS F O     1 
ATOM   9784  C  CB    . HIS H  4 18  ? 14.274  -49.746 42.065 1.00 83.90  ? 18   HIS F CB    1 
ATOM   9785  C  CG    . HIS H  4 18  ? 14.531  -51.227 42.026 1.00 85.31  ? 18   HIS F CG    1 
ATOM   9786  N  ND1   . HIS H  4 18  ? 13.841  -52.127 42.815 1.00 86.44  ? 18   HIS F ND1   1 
ATOM   9787  C  CD2   . HIS H  4 18  ? 15.410  -51.962 41.299 1.00 86.03  ? 18   HIS F CD2   1 
ATOM   9788  C  CE1   . HIS H  4 18  ? 14.279  -53.351 42.570 1.00 86.54  ? 18   HIS F CE1   1 
ATOM   9789  N  NE2   . HIS H  4 18  ? 15.232  -53.279 41.655 1.00 86.42  ? 18   HIS F NE2   1 
ATOM   9790  N  N     . ARG H  4 19  ? 11.671  -47.711 41.894 1.00 79.75  ? 19   ARG F N     1 
ATOM   9791  C  CA    . ARG H  4 19  ? 11.091  -46.437 42.293 1.00 77.47  ? 19   ARG F CA    1 
ATOM   9792  C  C     . ARG H  4 19  ? 10.416  -46.609 43.654 1.00 75.00  ? 19   ARG F C     1 
ATOM   9793  O  O     . ARG H  4 19  ? 9.347   -47.219 43.744 1.00 74.87  ? 19   ARG F O     1 
ATOM   9794  C  CB    . ARG H  4 19  ? 10.078  -45.971 41.238 1.00 78.04  ? 19   ARG F CB    1 
ATOM   9795  C  CG    . ARG H  4 19  ? 9.838   -44.461 41.223 1.00 80.44  ? 19   ARG F CG    1 
ATOM   9796  C  CD    . ARG H  4 19  ? 8.720   -44.046 42.187 1.00 84.20  ? 19   ARG F CD    1 
ATOM   9797  N  NE    . ARG H  4 19  ? 9.027   -42.782 42.859 1.00 86.79  ? 19   ARG F NE    1 
ATOM   9798  C  CZ    . ARG H  4 19  ? 8.121   -41.884 43.240 1.00 87.88  ? 19   ARG F CZ    1 
ATOM   9799  N  NH1   . ARG H  4 19  ? 6.827   -42.093 43.005 1.00 88.20  ? 19   ARG F NH1   1 
ATOM   9800  N  NH2   . ARG H  4 19  ? 8.514   -40.766 43.844 1.00 87.90  ? 19   ARG F NH2   1 
ATOM   9801  N  N     . LYS H  4 20  ? 11.050  -46.079 44.698 1.00 71.73  ? 20   LYS F N     1 
ATOM   9802  C  CA    . LYS H  4 20  ? 10.568  -46.167 46.091 1.00 68.75  ? 20   LYS F CA    1 
ATOM   9803  C  C     . LYS H  4 20  ? 9.033   -46.105 46.291 1.00 65.89  ? 20   LYS F C     1 
ATOM   9804  O  O     . LYS H  4 20  ? 8.332   -45.338 45.626 1.00 65.84  ? 20   LYS F O     1 
ATOM   9805  C  CB    . LYS H  4 20  ? 11.264  -45.088 46.938 1.00 69.39  ? 20   LYS F CB    1 
ATOM   9806  C  CG    . LYS H  4 20  ? 11.026  -45.177 48.444 1.00 70.90  ? 20   LYS F CG    1 
ATOM   9807  C  CD    . LYS H  4 20  ? 11.390  -46.555 49.007 1.00 73.40  ? 20   LYS F CD    1 
ATOM   9808  C  CE    . LYS H  4 20  ? 10.999  -46.655 50.475 1.00 74.70  ? 20   LYS F CE    1 
ATOM   9809  N  NZ    . LYS H  4 20  ? 10.878  -48.072 50.909 1.00 74.88  ? 20   LYS F NZ    1 
ATOM   9810  N  N     . VAL H  4 21  ? 8.533   -46.918 47.218 1.00 62.09  ? 21   VAL F N     1 
ATOM   9811  C  CA    . VAL H  4 21  ? 7.102   -47.068 47.469 1.00 58.31  ? 21   VAL F CA    1 
ATOM   9812  C  C     . VAL H  4 21  ? 6.640   -45.975 48.417 1.00 55.98  ? 21   VAL F C     1 
ATOM   9813  O  O     . VAL H  4 21  ? 7.175   -45.837 49.518 1.00 55.78  ? 21   VAL F O     1 
ATOM   9814  C  CB    . VAL H  4 21  ? 6.793   -48.459 48.081 1.00 58.33  ? 21   VAL F CB    1 
ATOM   9815  C  CG1   . VAL H  4 21  ? 5.391   -48.522 48.657 1.00 57.68  ? 21   VAL F CG1   1 
ATOM   9816  C  CG2   . VAL H  4 21  ? 6.996   -49.549 47.047 1.00 58.51  ? 21   VAL F CG2   1 
ATOM   9817  N  N     . LEU H  4 22  ? 5.642   -45.206 47.988 1.00 52.89  ? 22   LEU F N     1 
ATOM   9818  C  CA    . LEU H  4 22  ? 5.119   -44.098 48.781 1.00 49.69  ? 22   LEU F CA    1 
ATOM   9819  C  C     . LEU H  4 22  ? 3.953   -44.535 49.643 1.00 47.72  ? 22   LEU F C     1 
ATOM   9820  O  O     . LEU H  4 22  ? 2.905   -44.908 49.134 1.00 47.19  ? 22   LEU F O     1 
ATOM   9821  C  CB    . LEU H  4 22  ? 4.705   -42.935 47.881 1.00 49.43  ? 22   LEU F CB    1 
ATOM   9822  C  CG    . LEU H  4 22  ? 5.794   -42.404 46.948 1.00 49.37  ? 22   LEU F CG    1 
ATOM   9823  C  CD1   . LEU H  4 22  ? 5.197   -41.540 45.869 1.00 48.86  ? 22   LEU F CD1   1 
ATOM   9824  C  CD2   . LEU H  4 22  ? 6.898   -41.661 47.709 1.00 50.16  ? 22   LEU F CD2   1 
ATOM   9825  N  N     . ARG H  4 23  ? 4.145   -44.488 50.955 1.00 45.71  ? 23   ARG F N     1 
ATOM   9826  C  CA    . ARG H  4 23  ? 3.083   -44.838 51.894 1.00 44.23  ? 23   ARG F CA    1 
ATOM   9827  C  C     . ARG H  4 23  ? 3.104   -43.990 53.163 1.00 43.70  ? 23   ARG F C     1 
ATOM   9828  O  O     . ARG H  4 23  ? 4.175   -43.645 53.664 1.00 43.57  ? 23   ARG F O     1 
ATOM   9829  C  CB    . ARG H  4 23  ? 3.118   -46.327 52.249 1.00 43.60  ? 23   ARG F CB    1 
ATOM   9830  C  CG    . ARG H  4 23  ? 4.497   -46.857 52.558 1.00 42.16  ? 23   ARG F CG    1 
ATOM   9831  C  CD    . ARG H  4 23  ? 4.535   -48.366 52.512 1.00 37.48  ? 23   ARG F CD    1 
ATOM   9832  N  NE    . ARG H  4 23  ? 4.218   -48.891 53.828 1.00 35.39  ? 23   ARG F NE    1 
ATOM   9833  C  CZ    . ARG H  4 23  ? 5.116   -49.207 54.758 1.00 31.42  ? 23   ARG F CZ    1 
ATOM   9834  N  NH1   . ARG H  4 23  ? 6.422   -49.094 54.539 1.00 29.82  ? 23   ARG F NH1   1 
ATOM   9835  N  NH2   . ARG H  4 23  ? 4.687   -49.660 55.908 1.00 28.87  ? 23   ARG F NH2   1 
ATOM   9836  N  N     . ASP H  4 24  ? 1.903   -43.660 53.654 1.00 42.96  ? 24   ASP F N     1 
ATOM   9837  C  CA    . ASP H  4 24  ? 1.685   -42.942 54.922 1.00 42.11  ? 24   ASP F CA    1 
ATOM   9838  C  C     . ASP H  4 24  ? 2.413   -41.597 55.035 1.00 40.77  ? 24   ASP F C     1 
ATOM   9839  O  O     . ASP H  4 24  ? 2.889   -41.202 56.105 1.00 40.16  ? 24   ASP F O     1 
ATOM   9840  C  CB    . ASP H  4 24  ? 2.010   -43.835 56.119 1.00 42.52  ? 24   ASP F CB    1 
ATOM   9841  C  CG    . ASP H  4 24  ? 1.121   -43.539 57.309 1.00 45.39  ? 24   ASP F CG    1 
ATOM   9842  O  OD1   . ASP H  4 24  ? -0.116  -43.395 57.100 1.00 47.32  ? 24   ASP F OD1   1 
ATOM   9843  O  OD2   . ASP H  4 24  ? 1.654   -43.453 58.449 1.00 47.92  ? 24   ASP F OD2   1 
ATOM   9844  N  N     . ASN H  4 25  ? 2.472   -40.894 53.915 1.00 39.23  ? 25   ASN F N     1 
ATOM   9845  C  CA    . ASN H  4 25  ? 3.045   -39.576 53.869 1.00 37.90  ? 25   ASN F CA    1 
ATOM   9846  C  C     . ASN H  4 25  ? 2.211   -38.471 54.559 1.00 37.60  ? 25   ASN F C     1 
ATOM   9847  O  O     . ASN H  4 25  ? 2.731   -37.409 54.875 1.00 37.57  ? 25   ASN F O     1 
ATOM   9848  C  CB    . ASN H  4 25  ? 3.321   -39.244 52.428 1.00 37.69  ? 25   ASN F CB    1 
ATOM   9849  C  CG    . ASN H  4 25  ? 4.497   -40.015 51.894 1.00 37.64  ? 25   ASN F CG    1 
ATOM   9850  O  OD1   . ASN H  4 25  ? 5.628   -39.797 52.328 1.00 39.02  ? 25   ASN F OD1   1 
ATOM   9851  N  ND2   . ASN H  4 25  ? 4.248   -40.921 50.951 1.00 35.89  ? 25   ASN F ND2   1 
ATOM   9852  N  N     . ILE H  4 26  ? 0.934   -38.733 54.821 1.00 36.85  ? 26   ILE F N     1 
ATOM   9853  C  CA    . ILE H  4 26  ? 0.092   -37.786 55.512 1.00 36.69  ? 26   ILE F CA    1 
ATOM   9854  C  C     . ILE H  4 26  ? 0.697   -37.453 56.881 1.00 36.59  ? 26   ILE F C     1 
ATOM   9855  O  O     . ILE H  4 26  ? 0.382   -36.433 57.485 1.00 36.59  ? 26   ILE F O     1 
ATOM   9856  C  CB    . ILE H  4 26  ? -1.391  -38.290 55.631 1.00 36.28  ? 26   ILE F CB    1 
ATOM   9857  C  CG1   . ILE H  4 26  ? -2.354  -37.152 56.006 1.00 36.93  ? 26   ILE F CG1   1 
ATOM   9858  C  CG2   . ILE H  4 26  ? -1.523  -39.349 56.692 1.00 36.58  ? 26   ILE F CG2   1 
ATOM   9859  C  CD1   . ILE H  4 26  ? -2.448  -35.980 55.021 1.00 35.09  ? 26   ILE F CD1   1 
ATOM   9860  N  N     . GLN H  4 27  ? 1.581   -38.312 57.363 1.00 36.71  ? 27   GLN F N     1 
ATOM   9861  C  CA    . GLN H  4 27  ? 2.119   -38.145 58.717 1.00 36.37  ? 27   GLN F CA    1 
ATOM   9862  C  C     . GLN H  4 27  ? 3.317   -37.251 58.638 1.00 36.07  ? 27   GLN F C     1 
ATOM   9863  O  O     . GLN H  4 27  ? 3.886   -36.895 59.654 1.00 37.50  ? 27   GLN F O     1 
ATOM   9864  C  CB    . GLN H  4 27  ? 2.471   -39.487 59.382 1.00 35.90  ? 27   GLN F CB    1 
ATOM   9865  C  CG    . GLN H  4 27  ? 1.263   -40.381 59.660 1.00 35.52  ? 27   GLN F CG    1 
ATOM   9866  C  CD    . GLN H  4 27  ? 0.387   -39.878 60.797 1.00 36.08  ? 27   GLN F CD    1 
ATOM   9867  O  OE1   . GLN H  4 27  ? 0.894   -39.342 61.779 1.00 39.51  ? 27   GLN F OE1   1 
ATOM   9868  N  NE2   . GLN H  4 27  ? -0.935  -40.070 60.685 1.00 34.58  ? 27   GLN F NE2   1 
ATOM   9869  N  N     . GLY H  4 28  ? 3.693   -36.884 57.426 1.00 35.33  ? 28   GLY F N     1 
ATOM   9870  C  CA    . GLY H  4 28  ? 4.733   -35.900 57.225 1.00 35.22  ? 28   GLY F CA    1 
ATOM   9871  C  C     . GLY H  4 28  ? 4.172   -34.520 57.522 1.00 35.50  ? 28   GLY F C     1 
ATOM   9872  O  O     . GLY H  4 28  ? 4.931   -33.553 57.647 1.00 36.28  ? 28   GLY F O     1 
ATOM   9873  N  N     . ILE H  4 29  ? 2.842   -34.418 57.608 1.00 34.56  ? 29   ILE F N     1 
ATOM   9874  C  CA    . ILE H  4 29  ? 2.199   -33.219 58.095 1.00 33.43  ? 29   ILE F CA    1 
ATOM   9875  C  C     . ILE H  4 29  ? 2.188   -33.330 59.615 1.00 33.02  ? 29   ILE F C     1 
ATOM   9876  O  O     . ILE H  4 29  ? 1.221   -33.833 60.211 1.00 32.37  ? 29   ILE F O     1 
ATOM   9877  C  CB    . ILE H  4 29  ? 0.747   -33.046 57.571 1.00 33.63  ? 29   ILE F CB    1 
ATOM   9878  C  CG1   . ILE H  4 29  ? 0.601   -33.382 56.070 1.00 32.95  ? 29   ILE F CG1   1 
ATOM   9879  C  CG2   . ILE H  4 29  ? 0.250   -31.655 57.878 1.00 33.32  ? 29   ILE F CG2   1 
ATOM   9880  C  CD1   . ILE H  4 29  ? 1.617   -32.740 55.138 1.00 30.40  ? 29   ILE F CD1   1 
ATOM   9881  N  N     . THR H  4 30  ? 3.265   -32.828 60.225 1.00 32.46  ? 30   THR F N     1 
ATOM   9882  C  CA    . THR H  4 30  ? 3.539   -33.006 61.643 1.00 32.58  ? 30   THR F CA    1 
ATOM   9883  C  C     . THR H  4 30  ? 2.613   -32.214 62.564 1.00 32.35  ? 30   THR F C     1 
ATOM   9884  O  O     . THR H  4 30  ? 1.941   -31.270 62.150 1.00 32.49  ? 30   THR F O     1 
ATOM   9885  C  CB    . THR H  4 30  ? 4.993   -32.631 61.983 1.00 32.39  ? 30   THR F CB    1 
ATOM   9886  O  OG1   . THR H  4 30  ? 5.182   -31.248 61.712 1.00 34.28  ? 30   THR F OG1   1 
ATOM   9887  C  CG2   . THR H  4 30  ? 5.987   -33.412 61.152 1.00 33.29  ? 30   THR F CG2   1 
ATOM   9888  N  N     . LYS H  4 31  ? 2.612   -32.600 63.831 1.00 31.93  ? 31   LYS F N     1 
ATOM   9889  C  CA    . LYS H  4 31  ? 1.863   -31.910 64.867 1.00 31.74  ? 31   LYS F CA    1 
ATOM   9890  C  C     . LYS H  4 31  ? 2.224   -30.413 64.978 1.00 31.48  ? 31   LYS F C     1 
ATOM   9891  O  O     . LYS H  4 31  ? 1.323   -29.566 65.104 1.00 31.65  ? 31   LYS F O     1 
ATOM   9892  C  CB    . LYS H  4 31  ? 2.075   -32.627 66.203 1.00 31.73  ? 31   LYS F CB    1 
ATOM   9893  C  CG    . LYS H  4 31  ? 1.200   -32.156 67.297 1.00 32.80  ? 31   LYS F CG    1 
ATOM   9894  C  CD    . LYS H  4 31  ? 1.510   -32.841 68.593 1.00 35.32  ? 31   LYS F CD    1 
ATOM   9895  C  CE    . LYS H  4 31  ? 0.950   -32.010 69.752 1.00 38.04  ? 31   LYS F CE    1 
ATOM   9896  N  NZ    . LYS H  4 31  ? 1.110   -32.713 71.065 1.00 40.95  ? 31   LYS F NZ    1 
ATOM   9897  N  N     . PRO H  4 32  ? 3.527   -30.074 64.921 1.00 30.77  ? 32   PRO F N     1 
ATOM   9898  C  CA    . PRO H  4 32  ? 3.885   -28.654 65.037 1.00 30.45  ? 32   PRO F CA    1 
ATOM   9899  C  C     . PRO H  4 32  ? 3.518   -27.844 63.806 1.00 29.65  ? 32   PRO F C     1 
ATOM   9900  O  O     . PRO H  4 32  ? 3.171   -26.687 63.936 1.00 29.93  ? 32   PRO F O     1 
ATOM   9901  C  CB    . PRO H  4 32  ? 5.415   -28.673 65.205 1.00 30.34  ? 32   PRO F CB    1 
ATOM   9902  C  CG    . PRO H  4 32  ? 5.778   -30.116 65.395 1.00 31.89  ? 32   PRO F CG    1 
ATOM   9903  C  CD    . PRO H  4 32  ? 4.716   -30.918 64.749 1.00 30.73  ? 32   PRO F CD    1 
ATOM   9904  N  N     . ALA H  4 33  ? 3.632   -28.433 62.623 1.00 28.94  ? 33   ALA F N     1 
ATOM   9905  C  CA    . ALA H  4 33  ? 3.187   -27.774 61.422 1.00 28.86  ? 33   ALA F CA    1 
ATOM   9906  C  C     . ALA H  4 33  ? 1.688   -27.448 61.510 1.00 28.95  ? 33   ALA F C     1 
ATOM   9907  O  O     . ALA H  4 33  ? 1.276   -26.336 61.205 1.00 29.35  ? 33   ALA F O     1 
ATOM   9908  C  CB    . ALA H  4 33  ? 3.474   -28.620 60.232 1.00 28.74  ? 33   ALA F CB    1 
ATOM   9909  N  N     . ILE H  4 34  ? 0.877   -28.406 61.942 1.00 29.05  ? 34   ILE F N     1 
ATOM   9910  C  CA    . ILE H  4 34  ? -0.559  -28.184 62.059 1.00 29.28  ? 34   ILE F CA    1 
ATOM   9911  C  C     . ILE H  4 34  ? -0.818  -27.097 63.102 1.00 30.06  ? 34   ILE F C     1 
ATOM   9912  O  O     . ILE H  4 34  ? -1.641  -26.195 62.885 1.00 30.18  ? 34   ILE F O     1 
ATOM   9913  C  CB    . ILE H  4 34  ? -1.334  -29.501 62.419 1.00 29.35  ? 34   ILE F CB    1 
ATOM   9914  C  CG1   . ILE H  4 34  ? -1.253  -30.513 61.265 1.00 28.38  ? 34   ILE F CG1   1 
ATOM   9915  C  CG2   . ILE H  4 34  ? -2.790  -29.208 62.820 1.00 27.04  ? 34   ILE F CG2   1 
ATOM   9916  C  CD1   . ILE H  4 34  ? -1.383  -31.958 61.710 1.00 26.63  ? 34   ILE F CD1   1 
ATOM   9917  N  N     . ARG H  4 35  ? -0.106  -27.180 64.225 1.00 30.19  ? 35   ARG F N     1 
ATOM   9918  C  CA    . ARG H  4 35  ? -0.242  -26.196 65.288 1.00 30.28  ? 35   ARG F CA    1 
ATOM   9919  C  C     . ARG H  4 35  ? 0.083   -24.805 64.766 1.00 29.49  ? 35   ARG F C     1 
ATOM   9920  O  O     . ARG H  4 35  ? -0.603  -23.828 65.102 1.00 29.22  ? 35   ARG F O     1 
ATOM   9921  C  CB    . ARG H  4 35  ? 0.651   -26.531 66.470 1.00 30.58  ? 35   ARG F CB    1 
ATOM   9922  C  CG    . ARG H  4 35  ? 0.317   -25.689 67.689 1.00 35.71  ? 35   ARG F CG    1 
ATOM   9923  C  CD    . ARG H  4 35  ? 1.447   -25.572 68.720 1.00 40.58  ? 35   ARG F CD    1 
ATOM   9924  N  NE    . ARG H  4 35  ? 2.030   -26.876 68.991 1.00 45.66  ? 35   ARG F NE    1 
ATOM   9925  C  CZ    . ARG H  4 35  ? 1.363   -27.886 69.532 1.00 48.63  ? 35   ARG F CZ    1 
ATOM   9926  N  NH1   . ARG H  4 35  ? 0.075   -27.736 69.860 1.00 47.17  ? 35   ARG F NH1   1 
ATOM   9927  N  NH2   . ARG H  4 35  ? 1.995   -29.046 69.736 1.00 50.57  ? 35   ARG F NH2   1 
ATOM   9928  N  N     . ARG H  4 36  ? 1.113   -24.720 63.934 1.00 28.84  ? 36   ARG F N     1 
ATOM   9929  C  CA    . ARG H  4 36  ? 1.516   -23.442 63.343 1.00 28.70  ? 36   ARG F CA    1 
ATOM   9930  C  C     . ARG H  4 36  ? 0.397   -22.854 62.491 1.00 28.00  ? 36   ARG F C     1 
ATOM   9931  O  O     . ARG H  4 36  ? 0.090   -21.682 62.610 1.00 28.56  ? 36   ARG F O     1 
ATOM   9932  C  CB    . ARG H  4 36  ? 2.791   -23.601 62.516 1.00 28.79  ? 36   ARG F CB    1 
ATOM   9933  C  CG    . ARG H  4 36  ? 4.058   -23.588 63.341 1.00 28.99  ? 36   ARG F CG    1 
ATOM   9934  C  CD    . ARG H  4 36  ? 5.267   -23.300 62.467 1.00 29.64  ? 36   ARG F CD    1 
ATOM   9935  N  NE    . ARG H  4 36  ? 5.517   -24.366 61.491 1.00 30.14  ? 36   ARG F NE    1 
ATOM   9936  C  CZ    . ARG H  4 36  ? 6.180   -25.501 61.756 1.00 28.06  ? 36   ARG F CZ    1 
ATOM   9937  N  NH1   . ARG H  4 36  ? 6.667   -25.734 62.975 1.00 23.11  ? 36   ARG F NH1   1 
ATOM   9938  N  NH2   . ARG H  4 36  ? 6.362   -26.397 60.788 1.00 25.11  ? 36   ARG F NH2   1 
ATOM   9939  N  N     . LEU H  4 37  ? -0.226  -23.680 61.659 1.00 27.35  ? 37   LEU F N     1 
ATOM   9940  C  CA    . LEU H  4 37  ? -1.365  -23.252 60.847 1.00 26.84  ? 37   LEU F CA    1 
ATOM   9941  C  C     . LEU H  4 37  ? -2.520  -22.796 61.715 1.00 26.45  ? 37   LEU F C     1 
ATOM   9942  O  O     . LEU H  4 37  ? -3.193  -21.818 61.401 1.00 27.04  ? 37   LEU F O     1 
ATOM   9943  C  CB    . LEU H  4 37  ? -1.836  -24.374 59.927 1.00 26.97  ? 37   LEU F CB    1 
ATOM   9944  C  CG    . LEU H  4 37  ? -0.897  -24.849 58.815 1.00 26.25  ? 37   LEU F CG    1 
ATOM   9945  C  CD1   . LEU H  4 37  ? -1.178  -26.297 58.411 1.00 23.87  ? 37   LEU F CD1   1 
ATOM   9946  C  CD2   . LEU H  4 37  ? -1.006  -23.935 57.612 1.00 24.88  ? 37   LEU F CD2   1 
ATOM   9947  N  N     . ALA H  4 38  ? -2.749  -23.487 62.820 1.00 25.93  ? 38   ALA F N     1 
ATOM   9948  C  CA    . ALA H  4 38  ? -3.799  -23.077 63.747 1.00 25.29  ? 38   ALA F CA    1 
ATOM   9949  C  C     . ALA H  4 38  ? -3.505  -21.663 64.267 1.00 25.13  ? 38   ALA F C     1 
ATOM   9950  O  O     . ALA H  4 38  ? -4.411  -20.807 64.393 1.00 24.21  ? 38   ALA F O     1 
ATOM   9951  C  CB    . ALA H  4 38  ? -3.888  -24.048 64.878 1.00 24.55  ? 38   ALA F CB    1 
ATOM   9952  N  N     . ARG H  4 39  ? -2.222  -21.423 64.546 1.00 25.08  ? 39   ARG F N     1 
ATOM   9953  C  CA    . ARG H  4 39  ? -1.790  -20.142 65.083 1.00 24.81  ? 39   ARG F CA    1 
ATOM   9954  C  C     . ARG H  4 39  ? -2.096  -19.025 64.087 1.00 24.69  ? 39   ARG F C     1 
ATOM   9955  O  O     . ARG H  4 39  ? -2.712  -18.025 64.455 1.00 24.80  ? 39   ARG F O     1 
ATOM   9956  C  CB    . ARG H  4 39  ? -0.316  -20.174 65.433 1.00 24.60  ? 39   ARG F CB    1 
ATOM   9957  C  CG    . ARG H  4 39  ? 0.030   -21.142 66.525 1.00 24.29  ? 39   ARG F CG    1 
ATOM   9958  C  CD    . ARG H  4 39  ? -0.620  -20.803 67.849 1.00 24.94  ? 39   ARG F CD    1 
ATOM   9959  N  NE    . ARG H  4 39  ? -0.118  -21.698 68.888 1.00 25.54  ? 39   ARG F NE    1 
ATOM   9960  C  CZ    . ARG H  4 39  ? -0.884  -22.395 69.719 1.00 26.42  ? 39   ARG F CZ    1 
ATOM   9961  N  NH1   . ARG H  4 39  ? -2.206  -22.300 69.680 1.00 25.20  ? 39   ARG F NH1   1 
ATOM   9962  N  NH2   . ARG H  4 39  ? -0.318  -23.174 70.619 1.00 29.44  ? 39   ARG F NH2   1 
ATOM   9963  N  N     . ARG H  4 40  ? -1.726  -19.216 62.824 1.00 23.98  ? 40   ARG F N     1 
ATOM   9964  C  CA    . ARG H  4 40  ? -2.065  -18.214 61.802 1.00 23.92  ? 40   ARG F CA    1 
ATOM   9965  C  C     . ARG H  4 40  ? -3.584  -17.999 61.730 1.00 23.92  ? 40   ARG F C     1 
ATOM   9966  O  O     . ARG H  4 40  ? -4.057  -16.894 61.462 1.00 24.57  ? 40   ARG F O     1 
ATOM   9967  C  CB    . ARG H  4 40  ? -1.471  -18.596 60.446 1.00 23.19  ? 40   ARG F CB    1 
ATOM   9968  C  CG    . ARG H  4 40  ? -1.516  -17.539 59.399 1.00 21.88  ? 40   ARG F CG    1 
ATOM   9969  C  CD    . ARG H  4 40  ? -0.557  -17.868 58.237 1.00 21.15  ? 40   ARG F CD    1 
ATOM   9970  N  NE    . ARG H  4 40  ? 0.821   -17.499 58.564 1.00 21.59  ? 40   ARG F NE    1 
ATOM   9971  C  CZ    . ARG H  4 40  ? 1.890   -17.849 57.850 1.00 21.61  ? 40   ARG F CZ    1 
ATOM   9972  N  NH1   . ARG H  4 40  ? 1.737   -18.552 56.746 1.00 19.70  ? 40   ARG F NH1   1 
ATOM   9973  N  NH2   . ARG H  4 40  ? 3.120   -17.486 58.238 1.00 21.67  ? 40   ARG F NH2   1 
ATOM   9974  N  N     . GLY H  4 41  ? -4.348  -19.046 62.020 1.00 24.09  ? 41   GLY F N     1 
ATOM   9975  C  CA    . GLY H  4 41  ? -5.810  -18.972 61.964 1.00 23.65  ? 41   GLY F CA    1 
ATOM   9976  C  C     . GLY H  4 41  ? -6.384  -18.463 63.264 1.00 23.60  ? 41   GLY F C     1 
ATOM   9977  O  O     . GLY H  4 41  ? -7.586  -18.454 63.445 1.00 23.33  ? 41   GLY F O     1 
ATOM   9978  N  N     . GLY H  4 42  ? -5.516  -18.054 64.182 1