data_2O2C
# 
_entry.id   2O2C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2O2C         
RCSB  RCSB040598   
WWPDB D_1000040598 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2O2D 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2O2C 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-29 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arsenieva, D.' 1 
'Mazock, G.H.'  2 
'Appavu, B.L.'  3 
'Jeffery, C.J.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of phosphoglucose isomerase from Trypanosoma brucei complexed with glucose-6-phosphate at 1.6 A resolution' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            74 
_citation.page_first                72 
_citation.page_last                 80 
_citation.year                      2008 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18561188 
_citation.pdbx_database_id_DOI      10.1002/prot.22133 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Arsenieva, D.' 1 ? 
primary 'Appavu, B.L.'  2 ? 
primary 'Mazock, G.H.'  3 ? 
primary 'Jeffery, C.J.' 4 ? 
# 
_cell.length_a           125.837 
_cell.length_b           221.253 
_cell.length_c           128.087 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2O2C 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.entry_id                         2O2C 
_symmetry.Int_Tables_number                20 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glucose-6-phosphate isomerase, glycosomal' 68458.656 3    5.3.1.9 ? ? ? 
2 non-polymer man GLUCOSE-6-PHOSPHATE                         260.136   3    ?       ? ? ? 
3 non-polymer syn GLYCEROL                                    92.094    6    ?       ? ? ? 
4 water       nat water                                       18.015    1311 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'GPI; Phosphoglucose isomerase; PGI; Phosphohexose isomerase; PHI' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.5.3.1.9 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSYLDDLRIDLAASPASGGSASIAVGSFNIPYEVTRRLKGVGADADTTLTSCASWTQLQKLYEQYGDEPIKKHFETDSE
RGQRYSVKVSLGSKDENFLFLDYSKSHINDEIKCALLRLAEERGIRQFVQSVFRGERVNTTENRPVLHIALRNRSNRPIY
VDGKDVMPAVNKVLDQMRSFSEKVRTGEWKGHTGKAIRHVVNIGIGGSDLGPVMATEALKPFSQRDLSLHFVSNVDGTHI
AEVLKSIDIEATLFIVASKTFTTQETITNALSARRALLDYLRSRGIDEKGSVAKHFVALSTNNQKVKEFGIDEENMFQFW
DWVGGRYSMWSAIGLPIMISIGYENFVELLTGAHVIDEHFANAPPEQNVPLLLALVGVWYINFFGAVTHAILPYDQYLWR
LPAYLQQLDMESNGKYVTRSGKTVSTLTGPIIFGEAGTNGQHAFYQLIHQGTNLIPCDFIGAIQSQNKIGDHHKIFMSNF
FAQTEALMIGKSPSEVRRELEAAGERSAEKINALLPHKTFIGGRPSNTLLIKSLTPRALGAIIAMYEHKVLVQGAIWGID
SYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNELSHLHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSYLDDLRIDLAASPASGGSASIAVGSFNIPYEVTRRLKGVGADADTTLTSCASWTQLQKLYEQYGDEPIKKHFETDSE
RGQRYSVKVSLGSKDENFLFLDYSKSHINDEIKCALLRLAEERGIRQFVQSVFRGERVNTTENRPVLHIALRNRSNRPIY
VDGKDVMPAVNKVLDQMRSFSEKVRTGEWKGHTGKAIRHVVNIGIGGSDLGPVMATEALKPFSQRDLSLHFVSNVDGTHI
AEVLKSIDIEATLFIVASKTFTTQETITNALSARRALLDYLRSRGIDEKGSVAKHFVALSTNNQKVKEFGIDEENMFQFW
DWVGGRYSMWSAIGLPIMISIGYENFVELLTGAHVIDEHFANAPPEQNVPLLLALVGVWYINFFGAVTHAILPYDQYLWR
LPAYLQQLDMESNGKYVTRSGKTVSTLTGPIIFGEAGTNGQHAFYQLIHQGTNLIPCDFIGAIQSQNKIGDHHKIFMSNF
FAQTEALMIGKSPSEVRRELEAAGERSAEKINALLPHKTFIGGRPSNTLLIKSLTPRALGAIIAMYEHKVLVQGAIWGID
SYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNELSHLHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   TYR n 
1 5   LEU n 
1 6   ASP n 
1 7   ASP n 
1 8   LEU n 
1 9   ARG n 
1 10  ILE n 
1 11  ASP n 
1 12  LEU n 
1 13  ALA n 
1 14  ALA n 
1 15  SER n 
1 16  PRO n 
1 17  ALA n 
1 18  SER n 
1 19  GLY n 
1 20  GLY n 
1 21  SER n 
1 22  ALA n 
1 23  SER n 
1 24  ILE n 
1 25  ALA n 
1 26  VAL n 
1 27  GLY n 
1 28  SER n 
1 29  PHE n 
1 30  ASN n 
1 31  ILE n 
1 32  PRO n 
1 33  TYR n 
1 34  GLU n 
1 35  VAL n 
1 36  THR n 
1 37  ARG n 
1 38  ARG n 
1 39  LEU n 
1 40  LYS n 
1 41  GLY n 
1 42  VAL n 
1 43  GLY n 
1 44  ALA n 
1 45  ASP n 
1 46  ALA n 
1 47  ASP n 
1 48  THR n 
1 49  THR n 
1 50  LEU n 
1 51  THR n 
1 52  SER n 
1 53  CYS n 
1 54  ALA n 
1 55  SER n 
1 56  TRP n 
1 57  THR n 
1 58  GLN n 
1 59  LEU n 
1 60  GLN n 
1 61  LYS n 
1 62  LEU n 
1 63  TYR n 
1 64  GLU n 
1 65  GLN n 
1 66  TYR n 
1 67  GLY n 
1 68  ASP n 
1 69  GLU n 
1 70  PRO n 
1 71  ILE n 
1 72  LYS n 
1 73  LYS n 
1 74  HIS n 
1 75  PHE n 
1 76  GLU n 
1 77  THR n 
1 78  ASP n 
1 79  SER n 
1 80  GLU n 
1 81  ARG n 
1 82  GLY n 
1 83  GLN n 
1 84  ARG n 
1 85  TYR n 
1 86  SER n 
1 87  VAL n 
1 88  LYS n 
1 89  VAL n 
1 90  SER n 
1 91  LEU n 
1 92  GLY n 
1 93  SER n 
1 94  LYS n 
1 95  ASP n 
1 96  GLU n 
1 97  ASN n 
1 98  PHE n 
1 99  LEU n 
1 100 PHE n 
1 101 LEU n 
1 102 ASP n 
1 103 TYR n 
1 104 SER n 
1 105 LYS n 
1 106 SER n 
1 107 HIS n 
1 108 ILE n 
1 109 ASN n 
1 110 ASP n 
1 111 GLU n 
1 112 ILE n 
1 113 LYS n 
1 114 CYS n 
1 115 ALA n 
1 116 LEU n 
1 117 LEU n 
1 118 ARG n 
1 119 LEU n 
1 120 ALA n 
1 121 GLU n 
1 122 GLU n 
1 123 ARG n 
1 124 GLY n 
1 125 ILE n 
1 126 ARG n 
1 127 GLN n 
1 128 PHE n 
1 129 VAL n 
1 130 GLN n 
1 131 SER n 
1 132 VAL n 
1 133 PHE n 
1 134 ARG n 
1 135 GLY n 
1 136 GLU n 
1 137 ARG n 
1 138 VAL n 
1 139 ASN n 
1 140 THR n 
1 141 THR n 
1 142 GLU n 
1 143 ASN n 
1 144 ARG n 
1 145 PRO n 
1 146 VAL n 
1 147 LEU n 
1 148 HIS n 
1 149 ILE n 
1 150 ALA n 
1 151 LEU n 
1 152 ARG n 
1 153 ASN n 
1 154 ARG n 
1 155 SER n 
1 156 ASN n 
1 157 ARG n 
1 158 PRO n 
1 159 ILE n 
1 160 TYR n 
1 161 VAL n 
1 162 ASP n 
1 163 GLY n 
1 164 LYS n 
1 165 ASP n 
1 166 VAL n 
1 167 MET n 
1 168 PRO n 
1 169 ALA n 
1 170 VAL n 
1 171 ASN n 
1 172 LYS n 
1 173 VAL n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 MET n 
1 178 ARG n 
1 179 SER n 
1 180 PHE n 
1 181 SER n 
1 182 GLU n 
1 183 LYS n 
1 184 VAL n 
1 185 ARG n 
1 186 THR n 
1 187 GLY n 
1 188 GLU n 
1 189 TRP n 
1 190 LYS n 
1 191 GLY n 
1 192 HIS n 
1 193 THR n 
1 194 GLY n 
1 195 LYS n 
1 196 ALA n 
1 197 ILE n 
1 198 ARG n 
1 199 HIS n 
1 200 VAL n 
1 201 VAL n 
1 202 ASN n 
1 203 ILE n 
1 204 GLY n 
1 205 ILE n 
1 206 GLY n 
1 207 GLY n 
1 208 SER n 
1 209 ASP n 
1 210 LEU n 
1 211 GLY n 
1 212 PRO n 
1 213 VAL n 
1 214 MET n 
1 215 ALA n 
1 216 THR n 
1 217 GLU n 
1 218 ALA n 
1 219 LEU n 
1 220 LYS n 
1 221 PRO n 
1 222 PHE n 
1 223 SER n 
1 224 GLN n 
1 225 ARG n 
1 226 ASP n 
1 227 LEU n 
1 228 SER n 
1 229 LEU n 
1 230 HIS n 
1 231 PHE n 
1 232 VAL n 
1 233 SER n 
1 234 ASN n 
1 235 VAL n 
1 236 ASP n 
1 237 GLY n 
1 238 THR n 
1 239 HIS n 
1 240 ILE n 
1 241 ALA n 
1 242 GLU n 
1 243 VAL n 
1 244 LEU n 
1 245 LYS n 
1 246 SER n 
1 247 ILE n 
1 248 ASP n 
1 249 ILE n 
1 250 GLU n 
1 251 ALA n 
1 252 THR n 
1 253 LEU n 
1 254 PHE n 
1 255 ILE n 
1 256 VAL n 
1 257 ALA n 
1 258 SER n 
1 259 LYS n 
1 260 THR n 
1 261 PHE n 
1 262 THR n 
1 263 THR n 
1 264 GLN n 
1 265 GLU n 
1 266 THR n 
1 267 ILE n 
1 268 THR n 
1 269 ASN n 
1 270 ALA n 
1 271 LEU n 
1 272 SER n 
1 273 ALA n 
1 274 ARG n 
1 275 ARG n 
1 276 ALA n 
1 277 LEU n 
1 278 LEU n 
1 279 ASP n 
1 280 TYR n 
1 281 LEU n 
1 282 ARG n 
1 283 SER n 
1 284 ARG n 
1 285 GLY n 
1 286 ILE n 
1 287 ASP n 
1 288 GLU n 
1 289 LYS n 
1 290 GLY n 
1 291 SER n 
1 292 VAL n 
1 293 ALA n 
1 294 LYS n 
1 295 HIS n 
1 296 PHE n 
1 297 VAL n 
1 298 ALA n 
1 299 LEU n 
1 300 SER n 
1 301 THR n 
1 302 ASN n 
1 303 ASN n 
1 304 GLN n 
1 305 LYS n 
1 306 VAL n 
1 307 LYS n 
1 308 GLU n 
1 309 PHE n 
1 310 GLY n 
1 311 ILE n 
1 312 ASP n 
1 313 GLU n 
1 314 GLU n 
1 315 ASN n 
1 316 MET n 
1 317 PHE n 
1 318 GLN n 
1 319 PHE n 
1 320 TRP n 
1 321 ASP n 
1 322 TRP n 
1 323 VAL n 
1 324 GLY n 
1 325 GLY n 
1 326 ARG n 
1 327 TYR n 
1 328 SER n 
1 329 MET n 
1 330 TRP n 
1 331 SER n 
1 332 ALA n 
1 333 ILE n 
1 334 GLY n 
1 335 LEU n 
1 336 PRO n 
1 337 ILE n 
1 338 MET n 
1 339 ILE n 
1 340 SER n 
1 341 ILE n 
1 342 GLY n 
1 343 TYR n 
1 344 GLU n 
1 345 ASN n 
1 346 PHE n 
1 347 VAL n 
1 348 GLU n 
1 349 LEU n 
1 350 LEU n 
1 351 THR n 
1 352 GLY n 
1 353 ALA n 
1 354 HIS n 
1 355 VAL n 
1 356 ILE n 
1 357 ASP n 
1 358 GLU n 
1 359 HIS n 
1 360 PHE n 
1 361 ALA n 
1 362 ASN n 
1 363 ALA n 
1 364 PRO n 
1 365 PRO n 
1 366 GLU n 
1 367 GLN n 
1 368 ASN n 
1 369 VAL n 
1 370 PRO n 
1 371 LEU n 
1 372 LEU n 
1 373 LEU n 
1 374 ALA n 
1 375 LEU n 
1 376 VAL n 
1 377 GLY n 
1 378 VAL n 
1 379 TRP n 
1 380 TYR n 
1 381 ILE n 
1 382 ASN n 
1 383 PHE n 
1 384 PHE n 
1 385 GLY n 
1 386 ALA n 
1 387 VAL n 
1 388 THR n 
1 389 HIS n 
1 390 ALA n 
1 391 ILE n 
1 392 LEU n 
1 393 PRO n 
1 394 TYR n 
1 395 ASP n 
1 396 GLN n 
1 397 TYR n 
1 398 LEU n 
1 399 TRP n 
1 400 ARG n 
1 401 LEU n 
1 402 PRO n 
1 403 ALA n 
1 404 TYR n 
1 405 LEU n 
1 406 GLN n 
1 407 GLN n 
1 408 LEU n 
1 409 ASP n 
1 410 MET n 
1 411 GLU n 
1 412 SER n 
1 413 ASN n 
1 414 GLY n 
1 415 LYS n 
1 416 TYR n 
1 417 VAL n 
1 418 THR n 
1 419 ARG n 
1 420 SER n 
1 421 GLY n 
1 422 LYS n 
1 423 THR n 
1 424 VAL n 
1 425 SER n 
1 426 THR n 
1 427 LEU n 
1 428 THR n 
1 429 GLY n 
1 430 PRO n 
1 431 ILE n 
1 432 ILE n 
1 433 PHE n 
1 434 GLY n 
1 435 GLU n 
1 436 ALA n 
1 437 GLY n 
1 438 THR n 
1 439 ASN n 
1 440 GLY n 
1 441 GLN n 
1 442 HIS n 
1 443 ALA n 
1 444 PHE n 
1 445 TYR n 
1 446 GLN n 
1 447 LEU n 
1 448 ILE n 
1 449 HIS n 
1 450 GLN n 
1 451 GLY n 
1 452 THR n 
1 453 ASN n 
1 454 LEU n 
1 455 ILE n 
1 456 PRO n 
1 457 CYS n 
1 458 ASP n 
1 459 PHE n 
1 460 ILE n 
1 461 GLY n 
1 462 ALA n 
1 463 ILE n 
1 464 GLN n 
1 465 SER n 
1 466 GLN n 
1 467 ASN n 
1 468 LYS n 
1 469 ILE n 
1 470 GLY n 
1 471 ASP n 
1 472 HIS n 
1 473 HIS n 
1 474 LYS n 
1 475 ILE n 
1 476 PHE n 
1 477 MET n 
1 478 SER n 
1 479 ASN n 
1 480 PHE n 
1 481 PHE n 
1 482 ALA n 
1 483 GLN n 
1 484 THR n 
1 485 GLU n 
1 486 ALA n 
1 487 LEU n 
1 488 MET n 
1 489 ILE n 
1 490 GLY n 
1 491 LYS n 
1 492 SER n 
1 493 PRO n 
1 494 SER n 
1 495 GLU n 
1 496 VAL n 
1 497 ARG n 
1 498 ARG n 
1 499 GLU n 
1 500 LEU n 
1 501 GLU n 
1 502 ALA n 
1 503 ALA n 
1 504 GLY n 
1 505 GLU n 
1 506 ARG n 
1 507 SER n 
1 508 ALA n 
1 509 GLU n 
1 510 LYS n 
1 511 ILE n 
1 512 ASN n 
1 513 ALA n 
1 514 LEU n 
1 515 LEU n 
1 516 PRO n 
1 517 HIS n 
1 518 LYS n 
1 519 THR n 
1 520 PHE n 
1 521 ILE n 
1 522 GLY n 
1 523 GLY n 
1 524 ARG n 
1 525 PRO n 
1 526 SER n 
1 527 ASN n 
1 528 THR n 
1 529 LEU n 
1 530 LEU n 
1 531 ILE n 
1 532 LYS n 
1 533 SER n 
1 534 LEU n 
1 535 THR n 
1 536 PRO n 
1 537 ARG n 
1 538 ALA n 
1 539 LEU n 
1 540 GLY n 
1 541 ALA n 
1 542 ILE n 
1 543 ILE n 
1 544 ALA n 
1 545 MET n 
1 546 TYR n 
1 547 GLU n 
1 548 HIS n 
1 549 LYS n 
1 550 VAL n 
1 551 LEU n 
1 552 VAL n 
1 553 GLN n 
1 554 GLY n 
1 555 ALA n 
1 556 ILE n 
1 557 TRP n 
1 558 GLY n 
1 559 ILE n 
1 560 ASP n 
1 561 SER n 
1 562 TYR n 
1 563 ASP n 
1 564 GLN n 
1 565 TRP n 
1 566 GLY n 
1 567 VAL n 
1 568 GLU n 
1 569 LEU n 
1 570 GLY n 
1 571 LYS n 
1 572 VAL n 
1 573 LEU n 
1 574 ALA n 
1 575 LYS n 
1 576 SER n 
1 577 ILE n 
1 578 LEU n 
1 579 PRO n 
1 580 GLN n 
1 581 LEU n 
1 582 ARG n 
1 583 PRO n 
1 584 GLY n 
1 585 MET n 
1 586 ARG n 
1 587 VAL n 
1 588 ASN n 
1 589 ASN n 
1 590 HIS n 
1 591 ASP n 
1 592 SER n 
1 593 SER n 
1 594 THR n 
1 595 ASN n 
1 596 GLY n 
1 597 LEU n 
1 598 ILE n 
1 599 ASN n 
1 600 MET n 
1 601 PHE n 
1 602 ASN n 
1 603 GLU n 
1 604 LEU n 
1 605 SER n 
1 606 HIS n 
1 607 LEU n 
1 608 HIS n 
1 609 HIS n 
1 610 HIS n 
1 611 HIS n 
1 612 HIS n 
1 613 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Trypanosoma 
_entity_src_gen.pdbx_gene_src_gene                 PGI 
_entity_src_gen.gene_src_species                   'Trypanosoma brucei' 
_entity_src_gen.gene_src_strain                    '927/4 GUTat10.1' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Trypanosoma brucei brucei' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEMEX-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'gene placed directly under T7 promoter' 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_TRYBB 
_struct_ref.pdbx_db_accession          P13377 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSYLDDLRIDLAASPASGGSASIAVGSFNIPYEVTRRLKGVGADADTTLTSCASWTQLQKLYEQYGDEPIKKHFEADSE
RGQRYSVKVSLGSKDENFLFLDYSKSHINDEIKCALLRLAEERGIRQFVQSVFRGERVNTTENRPVLHIALRNRSNRPIY
VDGKDVMPAVNKVLDQMRSFSEKVRTGEWKGHTGKAIRHVVNIGIGGSDLGPVMATEALKPFSQRDLSLHFVSNVDGTHI
AEVLKSIDIEATLFIVASKTFTTQETITNALSARRALLDYLRSRGIDEKGSVAKHFVALSTNNQKVKEFGIDEENMFQFW
DWVGGRYSMWSAIGLPIMISIGYENFVELLTGAHVIDEHFANAPPEQNVPLLLALVGVWYINFFGAVTHAILPYDQYLWR
LPAYLQQLDMESNGKYVTRSGKTVSTLTGPIIFGEAGTNGQHAFYQLIHQGTNLIPCDFIGAIQSQNKIGDHHKIFMSNF
FAQTEALMIGKSPSEVRRELEAAGERSAEKINALLPHKTFIGGRPSNTLLIKSLTPRALGAIIAMYEHKVLVQGAIWGID
SYDQWGVELGKVLAKSILPQLRPGMRVNNHDSSTNGLINMFNELSHL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O2C A 1 ? 607 ? P13377 1 ? 607 ? 1 607 
2 1 2O2C B 1 ? 607 ? P13377 1 ? 607 ? 1 607 
3 1 2O2C C 1 ? 607 ? P13377 1 ? 607 ? 1 607 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O2C THR A 77  ? UNP P13377 ALA 77 CONFLICT         77  1  
1 2O2C HIS A 608 ? UNP P13377 ?   ?  'EXPRESSION TAG' 608 2  
1 2O2C HIS A 609 ? UNP P13377 ?   ?  'EXPRESSION TAG' 609 3  
1 2O2C HIS A 610 ? UNP P13377 ?   ?  'EXPRESSION TAG' 610 4  
1 2O2C HIS A 611 ? UNP P13377 ?   ?  'EXPRESSION TAG' 611 5  
1 2O2C HIS A 612 ? UNP P13377 ?   ?  'EXPRESSION TAG' 612 6  
1 2O2C HIS A 613 ? UNP P13377 ?   ?  'EXPRESSION TAG' 613 7  
2 2O2C THR B 77  ? UNP P13377 ALA 77 CONFLICT         77  8  
2 2O2C HIS B 608 ? UNP P13377 ?   ?  'EXPRESSION TAG' 608 9  
2 2O2C HIS B 609 ? UNP P13377 ?   ?  'EXPRESSION TAG' 609 10 
2 2O2C HIS B 610 ? UNP P13377 ?   ?  'EXPRESSION TAG' 610 11 
2 2O2C HIS B 611 ? UNP P13377 ?   ?  'EXPRESSION TAG' 611 12 
2 2O2C HIS B 612 ? UNP P13377 ?   ?  'EXPRESSION TAG' 612 13 
2 2O2C HIS B 613 ? UNP P13377 ?   ?  'EXPRESSION TAG' 613 14 
3 2O2C THR C 77  ? UNP P13377 ALA 77 CONFLICT         77  15 
3 2O2C HIS C 608 ? UNP P13377 ?   ?  'EXPRESSION TAG' 608 16 
3 2O2C HIS C 609 ? UNP P13377 ?   ?  'EXPRESSION TAG' 609 17 
3 2O2C HIS C 610 ? UNP P13377 ?   ?  'EXPRESSION TAG' 610 18 
3 2O2C HIS C 611 ? UNP P13377 ?   ?  'EXPRESSION TAG' 611 19 
3 2O2C HIS C 612 ? UNP P13377 ?   ?  'EXPRESSION TAG' 612 20 
3 2O2C HIS C 613 ? UNP P13377 ?   ?  'EXPRESSION TAG' 613 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ?                               'C3 H7 N O2 S'   121.158 
G6Q non-polymer         . GLUCOSE-6-PHOSPHATE ?                               'C6 H13 O9 P'    260.136 
GLN 'L-peptide linking' y GLUTAMINE           ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL            'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE           ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O2C 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.31 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'10% PEG 3350, 50 mM sodium citrate and 50 mM dithiothreitol, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2004-10-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
# 
_reflns.entry_id                     2O2C 
_reflns.d_resolution_high            1.580 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   243991 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_netI_over_sigmaI        13.100 
_reflns.pdbx_chi_squared             1.561 
_reflns.pdbx_redundancy              4.300 
_reflns.percent_possible_obs         99.700 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   242378 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.580 
_reflns_shell.d_res_low              1.640 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.352 
_reflns_shell.meanI_over_sigI_obs    3.4 
_reflns_shell.pdbx_Rsym_value        0.352 
_reflns_shell.pdbx_chi_squared       1.044 
_reflns_shell.pdbx_redundancy        3.70 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      23717 
_reflns_shell.percent_possible_all   97.80 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O2C 
_refine.B_iso_mean                               18.446 
_refine.ls_d_res_high                            1.580 
_refine.ls_d_res_low                             40. 
_refine.pdbx_ls_sigma_F                          0. 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     246984 
_refine.ls_number_reflns_obs                     243991 
_refine.ls_number_reflns_R_free                  12241 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2 
_refine.ls_R_factor_R_free                       0.213 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1T10' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             anisotropic 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2O2C 
_refine_analyze.Luzzati_coordinate_error_obs    0.189 
_refine_analyze.Luzzati_sigma_a_obs             0.130 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.204 
_refine_analyze.Luzzati_sigma_a_free            0.151 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13330 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         84 
_refine_hist.number_atoms_solvent             1311 
_refine_hist.number_atoms_total               14725 
_refine_hist.d_res_high                       1.580 
_refine_hist.d_res_low                        40. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg 1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d    0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
1.58 1.64 23700 1225 0.2724 0.2846 . 98.48 . . . . . . 'X-RAY DIFFRACTION' 
1.64 1.70 24092 1209 0.2486 0.2693 . 99.95 . . . . . . 'X-RAY DIFFRACTION' 
1.70 1.78 24040 1190 0.2337 0.2552 . 100   . . . . . . 'X-RAY DIFFRACTION' 
1.78 1.87 24119 1186 0.2174 0.2428 . 100   . . . . . . 'X-RAY DIFFRACTION' 
1.87 1.99 24121 1188 0.2099 0.2328 . 100   . . . . . . 'X-RAY DIFFRACTION' 
1.99 2.14 24141 1245 0.2016 0.2163 . 99.99 . . . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O2C 
_struct.title                     
'Crystal structure of phosphoglucose isomerase from T. brucei containing glucose-6-phosphate in the active site' 
_struct.pdbx_descriptor           'Glucose-6-phosphate isomerase, glycosomal (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O2C 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'dimer, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   CYS A 53  ? GLY A 67  ? CYS A 53  GLY A 67  1 ? 15 
HELX_P HELX_P2   2   PRO A 70  ? ASP A 78  ? PRO A 70  ASP A 78  1 ? 9  
HELX_P HELX_P3   3   GLU A 80  ? TYR A 85  ? GLU A 80  TYR A 85  1 ? 6  
HELX_P HELX_P4   4   ASN A 109 ? ARG A 123 ? ASN A 109 ARG A 123 1 ? 15 
HELX_P HELX_P5   5   GLY A 124 ? ARG A 134 ? GLY A 124 ARG A 134 1 ? 11 
HELX_P HELX_P6   6   LEU A 147 ? ARG A 152 ? LEU A 147 ARG A 152 1 ? 6  
HELX_P HELX_P7   7   VAL A 166 ? THR A 186 ? VAL A 166 THR A 186 1 ? 21 
HELX_P HELX_P8   8   ILE A 205 ? SER A 208 ? ILE A 205 SER A 208 5 ? 4  
HELX_P HELX_P9   9   ASP A 209 ? LEU A 219 ? ASP A 209 LEU A 219 1 ? 11 
HELX_P HELX_P10  10  LYS A 220 ? SER A 223 ? LYS A 220 SER A 223 5 ? 4  
HELX_P HELX_P11  11  ASP A 236 ? ILE A 247 ? ASP A 236 ILE A 247 1 ? 12 
HELX_P HELX_P12  12  ASP A 248 ? GLU A 250 ? ASP A 248 GLU A 250 5 ? 3  
HELX_P HELX_P13  13  THR A 263 ? ARG A 284 ? THR A 263 ARG A 284 1 ? 22 
HELX_P HELX_P14  14  SER A 291 ? HIS A 295 ? SER A 291 HIS A 295 1 ? 5  
HELX_P HELX_P15  15  ASN A 302 ? GLY A 310 ? ASN A 302 GLY A 310 1 ? 9  
HELX_P HELX_P16  16  ASP A 312 ? GLU A 314 ? ASP A 312 GLU A 314 5 ? 3  
HELX_P HELX_P17  17  GLY A 324 ? SER A 328 ? GLY A 324 SER A 328 5 ? 5  
HELX_P HELX_P18  18  SER A 331 ? ILE A 333 ? SER A 331 ILE A 333 5 ? 3  
HELX_P HELX_P19  19  GLY A 334 ? GLY A 342 ? GLY A 334 GLY A 342 1 ? 9  
HELX_P HELX_P20  20  GLY A 342 ? ALA A 363 ? GLY A 342 ALA A 363 1 ? 22 
HELX_P HELX_P21  21  PRO A 364 ? GLN A 367 ? PRO A 364 GLN A 367 5 ? 4  
HELX_P HELX_P22  22  ASN A 368 ? PHE A 383 ? ASN A 368 PHE A 383 1 ? 16 
HELX_P HELX_P23  23  ASP A 395 ? TRP A 399 ? ASP A 395 TRP A 399 5 ? 5  
HELX_P HELX_P24  24  ARG A 400 ? GLY A 414 ? ARG A 400 GLY A 414 1 ? 15 
HELX_P HELX_P25  25  THR A 438 ? ALA A 443 ? THR A 438 ALA A 443 5 ? 6  
HELX_P HELX_P26  26  PHE A 444 ? GLY A 451 ? PHE A 444 GLY A 451 1 ? 8  
HELX_P HELX_P27  27  ASP A 471 ? GLY A 490 ? ASP A 471 GLY A 490 1 ? 20 
HELX_P HELX_P28  28  SER A 492 ? ALA A 503 ? SER A 492 ALA A 503 1 ? 12 
HELX_P HELX_P29  29  SER A 507 ? LEU A 515 ? SER A 507 LEU A 515 1 ? 9  
HELX_P HELX_P30  30  THR A 535 ? GLY A 558 ? THR A 535 GLY A 558 1 ? 24 
HELX_P HELX_P31  31  GLN A 564 ? GLY A 566 ? GLN A 564 GLY A 566 5 ? 3  
HELX_P HELX_P32  32  VAL A 567 ? LEU A 578 ? VAL A 567 LEU A 578 1 ? 12 
HELX_P HELX_P33  33  PRO A 579 ? LEU A 581 ? PRO A 579 LEU A 581 5 ? 3  
HELX_P HELX_P34  34  ASP A 591 ? SER A 605 ? ASP A 591 SER A 605 1 ? 15 
HELX_P HELX_P35  35  CYS B 53  ? GLY B 67  ? CYS B 53  GLY B 67  1 ? 15 
HELX_P HELX_P36  36  PRO B 70  ? ASP B 78  ? PRO B 70  ASP B 78  1 ? 9  
HELX_P HELX_P37  37  GLU B 80  ? TYR B 85  ? GLU B 80  TYR B 85  1 ? 6  
HELX_P HELX_P38  38  ASN B 109 ? ARG B 123 ? ASN B 109 ARG B 123 1 ? 15 
HELX_P HELX_P39  39  GLY B 124 ? ARG B 134 ? GLY B 124 ARG B 134 1 ? 11 
HELX_P HELX_P40  40  LEU B 147 ? ARG B 152 ? LEU B 147 ARG B 152 1 ? 6  
HELX_P HELX_P41  41  VAL B 166 ? THR B 186 ? VAL B 166 THR B 186 1 ? 21 
HELX_P HELX_P42  42  ILE B 205 ? SER B 208 ? ILE B 205 SER B 208 5 ? 4  
HELX_P HELX_P43  43  ASP B 209 ? LEU B 219 ? ASP B 209 LEU B 219 1 ? 11 
HELX_P HELX_P44  44  LYS B 220 ? SER B 223 ? LYS B 220 SER B 223 5 ? 4  
HELX_P HELX_P45  45  ASP B 236 ? ILE B 247 ? ASP B 236 ILE B 247 1 ? 12 
HELX_P HELX_P46  46  ASP B 248 ? GLU B 250 ? ASP B 248 GLU B 250 5 ? 3  
HELX_P HELX_P47  47  THR B 263 ? ARG B 284 ? THR B 263 ARG B 284 1 ? 22 
HELX_P HELX_P48  48  SER B 291 ? HIS B 295 ? SER B 291 HIS B 295 1 ? 5  
HELX_P HELX_P49  49  ASN B 302 ? GLY B 310 ? ASN B 302 GLY B 310 1 ? 9  
HELX_P HELX_P50  50  ASP B 312 ? GLU B 314 ? ASP B 312 GLU B 314 5 ? 3  
HELX_P HELX_P51  51  GLY B 324 ? SER B 328 ? GLY B 324 SER B 328 5 ? 5  
HELX_P HELX_P52  52  SER B 331 ? ILE B 333 ? SER B 331 ILE B 333 5 ? 3  
HELX_P HELX_P53  53  GLY B 334 ? GLY B 342 ? GLY B 334 GLY B 342 1 ? 9  
HELX_P HELX_P54  54  GLY B 342 ? ALA B 363 ? GLY B 342 ALA B 363 1 ? 22 
HELX_P HELX_P55  55  PRO B 364 ? GLN B 367 ? PRO B 364 GLN B 367 5 ? 4  
HELX_P HELX_P56  56  ASN B 368 ? PHE B 383 ? ASN B 368 PHE B 383 1 ? 16 
HELX_P HELX_P57  57  ASP B 395 ? TRP B 399 ? ASP B 395 TRP B 399 5 ? 5  
HELX_P HELX_P58  58  ARG B 400 ? GLY B 414 ? ARG B 400 GLY B 414 1 ? 15 
HELX_P HELX_P59  59  THR B 438 ? ALA B 443 ? THR B 438 ALA B 443 5 ? 6  
HELX_P HELX_P60  60  PHE B 444 ? GLY B 451 ? PHE B 444 GLY B 451 1 ? 8  
HELX_P HELX_P61  61  ASP B 471 ? GLY B 490 ? ASP B 471 GLY B 490 1 ? 20 
HELX_P HELX_P62  62  SER B 492 ? ALA B 502 ? SER B 492 ALA B 502 1 ? 11 
HELX_P HELX_P63  63  SER B 507 ? LEU B 515 ? SER B 507 LEU B 515 1 ? 9  
HELX_P HELX_P64  64  PRO B 516 ? THR B 519 ? PRO B 516 THR B 519 5 ? 4  
HELX_P HELX_P65  65  THR B 535 ? GLY B 558 ? THR B 535 GLY B 558 1 ? 24 
HELX_P HELX_P66  66  GLN B 564 ? GLY B 566 ? GLN B 564 GLY B 566 5 ? 3  
HELX_P HELX_P67  67  VAL B 567 ? LEU B 578 ? VAL B 567 LEU B 578 1 ? 12 
HELX_P HELX_P68  68  PRO B 579 ? LEU B 581 ? PRO B 579 LEU B 581 5 ? 3  
HELX_P HELX_P69  69  ASP B 591 ? SER B 605 ? ASP B 591 SER B 605 1 ? 15 
HELX_P HELX_P70  70  CYS C 53  ? GLY C 67  ? CYS C 53  GLY C 67  1 ? 15 
HELX_P HELX_P71  71  ILE C 71  ? ASP C 78  ? ILE C 71  ASP C 78  1 ? 8  
HELX_P HELX_P72  72  GLU C 80  ? TYR C 85  ? GLU C 80  TYR C 85  1 ? 6  
HELX_P HELX_P73  73  ASN C 109 ? ARG C 123 ? ASN C 109 ARG C 123 1 ? 15 
HELX_P HELX_P74  74  GLY C 124 ? GLY C 135 ? GLY C 124 GLY C 135 1 ? 12 
HELX_P HELX_P75  75  LEU C 147 ? ARG C 152 ? LEU C 147 ARG C 152 1 ? 6  
HELX_P HELX_P76  76  VAL C 166 ? THR C 186 ? VAL C 166 THR C 186 1 ? 21 
HELX_P HELX_P77  77  ILE C 205 ? SER C 208 ? ILE C 205 SER C 208 5 ? 4  
HELX_P HELX_P78  78  ASP C 209 ? LEU C 219 ? ASP C 209 LEU C 219 1 ? 11 
HELX_P HELX_P79  79  LYS C 220 ? SER C 223 ? LYS C 220 SER C 223 5 ? 4  
HELX_P HELX_P80  80  ASP C 236 ? ILE C 247 ? ASP C 236 ILE C 247 1 ? 12 
HELX_P HELX_P81  81  ASP C 248 ? GLU C 250 ? ASP C 248 GLU C 250 5 ? 3  
HELX_P HELX_P82  82  THR C 263 ? ARG C 284 ? THR C 263 ARG C 284 1 ? 22 
HELX_P HELX_P83  83  SER C 291 ? HIS C 295 ? SER C 291 HIS C 295 1 ? 5  
HELX_P HELX_P84  84  ASN C 302 ? GLY C 310 ? ASN C 302 GLY C 310 1 ? 9  
HELX_P HELX_P85  85  ASP C 312 ? GLU C 314 ? ASP C 312 GLU C 314 5 ? 3  
HELX_P HELX_P86  86  GLY C 324 ? SER C 328 ? GLY C 324 SER C 328 5 ? 5  
HELX_P HELX_P87  87  SER C 331 ? ILE C 333 ? SER C 331 ILE C 333 5 ? 3  
HELX_P HELX_P88  88  GLY C 334 ? GLY C 342 ? GLY C 334 GLY C 342 1 ? 9  
HELX_P HELX_P89  89  GLY C 342 ? ALA C 363 ? GLY C 342 ALA C 363 1 ? 22 
HELX_P HELX_P90  90  PRO C 364 ? GLN C 367 ? PRO C 364 GLN C 367 5 ? 4  
HELX_P HELX_P91  91  ASN C 368 ? PHE C 383 ? ASN C 368 PHE C 383 1 ? 16 
HELX_P HELX_P92  92  ASP C 395 ? TRP C 399 ? ASP C 395 TRP C 399 5 ? 5  
HELX_P HELX_P93  93  ARG C 400 ? GLY C 414 ? ARG C 400 GLY C 414 1 ? 15 
HELX_P HELX_P94  94  THR C 438 ? HIS C 442 ? THR C 438 HIS C 442 5 ? 5  
HELX_P HELX_P95  95  PHE C 444 ? GLY C 451 ? PHE C 444 GLY C 451 1 ? 8  
HELX_P HELX_P96  96  ASP C 471 ? GLY C 490 ? ASP C 471 GLY C 490 1 ? 20 
HELX_P HELX_P97  97  SER C 492 ? ALA C 502 ? SER C 492 ALA C 502 1 ? 11 
HELX_P HELX_P98  98  SER C 507 ? LEU C 515 ? SER C 507 LEU C 515 1 ? 9  
HELX_P HELX_P99  99  PRO C 516 ? THR C 519 ? PRO C 516 THR C 519 5 ? 4  
HELX_P HELX_P100 100 THR C 535 ? GLY C 558 ? THR C 535 GLY C 558 1 ? 24 
HELX_P HELX_P101 101 GLN C 564 ? GLY C 566 ? GLN C 564 GLY C 566 5 ? 3  
HELX_P HELX_P102 102 VAL C 567 ? LEU C 578 ? VAL C 567 LEU C 578 1 ? 12 
HELX_P HELX_P103 103 PRO C 579 ? LEU C 581 ? PRO C 579 LEU C 581 5 ? 3  
HELX_P HELX_P104 104 ASP C 591 ? SER C 605 ? ASP C 591 SER C 605 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 437 A . ? GLY 437 A THR 438 A ? THR 438 A 1 0.61 
2 GLY 437 B . ? GLY 437 B THR 438 B ? THR 438 B 1 0.71 
3 GLY 437 C . ? GLY 437 C THR 438 C ? THR 438 C 1 0.85 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 5 ? 
D ? 6 ? 
E ? 2 ? 
F ? 5 ? 
G ? 6 ? 
H ? 2 ? 
I ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? parallel      
C 4 5 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? parallel      
D 5 6 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? parallel      
G 4 5 ? parallel      
G 5 6 ? parallel      
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 86  ? SER A 90  ? SER A 86  SER A 90  
A 2 PHE A 98  ? LYS A 105 ? PHE A 98  LYS A 105 
A 3 SER A 526 ? SER A 533 ? SER A 526 SER A 533 
A 4 CYS A 457 ? GLN A 464 ? CYS A 457 GLN A 464 
A 5 THR A 388 ? TYR A 394 ? THR A 388 TYR A 394 
A 6 ILE A 431 ? PHE A 433 ? ILE A 431 PHE A 433 
B 1 TYR A 160 ? VAL A 161 ? TYR A 160 VAL A 161 
B 2 LYS A 164 ? ASP A 165 ? LYS A 164 ASP A 165 
C 1 SER A 228 ? VAL A 232 ? SER A 228 VAL A 232 
C 2 HIS A 199 ? ILE A 203 ? HIS A 199 ILE A 203 
C 3 THR A 252 ? ALA A 257 ? THR A 252 ALA A 257 
C 4 PHE A 296 ? SER A 300 ? PHE A 296 SER A 300 
C 5 MET A 316 ? GLN A 318 ? MET A 316 GLN A 318 
D 1 SER B 86  ? SER B 90  ? SER B 86  SER B 90  
D 2 PHE B 98  ? ASP B 102 ? PHE B 98  ASP B 102 
D 3 SER B 526 ? SER B 533 ? SER B 526 SER B 533 
D 4 CYS B 457 ? GLN B 464 ? CYS B 457 GLN B 464 
D 5 THR B 388 ? TYR B 394 ? THR B 388 TYR B 394 
D 6 ILE B 431 ? PHE B 433 ? ILE B 431 PHE B 433 
E 1 TYR B 160 ? VAL B 161 ? TYR B 160 VAL B 161 
E 2 LYS B 164 ? ASP B 165 ? LYS B 164 ASP B 165 
F 1 SER B 228 ? VAL B 232 ? SER B 228 VAL B 232 
F 2 HIS B 199 ? ILE B 203 ? HIS B 199 ILE B 203 
F 3 THR B 252 ? ALA B 257 ? THR B 252 ALA B 257 
F 4 PHE B 296 ? SER B 300 ? PHE B 296 SER B 300 
F 5 MET B 316 ? GLN B 318 ? MET B 316 GLN B 318 
G 1 SER C 86  ? SER C 90  ? SER C 86  SER C 90  
G 2 PHE C 98  ? ASP C 102 ? PHE C 98  ASP C 102 
G 3 SER C 526 ? SER C 533 ? SER C 526 SER C 533 
G 4 CYS C 457 ? GLN C 464 ? CYS C 457 GLN C 464 
G 5 THR C 388 ? TYR C 394 ? THR C 388 TYR C 394 
G 6 ILE C 431 ? PHE C 433 ? ILE C 431 PHE C 433 
H 1 TYR C 160 ? VAL C 161 ? TYR C 160 VAL C 161 
H 2 LYS C 164 ? ASP C 165 ? LYS C 164 ASP C 165 
I 1 SER C 228 ? VAL C 232 ? SER C 228 VAL C 232 
I 2 HIS C 199 ? ILE C 203 ? HIS C 199 ILE C 203 
I 3 THR C 252 ? ALA C 257 ? THR C 252 ALA C 257 
I 4 PHE C 296 ? SER C 300 ? PHE C 296 SER C 300 
I 5 MET C 316 ? GLN C 318 ? MET C 316 GLN C 318 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 89  ? N VAL A 89  O LEU A 99  ? O LEU A 99  
A 2 3 N ASP A 102 ? N ASP A 102 O THR A 528 ? O THR A 528 
A 3 4 O LEU A 529 ? O LEU A 529 N PHE A 459 ? N PHE A 459 
A 4 5 O ILE A 460 ? O ILE A 460 N TYR A 394 ? N TYR A 394 
A 5 6 N ILE A 391 ? N ILE A 391 O PHE A 433 ? O PHE A 433 
B 1 2 N VAL A 161 ? N VAL A 161 O LYS A 164 ? O LYS A 164 
C 1 2 O VAL A 232 ? O VAL A 232 N ASN A 202 ? N ASN A 202 
C 2 3 N ILE A 203 ? N ILE A 203 O ILE A 255 ? O ILE A 255 
C 3 4 N VAL A 256 ? N VAL A 256 O VAL A 297 ? O VAL A 297 
C 4 5 N ALA A 298 ? N ALA A 298 O PHE A 317 ? O PHE A 317 
D 1 2 N VAL B 89  ? N VAL B 89  O LEU B 99  ? O LEU B 99  
D 2 3 N ASP B 102 ? N ASP B 102 O THR B 528 ? O THR B 528 
D 3 4 O LEU B 529 ? O LEU B 529 N PHE B 459 ? N PHE B 459 
D 4 5 O ILE B 460 ? O ILE B 460 N TYR B 394 ? N TYR B 394 
D 5 6 N ILE B 391 ? N ILE B 391 O PHE B 433 ? O PHE B 433 
E 1 2 N VAL B 161 ? N VAL B 161 O LYS B 164 ? O LYS B 164 
F 1 2 O SER B 228 ? O SER B 228 N VAL B 200 ? N VAL B 200 
F 2 3 N ILE B 203 ? N ILE B 203 O ILE B 255 ? O ILE B 255 
F 3 4 N VAL B 256 ? N VAL B 256 O VAL B 297 ? O VAL B 297 
F 4 5 N ALA B 298 ? N ALA B 298 O PHE B 317 ? O PHE B 317 
G 1 2 N VAL C 89  ? N VAL C 89  O LEU C 99  ? O LEU C 99  
G 2 3 N ASP C 102 ? N ASP C 102 O THR C 528 ? O THR C 528 
G 3 4 O LEU C 529 ? O LEU C 529 N PHE C 459 ? N PHE C 459 
G 4 5 O ILE C 460 ? O ILE C 460 N TYR C 394 ? N TYR C 394 
G 5 6 N ILE C 391 ? N ILE C 391 O PHE C 433 ? O PHE C 433 
H 1 2 N VAL C 161 ? N VAL C 161 O LYS C 164 ? O LYS C 164 
I 1 2 O VAL C 232 ? O VAL C 232 N ASN C 202 ? N ASN C 202 
I 2 3 N VAL C 201 ? N VAL C 201 O ILE C 255 ? O ILE C 255 
I 3 4 N VAL C 256 ? N VAL C 256 O VAL C 297 ? O VAL C 297 
I 4 5 N ALA C 298 ? N ALA C 298 O PHE C 317 ? O PHE C 317 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE G6Q A 5001' 
AC2 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE G6Q B 5002' 
AC3 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE G6Q C 5003' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL A 7001' 
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE GOL A 7005' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL B 7002' 
AC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL B 7004' 
AC8 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE GOL B 7006' 
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL C 7003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 20 ILE A 205 ? ILE A 205  . ? 1_555 ? 
2   AC1 20 GLY A 206 ? GLY A 206  . ? 1_555 ? 
3   AC1 20 GLY A 207 ? GLY A 207  . ? 1_555 ? 
4   AC1 20 SER A 208 ? SER A 208  . ? 1_555 ? 
5   AC1 20 SER A 258 ? SER A 258  . ? 1_555 ? 
6   AC1 20 LYS A 259 ? LYS A 259  . ? 1_555 ? 
7   AC1 20 THR A 260 ? THR A 260  . ? 1_555 ? 
8   AC1 20 THR A 263 ? THR A 263  . ? 1_555 ? 
9   AC1 20 GLY A 325 ? GLY A 325  . ? 1_555 ? 
10  AC1 20 ARG A 326 ? ARG A 326  . ? 1_555 ? 
11  AC1 20 GLN A 407 ? GLN A 407  . ? 1_555 ? 
12  AC1 20 GLU A 411 ? GLU A 411  . ? 1_555 ? 
13  AC1 20 HIS A 442 ? HIS A 442  . ? 4_555 ? 
14  AC1 20 GLN A 564 ? GLN A 564  . ? 1_555 ? 
15  AC1 20 HOH M .   ? HOH A 7018 . ? 1_555 ? 
16  AC1 20 HOH M .   ? HOH A 7128 . ? 1_555 ? 
17  AC1 20 HOH M .   ? HOH A 7164 . ? 1_555 ? 
18  AC1 20 HOH M .   ? HOH A 7337 . ? 1_555 ? 
19  AC1 20 HOH M .   ? HOH A 7340 . ? 1_555 ? 
20  AC1 20 HOH M .   ? HOH A 7363 . ? 1_555 ? 
21  AC2 22 ILE B 205 ? ILE B 205  . ? 1_555 ? 
22  AC2 22 GLY B 206 ? GLY B 206  . ? 1_555 ? 
23  AC2 22 GLY B 207 ? GLY B 207  . ? 1_555 ? 
24  AC2 22 SER B 208 ? SER B 208  . ? 1_555 ? 
25  AC2 22 SER B 258 ? SER B 258  . ? 1_555 ? 
26  AC2 22 LYS B 259 ? LYS B 259  . ? 1_555 ? 
27  AC2 22 THR B 260 ? THR B 260  . ? 1_555 ? 
28  AC2 22 THR B 263 ? THR B 263  . ? 1_555 ? 
29  AC2 22 GLY B 325 ? GLY B 325  . ? 1_555 ? 
30  AC2 22 ARG B 326 ? ARG B 326  . ? 1_555 ? 
31  AC2 22 GLN B 407 ? GLN B 407  . ? 1_555 ? 
32  AC2 22 GLU B 411 ? GLU B 411  . ? 1_555 ? 
33  AC2 22 GLN B 564 ? GLN B 564  . ? 1_555 ? 
34  AC2 22 HOH N .   ? HOH B 7012 . ? 1_555 ? 
35  AC2 22 HOH N .   ? HOH B 7112 . ? 1_555 ? 
36  AC2 22 HOH N .   ? HOH B 7288 . ? 1_555 ? 
37  AC2 22 HOH N .   ? HOH B 7318 . ? 1_555 ? 
38  AC2 22 HOH N .   ? HOH B 7325 . ? 1_555 ? 
39  AC2 22 HOH N .   ? HOH B 7362 . ? 1_555 ? 
40  AC2 22 HOH N .   ? HOH B 7373 . ? 1_555 ? 
41  AC2 22 HOH N .   ? HOH B 7447 . ? 1_555 ? 
42  AC2 22 HIS C 442 ? HIS C 442  . ? 1_555 ? 
43  AC3 19 HIS B 442 ? HIS B 442  . ? 1_555 ? 
44  AC3 19 ILE C 205 ? ILE C 205  . ? 1_555 ? 
45  AC3 19 GLY C 207 ? GLY C 207  . ? 1_555 ? 
46  AC3 19 SER C 208 ? SER C 208  . ? 1_555 ? 
47  AC3 19 SER C 258 ? SER C 258  . ? 1_555 ? 
48  AC3 19 LYS C 259 ? LYS C 259  . ? 1_555 ? 
49  AC3 19 THR C 260 ? THR C 260  . ? 1_555 ? 
50  AC3 19 THR C 263 ? THR C 263  . ? 1_555 ? 
51  AC3 19 GLY C 325 ? GLY C 325  . ? 1_555 ? 
52  AC3 19 ARG C 326 ? ARG C 326  . ? 1_555 ? 
53  AC3 19 GLN C 407 ? GLN C 407  . ? 1_555 ? 
54  AC3 19 GLU C 411 ? GLU C 411  . ? 1_555 ? 
55  AC3 19 GLN C 564 ? GLN C 564  . ? 1_555 ? 
56  AC3 19 HOH O .   ? HOH C 7014 . ? 1_555 ? 
57  AC3 19 HOH O .   ? HOH C 7105 . ? 1_555 ? 
58  AC3 19 HOH O .   ? HOH C 7243 . ? 1_555 ? 
59  AC3 19 HOH O .   ? HOH C 7257 . ? 1_555 ? 
60  AC3 19 HOH O .   ? HOH C 7261 . ? 1_555 ? 
61  AC3 19 HOH O .   ? HOH C 7273 . ? 1_555 ? 
62  AC4 9  THR A 77  ? THR A 77   . ? 1_555 ? 
63  AC4 9  ASP A 78  ? ASP A 78   . ? 1_555 ? 
64  AC4 9  ARG A 81  ? ARG A 81   . ? 1_555 ? 
65  AC4 9  TYR A 85  ? TYR A 85   . ? 1_555 ? 
66  AC4 9  ASN A 109 ? ASN A 109  . ? 1_555 ? 
67  AC4 9  ASP A 110 ? ASP A 110  . ? 1_555 ? 
68  AC4 9  HOH M .   ? HOH A 7213 . ? 1_555 ? 
69  AC4 9  HOH M .   ? HOH A 7278 . ? 1_555 ? 
70  AC4 9  ASN B 588 ? ASN B 588  . ? 2_554 ? 
71  AC5 7  LEU A 278 ? LEU A 278  . ? 1_555 ? 
72  AC5 7  GLU A 288 ? GLU A 288  . ? 1_555 ? 
73  AC5 7  LYS A 289 ? LYS A 289  . ? 1_555 ? 
74  AC5 7  GLY A 290 ? GLY A 290  . ? 1_555 ? 
75  AC5 7  SER A 291 ? SER A 291  . ? 1_555 ? 
76  AC5 7  VAL A 292 ? VAL A 292  . ? 1_555 ? 
77  AC5 7  HOH M .   ? HOH A 7242 . ? 1_555 ? 
78  AC6 6  HIS B 74  ? HIS B 74   . ? 1_555 ? 
79  AC6 6  THR B 77  ? THR B 77   . ? 1_555 ? 
80  AC6 6  ASP B 78  ? ASP B 78   . ? 1_555 ? 
81  AC6 6  ARG B 81  ? ARG B 81   . ? 1_555 ? 
82  AC6 6  ASP B 110 ? ASP B 110  . ? 1_555 ? 
83  AC6 6  HOH N .   ? HOH B 7383 . ? 1_555 ? 
84  AC7 6  GLU B 188 ? GLU B 188  . ? 1_555 ? 
85  AC7 6  TRP B 189 ? TRP B 189  . ? 1_555 ? 
86  AC7 6  LYS B 190 ? LYS B 190  . ? 1_555 ? 
87  AC7 6  LYS B 294 ? LYS B 294  . ? 1_555 ? 
88  AC7 6  HOH N .   ? HOH B 7264 . ? 1_555 ? 
89  AC7 6  HOH N .   ? HOH B 7303 . ? 1_555 ? 
90  AC8 9  LYS B 220 ? LYS B 220  . ? 1_555 ? 
91  AC8 9  GLN B 396 ? GLN B 396  . ? 1_555 ? 
92  AC8 9  TYR B 397 ? TYR B 397  . ? 1_555 ? 
93  AC8 9  TRP B 399 ? TRP B 399  . ? 1_555 ? 
94  AC8 9  HOH N .   ? HOH B 7146 . ? 1_555 ? 
95  AC8 9  HOH N .   ? HOH B 7241 . ? 1_555 ? 
96  AC8 9  HOH N .   ? HOH B 7403 . ? 1_555 ? 
97  AC8 9  HIS C 239 ? HIS C 239  . ? 1_555 ? 
98  AC8 9  GLU C 242 ? GLU C 242  . ? 1_555 ? 
99  AC9 6  HIS C 74  ? HIS C 74   . ? 1_555 ? 
100 AC9 6  ASP C 78  ? ASP C 78   . ? 1_555 ? 
101 AC9 6  ARG C 81  ? ARG C 81   . ? 1_555 ? 
102 AC9 6  TYR C 85  ? TYR C 85   . ? 1_555 ? 
103 AC9 6  ASN C 109 ? ASN C 109  . ? 1_555 ? 
104 AC9 6  ASP C 110 ? ASP C 110  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2O2C 
_atom_sites.fract_transf_matrix[1][1]   0.007947 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004520 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007807 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLY A 1 43  ? 14.261  -20.339 9.098   1.00 41.43 ? 43   GLY A N   1 
ATOM   2     C CA  . GLY A 1 43  ? 15.106  -20.469 10.318  1.00 40.90 ? 43   GLY A CA  1 
ATOM   3     C C   . GLY A 1 43  ? 14.313  -20.357 11.607  1.00 41.01 ? 43   GLY A C   1 
ATOM   4     O O   . GLY A 1 43  ? 13.254  -20.977 11.748  1.00 41.06 ? 43   GLY A O   1 
ATOM   5     N N   . ALA A 1 44  ? 14.823  -19.553 12.539  1.00 40.53 ? 44   ALA A N   1 
ATOM   6     C CA  . ALA A 1 44  ? 14.193  -19.329 13.844  1.00 39.88 ? 44   ALA A CA  1 
ATOM   7     C C   . ALA A 1 44  ? 13.144  -18.212 13.808  1.00 38.89 ? 44   ALA A C   1 
ATOM   8     O O   . ALA A 1 44  ? 12.900  -17.611 12.755  1.00 39.62 ? 44   ALA A O   1 
ATOM   9     C CB  . ALA A 1 44  ? 15.263  -19.022 14.890  1.00 40.16 ? 44   ALA A CB  1 
ATOM   10    N N   . ASP A 1 45  ? 12.539  -17.933 14.967  1.00 37.49 ? 45   ASP A N   1 
ATOM   11    C CA  . ASP A 1 45  ? 11.512  -16.893 15.114  1.00 36.10 ? 45   ASP A CA  1 
ATOM   12    C C   . ASP A 1 45  ? 12.122  -15.493 14.977  1.00 34.64 ? 45   ASP A C   1 
ATOM   13    O O   . ASP A 1 45  ? 13.319  -15.312 15.218  1.00 34.07 ? 45   ASP A O   1 
ATOM   14    C CB  . ASP A 1 45  ? 10.809  -17.021 16.476  1.00 37.70 ? 45   ASP A CB  1 
ATOM   15    C CG  . ASP A 1 45  ? 10.137  -18.379 16.676  1.00 39.19 ? 45   ASP A CG  1 
ATOM   16    O OD1 . ASP A 1 45  ? 9.550   -18.922 15.713  1.00 39.77 ? 45   ASP A OD1 1 
ATOM   17    O OD2 . ASP A 1 45  ? 10.193  -18.905 17.810  1.00 39.87 ? 45   ASP A OD2 1 
ATOM   18    N N   . ALA A 1 46  ? 11.311  -14.523 14.559  1.00 32.03 ? 46   ALA A N   1 
ATOM   19    C CA  . ALA A 1 46  ? 11.771  -13.143 14.388  1.00 30.26 ? 46   ALA A CA  1 
ATOM   20    C C   . ALA A 1 46  ? 11.811  -12.382 15.707  1.00 29.04 ? 46   ALA A C   1 
ATOM   21    O O   . ALA A 1 46  ? 10.922  -12.536 16.551  1.00 27.80 ? 46   ALA A O   1 
ATOM   22    C CB  . ALA A 1 46  ? 10.901  -12.409 13.377  1.00 30.17 ? 46   ALA A CB  1 
ATOM   23    N N   . ASP A 1 47  ? 12.867  -11.586 15.884  1.00 26.65 ? 47   ASP A N   1 
ATOM   24    C CA  . ASP A 1 47  ? 13.070  -10.777 17.089  1.00 26.23 ? 47   ASP A CA  1 
ATOM   25    C C   . ASP A 1 47  ? 12.104  -9.595  17.124  1.00 26.39 ? 47   ASP A C   1 
ATOM   26    O O   . ASP A 1 47  ? 11.975  -8.858  16.148  1.00 25.93 ? 47   ASP A O   1 
ATOM   27    C CB  . ASP A 1 47  ? 14.530  -10.289 17.154  1.00 25.01 ? 47   ASP A CB  1 
ATOM   28    C CG  . ASP A 1 47  ? 14.811  -9.401  18.360  1.00 25.78 ? 47   ASP A CG  1 
ATOM   29    O OD1 . ASP A 1 47  ? 14.322  -9.706  19.469  1.00 26.13 ? 47   ASP A OD1 1 
ATOM   30    O OD2 . ASP A 1 47  ? 15.521  -8.388  18.193  1.00 24.16 ? 47   ASP A OD2 1 
ATOM   31    N N   . THR A 1 48  ? 11.425  -9.442  18.260  1.00 26.54 ? 48   THR A N   1 
ATOM   32    C CA  . THR A 1 48  ? 10.461  -8.364  18.458  1.00 27.62 ? 48   THR A CA  1 
ATOM   33    C C   . THR A 1 48  ? 10.903  -7.362  19.524  1.00 27.13 ? 48   THR A C   1 
ATOM   34    O O   . THR A 1 48  ? 10.335  -6.275  19.608  1.00 27.86 ? 48   THR A O   1 
ATOM   35    C CB  . THR A 1 48  ? 9.062   -8.915  18.860  1.00 28.07 ? 48   THR A CB  1 
ATOM   36    O OG1 . THR A 1 48  ? 9.137   -9.520  20.158  1.00 29.93 ? 48   THR A OG1 1 
ATOM   37    C CG2 . THR A 1 48  ? 8.562   -9.941  17.845  1.00 29.52 ? 48   THR A CG2 1 
ATOM   38    N N   . THR A 1 49  ? 11.938  -7.708  20.294  1.00 27.32 ? 49   THR A N   1 
ATOM   39    C CA  . THR A 1 49  ? 12.449  -6.870  21.395  1.00 27.17 ? 49   THR A CA  1 
ATOM   40    C C   . THR A 1 49  ? 12.872  -5.442  21.042  1.00 26.86 ? 49   THR A C   1 
ATOM   41    O O   . THR A 1 49  ? 12.655  -4.522  21.832  1.00 26.46 ? 49   THR A O   1 
ATOM   42    C CB  . THR A 1 49  ? 13.600  -7.565  22.178  1.00 28.68 ? 49   THR A CB  1 
ATOM   43    O OG1 . THR A 1 49  ? 14.782  -7.625  21.369  1.00 27.45 ? 49   THR A OG1 1 
ATOM   44    C CG2 . THR A 1 49  ? 13.197  -8.983  22.588  1.00 28.68 ? 49   THR A CG2 1 
ATOM   45    N N   . LEU A 1 50  ? 13.447  -5.264  19.850  1.00 25.65 ? 50   LEU A N   1 
ATOM   46    C CA  . LEU A 1 50  ? 13.882  -3.948  19.392  1.00 25.31 ? 50   LEU A CA  1 
ATOM   47    C C   . LEU A 1 50  ? 12.736  -3.135  18.753  1.00 25.70 ? 50   LEU A C   1 
ATOM   48    O O   . LEU A 1 50  ? 12.529  -1.988  19.120  1.00 25.29 ? 50   LEU A O   1 
ATOM   49    C CB  . LEU A 1 50  ? 15.077  -4.063  18.426  1.00 23.72 ? 50   LEU A CB  1 
ATOM   50    C CG  . LEU A 1 50  ? 15.612  -2.786  17.754  1.00 22.63 ? 50   LEU A CG  1 
ATOM   51    C CD1 . LEU A 1 50  ? 15.981  -1.721  18.784  1.00 20.93 ? 50   LEU A CD1 1 
ATOM   52    C CD2 . LEU A 1 50  ? 16.802  -3.109  16.889  1.00 20.53 ? 50   LEU A CD2 1 
ATOM   53    N N   . THR A 1 51  ? 12.059  -3.698  17.753  1.00 27.16 ? 51   THR A N   1 
ATOM   54    C CA  . THR A 1 51  ? 10.941  -3.041  17.059  1.00 29.85 ? 51   THR A CA  1 
ATOM   55    C C   . THR A 1 51  ? 9.709   -2.746  17.968  1.00 30.95 ? 51   THR A C   1 
ATOM   56    O O   . THR A 1 51  ? 8.903   -1.865  17.553  1.00 31.65 ? 51   THR A O   1 
ATOM   57    C CB  . THR A 1 51  ? 10.519  -3.843  15.794  1.00 30.15 ? 51   THR A CB  1 
ATOM   58    O OG1 . THR A 1 51  ? 10.294  -5.216  16.141  1.00 31.23 ? 51   THR A OG1 1 
ATOM   59    C CG2 . THR A 1 51  ? 11.600  -3.762  14.722  1.00 30.80 ? 51   THR A CG2 1 
ATOM   60    N N   . SER A 1 52  ? 9.589   -3.430  19.119  1.00 32.12 ? 52   SER A N   1 
ATOM   61    C CA  . SER A 1 52  ? 8.487   -3.241  20.119  1.00 32.52 ? 52   SER A CA  1 
ATOM   62    C C   . SER A 1 52  ? 8.809   -2.173  21.166  1.00 32.12 ? 52   SER A C   1 
ATOM   63    O O   . SER A 1 52  ? 7.965   -1.860  22.017  1.00 32.64 ? 52   SER A O   1 
ATOM   64    C CB  . SER A 1 52  ? 8.088   -4.544  20.829  1.00 32.69 ? 52   SER A CB  1 
ATOM   65    O OG  . SER A 1 52  ? 7.610   -5.497  19.901  1.00 34.44 ? 52   SER A OG  1 
ATOM   66    N N   . CYS A 1 53  ? 10.030  -1.628  21.114  1.00 30.53 ? 53   CYS A N   1 
ATOM   67    C CA  . CYS A 1 53  ? 10.458  -0.565  22.031  1.00 29.58 ? 53   CYS A CA  1 
ATOM   68    C C   . CYS A 1 53  ? 9.680   0.697   21.676  1.00 27.78 ? 53   CYS A C   1 
ATOM   69    O O   . CYS A 1 53  ? 9.493   0.997   20.489  1.00 26.68 ? 53   CYS A O   1 
ATOM   70    C CB  . CYS A 1 53  ? 11.966  -0.274  21.902  1.00 29.60 ? 53   CYS A CB  1 
ATOM   71    S SG  . CYS A 1 53  ? 13.082  -1.399  22.789  1.00 34.29 ? 53   CYS A SG  1 
ATOM   72    N N   . ALA A 1 54  ? 9.194   1.400   22.702  1.00 25.80 ? 54   ALA A N   1 
ATOM   73    C CA  . ALA A 1 54  ? 8.431   2.641   22.538  1.00 25.01 ? 54   ALA A CA  1 
ATOM   74    C C   . ALA A 1 54  ? 9.280   3.705   21.845  1.00 23.58 ? 54   ALA A C   1 
ATOM   75    O O   . ALA A 1 54  ? 8.790   4.456   21.003  1.00 23.65 ? 54   ALA A O   1 
ATOM   76    C CB  . ALA A 1 54  ? 7.954   3.148   23.893  1.00 26.58 ? 54   ALA A CB  1 
ATOM   77    N N   . SER A 1 55  ? 10.578  3.679   22.145  1.00 23.13 ? 55   SER A N   1 
ATOM   78    C CA  . SER A 1 55  ? 11.545  4.604   21.572  1.00 22.25 ? 55   SER A CA  1 
ATOM   79    C C   . SER A 1 55  ? 11.797  4.366   20.083  1.00 20.58 ? 55   SER A C   1 
ATOM   80    O O   . SER A 1 55  ? 12.045  5.313   19.341  1.00 19.21 ? 55   SER A O   1 
ATOM   81    C CB  . SER A 1 55  ? 12.859  4.532   22.338  1.00 24.50 ? 55   SER A CB  1 
ATOM   82    O OG  . SER A 1 55  ? 13.317  3.193   22.439  1.00 26.31 ? 55   SER A OG  1 
ATOM   83    N N   . TRP A 1 56  ? 11.693  3.106   19.655  1.00 19.67 ? 56   TRP A N   1 
ATOM   84    C CA  . TRP A 1 56  ? 11.882  2.732   18.248  1.00 18.80 ? 56   TRP A CA  1 
ATOM   85    C C   . TRP A 1 56  ? 10.692  3.214   17.419  1.00 19.11 ? 56   TRP A C   1 
ATOM   86    O O   . TRP A 1 56  ? 10.870  3.737   16.316  1.00 17.80 ? 56   TRP A O   1 
ATOM   87    C CB  . TRP A 1 56  ? 12.032  1.213   18.103  1.00 19.61 ? 56   TRP A CB  1 
ATOM   88    C CG  . TRP A 1 56  ? 12.552  0.764   16.756  1.00 18.59 ? 56   TRP A CG  1 
ATOM   89    C CD1 . TRP A 1 56  ? 11.817  0.287   15.701  1.00 19.73 ? 56   TRP A CD1 1 
ATOM   90    C CD2 . TRP A 1 56  ? 13.918  0.731   16.338  1.00 19.01 ? 56   TRP A CD2 1 
ATOM   91    N NE1 . TRP A 1 56  ? 12.643  -0.052  14.656  1.00 19.61 ? 56   TRP A NE1 1 
ATOM   92    C CE2 . TRP A 1 56  ? 13.939  0.209   15.016  1.00 19.31 ? 56   TRP A CE2 1 
ATOM   93    C CE3 . TRP A 1 56  ? 15.137  1.093   16.949  1.00 19.31 ? 56   TRP A CE3 1 
ATOM   94    C CZ2 . TRP A 1 56  ? 15.139  0.035   14.291  1.00 19.21 ? 56   TRP A CZ2 1 
ATOM   95    C CZ3 . TRP A 1 56  ? 16.343  0.919   16.227  1.00 20.87 ? 56   TRP A CZ3 1 
ATOM   96    C CH2 . TRP A 1 56  ? 16.325  0.392   14.914  1.00 19.37 ? 56   TRP A CH2 1 
ATOM   97    N N   . THR A 1 57  ? 9.491   3.039   17.982  1.00 19.65 ? 57   THR A N   1 
ATOM   98    C CA  . THR A 1 57  ? 8.229   3.448   17.364  1.00 20.48 ? 57   THR A CA  1 
ATOM   99    C C   . THR A 1 57  ? 8.213   4.968   17.204  1.00 19.76 ? 57   THR A C   1 
ATOM   100   O O   . THR A 1 57  ? 7.789   5.479   16.161  1.00 20.73 ? 57   THR A O   1 
ATOM   101   C CB  . THR A 1 57  ? 7.009   2.977   18.218  1.00 22.22 ? 57   THR A CB  1 
ATOM   102   O OG1 . THR A 1 57  ? 6.896   1.551   18.133  1.00 24.90 ? 57   THR A OG1 1 
ATOM   103   C CG2 . THR A 1 57  ? 5.695   3.601   17.720  1.00 24.51 ? 57   THR A CG2 1 
ATOM   104   N N   . GLN A 1 58  ? 8.748   5.666   18.208  1.00 18.41 ? 58   GLN A N   1 
ATOM   105   C CA  . GLN A 1 58  ? 8.826   7.125   18.197  1.00 18.97 ? 58   GLN A CA  1 
ATOM   106   C C   . GLN A 1 58  ? 9.833   7.614   17.160  1.00 17.48 ? 58   GLN A C   1 
ATOM   107   O O   . GLN A 1 58  ? 9.571   8.590   16.464  1.00 17.14 ? 58   GLN A O   1 
ATOM   108   C CB  . GLN A 1 58  ? 9.161   7.680   19.590  1.00 20.52 ? 58   GLN A CB  1 
ATOM   109   C CG  . GLN A 1 58  ? 9.127   9.222   19.712  1.00 25.48 ? 58   GLN A CG  1 
ATOM   110   C CD  . GLN A 1 58  ? 7.779   9.850   19.350  1.00 27.27 ? 58   GLN A CD  1 
ATOM   111   O OE1 . GLN A 1 58  ? 6.726   9.216   19.454  1.00 30.38 ? 58   GLN A OE1 1 
ATOM   112   N NE2 . GLN A 1 58  ? 7.812   11.108  18.925  1.00 29.90 ? 58   GLN A NE2 1 
ATOM   113   N N   . LEU A 1 59  ? 10.954  6.904   17.026  1.00 16.97 ? 59   LEU A N   1 
ATOM   114   C CA  . LEU A 1 59  ? 11.973  7.264   16.042  1.00 15.94 ? 59   LEU A CA  1 
ATOM   115   C C   . LEU A 1 59  ? 11.470  7.092   14.610  1.00 15.68 ? 59   LEU A C   1 
ATOM   116   O O   . LEU A 1 59  ? 11.802  7.895   13.737  1.00 16.18 ? 59   LEU A O   1 
ATOM   117   C CB  . LEU A 1 59  ? 13.252  6.463   16.270  1.00 15.26 ? 59   LEU A CB  1 
ATOM   118   C CG  . LEU A 1 59  ? 14.194  6.951   17.369  1.00 14.22 ? 59   LEU A CG  1 
ATOM   119   C CD1 . LEU A 1 59  ? 15.211  5.880   17.673  1.00 14.03 ? 59   LEU A CD1 1 
ATOM   120   C CD2 . LEU A 1 59  ? 14.874  8.237   16.949  1.00 14.88 ? 59   LEU A CD2 1 
ATOM   121   N N   . GLN A 1 60  ? 10.608  6.090   14.397  1.00 16.69 ? 60   GLN A N   1 
ATOM   122   C CA  . GLN A 1 60  ? 10.008  5.832   13.083  1.00 18.07 ? 60   GLN A CA  1 
ATOM   123   C C   . GLN A 1 60  ? 9.042   6.962   12.735  1.00 17.22 ? 60   GLN A C   1 
ATOM   124   O O   . GLN A 1 60  ? 9.015   7.434   11.596  1.00 18.27 ? 60   GLN A O   1 
ATOM   125   C CB  . GLN A 1 60  ? 9.283   4.480   13.067  1.00 19.26 ? 60   GLN A CB  1 
ATOM   126   C CG  . GLN A 1 60  ? 8.823   3.998   11.681  1.00 23.73 ? 60   GLN A CG  1 
ATOM   127   C CD  . GLN A 1 60  ? 9.935   4.007   10.641  1.00 25.90 ? 60   GLN A CD  1 
ATOM   128   O OE1 . GLN A 1 60  ? 9.895   4.781   9.686   1.00 28.50 ? 60   GLN A OE1 1 
ATOM   129   N NE2 . GLN A 1 60  ? 10.936  3.154   10.831  1.00 28.06 ? 60   GLN A NE2 1 
ATOM   130   N N   . LYS A 1 61  ? 8.330   7.434   13.762  1.00 17.55 ? 61   LYS A N   1 
ATOM   131   C CA  . LYS A 1 61  ? 7.365   8.532   13.656  1.00 18.04 ? 61   LYS A CA  1 
ATOM   132   C C   . LYS A 1 61  ? 8.112   9.839   13.355  1.00 16.65 ? 61   LYS A C   1 
ATOM   133   O O   . LYS A 1 61  ? 7.701   10.599  12.480  1.00 16.31 ? 61   LYS A O   1 
ATOM   134   C CB  . LYS A 1 61  ? 6.580   8.649   14.971  1.00 20.40 ? 61   LYS A CB  1 
ATOM   135   C CG  . LYS A 1 61  ? 5.394   9.597   14.964  1.00 25.29 ? 61   LYS A CG  1 
ATOM   136   C CD  . LYS A 1 61  ? 4.832   9.729   16.373  1.00 28.03 ? 61   LYS A CD  1 
ATOM   137   C CE  . LYS A 1 61  ? 3.618   10.635  16.408  1.00 29.08 ? 61   LYS A CE  1 
ATOM   138   N NZ  . LYS A 1 61  ? 3.106   10.848  17.790  1.00 31.94 ? 61   LYS A NZ  1 
ATOM   139   N N   . LEU A 1 62  ? 9.243   10.049  14.036  1.00 15.61 ? 62   LEU A N   1 
ATOM   140   C CA  . LEU A 1 62  ? 10.072  11.245  13.842  1.00 15.45 ? 62   LEU A CA  1 
ATOM   141   C C   . LEU A 1 62  ? 10.761  11.279  12.478  1.00 14.82 ? 62   LEU A C   1 
ATOM   142   O O   . LEU A 1 62  ? 11.021  12.356  11.942  1.00 15.05 ? 62   LEU A O   1 
ATOM   143   C CB  . LEU A 1 62  ? 11.097  11.389  14.969  1.00 16.32 ? 62   LEU A CB  1 
ATOM   144   C CG  . LEU A 1 62  ? 10.559  11.686  16.375  1.00 16.48 ? 62   LEU A CG  1 
ATOM   145   C CD1 . LEU A 1 62  ? 11.688  11.605  17.352  1.00 16.82 ? 62   LEU A CD1 1 
ATOM   146   C CD2 . LEU A 1 62  ? 9.885   13.040  16.472  1.00 17.56 ? 62   LEU A CD2 1 
ATOM   147   N N   . TYR A 1 63  ? 11.033  10.095  11.917  1.00 15.11 ? 63   TYR A N   1 
ATOM   148   C CA  . TYR A 1 63  ? 11.644  9.980   10.593  1.00 15.48 ? 63   TYR A CA  1 
ATOM   149   C C   . TYR A 1 63  ? 10.640  10.416  9.523   1.00 16.16 ? 63   TYR A C   1 
ATOM   150   O O   . TYR A 1 63  ? 10.999  11.133  8.591   1.00 15.86 ? 63   TYR A O   1 
ATOM   151   C CB  . TYR A 1 63  ? 12.129  8.543   10.319  1.00 15.55 ? 63   TYR A CB  1 
ATOM   152   C CG  . TYR A 1 63  ? 12.584  8.323   8.890   1.00 16.14 ? 63   TYR A CG  1 
ATOM   153   C CD1 . TYR A 1 63  ? 13.756  8.934   8.401   1.00 16.38 ? 63   TYR A CD1 1 
ATOM   154   C CD2 . TYR A 1 63  ? 11.815  7.538   8.001   1.00 15.83 ? 63   TYR A CD2 1 
ATOM   155   C CE1 . TYR A 1 63  ? 14.150  8.775   7.061   1.00 17.04 ? 63   TYR A CE1 1 
ATOM   156   C CE2 . TYR A 1 63  ? 12.204  7.370   6.659   1.00 17.12 ? 63   TYR A CE2 1 
ATOM   157   C CZ  . TYR A 1 63  ? 13.374  7.995   6.199   1.00 17.84 ? 63   TYR A CZ  1 
ATOM   158   O OH  . TYR A 1 63  ? 13.762  7.836   4.893   1.00 19.39 ? 63   TYR A OH  1 
ATOM   159   N N   . GLU A 1 64  ? 9.401   9.943   9.663   1.00 17.23 ? 64   GLU A N   1 
ATOM   160   C CA  . GLU A 1 64  ? 8.313   10.268  8.738   1.00 18.53 ? 64   GLU A CA  1 
ATOM   161   C C   . GLU A 1 64  ? 8.024   11.769  8.743   1.00 17.86 ? 64   GLU A C   1 
ATOM   162   O O   . GLU A 1 64  ? 7.757   12.355  7.697   1.00 20.04 ? 64   GLU A O   1 
ATOM   163   C CB  . GLU A 1 64  ? 7.045   9.503   9.122   1.00 20.95 ? 64   GLU A CB  1 
ATOM   164   C CG  . GLU A 1 64  ? 7.102   8.000   8.864   1.00 26.87 ? 64   GLU A CG  1 
ATOM   165   C CD  . GLU A 1 64  ? 5.927   7.245   9.475   1.00 31.01 ? 64   GLU A CD  1 
ATOM   166   O OE1 . GLU A 1 64  ? 4.892   7.872   9.796   1.00 34.06 ? 64   GLU A OE1 1 
ATOM   167   O OE2 . GLU A 1 64  ? 6.039   6.010   9.634   1.00 34.36 ? 64   GLU A OE2 1 
ATOM   168   N N   . GLN A 1 65  ? 8.185   12.377  9.918   1.00 17.26 ? 65   GLN A N   1 
ATOM   169   C CA  . GLN A 1 65  ? 7.950   13.804  10.129  1.00 16.89 ? 65   GLN A CA  1 
ATOM   170   C C   . GLN A 1 65  ? 9.072   14.739  9.684   1.00 17.63 ? 65   GLN A C   1 
ATOM   171   O O   . GLN A 1 65  ? 8.827   15.690  8.938   1.00 16.49 ? 65   GLN A O   1 
ATOM   172   C CB  . GLN A 1 65  ? 7.654   14.074  11.609  1.00 17.23 ? 65   GLN A CB  1 
ATOM   173   C CG  . GLN A 1 65  ? 6.317   13.537  12.107  1.00 20.67 ? 65   GLN A CG  1 
ATOM   174   C CD  . GLN A 1 65  ? 6.144   13.643  13.619  1.00 22.29 ? 65   GLN A CD  1 
ATOM   175   O OE1 . GLN A 1 65  ? 6.971   14.225  14.323  1.00 24.02 ? 65   GLN A OE1 1 
ATOM   176   N NE2 . GLN A 1 65  ? 5.048   13.086  14.122  1.00 25.21 ? 65   GLN A NE2 1 
ATOM   177   N N   . TYR A 1 66  ? 10.299  14.448  10.122  1.00 16.56 ? 66   TYR A N   1 
ATOM   178   C CA  . TYR A 1 66  ? 11.456  15.307  9.845   1.00 16.35 ? 66   TYR A CA  1 
ATOM   179   C C   . TYR A 1 66  ? 12.539  14.814  8.882   1.00 17.08 ? 66   TYR A C   1 
ATOM   180   O O   . TYR A 1 66  ? 13.480  15.561  8.583   1.00 16.59 ? 66   TYR A O   1 
ATOM   181   C CB  . TYR A 1 66  ? 12.116  15.715  11.173  1.00 16.34 ? 66   TYR A CB  1 
ATOM   182   C CG  . TYR A 1 66  ? 11.163  16.237  12.235  1.00 16.33 ? 66   TYR A CG  1 
ATOM   183   C CD1 . TYR A 1 66  ? 10.391  17.399  12.015  1.00 16.11 ? 66   TYR A CD1 1 
ATOM   184   C CD2 . TYR A 1 66  ? 11.013  15.560  13.460  1.00 16.53 ? 66   TYR A CD2 1 
ATOM   185   C CE1 . TYR A 1 66  ? 9.482   17.877  12.998  1.00 16.79 ? 66   TYR A CE1 1 
ATOM   186   C CE2 . TYR A 1 66  ? 10.106  16.030  14.453  1.00 16.33 ? 66   TYR A CE2 1 
ATOM   187   C CZ  . TYR A 1 66  ? 9.348   17.182  14.210  1.00 16.83 ? 66   TYR A CZ  1 
ATOM   188   O OH  . TYR A 1 66  ? 8.459   17.613  15.162  1.00 16.44 ? 66   TYR A OH  1 
ATOM   189   N N   . GLY A 1 67  ? 12.397  13.588  8.375   1.00 17.64 ? 67   GLY A N   1 
ATOM   190   C CA  . GLY A 1 67  ? 13.381  13.013  7.455   1.00 19.92 ? 67   GLY A CA  1 
ATOM   191   C C   . GLY A 1 67  ? 13.633  13.745  6.144   1.00 21.55 ? 67   GLY A C   1 
ATOM   192   O O   . GLY A 1 67  ? 14.758  13.723  5.634   1.00 22.88 ? 67   GLY A O   1 
ATOM   193   N N   . ASP A 1 68  ? 12.601  14.412  5.626   1.00 21.88 ? 68   ASP A N   1 
ATOM   194   C CA  . ASP A 1 68  ? 12.680  15.169  4.371   1.00 22.55 ? 68   ASP A CA  1 
ATOM   195   C C   . ASP A 1 68  ? 13.177  16.607  4.539   1.00 21.21 ? 68   ASP A C   1 
ATOM   196   O O   . ASP A 1 68  ? 13.407  17.305  3.544   1.00 22.34 ? 68   ASP A O   1 
ATOM   197   C CB  . ASP A 1 68  ? 11.324  15.173  3.645   1.00 26.84 ? 68   ASP A CB  1 
ATOM   198   C CG  . ASP A 1 68  ? 11.020  13.855  2.946   1.00 30.99 ? 68   ASP A CG  1 
ATOM   199   O OD1 . ASP A 1 68  ? 11.925  13.282  2.298   1.00 33.73 ? 68   ASP A OD1 1 
ATOM   200   O OD2 . ASP A 1 68  ? 9.855   13.401  3.025   1.00 34.04 ? 68   ASP A OD2 1 
ATOM   201   N N   . GLU A 1 69  ? 13.339  17.048  5.788   1.00 18.42 ? 69   GLU A N   1 
ATOM   202   C CA  . GLU A 1 69  ? 13.828  18.401  6.072   1.00 18.05 ? 69   GLU A CA  1 
ATOM   203   C C   . GLU A 1 69  ? 15.331  18.434  5.796   1.00 17.99 ? 69   GLU A C   1 
ATOM   204   O O   . GLU A 1 69  ? 16.066  17.586  6.313   1.00 18.12 ? 69   GLU A O   1 
ATOM   205   C CB  . GLU A 1 69  ? 13.542  18.803  7.526   1.00 16.99 ? 69   GLU A CB  1 
ATOM   206   C CG  . GLU A 1 69  ? 12.056  18.991  7.832   1.00 19.02 ? 69   GLU A CG  1 
ATOM   207   C CD  . GLU A 1 69  ? 11.772  19.505  9.241   1.00 20.65 ? 69   GLU A CD  1 
ATOM   208   O OE1 . GLU A 1 69  ? 12.705  19.643  10.065  1.00 22.36 ? 69   GLU A OE1 1 
ATOM   209   O OE2 . GLU A 1 69  ? 10.588  19.768  9.532   1.00 21.53 ? 69   GLU A OE2 1 
ATOM   210   N N   . PRO A 1 70  ? 15.798  19.370  4.932   1.00 18.38 ? 70   PRO A N   1 
ATOM   211   C CA  . PRO A 1 70  ? 17.234  19.449  4.622   1.00 17.49 ? 70   PRO A CA  1 
ATOM   212   C C   . PRO A 1 70  ? 18.087  19.818  5.834   1.00 17.09 ? 70   PRO A C   1 
ATOM   213   O O   . PRO A 1 70  ? 17.610  20.486  6.752   1.00 16.23 ? 70   PRO A O   1 
ATOM   214   C CB  . PRO A 1 70  ? 17.294  20.516  3.523   1.00 19.33 ? 70   PRO A CB  1 
ATOM   215   C CG  . PRO A 1 70  ? 16.111  21.389  3.809   1.00 19.97 ? 70   PRO A CG  1 
ATOM   216   C CD  . PRO A 1 70  ? 15.044  20.389  4.172   1.00 18.70 ? 70   PRO A CD  1 
ATOM   217   N N   . ILE A 1 71  ? 19.337  19.354  5.844   1.00 15.20 ? 71   ILE A N   1 
ATOM   218   C CA  . ILE A 1 71  ? 20.255  19.628  6.953   1.00 14.85 ? 71   ILE A CA  1 
ATOM   219   C C   . ILE A 1 71  ? 20.453  21.125  7.211   1.00 14.51 ? 71   ILE A C   1 
ATOM   220   O O   . ILE A 1 71  ? 20.499  21.549  8.368   1.00 15.05 ? 71   ILE A O   1 
ATOM   221   C CB  . ILE A 1 71  ? 21.634  18.963  6.736   1.00 14.51 ? 71   ILE A CB  1 
ATOM   222   C CG1 . ILE A 1 71  ? 21.465  17.466  6.471   1.00 14.73 ? 71   ILE A CG1 1 
ATOM   223   C CG2 . ILE A 1 71  ? 22.507  19.150  7.972   1.00 15.01 ? 71   ILE A CG2 1 
ATOM   224   C CD1 . ILE A 1 71  ? 22.759  16.737  6.167   1.00 14.11 ? 71   ILE A CD1 1 
ATOM   225   N N   . LYS A 1 72  ? 20.502  21.914  6.132   1.00 15.68 ? 72   LYS A N   1 
ATOM   226   C CA  . LYS A 1 72  ? 20.684  23.364  6.226   1.00 16.15 ? 72   LYS A CA  1 
ATOM   227   C C   . LYS A 1 72  ? 19.576  24.079  7.001   1.00 15.93 ? 72   LYS A C   1 
ATOM   228   O O   . LYS A 1 72  ? 19.837  25.107  7.624   1.00 16.28 ? 72   LYS A O   1 
ATOM   229   C CB  . LYS A 1 72  ? 20.865  23.998  4.840   1.00 17.89 ? 72   LYS A CB  1 
ATOM   230   C CG  . LYS A 1 72  ? 19.686  23.861  3.871   1.00 21.72 ? 72   LYS A CG  1 
ATOM   231   C CD  . LYS A 1 72  ? 19.946  24.607  2.561   1.00 24.95 ? 72   LYS A CD  1 
ATOM   232   C CE  . LYS A 1 72  ? 21.206  24.131  1.872   1.00 26.87 ? 72   LYS A CE  1 
ATOM   233   N NZ  . LYS A 1 72  ? 21.631  25.018  0.746   1.00 30.60 ? 72   LYS A NZ  1 
ATOM   234   N N   . LYS A 1 73  ? 18.374  23.490  7.014   1.00 16.52 ? 73   LYS A N   1 
ATOM   235   C CA  . LYS A 1 73  ? 17.220  24.052  7.734   1.00 17.18 ? 73   LYS A CA  1 
ATOM   236   C C   . LYS A 1 73  ? 17.484  24.096  9.242   1.00 16.91 ? 73   LYS A C   1 
ATOM   237   O O   . LYS A 1 73  ? 17.130  25.067  9.908   1.00 16.97 ? 73   LYS A O   1 
ATOM   238   C CB  . LYS A 1 73  ? 15.940  23.253  7.447   1.00 17.59 ? 73   LYS A CB  1 
ATOM   239   C CG  . LYS A 1 73  ? 14.735  23.629  8.324   1.00 20.26 ? 73   LYS A CG  1 
ATOM   240   C CD  . LYS A 1 73  ? 13.535  22.748  8.058   1.00 21.96 ? 73   LYS A CD  1 
ATOM   241   C CE  . LYS A 1 73  ? 12.307  23.242  8.812   1.00 22.56 ? 73   LYS A CE  1 
ATOM   242   N NZ  . LYS A 1 73  ? 12.377  22.983  10.285  1.00 22.78 ? 73   LYS A NZ  1 
ATOM   243   N N   . HIS A 1 74  ? 18.168  23.072  9.751   1.00 15.57 ? 74   HIS A N   1 
ATOM   244   C CA  . HIS A 1 74  ? 18.492  22.980  11.173  1.00 15.38 ? 74   HIS A CA  1 
ATOM   245   C C   . HIS A 1 74  ? 19.520  24.036  11.591  1.00 16.24 ? 74   HIS A C   1 
ATOM   246   O O   . HIS A 1 74  ? 19.502  24.510  12.729  1.00 17.21 ? 74   HIS A O   1 
ATOM   247   C CB  . HIS A 1 74  ? 18.966  21.568  11.521  1.00 15.05 ? 74   HIS A CB  1 
ATOM   248   C CG  . HIS A 1 74  ? 17.980  20.498  11.167  1.00 15.16 ? 74   HIS A CG  1 
ATOM   249   N ND1 . HIS A 1 74  ? 16.622  20.641  11.360  1.00 17.21 ? 74   HIS A ND1 1 
ATOM   250   C CD2 . HIS A 1 74  ? 18.153  19.278  10.605  1.00 15.89 ? 74   HIS A CD2 1 
ATOM   251   C CE1 . HIS A 1 74  ? 16.001  19.558  10.928  1.00 16.05 ? 74   HIS A CE1 1 
ATOM   252   N NE2 . HIS A 1 74  ? 16.907  18.715  10.466  1.00 16.60 ? 74   HIS A NE2 1 
ATOM   253   N N   . PHE A 1 75  ? 20.378  24.427  10.645  1.00 15.65 ? 75   PHE A N   1 
ATOM   254   C CA  . PHE A 1 75  ? 21.393  25.460  10.874  1.00 16.73 ? 75   PHE A CA  1 
ATOM   255   C C   . PHE A 1 75  ? 20.770  26.852  10.813  1.00 18.30 ? 75   PHE A C   1 
ATOM   256   O O   . PHE A 1 75  ? 21.216  27.771  11.504  1.00 18.21 ? 75   PHE A O   1 
ATOM   257   C CB  . PHE A 1 75  ? 22.517  25.350  9.840   1.00 14.78 ? 75   PHE A CB  1 
ATOM   258   C CG  . PHE A 1 75  ? 23.495  24.256  10.133  1.00 14.35 ? 75   PHE A CG  1 
ATOM   259   C CD1 . PHE A 1 75  ? 23.286  22.956  9.631   1.00 15.14 ? 75   PHE A CD1 1 
ATOM   260   C CD2 . PHE A 1 75  ? 24.622  24.507  10.935  1.00 14.16 ? 75   PHE A CD2 1 
ATOM   261   C CE1 . PHE A 1 75  ? 24.195  21.907  9.927   1.00 16.60 ? 75   PHE A CE1 1 
ATOM   262   C CE2 . PHE A 1 75  ? 25.538  23.473  11.242  1.00 15.68 ? 75   PHE A CE2 1 
ATOM   263   C CZ  . PHE A 1 75  ? 25.321  22.167  10.734  1.00 14.84 ? 75   PHE A CZ  1 
ATOM   264   N N   . GLU A 1 76  ? 19.725  26.981  9.993   1.00 20.97 ? 76   GLU A N   1 
ATOM   265   C CA  . GLU A 1 76  ? 18.996  28.239  9.818   1.00 23.39 ? 76   GLU A CA  1 
ATOM   266   C C   . GLU A 1 76  ? 18.085  28.553  11.010  1.00 24.19 ? 76   GLU A C   1 
ATOM   267   O O   . GLU A 1 76  ? 17.874  29.725  11.340  1.00 25.36 ? 76   GLU A O   1 
ATOM   268   C CB  . GLU A 1 76  ? 18.187  28.204  8.514   1.00 26.22 ? 76   GLU A CB  1 
ATOM   269   C CG  . GLU A 1 76  ? 19.051  28.276  7.251   1.00 29.26 ? 76   GLU A CG  1 
ATOM   270   C CD  . GLU A 1 76  ? 18.375  27.723  5.993   1.00 31.85 ? 76   GLU A CD  1 
ATOM   271   O OE1 . GLU A 1 76  ? 17.378  26.975  6.095   1.00 33.74 ? 76   GLU A OE1 1 
ATOM   272   O OE2 . GLU A 1 76  ? 18.868  28.027  4.886   1.00 32.84 ? 76   GLU A OE2 1 
ATOM   273   N N   . THR A 1 77  ? 17.591  27.509  11.680  1.00 23.95 ? 77   THR A N   1 
ATOM   274   C CA  . THR A 1 77  ? 16.707  27.670  12.839  1.00 24.50 ? 77   THR A CA  1 
ATOM   275   C C   . THR A 1 77  ? 17.434  27.680  14.190  1.00 24.76 ? 77   THR A C   1 
ATOM   276   O O   . THR A 1 77  ? 16.868  28.108  15.203  1.00 26.28 ? 77   THR A O   1 
ATOM   277   C CB  . THR A 1 77  ? 15.567  26.610  12.852  1.00 24.69 ? 77   THR A CB  1 
ATOM   278   O OG1 . THR A 1 77  ? 16.110  25.304  13.079  1.00 25.66 ? 77   THR A OG1 1 
ATOM   279   C CG2 . THR A 1 77  ? 14.814  26.618  11.528  1.00 25.98 ? 77   THR A CG2 1 
ATOM   280   N N   . ASP A 1 78  ? 18.686  27.221  14.192  1.00 23.17 ? 78   ASP A N   1 
ATOM   281   C CA  . ASP A 1 78  ? 19.524  27.175  15.395  1.00 21.82 ? 78   ASP A CA  1 
ATOM   282   C C   . ASP A 1 78  ? 20.909  27.721  15.033  1.00 21.41 ? 78   ASP A C   1 
ATOM   283   O O   . ASP A 1 78  ? 21.738  27.014  14.449  1.00 20.89 ? 78   ASP A O   1 
ATOM   284   C CB  . ASP A 1 78  ? 19.597  25.731  15.932  1.00 21.13 ? 78   ASP A CB  1 
ATOM   285   C CG  . ASP A 1 78  ? 20.521  25.563  17.153  1.00 22.19 ? 78   ASP A CG  1 
ATOM   286   O OD1 . ASP A 1 78  ? 21.043  26.555  17.703  1.00 22.31 ? 78   ASP A OD1 1 
ATOM   287   O OD2 . ASP A 1 78  ? 20.743  24.402  17.556  1.00 21.25 ? 78   ASP A OD2 1 
ATOM   288   N N   . SER A 1 79  ? 21.161  28.969  15.435  1.00 20.85 ? 79   SER A N   1 
ATOM   289   C CA  . SER A 1 79  ? 22.427  29.659  15.167  1.00 20.21 ? 79   SER A CA  1 
ATOM   290   C C   . SER A 1 79  ? 23.634  29.124  15.948  1.00 20.24 ? 79   SER A C   1 
ATOM   291   O O   . SER A 1 79  ? 24.782  29.415  15.595  1.00 20.73 ? 79   SER A O   1 
ATOM   292   C CB  . SER A 1 79  ? 22.269  31.168  15.407  1.00 20.98 ? 79   SER A CB  1 
ATOM   293   O OG  . SER A 1 79  ? 21.892  31.448  16.745  1.00 22.72 ? 79   SER A OG  1 
ATOM   294   N N   . GLU A 1 80  ? 23.365  28.336  16.991  1.00 19.93 ? 80   GLU A N   1 
ATOM   295   C CA  . GLU A 1 80  ? 24.413  27.742  17.829  1.00 19.39 ? 80   GLU A CA  1 
ATOM   296   C C   . GLU A 1 80  ? 24.537  26.230  17.604  1.00 17.70 ? 80   GLU A C   1 
ATOM   297   O O   . GLU A 1 80  ? 25.159  25.538  18.421  1.00 18.56 ? 80   GLU A O   1 
ATOM   298   C CB  . GLU A 1 80  ? 24.128  27.995  19.321  1.00 22.17 ? 80   GLU A CB  1 
ATOM   299   C CG  . GLU A 1 80  ? 24.194  29.450  19.788  1.00 28.05 ? 80   GLU A CG  1 
ATOM   300   C CD  . GLU A 1 80  ? 23.241  29.765  20.935  1.00 32.02 ? 80   GLU A CD  1 
ATOM   301   O OE1 . GLU A 1 80  ? 22.909  28.859  21.736  1.00 34.06 ? 80   GLU A OE1 1 
ATOM   302   O OE2 . GLU A 1 80  ? 22.823  30.941  21.041  1.00 35.99 ? 80   GLU A OE2 1 
ATOM   303   N N   . ARG A 1 81  ? 24.004  25.732  16.483  1.00 15.95 ? 81   ARG A N   1 
ATOM   304   C CA  . ARG A 1 81  ? 24.029  24.293  16.171  1.00 14.88 ? 81   ARG A CA  1 
ATOM   305   C C   . ARG A 1 81  ? 25.410  23.645  16.178  1.00 15.59 ? 81   ARG A C   1 
ATOM   306   O O   . ARG A 1 81  ? 25.571  22.553  16.726  1.00 14.78 ? 81   ARG A O   1 
ATOM   307   C CB  . ARG A 1 81  ? 23.308  23.990  14.852  1.00 14.28 ? 81   ARG A CB  1 
ATOM   308   C CG  . ARG A 1 81  ? 23.170  22.489  14.580  1.00 13.44 ? 81   ARG A CG  1 
ATOM   309   C CD  . ARG A 1 81  ? 22.390  22.181  13.340  1.00 12.89 ? 81   ARG A CD  1 
ATOM   310   N NE  . ARG A 1 81  ? 22.479  20.760  12.994  1.00 12.93 ? 81   ARG A NE  1 
ATOM   311   C CZ  . ARG A 1 81  ? 21.688  19.805  13.479  1.00 13.87 ? 81   ARG A CZ  1 
ATOM   312   N NH1 . ARG A 1 81  ? 20.720  20.096  14.343  1.00 15.15 ? 81   ARG A NH1 1 
ATOM   313   N NH2 . ARG A 1 81  ? 21.859  18.552  13.085  1.00 14.24 ? 81   ARG A NH2 1 
ATOM   314   N N   . GLY A 1 82  ? 26.396  24.343  15.614  1.00 15.99 ? 82   GLY A N   1 
ATOM   315   C CA  . GLY A 1 82  ? 27.765  23.843  15.564  1.00 17.68 ? 82   GLY A CA  1 
ATOM   316   C C   . GLY A 1 82  ? 28.332  23.493  16.929  1.00 18.86 ? 82   GLY A C   1 
ATOM   317   O O   . GLY A 1 82  ? 28.934  22.430  17.090  1.00 20.37 ? 82   GLY A O   1 
ATOM   318   N N   . GLN A 1 83  ? 28.049  24.339  17.922  1.00 18.63 ? 83   GLN A N   1 
ATOM   319   C CA  . GLN A 1 83  ? 28.510  24.141  19.296  1.00 20.37 ? 83   GLN A CA  1 
ATOM   320   C C   . GLN A 1 83  ? 27.664  23.137  20.080  1.00 19.03 ? 83   GLN A C   1 
ATOM   321   O O   . GLN A 1 83  ? 28.204  22.320  20.827  1.00 19.23 ? 83   GLN A O   1 
ATOM   322   C CB  . GLN A 1 83  ? 28.561  25.476  20.047  1.00 23.66 ? 83   GLN A CB  1 
ATOM   323   C CG  . GLN A 1 83  ? 29.715  26.387  19.636  1.00 30.30 ? 83   GLN A CG  1 
ATOM   324   C CD  . GLN A 1 83  ? 29.814  27.639  20.495  1.00 33.20 ? 83   GLN A CD  1 
ATOM   325   O OE1 . GLN A 1 83  ? 30.108  27.567  21.694  1.00 36.91 ? 83   GLN A OE1 1 
ATOM   326   N NE2 . GLN A 1 83  ? 29.578  28.795  19.886  1.00 36.41 ? 83   GLN A NE2 1 
ATOM   327   N N   . ARG A 1 84  ? 26.344  23.182  19.880  1.00 19.16 ? 84   ARG A N   1 
ATOM   328   C CA  . ARG A 1 84  ? 25.410  22.287  20.572  1.00 17.82 ? 84   ARG A CA  1 
ATOM   329   C C   . ARG A 1 84  ? 25.493  20.835  20.105  1.00 17.33 ? 84   ARG A C   1 
ATOM   330   O O   . ARG A 1 84  ? 25.196  19.910  20.870  1.00 17.57 ? 84   ARG A O   1 
ATOM   331   C CB  . ARG A 1 84  ? 23.970  22.798  20.432  1.00 19.11 ? 84   ARG A CB  1 
ATOM   332   C CG  . ARG A 1 84  ? 23.716  24.146  21.112  1.00 20.53 ? 84   ARG A CG  1 
ATOM   333   C CD  . ARG A 1 84  ? 22.286  24.632  20.917  1.00 21.35 ? 84   ARG A CD  1 
ATOM   334   N NE  . ARG A 1 84  ? 21.325  23.904  21.744  1.00 22.48 ? 84   ARG A NE  1 
ATOM   335   C CZ  . ARG A 1 84  ? 20.358  23.116  21.275  1.00 22.60 ? 84   ARG A CZ  1 
ATOM   336   N NH1 . ARG A 1 84  ? 20.209  22.939  19.968  1.00 21.68 ? 84   ARG A NH1 1 
ATOM   337   N NH2 . ARG A 1 84  ? 19.545  22.495  22.119  1.00 23.84 ? 84   ARG A NH2 1 
ATOM   338   N N   . TYR A 1 85  ? 25.892  20.649  18.848  1.00 14.97 ? 85   TYR A N   1 
ATOM   339   C CA  . TYR A 1 85  ? 26.024  19.325  18.257  1.00 14.67 ? 85   TYR A CA  1 
ATOM   340   C C   . TYR A 1 85  ? 27.481  18.928  18.022  1.00 14.05 ? 85   TYR A C   1 
ATOM   341   O O   . TYR A 1 85  ? 27.846  18.364  16.974  1.00 13.65 ? 85   TYR A O   1 
ATOM   342   C CB  . TYR A 1 85  ? 25.211  19.225  16.966  1.00 14.35 ? 85   TYR A CB  1 
ATOM   343   C CG  . TYR A 1 85  ? 23.726  19.041  17.141  1.00 14.20 ? 85   TYR A CG  1 
ATOM   344   C CD1 . TYR A 1 85  ? 22.940  20.019  17.787  1.00 16.02 ? 85   TYR A CD1 1 
ATOM   345   C CD2 . TYR A 1 85  ? 23.094  17.866  16.694  1.00 13.66 ? 85   TYR A CD2 1 
ATOM   346   C CE1 . TYR A 1 85  ? 21.562  19.826  17.995  1.00 15.16 ? 85   TYR A CE1 1 
ATOM   347   C CE2 . TYR A 1 85  ? 21.711  17.658  16.891  1.00 15.12 ? 85   TYR A CE2 1 
ATOM   348   C CZ  . TYR A 1 85  ? 20.961  18.643  17.547  1.00 16.22 ? 85   TYR A CZ  1 
ATOM   349   O OH  . TYR A 1 85  ? 19.638  18.426  17.781  1.00 17.83 ? 85   TYR A OH  1 
ATOM   350   N N   . SER A 1 86  ? 28.299  19.198  19.033  1.00 13.41 ? 86   SER A N   1 
ATOM   351   C CA  . SER A 1 86  ? 29.715  18.867  19.012  1.00 14.48 ? 86   SER A CA  1 
ATOM   352   C C   . SER A 1 86  ? 30.245  18.691  20.428  1.00 15.16 ? 86   SER A C   1 
ATOM   353   O O   . SER A 1 86  ? 29.721  19.292  21.367  1.00 16.10 ? 86   SER A O   1 
ATOM   354   C CB  . SER A 1 86  ? 30.517  19.924  18.258  1.00 16.59 ? 86   SER A CB  1 
ATOM   355   O OG  . SER A 1 86  ? 30.519  21.176  18.916  1.00 16.38 ? 86   SER A OG  1 
ATOM   356   N N   . VAL A 1 87  ? 31.229  17.804  20.580  1.00 13.72 ? 87   VAL A N   1 
ATOM   357   C CA  . VAL A 1 87  ? 31.848  17.500  21.879  1.00 14.21 ? 87   VAL A CA  1 
ATOM   358   C C   . VAL A 1 87  ? 33.370  17.405  21.731  1.00 14.90 ? 87   VAL A C   1 
ATOM   359   O O   . VAL A 1 87  ? 33.864  16.756  20.806  1.00 15.19 ? 87   VAL A O   1 
ATOM   360   C CB  . VAL A 1 87  ? 31.345  16.122  22.470  1.00 14.12 ? 87   VAL A CB  1 
ATOM   361   C CG1 . VAL A 1 87  ? 31.903  15.885  23.883  1.00 14.73 ? 87   VAL A CG1 1 
ATOM   362   C CG2 . VAL A 1 87  ? 29.830  16.039  22.509  1.00 16.42 ? 87   VAL A CG2 1 
ATOM   363   N N   . LYS A 1 88  ? 34.095  18.030  22.660  1.00 15.14 ? 88   LYS A N   1 
ATOM   364   C CA  . LYS A 1 88  ? 35.557  17.998  22.684  1.00 15.03 ? 88   LYS A CA  1 
ATOM   365   C C   . LYS A 1 88  ? 35.995  17.172  23.895  1.00 15.33 ? 88   LYS A C   1 
ATOM   366   O O   . LYS A 1 88  ? 35.593  17.458  25.026  1.00 15.72 ? 88   LYS A O   1 
ATOM   367   C CB  . LYS A 1 88  ? 36.131  19.420  22.780  1.00 16.42 ? 88   LYS A CB  1 
ATOM   368   C CG  . LYS A 1 88  ? 37.659  19.485  22.759  1.00 20.66 ? 88   LYS A CG  1 
ATOM   369   C CD  . LYS A 1 88  ? 38.158  20.872  22.383  1.00 25.29 ? 88   LYS A CD  1 
ATOM   370   C CE  . LYS A 1 88  ? 39.643  21.028  22.619  1.00 28.08 ? 88   LYS A CE  1 
ATOM   371   N NZ  . LYS A 1 88  ? 40.089  20.568  23.964  1.00 33.25 ? 88   LYS A NZ  1 
ATOM   372   N N   . VAL A 1 89  ? 36.778  16.124  23.640  1.00 14.55 ? 89   VAL A N   1 
ATOM   373   C CA  . VAL A 1 89  ? 37.287  15.248  24.698  1.00 14.74 ? 89   VAL A CA  1 
ATOM   374   C C   . VAL A 1 89  ? 38.799  15.425  24.783  1.00 14.97 ? 89   VAL A C   1 
ATOM   375   O O   . VAL A 1 89  ? 39.512  15.123  23.826  1.00 15.05 ? 89   VAL A O   1 
ATOM   376   C CB  . VAL A 1 89  ? 36.995  13.739  24.412  1.00 14.95 ? 89   VAL A CB  1 
ATOM   377   C CG1 . VAL A 1 89  ? 37.404  12.863  25.607  1.00 15.02 ? 89   VAL A CG1 1 
ATOM   378   C CG2 . VAL A 1 89  ? 35.543  13.533  24.095  1.00 15.53 ? 89   VAL A CG2 1 
ATOM   379   N N   . SER A 1 90  ? 39.276  15.897  25.934  1.00 14.47 ? 90   SER A N   1 
ATOM   380   C CA  . SER A 1 90  ? 40.708  16.090  26.171  1.00 16.13 ? 90   SER A CA  1 
ATOM   381   C C   . SER A 1 90  ? 41.390  14.729  26.313  1.00 15.50 ? 90   SER A C   1 
ATOM   382   O O   . SER A 1 90  ? 40.815  13.795  26.884  1.00 16.08 ? 90   SER A O   1 
ATOM   383   C CB  . SER A 1 90  ? 40.934  16.913  27.447  1.00 18.41 ? 90   SER A CB  1 
ATOM   384   O OG  . SER A 1 90  ? 42.315  16.999  27.774  1.00 21.03 ? 90   SER A OG  1 
ATOM   385   N N   . LEU A 1 91  ? 42.598  14.612  25.762  1.00 15.49 ? 91   LEU A N   1 
ATOM   386   C CA  . LEU A 1 91  ? 43.346  13.361  25.853  1.00 15.79 ? 91   LEU A CA  1 
ATOM   387   C C   . LEU A 1 91  ? 44.229  13.261  27.097  1.00 17.01 ? 91   LEU A C   1 
ATOM   388   O O   . LEU A 1 91  ? 44.851  12.225  27.340  1.00 17.01 ? 91   LEU A O   1 
ATOM   389   C CB  . LEU A 1 91  ? 44.137  13.086  24.570  1.00 16.47 ? 91   LEU A CB  1 
ATOM   390   C CG  . LEU A 1 91  ? 43.301  12.882  23.301  1.00 17.45 ? 91   LEU A CG  1 
ATOM   391   C CD1 . LEU A 1 91  ? 44.209  12.499  22.163  1.00 16.86 ? 91   LEU A CD1 1 
ATOM   392   C CD2 . LEU A 1 91  ? 42.178  11.866  23.486  1.00 18.40 ? 91   LEU A CD2 1 
ATOM   393   N N   . GLY A 1 92  ? 44.257  14.342  27.883  1.00 18.39 ? 92   GLY A N   1 
ATOM   394   C CA  . GLY A 1 92  ? 45.020  14.382  29.125  1.00 19.41 ? 92   GLY A CA  1 
ATOM   395   C C   . GLY A 1 92  ? 46.530  14.501  29.040  1.00 20.42 ? 92   GLY A C   1 
ATOM   396   O O   . GLY A 1 92  ? 47.220  14.269  30.038  1.00 21.62 ? 92   GLY A O   1 
ATOM   397   N N   . SER A 1 93  ? 47.042  14.840  27.861  1.00 19.48 ? 93   SER A N   1 
ATOM   398   C CA  . SER A 1 93  ? 48.478  14.997  27.641  1.00 19.75 ? 93   SER A CA  1 
ATOM   399   C C   . SER A 1 93  ? 48.905  16.458  27.720  1.00 20.65 ? 93   SER A C   1 
ATOM   400   O O   . SER A 1 93  ? 48.082  17.359  27.527  1.00 21.01 ? 93   SER A O   1 
ATOM   401   C CB  . SER A 1 93  ? 48.889  14.385  26.299  1.00 19.64 ? 93   SER A CB  1 
ATOM   402   O OG  . SER A 1 93  ? 47.935  14.661  25.284  1.00 20.55 ? 93   SER A OG  1 
ATOM   403   N N   . LYS A 1 94  ? 50.201  16.675  27.962  1.00 21.68 ? 94   LYS A N   1 
ATOM   404   C CA  . LYS A 1 94  ? 50.792  18.012  28.094  1.00 22.54 ? 94   LYS A CA  1 
ATOM   405   C C   . LYS A 1 94  ? 50.692  18.891  26.838  1.00 21.58 ? 94   LYS A C   1 
ATOM   406   O O   . LYS A 1 94  ? 50.642  20.123  26.942  1.00 22.60 ? 94   LYS A O   1 
ATOM   407   C CB  . LYS A 1 94  ? 52.253  17.891  28.564  1.00 24.31 ? 94   LYS A CB  1 
ATOM   408   C CG  . LYS A 1 94  ? 52.896  19.204  29.029  1.00 29.14 ? 94   LYS A CG  1 
ATOM   409   C CD  . LYS A 1 94  ? 54.275  18.991  29.639  1.00 32.02 ? 94   LYS A CD  1 
ATOM   410   C CE  . LYS A 1 94  ? 54.992  20.318  29.880  1.00 34.02 ? 94   LYS A CE  1 
ATOM   411   N NZ  . LYS A 1 94  ? 54.211  21.274  30.723  1.00 36.12 ? 94   LYS A NZ  1 
ATOM   412   N N   . ASP A 1 95  ? 50.601  18.258  25.665  1.00 20.69 ? 95   ASP A N   1 
ATOM   413   C CA  . ASP A 1 95  ? 50.488  18.972  24.388  1.00 19.61 ? 95   ASP A CA  1 
ATOM   414   C C   . ASP A 1 95  ? 49.061  19.504  24.135  1.00 18.77 ? 95   ASP A C   1 
ATOM   415   O O   . ASP A 1 95  ? 48.793  20.132  23.106  1.00 18.46 ? 95   ASP A O   1 
ATOM   416   C CB  . ASP A 1 95  ? 50.976  18.086  23.216  1.00 18.86 ? 95   ASP A CB  1 
ATOM   417   C CG  . ASP A 1 95  ? 50.134  16.816  23.014  1.00 20.26 ? 95   ASP A CG  1 
ATOM   418   O OD1 . ASP A 1 95  ? 49.277  16.502  23.864  1.00 18.60 ? 95   ASP A OD1 1 
ATOM   419   O OD2 . ASP A 1 95  ? 50.337  16.129  21.988  1.00 19.49 ? 95   ASP A OD2 1 
ATOM   420   N N   . GLU A 1 96  ? 48.170  19.234  25.094  1.00 18.15 ? 96   GLU A N   1 
ATOM   421   C CA  . GLU A 1 96  ? 46.755  19.634  25.086  1.00 18.60 ? 96   GLU A CA  1 
ATOM   422   C C   . GLU A 1 96  ? 45.968  19.077  23.890  1.00 17.43 ? 96   GLU A C   1 
ATOM   423   O O   . GLU A 1 96  ? 45.061  19.725  23.355  1.00 17.08 ? 96   GLU A O   1 
ATOM   424   C CB  . GLU A 1 96  ? 46.602  21.164  25.221  1.00 21.82 ? 96   GLU A CB  1 
ATOM   425   C CG  . GLU A 1 96  ? 47.181  21.740  26.524  1.00 25.72 ? 96   GLU A CG  1 
ATOM   426   C CD  . GLU A 1 96  ? 47.102  23.259  26.611  1.00 28.17 ? 96   GLU A CD  1 
ATOM   427   O OE1 . GLU A 1 96  ? 47.155  23.938  25.561  1.00 30.86 ? 96   GLU A OE1 1 
ATOM   428   O OE2 . GLU A 1 96  ? 46.996  23.779  27.743  1.00 30.52 ? 96   GLU A OE2 1 
ATOM   429   N N   . ASN A 1 97  ? 46.312  17.843  23.510  1.00 15.96 ? 97   ASN A N   1 
ATOM   430   C CA  . ASN A 1 97  ? 45.666  17.144  22.397  1.00 14.68 ? 97   ASN A CA  1 
ATOM   431   C C   . ASN A 1 97  ? 44.237  16.766  22.792  1.00 14.54 ? 97   ASN A C   1 
ATOM   432   O O   . ASN A 1 97  ? 43.915  16.641  23.982  1.00 14.54 ? 97   ASN A O   1 
ATOM   433   C CB  . ASN A 1 97  ? 46.472  15.892  22.000  1.00 14.67 ? 97   ASN A CB  1 
ATOM   434   C CG  . ASN A 1 97  ? 46.275  15.486  20.534  1.00 14.27 ? 97   ASN A CG  1 
ATOM   435   O OD1 . ASN A 1 97  ? 45.389  15.988  19.839  1.00 13.16 ? 97   ASN A OD1 1 
ATOM   436   N ND2 . ASN A 1 97  ? 47.117  14.570  20.063  1.00 13.57 ? 97   ASN A ND2 1 
ATOM   437   N N   . PHE A 1 98  ? 43.384  16.625  21.783  1.00 12.26 ? 98   PHE A N   1 
ATOM   438   C CA  . PHE A 1 98  ? 41.982  16.300  21.987  1.00 13.78 ? 98   PHE A CA  1 
ATOM   439   C C   . PHE A 1 98  ? 41.393  15.526  20.815  1.00 13.77 ? 98   PHE A C   1 
ATOM   440   O O   . PHE A 1 98  ? 42.014  15.417  19.767  1.00 13.53 ? 98   PHE A O   1 
ATOM   441   C CB  . PHE A 1 98  ? 41.170  17.593  22.207  1.00 13.39 ? 98   PHE A CB  1 
ATOM   442   C CG  . PHE A 1 98  ? 41.299  18.599  21.085  1.00 14.90 ? 98   PHE A CG  1 
ATOM   443   C CD1 . PHE A 1 98  ? 40.517  18.487  19.914  1.00 14.81 ? 98   PHE A CD1 1 
ATOM   444   C CD2 . PHE A 1 98  ? 42.218  19.660  21.187  1.00 15.73 ? 98   PHE A CD2 1 
ATOM   445   C CE1 . PHE A 1 98  ? 40.651  19.406  18.853  1.00 15.10 ? 98   PHE A CE1 1 
ATOM   446   C CE2 . PHE A 1 98  ? 42.357  20.591  20.139  1.00 15.49 ? 98   PHE A CE2 1 
ATOM   447   C CZ  . PHE A 1 98  ? 41.573  20.461  18.967  1.00 14.98 ? 98   PHE A CZ  1 
ATOM   448   N N   . LEU A 1 99  ? 40.157  15.068  21.003  1.00 14.50 ? 99   LEU A N   1 
ATOM   449   C CA  . LEU A 1 99  ? 39.377  14.379  19.979  1.00 16.79 ? 99   LEU A CA  1 
ATOM   450   C C   . LEU A 1 99  ? 38.064  15.168  19.974  1.00 16.32 ? 99   LEU A C   1 
ATOM   451   O O   . LEU A 1 99  ? 37.345  15.197  20.977  1.00 18.54 ? 99   LEU A O   1 
ATOM   452   C CB  . LEU A 1 99  ? 39.153  12.898  20.342  1.00 18.68 ? 99   LEU A CB  1 
ATOM   453   C CG  . LEU A 1 99  ? 38.334  11.981  19.413  1.00 21.02 ? 99   LEU A CG  1 
ATOM   454   C CD1 . LEU A 1 99  ? 38.867  11.974  17.982  1.00 22.24 ? 99   LEU A CD1 1 
ATOM   455   C CD2 . LEU A 1 99  ? 38.331  10.570  19.973  1.00 20.43 ? 99   LEU A CD2 1 
ATOM   456   N N   . PHE A 1 100 ? 37.823  15.885  18.877  1.00 14.68 ? 100  PHE A N   1 
ATOM   457   C CA  . PHE A 1 100 ? 36.624  16.713  18.707  1.00 14.79 ? 100  PHE A CA  1 
ATOM   458   C C   . PHE A 1 100 ? 35.689  16.098  17.676  1.00 15.46 ? 100  PHE A C   1 
ATOM   459   O O   . PHE A 1 100 ? 36.072  15.933  16.517  1.00 16.60 ? 100  PHE A O   1 
ATOM   460   C CB  . PHE A 1 100 ? 37.044  18.134  18.266  1.00 15.37 ? 100  PHE A CB  1 
ATOM   461   C CG  . PHE A 1 100 ? 35.898  19.085  17.994  1.00 16.19 ? 100  PHE A CG  1 
ATOM   462   C CD1 . PHE A 1 100 ? 35.111  19.587  19.048  1.00 16.92 ? 100  PHE A CD1 1 
ATOM   463   C CD2 . PHE A 1 100 ? 35.638  19.533  16.680  1.00 16.89 ? 100  PHE A CD2 1 
ATOM   464   C CE1 . PHE A 1 100 ? 34.079  20.533  18.807  1.00 18.56 ? 100  PHE A CE1 1 
ATOM   465   C CE2 . PHE A 1 100 ? 34.609  20.477  16.417  1.00 17.63 ? 100  PHE A CE2 1 
ATOM   466   C CZ  . PHE A 1 100 ? 33.831  20.979  17.482  1.00 18.42 ? 100  PHE A CZ  1 
ATOM   467   N N   . LEU A 1 101 ? 34.464  15.789  18.099  1.00 14.13 ? 101  LEU A N   1 
ATOM   468   C CA  . LEU A 1 101 ? 33.457  15.232  17.201  1.00 13.57 ? 101  LEU A CA  1 
ATOM   469   C C   . LEU A 1 101 ? 32.398  16.285  16.916  1.00 13.51 ? 101  LEU A C   1 
ATOM   470   O O   . LEU A 1 101 ? 31.814  16.842  17.840  1.00 13.95 ? 101  LEU A O   1 
ATOM   471   C CB  . LEU A 1 101 ? 32.774  13.984  17.798  1.00 13.94 ? 101  LEU A CB  1 
ATOM   472   C CG  . LEU A 1 101 ? 31.531  13.425  17.063  1.00 15.16 ? 101  LEU A CG  1 
ATOM   473   C CD1 . LEU A 1 101 ? 31.887  12.887  15.682  1.00 17.31 ? 101  LEU A CD1 1 
ATOM   474   C CD2 . LEU A 1 101 ? 30.843  12.355  17.881  1.00 16.93 ? 101  LEU A CD2 1 
ATOM   475   N N   . ASP A 1 102 ? 32.186  16.553  15.631  1.00 12.68 ? 102  ASP A N   1 
ATOM   476   C CA  . ASP A 1 102 ? 31.163  17.484  15.172  1.00 11.16 ? 102  ASP A CA  1 
ATOM   477   C C   . ASP A 1 102 ? 30.202  16.612  14.365  1.00 12.25 ? 102  ASP A C   1 
ATOM   478   O O   . ASP A 1 102 ? 30.540  16.163  13.271  1.00 12.13 ? 102  ASP A O   1 
ATOM   479   C CB  . ASP A 1 102 ? 31.780  18.594  14.291  1.00 12.85 ? 102  ASP A CB  1 
ATOM   480   C CG  . ASP A 1 102 ? 30.750  19.624  13.801  1.00 14.37 ? 102  ASP A CG  1 
ATOM   481   O OD1 . ASP A 1 102 ? 29.555  19.302  13.682  1.00 15.98 ? 102  ASP A OD1 1 
ATOM   482   O OD2 . ASP A 1 102 ? 31.142  20.767  13.506  1.00 16.68 ? 102  ASP A OD2 1 
ATOM   483   N N   . TYR A 1 103 ? 29.013  16.377  14.921  1.00 12.25 ? 103  TYR A N   1 
ATOM   484   C CA  . TYR A 1 103 ? 27.989  15.566  14.263  1.00 12.72 ? 103  TYR A CA  1 
ATOM   485   C C   . TYR A 1 103 ? 26.790  16.421  13.828  1.00 13.13 ? 103  TYR A C   1 
ATOM   486   O O   . TYR A 1 103 ? 25.697  15.898  13.580  1.00 13.58 ? 103  TYR A O   1 
ATOM   487   C CB  . TYR A 1 103 ? 27.559  14.391  15.176  1.00 12.28 ? 103  TYR A CB  1 
ATOM   488   C CG  . TYR A 1 103 ? 26.943  14.780  16.508  1.00 12.29 ? 103  TYR A CG  1 
ATOM   489   C CD1 . TYR A 1 103 ? 27.753  15.151  17.602  1.00 13.70 ? 103  TYR A CD1 1 
ATOM   490   C CD2 . TYR A 1 103 ? 25.543  14.796  16.675  1.00 13.74 ? 103  TYR A CD2 1 
ATOM   491   C CE1 . TYR A 1 103 ? 27.180  15.536  18.832  1.00 14.01 ? 103  TYR A CE1 1 
ATOM   492   C CE2 . TYR A 1 103 ? 24.960  15.179  17.899  1.00 14.31 ? 103  TYR A CE2 1 
ATOM   493   C CZ  . TYR A 1 103 ? 25.783  15.550  18.965  1.00 14.07 ? 103  TYR A CZ  1 
ATOM   494   O OH  . TYR A 1 103 ? 25.217  15.961  20.142  1.00 16.17 ? 103  TYR A OH  1 
ATOM   495   N N   . SER A 1 104 ? 27.024  17.729  13.696  1.00 13.74 ? 104  SER A N   1 
ATOM   496   C CA  . SER A 1 104 ? 25.985  18.696  13.321  1.00 12.35 ? 104  SER A CA  1 
ATOM   497   C C   . SER A 1 104 ? 25.459  18.626  11.901  1.00 12.84 ? 104  SER A C   1 
ATOM   498   O O   . SER A 1 104 ? 24.318  19.015  11.650  1.00 11.98 ? 104  SER A O   1 
ATOM   499   C CB  . SER A 1 104 ? 26.449  20.126  13.618  1.00 13.03 ? 104  SER A CB  1 
ATOM   500   O OG  . SER A 1 104 ? 27.501  20.514  12.757  1.00 13.76 ? 104  SER A OG  1 
ATOM   501   N N   . LYS A 1 105 ? 26.292  18.154  10.973  1.00 11.82 ? 105  LYS A N   1 
ATOM   502   C CA  . LYS A 1 105 ? 25.880  18.037  9.578   1.00 11.60 ? 105  LYS A CA  1 
ATOM   503   C C   . LYS A 1 105 ? 25.129  16.714  9.415   1.00 12.06 ? 105  LYS A C   1 
ATOM   504   O O   . LYS A 1 105 ? 25.616  15.760  8.809   1.00 12.43 ? 105  LYS A O   1 
ATOM   505   C CB  . LYS A 1 105 ? 27.087  18.154  8.637   1.00 11.88 ? 105  LYS A CB  1 
ATOM   506   C CG  . LYS A 1 105 ? 27.859  19.459  8.801   1.00 12.42 ? 105  LYS A CG  1 
ATOM   507   C CD  . LYS A 1 105 ? 28.768  19.705  7.619   1.00 11.07 ? 105  LYS A CD  1 
ATOM   508   C CE  . LYS A 1 105 ? 29.663  20.921  7.825   1.00 13.50 ? 105  LYS A CE  1 
ATOM   509   N NZ  . LYS A 1 105 ? 30.836  20.618  8.698   1.00 14.08 ? 105  LYS A NZ  1 
ATOM   510   N N   . SER A 1 106 ? 23.924  16.695  9.985   1.00 11.43 ? 106  SER A N   1 
ATOM   511   C CA  . SER A 1 106 ? 23.042  15.531  9.998   1.00 11.88 ? 106  SER A CA  1 
ATOM   512   C C   . SER A 1 106 ? 21.568  15.941  10.022  1.00 11.99 ? 106  SER A C   1 
ATOM   513   O O   . SER A 1 106 ? 21.240  17.070  10.399  1.00 13.18 ? 106  SER A O   1 
ATOM   514   C CB  . SER A 1 106 ? 23.345  14.689  11.236  1.00 11.91 ? 106  SER A CB  1 
ATOM   515   O OG  . SER A 1 106 ? 23.203  15.465  12.419  1.00 13.89 ? 106  SER A OG  1 
ATOM   516   N N   . HIS A 1 107 ? 20.690  15.002  9.657   1.00 12.81 ? 107  HIS A N   1 
ATOM   517   C CA  . HIS A 1 107 ? 19.234  15.219  9.634   1.00 12.53 ? 107  HIS A CA  1 
ATOM   518   C C   . HIS A 1 107 ? 18.691  14.919  11.034  1.00 13.76 ? 107  HIS A C   1 
ATOM   519   O O   . HIS A 1 107 ? 17.833  14.041  11.221  1.00 13.89 ? 107  HIS A O   1 
ATOM   520   C CB  . HIS A 1 107 ? 18.562  14.270  8.638   1.00 13.72 ? 107  HIS A CB  1 
ATOM   521   C CG  . HIS A 1 107 ? 19.042  14.406  7.229   1.00 13.10 ? 107  HIS A CG  1 
ATOM   522   N ND1 . HIS A 1 107 ? 20.145  13.735  6.753   1.00 13.76 ? 107  HIS A ND1 1 
ATOM   523   C CD2 . HIS A 1 107 ? 18.525  15.076  6.174   1.00 14.18 ? 107  HIS A CD2 1 
ATOM   524   C CE1 . HIS A 1 107 ? 20.285  13.978  5.464   1.00 15.51 ? 107  HIS A CE1 1 
ATOM   525   N NE2 . HIS A 1 107 ? 19.315  14.791  5.087   1.00 15.64 ? 107  HIS A NE2 1 
ATOM   526   N N   . ILE A 1 108 ? 19.233  15.628  12.022  1.00 13.08 ? 108  ILE A N   1 
ATOM   527   C CA  . ILE A 1 108 ? 18.879  15.431  13.421  1.00 13.26 ? 108  ILE A CA  1 
ATOM   528   C C   . ILE A 1 108 ? 18.571  16.752  14.125  1.00 14.56 ? 108  ILE A C   1 
ATOM   529   O O   . ILE A 1 108 ? 19.426  17.632  14.203  1.00 13.67 ? 108  ILE A O   1 
ATOM   530   C CB  . ILE A 1 108 ? 20.059  14.704  14.195  1.00 13.24 ? 108  ILE A CB  1 
ATOM   531   C CG1 . ILE A 1 108 ? 20.362  13.329  13.585  1.00 13.82 ? 108  ILE A CG1 1 
ATOM   532   C CG2 . ILE A 1 108 ? 19.716  14.509  15.675  1.00 13.12 ? 108  ILE A CG2 1 
ATOM   533   C CD1 . ILE A 1 108 ? 21.621  12.652  14.106  1.00 14.01 ? 108  ILE A CD1 1 
ATOM   534   N N   . ASN A 1 109 ? 17.336  16.885  14.608  1.00 15.05 ? 109  ASN A N   1 
ATOM   535   C CA  . ASN A 1 109 ? 16.936  18.063  15.381  1.00 15.27 ? 109  ASN A CA  1 
ATOM   536   C C   . ASN A 1 109 ? 16.927  17.634  16.855  1.00 15.58 ? 109  ASN A C   1 
ATOM   537   O O   . ASN A 1 109 ? 17.233  16.474  17.154  1.00 14.87 ? 109  ASN A O   1 
ATOM   538   C CB  . ASN A 1 109 ? 15.582  18.651  14.911  1.00 14.93 ? 109  ASN A CB  1 
ATOM   539   C CG  . ASN A 1 109 ? 14.422  17.652  14.962  1.00 16.97 ? 109  ASN A CG  1 
ATOM   540   O OD1 . ASN A 1 109 ? 14.476  16.624  15.637  1.00 15.91 ? 109  ASN A OD1 1 
ATOM   541   N ND2 . ASN A 1 109 ? 13.346  17.986  14.258  1.00 15.65 ? 109  ASN A ND2 1 
ATOM   542   N N   . ASP A 1 110 ? 16.588  18.543  17.772  1.00 15.86 ? 110  ASP A N   1 
ATOM   543   C CA  . ASP A 1 110 ? 16.565  18.223  19.206  1.00 16.08 ? 110  ASP A CA  1 
ATOM   544   C C   . ASP A 1 110 ? 15.643  17.071  19.610  1.00 15.76 ? 110  ASP A C   1 
ATOM   545   O O   . ASP A 1 110 ? 15.996  16.271  20.478  1.00 16.12 ? 110  ASP A O   1 
ATOM   546   C CB  . ASP A 1 110 ? 16.270  19.473  20.045  1.00 17.23 ? 110  ASP A CB  1 
ATOM   547   C CG  . ASP A 1 110 ? 17.468  20.415  20.155  1.00 19.41 ? 110  ASP A CG  1 
ATOM   548   O OD1 . ASP A 1 110 ? 18.591  20.058  19.725  1.00 19.75 ? 110  ASP A OD1 1 
ATOM   549   O OD2 . ASP A 1 110 ? 17.284  21.527  20.688  1.00 21.25 ? 110  ASP A OD2 1 
ATOM   550   N N   . GLU A 1 111 ? 14.503  16.955  18.922  1.00 15.65 ? 111  GLU A N   1 
ATOM   551   C CA  . GLU A 1 111 ? 13.516  15.895  19.172  1.00 16.83 ? 111  GLU A CA  1 
ATOM   552   C C   . GLU A 1 111 ? 14.065  14.517  18.804  1.00 16.15 ? 111  GLU A C   1 
ATOM   553   O O   . GLU A 1 111 ? 13.854  13.547  19.533  1.00 16.51 ? 111  GLU A O   1 
ATOM   554   C CB  . GLU A 1 111 ? 12.236  16.169  18.382  1.00 17.91 ? 111  GLU A CB  1 
ATOM   555   C CG  . GLU A 1 111 ? 11.514  17.435  18.808  1.00 21.81 ? 111  GLU A CG  1 
ATOM   556   C CD  . GLU A 1 111 ? 10.530  17.914  17.767  1.00 24.77 ? 111  GLU A CD  1 
ATOM   557   O OE1 . GLU A 1 111 ? 9.429   17.335  17.682  1.00 24.17 ? 111  GLU A OE1 1 
ATOM   558   O OE2 . GLU A 1 111 ? 10.868  18.860  17.018  1.00 26.08 ? 111  GLU A OE2 1 
ATOM   559   N N   . ILE A 1 112 ? 14.796  14.453  17.690  1.00 15.57 ? 112  ILE A N   1 
ATOM   560   C CA  . ILE A 1 112 ? 15.412  13.207  17.219  1.00 14.71 ? 112  ILE A CA  1 
ATOM   561   C C   . ILE A 1 112 ? 16.590  12.828  18.124  1.00 14.86 ? 112  ILE A C   1 
ATOM   562   O O   . ILE A 1 112 ? 16.706  11.668  18.516  1.00 14.47 ? 112  ILE A O   1 
ATOM   563   C CB  . ILE A 1 112 ? 15.857  13.315  15.729  1.00 14.19 ? 112  ILE A CB  1 
ATOM   564   C CG1 . ILE A 1 112 ? 14.625  13.442  14.830  1.00 14.53 ? 112  ILE A CG1 1 
ATOM   565   C CG2 . ILE A 1 112 ? 16.677  12.082  15.304  1.00 14.14 ? 112  ILE A CG2 1 
ATOM   566   C CD1 . ILE A 1 112 ? 14.900  14.064  13.471  1.00 14.62 ? 112  ILE A CD1 1 
ATOM   567   N N   . LYS A 1 113 ? 17.413  13.816  18.494  1.00 15.47 ? 113  LYS A N   1 
ATOM   568   C CA  . LYS A 1 113 ? 18.571  13.598  19.373  1.00 15.29 ? 113  LYS A CA  1 
ATOM   569   C C   . LYS A 1 113 ? 18.112  13.025  20.715  1.00 16.28 ? 113  LYS A C   1 
ATOM   570   O O   . LYS A 1 113 ? 18.657  12.026  21.181  1.00 16.77 ? 113  LYS A O   1 
ATOM   571   C CB  . LYS A 1 113 ? 19.355  14.903  19.574  1.00 13.62 ? 113  LYS A CB  1 
ATOM   572   C CG  . LYS A 1 113 ? 20.602  14.787  20.457  1.00 16.86 ? 113  LYS A CG  1 
ATOM   573   C CD  . LYS A 1 113 ? 21.299  16.124  20.561  1.00 18.65 ? 113  LYS A CD  1 
ATOM   574   C CE  . LYS A 1 113 ? 22.323  16.144  21.671  1.00 20.90 ? 113  LYS A CE  1 
ATOM   575   N NZ  . LYS A 1 113 ? 23.152  17.382  21.592  1.00 23.76 ? 113  LYS A NZ  1 
ATOM   576   N N   . CYS A 1 114 ? 17.031  13.593  21.252  1.00 16.95 ? 114  CYS A N   1 
ATOM   577   C CA  . CYS A 1 114 ? 16.446  13.155  22.519  1.00 17.54 ? 114  CYS A CA  1 
ATOM   578   C C   . CYS A 1 114 ? 15.901  11.731  22.408  1.00 15.90 ? 114  CYS A C   1 
ATOM   579   O O   . CYS A 1 114 ? 16.153  10.904  23.284  1.00 16.60 ? 114  CYS A O   1 
ATOM   580   C CB  . CYS A 1 114 ? 15.330  14.111  22.948  1.00 19.80 ? 114  CYS A CB  1 
ATOM   581   S SG  . CYS A 1 114 ? 14.515  13.670  24.497  1.00 30.50 ? 114  CYS A SG  1 
ATOM   582   N N   . ALA A 1 115 ? 15.231  11.438  21.292  1.00 15.13 ? 115  ALA A N   1 
ATOM   583   C CA  . ALA A 1 115 ? 14.652  10.116  21.043  1.00 14.65 ? 115  ALA A CA  1 
ATOM   584   C C   . ALA A 1 115 ? 15.698  9.021   20.845  1.00 15.64 ? 115  ALA A C   1 
ATOM   585   O O   . ALA A 1 115 ? 15.479  7.868   21.238  1.00 16.47 ? 115  ALA A O   1 
ATOM   586   C CB  . ALA A 1 115 ? 13.707  10.171  19.876  1.00 15.70 ? 115  ALA A CB  1 
ATOM   587   N N   . LEU A 1 116 ? 16.838  9.392   20.253  1.00 16.00 ? 116  LEU A N   1 
ATOM   588   C CA  . LEU A 1 116 ? 17.951  8.454   20.040  1.00 15.38 ? 116  LEU A CA  1 
ATOM   589   C C   . LEU A 1 116 ? 18.587  8.116   21.389  1.00 15.06 ? 116  LEU A C   1 
ATOM   590   O O   . LEU A 1 116 ? 18.935  6.960   21.649  1.00 14.94 ? 116  LEU A O   1 
ATOM   591   C CB  . LEU A 1 116 ? 19.004  9.052   19.101  1.00 15.16 ? 116  LEU A CB  1 
ATOM   592   C CG  . LEU A 1 116 ? 18.701  9.084   17.600  1.00 14.10 ? 116  LEU A CG  1 
ATOM   593   C CD1 . LEU A 1 116 ? 19.691  10.010  16.919  1.00 14.06 ? 116  LEU A CD1 1 
ATOM   594   C CD2 . LEU A 1 116 ? 18.755  7.681   16.993  1.00 15.00 ? 116  LEU A CD2 1 
ATOM   595   N N   . LEU A 1 117 ? 18.694  9.126   22.256  1.00 15.03 ? 117  LEU A N   1 
ATOM   596   C CA  . LEU A 1 117 ? 19.249  8.959   23.601  1.00 15.14 ? 117  LEU A CA  1 
ATOM   597   C C   . LEU A 1 117 ? 18.320  8.111   24.469  1.00 16.00 ? 117  LEU A C   1 
ATOM   598   O O   . LEU A 1 117 ? 18.788  7.317   25.289  1.00 16.63 ? 117  LEU A O   1 
ATOM   599   C CB  . LEU A 1 117 ? 19.521  10.316  24.254  1.00 15.93 ? 117  LEU A CB  1 
ATOM   600   C CG  . LEU A 1 117 ? 20.692  11.118  23.669  1.00 16.60 ? 117  LEU A CG  1 
ATOM   601   C CD1 . LEU A 1 117 ? 20.703  12.509  24.272  1.00 18.63 ? 117  LEU A CD1 1 
ATOM   602   C CD2 . LEU A 1 117 ? 22.027  10.413  23.894  1.00 18.02 ? 117  LEU A CD2 1 
ATOM   603   N N   . ARG A 1 118 ? 17.010  8.235   24.236  1.00 16.49 ? 118  ARG A N   1 
ATOM   604   C CA  . ARG A 1 118 ? 16.015  7.445   24.970  1.00 18.15 ? 118  ARG A CA  1 
ATOM   605   C C   . ARG A 1 118 ? 16.070  5.981   24.528  1.00 18.32 ? 118  ARG A C   1 
ATOM   606   O O   . ARG A 1 118 ? 15.797  5.085   25.328  1.00 18.28 ? 118  ARG A O   1 
ATOM   607   C CB  . ARG A 1 118 ? 14.597  7.986   24.778  1.00 19.66 ? 118  ARG A CB  1 
ATOM   608   C CG  . ARG A 1 118 ? 14.325  9.351   25.405  1.00 25.22 ? 118  ARG A CG  1 
ATOM   609   C CD  . ARG A 1 118 ? 12.824  9.659   25.515  1.00 28.06 ? 118  ARG A CD  1 
ATOM   610   N NE  . ARG A 1 118 ? 12.034  9.118   24.403  1.00 32.57 ? 118  ARG A NE  1 
ATOM   611   C CZ  . ARG A 1 118 ? 11.627  9.802   23.336  1.00 33.50 ? 118  ARG A CZ  1 
ATOM   612   N NH1 . ARG A 1 118 ? 11.917  11.092  23.190  1.00 33.10 ? 118  ARG A NH1 1 
ATOM   613   N NH2 . ARG A 1 118 ? 10.951  9.172   22.386  1.00 34.51 ? 118  ARG A NH2 1 
ATOM   614   N N   . LEU A 1 119 ? 16.459  5.749   23.265  1.00 17.27 ? 119  LEU A N   1 
ATOM   615   C CA  . LEU A 1 119 ? 16.603  4.390   22.720  1.00 16.96 ? 119  LEU A CA  1 
ATOM   616   C C   . LEU A 1 119 ? 17.759  3.698   23.427  1.00 16.81 ? 119  LEU A C   1 
ATOM   617   O O   . LEU A 1 119 ? 17.657  2.527   23.798  1.00 15.96 ? 119  LEU A O   1 
ATOM   618   C CB  . LEU A 1 119 ? 16.844  4.410   21.199  1.00 16.21 ? 119  LEU A CB  1 
ATOM   619   C CG  . LEU A 1 119 ? 17.190  3.081   20.500  1.00 16.04 ? 119  LEU A CG  1 
ATOM   620   C CD1 . LEU A 1 119 ? 16.005  2.122   20.539  1.00 17.83 ? 119  LEU A CD1 1 
ATOM   621   C CD2 . LEU A 1 119 ? 17.643  3.332   19.077  1.00 16.33 ? 119  LEU A CD2 1 
ATOM   622   N N   . ALA A 1 120 ? 18.827  4.464   23.652  1.00 17.54 ? 120  ALA A N   1 
ATOM   623   C CA  . ALA A 1 120 ? 20.021  3.981   24.338  1.00 17.91 ? 120  ALA A CA  1 
ATOM   624   C C   . ALA A 1 120 ? 19.695  3.586   25.785  1.00 18.85 ? 120  ALA A C   1 
ATOM   625   O O   . ALA A 1 120 ? 20.159  2.551   26.264  1.00 18.43 ? 120  ALA A O   1 
ATOM   626   C CB  . ALA A 1 120 ? 21.123  5.033   24.296  1.00 17.98 ? 120  ALA A CB  1 
ATOM   627   N N   . GLU A 1 121 ? 18.822  4.365   26.430  1.00 19.92 ? 121  GLU A N   1 
ATOM   628   C CA  . GLU A 1 121 ? 18.394  4.092   27.809  1.00 21.18 ? 121  GLU A CA  1 
ATOM   629   C C   . GLU A 1 121 ? 17.505  2.847   27.876  1.00 20.99 ? 121  GLU A C   1 
ATOM   630   O O   . GLU A 1 121 ? 17.720  1.979   28.729  1.00 21.12 ? 121  GLU A O   1 
ATOM   631   C CB  . GLU A 1 121 ? 17.631  5.279   28.400  1.00 23.54 ? 121  GLU A CB  1 
ATOM   632   C CG  . GLU A 1 121 ? 18.473  6.509   28.704  1.00 29.10 ? 121  GLU A CG  1 
ATOM   633   C CD  . GLU A 1 121 ? 17.716  7.565   29.507  1.00 32.44 ? 121  GLU A CD  1 
ATOM   634   O OE1 . GLU A 1 121 ? 16.475  7.463   29.651  1.00 34.76 ? 121  GLU A OE1 1 
ATOM   635   O OE2 . GLU A 1 121 ? 18.373  8.507   30.005  1.00 36.13 ? 121  GLU A OE2 1 
ATOM   636   N N   . GLU A 1 122 ? 16.554  2.746   26.939  1.00 20.84 ? 122  GLU A N   1 
ATOM   637   C CA  . GLU A 1 122 ? 15.613  1.624   26.852  1.00 20.94 ? 122  GLU A CA  1 
ATOM   638   C C   . GLU A 1 122 ? 16.264  0.275   26.555  1.00 20.33 ? 122  GLU A C   1 
ATOM   639   O O   . GLU A 1 122 ? 15.826  -0.756  27.076  1.00 19.90 ? 122  GLU A O   1 
ATOM   640   C CB  . GLU A 1 122 ? 14.529  1.894   25.802  1.00 24.12 ? 122  GLU A CB  1 
ATOM   641   C CG  . GLU A 1 122 ? 13.111  1.745   26.325  1.00 30.24 ? 122  GLU A CG  1 
ATOM   642   C CD  . GLU A 1 122 ? 12.072  1.916   25.234  1.00 32.10 ? 122  GLU A CD  1 
ATOM   643   O OE1 . GLU A 1 122 ? 11.926  3.038   24.703  1.00 34.15 ? 122  GLU A OE1 1 
ATOM   644   O OE2 . GLU A 1 122 ? 11.404  0.931   24.895  1.00 34.52 ? 122  GLU A OE2 1 
ATOM   645   N N   . ARG A 1 123 ? 17.309  0.298   25.727  1.00 18.79 ? 123  ARG A N   1 
ATOM   646   C CA  . ARG A 1 123 ? 18.048  -0.911  25.358  1.00 18.23 ? 123  ARG A CA  1 
ATOM   647   C C   . ARG A 1 123 ? 19.131  -1.280  26.377  1.00 17.72 ? 123  ARG A C   1 
ATOM   648   O O   . ARG A 1 123 ? 19.848  -2.270  26.200  1.00 18.68 ? 123  ARG A O   1 
ATOM   649   C CB  . ARG A 1 123 ? 18.644  -0.771  23.948  1.00 18.70 ? 123  ARG A CB  1 
ATOM   650   C CG  . ARG A 1 123 ? 17.599  -0.739  22.835  1.00 19.09 ? 123  ARG A CG  1 
ATOM   651   C CD  . ARG A 1 123 ? 16.846  -2.061  22.718  1.00 20.50 ? 123  ARG A CD  1 
ATOM   652   N NE  . ARG A 1 123 ? 17.633  -3.085  22.035  1.00 21.21 ? 123  ARG A NE  1 
ATOM   653   C CZ  . ARG A 1 123 ? 17.281  -4.365  21.922  1.00 24.01 ? 123  ARG A CZ  1 
ATOM   654   N NH1 . ARG A 1 123 ? 16.148  -4.810  22.456  1.00 25.59 ? 123  ARG A NH1 1 
ATOM   655   N NH2 . ARG A 1 123 ? 18.050  -5.199  21.236  1.00 24.47 ? 123  ARG A NH2 1 
ATOM   656   N N   . GLY A 1 124 ? 19.236  -0.469  27.433  1.00 17.31 ? 124  GLY A N   1 
ATOM   657   C CA  . GLY A 1 124 ? 20.191  -0.694  28.508  1.00 16.71 ? 124  GLY A CA  1 
ATOM   658   C C   . GLY A 1 124 ? 21.666  -0.635  28.160  1.00 16.34 ? 124  GLY A C   1 
ATOM   659   O O   . GLY A 1 124 ? 22.435  -1.481  28.620  1.00 16.82 ? 124  GLY A O   1 
ATOM   660   N N   . ILE A 1 125 ? 22.062  0.374   27.382  1.00 16.18 ? 125  ILE A N   1 
ATOM   661   C CA  . ILE A 1 125 ? 23.458  0.548   26.964  1.00 16.03 ? 125  ILE A CA  1 
ATOM   662   C C   . ILE A 1 125 ? 24.408  0.787   28.136  1.00 16.11 ? 125  ILE A C   1 
ATOM   663   O O   . ILE A 1 125 ? 25.468  0.171   28.190  1.00 16.62 ? 125  ILE A O   1 
ATOM   664   C CB  . ILE A 1 125 ? 23.615  1.685   25.885  1.00 16.11 ? 125  ILE A CB  1 
ATOM   665   C CG1 . ILE A 1 125 ? 22.802  1.347   24.628  1.00 17.84 ? 125  ILE A CG1 1 
ATOM   666   C CG2 . ILE A 1 125 ? 25.095  1.919   25.507  1.00 15.97 ? 125  ILE A CG2 1 
ATOM   667   C CD1 . ILE A 1 125 ? 23.079  0.006   23.980  1.00 19.03 ? 125  ILE A CD1 1 
ATOM   668   N N   . ARG A 1 126 ? 23.994  1.625   29.090  1.00 16.36 ? 126  ARG A N   1 
ATOM   669   C CA  . ARG A 1 126 ? 24.799  1.950   30.275  1.00 17.53 ? 126  ARG A CA  1 
ATOM   670   C C   . ARG A 1 126 ? 25.183  0.690   31.064  1.00 18.04 ? 126  ARG A C   1 
ATOM   671   O O   . ARG A 1 126 ? 26.363  0.483   31.375  1.00 17.56 ? 126  ARG A O   1 
ATOM   672   C CB  . ARG A 1 126 ? 24.034  2.943   31.166  1.00 19.71 ? 126  ARG A CB  1 
ATOM   673   C CG  . ARG A 1 126 ? 24.751  3.379   32.453  1.00 23.39 ? 126  ARG A CG  1 
ATOM   674   C CD  . ARG A 1 126 ? 23.952  4.428   33.239  1.00 27.40 ? 126  ARG A CD  1 
ATOM   675   N NE  . ARG A 1 126 ? 22.625  3.962   33.662  1.00 30.21 ? 126  ARG A NE  1 
ATOM   676   C CZ  . ARG A 1 126 ? 21.466  4.433   33.190  1.00 31.71 ? 126  ARG A CZ  1 
ATOM   677   N NH1 . ARG A 1 126 ? 21.449  5.389   32.266  1.00 33.32 ? 126  ARG A NH1 1 
ATOM   678   N NH2 . ARG A 1 126 ? 20.320  3.937   33.633  1.00 33.23 ? 126  ARG A NH2 1 
ATOM   679   N N   . GLN A 1 127 ? 24.197  -0.183  31.274  1.00 18.33 ? 127  GLN A N   1 
ATOM   680   C CA  . GLN A 1 127 ? 24.374  -1.442  32.001  1.00 18.75 ? 127  GLN A CA  1 
ATOM   681   C C   . GLN A 1 127 ? 25.181  -2.465  31.201  1.00 17.99 ? 127  GLN A C   1 
ATOM   682   O O   . GLN A 1 127 ? 25.975  -3.211  31.777  1.00 18.16 ? 127  GLN A O   1 
ATOM   683   C CB  . GLN A 1 127 ? 23.012  -2.030  32.400  1.00 20.73 ? 127  GLN A CB  1 
ATOM   684   C CG  . GLN A 1 127 ? 22.183  -1.143  33.345  1.00 23.70 ? 127  GLN A CG  1 
ATOM   685   C CD  . GLN A 1 127 ? 21.165  -0.251  32.632  1.00 25.41 ? 127  GLN A CD  1 
ATOM   686   O OE1 . GLN A 1 127 ? 21.430  0.309   31.563  1.00 23.37 ? 127  GLN A OE1 1 
ATOM   687   N NE2 . GLN A 1 127 ? 19.989  -0.108  33.239  1.00 27.39 ? 127  GLN A NE2 1 
ATOM   688   N N   . PHE A 1 128 ? 25.009  -2.457  29.875  1.00 16.89 ? 128  PHE A N   1 
ATOM   689   C CA  . PHE A 1 128 ? 25.732  -3.370  28.978  1.00 15.96 ? 128  PHE A CA  1 
ATOM   690   C C   . PHE A 1 128 ? 27.223  -3.019  28.958  1.00 15.67 ? 128  PHE A C   1 
ATOM   691   O O   . PHE A 1 128 ? 28.065  -3.916  28.939  1.00 14.91 ? 128  PHE A O   1 
ATOM   692   C CB  . PHE A 1 128 ? 25.150  -3.329  27.551  1.00 16.48 ? 128  PHE A CB  1 
ATOM   693   C CG  . PHE A 1 128 ? 25.785  -4.318  26.597  1.00 16.66 ? 128  PHE A CG  1 
ATOM   694   C CD1 . PHE A 1 128 ? 25.475  -5.690  26.671  1.00 16.98 ? 128  PHE A CD1 1 
ATOM   695   C CD2 . PHE A 1 128 ? 26.722  -3.885  25.635  1.00 16.15 ? 128  PHE A CD2 1 
ATOM   696   C CE1 . PHE A 1 128 ? 26.096  -6.625  25.799  1.00 19.09 ? 128  PHE A CE1 1 
ATOM   697   C CE2 . PHE A 1 128 ? 27.353  -4.801  24.754  1.00 16.00 ? 128  PHE A CE2 1 
ATOM   698   C CZ  . PHE A 1 128 ? 27.042  -6.177  24.835  1.00 16.81 ? 128  PHE A CZ  1 
ATOM   699   N N   . VAL A 1 129 ? 27.525  -1.717  28.951  1.00 14.85 ? 129  VAL A N   1 
ATOM   700   C CA  . VAL A 1 129 ? 28.905  -1.207  28.953  1.00 14.50 ? 129  VAL A CA  1 
ATOM   701   C C   . VAL A 1 129 ? 29.607  -1.612  30.250  1.00 15.07 ? 129  VAL A C   1 
ATOM   702   O O   . VAL A 1 129 ? 30.759  -2.053  30.223  1.00 15.07 ? 129  VAL A O   1 
ATOM   703   C CB  . VAL A 1 129 ? 28.929  0.342   28.787  1.00 13.65 ? 129  VAL A CB  1 
ATOM   704   C CG1 . VAL A 1 129 ? 30.322  0.926   29.053  1.00 15.59 ? 129  VAL A CG1 1 
ATOM   705   C CG2 . VAL A 1 129 ? 28.485  0.705   27.389  1.00 15.29 ? 129  VAL A CG2 1 
ATOM   706   N N   . GLN A 1 130 ? 28.891  -1.490  31.372  1.00 15.21 ? 130  GLN A N   1 
ATOM   707   C CA  . GLN A 1 130 ? 29.438  -1.871  32.671  1.00 15.81 ? 130  GLN A CA  1 
ATOM   708   C C   . GLN A 1 130 ? 29.723  -3.368  32.706  1.00 15.66 ? 130  GLN A C   1 
ATOM   709   O O   . GLN A 1 130 ? 30.775  -3.780  33.181  1.00 16.32 ? 130  GLN A O   1 
ATOM   710   C CB  . GLN A 1 130 ? 28.503  -1.458  33.812  1.00 17.36 ? 130  GLN A CB  1 
ATOM   711   C CG  . GLN A 1 130 ? 28.443  0.055   34.053  1.00 18.84 ? 130  GLN A CG  1 
ATOM   712   C CD  . GLN A 1 130 ? 29.806  0.684   34.343  1.00 21.10 ? 130  GLN A CD  1 
ATOM   713   O OE1 . GLN A 1 130 ? 30.510  0.279   35.268  1.00 22.82 ? 130  GLN A OE1 1 
ATOM   714   N NE2 . GLN A 1 130 ? 30.181  1.676   33.541  1.00 22.22 ? 130  GLN A NE2 1 
ATOM   715   N N   . SER A 1 131 ? 28.846  -4.148  32.072  1.00 15.73 ? 131  SER A N   1 
ATOM   716   C CA  . SER A 1 131 ? 28.994  -5.602  31.984  1.00 16.15 ? 131  SER A CA  1 
ATOM   717   C C   . SER A 1 131 ? 30.233  -5.994  31.174  1.00 16.62 ? 131  SER A C   1 
ATOM   718   O O   . SER A 1 131 ? 30.979  -6.890  31.573  1.00 17.07 ? 131  SER A O   1 
ATOM   719   C CB  . SER A 1 131 ? 27.746  -6.240  31.369  1.00 17.97 ? 131  SER A CB  1 
ATOM   720   O OG  . SER A 1 131 ? 26.631  -6.114  32.234  1.00 22.39 ? 131  SER A OG  1 
ATOM   721   N N   . VAL A 1 132 ? 30.486  -5.263  30.085  1.00 15.47 ? 132  VAL A N   1 
ATOM   722   C CA  . VAL A 1 132 ? 31.643  -5.504  29.215  1.00 14.99 ? 132  VAL A CA  1 
ATOM   723   C C   . VAL A 1 132 ? 32.941  -5.194  29.973  1.00 14.59 ? 132  VAL A C   1 
ATOM   724   O O   . VAL A 1 132 ? 33.827  -6.045  30.061  1.00 14.15 ? 132  VAL A O   1 
ATOM   725   C CB  . VAL A 1 132 ? 31.568  -4.635  27.909  1.00 13.62 ? 132  VAL A CB  1 
ATOM   726   C CG1 . VAL A 1 132 ? 32.844  -4.782  27.060  1.00 14.86 ? 132  VAL A CG1 1 
ATOM   727   C CG2 . VAL A 1 132 ? 30.375  -5.053  27.072  1.00 14.19 ? 132  VAL A CG2 1 
ATOM   728   N N   . PHE A 1 133 ? 32.993  -4.001  30.573  1.00 15.51 ? 133  PHE A N   1 
ATOM   729   C CA  . PHE A 1 133 ? 34.156  -3.517  31.329  1.00 15.50 ? 133  PHE A CA  1 
ATOM   730   C C   . PHE A 1 133 ? 34.527  -4.308  32.585  1.00 15.88 ? 133  PHE A C   1 
ATOM   731   O O   . PHE A 1 133 ? 35.703  -4.367  32.955  1.00 16.40 ? 133  PHE A O   1 
ATOM   732   C CB  . PHE A 1 133 ? 33.970  -2.041  31.705  1.00 16.73 ? 133  PHE A CB  1 
ATOM   733   C CG  . PHE A 1 133 ? 34.331  -1.065  30.606  1.00 16.98 ? 133  PHE A CG  1 
ATOM   734   C CD1 . PHE A 1 133 ? 33.762  -1.162  29.315  1.00 17.78 ? 133  PHE A CD1 1 
ATOM   735   C CD2 . PHE A 1 133 ? 35.229  -0.015  30.874  1.00 17.38 ? 133  PHE A CD2 1 
ATOM   736   C CE1 . PHE A 1 133 ? 34.079  -0.218  28.298  1.00 18.95 ? 133  PHE A CE1 1 
ATOM   737   C CE2 . PHE A 1 133 ? 35.560  0.941   29.875  1.00 17.43 ? 133  PHE A CE2 1 
ATOM   738   C CZ  . PHE A 1 133 ? 34.981  0.840   28.582  1.00 16.93 ? 133  PHE A CZ  1 
ATOM   739   N N   . ARG A 1 134 ? 33.525  -4.920  33.218  1.00 17.23 ? 134  ARG A N   1 
ATOM   740   C CA  . ARG A 1 134 ? 33.718  -5.707  34.440  1.00 18.00 ? 134  ARG A CA  1 
ATOM   741   C C   . ARG A 1 134 ? 34.027  -7.192  34.196  1.00 17.47 ? 134  ARG A C   1 
ATOM   742   O O   . ARG A 1 134 ? 34.242  -7.954  35.142  1.00 18.17 ? 134  ARG A O   1 
ATOM   743   C CB  . ARG A 1 134 ? 32.527  -5.528  35.391  1.00 20.82 ? 134  ARG A CB  1 
ATOM   744   C CG  . ARG A 1 134 ? 32.426  -4.121  35.975  1.00 24.63 ? 134  ARG A CG  1 
ATOM   745   C CD  . ARG A 1 134 ? 31.058  -3.853  36.582  1.00 28.66 ? 134  ARG A CD  1 
ATOM   746   N NE  . ARG A 1 134 ? 30.924  -2.487  37.107  1.00 32.35 ? 134  ARG A NE  1 
ATOM   747   C CZ  . ARG A 1 134 ? 29.805  -1.990  37.644  1.00 34.65 ? 134  ARG A CZ  1 
ATOM   748   N NH1 . ARG A 1 134 ? 28.714  -2.739  37.734  1.00 35.62 ? 134  ARG A NH1 1 
ATOM   749   N NH2 . ARG A 1 134 ? 29.755  -0.744  38.099  1.00 35.17 ? 134  ARG A NH2 1 
ATOM   750   N N   . GLY A 1 135 ? 34.023  -7.598  32.926  1.00 15.47 ? 135  GLY A N   1 
ATOM   751   C CA  . GLY A 1 135 ? 34.367  -8.971  32.577  1.00 14.95 ? 135  GLY A CA  1 
ATOM   752   C C   . GLY A 1 135 ? 33.249  -9.983  32.426  1.00 14.54 ? 135  GLY A C   1 
ATOM   753   O O   . GLY A 1 135 ? 33.505  -11.192 32.358  1.00 14.59 ? 135  GLY A O   1 
ATOM   754   N N   . GLU A 1 136 ? 32.003  -9.518  32.375  1.00 14.15 ? 136  GLU A N   1 
ATOM   755   C CA  . GLU A 1 136 ? 30.870  -10.437 32.192  1.00 15.74 ? 136  GLU A CA  1 
ATOM   756   C C   . GLU A 1 136 ? 30.969  -11.093 30.814  1.00 15.73 ? 136  GLU A C   1 
ATOM   757   O O   . GLU A 1 136 ? 31.519  -10.505 29.875  1.00 15.42 ? 136  GLU A O   1 
ATOM   758   C CB  . GLU A 1 136 ? 29.531  -9.708  32.314  1.00 17.89 ? 136  GLU A CB  1 
ATOM   759   C CG  . GLU A 1 136 ? 29.217  -9.203  33.723  1.00 23.23 ? 136  GLU A CG  1 
ATOM   760   C CD  . GLU A 1 136 ? 28.939  -10.326 34.737  1.00 25.84 ? 136  GLU A CD  1 
ATOM   761   O OE1 . GLU A 1 136 ? 28.153  -11.254 34.422  1.00 27.10 ? 136  GLU A OE1 1 
ATOM   762   O OE2 . GLU A 1 136 ? 29.503  -10.274 35.855  1.00 30.90 ? 136  GLU A OE2 1 
ATOM   763   N N   . ARG A 1 137 ? 30.462  -12.318 30.709  1.00 15.98 ? 137  ARG A N   1 
ATOM   764   C CA  . ARG A 1 137 ? 30.494  -13.080 29.464  1.00 17.06 ? 137  ARG A CA  1 
ATOM   765   C C   . ARG A 1 137 ? 29.395  -12.625 28.502  1.00 16.80 ? 137  ARG A C   1 
ATOM   766   O O   . ARG A 1 137 ? 28.384  -13.310 28.310  1.00 18.09 ? 137  ARG A O   1 
ATOM   767   C CB  . ARG A 1 137 ? 30.405  -14.580 29.777  1.00 16.71 ? 137  ARG A CB  1 
ATOM   768   C CG  . ARG A 1 137 ? 31.672  -15.125 30.429  1.00 19.48 ? 137  ARG A CG  1 
ATOM   769   C CD  . ARG A 1 137 ? 31.477  -16.454 31.165  1.00 22.83 ? 137  ARG A CD  1 
ATOM   770   N NE  . ARG A 1 137 ? 32.605  -16.775 32.060  1.00 27.13 ? 137  ARG A NE  1 
ATOM   771   C CZ  . ARG A 1 137 ? 33.816  -17.185 31.657  1.00 29.79 ? 137  ARG A CZ  1 
ATOM   772   N NH1 . ARG A 1 137 ? 34.075  -17.336 30.368  1.00 31.44 ? 137  ARG A NH1 1 
ATOM   773   N NH2 . ARG A 1 137 ? 34.785  -17.451 32.526  1.00 31.96 ? 137  ARG A NH2 1 
ATOM   774   N N   . VAL A 1 138 ? 29.622  -11.446 27.912  1.00 16.10 ? 138  VAL A N   1 
ATOM   775   C CA  . VAL A 1 138 ? 28.703  -10.797 26.970  1.00 16.08 ? 138  VAL A CA  1 
ATOM   776   C C   . VAL A 1 138 ? 28.741  -11.457 25.583  1.00 14.93 ? 138  VAL A C   1 
ATOM   777   O O   . VAL A 1 138 ? 27.800  -11.334 24.790  1.00 15.65 ? 138  VAL A O   1 
ATOM   778   C CB  . VAL A 1 138 ? 28.984  -9.264  26.862  1.00 16.27 ? 138  VAL A CB  1 
ATOM   779   C CG1 . VAL A 1 138 ? 28.914  -8.596  28.226  1.00 17.58 ? 138  VAL A CG1 1 
ATOM   780   C CG2 . VAL A 1 138 ? 30.345  -8.996  26.288  1.00 17.84 ? 138  VAL A CG2 1 
ATOM   781   N N   . ASN A 1 139 ? 29.858  -12.126 25.288  1.00 14.78 ? 139  ASN A N   1 
ATOM   782   C CA  . ASN A 1 139 ? 30.013  -12.881 24.040  1.00 13.76 ? 139  ASN A CA  1 
ATOM   783   C C   . ASN A 1 139 ? 29.339  -14.225 24.368  1.00 14.04 ? 139  ASN A C   1 
ATOM   784   O O   . ASN A 1 139 ? 29.998  -15.235 24.631  1.00 15.81 ? 139  ASN A O   1 
ATOM   785   C CB  . ASN A 1 139 ? 31.500  -13.069 23.681  1.00 13.81 ? 139  ASN A CB  1 
ATOM   786   C CG  . ASN A 1 139 ? 31.704  -13.877 22.387  1.00 13.43 ? 139  ASN A CG  1 
ATOM   787   O OD1 . ASN A 1 139 ? 30.747  -14.369 21.798  1.00 13.51 ? 139  ASN A OD1 1 
ATOM   788   N ND2 . ASN A 1 139 ? 32.950  -14.022 21.960  1.00 14.65 ? 139  ASN A ND2 1 
ATOM   789   N N   . THR A 1 140 ? 28.011  -14.187 24.324  1.00 15.40 ? 140  THR A N   1 
ATOM   790   C CA  . THR A 1 140 ? 27.126  -15.296 24.674  1.00 15.59 ? 140  THR A CA  1 
ATOM   791   C C   . THR A 1 140 ? 27.227  -16.578 23.842  1.00 16.03 ? 140  THR A C   1 
ATOM   792   O O   . THR A 1 140 ? 27.051  -17.678 24.365  1.00 17.51 ? 140  THR A O   1 
ATOM   793   C CB  . THR A 1 140 ? 25.650  -14.827 24.645  1.00 17.22 ? 140  THR A CB  1 
ATOM   794   O OG1 . THR A 1 140 ? 25.381  -14.228 23.375  1.00 18.35 ? 140  THR A OG1 1 
ATOM   795   C CG2 . THR A 1 140 ? 25.341  -13.803 25.733  1.00 17.93 ? 140  THR A CG2 1 
ATOM   796   N N   . THR A 1 141 ? 27.516  -16.449 22.551  1.00 16.02 ? 141  THR A N   1 
ATOM   797   C CA  . THR A 1 141 ? 27.596  -17.633 21.686  1.00 15.80 ? 141  THR A CA  1 
ATOM   798   C C   . THR A 1 141 ? 28.854  -18.480 21.946  1.00 17.27 ? 141  THR A C   1 
ATOM   799   O O   . THR A 1 141 ? 28.919  -19.660 21.583  1.00 18.39 ? 141  THR A O   1 
ATOM   800   C CB  . THR A 1 141 ? 27.561  -17.249 20.191  1.00 16.30 ? 141  THR A CB  1 
ATOM   801   O OG1 . THR A 1 141 ? 28.764  -16.554 19.860  1.00 16.00 ? 141  THR A OG1 1 
ATOM   802   C CG2 . THR A 1 141 ? 26.381  -16.342 19.868  1.00 16.21 ? 141  THR A CG2 1 
ATOM   803   N N   . GLU A 1 142 ? 29.850  -17.855 22.571  1.00 17.21 ? 142  GLU A N   1 
ATOM   804   C CA  . GLU A 1 142 ? 31.124  -18.502 22.893  1.00 18.22 ? 142  GLU A CA  1 
ATOM   805   C C   . GLU A 1 142 ? 31.372  -18.518 24.401  1.00 18.18 ? 142  GLU A C   1 
ATOM   806   O O   . GLU A 1 142 ? 32.396  -19.034 24.873  1.00 19.28 ? 142  GLU A O   1 
ATOM   807   C CB  . GLU A 1 142 ? 32.269  -17.786 22.166  1.00 18.71 ? 142  GLU A CB  1 
ATOM   808   C CG  . GLU A 1 142 ? 32.229  -17.935 20.635  1.00 19.36 ? 142  GLU A CG  1 
ATOM   809   C CD  . GLU A 1 142 ? 33.352  -17.183 19.903  1.00 21.42 ? 142  GLU A CD  1 
ATOM   810   O OE1 . GLU A 1 142 ? 33.642  -16.016 20.260  1.00 20.52 ? 142  GLU A OE1 1 
ATOM   811   O OE2 . GLU A 1 142 ? 33.944  -17.758 18.952  1.00 22.08 ? 142  GLU A OE2 1 
ATOM   812   N N   . ASN A 1 143 ? 30.422  -17.942 25.146  1.00 19.06 ? 143  ASN A N   1 
ATOM   813   C CA  . ASN A 1 143 ? 30.451  -17.840 26.617  1.00 19.12 ? 143  ASN A CA  1 
ATOM   814   C C   . ASN A 1 143 ? 31.799  -17.319 27.125  1.00 19.27 ? 143  ASN A C   1 
ATOM   815   O O   . ASN A 1 143 ? 32.452  -17.948 27.969  1.00 18.60 ? 143  ASN A O   1 
ATOM   816   C CB  . ASN A 1 143 ? 30.139  -19.198 27.276  1.00 20.17 ? 143  ASN A CB  1 
ATOM   817   C CG  . ASN A 1 143 ? 29.665  -19.047 28.725  1.00 20.38 ? 143  ASN A CG  1 
ATOM   818   O OD1 . ASN A 1 143 ? 29.188  -17.983 29.111  1.00 21.32 ? 143  ASN A OD1 1 
ATOM   819   N ND2 . ASN A 1 143 ? 29.797  -20.099 29.521  1.00 22.16 ? 143  ASN A ND2 1 
ATOM   820   N N   . ARG A 1 144 ? 32.218  -16.183 26.575  1.00 18.89 ? 144  ARG A N   1 
ATOM   821   C CA  . ARG A 1 144 ? 33.513  -15.594 26.899  1.00 18.23 ? 144  ARG A CA  1 
ATOM   822   C C   . ARG A 1 144 ? 33.453  -14.097 27.190  1.00 15.86 ? 144  ARG A C   1 
ATOM   823   O O   . ARG A 1 144 ? 32.541  -13.411 26.712  1.00 13.22 ? 144  ARG A O   1 
ATOM   824   C CB  . ARG A 1 144 ? 34.479  -15.845 25.729  1.00 22.56 ? 144  ARG A CB  1 
ATOM   825   C CG  . ARG A 1 144 ? 35.353  -17.084 25.897  1.00 27.14 ? 144  ARG A CG  1 
ATOM   826   C CD  . ARG A 1 144 ? 35.543  -17.840 24.594  1.00 30.45 ? 144  ARG A CD  1 
ATOM   827   N NE  . ARG A 1 144 ? 36.231  -17.066 23.565  1.00 30.45 ? 144  ARG A NE  1 
ATOM   828   C CZ  . ARG A 1 144 ? 36.642  -17.558 22.397  1.00 31.46 ? 144  ARG A CZ  1 
ATOM   829   N NH1 . ARG A 1 144 ? 36.436  -18.834 22.089  1.00 32.49 ? 144  ARG A NH1 1 
ATOM   830   N NH2 . ARG A 1 144 ? 37.267  -16.770 21.533  1.00 30.90 ? 144  ARG A NH2 1 
ATOM   831   N N   . PRO A 1 145 ? 34.371  -13.580 28.049  1.00 13.61 ? 145  PRO A N   1 
ATOM   832   C CA  . PRO A 1 145 ? 34.370  -12.139 28.346  1.00 13.09 ? 145  PRO A CA  1 
ATOM   833   C C   . PRO A 1 145 ? 34.905  -11.387 27.121  1.00 11.77 ? 145  PRO A C   1 
ATOM   834   O O   . PRO A 1 145 ? 35.405  -12.004 26.173  1.00 11.74 ? 145  PRO A O   1 
ATOM   835   C CB  . PRO A 1 145 ? 35.360  -12.021 29.508  1.00 13.72 ? 145  PRO A CB  1 
ATOM   836   C CG  . PRO A 1 145 ? 35.340  -13.375 30.144  1.00 14.04 ? 145  PRO A CG  1 
ATOM   837   C CD  . PRO A 1 145 ? 35.312  -14.278 28.954  1.00 15.06 ? 145  PRO A CD  1 
ATOM   838   N N   . VAL A 1 146 ? 34.750  -10.069 27.125  1.00 10.75 ? 146  VAL A N   1 
ATOM   839   C CA  . VAL A 1 146 ? 35.215  -9.209  26.035  1.00 11.55 ? 146  VAL A CA  1 
ATOM   840   C C   . VAL A 1 146 ? 35.993  -8.135  26.758  1.00 11.66 ? 146  VAL A C   1 
ATOM   841   O O   . VAL A 1 146 ? 35.433  -7.134  27.222  1.00 12.40 ? 146  VAL A O   1 
ATOM   842   C CB  . VAL A 1 146 ? 34.027  -8.618  25.250  1.00 10.65 ? 146  VAL A CB  1 
ATOM   843   C CG1 . VAL A 1 146 ? 34.506  -7.655  24.196  1.00 13.55 ? 146  VAL A CG1 1 
ATOM   844   C CG2 . VAL A 1 146 ? 33.250  -9.733  24.592  1.00 12.20 ? 146  VAL A CG2 1 
ATOM   845   N N   . LEU A 1 147 ? 37.297  -8.366  26.875  1.00 12.05 ? 147  LEU A N   1 
ATOM   846   C CA  . LEU A 1 147 ? 38.142  -7.462  27.627  1.00 11.00 ? 147  LEU A CA  1 
ATOM   847   C C   . LEU A 1 147 ? 39.343  -6.821  26.964  1.00 10.31 ? 147  LEU A C   1 
ATOM   848   O O   . LEU A 1 147 ? 40.438  -6.802  27.535  1.00 11.29 ? 147  LEU A O   1 
ATOM   849   C CB  . LEU A 1 147 ? 38.550  -8.131  28.948  1.00 12.11 ? 147  LEU A CB  1 
ATOM   850   C CG  . LEU A 1 147 ? 37.483  -8.334  30.015  1.00 11.75 ? 147  LEU A CG  1 
ATOM   851   C CD1 . LEU A 1 147 ? 38.028  -9.230  31.083  1.00 13.58 ? 147  LEU A CD1 1 
ATOM   852   C CD2 . LEU A 1 147 ? 37.045  -6.988  30.572  1.00 13.61 ? 147  LEU A CD2 1 
ATOM   853   N N   . HIS A 1 148 ? 39.139  -6.247  25.780  1.00 9.97  ? 148  HIS A N   1 
ATOM   854   C CA  . HIS A 1 148 ? 40.235  -5.544  25.115  1.00 10.95 ? 148  HIS A CA  1 
ATOM   855   C C   . HIS A 1 148 ? 40.577  -4.269  25.897  1.00 11.62 ? 148  HIS A C   1 
ATOM   856   O O   . HIS A 1 148 ? 41.709  -3.794  25.837  1.00 11.98 ? 148  HIS A O   1 
ATOM   857   C CB  . HIS A 1 148 ? 39.940  -5.233  23.646  1.00 11.67 ? 148  HIS A CB  1 
ATOM   858   C CG  . HIS A 1 148 ? 38.550  -4.745  23.391  1.00 11.36 ? 148  HIS A CG  1 
ATOM   859   N ND1 . HIS A 1 148 ? 37.491  -5.603  23.190  1.00 11.39 ? 148  HIS A ND1 1 
ATOM   860   C CD2 . HIS A 1 148 ? 38.047  -3.492  23.287  1.00 11.27 ? 148  HIS A CD2 1 
ATOM   861   C CE1 . HIS A 1 148 ? 36.395  -4.898  22.975  1.00 11.27 ? 148  HIS A CE1 1 
ATOM   862   N NE2 . HIS A 1 148 ? 36.705  -3.615  23.028  1.00 11.12 ? 148  HIS A NE2 1 
ATOM   863   N N   . ILE A 1 149 ? 39.622  -3.791  26.702  1.00 11.88 ? 149  ILE A N   1 
ATOM   864   C CA  . ILE A 1 149 ? 39.827  -2.602  27.533  1.00 11.60 ? 149  ILE A CA  1 
ATOM   865   C C   . ILE A 1 149 ? 40.838  -2.869  28.663  1.00 12.24 ? 149  ILE A C   1 
ATOM   866   O O   . ILE A 1 149 ? 41.456  -1.939  29.184  1.00 12.87 ? 149  ILE A O   1 
ATOM   867   C CB  . ILE A 1 149 ? 38.483  -2.003  28.089  1.00 12.08 ? 149  ILE A CB  1 
ATOM   868   C CG1 . ILE A 1 149 ? 37.714  -3.002  28.967  1.00 12.51 ? 149  ILE A CG1 1 
ATOM   869   C CG2 . ILE A 1 149 ? 37.613  -1.537  26.938  1.00 11.12 ? 149  ILE A CG2 1 
ATOM   870   C CD1 . ILE A 1 149 ? 37.930  -2.805  30.468  1.00 13.81 ? 149  ILE A CD1 1 
ATOM   871   N N   . ALA A 1 150 ? 40.986  -4.147  29.027  1.00 11.48 ? 150  ALA A N   1 
ATOM   872   C CA  . ALA A 1 150 ? 41.923  -4.562  30.070  1.00 11.41 ? 150  ALA A CA  1 
ATOM   873   C C   . ALA A 1 150 ? 43.371  -4.443  29.608  1.00 11.83 ? 150  ALA A C   1 
ATOM   874   O O   . ALA A 1 150 ? 44.258  -4.145  30.407  1.00 13.09 ? 150  ALA A O   1 
ATOM   875   C CB  . ALA A 1 150 ? 41.631  -5.989  30.523  1.00 10.62 ? 150  ALA A CB  1 
ATOM   876   N N   . LEU A 1 151 ? 43.584  -4.593  28.299  1.00 12.15 ? 151  LEU A N   1 
ATOM   877   C CA  . LEU A 1 151 ? 44.914  -4.517  27.698  1.00 10.55 ? 151  LEU A CA  1 
ATOM   878   C C   . LEU A 1 151 ? 45.551  -3.142  27.822  1.00 11.06 ? 151  LEU A C   1 
ATOM   879   O O   . LEU A 1 151 ? 46.782  -3.022  27.896  1.00 10.74 ? 151  LEU A O   1 
ATOM   880   C CB  . LEU A 1 151 ? 44.852  -4.921  26.224  1.00 11.23 ? 151  LEU A CB  1 
ATOM   881   C CG  . LEU A 1 151 ? 44.296  -6.305  25.898  1.00 10.95 ? 151  LEU A CG  1 
ATOM   882   C CD1 . LEU A 1 151 ? 44.018  -6.393  24.409  1.00 10.53 ? 151  LEU A CD1 1 
ATOM   883   C CD2 . LEU A 1 151 ? 45.262  -7.390  26.356  1.00 10.33 ? 151  LEU A CD2 1 
ATOM   884   N N   . ARG A 1 152 ? 44.697  -2.127  27.911  1.00 10.83 ? 152  ARG A N   1 
ATOM   885   C CA  . ARG A 1 152 ? 45.127  -0.743  28.021  1.00 11.80 ? 152  ARG A CA  1 
ATOM   886   C C   . ARG A 1 152 ? 44.687  -0.073  29.325  1.00 12.01 ? 152  ARG A C   1 
ATOM   887   O O   . ARG A 1 152 ? 44.674  1.152   29.423  1.00 11.31 ? 152  ARG A O   1 
ATOM   888   C CB  . ARG A 1 152 ? 44.623  0.049   26.808  1.00 10.59 ? 152  ARG A CB  1 
ATOM   889   C CG  . ARG A 1 152 ? 43.118  0.202   26.704  1.00 10.62 ? 152  ARG A CG  1 
ATOM   890   C CD  . ARG A 1 152 ? 42.574  -0.525  25.504  1.00 10.27 ? 152  ARG A CD  1 
ATOM   891   N NE  . ARG A 1 152 ? 41.212  -0.084  25.214  1.00 10.60 ? 152  ARG A NE  1 
ATOM   892   C CZ  . ARG A 1 152 ? 40.523  -0.418  24.126  1.00 12.21 ? 152  ARG A CZ  1 
ATOM   893   N NH1 . ARG A 1 152 ? 41.053  -1.214  23.206  1.00 10.10 ? 152  ARG A NH1 1 
ATOM   894   N NH2 . ARG A 1 152 ? 39.307  0.082   23.938  1.00 11.23 ? 152  ARG A NH2 1 
ATOM   895   N N   . ASN A 1 153 ? 44.336  -0.883  30.322  1.00 12.95 ? 153  ASN A N   1 
ATOM   896   C CA  . ASN A 1 153 ? 43.891  -0.379  31.624  1.00 12.61 ? 153  ASN A CA  1 
ATOM   897   C C   . ASN A 1 153 ? 45.092  0.136   32.442  1.00 14.06 ? 153  ASN A C   1 
ATOM   898   O O   . ASN A 1 153 ? 45.629  -0.561  33.305  1.00 13.81 ? 153  ASN A O   1 
ATOM   899   C CB  . ASN A 1 153 ? 43.100  -1.488  32.345  1.00 11.99 ? 153  ASN A CB  1 
ATOM   900   C CG  . ASN A 1 153 ? 42.621  -1.096  33.741  1.00 15.02 ? 153  ASN A CG  1 
ATOM   901   O OD1 . ASN A 1 153 ? 42.357  0.074   34.035  1.00 14.65 ? 153  ASN A OD1 1 
ATOM   902   N ND2 . ASN A 1 153 ? 42.507  -2.095  34.609  1.00 14.53 ? 153  ASN A ND2 1 
ATOM   903   N N   . ARG A 1 154 ? 45.477  1.386   32.161  1.00 14.53 ? 154  ARG A N   1 
ATOM   904   C CA  . ARG A 1 154 ? 46.615  2.044   32.815  1.00 15.29 ? 154  ARG A CA  1 
ATOM   905   C C   . ARG A 1 154 ? 46.432  2.316   34.305  1.00 16.52 ? 154  ARG A C   1 
ATOM   906   O O   . ARG A 1 154 ? 47.419  2.428   35.037  1.00 18.39 ? 154  ARG A O   1 
ATOM   907   C CB  . ARG A 1 154 ? 46.977  3.356   32.102  1.00 15.26 ? 154  ARG A CB  1 
ATOM   908   C CG  . ARG A 1 154 ? 47.217  3.248   30.587  1.00 15.15 ? 154  ARG A CG  1 
ATOM   909   C CD  . ARG A 1 154 ? 48.233  2.176   30.198  1.00 14.83 ? 154  ARG A CD  1 
ATOM   910   N NE  . ARG A 1 154 ? 49.550  2.390   30.799  1.00 15.51 ? 154  ARG A NE  1 
ATOM   911   C CZ  . ARG A 1 154 ? 50.532  1.493   30.800  1.00 16.66 ? 154  ARG A CZ  1 
ATOM   912   N NH1 . ARG A 1 154 ? 50.363  0.304   30.236  1.00 16.04 ? 154  ARG A NH1 1 
ATOM   913   N NH2 . ARG A 1 154 ? 51.702  1.794   31.355  1.00 16.75 ? 154  ARG A NH2 1 
ATOM   914   N N   . SER A 1 155 ? 45.175  2.384   34.749  1.00 17.07 ? 155  SER A N   1 
ATOM   915   C CA  . SER A 1 155 ? 44.846  2.627   36.160  1.00 17.42 ? 155  SER A CA  1 
ATOM   916   C C   . SER A 1 155 ? 45.124  1.392   37.020  1.00 18.07 ? 155  SER A C   1 
ATOM   917   O O   . SER A 1 155 ? 45.259  1.493   38.245  1.00 18.06 ? 155  SER A O   1 
ATOM   918   C CB  . SER A 1 155 ? 43.371  3.028   36.308  1.00 18.41 ? 155  SER A CB  1 
ATOM   919   O OG  . SER A 1 155 ? 42.500  1.928   36.082  1.00 20.34 ? 155  SER A OG  1 
ATOM   920   N N   . ASN A 1 156 ? 45.210  0.237   36.349  1.00 17.22 ? 156  ASN A N   1 
ATOM   921   C CA  . ASN A 1 156 ? 45.440  -1.080  36.958  1.00 18.18 ? 156  ASN A CA  1 
ATOM   922   C C   . ASN A 1 156 ? 44.341  -1.497  37.928  1.00 19.14 ? 156  ASN A C   1 
ATOM   923   O O   . ASN A 1 156 ? 44.564  -2.273  38.861  1.00 19.69 ? 156  ASN A O   1 
ATOM   924   C CB  . ASN A 1 156 ? 46.848  -1.207  37.567  1.00 18.00 ? 156  ASN A CB  1 
ATOM   925   C CG  . ASN A 1 156 ? 47.922  -1.350  36.507  1.00 18.67 ? 156  ASN A CG  1 
ATOM   926   O OD1 . ASN A 1 156 ? 47.773  -2.127  35.559  1.00 17.91 ? 156  ASN A OD1 1 
ATOM   927   N ND2 . ASN A 1 156 ? 49.003  -0.596  36.653  1.00 19.93 ? 156  ASN A ND2 1 
ATOM   928   N N   . ARG A 1 157 ? 43.140  -0.971  37.659  1.00 19.96 ? 157  ARG A N   1 
ATOM   929   C CA  . ARG A 1 157 ? 41.919  -1.258  38.411  1.00 21.03 ? 157  ARG A CA  1 
ATOM   930   C C   . ARG A 1 157 ? 41.673  -2.751  38.171  1.00 20.51 ? 157  ARG A C   1 
ATOM   931   O O   . ARG A 1 157 ? 41.694  -3.198  37.016  1.00 20.01 ? 157  ARG A O   1 
ATOM   932   C CB  . ARG A 1 157 ? 40.766  -0.425  37.831  1.00 23.42 ? 157  ARG A CB  1 
ATOM   933   C CG  . ARG A 1 157 ? 39.354  -0.741  38.343  1.00 25.99 ? 157  ARG A CG  1 
ATOM   934   C CD  . ARG A 1 157 ? 38.288  0.005   37.532  1.00 28.31 ? 157  ARG A CD  1 
ATOM   935   N NE  . ARG A 1 157 ? 38.176  -0.481  36.150  1.00 29.66 ? 157  ARG A NE  1 
ATOM   936   C CZ  . ARG A 1 157 ? 38.455  0.240   35.059  1.00 30.81 ? 157  ARG A CZ  1 
ATOM   937   N NH1 . ARG A 1 157 ? 38.872  1.499   35.159  1.00 30.84 ? 157  ARG A NH1 1 
ATOM   938   N NH2 . ARG A 1 157 ? 38.326  -0.310  33.859  1.00 31.32 ? 157  ARG A NH2 1 
ATOM   939   N N   . PRO A 1 158 ? 41.522  -3.550  39.249  1.00 20.07 ? 158  PRO A N   1 
ATOM   940   C CA  . PRO A 1 158 ? 41.291  -4.986  39.083  1.00 19.07 ? 158  PRO A CA  1 
ATOM   941   C C   . PRO A 1 158 ? 40.070  -5.384  38.248  1.00 17.97 ? 158  PRO A C   1 
ATOM   942   O O   . PRO A 1 158 ? 38.983  -4.821  38.400  1.00 18.93 ? 158  PRO A O   1 
ATOM   943   C CB  . PRO A 1 158 ? 41.175  -5.472  40.526  1.00 19.60 ? 158  PRO A CB  1 
ATOM   944   C CG  . PRO A 1 158 ? 42.074  -4.549  41.266  1.00 20.36 ? 158  PRO A CG  1 
ATOM   945   C CD  . PRO A 1 158 ? 41.671  -3.225  40.684  1.00 20.38 ? 158  PRO A CD  1 
ATOM   946   N N   . ILE A 1 159 ? 40.319  -6.253  37.267  1.00 16.52 ? 159  ILE A N   1 
ATOM   947   C CA  . ILE A 1 159 ? 39.289  -6.780  36.371  1.00 15.71 ? 159  ILE A CA  1 
ATOM   948   C C   . ILE A 1 159 ? 39.425  -8.298  36.497  1.00 14.91 ? 159  ILE A C   1 
ATOM   949   O O   . ILE A 1 159 ? 40.481  -8.864  36.213  1.00 14.83 ? 159  ILE A O   1 
ATOM   950   C CB  . ILE A 1 159 ? 39.483  -6.312  34.893  1.00 15.31 ? 159  ILE A CB  1 
ATOM   951   C CG1 . ILE A 1 159 ? 39.418  -4.776  34.808  1.00 15.99 ? 159  ILE A CG1 1 
ATOM   952   C CG2 . ILE A 1 159 ? 38.384  -6.903  34.013  1.00 16.63 ? 159  ILE A CG2 1 
ATOM   953   C CD1 . ILE A 1 159 ? 39.827  -4.179  33.476  1.00 16.36 ? 159  ILE A CD1 1 
ATOM   954   N N   . TYR A 1 160 ? 38.336  -8.945  36.896  1.00 14.81 ? 160  TYR A N   1 
ATOM   955   C CA  . TYR A 1 160 ? 38.347  -10.382 37.140  1.00 14.88 ? 160  TYR A CA  1 
ATOM   956   C C   . TYR A 1 160 ? 37.746  -11.322 36.106  1.00 14.05 ? 160  TYR A C   1 
ATOM   957   O O   . TYR A 1 160 ? 36.673  -11.063 35.563  1.00 14.84 ? 160  TYR A O   1 
ATOM   958   C CB  . TYR A 1 160 ? 37.704  -10.671 38.503  1.00 15.13 ? 160  TYR A CB  1 
ATOM   959   C CG  . TYR A 1 160 ? 38.305  -9.893  39.659  1.00 15.75 ? 160  TYR A CG  1 
ATOM   960   C CD1 . TYR A 1 160 ? 37.820  -8.608  39.996  1.00 15.66 ? 160  TYR A CD1 1 
ATOM   961   C CD2 . TYR A 1 160 ? 39.365  -10.428 40.419  1.00 17.26 ? 160  TYR A CD2 1 
ATOM   962   C CE1 . TYR A 1 160 ? 38.382  -7.870  41.071  1.00 16.95 ? 160  TYR A CE1 1 
ATOM   963   C CE2 . TYR A 1 160 ? 39.943  -9.698  41.494  1.00 16.44 ? 160  TYR A CE2 1 
ATOM   964   C CZ  . TYR A 1 160 ? 39.444  -8.426  41.811  1.00 17.43 ? 160  TYR A CZ  1 
ATOM   965   O OH  . TYR A 1 160 ? 39.988  -7.715  42.854  1.00 19.98 ? 160  TYR A OH  1 
ATOM   966   N N   . VAL A 1 161 ? 38.480  -12.406 35.842  1.00 13.80 ? 161  VAL A N   1 
ATOM   967   C CA  . VAL A 1 161 ? 38.073  -13.495 34.941  1.00 15.83 ? 161  VAL A CA  1 
ATOM   968   C C   . VAL A 1 161 ? 38.379  -14.749 35.758  1.00 17.07 ? 161  VAL A C   1 
ATOM   969   O O   . VAL A 1 161 ? 39.523  -14.958 36.172  1.00 17.56 ? 161  VAL A O   1 
ATOM   970   C CB  . VAL A 1 161 ? 38.871  -13.531 33.594  1.00 16.31 ? 161  VAL A CB  1 
ATOM   971   C CG1 . VAL A 1 161 ? 38.512  -14.778 32.769  1.00 16.74 ? 161  VAL A CG1 1 
ATOM   972   C CG2 . VAL A 1 161 ? 38.553  -12.315 32.768  1.00 16.45 ? 161  VAL A CG2 1 
ATOM   973   N N   . ASP A 1 162 ? 37.343  -15.559 36.000  1.00 19.62 ? 162  ASP A N   1 
ATOM   974   C CA  . ASP A 1 162 ? 37.415  -16.806 36.793  1.00 21.47 ? 162  ASP A CA  1 
ATOM   975   C C   . ASP A 1 162 ? 37.937  -16.542 38.221  1.00 21.27 ? 162  ASP A C   1 
ATOM   976   O O   . ASP A 1 162 ? 38.680  -17.351 38.794  1.00 22.30 ? 162  ASP A O   1 
ATOM   977   C CB  . ASP A 1 162 ? 38.266  -17.895 36.091  1.00 24.17 ? 162  ASP A CB  1 
ATOM   978   C CG  . ASP A 1 162 ? 37.775  -18.232 34.685  1.00 26.42 ? 162  ASP A CG  1 
ATOM   979   O OD1 . ASP A 1 162 ? 36.549  -18.300 34.462  1.00 30.51 ? 162  ASP A OD1 1 
ATOM   980   O OD2 . ASP A 1 162 ? 38.635  -18.443 33.801  1.00 30.29 ? 162  ASP A OD2 1 
ATOM   981   N N   . GLY A 1 163 ? 37.595  -15.362 38.744  1.00 21.11 ? 163  GLY A N   1 
ATOM   982   C CA  . GLY A 1 163 ? 38.000  -14.948 40.082  1.00 20.88 ? 163  GLY A CA  1 
ATOM   983   C C   . GLY A 1 163 ? 39.417  -14.428 40.246  1.00 20.46 ? 163  GLY A C   1 
ATOM   984   O O   . GLY A 1 163 ? 39.833  -14.120 41.365  1.00 20.95 ? 163  GLY A O   1 
ATOM   985   N N   . LYS A 1 164 ? 40.150  -14.322 39.136  1.00 19.46 ? 164  LYS A N   1 
ATOM   986   C CA  . LYS A 1 164 ? 41.538  -13.852 39.144  1.00 19.32 ? 164  LYS A CA  1 
ATOM   987   C C   . LYS A 1 164 ? 41.689  -12.544 38.379  1.00 17.87 ? 164  LYS A C   1 
ATOM   988   O O   . LYS A 1 164 ? 41.180  -12.414 37.259  1.00 16.65 ? 164  LYS A O   1 
ATOM   989   C CB  . LYS A 1 164 ? 42.465  -14.900 38.501  1.00 21.72 ? 164  LYS A CB  1 
ATOM   990   C CG  . LYS A 1 164 ? 42.505  -16.273 39.182  1.00 25.73 ? 164  LYS A CG  1 
ATOM   991   C CD  . LYS A 1 164 ? 42.274  -17.417 38.185  1.00 30.46 ? 164  LYS A CD  1 
ATOM   992   C CE  . LYS A 1 164 ? 43.445  -17.616 37.221  1.00 32.06 ? 164  LYS A CE  1 
ATOM   993   N NZ  . LYS A 1 164 ? 43.123  -18.647 36.191  1.00 36.47 ? 164  LYS A NZ  1 
ATOM   994   N N   . ASP A 1 165 ? 42.399  -11.584 38.982  1.00 17.07 ? 165  ASP A N   1 
ATOM   995   C CA  . ASP A 1 165 ? 42.670  -10.279 38.361  1.00 16.79 ? 165  ASP A CA  1 
ATOM   996   C C   . ASP A 1 165 ? 43.585  -10.534 37.162  1.00 15.50 ? 165  ASP A C   1 
ATOM   997   O O   . ASP A 1 165 ? 44.631  -11.176 37.300  1.00 16.21 ? 165  ASP A O   1 
ATOM   998   C CB  . ASP A 1 165 ? 43.347  -9.334  39.376  1.00 16.33 ? 165  ASP A CB  1 
ATOM   999   C CG  . ASP A 1 165 ? 43.642  -7.934  38.814  1.00 17.64 ? 165  ASP A CG  1 
ATOM   1000  O OD1 . ASP A 1 165 ? 43.150  -7.563  37.722  1.00 15.34 ? 165  ASP A OD1 1 
ATOM   1001  O OD2 . ASP A 1 165 ? 44.369  -7.182  39.489  1.00 17.17 ? 165  ASP A OD2 1 
ATOM   1002  N N   . VAL A 1 166 ? 43.166  -10.047 35.995  1.00 14.53 ? 166  VAL A N   1 
ATOM   1003  C CA  . VAL A 1 166 ? 43.929  -10.234 34.761  1.00 13.94 ? 166  VAL A CA  1 
ATOM   1004  C C   . VAL A 1 166 ? 45.046  -9.232  34.542  1.00 13.63 ? 166  VAL A C   1 
ATOM   1005  O O   . VAL A 1 166 ? 45.917  -9.460  33.698  1.00 13.96 ? 166  VAL A O   1 
ATOM   1006  C CB  . VAL A 1 166 ? 43.030  -10.235 33.501  1.00 14.09 ? 166  VAL A CB  1 
ATOM   1007  C CG1 . VAL A 1 166 ? 42.039  -11.353 33.581  1.00 16.00 ? 166  VAL A CG1 1 
ATOM   1008  C CG2 . VAL A 1 166 ? 42.331  -8.882  33.286  1.00 13.02 ? 166  VAL A CG2 1 
ATOM   1009  N N   . MET A 1 167 ? 45.034  -8.148  35.321  1.00 14.37 ? 167  MET A N   1 
ATOM   1010  C CA  . MET A 1 167 ? 46.040  -7.098  35.188  1.00 14.38 ? 167  MET A CA  1 
ATOM   1011  C C   . MET A 1 167 ? 47.509  -7.502  35.352  1.00 14.76 ? 167  MET A C   1 
ATOM   1012  O O   . MET A 1 167 ? 48.339  -7.038  34.564  1.00 15.15 ? 167  MET A O   1 
ATOM   1013  C CB  . MET A 1 167 ? 45.670  -5.829  35.978  1.00 15.37 ? 167  MET A CB  1 
ATOM   1014  C CG  . MET A 1 167 ? 44.394  -5.130  35.478  1.00 14.92 ? 167  MET A CG  1 
ATOM   1015  S SD  . MET A 1 167 ? 44.262  -4.939  33.660  1.00 14.31 ? 167  MET A SD  1 
ATOM   1016  C CE  . MET A 1 167 ? 45.710  -3.907  33.311  1.00 14.53 ? 167  MET A CE  1 
ATOM   1017  N N   . PRO A 1 168 ? 47.853  -8.392  36.329  1.00 15.18 ? 168  PRO A N   1 
ATOM   1018  C CA  . PRO A 1 168 ? 49.271  -8.769  36.442  1.00 14.55 ? 168  PRO A CA  1 
ATOM   1019  C C   . PRO A 1 168 ? 49.774  -9.505  35.189  1.00 15.01 ? 168  PRO A C   1 
ATOM   1020  O O   . PRO A 1 168 ? 50.896  -9.275  34.751  1.00 15.77 ? 168  PRO A O   1 
ATOM   1021  C CB  . PRO A 1 168 ? 49.278  -9.685  37.663  1.00 14.55 ? 168  PRO A CB  1 
ATOM   1022  C CG  . PRO A 1 168 ? 48.252  -9.074  38.527  1.00 14.05 ? 168  PRO A CG  1 
ATOM   1023  C CD  . PRO A 1 168 ? 47.134  -8.854  37.538  1.00 16.05 ? 168  PRO A CD  1 
ATOM   1024  N N   . ALA A 1 169 ? 48.891  -10.301 34.572  1.00 14.94 ? 169  ALA A N   1 
ATOM   1025  C CA  . ALA A 1 169 ? 49.206  -11.063 33.359  1.00 13.83 ? 169  ALA A CA  1 
ATOM   1026  C C   . ALA A 1 169 ? 49.362  -10.138 32.147  1.00 13.82 ? 169  ALA A C   1 
ATOM   1027  O O   . ALA A 1 169 ? 50.262  -10.334 31.323  1.00 13.73 ? 169  ALA A O   1 
ATOM   1028  C CB  . ALA A 1 169 ? 48.135  -12.113 33.097  1.00 16.26 ? 169  ALA A CB  1 
ATOM   1029  N N   . VAL A 1 170 ? 48.503  -9.115  32.073  1.00 12.84 ? 170  VAL A N   1 
ATOM   1030  C CA  . VAL A 1 170 ? 48.531  -8.111  30.997  1.00 13.39 ? 170  VAL A CA  1 
ATOM   1031  C C   . VAL A 1 170 ? 49.843  -7.326  31.072  1.00 13.10 ? 170  VAL A C   1 
ATOM   1032  O O   . VAL A 1 170 ? 50.545  -7.172  30.068  1.00 12.72 ? 170  VAL A O   1 
ATOM   1033  C CB  . VAL A 1 170 ? 47.307  -7.141  31.100  1.00 12.24 ? 170  VAL A CB  1 
ATOM   1034  C CG1 . VAL A 1 170 ? 47.489  -5.897  30.219  1.00 13.22 ? 170  VAL A CG1 1 
ATOM   1035  C CG2 . VAL A 1 170 ? 46.031  -7.866  30.702  1.00 13.00 ? 170  VAL A CG2 1 
ATOM   1036  N N   . ASN A 1 171 ? 50.179  -6.886  32.284  1.00 13.62 ? 171  ASN A N   1 
ATOM   1037  C CA  . ASN A 1 171 ? 51.392  -6.116  32.534  1.00 15.02 ? 171  ASN A CA  1 
ATOM   1038  C C   . ASN A 1 171 ? 52.680  -6.926  32.388  1.00 14.59 ? 171  ASN A C   1 
ATOM   1039  O O   . ASN A 1 171 ? 53.717  -6.365  32.019  1.00 14.33 ? 171  ASN A O   1 
ATOM   1040  C CB  . ASN A 1 171 ? 51.323  -5.430  33.902  1.00 15.54 ? 171  ASN A CB  1 
ATOM   1041  C CG  . ASN A 1 171 ? 50.245  -4.361  33.963  1.00 17.50 ? 171  ASN A CG  1 
ATOM   1042  O OD1 . ASN A 1 171 ? 50.000  -3.648  32.985  1.00 18.97 ? 171  ASN A OD1 1 
ATOM   1043  N ND2 . ASN A 1 171 ? 49.594  -4.243  35.115  1.00 16.94 ? 171  ASN A ND2 1 
ATOM   1044  N N   . LYS A 1 172 ? 52.598  -8.241  32.629  1.00 14.89 ? 172  LYS A N   1 
ATOM   1045  C CA  . LYS A 1 172 ? 53.750  -9.147  32.494  1.00 15.05 ? 172  LYS A CA  1 
ATOM   1046  C C   . LYS A 1 172 ? 54.154  -9.253  31.020  1.00 14.50 ? 172  LYS A C   1 
ATOM   1047  O O   . LYS A 1 172 ? 55.343  -9.195  30.698  1.00 15.13 ? 172  LYS A O   1 
ATOM   1048  C CB  . LYS A 1 172 ? 53.431  -10.543 33.051  1.00 16.57 ? 172  LYS A CB  1 
ATOM   1049  C CG  . LYS A 1 172 ? 54.608  -11.530 33.039  1.00 18.89 ? 172  LYS A CG  1 
ATOM   1050  C CD  . LYS A 1 172 ? 54.179  -12.932 33.449  1.00 22.26 ? 172  LYS A CD  1 
ATOM   1051  C CE  . LYS A 1 172 ? 55.336  -13.921 33.338  1.00 24.16 ? 172  LYS A CE  1 
ATOM   1052  N NZ  . LYS A 1 172 ? 54.917  -15.327 33.622  1.00 28.19 ? 172  LYS A NZ  1 
ATOM   1053  N N   . VAL A 1 173 ? 53.156  -9.367  30.137  1.00 13.88 ? 173  VAL A N   1 
ATOM   1054  C CA  . VAL A 1 173 ? 53.400  -9.454  28.694  1.00 12.79 ? 173  VAL A CA  1 
ATOM   1055  C C   . VAL A 1 173 ? 53.899  -8.109  28.164  1.00 11.79 ? 173  VAL A C   1 
ATOM   1056  O O   . VAL A 1 173 ? 54.827  -8.087  27.361  1.00 12.20 ? 173  VAL A O   1 
ATOM   1057  C CB  . VAL A 1 173 ? 52.154  -9.969  27.909  1.00 12.84 ? 173  VAL A CB  1 
ATOM   1058  C CG1 . VAL A 1 173 ? 52.423  -10.004 26.391  1.00 13.53 ? 173  VAL A CG1 1 
ATOM   1059  C CG2 . VAL A 1 173 ? 51.820  -11.382 28.369  1.00 12.52 ? 173  VAL A CG2 1 
ATOM   1060  N N   . LEU A 1 174 ? 53.350  -7.001  28.679  1.00 10.86 ? 174  LEU A N   1 
ATOM   1061  C CA  . LEU A 1 174 ? 53.794  -5.664  28.262  1.00 11.50 ? 174  LEU A CA  1 
ATOM   1062  C C   . LEU A 1 174 ? 55.267  -5.437  28.623  1.00 12.62 ? 174  LEU A C   1 
ATOM   1063  O O   . LEU A 1 174 ? 56.013  -4.851  27.835  1.00 12.19 ? 174  LEU A O   1 
ATOM   1064  C CB  . LEU A 1 174 ? 52.907  -4.561  28.849  1.00 12.37 ? 174  LEU A CB  1 
ATOM   1065  C CG  . LEU A 1 174 ? 51.541  -4.366  28.175  1.00 13.07 ? 174  LEU A CG  1 
ATOM   1066  C CD1 . LEU A 1 174 ? 50.698  -3.392  28.983  1.00 13.53 ? 174  LEU A CD1 1 
ATOM   1067  C CD2 . LEU A 1 174 ? 51.710  -3.867  26.729  1.00 14.07 ? 174  LEU A CD2 1 
ATOM   1068  N N   . ASP A 1 175 ? 55.689  -5.997  29.763  1.00 13.27 ? 175  ASP A N   1 
ATOM   1069  C CA  . ASP A 1 175 ? 57.077  -5.904  30.223  1.00 13.95 ? 175  ASP A CA  1 
ATOM   1070  C C   . ASP A 1 175 ? 57.979  -6.801  29.365  1.00 13.83 ? 175  ASP A C   1 
ATOM   1071  O O   . ASP A 1 175 ? 59.107  -6.420  29.048  1.00 14.55 ? 175  ASP A O   1 
ATOM   1072  C CB  . ASP A 1 175 ? 57.193  -6.283  31.711  1.00 16.07 ? 175  ASP A CB  1 
ATOM   1073  C CG  . ASP A 1 175 ? 58.630  -6.229  32.224  1.00 19.55 ? 175  ASP A CG  1 
ATOM   1074  O OD1 . ASP A 1 175 ? 59.151  -5.113  32.430  1.00 21.30 ? 175  ASP A OD1 1 
ATOM   1075  O OD2 . ASP A 1 175 ? 59.235  -7.310  32.380  1.00 21.02 ? 175  ASP A OD2 1 
ATOM   1076  N N   . GLN A 1 176 ? 57.462  -7.972  28.976  1.00 12.99 ? 176  GLN A N   1 
ATOM   1077  C CA  . GLN A 1 176 ? 58.195  -8.922  28.131  1.00 13.40 ? 176  GLN A CA  1 
ATOM   1078  C C   . GLN A 1 176 ? 58.404  -8.288  26.746  1.00 13.92 ? 176  GLN A C   1 
ATOM   1079  O O   . GLN A 1 176 ? 59.487  -8.387  26.168  1.00 13.97 ? 176  GLN A O   1 
ATOM   1080  C CB  . GLN A 1 176 ? 57.412  -10.237 28.010  1.00 13.22 ? 176  GLN A CB  1 
ATOM   1081  C CG  . GLN A 1 176 ? 58.156  -11.379 27.313  1.00 13.84 ? 176  GLN A CG  1 
ATOM   1082  C CD  . GLN A 1 176 ? 57.239  -12.495 26.837  1.00 14.93 ? 176  GLN A CD  1 
ATOM   1083  O OE1 . GLN A 1 176 ? 56.067  -12.571 27.215  1.00 16.80 ? 176  GLN A OE1 1 
ATOM   1084  N NE2 . GLN A 1 176 ? 57.767  -13.353 25.969  1.00 16.44 ? 176  GLN A NE2 1 
ATOM   1085  N N   . MET A 1 177 ? 57.376  -7.577  26.271  1.00 13.95 ? 177  MET A N   1 
ATOM   1086  C CA  . MET A 1 177 ? 57.408  -6.874  24.983  1.00 13.49 ? 177  MET A CA  1 
ATOM   1087  C C   . MET A 1 177 ? 58.420  -5.730  25.024  1.00 13.48 ? 177  MET A C   1 
ATOM   1088  O O   . MET A 1 177 ? 59.162  -5.529  24.064  1.00 14.02 ? 177  MET A O   1 
ATOM   1089  C CB  . MET A 1 177 ? 56.025  -6.323  24.633  1.00 13.17 ? 177  MET A CB  1 
ATOM   1090  C CG  . MET A 1 177 ? 54.998  -7.368  24.246  1.00 12.13 ? 177  MET A CG  1 
ATOM   1091  S SD  . MET A 1 177 ? 53.306  -6.732  24.272  1.00 13.30 ? 177  MET A SD  1 
ATOM   1092  C CE  . MET A 1 177 ? 53.283  -5.738  22.787  1.00 13.77 ? 177  MET A CE  1 
ATOM   1093  N N   . ARG A 1 178 ? 58.471  -5.024  26.158  1.00 13.85 ? 178  ARG A N   1 
ATOM   1094  C CA  . ARG A 1 178 ? 59.404  -3.910  26.385  1.00 14.72 ? 178  ARG A CA  1 
ATOM   1095  C C   . ARG A 1 178 ? 60.849  -4.402  26.285  1.00 15.47 ? 178  ARG A C   1 
ATOM   1096  O O   . ARG A 1 178 ? 61.633  -3.872  25.500  1.00 15.18 ? 178  ARG A O   1 
ATOM   1097  C CB  . ARG A 1 178 ? 59.184  -3.306  27.779  1.00 16.03 ? 178  ARG A CB  1 
ATOM   1098  C CG  . ARG A 1 178 ? 60.168  -2.186  28.172  1.00 18.40 ? 178  ARG A CG  1 
ATOM   1099  C CD  . ARG A 1 178 ? 60.155  -1.915  29.674  1.00 22.03 ? 178  ARG A CD  1 
ATOM   1100  N NE  . ARG A 1 178 ? 60.502  -3.108  30.453  1.00 26.34 ? 178  ARG A NE  1 
ATOM   1101  C CZ  . ARG A 1 178 ? 61.720  -3.651  30.536  1.00 27.69 ? 178  ARG A CZ  1 
ATOM   1102  N NH1 . ARG A 1 178 ? 62.756  -3.114  29.895  1.00 29.61 ? 178  ARG A NH1 1 
ATOM   1103  N NH2 . ARG A 1 178 ? 61.886  -4.775  31.217  1.00 29.70 ? 178  ARG A NH2 1 
ATOM   1104  N N   . SER A 1 179 ? 61.158  -5.449  27.052  1.00 15.44 ? 179  SER A N   1 
ATOM   1105  C CA  . SER A 1 179 ? 62.491  -6.055  27.100  1.00 16.15 ? 179  SER A CA  1 
ATOM   1106  C C   . SER A 1 179 ? 62.971  -6.540  25.732  1.00 15.89 ? 179  SER A C   1 
ATOM   1107  O O   . SER A 1 179 ? 64.063  -6.175  25.298  1.00 16.10 ? 179  SER A O   1 
ATOM   1108  C CB  . SER A 1 179 ? 62.503  -7.211  28.108  1.00 16.75 ? 179  SER A CB  1 
ATOM   1109  O OG  . SER A 1 179 ? 63.793  -7.781  28.238  1.00 21.67 ? 179  SER A OG  1 
ATOM   1110  N N   . PHE A 1 180 ? 62.113  -7.283  25.030  1.00 15.42 ? 180  PHE A N   1 
ATOM   1111  C CA  . PHE A 1 180 ? 62.443  -7.819  23.708  1.00 14.33 ? 180  PHE A CA  1 
ATOM   1112  C C   . PHE A 1 180 ? 62.567  -6.736  22.636  1.00 14.38 ? 180  PHE A C   1 
ATOM   1113  O O   . PHE A 1 180 ? 63.521  -6.759  21.854  1.00 14.07 ? 180  PHE A O   1 
ATOM   1114  C CB  . PHE A 1 180 ? 61.429  -8.889  23.282  1.00 15.27 ? 180  PHE A CB  1 
ATOM   1115  C CG  . PHE A 1 180 ? 61.707  -9.495  21.923  1.00 15.09 ? 180  PHE A CG  1 
ATOM   1116  C CD1 . PHE A 1 180 ? 62.776  -10.392 21.742  1.00 14.69 ? 180  PHE A CD1 1 
ATOM   1117  C CD2 . PHE A 1 180 ? 60.911  -9.148  20.810  1.00 15.47 ? 180  PHE A CD2 1 
ATOM   1118  C CE1 . PHE A 1 180 ? 63.055  -10.936 20.464  1.00 15.00 ? 180  PHE A CE1 1 
ATOM   1119  C CE2 . PHE A 1 180 ? 61.179  -9.685  19.529  1.00 14.99 ? 180  PHE A CE2 1 
ATOM   1120  C CZ  . PHE A 1 180 ? 62.257  -10.582 19.359  1.00 15.71 ? 180  PHE A CZ  1 
ATOM   1121  N N   . SER A 1 181 ? 61.602  -5.814  22.589  1.00 14.20 ? 181  SER A N   1 
ATOM   1122  C CA  . SER A 1 181 ? 61.624  -4.725  21.606  1.00 14.74 ? 181  SER A CA  1 
ATOM   1123  C C   . SER A 1 181 ? 62.869  -3.854  21.757  1.00 15.18 ? 181  SER A C   1 
ATOM   1124  O O   . SER A 1 181 ? 63.448  -3.442  20.756  1.00 13.99 ? 181  SER A O   1 
ATOM   1125  C CB  . SER A 1 181 ? 60.352  -3.871  21.675  1.00 14.06 ? 181  SER A CB  1 
ATOM   1126  O OG  . SER A 1 181 ? 60.247  -3.163  22.895  1.00 16.16 ? 181  SER A OG  1 
ATOM   1127  N N   . GLU A 1 182 ? 63.327  -3.674  23.001  1.00 15.70 ? 182  GLU A N   1 
ATOM   1128  C CA  . GLU A 1 182 ? 64.534  -2.887  23.269  1.00 17.46 ? 182  GLU A CA  1 
ATOM   1129  C C   . GLU A 1 182 ? 65.784  -3.592  22.753  1.00 17.46 ? 182  GLU A C   1 
ATOM   1130  O O   . GLU A 1 182 ? 66.673  -2.938  22.211  1.00 18.97 ? 182  GLU A O   1 
ATOM   1131  C CB  . GLU A 1 182 ? 64.686  -2.551  24.761  1.00 18.87 ? 182  GLU A CB  1 
ATOM   1132  C CG  . GLU A 1 182 ? 63.820  -1.380  25.258  1.00 22.83 ? 182  GLU A CG  1 
ATOM   1133  C CD  . GLU A 1 182 ? 64.039  -0.065  24.503  1.00 26.41 ? 182  GLU A CD  1 
ATOM   1134  O OE1 . GLU A 1 182 ? 65.206  0.327   24.272  1.00 27.58 ? 182  GLU A OE1 1 
ATOM   1135  O OE2 . GLU A 1 182 ? 63.032  0.584   24.146  1.00 28.07 ? 182  GLU A OE2 1 
ATOM   1136  N N   . LYS A 1 183 ? 65.806  -4.926  22.850  1.00 16.72 ? 183  LYS A N   1 
ATOM   1137  C CA  . LYS A 1 183 ? 66.933  -5.737  22.365  1.00 16.72 ? 183  LYS A CA  1 
ATOM   1138  C C   . LYS A 1 183 ? 67.035  -5.674  20.837  1.00 16.53 ? 183  LYS A C   1 
ATOM   1139  O O   . LYS A 1 183 ? 68.132  -5.618  20.284  1.00 16.21 ? 183  LYS A O   1 
ATOM   1140  C CB  . LYS A 1 183 ? 66.798  -7.200  22.806  1.00 18.13 ? 183  LYS A CB  1 
ATOM   1141  C CG  . LYS A 1 183 ? 66.985  -7.437  24.300  1.00 20.74 ? 183  LYS A CG  1 
ATOM   1142  C CD  . LYS A 1 183 ? 66.773  -8.903  24.656  1.00 22.87 ? 183  LYS A CD  1 
ATOM   1143  C CE  . LYS A 1 183 ? 66.817  -9.117  26.166  1.00 25.23 ? 183  LYS A CE  1 
ATOM   1144  N NZ  . LYS A 1 183 ? 66.463  -10.518 26.532  1.00 27.45 ? 183  LYS A NZ  1 
ATOM   1145  N N   . VAL A 1 184 ? 65.880  -5.636  20.171  1.00 15.32 ? 184  VAL A N   1 
ATOM   1146  C CA  . VAL A 1 184 ? 65.818  -5.561  18.709  1.00 14.05 ? 184  VAL A CA  1 
ATOM   1147  C C   . VAL A 1 184 ? 66.238  -4.168  18.225  1.00 14.37 ? 184  VAL A C   1 
ATOM   1148  O O   . VAL A 1 184 ? 67.082  -4.055  17.336  1.00 15.82 ? 184  VAL A O   1 
ATOM   1149  C CB  . VAL A 1 184 ? 64.393  -5.935  18.181  1.00 13.79 ? 184  VAL A CB  1 
ATOM   1150  C CG1 . VAL A 1 184 ? 64.295  -5.767  16.661  1.00 13.88 ? 184  VAL A CG1 1 
ATOM   1151  C CG2 . VAL A 1 184 ? 64.080  -7.372  18.540  1.00 13.62 ? 184  VAL A CG2 1 
ATOM   1152  N N   . ARG A 1 185 ? 65.699  -3.132  18.873  1.00 15.19 ? 185  ARG A N   1 
ATOM   1153  C CA  . ARG A 1 185 ? 65.969  -1.726  18.537  1.00 15.42 ? 185  ARG A CA  1 
ATOM   1154  C C   . ARG A 1 185 ? 67.398  -1.239  18.769  1.00 16.29 ? 185  ARG A C   1 
ATOM   1155  O O   . ARG A 1 185 ? 67.911  -0.437  17.988  1.00 16.72 ? 185  ARG A O   1 
ATOM   1156  C CB  . ARG A 1 185 ? 65.001  -0.806  19.285  1.00 14.86 ? 185  ARG A CB  1 
ATOM   1157  C CG  . ARG A 1 185 ? 63.568  -0.886  18.794  1.00 16.07 ? 185  ARG A CG  1 
ATOM   1158  C CD  . ARG A 1 185 ? 62.582  -0.286  19.789  1.00 13.53 ? 185  ARG A CD  1 
ATOM   1159  N NE  . ARG A 1 185 ? 62.752  1.154   19.990  1.00 13.77 ? 185  ARG A NE  1 
ATOM   1160  C CZ  . ARG A 1 185 ? 62.281  2.101   19.182  1.00 14.71 ? 185  ARG A CZ  1 
ATOM   1161  N NH1 . ARG A 1 185 ? 61.605  1.783   18.082  1.00 14.40 ? 185  ARG A NH1 1 
ATOM   1162  N NH2 . ARG A 1 185 ? 62.415  3.375   19.521  1.00 15.63 ? 185  ARG A NH2 1 
ATOM   1163  N N   . THR A 1 186 ? 68.031  -1.719  19.840  1.00 17.04 ? 186  THR A N   1 
ATOM   1164  C CA  . THR A 1 186 ? 69.404  -1.320  20.173  1.00 17.53 ? 186  THR A CA  1 
ATOM   1165  C C   . THR A 1 186 ? 70.465  -2.112  19.405  1.00 18.24 ? 186  THR A C   1 
ATOM   1166  O O   . THR A 1 186 ? 71.645  -1.739  19.402  1.00 19.07 ? 186  THR A O   1 
ATOM   1167  C CB  . THR A 1 186 ? 69.695  -1.454  21.690  1.00 17.07 ? 186  THR A CB  1 
ATOM   1168  O OG1 . THR A 1 186 ? 69.483  -2.811  22.104  1.00 18.53 ? 186  THR A OG1 1 
ATOM   1169  C CG2 . THR A 1 186 ? 68.809  -0.511  22.501  1.00 17.96 ? 186  THR A CG2 1 
ATOM   1170  N N   . GLY A 1 187 ? 70.036  -3.206  18.779  1.00 17.66 ? 187  GLY A N   1 
ATOM   1171  C CA  . GLY A 1 187 ? 70.940  -4.052  18.018  1.00 18.00 ? 187  GLY A CA  1 
ATOM   1172  C C   . GLY A 1 187 ? 71.556  -5.179  18.829  1.00 19.26 ? 187  GLY A C   1 
ATOM   1173  O O   . GLY A 1 187 ? 72.465  -5.858  18.344  1.00 19.18 ? 187  GLY A O   1 
ATOM   1174  N N   . GLU A 1 188 ? 71.054  -5.385  20.051  1.00 19.24 ? 188  GLU A N   1 
ATOM   1175  C CA  . GLU A 1 188 ? 71.534  -6.438  20.956  1.00 20.80 ? 188  GLU A CA  1 
ATOM   1176  C C   . GLU A 1 188 ? 71.114  -7.827  20.461  1.00 20.40 ? 188  GLU A C   1 
ATOM   1177  O O   . GLU A 1 188 ? 71.895  -8.782  20.554  1.00 21.80 ? 188  GLU A O   1 
ATOM   1178  C CB  . GLU A 1 188 ? 71.004  -6.200  22.379  1.00 22.34 ? 188  GLU A CB  1 
ATOM   1179  C CG  . GLU A 1 188 ? 71.607  -7.104  23.470  1.00 27.35 ? 188  GLU A CG  1 
ATOM   1180  C CD  . GLU A 1 188 ? 70.766  -7.150  24.739  1.00 28.44 ? 188  GLU A CD  1 
ATOM   1181  O OE1 . GLU A 1 188 ? 70.447  -6.072  25.294  1.00 30.66 ? 188  GLU A OE1 1 
ATOM   1182  O OE2 . GLU A 1 188 ? 70.421  -8.268  25.182  1.00 29.90 ? 188  GLU A OE2 1 
ATOM   1183  N N   . TRP A 1 189 ? 69.893  -7.929  19.924  1.00 19.36 ? 189  TRP A N   1 
ATOM   1184  C CA  . TRP A 1 189 ? 69.379  -9.197  19.398  1.00 18.12 ? 189  TRP A CA  1 
ATOM   1185  C C   . TRP A 1 189 ? 70.049  -9.478  18.055  1.00 19.30 ? 189  TRP A C   1 
ATOM   1186  O O   . TRP A 1 189 ? 69.902  -8.709  17.098  1.00 19.07 ? 189  TRP A O   1 
ATOM   1187  C CB  . TRP A 1 189 ? 67.850  -9.162  19.237  1.00 17.48 ? 189  TRP A CB  1 
ATOM   1188  C CG  . TRP A 1 189 ? 67.233  -10.523 19.016  1.00 17.25 ? 189  TRP A CG  1 
ATOM   1189  C CD1 . TRP A 1 189 ? 67.097  -11.185 17.820  1.00 17.24 ? 189  TRP A CD1 1 
ATOM   1190  C CD2 . TRP A 1 189 ? 66.712  -11.405 20.019  1.00 17.81 ? 189  TRP A CD2 1 
ATOM   1191  N NE1 . TRP A 1 189 ? 66.538  -12.420 18.018  1.00 17.21 ? 189  TRP A NE1 1 
ATOM   1192  C CE2 . TRP A 1 189 ? 66.287  -12.589 19.353  1.00 17.78 ? 189  TRP A CE2 1 
ATOM   1193  C CE3 . TRP A 1 189 ? 66.562  -11.316 21.421  1.00 19.95 ? 189  TRP A CE3 1 
ATOM   1194  C CZ2 . TRP A 1 189 ? 65.715  -13.687 20.044  1.00 18.88 ? 189  TRP A CZ2 1 
ATOM   1195  C CZ3 . TRP A 1 189 ? 65.989  -12.414 22.117  1.00 20.66 ? 189  TRP A CZ3 1 
ATOM   1196  C CH2 . TRP A 1 189 ? 65.575  -13.583 21.417  1.00 19.49 ? 189  TRP A CH2 1 
ATOM   1197  N N   . LYS A 1 190 ? 70.772  -10.593 18.005  1.00 19.03 ? 190  LYS A N   1 
ATOM   1198  C CA  . LYS A 1 190 ? 71.504  -10.992 16.810  1.00 19.86 ? 190  LYS A CA  1 
ATOM   1199  C C   . LYS A 1 190 ? 70.891  -12.151 16.048  1.00 19.35 ? 190  LYS A C   1 
ATOM   1200  O O   . LYS A 1 190 ? 70.257  -13.039 16.632  1.00 20.08 ? 190  LYS A O   1 
ATOM   1201  C CB  . LYS A 1 190 ? 72.955  -11.372 17.164  1.00 20.48 ? 190  LYS A CB  1 
ATOM   1202  C CG  . LYS A 1 190 ? 73.748  -10.358 17.989  1.00 21.60 ? 190  LYS A CG  1 
ATOM   1203  C CD  . LYS A 1 190 ? 73.932  -9.025  17.276  1.00 22.54 ? 190  LYS A CD  1 
ATOM   1204  C CE  . LYS A 1 190 ? 74.850  -8.112  18.071  1.00 23.56 ? 190  LYS A CE  1 
ATOM   1205  N NZ  . LYS A 1 190 ? 75.021  -6.792  17.407  1.00 24.93 ? 190  LYS A NZ  1 
ATOM   1206  N N   . GLY A 1 191 ? 71.147  -12.160 14.739  1.00 19.54 ? 191  GLY A N   1 
ATOM   1207  C CA  . GLY A 1 191 ? 70.699  -13.236 13.873  1.00 19.22 ? 191  GLY A CA  1 
ATOM   1208  C C   . GLY A 1 191 ? 71.690  -14.386 14.012  1.00 19.66 ? 191  GLY A C   1 
ATOM   1209  O O   . GLY A 1 191 ? 72.649  -14.273 14.788  1.00 20.83 ? 191  GLY A O   1 
ATOM   1210  N N   . HIS A 1 192 ? 71.509  -15.454 13.235  1.00 18.94 ? 192  HIS A N   1 
ATOM   1211  C CA  . HIS A 1 192 ? 72.378  -16.636 13.303  1.00 20.47 ? 192  HIS A CA  1 
ATOM   1212  C C   . HIS A 1 192 ? 73.854  -16.414 12.961  1.00 21.38 ? 192  HIS A C   1 
ATOM   1213  O O   . HIS A 1 192 ? 74.727  -17.102 13.503  1.00 22.12 ? 192  HIS A O   1 
ATOM   1214  C CB  . HIS A 1 192 ? 71.806  -17.767 12.446  1.00 20.98 ? 192  HIS A CB  1 
ATOM   1215  C CG  . HIS A 1 192 ? 72.352  -19.120 12.789  1.00 21.82 ? 192  HIS A CG  1 
ATOM   1216  N ND1 . HIS A 1 192 ? 72.396  -19.599 14.081  1.00 22.75 ? 192  HIS A ND1 1 
ATOM   1217  C CD2 . HIS A 1 192 ? 72.862  -20.099 12.007  1.00 22.70 ? 192  HIS A CD2 1 
ATOM   1218  C CE1 . HIS A 1 192 ? 72.908  -20.816 14.080  1.00 23.06 ? 192  HIS A CE1 1 
ATOM   1219  N NE2 . HIS A 1 192 ? 73.198  -21.144 12.834  1.00 23.58 ? 192  HIS A NE2 1 
ATOM   1220  N N   . THR A 1 193 ? 74.117  -15.448 12.081  1.00 21.39 ? 193  THR A N   1 
ATOM   1221  C CA  . THR A 1 193 ? 75.477  -15.115 11.656  1.00 21.65 ? 193  THR A CA  1 
ATOM   1222  C C   . THR A 1 193 ? 76.070  -13.919 12.416  1.00 21.65 ? 193  THR A C   1 
ATOM   1223  O O   . THR A 1 193 ? 77.134  -13.402 12.047  1.00 22.73 ? 193  THR A O   1 
ATOM   1224  C CB  . THR A 1 193 ? 75.542  -14.851 10.134  1.00 21.64 ? 193  THR A CB  1 
ATOM   1225  O OG1 . THR A 1 193 ? 74.616  -13.815 9.783   1.00 24.03 ? 193  THR A OG1 1 
ATOM   1226  C CG2 . THR A 1 193 ? 75.209  -16.108 9.351   1.00 22.07 ? 193  THR A CG2 1 
ATOM   1227  N N   . GLY A 1 194 ? 75.367  -13.481 13.464  1.00 20.53 ? 194  GLY A N   1 
ATOM   1228  C CA  . GLY A 1 194 ? 75.825  -12.375 14.291  1.00 20.12 ? 194  GLY A CA  1 
ATOM   1229  C C   . GLY A 1 194 ? 75.420  -10.957 13.921  1.00 20.82 ? 194  GLY A C   1 
ATOM   1230  O O   . GLY A 1 194 ? 75.880  -10.008 14.560  1.00 20.74 ? 194  GLY A O   1 
ATOM   1231  N N   . LYS A 1 195 ? 74.551  -10.807 12.920  1.00 20.45 ? 195  LYS A N   1 
ATOM   1232  C CA  . LYS A 1 195 ? 74.098  -9.486  12.476  1.00 20.49 ? 195  LYS A CA  1 
ATOM   1233  C C   . LYS A 1 195 ? 72.941  -8.933  13.295  1.00 19.16 ? 195  LYS A C   1 
ATOM   1234  O O   . LYS A 1 195 ? 72.075  -9.686  13.747  1.00 18.08 ? 195  LYS A O   1 
ATOM   1235  C CB  . LYS A 1 195 ? 73.661  -9.520  11.006  1.00 22.35 ? 195  LYS A CB  1 
ATOM   1236  C CG  . LYS A 1 195 ? 74.766  -9.742  9.987   1.00 25.81 ? 195  LYS A CG  1 
ATOM   1237  C CD  . LYS A 1 195 ? 74.218  -9.523  8.583   1.00 28.47 ? 195  LYS A CD  1 
ATOM   1238  C CE  . LYS A 1 195 ? 75.282  -9.700  7.514   1.00 30.36 ? 195  LYS A CE  1 
ATOM   1239  N NZ  . LYS A 1 195 ? 74.713  -9.497  6.148   1.00 31.87 ? 195  LYS A NZ  1 
ATOM   1240  N N   . ALA A 1 196 ? 72.917  -7.608  13.442  1.00 18.03 ? 196  ALA A N   1 
ATOM   1241  C CA  . ALA A 1 196 ? 71.845  -6.906  14.148  1.00 18.04 ? 196  ALA A CA  1 
ATOM   1242  C C   . ALA A 1 196 ? 70.610  -6.953  13.239  1.00 16.77 ? 196  ALA A C   1 
ATOM   1243  O O   . ALA A 1 196 ? 70.741  -7.099  12.023  1.00 17.41 ? 196  ALA A O   1 
ATOM   1244  C CB  . ALA A 1 196 ? 72.247  -5.468  14.415  1.00 18.27 ? 196  ALA A CB  1 
ATOM   1245  N N   . ILE A 1 197 ? 69.423  -6.868  13.835  1.00 16.26 ? 197  ILE A N   1 
ATOM   1246  C CA  . ILE A 1 197 ? 68.174  -6.922  13.075  1.00 16.12 ? 197  ILE A CA  1 
ATOM   1247  C C   . ILE A 1 197 ? 67.903  -5.619  12.315  1.00 15.01 ? 197  ILE A C   1 
ATOM   1248  O O   . ILE A 1 197 ? 67.963  -4.531  12.886  1.00 14.68 ? 197  ILE A O   1 
ATOM   1249  C CB  . ILE A 1 197 ? 66.971  -7.306  14.001  1.00 15.51 ? 197  ILE A CB  1 
ATOM   1250  C CG1 . ILE A 1 197 ? 67.219  -8.668  14.676  1.00 16.05 ? 197  ILE A CG1 1 
ATOM   1251  C CG2 . ILE A 1 197 ? 65.641  -7.310  13.230  1.00 15.75 ? 197  ILE A CG2 1 
ATOM   1252  C CD1 . ILE A 1 197 ? 67.428  -9.876  13.730  1.00 15.16 ? 197  ILE A CD1 1 
ATOM   1253  N N   . ARG A 1 198 ? 67.670  -5.758  11.008  1.00 15.19 ? 198  ARG A N   1 
ATOM   1254  C CA  . ARG A 1 198 ? 67.376  -4.634  10.120  1.00 15.10 ? 198  ARG A CA  1 
ATOM   1255  C C   . ARG A 1 198 ? 65.978  -4.748  9.517   1.00 14.62 ? 198  ARG A C   1 
ATOM   1256  O O   . ARG A 1 198 ? 65.404  -3.747  9.083   1.00 15.09 ? 198  ARG A O   1 
ATOM   1257  C CB  . ARG A 1 198 ? 68.413  -4.539  8.981   1.00 16.66 ? 198  ARG A CB  1 
ATOM   1258  C CG  . ARG A 1 198 ? 69.846  -4.169  9.401   1.00 18.67 ? 198  ARG A CG  1 
ATOM   1259  C CD  . ARG A 1 198 ? 70.085  -2.653  9.489   1.00 22.59 ? 198  ARG A CD  1 
ATOM   1260  N NE  . ARG A 1 198 ? 69.320  -1.993  10.547  1.00 24.09 ? 198  ARG A NE  1 
ATOM   1261  C CZ  . ARG A 1 198 ? 69.639  -1.993  11.843  1.00 25.87 ? 198  ARG A CZ  1 
ATOM   1262  N NH1 . ARG A 1 198 ? 70.728  -2.618  12.278  1.00 26.16 ? 198  ARG A NH1 1 
ATOM   1263  N NH2 . ARG A 1 198 ? 68.832  -1.405  12.716  1.00 25.74 ? 198  ARG A NH2 1 
ATOM   1264  N N   . HIS A 1 199 ? 65.455  -5.975  9.465   1.00 13.44 ? 199  HIS A N   1 
ATOM   1265  C CA  . HIS A 1 199 ? 64.130  -6.249  8.898   1.00 13.24 ? 199  HIS A CA  1 
ATOM   1266  C C   . HIS A 1 199 ? 63.237  -7.015  9.864   1.00 12.85 ? 199  HIS A C   1 
ATOM   1267  O O   . HIS A 1 199 ? 63.654  -8.009  10.454  1.00 11.80 ? 199  HIS A O   1 
ATOM   1268  C CB  . HIS A 1 199 ? 64.252  -7.052  7.600   1.00 14.56 ? 199  HIS A CB  1 
ATOM   1269  C CG  . HIS A 1 199 ? 65.101  -6.397  6.554   1.00 17.48 ? 199  HIS A CG  1 
ATOM   1270  N ND1 . HIS A 1 199 ? 64.614  -5.437  5.696   1.00 17.94 ? 199  HIS A ND1 1 
ATOM   1271  C CD2 . HIS A 1 199 ? 66.409  -6.556  6.241   1.00 18.85 ? 199  HIS A CD2 1 
ATOM   1272  C CE1 . HIS A 1 199 ? 65.586  -5.028  4.900   1.00 20.45 ? 199  HIS A CE1 1 
ATOM   1273  N NE2 . HIS A 1 199 ? 66.685  -5.691  5.210   1.00 19.70 ? 199  HIS A NE2 1 
ATOM   1274  N N   . VAL A 1 200 ? 62.007  -6.534  10.029  1.00 12.06 ? 200  VAL A N   1 
ATOM   1275  C CA  . VAL A 1 200 ? 61.030  -7.169  10.910  1.00 12.44 ? 200  VAL A CA  1 
ATOM   1276  C C   . VAL A 1 200 ? 59.848  -7.576  10.028  1.00 12.30 ? 200  VAL A C   1 
ATOM   1277  O O   . VAL A 1 200 ? 59.185  -6.726  9.437   1.00 12.50 ? 200  VAL A O   1 
ATOM   1278  C CB  . VAL A 1 200 ? 60.580  -6.203  12.056  1.00 12.64 ? 200  VAL A CB  1 
ATOM   1279  C CG1 . VAL A 1 200 ? 59.565  -6.878  12.967  1.00 13.93 ? 200  VAL A CG1 1 
ATOM   1280  C CG2 . VAL A 1 200 ? 61.787  -5.745  12.879  1.00 14.02 ? 200  VAL A CG2 1 
ATOM   1281  N N   . VAL A 1 201 ? 59.628  -8.884  9.912   1.00 11.68 ? 201  VAL A N   1 
ATOM   1282  C CA  . VAL A 1 201 ? 58.553  -9.426  9.085   1.00 11.58 ? 201  VAL A CA  1 
ATOM   1283  C C   . VAL A 1 201 ? 57.438  -10.039 9.933   1.00 11.94 ? 201  VAL A C   1 
ATOM   1284  O O   . VAL A 1 201 ? 57.639  -11.064 10.590  1.00 11.38 ? 201  VAL A O   1 
ATOM   1285  C CB  . VAL A 1 201 ? 59.094  -10.496 8.084   1.00 12.28 ? 201  VAL A CB  1 
ATOM   1286  C CG1 . VAL A 1 201 ? 57.978  -11.065 7.206   1.00 12.23 ? 201  VAL A CG1 1 
ATOM   1287  C CG2 . VAL A 1 201 ? 60.183  -9.915  7.205   1.00 12.18 ? 201  VAL A CG2 1 
ATOM   1288  N N   . ASN A 1 202 ? 56.261  -9.418  9.891   1.00 10.84 ? 202  ASN A N   1 
ATOM   1289  C CA  . ASN A 1 202 ? 55.101  -9.926  10.618  1.00 11.64 ? 202  ASN A CA  1 
ATOM   1290  C C   . ASN A 1 202 ? 54.370  -10.883 9.677   1.00 11.75 ? 202  ASN A C   1 
ATOM   1291  O O   . ASN A 1 202 ? 54.197  -10.590 8.491   1.00 14.10 ? 202  ASN A O   1 
ATOM   1292  C CB  . ASN A 1 202 ? 54.174  -8.782  11.045  1.00 12.08 ? 202  ASN A CB  1 
ATOM   1293  C CG  . ASN A 1 202 ? 53.077  -9.232  12.011  1.00 13.68 ? 202  ASN A CG  1 
ATOM   1294  O OD1 . ASN A 1 202 ? 53.314  -9.376  13.204  1.00 13.78 ? 202  ASN A OD1 1 
ATOM   1295  N ND2 . ASN A 1 202 ? 51.872  -9.449  11.486  1.00 14.33 ? 202  ASN A ND2 1 
ATOM   1296  N N   . ILE A 1 203 ? 54.050  -12.067 10.195  1.00 11.08 ? 203  ILE A N   1 
ATOM   1297  C CA  . ILE A 1 203 ? 53.342  -13.099 9.449   1.00 11.97 ? 203  ILE A CA  1 
ATOM   1298  C C   . ILE A 1 203 ? 52.029  -13.342 10.201  1.00 11.16 ? 203  ILE A C   1 
ATOM   1299  O O   . ILE A 1 203 ? 52.023  -13.881 11.309  1.00 11.79 ? 203  ILE A O   1 
ATOM   1300  C CB  . ILE A 1 203 ? 54.168  -14.421 9.348   1.00 12.40 ? 203  ILE A CB  1 
ATOM   1301  C CG1 . ILE A 1 203 ? 55.514  -14.168 8.651   1.00 12.87 ? 203  ILE A CG1 1 
ATOM   1302  C CG2 . ILE A 1 203 ? 53.381  -15.478 8.582   1.00 12.98 ? 203  ILE A CG2 1 
ATOM   1303  C CD1 . ILE A 1 203 ? 56.507  -15.315 8.765   1.00 14.57 ? 203  ILE A CD1 1 
ATOM   1304  N N   . GLY A 1 204 ? 50.929  -12.924 9.589   1.00 11.02 ? 204  GLY A N   1 
ATOM   1305  C CA  . GLY A 1 204 ? 49.620  -13.084 10.197  1.00 10.72 ? 204  GLY A CA  1 
ATOM   1306  C C   . GLY A 1 204 ? 48.565  -12.549 9.262   1.00 11.03 ? 204  GLY A C   1 
ATOM   1307  O O   . GLY A 1 204 ? 48.898  -11.814 8.341   1.00 11.04 ? 204  GLY A O   1 
ATOM   1308  N N   . ILE A 1 205 ? 47.303  -12.890 9.506   1.00 11.07 ? 205  ILE A N   1 
ATOM   1309  C CA  . ILE A 1 205 ? 46.205  -12.442 8.652   1.00 11.39 ? 205  ILE A CA  1 
ATOM   1310  C C   . ILE A 1 205 ? 45.026  -11.915 9.486   1.00 11.63 ? 205  ILE A C   1 
ATOM   1311  O O   . ILE A 1 205 ? 44.884  -12.278 10.654  1.00 11.63 ? 205  ILE A O   1 
ATOM   1312  C CB  . ILE A 1 205 ? 45.795  -13.575 7.656   1.00 11.63 ? 205  ILE A CB  1 
ATOM   1313  C CG1 . ILE A 1 205 ? 44.972  -13.000 6.497   1.00 11.27 ? 205  ILE A CG1 1 
ATOM   1314  C CG2 . ILE A 1 205 ? 45.083  -14.718 8.387   1.00 11.96 ? 205  ILE A CG2 1 
ATOM   1315  C CD1 . ILE A 1 205 ? 44.884  -13.903 5.289   1.00 13.37 ? 205  ILE A CD1 1 
ATOM   1316  N N   . GLY A 1 206 ? 44.249  -10.999 8.900   1.00 10.35 ? 206  GLY A N   1 
ATOM   1317  C CA  . GLY A 1 206 ? 43.092  -10.420 9.576   1.00 10.04 ? 206  GLY A CA  1 
ATOM   1318  C C   . GLY A 1 206 ? 43.438  -9.624  10.817  1.00 9.36  ? 206  GLY A C   1 
ATOM   1319  O O   . GLY A 1 206 ? 44.179  -8.644  10.739  1.00 11.25 ? 206  GLY A O   1 
ATOM   1320  N N   . GLY A 1 207 ? 42.956  -10.091 11.971  1.00 10.43 ? 207  GLY A N   1 
ATOM   1321  C CA  . GLY A 1 207 ? 43.229  -9.418  13.234  1.00 10.30 ? 207  GLY A CA  1 
ATOM   1322  C C   . GLY A 1 207 ? 44.691  -9.447  13.653  1.00 10.79 ? 207  GLY A C   1 
ATOM   1323  O O   . GLY A 1 207 ? 45.131  -8.636  14.472  1.00 12.75 ? 207  GLY A O   1 
ATOM   1324  N N   . SER A 1 208 ? 45.441  -10.370 13.059  1.00 11.10 ? 208  SER A N   1 
ATOM   1325  C CA  . SER A 1 208 ? 46.868  -10.516 13.327  1.00 11.92 ? 208  SER A CA  1 
ATOM   1326  C C   . SER A 1 208 ? 47.712  -9.833  12.237  1.00 13.90 ? 208  SER A C   1 
ATOM   1327  O O   . SER A 1 208 ? 48.919  -10.091 12.120  1.00 15.13 ? 208  SER A O   1 
ATOM   1328  C CB  . SER A 1 208 ? 47.222  -11.997 13.428  1.00 11.52 ? 208  SER A CB  1 
ATOM   1329  O OG  . SER A 1 208 ? 46.620  -12.596 14.563  1.00 12.49 ? 208  SER A OG  1 
ATOM   1330  N N   . ASP A 1 209 ? 47.076  -8.938  11.474  1.00 12.55 ? 209  ASP A N   1 
ATOM   1331  C CA  . ASP A 1 209 ? 47.726  -8.205  10.378  1.00 12.38 ? 209  ASP A CA  1 
ATOM   1332  C C   . ASP A 1 209 ? 47.301  -6.747  10.266  1.00 11.55 ? 209  ASP A C   1 
ATOM   1333  O O   . ASP A 1 209 ? 48.149  -5.854  10.295  1.00 11.28 ? 209  ASP A O   1 
ATOM   1334  C CB  . ASP A 1 209 ? 47.451  -8.901  9.030   1.00 12.75 ? 209  ASP A CB  1 
ATOM   1335  C CG  . ASP A 1 209 ? 47.930  -8.097  7.814   1.00 15.27 ? 209  ASP A CG  1 
ATOM   1336  O OD1 . ASP A 1 209 ? 49.158  -7.945  7.632   1.00 14.36 ? 209  ASP A OD1 1 
ATOM   1337  O OD2 . ASP A 1 209 ? 47.069  -7.633  7.032   1.00 15.87 ? 209  ASP A OD2 1 
ATOM   1338  N N   . LEU A 1 210 ? 45.994  -6.518  10.116  1.00 10.14 ? 210  LEU A N   1 
ATOM   1339  C CA  . LEU A 1 210 ? 45.457  -5.170  9.913   1.00 10.70 ? 210  LEU A CA  1 
ATOM   1340  C C   . LEU A 1 210 ? 45.812  -4.096  10.936  1.00 10.05 ? 210  LEU A C   1 
ATOM   1341  O O   . LEU A 1 210 ? 46.111  -2.970  10.546  1.00 11.06 ? 210  LEU A O   1 
ATOM   1342  C CB  . LEU A 1 210 ? 43.950  -5.218  9.636   1.00 11.32 ? 210  LEU A CB  1 
ATOM   1343  C CG  . LEU A 1 210 ? 43.501  -5.873  8.318   1.00 15.77 ? 210  LEU A CG  1 
ATOM   1344  C CD1 . LEU A 1 210 ? 41.989  -5.933  8.282   1.00 17.22 ? 210  LEU A CD1 1 
ATOM   1345  C CD2 . LEU A 1 210 ? 44.007  -5.124  7.087   1.00 17.31 ? 210  LEU A CD2 1 
ATOM   1346  N N   . GLY A 1 211 ? 45.819  -4.459  12.223  1.00 9.56  ? 211  GLY A N   1 
ATOM   1347  C CA  . GLY A 1 211 ? 46.191  -3.536  13.299  1.00 10.30 ? 211  GLY A CA  1 
ATOM   1348  C C   . GLY A 1 211 ? 47.648  -3.142  13.163  1.00 10.27 ? 211  GLY A C   1 
ATOM   1349  O O   . GLY A 1 211 ? 47.956  -1.944  13.119  1.00 10.24 ? 211  GLY A O   1 
ATOM   1350  N N   . PRO A 1 212 ? 48.571  -4.128  13.117  1.00 10.55 ? 212  PRO A N   1 
ATOM   1351  C CA  . PRO A 1 212 ? 50.005  -3.868  12.963  1.00 10.63 ? 212  PRO A CA  1 
ATOM   1352  C C   . PRO A 1 212 ? 50.323  -3.029  11.720  1.00 11.48 ? 212  PRO A C   1 
ATOM   1353  O O   . PRO A 1 212 ? 51.127  -2.107  11.801  1.00 11.21 ? 212  PRO A O   1 
ATOM   1354  C CB  . PRO A 1 212 ? 50.578  -5.271  12.876  1.00 11.60 ? 212  PRO A CB  1 
ATOM   1355  C CG  . PRO A 1 212 ? 49.779  -5.977  13.903  1.00 11.68 ? 212  PRO A CG  1 
ATOM   1356  C CD  . PRO A 1 212 ? 48.370  -5.509  13.617  1.00 11.83 ? 212  PRO A CD  1 
ATOM   1357  N N   . VAL A 1 213 ? 49.623  -3.292  10.610  1.00 9.44  ? 213  VAL A N   1 
ATOM   1358  C CA  . VAL A 1 213 ? 49.810  -2.531  9.363   1.00 10.81 ? 213  VAL A CA  1 
ATOM   1359  C C   . VAL A 1 213 ? 49.336  -1.085  9.557   1.00 9.47  ? 213  VAL A C   1 
ATOM   1360  O O   . VAL A 1 213 ? 50.108  -0.151  9.369   1.00 9.40  ? 213  VAL A O   1 
ATOM   1361  C CB  . VAL A 1 213 ? 49.031  -3.163  8.152   1.00 10.47 ? 213  VAL A CB  1 
ATOM   1362  C CG1 . VAL A 1 213 ? 49.090  -2.255  6.909   1.00 12.88 ? 213  VAL A CG1 1 
ATOM   1363  C CG2 . VAL A 1 213 ? 49.607  -4.510  7.794   1.00 12.83 ? 213  VAL A CG2 1 
ATOM   1364  N N   . MET A 1 214 ? 48.080  -0.925  9.971   1.00 8.17  ? 214  MET A N   1 
ATOM   1365  C CA  . MET A 1 214 ? 47.475  0.393   10.179  1.00 9.09  ? 214  MET A CA  1 
ATOM   1366  C C   . MET A 1 214 ? 48.248  1.287   11.139  1.00 9.39  ? 214  MET A C   1 
ATOM   1367  O O   . MET A 1 214 ? 48.514  2.444   10.818  1.00 10.29 ? 214  MET A O   1 
ATOM   1368  C CB  . MET A 1 214 ? 46.014  0.232   10.639  1.00 9.69  ? 214  MET A CB  1 
ATOM   1369  C CG  . MET A 1 214 ? 45.236  1.521   10.928  1.00 10.70 ? 214  MET A CG  1 
ATOM   1370  S SD  . MET A 1 214 ? 45.568  2.304   12.520  1.00 10.84 ? 214  MET A SD  1 
ATOM   1371  C CE  . MET A 1 214 ? 45.089  0.991   13.642  1.00 10.96 ? 214  MET A CE  1 
ATOM   1372  N N   . ALA A 1 215 ? 48.622  0.732   12.291  1.00 9.15  ? 215  ALA A N   1 
ATOM   1373  C CA  . ALA A 1 215 ? 49.337  1.484   13.317  1.00 10.05 ? 215  ALA A CA  1 
ATOM   1374  C C   . ALA A 1 215 ? 50.778  1.847   12.985  1.00 9.36  ? 215  ALA A C   1 
ATOM   1375  O O   . ALA A 1 215 ? 51.204  2.956   13.305  1.00 11.23 ? 215  ALA A O   1 
ATOM   1376  C CB  . ALA A 1 215 ? 49.251  0.780   14.649  1.00 10.86 ? 215  ALA A CB  1 
ATOM   1377  N N   . THR A 1 216 ? 51.521  0.942   12.338  1.00 10.69 ? 216  THR A N   1 
ATOM   1378  C CA  . THR A 1 216 ? 52.912  1.249   11.959  1.00 10.55 ? 216  THR A CA  1 
ATOM   1379  C C   . THR A 1 216 ? 52.937  2.291   10.839  1.00 10.59 ? 216  THR A C   1 
ATOM   1380  O O   . THR A 1 216 ? 53.841  3.125   10.786  1.00 11.30 ? 216  THR A O   1 
ATOM   1381  C CB  . THR A 1 216 ? 53.752  0.010   11.545  1.00 11.28 ? 216  THR A CB  1 
ATOM   1382  O OG1 . THR A 1 216 ? 53.082  -0.728  10.516  1.00 10.84 ? 216  THR A OG1 1 
ATOM   1383  C CG2 . THR A 1 216 ? 54.014  -0.887  12.739  1.00 13.03 ? 216  THR A CG2 1 
ATOM   1384  N N   . GLU A 1 217 ? 51.905  2.276   9.994   1.00 9.53  ? 217  GLU A N   1 
ATOM   1385  C CA  . GLU A 1 217 ? 51.783  3.256   8.913   1.00 10.49 ? 217  GLU A CA  1 
ATOM   1386  C C   . GLU A 1 217 ? 51.359  4.602   9.494   1.00 11.00 ? 217  GLU A C   1 
ATOM   1387  O O   . GLU A 1 217 ? 51.938  5.636   9.155   1.00 11.86 ? 217  GLU A O   1 
ATOM   1388  C CB  . GLU A 1 217 ? 50.761  2.807   7.858   1.00 11.11 ? 217  GLU A CB  1 
ATOM   1389  C CG  . GLU A 1 217 ? 51.235  1.681   6.940   1.00 12.51 ? 217  GLU A CG  1 
ATOM   1390  C CD  . GLU A 1 217 ? 52.447  2.062   6.103   1.00 14.54 ? 217  GLU A CD  1 
ATOM   1391  O OE1 . GLU A 1 217 ? 52.345  2.990   5.276   1.00 14.04 ? 217  GLU A OE1 1 
ATOM   1392  O OE2 . GLU A 1 217 ? 53.508  1.434   6.284   1.00 17.96 ? 217  GLU A OE2 1 
ATOM   1393  N N   . ALA A 1 218 ? 50.392  4.568   10.416  1.00 10.27 ? 218  ALA A N   1 
ATOM   1394  C CA  . ALA A 1 218 ? 49.866  5.771   11.066  1.00 10.70 ? 218  ALA A CA  1 
ATOM   1395  C C   . ALA A 1 218 ? 50.864  6.524   11.923  1.00 11.02 ? 218  ALA A C   1 
ATOM   1396  O O   . ALA A 1 218 ? 50.850  7.759   11.971  1.00 12.31 ? 218  ALA A O   1 
ATOM   1397  C CB  . ALA A 1 218 ? 48.630  5.436   11.888  1.00 10.78 ? 218  ALA A CB  1 
ATOM   1398  N N   . LEU A 1 219 ? 51.748  5.765   12.567  1.00 12.09 ? 219  LEU A N   1 
ATOM   1399  C CA  . LEU A 1 219 ? 52.743  6.323   13.473  1.00 11.93 ? 219  LEU A CA  1 
ATOM   1400  C C   . LEU A 1 219 ? 54.182  6.273   12.980  1.00 12.76 ? 219  LEU A C   1 
ATOM   1401  O O   . LEU A 1 219 ? 55.124  6.289   13.778  1.00 13.30 ? 219  LEU A O   1 
ATOM   1402  C CB  . LEU A 1 219 ? 52.606  5.670   14.857  1.00 11.45 ? 219  LEU A CB  1 
ATOM   1403  C CG  . LEU A 1 219 ? 51.199  5.744   15.462  1.00 11.23 ? 219  LEU A CG  1 
ATOM   1404  C CD1 . LEU A 1 219 ? 51.115  4.908   16.719  1.00 12.30 ? 219  LEU A CD1 1 
ATOM   1405  C CD2 . LEU A 1 219 ? 50.768  7.190   15.681  1.00 12.08 ? 219  LEU A CD2 1 
ATOM   1406  N N   . LYS A 1 220 ? 54.343  6.353   11.657  1.00 13.05 ? 220  LYS A N   1 
ATOM   1407  C CA  . LYS A 1 220 ? 55.662  6.346   11.016  1.00 14.34 ? 220  LYS A CA  1 
ATOM   1408  C C   . LYS A 1 220 ? 56.626  7.483   11.474  1.00 14.44 ? 220  LYS A C   1 
ATOM   1409  O O   . LYS A 1 220 ? 57.834  7.240   11.552  1.00 14.06 ? 220  LYS A O   1 
ATOM   1410  C CB  . LYS A 1 220 ? 55.521  6.275   9.482   1.00 16.69 ? 220  LYS A CB  1 
ATOM   1411  C CG  . LYS A 1 220 ? 56.756  5.756   8.744   1.00 20.87 ? 220  LYS A CG  1 
ATOM   1412  C CD  . LYS A 1 220 ? 56.529  5.610   7.242   1.00 22.71 ? 220  LYS A CD  1 
ATOM   1413  C CE  . LYS A 1 220 ? 55.986  4.238   6.866   1.00 25.52 ? 220  LYS A CE  1 
ATOM   1414  N NZ  . LYS A 1 220 ? 55.822  4.105   5.388   1.00 27.95 ? 220  LYS A NZ  1 
ATOM   1415  N N   . PRO A 1 221 ? 56.121  8.709   11.813  1.00 13.49 ? 221  PRO A N   1 
ATOM   1416  C CA  . PRO A 1 221 ? 57.069  9.750   12.257  1.00 13.78 ? 221  PRO A CA  1 
ATOM   1417  C C   . PRO A 1 221 ? 57.697  9.461   13.623  1.00 14.93 ? 221  PRO A C   1 
ATOM   1418  O O   . PRO A 1 221 ? 58.707  10.067  13.991  1.00 16.05 ? 221  PRO A O   1 
ATOM   1419  C CB  . PRO A 1 221 ? 56.188  10.990  12.389  1.00 15.05 ? 221  PRO A CB  1 
ATOM   1420  C CG  . PRO A 1 221 ? 55.158  10.772  11.464  1.00 14.80 ? 221  PRO A CG  1 
ATOM   1421  C CD  . PRO A 1 221 ? 54.799  9.336   11.612  1.00 14.34 ? 221  PRO A CD  1 
ATOM   1422  N N   . PHE A 1 222 ? 57.071  8.545   14.363  1.00 13.32 ? 222  PHE A N   1 
ATOM   1423  C CA  . PHE A 1 222 ? 57.516  8.162   15.705  1.00 13.25 ? 222  PHE A CA  1 
ATOM   1424  C C   . PHE A 1 222 ? 58.283  6.843   15.687  1.00 12.85 ? 222  PHE A C   1 
ATOM   1425  O O   . PHE A 1 222 ? 58.606  6.294   16.740  1.00 15.06 ? 222  PHE A O   1 
ATOM   1426  C CB  . PHE A 1 222 ? 56.301  8.072   16.645  1.00 14.37 ? 222  PHE A CB  1 
ATOM   1427  C CG  . PHE A 1 222 ? 55.446  9.311   16.646  1.00 14.62 ? 222  PHE A CG  1 
ATOM   1428  C CD1 . PHE A 1 222 ? 54.376  9.443   15.732  1.00 14.16 ? 222  PHE A CD1 1 
ATOM   1429  C CD2 . PHE A 1 222 ? 55.737  10.380  17.514  1.00 15.70 ? 222  PHE A CD2 1 
ATOM   1430  C CE1 . PHE A 1 222 ? 53.607  10.633  15.675  1.00 14.68 ? 222  PHE A CE1 1 
ATOM   1431  C CE2 . PHE A 1 222 ? 54.978  11.580  17.473  1.00 16.27 ? 222  PHE A CE2 1 
ATOM   1432  C CZ  . PHE A 1 222 ? 53.910  11.707  16.549  1.00 15.06 ? 222  PHE A CZ  1 
ATOM   1433  N N   . SER A 1 223 ? 58.619  6.377   14.483  1.00 13.73 ? 223  SER A N   1 
ATOM   1434  C CA  . SER A 1 223 ? 59.333  5.117   14.300  1.00 13.34 ? 223  SER A CA  1 
ATOM   1435  C C   . SER A 1 223 ? 60.851  5.226   14.202  1.00 13.73 ? 223  SER A C   1 
ATOM   1436  O O   . SER A 1 223 ? 61.395  6.308   13.960  1.00 13.35 ? 223  SER A O   1 
ATOM   1437  C CB  . SER A 1 223 ? 58.817  4.388   13.055  1.00 15.12 ? 223  SER A CB  1 
ATOM   1438  O OG  . SER A 1 223 ? 59.265  5.015   11.861  1.00 14.66 ? 223  SER A OG  1 
ATOM   1439  N N   . GLN A 1 224 ? 61.509  4.079   14.380  1.00 12.83 ? 224  GLN A N   1 
ATOM   1440  C CA  . GLN A 1 224 ? 62.960  3.966   14.252  1.00 13.60 ? 224  GLN A CA  1 
ATOM   1441  C C   . GLN A 1 224 ? 63.144  3.568   12.785  1.00 13.59 ? 224  GLN A C   1 
ATOM   1442  O O   . GLN A 1 224 ? 62.838  2.437   12.387  1.00 13.41 ? 224  GLN A O   1 
ATOM   1443  C CB  . GLN A 1 224 ? 63.519  2.889   15.185  1.00 13.85 ? 224  GLN A CB  1 
ATOM   1444  C CG  . GLN A 1 224 ? 65.046  2.872   15.243  1.00 16.22 ? 224  GLN A CG  1 
ATOM   1445  C CD  . GLN A 1 224 ? 65.589  1.985   16.346  1.00 17.07 ? 224  GLN A CD  1 
ATOM   1446  O OE1 . GLN A 1 224 ? 65.322  2.217   17.525  1.00 18.70 ? 224  GLN A OE1 1 
ATOM   1447  N NE2 . GLN A 1 224 ? 66.369  0.977   15.969  1.00 16.82 ? 224  GLN A NE2 1 
ATOM   1448  N N   . ARG A 1 225 ? 63.612  4.526   11.994  1.00 15.17 ? 225  ARG A N   1 
ATOM   1449  C CA  . ARG A 1 225 ? 63.799  4.363   10.551  1.00 16.43 ? 225  ARG A CA  1 
ATOM   1450  C C   . ARG A 1 225 ? 64.725  3.260   10.030  1.00 17.04 ? 225  ARG A C   1 
ATOM   1451  O O   . ARG A 1 225 ? 64.526  2.783   8.909   1.00 17.39 ? 225  ARG A O   1 
ATOM   1452  C CB  . ARG A 1 225 ? 64.163  5.710   9.914   1.00 17.04 ? 225  ARG A CB  1 
ATOM   1453  C CG  . ARG A 1 225 ? 63.129  6.825   10.127  1.00 18.40 ? 225  ARG A CG  1 
ATOM   1454  C CD  . ARG A 1 225 ? 61.804  6.532   9.429   1.00 18.41 ? 225  ARG A CD  1 
ATOM   1455  N NE  . ARG A 1 225 ? 60.855  7.638   9.561   1.00 18.05 ? 225  ARG A NE  1 
ATOM   1456  C CZ  . ARG A 1 225 ? 59.982  8.000   8.624   1.00 17.48 ? 225  ARG A CZ  1 
ATOM   1457  N NH1 . ARG A 1 225 ? 59.924  7.350   7.467   1.00 18.30 ? 225  ARG A NH1 1 
ATOM   1458  N NH2 . ARG A 1 225 ? 59.161  9.015   8.846   1.00 17.61 ? 225  ARG A NH2 1 
ATOM   1459  N N   . ASP A 1 226 ? 65.687  2.816   10.845  1.00 17.36 ? 226  ASP A N   1 
ATOM   1460  C CA  . ASP A 1 226 ? 66.609  1.757   10.416  1.00 18.52 ? 226  ASP A CA  1 
ATOM   1461  C C   . ASP A 1 226 ? 66.043  0.329   10.510  1.00 17.83 ? 226  ASP A C   1 
ATOM   1462  O O   . ASP A 1 226 ? 66.740  -0.651  10.226  1.00 18.34 ? 226  ASP A O   1 
ATOM   1463  C CB  . ASP A 1 226 ? 67.991  1.885   11.098  1.00 19.77 ? 226  ASP A CB  1 
ATOM   1464  C CG  . ASP A 1 226 ? 67.953  1.681   12.613  1.00 22.41 ? 226  ASP A CG  1 
ATOM   1465  O OD1 . ASP A 1 226 ? 66.991  1.093   13.153  1.00 22.67 ? 226  ASP A OD1 1 
ATOM   1466  O OD2 . ASP A 1 226 ? 68.937  2.083   13.273  1.00 25.19 ? 226  ASP A OD2 1 
ATOM   1467  N N   . LEU A 1 227 ? 64.793  0.230   10.961  1.00 16.67 ? 227  LEU A N   1 
ATOM   1468  C CA  . LEU A 1 227 ? 64.092  -1.047  11.070  1.00 15.92 ? 227  LEU A CA  1 
ATOM   1469  C C   . LEU A 1 227 ? 62.963  -1.070  10.040  1.00 15.95 ? 227  LEU A C   1 
ATOM   1470  O O   . LEU A 1 227 ? 61.962  -0.359  10.189  1.00 17.58 ? 227  LEU A O   1 
ATOM   1471  C CB  . LEU A 1 227 ? 63.522  -1.247  12.479  1.00 15.89 ? 227  LEU A CB  1 
ATOM   1472  C CG  . LEU A 1 227 ? 64.485  -1.451  13.649  1.00 16.04 ? 227  LEU A CG  1 
ATOM   1473  C CD1 . LEU A 1 227 ? 63.697  -1.400  14.938  1.00 15.89 ? 227  LEU A CD1 1 
ATOM   1474  C CD2 . LEU A 1 227 ? 65.229  -2.772  13.529  1.00 16.91 ? 227  LEU A CD2 1 
ATOM   1475  N N   . SER A 1 228 ? 63.145  -1.866  8.984   1.00 14.70 ? 228  SER A N   1 
ATOM   1476  C CA  . SER A 1 228 ? 62.149  -1.996  7.917   1.00 15.61 ? 228  SER A CA  1 
ATOM   1477  C C   . SER A 1 228 ? 61.086  -3.023  8.287   1.00 14.66 ? 228  SER A C   1 
ATOM   1478  O O   . SER A 1 228 ? 61.408  -4.166  8.616   1.00 14.94 ? 228  SER A O   1 
ATOM   1479  C CB  . SER A 1 228 ? 62.815  -2.388  6.596   1.00 16.66 ? 228  SER A CB  1 
ATOM   1480  O OG  . SER A 1 228 ? 63.691  -1.371  6.148   1.00 21.11 ? 228  SER A OG  1 
ATOM   1481  N N   . LEU A 1 229 ? 59.826  -2.589  8.266   1.00 14.24 ? 229  LEU A N   1 
ATOM   1482  C CA  . LEU A 1 229 ? 58.687  -3.447  8.590   1.00 14.26 ? 229  LEU A CA  1 
ATOM   1483  C C   . LEU A 1 229 ? 58.060  -4.032  7.327   1.00 14.32 ? 229  LEU A C   1 
ATOM   1484  O O   . LEU A 1 229 ? 57.821  -3.316  6.354   1.00 15.05 ? 229  LEU A O   1 
ATOM   1485  C CB  . LEU A 1 229 ? 57.640  -2.664  9.397   1.00 16.69 ? 229  LEU A CB  1 
ATOM   1486  C CG  . LEU A 1 229 ? 57.684  -2.616  10.936  1.00 20.59 ? 229  LEU A CG  1 
ATOM   1487  C CD1 . LEU A 1 229 ? 57.165  -3.924  11.505  1.00 22.01 ? 229  LEU A CD1 1 
ATOM   1488  C CD2 . LEU A 1 229 ? 59.081  -2.300  11.480  1.00 20.13 ? 229  LEU A CD2 1 
ATOM   1489  N N   . HIS A 1 230 ? 57.863  -5.352  7.337   1.00 12.52 ? 230  HIS A N   1 
ATOM   1490  C CA  . HIS A 1 230 ? 57.273  -6.084  6.213   1.00 12.16 ? 230  HIS A CA  1 
ATOM   1491  C C   . HIS A 1 230 ? 56.098  -6.894  6.744   1.00 12.52 ? 230  HIS A C   1 
ATOM   1492  O O   . HIS A 1 230 ? 56.106  -7.333  7.900   1.00 12.16 ? 230  HIS A O   1 
ATOM   1493  C CB  . HIS A 1 230 ? 58.292  -7.033  5.563   1.00 12.61 ? 230  HIS A CB  1 
ATOM   1494  C CG  . HIS A 1 230 ? 59.586  -6.379  5.180   1.00 13.57 ? 230  HIS A CG  1 
ATOM   1495  N ND1 . HIS A 1 230 ? 59.818  -5.861  3.923   1.00 14.80 ? 230  HIS A ND1 1 
ATOM   1496  C CD2 . HIS A 1 230 ? 60.716  -6.156  5.893   1.00 14.16 ? 230  HIS A CD2 1 
ATOM   1497  C CE1 . HIS A 1 230 ? 61.034  -5.346  3.880   1.00 13.93 ? 230  HIS A CE1 1 
ATOM   1498  N NE2 . HIS A 1 230 ? 61.600  -5.512  5.062   1.00 15.01 ? 230  HIS A NE2 1 
ATOM   1499  N N   . PHE A 1 231 ? 55.064  -7.053  5.917   1.00 11.66 ? 231  PHE A N   1 
ATOM   1500  C CA  . PHE A 1 231 ? 53.868  -7.782  6.324   1.00 12.52 ? 231  PHE A CA  1 
ATOM   1501  C C   . PHE A 1 231 ? 53.450  -8.855  5.334   1.00 14.07 ? 231  PHE A C   1 
ATOM   1502  O O   . PHE A 1 231 ? 53.093  -8.560  4.189   1.00 16.84 ? 231  PHE A O   1 
ATOM   1503  C CB  . PHE A 1 231 ? 52.698  -6.811  6.580   1.00 12.49 ? 231  PHE A CB  1 
ATOM   1504  C CG  . PHE A 1 231 ? 52.968  -5.806  7.672   1.00 12.46 ? 231  PHE A CG  1 
ATOM   1505  C CD1 . PHE A 1 231 ? 52.663  -6.105  9.013   1.00 13.20 ? 231  PHE A CD1 1 
ATOM   1506  C CD2 . PHE A 1 231 ? 53.579  -4.569  7.375   1.00 13.46 ? 231  PHE A CD2 1 
ATOM   1507  C CE1 . PHE A 1 231 ? 52.968  -5.187  10.055  1.00 14.44 ? 231  PHE A CE1 1 
ATOM   1508  C CE2 . PHE A 1 231 ? 53.891  -3.642  8.405   1.00 14.50 ? 231  PHE A CE2 1 
ATOM   1509  C CZ  . PHE A 1 231 ? 53.585  -3.955  9.749   1.00 14.98 ? 231  PHE A CZ  1 
ATOM   1510  N N   . VAL A 1 232 ? 53.557  -10.109 5.776   1.00 11.74 ? 232  VAL A N   1 
ATOM   1511  C CA  . VAL A 1 232 ? 53.165  -11.265 4.974   1.00 12.26 ? 232  VAL A CA  1 
ATOM   1512  C C   . VAL A 1 232 ? 51.834  -11.733 5.562   1.00 12.41 ? 232  VAL A C   1 
ATOM   1513  O O   . VAL A 1 232 ? 51.763  -12.098 6.733   1.00 13.88 ? 232  VAL A O   1 
ATOM   1514  C CB  . VAL A 1 232 ? 54.215  -12.405 5.047   1.00 11.19 ? 232  VAL A CB  1 
ATOM   1515  C CG1 . VAL A 1 232 ? 53.780  -13.582 4.199   1.00 11.77 ? 232  VAL A CG1 1 
ATOM   1516  C CG2 . VAL A 1 232 ? 55.546  -11.919 4.551   1.00 12.74 ? 232  VAL A CG2 1 
ATOM   1517  N N   . SER A 1 233 ? 50.785  -11.712 4.746   1.00 11.72 ? 233  SER A N   1 
ATOM   1518  C CA  . SER A 1 233 ? 49.451  -12.101 5.205   1.00 11.23 ? 233  SER A CA  1 
ATOM   1519  C C   . SER A 1 233 ? 48.717  -13.059 4.292   1.00 11.51 ? 233  SER A C   1 
ATOM   1520  O O   . SER A 1 233 ? 48.211  -14.093 4.740   1.00 11.21 ? 233  SER A O   1 
ATOM   1521  C CB  . SER A 1 233 ? 48.598  -10.852 5.430   1.00 11.97 ? 233  SER A CB  1 
ATOM   1522  O OG  . SER A 1 233 ? 48.580  -10.017 4.287   1.00 11.85 ? 233  SER A OG  1 
ATOM   1523  N N   . ASN A 1 234 ? 48.663  -12.706 3.010   1.00 10.48 ? 234  ASN A N   1 
ATOM   1524  C CA  . ASN A 1 234 ? 47.989  -13.501 1.987   1.00 10.69 ? 234  ASN A CA  1 
ATOM   1525  C C   . ASN A 1 234 ? 48.711  -14.831 1.791   1.00 11.00 ? 234  ASN A C   1 
ATOM   1526  O O   . ASN A 1 234 ? 49.938  -14.877 1.865   1.00 10.00 ? 234  ASN A O   1 
ATOM   1527  C CB  . ASN A 1 234 ? 47.998  -12.723 0.661   1.00 10.57 ? 234  ASN A CB  1 
ATOM   1528  C CG  . ASN A 1 234 ? 46.891  -13.146 -0.290  1.00 10.47 ? 234  ASN A CG  1 
ATOM   1529  O OD1 . ASN A 1 234 ? 46.338  -14.244 -0.187  1.00 10.84 ? 234  ASN A OD1 1 
ATOM   1530  N ND2 . ASN A 1 234 ? 46.583  -12.276 -1.249  1.00 10.86 ? 234  ASN A ND2 1 
ATOM   1531  N N   . VAL A 1 235 ? 47.953  -15.907 1.561   1.00 9.68  ? 235  VAL A N   1 
ATOM   1532  C CA  . VAL A 1 235 ? 48.566  -17.216 1.310   1.00 11.88 ? 235  VAL A CA  1 
ATOM   1533  C C   . VAL A 1 235 ? 49.075  -17.285 -0.134  1.00 10.67 ? 235  VAL A C   1 
ATOM   1534  O O   . VAL A 1 235 ? 49.790  -18.209 -0.502  1.00 13.33 ? 235  VAL A O   1 
ATOM   1535  C CB  . VAL A 1 235 ? 47.629  -18.401 1.663   1.00 12.21 ? 235  VAL A CB  1 
ATOM   1536  C CG1 . VAL A 1 235 ? 46.408  -18.429 0.795   1.00 13.63 ? 235  VAL A CG1 1 
ATOM   1537  C CG2 . VAL A 1 235 ? 48.386  -19.733 1.672   1.00 14.58 ? 235  VAL A CG2 1 
ATOM   1538  N N   . ASP A 1 236 ? 48.710  -16.289 -0.946  1.00 11.49 ? 236  ASP A N   1 
ATOM   1539  C CA  . ASP A 1 236 ? 49.191  -16.182 -2.326  1.00 9.72  ? 236  ASP A CA  1 
ATOM   1540  C C   . ASP A 1 236 ? 50.712  -16.116 -2.192  1.00 10.45 ? 236  ASP A C   1 
ATOM   1541  O O   . ASP A 1 236 ? 51.226  -15.256 -1.470  1.00 11.62 ? 236  ASP A O   1 
ATOM   1542  C CB  . ASP A 1 236 ? 48.690  -14.871 -2.952  1.00 11.06 ? 236  ASP A CB  1 
ATOM   1543  C CG  . ASP A 1 236 ? 49.081  -14.703 -4.423  1.00 12.22 ? 236  ASP A CG  1 
ATOM   1544  O OD1 . ASP A 1 236 ? 49.896  -15.482 -4.961  1.00 13.01 ? 236  ASP A OD1 1 
ATOM   1545  O OD2 . ASP A 1 236 ? 48.575  -13.749 -5.050  1.00 13.50 ? 236  ASP A OD2 1 
ATOM   1546  N N   . GLY A 1 237 ? 51.391  -17.057 -2.855  1.00 10.48 ? 237  GLY A N   1 
ATOM   1547  C CA  . GLY A 1 237 ? 52.848  -17.163 -2.831  1.00 10.40 ? 237  GLY A CA  1 
ATOM   1548  C C   . GLY A 1 237 ? 53.616  -15.896 -3.118  1.00 10.54 ? 237  GLY A C   1 
ATOM   1549  O O   . GLY A 1 237 ? 54.740  -15.724 -2.659  1.00 11.32 ? 237  GLY A O   1 
ATOM   1550  N N   . THR A 1 238 ? 52.951  -14.985 -3.823  1.00 10.28 ? 238  THR A N   1 
ATOM   1551  C CA  . THR A 1 238 ? 53.479  -13.680 -4.179  1.00 10.39 ? 238  THR A CA  1 
ATOM   1552  C C   . THR A 1 238 ? 53.856  -12.842 -2.959  1.00 11.26 ? 238  THR A C   1 
ATOM   1553  O O   . THR A 1 238 ? 54.886  -12.165 -2.974  1.00 10.90 ? 238  THR A O   1 
ATOM   1554  C CB  . THR A 1 238 ? 52.429  -12.927 -5.014  1.00 10.24 ? 238  THR A CB  1 
ATOM   1555  O OG1 . THR A 1 238 ? 52.391  -13.487 -6.328  1.00 11.80 ? 238  THR A OG1 1 
ATOM   1556  C CG2 . THR A 1 238 ? 52.682  -11.423 -5.071  1.00 11.83 ? 238  THR A CG2 1 
ATOM   1557  N N   . HIS A 1 239 ? 53.024  -12.896 -1.916  1.00 11.29 ? 239  HIS A N   1 
ATOM   1558  C CA  . HIS A 1 239 ? 53.256  -12.112 -0.702  1.00 11.39 ? 239  HIS A CA  1 
ATOM   1559  C C   . HIS A 1 239 ? 54.577  -12.444 0.003   1.00 13.01 ? 239  HIS A C   1 
ATOM   1560  O O   . HIS A 1 239 ? 55.370  -11.551 0.281   1.00 12.80 ? 239  HIS A O   1 
ATOM   1561  C CB  . HIS A 1 239 ? 52.063  -12.221 0.263   1.00 12.37 ? 239  HIS A CB  1 
ATOM   1562  C CG  . HIS A 1 239 ? 51.627  -10.905 0.845   1.00 12.04 ? 239  HIS A CG  1 
ATOM   1563  N ND1 . HIS A 1 239 ? 52.040  -9.689  0.344   1.00 17.09 ? 239  HIS A ND1 1 
ATOM   1564  C CD2 . HIS A 1 239 ? 50.808  -10.621 1.884   1.00 10.71 ? 239  HIS A CD2 1 
ATOM   1565  C CE1 . HIS A 1 239 ? 51.496  -8.713  1.055   1.00 15.94 ? 239  HIS A CE1 1 
ATOM   1566  N NE2 . HIS A 1 239 ? 50.745  -9.253  1.994   1.00 15.62 ? 239  HIS A NE2 1 
ATOM   1567  N N   . ILE A 1 240 ? 54.841  -13.725 0.241   1.00 13.79 ? 240  ILE A N   1 
ATOM   1568  C CA  . ILE A 1 240 ? 56.092  -14.108 0.891   1.00 13.68 ? 240  ILE A CA  1 
ATOM   1569  C C   . ILE A 1 240 ? 57.287  -13.961 -0.060  1.00 14.00 ? 240  ILE A C   1 
ATOM   1570  O O   . ILE A 1 240 ? 58.393  -13.635 0.363   1.00 14.87 ? 240  ILE A O   1 
ATOM   1571  C CB  . ILE A 1 240 ? 56.010  -15.567 1.446   1.00 13.87 ? 240  ILE A CB  1 
ATOM   1572  C CG1 . ILE A 1 240 ? 57.169  -15.876 2.397   1.00 17.99 ? 240  ILE A CG1 1 
ATOM   1573  C CG2 . ILE A 1 240 ? 56.060  -16.593 0.321   1.00 14.31 ? 240  ILE A CG2 1 
ATOM   1574  C CD1 . ILE A 1 240 ? 57.453  -14.791 3.422   1.00 20.31 ? 240  ILE A CD1 1 
ATOM   1575  N N   . ALA A 1 241 ? 57.027  -14.194 -1.343  1.00 12.71 ? 241  ALA A N   1 
ATOM   1576  C CA  . ALA A 1 241 ? 58.044  -14.117 -2.391  1.00 12.34 ? 241  ALA A CA  1 
ATOM   1577  C C   . ALA A 1 241 ? 58.636  -12.719 -2.529  1.00 11.46 ? 241  ALA A C   1 
ATOM   1578  O O   . ALA A 1 241 ? 59.858  -12.548 -2.598  1.00 12.25 ? 241  ALA A O   1 
ATOM   1579  C CB  . ALA A 1 241 ? 57.451  -14.545 -3.727  1.00 12.37 ? 241  ALA A CB  1 
ATOM   1580  N N   . GLU A 1 242 ? 57.749  -11.724 -2.566  1.00 11.33 ? 242  GLU A N   1 
ATOM   1581  C CA  . GLU A 1 242 ? 58.141  -10.325 -2.704  1.00 11.53 ? 242  GLU A CA  1 
ATOM   1582  C C   . GLU A 1 242 ? 58.862  -9.791  -1.476  1.00 11.11 ? 242  GLU A C   1 
ATOM   1583  O O   . GLU A 1 242 ? 59.746  -8.939  -1.590  1.00 12.93 ? 242  GLU A O   1 
ATOM   1584  C CB  . GLU A 1 242 ? 56.923  -9.452  -3.030  1.00 12.32 ? 242  GLU A CB  1 
ATOM   1585  C CG  . GLU A 1 242 ? 56.391  -9.635  -4.458  1.00 13.83 ? 242  GLU A CG  1 
ATOM   1586  C CD  . GLU A 1 242 ? 57.367  -9.146  -5.556  1.00 13.86 ? 242  GLU A CD  1 
ATOM   1587  O OE1 . GLU A 1 242 ? 58.268  -8.320  -5.262  1.00 17.13 ? 242  GLU A OE1 1 
ATOM   1588  O OE2 . GLU A 1 242 ? 57.230  -9.583  -6.724  1.00 14.08 ? 242  GLU A OE2 1 
ATOM   1589  N N   . VAL A 1 243 ? 58.504  -10.322 -0.306  1.00 11.40 ? 243  VAL A N   1 
ATOM   1590  C CA  . VAL A 1 243 ? 59.145  -9.926  0.948   1.00 10.87 ? 243  VAL A CA  1 
ATOM   1591  C C   . VAL A 1 243 ? 60.551  -10.538 1.003   1.00 11.55 ? 243  VAL A C   1 
ATOM   1592  O O   . VAL A 1 243 ? 61.501  -9.860  1.393   1.00 12.53 ? 243  VAL A O   1 
ATOM   1593  C CB  . VAL A 1 243 ? 58.289  -10.322 2.182   1.00 10.18 ? 243  VAL A CB  1 
ATOM   1594  C CG1 . VAL A 1 243 ? 59.091  -10.207 3.487   1.00 11.04 ? 243  VAL A CG1 1 
ATOM   1595  C CG2 . VAL A 1 243 ? 57.081  -9.402  2.265   1.00 12.32 ? 243  VAL A CG2 1 
ATOM   1596  N N   . LEU A 1 244 ? 60.677  -11.788 0.545   1.00 12.19 ? 244  LEU A N   1 
ATOM   1597  C CA  . LEU A 1 244 ? 61.971  -12.480 0.513   1.00 12.32 ? 244  LEU A CA  1 
ATOM   1598  C C   . LEU A 1 244 ? 62.968  -11.796 -0.431  1.00 13.77 ? 244  LEU A C   1 
ATOM   1599  O O   . LEU A 1 244 ? 64.179  -11.840 -0.200  1.00 14.32 ? 244  LEU A O   1 
ATOM   1600  C CB  . LEU A 1 244 ? 61.802  -13.958 0.145   1.00 12.67 ? 244  LEU A CB  1 
ATOM   1601  C CG  . LEU A 1 244 ? 61.151  -14.900 1.162   1.00 13.12 ? 244  LEU A CG  1 
ATOM   1602  C CD1 . LEU A 1 244 ? 60.979  -16.272 0.542   1.00 13.44 ? 244  LEU A CD1 1 
ATOM   1603  C CD2 . LEU A 1 244 ? 61.932  -14.969 2.463   1.00 13.95 ? 244  LEU A CD2 1 
ATOM   1604  N N   . LYS A 1 245 ? 62.436  -11.112 -1.450  1.00 14.38 ? 245  LYS A N   1 
ATOM   1605  C CA  . LYS A 1 245 ? 63.236  -10.359 -2.427  1.00 16.32 ? 245  LYS A CA  1 
ATOM   1606  C C   . LYS A 1 245 ? 63.713  -9.019  -1.853  1.00 17.48 ? 245  LYS A C   1 
ATOM   1607  O O   . LYS A 1 245 ? 64.711  -8.459  -2.319  1.00 18.34 ? 245  LYS A O   1 
ATOM   1608  C CB  . LYS A 1 245 ? 62.409  -10.048 -3.685  1.00 17.04 ? 245  LYS A CB  1 
ATOM   1609  C CG  . LYS A 1 245 ? 62.176  -11.200 -4.648  1.00 19.59 ? 245  LYS A CG  1 
ATOM   1610  C CD  . LYS A 1 245 ? 61.384  -10.732 -5.866  1.00 22.65 ? 245  LYS A CD  1 
ATOM   1611  C CE  . LYS A 1 245 ? 61.200  -11.847 -6.891  1.00 25.13 ? 245  LYS A CE  1 
ATOM   1612  N NZ  . LYS A 1 245 ? 62.470  -12.287 -7.508  1.00 29.05 ? 245  LYS A NZ  1 
ATOM   1613  N N   . SER A 1 246 ? 63.005  -8.535  -0.831  1.00 17.74 ? 246  SER A N   1 
ATOM   1614  C CA  . SER A 1 246 ? 63.279  -7.241  -0.197  1.00 19.35 ? 246  SER A CA  1 
ATOM   1615  C C   . SER A 1 246 ? 64.069  -7.295  1.117   1.00 20.18 ? 246  SER A C   1 
ATOM   1616  O O   . SER A 1 246 ? 64.376  -6.254  1.720   1.00 21.81 ? 246  SER A O   1 
ATOM   1617  C CB  . SER A 1 246 ? 61.950  -6.534  0.093   1.00 21.08 ? 246  SER A CB  1 
ATOM   1618  O OG  . SER A 1 246 ? 61.074  -6.673  -1.015  1.00 24.16 ? 246  SER A OG  1 
ATOM   1619  N N   . ILE A 1 247 ? 64.428  -8.472  1.578   1.00 18.64 ? 247  ILE A N   1 
ATOM   1620  C CA  . ILE A 1 247 ? 65.143  -8.569  2.863   1.00 19.12 ? 247  ILE A CA  1 
ATOM   1621  C C   . ILE A 1 247 ? 66.485  -9.293  2.767   1.00 19.40 ? 247  ILE A C   1 
ATOM   1622  O O   . ILE A 1 247 ? 66.765  -9.989  1.778   1.00 20.58 ? 247  ILE A O   1 
ATOM   1623  C CB  . ILE A 1 247 ? 64.326  -9.361  3.889   1.00 16.69 ? 247  ILE A CB  1 
ATOM   1624  C CG1 . ILE A 1 247 ? 64.044  -10.800 3.448   1.00 17.55 ? 247  ILE A CG1 1 
ATOM   1625  C CG2 . ILE A 1 247 ? 62.961  -8.740  4.182   1.00 15.82 ? 247  ILE A CG2 1 
ATOM   1626  C CD1 . ILE A 1 247 ? 63.544  -11.690 4.588   1.00 16.98 ? 247  ILE A CD1 1 
ATOM   1627  N N   . ASP A 1 248 ? 67.228  -9.053  3.834   1.00 20.00 ? 248  ASP A N   1 
ATOM   1628  C CA  . ASP A 1 248 ? 68.515  -9.691  4.135   1.00 19.83 ? 248  ASP A CA  1 
ATOM   1629  C C   . ASP A 1 248 ? 68.225  -10.630 5.305   1.00 18.14 ? 248  ASP A C   1 
ATOM   1630  O O   . ASP A 1 248 ? 68.328  -10.241 6.474   1.00 18.34 ? 248  ASP A O   1 
ATOM   1631  C CB  . ASP A 1 248 ? 69.554  -8.626  4.514   1.00 21.74 ? 248  ASP A CB  1 
ATOM   1632  C CG  . ASP A 1 248 ? 70.811  -9.216  5.166   1.00 25.18 ? 248  ASP A CG  1 
ATOM   1633  O OD1 . ASP A 1 248 ? 70.910  -10.491 5.340   1.00 26.02 ? 248  ASP A OD1 1 
ATOM   1634  O OD2 . ASP A 1 248 ? 71.772  -8.439  5.541   1.00 26.81 ? 248  ASP A OD2 1 
ATOM   1635  N N   . ILE A 1 249 ? 67.846  -11.832 4.929   1.00 17.42 ? 249  ILE A N   1 
ATOM   1636  C CA  . ILE A 1 249 ? 67.380  -12.876 5.861   1.00 18.30 ? 249  ILE A CA  1 
ATOM   1637  C C   . ILE A 1 249 ? 68.300  -13.071 7.091   1.00 18.04 ? 249  ILE A C   1 
ATOM   1638  O O   . ILE A 1 249 ? 67.856  -13.534 8.150   1.00 18.45 ? 249  ILE A O   1 
ATOM   1639  C CB  . ILE A 1 249 ? 67.224  -14.205 5.121   1.00 18.81 ? 249  ILE A CB  1 
ATOM   1640  C CG1 . ILE A 1 249 ? 66.216  -15.138 5.797   1.00 21.21 ? 249  ILE A CG1 1 
ATOM   1641  C CG2 . ILE A 1 249 ? 68.525  -14.995 5.015   1.00 20.99 ? 249  ILE A CG2 1 
ATOM   1642  C CD1 . ILE A 1 249 ? 65.201  -15.737 4.821   1.00 21.42 ? 249  ILE A CD1 1 
ATOM   1643  N N   . GLU A 1 250 ? 69.572  -12.727 6.970   1.00 18.44 ? 250  GLU A N   1 
ATOM   1644  C CA  . GLU A 1 250 ? 70.537  -12.872 8.097   1.00 18.11 ? 250  GLU A CA  1 
ATOM   1645  C C   . GLU A 1 250 ? 70.240  -11.847 9.186   1.00 17.20 ? 250  GLU A C   1 
ATOM   1646  O O   . GLU A 1 250 ? 70.549  -12.057 10.362  1.00 17.33 ? 250  GLU A O   1 
ATOM   1647  C CB  . GLU A 1 250 ? 71.963  -12.614 7.609   1.00 19.63 ? 250  GLU A CB  1 
ATOM   1648  C CG  . GLU A 1 250 ? 72.596  -13.814 6.907   1.00 23.51 ? 250  GLU A CG  1 
ATOM   1649  C CD  . GLU A 1 250 ? 73.983  -13.497 6.349   1.00 24.78 ? 250  GLU A CD  1 
ATOM   1650  O OE1 . GLU A 1 250 ? 74.977  -13.323 7.153   1.00 26.03 ? 250  GLU A OE1 1 
ATOM   1651  O OE2 . GLU A 1 250 ? 74.159  -13.399 5.075   1.00 27.27 ? 250  GLU A OE2 1 
ATOM   1652  N N   . ALA A 1 251 ? 69.624  -10.744 8.766   1.00 16.04 ? 251  ALA A N   1 
ATOM   1653  C CA  . ALA A 1 251 ? 69.272  -9.635  9.640   1.00 14.39 ? 251  ALA A CA  1 
ATOM   1654  C C   . ALA A 1 251 ? 67.753  -9.489  9.765   1.00 13.38 ? 251  ALA A C   1 
ATOM   1655  O O   . ALA A 1 251 ? 67.251  -8.397  10.043  1.00 14.41 ? 251  ALA A O   1 
ATOM   1656  C CB  . ALA A 1 251 ? 69.885  -8.349  9.085   1.00 14.66 ? 251  ALA A CB  1 
ATOM   1657  N N   . THR A 1 252 ? 67.034  -10.600 9.604   1.00 13.31 ? 252  THR A N   1 
ATOM   1658  C CA  . THR A 1 252 ? 65.575  -10.583 9.679   1.00 13.02 ? 252  THR A CA  1 
ATOM   1659  C C   . THR A 1 252 ? 64.961  -11.353 10.842  1.00 13.17 ? 252  THR A C   1 
ATOM   1660  O O   . THR A 1 252 ? 65.313  -12.505 11.099  1.00 13.17 ? 252  THR A O   1 
ATOM   1661  C CB  . THR A 1 252 ? 64.945  -11.104 8.359   1.00 12.46 ? 252  THR A CB  1 
ATOM   1662  O OG1 . THR A 1 252 ? 65.415  -10.313 7.263   1.00 13.17 ? 252  THR A OG1 1 
ATOM   1663  C CG2 . THR A 1 252 ? 63.418  -11.030 8.382   1.00 13.14 ? 252  THR A CG2 1 
ATOM   1664  N N   . LEU A 1 253 ? 64.018  -10.691 11.512  1.00 13.08 ? 253  LEU A N   1 
ATOM   1665  C CA  . LEU A 1 253 ? 63.256  -11.281 12.603  1.00 12.84 ? 253  LEU A CA  1 
ATOM   1666  C C   . LEU A 1 253 ? 61.860  -11.539 12.041  1.00 12.69 ? 253  LEU A C   1 
ATOM   1667  O O   . LEU A 1 253 ? 61.218  -10.624 11.513  1.00 12.74 ? 253  LEU A O   1 
ATOM   1668  C CB  . LEU A 1 253 ? 63.144  -10.324 13.801  1.00 14.11 ? 253  LEU A CB  1 
ATOM   1669  C CG  . LEU A 1 253 ? 62.202  -10.743 14.945  1.00 14.04 ? 253  LEU A CG  1 
ATOM   1670  C CD1 . LEU A 1 253 ? 62.793  -11.903 15.750  1.00 15.89 ? 253  LEU A CD1 1 
ATOM   1671  C CD2 . LEU A 1 253 ? 61.925  -9.551  15.829  1.00 15.27 ? 253  LEU A CD2 1 
ATOM   1672  N N   . PHE A 1 254 ? 61.422  -12.791 12.127  1.00 12.14 ? 254  PHE A N   1 
ATOM   1673  C CA  . PHE A 1 254 ? 60.095  -13.177 11.674  1.00 12.64 ? 254  PHE A CA  1 
ATOM   1674  C C   . PHE A 1 254 ? 59.198  -13.296 12.900  1.00 12.66 ? 254  PHE A C   1 
ATOM   1675  O O   . PHE A 1 254 ? 59.559  -13.932 13.897  1.00 12.38 ? 254  PHE A O   1 
ATOM   1676  C CB  . PHE A 1 254 ? 60.120  -14.511 10.926  1.00 13.21 ? 254  PHE A CB  1 
ATOM   1677  C CG  . PHE A 1 254 ? 60.854  -14.475 9.613   1.00 13.74 ? 254  PHE A CG  1 
ATOM   1678  C CD1 . PHE A 1 254 ? 60.240  -13.951 8.465   1.00 13.76 ? 254  PHE A CD1 1 
ATOM   1679  C CD2 . PHE A 1 254 ? 62.162  -14.986 9.510   1.00 14.27 ? 254  PHE A CD2 1 
ATOM   1680  C CE1 . PHE A 1 254 ? 60.916  -13.929 7.212   1.00 14.23 ? 254  PHE A CE1 1 
ATOM   1681  C CE2 . PHE A 1 254 ? 62.853  -14.977 8.271   1.00 15.40 ? 254  PHE A CE2 1 
ATOM   1682  C CZ  . PHE A 1 254 ? 62.228  -14.444 7.118   1.00 13.77 ? 254  PHE A CZ  1 
ATOM   1683  N N   . ILE A 1 255 ? 58.052  -12.624 12.839  1.00 11.99 ? 255  ILE A N   1 
ATOM   1684  C CA  . ILE A 1 255 ? 57.077  -12.636 13.920  1.00 13.03 ? 255  ILE A CA  1 
ATOM   1685  C C   . ILE A 1 255 ? 55.830  -13.378 13.428  1.00 13.39 ? 255  ILE A C   1 
ATOM   1686  O O   . ILE A 1 255 ? 55.131  -12.887 12.538  1.00 14.18 ? 255  ILE A O   1 
ATOM   1687  C CB  . ILE A 1 255 ? 56.684  -11.184 14.352  1.00 12.41 ? 255  ILE A CB  1 
ATOM   1688  C CG1 . ILE A 1 255 ? 57.918  -10.388 14.809  1.00 11.69 ? 255  ILE A CG1 1 
ATOM   1689  C CG2 . ILE A 1 255 ? 55.669  -11.230 15.465  1.00 13.56 ? 255  ILE A CG2 1 
ATOM   1690  C CD1 . ILE A 1 255 ? 57.634  -8.960  15.261  1.00 13.78 ? 255  ILE A CD1 1 
ATOM   1691  N N   . VAL A 1 256 ? 55.556  -14.550 14.003  1.00 13.22 ? 256  VAL A N   1 
ATOM   1692  C CA  . VAL A 1 256 ? 54.375  -15.326 13.611  1.00 13.43 ? 256  VAL A CA  1 
ATOM   1693  C C   . VAL A 1 256 ? 53.227  -14.964 14.562  1.00 14.21 ? 256  VAL A C   1 
ATOM   1694  O O   . VAL A 1 256 ? 53.221  -15.344 15.732  1.00 12.74 ? 256  VAL A O   1 
ATOM   1695  C CB  . VAL A 1 256 ? 54.644  -16.862 13.592  1.00 14.27 ? 256  VAL A CB  1 
ATOM   1696  C CG1 . VAL A 1 256 ? 53.482  -17.590 12.917  1.00 14.61 ? 256  VAL A CG1 1 
ATOM   1697  C CG2 . VAL A 1 256 ? 55.938  -17.175 12.842  1.00 13.79 ? 256  VAL A CG2 1 
ATOM   1698  N N   . ALA A 1 257 ? 52.287  -14.182 14.031  1.00 13.54 ? 257  ALA A N   1 
ATOM   1699  C CA  . ALA A 1 257 ? 51.130  -13.691 14.771  1.00 12.77 ? 257  ALA A CA  1 
ATOM   1700  C C   . ALA A 1 257 ? 49.865  -14.448 14.393  1.00 14.04 ? 257  ALA A C   1 
ATOM   1701  O O   . ALA A 1 257 ? 49.426  -14.418 13.241  1.00 13.75 ? 257  ALA A O   1 
ATOM   1702  C CB  . ALA A 1 257 ? 50.960  -12.204 14.513  1.00 12.93 ? 257  ALA A CB  1 
ATOM   1703  N N   . SER A 1 258 ? 49.285  -15.116 15.389  1.00 13.63 ? 258  SER A N   1 
ATOM   1704  C CA  . SER A 1 258 ? 48.076  -15.911 15.216  1.00 15.15 ? 258  SER A CA  1 
ATOM   1705  C C   . SER A 1 258 ? 47.505  -16.314 16.571  1.00 15.93 ? 258  SER A C   1 
ATOM   1706  O O   . SER A 1 258 ? 48.187  -16.953 17.373  1.00 15.77 ? 258  SER A O   1 
ATOM   1707  C CB  . SER A 1 258 ? 48.388  -17.159 14.392  1.00 15.44 ? 258  SER A CB  1 
ATOM   1708  O OG  . SER A 1 258 ? 47.235  -17.966 14.255  1.00 17.79 ? 258  SER A OG  1 
ATOM   1709  N N   . LYS A 1 259 ? 46.240  -15.959 16.796  1.00 16.09 ? 259  LYS A N   1 
ATOM   1710  C CA  . LYS A 1 259 ? 45.531  -16.267 18.041  1.00 16.65 ? 259  LYS A CA  1 
ATOM   1711  C C   . LYS A 1 259 ? 45.422  -17.759 18.306  1.00 17.06 ? 259  LYS A C   1 
ATOM   1712  O O   . LYS A 1 259 ? 45.701  -18.234 19.405  1.00 17.48 ? 259  LYS A O   1 
ATOM   1713  C CB  . LYS A 1 259 ? 44.118  -15.657 18.025  1.00 16.35 ? 259  LYS A CB  1 
ATOM   1714  C CG  . LYS A 1 259 ? 43.345  -15.873 19.341  1.00 17.53 ? 259  LYS A CG  1 
ATOM   1715  C CD  . LYS A 1 259 ? 42.065  -15.060 19.428  1.00 16.42 ? 259  LYS A CD  1 
ATOM   1716  C CE  . LYS A 1 259 ? 41.360  -15.251 20.766  1.00 16.23 ? 259  LYS A CE  1 
ATOM   1717  N NZ  . LYS A 1 259 ? 40.065  -14.517 20.842  1.00 16.17 ? 259  LYS A NZ  1 
ATOM   1718  N N   . THR A 1 260 ? 45.025  -18.481 17.268  1.00 17.45 ? 260  THR A N   1 
ATOM   1719  C CA  . THR A 1 260 ? 44.825  -19.921 17.339  1.00 17.83 ? 260  THR A CA  1 
ATOM   1720  C C   . THR A 1 260 ? 46.098  -20.699 17.023  1.00 18.64 ? 260  THR A C   1 
ATOM   1721  O O   . THR A 1 260 ? 46.349  -21.774 17.581  1.00 18.09 ? 260  THR A O   1 
ATOM   1722  C CB  . THR A 1 260 ? 43.735  -20.346 16.328  1.00 18.37 ? 260  THR A CB  1 
ATOM   1723  O OG1 . THR A 1 260 ? 44.165  -20.002 15.004  1.00 17.71 ? 260  THR A OG1 1 
ATOM   1724  C CG2 . THR A 1 260 ? 42.411  -19.629 16.594  1.00 18.72 ? 260  THR A CG2 1 
ATOM   1725  N N   . PHE A 1 261 ? 46.889  -20.133 16.111  1.00 18.10 ? 261  PHE A N   1 
ATOM   1726  C CA  . PHE A 1 261 ? 48.142  -20.719 15.617  1.00 18.17 ? 261  PHE A CA  1 
ATOM   1727  C C   . PHE A 1 261 ? 47.870  -21.940 14.755  1.00 18.16 ? 261  PHE A C   1 
ATOM   1728  O O   . PHE A 1 261 ? 48.688  -22.862 14.679  1.00 20.33 ? 261  PHE A O   1 
ATOM   1729  C CB  . PHE A 1 261 ? 49.126  -21.051 16.745  1.00 18.55 ? 261  PHE A CB  1 
ATOM   1730  C CG  . PHE A 1 261 ? 50.546  -20.700 16.426  1.00 17.95 ? 261  PHE A CG  1 
ATOM   1731  C CD1 . PHE A 1 261 ? 50.976  -19.367 16.519  1.00 17.26 ? 261  PHE A CD1 1 
ATOM   1732  C CD2 . PHE A 1 261 ? 51.463  -21.683 16.013  1.00 16.96 ? 261  PHE A CD2 1 
ATOM   1733  C CE1 . PHE A 1 261 ? 52.298  -19.009 16.203  1.00 17.45 ? 261  PHE A CE1 1 
ATOM   1734  C CE2 . PHE A 1 261 ? 52.796  -21.340 15.690  1.00 17.99 ? 261  PHE A CE2 1 
ATOM   1735  C CZ  . PHE A 1 261 ? 53.213  -19.999 15.787  1.00 17.17 ? 261  PHE A CZ  1 
ATOM   1736  N N   . THR A 1 262 ? 46.697  -21.939 14.124  1.00 19.11 ? 262  THR A N   1 
ATOM   1737  C CA  . THR A 1 262 ? 46.261  -23.036 13.256  1.00 18.50 ? 262  THR A CA  1 
ATOM   1738  C C   . THR A 1 262 ? 45.709  -22.513 11.921  1.00 18.29 ? 262  THR A C   1 
ATOM   1739  O O   . THR A 1 262 ? 45.397  -23.304 11.022  1.00 19.92 ? 262  THR A O   1 
ATOM   1740  C CB  . THR A 1 262 ? 45.159  -23.903 13.922  1.00 18.68 ? 262  THR A CB  1 
ATOM   1741  O OG1 . THR A 1 262 ? 44.024  -23.085 14.207  1.00 18.58 ? 262  THR A OG1 1 
ATOM   1742  C CG2 . THR A 1 262 ? 45.636  -24.547 15.218  1.00 19.38 ? 262  THR A CG2 1 
ATOM   1743  N N   . THR A 1 263 ? 45.582  -21.189 11.797  1.00 17.47 ? 263  THR A N   1 
ATOM   1744  C CA  . THR A 1 263 ? 45.069  -20.552 10.569  1.00 16.59 ? 263  THR A CA  1 
ATOM   1745  C C   . THR A 1 263 ? 45.961  -20.969 9.399   1.00 16.53 ? 263  THR A C   1 
ATOM   1746  O O   . THR A 1 263 ? 47.178  -20.752 9.429   1.00 15.29 ? 263  THR A O   1 
ATOM   1747  C CB  . THR A 1 263 ? 45.051  -19.012 10.707  1.00 17.21 ? 263  THR A CB  1 
ATOM   1748  O OG1 . THR A 1 263 ? 44.268  -18.659 11.849  1.00 17.80 ? 263  THR A OG1 1 
ATOM   1749  C CG2 . THR A 1 263 ? 44.464  -18.328 9.485   1.00 16.80 ? 263  THR A CG2 1 
ATOM   1750  N N   . GLN A 1 264 ? 45.340  -21.616 8.409   1.00 15.13 ? 264  GLN A N   1 
ATOM   1751  C CA  . GLN A 1 264 ? 46.031  -22.139 7.229   1.00 15.14 ? 264  GLN A CA  1 
ATOM   1752  C C   . GLN A 1 264 ? 46.978  -21.165 6.534   1.00 14.37 ? 264  GLN A C   1 
ATOM   1753  O O   . GLN A 1 264 ? 48.122  -21.517 6.271   1.00 13.12 ? 264  GLN A O   1 
ATOM   1754  C CB  . GLN A 1 264 ? 45.038  -22.741 6.231   1.00 16.30 ? 264  GLN A CB  1 
ATOM   1755  C CG  . GLN A 1 264 ? 45.702  -23.626 5.170   1.00 18.78 ? 264  GLN A CG  1 
ATOM   1756  C CD  . GLN A 1 264 ? 44.718  -24.434 4.355   1.00 20.69 ? 264  GLN A CD  1 
ATOM   1757  O OE1 . GLN A 1 264 ? 44.835  -25.660 4.258   1.00 23.92 ? 264  GLN A OE1 1 
ATOM   1758  N NE2 . GLN A 1 264 ? 43.759  -23.756 3.744   1.00 19.36 ? 264  GLN A NE2 1 
ATOM   1759  N N   . GLU A 1 265 ? 46.525  -19.931 6.325   1.00 12.96 ? 265  GLU A N   1 
ATOM   1760  C CA  . GLU A 1 265 ? 47.335  -18.893 5.682   1.00 14.09 ? 265  GLU A CA  1 
ATOM   1761  C C   . GLU A 1 265 ? 48.638  -18.597 6.416   1.00 12.75 ? 265  GLU A C   1 
ATOM   1762  O O   . GLU A 1 265 ? 49.722  -18.635 5.828   1.00 13.23 ? 265  GLU A O   1 
ATOM   1763  C CB  . GLU A 1 265 ? 46.544  -17.583 5.583   1.00 14.43 ? 265  GLU A CB  1 
ATOM   1764  C CG  . GLU A 1 265 ? 45.491  -17.541 4.492   1.00 17.01 ? 265  GLU A CG  1 
ATOM   1765  C CD  . GLU A 1 265 ? 44.099  -17.931 4.922   1.00 16.21 ? 265  GLU A CD  1 
ATOM   1766  O OE1 . GLU A 1 265 ? 43.916  -18.740 5.857   1.00 17.32 ? 265  GLU A OE1 1 
ATOM   1767  O OE2 . GLU A 1 265 ? 43.158  -17.384 4.308   1.00 18.71 ? 265  GLU A OE2 1 
ATOM   1768  N N   . THR A 1 266 ? 48.508  -18.362 7.719   1.00 13.18 ? 266  THR A N   1 
ATOM   1769  C CA  . THR A 1 266 ? 49.623  -18.017 8.589   1.00 11.94 ? 266  THR A CA  1 
ATOM   1770  C C   . THR A 1 266 ? 50.628  -19.143 8.781   1.00 11.79 ? 266  THR A C   1 
ATOM   1771  O O   . THR A 1 266 ? 51.830  -18.906 8.686   1.00 12.42 ? 266  THR A O   1 
ATOM   1772  C CB  . THR A 1 266 ? 49.094  -17.470 9.930   1.00 13.25 ? 266  THR A CB  1 
ATOM   1773  O OG1 . THR A 1 266 ? 48.188  -16.396 9.649   1.00 12.52 ? 266  THR A OG1 1 
ATOM   1774  C CG2 . THR A 1 266 ? 50.226  -16.934 10.806  1.00 12.84 ? 266  THR A CG2 1 
ATOM   1775  N N   . ILE A 1 267 ? 50.135  -20.367 8.979   1.00 12.59 ? 267  ILE A N   1 
ATOM   1776  C CA  . ILE A 1 267 ? 51.017  -21.522 9.158   1.00 13.74 ? 267  ILE A CA  1 
ATOM   1777  C C   . ILE A 1 267 ? 51.756  -21.855 7.861   1.00 12.93 ? 267  ILE A C   1 
ATOM   1778  O O   . ILE A 1 267 ? 52.961  -22.099 7.900   1.00 13.62 ? 267  ILE A O   1 
ATOM   1779  C CB  . ILE A 1 267 ? 50.251  -22.753 9.750   1.00 14.99 ? 267  ILE A CB  1 
ATOM   1780  C CG1 . ILE A 1 267 ? 49.581  -22.359 11.074  1.00 17.77 ? 267  ILE A CG1 1 
ATOM   1781  C CG2 . ILE A 1 267 ? 51.195  -23.953 9.991   1.00 17.27 ? 267  ILE A CG2 1 
ATOM   1782  C CD1 . ILE A 1 267 ? 50.482  -21.631 12.089  1.00 20.22 ? 267  ILE A CD1 1 
ATOM   1783  N N   . THR A 1 268 ? 51.070  -21.742 6.719   1.00 12.93 ? 268  THR A N   1 
ATOM   1784  C CA  . THR A 1 268 ? 51.679  -22.007 5.404   1.00 12.77 ? 268  THR A CA  1 
ATOM   1785  C C   . THR A 1 268 ? 52.799  -20.991 5.134   1.00 12.44 ? 268  THR A C   1 
ATOM   1786  O O   . THR A 1 268 ? 53.895  -21.369 4.712   1.00 12.73 ? 268  THR A O   1 
ATOM   1787  C CB  . THR A 1 268 ? 50.630  -21.941 4.261   1.00 13.55 ? 268  THR A CB  1 
ATOM   1788  O OG1 . THR A 1 268 ? 49.588  -22.891 4.522   1.00 15.81 ? 268  THR A OG1 1 
ATOM   1789  C CG2 . THR A 1 268 ? 51.251  -22.268 2.904   1.00 12.83 ? 268  THR A CG2 1 
ATOM   1790  N N   . ASN A 1 269 ? 52.528  -19.717 5.433   1.00 11.35 ? 269  ASN A N   1 
ATOM   1791  C CA  . ASN A 1 269 ? 53.513  -18.646 5.253   1.00 11.35 ? 269  ASN A CA  1 
ATOM   1792  C C   . ASN A 1 269 ? 54.688  -18.786 6.218   1.00 12.52 ? 269  ASN A C   1 
ATOM   1793  O O   . ASN A 1 269 ? 55.842  -18.602 5.817   1.00 12.83 ? 269  ASN A O   1 
ATOM   1794  C CB  . ASN A 1 269 ? 52.868  -17.271 5.447   1.00 10.73 ? 269  ASN A CB  1 
ATOM   1795  C CG  . ASN A 1 269 ? 52.180  -16.758 4.202   1.00 12.49 ? 269  ASN A CG  1 
ATOM   1796  O OD1 . ASN A 1 269 ? 52.585  -17.057 3.082   1.00 12.72 ? 269  ASN A OD1 1 
ATOM   1797  N ND2 . ASN A 1 269 ? 51.161  -15.925 4.398   1.00 10.82 ? 269  ASN A ND2 1 
ATOM   1798  N N   . ALA A 1 270 ? 54.387  -19.161 7.466   1.00 12.07 ? 270  ALA A N   1 
ATOM   1799  C CA  . ALA A 1 270 ? 55.401  -19.350 8.512   1.00 13.07 ? 270  ALA A CA  1 
ATOM   1800  C C   . ALA A 1 270 ? 56.354  -20.494 8.171   1.00 12.98 ? 270  ALA A C   1 
ATOM   1801  O O   . ALA A 1 270 ? 57.570  -20.366 8.357   1.00 13.72 ? 270  ALA A O   1 
ATOM   1802  C CB  . ALA A 1 270 ? 54.743  -19.592 9.860   1.00 14.11 ? 270  ALA A CB  1 
ATOM   1803  N N   . LEU A 1 271 ? 55.799  -21.570 7.602   1.00 13.80 ? 271  LEU A N   1 
ATOM   1804  C CA  . LEU A 1 271 ? 56.577  -22.740 7.184   1.00 13.82 ? 271  LEU A CA  1 
ATOM   1805  C C   . LEU A 1 271 ? 57.481  -22.408 5.999   1.00 14.78 ? 271  LEU A C   1 
ATOM   1806  O O   . LEU A 1 271 ? 58.598  -22.916 5.908   1.00 14.68 ? 271  LEU A O   1 
ATOM   1807  C CB  . LEU A 1 271 ? 55.659  -23.915 6.830   1.00 14.78 ? 271  LEU A CB  1 
ATOM   1808  C CG  . LEU A 1 271 ? 54.906  -24.613 7.970   1.00 17.34 ? 271  LEU A CG  1 
ATOM   1809  C CD1 . LEU A 1 271 ? 53.956  -25.646 7.383   1.00 18.01 ? 271  LEU A CD1 1 
ATOM   1810  C CD2 . LEU A 1 271 ? 55.872  -25.261 8.954   1.00 18.66 ? 271  LEU A CD2 1 
ATOM   1811  N N   . SER A 1 272 ? 57.010  -21.518 5.122   1.00 13.54 ? 272  SER A N   1 
ATOM   1812  C CA  . SER A 1 272 ? 57.795  -21.094 3.962   1.00 12.83 ? 272  SER A CA  1 
ATOM   1813  C C   . SER A 1 272 ? 58.900  -20.139 4.362   1.00 12.85 ? 272  SER A C   1 
ATOM   1814  O O   . SER A 1 272 ? 59.970  -20.141 3.750   1.00 14.92 ? 272  SER A O   1 
ATOM   1815  C CB  . SER A 1 272 ? 56.917  -20.453 2.904   1.00 13.76 ? 272  SER A CB  1 
ATOM   1816  O OG  . SER A 1 272 ? 56.159  -21.457 2.267   1.00 14.92 ? 272  SER A OG  1 
ATOM   1817  N N   . ALA A 1 273 ? 58.635  -19.342 5.403   1.00 13.50 ? 273  ALA A N   1 
ATOM   1818  C CA  . ALA A 1 273 ? 59.612  -18.393 5.937   1.00 12.08 ? 273  ALA A CA  1 
ATOM   1819  C C   . ALA A 1 273 ? 60.723  -19.175 6.633   1.00 13.60 ? 273  ALA A C   1 
ATOM   1820  O O   . ALA A 1 273 ? 61.901  -18.814 6.526   1.00 13.55 ? 273  ALA A O   1 
ATOM   1821  C CB  . ALA A 1 273 ? 58.952  -17.441 6.911   1.00 11.86 ? 273  ALA A CB  1 
ATOM   1822  N N   . ARG A 1 274 ? 60.343  -20.269 7.305   1.00 14.11 ? 274  ARG A N   1 
ATOM   1823  C CA  . ARG A 1 274 ? 61.298  -21.138 8.000   1.00 15.37 ? 274  ARG A CA  1 
ATOM   1824  C C   . ARG A 1 274 ? 62.161  -21.885 6.993   1.00 15.33 ? 274  ARG A C   1 
ATOM   1825  O O   . ARG A 1 274 ? 63.386  -21.943 7.155   1.00 15.29 ? 274  ARG A O   1 
ATOM   1826  C CB  . ARG A 1 274 ? 60.584  -22.118 8.942   1.00 17.33 ? 274  ARG A CB  1 
ATOM   1827  C CG  . ARG A 1 274 ? 61.521  -22.791 9.949   1.00 19.48 ? 274  ARG A CG  1 
ATOM   1828  C CD  . ARG A 1 274 ? 60.791  -23.758 10.855  1.00 22.91 ? 274  ARG A CD  1 
ATOM   1829  N NE  . ARG A 1 274 ? 60.272  -24.916 10.129  1.00 24.66 ? 274  ARG A NE  1 
ATOM   1830  C CZ  . ARG A 1 274 ? 59.374  -25.773 10.610  1.00 26.77 ? 274  ARG A CZ  1 
ATOM   1831  N NH1 . ARG A 1 274 ? 58.872  -25.614 11.830  1.00 27.89 ? 274  ARG A NH1 1 
ATOM   1832  N NH2 . ARG A 1 274 ? 58.979  -26.800 9.870   1.00 27.75 ? 274  ARG A NH2 1 
ATOM   1833  N N   . ARG A 1 275 ? 61.527  -22.367 5.919   1.00 15.61 ? 275  ARG A N   1 
ATOM   1834  C CA  . ARG A 1 275 ? 62.223  -23.086 4.850   1.00 16.95 ? 275  ARG A CA  1 
ATOM   1835  C C   . ARG A 1 275 ? 63.220  -22.150 4.165   1.00 16.25 ? 275  ARG A C   1 
ATOM   1836  O O   . ARG A 1 275 ? 64.336  -22.561 3.862   1.00 15.78 ? 275  ARG A O   1 
ATOM   1837  C CB  . ARG A 1 275 ? 61.240  -23.651 3.815   1.00 19.21 ? 275  ARG A CB  1 
ATOM   1838  C CG  . ARG A 1 275 ? 61.881  -24.664 2.854   1.00 24.38 ? 275  ARG A CG  1 
ATOM   1839  C CD  . ARG A 1 275 ? 61.103  -24.842 1.562   1.00 27.76 ? 275  ARG A CD  1 
ATOM   1840  N NE  . ARG A 1 275 ? 61.868  -25.635 0.597   1.00 31.32 ? 275  ARG A NE  1 
ATOM   1841  C CZ  . ARG A 1 275 ? 61.359  -26.232 -0.479  1.00 32.95 ? 275  ARG A CZ  1 
ATOM   1842  N NH1 . ARG A 1 275 ? 60.064  -26.140 -0.758  1.00 34.46 ? 275  ARG A NH1 1 
ATOM   1843  N NH2 . ARG A 1 275 ? 62.154  -26.923 -1.287  1.00 34.30 ? 275  ARG A NH2 1 
ATOM   1844  N N   . ALA A 1 276 ? 62.840  -20.876 4.024   1.00 15.72 ? 276  ALA A N   1 
ATOM   1845  C CA  . ALA A 1 276 ? 63.692  -19.861 3.401   1.00 14.91 ? 276  ALA A CA  1 
ATOM   1846  C C   . ALA A 1 276 ? 64.958  -19.590 4.216   1.00 14.54 ? 276  ALA A C   1 
ATOM   1847  O O   . ALA A 1 276 ? 66.049  -19.482 3.649   1.00 15.39 ? 276  ALA A O   1 
ATOM   1848  C CB  . ALA A 1 276 ? 62.912  -18.571 3.183   1.00 14.86 ? 276  ALA A CB  1 
ATOM   1849  N N   . LEU A 1 277 ? 64.817  -19.538 5.545   1.00 14.61 ? 277  LEU A N   1 
ATOM   1850  C CA  . LEU A 1 277 ? 65.958  -19.314 6.440   1.00 14.20 ? 277  LEU A CA  1 
ATOM   1851  C C   . LEU A 1 277 ? 66.938  -20.482 6.336   1.00 14.00 ? 277  LEU A C   1 
ATOM   1852  O O   . LEU A 1 277 ? 68.131  -20.267 6.119   1.00 15.51 ? 277  LEU A O   1 
ATOM   1853  C CB  . LEU A 1 277 ? 65.499  -19.146 7.901   1.00 15.29 ? 277  LEU A CB  1 
ATOM   1854  C CG  . LEU A 1 277 ? 66.594  -19.033 8.981   1.00 16.16 ? 277  LEU A CG  1 
ATOM   1855  C CD1 . LEU A 1 277 ? 67.407  -17.751 8.812   1.00 16.84 ? 277  LEU A CD1 1 
ATOM   1856  C CD2 . LEU A 1 277 ? 65.971  -19.103 10.358  1.00 16.48 ? 277  LEU A CD2 1 
ATOM   1857  N N   . LEU A 1 278 ? 66.404  -21.702 6.407   1.00 14.76 ? 278  LEU A N   1 
ATOM   1858  C CA  . LEU A 1 278 ? 67.208  -22.919 6.331   1.00 16.05 ? 278  LEU A CA  1 
ATOM   1859  C C   . LEU A 1 278 ? 67.833  -23.145 4.950   1.00 16.72 ? 278  LEU A C   1 
ATOM   1860  O O   . LEU A 1 278 ? 68.962  -23.634 4.859   1.00 17.72 ? 278  LEU A O   1 
ATOM   1861  C CB  . LEU A 1 278 ? 66.390  -24.140 6.782   1.00 17.50 ? 278  LEU A CB  1 
ATOM   1862  C CG  . LEU A 1 278 ? 65.768  -24.117 8.189   1.00 20.03 ? 278  LEU A CG  1 
ATOM   1863  C CD1 . LEU A 1 278 ? 64.934  -25.370 8.389   1.00 21.62 ? 278  LEU A CD1 1 
ATOM   1864  C CD2 . LEU A 1 278 ? 66.819  -23.998 9.289   1.00 22.23 ? 278  LEU A CD2 1 
ATOM   1865  N N   . ASP A 1 279 ? 67.128  -22.723 3.895   1.00 16.63 ? 279  ASP A N   1 
ATOM   1866  C CA  . ASP A 1 279 ? 67.617  -22.834 2.511   1.00 16.52 ? 279  ASP A CA  1 
ATOM   1867  C C   . ASP A 1 279 ? 68.801  -21.889 2.276   1.00 15.60 ? 279  ASP A C   1 
ATOM   1868  O O   . ASP A 1 279 ? 69.768  -22.259 1.604   1.00 15.28 ? 279  ASP A O   1 
ATOM   1869  C CB  . ASP A 1 279 ? 66.510  -22.503 1.498   1.00 17.80 ? 279  ASP A CB  1 
ATOM   1870  C CG  . ASP A 1 279 ? 65.592  -23.687 1.194   1.00 19.41 ? 279  ASP A CG  1 
ATOM   1871  O OD1 . ASP A 1 279 ? 65.782  -24.793 1.749   1.00 19.42 ? 279  ASP A OD1 1 
ATOM   1872  O OD2 . ASP A 1 279 ? 64.661  -23.499 0.384   1.00 20.91 ? 279  ASP A OD2 1 
ATOM   1873  N N   . TYR A 1 280 ? 68.735  -20.689 2.862   1.00 15.86 ? 280  TYR A N   1 
ATOM   1874  C CA  . TYR A 1 280 ? 69.806  -19.695 2.734   1.00 16.32 ? 280  TYR A CA  1 
ATOM   1875  C C   . TYR A 1 280 ? 71.080  -20.185 3.404   1.00 16.59 ? 280  TYR A C   1 
ATOM   1876  O O   . TYR A 1 280 ? 72.160  -20.097 2.820   1.00 16.63 ? 280  TYR A O   1 
ATOM   1877  C CB  . TYR A 1 280 ? 69.404  -18.345 3.349   1.00 18.02 ? 280  TYR A CB  1 
ATOM   1878  C CG  . TYR A 1 280 ? 70.485  -17.280 3.237   1.00 20.47 ? 280  TYR A CG  1 
ATOM   1879  C CD1 . TYR A 1 280 ? 70.680  -16.571 2.034   1.00 21.54 ? 280  TYR A CD1 1 
ATOM   1880  C CD2 . TYR A 1 280 ? 71.363  -17.020 4.317   1.00 20.63 ? 280  TYR A CD2 1 
ATOM   1881  C CE1 . TYR A 1 280 ? 71.735  -15.621 1.904   1.00 23.89 ? 280  TYR A CE1 1 
ATOM   1882  C CE2 . TYR A 1 280 ? 72.416  -16.086 4.192   1.00 23.18 ? 280  TYR A CE2 1 
ATOM   1883  C CZ  . TYR A 1 280 ? 72.594  -15.393 2.989   1.00 24.55 ? 280  TYR A CZ  1 
ATOM   1884  O OH  . TYR A 1 280 ? 73.625  -14.488 2.866   1.00 26.76 ? 280  TYR A OH  1 
ATOM   1885  N N   . LEU A 1 281 ? 70.945  -20.635 4.651   1.00 17.40 ? 281  LEU A N   1 
ATOM   1886  C CA  . LEU A 1 281 ? 72.081  -21.131 5.426   1.00 18.75 ? 281  LEU A CA  1 
ATOM   1887  C C   . LEU A 1 281 ? 72.737  -22.348 4.780   1.00 20.22 ? 281  LEU A C   1 
ATOM   1888  O O   . LEU A 1 281 ? 73.965  -22.427 4.720   1.00 20.31 ? 281  LEU A O   1 
ATOM   1889  C CB  . LEU A 1 281 ? 71.657  -21.437 6.866   1.00 18.37 ? 281  LEU A CB  1 
ATOM   1890  C CG  . LEU A 1 281 ? 71.121  -20.263 7.694   1.00 18.43 ? 281  LEU A CG  1 
ATOM   1891  C CD1 . LEU A 1 281 ? 70.512  -20.799 8.964   1.00 18.80 ? 281  LEU A CD1 1 
ATOM   1892  C CD2 . LEU A 1 281 ? 72.198  -19.223 8.006   1.00 19.51 ? 281  LEU A CD2 1 
ATOM   1893  N N   . ARG A 1 282 ? 71.915  -23.227 4.201   1.00 20.10 ? 282  ARG A N   1 
ATOM   1894  C CA  . ARG A 1 282 ? 72.397  -24.439 3.529   1.00 20.87 ? 282  ARG A CA  1 
ATOM   1895  C C   . ARG A 1 282 ? 73.184  -24.112 2.252   1.00 21.66 ? 282  ARG A C   1 
ATOM   1896  O O   . ARG A 1 282 ? 74.188  -24.768 1.951   1.00 21.57 ? 282  ARG A O   1 
ATOM   1897  C CB  . ARG A 1 282 ? 71.229  -25.360 3.187   1.00 23.22 ? 282  ARG A CB  1 
ATOM   1898  C CG  . ARG A 1 282 ? 71.594  -26.838 3.054   1.00 26.48 ? 282  ARG A CG  1 
ATOM   1899  C CD  . ARG A 1 282 ? 70.400  -27.688 2.622   1.00 27.79 ? 282  ARG A CD  1 
ATOM   1900  N NE  . ARG A 1 282 ? 69.284  -27.645 3.573   1.00 29.62 ? 282  ARG A NE  1 
ATOM   1901  C CZ  . ARG A 1 282 ? 68.066  -27.175 3.297   1.00 30.92 ? 282  ARG A CZ  1 
ATOM   1902  N NH1 . ARG A 1 282 ? 67.785  -26.694 2.087   1.00 30.48 ? 282  ARG A NH1 1 
ATOM   1903  N NH2 . ARG A 1 282 ? 67.136  -27.160 4.240   1.00 29.88 ? 282  ARG A NH2 1 
ATOM   1904  N N   . SER A 1 283 ? 72.746  -23.069 1.540   1.00 19.47 ? 283  SER A N   1 
ATOM   1905  C CA  . SER A 1 283 ? 73.390  -22.626 0.298   1.00 19.48 ? 283  SER A CA  1 
ATOM   1906  C C   . SER A 1 283 ? 74.749  -21.966 0.535   1.00 19.71 ? 283  SER A C   1 
ATOM   1907  O O   . SER A 1 283 ? 75.597  -21.933 -0.356  1.00 18.23 ? 283  SER A O   1 
ATOM   1908  C CB  . SER A 1 283 ? 72.478  -21.660 -0.458  1.00 17.50 ? 283  SER A CB  1 
ATOM   1909  O OG  . SER A 1 283 ? 72.408  -20.382 0.154   1.00 18.11 ? 283  SER A OG  1 
ATOM   1910  N N   . ARG A 1 284 ? 74.919  -21.434 1.746   1.00 20.90 ? 284  ARG A N   1 
ATOM   1911  C CA  . ARG A 1 284 ? 76.144  -20.761 2.176   1.00 24.17 ? 284  ARG A CA  1 
ATOM   1912  C C   . ARG A 1 284 ? 77.049  -21.720 2.960   1.00 25.96 ? 284  ARG A C   1 
ATOM   1913  O O   . ARG A 1 284 ? 78.162  -21.351 3.345   1.00 26.35 ? 284  ARG A O   1 
ATOM   1914  C CB  . ARG A 1 284 ? 75.791  -19.565 3.059   1.00 25.62 ? 284  ARG A CB  1 
ATOM   1915  C CG  . ARG A 1 284 ? 75.134  -18.365 2.368   1.00 28.03 ? 284  ARG A CG  1 
ATOM   1916  C CD  . ARG A 1 284 ? 76.150  -17.405 1.740   1.00 31.59 ? 284  ARG A CD  1 
ATOM   1917  N NE  . ARG A 1 284 ? 77.246  -17.041 2.645   1.00 33.38 ? 284  ARG A NE  1 
ATOM   1918  C CZ  . ARG A 1 284 ? 77.205  -16.091 3.580   1.00 35.24 ? 284  ARG A CZ  1 
ATOM   1919  N NH1 . ARG A 1 284 ? 76.110  -15.361 3.769   1.00 35.66 ? 284  ARG A NH1 1 
ATOM   1920  N NH2 . ARG A 1 284 ? 78.270  -15.879 4.346   1.00 35.56 ? 284  ARG A NH2 1 
ATOM   1921  N N   . GLY A 1 285 ? 76.542  -22.929 3.218   1.00 26.93 ? 285  GLY A N   1 
ATOM   1922  C CA  . GLY A 1 285 ? 77.281  -23.951 3.952   1.00 29.06 ? 285  GLY A CA  1 
ATOM   1923  C C   . GLY A 1 285 ? 77.332  -23.772 5.461   1.00 29.90 ? 285  GLY A C   1 
ATOM   1924  O O   . GLY A 1 285 ? 78.090  -24.472 6.138   1.00 31.93 ? 285  GLY A O   1 
ATOM   1925  N N   . ILE A 1 286 ? 76.512  -22.860 5.985   1.00 29.64 ? 286  ILE A N   1 
ATOM   1926  C CA  . ILE A 1 286 ? 76.450  -22.549 7.418   1.00 29.65 ? 286  ILE A CA  1 
ATOM   1927  C C   . ILE A 1 286 ? 75.567  -23.544 8.183   1.00 30.32 ? 286  ILE A C   1 
ATOM   1928  O O   . ILE A 1 286 ? 74.503  -23.944 7.693   1.00 29.69 ? 286  ILE A O   1 
ATOM   1929  C CB  . ILE A 1 286 ? 75.942  -21.078 7.642   1.00 29.55 ? 286  ILE A CB  1 
ATOM   1930  C CG1 . ILE A 1 286 ? 76.851  -20.093 6.889   1.00 29.07 ? 286  ILE A CG1 1 
ATOM   1931  C CG2 . ILE A 1 286 ? 75.916  -20.709 9.142   1.00 28.73 ? 286  ILE A CG2 1 
ATOM   1932  C CD1 . ILE A 1 286 ? 76.206  -18.761 6.550   1.00 29.83 ? 286  ILE A CD1 1 
ATOM   1933  N N   . ASP A 1 287 ? 76.026  -23.929 9.380   1.00 29.96 ? 287  ASP A N   1 
ATOM   1934  C CA  . ASP A 1 287 ? 75.320  -24.851 10.277  1.00 30.51 ? 287  ASP A CA  1 
ATOM   1935  C C   . ASP A 1 287 ? 74.025  -24.165 10.729  1.00 29.74 ? 287  ASP A C   1 
ATOM   1936  O O   . ASP A 1 287 ? 74.056  -23.035 11.215  1.00 29.35 ? 287  ASP A O   1 
ATOM   1937  C CB  . ASP A 1 287 ? 76.204  -25.184 11.491  1.00 31.68 ? 287  ASP A CB  1 
ATOM   1938  C CG  . ASP A 1 287 ? 75.591  -26.243 12.413  1.00 33.24 ? 287  ASP A CG  1 
ATOM   1939  O OD1 . ASP A 1 287 ? 74.389  -26.555 12.296  1.00 32.43 ? 287  ASP A OD1 1 
ATOM   1940  O OD2 . ASP A 1 287 ? 76.328  -26.767 13.279  1.00 35.97 ? 287  ASP A OD2 1 
ATOM   1941  N N   . GLU A 1 288 ? 72.909  -24.878 10.567  1.00 30.08 ? 288  GLU A N   1 
ATOM   1942  C CA  . GLU A 1 288 ? 71.575  -24.370 10.895  1.00 30.04 ? 288  GLU A CA  1 
ATOM   1943  C C   . GLU A 1 288 ? 71.046  -24.601 12.317  1.00 29.05 ? 288  GLU A C   1 
ATOM   1944  O O   . GLU A 1 288 ? 69.959  -24.117 12.649  1.00 28.12 ? 288  GLU A O   1 
ATOM   1945  C CB  . GLU A 1 288 ? 70.564  -24.910 9.871   1.00 31.43 ? 288  GLU A CB  1 
ATOM   1946  C CG  . GLU A 1 288 ? 70.026  -26.321 10.168  1.00 35.35 ? 288  GLU A CG  1 
ATOM   1947  C CD  . GLU A 1 288 ? 69.493  -27.046 8.940   1.00 37.30 ? 288  GLU A CD  1 
ATOM   1948  O OE1 . GLU A 1 288 ? 68.458  -26.634 8.377   1.00 39.39 ? 288  GLU A OE1 1 
ATOM   1949  O OE2 . GLU A 1 288 ? 70.120  -28.046 8.532   1.00 39.57 ? 288  GLU A OE2 1 
ATOM   1950  N N   . LYS A 1 289 ? 71.796  -25.329 13.146  1.00 27.52 ? 289  LYS A N   1 
ATOM   1951  C CA  . LYS A 1 289 ? 71.373  -25.626 14.521  1.00 27.24 ? 289  LYS A CA  1 
ATOM   1952  C C   . LYS A 1 289 ? 71.241  -24.405 15.435  1.00 25.42 ? 289  LYS A C   1 
ATOM   1953  O O   . LYS A 1 289 ? 72.202  -23.656 15.640  1.00 24.98 ? 289  LYS A O   1 
ATOM   1954  C CB  . LYS A 1 289 ? 72.291  -26.682 15.163  1.00 28.67 ? 289  LYS A CB  1 
ATOM   1955  C CG  . LYS A 1 289 ? 72.166  -28.088 14.566  1.00 32.42 ? 289  LYS A CG  1 
ATOM   1956  C CD  . LYS A 1 289 ? 70.820  -28.755 14.883  1.00 33.99 ? 289  LYS A CD  1 
ATOM   1957  C CE  . LYS A 1 289 ? 70.961  -29.897 15.890  1.00 36.13 ? 289  LYS A CE  1 
ATOM   1958  N NZ  . LYS A 1 289 ? 71.449  -29.455 17.231  1.00 37.54 ? 289  LYS A NZ  1 
ATOM   1959  N N   . GLY A 1 290 ? 70.013  -24.183 15.910  1.00 24.12 ? 290  GLY A N   1 
ATOM   1960  C CA  . GLY A 1 290 ? 69.710  -23.068 16.796  1.00 23.36 ? 290  GLY A CA  1 
ATOM   1961  C C   . GLY A 1 290 ? 69.328  -21.771 16.098  1.00 21.51 ? 290  GLY A C   1 
ATOM   1962  O O   . GLY A 1 290 ? 69.144  -20.747 16.762  1.00 22.31 ? 290  GLY A O   1 
ATOM   1963  N N   . SER A 1 291 ? 69.188  -21.820 14.771  1.00 20.91 ? 291  SER A N   1 
ATOM   1964  C CA  . SER A 1 291 ? 68.842  -20.641 13.966  1.00 19.30 ? 291  SER A CA  1 
ATOM   1965  C C   . SER A 1 291 ? 67.410  -20.146 14.103  1.00 19.67 ? 291  SER A C   1 
ATOM   1966  O O   . SER A 1 291 ? 67.179  -18.935 14.167  1.00 18.54 ? 291  SER A O   1 
ATOM   1967  C CB  . SER A 1 291 ? 69.159  -20.878 12.485  1.00 18.54 ? 291  SER A CB  1 
ATOM   1968  O OG  . SER A 1 291 ? 68.438  -21.964 11.932  1.00 17.87 ? 291  SER A OG  1 
ATOM   1969  N N   . VAL A 1 292 ? 66.462  -21.086 14.169  1.00 20.12 ? 292  VAL A N   1 
ATOM   1970  C CA  . VAL A 1 292 ? 65.033  -20.773 14.286  1.00 20.37 ? 292  VAL A CA  1 
ATOM   1971  C C   . VAL A 1 292 ? 64.714  -19.960 15.553  1.00 20.35 ? 292  VAL A C   1 
ATOM   1972  O O   . VAL A 1 292 ? 63.974  -18.977 15.486  1.00 19.76 ? 292  VAL A O   1 
ATOM   1973  C CB  . VAL A 1 292 ? 64.157  -22.074 14.188  1.00 20.73 ? 292  VAL A CB  1 
ATOM   1974  C CG1 . VAL A 1 292 ? 62.656  -21.767 14.339  1.00 20.66 ? 292  VAL A CG1 1 
ATOM   1975  C CG2 . VAL A 1 292 ? 64.391  -22.752 12.846  1.00 20.91 ? 292  VAL A CG2 1 
ATOM   1976  N N   . ALA A 1 293 ? 65.373  -20.304 16.661  1.00 19.76 ? 293  ALA A N   1 
ATOM   1977  C CA  . ALA A 1 293 ? 65.182  -19.628 17.951  1.00 20.05 ? 293  ALA A CA  1 
ATOM   1978  C C   . ALA A 1 293 ? 65.640  -18.163 17.977  1.00 19.98 ? 293  ALA A C   1 
ATOM   1979  O O   . ALA A 1 293 ? 65.150  -17.367 18.786  1.00 21.29 ? 293  ALA A O   1 
ATOM   1980  C CB  . ALA A 1 293 ? 65.876  -20.414 19.060  1.00 20.78 ? 293  ALA A CB  1 
ATOM   1981  N N   . LYS A 1 294 ? 66.563  -17.814 17.077  1.00 19.24 ? 294  LYS A N   1 
ATOM   1982  C CA  . LYS A 1 294 ? 67.094  -16.453 16.983  1.00 18.87 ? 294  LYS A CA  1 
ATOM   1983  C C   . LYS A 1 294 ? 66.317  -15.598 15.978  1.00 18.56 ? 294  LYS A C   1 
ATOM   1984  O O   . LYS A 1 294 ? 66.300  -14.369 16.086  1.00 19.74 ? 294  LYS A O   1 
ATOM   1985  C CB  . LYS A 1 294 ? 68.567  -16.486 16.560  1.00 19.79 ? 294  LYS A CB  1 
ATOM   1986  C CG  . LYS A 1 294 ? 69.479  -17.291 17.474  1.00 20.71 ? 294  LYS A CG  1 
ATOM   1987  C CD  . LYS A 1 294 ? 70.855  -17.416 16.857  1.00 22.17 ? 294  LYS A CD  1 
ATOM   1988  C CE  . LYS A 1 294 ? 71.741  -18.385 17.616  1.00 23.54 ? 294  LYS A CE  1 
ATOM   1989  N NZ  . LYS A 1 294 ? 73.038  -18.570 16.904  1.00 25.07 ? 294  LYS A NZ  1 
ATOM   1990  N N   . HIS A 1 295 ? 65.676  -16.255 15.014  1.00 17.76 ? 295  HIS A N   1 
ATOM   1991  C CA  . HIS A 1 295 ? 64.934  -15.563 13.958  1.00 16.12 ? 295  HIS A CA  1 
ATOM   1992  C C   . HIS A 1 295 ? 63.410  -15.595 14.022  1.00 16.54 ? 295  HIS A C   1 
ATOM   1993  O O   . HIS A 1 295 ? 62.760  -14.893 13.247  1.00 14.85 ? 295  HIS A O   1 
ATOM   1994  C CB  . HIS A 1 295 ? 65.373  -16.085 12.589  1.00 16.05 ? 295  HIS A CB  1 
ATOM   1995  C CG  . HIS A 1 295 ? 66.776  -15.719 12.217  1.00 15.33 ? 295  HIS A CG  1 
ATOM   1996  N ND1 . HIS A 1 295 ? 67.074  -14.616 11.450  1.00 15.49 ? 295  HIS A ND1 1 
ATOM   1997  C CD2 . HIS A 1 295 ? 67.959  -16.316 12.495  1.00 16.00 ? 295  HIS A CD2 1 
ATOM   1998  C CE1 . HIS A 1 295 ? 68.380  -14.548 11.269  1.00 16.96 ? 295  HIS A CE1 1 
ATOM   1999  N NE2 . HIS A 1 295 ? 68.941  -15.569 11.894  1.00 16.13 ? 295  HIS A NE2 1 
ATOM   2000  N N   . PHE A 1 296 ? 62.847  -16.443 14.885  1.00 14.82 ? 296  PHE A N   1 
ATOM   2001  C CA  . PHE A 1 296 ? 61.390  -16.581 15.016  1.00 14.70 ? 296  PHE A CA  1 
ATOM   2002  C C   . PHE A 1 296 ? 60.831  -16.389 16.416  1.00 15.44 ? 296  PHE A C   1 
ATOM   2003  O O   . PHE A 1 296 ? 61.370  -16.923 17.386  1.00 15.82 ? 296  PHE A O   1 
ATOM   2004  C CB  . PHE A 1 296 ? 60.925  -17.966 14.537  1.00 14.39 ? 296  PHE A CB  1 
ATOM   2005  C CG  . PHE A 1 296 ? 60.918  -18.133 13.052  1.00 14.62 ? 296  PHE A CG  1 
ATOM   2006  C CD1 . PHE A 1 296 ? 62.108  -18.403 12.354  1.00 14.45 ? 296  PHE A CD1 1 
ATOM   2007  C CD2 . PHE A 1 296 ? 59.719  -17.987 12.332  1.00 14.60 ? 296  PHE A CD2 1 
ATOM   2008  C CE1 . PHE A 1 296 ? 62.112  -18.516 10.951  1.00 15.26 ? 296  PHE A CE1 1 
ATOM   2009  C CE2 . PHE A 1 296 ? 59.701  -18.101 10.924  1.00 15.63 ? 296  PHE A CE2 1 
ATOM   2010  C CZ  . PHE A 1 296 ? 60.898  -18.360 10.236  1.00 15.86 ? 296  PHE A CZ  1 
ATOM   2011  N N   . VAL A 1 297 ? 59.761  -15.597 16.508  1.00 14.13 ? 297  VAL A N   1 
ATOM   2012  C CA  . VAL A 1 297 ? 59.034  -15.364 17.761  1.00 13.01 ? 297  VAL A CA  1 
ATOM   2013  C C   . VAL A 1 297 ? 57.546  -15.563 17.447  1.00 13.18 ? 297  VAL A C   1 
ATOM   2014  O O   . VAL A 1 297 ? 57.141  -15.499 16.276  1.00 12.76 ? 297  VAL A O   1 
ATOM   2015  C CB  . VAL A 1 297 ? 59.288  -13.960 18.413  1.00 13.28 ? 297  VAL A CB  1 
ATOM   2016  C CG1 . VAL A 1 297 ? 60.719  -13.854 18.919  1.00 13.41 ? 297  VAL A CG1 1 
ATOM   2017  C CG2 . VAL A 1 297 ? 58.990  -12.831 17.456  1.00 14.13 ? 297  VAL A CG2 1 
ATOM   2018  N N   . ALA A 1 298 ? 56.745  -15.821 18.479  1.00 12.42 ? 298  ALA A N   1 
ATOM   2019  C CA  . ALA A 1 298 ? 55.312  -16.057 18.297  1.00 12.78 ? 298  ALA A CA  1 
ATOM   2020  C C   . ALA A 1 298 ? 54.409  -15.247 19.211  1.00 13.08 ? 298  ALA A C   1 
ATOM   2021  O O   . ALA A 1 298 ? 54.745  -14.990 20.369  1.00 13.27 ? 298  ALA A O   1 
ATOM   2022  C CB  . ALA A 1 298 ? 55.007  -17.531 18.466  1.00 12.80 ? 298  ALA A CB  1 
ATOM   2023  N N   . LEU A 1 299 ? 53.288  -14.793 18.649  1.00 13.18 ? 299  LEU A N   1 
ATOM   2024  C CA  . LEU A 1 299 ? 52.273  -14.025 19.383  1.00 13.30 ? 299  LEU A CA  1 
ATOM   2025  C C   . LEU A 1 299 ? 51.029  -14.902 19.288  1.00 15.49 ? 299  LEU A C   1 
ATOM   2026  O O   . LEU A 1 299 ? 50.409  -14.986 18.219  1.00 15.18 ? 299  LEU A O   1 
ATOM   2027  C CB  . LEU A 1 299 ? 52.018  -12.664 18.718  1.00 13.99 ? 299  LEU A CB  1 
ATOM   2028  C CG  . LEU A 1 299 ? 53.214  -11.860 18.196  1.00 12.60 ? 299  LEU A CG  1 
ATOM   2029  C CD1 . LEU A 1 299 ? 52.756  -10.623 17.481  1.00 13.59 ? 299  LEU A CD1 1 
ATOM   2030  C CD2 . LEU A 1 299 ? 54.180  -11.507 19.299  1.00 11.87 ? 299  LEU A CD2 1 
ATOM   2031  N N   . SER A 1 300 ? 50.684  -15.574 20.392  1.00 16.43 ? 300  SER A N   1 
ATOM   2032  C CA  . SER A 1 300 ? 49.551  -16.505 20.398  1.00 18.14 ? 300  SER A CA  1 
ATOM   2033  C C   . SER A 1 300 ? 48.908  -16.757 21.763  1.00 18.81 ? 300  SER A C   1 
ATOM   2034  O O   . SER A 1 300 ? 49.323  -16.189 22.774  1.00 18.72 ? 300  SER A O   1 
ATOM   2035  C CB  . SER A 1 300 ? 50.017  -17.846 19.820  1.00 18.08 ? 300  SER A CB  1 
ATOM   2036  O OG  . SER A 1 300 ? 48.927  -18.652 19.422  1.00 17.47 ? 300  SER A OG  1 
ATOM   2037  N N   . THR A 1 301 ? 47.850  -17.574 21.753  1.00 20.21 ? 301  THR A N   1 
ATOM   2038  C CA  . THR A 1 301 ? 47.139  -17.995 22.965  1.00 20.91 ? 301  THR A CA  1 
ATOM   2039  C C   . THR A 1 301 ? 47.392  -19.498 23.115  1.00 22.06 ? 301  THR A C   1 
ATOM   2040  O O   . THR A 1 301 ? 47.255  -20.056 24.205  1.00 22.92 ? 301  THR A O   1 
ATOM   2041  C CB  . THR A 1 301 ? 45.591  -17.790 22.876  1.00 20.24 ? 301  THR A CB  1 
ATOM   2042  O OG1 . THR A 1 301 ? 45.035  -18.654 21.874  1.00 21.10 ? 301  THR A OG1 1 
ATOM   2043  C CG2 . THR A 1 301 ? 45.240  -16.357 22.547  1.00 21.42 ? 301  THR A CG2 1 
ATOM   2044  N N   . ASN A 1 302 ? 47.763  -20.129 21.997  1.00 23.67 ? 302  ASN A N   1 
ATOM   2045  C CA  . ASN A 1 302 ? 48.015  -21.569 21.922  1.00 25.39 ? 302  ASN A CA  1 
ATOM   2046  C C   . ASN A 1 302 ? 49.484  -21.921 22.156  1.00 25.57 ? 302  ASN A C   1 
ATOM   2047  O O   . ASN A 1 302 ? 50.291  -21.947 21.222  1.00 25.09 ? 302  ASN A O   1 
ATOM   2048  C CB  . ASN A 1 302 ? 47.547  -22.096 20.559  1.00 27.33 ? 302  ASN A CB  1 
ATOM   2049  C CG  . ASN A 1 302 ? 47.140  -23.564 20.593  1.00 29.02 ? 302  ASN A CG  1 
ATOM   2050  O OD1 . ASN A 1 302 ? 47.872  -24.422 21.092  1.00 30.00 ? 302  ASN A OD1 1 
ATOM   2051  N ND2 . ASN A 1 302 ? 45.976  -23.861 20.025  1.00 31.42 ? 302  ASN A ND2 1 
ATOM   2052  N N   . ASN A 1 303 ? 49.800  -22.256 23.406  1.00 26.39 ? 303  ASN A N   1 
ATOM   2053  C CA  . ASN A 1 303 ? 51.151  -22.627 23.831  1.00 27.58 ? 303  ASN A CA  1 
ATOM   2054  C C   . ASN A 1 303 ? 51.674  -23.924 23.215  1.00 28.38 ? 303  ASN A C   1 
ATOM   2055  O O   . ASN A 1 303 ? 52.864  -24.027 22.900  1.00 29.10 ? 303  ASN A O   1 
ATOM   2056  C CB  . ASN A 1 303 ? 51.213  -22.718 25.359  1.00 28.19 ? 303  ASN A CB  1 
ATOM   2057  C CG  . ASN A 1 303 ? 50.853  -21.407 26.038  1.00 28.05 ? 303  ASN A CG  1 
ATOM   2058  O OD1 . ASN A 1 303 ? 49.687  -21.007 26.063  1.00 27.91 ? 303  ASN A OD1 1 
ATOM   2059  N ND2 . ASN A 1 303 ? 51.856  -20.725 26.578  1.00 27.96 ? 303  ASN A ND2 1 
ATOM   2060  N N   . GLN A 1 304 ? 50.764  -24.872 22.984  1.00 29.54 ? 304  GLN A N   1 
ATOM   2061  C CA  . GLN A 1 304 ? 51.090  -26.183 22.417  1.00 31.03 ? 304  GLN A CA  1 
ATOM   2062  C C   . GLN A 1 304 ? 51.517  -26.147 20.948  1.00 30.38 ? 304  GLN A C   1 
ATOM   2063  O O   . GLN A 1 304 ? 52.531  -26.749 20.585  1.00 30.78 ? 304  GLN A O   1 
ATOM   2064  C CB  . GLN A 1 304 ? 49.910  -27.149 22.596  1.00 32.90 ? 304  GLN A CB  1 
ATOM   2065  C CG  . GLN A 1 304 ? 50.279  -28.636 22.585  1.00 36.05 ? 304  GLN A CG  1 
ATOM   2066  C CD  . GLN A 1 304 ? 50.953  -29.092 23.874  1.00 37.50 ? 304  GLN A CD  1 
ATOM   2067  O OE1 . GLN A 1 304 ? 52.180  -29.022 24.010  1.00 38.56 ? 304  GLN A OE1 1 
ATOM   2068  N NE2 . GLN A 1 304 ? 50.153  -29.561 24.827  1.00 38.43 ? 304  GLN A NE2 1 
ATOM   2069  N N   . LYS A 1 305 ? 50.765  -25.410 20.125  1.00 30.40 ? 305  LYS A N   1 
ATOM   2070  C CA  . LYS A 1 305 ? 51.053  -25.288 18.688  1.00 29.97 ? 305  LYS A CA  1 
ATOM   2071  C C   . LYS A 1 305 ? 52.315  -24.474 18.385  1.00 29.05 ? 305  LYS A C   1 
ATOM   2072  O O   . LYS A 1 305 ? 52.956  -24.679 17.350  1.00 29.14 ? 305  LYS A O   1 
ATOM   2073  C CB  . LYS A 1 305 ? 49.842  -24.724 17.936  1.00 30.39 ? 305  LYS A CB  1 
ATOM   2074  C CG  . LYS A 1 305 ? 48.632  -25.663 17.864  1.00 31.68 ? 305  LYS A CG  1 
ATOM   2075  C CD  . LYS A 1 305 ? 48.794  -26.756 16.809  1.00 33.90 ? 305  LYS A CD  1 
ATOM   2076  C CE  . LYS A 1 305 ? 47.723  -27.827 16.964  1.00 34.94 ? 305  LYS A CE  1 
ATOM   2077  N NZ  . LYS A 1 305 ? 47.963  -28.997 16.073  1.00 36.50 ? 305  LYS A NZ  1 
ATOM   2078  N N   . VAL A 1 306 ? 52.683  -23.584 19.312  1.00 28.06 ? 306  VAL A N   1 
ATOM   2079  C CA  . VAL A 1 306 ? 53.890  -22.752 19.193  1.00 27.10 ? 306  VAL A CA  1 
ATOM   2080  C C   . VAL A 1 306 ? 55.133  -23.620 19.430  1.00 28.19 ? 306  VAL A C   1 
ATOM   2081  O O   . VAL A 1 306 ? 56.163  -23.439 18.764  1.00 27.04 ? 306  VAL A O   1 
ATOM   2082  C CB  . VAL A 1 306 ? 53.848  -21.548 20.192  1.00 26.17 ? 306  VAL A CB  1 
ATOM   2083  C CG1 . VAL A 1 306 ? 55.129  -20.712 20.130  1.00 24.90 ? 306  VAL A CG1 1 
ATOM   2084  C CG2 . VAL A 1 306 ? 52.672  -20.662 19.871  1.00 24.86 ? 306  VAL A CG2 1 
ATOM   2085  N N   . LYS A 1 307 ? 55.009  -24.579 20.354  1.00 29.98 ? 307  LYS A N   1 
ATOM   2086  C CA  . LYS A 1 307 ? 56.096  -25.505 20.683  1.00 32.79 ? 307  LYS A CA  1 
ATOM   2087  C C   . LYS A 1 307 ? 56.375  -26.512 19.567  1.00 32.97 ? 307  LYS A C   1 
ATOM   2088  O O   . LYS A 1 307 ? 57.530  -26.871 19.330  1.00 34.00 ? 307  LYS A O   1 
ATOM   2089  C CB  . LYS A 1 307 ? 55.805  -26.243 21.999  1.00 34.47 ? 307  LYS A CB  1 
ATOM   2090  C CG  . LYS A 1 307 ? 56.032  -25.416 23.272  1.00 36.63 ? 307  LYS A CG  1 
ATOM   2091  C CD  . LYS A 1 307 ? 57.501  -25.048 23.514  1.00 39.20 ? 307  LYS A CD  1 
ATOM   2092  C CE  . LYS A 1 307 ? 58.350  -26.259 23.939  1.00 39.73 ? 307  LYS A CE  1 
ATOM   2093  N NZ  . LYS A 1 307 ? 57.936  -26.842 25.241  1.00 41.24 ? 307  LYS A NZ  1 
ATOM   2094  N N   . GLU A 1 308 ? 55.314  -26.914 18.859  1.00 34.23 ? 308  GLU A N   1 
ATOM   2095  C CA  . GLU A 1 308 ? 55.390  -27.871 17.746  1.00 35.69 ? 308  GLU A CA  1 
ATOM   2096  C C   . GLU A 1 308 ? 56.116  -27.305 16.523  1.00 36.01 ? 308  GLU A C   1 
ATOM   2097  O O   . GLU A 1 308 ? 56.695  -28.058 15.732  1.00 37.00 ? 308  GLU A O   1 
ATOM   2098  C CB  . GLU A 1 308 ? 53.991  -28.316 17.323  1.00 37.01 ? 308  GLU A CB  1 
ATOM   2099  C CG  . GLU A 1 308 ? 53.084  -28.775 18.450  1.00 39.61 ? 308  GLU A CG  1 
ATOM   2100  C CD  . GLU A 1 308 ? 51.939  -29.641 17.967  1.00 41.49 ? 308  GLU A CD  1 
ATOM   2101  O OE1 . GLU A 1 308 ? 52.023  -30.180 16.837  1.00 42.70 ? 308  GLU A OE1 1 
ATOM   2102  O OE2 . GLU A 1 308 ? 50.951  -29.788 18.713  1.00 42.63 ? 308  GLU A OE2 1 
ATOM   2103  N N   . PHE A 1 309 ? 56.072  -25.976 16.380  1.00 35.62 ? 309  PHE A N   1 
ATOM   2104  C CA  . PHE A 1 309 ? 56.718  -25.262 15.276  1.00 34.78 ? 309  PHE A CA  1 
ATOM   2105  C C   . PHE A 1 309 ? 58.237  -25.199 15.486  1.00 35.17 ? 309  PHE A C   1 
ATOM   2106  O O   . PHE A 1 309 ? 59.003  -25.252 14.520  1.00 36.40 ? 309  PHE A O   1 
ATOM   2107  C CB  . PHE A 1 309 ? 56.117  -23.845 15.143  1.00 33.53 ? 309  PHE A CB  1 
ATOM   2108  C CG  . PHE A 1 309 ? 56.595  -23.078 13.929  1.00 32.09 ? 309  PHE A CG  1 
ATOM   2109  C CD1 . PHE A 1 309 ? 56.040  -23.321 12.656  1.00 31.57 ? 309  PHE A CD1 1 
ATOM   2110  C CD2 . PHE A 1 309 ? 57.621  -22.118 14.049  1.00 31.28 ? 309  PHE A CD2 1 
ATOM   2111  C CE1 . PHE A 1 309 ? 56.506  -22.612 11.514  1.00 29.98 ? 309  PHE A CE1 1 
ATOM   2112  C CE2 . PHE A 1 309 ? 58.101  -21.402 12.925  1.00 30.90 ? 309  PHE A CE2 1 
ATOM   2113  C CZ  . PHE A 1 309 ? 57.543  -21.649 11.651  1.00 29.76 ? 309  PHE A CZ  1 
ATOM   2114  N N   . GLY A 1 310 ? 58.656  -25.066 16.745  1.00 34.29 ? 310  GLY A N   1 
ATOM   2115  C CA  . GLY A 1 310 ? 60.072  -25.003 17.062  1.00 33.87 ? 310  GLY A CA  1 
ATOM   2116  C C   . GLY A 1 310 ? 60.524  -23.681 17.648  1.00 33.07 ? 310  GLY A C   1 
ATOM   2117  O O   . GLY A 1 310 ? 61.712  -23.356 17.620  1.00 33.82 ? 310  GLY A O   1 
ATOM   2118  N N   . ILE A 1 311 ? 59.569  -22.912 18.169  1.00 32.21 ? 311  ILE A N   1 
ATOM   2119  C CA  . ILE A 1 311 ? 59.850  -21.615 18.785  1.00 31.59 ? 311  ILE A CA  1 
ATOM   2120  C C   . ILE A 1 311 ? 59.985  -21.806 20.295  1.00 32.45 ? 311  ILE A C   1 
ATOM   2121  O O   . ILE A 1 311 ? 59.209  -22.551 20.902  1.00 32.57 ? 311  ILE A O   1 
ATOM   2122  C CB  . ILE A 1 311 ? 58.726  -20.570 18.447  1.00 29.43 ? 311  ILE A CB  1 
ATOM   2123  C CG1 . ILE A 1 311 ? 58.748  -20.256 16.947  1.00 28.27 ? 311  ILE A CG1 1 
ATOM   2124  C CG2 . ILE A 1 311 ? 58.894  -19.267 19.265  1.00 28.59 ? 311  ILE A CG2 1 
ATOM   2125  C CD1 . ILE A 1 311 ? 57.609  -19.367 16.447  1.00 27.40 ? 311  ILE A CD1 1 
ATOM   2126  N N   . ASP A 1 312 ? 60.972  -21.125 20.879  1.00 33.90 ? 312  ASP A N   1 
ATOM   2127  C CA  . ASP A 1 312 ? 61.242  -21.165 22.324  1.00 35.20 ? 312  ASP A CA  1 
ATOM   2128  C C   . ASP A 1 312 ? 60.079  -20.550 23.108  1.00 34.80 ? 312  ASP A C   1 
ATOM   2129  O O   . ASP A 1 312 ? 59.469  -19.574 22.659  1.00 33.60 ? 312  ASP A O   1 
ATOM   2130  C CB  . ASP A 1 312 ? 62.536  -20.401 22.643  1.00 37.41 ? 312  ASP A CB  1 
ATOM   2131  C CG  . ASP A 1 312 ? 63.806  -21.166 22.262  1.00 39.71 ? 312  ASP A CG  1 
ATOM   2132  O OD1 . ASP A 1 312 ? 63.720  -22.264 21.659  1.00 40.83 ? 312  ASP A OD1 1 
ATOM   2133  O OD2 . ASP A 1 312 ? 64.909  -20.660 22.571  1.00 41.38 ? 312  ASP A OD2 1 
ATOM   2134  N N   . GLU A 1 313 ? 59.762  -21.145 24.262  1.00 34.15 ? 313  GLU A N   1 
ATOM   2135  C CA  . GLU A 1 313 ? 58.680  -20.676 25.137  1.00 33.64 ? 313  GLU A CA  1 
ATOM   2136  C C   . GLU A 1 313 ? 58.990  -19.278 25.709  1.00 32.73 ? 313  GLU A C   1 
ATOM   2137  O O   . GLU A 1 313 ? 58.078  -18.494 25.997  1.00 31.88 ? 313  GLU A O   1 
ATOM   2138  C CB  . GLU A 1 313 ? 58.410  -21.718 26.247  1.00 35.08 ? 313  GLU A CB  1 
ATOM   2139  C CG  . GLU A 1 313 ? 57.325  -21.389 27.312  1.00 36.65 ? 313  GLU A CG  1 
ATOM   2140  C CD  . GLU A 1 313 ? 56.039  -20.782 26.749  1.00 37.85 ? 313  GLU A CD  1 
ATOM   2141  O OE1 . GLU A 1 313 ? 55.130  -21.534 26.348  1.00 38.31 ? 313  GLU A OE1 1 
ATOM   2142  O OE2 . GLU A 1 313 ? 55.945  -19.532 26.715  1.00 37.98 ? 313  GLU A OE2 1 
ATOM   2143  N N   . GLU A 1 314 ? 60.278  -18.949 25.763  1.00 31.55 ? 314  GLU A N   1 
ATOM   2144  C CA  . GLU A 1 314 ? 60.774  -17.658 26.249  1.00 31.11 ? 314  GLU A CA  1 
ATOM   2145  C C   . GLU A 1 314 ? 60.465  -16.574 25.205  1.00 29.08 ? 314  GLU A C   1 
ATOM   2146  O O   . GLU A 1 314 ? 60.367  -15.388 25.527  1.00 29.73 ? 314  GLU A O   1 
ATOM   2147  C CB  . GLU A 1 314 ? 62.298  -17.715 26.468  1.00 34.27 ? 314  GLU A CB  1 
ATOM   2148  C CG  . GLU A 1 314 ? 62.832  -18.972 27.172  1.00 38.82 ? 314  GLU A CG  1 
ATOM   2149  C CD  . GLU A 1 314 ? 63.085  -20.135 26.221  1.00 40.89 ? 314  GLU A CD  1 
ATOM   2150  O OE1 . GLU A 1 314 ? 64.131  -20.131 25.533  1.00 43.67 ? 314  GLU A OE1 1 
ATOM   2151  O OE2 . GLU A 1 314 ? 62.240  -21.055 26.155  1.00 42.56 ? 314  GLU A OE2 1 
ATOM   2152  N N   . ASN A 1 315 ? 60.281  -17.020 23.961  1.00 26.42 ? 315  ASN A N   1 
ATOM   2153  C CA  . ASN A 1 315 ? 59.992  -16.145 22.829  1.00 24.55 ? 315  ASN A CA  1 
ATOM   2154  C C   . ASN A 1 315 ? 58.528  -16.159 22.371  1.00 22.72 ? 315  ASN A C   1 
ATOM   2155  O O   . ASN A 1 315 ? 58.212  -15.757 21.241  1.00 21.50 ? 315  ASN A O   1 
ATOM   2156  C CB  . ASN A 1 315 ? 60.945  -16.467 21.678  1.00 26.93 ? 315  ASN A CB  1 
ATOM   2157  C CG  . ASN A 1 315 ? 62.406  -16.252 22.054  1.00 27.93 ? 315  ASN A CG  1 
ATOM   2158  O OD1 . ASN A 1 315 ? 62.767  -15.226 22.637  1.00 30.11 ? 315  ASN A OD1 1 
ATOM   2159  N ND2 . ASN A 1 315 ? 63.243  -17.228 21.746  1.00 30.15 ? 315  ASN A ND2 1 
ATOM   2160  N N   . MET A 1 316 ? 57.642  -16.647 23.238  1.00 18.81 ? 316  MET A N   1 
ATOM   2161  C CA  . MET A 1 316 ? 56.209  -16.653 22.956  1.00 18.12 ? 316  MET A CA  1 
ATOM   2162  C C   . MET A 1 316 ? 55.586  -15.526 23.780  1.00 17.43 ? 316  MET A C   1 
ATOM   2163  O O   . MET A 1 316 ? 55.806  -15.433 24.992  1.00 17.79 ? 316  MET A O   1 
ATOM   2164  C CB  . MET A 1 316 ? 55.549  -17.991 23.313  1.00 18.62 ? 316  MET A CB  1 
ATOM   2165  C CG  . MET A 1 316 ? 54.027  -17.949 23.168  1.00 21.34 ? 316  MET A CG  1 
ATOM   2166  S SD  . MET A 1 316 ? 53.181  -19.480 23.473  1.00 24.59 ? 316  MET A SD  1 
ATOM   2167  C CE  . MET A 1 316 ? 51.507  -18.931 23.361  1.00 22.71 ? 316  MET A CE  1 
ATOM   2168  N N   . PHE A 1 317 ? 54.838  -14.661 23.101  1.00 15.29 ? 317  PHE A N   1 
ATOM   2169  C CA  . PHE A 1 317 ? 54.173  -13.526 23.735  1.00 14.20 ? 317  PHE A CA  1 
ATOM   2170  C C   . PHE A 1 317 ? 52.696  -13.861 23.806  1.00 14.25 ? 317  PHE A C   1 
ATOM   2171  O O   . PHE A 1 317 ? 51.999  -13.944 22.795  1.00 13.31 ? 317  PHE A O   1 
ATOM   2172  C CB  . PHE A 1 317 ? 54.436  -12.237 22.952  1.00 13.66 ? 317  PHE A CB  1 
ATOM   2173  C CG  . PHE A 1 317 ? 55.891  -11.880 22.848  1.00 11.92 ? 317  PHE A CG  1 
ATOM   2174  C CD1 . PHE A 1 317 ? 56.742  -12.583 21.967  1.00 12.70 ? 317  PHE A CD1 1 
ATOM   2175  C CD2 . PHE A 1 317 ? 56.438  -10.877 23.663  1.00 13.05 ? 317  PHE A CD2 1 
ATOM   2176  C CE1 . PHE A 1 317 ? 58.127  -12.302 21.904  1.00 11.89 ? 317  PHE A CE1 1 
ATOM   2177  C CE2 . PHE A 1 317 ? 57.823  -10.583 23.611  1.00 13.31 ? 317  PHE A CE2 1 
ATOM   2178  C CZ  . PHE A 1 317 ? 58.663  -11.304 22.729  1.00 12.78 ? 317  PHE A CZ  1 
ATOM   2179  N N   . GLN A 1 318 ? 52.254  -14.081 25.037  1.00 13.66 ? 318  GLN A N   1 
ATOM   2180  C CA  . GLN A 1 318 ? 50.897  -14.479 25.350  1.00 14.49 ? 318  GLN A CA  1 
ATOM   2181  C C   . GLN A 1 318 ? 49.832  -13.393 25.387  1.00 13.73 ? 318  GLN A C   1 
ATOM   2182  O O   . GLN A 1 318 ? 50.077  -12.263 25.813  1.00 13.80 ? 318  GLN A O   1 
ATOM   2183  C CB  . GLN A 1 318 ? 50.898  -15.178 26.717  1.00 17.27 ? 318  GLN A CB  1 
ATOM   2184  C CG  . GLN A 1 318 ? 49.625  -15.978 27.031  1.00 20.16 ? 318  GLN A CG  1 
ATOM   2185  C CD  . GLN A 1 318 ? 49.773  -17.459 26.714  1.00 23.04 ? 318  GLN A CD  1 
ATOM   2186  O OE1 . GLN A 1 318 ? 50.849  -18.019 26.879  1.00 25.55 ? 318  GLN A OE1 1 
ATOM   2187  N NE2 . GLN A 1 318 ? 48.693  -18.100 26.278  1.00 23.79 ? 318  GLN A NE2 1 
ATOM   2188  N N   . PHE A 1 319 ? 48.652  -13.806 24.923  1.00 13.75 ? 319  PHE A N   1 
ATOM   2189  C CA  . PHE A 1 319 ? 47.412  -13.055 24.946  1.00 13.67 ? 319  PHE A CA  1 
ATOM   2190  C C   . PHE A 1 319 ? 46.269  -14.059 25.243  1.00 13.90 ? 319  PHE A C   1 
ATOM   2191  O O   . PHE A 1 319 ? 46.516  -15.273 25.301  1.00 15.34 ? 319  PHE A O   1 
ATOM   2192  C CB  . PHE A 1 319 ? 47.233  -12.005 23.820  1.00 13.14 ? 319  PHE A CB  1 
ATOM   2193  C CG  . PHE A 1 319 ? 46.902  -12.529 22.426  1.00 13.84 ? 319  PHE A CG  1 
ATOM   2194  C CD1 . PHE A 1 319 ? 47.914  -13.045 21.609  1.00 15.06 ? 319  PHE A CD1 1 
ATOM   2195  C CD2 . PHE A 1 319 ? 45.586  -12.458 21.959  1.00 14.67 ? 319  PHE A CD2 1 
ATOM   2196  C CE1 . PHE A 1 319 ? 47.607  -13.485 20.314  1.00 14.80 ? 319  PHE A CE1 1 
ATOM   2197  C CE2 . PHE A 1 319 ? 45.280  -12.893 20.664  1.00 15.03 ? 319  PHE A CE2 1 
ATOM   2198  C CZ  . PHE A 1 319 ? 46.291  -13.404 19.841  1.00 16.41 ? 319  PHE A CZ  1 
ATOM   2199  N N   . TRP A 1 320 ? 45.048  -13.582 25.484  1.00 14.47 ? 320  TRP A N   1 
ATOM   2200  C CA  . TRP A 1 320 ? 43.975  -14.467 25.954  1.00 14.29 ? 320  TRP A CA  1 
ATOM   2201  C C   . TRP A 1 320 ? 42.727  -14.573 25.096  1.00 13.83 ? 320  TRP A C   1 
ATOM   2202  O O   . TRP A 1 320 ? 42.556  -13.781 24.175  1.00 13.71 ? 320  TRP A O   1 
ATOM   2203  C CB  . TRP A 1 320 ? 43.642  -14.037 27.390  1.00 14.74 ? 320  TRP A CB  1 
ATOM   2204  C CG  . TRP A 1 320 ? 44.890  -13.891 28.247  1.00 15.88 ? 320  TRP A CG  1 
ATOM   2205  C CD1 . TRP A 1 320 ? 45.442  -14.832 29.064  1.00 16.83 ? 320  TRP A CD1 1 
ATOM   2206  C CD2 . TRP A 1 320 ? 45.774  -12.764 28.280  1.00 15.98 ? 320  TRP A CD2 1 
ATOM   2207  N NE1 . TRP A 1 320 ? 46.621  -14.364 29.603  1.00 16.35 ? 320  TRP A NE1 1 
ATOM   2208  C CE2 . TRP A 1 320 ? 46.847  -13.104 29.135  1.00 16.73 ? 320  TRP A CE2 1 
ATOM   2209  C CE3 . TRP A 1 320 ? 45.768  -11.504 27.657  1.00 15.15 ? 320  TRP A CE3 1 
ATOM   2210  C CZ2 . TRP A 1 320 ? 47.910  -12.222 29.381  1.00 16.28 ? 320  TRP A CZ2 1 
ATOM   2211  C CZ3 . TRP A 1 320 ? 46.829  -10.629 27.901  1.00 15.38 ? 320  TRP A CZ3 1 
ATOM   2212  C CH2 . TRP A 1 320 ? 47.883  -10.994 28.759  1.00 16.47 ? 320  TRP A CH2 1 
ATOM   2213  N N   . ASP A 1 321 ? 41.854  -15.540 25.405  1.00 15.76 ? 321  ASP A N   1 
ATOM   2214  C CA  . ASP A 1 321 ? 40.621  -15.768 24.634  1.00 16.05 ? 321  ASP A CA  1 
ATOM   2215  C C   . ASP A 1 321 ? 39.631  -14.601 24.598  1.00 15.05 ? 321  ASP A C   1 
ATOM   2216  O O   . ASP A 1 321 ? 38.891  -14.437 23.623  1.00 14.94 ? 321  ASP A O   1 
ATOM   2217  C CB  . ASP A 1 321 ? 39.925  -17.089 25.040  1.00 19.29 ? 321  ASP A CB  1 
ATOM   2218  C CG  . ASP A 1 321 ? 39.450  -17.117 26.494  1.00 23.26 ? 321  ASP A CG  1 
ATOM   2219  O OD1 . ASP A 1 321 ? 39.754  -16.196 27.287  1.00 26.12 ? 321  ASP A OD1 1 
ATOM   2220  O OD2 . ASP A 1 321 ? 38.755  -18.097 26.850  1.00 27.51 ? 321  ASP A OD2 1 
ATOM   2221  N N   . TRP A 1 322 ? 39.685  -13.760 25.633  1.00 13.56 ? 322  TRP A N   1 
ATOM   2222  C CA  . TRP A 1 322 ? 38.823  -12.586 25.737  1.00 13.48 ? 322  TRP A CA  1 
ATOM   2223  C C   . TRP A 1 322 ? 39.307  -11.391 24.904  1.00 12.88 ? 322  TRP A C   1 
ATOM   2224  O O   . TRP A 1 322 ? 38.738  -10.296 24.971  1.00 12.94 ? 322  TRP A O   1 
ATOM   2225  C CB  . TRP A 1 322 ? 38.573  -12.192 27.204  1.00 13.73 ? 322  TRP A CB  1 
ATOM   2226  C CG  . TRP A 1 322 ? 39.727  -12.317 28.159  1.00 13.03 ? 322  TRP A CG  1 
ATOM   2227  C CD1 . TRP A 1 322 ? 39.912  -13.310 29.087  1.00 14.01 ? 322  TRP A CD1 1 
ATOM   2228  C CD2 . TRP A 1 322 ? 40.788  -11.373 28.366  1.00 13.48 ? 322  TRP A CD2 1 
ATOM   2229  N NE1 . TRP A 1 322 ? 41.011  -13.034 29.865  1.00 13.89 ? 322  TRP A NE1 1 
ATOM   2230  C CE2 . TRP A 1 322 ? 41.569  -11.853 29.450  1.00 13.66 ? 322  TRP A CE2 1 
ATOM   2231  C CE3 . TRP A 1 322 ? 41.156  -10.159 27.748  1.00 13.38 ? 322  TRP A CE3 1 
ATOM   2232  C CZ2 . TRP A 1 322 ? 42.701  -11.162 29.933  1.00 13.71 ? 322  TRP A CZ2 1 
ATOM   2233  C CZ3 . TRP A 1 322 ? 42.291  -9.459  28.234  1.00 13.54 ? 322  TRP A CZ3 1 
ATOM   2234  C CH2 . TRP A 1 322 ? 43.045  -9.970  29.317  1.00 14.48 ? 322  TRP A CH2 1 
ATOM   2235  N N   . VAL A 1 323 ? 40.401  -11.607 24.172  1.00 12.53 ? 323  VAL A N   1 
ATOM   2236  C CA  . VAL A 1 323 ? 40.964  -10.608 23.270  1.00 11.70 ? 323  VAL A CA  1 
ATOM   2237  C C   . VAL A 1 323 ? 40.546  -11.054 21.862  1.00 12.06 ? 323  VAL A C   1 
ATOM   2238  O O   . VAL A 1 323 ? 41.083  -12.034 21.330  1.00 12.36 ? 323  VAL A O   1 
ATOM   2239  C CB  . VAL A 1 323 ? 42.526  -10.558 23.324  1.00 12.52 ? 323  VAL A CB  1 
ATOM   2240  C CG1 . VAL A 1 323 ? 43.062  -9.590  22.296  1.00 13.64 ? 323  VAL A CG1 1 
ATOM   2241  C CG2 . VAL A 1 323 ? 43.019  -10.151 24.684  1.00 12.48 ? 323  VAL A CG2 1 
ATOM   2242  N N   . GLY A 1 324 ? 39.573  -10.352 21.278  1.00 11.21 ? 324  GLY A N   1 
ATOM   2243  C CA  . GLY A 1 324 ? 39.125  -10.666 19.931  1.00 12.38 ? 324  GLY A CA  1 
ATOM   2244  C C   . GLY A 1 324 ? 40.201  -10.235 18.947  1.00 12.37 ? 324  GLY A C   1 
ATOM   2245  O O   . GLY A 1 324 ? 40.885  -9.245  19.198  1.00 12.18 ? 324  GLY A O   1 
ATOM   2246  N N   . GLY A 1 325 ? 40.374  -10.983 17.860  1.00 11.72 ? 325  GLY A N   1 
ATOM   2247  C CA  . GLY A 1 325 ? 41.393  -10.654 16.868  1.00 11.96 ? 325  GLY A CA  1 
ATOM   2248  C C   . GLY A 1 325 ? 41.341  -9.234  16.328  1.00 12.26 ? 325  GLY A C   1 
ATOM   2249  O O   . GLY A 1 325 ? 42.364  -8.556  16.264  1.00 11.79 ? 325  GLY A O   1 
ATOM   2250  N N   . ARG A 1 326 ? 40.141  -8.764  15.991  1.00 10.97 ? 326  ARG A N   1 
ATOM   2251  C CA  . ARG A 1 326 ? 39.941  -7.408  15.471  1.00 11.52 ? 326  ARG A CA  1 
ATOM   2252  C C   . ARG A 1 326 ? 39.990  -6.338  16.567  1.00 10.95 ? 326  ARG A C   1 
ATOM   2253  O O   . ARG A 1 326 ? 39.715  -5.160  16.324  1.00 12.29 ? 326  ARG A O   1 
ATOM   2254  C CB  . ARG A 1 326 ? 38.626  -7.331  14.684  1.00 10.18 ? 326  ARG A CB  1 
ATOM   2255  C CG  . ARG A 1 326 ? 37.426  -7.915  15.407  1.00 10.92 ? 326  ARG A CG  1 
ATOM   2256  C CD  . ARG A 1 326 ? 36.192  -7.979  14.526  1.00 10.32 ? 326  ARG A CD  1 
ATOM   2257  N NE  . ARG A 1 326 ? 35.006  -8.473  15.247  1.00 10.40 ? 326  ARG A NE  1 
ATOM   2258  C CZ  . ARG A 1 326 ? 34.664  -9.761  15.352  1.00 10.68 ? 326  ARG A CZ  1 
ATOM   2259  N NH1 . ARG A 1 326 ? 35.403  -10.697 14.785  1.00 10.19 ? 326  ARG A NH1 1 
ATOM   2260  N NH2 . ARG A 1 326 ? 33.577  -10.133 16.020  1.00 11.39 ? 326  ARG A NH2 1 
ATOM   2261  N N   . TYR A 1 327 ? 40.351  -6.775  17.775  1.00 10.33 ? 327  TYR A N   1 
ATOM   2262  C CA  . TYR A 1 327 ? 40.489  -5.908  18.954  1.00 10.54 ? 327  TYR A CA  1 
ATOM   2263  C C   . TYR A 1 327 ? 41.810  -6.247  19.663  1.00 11.72 ? 327  TYR A C   1 
ATOM   2264  O O   . TYR A 1 327 ? 41.975  -5.952  20.852  1.00 11.68 ? 327  TYR A O   1 
ATOM   2265  C CB  . TYR A 1 327 ? 39.360  -6.196  19.960  1.00 11.62 ? 327  TYR A CB  1 
ATOM   2266  C CG  . TYR A 1 327 ? 37.955  -5.902  19.500  1.00 10.58 ? 327  TYR A CG  1 
ATOM   2267  C CD1 . TYR A 1 327 ? 37.426  -4.601  19.585  1.00 11.47 ? 327  TYR A CD1 1 
ATOM   2268  C CD2 . TYR A 1 327 ? 37.141  -6.924  18.978  1.00 11.75 ? 327  TYR A CD2 1 
ATOM   2269  C CE1 . TYR A 1 327 ? 36.115  -4.321  19.164  1.00 11.37 ? 327  TYR A CE1 1 
ATOM   2270  C CE2 . TYR A 1 327 ? 35.827  -6.655  18.539  1.00 10.95 ? 327  TYR A CE2 1 
ATOM   2271  C CZ  . TYR A 1 327 ? 35.326  -5.353  18.637  1.00 10.24 ? 327  TYR A CZ  1 
ATOM   2272  O OH  . TYR A 1 327 ? 34.055  -5.078  18.201  1.00 11.74 ? 327  TYR A OH  1 
ATOM   2273  N N   . SER A 1 328 ? 42.753  -6.835  18.926  1.00 10.55 ? 328  SER A N   1 
ATOM   2274  C CA  . SER A 1 328 ? 44.026  -7.311  19.492  1.00 10.03 ? 328  SER A CA  1 
ATOM   2275  C C   . SER A 1 328 ? 45.292  -6.484  19.320  1.00 11.01 ? 328  SER A C   1 
ATOM   2276  O O   . SER A 1 328 ? 46.348  -6.872  19.821  1.00 11.43 ? 328  SER A O   1 
ATOM   2277  C CB  . SER A 1 328 ? 44.316  -8.707  18.934  1.00 9.28  ? 328  SER A CB  1 
ATOM   2278  O OG  . SER A 1 328 ? 44.654  -8.616  17.558  1.00 11.52 ? 328  SER A OG  1 
ATOM   2279  N N   . MET A 1 329 ? 45.228  -5.358  18.617  1.00 11.21 ? 329  MET A N   1 
ATOM   2280  C CA  . MET A 1 329 ? 46.448  -4.560  18.394  1.00 12.53 ? 329  MET A CA  1 
ATOM   2281  C C   . MET A 1 329 ? 47.081  -4.011  19.687  1.00 12.96 ? 329  MET A C   1 
ATOM   2282  O O   . MET A 1 329 ? 48.238  -3.590  19.701  1.00 13.12 ? 329  MET A O   1 
ATOM   2283  C CB  . MET A 1 329 ? 46.166  -3.407  17.431  1.00 13.07 ? 329  MET A CB  1 
ATOM   2284  C CG  . MET A 1 329 ? 45.083  -2.454  17.918  1.00 12.55 ? 329  MET A CG  1 
ATOM   2285  S SD  . MET A 1 329 ? 44.941  -0.958  16.912  1.00 13.36 ? 329  MET A SD  1 
ATOM   2286  C CE  . MET A 1 329 ? 46.314  0.109   17.411  1.00 14.55 ? 329  MET A CE  1 
ATOM   2287  N N   . TRP A 1 330 ? 46.308  -4.055  20.769  1.00 10.60 ? 330  TRP A N   1 
ATOM   2288  C CA  . TRP A 1 330 ? 46.724  -3.553  22.083  1.00 11.25 ? 330  TRP A CA  1 
ATOM   2289  C C   . TRP A 1 330 ? 47.466  -4.592  22.914  1.00 11.63 ? 330  TRP A C   1 
ATOM   2290  O O   . TRP A 1 330 ? 48.085  -4.259  23.930  1.00 11.86 ? 330  TRP A O   1 
ATOM   2291  C CB  . TRP A 1 330 ? 45.494  -3.093  22.874  1.00 10.96 ? 330  TRP A CB  1 
ATOM   2292  C CG  . TRP A 1 330 ? 44.441  -2.420  22.037  1.00 11.14 ? 330  TRP A CG  1 
ATOM   2293  C CD1 . TRP A 1 330 ? 43.311  -2.986  21.514  1.00 11.69 ? 330  TRP A CD1 1 
ATOM   2294  C CD2 . TRP A 1 330 ? 44.437  -1.058  21.619  1.00 11.51 ? 330  TRP A CD2 1 
ATOM   2295  N NE1 . TRP A 1 330 ? 42.603  -2.057  20.794  1.00 10.74 ? 330  TRP A NE1 1 
ATOM   2296  C CE2 . TRP A 1 330 ? 43.266  -0.867  20.843  1.00 10.99 ? 330  TRP A CE2 1 
ATOM   2297  C CE3 . TRP A 1 330 ? 45.306  0.023   21.822  1.00 11.09 ? 330  TRP A CE3 1 
ATOM   2298  C CZ2 . TRP A 1 330 ? 42.948  0.370   20.275  1.00 12.11 ? 330  TRP A CZ2 1 
ATOM   2299  C CZ3 . TRP A 1 330 ? 44.986  1.258   21.248  1.00 11.50 ? 330  TRP A CZ3 1 
ATOM   2300  C CH2 . TRP A 1 330 ? 43.814  1.418   20.484  1.00 10.59 ? 330  TRP A CH2 1 
ATOM   2301  N N   . SER A 1 331 ? 47.371  -5.847  22.480  1.00 10.93 ? 331  SER A N   1 
ATOM   2302  C CA  . SER A 1 331 ? 47.990  -6.983  23.156  1.00 11.35 ? 331  SER A CA  1 
ATOM   2303  C C   . SER A 1 331 ? 49.372  -7.305  22.589  1.00 12.65 ? 331  SER A C   1 
ATOM   2304  O O   . SER A 1 331 ? 50.033  -6.444  22.003  1.00 12.13 ? 331  SER A O   1 
ATOM   2305  C CB  . SER A 1 331 ? 47.079  -8.216  23.012  1.00 11.77 ? 331  SER A CB  1 
ATOM   2306  O OG  . SER A 1 331 ? 47.103  -8.741  21.692  1.00 11.65 ? 331  SER A OG  1 
ATOM   2307  N N   . ALA A 1 332 ? 49.760  -8.578  22.736  1.00 12.56 ? 332  ALA A N   1 
ATOM   2308  C CA  . ALA A 1 332 ? 51.017  -9.134  22.234  1.00 11.72 ? 332  ALA A CA  1 
ATOM   2309  C C   . ALA A 1 332 ? 51.105  -8.948  20.723  1.00 11.31 ? 332  ALA A C   1 
ATOM   2310  O O   . ALA A 1 332 ? 52.193  -8.778  20.188  1.00 12.09 ? 332  ALA A O   1 
ATOM   2311  C CB  . ALA A 1 332 ? 51.089  -10.606 22.572  1.00 13.13 ? 332  ALA A CB  1 
ATOM   2312  N N   . ILE A 1 333 ? 49.938  -8.908  20.066  1.00 11.14 ? 333  ILE A N   1 
ATOM   2313  C CA  . ILE A 1 333 ? 49.814  -8.713  18.609  1.00 11.16 ? 333  ILE A CA  1 
ATOM   2314  C C   . ILE A 1 333 ? 50.451  -7.390  18.193  1.00 10.72 ? 333  ILE A C   1 
ATOM   2315  O O   . ILE A 1 333 ? 50.971  -7.257  17.082  1.00 11.85 ? 333  ILE A O   1 
ATOM   2316  C CB  . ILE A 1 333 ? 48.316  -8.813  18.156  1.00 11.89 ? 333  ILE A CB  1 
ATOM   2317  C CG1 . ILE A 1 333 ? 47.831  -10.264 18.263  1.00 13.07 ? 333  ILE A CG1 1 
ATOM   2318  C CG2 . ILE A 1 333 ? 48.070  -8.263  16.731  1.00 11.65 ? 333  ILE A CG2 1 
ATOM   2319  C CD1 . ILE A 1 333 ? 48.493  -11.265 17.308  1.00 12.67 ? 333  ILE A CD1 1 
ATOM   2320  N N   . GLY A 1 334 ? 50.478  -6.456  19.141  1.00 10.52 ? 334  GLY A N   1 
ATOM   2321  C CA  . GLY A 1 334 ? 51.073  -5.155  18.918  1.00 10.38 ? 334  GLY A CA  1 
ATOM   2322  C C   . GLY A 1 334 ? 52.590  -5.136  18.992  1.00 10.55 ? 334  GLY A C   1 
ATOM   2323  O O   . GLY A 1 334 ? 53.163  -4.056  18.908  1.00 10.98 ? 334  GLY A O   1 
ATOM   2324  N N   . LEU A 1 335 ? 53.246  -6.301  19.114  1.00 10.94 ? 335  LEU A N   1 
ATOM   2325  C CA  . LEU A 1 335 ? 54.722  -6.347  19.181  1.00 11.55 ? 335  LEU A CA  1 
ATOM   2326  C C   . LEU A 1 335 ? 55.419  -5.644  17.993  1.00 12.48 ? 335  LEU A C   1 
ATOM   2327  O O   . LEU A 1 335 ? 56.346  -4.866  18.231  1.00 12.51 ? 335  LEU A O   1 
ATOM   2328  C CB  . LEU A 1 335 ? 55.276  -7.767  19.427  1.00 12.09 ? 335  LEU A CB  1 
ATOM   2329  C CG  . LEU A 1 335 ? 56.804  -7.906  19.583  1.00 12.42 ? 335  LEU A CG  1 
ATOM   2330  C CD1 . LEU A 1 335 ? 57.298  -7.223  20.860  1.00 13.60 ? 335  LEU A CD1 1 
ATOM   2331  C CD2 . LEU A 1 335 ? 57.211  -9.357  19.564  1.00 11.81 ? 335  LEU A CD2 1 
ATOM   2332  N N   . PRO A 1 336 ? 54.975  -5.881  16.721  1.00 12.96 ? 336  PRO A N   1 
ATOM   2333  C CA  . PRO A 1 336 ? 55.653  -5.173  15.622  1.00 12.13 ? 336  PRO A CA  1 
ATOM   2334  C C   . PRO A 1 336 ? 55.471  -3.646  15.706  1.00 12.01 ? 336  PRO A C   1 
ATOM   2335  O O   . PRO A 1 336 ? 56.344  -2.899  15.264  1.00 12.23 ? 336  PRO A O   1 
ATOM   2336  C CB  . PRO A 1 336 ? 55.013  -5.776  14.365  1.00 13.56 ? 336  PRO A CB  1 
ATOM   2337  C CG  . PRO A 1 336 ? 53.721  -6.335  14.843  1.00 13.80 ? 336  PRO A CG  1 
ATOM   2338  C CD  . PRO A 1 336 ? 54.099  -6.928  16.153  1.00 14.24 ? 336  PRO A CD  1 
ATOM   2339  N N   . ILE A 1 337 ? 54.376  -3.199  16.338  1.00 10.58 ? 337  ILE A N   1 
ATOM   2340  C CA  . ILE A 1 337 ? 54.116  -1.762  16.528  1.00 10.76 ? 337  ILE A CA  1 
ATOM   2341  C C   . ILE A 1 337 ? 55.121  -1.233  17.554  1.00 11.92 ? 337  ILE A C   1 
ATOM   2342  O O   . ILE A 1 337 ? 55.768  -0.218  17.312  1.00 12.73 ? 337  ILE A O   1 
ATOM   2343  C CB  . ILE A 1 337 ? 52.666  -1.462  17.028  1.00 10.76 ? 337  ILE A CB  1 
ATOM   2344  C CG1 . ILE A 1 337 ? 51.637  -2.125  16.115  1.00 11.37 ? 337  ILE A CG1 1 
ATOM   2345  C CG2 . ILE A 1 337 ? 52.418  0.059   17.100  1.00 10.93 ? 337  ILE A CG2 1 
ATOM   2346  C CD1 . ILE A 1 337 ? 50.210  -2.128  16.678  1.00 12.02 ? 337  ILE A CD1 1 
ATOM   2347  N N   . MET A 1 338 ? 55.298  -1.972  18.653  1.00 11.39 ? 338  MET A N   1 
ATOM   2348  C CA  . MET A 1 338 ? 56.242  -1.583  19.707  1.00 11.84 ? 338  MET A CA  1 
ATOM   2349  C C   . MET A 1 338 ? 57.698  -1.599  19.225  1.00 11.84 ? 338  MET A C   1 
ATOM   2350  O O   . MET A 1 338 ? 58.483  -0.744  19.624  1.00 12.70 ? 338  MET A O   1 
ATOM   2351  C CB  . MET A 1 338 ? 56.095  -2.467  20.946  1.00 12.37 ? 338  MET A CB  1 
ATOM   2352  C CG  . MET A 1 338 ? 56.800  -1.878  22.155  1.00 11.85 ? 338  MET A CG  1 
ATOM   2353  S SD  . MET A 1 338 ? 56.861  -2.910  23.601  1.00 13.57 ? 338  MET A SD  1 
ATOM   2354  C CE  . MET A 1 338 ? 55.270  -2.642  24.290  1.00 13.54 ? 338  MET A CE  1 
ATOM   2355  N N   . ILE A 1 339 ? 58.045  -2.552  18.359  1.00 12.61 ? 339  ILE A N   1 
ATOM   2356  C CA  . ILE A 1 339 ? 59.408  -2.635  17.808  1.00 11.81 ? 339  ILE A CA  1 
ATOM   2357  C C   . ILE A 1 339 ? 59.671  -1.409  16.926  1.00 13.21 ? 339  ILE A C   1 
ATOM   2358  O O   . ILE A 1 339 ? 60.752  -0.825  16.973  1.00 12.76 ? 339  ILE A O   1 
ATOM   2359  C CB  . ILE A 1 339 ? 59.633  -3.959  17.004  1.00 11.29 ? 339  ILE A CB  1 
ATOM   2360  C CG1 . ILE A 1 339 ? 59.668  -5.145  17.976  1.00 12.73 ? 339  ILE A CG1 1 
ATOM   2361  C CG2 . ILE A 1 339 ? 60.947  -3.912  16.192  1.00 13.13 ? 339  ILE A CG2 1 
ATOM   2362  C CD1 . ILE A 1 339 ? 59.760  -6.508  17.328  1.00 12.18 ? 339  ILE A CD1 1 
ATOM   2363  N N   . SER A 1 340 ? 58.647  -0.986  16.190  1.00 11.78 ? 340  SER A N   1 
ATOM   2364  C CA  . SER A 1 340 ? 58.771  0.168   15.310  1.00 11.91 ? 340  SER A CA  1 
ATOM   2365  C C   . SER A 1 340 ? 58.805  1.510   16.043  1.00 12.27 ? 340  SER A C   1 
ATOM   2366  O O   . SER A 1 340 ? 59.741  2.282   15.851  1.00 13.39 ? 340  SER A O   1 
ATOM   2367  C CB  . SER A 1 340 ? 57.655  0.165   14.260  1.00 12.34 ? 340  SER A CB  1 
ATOM   2368  O OG  . SER A 1 340 ? 57.824  1.228   13.333  1.00 14.37 ? 340  SER A OG  1 
ATOM   2369  N N   . ILE A 1 341 ? 57.839  1.743   16.934  1.00 11.55 ? 341  ILE A N   1 
ATOM   2370  C CA  . ILE A 1 341 ? 57.738  3.020   17.648  1.00 11.57 ? 341  ILE A CA  1 
ATOM   2371  C C   . ILE A 1 341 ? 58.327  3.125   19.060  1.00 11.67 ? 341  ILE A C   1 
ATOM   2372  O O   . ILE A 1 341 ? 58.459  4.228   19.593  1.00 12.62 ? 341  ILE A O   1 
ATOM   2373  C CB  . ILE A 1 341 ? 56.268  3.564   17.638  1.00 11.99 ? 341  ILE A CB  1 
ATOM   2374  C CG1 . ILE A 1 341 ? 55.345  2.682   18.495  1.00 12.17 ? 341  ILE A CG1 1 
ATOM   2375  C CG2 . ILE A 1 341 ? 55.758  3.677   16.190  1.00 14.45 ? 341  ILE A CG2 1 
ATOM   2376  C CD1 . ILE A 1 341 ? 53.922  3.209   18.658  1.00 12.78 ? 341  ILE A CD1 1 
ATOM   2377  N N   . GLY A 1 342 ? 58.666  1.984   19.658  1.00 11.53 ? 342  GLY A N   1 
ATOM   2378  C CA  . GLY A 1 342 ? 59.229  1.977   21.002  1.00 13.08 ? 342  GLY A CA  1 
ATOM   2379  C C   . GLY A 1 342 ? 58.197  1.827   22.096  1.00 13.10 ? 342  GLY A C   1 
ATOM   2380  O O   . GLY A 1 342 ? 57.024  2.156   21.898  1.00 12.75 ? 342  GLY A O   1 
ATOM   2381  N N   . TYR A 1 343 ? 58.652  1.355   23.258  1.00 12.82 ? 343  TYR A N   1 
ATOM   2382  C CA  . TYR A 1 343 ? 57.799  1.141   24.429  1.00 12.97 ? 343  TYR A CA  1 
ATOM   2383  C C   . TYR A 1 343 ? 57.028  2.371   24.901  1.00 13.97 ? 343  TYR A C   1 
ATOM   2384  O O   . TYR A 1 343 ? 55.819  2.285   25.110  1.00 12.11 ? 343  TYR A O   1 
ATOM   2385  C CB  . TYR A 1 343 ? 58.617  0.551   25.588  1.00 13.95 ? 343  TYR A CB  1 
ATOM   2386  C CG  . TYR A 1 343 ? 57.837  0.355   26.878  1.00 13.14 ? 343  TYR A CG  1 
ATOM   2387  C CD1 . TYR A 1 343 ? 56.858  -0.659  26.991  1.00 13.68 ? 343  TYR A CD1 1 
ATOM   2388  C CD2 . TYR A 1 343 ? 58.061  1.197   27.990  1.00 15.02 ? 343  TYR A CD2 1 
ATOM   2389  C CE1 . TYR A 1 343 ? 56.120  -0.833  28.191  1.00 13.99 ? 343  TYR A CE1 1 
ATOM   2390  C CE2 . TYR A 1 343 ? 57.326  1.038   29.187  1.00 15.63 ? 343  TYR A CE2 1 
ATOM   2391  C CZ  . TYR A 1 343 ? 56.363  0.023   29.278  1.00 15.38 ? 343  TYR A CZ  1 
ATOM   2392  O OH  . TYR A 1 343 ? 55.648  -0.116  30.437  1.00 17.52 ? 343  TYR A OH  1 
ATOM   2393  N N   . GLU A 1 344 ? 57.726  3.495   25.079  1.00 14.32 ? 344  GLU A N   1 
ATOM   2394  C CA  . GLU A 1 344 ? 57.090  4.727   25.551  1.00 15.20 ? 344  GLU A CA  1 
ATOM   2395  C C   . GLU A 1 344 ? 55.974  5.223   24.631  1.00 14.18 ? 344  GLU A C   1 
ATOM   2396  O O   . GLU A 1 344 ? 54.913  5.637   25.103  1.00 14.29 ? 344  GLU A O   1 
ATOM   2397  C CB  . GLU A 1 344 ? 58.130  5.823   25.811  1.00 18.90 ? 344  GLU A CB  1 
ATOM   2398  C CG  . GLU A 1 344 ? 59.117  5.518   26.960  1.00 24.45 ? 344  GLU A CG  1 
ATOM   2399  C CD  . GLU A 1 344 ? 58.451  5.265   28.316  1.00 28.78 ? 344  GLU A CD  1 
ATOM   2400  O OE1 . GLU A 1 344 ? 57.515  6.005   28.697  1.00 33.24 ? 344  GLU A OE1 1 
ATOM   2401  O OE2 . GLU A 1 344 ? 58.881  4.321   29.019  1.00 32.97 ? 344  GLU A OE2 1 
ATOM   2402  N N   . ASN A 1 345 ? 56.183  5.077   23.324  1.00 13.34 ? 345  ASN A N   1 
ATOM   2403  C CA  . ASN A 1 345 ? 55.176  5.474   22.349  1.00 12.60 ? 345  ASN A CA  1 
ATOM   2404  C C   . ASN A 1 345 ? 54.024  4.467   22.316  1.00 12.64 ? 345  ASN A C   1 
ATOM   2405  O O   . ASN A 1 345 ? 52.882  4.856   22.083  1.00 11.88 ? 345  ASN A O   1 
ATOM   2406  C CB  . ASN A 1 345 ? 55.789  5.661   20.963  1.00 12.88 ? 345  ASN A CB  1 
ATOM   2407  C CG  . ASN A 1 345 ? 56.502  6.997   20.802  1.00 13.29 ? 345  ASN A CG  1 
ATOM   2408  O OD1 . ASN A 1 345 ? 56.117  8.003   21.402  1.00 14.04 ? 345  ASN A OD1 1 
ATOM   2409  N ND2 . ASN A 1 345 ? 57.523  7.016   19.956  1.00 15.31 ? 345  ASN A ND2 1 
ATOM   2410  N N   . PHE A 1 346 ? 54.314  3.192   22.609  1.00 12.23 ? 346  PHE A N   1 
ATOM   2411  C CA  . PHE A 1 346 ? 53.266  2.160   22.644  1.00 12.52 ? 346  PHE A CA  1 
ATOM   2412  C C   . PHE A 1 346 ? 52.388  2.391   23.879  1.00 12.69 ? 346  PHE A C   1 
ATOM   2413  O O   . PHE A 1 346 ? 51.177  2.185   23.821  1.00 12.22 ? 346  PHE A O   1 
ATOM   2414  C CB  . PHE A 1 346 ? 53.845  0.737   22.658  1.00 12.20 ? 346  PHE A CB  1 
ATOM   2415  C CG  . PHE A 1 346 ? 52.815  -0.348  22.395  1.00 12.62 ? 346  PHE A CG  1 
ATOM   2416  C CD1 . PHE A 1 346 ? 52.456  -0.685  21.079  1.00 13.65 ? 346  PHE A CD1 1 
ATOM   2417  C CD2 . PHE A 1 346 ? 52.193  -1.034  23.462  1.00 12.29 ? 346  PHE A CD2 1 
ATOM   2418  C CE1 . PHE A 1 346 ? 51.487  -1.692  20.817  1.00 13.84 ? 346  PHE A CE1 1 
ATOM   2419  C CE2 . PHE A 1 346 ? 51.223  -2.044  23.219  1.00 12.34 ? 346  PHE A CE2 1 
ATOM   2420  C CZ  . PHE A 1 346 ? 50.870  -2.374  21.891  1.00 13.44 ? 346  PHE A CZ  1 
ATOM   2421  N N   . VAL A 1 347 ? 53.003  2.833   24.980  1.00 12.89 ? 347  VAL A N   1 
ATOM   2422  C CA  . VAL A 1 347 ? 52.277  3.140   26.214  1.00 11.91 ? 347  VAL A CA  1 
ATOM   2423  C C   . VAL A 1 347 ? 51.357  4.338   25.962  1.00 11.95 ? 347  VAL A C   1 
ATOM   2424  O O   . VAL A 1 347 ? 50.239  4.363   26.464  1.00 12.68 ? 347  VAL A O   1 
ATOM   2425  C CB  . VAL A 1 347 ? 53.250  3.389   27.406  1.00 13.44 ? 347  VAL A CB  1 
ATOM   2426  C CG1 . VAL A 1 347 ? 52.538  4.004   28.620  1.00 12.99 ? 347  VAL A CG1 1 
ATOM   2427  C CG2 . VAL A 1 347 ? 53.837  2.077   27.821  1.00 13.89 ? 347  VAL A CG2 1 
ATOM   2428  N N   . GLU A 1 348 ? 51.807  5.277   25.121  1.00 12.19 ? 348  GLU A N   1 
ATOM   2429  C CA  . GLU A 1 348 ? 51.003  6.446   24.763  1.00 11.75 ? 348  GLU A CA  1 
ATOM   2430  C C   . GLU A 1 348 ? 49.779  6.009   23.956  1.00 11.87 ? 348  GLU A C   1 
ATOM   2431  O O   . GLU A 1 348 ? 48.680  6.512   24.187  1.00 11.42 ? 348  GLU A O   1 
ATOM   2432  C CB  . GLU A 1 348 ? 51.824  7.476   23.979  1.00 14.12 ? 348  GLU A CB  1 
ATOM   2433  C CG  . GLU A 1 348 ? 52.654  8.430   24.843  1.00 15.25 ? 348  GLU A CG  1 
ATOM   2434  C CD  . GLU A 1 348 ? 51.799  9.405   25.644  1.00 18.60 ? 348  GLU A CD  1 
ATOM   2435  O OE1 . GLU A 1 348 ? 51.094  10.239  25.029  1.00 18.05 ? 348  GLU A OE1 1 
ATOM   2436  O OE2 . GLU A 1 348 ? 51.833  9.339   26.891  1.00 20.15 ? 348  GLU A OE2 1 
ATOM   2437  N N   . LEU A 1 349 ? 49.973  5.021   23.070  1.00 12.25 ? 349  LEU A N   1 
ATOM   2438  C CA  . LEU A 1 349 ? 48.902  4.450   22.238  1.00 12.17 ? 349  LEU A CA  1 
ATOM   2439  C C   . LEU A 1 349 ? 47.839  3.810   23.138  1.00 12.30 ? 349  LEU A C   1 
ATOM   2440  O O   . LEU A 1 349 ? 46.641  4.064   22.976  1.00 11.24 ? 349  LEU A O   1 
ATOM   2441  C CB  . LEU A 1 349 ? 49.483  3.417   21.253  1.00 12.51 ? 349  LEU A CB  1 
ATOM   2442  C CG  . LEU A 1 349 ? 48.586  2.583   20.318  1.00 12.61 ? 349  LEU A CG  1 
ATOM   2443  C CD1 . LEU A 1 349 ? 47.879  3.447   19.293  1.00 13.72 ? 349  LEU A CD1 1 
ATOM   2444  C CD2 . LEU A 1 349 ? 49.430  1.540   19.615  1.00 14.67 ? 349  LEU A CD2 1 
ATOM   2445  N N   . LEU A 1 350 ? 48.304  3.058   24.139  1.00 11.96 ? 350  LEU A N   1 
ATOM   2446  C CA  . LEU A 1 350 ? 47.429  2.406   25.114  1.00 11.71 ? 350  LEU A CA  1 
ATOM   2447  C C   . LEU A 1 350 ? 46.691  3.429   25.977  1.00 12.28 ? 350  LEU A C   1 
ATOM   2448  O O   . LEU A 1 350 ? 45.499  3.272   26.242  1.00 12.26 ? 350  LEU A O   1 
ATOM   2449  C CB  . LEU A 1 350 ? 48.233  1.483   26.036  1.00 11.36 ? 350  LEU A CB  1 
ATOM   2450  C CG  . LEU A 1 350 ? 48.926  0.242   25.471  1.00 12.67 ? 350  LEU A CG  1 
ATOM   2451  C CD1 . LEU A 1 350 ? 49.761  -0.402  26.566  1.00 13.88 ? 350  LEU A CD1 1 
ATOM   2452  C CD2 . LEU A 1 350 ? 47.937  -0.758  24.895  1.00 13.13 ? 350  LEU A CD2 1 
ATOM   2453  N N   . THR A 1 351 ? 47.397  4.494   26.367  1.00 11.55 ? 351  THR A N   1 
ATOM   2454  C CA  . THR A 1 351 ? 46.832  5.555   27.209  1.00 12.16 ? 351  THR A CA  1 
ATOM   2455  C C   . THR A 1 351 ? 45.724  6.325   26.495  1.00 11.15 ? 351  THR A C   1 
ATOM   2456  O O   . THR A 1 351 ? 44.720  6.665   27.116  1.00 10.96 ? 351  THR A O   1 
ATOM   2457  C CB  . THR A 1 351 ? 47.928  6.508   27.756  1.00 11.93 ? 351  THR A CB  1 
ATOM   2458  O OG1 . THR A 1 351 ? 48.957  5.725   28.375  1.00 12.58 ? 351  THR A OG1 1 
ATOM   2459  C CG2 . THR A 1 351 ? 47.361  7.472   28.807  1.00 13.30 ? 351  THR A CG2 1 
ATOM   2460  N N   . GLY A 1 352 ? 45.876  6.524   25.182  1.00 12.25 ? 352  GLY A N   1 
ATOM   2461  C CA  . GLY A 1 352 ? 44.862  7.217   24.401  1.00 11.28 ? 352  GLY A CA  1 
ATOM   2462  C C   . GLY A 1 352 ? 43.571  6.433   24.374  1.00 11.48 ? 352  GLY A C   1 
ATOM   2463  O O   . GLY A 1 352 ? 42.480  7.002   24.482  1.00 11.92 ? 352  GLY A O   1 
ATOM   2464  N N   . ALA A 1 353 ? 43.715  5.113   24.278  1.00 11.17 ? 353  ALA A N   1 
ATOM   2465  C CA  . ALA A 1 353 ? 42.580  4.208   24.279  1.00 11.13 ? 353  ALA A CA  1 
ATOM   2466  C C   . ALA A 1 353 ? 41.921  4.208   25.651  1.00 10.83 ? 353  ALA A C   1 
ATOM   2467  O O   . ALA A 1 353 ? 40.698  4.306   25.745  1.00 12.64 ? 353  ALA A O   1 
ATOM   2468  C CB  . ALA A 1 353 ? 43.011  2.825   23.896  1.00 10.74 ? 353  ALA A CB  1 
ATOM   2469  N N   . HIS A 1 354 ? 42.754  4.204   26.696  1.00 12.31 ? 354  HIS A N   1 
ATOM   2470  C CA  . HIS A 1 354 ? 42.296  4.221   28.092  1.00 11.82 ? 354  HIS A CA  1 
ATOM   2471  C C   . HIS A 1 354 ? 41.495  5.484   28.422  1.00 12.90 ? 354  HIS A C   1 
ATOM   2472  O O   . HIS A 1 354 ? 40.466  5.397   29.099  1.00 14.26 ? 354  HIS A O   1 
ATOM   2473  C CB  . HIS A 1 354 ? 43.484  4.082   29.051  1.00 12.72 ? 354  HIS A CB  1 
ATOM   2474  C CG  . HIS A 1 354 ? 43.091  3.942   30.492  1.00 13.93 ? 354  HIS A CG  1 
ATOM   2475  N ND1 . HIS A 1 354 ? 42.390  2.855   30.970  1.00 15.15 ? 354  HIS A ND1 1 
ATOM   2476  C CD2 . HIS A 1 354 ? 43.270  4.769   31.551  1.00 15.30 ? 354  HIS A CD2 1 
ATOM   2477  C CE1 . HIS A 1 354 ? 42.154  3.019   32.260  1.00 14.72 ? 354  HIS A CE1 1 
ATOM   2478  N NE2 . HIS A 1 354 ? 42.678  4.172   32.637  1.00 15.47 ? 354  HIS A NE2 1 
ATOM   2479  N N   . VAL A 1 355 ? 41.945  6.637   27.915  1.00 12.37 ? 355  VAL A N   1 
ATOM   2480  C CA  . VAL A 1 355 ? 41.262  7.917   28.142  1.00 12.82 ? 355  VAL A CA  1 
ATOM   2481  C C   . VAL A 1 355 ? 39.854  7.877   27.531  1.00 11.95 ? 355  VAL A C   1 
ATOM   2482  O O   . VAL A 1 355 ? 38.894  8.310   28.164  1.00 12.83 ? 355  VAL A O   1 
ATOM   2483  C CB  . VAL A 1 355 ? 42.098  9.118   27.599  1.00 13.94 ? 355  VAL A CB  1 
ATOM   2484  C CG1 . VAL A 1 355 ? 41.313  10.437  27.689  1.00 16.39 ? 355  VAL A CG1 1 
ATOM   2485  C CG2 . VAL A 1 355 ? 43.378  9.257   28.414  1.00 16.33 ? 355  VAL A CG2 1 
ATOM   2486  N N   . ILE A 1 356 ? 39.734  7.282   26.343  1.00 12.05 ? 356  ILE A N   1 
ATOM   2487  C CA  . ILE A 1 356 ? 38.438  7.158   25.675  1.00 11.07 ? 356  ILE A CA  1 
ATOM   2488  C C   . ILE A 1 356 ? 37.563  6.074   26.321  1.00 11.26 ? 356  ILE A C   1 
ATOM   2489  O O   . ILE A 1 356 ? 36.340  6.217   26.345  1.00 11.42 ? 356  ILE A O   1 
ATOM   2490  C CB  . ILE A 1 356 ? 38.603  6.996   24.142  1.00 11.64 ? 356  ILE A CB  1 
ATOM   2491  C CG1 . ILE A 1 356 ? 39.268  8.258   23.583  1.00 11.49 ? 356  ILE A CG1 1 
ATOM   2492  C CG2 . ILE A 1 356 ? 37.261  6.747   23.429  1.00 13.10 ? 356  ILE A CG2 1 
ATOM   2493  C CD1 . ILE A 1 356 ? 38.540  9.587   23.802  1.00 13.85 ? 356  ILE A CD1 1 
ATOM   2494  N N   . ASP A 1 357 ? 38.193  5.040   26.895  1.00 12.04 ? 357  ASP A N   1 
ATOM   2495  C CA  . ASP A 1 357 ? 37.462  3.971   27.597  1.00 12.45 ? 357  ASP A CA  1 
ATOM   2496  C C   . ASP A 1 357 ? 36.784  4.578   28.831  1.00 12.73 ? 357  ASP A C   1 
ATOM   2497  O O   . ASP A 1 357 ? 35.613  4.317   29.094  1.00 14.29 ? 357  ASP A O   1 
ATOM   2498  C CB  . ASP A 1 357 ? 38.396  2.852   28.082  1.00 12.04 ? 357  ASP A CB  1 
ATOM   2499  C CG  . ASP A 1 357 ? 38.995  2.027   26.960  1.00 12.24 ? 357  ASP A CG  1 
ATOM   2500  O OD1 . ASP A 1 357 ? 38.459  2.005   25.830  1.00 12.14 ? 357  ASP A OD1 1 
ATOM   2501  O OD2 . ASP A 1 357 ? 40.029  1.380   27.227  1.00 12.24 ? 357  ASP A OD2 1 
ATOM   2502  N N   . GLU A 1 358 ? 37.532  5.426   29.546  1.00 14.08 ? 358  GLU A N   1 
ATOM   2503  C CA  . GLU A 1 358 ? 37.037  6.106   30.744  1.00 14.95 ? 358  GLU A CA  1 
ATOM   2504  C C   . GLU A 1 358 ? 35.953  7.126   30.403  1.00 14.59 ? 358  GLU A C   1 
ATOM   2505  O O   . GLU A 1 358 ? 34.970  7.247   31.129  1.00 15.47 ? 358  GLU A O   1 
ATOM   2506  C CB  . GLU A 1 358 ? 38.183  6.777   31.508  1.00 16.64 ? 358  GLU A CB  1 
ATOM   2507  C CG  . GLU A 1 358 ? 39.223  5.805   32.093  1.00 20.29 ? 358  GLU A CG  1 
ATOM   2508  C CD  . GLU A 1 358 ? 38.644  4.830   33.108  1.00 23.52 ? 358  GLU A CD  1 
ATOM   2509  O OE1 . GLU A 1 358 ? 38.118  5.288   34.146  1.00 25.15 ? 358  GLU A OE1 1 
ATOM   2510  O OE2 . GLU A 1 358 ? 38.718  3.603   32.868  1.00 25.26 ? 358  GLU A OE2 1 
ATOM   2511  N N   . HIS A 1 359 ? 36.123  7.815   29.271  1.00 14.27 ? 359  HIS A N   1 
ATOM   2512  C CA  . HIS A 1 359 ? 35.156  8.799   28.776  1.00 13.72 ? 359  HIS A CA  1 
ATOM   2513  C C   . HIS A 1 359 ? 33.850  8.074   28.422  1.00 13.71 ? 359  HIS A C   1 
ATOM   2514  O O   . HIS A 1 359 ? 32.773  8.490   28.836  1.00 14.94 ? 359  HIS A O   1 
ATOM   2515  C CB  . HIS A 1 359 ? 35.730  9.535   27.541  1.00 13.77 ? 359  HIS A CB  1 
ATOM   2516  C CG  . HIS A 1 359 ? 34.708  10.263  26.716  1.00 14.82 ? 359  HIS A CG  1 
ATOM   2517  N ND1 . HIS A 1 359 ? 34.147  11.460  27.107  1.00 14.86 ? 359  HIS A ND1 1 
ATOM   2518  C CD2 . HIS A 1 359 ? 34.120  9.940   25.537  1.00 15.30 ? 359  HIS A CD2 1 
ATOM   2519  C CE1 . HIS A 1 359 ? 33.254  11.837  26.210  1.00 14.86 ? 359  HIS A CE1 1 
ATOM   2520  N NE2 . HIS A 1 359 ? 33.217  10.932  25.248  1.00 14.59 ? 359  HIS A NE2 1 
ATOM   2521  N N   . PHE A 1 360 ? 33.971  6.978   27.674  1.00 12.79 ? 360  PHE A N   1 
ATOM   2522  C CA  . PHE A 1 360 ? 32.818  6.188   27.241  1.00 12.62 ? 360  PHE A CA  1 
ATOM   2523  C C   . PHE A 1 360 ? 32.000  5.613   28.404  1.00 13.08 ? 360  PHE A C   1 
ATOM   2524  O O   . PHE A 1 360 ? 30.769  5.677   28.391  1.00 13.73 ? 360  PHE A O   1 
ATOM   2525  C CB  . PHE A 1 360 ? 33.296  5.066   26.304  1.00 11.42 ? 360  PHE A CB  1 
ATOM   2526  C CG  . PHE A 1 360 ? 32.200  4.153   25.810  1.00 12.02 ? 360  PHE A CG  1 
ATOM   2527  C CD1 . PHE A 1 360 ? 31.100  4.663   25.097  1.00 12.62 ? 360  PHE A CD1 1 
ATOM   2528  C CD2 . PHE A 1 360 ? 32.285  2.767   26.031  1.00 10.80 ? 360  PHE A CD2 1 
ATOM   2529  C CE1 . PHE A 1 360 ? 30.093  3.804   24.603  1.00 11.56 ? 360  PHE A CE1 1 
ATOM   2530  C CE2 . PHE A 1 360 ? 31.292  1.890   25.539  1.00 11.79 ? 360  PHE A CE2 1 
ATOM   2531  C CZ  . PHE A 1 360 ? 30.194  2.413   24.824  1.00 10.25 ? 360  PHE A CZ  1 
ATOM   2532  N N   . ALA A 1 361 ? 32.694  5.081   29.405  1.00 14.22 ? 361  ALA A N   1 
ATOM   2533  C CA  . ALA A 1 361 ? 32.039  4.482   30.563  1.00 16.17 ? 361  ALA A CA  1 
ATOM   2534  C C   . ALA A 1 361 ? 31.463  5.467   31.577  1.00 17.66 ? 361  ALA A C   1 
ATOM   2535  O O   . ALA A 1 361 ? 30.495  5.139   32.269  1.00 19.41 ? 361  ALA A O   1 
ATOM   2536  C CB  . ALA A 1 361 ? 32.997  3.535   31.258  1.00 16.13 ? 361  ALA A CB  1 
ATOM   2537  N N   . ASN A 1 362 ? 32.013  6.684   31.620  1.00 18.10 ? 362  ASN A N   1 
ATOM   2538  C CA  . ASN A 1 362 ? 31.588  7.678   32.613  1.00 18.89 ? 362  ASN A CA  1 
ATOM   2539  C C   . ASN A 1 362 ? 30.891  8.961   32.172  1.00 18.08 ? 362  ASN A C   1 
ATOM   2540  O O   . ASN A 1 362 ? 30.127  9.534   32.956  1.00 17.96 ? 362  ASN A O   1 
ATOM   2541  C CB  . ASN A 1 362 ? 32.770  8.050   33.518  1.00 21.36 ? 362  ASN A CB  1 
ATOM   2542  C CG  . ASN A 1 362 ? 33.427  6.835   34.158  1.00 23.57 ? 362  ASN A CG  1 
ATOM   2543  O OD1 . ASN A 1 362 ? 32.848  6.189   35.034  1.00 27.18 ? 362  ASN A OD1 1 
ATOM   2544  N ND2 . ASN A 1 362 ? 34.627  6.506   33.705  1.00 23.40 ? 362  ASN A ND2 1 
ATOM   2545  N N   . ALA A 1 363 ? 31.150  9.420   30.947  1.00 17.16 ? 363  ALA A N   1 
ATOM   2546  C CA  . ALA A 1 363 ? 30.549  10.662  30.440  1.00 17.56 ? 363  ALA A CA  1 
ATOM   2547  C C   . ALA A 1 363 ? 29.031  10.586  30.240  1.00 17.98 ? 363  ALA A C   1 
ATOM   2548  O O   . ALA A 1 363 ? 28.515  9.529   29.858  1.00 16.65 ? 363  ALA A O   1 
ATOM   2549  C CB  . ALA A 1 363 ? 31.225  11.087  29.131  1.00 17.36 ? 363  ALA A CB  1 
ATOM   2550  N N   . PRO A 1 364 ? 28.293  11.690  30.544  1.00 18.98 ? 364  PRO A N   1 
ATOM   2551  C CA  . PRO A 1 364 ? 26.831  11.748  30.389  1.00 20.26 ? 364  PRO A CA  1 
ATOM   2552  C C   . PRO A 1 364 ? 26.434  11.463  28.929  1.00 20.11 ? 364  PRO A C   1 
ATOM   2553  O O   . PRO A 1 364 ? 27.156  11.873  28.013  1.00 19.13 ? 364  PRO A O   1 
ATOM   2554  C CB  . PRO A 1 364 ? 26.514  13.192  30.784  1.00 20.71 ? 364  PRO A CB  1 
ATOM   2555  C CG  . PRO A 1 364 ? 27.527  13.481  31.819  1.00 21.90 ? 364  PRO A CG  1 
ATOM   2556  C CD  . PRO A 1 364 ? 28.776  12.936  31.182  1.00 19.84 ? 364  PRO A CD  1 
ATOM   2557  N N   . PRO A 1 365 ? 25.308  10.743  28.694  1.00 19.95 ? 365  PRO A N   1 
ATOM   2558  C CA  . PRO A 1 365 ? 24.827  10.395  27.346  1.00 19.88 ? 365  PRO A CA  1 
ATOM   2559  C C   . PRO A 1 365 ? 24.903  11.449  26.238  1.00 20.52 ? 365  PRO A C   1 
ATOM   2560  O O   . PRO A 1 365 ? 25.432  11.172  25.149  1.00 20.80 ? 365  PRO A O   1 
ATOM   2561  C CB  . PRO A 1 365 ? 23.391  9.958   27.607  1.00 20.56 ? 365  PRO A CB  1 
ATOM   2562  C CG  . PRO A 1 365 ? 23.504  9.273   28.909  1.00 20.73 ? 365  PRO A CG  1 
ATOM   2563  C CD  . PRO A 1 365 ? 24.358  10.230  29.707  1.00 20.11 ? 365  PRO A CD  1 
ATOM   2564  N N   . GLU A 1 366 ? 24.461  12.665  26.552  1.00 20.52 ? 366  GLU A N   1 
ATOM   2565  C CA  . GLU A 1 366 ? 24.451  13.777  25.600  1.00 21.18 ? 366  GLU A CA  1 
ATOM   2566  C C   . GLU A 1 366 ? 25.832  14.366  25.268  1.00 20.14 ? 366  GLU A C   1 
ATOM   2567  O O   . GLU A 1 366 ? 25.954  15.175  24.346  1.00 19.62 ? 366  GLU A O   1 
ATOM   2568  C CB  . GLU A 1 366 ? 23.470  14.873  26.068  1.00 23.76 ? 366  GLU A CB  1 
ATOM   2569  C CG  . GLU A 1 366 ? 23.886  15.732  27.289  1.00 27.45 ? 366  GLU A CG  1 
ATOM   2570  C CD  . GLU A 1 366 ? 23.778  15.036  28.650  1.00 30.30 ? 366  GLU A CD  1 
ATOM   2571  O OE1 . GLU A 1 366 ? 23.140  13.961  28.769  1.00 30.04 ? 366  GLU A OE1 1 
ATOM   2572  O OE2 . GLU A 1 366 ? 24.337  15.589  29.622  1.00 32.17 ? 366  GLU A OE2 1 
ATOM   2573  N N   . GLN A 1 367 ? 26.853  13.957  26.027  1.00 18.21 ? 367  GLN A N   1 
ATOM   2574  C CA  . GLN A 1 367 ? 28.237  14.412  25.844  1.00 17.60 ? 367  GLN A CA  1 
ATOM   2575  C C   . GLN A 1 367 ? 29.205  13.230  25.660  1.00 16.36 ? 367  GLN A C   1 
ATOM   2576  O O   . GLN A 1 367 ? 30.421  13.385  25.789  1.00 16.18 ? 367  GLN A O   1 
ATOM   2577  C CB  . GLN A 1 367 ? 28.696  15.253  27.054  1.00 19.65 ? 367  GLN A CB  1 
ATOM   2578  C CG  . GLN A 1 367 ? 27.969  16.591  27.279  1.00 24.25 ? 367  GLN A CG  1 
ATOM   2579  C CD  . GLN A 1 367 ? 28.142  17.584  26.137  1.00 26.25 ? 367  GLN A CD  1 
ATOM   2580  O OE1 . GLN A 1 367 ? 27.163  18.112  25.613  1.00 30.26 ? 367  GLN A OE1 1 
ATOM   2581  N NE2 . GLN A 1 367 ? 29.388  17.844  25.754  1.00 28.51 ? 367  GLN A NE2 1 
ATOM   2582  N N   . ASN A 1 368 ? 28.656  12.065  25.320  1.00 14.96 ? 368  ASN A N   1 
ATOM   2583  C CA  . ASN A 1 368 ? 29.425  10.831  25.133  1.00 12.89 ? 368  ASN A CA  1 
ATOM   2584  C C   . ASN A 1 368 ? 29.709  10.616  23.633  1.00 12.71 ? 368  ASN A C   1 
ATOM   2585  O O   . ASN A 1 368 ? 28.811  10.236  22.879  1.00 13.01 ? 368  ASN A O   1 
ATOM   2586  C CB  . ASN A 1 368 ? 28.608  9.673   25.729  1.00 13.05 ? 368  ASN A CB  1 
ATOM   2587  C CG  . ASN A 1 368 ? 29.418  8.408   25.939  1.00 13.97 ? 368  ASN A CG  1 
ATOM   2588  O OD1 . ASN A 1 368 ? 29.963  7.835   24.996  1.00 14.34 ? 368  ASN A OD1 1 
ATOM   2589  N ND2 . ASN A 1 368 ? 29.453  7.936   27.178  1.00 13.97 ? 368  ASN A ND2 1 
ATOM   2590  N N   . VAL A 1 369 ? 30.968  10.807  23.226  1.00 12.17 ? 369  VAL A N   1 
ATOM   2591  C CA  . VAL A 1 369 ? 31.375  10.683  21.813  1.00 12.58 ? 369  VAL A CA  1 
ATOM   2592  C C   . VAL A 1 369 ? 31.079  9.350   21.094  1.00 12.14 ? 369  VAL A C   1 
ATOM   2593  O O   . VAL A 1 369 ? 30.448  9.382   20.028  1.00 12.59 ? 369  VAL A O   1 
ATOM   2594  C CB  . VAL A 1 369 ? 32.854  11.206  21.580  1.00 12.45 ? 369  VAL A CB  1 
ATOM   2595  C CG1 . VAL A 1 369 ? 33.380  10.866  20.182  1.00 13.22 ? 369  VAL A CG1 1 
ATOM   2596  C CG2 . VAL A 1 369 ? 32.894  12.690  21.757  1.00 13.21 ? 369  VAL A CG2 1 
ATOM   2597  N N   . PRO A 1 370 ? 31.487  8.177   21.657  1.00 11.93 ? 370  PRO A N   1 
ATOM   2598  C CA  . PRO A 1 370 ? 31.176  6.939   20.929  1.00 12.13 ? 370  PRO A CA  1 
ATOM   2599  C C   . PRO A 1 370 ? 29.681  6.606   20.875  1.00 12.15 ? 370  PRO A C   1 
ATOM   2600  O O   . PRO A 1 370 ? 29.217  6.027   19.894  1.00 10.90 ? 370  PRO A O   1 
ATOM   2601  C CB  . PRO A 1 370 ? 31.957  5.887   21.701  1.00 12.54 ? 370  PRO A CB  1 
ATOM   2602  C CG  . PRO A 1 370 ? 33.075  6.656   22.336  1.00 12.32 ? 370  PRO A CG  1 
ATOM   2603  C CD  . PRO A 1 370 ? 32.342  7.857   22.819  1.00 12.39 ? 370  PRO A CD  1 
ATOM   2604  N N   . LEU A 1 371 ? 28.934  7.004   21.911  1.00 12.39 ? 371  LEU A N   1 
ATOM   2605  C CA  . LEU A 1 371 ? 27.484  6.773   21.955  1.00 11.82 ? 371  LEU A CA  1 
ATOM   2606  C C   . LEU A 1 371 ? 26.779  7.614   20.884  1.00 12.07 ? 371  LEU A C   1 
ATOM   2607  O O   . LEU A 1 371 ? 25.949  7.093   20.140  1.00 12.43 ? 371  LEU A O   1 
ATOM   2608  C CB  . LEU A 1 371 ? 26.908  7.099   23.338  1.00 13.37 ? 371  LEU A CB  1 
ATOM   2609  C CG  . LEU A 1 371 ? 25.405  6.868   23.551  1.00 13.01 ? 371  LEU A CG  1 
ATOM   2610  C CD1 . LEU A 1 371 ? 25.095  5.397   23.740  1.00 13.00 ? 371  LEU A CD1 1 
ATOM   2611  C CD2 . LEU A 1 371 ? 24.931  7.649   24.737  1.00 14.46 ? 371  LEU A CD2 1 
ATOM   2612  N N   . LEU A 1 372 ? 27.153  8.892   20.786  1.00 12.59 ? 372  LEU A N   1 
ATOM   2613  C CA  . LEU A 1 372 ? 26.575  9.805   19.799  1.00 12.55 ? 372  LEU A CA  1 
ATOM   2614  C C   . LEU A 1 372 ? 26.888  9.377   18.368  1.00 12.61 ? 372  LEU A C   1 
ATOM   2615  O O   . LEU A 1 372 ? 25.997  9.355   17.524  1.00 12.91 ? 372  LEU A O   1 
ATOM   2616  C CB  . LEU A 1 372 ? 27.034  11.245  20.051  1.00 13.79 ? 372  LEU A CB  1 
ATOM   2617  C CG  . LEU A 1 372 ? 26.447  11.907  21.305  1.00 14.73 ? 372  LEU A CG  1 
ATOM   2618  C CD1 . LEU A 1 372 ? 27.307  13.086  21.706  1.00 15.01 ? 372  LEU A CD1 1 
ATOM   2619  C CD2 . LEU A 1 372 ? 24.994  12.325  21.088  1.00 16.95 ? 372  LEU A CD2 1 
ATOM   2620  N N   . LEU A 1 373 ? 28.123  8.924   18.144  1.00 11.69 ? 373  LEU A N   1 
ATOM   2621  C CA  . LEU A 1 373 ? 28.576  8.453   16.830  1.00 11.98 ? 373  LEU A CA  1 
ATOM   2622  C C   . LEU A 1 373 ? 27.787  7.200   16.419  1.00 11.62 ? 373  LEU A C   1 
ATOM   2623  O O   . LEU A 1 373 ? 27.369  7.065   15.267  1.00 12.24 ? 373  LEU A O   1 
ATOM   2624  C CB  . LEU A 1 373 ? 30.076  8.150   16.880  1.00 13.03 ? 373  LEU A CB  1 
ATOM   2625  C CG  . LEU A 1 373 ? 30.870  8.006   15.581  1.00 15.73 ? 373  LEU A CG  1 
ATOM   2626  C CD1 . LEU A 1 373 ? 30.867  9.300   14.779  1.00 15.26 ? 373  LEU A CD1 1 
ATOM   2627  C CD2 . LEU A 1 373 ? 32.290  7.584   15.913  1.00 15.17 ? 373  LEU A CD2 1 
ATOM   2628  N N   . ALA A 1 374 ? 27.518  6.338   17.399  1.00 11.33 ? 374  ALA A N   1 
ATOM   2629  C CA  . ALA A 1 374 ? 26.763  5.111   17.179  1.00 11.37 ? 374  ALA A CA  1 
ATOM   2630  C C   . ALA A 1 374 ? 25.297  5.361   16.880  1.00 10.06 ? 374  ALA A C   1 
ATOM   2631  O O   . ALA A 1 374 ? 24.723  4.724   15.995  1.00 10.51 ? 374  ALA A O   1 
ATOM   2632  C CB  . ALA A 1 374 ? 26.888  4.223   18.361  1.00 11.27 ? 374  ALA A CB  1 
ATOM   2633  N N   . LEU A 1 375 ? 24.713  6.316   17.603  1.00 11.16 ? 375  LEU A N   1 
ATOM   2634  C CA  . LEU A 1 375 ? 23.309  6.681   17.433  1.00 11.12 ? 375  LEU A CA  1 
ATOM   2635  C C   . LEU A 1 375 ? 23.026  7.383   16.108  1.00 11.10 ? 375  LEU A C   1 
ATOM   2636  O O   . LEU A 1 375 ? 21.978  7.151   15.502  1.00 10.85 ? 375  LEU A O   1 
ATOM   2637  C CB  . LEU A 1 375 ? 22.825  7.520   18.616  1.00 11.98 ? 375  LEU A CB  1 
ATOM   2638  C CG  . LEU A 1 375 ? 22.642  6.752   19.929  1.00 13.19 ? 375  LEU A CG  1 
ATOM   2639  C CD1 . LEU A 1 375 ? 22.384  7.740   21.044  1.00 13.47 ? 375  LEU A CD1 1 
ATOM   2640  C CD2 . LEU A 1 375 ? 21.503  5.741   19.828  1.00 14.94 ? 375  LEU A CD2 1 
ATOM   2641  N N   . VAL A 1 376 ? 23.971  8.215   15.654  1.00 11.22 ? 376  VAL A N   1 
ATOM   2642  C CA  . VAL A 1 376 ? 23.865  8.918   14.368  1.00 11.53 ? 376  VAL A CA  1 
ATOM   2643  C C   . VAL A 1 376 ? 23.887  7.835   13.274  1.00 10.59 ? 376  VAL A C   1 
ATOM   2644  O O   . VAL A 1 376 ? 23.121  7.903   12.313  1.00 11.47 ? 376  VAL A O   1 
ATOM   2645  C CB  . VAL A 1 376 ? 25.042  9.937   14.164  1.00 12.10 ? 376  VAL A CB  1 
ATOM   2646  C CG1 . VAL A 1 376 ? 25.058  10.515  12.737  1.00 12.69 ? 376  VAL A CG1 1 
ATOM   2647  C CG2 . VAL A 1 376 ? 24.899  11.086  15.151  1.00 13.22 ? 376  VAL A CG2 1 
ATOM   2648  N N   . GLY A 1 377 ? 24.701  6.800   13.508  1.00 11.35 ? 377  GLY A N   1 
ATOM   2649  C CA  . GLY A 1 377 ? 24.822  5.679   12.589  1.00 11.25 ? 377  GLY A CA  1 
ATOM   2650  C C   . GLY A 1 377 ? 23.542  4.862   12.505  1.00 11.43 ? 377  GLY A C   1 
ATOM   2651  O O   . GLY A 1 377 ? 23.091  4.545   11.408  1.00 11.46 ? 377  GLY A O   1 
ATOM   2652  N N   . VAL A 1 378 ? 22.931  4.586   13.663  1.00 11.20 ? 378  VAL A N   1 
ATOM   2653  C CA  . VAL A 1 378 ? 21.669  3.833   13.753  1.00 11.21 ? 378  VAL A CA  1 
ATOM   2654  C C   . VAL A 1 378 ? 20.546  4.611   13.058  1.00 10.63 ? 378  VAL A C   1 
ATOM   2655  O O   . VAL A 1 378 ? 19.728  4.020   12.350  1.00 11.17 ? 378  VAL A O   1 
ATOM   2656  C CB  . VAL A 1 378 ? 21.307  3.509   15.245  1.00 11.73 ? 378  VAL A CB  1 
ATOM   2657  C CG1 . VAL A 1 378 ? 19.827  3.119   15.414  1.00 12.56 ? 378  VAL A CG1 1 
ATOM   2658  C CG2 . VAL A 1 378 ? 22.175  2.365   15.742  1.00 12.65 ? 378  VAL A CG2 1 
ATOM   2659  N N   . TRP A 1 379 ? 20.564  5.937   13.209  1.00 10.36 ? 379  TRP A N   1 
ATOM   2660  C CA  . TRP A 1 379 ? 19.570  6.806   12.580  1.00 11.46 ? 379  TRP A CA  1 
ATOM   2661  C C   . TRP A 1 379 ? 19.624  6.658   11.054  1.00 11.38 ? 379  TRP A C   1 
ATOM   2662  O O   . TRP A 1 379 ? 18.598  6.430   10.408  1.00 11.27 ? 379  TRP A O   1 
ATOM   2663  C CB  . TRP A 1 379 ? 19.787  8.267   13.022  1.00 10.73 ? 379  TRP A CB  1 
ATOM   2664  C CG  . TRP A 1 379 ? 18.832  9.298   12.448  1.00 11.89 ? 379  TRP A CG  1 
ATOM   2665  C CD1 . TRP A 1 379 ? 19.174  10.380  11.690  1.00 12.24 ? 379  TRP A CD1 1 
ATOM   2666  C CD2 . TRP A 1 379 ? 17.406  9.361   12.615  1.00 11.96 ? 379  TRP A CD2 1 
ATOM   2667  N NE1 . TRP A 1 379 ? 18.060  11.123  11.378  1.00 13.04 ? 379  TRP A NE1 1 
ATOM   2668  C CE2 . TRP A 1 379 ? 16.960  10.522  11.928  1.00 12.38 ? 379  TRP A CE2 1 
ATOM   2669  C CE3 . TRP A 1 379 ? 16.455  8.552   13.279  1.00 13.18 ? 379  TRP A CE3 1 
ATOM   2670  C CZ2 . TRP A 1 379 ? 15.602  10.900  11.884  1.00 13.68 ? 379  TRP A CZ2 1 
ATOM   2671  C CZ3 . TRP A 1 379 ? 15.093  8.930   13.238  1.00 13.51 ? 379  TRP A CZ3 1 
ATOM   2672  C CH2 . TRP A 1 379 ? 14.691  10.098  12.544  1.00 14.61 ? 379  TRP A CH2 1 
ATOM   2673  N N   . TYR A 1 380 ? 20.835  6.668   10.502  1.00 10.59 ? 380  TYR A N   1 
ATOM   2674  C CA  . TYR A 1 380 ? 21.003  6.524   9.063   1.00 10.33 ? 380  TYR A CA  1 
ATOM   2675  C C   . TYR A 1 380 ? 20.801  5.122   8.505   1.00 10.52 ? 380  TYR A C   1 
ATOM   2676  O O   . TYR A 1 380 ? 20.181  4.964   7.455   1.00 11.15 ? 380  TYR A O   1 
ATOM   2677  C CB  . TYR A 1 380 ? 22.333  7.119   8.608   1.00 9.92  ? 380  TYR A CB  1 
ATOM   2678  C CG  . TYR A 1 380 ? 22.260  8.624   8.519   1.00 10.03 ? 380  TYR A CG  1 
ATOM   2679  C CD1 . TYR A 1 380 ? 21.427  9.246   7.561   1.00 9.55  ? 380  TYR A CD1 1 
ATOM   2680  C CD2 . TYR A 1 380 ? 22.940  9.438   9.444   1.00 11.60 ? 380  TYR A CD2 1 
ATOM   2681  C CE1 . TYR A 1 380 ? 21.259  10.649  7.533   1.00 10.46 ? 380  TYR A CE1 1 
ATOM   2682  C CE2 . TYR A 1 380 ? 22.783  10.845  9.427   1.00 11.13 ? 380  TYR A CE2 1 
ATOM   2683  C CZ  . TYR A 1 380 ? 21.941  11.434  8.467   1.00 10.66 ? 380  TYR A CZ  1 
ATOM   2684  O OH  . TYR A 1 380 ? 21.814  12.794  8.423   1.00 10.96 ? 380  TYR A OH  1 
ATOM   2685  N N   . ILE A 1 381 ? 21.268  4.108   9.230   1.00 9.92  ? 381  ILE A N   1 
ATOM   2686  C CA  . ILE A 1 381 ? 21.127  2.717   8.786   1.00 10.62 ? 381  ILE A CA  1 
ATOM   2687  C C   . ILE A 1 381 ? 19.685  2.203   8.853   1.00 11.71 ? 381  ILE A C   1 
ATOM   2688  O O   . ILE A 1 381 ? 19.133  1.750   7.850   1.00 12.40 ? 381  ILE A O   1 
ATOM   2689  C CB  . ILE A 1 381 ? 22.039  1.750   9.617   1.00 11.28 ? 381  ILE A CB  1 
ATOM   2690  C CG1 . ILE A 1 381 ? 23.511  2.101   9.402   1.00 11.49 ? 381  ILE A CG1 1 
ATOM   2691  C CG2 . ILE A 1 381 ? 21.814  0.276   9.212   1.00 11.98 ? 381  ILE A CG2 1 
ATOM   2692  C CD1 . ILE A 1 381 ? 24.428  1.569   10.483  1.00 12.18 ? 381  ILE A CD1 1 
ATOM   2693  N N   . ASN A 1 382 ? 19.085  2.321   10.032  1.00 11.35 ? 382  ASN A N   1 
ATOM   2694  C CA  . ASN A 1 382 ? 17.744  1.796   10.271  1.00 11.68 ? 382  ASN A CA  1 
ATOM   2695  C C   . ASN A 1 382 ? 16.540  2.655   9.894   1.00 13.57 ? 382  ASN A C   1 
ATOM   2696  O O   . ASN A 1 382 ? 15.425  2.151   9.790   1.00 14.69 ? 382  ASN A O   1 
ATOM   2697  C CB  . ASN A 1 382 ? 17.630  1.360   11.731  1.00 12.63 ? 382  ASN A CB  1 
ATOM   2698  C CG  . ASN A 1 382 ? 18.685  0.325   12.133  1.00 12.93 ? 382  ASN A CG  1 
ATOM   2699  O OD1 . ASN A 1 382 ? 19.522  0.598   12.983  1.00 12.44 ? 382  ASN A OD1 1 
ATOM   2700  N ND2 . ASN A 1 382 ? 18.637  -0.858  11.530  1.00 13.13 ? 382  ASN A ND2 1 
ATOM   2701  N N   . PHE A 1 383 ? 16.733  3.950   9.695   1.00 12.89 ? 383  PHE A N   1 
ATOM   2702  C CA  . PHE A 1 383 ? 15.586  4.778   9.358   1.00 13.36 ? 383  PHE A CA  1 
ATOM   2703  C C   . PHE A 1 383 ? 15.685  5.341   7.960   1.00 13.88 ? 383  PHE A C   1 
ATOM   2704  O O   . PHE A 1 383 ? 14.724  5.274   7.194   1.00 14.95 ? 383  PHE A O   1 
ATOM   2705  C CB  . PHE A 1 383 ? 15.369  5.800   10.462  1.00 13.60 ? 383  PHE A CB  1 
ATOM   2706  C CG  . PHE A 1 383 ? 15.041  5.158   11.777  1.00 14.30 ? 383  PHE A CG  1 
ATOM   2707  C CD1 . PHE A 1 383 ? 13.709  4.857   12.101  1.00 14.18 ? 383  PHE A CD1 1 
ATOM   2708  C CD2 . PHE A 1 383 ? 16.062  4.779   12.668  1.00 13.75 ? 383  PHE A CD2 1 
ATOM   2709  C CE1 . PHE A 1 383 ? 13.392  4.182   13.295  1.00 15.25 ? 383  PHE A CE1 1 
ATOM   2710  C CE2 . PHE A 1 383 ? 15.761  4.104   13.866  1.00 14.41 ? 383  PHE A CE2 1 
ATOM   2711  C CZ  . PHE A 1 383 ? 14.422  3.806   14.179  1.00 15.16 ? 383  PHE A CZ  1 
ATOM   2712  N N   . PHE A 1 384 ? 16.881  5.791   7.589   1.00 13.70 ? 384  PHE A N   1 
ATOM   2713  C CA  . PHE A 1 384 ? 17.119  6.297   6.239   1.00 13.12 ? 384  PHE A CA  1 
ATOM   2714  C C   . PHE A 1 384 ? 17.421  5.156   5.260   1.00 12.77 ? 384  PHE A C   1 
ATOM   2715  O O   . PHE A 1 384 ? 17.276  5.321   4.048   1.00 13.59 ? 384  PHE A O   1 
ATOM   2716  C CB  . PHE A 1 384 ? 18.266  7.307   6.217   1.00 13.28 ? 384  PHE A CB  1 
ATOM   2717  C CG  . PHE A 1 384 ? 17.849  8.708   6.550   1.00 12.90 ? 384  PHE A CG  1 
ATOM   2718  C CD1 . PHE A 1 384 ? 17.683  9.110   7.889   1.00 13.87 ? 384  PHE A CD1 1 
ATOM   2719  C CD2 . PHE A 1 384 ? 17.611  9.639   5.523   1.00 13.10 ? 384  PHE A CD2 1 
ATOM   2720  C CE1 . PHE A 1 384 ? 17.276  10.438  8.200   1.00 14.20 ? 384  PHE A CE1 1 
ATOM   2721  C CE2 . PHE A 1 384 ? 17.209  10.965  5.814   1.00 14.26 ? 384  PHE A CE2 1 
ATOM   2722  C CZ  . PHE A 1 384 ? 17.040  11.359  7.154   1.00 13.98 ? 384  PHE A CZ  1 
ATOM   2723  N N   . GLY A 1 385 ? 17.829  4.002   5.799   1.00 12.31 ? 385  GLY A N   1 
ATOM   2724  C CA  . GLY A 1 385 ? 18.147  2.845   4.975   1.00 13.12 ? 385  GLY A CA  1 
ATOM   2725  C C   . GLY A 1 385 ? 19.502  2.920   4.286   1.00 13.04 ? 385  GLY A C   1 
ATOM   2726  O O   . GLY A 1 385 ? 19.698  2.303   3.237   1.00 13.70 ? 385  GLY A O   1 
ATOM   2727  N N   . ALA A 1 386 ? 20.425  3.690   4.868   1.00 12.18 ? 386  ALA A N   1 
ATOM   2728  C CA  . ALA A 1 386 ? 21.777  3.860   4.330   1.00 11.99 ? 386  ALA A CA  1 
ATOM   2729  C C   . ALA A 1 386 ? 22.639  2.668   4.746   1.00 12.04 ? 386  ALA A C   1 
ATOM   2730  O O   . ALA A 1 386 ? 23.008  2.532   5.916   1.00 14.01 ? 386  ALA A O   1 
ATOM   2731  C CB  . ALA A 1 386 ? 22.384  5.167   4.826   1.00 13.57 ? 386  ALA A CB  1 
ATOM   2732  N N   . VAL A 1 387 ? 22.933  1.805   3.771   1.00 11.81 ? 387  VAL A N   1 
ATOM   2733  C CA  . VAL A 1 387 ? 23.701  0.584   3.995   1.00 12.13 ? 387  VAL A CA  1 
ATOM   2734  C C   . VAL A 1 387 ? 25.215  0.700   3.835   1.00 11.40 ? 387  VAL A C   1 
ATOM   2735  O O   . VAL A 1 387 ? 25.926  -0.301  3.952   1.00 11.76 ? 387  VAL A O   1 
ATOM   2736  C CB  . VAL A 1 387 ? 23.154  -0.602  3.133   1.00 12.84 ? 387  VAL A CB  1 
ATOM   2737  C CG1 . VAL A 1 387 ? 21.690  -0.860  3.464   1.00 15.69 ? 387  VAL A CG1 1 
ATOM   2738  C CG2 . VAL A 1 387 ? 23.327  -0.342  1.635   1.00 15.07 ? 387  VAL A CG2 1 
ATOM   2739  N N   . THR A 1 388 ? 25.701  1.897   3.506   1.00 10.24 ? 388  THR A N   1 
ATOM   2740  C CA  . THR A 1 388 ? 27.139  2.125   3.355   1.00 10.80 ? 388  THR A CA  1 
ATOM   2741  C C   . THR A 1 388 ? 27.583  3.256   4.276   1.00 10.75 ? 388  THR A C   1 
ATOM   2742  O O   . THR A 1 388 ? 26.780  4.105   4.655   1.00 10.55 ? 388  THR A O   1 
ATOM   2743  C CB  . THR A 1 388 ? 27.571  2.451   1.888   1.00 12.32 ? 388  THR A CB  1 
ATOM   2744  O OG1 . THR A 1 388 ? 27.094  3.747   1.509   1.00 13.62 ? 388  THR A OG1 1 
ATOM   2745  C CG2 . THR A 1 388 ? 27.038  1.409   0.906   1.00 11.94 ? 388  THR A CG2 1 
ATOM   2746  N N   . HIS A 1 389 ? 28.865  3.253   4.632   1.00 9.94  ? 389  HIS A N   1 
ATOM   2747  C CA  . HIS A 1 389 ? 29.442  4.267   5.509   1.00 9.73  ? 389  HIS A CA  1 
ATOM   2748  C C   . HIS A 1 389 ? 30.884  4.467   5.050   1.00 9.34  ? 389  HIS A C   1 
ATOM   2749  O O   . HIS A 1 389 ? 31.654  3.512   4.968   1.00 10.84 ? 389  HIS A O   1 
ATOM   2750  C CB  . HIS A 1 389 ? 29.372  3.789   6.972   1.00 11.16 ? 389  HIS A CB  1 
ATOM   2751  C CG  . HIS A 1 389 ? 29.890  4.778   7.972   1.00 13.17 ? 389  HIS A CG  1 
ATOM   2752  N ND1 . HIS A 1 389 ? 29.108  5.785   8.497   1.00 16.11 ? 389  HIS A ND1 1 
ATOM   2753  C CD2 . HIS A 1 389 ? 31.108  4.907   8.549   1.00 15.48 ? 389  HIS A CD2 1 
ATOM   2754  C CE1 . HIS A 1 389 ? 29.824  6.493   9.353   1.00 15.81 ? 389  HIS A CE1 1 
ATOM   2755  N NE2 . HIS A 1 389 ? 31.042  5.982   9.401   1.00 16.14 ? 389  HIS A NE2 1 
ATOM   2756  N N   . ALA A 1 390 ? 31.237  5.714   4.748   1.00 8.53  ? 390  ALA A N   1 
ATOM   2757  C CA  . ALA A 1 390 ? 32.579  6.037   4.284   1.00 9.52  ? 390  ALA A CA  1 
ATOM   2758  C C   . ALA A 1 390 ? 33.494  6.575   5.377   1.00 9.10  ? 390  ALA A C   1 
ATOM   2759  O O   . ALA A 1 390 ? 33.083  7.413   6.173   1.00 11.59 ? 390  ALA A O   1 
ATOM   2760  C CB  . ALA A 1 390 ? 32.507  7.030   3.124   1.00 8.44  ? 390  ALA A CB  1 
ATOM   2761  N N   . ILE A 1 391 ? 34.705  6.020   5.452   1.00 8.31  ? 391  ILE A N   1 
ATOM   2762  C CA  . ILE A 1 391 ? 35.733  6.459   6.407   1.00 9.41  ? 391  ILE A CA  1 
ATOM   2763  C C   . ILE A 1 391 ? 36.731  7.201   5.526   1.00 9.12  ? 391  ILE A C   1 
ATOM   2764  O O   . ILE A 1 391 ? 37.401  6.601   4.682   1.00 9.34  ? 391  ILE A O   1 
ATOM   2765  C CB  . ILE A 1 391 ? 36.425  5.261   7.129   1.00 10.09 ? 391  ILE A CB  1 
ATOM   2766  C CG1 . ILE A 1 391 ? 35.401  4.454   7.947   1.00 12.17 ? 391  ILE A CG1 1 
ATOM   2767  C CG2 . ILE A 1 391 ? 37.594  5.753   8.014   1.00 11.64 ? 391  ILE A CG2 1 
ATOM   2768  C CD1 . ILE A 1 391 ? 34.708  5.212   9.089   1.00 12.46 ? 391  ILE A CD1 1 
ATOM   2769  N N   . LEU A 1 392 ? 36.787  8.522   5.697   1.00 10.07 ? 392  LEU A N   1 
ATOM   2770  C CA  . LEU A 1 392 ? 37.645  9.386   4.884   1.00 9.18  ? 392  LEU A CA  1 
ATOM   2771  C C   . LEU A 1 392 ? 38.685  10.148  5.715   1.00 9.31  ? 392  LEU A C   1 
ATOM   2772  O O   . LEU A 1 392 ? 38.472  11.314  6.081   1.00 9.81  ? 392  LEU A O   1 
ATOM   2773  C CB  . LEU A 1 392 ? 36.758  10.350  4.068   1.00 9.22  ? 392  LEU A CB  1 
ATOM   2774  C CG  . LEU A 1 392 ? 35.632  9.698   3.235   1.00 9.70  ? 392  LEU A CG  1 
ATOM   2775  C CD1 . LEU A 1 392 ? 34.658  10.716  2.718   1.00 10.86 ? 392  LEU A CD1 1 
ATOM   2776  C CD2 . LEU A 1 392 ? 36.207  8.858   2.098   1.00 10.75 ? 392  LEU A CD2 1 
ATOM   2777  N N   . PRO A 1 393 ? 39.832  9.498   6.019   1.00 8.46  ? 393  PRO A N   1 
ATOM   2778  C CA  . PRO A 1 393 ? 40.858  10.172  6.810   1.00 9.59  ? 393  PRO A CA  1 
ATOM   2779  C C   . PRO A 1 393 ? 41.751  11.111  6.012   1.00 10.19 ? 393  PRO A C   1 
ATOM   2780  O O   . PRO A 1 393 ? 42.376  10.715  5.032   1.00 9.69  ? 393  PRO A O   1 
ATOM   2781  C CB  . PRO A 1 393 ? 41.632  9.008   7.422   1.00 10.22 ? 393  PRO A CB  1 
ATOM   2782  C CG  . PRO A 1 393 ? 41.588  7.967   6.355   1.00 10.49 ? 393  PRO A CG  1 
ATOM   2783  C CD  . PRO A 1 393 ? 40.203  8.086   5.773   1.00 9.45  ? 393  PRO A CD  1 
ATOM   2784  N N   . TYR A 1 394 ? 41.731  12.382  6.395   1.00 10.02 ? 394  TYR A N   1 
ATOM   2785  C CA  . TYR A 1 394 ? 42.570  13.366  5.741   1.00 9.71  ? 394  TYR A CA  1 
ATOM   2786  C C   . TYR A 1 394 ? 43.911  13.410  6.461   1.00 10.60 ? 394  TYR A C   1 
ATOM   2787  O O   . TYR A 1 394 ? 44.245  14.361  7.170   1.00 11.14 ? 394  TYR A O   1 
ATOM   2788  C CB  . TYR A 1 394 ? 41.892  14.742  5.676   1.00 9.14  ? 394  TYR A CB  1 
ATOM   2789  C CG  . TYR A 1 394 ? 40.910  14.871  4.530   1.00 8.14  ? 394  TYR A CG  1 
ATOM   2790  C CD1 . TYR A 1 394 ? 39.772  14.037  4.458   1.00 9.51  ? 394  TYR A CD1 1 
ATOM   2791  C CD2 . TYR A 1 394 ? 41.126  15.800  3.485   1.00 8.72  ? 394  TYR A CD2 1 
ATOM   2792  C CE1 . TYR A 1 394 ? 38.874  14.114  3.368   1.00 9.22  ? 394  TYR A CE1 1 
ATOM   2793  C CE2 . TYR A 1 394 ? 40.221  15.892  2.385   1.00 9.03  ? 394  TYR A CE2 1 
ATOM   2794  C CZ  . TYR A 1 394 ? 39.099  15.038  2.339   1.00 10.63 ? 394  TYR A CZ  1 
ATOM   2795  O OH  . TYR A 1 394 ? 38.226  15.078  1.275   1.00 10.44 ? 394  TYR A OH  1 
ATOM   2796  N N   . ASP A 1 395 ? 44.666  12.336  6.247   1.00 10.06 ? 395  ASP A N   1 
ATOM   2797  C CA  . ASP A 1 395 ? 46.004  12.134  6.785   1.00 10.73 ? 395  ASP A CA  1 
ATOM   2798  C C   . ASP A 1 395 ? 46.516  10.920  6.022   1.00 10.90 ? 395  ASP A C   1 
ATOM   2799  O O   . ASP A 1 395 ? 45.964  9.819   6.142   1.00 11.47 ? 395  ASP A O   1 
ATOM   2800  C CB  . ASP A 1 395 ? 45.975  11.856  8.303   1.00 11.94 ? 395  ASP A CB  1 
ATOM   2801  C CG  . ASP A 1 395 ? 47.357  11.923  8.940   1.00 14.88 ? 395  ASP A CG  1 
ATOM   2802  O OD1 . ASP A 1 395 ? 48.218  11.105  8.575   1.00 16.34 ? 395  ASP A OD1 1 
ATOM   2803  O OD2 . ASP A 1 395 ? 47.583  12.785  9.814   1.00 16.07 ? 395  ASP A OD2 1 
ATOM   2804  N N   . GLN A 1 396 ? 47.573  11.125  5.238   1.00 9.32  ? 396  GLN A N   1 
ATOM   2805  C CA  . GLN A 1 396 ? 48.167  10.059  4.435   1.00 9.76  ? 396  GLN A CA  1 
ATOM   2806  C C   . GLN A 1 396 ? 48.680  8.871   5.257   1.00 9.69  ? 396  GLN A C   1 
ATOM   2807  O O   . GLN A 1 396 ? 48.630  7.738   4.795   1.00 9.95  ? 396  GLN A O   1 
ATOM   2808  C CB  . GLN A 1 396 ? 49.270  10.629  3.528   1.00 11.42 ? 396  GLN A CB  1 
ATOM   2809  C CG  . GLN A 1 396 ? 49.924  9.628   2.551   1.00 13.15 ? 396  GLN A CG  1 
ATOM   2810  C CD  . GLN A 1 396 ? 48.935  8.992   1.576   1.00 14.25 ? 396  GLN A CD  1 
ATOM   2811  O OE1 . GLN A 1 396 ? 47.931  9.596   1.201   1.00 13.33 ? 396  GLN A OE1 1 
ATOM   2812  N NE2 . GLN A 1 396 ? 49.221  7.758   1.167   1.00 16.16 ? 396  GLN A NE2 1 
ATOM   2813  N N   . TYR A 1 397 ? 49.121  9.133   6.486   1.00 10.35 ? 397  TYR A N   1 
ATOM   2814  C CA  . TYR A 1 397 ? 49.610  8.070   7.367   1.00 10.09 ? 397  TYR A CA  1 
ATOM   2815  C C   . TYR A 1 397 ? 48.466  7.126   7.765   1.00 10.24 ? 397  TYR A C   1 
ATOM   2816  O O   . TYR A 1 397 ? 48.691  5.950   8.045   1.00 11.10 ? 397  TYR A O   1 
ATOM   2817  C CB  . TYR A 1 397 ? 50.267  8.660   8.618   1.00 11.27 ? 397  TYR A CB  1 
ATOM   2818  C CG  . TYR A 1 397 ? 51.618  9.298   8.404   1.00 10.10 ? 397  TYR A CG  1 
ATOM   2819  C CD1 . TYR A 1 397 ? 52.686  8.578   7.822   1.00 11.30 ? 397  TYR A CD1 1 
ATOM   2820  C CD2 . TYR A 1 397 ? 51.848  10.619  8.810   1.00 9.79  ? 397  TYR A CD2 1 
ATOM   2821  C CE1 . TYR A 1 397 ? 53.966  9.170   7.651   1.00 10.61 ? 397  TYR A CE1 1 
ATOM   2822  C CE2 . TYR A 1 397 ? 53.113  11.224  8.646   1.00 9.94  ? 397  TYR A CE2 1 
ATOM   2823  C CZ  . TYR A 1 397 ? 54.164  10.493  8.067   1.00 11.87 ? 397  TYR A CZ  1 
ATOM   2824  O OH  . TYR A 1 397 ? 55.391  11.087  7.920   1.00 11.30 ? 397  TYR A OH  1 
ATOM   2825  N N   . LEU A 1 398 ? 47.238  7.644   7.737   1.00 8.58  ? 398  LEU A N   1 
ATOM   2826  C CA  . LEU A 1 398 ? 46.050  6.855   8.067   1.00 10.29 ? 398  LEU A CA  1 
ATOM   2827  C C   . LEU A 1 398 ? 45.429  6.184   6.839   1.00 10.19 ? 398  LEU A C   1 
ATOM   2828  O O   . LEU A 1 398 ? 44.255  5.804   6.865   1.00 9.76  ? 398  LEU A O   1 
ATOM   2829  C CB  . LEU A 1 398 ? 44.999  7.736   8.745   1.00 10.83 ? 398  LEU A CB  1 
ATOM   2830  C CG  . LEU A 1 398 ? 45.179  8.156   10.195  1.00 12.94 ? 398  LEU A CG  1 
ATOM   2831  C CD1 . LEU A 1 398 ? 44.053  9.097   10.600  1.00 11.39 ? 398  LEU A CD1 1 
ATOM   2832  C CD2 . LEU A 1 398 ? 45.208  6.939   11.098  1.00 14.43 ? 398  LEU A CD2 1 
ATOM   2833  N N   . TRP A 1 399 ? 46.228  5.976   5.790   1.00 9.91  ? 399  TRP A N   1 
ATOM   2834  C CA  . TRP A 1 399 ? 45.729  5.359   4.559   1.00 9.76  ? 399  TRP A CA  1 
ATOM   2835  C C   . TRP A 1 399 ? 45.220  3.914   4.709   1.00 10.45 ? 399  TRP A C   1 
ATOM   2836  O O   . TRP A 1 399 ? 44.446  3.444   3.873   1.00 11.11 ? 399  TRP A O   1 
ATOM   2837  C CB  . TRP A 1 399 ? 46.754  5.488   3.415   1.00 11.13 ? 399  TRP A CB  1 
ATOM   2838  C CG  . TRP A 1 399 ? 47.949  4.567   3.480   1.00 12.70 ? 399  TRP A CG  1 
ATOM   2839  C CD1 . TRP A 1 399 ? 49.039  4.672   4.306   1.00 11.64 ? 399  TRP A CD1 1 
ATOM   2840  C CD2 . TRP A 1 399 ? 48.158  3.394   2.688   1.00 15.85 ? 399  TRP A CD2 1 
ATOM   2841  N NE1 . TRP A 1 399 ? 49.911  3.632   4.081   1.00 13.43 ? 399  TRP A NE1 1 
ATOM   2842  C CE2 . TRP A 1 399 ? 49.402  2.830   3.094   1.00 17.11 ? 399  TRP A CE2 1 
ATOM   2843  C CE3 . TRP A 1 399 ? 47.414  2.756   1.670   1.00 20.19 ? 399  TRP A CE3 1 
ATOM   2844  C CZ2 . TRP A 1 399 ? 49.924  1.645   2.518   1.00 19.56 ? 399  TRP A CZ2 1 
ATOM   2845  C CZ3 . TRP A 1 399 ? 47.933  1.570   1.088   1.00 21.52 ? 399  TRP A CZ3 1 
ATOM   2846  C CH2 . TRP A 1 399 ? 49.180  1.030   1.522   1.00 21.88 ? 399  TRP A CH2 1 
ATOM   2847  N N   . ARG A 1 400 ? 45.666  3.223   5.763   1.00 9.60  ? 400  ARG A N   1 
ATOM   2848  C CA  . ARG A 1 400 ? 45.213  1.857   6.023   1.00 10.36 ? 400  ARG A CA  1 
ATOM   2849  C C   . ARG A 1 400 ? 44.141  1.782   7.112   1.00 10.68 ? 400  ARG A C   1 
ATOM   2850  O O   . ARG A 1 400 ? 43.731  0.688   7.511   1.00 11.33 ? 400  ARG A O   1 
ATOM   2851  C CB  . ARG A 1 400 ? 46.378  0.896   6.310   1.00 12.27 ? 400  ARG A CB  1 
ATOM   2852  C CG  . ARG A 1 400 ? 47.296  0.611   5.118   1.00 15.24 ? 400  ARG A CG  1 
ATOM   2853  C CD  . ARG A 1 400 ? 46.546  0.182   3.858   1.00 20.14 ? 400  ARG A CD  1 
ATOM   2854  N NE  . ARG A 1 400 ? 46.091  -1.197  3.859   1.00 21.48 ? 400  ARG A NE  1 
ATOM   2855  C CZ  . ARG A 1 400 ? 45.199  -1.695  3.007   1.00 21.77 ? 400  ARG A CZ  1 
ATOM   2856  N NH1 . ARG A 1 400 ? 44.653  -0.924  2.072   1.00 23.87 ? 400  ARG A NH1 1 
ATOM   2857  N NH2 . ARG A 1 400 ? 44.854  -2.973  3.085   1.00 24.73 ? 400  ARG A NH2 1 
ATOM   2858  N N   . LEU A 1 401 ? 43.659  2.947   7.558   1.00 9.26  ? 401  LEU A N   1 
ATOM   2859  C CA  . LEU A 1 401 ? 42.584  3.001   8.556   1.00 9.21  ? 401  LEU A CA  1 
ATOM   2860  C C   . LEU A 1 401 ? 41.245  2.471   8.001   1.00 9.26  ? 401  LEU A C   1 
ATOM   2861  O O   . LEU A 1 401 ? 40.560  1.735   8.713   1.00 9.94  ? 401  LEU A O   1 
ATOM   2862  C CB  . LEU A 1 401 ? 42.436  4.405   9.187   1.00 10.28 ? 401  LEU A CB  1 
ATOM   2863  C CG  . LEU A 1 401 ? 41.387  4.595   10.292  1.00 11.93 ? 401  LEU A CG  1 
ATOM   2864  C CD1 . LEU A 1 401 ? 41.748  3.760   11.498  1.00 13.43 ? 401  LEU A CD1 1 
ATOM   2865  C CD2 . LEU A 1 401 ? 41.263  6.053   10.677  1.00 13.32 ? 401  LEU A CD2 1 
ATOM   2866  N N   . PRO A 1 402 ? 40.861  2.817   6.735   1.00 10.14 ? 402  PRO A N   1 
ATOM   2867  C CA  . PRO A 1 402 ? 39.582  2.283   6.235   1.00 9.03  ? 402  PRO A CA  1 
ATOM   2868  C C   . PRO A 1 402 ? 39.530  0.750   6.203   1.00 8.84  ? 402  PRO A C   1 
ATOM   2869  O O   . PRO A 1 402 ? 38.537  0.164   6.625   1.00 9.64  ? 402  PRO A O   1 
ATOM   2870  C CB  . PRO A 1 402 ? 39.496  2.876   4.834   1.00 10.25 ? 402  PRO A CB  1 
ATOM   2871  C CG  . PRO A 1 402 ? 40.142  4.193   5.006   1.00 11.56 ? 402  PRO A CG  1 
ATOM   2872  C CD  . PRO A 1 402 ? 41.376  3.818   5.773   1.00 9.95  ? 402  PRO A CD  1 
ATOM   2873  N N   . ALA A 1 403 ? 40.633  0.115   5.791   1.00 9.13  ? 403  ALA A N   1 
ATOM   2874  C CA  . ALA A 1 403 ? 40.715  -1.353  5.738   1.00 8.11  ? 403  ALA A CA  1 
ATOM   2875  C C   . ALA A 1 403 ? 40.621  -1.958  7.142   1.00 8.92  ? 403  ALA A C   1 
ATOM   2876  O O   . ALA A 1 403 ? 39.991  -3.005  7.331   1.00 9.12  ? 403  ALA A O   1 
ATOM   2877  C CB  . ALA A 1 403 ? 42.005  -1.802  5.056   1.00 9.38  ? 403  ALA A CB  1 
ATOM   2878  N N   . TYR A 1 404 ? 41.196  -1.261  8.127   1.00 8.71  ? 404  TYR A N   1 
ATOM   2879  C CA  . TYR A 1 404 ? 41.158  -1.711  9.521   1.00 8.68  ? 404  TYR A CA  1 
ATOM   2880  C C   . TYR A 1 404 ? 39.729  -1.639  10.055  1.00 9.50  ? 404  TYR A C   1 
ATOM   2881  O O   . TYR A 1 404 ? 39.251  -2.581  10.698  1.00 10.19 ? 404  TYR A O   1 
ATOM   2882  C CB  . TYR A 1 404 ? 42.070  -0.849  10.404  1.00 7.77  ? 404  TYR A CB  1 
ATOM   2883  C CG  . TYR A 1 404 ? 42.088  -1.280  11.858  1.00 8.72  ? 404  TYR A CG  1 
ATOM   2884  C CD1 . TYR A 1 404 ? 42.833  -2.400  12.260  1.00 10.34 ? 404  TYR A CD1 1 
ATOM   2885  C CD2 . TYR A 1 404 ? 41.326  -0.599  12.835  1.00 10.82 ? 404  TYR A CD2 1 
ATOM   2886  C CE1 . TYR A 1 404 ? 42.827  -2.842  13.607  1.00 11.62 ? 404  TYR A CE1 1 
ATOM   2887  C CE2 . TYR A 1 404 ? 41.311  -1.037  14.186  1.00 11.70 ? 404  TYR A CE2 1 
ATOM   2888  C CZ  . TYR A 1 404 ? 42.072  -2.158  14.557  1.00 10.72 ? 404  TYR A CZ  1 
ATOM   2889  O OH  . TYR A 1 404 ? 42.119  -2.575  15.865  1.00 11.48 ? 404  TYR A OH  1 
ATOM   2890  N N   . LEU A 1 405 ? 39.075  -0.503  9.809   1.00 10.84 ? 405  LEU A N   1 
ATOM   2891  C CA  . LEU A 1 405 ? 37.705  -0.293  10.259  1.00 11.26 ? 405  LEU A CA  1 
ATOM   2892  C C   . LEU A 1 405 ? 36.701  -1.180  9.545   1.00 12.88 ? 405  LEU A C   1 
ATOM   2893  O O   . LEU A 1 405 ? 35.622  -1.440  10.086  1.00 12.31 ? 405  LEU A O   1 
ATOM   2894  C CB  . LEU A 1 405 ? 37.314  1.185   10.198  1.00 12.27 ? 405  LEU A CB  1 
ATOM   2895  C CG  . LEU A 1 405 ? 38.108  2.085   11.155  1.00 13.51 ? 405  LEU A CG  1 
ATOM   2896  C CD1 . LEU A 1 405 ? 37.605  3.498   11.061  1.00 13.38 ? 405  LEU A CD1 1 
ATOM   2897  C CD2 . LEU A 1 405 ? 38.039  1.608   12.603  1.00 11.67 ? 405  LEU A CD2 1 
ATOM   2898  N N   . GLN A 1 406 ? 37.088  -1.698  8.370   1.00 11.40 ? 406  GLN A N   1 
ATOM   2899  C CA  . GLN A 1 406 ? 36.248  -2.631  7.614   1.00 12.78 ? 406  GLN A CA  1 
ATOM   2900  C C   . GLN A 1 406 ? 36.123  -3.902  8.427   1.00 12.32 ? 406  GLN A C   1 
ATOM   2901  O O   . GLN A 1 406 ? 35.022  -4.383  8.632   1.00 11.61 ? 406  GLN A O   1 
ATOM   2902  C CB  . GLN A 1 406 ? 36.838  -2.997  6.256   1.00 15.04 ? 406  GLN A CB  1 
ATOM   2903  C CG  . GLN A 1 406 ? 36.592  -2.004  5.155   1.00 15.02 ? 406  GLN A CG  1 
ATOM   2904  C CD  . GLN A 1 406 ? 37.019  -2.528  3.800   1.00 14.53 ? 406  GLN A CD  1 
ATOM   2905  O OE1 . GLN A 1 406 ? 38.027  -3.223  3.679   1.00 14.00 ? 406  GLN A OE1 1 
ATOM   2906  N NE2 . GLN A 1 406 ? 36.246  -2.200  2.772   1.00 13.08 ? 406  GLN A NE2 1 
ATOM   2907  N N   . GLN A 1 407 ? 37.249  -4.399  8.947   1.00 12.24 ? 407  GLN A N   1 
ATOM   2908  C CA  . GLN A 1 407 ? 37.225  -5.604  9.767   1.00 11.89 ? 407  GLN A CA  1 
ATOM   2909  C C   . GLN A 1 407 ? 36.519  -5.349  11.085  1.00 11.91 ? 407  GLN A C   1 
ATOM   2910  O O   . GLN A 1 407 ? 35.618  -6.095  11.452  1.00 12.37 ? 407  GLN A O   1 
ATOM   2911  C CB  . GLN A 1 407 ? 38.623  -6.165  10.054  1.00 12.99 ? 407  GLN A CB  1 
ATOM   2912  C CG  . GLN A 1 407 ? 38.550  -7.454  10.889  1.00 16.50 ? 407  GLN A CG  1 
ATOM   2913  C CD  . GLN A 1 407 ? 39.875  -8.105  11.195  1.00 17.90 ? 407  GLN A CD  1 
ATOM   2914  O OE1 . GLN A 1 407 ? 40.927  -7.650  10.768  1.00 21.53 ? 407  GLN A OE1 1 
ATOM   2915  N NE2 . GLN A 1 407 ? 39.819  -9.194  11.945  1.00 22.07 ? 407  GLN A NE2 1 
ATOM   2916  N N   . LEU A 1 408 ? 36.893  -4.261  11.755  1.00 10.92 ? 408  LEU A N   1 
ATOM   2917  C CA  . LEU A 1 408 ? 36.307  -3.912  13.046  1.00 10.21 ? 408  LEU A CA  1 
ATOM   2918  C C   . LEU A 1 408 ? 34.783  -3.819  13.015  1.00 10.41 ? 408  LEU A C   1 
ATOM   2919  O O   . LEU A 1 408 ? 34.116  -4.450  13.821  1.00 11.75 ? 408  LEU A O   1 
ATOM   2920  C CB  . LEU A 1 408 ? 36.907  -2.604  13.591  1.00 9.71  ? 408  LEU A CB  1 
ATOM   2921  C CG  . LEU A 1 408 ? 36.365  -2.059  14.924  1.00 9.82  ? 408  LEU A CG  1 
ATOM   2922  C CD1 . LEU A 1 408 ? 36.515  -3.092  16.005  1.00 10.38 ? 408  LEU A CD1 1 
ATOM   2923  C CD2 . LEU A 1 408 ? 37.087  -0.804  15.320  1.00 10.50 ? 408  LEU A CD2 1 
ATOM   2924  N N   . ASP A 1 409 ? 34.250  -3.086  12.045  1.00 9.60  ? 409  ASP A N   1 
ATOM   2925  C CA  . ASP A 1 409 ? 32.808  -2.903  11.934  1.00 9.32  ? 409  ASP A CA  1 
ATOM   2926  C C   . ASP A 1 409 ? 32.085  -4.068  11.259  1.00 10.39 ? 409  ASP A C   1 
ATOM   2927  O O   . ASP A 1 409 ? 31.163  -4.640  11.850  1.00 11.49 ? 409  ASP A O   1 
ATOM   2928  C CB  . ASP A 1 409 ? 32.522  -1.582  11.205  1.00 10.07 ? 409  ASP A CB  1 
ATOM   2929  C CG  . ASP A 1 409 ? 31.089  -1.081  11.389  1.00 12.00 ? 409  ASP A CG  1 
ATOM   2930  O OD1 . ASP A 1 409 ? 30.144  -1.893  11.425  1.00 15.18 ? 409  ASP A OD1 1 
ATOM   2931  O OD2 . ASP A 1 409 ? 30.913  0.152   11.481  1.00 15.91 ? 409  ASP A OD2 1 
ATOM   2932  N N   . MET A 1 410 ? 32.518  -4.433  10.053  1.00 10.03 ? 410  MET A N   1 
ATOM   2933  C CA  . MET A 1 410 ? 31.866  -5.498  9.285   1.00 9.08  ? 410  MET A CA  1 
ATOM   2934  C C   . MET A 1 410 ? 31.941  -6.903  9.856   1.00 9.34  ? 410  MET A C   1 
ATOM   2935  O O   . MET A 1 410 ? 30.950  -7.639  9.794   1.00 10.18 ? 410  MET A O   1 
ATOM   2936  C CB  . MET A 1 410 ? 32.318  -5.469  7.827   1.00 9.45  ? 410  MET A CB  1 
ATOM   2937  C CG  . MET A 1 410 ? 32.004  -4.147  7.127   1.00 9.94  ? 410  MET A CG  1 
ATOM   2938  S SD  . MET A 1 410 ? 32.739  -3.983  5.494   1.00 12.13 ? 410  MET A SD  1 
ATOM   2939  C CE  . MET A 1 410 ? 31.705  -5.065  4.536   1.00 12.77 ? 410  MET A CE  1 
ATOM   2940  N N   . GLU A 1 411 ? 33.082  -7.274  10.441  1.00 8.98  ? 411  GLU A N   1 
ATOM   2941  C CA  . GLU A 1 411 ? 33.186  -8.606  11.035  1.00 9.14  ? 411  GLU A CA  1 
ATOM   2942  C C   . GLU A 1 411 ? 32.469  -8.666  12.388  1.00 9.15  ? 411  GLU A C   1 
ATOM   2943  O O   . GLU A 1 411 ? 31.973  -9.719  12.787  1.00 10.89 ? 411  GLU A O   1 
ATOM   2944  C CB  . GLU A 1 411 ? 34.636  -9.083  11.141  1.00 10.36 ? 411  GLU A CB  1 
ATOM   2945  C CG  . GLU A 1 411 ? 34.763  -10.594 11.282  1.00 13.48 ? 411  GLU A CG  1 
ATOM   2946  C CD  . GLU A 1 411 ? 36.183  -11.071 11.267  1.00 17.66 ? 411  GLU A CD  1 
ATOM   2947  O OE1 . GLU A 1 411 ? 36.929  -10.680 12.181  1.00 19.17 ? 411  GLU A OE1 1 
ATOM   2948  O OE2 . GLU A 1 411 ? 36.548  -11.840 10.355  1.00 18.69 ? 411  GLU A OE2 1 
ATOM   2949  N N   . SER A 1 412 ? 32.359  -7.519  13.056  1.00 9.77  ? 412  SER A N   1 
ATOM   2950  C CA  . SER A 1 412 ? 31.661  -7.459  14.333  1.00 9.50  ? 412  SER A CA  1 
ATOM   2951  C C   . SER A 1 412 ? 30.152  -7.424  14.176  1.00 10.08 ? 412  SER A C   1 
ATOM   2952  O O   . SER A 1 412 ? 29.440  -8.258  14.736  1.00 10.45 ? 412  SER A O   1 
ATOM   2953  C CB  . SER A 1 412 ? 32.057  -6.220  15.131  1.00 11.04 ? 412  SER A CB  1 
ATOM   2954  O OG  . SER A 1 412 ? 33.397  -6.259  15.584  1.00 10.93 ? 412  SER A OG  1 
ATOM   2955  N N   . ASN A 1 413 ? 29.677  -6.487  13.358  1.00 9.21  ? 413  ASN A N   1 
ATOM   2956  C CA  . ASN A 1 413 ? 28.250  -6.276  13.197  1.00 9.28  ? 413  ASN A CA  1 
ATOM   2957  C C   . ASN A 1 413 ? 27.522  -6.798  11.963  1.00 9.08  ? 413  ASN A C   1 
ATOM   2958  O O   . ASN A 1 413 ? 26.324  -6.552  11.800  1.00 9.66  ? 413  ASN A O   1 
ATOM   2959  C CB  . ASN A 1 413 ? 27.923  -4.803  13.480  1.00 9.42  ? 413  ASN A CB  1 
ATOM   2960  C CG  . ASN A 1 413 ? 28.171  -4.415  14.942  1.00 10.88 ? 413  ASN A CG  1 
ATOM   2961  O OD1 . ASN A 1 413 ? 28.232  -5.269  15.827  1.00 13.83 ? 413  ASN A OD1 1 
ATOM   2962  N ND2 . ASN A 1 413 ? 28.310  -3.121  15.192  1.00 11.02 ? 413  ASN A ND2 1 
ATOM   2963  N N   . GLY A 1 414 ? 28.223  -7.570  11.133  1.00 8.61  ? 414  GLY A N   1 
ATOM   2964  C CA  . GLY A 1 414 ? 27.602  -8.160  9.958   1.00 9.97  ? 414  GLY A CA  1 
ATOM   2965  C C   . GLY A 1 414 ? 26.994  -9.483  10.376  1.00 9.48  ? 414  GLY A C   1 
ATOM   2966  O O   . GLY A 1 414 ? 27.518  -10.553 10.068  1.00 11.15 ? 414  GLY A O   1 
ATOM   2967  N N   . LYS A 1 415 ? 25.910  -9.378  11.146  1.00 10.20 ? 415  LYS A N   1 
ATOM   2968  C CA  . LYS A 1 415 ? 25.198  -10.521 11.718  1.00 10.35 ? 415  LYS A CA  1 
ATOM   2969  C C   . LYS A 1 415 ? 23.707  -10.425 11.415  1.00 11.89 ? 415  LYS A C   1 
ATOM   2970  O O   . LYS A 1 415 ? 23.172  -9.324  11.275  1.00 12.40 ? 415  LYS A O   1 
ATOM   2971  C CB  . LYS A 1 415 ? 25.378  -10.529 13.251  1.00 10.95 ? 415  LYS A CB  1 
ATOM   2972  C CG  . LYS A 1 415 ? 26.825  -10.415 13.773  1.00 11.76 ? 415  LYS A CG  1 
ATOM   2973  C CD  . LYS A 1 415 ? 27.599  -11.703 13.566  1.00 11.05 ? 415  LYS A CD  1 
ATOM   2974  C CE  . LYS A 1 415 ? 29.106  -11.480 13.673  1.00 10.76 ? 415  LYS A CE  1 
ATOM   2975  N NZ  . LYS A 1 415 ? 29.581  -10.987 14.995  1.00 9.23  ? 415  LYS A NZ  1 
ATOM   2976  N N   . TYR A 1 416 ? 23.037  -11.572 11.312  1.00 12.07 ? 416  TYR A N   1 
ATOM   2977  C CA  . TYR A 1 416 ? 21.598  -11.559 11.059  1.00 13.11 ? 416  TYR A CA  1 
ATOM   2978  C C   . TYR A 1 416 ? 20.742  -12.291 12.087  1.00 14.78 ? 416  TYR A C   1 
ATOM   2979  O O   . TYR A 1 416 ? 19.545  -12.513 11.881  1.00 14.05 ? 416  TYR A O   1 
ATOM   2980  C CB  . TYR A 1 416 ? 21.235  -11.925 9.605   1.00 14.12 ? 416  TYR A CB  1 
ATOM   2981  C CG  . TYR A 1 416 ? 21.724  -13.240 9.019   1.00 13.79 ? 416  TYR A CG  1 
ATOM   2982  C CD1 . TYR A 1 416 ? 22.069  -14.351 9.829   1.00 14.99 ? 416  TYR A CD1 1 
ATOM   2983  C CD2 . TYR A 1 416 ? 21.798  -13.391 7.624   1.00 14.23 ? 416  TYR A CD2 1 
ATOM   2984  C CE1 . TYR A 1 416 ? 22.473  -15.581 9.256   1.00 14.40 ? 416  TYR A CE1 1 
ATOM   2985  C CE2 . TYR A 1 416 ? 22.197  -14.609 7.041   1.00 14.18 ? 416  TYR A CE2 1 
ATOM   2986  C CZ  . TYR A 1 416 ? 22.530  -15.693 7.862   1.00 14.61 ? 416  TYR A CZ  1 
ATOM   2987  O OH  . TYR A 1 416 ? 22.908  -16.870 7.291   1.00 14.64 ? 416  TYR A OH  1 
ATOM   2988  N N   . VAL A 1 417 ? 21.389  -12.686 13.180  1.00 15.67 ? 417  VAL A N   1 
ATOM   2989  C CA  . VAL A 1 417 ? 20.736  -13.364 14.295  1.00 17.66 ? 417  VAL A CA  1 
ATOM   2990  C C   . VAL A 1 417 ? 21.163  -12.681 15.594  1.00 17.92 ? 417  VAL A C   1 
ATOM   2991  O O   . VAL A 1 417 ? 22.294  -12.191 15.707  1.00 17.94 ? 417  VAL A O   1 
ATOM   2992  C CB  . VAL A 1 417 ? 21.044  -14.897 14.341  1.00 19.30 ? 417  VAL A CB  1 
ATOM   2993  C CG1 . VAL A 1 417 ? 20.344  -15.616 13.189  1.00 19.94 ? 417  VAL A CG1 1 
ATOM   2994  C CG2 . VAL A 1 417 ? 22.534  -15.157 14.273  1.00 21.57 ? 417  VAL A CG2 1 
ATOM   2995  N N   . THR A 1 418 ? 20.238  -12.609 16.548  1.00 17.72 ? 418  THR A N   1 
ATOM   2996  C CA  . THR A 1 418 ? 20.487  -11.984 17.850  1.00 19.29 ? 418  THR A CA  1 
ATOM   2997  C C   . THR A 1 418 ? 21.206  -12.951 18.799  1.00 21.15 ? 418  THR A C   1 
ATOM   2998  O O   . THR A 1 418 ? 21.416  -14.115 18.448  1.00 20.74 ? 418  THR A O   1 
ATOM   2999  C CB  . THR A 1 418 ? 19.160  -11.522 18.512  1.00 19.24 ? 418  THR A CB  1 
ATOM   3000  O OG1 . THR A 1 418 ? 18.311  -12.654 18.744  1.00 18.50 ? 418  THR A OG1 1 
ATOM   3001  C CG2 . THR A 1 418 ? 18.437  -10.516 17.631  1.00 18.34 ? 418  THR A CG2 1 
ATOM   3002  N N   . ARG A 1 419 ? 21.563  -12.467 19.995  1.00 23.15 ? 419  ARG A N   1 
ATOM   3003  C CA  . ARG A 1 419 ? 22.235  -13.280 21.030  1.00 27.42 ? 419  ARG A CA  1 
ATOM   3004  C C   . ARG A 1 419 ? 21.352  -14.442 21.482  1.00 29.41 ? 419  ARG A C   1 
ATOM   3005  O O   . ARG A 1 419 ? 21.848  -15.521 21.810  1.00 31.55 ? 419  ARG A O   1 
ATOM   3006  C CB  . ARG A 1 419 ? 22.554  -12.444 22.270  1.00 28.01 ? 419  ARG A CB  1 
ATOM   3007  C CG  . ARG A 1 419 ? 23.565  -11.352 22.087  1.00 30.79 ? 419  ARG A CG  1 
ATOM   3008  C CD  . ARG A 1 419 ? 23.877  -10.731 23.440  1.00 31.93 ? 419  ARG A CD  1 
ATOM   3009  N NE  . ARG A 1 419 ? 24.302  -9.344  23.320  1.00 33.69 ? 419  ARG A NE  1 
ATOM   3010  C CZ  . ARG A 1 419 ? 23.494  -8.289  23.423  1.00 34.22 ? 419  ARG A CZ  1 
ATOM   3011  N NH1 . ARG A 1 419 ? 22.194  -8.446  23.653  1.00 34.73 ? 419  ARG A NH1 1 
ATOM   3012  N NH2 . ARG A 1 419 ? 23.988  -7.070  23.281  1.00 34.57 ? 419  ARG A NH2 1 
ATOM   3013  N N   . SER A 1 420 ? 20.039  -14.200 21.484  1.00 31.04 ? 420  SER A N   1 
ATOM   3014  C CA  . SER A 1 420 ? 19.035  -15.189 21.880  1.00 32.02 ? 420  SER A CA  1 
ATOM   3015  C C   . SER A 1 420 ? 18.773  -16.220 20.775  1.00 31.81 ? 420  SER A C   1 
ATOM   3016  O O   . SER A 1 420 ? 18.062  -17.209 20.989  1.00 34.08 ? 420  SER A O   1 
ATOM   3017  C CB  . SER A 1 420 ? 17.736  -14.483 22.284  1.00 33.03 ? 420  SER A CB  1 
ATOM   3018  O OG  . SER A 1 420 ? 17.254  -13.640 21.250  1.00 34.87 ? 420  SER A OG  1 
ATOM   3019  N N   . GLY A 1 421 ? 19.357  -15.978 19.601  1.00 30.80 ? 421  GLY A N   1 
ATOM   3020  C CA  . GLY A 1 421 ? 19.210  -16.883 18.476  1.00 28.14 ? 421  GLY A CA  1 
ATOM   3021  C C   . GLY A 1 421 ? 18.019  -16.639 17.572  1.00 27.39 ? 421  GLY A C   1 
ATOM   3022  O O   . GLY A 1 421 ? 17.624  -17.520 16.807  1.00 27.15 ? 421  GLY A O   1 
ATOM   3023  N N   . LYS A 1 422 ? 17.435  -15.450 17.675  1.00 25.24 ? 422  LYS A N   1 
ATOM   3024  C CA  . LYS A 1 422 ? 16.283  -15.075 16.860  1.00 24.68 ? 422  LYS A CA  1 
ATOM   3025  C C   . LYS A 1 422 ? 16.757  -14.227 15.680  1.00 22.93 ? 422  LYS A C   1 
ATOM   3026  O O   . LYS A 1 422 ? 17.767  -13.543 15.793  1.00 22.36 ? 422  LYS A O   1 
ATOM   3027  C CB  . LYS A 1 422 ? 15.271  -14.305 17.714  1.00 27.28 ? 422  LYS A CB  1 
ATOM   3028  C CG  . LYS A 1 422 ? 14.301  -15.182 18.530  1.00 31.32 ? 422  LYS A CG  1 
ATOM   3029  C CD  . LYS A 1 422 ? 14.930  -15.889 19.727  1.00 35.02 ? 422  LYS A CD  1 
ATOM   3030  C CE  . LYS A 1 422 ? 13.942  -16.881 20.324  1.00 36.96 ? 422  LYS A CE  1 
ATOM   3031  N NZ  . LYS A 1 422 ? 14.583  -17.831 21.276  1.00 39.09 ? 422  LYS A NZ  1 
ATOM   3032  N N   . THR A 1 423 ? 16.054  -14.297 14.546  1.00 20.91 ? 423  THR A N   1 
ATOM   3033  C CA  . THR A 1 423 ? 16.436  -13.521 13.356  1.00 19.67 ? 423  THR A CA  1 
ATOM   3034  C C   . THR A 1 423 ? 16.156  -12.029 13.553  1.00 18.46 ? 423  THR A C   1 
ATOM   3035  O O   . THR A 1 423 ? 15.100  -11.661 14.077  1.00 18.53 ? 423  THR A O   1 
ATOM   3036  C CB  . THR A 1 423 ? 15.724  -14.022 12.066  1.00 20.99 ? 423  THR A CB  1 
ATOM   3037  O OG1 . THR A 1 423 ? 14.308  -13.840 12.183  1.00 22.97 ? 423  THR A OG1 1 
ATOM   3038  C CG2 . THR A 1 423 ? 16.020  -15.496 11.825  1.00 22.31 ? 423  THR A CG2 1 
ATOM   3039  N N   . VAL A 1 424 ? 17.110  -11.177 13.165  1.00 15.82 ? 424  VAL A N   1 
ATOM   3040  C CA  . VAL A 1 424 ? 16.941  -9.724  13.311  1.00 14.51 ? 424  VAL A CA  1 
ATOM   3041  C C   . VAL A 1 424 ? 15.805  -9.201  12.434  1.00 14.10 ? 424  VAL A C   1 
ATOM   3042  O O   . VAL A 1 424 ? 15.538  -9.747  11.360  1.00 14.39 ? 424  VAL A O   1 
ATOM   3043  C CB  . VAL A 1 424 ? 18.250  -8.917  13.014  1.00 14.60 ? 424  VAL A CB  1 
ATOM   3044  C CG1 . VAL A 1 424 ? 19.342  -9.292  13.992  1.00 14.49 ? 424  VAL A CG1 1 
ATOM   3045  C CG2 . VAL A 1 424 ? 18.717  -9.113  11.579  1.00 14.34 ? 424  VAL A CG2 1 
ATOM   3046  N N   . SER A 1 425 ? 15.096  -8.203  12.952  1.00 14.83 ? 425  SER A N   1 
ATOM   3047  C CA  . SER A 1 425 ? 13.984  -7.585  12.234  1.00 16.14 ? 425  SER A CA  1 
ATOM   3048  C C   . SER A 1 425 ? 14.387  -6.217  11.702  1.00 14.86 ? 425  SER A C   1 
ATOM   3049  O O   . SER A 1 425 ? 13.547  -5.453  11.222  1.00 15.89 ? 425  SER A O   1 
ATOM   3050  C CB  . SER A 1 425 ? 12.759  -7.477  13.141  1.00 18.38 ? 425  SER A CB  1 
ATOM   3051  O OG  . SER A 1 425 ? 12.246  -8.766  13.423  1.00 21.78 ? 425  SER A OG  1 
ATOM   3052  N N   . THR A 1 426 ? 15.679  -5.902  11.831  1.00 13.75 ? 426  THR A N   1 
ATOM   3053  C CA  . THR A 1 426 ? 16.234  -4.631  11.361  1.00 12.40 ? 426  THR A CA  1 
ATOM   3054  C C   . THR A 1 426 ? 17.532  -4.895  10.614  1.00 12.14 ? 426  THR A C   1 
ATOM   3055  O O   . THR A 1 426 ? 18.102  -5.988  10.706  1.00 12.55 ? 426  THR A O   1 
ATOM   3056  C CB  . THR A 1 426 ? 16.580  -3.640  12.539  1.00 14.46 ? 426  THR A CB  1 
ATOM   3057  O OG1 . THR A 1 426 ? 17.752  -4.085  13.240  1.00 14.32 ? 426  THR A OG1 1 
ATOM   3058  C CG2 . THR A 1 426 ? 15.426  -3.503  13.522  1.00 15.17 ? 426  THR A CG2 1 
ATOM   3059  N N   . LEU A 1 427 ? 18.005  -3.873  9.900   1.00 11.75 ? 427  LEU A N   1 
ATOM   3060  C CA  . LEU A 1 427 ? 19.281  -3.949  9.199   1.00 11.57 ? 427  LEU A CA  1 
ATOM   3061  C C   . LEU A 1 427 ? 20.366  -3.840  10.268  1.00 11.81 ? 427  LEU A C   1 
ATOM   3062  O O   . LEU A 1 427 ? 20.142  -3.242  11.327  1.00 12.20 ? 427  LEU A O   1 
ATOM   3063  C CB  . LEU A 1 427 ? 19.435  -2.791  8.207   1.00 12.26 ? 427  LEU A CB  1 
ATOM   3064  C CG  . LEU A 1 427 ? 18.510  -2.729  6.988   1.00 14.95 ? 427  LEU A CG  1 
ATOM   3065  C CD1 . LEU A 1 427 ? 18.851  -1.490  6.172   1.00 15.67 ? 427  LEU A CD1 1 
ATOM   3066  C CD2 . LEU A 1 427 ? 18.641  -3.988  6.128   1.00 15.39 ? 427  LEU A CD2 1 
ATOM   3067  N N   . THR A 1 428 ? 21.491  -4.511  10.041  1.00 10.71 ? 428  THR A N   1 
ATOM   3068  C CA  . THR A 1 428 ? 22.592  -4.448  10.983  1.00 11.14 ? 428  THR A CA  1 
ATOM   3069  C C   . THR A 1 428 ? 23.784  -3.703  10.379  1.00 10.38 ? 428  THR A C   1 
ATOM   3070  O O   . THR A 1 428 ? 23.596  -2.636  9.788   1.00 10.61 ? 428  THR A O   1 
ATOM   3071  C CB  . THR A 1 428 ? 22.971  -5.837  11.565  1.00 10.60 ? 428  THR A CB  1 
ATOM   3072  O OG1 . THR A 1 428 ? 23.286  -6.737  10.503  1.00 10.91 ? 428  THR A OG1 1 
ATOM   3073  C CG2 . THR A 1 428 ? 21.820  -6.404  12.415  1.00 11.56 ? 428  THR A CG2 1 
ATOM   3074  N N   . GLY A 1 429 ? 24.993  -4.251  10.541  1.00 10.04 ? 429  GLY A N   1 
ATOM   3075  C CA  . GLY A 1 429 ? 26.209  -3.622  10.051  1.00 11.85 ? 429  GLY A CA  1 
ATOM   3076  C C   . GLY A 1 429 ? 26.249  -3.156  8.606   1.00 10.43 ? 429  GLY A C   1 
ATOM   3077  O O   . GLY A 1 429 ? 25.786  -3.871  7.715   1.00 11.34 ? 429  GLY A O   1 
ATOM   3078  N N   . PRO A 1 430 ? 26.746  -1.928  8.357   1.00 10.93 ? 430  PRO A N   1 
ATOM   3079  C CA  . PRO A 1 430 ? 26.824  -1.410  6.993   1.00 10.73 ? 430  PRO A CA  1 
ATOM   3080  C C   . PRO A 1 430 ? 28.142  -1.798  6.311   1.00 10.98 ? 430  PRO A C   1 
ATOM   3081  O O   . PRO A 1 430 ? 29.054  -2.338  6.951   1.00 11.33 ? 430  PRO A O   1 
ATOM   3082  C CB  . PRO A 1 430 ? 26.746  0.101   7.216   1.00 11.89 ? 430  PRO A CB  1 
ATOM   3083  C CG  . PRO A 1 430 ? 27.552  0.289   8.462   1.00 11.53 ? 430  PRO A CG  1 
ATOM   3084  C CD  . PRO A 1 430 ? 27.094  -0.874  9.338   1.00 10.75 ? 430  PRO A CD  1 
ATOM   3085  N N   . ILE A 1 431 ? 28.222  -1.517  5.013   1.00 10.18 ? 431  ILE A N   1 
ATOM   3086  C CA  . ILE A 1 431 ? 29.437  -1.763  4.245   1.00 10.25 ? 431  ILE A CA  1 
ATOM   3087  C C   . ILE A 1 431 ? 30.328  -0.542  4.481   1.00 9.41  ? 431  ILE A C   1 
ATOM   3088  O O   . ILE A 1 431 ? 29.886  0.590   4.319   1.00 11.16 ? 431  ILE A O   1 
ATOM   3089  C CB  . ILE A 1 431 ? 29.146  -1.916  2.719   1.00 9.63  ? 431  ILE A CB  1 
ATOM   3090  C CG1 . ILE A 1 431 ? 28.455  -3.251  2.440   1.00 13.03 ? 431  ILE A CG1 1 
ATOM   3091  C CG2 . ILE A 1 431 ? 30.436  -1.835  1.895   1.00 11.33 ? 431  ILE A CG2 1 
ATOM   3092  C CD1 . ILE A 1 431 ? 26.951  -3.204  2.549   1.00 12.75 ? 431  ILE A CD1 1 
ATOM   3093  N N   . ILE A 1 432 ? 31.560  -0.797  4.914   1.00 8.31  ? 432  ILE A N   1 
ATOM   3094  C CA  . ILE A 1 432 ? 32.536  0.254   5.170   1.00 9.71  ? 432  ILE A CA  1 
ATOM   3095  C C   . ILE A 1 432 ? 33.487  0.326   3.979   1.00 8.68  ? 432  ILE A C   1 
ATOM   3096  O O   . ILE A 1 432 ? 33.902  -0.702  3.448   1.00 9.53  ? 432  ILE A O   1 
ATOM   3097  C CB  . ILE A 1 432 ? 33.366  -0.047  6.465   1.00 9.42  ? 432  ILE A CB  1 
ATOM   3098  C CG1 . ILE A 1 432 ? 32.460  -0.186  7.693   1.00 12.06 ? 432  ILE A CG1 1 
ATOM   3099  C CG2 . ILE A 1 432 ? 34.472  0.993   6.687   1.00 10.46 ? 432  ILE A CG2 1 
ATOM   3100  C CD1 . ILE A 1 432 ? 31.748  1.079   8.141   1.00 15.25 ? 432  ILE A CD1 1 
ATOM   3101  N N   . PHE A 1 433 ? 33.774  1.547   3.538   1.00 8.48  ? 433  PHE A N   1 
ATOM   3102  C CA  . PHE A 1 433 ? 34.721  1.780   2.452   1.00 8.73  ? 433  PHE A CA  1 
ATOM   3103  C C   . PHE A 1 433 ? 35.349  3.156   2.660   1.00 9.83  ? 433  PHE A C   1 
ATOM   3104  O O   . PHE A 1 433 ? 34.915  3.920   3.527   1.00 9.08  ? 433  PHE A O   1 
ATOM   3105  C CB  . PHE A 1 433 ? 34.055  1.664   1.057   1.00 9.51  ? 433  PHE A CB  1 
ATOM   3106  C CG  . PHE A 1 433 ? 33.225  2.859   0.651   1.00 8.84  ? 433  PHE A CG  1 
ATOM   3107  C CD1 . PHE A 1 433 ? 31.967  3.095   1.234   1.00 9.02  ? 433  PHE A CD1 1 
ATOM   3108  C CD2 . PHE A 1 433 ? 33.705  3.757   -0.327  1.00 9.30  ? 433  PHE A CD2 1 
ATOM   3109  C CE1 . PHE A 1 433 ? 31.192  4.206   0.851   1.00 10.40 ? 433  PHE A CE1 1 
ATOM   3110  C CE2 . PHE A 1 433 ? 32.939  4.875   -0.717  1.00 10.35 ? 433  PHE A CE2 1 
ATOM   3111  C CZ  . PHE A 1 433 ? 31.680  5.099   -0.128  1.00 11.03 ? 433  PHE A CZ  1 
ATOM   3112  N N   . GLY A 1 434 ? 36.368  3.445   1.859   1.00 9.38  ? 434  GLY A N   1 
ATOM   3113  C CA  . GLY A 1 434 ? 37.032  4.729   1.928   1.00 9.82  ? 434  GLY A CA  1 
ATOM   3114  C C   . GLY A 1 434 ? 38.502  4.659   1.595   1.00 10.46 ? 434  GLY A C   1 
ATOM   3115  O O   . GLY A 1 434 ? 39.104  3.579   1.531   1.00 10.33 ? 434  GLY A O   1 
ATOM   3116  N N   . GLU A 1 435 ? 39.055  5.845   1.355   1.00 9.89  ? 435  GLU A N   1 
ATOM   3117  C CA  . GLU A 1 435 ? 40.458  6.071   1.035   1.00 11.01 ? 435  GLU A CA  1 
ATOM   3118  C C   . GLU A 1 435 ? 40.855  7.401   1.661   1.00 9.43  ? 435  GLU A C   1 
ATOM   3119  O O   . GLU A 1 435 ? 39.995  8.226   1.986   1.00 10.80 ? 435  GLU A O   1 
ATOM   3120  C CB  . GLU A 1 435 ? 40.676  6.129   -0.488  1.00 13.21 ? 435  GLU A CB  1 
ATOM   3121  C CG  . GLU A 1 435 ? 40.573  4.766   -1.197  1.00 18.30 ? 435  GLU A CG  1 
ATOM   3122  C CD  . GLU A 1 435 ? 41.727  3.796   -0.858  1.00 22.17 ? 435  GLU A CD  1 
ATOM   3123  O OE1 . GLU A 1 435 ? 42.879  4.251   -0.655  1.00 26.77 ? 435  GLU A OE1 1 
ATOM   3124  O OE2 . GLU A 1 435 ? 41.492  2.565   -0.815  1.00 25.90 ? 435  GLU A OE2 1 
ATOM   3125  N N   . ALA A 1 436 ? 42.157  7.607   1.830   1.00 8.56  ? 436  ALA A N   1 
ATOM   3126  C CA  . ALA A 1 436 ? 42.674  8.844   2.403   1.00 10.39 ? 436  ALA A CA  1 
ATOM   3127  C C   . ALA A 1 436 ? 42.380  10.056  1.520   1.00 10.43 ? 436  ALA A C   1 
ATOM   3128  O O   . ALA A 1 436 ? 42.496  9.976   0.295   1.00 11.82 ? 436  ALA A O   1 
ATOM   3129  C CB  . ALA A 1 436 ? 44.182  8.732   2.615   1.00 11.07 ? 436  ALA A CB  1 
ATOM   3130  N N   . GLY A 1 437 ? 41.975  11.157  2.162   1.00 9.65  ? 437  GLY A N   1 
ATOM   3131  C CA  . GLY A 1 437 ? 41.718  12.422  1.470   1.00 10.45 ? 437  GLY A CA  1 
ATOM   3132  C C   . GLY A 1 437 ? 43.088  13.057  1.220   1.00 9.96  ? 437  GLY A C   1 
ATOM   3133  O O   . GLY A 1 437 ? 43.988  12.774  1.982   1.00 10.99 ? 437  GLY A O   1 
ATOM   3134  N N   . THR A 1 438 ? 43.293  13.820  0.140   1.00 11.52 ? 438  THR A N   1 
ATOM   3135  C CA  . THR A 1 438 ? 42.280  14.133  -0.872  1.00 12.61 ? 438  THR A CA  1 
ATOM   3136  C C   . THR A 1 438 ? 42.139  13.181  -2.053  1.00 14.12 ? 438  THR A C   1 
ATOM   3137  O O   . THR A 1 438 ? 41.370  13.462  -2.972  1.00 15.40 ? 438  THR A O   1 
ATOM   3138  C CB  . THR A 1 438 ? 42.588  15.490  -1.556  1.00 13.08 ? 438  THR A CB  1 
ATOM   3139  O OG1 . THR A 1 438 ? 43.753  15.346  -2.375  1.00 14.23 ? 438  THR A OG1 1 
ATOM   3140  C CG2 . THR A 1 438 ? 42.826  16.608  -0.578  1.00 10.83 ? 438  THR A CG2 1 
ATOM   3141  N N   . ASN A 1 439 ? 42.881  12.081  -2.076  1.00 14.03 ? 439  ASN A N   1 
ATOM   3142  C CA  . ASN A 1 439 ? 42.817  11.170  -3.224  1.00 16.23 ? 439  ASN A CA  1 
ATOM   3143  C C   . ASN A 1 439 ? 41.397  10.719  -3.589  1.00 16.13 ? 439  ASN A C   1 
ATOM   3144  O O   . ASN A 1 439 ? 41.088  10.467  -4.754  1.00 17.41 ? 439  ASN A O   1 
ATOM   3145  C CB  . ASN A 1 439 ? 43.704  9.958   -2.976  1.00 17.21 ? 439  ASN A CB  1 
ATOM   3146  C CG  . ASN A 1 439 ? 45.169  10.330  -2.817  1.00 18.29 ? 439  ASN A CG  1 
ATOM   3147  O OD1 . ASN A 1 439 ? 45.554  10.911  -1.812  1.00 19.62 ? 439  ASN A OD1 1 
ATOM   3148  N ND2 . ASN A 1 439 ? 45.980  10.001  -3.808  1.00 19.13 ? 439  ASN A ND2 1 
ATOM   3149  N N   . GLY A 1 440 ? 40.534  10.679  -2.573  1.00 14.99 ? 440  GLY A N   1 
ATOM   3150  C CA  . GLY A 1 440 ? 39.152  10.260  -2.750  1.00 14.67 ? 440  GLY A CA  1 
ATOM   3151  C C   . GLY A 1 440 ? 38.320  11.222  -3.574  1.00 15.21 ? 440  GLY A C   1 
ATOM   3152  O O   . GLY A 1 440 ? 37.379  10.818  -4.275  1.00 14.12 ? 440  GLY A O   1 
ATOM   3153  N N   . GLN A 1 441 ? 38.665  12.508  -3.475  1.00 14.04 ? 441  GLN A N   1 
ATOM   3154  C CA  . GLN A 1 441 ? 37.985  13.589  -4.192  1.00 13.96 ? 441  GLN A CA  1 
ATOM   3155  C C   . GLN A 1 441 ? 38.031  13.437  -5.702  1.00 15.30 ? 441  GLN A C   1 
ATOM   3156  O O   . GLN A 1 441 ? 37.094  13.807  -6.414  1.00 17.46 ? 441  GLN A O   1 
ATOM   3157  C CB  . GLN A 1 441 ? 38.581  14.939  -3.801  1.00 13.48 ? 441  GLN A CB  1 
ATOM   3158  C CG  . GLN A 1 441 ? 38.338  15.336  -2.358  1.00 11.73 ? 441  GLN A CG  1 
ATOM   3159  C CD  . GLN A 1 441 ? 39.017  16.627  -1.929  1.00 11.18 ? 441  GLN A CD  1 
ATOM   3160  O OE1 . GLN A 1 441 ? 39.246  16.825  -0.742  1.00 11.92 ? 441  GLN A OE1 1 
ATOM   3161  N NE2 . GLN A 1 441 ? 39.345  17.498  -2.881  1.00 11.69 ? 441  GLN A NE2 1 
ATOM   3162  N N   . HIS A 1 442 ? 39.142  12.878  -6.168  1.00 16.07 ? 442  HIS A N   1 
ATOM   3163  C CA  . HIS A 1 442 ? 39.384  12.664  -7.594  1.00 17.35 ? 442  HIS A CA  1 
ATOM   3164  C C   . HIS A 1 442 ? 39.169  11.199  -7.955  1.00 18.23 ? 442  HIS A C   1 
ATOM   3165  O O   . HIS A 1 442 ? 39.635  10.726  -8.998  1.00 20.47 ? 442  HIS A O   1 
ATOM   3166  C CB  . HIS A 1 442 ? 40.827  13.050  -7.937  1.00 17.61 ? 442  HIS A CB  1 
ATOM   3167  C CG  . HIS A 1 442 ? 41.246  14.387  -7.416  1.00 17.43 ? 442  HIS A CG  1 
ATOM   3168  N ND1 . HIS A 1 442 ? 41.375  15.486  -8.231  1.00 17.12 ? 442  HIS A ND1 1 
ATOM   3169  C CD2 . HIS A 1 442 ? 41.569  14.799  -6.167  1.00 17.73 ? 442  HIS A CD2 1 
ATOM   3170  C CE1 . HIS A 1 442 ? 41.769  16.513  -7.507  1.00 15.89 ? 442  HIS A CE1 1 
ATOM   3171  N NE2 . HIS A 1 442 ? 41.890  16.128  -6.254  1.00 19.05 ? 442  HIS A NE2 1 
ATOM   3172  N N   . ALA A 1 443 ? 38.453  10.494  -7.081  1.00 17.59 ? 443  ALA A N   1 
ATOM   3173  C CA  . ALA A 1 443 ? 38.179  9.077   -7.247  1.00 16.27 ? 443  ALA A CA  1 
ATOM   3174  C C   . ALA A 1 443 ? 36.697  8.726   -7.266  1.00 15.37 ? 443  ALA A C   1 
ATOM   3175  O O   . ALA A 1 443 ? 36.153  8.333   -8.297  1.00 16.90 ? 443  ALA A O   1 
ATOM   3176  C CB  . ALA A 1 443 ? 38.871  8.283   -6.140  1.00 18.44 ? 443  ALA A CB  1 
ATOM   3177  N N   . PHE A 1 444 ? 36.044  8.874   -6.117  1.00 13.24 ? 444  PHE A N   1 
ATOM   3178  C CA  . PHE A 1 444 ? 34.638  8.495   -5.973  1.00 11.85 ? 444  PHE A CA  1 
ATOM   3179  C C   . PHE A 1 444 ? 33.701  9.519   -5.332  1.00 11.50 ? 444  PHE A C   1 
ATOM   3180  O O   . PHE A 1 444 ? 32.536  9.211   -5.070  1.00 11.07 ? 444  PHE A O   1 
ATOM   3181  C CB  . PHE A 1 444 ? 34.547  7.184   -5.175  1.00 12.32 ? 444  PHE A CB  1 
ATOM   3182  C CG  . PHE A 1 444 ? 35.307  7.198   -3.866  1.00 11.09 ? 444  PHE A CG  1 
ATOM   3183  C CD1 . PHE A 1 444 ? 34.748  7.765   -2.703  1.00 11.03 ? 444  PHE A CD1 1 
ATOM   3184  C CD2 . PHE A 1 444 ? 36.596  6.642   -3.794  1.00 12.34 ? 444  PHE A CD2 1 
ATOM   3185  C CE1 . PHE A 1 444 ? 35.461  7.781   -1.491  1.00 10.54 ? 444  PHE A CE1 1 
ATOM   3186  C CE2 . PHE A 1 444 ? 37.321  6.649   -2.588  1.00 13.18 ? 444  PHE A CE2 1 
ATOM   3187  C CZ  . PHE A 1 444 ? 36.751  7.224   -1.431  1.00 11.65 ? 444  PHE A CZ  1 
ATOM   3188  N N   . TYR A 1 445 ? 34.203  10.716  -5.037  1.00 10.93 ? 445  TYR A N   1 
ATOM   3189  C CA  . TYR A 1 445 ? 33.365  11.747  -4.414  1.00 11.56 ? 445  TYR A CA  1 
ATOM   3190  C C   . TYR A 1 445 ? 32.271  12.221  -5.348  1.00 11.88 ? 445  TYR A C   1 
ATOM   3191  O O   . TYR A 1 445 ? 31.256  12.745  -4.900  1.00 12.37 ? 445  TYR A O   1 
ATOM   3192  C CB  . TYR A 1 445 ? 34.188  12.942  -3.946  1.00 11.51 ? 445  TYR A CB  1 
ATOM   3193  C CG  . TYR A 1 445 ? 34.859  12.773  -2.597  1.00 10.24 ? 445  TYR A CG  1 
ATOM   3194  C CD1 . TYR A 1 445 ? 35.333  11.517  -2.167  1.00 11.34 ? 445  TYR A CD1 1 
ATOM   3195  C CD2 . TYR A 1 445 ? 35.065  13.879  -1.755  1.00 10.59 ? 445  TYR A CD2 1 
ATOM   3196  C CE1 . TYR A 1 445 ? 36.006  11.370  -0.934  1.00 10.73 ? 445  TYR A CE1 1 
ATOM   3197  C CE2 . TYR A 1 445 ? 35.737  13.744  -0.514  1.00 11.89 ? 445  TYR A CE2 1 
ATOM   3198  C CZ  . TYR A 1 445 ? 36.205  12.490  -0.120  1.00 12.64 ? 445  TYR A CZ  1 
ATOM   3199  O OH  . TYR A 1 445 ? 36.882  12.361  1.063   1.00 15.30 ? 445  TYR A OH  1 
ATOM   3200  N N   . GLN A 1 446 ? 32.478  11.991  -6.647  1.00 10.75 ? 446  GLN A N   1 
ATOM   3201  C CA  . GLN A 1 446 ? 31.497  12.335  -7.674  1.00 9.91  ? 446  GLN A CA  1 
ATOM   3202  C C   . GLN A 1 446 ? 30.175  11.635  -7.326  1.00 10.34 ? 446  GLN A C   1 
ATOM   3203  O O   . GLN A 1 446 ? 29.111  12.251  -7.386  1.00 10.63 ? 446  GLN A O   1 
ATOM   3204  C CB  . GLN A 1 446 ? 31.994  11.877  -9.051  1.00 10.54 ? 446  GLN A CB  1 
ATOM   3205  C CG  . GLN A 1 446 ? 30.924  11.726  -10.155 1.00 11.20 ? 446  GLN A CG  1 
ATOM   3206  C CD  . GLN A 1 446 ? 30.318  13.041  -10.575 1.00 11.45 ? 446  GLN A CD  1 
ATOM   3207  O OE1 . GLN A 1 446 ? 31.034  13.980  -10.896 1.00 11.54 ? 446  GLN A OE1 1 
ATOM   3208  N NE2 . GLN A 1 446 ? 28.988  13.116  -10.566 1.00 9.27  ? 446  GLN A NE2 1 
ATOM   3209  N N   . LEU A 1 447 ? 30.278  10.367  -6.917  1.00 10.50 ? 447  LEU A N   1 
ATOM   3210  C CA  . LEU A 1 447 ? 29.118  9.568   -6.533  1.00 10.57 ? 447  LEU A CA  1 
ATOM   3211  C C   . LEU A 1 447 ? 28.530  10.022  -5.191  1.00 11.00 ? 447  LEU A C   1 
ATOM   3212  O O   . LEU A 1 447 ? 27.313  10.025  -5.028  1.00 11.02 ? 447  LEU A O   1 
ATOM   3213  C CB  . LEU A 1 447 ? 29.471  8.065   -6.508  1.00 9.98  ? 447  LEU A CB  1 
ATOM   3214  C CG  . LEU A 1 447 ? 28.334  7.044   -6.280  1.00 10.69 ? 447  LEU A CG  1 
ATOM   3215  C CD1 . LEU A 1 447 ? 28.508  5.814   -7.135  1.00 11.09 ? 447  LEU A CD1 1 
ATOM   3216  C CD2 . LEU A 1 447 ? 28.243  6.637   -4.833  1.00 12.03 ? 447  LEU A CD2 1 
ATOM   3217  N N   . ILE A 1 448 ? 29.379  10.403  -4.236  1.00 10.64 ? 448  ILE A N   1 
ATOM   3218  C CA  . ILE A 1 448 ? 28.886  10.851  -2.924  1.00 10.52 ? 448  ILE A CA  1 
ATOM   3219  C C   . ILE A 1 448 ? 28.079  12.162  -3.068  1.00 11.06 ? 448  ILE A C   1 
ATOM   3220  O O   . ILE A 1 448 ? 27.014  12.309  -2.465  1.00 12.91 ? 448  ILE A O   1 
ATOM   3221  C CB  . ILE A 1 448 ? 30.042  10.990  -1.880  1.00 11.67 ? 448  ILE A CB  1 
ATOM   3222  C CG1 . ILE A 1 448 ? 30.801  9.656   -1.754  1.00 11.62 ? 448  ILE A CG1 1 
ATOM   3223  C CG2 . ILE A 1 448 ? 29.485  11.383  -0.500  1.00 10.75 ? 448  ILE A CG2 1 
ATOM   3224  C CD1 . ILE A 1 448 ? 31.970  9.669   -0.755  1.00 12.48 ? 448  ILE A CD1 1 
ATOM   3225  N N   . HIS A 1 449 ? 28.535  13.032  -3.967  1.00 11.50 ? 449  HIS A N   1 
ATOM   3226  C CA  . HIS A 1 449 ? 27.882  14.313  -4.234  1.00 11.50 ? 449  HIS A CA  1 
ATOM   3227  C C   . HIS A 1 449 ? 26.694  14.245  -5.189  1.00 11.79 ? 449  HIS A C   1 
ATOM   3228  O O   . HIS A 1 449 ? 25.669  14.886  -4.947  1.00 12.95 ? 449  HIS A O   1 
ATOM   3229  C CB  . HIS A 1 449 ? 28.880  15.315  -4.820  1.00 11.32 ? 449  HIS A CB  1 
ATOM   3230  C CG  . HIS A 1 449 ? 29.836  15.879  -3.821  1.00 12.19 ? 449  HIS A CG  1 
ATOM   3231  N ND1 . HIS A 1 449 ? 29.489  16.887  -2.947  1.00 12.99 ? 449  HIS A ND1 1 
ATOM   3232  C CD2 . HIS A 1 449 ? 31.139  15.601  -3.580  1.00 12.88 ? 449  HIS A CD2 1 
ATOM   3233  C CE1 . HIS A 1 449 ? 30.541  17.207  -2.215  1.00 13.33 ? 449  HIS A CE1 1 
ATOM   3234  N NE2 . HIS A 1 449 ? 31.553  16.441  -2.578  1.00 13.71 ? 449  HIS A NE2 1 
ATOM   3235  N N   . GLN A 1 450 ? 26.846  13.498  -6.284  1.00 11.76 ? 450  GLN A N   1 
ATOM   3236  C CA  . GLN A 1 450 ? 25.803  13.415  -7.309  1.00 11.98 ? 450  GLN A CA  1 
ATOM   3237  C C   . GLN A 1 450 ? 25.243  12.037  -7.656  1.00 12.56 ? 450  GLN A C   1 
ATOM   3238  O O   . GLN A 1 450 ? 24.621  11.861  -8.708  1.00 13.58 ? 450  GLN A O   1 
ATOM   3239  C CB  . GLN A 1 450 ? 26.266  14.128  -8.588  1.00 12.64 ? 450  GLN A CB  1 
ATOM   3240  C CG  . GLN A 1 450 ? 26.389  15.647  -8.473  1.00 13.77 ? 450  GLN A CG  1 
ATOM   3241  C CD  . GLN A 1 450 ? 26.749  16.313  -9.786  1.00 13.66 ? 450  GLN A CD  1 
ATOM   3242  O OE1 . GLN A 1 450 ? 27.483  15.754  -10.604 1.00 14.41 ? 450  GLN A OE1 1 
ATOM   3243  N NE2 . GLN A 1 450 ? 26.250  17.529  -9.984  1.00 13.76 ? 450  GLN A NE2 1 
ATOM   3244  N N   . GLY A 1 451 ? 25.421  11.076  -6.756  1.00 11.41 ? 451  GLY A N   1 
ATOM   3245  C CA  . GLY A 1 451 ? 24.908  9.735   -6.990  1.00 11.49 ? 451  GLY A CA  1 
ATOM   3246  C C   . GLY A 1 451 ? 23.509  9.549   -6.439  1.00 12.01 ? 451  GLY A C   1 
ATOM   3247  O O   . GLY A 1 451 ? 22.939  10.459  -5.829  1.00 12.82 ? 451  GLY A O   1 
ATOM   3248  N N   . THR A 1 452 ? 22.980  8.344   -6.620  1.00 11.59 ? 452  THR A N   1 
ATOM   3249  C CA  . THR A 1 452 ? 21.633  8.000   -6.171  1.00 12.83 ? 452  THR A CA  1 
ATOM   3250  C C   . THR A 1 452 ? 21.591  7.311   -4.801  1.00 14.15 ? 452  THR A C   1 
ATOM   3251  O O   . THR A 1 452 ? 20.566  6.741   -4.414  1.00 16.51 ? 452  THR A O   1 
ATOM   3252  C CB  . THR A 1 452 ? 20.925  7.112   -7.222  1.00 12.81 ? 452  THR A CB  1 
ATOM   3253  O OG1 . THR A 1 452 ? 21.753  5.987   -7.554  1.00 12.43 ? 452  THR A OG1 1 
ATOM   3254  C CG2 . THR A 1 452 ? 20.631  7.900   -8.489  1.00 12.53 ? 452  THR A CG2 1 
ATOM   3255  N N   . ASN A 1 453 ? 22.704  7.387   -4.069  1.00 15.16 ? 453  ASN A N   1 
ATOM   3256  C CA  . ASN A 1 453 ? 22.829  6.758   -2.752  1.00 17.26 ? 453  ASN A CA  1 
ATOM   3257  C C   . ASN A 1 453 ? 23.152  7.773   -1.667  1.00 17.30 ? 453  ASN A C   1 
ATOM   3258  O O   . ASN A 1 453 ? 23.926  8.706   -1.894  1.00 18.49 ? 453  ASN A O   1 
ATOM   3259  C CB  . ASN A 1 453 ? 23.973  5.729   -2.743  1.00 20.20 ? 453  ASN A CB  1 
ATOM   3260  C CG  . ASN A 1 453 ? 23.917  4.759   -3.906  1.00 22.91 ? 453  ASN A CG  1 
ATOM   3261  O OD1 . ASN A 1 453 ? 23.151  3.804   -3.887  1.00 25.53 ? 453  ASN A OD1 1 
ATOM   3262  N ND2 . ASN A 1 453 ? 24.747  4.995   -4.918  1.00 24.89 ? 453  ASN A ND2 1 
ATOM   3263  N N   . LEU A 1 454 ? 22.579  7.563   -0.482  1.00 15.99 ? 454  LEU A N   1 
ATOM   3264  C CA  . LEU A 1 454 ? 22.844  8.406   0.680   1.00 15.84 ? 454  LEU A CA  1 
ATOM   3265  C C   . LEU A 1 454 ? 23.992  7.704   1.402   1.00 14.03 ? 454  LEU A C   1 
ATOM   3266  O O   . LEU A 1 454 ? 23.860  6.545   1.810   1.00 14.24 ? 454  LEU A O   1 
ATOM   3267  C CB  . LEU A 1 454 ? 21.611  8.490   1.583   1.00 18.28 ? 454  LEU A CB  1 
ATOM   3268  C CG  . LEU A 1 454 ? 21.707  9.363   2.835   1.00 19.97 ? 454  LEU A CG  1 
ATOM   3269  C CD1 . LEU A 1 454 ? 22.093  10.776  2.498   1.00 23.60 ? 454  LEU A CD1 1 
ATOM   3270  C CD2 . LEU A 1 454 ? 20.368  9.359   3.493   1.00 23.10 ? 454  LEU A CD2 1 
ATOM   3271  N N   . ILE A 1 455 ? 25.137  8.380   1.485   1.00 12.58 ? 455  ILE A N   1 
ATOM   3272  C CA  . ILE A 1 455 ? 26.334  7.807   2.104   1.00 11.81 ? 455  ILE A CA  1 
ATOM   3273  C C   . ILE A 1 455 ? 26.904  8.624   3.272   1.00 11.51 ? 455  ILE A C   1 
ATOM   3274  O O   . ILE A 1 455 ? 27.592  9.630   3.053   1.00 12.35 ? 455  ILE A O   1 
ATOM   3275  C CB  . ILE A 1 455 ? 27.478  7.597   1.049   1.00 11.35 ? 455  ILE A CB  1 
ATOM   3276  C CG1 . ILE A 1 455 ? 26.982  6.783   -0.148  1.00 12.21 ? 455  ILE A CG1 1 
ATOM   3277  C CG2 . ILE A 1 455 ? 28.684  6.875   1.687   1.00 10.98 ? 455  ILE A CG2 1 
ATOM   3278  C CD1 . ILE A 1 455 ? 27.885  6.861   -1.334  1.00 12.74 ? 455  ILE A CD1 1 
ATOM   3279  N N   . PRO A 1 456 ? 26.647  8.192   4.527   1.00 10.10 ? 456  PRO A N   1 
ATOM   3280  C CA  . PRO A 1 456 ? 27.169  8.900   5.707   1.00 10.54 ? 456  PRO A CA  1 
ATOM   3281  C C   . PRO A 1 456 ? 28.697  8.808   5.671   1.00 10.64 ? 456  PRO A C   1 
ATOM   3282  O O   . PRO A 1 456 ? 29.248  7.752   5.356   1.00 10.74 ? 456  PRO A O   1 
ATOM   3283  C CB  . PRO A 1 456 ? 26.602  8.087   6.865   1.00 11.37 ? 456  PRO A CB  1 
ATOM   3284  C CG  . PRO A 1 456 ? 25.313  7.609   6.321   1.00 11.42 ? 456  PRO A CG  1 
ATOM   3285  C CD  . PRO A 1 456 ? 25.688  7.153   4.945   1.00 10.95 ? 456  PRO A CD  1 
ATOM   3286  N N   . CYS A 1 457 ? 29.359  9.936   5.902   1.00 9.21  ? 457  CYS A N   1 
ATOM   3287  C CA  . CYS A 1 457 ? 30.815  9.997   5.855   1.00 10.71 ? 457  CYS A CA  1 
ATOM   3288  C C   . CYS A 1 457 ? 31.455  10.474  7.151   1.00 11.62 ? 457  CYS A C   1 
ATOM   3289  O O   . CYS A 1 457 ? 30.929  11.354  7.820   1.00 13.63 ? 457  CYS A O   1 
ATOM   3290  C CB  . CYS A 1 457 ? 31.256  10.963  4.754   1.00 10.25 ? 457  CYS A CB  1 
ATOM   3291  S SG  . CYS A 1 457 ? 30.866  10.562  3.043   1.00 13.16 ? 457  CYS A SG  1 
ATOM   3292  N N   . ASP A 1 458 ? 32.591  9.870   7.498   1.00 10.89 ? 458  ASP A N   1 
ATOM   3293  C CA  . ASP A 1 458 ? 33.366  10.280  8.663   1.00 11.00 ? 458  ASP A CA  1 
ATOM   3294  C C   . ASP A 1 458 ? 34.657  10.895  8.139   1.00 10.91 ? 458  ASP A C   1 
ATOM   3295  O O   . ASP A 1 458 ? 35.474  10.209  7.523   1.00 12.18 ? 458  ASP A O   1 
ATOM   3296  C CB  . ASP A 1 458 ? 33.704  9.098   9.571   1.00 12.19 ? 458  ASP A CB  1 
ATOM   3297  C CG  . ASP A 1 458 ? 32.564  8.714   10.501  1.00 12.87 ? 458  ASP A CG  1 
ATOM   3298  O OD1 . ASP A 1 458 ? 31.500  9.373   10.500  1.00 12.88 ? 458  ASP A OD1 1 
ATOM   3299  O OD2 . ASP A 1 458 ? 32.744  7.728   11.239  1.00 14.70 ? 458  ASP A OD2 1 
ATOM   3300  N N   . PHE A 1 459 ? 34.782  12.206  8.316   1.00 9.88  ? 459  PHE A N   1 
ATOM   3301  C CA  . PHE A 1 459 ? 35.967  12.955  7.898   1.00 9.65  ? 459  PHE A CA  1 
ATOM   3302  C C   . PHE A 1 459 ? 36.860  13.127  9.120   1.00 10.44 ? 459  PHE A C   1 
ATOM   3303  O O   . PHE A 1 459 ? 36.463  13.759  10.098  1.00 12.64 ? 459  PHE A O   1 
ATOM   3304  C CB  . PHE A 1 459 ? 35.559  14.322  7.345   1.00 9.69  ? 459  PHE A CB  1 
ATOM   3305  C CG  . PHE A 1 459 ? 35.075  14.289  5.926   1.00 9.31  ? 459  PHE A CG  1 
ATOM   3306  C CD1 . PHE A 1 459 ? 33.802  13.787  5.605   1.00 9.10  ? 459  PHE A CD1 1 
ATOM   3307  C CD2 . PHE A 1 459 ? 35.871  14.813  4.900   1.00 9.09  ? 459  PHE A CD2 1 
ATOM   3308  C CE1 . PHE A 1 459 ? 33.327  13.813  4.268   1.00 10.53 ? 459  PHE A CE1 1 
ATOM   3309  C CE2 . PHE A 1 459 ? 35.411  14.842  3.562   1.00 9.76  ? 459  PHE A CE2 1 
ATOM   3310  C CZ  . PHE A 1 459 ? 34.132  14.341  3.245   1.00 9.45  ? 459  PHE A CZ  1 
ATOM   3311  N N   . ILE A 1 460 ? 38.057  12.540  9.061   1.00 10.01 ? 460  ILE A N   1 
ATOM   3312  C CA  . ILE A 1 460 ? 39.026  12.583  10.163  1.00 11.10 ? 460  ILE A CA  1 
ATOM   3313  C C   . ILE A 1 460 ? 40.244  13.419  9.759   1.00 11.17 ? 460  ILE A C   1 
ATOM   3314  O O   . ILE A 1 460 ? 40.830  13.183  8.710   1.00 11.59 ? 460  ILE A O   1 
ATOM   3315  C CB  . ILE A 1 460 ? 39.484  11.138  10.562  1.00 11.34 ? 460  ILE A CB  1 
ATOM   3316  C CG1 . ILE A 1 460 ? 38.266  10.260  10.875  1.00 11.94 ? 460  ILE A CG1 1 
ATOM   3317  C CG2 . ILE A 1 460 ? 40.426  11.176  11.783  1.00 13.57 ? 460  ILE A CG2 1 
ATOM   3318  C CD1 . ILE A 1 460 ? 38.553  8.770   10.922  1.00 12.18 ? 460  ILE A CD1 1 
ATOM   3319  N N   . GLY A 1 461 ? 40.602  14.404  10.583  1.00 11.32 ? 461  GLY A N   1 
ATOM   3320  C CA  . GLY A 1 461 ? 41.745  15.252  10.269  1.00 11.87 ? 461  GLY A CA  1 
ATOM   3321  C C   . GLY A 1 461 ? 42.498  15.782  11.467  1.00 12.78 ? 461  GLY A C   1 
ATOM   3322  O O   . GLY A 1 461 ? 42.001  15.739  12.596  1.00 13.05 ? 461  GLY A O   1 
ATOM   3323  N N   . ALA A 1 462 ? 43.709  16.275  11.207  1.00 12.27 ? 462  ALA A N   1 
ATOM   3324  C CA  . ALA A 1 462 ? 44.584  16.826  12.237  1.00 12.28 ? 462  ALA A CA  1 
ATOM   3325  C C   . ALA A 1 462 ? 44.889  18.290  11.956  1.00 11.67 ? 462  ALA A C   1 
ATOM   3326  O O   . ALA A 1 462 ? 45.097  18.667  10.805  1.00 11.97 ? 462  ALA A O   1 
ATOM   3327  C CB  . ALA A 1 462 ? 45.880  16.020  12.304  1.00 11.10 ? 462  ALA A CB  1 
ATOM   3328  N N   . ILE A 1 463 ? 44.903  19.108  13.009  1.00 12.00 ? 463  ILE A N   1 
ATOM   3329  C CA  . ILE A 1 463 ? 45.192  20.541  12.882  1.00 11.78 ? 463  ILE A CA  1 
ATOM   3330  C C   . ILE A 1 463 ? 46.664  20.776  12.525  1.00 11.92 ? 463  ILE A C   1 
ATOM   3331  O O   . ILE A 1 463 ? 46.979  21.642  11.702  1.00 13.25 ? 463  ILE A O   1 
ATOM   3332  C CB  . ILE A 1 463 ? 44.811  21.321  14.184  1.00 11.56 ? 463  ILE A CB  1 
ATOM   3333  C CG1 . ILE A 1 463 ? 43.297  21.294  14.383  1.00 11.95 ? 463  ILE A CG1 1 
ATOM   3334  C CG2 . ILE A 1 463 ? 45.241  22.779  14.098  1.00 12.39 ? 463  ILE A CG2 1 
ATOM   3335  C CD1 . ILE A 1 463 ? 42.814  21.820  15.728  1.00 13.66 ? 463  ILE A CD1 1 
ATOM   3336  N N   . GLN A 1 464 ? 47.543  19.974  13.123  1.00 12.01 ? 464  GLN A N   1 
ATOM   3337  C CA  . GLN A 1 464 ? 48.983  20.070  12.897  1.00 13.11 ? 464  GLN A CA  1 
ATOM   3338  C C   . GLN A 1 464 ? 49.552  18.833  12.208  1.00 13.66 ? 464  GLN A C   1 
ATOM   3339  O O   . GLN A 1 464 ? 49.242  17.697  12.588  1.00 14.12 ? 464  GLN A O   1 
ATOM   3340  C CB  . GLN A 1 464 ? 49.718  20.275  14.225  1.00 14.28 ? 464  GLN A CB  1 
ATOM   3341  C CG  . GLN A 1 464 ? 49.304  21.530  14.989  1.00 16.23 ? 464  GLN A CG  1 
ATOM   3342  C CD  . GLN A 1 464 ? 49.913  21.626  16.379  1.00 17.94 ? 464  GLN A CD  1 
ATOM   3343  O OE1 . GLN A 1 464 ? 50.525  20.680  16.879  1.00 18.76 ? 464  GLN A OE1 1 
ATOM   3344  N NE2 . GLN A 1 464 ? 49.738  22.781  17.014  1.00 18.43 ? 464  GLN A NE2 1 
ATOM   3345  N N   . SER A 1 465 ? 50.382  19.071  11.193  1.00 13.11 ? 465  SER A N   1 
ATOM   3346  C CA  . SER A 1 465 ? 51.051  18.007  10.444  1.00 13.21 ? 465  SER A CA  1 
ATOM   3347  C C   . SER A 1 465 ? 52.380  17.682  11.116  1.00 13.61 ? 465  SER A C   1 
ATOM   3348  O O   . SER A 1 465 ? 52.953  18.518  11.825  1.00 14.29 ? 465  SER A O   1 
ATOM   3349  C CB  . SER A 1 465 ? 51.346  18.459  9.012   1.00 13.81 ? 465  SER A CB  1 
ATOM   3350  O OG  . SER A 1 465 ? 51.922  17.413  8.248   1.00 13.22 ? 465  SER A OG  1 
ATOM   3351  N N   . GLN A 1 466 ? 52.865  16.465  10.884  1.00 12.75 ? 466  GLN A N   1 
ATOM   3352  C CA  . GLN A 1 466 ? 54.150  16.026  11.425  1.00 14.32 ? 466  GLN A CA  1 
ATOM   3353  C C   . GLN A 1 466 ? 55.254  16.394  10.443  1.00 15.24 ? 466  GLN A C   1 
ATOM   3354  O O   . GLN A 1 466 ? 56.438  16.447  10.793  1.00 17.25 ? 466  GLN A O   1 
ATOM   3355  C CB  . GLN A 1 466 ? 54.140  14.516  11.666  1.00 15.17 ? 466  GLN A CB  1 
ATOM   3356  C CG  . GLN A 1 466 ? 53.103  14.070  12.707  1.00 15.99 ? 466  GLN A CG  1 
ATOM   3357  C CD  . GLN A 1 466 ? 53.356  14.662  14.100  1.00 17.66 ? 466  GLN A CD  1 
ATOM   3358  O OE1 . GLN A 1 466 ? 54.483  14.647  14.588  1.00 17.70 ? 466  GLN A OE1 1 
ATOM   3359  N NE2 . GLN A 1 466 ? 52.311  15.180  14.734  1.00 16.81 ? 466  GLN A NE2 1 
ATOM   3360  N N   . ASN A 1 467 ? 54.822  16.634  9.206   1.00 16.53 ? 467  ASN A N   1 
ATOM   3361  C CA  . ASN A 1 467 ? 55.683  17.016  8.094   1.00 18.24 ? 467  ASN A CA  1 
ATOM   3362  C C   . ASN A 1 467 ? 55.206  18.353  7.560   1.00 21.63 ? 467  ASN A C   1 
ATOM   3363  O O   . ASN A 1 467 ? 54.227  18.438  6.809   1.00 23.97 ? 467  ASN A O   1 
ATOM   3364  C CB  . ASN A 1 467 ? 55.610  16.003  6.950   1.00 18.21 ? 467  ASN A CB  1 
ATOM   3365  C CG  . ASN A 1 467 ? 55.857  14.574  7.396   1.00 18.20 ? 467  ASN A CG  1 
ATOM   3366  O OD1 . ASN A 1 467 ? 54.927  13.781  7.462   1.00 16.94 ? 467  ASN A OD1 1 
ATOM   3367  N ND2 . ASN A 1 467 ? 57.106  14.240  7.691   1.00 17.15 ? 467  ASN A ND2 1 
ATOM   3368  N N   . LYS A 1 468 ? 55.924  19.392  7.950   1.00 22.76 ? 468  LYS A N   1 
ATOM   3369  C CA  . LYS A 1 468 ? 55.616  20.719  7.524   1.00 24.22 ? 468  LYS A CA  1 
ATOM   3370  C C   . LYS A 1 468 ? 56.412  21.164  6.341   1.00 22.80 ? 468  LYS A C   1 
ATOM   3371  O O   . LYS A 1 468 ? 57.550  21.623  6.468   1.00 24.91 ? 468  LYS A O   1 
ATOM   3372  C CB  . LYS A 1 468 ? 55.710  21.695  8.696   1.00 26.82 ? 468  LYS A CB  1 
ATOM   3373  C CG  . LYS A 1 468 ? 54.591  21.525  9.734   1.00 29.10 ? 468  LYS A CG  1 
ATOM   3374  C CD  . LYS A 1 468 ? 53.200  21.554  9.103   1.00 30.06 ? 468  LYS A CD  1 
ATOM   3375  C CE  . LYS A 1 468 ? 53.043  22.526  7.944   1.00 29.46 ? 468  LYS A CE  1 
ATOM   3376  N NZ  . LYS A 1 468 ? 51.759  23.114  7.767   1.00 30.92 ? 468  LYS A NZ  1 
ATOM   3377  N N   . ILE A 1 469 ? 55.791  20.947  5.183   1.00 21.44 ? 469  ILE A N   1 
ATOM   3378  C CA  . ILE A 1 469 ? 56.338  21.231  3.866   1.00 21.06 ? 469  ILE A CA  1 
ATOM   3379  C C   . ILE A 1 469 ? 55.550  22.378  3.242   1.00 20.42 ? 469  ILE A C   1 
ATOM   3380  O O   . ILE A 1 469 ? 54.386  22.213  2.844   1.00 18.47 ? 469  ILE A O   1 
ATOM   3381  C CB  . ILE A 1 469 ? 56.193  19.978  2.947   1.00 23.23 ? 469  ILE A CB  1 
ATOM   3382  C CG1 . ILE A 1 469 ? 56.474  18.688  3.720   1.00 24.32 ? 469  ILE A CG1 1 
ATOM   3383  C CG2 . ILE A 1 469 ? 57.169  20.030  1.773   1.00 25.30 ? 469  ILE A CG2 1 
ATOM   3384  C CD1 . ILE A 1 469 ? 57.904  18.563  4.247   1.00 24.42 ? 469  ILE A CD1 1 
ATOM   3385  N N   . GLY A 1 470 ? 56.196  23.543  3.193   1.00 19.19 ? 470  GLY A N   1 
ATOM   3386  C CA  . GLY A 1 470 ? 55.609  24.745  2.628   1.00 19.66 ? 470  GLY A CA  1 
ATOM   3387  C C   . GLY A 1 470 ? 54.218  25.054  3.155   1.00 18.20 ? 470  GLY A C   1 
ATOM   3388  O O   . GLY A 1 470 ? 53.983  25.070  4.369   1.00 18.99 ? 470  GLY A O   1 
ATOM   3389  N N   . ASP A 1 471 ? 53.291  25.224  2.216   1.00 17.25 ? 471  ASP A N   1 
ATOM   3390  C CA  . ASP A 1 471 ? 51.889  25.540  2.505   1.00 17.80 ? 471  ASP A CA  1 
ATOM   3391  C C   . ASP A 1 471 ? 50.974  24.341  2.247   1.00 15.56 ? 471  ASP A C   1 
ATOM   3392  O O   . ASP A 1 471 ? 49.756  24.497  2.102   1.00 15.54 ? 471  ASP A O   1 
ATOM   3393  C CB  . ASP A 1 471 ? 51.433  26.715  1.619   1.00 20.89 ? 471  ASP A CB  1 
ATOM   3394  C CG  . ASP A 1 471 ? 52.056  28.062  2.030   1.00 23.16 ? 471  ASP A CG  1 
ATOM   3395  O OD1 . ASP A 1 471 ? 52.221  28.310  3.247   1.00 24.63 ? 471  ASP A OD1 1 
ATOM   3396  O OD2 . ASP A 1 471 ? 52.364  28.882  1.128   1.00 27.18 ? 471  ASP A OD2 1 
ATOM   3397  N N   . HIS A 1 472 ? 51.566  23.146  2.215   1.00 13.66 ? 472  HIS A N   1 
ATOM   3398  C CA  . HIS A 1 472 ? 50.838  21.901  1.945   1.00 12.85 ? 472  HIS A CA  1 
ATOM   3399  C C   . HIS A 1 472 ? 49.678  21.628  2.876   1.00 12.58 ? 472  HIS A C   1 
ATOM   3400  O O   . HIS A 1 472 ? 48.594  21.277  2.413   1.00 11.75 ? 472  HIS A O   1 
ATOM   3401  C CB  . HIS A 1 472 ? 51.774  20.694  1.998   1.00 12.60 ? 472  HIS A CB  1 
ATOM   3402  C CG  . HIS A 1 472 ? 52.459  20.388  0.701   1.00 13.31 ? 472  HIS A CG  1 
ATOM   3403  N ND1 . HIS A 1 472 ? 53.472  21.169  0.192   1.00 15.32 ? 472  HIS A ND1 1 
ATOM   3404  C CD2 . HIS A 1 472 ? 52.287  19.374  -0.181  1.00 12.22 ? 472  HIS A CD2 1 
ATOM   3405  C CE1 . HIS A 1 472 ? 53.892  20.648  -0.945  1.00 12.69 ? 472  HIS A CE1 1 
ATOM   3406  N NE2 . HIS A 1 472 ? 53.192  19.559  -1.195  1.00 15.28 ? 472  HIS A NE2 1 
ATOM   3407  N N   . HIS A 1 473 ? 49.896  21.821  4.178   1.00 11.86 ? 473  HIS A N   1 
ATOM   3408  C CA  . HIS A 1 473 ? 48.843  21.546  5.150   1.00 12.06 ? 473  HIS A CA  1 
ATOM   3409  C C   . HIS A 1 473 ? 47.603  22.429  5.078   1.00 11.95 ? 473  HIS A C   1 
ATOM   3410  O O   . HIS A 1 473 ? 46.493  21.912  5.212   1.00 11.64 ? 473  HIS A O   1 
ATOM   3411  C CB  . HIS A 1 473 ? 49.372  21.460  6.579   1.00 11.47 ? 473  HIS A CB  1 
ATOM   3412  C CG  . HIS A 1 473 ? 48.569  20.543  7.448   1.00 12.58 ? 473  HIS A CG  1 
ATOM   3413  N ND1 . HIS A 1 473 ? 47.947  20.959  8.603   1.00 13.91 ? 473  HIS A ND1 1 
ATOM   3414  C CD2 . HIS A 1 473 ? 48.237  19.240  7.288   1.00 9.34  ? 473  HIS A CD2 1 
ATOM   3415  C CE1 . HIS A 1 473 ? 47.266  19.950  9.117   1.00 10.89 ? 473  HIS A CE1 1 
ATOM   3416  N NE2 . HIS A 1 473 ? 47.425  18.897  8.339   1.00 14.90 ? 473  HIS A NE2 1 
ATOM   3417  N N   . LYS A 1 474 ? 47.774  23.734  4.846   1.00 12.71 ? 474  LYS A N   1 
ATOM   3418  C CA  . LYS A 1 474 ? 46.608  24.618  4.729   1.00 13.25 ? 474  LYS A CA  1 
ATOM   3419  C C   . LYS A 1 474 ? 45.826  24.343  3.439   1.00 11.87 ? 474  LYS A C   1 
ATOM   3420  O O   . LYS A 1 474 ? 44.595  24.366  3.448   1.00 11.72 ? 474  LYS A O   1 
ATOM   3421  C CB  . LYS A 1 474 ? 46.965  26.111  4.867   1.00 16.15 ? 474  LYS A CB  1 
ATOM   3422  C CG  . LYS A 1 474 ? 48.075  26.637  3.967   1.00 19.60 ? 474  LYS A CG  1 
ATOM   3423  C CD  . LYS A 1 474 ? 48.037  28.168  3.815   1.00 24.31 ? 474  LYS A CD  1 
ATOM   3424  C CE  . LYS A 1 474 ? 48.681  28.924  4.977   1.00 26.54 ? 474  LYS A CE  1 
ATOM   3425  N NZ  . LYS A 1 474 ? 47.905  28.922  6.237   1.00 30.70 ? 474  LYS A NZ  1 
ATOM   3426  N N   . ILE A 1 475 ? 46.546  23.999  2.364   1.00 12.36 ? 475  ILE A N   1 
ATOM   3427  C CA  . ILE A 1 475 ? 45.942  23.667  1.065   1.00 11.79 ? 475  ILE A CA  1 
ATOM   3428  C C   . ILE A 1 475 ? 45.132  22.378  1.234   1.00 12.04 ? 475  ILE A C   1 
ATOM   3429  O O   . ILE A 1 475 ? 43.984  22.292  0.810   1.00 13.29 ? 475  ILE A O   1 
ATOM   3430  C CB  . ILE A 1 475 ? 47.031  23.503  -0.045  1.00 12.80 ? 475  ILE A CB  1 
ATOM   3431  C CG1 . ILE A 1 475 ? 47.681  24.864  -0.338  1.00 13.20 ? 475  ILE A CG1 1 
ATOM   3432  C CG2 . ILE A 1 475 ? 46.420  22.937  -1.336  1.00 13.66 ? 475  ILE A CG2 1 
ATOM   3433  C CD1 . ILE A 1 475 ? 48.945  24.797  -1.185  1.00 13.73 ? 475  ILE A CD1 1 
ATOM   3434  N N   . PHE A 1 476 ? 45.726  21.441  1.967   1.00 12.80 ? 476  PHE A N   1 
ATOM   3435  C CA  . PHE A 1 476 ? 45.141  20.141  2.287   1.00 12.17 ? 476  PHE A CA  1 
ATOM   3436  C C   . PHE A 1 476 ? 43.885  20.284  3.142   1.00 12.89 ? 476  PHE A C   1 
ATOM   3437  O O   . PHE A 1 476 ? 42.841  19.702  2.827   1.00 12.95 ? 476  PHE A O   1 
ATOM   3438  C CB  . PHE A 1 476 ? 46.211  19.317  3.021   1.00 11.39 ? 476  PHE A CB  1 
ATOM   3439  C CG  . PHE A 1 476 ? 45.798  17.929  3.400   1.00 10.09 ? 476  PHE A CG  1 
ATOM   3440  C CD1 . PHE A 1 476 ? 45.191  17.063  2.468   1.00 10.76 ? 476  PHE A CD1 1 
ATOM   3441  C CD2 . PHE A 1 476 ? 46.109  17.448  4.682   1.00 9.54  ? 476  PHE A CD2 1 
ATOM   3442  C CE1 . PHE A 1 476 ? 44.908  15.730  2.801   1.00 10.23 ? 476  PHE A CE1 1 
ATOM   3443  C CE2 . PHE A 1 476 ? 45.835  16.119  5.032   1.00 12.00 ? 476  PHE A CE2 1 
ATOM   3444  C CZ  . PHE A 1 476 ? 45.234  15.258  4.074   1.00 10.01 ? 476  PHE A CZ  1 
ATOM   3445  N N   . MET A 1 477 ? 43.995  21.072  4.208   1.00 12.01 ? 477  MET A N   1 
ATOM   3446  C CA  . MET A 1 477 ? 42.877  21.278  5.114   1.00 12.14 ? 477  MET A CA  1 
ATOM   3447  C C   . MET A 1 477 ? 41.751  22.144  4.573   1.00 11.69 ? 477  MET A C   1 
ATOM   3448  O O   . MET A 1 477 ? 40.619  22.046  5.051   1.00 10.94 ? 477  MET A O   1 
ATOM   3449  C CB  . MET A 1 477 ? 43.358  21.724  6.487   1.00 13.18 ? 477  MET A CB  1 
ATOM   3450  C CG  . MET A 1 477 ? 44.175  20.643  7.196   1.00 12.33 ? 477  MET A CG  1 
ATOM   3451  S SD  . MET A 1 477 ? 43.296  19.086  7.492   1.00 13.49 ? 477  MET A SD  1 
ATOM   3452  C CE  . MET A 1 477 ? 42.504  19.476  9.034   1.00 16.20 ? 477  MET A CE  1 
ATOM   3453  N N   . SER A 1 478 ? 42.027  22.904  3.507   1.00 11.62 ? 478  SER A N   1 
ATOM   3454  C CA  . SER A 1 478 ? 40.988  23.722  2.874   1.00 10.27 ? 478  SER A CA  1 
ATOM   3455  C C   . SER A 1 478 ? 39.969  22.780  2.227   1.00 10.82 ? 478  SER A C   1 
ATOM   3456  O O   . SER A 1 478 ? 38.774  23.067  2.220   1.00 11.54 ? 478  SER A O   1 
ATOM   3457  C CB  . SER A 1 478 ? 41.573  24.695  1.839   1.00 10.33 ? 478  SER A CB  1 
ATOM   3458  O OG  . SER A 1 478 ? 42.003  24.052  0.651   1.00 11.70 ? 478  SER A OG  1 
ATOM   3459  N N   . ASN A 1 479 ? 40.456  21.621  1.776   1.00 10.68 ? 479  ASN A N   1 
ATOM   3460  C CA  . ASN A 1 479 ? 39.618  20.583  1.166   1.00 11.66 ? 479  ASN A CA  1 
ATOM   3461  C C   . ASN A 1 479 ? 38.808  19.853  2.235   1.00 11.46 ? 479  ASN A C   1 
ATOM   3462  O O   . ASN A 1 479 ? 37.644  19.543  2.020   1.00 10.63 ? 479  ASN A O   1 
ATOM   3463  C CB  . ASN A 1 479 ? 40.469  19.553  0.423   1.00 12.41 ? 479  ASN A CB  1 
ATOM   3464  C CG  . ASN A 1 479 ? 41.045  20.082  -0.863  1.00 11.19 ? 479  ASN A CG  1 
ATOM   3465  O OD1 . ASN A 1 479 ? 40.394  20.056  -1.908  1.00 13.34 ? 479  ASN A OD1 1 
ATOM   3466  N ND2 . ASN A 1 479 ? 42.286  20.538  -0.804  1.00 14.64 ? 479  ASN A ND2 1 
ATOM   3467  N N   . PHE A 1 480 ? 39.431  19.622  3.392   1.00 11.28 ? 480  PHE A N   1 
ATOM   3468  C CA  . PHE A 1 480 ? 38.813  18.930  4.531   1.00 11.49 ? 480  PHE A CA  1 
ATOM   3469  C C   . PHE A 1 480 ? 37.532  19.626  5.005   1.00 11.94 ? 480  PHE A C   1 
ATOM   3470  O O   . PHE A 1 480 ? 36.496  18.979  5.177   1.00 13.58 ? 480  PHE A O   1 
ATOM   3471  C CB  . PHE A 1 480 ? 39.845  18.805  5.671   1.00 11.05 ? 480  PHE A CB  1 
ATOM   3472  C CG  . PHE A 1 480 ? 39.337  18.115  6.915   1.00 12.14 ? 480  PHE A CG  1 
ATOM   3473  C CD1 . PHE A 1 480 ? 39.184  16.726  6.952   1.00 12.23 ? 480  PHE A CD1 1 
ATOM   3474  C CD2 . PHE A 1 480 ? 39.039  18.856  8.070   1.00 13.23 ? 480  PHE A CD2 1 
ATOM   3475  C CE1 . PHE A 1 480 ? 38.749  16.076  8.117   1.00 13.24 ? 480  PHE A CE1 1 
ATOM   3476  C CE2 . PHE A 1 480 ? 38.596  18.221  9.258   1.00 13.99 ? 480  PHE A CE2 1 
ATOM   3477  C CZ  . PHE A 1 480 ? 38.452  16.821  9.278   1.00 13.75 ? 480  PHE A CZ  1 
ATOM   3478  N N   . PHE A 1 481 ? 37.608  20.944  5.178   1.00 11.08 ? 481  PHE A N   1 
ATOM   3479  C CA  . PHE A 1 481 ? 36.464  21.736  5.625   1.00 11.02 ? 481  PHE A CA  1 
ATOM   3480  C C   . PHE A 1 481 ? 35.443  21.960  4.518   1.00 10.35 ? 481  PHE A C   1 
ATOM   3481  O O   . PHE A 1 481 ? 34.236  21.902  4.761   1.00 12.16 ? 481  PHE A O   1 
ATOM   3482  C CB  . PHE A 1 481 ? 36.934  23.084  6.190   1.00 12.28 ? 481  PHE A CB  1 
ATOM   3483  C CG  . PHE A 1 481 ? 37.886  22.958  7.346   1.00 12.49 ? 481  PHE A CG  1 
ATOM   3484  C CD1 . PHE A 1 481 ? 37.535  22.212  8.488   1.00 12.36 ? 481  PHE A CD1 1 
ATOM   3485  C CD2 . PHE A 1 481 ? 39.160  23.556  7.289   1.00 12.88 ? 481  PHE A CD2 1 
ATOM   3486  C CE1 . PHE A 1 481 ? 38.444  22.051  9.567   1.00 12.78 ? 481  PHE A CE1 1 
ATOM   3487  C CE2 . PHE A 1 481 ? 40.082  23.406  8.357   1.00 13.23 ? 481  PHE A CE2 1 
ATOM   3488  C CZ  . PHE A 1 481 ? 39.719  22.648  9.499   1.00 12.62 ? 481  PHE A CZ  1 
ATOM   3489  N N   . ALA A 1 482 ? 35.944  22.153  3.299   1.00 11.62 ? 482  ALA A N   1 
ATOM   3490  C CA  . ALA A 1 482 ? 35.110  22.400  2.125   1.00 10.70 ? 482  ALA A CA  1 
ATOM   3491  C C   . ALA A 1 482 ? 34.219  21.259  1.703   1.00 11.30 ? 482  ALA A C   1 
ATOM   3492  O O   . ALA A 1 482 ? 33.088  21.486  1.292   1.00 11.98 ? 482  ALA A O   1 
ATOM   3493  C CB  . ALA A 1 482 ? 35.953  22.778  0.979   1.00 11.59 ? 482  ALA A CB  1 
ATOM   3494  N N   . GLN A 1 483 ? 34.741  20.039  1.784   1.00 12.33 ? 483  GLN A N   1 
ATOM   3495  C CA  . GLN A 1 483 ? 33.984  18.863  1.378   1.00 10.84 ? 483  GLN A CA  1 
ATOM   3496  C C   . GLN A 1 483 ? 32.752  18.586  2.217   1.00 11.33 ? 483  GLN A C   1 
ATOM   3497  O O   . GLN A 1 483 ? 31.690  18.308  1.665   1.00 9.98  ? 483  GLN A O   1 
ATOM   3498  C CB  . GLN A 1 483 ? 34.889  17.637  1.293   1.00 11.82 ? 483  GLN A CB  1 
ATOM   3499  C CG  . GLN A 1 483 ? 35.841  17.657  0.102   1.00 11.27 ? 483  GLN A CG  1 
ATOM   3500  C CD  . GLN A 1 483 ? 35.145  17.540  -1.247  1.00 11.75 ? 483  GLN A CD  1 
ATOM   3501  O OE1 . GLN A 1 483 ? 34.061  16.954  -1.364  1.00 12.53 ? 483  GLN A OE1 1 
ATOM   3502  N NE2 . GLN A 1 483 ? 35.777  18.083  -2.278  1.00 13.28 ? 483  GLN A NE2 1 
ATOM   3503  N N   . THR A 1 484 ? 32.875  18.749  3.535   1.00 10.99 ? 484  THR A N   1 
ATOM   3504  C CA  . THR A 1 484 ? 31.746  18.537  4.441   1.00 11.80 ? 484  THR A CA  1 
ATOM   3505  C C   . THR A 1 484 ? 30.725  19.661  4.260   1.00 11.38 ? 484  THR A C   1 
ATOM   3506  O O   . THR A 1 484 ? 29.516  19.413  4.278   1.00 12.61 ? 484  THR A O   1 
ATOM   3507  C CB  . THR A 1 484 ? 32.178  18.440  5.919   1.00 11.81 ? 484  THR A CB  1 
ATOM   3508  O OG1 . THR A 1 484 ? 32.895  19.613  6.308   1.00 12.63 ? 484  THR A OG1 1 
ATOM   3509  C CG2 . THR A 1 484 ? 33.045  17.243  6.145   1.00 12.14 ? 484  THR A CG2 1 
ATOM   3510  N N   . GLU A 1 485 ? 31.224  20.880  4.018   1.00 11.70 ? 485  GLU A N   1 
ATOM   3511  C CA  . GLU A 1 485 ? 30.371  22.048  3.779   1.00 11.90 ? 485  GLU A CA  1 
ATOM   3512  C C   . GLU A 1 485 ? 29.600  21.835  2.467   1.00 11.16 ? 485  GLU A C   1 
ATOM   3513  O O   . GLU A 1 485 ? 28.384  22.020  2.425   1.00 10.34 ? 485  GLU A O   1 
ATOM   3514  C CB  . GLU A 1 485 ? 31.209  23.339  3.695   1.00 12.37 ? 485  GLU A CB  1 
ATOM   3515  C CG  . GLU A 1 485 ? 30.369  24.625  3.533   1.00 14.33 ? 485  GLU A CG  1 
ATOM   3516  C CD  . GLU A 1 485 ? 31.180  25.873  3.190   1.00 16.94 ? 485  GLU A CD  1 
ATOM   3517  O OE1 . GLU A 1 485 ? 32.337  25.759  2.725   1.00 16.73 ? 485  GLU A OE1 1 
ATOM   3518  O OE2 . GLU A 1 485 ? 30.635  26.983  3.367   1.00 16.56 ? 485  GLU A OE2 1 
ATOM   3519  N N   . ALA A 1 486 ? 30.313  21.359  1.442   1.00 11.53 ? 486  ALA A N   1 
ATOM   3520  C CA  . ALA A 1 486 ? 29.753  21.083  0.114   1.00 12.09 ? 486  ALA A CA  1 
ATOM   3521  C C   . ALA A 1 486 ? 28.665  20.026  0.140   1.00 12.51 ? 486  ALA A C   1 
ATOM   3522  O O   . ALA A 1 486 ? 27.607  20.197  -0.471  1.00 12.44 ? 486  ALA A O   1 
ATOM   3523  C CB  . ALA A 1 486 ? 30.854  20.666  -0.840  1.00 13.20 ? 486  ALA A CB  1 
ATOM   3524  N N   . LEU A 1 487 ? 28.919  18.958  0.896   1.00 12.34 ? 487  LEU A N   1 
ATOM   3525  C CA  . LEU A 1 487 ? 27.973  17.856  1.051   1.00 11.40 ? 487  LEU A CA  1 
ATOM   3526  C C   . LEU A 1 487 ? 26.682  18.325  1.717   1.00 11.75 ? 487  LEU A C   1 
ATOM   3527  O O   . LEU A 1 487 ? 25.590  17.938  1.313   1.00 11.22 ? 487  LEU A O   1 
ATOM   3528  C CB  . LEU A 1 487 ? 28.597  16.733  1.888   1.00 12.19 ? 487  LEU A CB  1 
ATOM   3529  C CG  . LEU A 1 487 ? 29.636  15.818  1.232   1.00 13.05 ? 487  LEU A CG  1 
ATOM   3530  C CD1 . LEU A 1 487 ? 30.289  14.944  2.281   1.00 14.28 ? 487  LEU A CD1 1 
ATOM   3531  C CD2 . LEU A 1 487 ? 29.009  14.977  0.145   1.00 11.75 ? 487  LEU A CD2 1 
ATOM   3532  N N   . MET A 1 488 ? 26.828  19.247  2.664   1.00 11.66 ? 488  MET A N   1 
ATOM   3533  C CA  . MET A 1 488 ? 25.703  19.785  3.413   1.00 13.65 ? 488  MET A CA  1 
ATOM   3534  C C   . MET A 1 488 ? 24.867  20.830  2.667   1.00 13.14 ? 488  MET A C   1 
ATOM   3535  O O   . MET A 1 488 ? 23.654  20.660  2.519   1.00 13.76 ? 488  MET A O   1 
ATOM   3536  C CB  . MET A 1 488 ? 26.222  20.364  4.732   1.00 15.72 ? 488  MET A CB  1 
ATOM   3537  C CG  . MET A 1 488 ? 25.184  20.576  5.811   1.00 19.20 ? 488  MET A CG  1 
ATOM   3538  S SD  . MET A 1 488 ? 24.216  22.084  5.639   1.00 20.86 ? 488  MET A SD  1 
ATOM   3539  C CE  . MET A 1 488 ? 25.255  23.190  6.488   1.00 20.79 ? 488  MET A CE  1 
ATOM   3540  N N   . ILE A 1 489 ? 25.513  21.904  2.208   1.00 14.06 ? 489  ILE A N   1 
ATOM   3541  C CA  . ILE A 1 489 ? 24.802  22.997  1.542   1.00 13.99 ? 489  ILE A CA  1 
ATOM   3542  C C   . ILE A 1 489 ? 24.395  22.804  0.088   1.00 14.93 ? 489  ILE A C   1 
ATOM   3543  O O   . ILE A 1 489 ? 23.357  23.314  -0.335  1.00 15.34 ? 489  ILE A O   1 
ATOM   3544  C CB  . ILE A 1 489 ? 25.530  24.387  1.701   1.00 13.92 ? 489  ILE A CB  1 
ATOM   3545  C CG1 . ILE A 1 489 ? 26.837  24.443  0.891   1.00 14.92 ? 489  ILE A CG1 1 
ATOM   3546  C CG2 . ILE A 1 489 ? 25.788  24.672  3.171   1.00 15.55 ? 489  ILE A CG2 1 
ATOM   3547  C CD1 . ILE A 1 489 ? 27.476  25.825  0.815   1.00 14.85 ? 489  ILE A CD1 1 
ATOM   3548  N N   . GLY A 1 490 ? 25.224  22.088  -0.672  1.00 13.78 ? 490  GLY A N   1 
ATOM   3549  C CA  . GLY A 1 490 ? 24.957  21.872  -2.085  1.00 15.23 ? 490  GLY A CA  1 
ATOM   3550  C C   . GLY A 1 490 ? 24.989  23.162  -2.896  1.00 16.47 ? 490  GLY A C   1 
ATOM   3551  O O   . GLY A 1 490 ? 25.642  24.129  -2.504  1.00 16.82 ? 490  GLY A O   1 
ATOM   3552  N N   . LYS A 1 491 ? 24.303  23.149  -4.037  1.00 18.30 ? 491  LYS A N   1 
ATOM   3553  C CA  . LYS A 1 491 ? 24.194  24.306  -4.927  1.00 20.04 ? 491  LYS A CA  1 
ATOM   3554  C C   . LYS A 1 491 ? 22.883  24.117  -5.688  1.00 21.22 ? 491  LYS A C   1 
ATOM   3555  O O   . LYS A 1 491 ? 22.759  23.220  -6.528  1.00 19.91 ? 491  LYS A O   1 
ATOM   3556  C CB  . LYS A 1 491 ? 25.403  24.405  -5.880  1.00 22.11 ? 491  LYS A CB  1 
ATOM   3557  C CG  . LYS A 1 491 ? 25.689  25.842  -6.336  1.00 24.82 ? 491  LYS A CG  1 
ATOM   3558  C CD  . LYS A 1 491 ? 27.052  26.031  -6.992  1.00 28.26 ? 491  LYS A CD  1 
ATOM   3559  C CE  . LYS A 1 491 ? 27.086  25.529  -8.418  1.00 30.82 ? 491  LYS A CE  1 
ATOM   3560  N NZ  . LYS A 1 491 ? 28.309  25.977  -9.146  1.00 33.68 ? 491  LYS A NZ  1 
ATOM   3561  N N   . SER A 1 492 ? 21.897  24.943  -5.337  1.00 23.25 ? 492  SER A N   1 
ATOM   3562  C CA  . SER A 1 492 ? 20.544  24.912  -5.908  1.00 25.56 ? 492  SER A CA  1 
ATOM   3563  C C   . SER A 1 492 ? 20.474  25.374  -7.377  1.00 27.23 ? 492  SER A C   1 
ATOM   3564  O O   . SER A 1 492 ? 21.417  26.015  -7.858  1.00 25.25 ? 492  SER A O   1 
ATOM   3565  C CB  . SER A 1 492 ? 19.616  25.773  -5.025  1.00 27.27 ? 492  SER A CB  1 
ATOM   3566  O OG  . SER A 1 492 ? 19.674  27.145  -5.373  1.00 29.74 ? 492  SER A OG  1 
ATOM   3567  N N   . PRO A 1 493 ? 19.385  25.021  -8.119  1.00 28.43 ? 493  PRO A N   1 
ATOM   3568  C CA  . PRO A 1 493 ? 19.251  25.441  -9.522  1.00 30.20 ? 493  PRO A CA  1 
ATOM   3569  C C   . PRO A 1 493 ? 19.365  26.954  -9.742  1.00 31.29 ? 493  PRO A C   1 
ATOM   3570  O O   . PRO A 1 493 ? 19.957  27.401  -10.730 1.00 31.72 ? 493  PRO A O   1 
ATOM   3571  C CB  . PRO A 1 493 ? 17.855  24.942  -9.882  1.00 29.70 ? 493  PRO A CB  1 
ATOM   3572  C CG  . PRO A 1 493 ? 17.785  23.667  -9.167  1.00 29.50 ? 493  PRO A CG  1 
ATOM   3573  C CD  . PRO A 1 493 ? 18.318  24.041  -7.805  1.00 29.38 ? 493  PRO A CD  1 
ATOM   3574  N N   . SER A 1 494 ? 18.852  27.718  -8.772  1.00 32.23 ? 494  SER A N   1 
ATOM   3575  C CA  . SER A 1 494 ? 18.880  29.183  -8.793  1.00 33.14 ? 494  SER A CA  1 
ATOM   3576  C C   . SER A 1 494 ? 20.288  29.744  -8.610  1.00 32.37 ? 494  SER A C   1 
ATOM   3577  O O   . SER A 1 494 ? 20.646  30.734  -9.250  1.00 33.08 ? 494  SER A O   1 
ATOM   3578  C CB  . SER A 1 494 ? 17.953  29.754  -7.717  1.00 34.18 ? 494  SER A CB  1 
ATOM   3579  O OG  . SER A 1 494 ? 16.590  29.621  -8.092  1.00 37.44 ? 494  SER A OG  1 
ATOM   3580  N N   . GLU A 1 495 ? 21.087  29.082  -7.765  1.00 31.55 ? 495  GLU A N   1 
ATOM   3581  C CA  . GLU A 1 495 ? 22.476  29.479  -7.485  1.00 30.98 ? 495  GLU A CA  1 
ATOM   3582  C C   . GLU A 1 495 ? 23.383  29.269  -8.700  1.00 29.76 ? 495  GLU A C   1 
ATOM   3583  O O   . GLU A 1 495 ? 24.291  30.064  -8.943  1.00 28.98 ? 495  GLU A O   1 
ATOM   3584  C CB  . GLU A 1 495 ? 23.042  28.684  -6.305  1.00 31.98 ? 495  GLU A CB  1 
ATOM   3585  C CG  . GLU A 1 495 ? 22.489  29.035  -4.938  1.00 33.53 ? 495  GLU A CG  1 
ATOM   3586  C CD  . GLU A 1 495 ? 23.101  28.180  -3.838  1.00 35.18 ? 495  GLU A CD  1 
ATOM   3587  O OE1 . GLU A 1 495 ? 24.227  28.500  -3.394  1.00 36.36 ? 495  GLU A OE1 1 
ATOM   3588  O OE2 . GLU A 1 495 ? 22.467  27.184  -3.423  1.00 34.46 ? 495  GLU A OE2 1 
ATOM   3589  N N   . VAL A 1 496 ? 23.122  28.193  -9.450  1.00 29.49 ? 496  VAL A N   1 
ATOM   3590  C CA  . VAL A 1 496 ? 23.877  27.848  -10.659 1.00 29.34 ? 496  VAL A CA  1 
ATOM   3591  C C   . VAL A 1 496 ? 23.593  28.888  -11.757 1.00 30.30 ? 496  VAL A C   1 
ATOM   3592  O O   . VAL A 1 496 ? 24.507  29.301  -12.471 1.00 30.38 ? 496  VAL A O   1 
ATOM   3593  C CB  . VAL A 1 496 ? 23.510  26.427  -11.182 1.00 28.62 ? 496  VAL A CB  1 
ATOM   3594  C CG1 . VAL A 1 496 ? 24.357  26.061  -12.411 1.00 28.44 ? 496  VAL A CG1 1 
ATOM   3595  C CG2 . VAL A 1 496 ? 23.688  25.371  -10.108 1.00 28.35 ? 496  VAL A CG2 1 
ATOM   3596  N N   . ARG A 1 497 ? 22.334  29.329  -11.841 1.00 31.97 ? 497  ARG A N   1 
ATOM   3597  C CA  . ARG A 1 497 ? 21.901  30.331  -12.821 1.00 33.34 ? 497  ARG A CA  1 
ATOM   3598  C C   . ARG A 1 497 ? 22.535  31.694  -12.521 1.00 34.24 ? 497  ARG A C   1 
ATOM   3599  O O   . ARG A 1 497 ? 22.971  32.383  -13.444 1.00 34.93 ? 497  ARG A O   1 
ATOM   3600  C CB  . ARG A 1 497 ? 20.368  30.437  -12.845 1.00 33.35 ? 497  ARG A CB  1 
ATOM   3601  C CG  . ARG A 1 497 ? 19.809  31.235  -14.032 1.00 34.90 ? 497  ARG A CG  1 
ATOM   3602  C CD  . ARG A 1 497 ? 18.284  31.228  -14.084 1.00 35.69 ? 497  ARG A CD  1 
ATOM   3603  N NE  . ARG A 1 497 ? 17.716  29.911  -14.372 1.00 37.25 ? 497  ARG A NE  1 
ATOM   3604  C CZ  . ARG A 1 497 ? 17.729  29.313  -15.566 1.00 37.59 ? 497  ARG A CZ  1 
ATOM   3605  N NH1 . ARG A 1 497 ? 18.292  29.903  -16.618 1.00 38.50 ? 497  ARG A NH1 1 
ATOM   3606  N NH2 . ARG A 1 497 ? 17.156  28.129  -15.713 1.00 37.87 ? 497  ARG A NH2 1 
ATOM   3607  N N   . ARG A 1 498 ? 22.635  32.039  -11.233 1.00 35.15 ? 498  ARG A N   1 
ATOM   3608  C CA  . ARG A 1 498 ? 23.236  33.306  -10.792 1.00 36.13 ? 498  ARG A CA  1 
ATOM   3609  C C   . ARG A 1 498 ? 24.741  33.339  -11.038 1.00 35.81 ? 498  ARG A C   1 
ATOM   3610  O O   . ARG A 1 498 ? 25.278  34.374  -11.427 1.00 36.33 ? 498  ARG A O   1 
ATOM   3611  C CB  . ARG A 1 498 ? 22.985  33.563  -9.301  1.00 37.35 ? 498  ARG A CB  1 
ATOM   3612  C CG  . ARG A 1 498 ? 21.549  33.876  -8.913  1.00 39.49 ? 498  ARG A CG  1 
ATOM   3613  C CD  . ARG A 1 498 ? 21.476  34.554  -7.540  1.00 41.25 ? 498  ARG A CD  1 
ATOM   3614  N NE  . ARG A 1 498 ? 22.230  33.847  -6.500  1.00 43.15 ? 498  ARG A NE  1 
ATOM   3615  C CZ  . ARG A 1 498 ? 21.701  33.030  -5.589  1.00 43.70 ? 498  ARG A CZ  1 
ATOM   3616  N NH1 . ARG A 1 498 ? 20.395  32.794  -5.565  1.00 44.52 ? 498  ARG A NH1 1 
ATOM   3617  N NH2 . ARG A 1 498 ? 22.489  32.445  -4.697  1.00 44.44 ? 498  ARG A NH2 1 
ATOM   3618  N N   . GLU A 1 499 ? 25.400  32.192  -10.839 1.00 35.40 ? 499  GLU A N   1 
ATOM   3619  C CA  . GLU A 1 499 ? 26.848  32.048  -11.022 1.00 35.44 ? 499  GLU A CA  1 
ATOM   3620  C C   . GLU A 1 499 ? 27.263  32.156  -12.492 1.00 34.97 ? 499  GLU A C   1 
ATOM   3621  O O   . GLU A 1 499 ? 28.286  32.772  -12.806 1.00 34.56 ? 499  GLU A O   1 
ATOM   3622  C CB  . GLU A 1 499 ? 27.334  30.714  -10.438 1.00 36.41 ? 499  GLU A CB  1 
ATOM   3623  C CG  . GLU A 1 499 ? 28.861  30.536  -10.423 1.00 38.22 ? 499  GLU A CG  1 
ATOM   3624  C CD  . GLU A 1 499 ? 29.309  29.194  -9.863  1.00 39.34 ? 499  GLU A CD  1 
ATOM   3625  O OE1 . GLU A 1 499 ? 28.520  28.544  -9.141  1.00 39.49 ? 499  GLU A OE1 1 
ATOM   3626  O OE2 . GLU A 1 499 ? 30.463  28.798  -10.137 1.00 40.11 ? 499  GLU A OE2 1 
ATOM   3627  N N   . LEU A 1 500 ? 26.457  31.568  -13.377 1.00 34.23 ? 500  LEU A N   1 
ATOM   3628  C CA  . LEU A 1 500 ? 26.725  31.598  -14.820 1.00 34.37 ? 500  LEU A CA  1 
ATOM   3629  C C   . LEU A 1 500 ? 26.421  32.964  -15.440 1.00 34.87 ? 500  LEU A C   1 
ATOM   3630  O O   . LEU A 1 500 ? 27.139  33.438  -16.325 1.00 34.89 ? 500  LEU A O   1 
ATOM   3631  C CB  . LEU A 1 500 ? 25.934  30.493  -15.541 1.00 32.97 ? 500  LEU A CB  1 
ATOM   3632  C CG  . LEU A 1 500 ? 26.441  29.059  -15.291 1.00 32.02 ? 500  LEU A CG  1 
ATOM   3633  C CD1 . LEU A 1 500 ? 25.394  28.010  -15.651 1.00 31.69 ? 500  LEU A CD1 1 
ATOM   3634  C CD2 . LEU A 1 500 ? 27.686  28.735  -16.099 1.00 32.44 ? 500  LEU A CD2 1 
ATOM   3635  N N   . GLU A 1 501 ? 25.364  33.611  -14.950 1.00 35.98 ? 501  GLU A N   1 
ATOM   3636  C CA  . GLU A 1 501 ? 24.954  34.923  -15.463 1.00 37.15 ? 501  GLU A CA  1 
ATOM   3637  C C   . GLU A 1 501 ? 25.839  36.050  -14.933 1.00 38.02 ? 501  GLU A C   1 
ATOM   3638  O O   . GLU A 1 501 ? 25.887  37.152  -15.495 1.00 38.76 ? 501  GLU A O   1 
ATOM   3639  C CB  . GLU A 1 501 ? 23.494  35.187  -15.095 1.00 38.05 ? 501  GLU A CB  1 
ATOM   3640  C CG  . GLU A 1 501 ? 22.501  34.515  -16.042 1.00 39.75 ? 501  GLU A CG  1 
ATOM   3641  C CD  . GLU A 1 501 ? 21.039  34.572  -15.555 1.00 40.81 ? 501  GLU A CD  1 
ATOM   3642  O OE1 . GLU A 1 501 ? 20.780  35.105  -14.437 1.00 41.76 ? 501  GLU A OE1 1 
ATOM   3643  O OE2 . GLU A 1 501 ? 20.127  34.076  -16.285 1.00 42.10 ? 501  GLU A OE2 1 
ATOM   3644  N N   . ALA A 1 502 ? 26.549  35.758  -13.840 1.00 38.18 ? 502  ALA A N   1 
ATOM   3645  C CA  . ALA A 1 502 ? 27.452  36.724  -13.192 1.00 38.68 ? 502  ALA A CA  1 
ATOM   3646  C C   . ALA A 1 502 ? 28.849  36.673  -13.803 1.00 38.90 ? 502  ALA A C   1 
ATOM   3647  O O   . ALA A 1 502 ? 29.640  37.624  -13.686 1.00 39.69 ? 502  ALA A O   1 
ATOM   3648  C CB  . ALA A 1 502 ? 27.540  36.438  -11.697 1.00 38.60 ? 502  ALA A CB  1 
ATOM   3649  N N   . ALA A 1 503 ? 29.152  35.539  -14.443 1.00 38.82 ? 503  ALA A N   1 
ATOM   3650  C CA  . ALA A 1 503 ? 30.442  35.294  -15.105 1.00 39.21 ? 503  ALA A CA  1 
ATOM   3651  C C   . ALA A 1 503 ? 30.407  35.841  -16.538 1.00 39.74 ? 503  ALA A C   1 
ATOM   3652  O O   . ALA A 1 503 ? 31.436  35.866  -17.239 1.00 40.43 ? 503  ALA A O   1 
ATOM   3653  C CB  . ALA A 1 503 ? 30.769  33.806  -15.106 1.00 39.14 ? 503  ALA A CB  1 
ATOM   3654  N N   . GLY A 1 504 ? 29.190  36.237  -16.953 1.00 40.04 ? 504  GLY A N   1 
ATOM   3655  C CA  . GLY A 1 504 ? 28.915  36.864  -18.247 1.00 40.19 ? 504  GLY A CA  1 
ATOM   3656  C C   . GLY A 1 504 ? 28.274  35.975  -19.320 1.00 39.98 ? 504  GLY A C   1 
ATOM   3657  O O   . GLY A 1 504 ? 28.460  36.176  -20.524 1.00 40.27 ? 504  GLY A O   1 
ATOM   3658  N N   . GLU A 1 505 ? 27.476  34.990  -18.922 1.00 39.55 ? 505  GLU A N   1 
ATOM   3659  C CA  . GLU A 1 505 ? 26.877  34.089  -19.916 1.00 38.76 ? 505  GLU A CA  1 
ATOM   3660  C C   . GLU A 1 505 ? 25.471  34.495  -20.268 1.00 38.28 ? 505  GLU A C   1 
ATOM   3661  O O   . GLU A 1 505 ? 24.525  34.327  -19.482 1.00 38.48 ? 505  GLU A O   1 
ATOM   3662  C CB  . GLU A 1 505 ? 26.877  32.652  -19.434 1.00 39.01 ? 505  GLU A CB  1 
ATOM   3663  C CG  . GLU A 1 505 ? 26.167  31.698  -20.399 1.00 39.00 ? 505  GLU A CG  1 
ATOM   3664  C CD  . GLU A 1 505 ? 26.996  31.360  -21.656 1.00 39.24 ? 505  GLU A CD  1 
ATOM   3665  O OE1 . GLU A 1 505 ? 28.023  30.629  -21.531 1.00 40.50 ? 505  GLU A OE1 1 
ATOM   3666  O OE2 . GLU A 1 505 ? 26.633  31.805  -22.782 1.00 39.13 ? 505  GLU A OE2 1 
ATOM   3667  N N   . ARG A 1 506 ? 25.358  34.985  -21.495 1.00 37.52 ? 506  ARG A N   1 
ATOM   3668  C CA  . ARG A 1 506 ? 24.120  35.483  -22.045 1.00 36.97 ? 506  ARG A CA  1 
ATOM   3669  C C   . ARG A 1 506 ? 23.351  34.421  -22.823 1.00 35.49 ? 506  ARG A C   1 
ATOM   3670  O O   . ARG A 1 506 ? 22.232  34.665  -23.283 1.00 35.42 ? 506  ARG A O   1 
ATOM   3671  C CB  . ARG A 1 506 ? 24.439  36.675  -22.948 1.00 37.89 ? 506  ARG A CB  1 
ATOM   3672  C CG  . ARG A 1 506 ? 25.164  37.809  -22.220 1.00 39.31 ? 506  ARG A CG  1 
ATOM   3673  C CD  . ARG A 1 506 ? 24.324  38.415  -21.090 1.00 41.15 ? 506  ARG A CD  1 
ATOM   3674  N NE  . ARG A 1 506 ? 23.166  39.177  -21.584 1.00 43.03 ? 506  ARG A NE  1 
ATOM   3675  C CZ  . ARG A 1 506 ? 21.994  39.285  -20.930 1.00 43.42 ? 506  ARG A CZ  1 
ATOM   3676  N NH1 . ARG A 1 506 ? 21.816  38.689  -19.762 1.00 44.07 ? 506  ARG A NH1 1 
ATOM   3677  N NH2 . ARG A 1 506 ? 20.970  39.986  -21.416 1.00 44.45 ? 506  ARG A NH2 1 
ATOM   3678  N N   . SER A 1 507 ? 23.943  33.236  -22.969 1.00 34.05 ? 507  SER A N   1 
ATOM   3679  C CA  . SER A 1 507 ? 23.301  32.134  -23.700 1.00 32.11 ? 507  SER A CA  1 
ATOM   3680  C C   . SER A 1 507 ? 22.372  31.340  -22.787 1.00 31.32 ? 507  SER A C   1 
ATOM   3681  O O   . SER A 1 507 ? 22.842  30.539  -21.966 1.00 30.90 ? 507  SER A O   1 
ATOM   3682  C CB  . SER A 1 507 ? 24.342  31.185  -24.290 1.00 31.42 ? 507  SER A CB  1 
ATOM   3683  O OG  . SER A 1 507 ? 23.721  30.053  -24.876 1.00 30.51 ? 507  SER A OG  1 
ATOM   3684  N N   . ALA A 1 508 ? 21.063  31.536  -22.963 1.00 29.88 ? 508  ALA A N   1 
ATOM   3685  C CA  . ALA A 1 508 ? 20.028  30.853  -22.182 1.00 29.29 ? 508  ALA A CA  1 
ATOM   3686  C C   . ALA A 1 508 ? 20.006  29.347  -22.446 1.00 28.31 ? 508  ALA A C   1 
ATOM   3687  O O   . ALA A 1 508 ? 19.609  28.566  -21.579 1.00 27.76 ? 508  ALA A O   1 
ATOM   3688  C CB  . ALA A 1 508 ? 18.664  31.455  -22.474 1.00 29.26 ? 508  ALA A CB  1 
ATOM   3689  N N   . GLU A 1 509 ? 20.480  28.958  -23.632 1.00 27.71 ? 509  GLU A N   1 
ATOM   3690  C CA  . GLU A 1 509 ? 20.555  27.559  -24.053 1.00 27.34 ? 509  GLU A CA  1 
ATOM   3691  C C   . GLU A 1 509 ? 21.623  26.803  -23.259 1.00 27.00 ? 509  GLU A C   1 
ATOM   3692  O O   . GLU A 1 509 ? 21.357  25.712  -22.748 1.00 25.64 ? 509  GLU A O   1 
ATOM   3693  C CB  . GLU A 1 509 ? 20.876  27.478  -25.551 1.00 28.42 ? 509  GLU A CB  1 
ATOM   3694  C CG  . GLU A 1 509 ? 21.028  26.054  -26.101 1.00 30.07 ? 509  GLU A CG  1 
ATOM   3695  C CD  . GLU A 1 509 ? 21.342  26.018  -27.581 1.00 30.62 ? 509  GLU A CD  1 
ATOM   3696  O OE1 . GLU A 1 509 ? 21.441  27.089  -28.212 1.00 33.15 ? 509  GLU A OE1 1 
ATOM   3697  O OE2 . GLU A 1 509 ? 21.459  24.902  -28.127 1.00 32.23 ? 509  GLU A OE2 1 
ATOM   3698  N N   . LYS A 1 510 ? 22.814  27.398  -23.154 1.00 26.50 ? 510  LYS A N   1 
ATOM   3699  C CA  . LYS A 1 510 ? 23.939  26.796  -22.431 1.00 27.10 ? 510  LYS A CA  1 
ATOM   3700  C C   . LYS A 1 510 ? 23.661  26.735  -20.925 1.00 26.31 ? 510  LYS A C   1 
ATOM   3701  O O   . LYS A 1 510 ? 24.018  25.751  -20.272 1.00 25.96 ? 510  LYS A O   1 
ATOM   3702  C CB  . LYS A 1 510 ? 25.242  27.558  -22.708 1.00 29.38 ? 510  LYS A CB  1 
ATOM   3703  C CG  . LYS A 1 510 ? 26.511  26.754  -22.382 1.00 32.50 ? 510  LYS A CG  1 
ATOM   3704  C CD  . LYS A 1 510 ? 27.804  27.550  -22.552 1.00 35.46 ? 510  LYS A CD  1 
ATOM   3705  C CE  . LYS A 1 510 ? 28.178  27.763  -24.015 1.00 37.28 ? 510  LYS A CE  1 
ATOM   3706  N NZ  . LYS A 1 510 ? 29.479  28.483  -24.149 1.00 39.30 ? 510  LYS A NZ  1 
ATOM   3707  N N   . ILE A 1 511 ? 22.972  27.755  -20.403 1.00 25.16 ? 511  ILE A N   1 
ATOM   3708  C CA  . ILE A 1 511 ? 22.607  27.819  -18.984 1.00 24.74 ? 511  ILE A CA  1 
ATOM   3709  C C   . ILE A 1 511 ? 21.631  26.691  -18.655 1.00 24.58 ? 511  ILE A C   1 
ATOM   3710  O O   . ILE A 1 511 ? 21.896  25.909  -17.746 1.00 23.52 ? 511  ILE A O   1 
ATOM   3711  C CB  . ILE A 1 511 ? 21.996  29.208  -18.588 1.00 25.13 ? 511  ILE A CB  1 
ATOM   3712  C CG1 . ILE A 1 511 ? 23.088  30.278  -18.596 1.00 26.16 ? 511  ILE A CG1 1 
ATOM   3713  C CG2 . ILE A 1 511 ? 21.352  29.158  -17.184 1.00 25.02 ? 511  ILE A CG2 1 
ATOM   3714  C CD1 . ILE A 1 511 ? 22.615  31.663  -18.197 1.00 28.37 ? 511  ILE A CD1 1 
ATOM   3715  N N   . ASN A 1 512 ? 20.565  26.561  -19.452 1.00 23.76 ? 512  ASN A N   1 
ATOM   3716  C CA  . ASN A 1 512 ? 19.542  25.525  -19.261 1.00 24.10 ? 512  ASN A CA  1 
ATOM   3717  C C   . ASN A 1 512 ? 20.051  24.097  -19.481 1.00 24.07 ? 512  ASN A C   1 
ATOM   3718  O O   . ASN A 1 512 ? 19.577  23.162  -18.826 1.00 24.75 ? 512  ASN A O   1 
ATOM   3719  C CB  . ASN A 1 512 ? 18.323  25.777  -20.163 1.00 24.81 ? 512  ASN A CB  1 
ATOM   3720  C CG  . ASN A 1 512 ? 17.492  26.985  -19.728 1.00 26.24 ? 512  ASN A CG  1 
ATOM   3721  O OD1 . ASN A 1 512 ? 17.508  27.396  -18.561 1.00 26.47 ? 512  ASN A OD1 1 
ATOM   3722  N ND2 . ASN A 1 512 ? 16.751  27.551  -20.672 1.00 25.51 ? 512  ASN A ND2 1 
ATOM   3723  N N   . ALA A 1 513 ? 21.028  23.947  -20.380 1.00 23.52 ? 513  ALA A N   1 
ATOM   3724  C CA  . ALA A 1 513 ? 21.618  22.641  -20.703 1.00 23.80 ? 513  ALA A CA  1 
ATOM   3725  C C   . ALA A 1 513 ? 22.577  22.133  -19.626 1.00 24.60 ? 513  ALA A C   1 
ATOM   3726  O O   . ALA A 1 513 ? 22.574  20.941  -19.302 1.00 25.08 ? 513  ALA A O   1 
ATOM   3727  C CB  . ALA A 1 513 ? 22.324  22.701  -22.048 1.00 24.02 ? 513  ALA A CB  1 
ATOM   3728  N N   . LEU A 1 514 ? 23.391  23.037  -19.080 1.00 24.28 ? 514  LEU A N   1 
ATOM   3729  C CA  . LEU A 1 514 ? 24.366  22.697  -18.032 1.00 24.25 ? 514  LEU A CA  1 
ATOM   3730  C C   . LEU A 1 514 ? 23.786  22.756  -16.620 1.00 23.56 ? 514  LEU A C   1 
ATOM   3731  O O   . LEU A 1 514 ? 24.370  22.210  -15.676 1.00 21.86 ? 514  LEU A O   1 
ATOM   3732  C CB  . LEU A 1 514 ? 25.579  23.638  -18.101 1.00 26.71 ? 514  LEU A CB  1 
ATOM   3733  C CG  . LEU A 1 514 ? 26.560  23.539  -19.284 1.00 28.33 ? 514  LEU A CG  1 
ATOM   3734  C CD1 . LEU A 1 514 ? 27.549  24.696  -19.262 1.00 30.55 ? 514  LEU A CD1 1 
ATOM   3735  C CD2 . LEU A 1 514 ? 27.349  22.248  -19.254 1.00 29.79 ? 514  LEU A CD2 1 
ATOM   3736  N N   . LEU A 1 515 ? 22.619  23.389  -16.492 1.00 21.72 ? 515  LEU A N   1 
ATOM   3737  C CA  . LEU A 1 515 ? 21.947  23.584  -15.209 1.00 22.43 ? 515  LEU A CA  1 
ATOM   3738  C C   . LEU A 1 515 ? 21.768  22.354  -14.313 1.00 20.56 ? 515  LEU A C   1 
ATOM   3739  O O   . LEU A 1 515 ? 22.272  22.366  -13.184 1.00 20.47 ? 515  LEU A O   1 
ATOM   3740  C CB  . LEU A 1 515 ? 20.603  24.312  -15.397 1.00 24.70 ? 515  LEU A CB  1 
ATOM   3741  C CG  . LEU A 1 515 ? 20.237  25.314  -14.297 1.00 28.96 ? 515  LEU A CG  1 
ATOM   3742  C CD1 . LEU A 1 515 ? 19.740  24.641  -13.048 1.00 30.11 ? 515  LEU A CD1 1 
ATOM   3743  C CD2 . LEU A 1 515 ? 21.398  26.191  -13.947 1.00 30.54 ? 515  LEU A CD2 1 
ATOM   3744  N N   . PRO A 1 516 ? 21.096  21.277  -14.801 1.00 20.05 ? 516  PRO A N   1 
ATOM   3745  C CA  . PRO A 1 516 ? 20.928  20.110  -13.926 1.00 18.69 ? 516  PRO A CA  1 
ATOM   3746  C C   . PRO A 1 516 ? 22.203  19.319  -13.610 1.00 17.97 ? 516  PRO A C   1 
ATOM   3747  O O   . PRO A 1 516 ? 22.316  18.719  -12.534 1.00 17.96 ? 516  PRO A O   1 
ATOM   3748  C CB  . PRO A 1 516 ? 19.911  19.266  -14.686 1.00 18.55 ? 516  PRO A CB  1 
ATOM   3749  C CG  . PRO A 1 516 ? 20.230  19.559  -16.089 1.00 21.29 ? 516  PRO A CG  1 
ATOM   3750  C CD  . PRO A 1 516 ? 20.403  21.029  -16.089 1.00 19.97 ? 516  PRO A CD  1 
ATOM   3751  N N   . HIS A 1 517 ? 23.161  19.356  -14.534 1.00 17.44 ? 517  HIS A N   1 
ATOM   3752  C CA  . HIS A 1 517 ? 24.439  18.657  -14.380 1.00 16.79 ? 517  HIS A CA  1 
ATOM   3753  C C   . HIS A 1 517 ? 25.347  19.319  -13.343 1.00 17.32 ? 517  HIS A C   1 
ATOM   3754  O O   . HIS A 1 517 ? 26.166  18.648  -12.711 1.00 16.90 ? 517  HIS A O   1 
ATOM   3755  C CB  . HIS A 1 517 ? 25.155  18.560  -15.731 1.00 16.90 ? 517  HIS A CB  1 
ATOM   3756  C CG  . HIS A 1 517 ? 24.390  17.792  -16.763 1.00 16.38 ? 517  HIS A CG  1 
ATOM   3757  N ND1 . HIS A 1 517 ? 23.661  18.405  -17.757 1.00 18.45 ? 517  HIS A ND1 1 
ATOM   3758  C CD2 . HIS A 1 517 ? 24.220  16.462  -16.940 1.00 14.81 ? 517  HIS A CD2 1 
ATOM   3759  C CE1 . HIS A 1 517 ? 23.071  17.484  -18.499 1.00 16.44 ? 517  HIS A CE1 1 
ATOM   3760  N NE2 . HIS A 1 517 ? 23.395  16.296  -18.023 1.00 18.26 ? 517  HIS A NE2 1 
ATOM   3761  N N   . LYS A 1 518 ? 25.154  20.624  -13.146 1.00 15.58 ? 518  LYS A N   1 
ATOM   3762  C CA  . LYS A 1 518 ? 25.928  21.422  -12.195 1.00 16.72 ? 518  LYS A CA  1 
ATOM   3763  C C   . LYS A 1 518 ? 25.223  21.610  -10.846 1.00 16.16 ? 518  LYS A C   1 
ATOM   3764  O O   . LYS A 1 518 ? 25.754  22.276  -9.950  1.00 16.55 ? 518  LYS A O   1 
ATOM   3765  C CB  . LYS A 1 518 ? 26.225  22.799  -12.798 1.00 19.27 ? 518  LYS A CB  1 
ATOM   3766  C CG  . LYS A 1 518 ? 27.331  22.846  -13.834 1.00 21.18 ? 518  LYS A CG  1 
ATOM   3767  C CD  . LYS A 1 518 ? 27.396  24.241  -14.451 1.00 24.25 ? 518  LYS A CD  1 
ATOM   3768  C CE  . LYS A 1 518 ? 28.718  24.515  -15.153 1.00 26.70 ? 518  LYS A CE  1 
ATOM   3769  N NZ  . LYS A 1 518 ? 29.845  24.701  -14.190 1.00 27.48 ? 518  LYS A NZ  1 
ATOM   3770  N N   . THR A 1 519 ? 24.023  21.040  -10.718 1.00 15.57 ? 519  THR A N   1 
ATOM   3771  C CA  . THR A 1 519 ? 23.224  21.139  -9.496  1.00 15.89 ? 519  THR A CA  1 
ATOM   3772  C C   . THR A 1 519 ? 23.625  20.080  -8.471  1.00 14.66 ? 519  THR A C   1 
ATOM   3773  O O   . THR A 1 519 ? 23.844  18.918  -8.815  1.00 15.49 ? 519  THR A O   1 
ATOM   3774  C CB  . THR A 1 519 ? 21.694  21.019  -9.807  1.00 17.07 ? 519  THR A CB  1 
ATOM   3775  O OG1 . THR A 1 519 ? 21.300  22.095  -10.663 1.00 19.32 ? 519  THR A OG1 1 
ATOM   3776  C CG2 . THR A 1 519 ? 20.834  21.068  -8.530  1.00 18.65 ? 519  THR A CG2 1 
ATOM   3777  N N   . PHE A 1 520 ? 23.765  20.526  -7.224  1.00 14.19 ? 520  PHE A N   1 
ATOM   3778  C CA  . PHE A 1 520 ? 24.111  19.665  -6.098  1.00 13.95 ? 520  PHE A CA  1 
ATOM   3779  C C   . PHE A 1 520 ? 22.949  19.763  -5.116  1.00 13.85 ? 520  PHE A C   1 
ATOM   3780  O O   . PHE A 1 520 ? 22.714  20.826  -4.534  1.00 15.42 ? 520  PHE A O   1 
ATOM   3781  C CB  . PHE A 1 520 ? 25.403  20.135  -5.425  1.00 13.59 ? 520  PHE A CB  1 
ATOM   3782  C CG  . PHE A 1 520 ? 26.638  19.941  -6.255  1.00 12.63 ? 520  PHE A CG  1 
ATOM   3783  C CD1 . PHE A 1 520 ? 26.930  20.809  -7.326  1.00 14.25 ? 520  PHE A CD1 1 
ATOM   3784  C CD2 . PHE A 1 520 ? 27.526  18.897  -5.960  1.00 13.43 ? 520  PHE A CD2 1 
ATOM   3785  C CE1 . PHE A 1 520 ? 28.093  20.641  -8.104  1.00 14.33 ? 520  PHE A CE1 1 
ATOM   3786  C CE2 . PHE A 1 520 ? 28.694  18.714  -6.720  1.00 13.22 ? 520  PHE A CE2 1 
ATOM   3787  C CZ  . PHE A 1 520 ? 28.981  19.592  -7.802  1.00 13.39 ? 520  PHE A CZ  1 
ATOM   3788  N N   . ILE A 1 521 ? 22.219  18.661  -4.931  1.00 14.73 ? 521  ILE A N   1 
ATOM   3789  C CA  . ILE A 1 521 ? 21.065  18.642  -4.023  1.00 15.25 ? 521  ILE A CA  1 
ATOM   3790  C C   . ILE A 1 521 ? 21.435  18.932  -2.570  1.00 14.98 ? 521  ILE A C   1 
ATOM   3791  O O   . ILE A 1 521 ? 20.642  19.512  -1.823  1.00 15.81 ? 521  ILE A O   1 
ATOM   3792  C CB  . ILE A 1 521 ? 20.253  17.305  -4.106  1.00 16.06 ? 521  ILE A CB  1 
ATOM   3793  C CG1 . ILE A 1 521 ? 21.129  16.093  -3.735  1.00 17.34 ? 521  ILE A CG1 1 
ATOM   3794  C CG2 . ILE A 1 521 ? 19.626  17.167  -5.500  1.00 17.14 ? 521  ILE A CG2 1 
ATOM   3795  C CD1 . ILE A 1 521 ? 20.365  14.782  -3.545  1.00 18.62 ? 521  ILE A CD1 1 
ATOM   3796  N N   . GLY A 1 522 ? 22.672  18.584  -2.206  1.00 14.07 ? 522  GLY A N   1 
ATOM   3797  C CA  . GLY A 1 522 ? 23.146  18.778  -0.848  1.00 13.08 ? 522  GLY A CA  1 
ATOM   3798  C C   . GLY A 1 522 ? 22.423  17.854  0.109   1.00 14.13 ? 522  GLY A C   1 
ATOM   3799  O O   . GLY A 1 522 ? 21.881  16.821  -0.307  1.00 14.52 ? 522  GLY A O   1 
ATOM   3800  N N   . GLY A 1 523 ? 22.400  18.236  1.385   1.00 13.40 ? 523  GLY A N   1 
ATOM   3801  C CA  . GLY A 1 523 ? 21.740  17.430  2.401   1.00 15.57 ? 523  GLY A CA  1 
ATOM   3802  C C   . GLY A 1 523 ? 22.383  16.068  2.589   1.00 15.82 ? 523  GLY A C   1 
ATOM   3803  O O   . GLY A 1 523 ? 21.713  15.116  2.989   1.00 17.24 ? 523  GLY A O   1 
ATOM   3804  N N   . ARG A 1 524 ? 23.666  15.972  2.231   1.00 14.78 ? 524  ARG A N   1 
ATOM   3805  C CA  . ARG A 1 524 ? 24.438  14.736  2.359   1.00 14.71 ? 524  ARG A CA  1 
ATOM   3806  C C   . ARG A 1 524 ? 25.149  14.877  3.714   1.00 13.79 ? 524  ARG A C   1 
ATOM   3807  O O   . ARG A 1 524 ? 25.907  15.830  3.927   1.00 14.28 ? 524  ARG A O   1 
ATOM   3808  C CB  . ARG A 1 524 ? 25.472  14.596  1.234   1.00 15.74 ? 524  ARG A CB  1 
ATOM   3809  C CG  . ARG A 1 524 ? 25.018  14.872  -0.205  1.00 19.42 ? 524  ARG A CG  1 
ATOM   3810  C CD  . ARG A 1 524 ? 24.241  13.726  -0.786  1.00 20.50 ? 524  ARG A CD  1 
ATOM   3811  N NE  . ARG A 1 524 ? 24.150  13.796  -2.245  1.00 20.07 ? 524  ARG A NE  1 
ATOM   3812  C CZ  . ARG A 1 524 ? 23.715  12.802  -3.017  1.00 20.97 ? 524  ARG A CZ  1 
ATOM   3813  N NH1 . ARG A 1 524 ? 23.329  11.651  -2.484  1.00 23.36 ? 524  ARG A NH1 1 
ATOM   3814  N NH2 . ARG A 1 524 ? 23.660  12.960  -4.331  1.00 19.83 ? 524  ARG A NH2 1 
ATOM   3815  N N   . PRO A 1 525 ? 24.926  13.927  4.641   1.00 11.38 ? 525  PRO A N   1 
ATOM   3816  C CA  . PRO A 1 525 ? 25.535  13.968  5.972   1.00 11.01 ? 525  PRO A CA  1 
ATOM   3817  C C   . PRO A 1 525 ? 27.004  13.631  6.123   1.00 10.62 ? 525  PRO A C   1 
ATOM   3818  O O   . PRO A 1 525 ? 27.583  12.916  5.309   1.00 11.94 ? 525  PRO A O   1 
ATOM   3819  C CB  . PRO A 1 525 ? 24.686  12.985  6.753   1.00 12.25 ? 525  PRO A CB  1 
ATOM   3820  C CG  . PRO A 1 525 ? 24.381  11.942  5.731   1.00 10.38 ? 525  PRO A CG  1 
ATOM   3821  C CD  . PRO A 1 525 ? 24.033  12.759  4.524   1.00 11.62 ? 525  PRO A CD  1 
ATOM   3822  N N   . SER A 1 526 ? 27.578  14.150  7.204   1.00 10.75 ? 526  SER A N   1 
ATOM   3823  C CA  . SER A 1 526 ? 28.968  13.904  7.543   1.00 10.94 ? 526  SER A CA  1 
ATOM   3824  C C   . SER A 1 526 ? 29.243  14.217  9.000   1.00 10.54 ? 526  SER A C   1 
ATOM   3825  O O   . SER A 1 526 ? 28.546  15.024  9.625   1.00 11.04 ? 526  SER A O   1 
ATOM   3826  C CB  . SER A 1 526 ? 29.927  14.724  6.665   1.00 12.15 ? 526  SER A CB  1 
ATOM   3827  O OG  . SER A 1 526 ? 29.880  16.108  6.974   1.00 11.93 ? 526  SER A OG  1 
ATOM   3828  N N   . ASN A 1 527 ? 30.226  13.506  9.540   1.00 10.48 ? 527  ASN A N   1 
ATOM   3829  C CA  . ASN A 1 527 ? 30.714  13.716  10.891  1.00 10.67 ? 527  ASN A CA  1 
ATOM   3830  C C   . ASN A 1 527 ? 32.149  14.175  10.679  1.00 11.36 ? 527  ASN A C   1 
ATOM   3831  O O   . ASN A 1 527 ? 32.838  13.672  9.786   1.00 12.46 ? 527  ASN A O   1 
ATOM   3832  C CB  . ASN A 1 527 ? 30.754  12.420  11.707  1.00 10.85 ? 527  ASN A CB  1 
ATOM   3833  C CG  . ASN A 1 527 ? 29.380  11.890  12.045  1.00 13.06 ? 527  ASN A CG  1 
ATOM   3834  O OD1 . ASN A 1 527 ? 28.485  12.639  12.427  1.00 14.18 ? 527  ASN A OD1 1 
ATOM   3835  N ND2 . ASN A 1 527 ? 29.214  10.580  11.923  1.00 12.90 ? 527  ASN A ND2 1 
ATOM   3836  N N   . THR A 1 528 ? 32.570  15.168  11.452  1.00 10.57 ? 528  THR A N   1 
ATOM   3837  C CA  . THR A 1 528 ? 33.939  15.653  11.378  1.00 11.41 ? 528  THR A CA  1 
ATOM   3838  C C   . THR A 1 528 ? 34.617  15.333  12.700  1.00 12.67 ? 528  THR A C   1 
ATOM   3839  O O   . THR A 1 528 ? 34.097  15.649  13.770  1.00 13.51 ? 528  THR A O   1 
ATOM   3840  C CB  . THR A 1 528 ? 34.024  17.171  11.060  1.00 11.10 ? 528  THR A CB  1 
ATOM   3841  O OG1 . THR A 1 528 ? 33.625  17.398  9.704   1.00 12.72 ? 528  THR A OG1 1 
ATOM   3842  C CG2 . THR A 1 528 ? 35.450  17.689  11.227  1.00 13.61 ? 528  THR A CG2 1 
ATOM   3843  N N   . LEU A 1 529 ? 35.729  14.611  12.600  1.00 12.50 ? 529  LEU A N   1 
ATOM   3844  C CA  . LEU A 1 529 ? 36.551  14.231  13.740  1.00 13.92 ? 529  LEU A CA  1 
ATOM   3845  C C   . LEU A 1 529 ? 37.860  14.990  13.578  1.00 13.65 ? 529  LEU A C   1 
ATOM   3846  O O   . LEU A 1 529 ? 38.588  14.797  12.603  1.00 14.71 ? 529  LEU A O   1 
ATOM   3847  C CB  . LEU A 1 529 ? 36.778  12.717  13.767  1.00 16.28 ? 529  LEU A CB  1 
ATOM   3848  C CG  . LEU A 1 529 ? 35.540  11.934  14.211  1.00 20.77 ? 529  LEU A CG  1 
ATOM   3849  C CD1 . LEU A 1 529 ? 35.290  10.731  13.324  1.00 22.13 ? 529  LEU A CD1 1 
ATOM   3850  C CD2 . LEU A 1 529 ? 35.674  11.561  15.672  1.00 23.22 ? 529  LEU A CD2 1 
ATOM   3851  N N   . LEU A 1 530 ? 38.103  15.916  14.499  1.00 12.85 ? 530  LEU A N   1 
ATOM   3852  C CA  . LEU A 1 530 ? 39.297  16.746  14.457  1.00 13.73 ? 530  LEU A CA  1 
ATOM   3853  C C   . LEU A 1 530 ? 40.159  16.563  15.698  1.00 14.82 ? 530  LEU A C   1 
ATOM   3854  O O   . LEU A 1 530 ? 39.651  16.553  16.820  1.00 15.84 ? 530  LEU A O   1 
ATOM   3855  C CB  . LEU A 1 530 ? 38.893  18.220  14.286  1.00 14.96 ? 530  LEU A CB  1 
ATOM   3856  C CG  . LEU A 1 530 ? 39.967  19.296  14.087  1.00 15.47 ? 530  LEU A CG  1 
ATOM   3857  C CD1 . LEU A 1 530 ? 40.748  19.066  12.793  1.00 16.82 ? 530  LEU A CD1 1 
ATOM   3858  C CD2 . LEU A 1 530 ? 39.312  20.670  14.068  1.00 17.16 ? 530  LEU A CD2 1 
ATOM   3859  N N   . ILE A 1 531 ? 41.453  16.348  15.476  1.00 13.27 ? 531  ILE A N   1 
ATOM   3860  C CA  . ILE A 1 531 ? 42.427  16.184  16.559  1.00 13.54 ? 531  ILE A CA  1 
ATOM   3861  C C   . ILE A 1 531 ? 43.479  17.281  16.400  1.00 12.38 ? 531  ILE A C   1 
ATOM   3862  O O   . ILE A 1 531 ? 43.561  17.898  15.334  1.00 11.99 ? 531  ILE A O   1 
ATOM   3863  C CB  . ILE A 1 531 ? 43.100  14.762  16.552  1.00 14.49 ? 531  ILE A CB  1 
ATOM   3864  C CG1 . ILE A 1 531 ? 43.753  14.469  15.198  1.00 13.08 ? 531  ILE A CG1 1 
ATOM   3865  C CG2 . ILE A 1 531 ? 42.066  13.683  16.894  1.00 15.61 ? 531  ILE A CG2 1 
ATOM   3866  C CD1 . ILE A 1 531 ? 44.445  13.146  15.092  1.00 14.11 ? 531  ILE A CD1 1 
ATOM   3867  N N   . LYS A 1 532 ? 44.254  17.556  17.452  1.00 11.92 ? 532  LYS A N   1 
ATOM   3868  C CA  . LYS A 1 532 ? 45.296  18.586  17.359  1.00 11.76 ? 532  LYS A CA  1 
ATOM   3869  C C   . LYS A 1 532 ? 46.450  18.073  16.481  1.00 12.10 ? 532  LYS A C   1 
ATOM   3870  O O   . LYS A 1 532 ? 46.933  18.795  15.607  1.00 13.03 ? 532  LYS A O   1 
ATOM   3871  C CB  . LYS A 1 532 ? 45.791  19.026  18.743  1.00 14.34 ? 532  LYS A CB  1 
ATOM   3872  C CG  . LYS A 1 532 ? 46.648  20.295  18.723  1.00 17.01 ? 532  LYS A CG  1 
ATOM   3873  C CD  . LYS A 1 532 ? 47.085  20.711  20.115  1.00 19.78 ? 532  LYS A CD  1 
ATOM   3874  C CE  . LYS A 1 532 ? 47.991  21.931  20.055  1.00 21.63 ? 532  LYS A CE  1 
ATOM   3875  N NZ  . LYS A 1 532 ? 48.774  22.100  21.304  1.00 24.95 ? 532  LYS A NZ  1 
ATOM   3876  N N   . SER A 1 533 ? 46.836  16.812  16.688  1.00 11.04 ? 533  SER A N   1 
ATOM   3877  C CA  . SER A 1 533 ? 47.895  16.162  15.906  1.00 12.39 ? 533  SER A CA  1 
ATOM   3878  C C   . SER A 1 533 ? 47.784  14.648  16.064  1.00 11.92 ? 533  SER A C   1 
ATOM   3879  O O   . SER A 1 533 ? 47.269  14.166  17.080  1.00 12.53 ? 533  SER A O   1 
ATOM   3880  C CB  . SER A 1 533 ? 49.297  16.628  16.336  1.00 12.90 ? 533  SER A CB  1 
ATOM   3881  O OG  . SER A 1 533 ? 49.671  16.096  17.594  1.00 15.19 ? 533  SER A OG  1 
ATOM   3882  N N   . LEU A 1 534 ? 48.258  13.906  15.060  1.00 12.72 ? 534  LEU A N   1 
ATOM   3883  C CA  . LEU A 1 534 ? 48.213  12.445  15.100  1.00 12.03 ? 534  LEU A CA  1 
ATOM   3884  C C   . LEU A 1 534 ? 49.434  11.848  15.795  1.00 12.10 ? 534  LEU A C   1 
ATOM   3885  O O   . LEU A 1 534 ? 50.424  11.453  15.165  1.00 12.22 ? 534  LEU A O   1 
ATOM   3886  C CB  . LEU A 1 534 ? 48.008  11.841  13.700  1.00 11.47 ? 534  LEU A CB  1 
ATOM   3887  C CG  . LEU A 1 534 ? 47.746  10.321  13.643  1.00 11.95 ? 534  LEU A CG  1 
ATOM   3888  C CD1 . LEU A 1 534 ? 46.445  9.936   14.347  1.00 13.59 ? 534  LEU A CD1 1 
ATOM   3889  C CD2 . LEU A 1 534 ? 47.728  9.881   12.204  1.00 13.35 ? 534  LEU A CD2 1 
ATOM   3890  N N   . THR A 1 535 ? 49.339  11.833  17.118  1.00 11.49 ? 535  THR A N   1 
ATOM   3891  C CA  . THR A 1 535 ? 50.359  11.294  18.010  1.00 12.31 ? 535  THR A CA  1 
ATOM   3892  C C   . THR A 1 535 ? 49.911  9.872   18.366  1.00 12.39 ? 535  THR A C   1 
ATOM   3893  O O   . THR A 1 535 ? 48.781  9.491   18.019  1.00 11.08 ? 535  THR A O   1 
ATOM   3894  C CB  . THR A 1 535 ? 50.402  12.130  19.327  1.00 12.71 ? 535  THR A CB  1 
ATOM   3895  O OG1 . THR A 1 535 ? 49.090  12.190  19.899  1.00 12.51 ? 535  THR A OG1 1 
ATOM   3896  C CG2 . THR A 1 535 ? 50.936  13.522  19.072  1.00 12.80 ? 535  THR A CG2 1 
ATOM   3897  N N   . PRO A 1 536 ? 50.797  9.040   18.984  1.00 11.92 ? 536  PRO A N   1 
ATOM   3898  C CA  . PRO A 1 536 ? 50.359  7.686   19.349  1.00 10.99 ? 536  PRO A CA  1 
ATOM   3899  C C   . PRO A 1 536 ? 49.122  7.702   20.247  1.00 11.27 ? 536  PRO A C   1 
ATOM   3900  O O   . PRO A 1 536 ? 48.211  6.896   20.053  1.00 10.96 ? 536  PRO A O   1 
ATOM   3901  C CB  . PRO A 1 536 ? 51.582  7.122   20.056  1.00 11.84 ? 536  PRO A CB  1 
ATOM   3902  C CG  . PRO A 1 536 ? 52.685  7.671   19.245  1.00 10.83 ? 536  PRO A CG  1 
ATOM   3903  C CD  . PRO A 1 536 ? 52.276  9.115   19.068  1.00 11.65 ? 536  PRO A CD  1 
ATOM   3904  N N   . ARG A 1 537 ? 49.049  8.696   21.137  1.00 10.22 ? 537  ARG A N   1 
ATOM   3905  C CA  . ARG A 1 537 ? 47.911  8.859   22.041  1.00 10.65 ? 537  ARG A CA  1 
ATOM   3906  C C   . ARG A 1 537 ? 46.635  9.175   21.258  1.00 10.58 ? 537  ARG A C   1 
ATOM   3907  O O   . ARG A 1 537 ? 45.574  8.617   21.551  1.00 11.07 ? 537  ARG A O   1 
ATOM   3908  C CB  . ARG A 1 537 ? 48.197  9.933   23.104  1.00 11.63 ? 537  ARG A CB  1 
ATOM   3909  C CG  . ARG A 1 537 ? 47.143  10.000  24.205  1.00 12.35 ? 537  ARG A CG  1 
ATOM   3910  C CD  . ARG A 1 537 ? 47.404  11.035  25.268  1.00 14.18 ? 537  ARG A CD  1 
ATOM   3911  N NE  . ARG A 1 537 ? 48.504  10.687  26.165  1.00 14.78 ? 537  ARG A NE  1 
ATOM   3912  C CZ  . ARG A 1 537 ? 48.450  10.762  27.495  1.00 15.00 ? 537  ARG A CZ  1 
ATOM   3913  N NH1 . ARG A 1 537 ? 47.346  11.168  28.112  1.00 15.62 ? 537  ARG A NH1 1 
ATOM   3914  N NH2 . ARG A 1 537 ? 49.525  10.468  28.212  1.00 16.11 ? 537  ARG A NH2 1 
ATOM   3915  N N   . ALA A 1 538 ? 46.763  9.993   20.211  1.00 10.68 ? 538  ALA A N   1 
ATOM   3916  C CA  . ALA A 1 538 ? 45.621  10.358  19.375  1.00 11.01 ? 538  ALA A CA  1 
ATOM   3917  C C   . ALA A 1 538 ? 45.083  9.172   18.588  1.00 10.77 ? 538  ALA A C   1 
ATOM   3918  O O   . ALA A 1 538 ? 43.865  9.007   18.499  1.00 10.85 ? 538  ALA A O   1 
ATOM   3919  C CB  . ALA A 1 538 ? 45.974  11.496  18.444  1.00 12.58 ? 538  ALA A CB  1 
ATOM   3920  N N   . LEU A 1 539 ? 45.979  8.322   18.072  1.00 10.82 ? 539  LEU A N   1 
ATOM   3921  C CA  . LEU A 1 539 ? 45.558  7.135   17.317  1.00 10.52 ? 539  LEU A CA  1 
ATOM   3922  C C   . LEU A 1 539 ? 44.807  6.169   18.227  1.00 11.10 ? 539  LEU A C   1 
ATOM   3923  O O   . LEU A 1 539 ? 43.758  5.653   17.843  1.00 10.84 ? 539  LEU A O   1 
ATOM   3924  C CB  . LEU A 1 539 ? 46.742  6.409   16.658  1.00 10.88 ? 539  LEU A CB  1 
ATOM   3925  C CG  . LEU A 1 539 ? 46.352  5.168   15.824  1.00 11.12 ? 539  LEU A CG  1 
ATOM   3926  C CD1 . LEU A 1 539 ? 45.550  5.563   14.592  1.00 11.39 ? 539  LEU A CD1 1 
ATOM   3927  C CD2 . LEU A 1 539 ? 47.559  4.378   15.433  1.00 11.33 ? 539  LEU A CD2 1 
ATOM   3928  N N   . GLY A 1 540 ? 45.324  5.996   19.449  1.00 10.57 ? 540  GLY A N   1 
ATOM   3929  C CA  . GLY A 1 540 ? 44.703  5.113   20.429  1.00 10.84 ? 540  GLY A CA  1 
ATOM   3930  C C   . GLY A 1 540 ? 43.291  5.544   20.753  1.00 10.94 ? 540  GLY A C   1 
ATOM   3931  O O   . GLY A 1 540 ? 42.382  4.721   20.863  1.00 12.43 ? 540  GLY A O   1 
ATOM   3932  N N   . ALA A 1 541 ? 43.114  6.859   20.826  1.00 10.17 ? 541  ALA A N   1 
ATOM   3933  C CA  . ALA A 1 541 ? 41.830  7.479   21.099  1.00 9.90  ? 541  ALA A CA  1 
ATOM   3934  C C   . ALA A 1 541 ? 40.816  7.238   19.988  1.00 10.61 ? 541  ALA A C   1 
ATOM   3935  O O   . ALA A 1 541 ? 39.669  6.869   20.257  1.00 12.35 ? 541  ALA A O   1 
ATOM   3936  C CB  . ALA A 1 541 ? 42.018  8.960   21.325  1.00 10.83 ? 541  ALA A CB  1 
ATOM   3937  N N   . ILE A 1 542 ? 41.278  7.376   18.744  1.00 10.39 ? 542  ILE A N   1 
ATOM   3938  C CA  . ILE A 1 542 ? 40.443  7.191   17.551  1.00 10.60 ? 542  ILE A CA  1 
ATOM   3939  C C   . ILE A 1 542 ? 39.955  5.746   17.405  1.00 9.93  ? 542  ILE A C   1 
ATOM   3940  O O   . ILE A 1 542 ? 38.768  5.518   17.167  1.00 11.13 ? 542  ILE A O   1 
ATOM   3941  C CB  . ILE A 1 542 ? 41.197  7.659   16.254  1.00 10.02 ? 542  ILE A CB  1 
ATOM   3942  C CG1 . ILE A 1 542 ? 41.365  9.183   16.274  1.00 10.99 ? 542  ILE A CG1 1 
ATOM   3943  C CG2 . ILE A 1 542 ? 40.445  7.230   14.960  1.00 12.20 ? 542  ILE A CG2 1 
ATOM   3944  C CD1 . ILE A 1 542 ? 42.328  9.718   15.221  1.00 12.70 ? 542  ILE A CD1 1 
ATOM   3945  N N   . ILE A 1 543 ? 40.860  4.783   17.590  1.00 10.68 ? 543  ILE A N   1 
ATOM   3946  C CA  . ILE A 1 543 ? 40.502  3.370   17.460  1.00 9.50  ? 543  ILE A CA  1 
ATOM   3947  C C   . ILE A 1 543 ? 39.539  2.928   18.562  1.00 10.45 ? 543  ILE A C   1 
ATOM   3948  O O   . ILE A 1 543 ? 38.542  2.269   18.268  1.00 11.41 ? 543  ILE A O   1 
ATOM   3949  C CB  . ILE A 1 543 ? 41.748  2.444   17.413  1.00 9.88  ? 543  ILE A CB  1 
ATOM   3950  C CG1 . ILE A 1 543 ? 42.738  2.898   16.331  1.00 10.46 ? 543  ILE A CG1 1 
ATOM   3951  C CG2 . ILE A 1 543 ? 41.335  0.989   17.160  1.00 8.03  ? 543  ILE A CG2 1 
ATOM   3952  C CD1 . ILE A 1 543 ? 42.173  2.969   14.931  1.00 12.08 ? 543  ILE A CD1 1 
ATOM   3953  N N   . ALA A 1 544 ? 39.795  3.361   19.799  1.00 10.09 ? 544  ALA A N   1 
ATOM   3954  C CA  . ALA A 1 544 ? 38.924  3.022   20.929  1.00 9.89  ? 544  ALA A CA  1 
ATOM   3955  C C   . ALA A 1 544 ? 37.525  3.593   20.727  1.00 9.26  ? 544  ALA A C   1 
ATOM   3956  O O   . ALA A 1 544 ? 36.545  2.937   21.055  1.00 11.48 ? 544  ALA A O   1 
ATOM   3957  C CB  . ALA A 1 544 ? 39.503  3.519   22.222  1.00 10.51 ? 544  ALA A CB  1 
ATOM   3958  N N   . MET A 1 545 ? 37.444  4.789   20.130  1.00 9.74  ? 545  MET A N   1 
ATOM   3959  C CA  . MET A 1 545 ? 36.162  5.447   19.844  1.00 9.98  ? 545  MET A CA  1 
ATOM   3960  C C   . MET A 1 545 ? 35.326  4.582   18.890  1.00 10.18 ? 545  MET A C   1 
ATOM   3961  O O   . MET A 1 545 ? 34.139  4.344   19.138  1.00 10.47 ? 545  MET A O   1 
ATOM   3962  C CB  . MET A 1 545 ? 36.398  6.838   19.242  1.00 11.60 ? 545  MET A CB  1 
ATOM   3963  C CG  . MET A 1 545 ? 35.131  7.596   18.860  1.00 10.72 ? 545  MET A CG  1 
ATOM   3964  S SD  . MET A 1 545 ? 35.444  9.006   17.816  1.00 13.91 ? 545  MET A SD  1 
ATOM   3965  C CE  . MET A 1 545 ? 36.067  8.202   16.390  1.00 15.18 ? 545  MET A CE  1 
ATOM   3966  N N   . TYR A 1 546 ? 35.977  4.068   17.846  1.00 10.24 ? 546  TYR A N   1 
ATOM   3967  C CA  . TYR A 1 546 ? 35.318  3.206   16.869  1.00 9.19  ? 546  TYR A CA  1 
ATOM   3968  C C   . TYR A 1 546 ? 34.960  1.839   17.439  1.00 8.85  ? 546  TYR A C   1 
ATOM   3969  O O   . TYR A 1 546 ? 33.915  1.296   17.102  1.00 11.06 ? 546  TYR A O   1 
ATOM   3970  C CB  . TYR A 1 546 ? 36.152  3.073   15.598  1.00 9.05  ? 546  TYR A CB  1 
ATOM   3971  C CG  . TYR A 1 546 ? 35.940  4.217   14.635  1.00 10.79 ? 546  TYR A CG  1 
ATOM   3972  C CD1 . TYR A 1 546 ? 34.709  4.371   13.957  1.00 10.20 ? 546  TYR A CD1 1 
ATOM   3973  C CD2 . TYR A 1 546 ? 36.955  5.163   14.401  1.00 9.00  ? 546  TYR A CD2 1 
ATOM   3974  C CE1 . TYR A 1 546 ? 34.494  5.455   13.066  1.00 10.85 ? 546  TYR A CE1 1 
ATOM   3975  C CE2 . TYR A 1 546 ? 36.755  6.253   13.507  1.00 11.19 ? 546  TYR A CE2 1 
ATOM   3976  C CZ  . TYR A 1 546 ? 35.525  6.387   12.850  1.00 10.63 ? 546  TYR A CZ  1 
ATOM   3977  O OH  . TYR A 1 546 ? 35.334  7.441   11.993  1.00 12.10 ? 546  TYR A OH  1 
ATOM   3978  N N   . GLU A 1 547 ? 35.796  1.321   18.344  1.00 10.12 ? 547  GLU A N   1 
ATOM   3979  C CA  . GLU A 1 547 ? 35.535  0.033   19.000  1.00 9.22  ? 547  GLU A CA  1 
ATOM   3980  C C   . GLU A 1 547 ? 34.272  0.154   19.852  1.00 9.06  ? 547  GLU A C   1 
ATOM   3981  O O   . GLU A 1 547 ? 33.411  -0.726  19.837  1.00 10.57 ? 547  GLU A O   1 
ATOM   3982  C CB  . GLU A 1 547 ? 36.706  -0.382  19.897  1.00 10.97 ? 547  GLU A CB  1 
ATOM   3983  C CG  . GLU A 1 547 ? 37.960  -0.821  19.149  1.00 12.11 ? 547  GLU A CG  1 
ATOM   3984  C CD  . GLU A 1 547 ? 39.091  -1.231  20.076  1.00 11.92 ? 547  GLU A CD  1 
ATOM   3985  O OE1 . GLU A 1 547 ? 39.073  -0.837  21.262  1.00 13.48 ? 547  GLU A OE1 1 
ATOM   3986  O OE2 . GLU A 1 547 ? 40.004  -1.948  19.615  1.00 11.33 ? 547  GLU A OE2 1 
ATOM   3987  N N   . HIS A 1 548 ? 34.127  1.307   20.503  1.00 9.54  ? 548  HIS A N   1 
ATOM   3988  C CA  . HIS A 1 548 ? 32.976  1.565   21.355  1.00 9.64  ? 548  HIS A CA  1 
ATOM   3989  C C   . HIS A 1 548 ? 31.711  1.931   20.588  1.00 10.43 ? 548  HIS A C   1 
ATOM   3990  O O   . HIS A 1 548 ? 30.603  1.633   21.044  1.00 11.28 ? 548  HIS A O   1 
ATOM   3991  C CB  . HIS A 1 548 ? 33.341  2.586   22.414  1.00 10.53 ? 548  HIS A CB  1 
ATOM   3992  C CG  . HIS A 1 548 ? 34.388  2.101   23.364  1.00 10.85 ? 548  HIS A CG  1 
ATOM   3993  N ND1 . HIS A 1 548 ? 34.572  0.763   23.641  1.00 12.81 ? 548  HIS A ND1 1 
ATOM   3994  C CD2 . HIS A 1 548 ? 35.297  2.769   24.111  1.00 13.42 ? 548  HIS A CD2 1 
ATOM   3995  C CE1 . HIS A 1 548 ? 35.550  0.630   24.519  1.00 12.07 ? 548  HIS A CE1 1 
ATOM   3996  N NE2 . HIS A 1 548 ? 36.004  1.832   24.821  1.00 12.42 ? 548  HIS A NE2 1 
ATOM   3997  N N   . LYS A 1 549 ? 31.884  2.510   19.395  1.00 10.84 ? 549  LYS A N   1 
ATOM   3998  C CA  . LYS A 1 549 ? 30.762  2.853   18.511  1.00 10.97 ? 549  LYS A CA  1 
ATOM   3999  C C   . LYS A 1 549 ? 30.126  1.522   18.073  1.00 10.62 ? 549  LYS A C   1 
ATOM   4000  O O   . LYS A 1 549 ? 28.902  1.353   18.127  1.00 11.21 ? 549  LYS A O   1 
ATOM   4001  C CB  . LYS A 1 549 ? 31.269  3.606   17.268  1.00 11.33 ? 549  LYS A CB  1 
ATOM   4002  C CG  . LYS A 1 549 ? 30.195  3.873   16.224  1.00 11.94 ? 549  LYS A CG  1 
ATOM   4003  C CD  . LYS A 1 549 ? 30.729  4.037   14.820  1.00 12.81 ? 549  LYS A CD  1 
ATOM   4004  C CE  . LYS A 1 549 ? 29.562  4.154   13.855  1.00 14.24 ? 549  LYS A CE  1 
ATOM   4005  N NZ  . LYS A 1 549 ? 29.993  4.413   12.456  1.00 14.45 ? 549  LYS A NZ  1 
ATOM   4006  N N   . VAL A 1 550 ? 30.996  0.576   17.709  1.00 11.82 ? 550  VAL A N   1 
ATOM   4007  C CA  . VAL A 1 550 ? 30.615  -0.764  17.258  1.00 10.59 ? 550  VAL A CA  1 
ATOM   4008  C C   . VAL A 1 550 ? 29.912  -1.548  18.377  1.00 11.86 ? 550  VAL A C   1 
ATOM   4009  O O   . VAL A 1 550 ? 28.939  -2.261  18.114  1.00 10.97 ? 550  VAL A O   1 
ATOM   4010  C CB  . VAL A 1 550 ? 31.857  -1.505  16.684  1.00 10.71 ? 550  VAL A CB  1 
ATOM   4011  C CG1 . VAL A 1 550 ? 31.594  -2.983  16.491  1.00 9.82  ? 550  VAL A CG1 1 
ATOM   4012  C CG2 . VAL A 1 550 ? 32.231  -0.891  15.337  1.00 10.16 ? 550  VAL A CG2 1 
ATOM   4013  N N   . LEU A 1 551 ? 30.362  -1.334  19.618  1.00 10.99 ? 551  LEU A N   1 
ATOM   4014  C CA  . LEU A 1 551 ? 29.780  -1.971  20.806  1.00 11.51 ? 551  LEU A CA  1 
ATOM   4015  C C   . LEU A 1 551 ? 28.333  -1.505  20.976  1.00 11.10 ? 551  LEU A C   1 
ATOM   4016  O O   . LEU A 1 551 ? 27.438  -2.325  21.159  1.00 12.91 ? 551  LEU A O   1 
ATOM   4017  C CB  . LEU A 1 551 ? 30.597  -1.621  22.070  1.00 12.23 ? 551  LEU A CB  1 
ATOM   4018  C CG  . LEU A 1 551 ? 30.247  -2.154  23.482  1.00 14.16 ? 551  LEU A CG  1 
ATOM   4019  C CD1 . LEU A 1 551 ? 31.467  -2.034  24.375  1.00 14.20 ? 551  LEU A CD1 1 
ATOM   4020  C CD2 . LEU A 1 551 ? 29.065  -1.427  24.131  1.00 13.75 ? 551  LEU A CD2 1 
ATOM   4021  N N   . VAL A 1 552 ? 28.124  -0.188  20.921  1.00 10.26 ? 552  VAL A N   1 
ATOM   4022  C CA  . VAL A 1 552 ? 26.789  0.389   21.092  1.00 10.30 ? 552  VAL A CA  1 
ATOM   4023  C C   . VAL A 1 552 ? 25.819  -0.044  19.995  1.00 10.15 ? 552  VAL A C   1 
ATOM   4024  O O   . VAL A 1 552 ? 24.702  -0.453  20.305  1.00 10.91 ? 552  VAL A O   1 
ATOM   4025  C CB  . VAL A 1 552 ? 26.830  1.934   21.202  1.00 10.82 ? 552  VAL A CB  1 
ATOM   4026  C CG1 . VAL A 1 552 ? 25.423  2.524   21.344  1.00 12.21 ? 552  VAL A CG1 1 
ATOM   4027  C CG2 . VAL A 1 552 ? 27.646  2.347   22.378  1.00 12.22 ? 552  VAL A CG2 1 
ATOM   4028  N N   . GLN A 1 553 ? 26.261  -0.002  18.735  1.00 10.44 ? 553  GLN A N   1 
ATOM   4029  C CA  . GLN A 1 553 ? 25.409  -0.401  17.611  1.00 8.96  ? 553  GLN A CA  1 
ATOM   4030  C C   . GLN A 1 553 ? 24.995  -1.862  17.705  1.00 9.77  ? 553  GLN A C   1 
ATOM   4031  O O   . GLN A 1 553 ? 23.821  -2.183  17.517  1.00 10.59 ? 553  GLN A O   1 
ATOM   4032  C CB  . GLN A 1 553 ? 26.080  -0.112  16.271  1.00 9.21  ? 553  GLN A CB  1 
ATOM   4033  C CG  . GLN A 1 553 ? 26.110  1.364   15.940  1.00 10.14 ? 553  GLN A CG  1 
ATOM   4034  C CD  . GLN A 1 553 ? 26.597  1.674   14.538  1.00 11.33 ? 553  GLN A CD  1 
ATOM   4035  O OE1 . GLN A 1 553 ? 27.307  0.881   13.913  1.00 11.76 ? 553  GLN A OE1 1 
ATOM   4036  N NE2 . GLN A 1 553 ? 26.236  2.856   14.044  1.00 10.93 ? 553  GLN A NE2 1 
ATOM   4037  N N   . GLY A 1 554 ? 25.943  -2.711  18.100  1.00 9.45  ? 554  GLY A N   1 
ATOM   4038  C CA  . GLY A 1 554 ? 25.680  -4.130  18.261  1.00 10.89 ? 554  GLY A CA  1 
ATOM   4039  C C   . GLY A 1 554 ? 24.709  -4.412  19.398  1.00 11.93 ? 554  GLY A C   1 
ATOM   4040  O O   . GLY A 1 554 ? 23.824  -5.260  19.269  1.00 13.33 ? 554  GLY A O   1 
ATOM   4041  N N   . ALA A 1 555 ? 24.826  -3.633  20.475  1.00 11.92 ? 555  ALA A N   1 
ATOM   4042  C CA  . ALA A 1 555 ? 23.960  -3.771  21.645  1.00 13.17 ? 555  ALA A CA  1 
ATOM   4043  C C   . ALA A 1 555 ? 22.534  -3.291  21.361  1.00 13.79 ? 555  ALA A C   1 
ATOM   4044  O O   . ALA A 1 555 ? 21.570  -3.877  21.865  1.00 14.54 ? 555  ALA A O   1 
ATOM   4045  C CB  . ALA A 1 555 ? 24.550  -3.031  22.818  1.00 12.52 ? 555  ALA A CB  1 
ATOM   4046  N N   . ILE A 1 556 ? 22.407  -2.251  20.529  1.00 12.83 ? 556  ILE A N   1 
ATOM   4047  C CA  . ILE A 1 556 ? 21.096  -1.712  20.137  1.00 12.09 ? 556  ILE A CA  1 
ATOM   4048  C C   . ILE A 1 556 ? 20.355  -2.759  19.294  1.00 13.21 ? 556  ILE A C   1 
ATOM   4049  O O   . ILE A 1 556 ? 19.191  -3.052  19.560  1.00 12.59 ? 556  ILE A O   1 
ATOM   4050  C CB  . ILE A 1 556 ? 21.229  -0.359  19.359  1.00 13.27 ? 556  ILE A CB  1 
ATOM   4051  C CG1 . ILE A 1 556 ? 21.673  0.741   20.325  1.00 14.73 ? 556  ILE A CG1 1 
ATOM   4052  C CG2 . ILE A 1 556 ? 19.893  0.039   18.670  1.00 13.75 ? 556  ILE A CG2 1 
ATOM   4053  C CD1 . ILE A 1 556 ? 22.042  2.044   19.661  1.00 19.20 ? 556  ILE A CD1 1 
ATOM   4054  N N   . TRP A 1 557 ? 21.074  -3.373  18.350  1.00 12.69 ? 557  TRP A N   1 
ATOM   4055  C CA  . TRP A 1 557 ? 20.513  -4.400  17.468  1.00 12.65 ? 557  TRP A CA  1 
ATOM   4056  C C   . TRP A 1 557 ? 20.300  -5.747  18.160  1.00 12.41 ? 557  TRP A C   1 
ATOM   4057  O O   . TRP A 1 557 ? 19.546  -6.591  17.665  1.00 14.31 ? 557  TRP A O   1 
ATOM   4058  C CB  . TRP A 1 557 ? 21.378  -4.572  16.209  1.00 12.97 ? 557  TRP A CB  1 
ATOM   4059  C CG  . TRP A 1 557 ? 21.421  -3.345  15.328  1.00 11.01 ? 557  TRP A CG  1 
ATOM   4060  C CD1 . TRP A 1 557 ? 20.397  -2.462  15.089  1.00 11.34 ? 557  TRP A CD1 1 
ATOM   4061  C CD2 . TRP A 1 557 ? 22.551  -2.851  14.601  1.00 11.01 ? 557  TRP A CD2 1 
ATOM   4062  N NE1 . TRP A 1 557 ? 20.821  -1.447  14.267  1.00 11.56 ? 557  TRP A NE1 1 
ATOM   4063  C CE2 . TRP A 1 557 ? 22.136  -1.655  13.946  1.00 11.17 ? 557  TRP A CE2 1 
ATOM   4064  C CE3 . TRP A 1 557 ? 23.881  -3.295  14.437  1.00 12.60 ? 557  TRP A CE3 1 
ATOM   4065  C CZ2 . TRP A 1 557 ? 23.008  -0.890  13.135  1.00 11.52 ? 557  TRP A CZ2 1 
ATOM   4066  C CZ3 . TRP A 1 557 ? 24.758  -2.531  13.625  1.00 10.83 ? 557  TRP A CZ3 1 
ATOM   4067  C CH2 . TRP A 1 557 ? 24.310  -1.340  12.986  1.00 11.88 ? 557  TRP A CH2 1 
ATOM   4068  N N   . GLY A 1 558 ? 20.959  -5.920  19.306  1.00 12.10 ? 558  GLY A N   1 
ATOM   4069  C CA  . GLY A 1 558 ? 20.844  -7.141  20.091  1.00 13.10 ? 558  GLY A CA  1 
ATOM   4070  C C   . GLY A 1 558 ? 21.671  -8.309  19.596  1.00 12.70 ? 558  GLY A C   1 
ATOM   4071  O O   . GLY A 1 558 ? 21.423  -9.451  19.987  1.00 13.43 ? 558  GLY A O   1 
ATOM   4072  N N   . ILE A 1 559 ? 22.665  -8.024  18.756  1.00 12.46 ? 559  ILE A N   1 
ATOM   4073  C CA  . ILE A 1 559 ? 23.537  -9.056  18.196  1.00 11.53 ? 559  ILE A CA  1 
ATOM   4074  C C   . ILE A 1 559 ? 24.820  -9.236  19.013  1.00 12.11 ? 559  ILE A C   1 
ATOM   4075  O O   . ILE A 1 559 ? 25.102  -8.449  19.922  1.00 12.39 ? 559  ILE A O   1 
ATOM   4076  C CB  . ILE A 1 559 ? 23.896  -8.746  16.703  1.00 12.42 ? 559  ILE A CB  1 
ATOM   4077  C CG1 . ILE A 1 559 ? 24.593  -7.382  16.585  1.00 12.60 ? 559  ILE A CG1 1 
ATOM   4078  C CG2 . ILE A 1 559 ? 22.632  -8.800  15.840  1.00 12.16 ? 559  ILE A CG2 1 
ATOM   4079  C CD1 . ILE A 1 559 ? 25.234  -7.094  15.244  1.00 15.24 ? 559  ILE A CD1 1 
ATOM   4080  N N   . ASP A 1 560 ? 25.564  -10.296 18.702  1.00 11.39 ? 560  ASP A N   1 
ATOM   4081  C CA  . ASP A 1 560 ? 26.844  -10.588 19.351  1.00 11.75 ? 560  ASP A CA  1 
ATOM   4082  C C   . ASP A 1 560 ? 27.920  -10.011 18.421  1.00 11.59 ? 560  ASP A C   1 
ATOM   4083  O O   . ASP A 1 560 ? 28.253  -10.604 17.394  1.00 12.47 ? 560  ASP A O   1 
ATOM   4084  C CB  . ASP A 1 560 ? 27.025  -12.109 19.525  1.00 12.88 ? 560  ASP A CB  1 
ATOM   4085  C CG  . ASP A 1 560 ? 28.274  -12.488 20.340  1.00 14.65 ? 560  ASP A CG  1 
ATOM   4086  O OD1 . ASP A 1 560 ? 29.209  -11.670 20.485  1.00 14.46 ? 560  ASP A OD1 1 
ATOM   4087  O OD2 . ASP A 1 560 ? 28.329  -13.637 20.824  1.00 14.65 ? 560  ASP A OD2 1 
ATOM   4088  N N   . SER A 1 561 ? 28.458  -8.856  18.813  1.00 12.13 ? 561  SER A N   1 
ATOM   4089  C CA  . SER A 1 561 ? 29.494  -8.157  18.050  1.00 11.29 ? 561  SER A CA  1 
ATOM   4090  C C   . SER A 1 561 ? 30.870  -8.793  18.242  1.00 12.44 ? 561  SER A C   1 
ATOM   4091  O O   . SER A 1 561 ? 31.882  -8.288  17.738  1.00 12.99 ? 561  SER A O   1 
ATOM   4092  C CB  . SER A 1 561 ? 29.633  -6.711  18.542  1.00 12.16 ? 561  SER A CB  1 
ATOM   4093  O OG  . SER A 1 561 ? 28.396  -6.028  18.401  1.00 11.08 ? 561  SER A OG  1 
ATOM   4094  N N   . TYR A 1 562 ? 30.929  -9.921  18.942  1.00 9.91  ? 562  TYR A N   1 
ATOM   4095  C CA  . TYR A 1 562 ? 32.248  -10.444 19.316  1.00 11.25 ? 562  TYR A CA  1 
ATOM   4096  C C   . TYR A 1 562 ? 32.601  -11.823 18.802  1.00 9.57  ? 562  TYR A C   1 
ATOM   4097  O O   . TYR A 1 562 ? 33.709  -12.313 19.045  1.00 12.17 ? 562  TYR A O   1 
ATOM   4098  C CB  . TYR A 1 562 ? 32.393  -10.313 20.819  1.00 10.22 ? 562  TYR A CB  1 
ATOM   4099  C CG  . TYR A 1 562 ? 32.206  -8.844  21.202  1.00 10.99 ? 562  TYR A CG  1 
ATOM   4100  C CD1 . TYR A 1 562 ? 33.183  -7.899  20.850  1.00 9.77  ? 562  TYR A CD1 1 
ATOM   4101  C CD2 . TYR A 1 562 ? 31.052  -8.432  21.873  1.00 10.66 ? 562  TYR A CD2 1 
ATOM   4102  C CE1 . TYR A 1 562 ? 32.992  -6.544  21.156  1.00 13.00 ? 562  TYR A CE1 1 
ATOM   4103  C CE2 . TYR A 1 562 ? 30.857  -7.078  22.173  1.00 12.49 ? 562  TYR A CE2 1 
ATOM   4104  C CZ  . TYR A 1 562 ? 31.825  -6.133  21.811  1.00 11.49 ? 562  TYR A CZ  1 
ATOM   4105  O OH  . TYR A 1 562 ? 31.629  -4.817  22.091  1.00 12.70 ? 562  TYR A OH  1 
ATOM   4106  N N   . ASP A 1 563 ? 31.686  -12.417 18.044  1.00 10.83 ? 563  ASP A N   1 
ATOM   4107  C CA  . ASP A 1 563 ? 31.920  -13.720 17.435  1.00 10.02 ? 563  ASP A CA  1 
ATOM   4108  C C   . ASP A 1 563 ? 32.089  -13.557 15.918  1.00 11.69 ? 563  ASP A C   1 
ATOM   4109  O O   . ASP A 1 563 ? 32.007  -12.439 15.397  1.00 11.23 ? 563  ASP A O   1 
ATOM   4110  C CB  . ASP A 1 563 ? 30.796  -14.718 17.786  1.00 11.64 ? 563  ASP A CB  1 
ATOM   4111  C CG  . ASP A 1 563 ? 29.410  -14.277 17.303  1.00 12.52 ? 563  ASP A CG  1 
ATOM   4112  O OD1 . ASP A 1 563 ? 29.284  -13.376 16.453  1.00 13.36 ? 563  ASP A OD1 1 
ATOM   4113  O OD2 . ASP A 1 563 ? 28.420  -14.865 17.769  1.00 13.31 ? 563  ASP A OD2 1 
ATOM   4114  N N   . GLN A 1 564 ? 32.375  -14.664 15.232  1.00 10.93 ? 564  GLN A N   1 
ATOM   4115  C CA  . GLN A 1 564 ? 32.570  -14.674 13.782  1.00 12.00 ? 564  GLN A CA  1 
ATOM   4116  C C   . GLN A 1 564 ? 32.313  -16.058 13.181  1.00 11.46 ? 564  GLN A C   1 
ATOM   4117  O O   . GLN A 1 564 ? 33.186  -16.666 12.558  1.00 13.05 ? 564  GLN A O   1 
ATOM   4118  C CB  . GLN A 1 564 ? 33.964  -14.117 13.373  1.00 12.35 ? 564  GLN A CB  1 
ATOM   4119  C CG  . GLN A 1 564 ? 35.216  -14.781 13.995  1.00 13.59 ? 564  GLN A CG  1 
ATOM   4120  C CD  . GLN A 1 564 ? 35.412  -14.448 15.459  1.00 13.16 ? 564  GLN A CD  1 
ATOM   4121  O OE1 . GLN A 1 564 ? 35.288  -13.290 15.870  1.00 13.35 ? 564  GLN A OE1 1 
ATOM   4122  N NE2 . GLN A 1 564 ? 35.663  -15.469 16.266  1.00 15.64 ? 564  GLN A NE2 1 
ATOM   4123  N N   . TRP A 1 565 ? 31.075  -16.526 13.328  1.00 12.30 ? 565  TRP A N   1 
ATOM   4124  C CA  . TRP A 1 565 ? 30.671  -17.836 12.810  1.00 12.72 ? 565  TRP A CA  1 
ATOM   4125  C C   . TRP A 1 565 ? 30.565  -17.872 11.284  1.00 13.06 ? 565  TRP A C   1 
ATOM   4126  O O   . TRP A 1 565 ? 30.638  -18.941 10.678  1.00 12.73 ? 565  TRP A O   1 
ATOM   4127  C CB  . TRP A 1 565 ? 29.334  -18.276 13.427  1.00 13.43 ? 565  TRP A CB  1 
ATOM   4128  C CG  . TRP A 1 565 ? 29.365  -18.449 14.924  1.00 14.18 ? 565  TRP A CG  1 
ATOM   4129  C CD1 . TRP A 1 565 ? 28.948  -17.543 15.856  1.00 13.95 ? 565  TRP A CD1 1 
ATOM   4130  C CD2 . TRP A 1 565 ? 29.863  -19.578 15.659  1.00 16.79 ? 565  TRP A CD2 1 
ATOM   4131  N NE1 . TRP A 1 565 ? 29.161  -18.026 17.127  1.00 15.90 ? 565  TRP A NE1 1 
ATOM   4132  C CE2 . TRP A 1 565 ? 29.721  -19.273 17.041  1.00 17.10 ? 565  TRP A CE2 1 
ATOM   4133  C CE3 . TRP A 1 565 ? 30.421  -20.822 15.288  1.00 18.08 ? 565  TRP A CE3 1 
ATOM   4134  C CZ2 . TRP A 1 565 ? 30.120  -20.169 18.065  1.00 19.18 ? 565  TRP A CZ2 1 
ATOM   4135  C CZ3 . TRP A 1 565 ? 30.824  -21.724 16.313  1.00 20.15 ? 565  TRP A CZ3 1 
ATOM   4136  C CH2 . TRP A 1 565 ? 30.667  -21.383 17.685  1.00 20.56 ? 565  TRP A CH2 1 
ATOM   4137  N N   . GLY A 1 566 ? 30.460  -16.686 10.682  1.00 13.37 ? 566  GLY A N   1 
ATOM   4138  C CA  . GLY A 1 566 ? 30.336  -16.543 9.239   1.00 14.11 ? 566  GLY A CA  1 
ATOM   4139  C C   . GLY A 1 566 ? 31.516  -16.898 8.360   1.00 15.06 ? 566  GLY A C   1 
ATOM   4140  O O   . GLY A 1 566 ? 31.367  -16.987 7.141   1.00 16.04 ? 566  GLY A O   1 
ATOM   4141  N N   . VAL A 1 567 ? 32.675  -17.122 8.972   1.00 15.46 ? 567  VAL A N   1 
ATOM   4142  C CA  . VAL A 1 567 ? 33.874  -17.475 8.224   1.00 16.36 ? 567  VAL A CA  1 
ATOM   4143  C C   . VAL A 1 567 ? 34.070  -18.993 8.117   1.00 16.82 ? 567  VAL A C   1 
ATOM   4144  O O   . VAL A 1 567 ? 34.884  -19.458 7.318   1.00 15.74 ? 567  VAL A O   1 
ATOM   4145  C CB  . VAL A 1 567 ? 35.150  -16.805 8.836   1.00 17.08 ? 567  VAL A CB  1 
ATOM   4146  C CG1 . VAL A 1 567 ? 34.921  -15.306 9.032   1.00 19.20 ? 567  VAL A CG1 1 
ATOM   4147  C CG2 . VAL A 1 567 ? 35.557  -17.465 10.154  1.00 17.74 ? 567  VAL A CG2 1 
ATOM   4148  N N   . GLU A 1 568 ? 33.270  -19.749 8.877   1.00 16.46 ? 568  GLU A N   1 
ATOM   4149  C CA  . GLU A 1 568 ? 33.372  -21.213 8.914   1.00 17.06 ? 568  GLU A CA  1 
ATOM   4150  C C   . GLU A 1 568 ? 33.064  -22.003 7.646   1.00 15.73 ? 568  GLU A C   1 
ATOM   4151  O O   . GLU A 1 568 ? 33.819  -22.914 7.311   1.00 16.81 ? 568  GLU A O   1 
ATOM   4152  C CB  . GLU A 1 568 ? 32.577  -21.793 10.088  1.00 19.18 ? 568  GLU A CB  1 
ATOM   4153  C CG  . GLU A 1 568 ? 33.145  -21.451 11.465  1.00 23.89 ? 568  GLU A CG  1 
ATOM   4154  C CD  . GLU A 1 568 ? 32.838  -22.508 12.525  1.00 27.82 ? 568  GLU A CD  1 
ATOM   4155  O OE1 . GLU A 1 568 ? 31.703  -23.034 12.565  1.00 28.71 ? 568  GLU A OE1 1 
ATOM   4156  O OE2 . GLU A 1 568 ? 33.747  -22.812 13.327  1.00 31.22 ? 568  GLU A OE2 1 
ATOM   4157  N N   . LEU A 1 569 ? 31.994  -21.647 6.928   1.00 14.39 ? 569  LEU A N   1 
ATOM   4158  C CA  . LEU A 1 569 ? 31.614  -22.370 5.705   1.00 13.66 ? 569  LEU A CA  1 
ATOM   4159  C C   . LEU A 1 569 ? 32.665  -22.320 4.598   1.00 14.24 ? 569  LEU A C   1 
ATOM   4160  O O   . LEU A 1 569 ? 32.970  -23.351 3.993   1.00 14.17 ? 569  LEU A O   1 
ATOM   4161  C CB  . LEU A 1 569 ? 30.267  -21.891 5.166   1.00 13.84 ? 569  LEU A CB  1 
ATOM   4162  C CG  . LEU A 1 569 ? 29.635  -22.678 4.012   1.00 14.37 ? 569  LEU A CG  1 
ATOM   4163  C CD1 . LEU A 1 569 ? 29.339  -24.131 4.391   1.00 12.96 ? 569  LEU A CD1 1 
ATOM   4164  C CD2 . LEU A 1 569 ? 28.389  -21.975 3.582   1.00 14.23 ? 569  LEU A CD2 1 
ATOM   4165  N N   . GLY A 1 570 ? 33.249  -21.138 4.389   1.00 13.04 ? 570  GLY A N   1 
ATOM   4166  C CA  . GLY A 1 570 ? 34.282  -20.957 3.378   1.00 13.57 ? 570  GLY A CA  1 
ATOM   4167  C C   . GLY A 1 570 ? 35.526  -21.778 3.686   1.00 13.93 ? 570  GLY A C   1 
ATOM   4168  O O   . GLY A 1 570 ? 36.129  -22.345 2.777   1.00 13.44 ? 570  GLY A O   1 
ATOM   4169  N N   . LYS A 1 571 ? 35.849  -21.902 4.977   1.00 13.88 ? 571  LYS A N   1 
ATOM   4170  C CA  . LYS A 1 571 ? 37.007  -22.679 5.434   1.00 13.82 ? 571  LYS A CA  1 
ATOM   4171  C C   . LYS A 1 571 ? 36.801  -24.181 5.238   1.00 14.04 ? 571  LYS A C   1 
ATOM   4172  O O   . LYS A 1 571 ? 37.707  -24.872 4.767   1.00 15.42 ? 571  LYS A O   1 
ATOM   4173  C CB  . LYS A 1 571 ? 37.315  -22.403 6.910   1.00 15.62 ? 571  LYS A CB  1 
ATOM   4174  C CG  . LYS A 1 571 ? 37.631  -20.954 7.229   1.00 16.74 ? 571  LYS A CG  1 
ATOM   4175  C CD  . LYS A 1 571 ? 38.369  -20.840 8.550   1.00 19.54 ? 571  LYS A CD  1 
ATOM   4176  C CE  . LYS A 1 571 ? 38.911  -19.435 8.755   1.00 20.10 ? 571  LYS A CE  1 
ATOM   4177  N NZ  . LYS A 1 571 ? 39.191  -19.157 10.194  1.00 22.29 ? 571  LYS A NZ  1 
ATOM   4178  N N   . VAL A 1 572 ? 35.596  -24.661 5.560   1.00 14.12 ? 572  VAL A N   1 
ATOM   4179  C CA  . VAL A 1 572 ? 35.236  -26.083 5.427   1.00 14.95 ? 572  VAL A CA  1 
ATOM   4180  C C   . VAL A 1 572 ? 35.194  -26.509 3.953   1.00 14.70 ? 572  VAL A C   1 
ATOM   4181  O O   . VAL A 1 572 ? 35.739  -27.559 3.589   1.00 15.37 ? 572  VAL A O   1 
ATOM   4182  C CB  . VAL A 1 572 ? 33.869  -26.400 6.136   1.00 16.36 ? 572  VAL A CB  1 
ATOM   4183  C CG1 . VAL A 1 572 ? 33.355  -27.805 5.782   1.00 18.97 ? 572  VAL A CG1 1 
ATOM   4184  C CG2 . VAL A 1 572 ? 34.029  -26.318 7.634   1.00 17.54 ? 572  VAL A CG2 1 
ATOM   4185  N N   . LEU A 1 573 ? 34.580  -25.681 3.107   1.00 14.15 ? 573  LEU A N   1 
ATOM   4186  C CA  . LEU A 1 573 ? 34.496  -25.992 1.680   1.00 13.49 ? 573  LEU A CA  1 
ATOM   4187  C C   . LEU A 1 573 ? 35.860  -25.878 0.984   1.00 13.79 ? 573  LEU A C   1 
ATOM   4188  O O   . LEU A 1 573 ? 36.114  -26.556 -0.010  1.00 14.23 ? 573  LEU A O   1 
ATOM   4189  C CB  . LEU A 1 573 ? 33.428  -25.137 0.982   1.00 15.01 ? 573  LEU A CB  1 
ATOM   4190  C CG  . LEU A 1 573 ? 31.972  -25.428 1.395   1.00 15.65 ? 573  LEU A CG  1 
ATOM   4191  C CD1 . LEU A 1 573 ? 30.999  -24.476 0.717   1.00 16.81 ? 573  LEU A CD1 1 
ATOM   4192  C CD2 . LEU A 1 573 ? 31.531  -26.836 1.031   1.00 18.19 ? 573  LEU A CD2 1 
ATOM   4193  N N   . ALA A 1 574 ? 36.757  -25.043 1.511   1.00 13.23 ? 574  ALA A N   1 
ATOM   4194  C CA  . ALA A 1 574 ? 38.094  -24.930 0.905   1.00 13.77 ? 574  ALA A CA  1 
ATOM   4195  C C   . ALA A 1 574 ? 38.915  -26.177 1.231   1.00 13.77 ? 574  ALA A C   1 
ATOM   4196  O O   . ALA A 1 574 ? 39.657  -26.701 0.395   1.00 14.22 ? 574  ALA A O   1 
ATOM   4197  C CB  . ALA A 1 574 ? 38.816  -23.674 1.393   1.00 13.73 ? 574  ALA A CB  1 
ATOM   4198  N N   . LYS A 1 575 ? 38.745  -26.660 2.459   1.00 15.10 ? 575  LYS A N   1 
ATOM   4199  C CA  . LYS A 1 575 ? 39.440  -27.855 2.937   1.00 16.14 ? 575  LYS A CA  1 
ATOM   4200  C C   . LYS A 1 575 ? 39.015  -29.091 2.148   1.00 16.41 ? 575  LYS A C   1 
ATOM   4201  O O   . LYS A 1 575 ? 39.812  -30.002 1.938   1.00 16.76 ? 575  LYS A O   1 
ATOM   4202  C CB  . LYS A 1 575 ? 39.150  -28.053 4.402   1.00 18.84 ? 575  LYS A CB  1 
ATOM   4203  C CG  . LYS A 1 575 ? 40.123  -27.344 5.351   1.00 24.35 ? 575  LYS A CG  1 
ATOM   4204  C CD  . LYS A 1 575 ? 39.822  -27.583 6.837   1.00 28.46 ? 575  LYS A CD  1 
ATOM   4205  C CE  . LYS A 1 575 ? 39.767  -29.064 7.216   1.00 31.31 ? 575  LYS A CE  1 
ATOM   4206  N NZ  . LYS A 1 575 ? 39.638  -29.974 6.057   1.00 35.87 ? 575  LYS A NZ  1 
ATOM   4207  N N   . SER A 1 576 ? 37.772  -29.073 1.663   1.00 15.29 ? 576  SER A N   1 
ATOM   4208  C CA  . SER A 1 576 ? 37.207  -30.169 0.872   1.00 15.96 ? 576  SER A CA  1 
ATOM   4209  C C   . SER A 1 576 ? 37.686  -30.108 -0.584  1.00 15.18 ? 576  SER A C   1 
ATOM   4210  O O   . SER A 1 576 ? 37.880  -31.145 -1.228  1.00 16.61 ? 576  SER A O   1 
ATOM   4211  C CB  . SER A 1 576 ? 35.674  -30.129 0.931   1.00 15.92 ? 576  SER A CB  1 
ATOM   4212  O OG  . SER A 1 576 ? 35.102  -31.263 0.302   1.00 21.45 ? 576  SER A OG  1 
ATOM   4213  N N   . ILE A 1 577 ? 37.903  -28.888 -1.081  1.00 13.99 ? 577  ILE A N   1 
ATOM   4214  C CA  . ILE A 1 577 ? 38.365  -28.659 -2.453  1.00 13.28 ? 577  ILE A CA  1 
ATOM   4215  C C   . ILE A 1 577 ? 39.876  -28.842 -2.623  1.00 13.50 ? 577  ILE A C   1 
ATOM   4216  O O   . ILE A 1 577 ? 40.315  -29.301 -3.675  1.00 14.11 ? 577  ILE A O   1 
ATOM   4217  C CB  . ILE A 1 577 ? 37.885  -27.252 -2.980  1.00 13.33 ? 577  ILE A CB  1 
ATOM   4218  C CG1 . ILE A 1 577 ? 36.375  -27.302 -3.216  1.00 12.77 ? 577  ILE A CG1 1 
ATOM   4219  C CG2 . ILE A 1 577 ? 38.590  -26.837 -4.296  1.00 12.05 ? 577  ILE A CG2 1 
ATOM   4220  C CD1 . ILE A 1 577 ? 35.739  -25.979 -3.594  1.00 13.90 ? 577  ILE A CD1 1 
ATOM   4221  N N   . LEU A 1 578 ? 40.655  -28.560 -1.572  1.00 14.20 ? 578  LEU A N   1 
ATOM   4222  C CA  . LEU A 1 578 ? 42.119  -28.683 -1.633  1.00 14.01 ? 578  LEU A CA  1 
ATOM   4223  C C   . LEU A 1 578 ? 42.681  -30.021 -2.177  1.00 15.34 ? 578  LEU A C   1 
ATOM   4224  O O   . LEU A 1 578 ? 43.519  -29.981 -3.086  1.00 15.14 ? 578  LEU A O   1 
ATOM   4225  C CB  . LEU A 1 578 ? 42.781  -28.255 -0.303  1.00 15.47 ? 578  LEU A CB  1 
ATOM   4226  C CG  . LEU A 1 578 ? 44.316  -28.201 -0.201  1.00 15.31 ? 578  LEU A CG  1 
ATOM   4227  C CD1 . LEU A 1 578 ? 44.900  -27.285 -1.268  1.00 16.12 ? 578  LEU A CD1 1 
ATOM   4228  C CD2 . LEU A 1 578 ? 44.733  -27.754 1.184   1.00 19.10 ? 578  LEU A CD2 1 
ATOM   4229  N N   . PRO A 1 579 ? 42.194  -31.200 -1.691  1.00 16.06 ? 579  PRO A N   1 
ATOM   4230  C CA  . PRO A 1 579 ? 42.747  -32.449 -2.243  1.00 17.22 ? 579  PRO A CA  1 
ATOM   4231  C C   . PRO A 1 579 ? 42.279  -32.777 -3.673  1.00 17.47 ? 579  PRO A C   1 
ATOM   4232  O O   . PRO A 1 579 ? 42.764  -33.729 -4.286  1.00 18.70 ? 579  PRO A O   1 
ATOM   4233  C CB  . PRO A 1 579 ? 42.283  -33.501 -1.233  1.00 18.03 ? 579  PRO A CB  1 
ATOM   4234  C CG  . PRO A 1 579 ? 40.989  -32.963 -0.758  1.00 18.95 ? 579  PRO A CG  1 
ATOM   4235  C CD  . PRO A 1 579 ? 41.334  -31.518 -0.530  1.00 17.67 ? 579  PRO A CD  1 
ATOM   4236  N N   . GLN A 1 580 ? 41.349  -31.971 -4.189  1.00 15.85 ? 580  GLN A N   1 
ATOM   4237  C CA  . GLN A 1 580 ? 40.812  -32.131 -5.543  1.00 15.10 ? 580  GLN A CA  1 
ATOM   4238  C C   . GLN A 1 580 ? 41.590  -31.294 -6.557  1.00 14.37 ? 580  GLN A C   1 
ATOM   4239  O O   . GLN A 1 580 ? 41.376  -31.420 -7.766  1.00 14.13 ? 580  GLN A O   1 
ATOM   4240  C CB  . GLN A 1 580 ? 39.333  -31.737 -5.594  1.00 16.19 ? 580  GLN A CB  1 
ATOM   4241  C CG  . GLN A 1 580 ? 38.421  -32.509 -4.654  1.00 15.68 ? 580  GLN A CG  1 
ATOM   4242  C CD  . GLN A 1 580 ? 36.951  -32.291 -4.951  1.00 18.88 ? 580  GLN A CD  1 
ATOM   4243  O OE1 . GLN A 1 580 ? 36.488  -31.152 -5.073  1.00 18.29 ? 580  GLN A OE1 1 
ATOM   4244  N NE2 . GLN A 1 580 ? 36.212  -33.384 -5.103  1.00 18.57 ? 580  GLN A NE2 1 
ATOM   4245  N N   . LEU A 1 581 ? 42.475  -30.423 -6.065  1.00 15.09 ? 581  LEU A N   1 
ATOM   4246  C CA  . LEU A 1 581 ? 43.277  -29.574 -6.945  1.00 15.48 ? 581  LEU A CA  1 
ATOM   4247  C C   . LEU A 1 581 ? 44.606  -30.238 -7.303  1.00 16.64 ? 581  LEU A C   1 
ATOM   4248  O O   . LEU A 1 581 ? 45.642  -29.988 -6.686  1.00 17.41 ? 581  LEU A O   1 
ATOM   4249  C CB  . LEU A 1 581 ? 43.484  -28.179 -6.332  1.00 15.41 ? 581  LEU A CB  1 
ATOM   4250  C CG  . LEU A 1 581 ? 42.230  -27.386 -5.939  1.00 15.65 ? 581  LEU A CG  1 
ATOM   4251  C CD1 . LEU A 1 581 ? 42.648  -25.999 -5.513  1.00 16.47 ? 581  LEU A CD1 1 
ATOM   4252  C CD2 . LEU A 1 581 ? 41.222  -27.290 -7.084  1.00 16.45 ? 581  LEU A CD2 1 
ATOM   4253  N N   . ARG A 1 582 ? 44.522  -31.182 -8.242  1.00 17.98 ? 582  ARG A N   1 
ATOM   4254  C CA  . ARG A 1 582 ? 45.672  -31.951 -8.734  1.00 19.05 ? 582  ARG A CA  1 
ATOM   4255  C C   . ARG A 1 582 ? 45.577  -31.959 -10.266 1.00 18.32 ? 582  ARG A C   1 
ATOM   4256  O O   . ARG A 1 582 ? 44.477  -32.079 -10.804 1.00 16.98 ? 582  ARG A O   1 
ATOM   4257  C CB  . ARG A 1 582 ? 45.611  -33.392 -8.193  1.00 20.44 ? 582  ARG A CB  1 
ATOM   4258  C CG  . ARG A 1 582 ? 45.689  -33.502 -6.670  1.00 26.36 ? 582  ARG A CG  1 
ATOM   4259  C CD  . ARG A 1 582 ? 45.286  -34.870 -6.183  1.00 29.13 ? 582  ARG A CD  1 
ATOM   4260  N NE  . ARG A 1 582 ? 46.423  -35.780 -6.137  1.00 34.12 ? 582  ARG A NE  1 
ATOM   4261  C CZ  . ARG A 1 582 ? 46.499  -36.850 -5.354  1.00 34.89 ? 582  ARG A CZ  1 
ATOM   4262  N NH1 . ARG A 1 582 ? 45.501  -37.170 -4.536  1.00 36.26 ? 582  ARG A NH1 1 
ATOM   4263  N NH2 . ARG A 1 582 ? 47.604  -37.582 -5.359  1.00 37.54 ? 582  ARG A NH2 1 
ATOM   4264  N N   . PRO A 1 583 ? 46.721  -31.834 -10.991 1.00 19.63 ? 583  PRO A N   1 
ATOM   4265  C CA  . PRO A 1 583 ? 46.718  -31.829 -12.464 1.00 19.47 ? 583  PRO A CA  1 
ATOM   4266  C C   . PRO A 1 583 ? 45.992  -33.007 -13.122 1.00 19.96 ? 583  PRO A C   1 
ATOM   4267  O O   . PRO A 1 583 ? 46.258  -34.168 -12.802 1.00 20.61 ? 583  PRO A O   1 
ATOM   4268  C CB  . PRO A 1 583 ? 48.206  -31.824 -12.807 1.00 21.11 ? 583  PRO A CB  1 
ATOM   4269  C CG  . PRO A 1 583 ? 48.795  -31.052 -11.693 1.00 21.86 ? 583  PRO A CG  1 
ATOM   4270  C CD  . PRO A 1 583 ? 48.099  -31.639 -10.493 1.00 20.36 ? 583  PRO A CD  1 
ATOM   4271  N N   . GLY A 1 584 ? 45.000  -32.675 -13.947 1.00 18.69 ? 584  GLY A N   1 
ATOM   4272  C CA  . GLY A 1 584 ? 44.219  -33.677 -14.652 1.00 18.48 ? 584  GLY A CA  1 
ATOM   4273  C C   . GLY A 1 584 ? 43.015  -34.250 -13.921 1.00 18.22 ? 584  GLY A C   1 
ATOM   4274  O O   . GLY A 1 584 ? 42.192  -34.922 -14.551 1.00 19.36 ? 584  GLY A O   1 
ATOM   4275  N N   . MET A 1 585 ? 42.891  -33.986 -12.619 1.00 17.42 ? 585  MET A N   1 
ATOM   4276  C CA  . MET A 1 585 ? 41.769  -34.499 -11.821 1.00 16.82 ? 585  MET A CA  1 
ATOM   4277  C C   . MET A 1 585 ? 40.435  -33.863 -12.204 1.00 18.26 ? 585  MET A C   1 
ATOM   4278  O O   . MET A 1 585 ? 40.370  -32.666 -12.494 1.00 17.28 ? 585  MET A O   1 
ATOM   4279  C CB  . MET A 1 585 ? 42.029  -34.325 -10.318 1.00 16.70 ? 585  MET A CB  1 
ATOM   4280  C CG  . MET A 1 585 ? 41.003  -35.025 -9.415  1.00 18.39 ? 585  MET A CG  1 
ATOM   4281  S SD  . MET A 1 585 ? 41.584  -35.307 -7.746  1.00 20.99 ? 585  MET A SD  1 
ATOM   4282  C CE  . MET A 1 585 ? 40.028  -35.712 -6.917  1.00 19.25 ? 585  MET A CE  1 
ATOM   4283  N N   . ARG A 1 586 ? 39.399  -34.701 -12.279 1.00 18.60 ? 586  ARG A N   1 
ATOM   4284  C CA  . ARG A 1 586 ? 38.047  -34.260 -12.620 1.00 21.08 ? 586  ARG A CA  1 
ATOM   4285  C C   . ARG A 1 586 ? 37.099  -34.521 -11.454 1.00 20.78 ? 586  ARG A C   1 
ATOM   4286  O O   . ARG A 1 586 ? 37.187  -35.562 -10.785 1.00 20.75 ? 586  ARG A O   1 
ATOM   4287  C CB  . ARG A 1 586 ? 37.536  -34.948 -13.899 1.00 23.88 ? 586  ARG A CB  1 
ATOM   4288  C CG  . ARG A 1 586 ? 38.403  -34.705 -15.141 1.00 28.01 ? 586  ARG A CG  1 
ATOM   4289  C CD  . ARG A 1 586 ? 37.674  -35.009 -16.449 1.00 32.61 ? 586  ARG A CD  1 
ATOM   4290  N NE  . ARG A 1 586 ? 36.734  -33.950 -16.832 1.00 36.23 ? 586  ARG A NE  1 
ATOM   4291  C CZ  . ARG A 1 586 ? 35.437  -34.129 -17.086 1.00 38.25 ? 586  ARG A CZ  1 
ATOM   4292  N NH1 . ARG A 1 586 ? 34.882  -35.336 -17.003 1.00 39.86 ? 586  ARG A NH1 1 
ATOM   4293  N NH2 . ARG A 1 586 ? 34.684  -33.088 -17.424 1.00 39.22 ? 586  ARG A NH2 1 
ATOM   4294  N N   . VAL A 1 587 ? 36.235  -33.543 -11.176 1.00 18.20 ? 587  VAL A N   1 
ATOM   4295  C CA  . VAL A 1 587 ? 35.261  -33.628 -10.085 1.00 17.41 ? 587  VAL A CA  1 
ATOM   4296  C C   . VAL A 1 587 ? 33.817  -33.516 -10.588 1.00 17.61 ? 587  VAL A C   1 
ATOM   4297  O O   . VAL A 1 587 ? 33.567  -32.948 -11.657 1.00 18.09 ? 587  VAL A O   1 
ATOM   4298  C CB  . VAL A 1 587 ? 35.518  -32.539 -8.986  1.00 16.51 ? 587  VAL A CB  1 
ATOM   4299  C CG1 . VAL A 1 587 ? 36.927  -32.654 -8.447  1.00 17.57 ? 587  VAL A CG1 1 
ATOM   4300  C CG2 . VAL A 1 587 ? 35.276  -31.127 -9.526  1.00 17.72 ? 587  VAL A CG2 1 
ATOM   4301  N N   . ASN A 1 588 ? 32.881  -34.039 -9.794  1.00 17.36 ? 588  ASN A N   1 
ATOM   4302  C CA  . ASN A 1 588 ? 31.451  -34.012 -10.121 1.00 18.11 ? 588  ASN A CA  1 
ATOM   4303  C C   . ASN A 1 588 ? 30.531  -33.876 -8.902  1.00 17.13 ? 588  ASN A C   1 
ATOM   4304  O O   . ASN A 1 588 ? 29.304  -33.878 -9.046  1.00 17.26 ? 588  ASN A O   1 
ATOM   4305  C CB  . ASN A 1 588 ? 31.046  -35.246 -10.967 1.00 19.79 ? 588  ASN A CB  1 
ATOM   4306  C CG  . ASN A 1 588 ? 31.404  -36.585 -10.306 1.00 22.30 ? 588  ASN A CG  1 
ATOM   4307  O OD1 . ASN A 1 588 ? 31.322  -36.747 -9.085  1.00 23.64 ? 588  ASN A OD1 1 
ATOM   4308  N ND2 . ASN A 1 588 ? 31.787  -37.555 -11.128 1.00 26.07 ? 588  ASN A ND2 1 
ATOM   4309  N N   . ASN A 1 589 ? 31.125  -33.701 -7.720  1.00 16.68 ? 589  ASN A N   1 
ATOM   4310  C CA  . ASN A 1 589 ? 30.368  -33.618 -6.464  1.00 16.73 ? 589  ASN A CA  1 
ATOM   4311  C C   . ASN A 1 589 ? 29.769  -32.265 -6.065  1.00 16.11 ? 589  ASN A C   1 
ATOM   4312  O O   . ASN A 1 589 ? 28.974  -32.191 -5.124  1.00 17.71 ? 589  ASN A O   1 
ATOM   4313  C CB  . ASN A 1 589 ? 31.201  -34.192 -5.302  1.00 16.56 ? 589  ASN A CB  1 
ATOM   4314  C CG  . ASN A 1 589 ? 32.427  -33.346 -4.973  1.00 17.17 ? 589  ASN A CG  1 
ATOM   4315  O OD1 . ASN A 1 589 ? 33.284  -33.121 -5.824  1.00 17.88 ? 589  ASN A OD1 1 
ATOM   4316  N ND2 . ASN A 1 589 ? 32.501  -32.868 -3.735  1.00 18.24 ? 589  ASN A ND2 1 
ATOM   4317  N N   . HIS A 1 590 ? 30.169  -31.202 -6.755  1.00 15.60 ? 590  HIS A N   1 
ATOM   4318  C CA  . HIS A 1 590 ? 29.658  -29.861 -6.461  1.00 15.82 ? 590  HIS A CA  1 
ATOM   4319  C C   . HIS A 1 590 ? 28.632  -29.485 -7.529  1.00 16.40 ? 590  HIS A C   1 
ATOM   4320  O O   . HIS A 1 590 ? 28.249  -30.318 -8.356  1.00 16.60 ? 590  HIS A O   1 
ATOM   4321  C CB  . HIS A 1 590 ? 30.789  -28.824 -6.516  1.00 16.29 ? 590  HIS A CB  1 
ATOM   4322  C CG  . HIS A 1 590 ? 32.034  -29.212 -5.783  1.00 15.81 ? 590  HIS A CG  1 
ATOM   4323  N ND1 . HIS A 1 590 ? 32.231  -28.927 -4.451  1.00 17.20 ? 590  HIS A ND1 1 
ATOM   4324  C CD2 . HIS A 1 590 ? 33.159  -29.837 -6.205  1.00 16.02 ? 590  HIS A CD2 1 
ATOM   4325  C CE1 . HIS A 1 590 ? 33.422  -29.361 -4.083  1.00 17.13 ? 590  HIS A CE1 1 
ATOM   4326  N NE2 . HIS A 1 590 ? 34.006  -29.918 -5.128  1.00 15.19 ? 590  HIS A NE2 1 
ATOM   4327  N N   . ASP A 1 591 ? 28.217  -28.216 -7.519  1.00 16.06 ? 591  ASP A N   1 
ATOM   4328  C CA  . ASP A 1 591 ? 27.290  -27.662 -8.514  1.00 14.62 ? 591  ASP A CA  1 
ATOM   4329  C C   . ASP A 1 591 ? 28.077  -27.565 -9.835  1.00 13.86 ? 591  ASP A C   1 
ATOM   4330  O O   . ASP A 1 591 ? 29.314  -27.558 -9.803  1.00 14.97 ? 591  ASP A O   1 
ATOM   4331  C CB  . ASP A 1 591 ? 26.800  -26.277 -8.067  1.00 15.45 ? 591  ASP A CB  1 
ATOM   4332  C CG  . ASP A 1 591 ? 27.940  -25.278 -7.865  1.00 15.43 ? 591  ASP A CG  1 
ATOM   4333  O OD1 . ASP A 1 591 ? 28.335  -24.634 -8.853  1.00 16.15 ? 591  ASP A OD1 1 
ATOM   4334  O OD2 . ASP A 1 591 ? 28.446  -25.149 -6.731  1.00 17.41 ? 591  ASP A OD2 1 
ATOM   4335  N N   . SER A 1 592 ? 27.384  -27.421 -10.965 1.00 13.22 ? 592  SER A N   1 
ATOM   4336  C CA  . SER A 1 592 ? 28.053  -27.367 -12.276 1.00 14.01 ? 592  SER A CA  1 
ATOM   4337  C C   . SER A 1 592 ? 29.059  -26.238 -12.513 1.00 13.58 ? 592  SER A C   1 
ATOM   4338  O O   . SER A 1 592 ? 29.995  -26.403 -13.294 1.00 13.40 ? 592  SER A O   1 
ATOM   4339  C CB  . SER A 1 592 ? 27.044  -27.440 -13.426 1.00 15.23 ? 592  SER A CB  1 
ATOM   4340  O OG  . SER A 1 592 ? 26.194  -26.309 -13.462 1.00 15.29 ? 592  SER A OG  1 
ATOM   4341  N N   . SER A 1 593 ? 28.874  -25.113 -11.817 1.00 13.56 ? 593  SER A N   1 
ATOM   4342  C CA  . SER A 1 593 ? 29.786  -23.969 -11.928 1.00 12.97 ? 593  SER A CA  1 
ATOM   4343  C C   . SER A 1 593 ? 31.112  -24.300 -11.255 1.00 13.24 ? 593  SER A C   1 
ATOM   4344  O O   . SER A 1 593 ? 32.158  -24.237 -11.895 1.00 12.60 ? 593  SER A O   1 
ATOM   4345  C CB  . SER A 1 593 ? 29.175  -22.725 -11.282 1.00 13.83 ? 593  SER A CB  1 
ATOM   4346  O OG  . SER A 1 593 ? 30.110  -21.661 -11.197 1.00 12.90 ? 593  SER A OG  1 
ATOM   4347  N N   . THR A 1 594 ? 31.039  -24.725 -9.991  1.00 13.30 ? 594  THR A N   1 
ATOM   4348  C CA  . THR A 1 594 ? 32.218  -25.091 -9.197  1.00 11.78 ? 594  THR A CA  1 
ATOM   4349  C C   . THR A 1 594 ? 32.950  -26.281 -9.830  1.00 12.74 ? 594  THR A C   1 
ATOM   4350  O O   . THR A 1 594 ? 34.176  -26.268 -9.901  1.00 12.90 ? 594  THR A O   1 
ATOM   4351  C CB  . THR A 1 594 ? 31.828  -25.395 -7.731  1.00 12.67 ? 594  THR A CB  1 
ATOM   4352  O OG1 . THR A 1 594 ? 31.103  -24.284 -7.193  1.00 12.83 ? 594  THR A OG1 1 
ATOM   4353  C CG2 . THR A 1 594 ? 33.050  -25.638 -6.856  1.00 12.44 ? 594  THR A CG2 1 
ATOM   4354  N N   . ASN A 1 595 ? 32.191  -27.247 -10.364 1.00 13.03 ? 595  ASN A N   1 
ATOM   4355  C CA  . ASN A 1 595 ? 32.773  -28.419 -11.038 1.00 13.74 ? 595  ASN A CA  1 
ATOM   4356  C C   . ASN A 1 595 ? 33.557  -27.971 -12.270 1.00 13.60 ? 595  ASN A C   1 
ATOM   4357  O O   . ASN A 1 595 ? 34.724  -28.335 -12.430 1.00 14.05 ? 595  ASN A O   1 
ATOM   4358  C CB  . ASN A 1 595 ? 31.695  -29.413 -11.498 1.00 12.89 ? 595  ASN A CB  1 
ATOM   4359  C CG  . ASN A 1 595 ? 31.148  -30.277 -10.373 1.00 14.72 ? 595  ASN A CG  1 
ATOM   4360  O OD1 . ASN A 1 595 ? 31.748  -30.414 -9.305  1.00 14.30 ? 595  ASN A OD1 1 
ATOM   4361  N ND2 . ASN A 1 595 ? 30.011  -30.910 -10.636 1.00 14.67 ? 595  ASN A ND2 1 
ATOM   4362  N N   . GLY A 1 596 ? 32.930  -27.101 -13.073 1.00 13.30 ? 596  GLY A N   1 
ATOM   4363  C CA  . GLY A 1 596 ? 33.540  -26.579 -14.287 1.00 13.12 ? 596  GLY A CA  1 
ATOM   4364  C C   . GLY A 1 596 ? 34.789  -25.751 -14.040 1.00 13.49 ? 596  GLY A C   1 
ATOM   4365  O O   . GLY A 1 596 ? 35.756  -25.850 -14.791 1.00 13.69 ? 596  GLY A O   1 
ATOM   4366  N N   . LEU A 1 597 ? 34.776  -24.983 -12.951 1.00 13.12 ? 597  LEU A N   1 
ATOM   4367  C CA  . LEU A 1 597 ? 35.904  -24.140 -12.563 1.00 12.48 ? 597  LEU A CA  1 
ATOM   4368  C C   . LEU A 1 597 ? 37.104  -24.950 -12.073 1.00 12.60 ? 597  LEU A C   1 
ATOM   4369  O O   . LEU A 1 597 ? 38.230  -24.716 -12.514 1.00 12.60 ? 597  LEU A O   1 
ATOM   4370  C CB  . LEU A 1 597 ? 35.468  -23.130 -11.503 1.00 12.88 ? 597  LEU A CB  1 
ATOM   4371  C CG  . LEU A 1 597 ? 34.608  -21.967 -12.007 1.00 13.45 ? 597  LEU A CG  1 
ATOM   4372  C CD1 . LEU A 1 597 ? 34.030  -21.201 -10.827 1.00 12.61 ? 597  LEU A CD1 1 
ATOM   4373  C CD2 . LEU A 1 597 ? 35.429  -21.070 -12.915 1.00 13.86 ? 597  LEU A CD2 1 
ATOM   4374  N N   . ILE A 1 598 ? 36.844  -25.928 -11.197 1.00 13.68 ? 598  ILE A N   1 
ATOM   4375  C CA  . ILE A 1 598 ? 37.885  -26.814 -10.656 1.00 13.16 ? 598  ILE A CA  1 
ATOM   4376  C C   . ILE A 1 598 ? 38.489  -27.667 -11.782 1.00 12.00 ? 598  ILE A C   1 
ATOM   4377  O O   . ILE A 1 598 ? 39.710  -27.823 -11.848 1.00 12.33 ? 598  ILE A O   1 
ATOM   4378  C CB  . ILE A 1 598 ? 37.320  -27.742 -9.524  1.00 12.52 ? 598  ILE A CB  1 
ATOM   4379  C CG1 . ILE A 1 598 ? 36.972  -26.910 -8.286  1.00 13.64 ? 598  ILE A CG1 1 
ATOM   4380  C CG2 . ILE A 1 598 ? 38.332  -28.857 -9.138  1.00 14.53 ? 598  ILE A CG2 1 
ATOM   4381  C CD1 . ILE A 1 598 ? 36.176  -27.671 -7.231  1.00 13.02 ? 598  ILE A CD1 1 
ATOM   4382  N N   . ASN A 1 599 ? 37.632  -28.166 -12.678 1.00 13.58 ? 599  ASN A N   1 
ATOM   4383  C CA  . ASN A 1 599 ? 38.078  -28.993 -13.806 1.00 15.01 ? 599  ASN A CA  1 
ATOM   4384  C C   . ASN A 1 599 ? 38.961  -28.230 -14.778 1.00 14.71 ? 599  ASN A C   1 
ATOM   4385  O O   . ASN A 1 599 ? 39.984  -28.757 -15.204 1.00 15.69 ? 599  ASN A O   1 
ATOM   4386  C CB  . ASN A 1 599 ? 36.893  -29.642 -14.534 1.00 14.51 ? 599  ASN A CB  1 
ATOM   4387  C CG  . ASN A 1 599 ? 36.230  -30.735 -13.708 1.00 16.36 ? 599  ASN A CG  1 
ATOM   4388  O OD1 . ASN A 1 599 ? 36.783  -31.195 -12.710 1.00 17.37 ? 599  ASN A OD1 1 
ATOM   4389  N ND2 . ASN A 1 599 ? 35.031  -31.141 -14.112 1.00 16.99 ? 599  ASN A ND2 1 
ATOM   4390  N N   . MET A 1 600 ? 38.625  -26.959 -15.026 1.00 15.13 ? 600  MET A N   1 
ATOM   4391  C CA  . MET A 1 600 ? 39.408  -26.094 -15.919 1.00 15.26 ? 600  MET A CA  1 
ATOM   4392  C C   . MET A 1 600 ? 40.770  -25.775 -15.293 1.00 14.66 ? 600  MET A C   1 
ATOM   4393  O O   . MET A 1 600 ? 41.799  -25.741 -15.982 1.00 15.87 ? 600  MET A O   1 
ATOM   4394  C CB  . MET A 1 600 ? 38.660  -24.790 -16.213 1.00 17.48 ? 600  MET A CB  1 
ATOM   4395  C CG  . MET A 1 600 ? 39.368  -23.892 -17.220 1.00 20.41 ? 600  MET A CG  1 
ATOM   4396  S SD  . MET A 1 600 ? 38.474  -22.375 -17.588 1.00 22.42 ? 600  MET A SD  1 
ATOM   4397  C CE  . MET A 1 600 ? 37.064  -22.851 -18.599 1.00 23.58 ? 600  MET A CE  1 
ATOM   4398  N N   . PHE A 1 601 ? 40.762  -25.561 -13.975 1.00 13.79 ? 601  PHE A N   1 
ATOM   4399  C CA  . PHE A 1 601 ? 41.979  -25.253 -13.218 1.00 13.12 ? 601  PHE A CA  1 
ATOM   4400  C C   . PHE A 1 601 ? 42.963  -26.422 -13.271 1.00 12.72 ? 601  PHE A C   1 
ATOM   4401  O O   . PHE A 1 601 ? 44.169  -26.226 -13.418 1.00 13.84 ? 601  PHE A O   1 
ATOM   4402  C CB  . PHE A 1 601 ? 41.627  -24.947 -11.748 1.00 14.22 ? 601  PHE A CB  1 
ATOM   4403  C CG  . PHE A 1 601 ? 42.825  -24.637 -10.872 1.00 14.29 ? 601  PHE A CG  1 
ATOM   4404  C CD1 . PHE A 1 601 ? 43.494  -25.666 -10.191 1.00 14.74 ? 601  PHE A CD1 1 
ATOM   4405  C CD2 . PHE A 1 601 ? 43.290  -23.312 -10.721 1.00 13.82 ? 601  PHE A CD2 1 
ATOM   4406  C CE1 . PHE A 1 601 ? 44.604  -25.385 -9.367  1.00 13.95 ? 601  PHE A CE1 1 
ATOM   4407  C CE2 . PHE A 1 601 ? 44.395  -23.017 -9.903  1.00 14.71 ? 601  PHE A CE2 1 
ATOM   4408  C CZ  . PHE A 1 601 ? 45.056  -24.057 -9.222  1.00 15.47 ? 601  PHE A CZ  1 
ATOM   4409  N N   . ASN A 1 602 ? 42.418  -27.629 -13.130 1.00 14.30 ? 602  ASN A N   1 
ATOM   4410  C CA  . ASN A 1 602 ? 43.192  -28.866 -13.122 1.00 14.76 ? 602  ASN A CA  1 
ATOM   4411  C C   . ASN A 1 602 ? 43.766  -29.222 -14.480 1.00 16.18 ? 602  ASN A C   1 
ATOM   4412  O O   . ASN A 1 602 ? 44.822  -29.850 -14.572 1.00 16.25 ? 602  ASN A O   1 
ATOM   4413  C CB  . ASN A 1 602 ? 42.329  -30.017 -12.583 1.00 13.82 ? 602  ASN A CB  1 
ATOM   4414  C CG  . ASN A 1 602 ? 42.141  -29.949 -11.065 1.00 14.18 ? 602  ASN A CG  1 
ATOM   4415  O OD1 . ASN A 1 602 ? 42.880  -29.245 -10.382 1.00 13.55 ? 602  ASN A OD1 1 
ATOM   4416  N ND2 . ASN A 1 602 ? 41.164  -30.680 -10.537 1.00 13.49 ? 602  ASN A ND2 1 
ATOM   4417  N N   . GLU A 1 603 ? 43.074  -28.781 -15.528 1.00 18.11 ? 603  GLU A N   1 
ATOM   4418  C CA  . GLU A 1 603 ? 43.493  -29.029 -16.907 1.00 20.94 ? 603  GLU A CA  1 
ATOM   4419  C C   . GLU A 1 603 ? 44.697  -28.174 -17.297 1.00 21.35 ? 603  GLU A C   1 
ATOM   4420  O O   . GLU A 1 603 ? 45.547  -28.612 -18.070 1.00 22.15 ? 603  GLU A O   1 
ATOM   4421  C CB  . GLU A 1 603 ? 42.355  -28.706 -17.886 1.00 23.64 ? 603  GLU A CB  1 
ATOM   4422  C CG  . GLU A 1 603 ? 41.045  -29.431 -17.645 1.00 28.39 ? 603  GLU A CG  1 
ATOM   4423  C CD  . GLU A 1 603 ? 39.891  -28.924 -18.512 1.00 32.23 ? 603  GLU A CD  1 
ATOM   4424  O OE1 . GLU A 1 603 ? 40.025  -27.866 -19.173 1.00 32.58 ? 603  GLU A OE1 1 
ATOM   4425  O OE2 . GLU A 1 603 ? 38.832  -29.593 -18.525 1.00 34.63 ? 603  GLU A OE2 1 
ATOM   4426  N N   . LEU A 1 604 ? 44.754  -26.953 -16.752 1.00 21.44 ? 604  LEU A N   1 
ATOM   4427  C CA  . LEU A 1 604 ? 45.804  -25.990 -17.087 1.00 22.57 ? 604  LEU A CA  1 
ATOM   4428  C C   . LEU A 1 604 ? 46.795  -25.541 -16.004 1.00 24.15 ? 604  LEU A C   1 
ATOM   4429  O O   . LEU A 1 604 ? 47.659  -24.700 -16.287 1.00 24.66 ? 604  LEU A O   1 
ATOM   4430  C CB  . LEU A 1 604 ? 45.158  -24.754 -17.743 1.00 23.11 ? 604  LEU A CB  1 
ATOM   4431  C CG  . LEU A 1 604 ? 44.264  -24.993 -18.967 1.00 24.02 ? 604  LEU A CG  1 
ATOM   4432  C CD1 . LEU A 1 604 ? 43.312  -23.852 -19.160 1.00 24.96 ? 604  LEU A CD1 1 
ATOM   4433  C CD2 . LEU A 1 604 ? 45.098  -25.261 -20.210 1.00 24.99 ? 604  LEU A CD2 1 
ATOM   4434  N N   . SER A 1 605 ? 46.693  -26.085 -14.784 1.00 25.28 ? 605  SER A N   1 
ATOM   4435  C CA  . SER A 1 605 ? 47.608  -25.726 -13.677 1.00 29.01 ? 605  SER A CA  1 
ATOM   4436  C C   . SER A 1 605 ? 49.041  -26.132 -13.998 1.00 32.51 ? 605  SER A C   1 
ATOM   4437  O O   . SER A 1 605 ? 50.000  -25.426 -13.655 1.00 33.65 ? 605  SER A O   1 
ATOM   4438  C CB  . SER A 1 605 ? 47.152  -26.360 -12.354 1.00 27.91 ? 605  SER A CB  1 
ATOM   4439  O OG  . SER A 1 605 ? 47.014  -27.766 -12.471 1.00 27.60 ? 605  SER A OG  1 
ATOM   4440  N N   . HIS A 1 606 ? 49.133  -27.257 -14.706 1.00 35.91 ? 606  HIS A N   1 
ATOM   4441  C CA  . HIS A 1 606 ? 50.356  -27.881 -15.205 1.00 40.22 ? 606  HIS A CA  1 
ATOM   4442  C C   . HIS A 1 606 ? 49.890  -29.012 -16.137 1.00 41.65 ? 606  HIS A C   1 
ATOM   4443  O O   . HIS A 1 606 ? 48.867  -29.681 -15.843 1.00 43.22 ? 606  HIS A O   1 
ATOM   4444  C CB  . HIS A 1 606 ? 51.233  -28.444 -14.073 1.00 41.64 ? 606  HIS A CB  1 
ATOM   4445  C CG  . HIS A 1 606 ? 52.565  -28.949 -14.539 1.00 43.37 ? 606  HIS A CG  1 
ATOM   4446  N ND1 . HIS A 1 606 ? 52.760  -30.249 -14.955 1.00 44.15 ? 606  HIS A ND1 1 
ATOM   4447  C CD2 . HIS A 1 606 ? 53.757  -28.323 -14.692 1.00 44.19 ? 606  HIS A CD2 1 
ATOM   4448  C CE1 . HIS A 1 606 ? 54.012  -30.402 -15.347 1.00 44.45 ? 606  HIS A CE1 1 
ATOM   4449  N NE2 . HIS A 1 606 ? 54.639  -29.248 -15.198 1.00 44.42 ? 606  HIS A NE2 1 
ATOM   4450  N N   . GLY B 1 43  ? -8.807  -48.122 58.294  1.00 41.62 ? 43   GLY B N   1 
ATOM   4451  C CA  . GLY B 1 43  ? -7.508  -48.024 57.572  1.00 41.14 ? 43   GLY B CA  1 
ATOM   4452  C C   . GLY B 1 43  ? -7.527  -48.691 56.212  1.00 41.15 ? 43   GLY B C   1 
ATOM   4453  O O   . GLY B 1 43  ? -8.599  -48.971 55.664  1.00 41.92 ? 43   GLY B O   1 
ATOM   4454  N N   . ALA B 1 44  ? -6.337  -48.941 55.667  1.00 40.67 ? 44   ALA B N   1 
ATOM   4455  C CA  . ALA B 1 44  ? -6.177  -49.580 54.361  1.00 39.78 ? 44   ALA B CA  1 
ATOM   4456  C C   . ALA B 1 44  ? -5.776  -51.055 54.484  1.00 38.89 ? 44   ALA B C   1 
ATOM   4457  O O   . ALA B 1 44  ? -5.481  -51.536 55.586  1.00 39.63 ? 44   ALA B O   1 
ATOM   4458  C CB  . ALA B 1 44  ? -5.141  -48.815 53.533  1.00 39.89 ? 44   ALA B CB  1 
ATOM   4459  N N   . ASP B 1 45  ? -5.784  -51.762 53.351  1.00 37.24 ? 45   ASP B N   1 
ATOM   4460  C CA  . ASP B 1 45  ? -5.415  -53.185 53.285  1.00 35.18 ? 45   ASP B CA  1 
ATOM   4461  C C   . ASP B 1 45  ? -3.895  -53.344 53.299  1.00 32.96 ? 45   ASP B C   1 
ATOM   4462  O O   . ASP B 1 45  ? -3.169  -52.396 53.000  1.00 31.87 ? 45   ASP B O   1 
ATOM   4463  C CB  . ASP B 1 45  ? -5.980  -53.834 52.011  1.00 37.13 ? 45   ASP B CB  1 
ATOM   4464  C CG  . ASP B 1 45  ? -7.505  -53.802 51.946  1.00 38.58 ? 45   ASP B CG  1 
ATOM   4465  O OD1 . ASP B 1 45  ? -8.166  -53.371 52.920  1.00 40.22 ? 45   ASP B OD1 1 
ATOM   4466  O OD2 . ASP B 1 45  ? -8.050  -54.219 50.902  1.00 40.37 ? 45   ASP B OD2 1 
ATOM   4467  N N   . ALA B 1 46  ? -3.420  -54.540 53.647  1.00 30.67 ? 46   ALA B N   1 
ATOM   4468  C CA  . ALA B 1 46  ? -1.985  -54.820 53.702  1.00 28.06 ? 46   ALA B CA  1 
ATOM   4469  C C   . ALA B 1 46  ? -1.409  -55.224 52.345  1.00 26.59 ? 46   ALA B C   1 
ATOM   4470  O O   . ALA B 1 46  ? -2.040  -55.962 51.580  1.00 25.98 ? 46   ALA B O   1 
ATOM   4471  C CB  . ALA B 1 46  ? -1.697  -55.892 54.743  1.00 29.00 ? 46   ALA B CB  1 
ATOM   4472  N N   . ASP B 1 47  ? -0.215  -54.711 52.049  1.00 24.26 ? 47   ASP B N   1 
ATOM   4473  C CA  . ASP B 1 47  ? 0.495   -54.998 50.800  1.00 23.13 ? 47   ASP B CA  1 
ATOM   4474  C C   . ASP B 1 47  ? 1.085   -56.405 50.832  1.00 23.30 ? 47   ASP B C   1 
ATOM   4475  O O   . ASP B 1 47  ? 1.725   -56.796 51.807  1.00 23.78 ? 47   ASP B O   1 
ATOM   4476  C CB  . ASP B 1 47  ? 1.612   -53.963 50.580  1.00 22.41 ? 47   ASP B CB  1 
ATOM   4477  C CG  . ASP B 1 47  ? 2.419   -54.209 49.308  1.00 22.99 ? 47   ASP B CG  1 
ATOM   4478  O OD1 . ASP B 1 47  ? 1.813   -54.412 48.230  1.00 22.36 ? 47   ASP B OD1 1 
ATOM   4479  O OD2 . ASP B 1 47  ? 3.667   -54.204 49.394  1.00 21.13 ? 47   ASP B OD2 1 
ATOM   4480  N N   . THR B 1 48  ? 0.847   -57.150 49.755  1.00 23.17 ? 48   THR B N   1 
ATOM   4481  C CA  . THR B 1 48  ? 1.354   -58.513 49.620  1.00 24.25 ? 48   THR B CA  1 
ATOM   4482  C C   . THR B 1 48  ? 2.336   -58.655 48.459  1.00 23.71 ? 48   THR B C   1 
ATOM   4483  O O   . THR B 1 48  ? 2.983   -59.691 48.339  1.00 23.87 ? 48   THR B O   1 
ATOM   4484  C CB  . THR B 1 48  ? 0.202   -59.546 49.426  1.00 25.13 ? 48   THR B CB  1 
ATOM   4485  O OG1 . THR B 1 48  ? -0.521  -59.253 48.221  1.00 26.88 ? 48   THR B OG1 1 
ATOM   4486  C CG2 . THR B 1 48  ? -0.750  -59.530 50.611  1.00 25.58 ? 48   THR B CG2 1 
ATOM   4487  N N   . THR B 1 49  ? 2.497   -57.599 47.653  1.00 23.05 ? 49   THR B N   1 
ATOM   4488  C CA  . THR B 1 49  ? 3.385   -57.622 46.477  1.00 23.15 ? 49   THR B CA  1 
ATOM   4489  C C   . THR B 1 49  ? 4.863   -57.915 46.742  1.00 22.62 ? 49   THR B C   1 
ATOM   4490  O O   . THR B 1 49  ? 5.503   -58.614 45.951  1.00 23.55 ? 49   THR B O   1 
ATOM   4491  C CB  . THR B 1 49  ? 3.268   -56.338 45.609  1.00 23.81 ? 49   THR B CB  1 
ATOM   4492  O OG1 . THR B 1 49  ? 3.823   -55.217 46.312  1.00 24.67 ? 49   THR B OG1 1 
ATOM   4493  C CG2 . THR B 1 49  ? 1.812   -56.053 45.257  1.00 24.51 ? 49   THR B CG2 1 
ATOM   4494  N N   . LEU B 1 50  ? 5.391   -57.401 47.856  1.00 21.98 ? 50   LEU B N   1 
ATOM   4495  C CA  . LEU B 1 50  ? 6.789   -57.630 48.221  1.00 21.15 ? 50   LEU B CA  1 
ATOM   4496  C C   . LEU B 1 50  ? 6.963   -58.990 48.897  1.00 22.49 ? 50   LEU B C   1 
ATOM   4497  O O   . LEU B 1 50  ? 7.835   -59.768 48.507  1.00 20.81 ? 50   LEU B O   1 
ATOM   4498  C CB  . LEU B 1 50  ? 7.319   -56.508 49.131  1.00 20.39 ? 50   LEU B CB  1 
ATOM   4499  C CG  . LEU B 1 50  ? 8.747   -56.611 49.699  1.00 18.31 ? 50   LEU B CG  1 
ATOM   4500  C CD1 . LEU B 1 50  ? 9.766   -57.005 48.629  1.00 19.59 ? 50   LEU B CD1 1 
ATOM   4501  C CD2 . LEU B 1 50  ? 9.147   -55.301 50.336  1.00 20.28 ? 50   LEU B CD2 1 
ATOM   4502  N N   . THR B 1 51  ? 6.115   -59.269 49.881  1.00 24.12 ? 51   THR B N   1 
ATOM   4503  C CA  . THR B 1 51  ? 6.169   -60.523 50.637  1.00 27.12 ? 51   THR B CA  1 
ATOM   4504  C C   . THR B 1 51  ? 5.842   -61.794 49.841  1.00 28.24 ? 51   THR B C   1 
ATOM   4505  O O   . THR B 1 51  ? 6.270   -62.887 50.227  1.00 28.80 ? 51   THR B O   1 
ATOM   4506  C CB  . THR B 1 51  ? 5.317   -60.453 51.931  1.00 27.52 ? 51   THR B CB  1 
ATOM   4507  O OG1 . THR B 1 51  ? 3.969   -60.085 51.612  1.00 28.54 ? 51   THR B OG1 1 
ATOM   4508  C CG2 . THR B 1 51  ? 5.906   -59.429 52.903  1.00 28.92 ? 51   THR B CG2 1 
ATOM   4509  N N   . SER B 1 52  ? 5.143   -61.635 48.711  1.00 29.22 ? 52   SER B N   1 
ATOM   4510  C CA  . SER B 1 52  ? 4.779   -62.762 47.844  1.00 29.80 ? 52   SER B CA  1 
ATOM   4511  C C   . SER B 1 52  ? 5.803   -63.030 46.740  1.00 29.37 ? 52   SER B C   1 
ATOM   4512  O O   . SER B 1 52  ? 5.651   -63.992 45.970  1.00 30.06 ? 52   SER B O   1 
ATOM   4513  C CB  . SER B 1 52  ? 3.386   -62.569 47.235  1.00 30.58 ? 52   SER B CB  1 
ATOM   4514  O OG  . SER B 1 52  ? 2.373   -62.924 48.159  1.00 33.17 ? 52   SER B OG  1 
ATOM   4515  N N   . CYS B 1 53  ? 6.835   -62.183 46.655  1.00 27.37 ? 53   CYS B N   1 
ATOM   4516  C CA  . CYS B 1 53  ? 7.914   -62.333 45.670  1.00 26.41 ? 53   CYS B CA  1 
ATOM   4517  C C   . CYS B 1 53  ? 8.669   -63.622 45.987  1.00 25.45 ? 53   CYS B C   1 
ATOM   4518  O O   . CYS B 1 53  ? 8.927   -63.914 47.161  1.00 24.67 ? 53   CYS B O   1 
ATOM   4519  C CB  . CYS B 1 53  ? 8.903   -61.155 45.732  1.00 25.51 ? 53   CYS B CB  1 
ATOM   4520  S SG  . CYS B 1 53  ? 8.494   -59.700 44.729  1.00 29.39 ? 53   CYS B SG  1 
ATOM   4521  N N   . ALA B 1 54  ? 8.984   -64.396 44.945  1.00 25.07 ? 54   ALA B N   1 
ATOM   4522  C CA  . ALA B 1 54  ? 9.707   -65.669 45.080  1.00 23.16 ? 54   ALA B CA  1 
ATOM   4523  C C   . ALA B 1 54  ? 11.068  -65.489 45.754  1.00 21.76 ? 54   ALA B C   1 
ATOM   4524  O O   . ALA B 1 54  ? 11.494  -66.324 46.553  1.00 21.16 ? 54   ALA B O   1 
ATOM   4525  C CB  . ALA B 1 54  ? 9.879   -66.319 43.712  1.00 22.91 ? 54   ALA B CB  1 
ATOM   4526  N N   . SER B 1 55  ? 11.697  -64.347 45.484  1.00 20.20 ? 55   SER B N   1 
ATOM   4527  C CA  . SER B 1 55  ? 12.997  -64.014 46.048  1.00 20.13 ? 55   SER B CA  1 
ATOM   4528  C C   . SER B 1 55  ? 12.938  -63.586 47.513  1.00 17.82 ? 55   SER B C   1 
ATOM   4529  O O   . SER B 1 55  ? 13.924  -63.735 48.225  1.00 18.04 ? 55   SER B O   1 
ATOM   4530  C CB  . SER B 1 55  ? 13.676  -62.944 45.207  1.00 22.76 ? 55   SER B CB  1 
ATOM   4531  O OG  . SER B 1 55  ? 12.835  -61.810 45.075  1.00 26.73 ? 55   SER B OG  1 
ATOM   4532  N N   . TRP B 1 56  ? 11.786  -63.070 47.959  1.00 16.76 ? 56   TRP B N   1 
ATOM   4533  C CA  . TRP B 1 56  ? 11.611  -62.660 49.356  1.00 16.51 ? 56   TRP B CA  1 
ATOM   4534  C C   . TRP B 1 56  ? 11.528  -63.897 50.247  1.00 16.68 ? 56   TRP B C   1 
ATOM   4535  O O   . TRP B 1 56  ? 12.140  -63.941 51.318  1.00 16.82 ? 56   TRP B O   1 
ATOM   4536  C CB  . TRP B 1 56  ? 10.343  -61.814 49.541  1.00 17.04 ? 56   TRP B CB  1 
ATOM   4537  C CG  . TRP B 1 56  ? 10.245  -61.152 50.900  1.00 16.80 ? 56   TRP B CG  1 
ATOM   4538  C CD1 . TRP B 1 56  ? 9.559   -61.608 51.998  1.00 16.88 ? 56   TRP B CD1 1 
ATOM   4539  C CD2 . TRP B 1 56  ? 10.856  -59.922 51.295  1.00 16.45 ? 56   TRP B CD2 1 
ATOM   4540  N NE1 . TRP B 1 56  ? 9.702   -60.735 53.048  1.00 17.80 ? 56   TRP B NE1 1 
ATOM   4541  C CE2 . TRP B 1 56  ? 10.491  -59.688 52.648  1.00 17.17 ? 56   TRP B CE2 1 
ATOM   4542  C CE3 . TRP B 1 56  ? 11.683  -58.985 50.639  1.00 17.43 ? 56   TRP B CE3 1 
ATOM   4543  C CZ2 . TRP B 1 56  ? 10.921  -58.547 53.360  1.00 17.07 ? 56   TRP B CZ2 1 
ATOM   4544  C CZ3 . TRP B 1 56  ? 12.111  -57.844 51.345  1.00 18.13 ? 56   TRP B CZ3 1 
ATOM   4545  C CH2 . TRP B 1 56  ? 11.723  -57.641 52.692  1.00 17.84 ? 56   TRP B CH2 1 
ATOM   4546  N N   . THR B 1 57  ? 10.749  -64.883 49.797  1.00 17.79 ? 57   THR B N   1 
ATOM   4547  C CA  . THR B 1 57  ? 10.575  -66.142 50.521  1.00 18.45 ? 57   THR B CA  1 
ATOM   4548  C C   . THR B 1 57  ? 11.892  -66.924 50.531  1.00 17.81 ? 57   THR B C   1 
ATOM   4549  O O   . THR B 1 57  ? 12.232  -67.555 51.534  1.00 18.15 ? 57   THR B O   1 
ATOM   4550  C CB  . THR B 1 57  ? 9.420   -66.987 49.931  1.00 20.09 ? 57   THR B CB  1 
ATOM   4551  O OG1 . THR B 1 57  ? 9.603   -67.150 48.520  1.00 26.39 ? 57   THR B OG1 1 
ATOM   4552  C CG2 . THR B 1 57  ? 8.085   -66.300 50.176  1.00 21.82 ? 57   THR B CG2 1 
ATOM   4553  N N   . GLN B 1 58  ? 12.671  -66.778 49.455  1.00 17.00 ? 58   GLN B N   1 
ATOM   4554  C CA  . GLN B 1 58  ? 13.977  -67.431 49.337  1.00 17.95 ? 58   GLN B CA  1 
ATOM   4555  C C   . GLN B 1 58  ? 14.978  -66.783 50.295  1.00 17.14 ? 58   GLN B C   1 
ATOM   4556  O O   . GLN B 1 58  ? 15.753  -67.485 50.936  1.00 16.90 ? 58   GLN B O   1 
ATOM   4557  C CB  . GLN B 1 58  ? 14.494  -67.386 47.887  1.00 19.64 ? 58   GLN B CB  1 
ATOM   4558  C CG  . GLN B 1 58  ? 15.827  -68.128 47.601  1.00 23.01 ? 58   GLN B CG  1 
ATOM   4559  C CD  . GLN B 1 58  ? 15.849  -69.594 48.050  1.00 24.16 ? 58   GLN B CD  1 
ATOM   4560  O OE1 . GLN B 1 58  ? 14.806  -70.250 48.169  1.00 26.35 ? 58   GLN B OE1 1 
ATOM   4561  N NE2 . GLN B 1 58  ? 17.048  -70.112 48.288  1.00 26.70 ? 58   GLN B NE2 1 
ATOM   4562  N N   . LEU B 1 59  ? 14.915  -65.456 50.429  1.00 16.30 ? 59   LEU B N   1 
ATOM   4563  C CA  . LEU B 1 59  ? 15.804  -64.731 51.339  1.00 14.95 ? 59   LEU B CA  1 
ATOM   4564  C C   . LEU B 1 59  ? 15.531  -65.070 52.808  1.00 14.13 ? 59   LEU B C   1 
ATOM   4565  O O   . LEU B 1 59  ? 16.461  -65.115 53.609  1.00 15.46 ? 59   LEU B O   1 
ATOM   4566  C CB  . LEU B 1 59  ? 15.715  -63.221 51.106  1.00 14.13 ? 59   LEU B CB  1 
ATOM   4567  C CG  . LEU B 1 59  ? 16.496  -62.605 49.945  1.00 13.77 ? 59   LEU B CG  1 
ATOM   4568  C CD1 . LEU B 1 59  ? 15.970  -61.218 49.650  1.00 13.03 ? 59   LEU B CD1 1 
ATOM   4569  C CD2 . LEU B 1 59  ? 17.972  -62.561 50.266  1.00 14.73 ? 59   LEU B CD2 1 
ATOM   4570  N N   . GLN B 1 60  ? 14.265  -65.353 53.139  1.00 16.04 ? 60   GLN B N   1 
ATOM   4571  C CA  . GLN B 1 60  ? 13.867  -65.735 54.502  1.00 15.85 ? 60   GLN B CA  1 
ATOM   4572  C C   . GLN B 1 60  ? 14.425  -67.124 54.826  1.00 15.71 ? 60   GLN B C   1 
ATOM   4573  O O   . GLN B 1 60  ? 14.918  -67.355 55.929  1.00 16.16 ? 60   GLN B O   1 
ATOM   4574  C CB  . GLN B 1 60  ? 12.334  -65.698 54.657  1.00 18.18 ? 60   GLN B CB  1 
ATOM   4575  C CG  . GLN B 1 60  ? 11.771  -66.114 56.041  1.00 22.45 ? 60   GLN B CG  1 
ATOM   4576  C CD  . GLN B 1 60  ? 12.420  -65.396 57.223  1.00 24.47 ? 60   GLN B CD  1 
ATOM   4577  O OE1 . GLN B 1 60  ? 12.562  -64.171 57.228  1.00 26.36 ? 60   GLN B OE1 1 
ATOM   4578  N NE2 . GLN B 1 60  ? 12.821  -66.165 58.232  1.00 25.87 ? 60   GLN B NE2 1 
ATOM   4579  N N   . LYS B 1 61  ? 14.416  -67.996 53.816  1.00 16.83 ? 61   LYS B N   1 
ATOM   4580  C CA  . LYS B 1 61  ? 14.932  -69.363 53.916  1.00 16.91 ? 61   LYS B CA  1 
ATOM   4581  C C   . LYS B 1 61  ? 16.453  -69.306 54.110  1.00 17.46 ? 61   LYS B C   1 
ATOM   4582  O O   . LYS B 1 61  ? 16.997  -69.991 54.977  1.00 17.92 ? 61   LYS B O   1 
ATOM   4583  C CB  . LYS B 1 61  ? 14.571  -70.138 52.642  1.00 18.57 ? 61   LYS B CB  1 
ATOM   4584  C CG  . LYS B 1 61  ? 15.127  -71.547 52.523  1.00 22.20 ? 61   LYS B CG  1 
ATOM   4585  C CD  . LYS B 1 61  ? 14.621  -72.187 51.242  1.00 24.05 ? 61   LYS B CD  1 
ATOM   4586  C CE  . LYS B 1 61  ? 15.013  -73.647 51.148  1.00 26.45 ? 61   LYS B CE  1 
ATOM   4587  N NZ  . LYS B 1 61  ? 16.487  -73.833 51.225  1.00 28.38 ? 61   LYS B NZ  1 
ATOM   4588  N N   . LEU B 1 62  ? 17.108  -68.411 53.366  1.00 15.75 ? 62   LEU B N   1 
ATOM   4589  C CA  . LEU B 1 62  ? 18.559  -68.233 53.458  1.00 15.22 ? 62   LEU B CA  1 
ATOM   4590  C C   . LEU B 1 62  ? 18.993  -67.612 54.786  1.00 14.75 ? 62   LEU B C   1 
ATOM   4591  O O   . LEU B 1 62  ? 20.091  -67.892 55.269  1.00 14.76 ? 62   LEU B O   1 
ATOM   4592  C CB  . LEU B 1 62  ? 19.083  -67.419 52.269  1.00 15.92 ? 62   LEU B CB  1 
ATOM   4593  C CG  . LEU B 1 62  ? 18.949  -68.065 50.882  1.00 16.28 ? 62   LEU B CG  1 
ATOM   4594  C CD1 . LEU B 1 62  ? 19.357  -67.083 49.825  1.00 17.50 ? 62   LEU B CD1 1 
ATOM   4595  C CD2 . LEU B 1 62  ? 19.782  -69.330 50.759  1.00 16.67 ? 62   LEU B CD2 1 
ATOM   4596  N N   . TYR B 1 63  ? 18.115  -66.789 55.375  1.00 15.11 ? 63   TYR B N   1 
ATOM   4597  C CA  . TYR B 1 63  ? 18.366  -66.148 56.673  1.00 15.75 ? 63   TYR B CA  1 
ATOM   4598  C C   . TYR B 1 63  ? 18.376  -67.211 57.768  1.00 16.25 ? 63   TYR B C   1 
ATOM   4599  O O   . TYR B 1 63  ? 19.261  -67.229 58.623  1.00 16.08 ? 63   TYR B O   1 
ATOM   4600  C CB  . TYR B 1 63  ? 17.295  -65.073 56.974  1.00 15.33 ? 63   TYR B CB  1 
ATOM   4601  C CG  . TYR B 1 63  ? 17.402  -64.450 58.356  1.00 16.06 ? 63   TYR B CG  1 
ATOM   4602  C CD1 . TYR B 1 63  ? 18.502  -63.639 58.703  1.00 15.66 ? 63   TYR B CD1 1 
ATOM   4603  C CD2 . TYR B 1 63  ? 16.441  -64.738 59.356  1.00 16.86 ? 63   TYR B CD2 1 
ATOM   4604  C CE1 . TYR B 1 63  ? 18.651  -63.137 60.020  1.00 16.87 ? 63   TYR B CE1 1 
ATOM   4605  C CE2 . TYR B 1 63  ? 16.584  -64.235 60.678  1.00 18.38 ? 63   TYR B CE2 1 
ATOM   4606  C CZ  . TYR B 1 63  ? 17.697  -63.436 60.994  1.00 17.65 ? 63   TYR B CZ  1 
ATOM   4607  O OH  . TYR B 1 63  ? 17.858  -62.934 62.262  1.00 21.23 ? 63   TYR B OH  1 
ATOM   4608  N N   . GLU B 1 64  ? 17.381  -68.091 57.716  1.00 18.24 ? 64   GLU B N   1 
ATOM   4609  C CA  . GLU B 1 64  ? 17.233  -69.179 58.678  1.00 19.92 ? 64   GLU B CA  1 
ATOM   4610  C C   . GLU B 1 64  ? 18.405  -70.165 58.596  1.00 19.30 ? 64   GLU B C   1 
ATOM   4611  O O   . GLU B 1 64  ? 18.907  -70.622 59.622  1.00 19.88 ? 64   GLU B O   1 
ATOM   4612  C CB  . GLU B 1 64  ? 15.914  -69.906 58.426  1.00 20.77 ? 64   GLU B CB  1 
ATOM   4613  C CG  . GLU B 1 64  ? 14.681  -69.006 58.458  1.00 24.29 ? 64   GLU B CG  1 
ATOM   4614  C CD  . GLU B 1 64  ? 13.372  -69.742 58.198  1.00 26.62 ? 64   GLU B CD  1 
ATOM   4615  O OE1 . GLU B 1 64  ? 13.380  -70.981 58.020  1.00 27.97 ? 64   GLU B OE1 1 
ATOM   4616  O OE2 . GLU B 1 64  ? 12.316  -69.072 58.179  1.00 28.94 ? 64   GLU B OE2 1 
ATOM   4617  N N   . GLN B 1 65  ? 18.887  -70.394 57.373  1.00 19.00 ? 65   GLN B N   1 
ATOM   4618  C CA  . GLN B 1 65  ? 19.998  -71.309 57.107  1.00 18.57 ? 65   GLN B CA  1 
ATOM   4619  C C   . GLN B 1 65  ? 21.399  -70.765 57.396  1.00 18.85 ? 65   GLN B C   1 
ATOM   4620  O O   . GLN B 1 65  ? 22.192  -71.428 58.072  1.00 18.66 ? 65   GLN B O   1 
ATOM   4621  C CB  . GLN B 1 65  ? 19.958  -71.793 55.648  1.00 19.10 ? 65   GLN B CB  1 
ATOM   4622  C CG  . GLN B 1 65  ? 18.681  -72.528 55.242  1.00 20.83 ? 65   GLN B CG  1 
ATOM   4623  C CD  . GLN B 1 65  ? 18.696  -73.062 53.809  1.00 21.46 ? 65   GLN B CD  1 
ATOM   4624  O OE1 . GLN B 1 65  ? 17.759  -73.744 53.395  1.00 24.56 ? 65   GLN B OE1 1 
ATOM   4625  N NE2 . GLN B 1 65  ? 19.755  -72.772 53.058  1.00 21.04 ? 65   GLN B NE2 1 
ATOM   4626  N N   . TYR B 1 66  ? 21.691  -69.557 56.902  1.00 18.32 ? 66   TYR B N   1 
ATOM   4627  C CA  . TYR B 1 66  ? 23.026  -68.957 57.034  1.00 18.73 ? 66   TYR B CA  1 
ATOM   4628  C C   . TYR B 1 66  ? 23.202  -67.685 57.868  1.00 18.81 ? 66   TYR B C   1 
ATOM   4629  O O   . TYR B 1 66  ? 24.338  -67.239 58.063  1.00 19.30 ? 66   TYR B O   1 
ATOM   4630  C CB  . TYR B 1 66  ? 23.612  -68.694 55.638  1.00 17.50 ? 66   TYR B CB  1 
ATOM   4631  C CG  . TYR B 1 66  ? 23.512  -69.850 54.663  1.00 17.36 ? 66   TYR B CG  1 
ATOM   4632  C CD1 . TYR B 1 66  ? 24.173  -71.074 54.912  1.00 17.04 ? 66   TYR B CD1 1 
ATOM   4633  C CD2 . TYR B 1 66  ? 22.765  -69.722 53.474  1.00 16.25 ? 66   TYR B CD2 1 
ATOM   4634  C CE1 . TYR B 1 66  ? 24.090  -72.150 53.990  1.00 17.71 ? 66   TYR B CE1 1 
ATOM   4635  C CE2 . TYR B 1 66  ? 22.676  -70.790 52.543  1.00 17.57 ? 66   TYR B CE2 1 
ATOM   4636  C CZ  . TYR B 1 66  ? 23.343  -71.998 52.813  1.00 17.21 ? 66   TYR B CZ  1 
ATOM   4637  O OH  . TYR B 1 66  ? 23.265  -73.023 51.905  1.00 15.57 ? 66   TYR B OH  1 
ATOM   4638  N N   . GLY B 1 67  ? 22.103  -67.111 58.355  1.00 20.48 ? 67   GLY B N   1 
ATOM   4639  C CA  . GLY B 1 67  ? 22.175  -65.881 59.146  1.00 23.05 ? 67   GLY B CA  1 
ATOM   4640  C C   . GLY B 1 67  ? 22.848  -65.983 60.508  1.00 25.62 ? 67   GLY B C   1 
ATOM   4641  O O   . GLY B 1 67  ? 23.326  -64.975 61.044  1.00 26.18 ? 67   GLY B O   1 
ATOM   4642  N N   . ASP B 1 68  ? 22.921  -67.206 61.038  1.00 27.46 ? 68   ASP B N   1 
ATOM   4643  C CA  . ASP B 1 68  ? 23.530  -67.495 62.342  1.00 29.14 ? 68   ASP B CA  1 
ATOM   4644  C C   . ASP B 1 68  ? 25.046  -67.704 62.214  1.00 28.24 ? 68   ASP B C   1 
ATOM   4645  O O   . ASP B 1 68  ? 25.762  -67.698 63.219  1.00 28.86 ? 68   ASP B O   1 
ATOM   4646  C CB  . ASP B 1 68  ? 22.861  -68.743 62.955  1.00 32.90 ? 68   ASP B CB  1 
ATOM   4647  C CG  . ASP B 1 68  ? 23.059  -68.863 64.450  1.00 36.73 ? 68   ASP B CG  1 
ATOM   4648  O OD1 . ASP B 1 68  ? 22.330  -68.184 65.207  1.00 39.77 ? 68   ASP B OD1 1 
ATOM   4649  O OD2 . ASP B 1 68  ? 23.927  -69.658 64.871  1.00 39.25 ? 68   ASP B OD2 1 
ATOM   4650  N N   . GLU B 1 69  ? 25.531  -67.877 60.983  1.00 27.25 ? 69   GLU B N   1 
ATOM   4651  C CA  . GLU B 1 69  ? 26.958  -68.079 60.732  1.00 26.67 ? 69   GLU B CA  1 
ATOM   4652  C C   . GLU B 1 69  ? 27.746  -66.775 60.896  1.00 25.40 ? 69   GLU B C   1 
ATOM   4653  O O   . GLU B 1 69  ? 27.407  -65.761 60.269  1.00 23.78 ? 69   GLU B O   1 
ATOM   4654  C CB  . GLU B 1 69  ? 27.193  -68.688 59.340  1.00 30.14 ? 69   GLU B CB  1 
ATOM   4655  C CG  . GLU B 1 69  ? 28.532  -69.421 59.191  1.00 35.89 ? 69   GLU B CG  1 
ATOM   4656  C CD  . GLU B 1 69  ? 28.647  -70.248 57.906  1.00 39.04 ? 69   GLU B CD  1 
ATOM   4657  O OE1 . GLU B 1 69  ? 27.660  -70.909 57.503  1.00 41.48 ? 69   GLU B OE1 1 
ATOM   4658  O OE2 . GLU B 1 69  ? 29.728  -70.225 57.279  1.00 40.69 ? 69   GLU B OE2 1 
ATOM   4659  N N   . PRO B 1 70  ? 28.788  -66.771 61.769  1.00 23.38 ? 70   PRO B N   1 
ATOM   4660  C CA  . PRO B 1 70  ? 29.604  -65.564 61.996  1.00 21.86 ? 70   PRO B CA  1 
ATOM   4661  C C   . PRO B 1 70  ? 30.266  -65.032 60.727  1.00 20.09 ? 70   PRO B C   1 
ATOM   4662  O O   . PRO B 1 70  ? 30.592  -65.804 59.822  1.00 19.14 ? 70   PRO B O   1 
ATOM   4663  C CB  . PRO B 1 70  ? 30.643  -66.030 63.023  1.00 22.56 ? 70   PRO B CB  1 
ATOM   4664  C CG  . PRO B 1 70  ? 30.702  -67.524 62.840  1.00 23.80 ? 70   PRO B CG  1 
ATOM   4665  C CD  . PRO B 1 70  ? 29.264  -67.881 62.623  1.00 23.55 ? 70   PRO B CD  1 
ATOM   4666  N N   . ILE B 1 71  ? 30.451  -63.712 60.665  1.00 19.16 ? 71   ILE B N   1 
ATOM   4667  C CA  . ILE B 1 71  ? 31.063  -63.057 59.504  1.00 17.87 ? 71   ILE B CA  1 
ATOM   4668  C C   . ILE B 1 71  ? 32.467  -63.588 59.188  1.00 17.41 ? 71   ILE B C   1 
ATOM   4669  O O   . ILE B 1 71  ? 32.787  -63.814 58.019  1.00 16.26 ? 71   ILE B O   1 
ATOM   4670  C CB  . ILE B 1 71  ? 31.119  -61.520 59.673  1.00 16.43 ? 71   ILE B CB  1 
ATOM   4671  C CG1 . ILE B 1 71  ? 29.740  -60.973 60.032  1.00 15.56 ? 71   ILE B CG1 1 
ATOM   4672  C CG2 . ILE B 1 71  ? 31.615  -60.865 58.380  1.00 16.72 ? 71   ILE B CG2 1 
ATOM   4673  C CD1 . ILE B 1 71  ? 29.700  -59.469 60.279  1.00 15.73 ? 71   ILE B CD1 1 
ATOM   4674  N N   . LYS B 1 72  ? 33.259  -63.839 60.236  1.00 19.97 ? 72   LYS B N   1 
ATOM   4675  C CA  . LYS B 1 72  ? 34.625  -64.359 60.100  1.00 21.45 ? 72   LYS B CA  1 
ATOM   4676  C C   . LYS B 1 72  ? 34.708  -65.693 59.346  1.00 21.36 ? 72   LYS B C   1 
ATOM   4677  O O   . LYS B 1 72  ? 35.709  -65.961 58.682  1.00 22.21 ? 72   LYS B O   1 
ATOM   4678  C CB  . LYS B 1 72  ? 35.321  -64.471 61.464  1.00 24.29 ? 72   LYS B CB  1 
ATOM   4679  C CG  . LYS B 1 72  ? 34.648  -65.396 62.489  1.00 27.02 ? 72   LYS B CG  1 
ATOM   4680  C CD  . LYS B 1 72  ? 35.551  -65.682 63.687  1.00 30.01 ? 72   LYS B CD  1 
ATOM   4681  C CE  . LYS B 1 72  ? 36.047  -64.405 64.350  1.00 31.31 ? 72   LYS B CE  1 
ATOM   4682  N NZ  . LYS B 1 72  ? 36.830  -64.682 65.582  1.00 33.72 ? 72   LYS B NZ  1 
ATOM   4683  N N   . LYS B 1 73  ? 33.627  -66.475 59.408  1.00 21.59 ? 73   LYS B N   1 
ATOM   4684  C CA  . LYS B 1 73  ? 33.507  -67.722 58.708  1.00 22.19 ? 73   LYS B CA  1 
ATOM   4685  C C   . LYS B 1 73  ? 33.571  -67.617 57.207  1.00 21.23 ? 73   LYS B C   1 
ATOM   4686  O O   . LYS B 1 73  ? 34.181  -68.434 56.510  1.00 21.06 ? 73   LYS B O   1 
ATOM   4687  C CB  . LYS B 1 73  ? 32.249  -68.537 59.168  1.00 25.11 ? 73   LYS B CB  1 
ATOM   4688  C CG  . LYS B 1 73  ? 31.962  -69.867 58.407  1.00 29.41 ? 73   LYS B CG  1 
ATOM   4689  C CD  . LYS B 1 73  ? 32.320  -71.145 59.181  1.00 32.94 ? 73   LYS B CD  1 
ATOM   4690  C CE  . LYS B 1 73  ? 33.367  -70.955 60.277  1.00 35.16 ? 73   LYS B CE  1 
ATOM   4691  N NZ  . LYS B 1 73  ? 34.304  -69.837 60.024  1.00 37.93 ? 73   LYS B NZ  1 
ATOM   4692  N N   . HIS B 1 74  ? 32.970  -66.540 56.720  1.00 19.70 ? 74   HIS B N   1 
ATOM   4693  C CA  . HIS B 1 74  ? 32.934  -66.253 55.289  1.00 18.69 ? 74   HIS B CA  1 
ATOM   4694  C C   . HIS B 1 74  ? 34.323  -65.911 54.743  1.00 18.54 ? 74   HIS B C   1 
ATOM   4695  O O   . HIS B 1 74  ? 34.629  -66.209 53.585  1.00 18.46 ? 74   HIS B O   1 
ATOM   4696  C CB  . HIS B 1 74  ? 31.940  -65.126 55.000  1.00 17.97 ? 74   HIS B CB  1 
ATOM   4697  C CG  . HIS B 1 74  ? 30.530  -65.448 55.387  1.00 17.90 ? 74   HIS B CG  1 
ATOM   4698  N ND1 . HIS B 1 74  ? 29.945  -66.669 55.127  1.00 18.96 ? 74   HIS B ND1 1 
ATOM   4699  C CD2 . HIS B 1 74  ? 29.592  -64.711 56.026  1.00 18.45 ? 74   HIS B CD2 1 
ATOM   4700  C CE1 . HIS B 1 74  ? 28.709  -66.670 55.592  1.00 19.06 ? 74   HIS B CE1 1 
ATOM   4701  N NE2 . HIS B 1 74  ? 28.470  -65.493 56.142  1.00 18.10 ? 74   HIS B NE2 1 
ATOM   4702  N N   . PHE B 1 75  ? 35.165  -65.330 55.602  1.00 18.12 ? 75   PHE B N   1 
ATOM   4703  C CA  . PHE B 1 75  ? 36.543  -64.967 55.258  1.00 18.67 ? 75   PHE B CA  1 
ATOM   4704  C C   . PHE B 1 75  ? 37.461  -66.188 55.277  1.00 20.14 ? 75   PHE B C   1 
ATOM   4705  O O   . PHE B 1 75  ? 38.439  -66.244 54.527  1.00 21.20 ? 75   PHE B O   1 
ATOM   4706  C CB  . PHE B 1 75  ? 37.070  -63.894 56.212  1.00 18.14 ? 75   PHE B CB  1 
ATOM   4707  C CG  . PHE B 1 75  ? 36.529  -62.523 55.930  1.00 17.02 ? 75   PHE B CG  1 
ATOM   4708  C CD1 . PHE B 1 75  ? 37.179  -61.670 55.017  1.00 16.18 ? 75   PHE B CD1 1 
ATOM   4709  C CD2 . PHE B 1 75  ? 35.381  -62.065 56.597  1.00 17.65 ? 75   PHE B CD2 1 
ATOM   4710  C CE1 . PHE B 1 75  ? 36.689  -60.361 54.768  1.00 15.89 ? 75   PHE B CE1 1 
ATOM   4711  C CE2 . PHE B 1 75  ? 34.875  -60.765 56.362  1.00 16.27 ? 75   PHE B CE2 1 
ATOM   4712  C CZ  . PHE B 1 75  ? 35.533  -59.910 55.444  1.00 16.72 ? 75   PHE B CZ  1 
ATOM   4713  N N   . GLU B 1 76  ? 37.117  -67.163 56.122  1.00 22.22 ? 76   GLU B N   1 
ATOM   4714  C CA  . GLU B 1 76  ? 37.866  -68.420 56.254  1.00 23.97 ? 76   GLU B CA  1 
ATOM   4715  C C   . GLU B 1 76  ? 37.637  -69.315 55.031  1.00 24.34 ? 76   GLU B C   1 
ATOM   4716  O O   . GLU B 1 76  ? 38.565  -69.977 54.555  1.00 25.53 ? 76   GLU B O   1 
ATOM   4717  C CB  . GLU B 1 76  ? 37.433  -69.174 57.514  1.00 25.69 ? 76   GLU B CB  1 
ATOM   4718  C CG  . GLU B 1 76  ? 37.797  -68.508 58.839  1.00 30.53 ? 76   GLU B CG  1 
ATOM   4719  C CD  . GLU B 1 76  ? 37.319  -69.294 60.054  1.00 33.79 ? 76   GLU B CD  1 
ATOM   4720  O OE1 . GLU B 1 76  ? 37.037  -70.509 59.923  1.00 35.95 ? 76   GLU B OE1 1 
ATOM   4721  O OE2 . GLU B 1 76  ? 37.222  -68.700 61.151  1.00 35.58 ? 76   GLU B OE2 1 
ATOM   4722  N N   . THR B 1 77  ? 36.408  -69.287 54.514  1.00 24.24 ? 77   THR B N   1 
ATOM   4723  C CA  . THR B 1 77  ? 35.986  -70.073 53.349  1.00 24.01 ? 77   THR B CA  1 
ATOM   4724  C C   . THR B 1 77  ? 36.488  -69.471 52.030  1.00 24.12 ? 77   THR B C   1 
ATOM   4725  O O   . THR B 1 77  ? 36.981  -70.190 51.152  1.00 23.82 ? 77   THR B O   1 
ATOM   4726  C CB  . THR B 1 77  ? 34.428  -70.177 53.296  1.00 25.01 ? 77   THR B CB  1 
ATOM   4727  O OG1 . THR B 1 77  ? 33.940  -70.734 54.524  1.00 25.89 ? 77   THR B OG1 1 
ATOM   4728  C CG2 . THR B 1 77  ? 33.958  -71.061 52.134  1.00 26.09 ? 77   THR B CG2 1 
ATOM   4729  N N   . ASP B 1 78  ? 36.378  -68.148 51.924  1.00 22.28 ? 78   ASP B N   1 
ATOM   4730  C CA  . ASP B 1 78  ? 36.763  -67.402 50.731  1.00 21.67 ? 78   ASP B CA  1 
ATOM   4731  C C   . ASP B 1 78  ? 37.961  -66.490 51.024  1.00 21.16 ? 78   ASP B C   1 
ATOM   4732  O O   . ASP B 1 78  ? 37.807  -65.426 51.627  1.00 20.66 ? 78   ASP B O   1 
ATOM   4733  C CB  . ASP B 1 78  ? 35.534  -66.602 50.263  1.00 22.06 ? 78   ASP B CB  1 
ATOM   4734  C CG  . ASP B 1 78  ? 35.771  -65.773 49.003  1.00 21.83 ? 78   ASP B CG  1 
ATOM   4735  O OD1 . ASP B 1 78  ? 36.826  -65.890 48.346  1.00 22.60 ? 78   ASP B OD1 1 
ATOM   4736  O OD2 . ASP B 1 78  ? 34.871  -64.972 48.674  1.00 22.79 ? 78   ASP B OD2 1 
ATOM   4737  N N   . SER B 1 79  ? 39.135  -66.892 50.532  1.00 21.01 ? 79   SER B N   1 
ATOM   4738  C CA  . SER B 1 79  ? 40.384  -66.145 50.721  1.00 21.28 ? 79   SER B CA  1 
ATOM   4739  C C   . SER B 1 79  ? 40.449  -64.851 49.895  1.00 20.49 ? 79   SER B C   1 
ATOM   4740  O O   . SER B 1 79  ? 41.309  -63.998 50.131  1.00 20.73 ? 79   SER B O   1 
ATOM   4741  C CB  . SER B 1 79  ? 41.590  -67.038 50.392  1.00 22.39 ? 79   SER B CB  1 
ATOM   4742  O OG  . SER B 1 79  ? 41.646  -67.351 49.009  1.00 23.71 ? 79   SER B OG  1 
ATOM   4743  N N   . GLU B 1 80  ? 39.535  -64.731 48.933  1.00 20.45 ? 80   GLU B N   1 
ATOM   4744  C CA  . GLU B 1 80  ? 39.447  -63.569 48.053  1.00 19.98 ? 80   GLU B CA  1 
ATOM   4745  C C   . GLU B 1 80  ? 38.210  -62.712 48.357  1.00 18.73 ? 80   GLU B C   1 
ATOM   4746  O O   . GLU B 1 80  ? 37.845  -61.857 47.543  1.00 18.53 ? 80   GLU B O   1 
ATOM   4747  C CB  . GLU B 1 80  ? 39.388  -64.020 46.584  1.00 23.80 ? 80   GLU B CB  1 
ATOM   4748  C CG  . GLU B 1 80  ? 40.608  -64.779 46.066  1.00 29.69 ? 80   GLU B CG  1 
ATOM   4749  C CD  . GLU B 1 80  ? 40.492  -65.143 44.590  1.00 32.78 ? 80   GLU B CD  1 
ATOM   4750  O OE1 . GLU B 1 80  ? 39.449  -65.700 44.177  1.00 35.22 ? 80   GLU B OE1 1 
ATOM   4751  O OE2 . GLU B 1 80  ? 41.453  -64.877 43.838  1.00 36.59 ? 80   GLU B OE2 1 
ATOM   4752  N N   . ARG B 1 81  ? 37.603  -62.902 49.536  1.00 16.76 ? 81   ARG B N   1 
ATOM   4753  C CA  . ARG B 1 81  ? 36.390  -62.165 49.928  1.00 16.30 ? 81   ARG B CA  1 
ATOM   4754  C C   . ARG B 1 81  ? 36.488  -60.643 49.892  1.00 16.24 ? 81   ARG B C   1 
ATOM   4755  O O   . ARG B 1 81  ? 35.553  -59.980 49.434  1.00 16.17 ? 81   ARG B O   1 
ATOM   4756  C CB  . ARG B 1 81  ? 35.859  -62.630 51.292  1.00 14.51 ? 81   ARG B CB  1 
ATOM   4757  C CG  . ARG B 1 81  ? 34.476  -62.045 51.627  1.00 14.87 ? 81   ARG B CG  1 
ATOM   4758  C CD  . ARG B 1 81  ? 33.900  -62.581 52.911  1.00 14.20 ? 81   ARG B CD  1 
ATOM   4759  N NE  . ARG B 1 81  ? 32.690  -61.857 53.314  1.00 13.47 ? 81   ARG B NE  1 
ATOM   4760  C CZ  . ARG B 1 81  ? 31.458  -62.122 52.883  1.00 14.56 ? 81   ARG B CZ  1 
ATOM   4761  N NH1 . ARG B 1 81  ? 31.236  -63.110 52.020  1.00 15.56 ? 81   ARG B NH1 1 
ATOM   4762  N NH2 . ARG B 1 81  ? 30.438  -61.390 53.310  1.00 14.27 ? 81   ARG B NH2 1 
ATOM   4763  N N   . GLY B 1 82  ? 37.633  -60.109 50.321  1.00 16.81 ? 82   GLY B N   1 
ATOM   4764  C CA  . GLY B 1 82  ? 37.854  -58.670 50.320  1.00 17.88 ? 82   GLY B CA  1 
ATOM   4765  C C   . GLY B 1 82  ? 37.727  -58.055 48.937  1.00 19.27 ? 82   GLY B C   1 
ATOM   4766  O O   . GLY B 1 82  ? 37.118  -56.998 48.786  1.00 19.90 ? 82   GLY B O   1 
ATOM   4767  N N   . GLN B 1 83  ? 38.225  -58.772 47.927  1.00 18.57 ? 83   GLN B N   1 
ATOM   4768  C CA  . GLN B 1 83  ? 38.184  -58.337 46.528  1.00 19.16 ? 83   GLN B CA  1 
ATOM   4769  C C   . GLN B 1 83  ? 36.823  -58.581 45.878  1.00 18.09 ? 83   GLN B C   1 
ATOM   4770  O O   . GLN B 1 83  ? 36.285  -57.700 45.204  1.00 17.83 ? 83   GLN B O   1 
ATOM   4771  C CB  . GLN B 1 83  ? 39.253  -59.068 45.707  1.00 22.18 ? 83   GLN B CB  1 
ATOM   4772  C CG  . GLN B 1 83  ? 40.657  -59.033 46.289  1.00 27.93 ? 83   GLN B CG  1 
ATOM   4773  C CD  . GLN B 1 83  ? 41.698  -59.560 45.317  1.00 31.93 ? 83   GLN B CD  1 
ATOM   4774  O OE1 . GLN B 1 83  ? 42.156  -58.834 44.425  1.00 35.01 ? 83   GLN B OE1 1 
ATOM   4775  N NE2 . GLN B 1 83  ? 42.081  -60.822 45.480  1.00 33.72 ? 83   GLN B NE2 1 
ATOM   4776  N N   . ARG B 1 84  ? 36.264  -59.771 46.108  1.00 16.92 ? 84   ARG B N   1 
ATOM   4777  C CA  . ARG B 1 84  ? 34.977  -60.181 45.540  1.00 16.98 ? 84   ARG B CA  1 
ATOM   4778  C C   . ARG B 1 84  ? 33.774  -59.413 46.084  1.00 16.20 ? 84   ARG B C   1 
ATOM   4779  O O   . ARG B 1 84  ? 32.758  -59.271 45.400  1.00 17.87 ? 84   ARG B O   1 
ATOM   4780  C CB  . ARG B 1 84  ? 34.772  -61.688 45.727  1.00 17.88 ? 84   ARG B CB  1 
ATOM   4781  C CG  . ARG B 1 84  ? 35.792  -62.553 44.969  1.00 18.24 ? 84   ARG B CG  1 
ATOM   4782  C CD  . ARG B 1 84  ? 35.541  -64.051 45.144  1.00 19.03 ? 84   ARG B CD  1 
ATOM   4783  N NE  . ARG B 1 84  ? 34.382  -64.523 44.386  1.00 20.14 ? 84   ARG B NE  1 
ATOM   4784  C CZ  . ARG B 1 84  ? 33.282  -65.050 44.921  1.00 20.22 ? 84   ARG B CZ  1 
ATOM   4785  N NH1 . ARG B 1 84  ? 33.167  -65.187 46.238  1.00 21.02 ? 84   ARG B NH1 1 
ATOM   4786  N NH2 . ARG B 1 84  ? 32.290  -65.443 44.135  1.00 21.54 ? 84   ARG B NH2 1 
ATOM   4787  N N   . TYR B 1 85  ? 33.893  -58.935 47.320  1.00 15.67 ? 85   TYR B N   1 
ATOM   4788  C CA  . TYR B 1 85  ? 32.827  -58.174 47.961  1.00 14.88 ? 85   TYR B CA  1 
ATOM   4789  C C   . TYR B 1 85  ? 33.188  -56.701 48.121  1.00 14.96 ? 85   TYR B C   1 
ATOM   4790  O O   . TYR B 1 85  ? 32.970  -56.088 49.177  1.00 14.93 ? 85   TYR B O   1 
ATOM   4791  C CB  . TYR B 1 85  ? 32.451  -58.790 49.305  1.00 15.42 ? 85   TYR B CB  1 
ATOM   4792  C CG  . TYR B 1 85  ? 31.559  -59.999 49.243  1.00 15.90 ? 85   TYR B CG  1 
ATOM   4793  C CD1 . TYR B 1 85  ? 31.965  -61.169 48.564  1.00 16.88 ? 85   TYR B CD1 1 
ATOM   4794  C CD2 . TYR B 1 85  ? 30.288  -59.981 49.845  1.00 14.95 ? 85   TYR B CD2 1 
ATOM   4795  C CE1 . TYR B 1 85  ? 31.120  -62.289 48.477  1.00 17.21 ? 85   TYR B CE1 1 
ATOM   4796  C CE2 . TYR B 1 85  ? 29.427  -61.100 49.770  1.00 16.07 ? 85   TYR B CE2 1 
ATOM   4797  C CZ  . TYR B 1 85  ? 29.858  -62.246 49.079  1.00 17.30 ? 85   TYR B CZ  1 
ATOM   4798  O OH  . TYR B 1 85  ? 29.033  -63.325 48.977  1.00 17.61 ? 85   TYR B OH  1 
ATOM   4799  N N   . SER B 1 86  ? 33.713  -56.138 47.036  1.00 13.74 ? 86   SER B N   1 
ATOM   4800  C CA  . SER B 1 86  ? 34.105  -54.737 46.980  1.00 14.50 ? 86   SER B CA  1 
ATOM   4801  C C   . SER B 1 86  ? 34.119  -54.226 45.544  1.00 15.02 ? 86   SER B C   1 
ATOM   4802  O O   . SER B 1 86  ? 34.290  -55.007 44.610  1.00 15.79 ? 86   SER B O   1 
ATOM   4803  C CB  . SER B 1 86  ? 35.466  -54.525 47.642  1.00 15.07 ? 86   SER B CB  1 
ATOM   4804  O OG  . SER B 1 86  ? 36.523  -55.144 46.936  1.00 16.14 ? 86   SER B OG  1 
ATOM   4805  N N   . VAL B 1 87  ? 33.857  -52.926 45.370  1.00 14.72 ? 87   VAL B N   1 
ATOM   4806  C CA  . VAL B 1 87  ? 33.829  -52.292 44.045  1.00 14.66 ? 87   VAL B CA  1 
ATOM   4807  C C   . VAL B 1 87  ? 34.508  -50.922 44.101  1.00 15.58 ? 87   VAL B C   1 
ATOM   4808  O O   . VAL B 1 87  ? 34.261  -50.136 45.023  1.00 16.11 ? 87   VAL B O   1 
ATOM   4809  C CB  . VAL B 1 87  ? 32.356  -52.054 43.511  1.00 15.42 ? 87   VAL B CB  1 
ATOM   4810  C CG1 . VAL B 1 87  ? 32.365  -51.657 42.024  1.00 16.60 ? 87   VAL B CG1 1 
ATOM   4811  C CG2 . VAL B 1 87  ? 31.463  -53.271 43.713  1.00 17.23 ? 87   VAL B CG2 1 
ATOM   4812  N N   . LYS B 1 88  ? 35.360  -50.650 43.114  1.00 16.03 ? 88   LYS B N   1 
ATOM   4813  C CA  . LYS B 1 88  ? 36.049  -49.369 42.996  1.00 16.25 ? 88   LYS B CA  1 
ATOM   4814  C C   . LYS B 1 88  ? 35.473  -48.632 41.784  1.00 16.62 ? 88   LYS B C   1 
ATOM   4815  O O   . LYS B 1 88  ? 35.448  -49.171 40.669  1.00 16.87 ? 88   LYS B O   1 
ATOM   4816  C CB  . LYS B 1 88  ? 37.571  -49.557 42.842  1.00 16.72 ? 88   LYS B CB  1 
ATOM   4817  C CG  . LYS B 1 88  ? 38.344  -48.237 42.680  1.00 19.53 ? 88   LYS B CG  1 
ATOM   4818  C CD  . LYS B 1 88  ? 39.831  -48.433 42.427  1.00 23.09 ? 88   LYS B CD  1 
ATOM   4819  C CE  . LYS B 1 88  ? 40.671  -47.893 43.561  1.00 25.36 ? 88   LYS B CE  1 
ATOM   4820  N NZ  . LYS B 1 88  ? 42.116  -48.207 43.392  1.00 26.89 ? 88   LYS B NZ  1 
ATOM   4821  N N   . VAL B 1 89  ? 34.965  -47.423 42.026  1.00 15.38 ? 89   VAL B N   1 
ATOM   4822  C CA  . VAL B 1 89  ? 34.393  -46.592 40.968  1.00 16.08 ? 89   VAL B CA  1 
ATOM   4823  C C   . VAL B 1 89  ? 35.273  -45.365 40.774  1.00 15.79 ? 89   VAL B C   1 
ATOM   4824  O O   . VAL B 1 89  ? 35.404  -44.547 41.681  1.00 16.16 ? 89   VAL B O   1 
ATOM   4825  C CB  . VAL B 1 89  ? 32.944  -46.111 41.301  1.00 16.95 ? 89   VAL B CB  1 
ATOM   4826  C CG1 . VAL B 1 89  ? 32.308  -45.421 40.086  1.00 17.38 ? 89   VAL B CG1 1 
ATOM   4827  C CG2 . VAL B 1 89  ? 32.088  -47.271 41.733  1.00 17.37 ? 89   VAL B CG2 1 
ATOM   4828  N N   . SER B 1 90  ? 35.851  -45.236 39.581  1.00 15.58 ? 90   SER B N   1 
ATOM   4829  C CA  . SER B 1 90  ? 36.700  -44.095 39.234  1.00 15.76 ? 90   SER B CA  1 
ATOM   4830  C C   . SER B 1 90  ? 35.830  -42.841 39.098  1.00 15.28 ? 90   SER B C   1 
ATOM   4831  O O   . SER B 1 90  ? 34.713  -42.914 38.589  1.00 14.54 ? 90   SER B O   1 
ATOM   4832  C CB  . SER B 1 90  ? 37.425  -44.361 37.909  1.00 16.91 ? 90   SER B CB  1 
ATOM   4833  O OG  . SER B 1 90  ? 38.018  -43.180 37.400  1.00 19.57 ? 90   SER B OG  1 
ATOM   4834  N N   . LEU B 1 91  ? 36.331  -41.708 39.586  1.00 15.62 ? 91   LEU B N   1 
ATOM   4835  C CA  . LEU B 1 91  ? 35.577  -40.459 39.486  1.00 15.11 ? 91   LEU B CA  1 
ATOM   4836  C C   . LEU B 1 91  ? 35.858  -39.671 38.204  1.00 16.53 ? 91   LEU B C   1 
ATOM   4837  O O   . LEU B 1 91  ? 35.257  -38.620 37.969  1.00 15.61 ? 91   LEU B O   1 
ATOM   4838  C CB  . LEU B 1 91  ? 35.760  -39.598 40.739  1.00 15.28 ? 91   LEU B CB  1 
ATOM   4839  C CG  . LEU B 1 91  ? 35.253  -40.216 42.048  1.00 15.73 ? 91   LEU B CG  1 
ATOM   4840  C CD1 . LEU B 1 91  ? 35.408  -39.215 43.161  1.00 15.02 ? 91   LEU B CD1 1 
ATOM   4841  C CD2 . LEU B 1 91  ? 33.813  -40.715 41.949  1.00 15.34 ? 91   LEU B CD2 1 
ATOM   4842  N N   . GLY B 1 92  ? 36.762  -40.206 37.379  1.00 18.48 ? 92   GLY B N   1 
ATOM   4843  C CA  . GLY B 1 92  ? 37.110  -39.599 36.100  1.00 20.36 ? 92   GLY B CA  1 
ATOM   4844  C C   . GLY B 1 92  ? 37.977  -38.355 36.101  1.00 21.06 ? 92   GLY B C   1 
ATOM   4845  O O   . GLY B 1 92  ? 38.145  -37.720 35.054  1.00 22.71 ? 92   GLY B O   1 
ATOM   4846  N N   . SER B 1 93  ? 38.518  -38.001 37.264  1.00 21.64 ? 93   SER B N   1 
ATOM   4847  C CA  . SER B 1 93  ? 39.376  -36.825 37.410  1.00 21.83 ? 93   SER B CA  1 
ATOM   4848  C C   . SER B 1 93  ? 40.857  -37.139 37.218  1.00 22.13 ? 93   SER B C   1 
ATOM   4849  O O   . SER B 1 93  ? 41.274  -38.296 37.333  1.00 21.71 ? 93   SER B O   1 
ATOM   4850  C CB  . SER B 1 93  ? 39.151  -36.165 38.769  1.00 21.70 ? 93   SER B CB  1 
ATOM   4851  O OG  . SER B 1 93  ? 39.043  -37.133 39.796  1.00 22.80 ? 93   SER B OG  1 
ATOM   4852  N N   . LYS B 1 94  ? 41.639  -36.086 36.966  1.00 22.87 ? 94   LYS B N   1 
ATOM   4853  C CA  . LYS B 1 94  ? 43.090  -36.162 36.733  1.00 23.99 ? 94   LYS B CA  1 
ATOM   4854  C C   . LYS B 1 94  ? 43.897  -36.676 37.928  1.00 22.77 ? 94   LYS B C   1 
ATOM   4855  O O   . LYS B 1 94  ? 44.938  -37.315 37.744  1.00 22.81 ? 94   LYS B O   1 
ATOM   4856  C CB  . LYS B 1 94  ? 43.629  -34.792 36.307  1.00 26.69 ? 94   LYS B CB  1 
ATOM   4857  C CG  . LYS B 1 94  ? 42.909  -34.171 35.114  1.00 31.84 ? 94   LYS B CG  1 
ATOM   4858  C CD  . LYS B 1 94  ? 43.404  -32.759 34.827  1.00 34.84 ? 94   LYS B CD  1 
ATOM   4859  C CE  . LYS B 1 94  ? 42.409  -31.973 33.973  1.00 37.14 ? 94   LYS B CE  1 
ATOM   4860  N NZ  . LYS B 1 94  ? 42.122  -32.612 32.656  1.00 39.12 ? 94   LYS B NZ  1 
ATOM   4861  N N   . ASP B 1 95  ? 43.392  -36.425 39.142  1.00 20.92 ? 95   ASP B N   1 
ATOM   4862  C CA  . ASP B 1 95  ? 44.039  -36.857 40.391  1.00 19.67 ? 95   ASP B CA  1 
ATOM   4863  C C   . ASP B 1 95  ? 43.837  -38.354 40.689  1.00 19.26 ? 95   ASP B C   1 
ATOM   4864  O O   . ASP B 1 95  ? 44.312  -38.860 41.710  1.00 19.60 ? 95   ASP B O   1 
ATOM   4865  C CB  . ASP B 1 95  ? 43.558  -35.995 41.583  1.00 19.27 ? 95   ASP B CB  1 
ATOM   4866  C CG  . ASP B 1 95  ? 42.053  -36.142 41.880  1.00 20.14 ? 95   ASP B CG  1 
ATOM   4867  O OD1 . ASP B 1 95  ? 41.346  -36.873 41.158  1.00 18.37 ? 95   ASP B OD1 1 
ATOM   4868  O OD2 . ASP B 1 95  ? 41.576  -35.523 42.858  1.00 19.53 ? 95   ASP B OD2 1 
ATOM   4869  N N   . GLU B 1 96  ? 43.101  -39.026 39.797  1.00 19.11 ? 96   GLU B N   1 
ATOM   4870  C CA  . GLU B 1 96  ? 42.765  -40.459 39.871  1.00 19.29 ? 96   GLU B CA  1 
ATOM   4871  C C   . GLU B 1 96  ? 41.958  -40.839 41.118  1.00 17.45 ? 96   GLU B C   1 
ATOM   4872  O O   . GLU B 1 96  ? 42.106  -41.934 41.671  1.00 17.55 ? 96   GLU B O   1 
ATOM   4873  C CB  . GLU B 1 96  ? 44.014  -41.349 39.711  1.00 21.90 ? 96   GLU B CB  1 
ATOM   4874  C CG  . GLU B 1 96  ? 44.716  -41.213 38.357  1.00 25.94 ? 96   GLU B CG  1 
ATOM   4875  C CD  . GLU B 1 96  ? 45.993  -42.042 38.256  1.00 28.50 ? 96   GLU B CD  1 
ATOM   4876  O OE1 . GLU B 1 96  ? 46.782  -42.074 39.226  1.00 30.53 ? 96   GLU B OE1 1 
ATOM   4877  O OE2 . GLU B 1 96  ? 46.216  -42.655 37.190  1.00 32.17 ? 96   GLU B OE2 1 
ATOM   4878  N N   . ASN B 1 97  ? 41.075  -39.925 41.529  1.00 15.79 ? 97   ASN B N   1 
ATOM   4879  C CA  . ASN B 1 97  ? 40.205  -40.119 42.693  1.00 14.59 ? 97   ASN B CA  1 
ATOM   4880  C C   . ASN B 1 97  ? 39.165  -41.201 42.387  1.00 14.11 ? 97   ASN B C   1 
ATOM   4881  O O   . ASN B 1 97  ? 38.824  -41.442 41.222  1.00 15.14 ? 97   ASN B O   1 
ATOM   4882  C CB  . ASN B 1 97  ? 39.506  -38.798 43.062  1.00 13.15 ? 97   ASN B CB  1 
ATOM   4883  C CG  . ASN B 1 97  ? 39.158  -38.690 44.549  1.00 13.59 ? 97   ASN B CG  1 
ATOM   4884  O OD1 . ASN B 1 97  ? 39.193  -39.668 45.295  1.00 13.69 ? 97   ASN B OD1 1 
ATOM   4885  N ND2 . ASN B 1 97  ? 38.818  -37.480 44.979  1.00 12.30 ? 97   ASN B ND2 1 
ATOM   4886  N N   . PHE B 1 98  ? 38.697  -41.864 43.441  1.00 13.84 ? 98   PHE B N   1 
ATOM   4887  C CA  . PHE B 1 98  ? 37.722  -42.943 43.326  1.00 13.89 ? 98   PHE B CA  1 
ATOM   4888  C C   . PHE B 1 98  ? 36.830  -43.035 44.556  1.00 14.46 ? 98   PHE B C   1 
ATOM   4889  O O   . PHE B 1 98  ? 37.083  -42.378 45.558  1.00 14.54 ? 98   PHE B O   1 
ATOM   4890  C CB  . PHE B 1 98  ? 38.441  -44.296 43.110  1.00 12.89 ? 98   PHE B CB  1 
ATOM   4891  C CG  . PHE B 1 98  ? 39.467  -44.626 44.168  1.00 13.66 ? 98   PHE B CG  1 
ATOM   4892  C CD1 . PHE B 1 98  ? 39.080  -45.156 45.425  1.00 13.79 ? 98   PHE B CD1 1 
ATOM   4893  C CD2 . PHE B 1 98  ? 40.829  -44.377 43.929  1.00 14.79 ? 98   PHE B CD2 1 
ATOM   4894  C CE1 . PHE B 1 98  ? 40.035  -45.424 46.435  1.00 14.01 ? 98   PHE B CE1 1 
ATOM   4895  C CE2 . PHE B 1 98  ? 41.795  -44.640 44.924  1.00 16.75 ? 98   PHE B CE2 1 
ATOM   4896  C CZ  . PHE B 1 98  ? 41.397  -45.164 46.183  1.00 15.40 ? 98   PHE B CZ  1 
ATOM   4897  N N   . LEU B 1 99  ? 35.826  -43.904 44.471  1.00 14.84 ? 99   LEU B N   1 
ATOM   4898  C CA  . LEU B 1 99  ? 34.921  -44.203 45.575  1.00 15.45 ? 99   LEU B CA  1 
ATOM   4899  C C   . LEU B 1 99  ? 34.968  -45.734 45.642  1.00 15.67 ? 99   LEU B C   1 
ATOM   4900  O O   . LEU B 1 99  ? 34.605  -46.415 44.682  1.00 16.16 ? 99   LEU B O   1 
ATOM   4901  C CB  . LEU B 1 99  ? 33.500  -43.675 45.308  1.00 17.41 ? 99   LEU B CB  1 
ATOM   4902  C CG  . LEU B 1 99  ? 32.372  -43.893 46.337  1.00 18.91 ? 99   LEU B CG  1 
ATOM   4903  C CD1 . LEU B 1 99  ? 32.790  -43.547 47.767  1.00 19.36 ? 99   LEU B CD1 1 
ATOM   4904  C CD2 . LEU B 1 99  ? 31.165  -43.064 45.938  1.00 19.79 ? 99   LEU B CD2 1 
ATOM   4905  N N   . PHE B 1 100 ? 35.515  -46.246 46.743  1.00 14.69 ? 100  PHE B N   1 
ATOM   4906  C CA  . PHE B 1 100 ? 35.665  -47.686 46.967  1.00 15.39 ? 100  PHE B CA  1 
ATOM   4907  C C   . PHE B 1 100 ? 34.739  -48.167 48.080  1.00 14.89 ? 100  PHE B C   1 
ATOM   4908  O O   . PHE B 1 100 ? 34.843  -47.703 49.210  1.00 15.36 ? 100  PHE B O   1 
ATOM   4909  C CB  . PHE B 1 100 ? 37.139  -47.994 47.315  1.00 14.78 ? 100  PHE B CB  1 
ATOM   4910  C CG  . PHE B 1 100 ? 37.435  -49.451 47.607  1.00 15.18 ? 100  PHE B CG  1 
ATOM   4911  C CD1 . PHE B 1 100 ? 37.328  -50.427 46.598  1.00 14.99 ? 100  PHE B CD1 1 
ATOM   4912  C CD2 . PHE B 1 100 ? 37.874  -49.845 48.889  1.00 15.57 ? 100  PHE B CD2 1 
ATOM   4913  C CE1 . PHE B 1 100 ? 37.661  -51.785 46.853  1.00 16.17 ? 100  PHE B CE1 1 
ATOM   4914  C CE2 . PHE B 1 100 ? 38.211  -51.199 49.168  1.00 17.09 ? 100  PHE B CE2 1 
ATOM   4915  C CZ  . PHE B 1 100 ? 38.106  -52.171 48.147  1.00 17.33 ? 100  PHE B CZ  1 
ATOM   4916  N N   . LEU B 1 101 ? 33.842  -49.096 47.747  1.00 13.31 ? 101  LEU B N   1 
ATOM   4917  C CA  . LEU B 1 101 ? 32.927  -49.676 48.730  1.00 13.38 ? 101  LEU B CA  1 
ATOM   4918  C C   . LEU B 1 101 ? 33.360  -51.100 49.039  1.00 13.17 ? 101  LEU B C   1 
ATOM   4919  O O   . LEU B 1 101 ? 33.502  -51.914 48.138  1.00 13.84 ? 101  LEU B O   1 
ATOM   4920  C CB  . LEU B 1 101 ? 31.464  -49.694 48.231  1.00 13.81 ? 101  LEU B CB  1 
ATOM   4921  C CG  . LEU B 1 101 ? 30.439  -50.531 49.041  1.00 14.16 ? 101  LEU B CG  1 
ATOM   4922  C CD1 . LEU B 1 101 ? 30.180  -49.942 50.422  1.00 15.29 ? 101  LEU B CD1 1 
ATOM   4923  C CD2 . LEU B 1 101 ? 29.139  -50.693 48.283  1.00 15.81 ? 101  LEU B CD2 1 
ATOM   4924  N N   . ASP B 1 102 ? 33.540  -51.376 50.325  1.00 12.89 ? 102  ASP B N   1 
ATOM   4925  C CA  . ASP B 1 102 ? 33.893  -52.700 50.810  1.00 12.29 ? 102  ASP B CA  1 
ATOM   4926  C C   . ASP B 1 102 ? 32.709  -53.100 51.690  1.00 12.66 ? 102  ASP B C   1 
ATOM   4927  O O   . ASP B 1 102 ? 32.526  -52.546 52.770  1.00 13.27 ? 102  ASP B O   1 
ATOM   4928  C CB  . ASP B 1 102 ? 35.206  -52.643 51.617  1.00 13.86 ? 102  ASP B CB  1 
ATOM   4929  C CG  . ASP B 1 102 ? 35.657  -54.010 52.140  1.00 15.59 ? 102  ASP B CG  1 
ATOM   4930  O OD1 . ASP B 1 102 ? 34.822  -54.917 52.315  1.00 16.35 ? 102  ASP B OD1 1 
ATOM   4931  O OD2 . ASP B 1 102 ? 36.864  -54.164 52.411  1.00 16.11 ? 102  ASP B OD2 1 
ATOM   4932  N N   . TYR B 1 103 ? 31.908  -54.053 51.211  1.00 12.05 ? 103  TYR B N   1 
ATOM   4933  C CA  . TYR B 1 103 ? 30.743  -54.536 51.951  1.00 11.69 ? 103  TYR B CA  1 
ATOM   4934  C C   . TYR B 1 103 ? 30.930  -55.988 52.425  1.00 11.62 ? 103  TYR B C   1 
ATOM   4935  O O   . TYR B 1 103 ? 29.959  -56.670 52.764  1.00 12.49 ? 103  TYR B O   1 
ATOM   4936  C CB  . TYR B 1 103 ? 29.450  -54.365 51.115  1.00 13.51 ? 103  TYR B CB  1 
ATOM   4937  C CG  . TYR B 1 103 ? 29.418  -55.104 49.786  1.00 12.85 ? 103  TYR B CG  1 
ATOM   4938  C CD1 . TYR B 1 103 ? 30.010  -54.549 48.632  1.00 13.26 ? 103  TYR B CD1 1 
ATOM   4939  C CD2 . TYR B 1 103 ? 28.825  -56.381 49.683  1.00 13.94 ? 103  TYR B CD2 1 
ATOM   4940  C CE1 . TYR B 1 103 ? 30.021  -55.255 47.405  1.00 14.55 ? 103  TYR B CE1 1 
ATOM   4941  C CE2 . TYR B 1 103 ? 28.830  -57.096 48.464  1.00 13.54 ? 103  TYR B CE2 1 
ATOM   4942  C CZ  . TYR B 1 103 ? 29.434  -56.530 47.337  1.00 14.86 ? 103  TYR B CZ  1 
ATOM   4943  O OH  . TYR B 1 103 ? 29.501  -57.253 46.171  1.00 16.32 ? 103  TYR B OH  1 
ATOM   4944  N N   . SER B 1 104 ? 32.189  -56.417 52.502  1.00 11.96 ? 104  SER B N   1 
ATOM   4945  C CA  . SER B 1 104 ? 32.548  -57.780 52.909  1.00 12.03 ? 104  SER B CA  1 
ATOM   4946  C C   . SER B 1 104 ? 32.297  -58.162 54.358  1.00 11.41 ? 104  SER B C   1 
ATOM   4947  O O   . SER B 1 104 ? 32.066  -59.333 54.653  1.00 12.14 ? 104  SER B O   1 
ATOM   4948  C CB  . SER B 1 104 ? 34.003  -58.081 52.540  1.00 11.86 ? 104  SER B CB  1 
ATOM   4949  O OG  . SER B 1 104 ? 34.900  -57.312 53.311  1.00 12.45 ? 104  SER B OG  1 
ATOM   4950  N N   . LYS B 1 105 ? 32.364  -57.184 55.262  1.00 10.92 ? 105  LYS B N   1 
ATOM   4951  C CA  . LYS B 1 105 ? 32.138  -57.444 56.686  1.00 10.89 ? 105  LYS B CA  1 
ATOM   4952  C C   . LYS B 1 105 ? 30.626  -57.467 56.942  1.00 12.34 ? 105  LYS B C   1 
ATOM   4953  O O   . LYS B 1 105 ? 30.061  -56.572 57.566  1.00 12.50 ? 105  LYS B O   1 
ATOM   4954  C CB  . LYS B 1 105 ? 32.873  -56.413 57.556  1.00 11.16 ? 105  LYS B CB  1 
ATOM   4955  C CG  . LYS B 1 105 ? 34.387  -56.370 57.313  1.00 12.04 ? 105  LYS B CG  1 
ATOM   4956  C CD  . LYS B 1 105 ? 35.116  -55.709 58.467  1.00 11.90 ? 105  LYS B CD  1 
ATOM   4957  C CE  . LYS B 1 105 ? 36.593  -55.481 58.170  1.00 13.11 ? 105  LYS B CE  1 
ATOM   4958  N NZ  . LYS B 1 105 ? 36.818  -54.347 57.224  1.00 13.45 ? 105  LYS B NZ  1 
ATOM   4959  N N   . SER B 1 106 ? 29.994  -58.517 56.418  1.00 12.63 ? 106  SER B N   1 
ATOM   4960  C CA  . SER B 1 106 ? 28.552  -58.725 56.498  1.00 12.12 ? 106  SER B CA  1 
ATOM   4961  C C   . SER B 1 106 ? 28.205  -60.215 56.554  1.00 12.33 ? 106  SER B C   1 
ATOM   4962  O O   . SER B 1 106 ? 29.015  -61.062 56.162  1.00 12.66 ? 106  SER B O   1 
ATOM   4963  C CB  . SER B 1 106 ? 27.885  -58.096 55.272  1.00 13.55 ? 106  SER B CB  1 
ATOM   4964  O OG  . SER B 1 106 ? 28.432  -58.617 54.068  1.00 15.32 ? 106  SER B OG  1 
ATOM   4965  N N   . HIS B 1 107 ? 26.994  -60.523 57.022  1.00 12.28 ? 107  HIS B N   1 
ATOM   4966  C CA  . HIS B 1 107 ? 26.499  -61.905 57.120  1.00 12.18 ? 107  HIS B CA  1 
ATOM   4967  C C   . HIS B 1 107 ? 25.901  -62.290 55.764  1.00 11.31 ? 107  HIS B C   1 
ATOM   4968  O O   . HIS B 1 107 ? 24.713  -62.624 55.657  1.00 12.89 ? 107  HIS B O   1 
ATOM   4969  C CB  . HIS B 1 107 ? 25.408  -62.006 58.184  1.00 13.43 ? 107  HIS B CB  1 
ATOM   4970  C CG  . HIS B 1 107 ? 25.862  -61.692 59.574  1.00 15.28 ? 107  HIS B CG  1 
ATOM   4971  N ND1 . HIS B 1 107 ? 25.922  -60.405 60.062  1.00 15.46 ? 107  HIS B ND1 1 
ATOM   4972  C CD2 . HIS B 1 107 ? 26.213  -62.500 60.601  1.00 15.53 ? 107  HIS B CD2 1 
ATOM   4973  C CE1 . HIS B 1 107 ? 26.284  -60.433 61.330  1.00 15.99 ? 107  HIS B CE1 1 
ATOM   4974  N NE2 . HIS B 1 107 ? 26.470  -61.693 61.682  1.00 16.61 ? 107  HIS B NE2 1 
ATOM   4975  N N   . ILE B 1 108 ? 26.722  -62.203 54.721  1.00 13.06 ? 108  ILE B N   1 
ATOM   4976  C CA  . ILE B 1 108 ? 26.284  -62.484 53.357  1.00 13.14 ? 108  ILE B CA  1 
ATOM   4977  C C   . ILE B 1 108 ? 27.243  -63.425 52.630  1.00 13.34 ? 108  ILE B C   1 
ATOM   4978  O O   . ILE B 1 108 ? 28.427  -63.126 52.512  1.00 13.77 ? 108  ILE B O   1 
ATOM   4979  C CB  . ILE B 1 108 ? 26.165  -61.138 52.520  1.00 13.83 ? 108  ILE B CB  1 
ATOM   4980  C CG1 . ILE B 1 108 ? 25.053  -60.238 53.071  1.00 14.37 ? 108  ILE B CG1 1 
ATOM   4981  C CG2 . ILE B 1 108 ? 25.886  -61.423 51.041  1.00 13.68 ? 108  ILE B CG2 1 
ATOM   4982  C CD1 . ILE B 1 108 ? 25.142  -58.779 52.665  1.00 14.22 ? 108  ILE B CD1 1 
ATOM   4983  N N   . ASN B 1 109 ? 26.725  -64.570 52.177  1.00 14.55 ? 109  ASN B N   1 
ATOM   4984  C CA  . ASN B 1 109 ? 27.519  -65.509 51.380  1.00 15.29 ? 109  ASN B CA  1 
ATOM   4985  C C   . ASN B 1 109 ? 27.058  -65.325 49.925  1.00 16.01 ? 109  ASN B C   1 
ATOM   4986  O O   . ASN B 1 109 ? 26.166  -64.508 49.671  1.00 16.04 ? 109  ASN B O   1 
ATOM   4987  C CB  . ASN B 1 109 ? 27.397  -66.974 51.874  1.00 14.31 ? 109  ASN B CB  1 
ATOM   4988  C CG  . ASN B 1 109 ? 25.959  -67.498 51.933  1.00 14.58 ? 109  ASN B CG  1 
ATOM   4989  O OD1 . ASN B 1 109 ? 25.052  -66.988 51.279  1.00 15.43 ? 109  ASN B OD1 1 
ATOM   4990  N ND2 . ASN B 1 109 ? 25.767  -68.562 52.702  1.00 16.34 ? 109  ASN B ND2 1 
ATOM   4991  N N   . ASP B 1 110 ? 27.657  -66.051 48.976  1.00 16.40 ? 110  ASP B N   1 
ATOM   4992  C CA  . ASP B 1 110 ? 27.289  -65.925 47.559  1.00 16.95 ? 110  ASP B CA  1 
ATOM   4993  C C   . ASP B 1 110 ? 25.820  -66.190 47.240  1.00 17.06 ? 110  ASP B C   1 
ATOM   4994  O O   . ASP B 1 110 ? 25.247  -65.511 46.385  1.00 17.70 ? 110  ASP B O   1 
ATOM   4995  C CB  . ASP B 1 110 ? 28.196  -66.785 46.669  1.00 19.01 ? 110  ASP B CB  1 
ATOM   4996  C CG  . ASP B 1 110 ? 29.603  -66.208 46.519  1.00 21.65 ? 110  ASP B CG  1 
ATOM   4997  O OD1 . ASP B 1 110 ? 29.854  -65.055 46.936  1.00 22.50 ? 110  ASP B OD1 1 
ATOM   4998  O OD2 . ASP B 1 110 ? 30.472  -66.919 45.978  1.00 23.43 ? 110  ASP B OD2 1 
ATOM   4999  N N   . GLU B 1 111 ? 25.205  -67.122 47.975  1.00 16.24 ? 111  GLU B N   1 
ATOM   5000  C CA  . GLU B 1 111 ? 23.787  -67.470 47.799  1.00 16.71 ? 111  GLU B CA  1 
ATOM   5001  C C   . GLU B 1 111 ? 22.868  -66.309 48.169  1.00 15.73 ? 111  GLU B C   1 
ATOM   5002  O O   . GLU B 1 111 ? 21.925  -66.004 47.435  1.00 16.77 ? 111  GLU B O   1 
ATOM   5003  C CB  . GLU B 1 111 ? 23.406  -68.693 48.638  1.00 19.44 ? 111  GLU B CB  1 
ATOM   5004  C CG  . GLU B 1 111 ? 23.753  -70.031 48.014  1.00 24.46 ? 111  GLU B CG  1 
ATOM   5005  C CD  . GLU B 1 111 ? 22.989  -71.173 48.659  1.00 25.71 ? 111  GLU B CD  1 
ATOM   5006  O OE1 . GLU B 1 111 ? 21.769  -71.295 48.410  1.00 27.80 ? 111  GLU B OE1 1 
ATOM   5007  O OE2 . GLU B 1 111 ? 23.607  -71.949 49.421  1.00 27.93 ? 111  GLU B OE2 1 
ATOM   5008  N N   . ILE B 1 112 ? 23.179  -65.651 49.289  1.00 15.91 ? 112  ILE B N   1 
ATOM   5009  C CA  . ILE B 1 112 ? 22.416  -64.503 49.790  1.00 14.28 ? 112  ILE B CA  1 
ATOM   5010  C C   . ILE B 1 112 ? 22.579  -63.300 48.854  1.00 14.12 ? 112  ILE B C   1 
ATOM   5011  O O   . ILE B 1 112 ? 21.592  -62.646 48.519  1.00 13.12 ? 112  ILE B O   1 
ATOM   5012  C CB  . ILE B 1 112 ? 22.830  -64.148 51.254  1.00 14.59 ? 112  ILE B CB  1 
ATOM   5013  C CG1 . ILE B 1 112 ? 22.383  -65.270 52.199  1.00 13.54 ? 112  ILE B CG1 1 
ATOM   5014  C CG2 . ILE B 1 112 ? 22.210  -62.818 51.704  1.00 15.11 ? 112  ILE B CG2 1 
ATOM   5015  C CD1 . ILE B 1 112 ? 23.106  -65.307 53.535  1.00 13.29 ? 112  ILE B CD1 1 
ATOM   5016  N N   . LYS B 1 113 ? 23.813  -63.069 48.396  1.00 14.10 ? 113  LYS B N   1 
ATOM   5017  C CA  . LYS B 1 113 ? 24.144  -61.970 47.478  1.00 15.20 ? 113  LYS B CA  1 
ATOM   5018  C C   . LYS B 1 113 ? 23.351  -62.096 46.178  1.00 15.50 ? 113  LYS B C   1 
ATOM   5019  O O   . LYS B 1 113 ? 22.744  -61.127 45.727  1.00 15.52 ? 113  LYS B O   1 
ATOM   5020  C CB  . LYS B 1 113 ? 25.652  -61.966 47.185  1.00 16.08 ? 113  LYS B CB  1 
ATOM   5021  C CG  . LYS B 1 113 ? 26.181  -60.763 46.409  1.00 18.76 ? 113  LYS B CG  1 
ATOM   5022  C CD  . LYS B 1 113 ? 27.690  -60.848 46.305  1.00 19.99 ? 113  LYS B CD  1 
ATOM   5023  C CE  . LYS B 1 113 ? 28.238  -59.955 45.221  1.00 23.07 ? 113  LYS B CE  1 
ATOM   5024  N NZ  . LYS B 1 113 ? 29.732  -59.962 45.255  1.00 22.01 ? 113  LYS B NZ  1 
ATOM   5025  N N   . CYS B 1 114 ? 23.288  -63.316 45.641  1.00 15.81 ? 114  CYS B N   1 
ATOM   5026  C CA  . CYS B 1 114 ? 22.557  -63.587 44.405  1.00 17.89 ? 114  CYS B CA  1 
ATOM   5027  C C   . CYS B 1 114 ? 21.045  -63.442 44.567  1.00 15.92 ? 114  CYS B C   1 
ATOM   5028  O O   . CYS B 1 114 ? 20.374  -62.926 43.672  1.00 16.51 ? 114  CYS B O   1 
ATOM   5029  C CB  . CYS B 1 114 ? 22.921  -64.969 43.865  1.00 21.18 ? 114  CYS B CB  1 
ATOM   5030  S SG  . CYS B 1 114 ? 24.634  -65.054 43.313  1.00 32.08 ? 114  CYS B SG  1 
ATOM   5031  N N   . ALA B 1 115 ? 20.537  -63.814 45.745  1.00 13.99 ? 115  ALA B N   1 
ATOM   5032  C CA  . ALA B 1 115 ? 19.112  -63.717 46.056  1.00 14.13 ? 115  ALA B CA  1 
ATOM   5033  C C   . ALA B 1 115 ? 18.681  -62.264 46.282  1.00 13.91 ? 115  ALA B C   1 
ATOM   5034  O O   . ALA B 1 115 ? 17.550  -61.894 45.953  1.00 14.30 ? 115  ALA B O   1 
ATOM   5035  C CB  . ALA B 1 115 ? 18.777  -64.567 47.251  1.00 15.15 ? 115  ALA B CB  1 
ATOM   5036  N N   . LEU B 1 116 ? 19.596  -61.451 46.822  1.00 14.60 ? 116  LEU B N   1 
ATOM   5037  C CA  . LEU B 1 116 ? 19.343  -60.022 47.052  1.00 13.52 ? 116  LEU B CA  1 
ATOM   5038  C C   . LEU B 1 116 ? 19.281  -59.315 45.694  1.00 14.07 ? 116  LEU B C   1 
ATOM   5039  O O   . LEU B 1 116 ? 18.436  -58.445 45.484  1.00 15.22 ? 116  LEU B O   1 
ATOM   5040  C CB  . LEU B 1 116 ? 20.434  -59.392 47.930  1.00 12.98 ? 116  LEU B CB  1 
ATOM   5041  C CG  . LEU B 1 116 ? 20.391  -59.598 49.451  1.00 12.56 ? 116  LEU B CG  1 
ATOM   5042  C CD1 . LEU B 1 116 ? 21.694  -59.144 50.071  1.00 12.18 ? 116  LEU B CD1 1 
ATOM   5043  C CD2 . LEU B 1 116 ? 19.208  -58.865 50.079  1.00 12.63 ? 116  LEU B CD2 1 
ATOM   5044  N N   . LEU B 1 117 ? 20.147  -59.736 44.766  1.00 14.93 ? 117  LEU B N   1 
ATOM   5045  C CA  . LEU B 1 117 ? 20.178  -59.178 43.409  1.00 15.12 ? 117  LEU B CA  1 
ATOM   5046  C C   . LEU B 1 117 ? 18.944  -59.614 42.617  1.00 15.73 ? 117  LEU B C   1 
ATOM   5047  O O   . LEU B 1 117 ? 18.427  -58.851 41.798  1.00 15.22 ? 117  LEU B O   1 
ATOM   5048  C CB  . LEU B 1 117 ? 21.460  -59.586 42.672  1.00 15.84 ? 117  LEU B CB  1 
ATOM   5049  C CG  . LEU B 1 117 ? 22.788  -58.988 43.155  1.00 17.30 ? 117  LEU B CG  1 
ATOM   5050  C CD1 . LEU B 1 117 ? 23.933  -59.603 42.373  1.00 18.48 ? 117  LEU B CD1 1 
ATOM   5051  C CD2 . LEU B 1 117 ? 22.798  -57.470 43.015  1.00 18.48 ? 117  LEU B CD2 1 
ATOM   5052  N N   . ARG B 1 118 ? 18.446  -60.820 42.915  1.00 16.63 ? 118  ARG B N   1 
ATOM   5053  C CA  . ARG B 1 118 ? 17.252  -61.367 42.262  1.00 17.85 ? 118  ARG B CA  1 
ATOM   5054  C C   . ARG B 1 118 ? 16.007  -60.613 42.733  1.00 16.48 ? 118  ARG B C   1 
ATOM   5055  O O   . ARG B 1 118 ? 15.060  -60.445 41.963  1.00 17.07 ? 118  ARG B O   1 
ATOM   5056  C CB  . ARG B 1 118 ? 17.091  -62.855 42.564  1.00 20.80 ? 118  ARG B CB  1 
ATOM   5057  C CG  . ARG B 1 118 ? 16.359  -63.644 41.477  1.00 27.06 ? 118  ARG B CG  1 
ATOM   5058  C CD  . ARG B 1 118 ? 16.173  -65.119 41.860  1.00 31.10 ? 118  ARG B CD  1 
ATOM   5059  N NE  . ARG B 1 118 ? 17.388  -65.742 42.401  1.00 34.49 ? 118  ARG B NE  1 
ATOM   5060  C CZ  . ARG B 1 118 ? 18.427  -66.170 41.681  1.00 37.23 ? 118  ARG B CZ  1 
ATOM   5061  N NH1 . ARG B 1 118 ? 18.433  -66.058 40.357  1.00 38.51 ? 118  ARG B NH1 1 
ATOM   5062  N NH2 . ARG B 1 118 ? 19.481  -66.690 42.298  1.00 38.20 ? 118  ARG B NH2 1 
ATOM   5063  N N   . LEU B 1 119 ? 16.034  -60.140 43.984  1.00 16.33 ? 119  LEU B N   1 
ATOM   5064  C CA  . LEU B 1 119 ? 14.928  -59.362 44.563  1.00 15.15 ? 119  LEU B CA  1 
ATOM   5065  C C   . LEU B 1 119 ? 14.800  -58.037 43.828  1.00 15.34 ? 119  LEU B C   1 
ATOM   5066  O O   . LEU B 1 119 ? 13.692  -57.603 43.503  1.00 14.66 ? 119  LEU B O   1 
ATOM   5067  C CB  . LEU B 1 119 ? 15.138  -59.122 46.070  1.00 16.05 ? 119  LEU B CB  1 
ATOM   5068  C CG  . LEU B 1 119 ? 14.169  -58.178 46.806  1.00 16.22 ? 119  LEU B CG  1 
ATOM   5069  C CD1 . LEU B 1 119 ? 12.727  -58.692 46.759  1.00 17.91 ? 119  LEU B CD1 1 
ATOM   5070  C CD2 . LEU B 1 119 ? 14.632  -57.986 48.237  1.00 16.06 ? 119  LEU B CD2 1 
ATOM   5071  N N   . ALA B 1 120 ? 15.955  -57.449 43.514  1.00 15.55 ? 120  ALA B N   1 
ATOM   5072  C CA  . ALA B 1 120 ? 16.030  -56.186 42.788  1.00 15.70 ? 120  ALA B CA  1 
ATOM   5073  C C   . ALA B 1 120 ? 15.482  -56.345 41.365  1.00 17.31 ? 120  ALA B C   1 
ATOM   5074  O O   . ALA B 1 120 ? 14.789  -55.461 40.854  1.00 17.35 ? 120  ALA B O   1 
ATOM   5075  C CB  . ALA B 1 120 ? 17.470  -55.679 42.761  1.00 16.14 ? 120  ALA B CB  1 
ATOM   5076  N N   . GLU B 1 121 ? 15.717  -57.524 40.785  1.00 18.14 ? 121  GLU B N   1 
ATOM   5077  C CA  . GLU B 1 121 ? 15.255  -57.867 39.436  1.00 19.74 ? 121  GLU B CA  1 
ATOM   5078  C C   . GLU B 1 121 ? 13.732  -58.049 39.437  1.00 19.32 ? 121  GLU B C   1 
ATOM   5079  O O   . GLU B 1 121 ? 13.040  -57.503 38.574  1.00 18.82 ? 121  GLU B O   1 
ATOM   5080  C CB  . GLU B 1 121 ? 15.956  -59.148 38.969  1.00 23.11 ? 121  GLU B CB  1 
ATOM   5081  C CG  . GLU B 1 121 ? 15.865  -59.458 37.473  1.00 29.21 ? 121  GLU B CG  1 
ATOM   5082  C CD  . GLU B 1 121 ? 16.734  -60.644 37.050  1.00 32.41 ? 121  GLU B CD  1 
ATOM   5083  O OE1 . GLU B 1 121 ? 17.391  -61.276 37.913  1.00 35.14 ? 121  GLU B OE1 1 
ATOM   5084  O OE2 . GLU B 1 121 ? 16.768  -60.944 35.835  1.00 36.66 ? 121  GLU B OE2 1 
ATOM   5085  N N   . GLU B 1 122 ? 13.225  -58.745 40.460  1.00 18.37 ? 122  GLU B N   1 
ATOM   5086  C CA  . GLU B 1 122 ? 11.791  -59.013 40.629  1.00 19.27 ? 122  GLU B CA  1 
ATOM   5087  C C   . GLU B 1 122 ? 10.954  -57.775 40.940  1.00 19.31 ? 122  GLU B C   1 
ATOM   5088  O O   . GLU B 1 122 ? 9.786   -57.699 40.551  1.00 20.14 ? 122  GLU B O   1 
ATOM   5089  C CB  . GLU B 1 122 ? 11.563  -60.044 41.732  1.00 22.34 ? 122  GLU B CB  1 
ATOM   5090  C CG  . GLU B 1 122 ? 11.052  -61.383 41.241  1.00 28.35 ? 122  GLU B CG  1 
ATOM   5091  C CD  . GLU B 1 122 ? 10.734  -62.331 42.380  1.00 30.14 ? 122  GLU B CD  1 
ATOM   5092  O OE1 . GLU B 1 122 ? 11.671  -62.774 43.064  1.00 33.07 ? 122  GLU B OE1 1 
ATOM   5093  O OE2 . GLU B 1 122 ? 9.544   -62.634 42.587  1.00 33.37 ? 122  GLU B OE2 1 
ATOM   5094  N N   . ARG B 1 123 ? 11.555  -56.819 41.652  1.00 18.29 ? 123  ARG B N   1 
ATOM   5095  C CA  . ARG B 1 123 ? 10.876  -55.577 42.018  1.00 18.08 ? 123  ARG B CA  1 
ATOM   5096  C C   . ARG B 1 123 ? 11.017  -54.492 40.956  1.00 18.16 ? 123  ARG B C   1 
ATOM   5097  O O   . ARG B 1 123 ? 10.510  -53.380 41.125  1.00 19.32 ? 123  ARG B O   1 
ATOM   5098  C CB  . ARG B 1 123 ? 11.344  -55.083 43.396  1.00 17.49 ? 123  ARG B CB  1 
ATOM   5099  C CG  . ARG B 1 123 ? 10.880  -55.973 44.554  1.00 18.66 ? 123  ARG B CG  1 
ATOM   5100  C CD  . ARG B 1 123 ? 9.361   -55.949 44.733  1.00 18.48 ? 123  ARG B CD  1 
ATOM   5101  N NE  . ARG B 1 123 ? 8.912   -54.772 45.477  1.00 18.19 ? 123  ARG B NE  1 
ATOM   5102  C CZ  . ARG B 1 123 ? 7.636   -54.447 45.691  1.00 19.92 ? 123  ARG B CZ  1 
ATOM   5103  N NH1 . ARG B 1 123 ? 6.647   -55.195 45.212  1.00 21.00 ? 123  ARG B NH1 1 
ATOM   5104  N NH2 . ARG B 1 123 ? 7.346   -53.390 46.435  1.00 19.72 ? 123  ARG B NH2 1 
ATOM   5105  N N   . GLY B 1 124 ? 11.701  -54.843 39.864  1.00 17.52 ? 124  GLY B N   1 
ATOM   5106  C CA  . GLY B 1 124 ? 11.908  -53.947 38.735  1.00 17.05 ? 124  GLY B CA  1 
ATOM   5107  C C   . GLY B 1 124 ? 12.676  -52.671 39.008  1.00 15.83 ? 124  GLY B C   1 
ATOM   5108  O O   . GLY B 1 124 ? 12.258  -51.597 38.561  1.00 16.53 ? 124  GLY B O   1 
ATOM   5109  N N   . ILE B 1 125 ? 13.804  -52.792 39.713  1.00 16.31 ? 125  ILE B N   1 
ATOM   5110  C CA  . ILE B 1 125 ? 14.644  -51.637 40.059  1.00 16.98 ? 125  ILE B CA  1 
ATOM   5111  C C   . ILE B 1 125 ? 15.233  -50.963 38.823  1.00 17.11 ? 125  ILE B C   1 
ATOM   5112  O O   . ILE B 1 125 ? 15.179  -49.739 38.719  1.00 16.90 ? 125  ILE B O   1 
ATOM   5113  C CB  . ILE B 1 125 ? 15.773  -52.015 41.084  1.00 18.30 ? 125  ILE B CB  1 
ATOM   5114  C CG1 . ILE B 1 125 ? 15.163  -52.516 42.399  1.00 19.44 ? 125  ILE B CG1 1 
ATOM   5115  C CG2 . ILE B 1 125 ? 16.723  -50.827 41.366  1.00 18.05 ? 125  ILE B CG2 1 
ATOM   5116  C CD1 . ILE B 1 125 ? 14.142  -51.630 43.055  1.00 21.37 ? 125  ILE B CD1 1 
ATOM   5117  N N   . ARG B 1 126 ? 15.710  -51.768 37.869  1.00 17.68 ? 126  ARG B N   1 
ATOM   5118  C CA  . ARG B 1 126 ? 16.304  -51.270 36.619  1.00 18.42 ? 126  ARG B CA  1 
ATOM   5119  C C   . ARG B 1 126 ? 15.324  -50.373 35.846  1.00 18.65 ? 126  ARG B C   1 
ATOM   5120  O O   . ARG B 1 126 ? 15.675  -49.253 35.468  1.00 18.88 ? 126  ARG B O   1 
ATOM   5121  C CB  . ARG B 1 126 ? 16.763  -52.443 35.744  1.00 21.05 ? 126  ARG B CB  1 
ATOM   5122  C CG  . ARG B 1 126 ? 17.513  -52.041 34.462  1.00 25.04 ? 126  ARG B CG  1 
ATOM   5123  C CD  . ARG B 1 126 ? 17.802  -53.240 33.556  1.00 28.95 ? 126  ARG B CD  1 
ATOM   5124  N NE  . ARG B 1 126 ? 16.625  -54.084 33.317  1.00 32.35 ? 126  ARG B NE  1 
ATOM   5125  C CZ  . ARG B 1 126 ? 15.625  -53.806 32.477  1.00 34.67 ? 126  ARG B CZ  1 
ATOM   5126  N NH1 . ARG B 1 126 ? 15.620  -52.686 31.759  1.00 36.32 ? 126  ARG B NH1 1 
ATOM   5127  N NH2 . ARG B 1 126 ? 14.612  -54.653 32.363  1.00 35.77 ? 126  ARG B NH2 1 
ATOM   5128  N N   . GLN B 1 127 ? 14.080  -50.841 35.708  1.00 17.69 ? 127  GLN B N   1 
ATOM   5129  C CA  . GLN B 1 127 ? 13.021  -50.109 35.008  1.00 18.13 ? 127  GLN B CA  1 
ATOM   5130  C C   . GLN B 1 127 ? 12.579  -48.851 35.761  1.00 17.80 ? 127  GLN B C   1 
ATOM   5131  O O   . GLN B 1 127 ? 12.268  -47.831 35.137  1.00 17.33 ? 127  GLN B O   1 
ATOM   5132  C CB  . GLN B 1 127 ? 11.805  -51.014 34.765  1.00 20.36 ? 127  GLN B CB  1 
ATOM   5133  C CG  . GLN B 1 127 ? 12.078  -52.234 33.886  1.00 23.55 ? 127  GLN B CG  1 
ATOM   5134  C CD  . GLN B 1 127 ? 12.196  -53.526 34.680  1.00 25.65 ? 127  GLN B CD  1 
ATOM   5135  O OE1 . GLN B 1 127 ? 11.393  -54.445 34.509  1.00 28.80 ? 127  GLN B OE1 1 
ATOM   5136  N NE2 . GLN B 1 127 ? 13.203  -53.606 35.544  1.00 22.40 ? 127  GLN B NE2 1 
ATOM   5137  N N   . PHE B 1 128 ? 12.583  -48.926 37.097  1.00 15.91 ? 128  PHE B N   1 
ATOM   5138  C CA  . PHE B 1 128 ? 12.199  -47.801 37.956  1.00 15.27 ? 128  PHE B CA  1 
ATOM   5139  C C   . PHE B 1 128 ? 13.229  -46.674 37.842  1.00 14.86 ? 128  PHE B C   1 
ATOM   5140  O O   . PHE B 1 128 ? 12.856  -45.500 37.776  1.00 15.81 ? 128  PHE B O   1 
ATOM   5141  C CB  . PHE B 1 128 ? 12.047  -48.251 39.424  1.00 15.95 ? 128  PHE B CB  1 
ATOM   5142  C CG  . PHE B 1 128 ? 11.550  -47.163 40.358  1.00 17.05 ? 128  PHE B CG  1 
ATOM   5143  C CD1 . PHE B 1 128 ? 10.192  -46.781 40.357  1.00 19.33 ? 128  PHE B CD1 1 
ATOM   5144  C CD2 . PHE B 1 128 ? 12.443  -46.498 41.222  1.00 15.90 ? 128  PHE B CD2 1 
ATOM   5145  C CE1 . PHE B 1 128 ? 9.723   -45.739 41.208  1.00 20.50 ? 128  PHE B CE1 1 
ATOM   5146  C CE2 . PHE B 1 128 ? 11.996  -45.454 42.080  1.00 17.25 ? 128  PHE B CE2 1 
ATOM   5147  C CZ  . PHE B 1 128 ? 10.634  -45.073 42.073  1.00 18.27 ? 128  PHE B CZ  1 
ATOM   5148  N N   . VAL B 1 129 ? 14.511  -47.042 37.803  1.00 15.19 ? 129  VAL B N   1 
ATOM   5149  C CA  . VAL B 1 129 ? 15.620  -46.088 37.681  1.00 13.41 ? 129  VAL B CA  1 
ATOM   5150  C C   . VAL B 1 129 ? 15.526  -45.342 36.353  1.00 14.65 ? 129  VAL B C   1 
ATOM   5151  O O   . VAL B 1 129 ? 15.628  -44.116 36.319  1.00 14.18 ? 129  VAL B O   1 
ATOM   5152  C CB  . VAL B 1 129 ? 16.994  -46.805 37.789  1.00 13.93 ? 129  VAL B CB  1 
ATOM   5153  C CG1 . VAL B 1 129 ? 18.164  -45.852 37.488  1.00 13.01 ? 129  VAL B CG1 1 
ATOM   5154  C CG2 . VAL B 1 129 ? 17.144  -47.388 39.172  1.00 15.11 ? 129  VAL B CG2 1 
ATOM   5155  N N   . GLN B 1 130 ? 15.272  -46.090 35.277  1.00 15.31 ? 130  GLN B N   1 
ATOM   5156  C CA  . GLN B 1 130 ? 15.139  -45.502 33.946  1.00 15.53 ? 130  GLN B CA  1 
ATOM   5157  C C   . GLN B 1 130 ? 13.957  -44.538 33.885  1.00 15.71 ? 130  GLN B C   1 
ATOM   5158  O O   . GLN B 1 130 ? 14.052  -43.487 33.257  1.00 14.79 ? 130  GLN B O   1 
ATOM   5159  C CB  . GLN B 1 130 ? 15.031  -46.595 32.872  1.00 16.70 ? 130  GLN B CB  1 
ATOM   5160  C CG  . GLN B 1 130 ? 16.312  -47.424 32.673  1.00 20.07 ? 130  GLN B CG  1 
ATOM   5161  C CD  . GLN B 1 130 ? 17.529  -46.595 32.251  1.00 22.35 ? 130  GLN B CD  1 
ATOM   5162  O OE1 . GLN B 1 130 ? 17.491  -45.863 31.256  1.00 23.40 ? 130  GLN B OE1 1 
ATOM   5163  N NE2 . GLN B 1 130 ? 18.614  -46.712 33.010  1.00 22.17 ? 130  GLN B NE2 1 
ATOM   5164  N N   . SER B 1 131 ? 12.898  -44.859 34.637  1.00 15.33 ? 131  SER B N   1 
ATOM   5165  C CA  . SER B 1 131 ? 11.694  -44.029 34.719  1.00 14.96 ? 131  SER B CA  1 
ATOM   5166  C C   . SER B 1 131 ? 11.979  -42.728 35.469  1.00 14.66 ? 131  SER B C   1 
ATOM   5167  O O   . SER B 1 131 ? 11.543  -41.661 35.045  1.00 14.07 ? 131  SER B O   1 
ATOM   5168  C CB  . SER B 1 131 ? 10.548  -44.785 35.399  1.00 17.38 ? 131  SER B CB  1 
ATOM   5169  O OG  . SER B 1 131 ? 10.066  -45.828 34.571  1.00 19.27 ? 131  SER B OG  1 
ATOM   5170  N N   . VAL B 1 132 ? 12.762  -42.821 36.548  1.00 14.67 ? 132  VAL B N   1 
ATOM   5171  C CA  . VAL B 1 132 ? 13.142  -41.651 37.350  1.00 13.20 ? 132  VAL B CA  1 
ATOM   5172  C C   . VAL B 1 132 ? 14.014  -40.718 36.501  1.00 13.33 ? 132  VAL B C   1 
ATOM   5173  O O   . VAL B 1 132 ? 13.731  -39.520 36.390  1.00 13.14 ? 132  VAL B O   1 
ATOM   5174  C CB  . VAL B 1 132 ? 13.943  -42.069 38.639  1.00 13.43 ? 132  VAL B CB  1 
ATOM   5175  C CG1 . VAL B 1 132 ? 14.476  -40.840 39.396  1.00 14.36 ? 132  VAL B CG1 1 
ATOM   5176  C CG2 . VAL B 1 132 ? 13.065  -42.881 39.566  1.00 14.01 ? 132  VAL B CG2 1 
ATOM   5177  N N   . PHE B 1 133 ? 15.020  -41.309 35.854  1.00 12.77 ? 133  PHE B N   1 
ATOM   5178  C CA  . PHE B 1 133 ? 15.978  -40.584 35.018  1.00 14.22 ? 133  PHE B CA  1 
ATOM   5179  C C   . PHE B 1 133 ? 15.414  -39.916 33.763  1.00 14.45 ? 133  PHE B C   1 
ATOM   5180  O O   . PHE B 1 133 ? 15.940  -38.886 33.335  1.00 15.45 ? 133  PHE B O   1 
ATOM   5181  C CB  . PHE B 1 133 ? 17.160  -41.489 34.651  1.00 14.81 ? 133  PHE B CB  1 
ATOM   5182  C CG  . PHE B 1 133 ? 18.222  -41.597 35.727  1.00 15.75 ? 133  PHE B CG  1 
ATOM   5183  C CD1 . PHE B 1 133 ? 17.898  -41.969 37.053  1.00 16.88 ? 133  PHE B CD1 1 
ATOM   5184  C CD2 . PHE B 1 133 ? 19.571  -41.361 35.404  1.00 16.34 ? 133  PHE B CD2 1 
ATOM   5185  C CE1 . PHE B 1 133 ? 18.915  -42.110 38.047  1.00 17.62 ? 133  PHE B CE1 1 
ATOM   5186  C CE2 . PHE B 1 133 ? 20.597  -41.495 36.378  1.00 17.50 ? 133  PHE B CE2 1 
ATOM   5187  C CZ  . PHE B 1 133 ? 20.268  -41.872 37.702  1.00 17.32 ? 133  PHE B CZ  1 
ATOM   5188  N N   . ARG B 1 134 ? 14.344  -40.475 33.192  1.00 14.97 ? 134  ARG B N   1 
ATOM   5189  C CA  . ARG B 1 134 ? 13.737  -39.887 31.992  1.00 16.46 ? 134  ARG B CA  1 
ATOM   5190  C C   . ARG B 1 134 ? 12.681  -38.819 32.305  1.00 16.25 ? 134  ARG B C   1 
ATOM   5191  O O   . ARG B 1 134 ? 12.153  -38.172 31.398  1.00 16.44 ? 134  ARG B O   1 
ATOM   5192  C CB  . ARG B 1 134 ? 13.181  -40.959 31.036  1.00 19.10 ? 134  ARG B CB  1 
ATOM   5193  C CG  . ARG B 1 134 ? 11.879  -41.640 31.442  1.00 21.82 ? 134  ARG B CG  1 
ATOM   5194  C CD  . ARG B 1 134 ? 11.343  -42.533 30.318  1.00 24.24 ? 134  ARG B CD  1 
ATOM   5195  N NE  . ARG B 1 134 ? 12.268  -43.611 29.974  1.00 26.48 ? 134  ARG B NE  1 
ATOM   5196  C CZ  . ARG B 1 134 ? 12.144  -44.881 30.361  1.00 26.52 ? 134  ARG B CZ  1 
ATOM   5197  N NH1 . ARG B 1 134 ? 11.121  -45.269 31.112  1.00 27.67 ? 134  ARG B NH1 1 
ATOM   5198  N NH2 . ARG B 1 134 ? 13.067  -45.765 30.009  1.00 26.18 ? 134  ARG B NH2 1 
ATOM   5199  N N   . GLY B 1 135 ? 12.362  -38.659 33.588  1.00 15.64 ? 135  GLY B N   1 
ATOM   5200  C CA  . GLY B 1 135 ? 11.398  -37.649 33.979  1.00 14.66 ? 135  GLY B CA  1 
ATOM   5201  C C   . GLY B 1 135 ? 9.963   -38.071 34.176  1.00 15.10 ? 135  GLY B C   1 
ATOM   5202  O O   . GLY B 1 135 ? 9.077   -37.211 34.201  1.00 15.05 ? 135  GLY B O   1 
ATOM   5203  N N   . GLU B 1 136 ? 9.716   -39.377 34.304  1.00 14.15 ? 136  GLU B N   1 
ATOM   5204  C CA  . GLU B 1 136 ? 8.359   -39.874 34.547  1.00 16.31 ? 136  GLU B CA  1 
ATOM   5205  C C   . GLU B 1 136 ? 7.939   -39.454 35.959  1.00 15.29 ? 136  GLU B C   1 
ATOM   5206  O O   . GLU B 1 136 ? 8.781   -39.307 36.851  1.00 15.43 ? 136  GLU B O   1 
ATOM   5207  C CB  . GLU B 1 136 ? 8.282   -41.393 34.400  1.00 18.19 ? 136  GLU B CB  1 
ATOM   5208  C CG  . GLU B 1 136 ? 8.363   -41.887 32.961  1.00 23.01 ? 136  GLU B CG  1 
ATOM   5209  C CD  . GLU B 1 136 ? 8.291   -43.415 32.850  1.00 25.43 ? 136  GLU B CD  1 
ATOM   5210  O OE1 . GLU B 1 136 ? 7.690   -44.060 33.745  1.00 28.52 ? 136  GLU B OE1 1 
ATOM   5211  O OE2 . GLU B 1 136 ? 8.845   -43.974 31.877  1.00 28.74 ? 136  GLU B OE2 1 
ATOM   5212  N N   . ARG B 1 137 ? 6.641   -39.240 36.139  1.00 15.79 ? 137  ARG B N   1 
ATOM   5213  C CA  . ARG B 1 137 ? 6.078   -38.802 37.414  1.00 16.12 ? 137  ARG B CA  1 
ATOM   5214  C C   . ARG B 1 137 ? 5.980   -39.939 38.429  1.00 16.29 ? 137  ARG B C   1 
ATOM   5215  O O   . ARG B 1 137 ? 4.884   -40.396 38.777  1.00 16.98 ? 137  ARG B O   1 
ATOM   5216  C CB  . ARG B 1 137 ? 4.727   -38.117 37.163  1.00 16.63 ? 137  ARG B CB  1 
ATOM   5217  C CG  . ARG B 1 137 ? 4.879   -36.836 36.345  1.00 19.87 ? 137  ARG B CG  1 
ATOM   5218  C CD  . ARG B 1 137 ? 3.564   -36.222 35.873  1.00 22.00 ? 137  ARG B CD  1 
ATOM   5219  N NE  . ARG B 1 137 ? 3.789   -35.060 34.992  1.00 23.39 ? 137  ARG B NE  1 
ATOM   5220  C CZ  . ARG B 1 137 ? 4.023   -33.813 35.418  1.00 24.60 ? 137  ARG B CZ  1 
ATOM   5221  N NH1 . ARG B 1 137 ? 4.062   -33.543 36.713  1.00 22.90 ? 137  ARG B NH1 1 
ATOM   5222  N NH2 . ARG B 1 137 ? 4.247   -32.821 34.563  1.00 26.02 ? 137  ARG B NH2 1 
ATOM   5223  N N   . VAL B 1 138 ? 7.156   -40.370 38.902  1.00 15.74 ? 138  VAL B N   1 
ATOM   5224  C CA  . VAL B 1 138 ? 7.315   -41.474 39.857  1.00 15.44 ? 138  VAL B CA  1 
ATOM   5225  C C   . VAL B 1 138 ? 6.875   -41.108 41.286  1.00 14.39 ? 138  VAL B C   1 
ATOM   5226  O O   . VAL B 1 138 ? 6.596   -41.984 42.110  1.00 15.50 ? 138  VAL B O   1 
ATOM   5227  C CB  . VAL B 1 138 ? 8.774   -42.037 39.842  1.00 15.82 ? 138  VAL B CB  1 
ATOM   5228  C CG1 . VAL B 1 138 ? 9.192   -42.446 38.437  1.00 16.66 ? 138  VAL B CG1 1 
ATOM   5229  C CG2 . VAL B 1 138 ? 9.763   -41.019 40.342  1.00 18.42 ? 138  VAL B CG2 1 
ATOM   5230  N N   . ASN B 1 139 ? 6.856   -39.807 41.584  1.00 13.38 ? 139  ASN B N   1 
ATOM   5231  C CA  . ASN B 1 139 ? 6.373   -39.311 42.885  1.00 13.22 ? 139  ASN B CA  1 
ATOM   5232  C C   . ASN B 1 139 ? 4.852   -39.226 42.656  1.00 13.91 ? 139  ASN B C   1 
ATOM   5233  O O   . ASN B 1 139 ? 4.295   -38.157 42.406  1.00 15.38 ? 139  ASN B O   1 
ATOM   5234  C CB  . ASN B 1 139 ? 6.988   -37.930 43.201  1.00 13.17 ? 139  ASN B CB  1 
ATOM   5235  C CG  . ASN B 1 139 ? 6.422   -37.297 44.484  1.00 12.89 ? 139  ASN B CG  1 
ATOM   5236  O OD1 . ASN B 1 139 ? 5.481   -37.812 45.077  1.00 13.78 ? 139  ASN B OD1 1 
ATOM   5237  N ND2 . ASN B 1 139 ? 6.981   -36.166 44.888  1.00 13.57 ? 139  ASN B ND2 1 
ATOM   5238  N N   . THR B 1 140 ? 4.213   -40.389 42.769  1.00 14.65 ? 140  THR B N   1 
ATOM   5239  C CA  . THR B 1 140 ? 2.790   -40.577 42.491  1.00 16.19 ? 140  THR B CA  1 
ATOM   5240  C C   . THR B 1 140 ? 1.772   -39.838 43.358  1.00 16.40 ? 140  THR B C   1 
ATOM   5241  O O   . THR B 1 140 ? 0.702   -39.460 42.880  1.00 16.40 ? 140  THR B O   1 
ATOM   5242  C CB  . THR B 1 140 ? 2.430   -42.085 42.506  1.00 16.51 ? 140  THR B CB  1 
ATOM   5243  O OG1 . THR B 1 140 ? 2.895   -42.660 43.728  1.00 18.14 ? 140  THR B OG1 1 
ATOM   5244  C CG2 . THR B 1 140 ? 3.073   -42.844 41.345  1.00 18.57 ? 140  THR B CG2 1 
ATOM   5245  N N   . THR B 1 141 ? 2.101   -39.620 44.629  1.00 15.74 ? 141  THR B N   1 
ATOM   5246  C CA  . THR B 1 141 ? 1.166   -38.948 45.536  1.00 15.62 ? 141  THR B CA  1 
ATOM   5247  C C   . THR B 1 141 ? 1.014   -37.461 45.214  1.00 16.00 ? 141  THR B C   1 
ATOM   5248  O O   . THR B 1 141 ? -0.042  -36.864 45.442  1.00 18.06 ? 141  THR B O   1 
ATOM   5249  C CB  . THR B 1 141 ? 1.587   -39.107 47.008  1.00 15.48 ? 141  THR B CB  1 
ATOM   5250  O OG1 . THR B 1 141 ? 2.806   -38.395 47.230  1.00 14.21 ? 141  THR B OG1 1 
ATOM   5251  C CG2 . THR B 1 141 ? 1.813   -40.560 47.366  1.00 15.91 ? 141  THR B CG2 1 
ATOM   5252  N N   . GLU B 1 142 ? 2.092   -36.880 44.688  1.00 16.01 ? 142  GLU B N   1 
ATOM   5253  C CA  . GLU B 1 142 ? 2.129   -35.472 44.306  1.00 15.86 ? 142  GLU B CA  1 
ATOM   5254  C C   . GLU B 1 142 ? 2.109   -35.295 42.783  1.00 16.47 ? 142  GLU B C   1 
ATOM   5255  O O   . GLU B 1 142 ? 2.034   -34.164 42.296  1.00 17.31 ? 142  GLU B O   1 
ATOM   5256  C CB  . GLU B 1 142 ? 3.370   -34.790 44.901  1.00 16.10 ? 142  GLU B CB  1 
ATOM   5257  C CG  . GLU B 1 142 ? 3.364   -34.696 46.424  1.00 16.96 ? 142  GLU B CG  1 
ATOM   5258  C CD  . GLU B 1 142 ? 4.568   -33.976 46.996  1.00 19.63 ? 142  GLU B CD  1 
ATOM   5259  O OE1 . GLU B 1 142 ? 5.711   -34.311 46.622  1.00 19.51 ? 142  GLU B OE1 1 
ATOM   5260  O OE2 . GLU B 1 142 ? 4.371   -33.080 47.842  1.00 20.68 ? 142  GLU B OE2 1 
ATOM   5261  N N   . ASN B 1 143 ? 2.167   -36.416 42.048  1.00 16.82 ? 143  ASN B N   1 
ATOM   5262  C CA  . ASN B 1 143 ? 2.175   -36.471 40.567  1.00 16.93 ? 143  ASN B CA  1 
ATOM   5263  C C   . ASN B 1 143 ? 3.273   -35.559 39.983  1.00 17.31 ? 143  ASN B C   1 
ATOM   5264  O O   . ASN B 1 143 ? 3.025   -34.694 39.138  1.00 17.95 ? 143  ASN B O   1 
ATOM   5265  C CB  . ASN B 1 143 ? 0.771   -36.153 39.999  1.00 18.92 ? 143  ASN B CB  1 
ATOM   5266  C CG  . ASN B 1 143 ? 0.663   -36.405 38.496  1.00 19.88 ? 143  ASN B CG  1 
ATOM   5267  O OD1 . ASN B 1 143 ? 1.247   -37.350 37.964  1.00 19.37 ? 143  ASN B OD1 1 
ATOM   5268  N ND2 . ASN B 1 143 ? -0.073  -35.540 37.806  1.00 21.80 ? 143  ASN B ND2 1 
ATOM   5269  N N   . ARG B 1 144 ? 4.488   -35.751 40.491  1.00 15.27 ? 144  ARG B N   1 
ATOM   5270  C CA  . ARG B 1 144 ? 5.645   -34.947 40.099  1.00 15.56 ? 144  ARG B CA  1 
ATOM   5271  C C   . ARG B 1 144 ? 6.843   -35.778 39.661  1.00 14.03 ? 144  ARG B C   1 
ATOM   5272  O O   . ARG B 1 144 ? 6.975   -36.941 40.069  1.00 12.95 ? 144  ARG B O   1 
ATOM   5273  C CB  . ARG B 1 144 ? 6.130   -34.108 41.296  1.00 17.33 ? 144  ARG B CB  1 
ATOM   5274  C CG  . ARG B 1 144 ? 5.266   -32.943 41.745  1.00 20.62 ? 144  ARG B CG  1 
ATOM   5275  C CD  . ARG B 1 144 ? 5.920   -32.294 42.959  1.00 21.95 ? 144  ARG B CD  1 
ATOM   5276  N NE  . ARG B 1 144 ? 5.075   -31.291 43.602  1.00 25.69 ? 144  ARG B NE  1 
ATOM   5277  C CZ  . ARG B 1 144 ? 5.410   -30.613 44.698  1.00 26.93 ? 144  ARG B CZ  1 
ATOM   5278  N NH1 . ARG B 1 144 ? 6.582   -30.819 45.293  1.00 26.62 ? 144  ARG B NH1 1 
ATOM   5279  N NH2 . ARG B 1 144 ? 4.567   -29.723 45.207  1.00 27.88 ? 144  ARG B NH2 1 
ATOM   5280  N N   . PRO B 1 145 ? 7.693   -35.231 38.756  1.00 14.11 ? 145  PRO B N   1 
ATOM   5281  C CA  . PRO B 1 145 ? 8.880   -35.992 38.344  1.00 13.74 ? 145  PRO B CA  1 
ATOM   5282  C C   . PRO B 1 145 ? 9.892   -35.872 39.503  1.00 12.55 ? 145  PRO B C   1 
ATOM   5283  O O   . PRO B 1 145 ? 9.667   -35.115 40.461  1.00 12.27 ? 145  PRO B O   1 
ATOM   5284  C CB  . PRO B 1 145 ? 9.373   -35.236 37.102  1.00 12.87 ? 145  PRO B CB  1 
ATOM   5285  C CG  . PRO B 1 145 ? 8.145   -34.546 36.588  1.00 14.22 ? 145  PRO B CG  1 
ATOM   5286  C CD  . PRO B 1 145 ? 7.471   -34.090 37.842  1.00 14.51 ? 145  PRO B CD  1 
ATOM   5287  N N   . VAL B 1 146 ? 10.949  -36.672 39.456  1.00 11.30 ? 146  VAL B N   1 
ATOM   5288  C CA  . VAL B 1 146 ? 11.993  -36.661 40.483  1.00 10.56 ? 146  VAL B CA  1 
ATOM   5289  C C   . VAL B 1 146 ? 13.266  -36.506 39.680  1.00 10.56 ? 146  VAL B C   1 
ATOM   5290  O O   . VAL B 1 146 ? 13.840  -37.480 39.185  1.00 10.87 ? 146  VAL B O   1 
ATOM   5291  C CB  . VAL B 1 146 ? 11.970  -37.970 41.297  1.00 10.96 ? 146  VAL B CB  1 
ATOM   5292  C CG1 . VAL B 1 146 ? 13.132  -38.028 42.244  1.00 12.15 ? 146  VAL B CG1 1 
ATOM   5293  C CG2 . VAL B 1 146 ? 10.673  -38.059 42.068  1.00 10.31 ? 146  VAL B CG2 1 
ATOM   5294  N N   . LEU B 1 147 ? 13.683  -35.253 39.522  1.00 10.26 ? 147  LEU B N   1 
ATOM   5295  C CA  . LEU B 1 147 ? 14.835  -34.960 38.692  1.00 9.29  ? 147  LEU B CA  1 
ATOM   5296  C C   . LEU B 1 147 ? 16.028  -34.205 39.251  1.00 9.67  ? 147  LEU B C   1 
ATOM   5297  O O   . LEU B 1 147 ? 16.577  -33.315 38.592  1.00 9.86  ? 147  LEU B O   1 
ATOM   5298  C CB  . LEU B 1 147 ? 14.371  -34.324 37.376  1.00 11.27 ? 147  LEU B CB  1 
ATOM   5299  C CG  . LEU B 1 147 ? 13.621  -35.168 36.350  1.00 10.34 ? 147  LEU B CG  1 
ATOM   5300  C CD1 . LEU B 1 147 ? 13.141  -34.265 35.253  1.00 13.37 ? 147  LEU B CD1 1 
ATOM   5301  C CD2 . LEU B 1 147 ? 14.520  -36.274 35.821  1.00 12.11 ? 147  LEU B CD2 1 
ATOM   5302  N N   . HIS B 1 148 ? 16.483  -34.596 40.438  1.00 9.26  ? 148  HIS B N   1 
ATOM   5303  C CA  . HIS B 1 148 ? 17.685  -33.977 40.993  1.00 9.40  ? 148  HIS B CA  1 
ATOM   5304  C C   . HIS B 1 148 ? 18.910  -34.360 40.138  1.00 10.18 ? 148  HIS B C   1 
ATOM   5305  O O   . HIS B 1 148 ? 19.900  -33.630 40.111  1.00 10.50 ? 148  HIS B O   1 
ATOM   5306  C CB  . HIS B 1 148 ? 17.902  -34.328 42.466  1.00 9.86  ? 148  HIS B CB  1 
ATOM   5307  C CG  . HIS B 1 148 ? 17.657  -35.766 42.796  1.00 9.35  ? 148  HIS B CG  1 
ATOM   5308  N ND1 . HIS B 1 148 ? 16.392  -36.269 43.005  1.00 9.81  ? 148  HIS B ND1 1 
ATOM   5309  C CD2 . HIS B 1 148 ? 18.510  -36.803 42.966  1.00 9.52  ? 148  HIS B CD2 1 
ATOM   5310  C CE1 . HIS B 1 148 ? 16.477  -37.557 43.291  1.00 10.37 ? 148  HIS B CE1 1 
ATOM   5311  N NE2 . HIS B 1 148 ? 17.751  -37.906 43.274  1.00 9.91  ? 148  HIS B NE2 1 
ATOM   5312  N N   . ILE B 1 149 ? 18.790  -35.454 39.374  1.00 9.73  ? 149  ILE B N   1 
ATOM   5313  C CA  . ILE B 1 149 ? 19.867  -35.899 38.482  1.00 9.73  ? 149  ILE B CA  1 
ATOM   5314  C C   . ILE B 1 149 ? 20.047  -34.927 37.302  1.00 9.87  ? 149  ILE B C   1 
ATOM   5315  O O   . ILE B 1 149 ? 21.138  -34.821 36.742  1.00 10.93 ? 149  ILE B O   1 
ATOM   5316  C CB  . ILE B 1 149 ? 19.695  -37.385 37.985  1.00 10.45 ? 149  ILE B CB  1 
ATOM   5317  C CG1 . ILE B 1 149 ? 18.407  -37.588 37.172  1.00 11.46 ? 149  ILE B CG1 1 
ATOM   5318  C CG2 . ILE B 1 149 ? 19.758  -38.344 39.167  1.00 9.99  ? 149  ILE B CG2 1 
ATOM   5319  C CD1 . ILE B 1 149 ? 18.630  -37.637 35.656  1.00 13.40 ? 149  ILE B CD1 1 
ATOM   5320  N N   . ALA B 1 150 ? 18.976  -34.200 36.965  1.00 9.74  ? 150  ALA B N   1 
ATOM   5321  C CA  . ALA B 1 150 ? 19.010  -33.215 35.877  1.00 10.92 ? 150  ALA B CA  1 
ATOM   5322  C C   . ALA B 1 150 ? 19.852  -31.995 36.249  1.00 11.20 ? 150  ALA B C   1 
ATOM   5323  O O   . ALA B 1 150 ? 20.514  -31.405 35.395  1.00 11.84 ? 150  ALA B O   1 
ATOM   5324  C CB  . ALA B 1 150 ? 17.600  -32.784 35.497  1.00 11.30 ? 150  ALA B CB  1 
ATOM   5325  N N   . LEU B 1 151 ? 19.880  -31.678 37.544  1.00 10.31 ? 151  LEU B N   1 
ATOM   5326  C CA  . LEU B 1 151 ? 20.637  -30.535 38.065  1.00 9.15  ? 151  LEU B CA  1 
ATOM   5327  C C   . LEU B 1 151 ? 22.146  -30.655 37.877  1.00 9.70  ? 151  LEU B C   1 
ATOM   5328  O O   . LEU B 1 151 ? 22.845  -29.649 37.743  1.00 9.29  ? 151  LEU B O   1 
ATOM   5329  C CB  . LEU B 1 151 ? 20.331  -30.331 39.548  1.00 9.20  ? 151  LEU B CB  1 
ATOM   5330  C CG  . LEU B 1 151 ? 18.874  -30.074 39.931  1.00 8.81  ? 151  LEU B CG  1 
ATOM   5331  C CD1 . LEU B 1 151 ? 18.741  -30.211 41.434  1.00 9.95  ? 151  LEU B CD1 1 
ATOM   5332  C CD2 . LEU B 1 151 ? 18.412  -28.700 39.453  1.00 9.13  ? 151  LEU B CD2 1 
ATOM   5333  N N   . ARG B 1 152 ? 22.626  -31.895 37.841  1.00 9.48  ? 152  ARG B N   1 
ATOM   5334  C CA  . ARG B 1 152 ? 24.043  -32.186 37.679  1.00 10.85 ? 152  ARG B CA  1 
ATOM   5335  C C   . ARG B 1 152 ? 24.350  -32.953 36.387  1.00 10.68 ? 152  ARG B C   1 
ATOM   5336  O O   . ARG B 1 152 ? 25.408  -33.568 36.261  1.00 11.75 ? 152  ARG B O   1 
ATOM   5337  C CB  . ARG B 1 152 ? 24.553  -32.955 38.905  1.00 10.44 ? 152  ARG B CB  1 
ATOM   5338  C CG  . ARG B 1 152 ? 23.955  -34.334 39.111  1.00 11.28 ? 152  ARG B CG  1 
ATOM   5339  C CD  . ARG B 1 152 ? 23.119  -34.418 40.371  1.00 11.63 ? 152  ARG B CD  1 
ATOM   5340  N NE  . ARG B 1 152 ? 22.826  -35.816 40.682  1.00 10.10 ? 152  ARG B NE  1 
ATOM   5341  C CZ  . ARG B 1 152 ? 22.343  -36.253 41.843  1.00 9.86  ? 152  ARG B CZ  1 
ATOM   5342  N NH1 . ARG B 1 152 ? 22.075  -35.406 42.827  1.00 10.94 ? 152  ARG B NH1 1 
ATOM   5343  N NH2 . ARG B 1 152 ? 22.159  -37.553 42.035  1.00 9.10  ? 152  ARG B NH2 1 
ATOM   5344  N N   . ASN B 1 153 ? 23.432  -32.889 35.423  1.00 11.25 ? 153  ASN B N   1 
ATOM   5345  C CA  . ASN B 1 153 ? 23.590  -33.585 34.141  1.00 11.44 ? 153  ASN B CA  1 
ATOM   5346  C C   . ASN B 1 153 ? 24.595  -32.847 33.245  1.00 11.30 ? 153  ASN B C   1 
ATOM   5347  O O   . ASN B 1 153 ? 24.215  -32.080 32.356  1.00 12.24 ? 153  ASN B O   1 
ATOM   5348  C CB  . ASN B 1 153 ? 22.205  -33.750 33.484  1.00 11.89 ? 153  ASN B CB  1 
ATOM   5349  C CG  . ASN B 1 153 ? 22.256  -34.390 32.100  1.00 12.51 ? 153  ASN B CG  1 
ATOM   5350  O OD1 . ASN B 1 153 ? 23.198  -35.104 31.754  1.00 14.03 ? 153  ASN B OD1 1 
ATOM   5351  N ND2 . ASN B 1 153 ? 21.232  -34.118 31.299  1.00 13.16 ? 153  ASN B ND2 1 
ATOM   5352  N N   . ARG B 1 154 ? 25.876  -33.141 33.474  1.00 11.12 ? 154  ARG B N   1 
ATOM   5353  C CA  . ARG B 1 154 ? 26.980  -32.517 32.744  1.00 13.32 ? 154  ARG B CA  1 
ATOM   5354  C C   . ARG B 1 154 ? 27.069  -32.891 31.272  1.00 14.35 ? 154  ARG B C   1 
ATOM   5355  O O   . ARG B 1 154 ? 27.605  -32.119 30.477  1.00 15.85 ? 154  ARG B O   1 
ATOM   5356  C CB  . ARG B 1 154 ? 28.323  -32.789 33.433  1.00 14.55 ? 154  ARG B CB  1 
ATOM   5357  C CG  . ARG B 1 154 ? 28.393  -32.420 34.920  1.00 14.48 ? 154  ARG B CG  1 
ATOM   5358  C CD  . ARG B 1 154 ? 27.959  -30.983 35.218  1.00 14.53 ? 154  ARG B CD  1 
ATOM   5359  N NE  . ARG B 1 154 ? 28.769  -29.987 34.520  1.00 16.86 ? 154  ARG B NE  1 
ATOM   5360  C CZ  . ARG B 1 154 ? 28.506  -28.682 34.497  1.00 16.49 ? 154  ARG B CZ  1 
ATOM   5361  N NH1 . ARG B 1 154 ? 27.447  -28.190 35.130  1.00 16.52 ? 154  ARG B NH1 1 
ATOM   5362  N NH2 . ARG B 1 154 ? 29.327  -27.858 33.860  1.00 16.35 ? 154  ARG B NH2 1 
ATOM   5363  N N   . SER B 1 155 ? 26.501  -34.044 30.911  1.00 15.94 ? 155  SER B N   1 
ATOM   5364  C CA  . SER B 1 155 ? 26.496  -34.514 29.516  1.00 16.77 ? 155  SER B CA  1 
ATOM   5365  C C   . SER B 1 155 ? 25.554  -33.652 28.673  1.00 16.77 ? 155  SER B C   1 
ATOM   5366  O O   . SER B 1 155 ? 25.685  -33.575 27.450  1.00 16.73 ? 155  SER B O   1 
ATOM   5367  C CB  . SER B 1 155 ? 26.046  -35.982 29.441  1.00 16.94 ? 155  SER B CB  1 
ATOM   5368  O OG  . SER B 1 155 ? 24.633  -36.107 29.541  1.00 20.44 ? 155  SER B OG  1 
ATOM   5369  N N   . ASN B 1 156 ? 24.613  -33.004 29.372  1.00 16.23 ? 156  ASN B N   1 
ATOM   5370  C CA  . ASN B 1 156 ? 23.586  -32.130 28.808  1.00 18.06 ? 156  ASN B CA  1 
ATOM   5371  C C   . ASN B 1 156 ? 22.631  -32.815 27.840  1.00 18.09 ? 156  ASN B C   1 
ATOM   5372  O O   . ASN B 1 156 ? 22.010  -32.162 26.994  1.00 19.43 ? 156  ASN B O   1 
ATOM   5373  C CB  . ASN B 1 156 ? 24.184  -30.848 28.203  1.00 17.55 ? 156  ASN B CB  1 
ATOM   5374  C CG  . ASN B 1 156 ? 24.404  -29.766 29.233  1.00 18.70 ? 156  ASN B CG  1 
ATOM   5375  O OD1 . ASN B 1 156 ? 25.439  -29.095 29.227  1.00 23.41 ? 156  ASN B OD1 1 
ATOM   5376  N ND2 . ASN B 1 156 ? 23.437  -29.586 30.121  1.00 18.55 ? 156  ASN B ND2 1 
ATOM   5377  N N   . ARG B 1 157 ? 22.503  -34.138 27.992  1.00 18.21 ? 157  ARG B N   1 
ATOM   5378  C CA  . ARG B 1 157 ? 21.587  -34.935 27.174  1.00 19.45 ? 157  ARG B CA  1 
ATOM   5379  C C   . ARG B 1 157 ? 20.177  -34.461 27.568  1.00 17.73 ? 157  ARG B C   1 
ATOM   5380  O O   . ARG B 1 157 ? 19.934  -34.136 28.742  1.00 18.19 ? 157  ARG B O   1 
ATOM   5381  C CB  . ARG B 1 157 ? 21.761  -36.442 27.434  1.00 22.67 ? 157  ARG B CB  1 
ATOM   5382  C CG  . ARG B 1 157 ? 21.157  -36.967 28.741  1.00 27.58 ? 157  ARG B CG  1 
ATOM   5383  C CD  . ARG B 1 157 ? 20.952  -38.468 28.718  1.00 32.23 ? 157  ARG B CD  1 
ATOM   5384  N NE  . ARG B 1 157 ? 22.119  -39.165 28.173  1.00 36.77 ? 157  ARG B NE  1 
ATOM   5385  C CZ  . ARG B 1 157 ? 23.253  -39.386 28.834  1.00 38.96 ? 157  ARG B CZ  1 
ATOM   5386  N NH1 . ARG B 1 157 ? 23.402  -38.968 30.088  1.00 40.05 ? 157  ARG B NH1 1 
ATOM   5387  N NH2 . ARG B 1 157 ? 24.236  -40.046 28.242  1.00 40.34 ? 157  ARG B NH2 1 
ATOM   5388  N N   . PRO B 1 158 ? 19.255  -34.352 26.597  1.00 16.20 ? 158  PRO B N   1 
ATOM   5389  C CA  . PRO B 1 158 ? 17.907  -33.894 26.936  1.00 15.43 ? 158  PRO B CA  1 
ATOM   5390  C C   . PRO B 1 158 ? 17.055  -34.758 27.871  1.00 15.07 ? 158  PRO B C   1 
ATOM   5391  O O   . PRO B 1 158 ? 17.098  -35.991 27.812  1.00 15.75 ? 158  PRO B O   1 
ATOM   5392  C CB  . PRO B 1 158 ? 17.269  -33.699 25.564  1.00 15.88 ? 158  PRO B CB  1 
ATOM   5393  C CG  . PRO B 1 158 ? 17.950  -34.713 24.717  1.00 17.16 ? 158  PRO B CG  1 
ATOM   5394  C CD  . PRO B 1 158 ? 19.379  -34.553 25.138  1.00 15.68 ? 158  PRO B CD  1 
ATOM   5395  N N   . ILE B 1 159 ? 16.407  -34.084 28.824  1.00 14.57 ? 159  ILE B N   1 
ATOM   5396  C CA  . ILE B 1 159 ? 15.509  -34.703 29.809  1.00 14.94 ? 159  ILE B CA  1 
ATOM   5397  C C   . ILE B 1 159 ? 14.211  -33.888 29.728  1.00 14.91 ? 159  ILE B C   1 
ATOM   5398  O O   . ILE B 1 159 ? 14.195  -32.692 30.039  1.00 14.65 ? 159  ILE B O   1 
ATOM   5399  C CB  . ILE B 1 159 ? 16.101  -34.680 31.264  1.00 15.21 ? 159  ILE B CB  1 
ATOM   5400  C CG1 . ILE B 1 159 ? 17.467  -35.390 31.299  1.00 15.89 ? 159  ILE B CG1 1 
ATOM   5401  C CG2 . ILE B 1 159 ? 15.147  -35.400 32.224  1.00 15.69 ? 159  ILE B CG2 1 
ATOM   5402  C CD1 . ILE B 1 159 ? 18.254  -35.238 32.585  1.00 15.83 ? 159  ILE B CD1 1 
ATOM   5403  N N   . TYR B 1 160 ? 13.127  -34.554 29.336  1.00 15.93 ? 160  TYR B N   1 
ATOM   5404  C CA  . TYR B 1 160 ? 11.827  -33.913 29.129  1.00 17.04 ? 160  TYR B CA  1 
ATOM   5405  C C   . TYR B 1 160 ? 10.768  -33.962 30.226  1.00 17.82 ? 160  TYR B C   1 
ATOM   5406  O O   . TYR B 1 160 ? 10.530  -35.009 30.838  1.00 19.61 ? 160  TYR B O   1 
ATOM   5407  C CB  . TYR B 1 160 ? 11.193  -34.430 27.825  1.00 18.73 ? 160  TYR B CB  1 
ATOM   5408  C CG  . TYR B 1 160 ? 12.079  -34.304 26.605  1.00 19.63 ? 160  TYR B CG  1 
ATOM   5409  C CD1 . TYR B 1 160 ? 12.958  -35.345 26.240  1.00 20.35 ? 160  TYR B CD1 1 
ATOM   5410  C CD2 . TYR B 1 160 ? 12.081  -33.125 25.829  1.00 20.46 ? 160  TYR B CD2 1 
ATOM   5411  C CE1 . TYR B 1 160 ? 13.830  -35.212 25.129  1.00 21.57 ? 160  TYR B CE1 1 
ATOM   5412  C CE2 . TYR B 1 160 ? 12.945  -32.982 24.711  1.00 21.27 ? 160  TYR B CE2 1 
ATOM   5413  C CZ  . TYR B 1 160 ? 13.812  -34.025 24.371  1.00 21.68 ? 160  TYR B CZ  1 
ATOM   5414  O OH  . TYR B 1 160 ? 14.656  -33.896 23.289  1.00 24.29 ? 160  TYR B OH  1 
ATOM   5415  N N   . VAL B 1 161 ? 10.150  -32.801 30.452  1.00 18.56 ? 161  VAL B N   1 
ATOM   5416  C CA  . VAL B 1 161 ? 9.040   -32.598 31.400  1.00 21.40 ? 161  VAL B CA  1 
ATOM   5417  C C   . VAL B 1 161 ? 8.080   -31.697 30.615  1.00 22.80 ? 161  VAL B C   1 
ATOM   5418  O O   . VAL B 1 161 ? 8.473   -30.612 30.161  1.00 22.95 ? 161  VAL B O   1 
ATOM   5419  C CB  . VAL B 1 161 ? 9.466   -31.883 32.729  1.00 21.03 ? 161  VAL B CB  1 
ATOM   5420  C CG1 . VAL B 1 161 ? 8.246   -31.586 33.614  1.00 22.26 ? 161  VAL B CG1 1 
ATOM   5421  C CG2 . VAL B 1 161 ? 10.420  -32.755 33.516  1.00 21.28 ? 161  VAL B CG2 1 
ATOM   5422  N N   . ASP B 1 162 ? 6.831   -32.155 30.470  1.00 24.74 ? 162  ASP B N   1 
ATOM   5423  C CA  . ASP B 1 162 ? 5.753   -31.466 29.727  1.00 26.62 ? 162  ASP B CA  1 
ATOM   5424  C C   . ASP B 1 162 ? 6.117   -31.271 28.240  1.00 27.03 ? 162  ASP B C   1 
ATOM   5425  O O   . ASP B 1 162 ? 5.682   -30.305 27.598  1.00 28.42 ? 162  ASP B O   1 
ATOM   5426  C CB  . ASP B 1 162 ? 5.368   -30.114 30.380  1.00 27.63 ? 162  ASP B CB  1 
ATOM   5427  C CG  . ASP B 1 162 ? 4.838   -30.262 31.806  1.00 29.71 ? 162  ASP B CG  1 
ATOM   5428  O OD1 . ASP B 1 162 ? 4.112   -31.239 32.097  1.00 29.63 ? 162  ASP B OD1 1 
ATOM   5429  O OD2 . ASP B 1 162 ? 5.145   -29.379 32.638  1.00 30.67 ? 162  ASP B OD2 1 
ATOM   5430  N N   . GLY B 1 163 ? 6.941   -32.187 27.724  1.00 27.15 ? 163  GLY B N   1 
ATOM   5431  C CA  . GLY B 1 163 ? 7.398   -32.150 26.337  1.00 26.92 ? 163  GLY B CA  1 
ATOM   5432  C C   . GLY B 1 163 ? 8.488   -31.124 26.054  1.00 26.51 ? 163  GLY B C   1 
ATOM   5433  O O   . GLY B 1 163 ? 8.805   -30.850 24.894  1.00 26.86 ? 163  GLY B O   1 
ATOM   5434  N N   . LYS B 1 164 ? 9.077   -30.587 27.123  1.00 24.97 ? 164  LYS B N   1 
ATOM   5435  C CA  . LYS B 1 164 ? 10.120  -29.568 27.048  1.00 22.99 ? 164  LYS B CA  1 
ATOM   5436  C C   . LYS B 1 164 ? 11.382  -30.016 27.794  1.00 21.40 ? 164  LYS B C   1 
ATOM   5437  O O   . LYS B 1 164 ? 11.297  -30.486 28.935  1.00 20.78 ? 164  LYS B O   1 
ATOM   5438  C CB  . LYS B 1 164 ? 9.576   -28.255 27.654  1.00 25.22 ? 164  LYS B CB  1 
ATOM   5439  C CG  . LYS B 1 164 ? 10.562  -27.087 27.799  1.00 28.32 ? 164  LYS B CG  1 
ATOM   5440  C CD  . LYS B 1 164 ? 10.785  -26.334 26.496  1.00 30.34 ? 164  LYS B CD  1 
ATOM   5441  C CE  . LYS B 1 164 ? 11.984  -25.400 26.594  1.00 31.12 ? 164  LYS B CE  1 
ATOM   5442  N NZ  . LYS B 1 164 ? 13.273  -26.159 26.619  1.00 29.43 ? 164  LYS B NZ  1 
ATOM   5443  N N   . ASP B 1 165 ? 12.541  -29.850 27.149  1.00 18.32 ? 165  ASP B N   1 
ATOM   5444  C CA  . ASP B 1 165 ? 13.847  -30.188 27.733  1.00 17.04 ? 165  ASP B CA  1 
ATOM   5445  C C   . ASP B 1 165 ? 14.100  -29.213 28.890  1.00 16.27 ? 165  ASP B C   1 
ATOM   5446  O O   . ASP B 1 165 ? 13.969  -27.997 28.725  1.00 16.55 ? 165  ASP B O   1 
ATOM   5447  C CB  . ASP B 1 165 ? 14.956  -30.074 26.664  1.00 16.99 ? 165  ASP B CB  1 
ATOM   5448  C CG  . ASP B 1 165 ? 16.364  -30.405 27.196  1.00 17.46 ? 165  ASP B CG  1 
ATOM   5449  O OD1 . ASP B 1 165 ? 16.513  -31.010 28.284  1.00 16.20 ? 165  ASP B OD1 1 
ATOM   5450  O OD2 . ASP B 1 165 ? 17.345  -30.068 26.499  1.00 18.34 ? 165  ASP B OD2 1 
ATOM   5451  N N   . VAL B 1 166 ? 14.429  -29.769 30.056  1.00 13.80 ? 166  VAL B N   1 
ATOM   5452  C CA  . VAL B 1 166 ? 14.689  -28.973 31.255  1.00 13.76 ? 166  VAL B CA  1 
ATOM   5453  C C   . VAL B 1 166 ? 16.106  -28.435 31.372  1.00 13.84 ? 166  VAL B C   1 
ATOM   5454  O O   . VAL B 1 166 ? 16.352  -27.515 32.158  1.00 13.79 ? 166  VAL B O   1 
ATOM   5455  C CB  . VAL B 1 166 ? 14.346  -29.745 32.557  1.00 13.88 ? 166  VAL B CB  1 
ATOM   5456  C CG1 . VAL B 1 166 ? 12.906  -30.166 32.546  1.00 14.47 ? 166  VAL B CG1 1 
ATOM   5457  C CG2 . VAL B 1 166 ? 15.268  -30.951 32.769  1.00 13.44 ? 166  VAL B CG2 1 
ATOM   5458  N N   . MET B 1 167 ? 17.022  -28.985 30.574  1.00 12.79 ? 167  MET B N   1 
ATOM   5459  C CA  . MET B 1 167 ? 18.418  -28.560 30.606  1.00 12.73 ? 167  MET B CA  1 
ATOM   5460  C C   . MET B 1 167 ? 18.716  -27.072 30.348  1.00 13.43 ? 167  MET B C   1 
ATOM   5461  O O   . MET B 1 167 ? 19.585  -26.517 31.027  1.00 12.58 ? 167  MET B O   1 
ATOM   5462  C CB  . MET B 1 167 ? 19.336  -29.498 29.804  1.00 13.76 ? 167  MET B CB  1 
ATOM   5463  C CG  . MET B 1 167 ? 19.385  -30.937 30.338  1.00 13.37 ? 167  MET B CG  1 
ATOM   5464  S SD  . MET B 1 167 ? 19.615  -31.096 32.148  1.00 14.06 ? 167  MET B SD  1 
ATOM   5465  C CE  . MET B 1 167 ? 21.229  -30.294 32.399  1.00 12.49 ? 167  MET B CE  1 
ATOM   5466  N N   . PRO B 1 168 ? 18.001  -26.399 29.393  1.00 13.98 ? 168  PRO B N   1 
ATOM   5467  C CA  . PRO B 1 168 ? 18.295  -24.971 29.188  1.00 13.90 ? 168  PRO B CA  1 
ATOM   5468  C C   . PRO B 1 168 ? 18.008  -24.134 30.439  1.00 14.57 ? 168  PRO B C   1 
ATOM   5469  O O   . PRO B 1 168 ? 18.775  -23.229 30.773  1.00 15.57 ? 168  PRO B O   1 
ATOM   5470  C CB  . PRO B 1 168 ? 17.358  -24.593 28.043  1.00 14.14 ? 168  PRO B CB  1 
ATOM   5471  C CG  . PRO B 1 168 ? 17.325  -25.817 27.234  1.00 14.24 ? 168  PRO B CG  1 
ATOM   5472  C CD  . PRO B 1 168 ? 17.155  -26.883 28.279  1.00 14.35 ? 168  PRO B CD  1 
ATOM   5473  N N   . ALA B 1 169 ? 16.954  -24.514 31.164  1.00 13.71 ? 169  ALA B N   1 
ATOM   5474  C CA  . ALA B 1 169 ? 16.536  -23.841 32.395  1.00 13.55 ? 169  ALA B CA  1 
ATOM   5475  C C   . ALA B 1 169 ? 17.517  -24.102 33.544  1.00 13.63 ? 169  ALA B C   1 
ATOM   5476  O O   . ALA B 1 169 ? 17.815  -23.194 34.324  1.00 14.27 ? 169  ALA B O   1 
ATOM   5477  C CB  . ALA B 1 169 ? 15.130  -24.274 32.784  1.00 14.19 ? 169  ALA B CB  1 
ATOM   5478  N N   . VAL B 1 170 ? 18.022  -25.337 33.625  1.00 12.83 ? 170  VAL B N   1 
ATOM   5479  C CA  . VAL B 1 170 ? 18.996  -25.741 34.651  1.00 12.26 ? 170  VAL B CA  1 
ATOM   5480  C C   . VAL B 1 170 ? 20.300  -24.956 34.469  1.00 12.53 ? 170  VAL B C   1 
ATOM   5481  O O   . VAL B 1 170 ? 20.810  -24.350 35.417  1.00 12.40 ? 170  VAL B O   1 
ATOM   5482  C CB  . VAL B 1 170 ? 19.280  -27.283 34.590  1.00 11.33 ? 170  VAL B CB  1 
ATOM   5483  C CG1 . VAL B 1 170 ? 20.515  -27.671 35.426  1.00 12.97 ? 170  VAL B CG1 1 
ATOM   5484  C CG2 . VAL B 1 170 ? 18.064  -28.063 35.070  1.00 11.90 ? 170  VAL B CG2 1 
ATOM   5485  N N   . ASN B 1 171 ? 20.784  -24.932 33.228  1.00 12.34 ? 171  ASN B N   1 
ATOM   5486  C CA  . ASN B 1 171 ? 22.027  -24.247 32.889  1.00 12.74 ? 171  ASN B CA  1 
ATOM   5487  C C   . ASN B 1 171 ? 21.954  -22.727 32.948  1.00 12.05 ? 171  ASN B C   1 
ATOM   5488  O O   . ASN B 1 171 ? 22.969  -22.082 33.226  1.00 13.85 ? 171  ASN B O   1 
ATOM   5489  C CB  . ASN B 1 171 ? 22.553  -24.727 31.534  1.00 14.27 ? 171  ASN B CB  1 
ATOM   5490  C CG  . ASN B 1 171 ? 22.976  -26.182 31.560  1.00 15.81 ? 171  ASN B CG  1 
ATOM   5491  O OD1 . ASN B 1 171 ? 22.777  -26.916 30.590  1.00 18.76 ? 171  ASN B OD1 1 
ATOM   5492  N ND2 . ASN B 1 171 ? 23.562  -26.610 32.670  1.00 14.65 ? 171  ASN B ND2 1 
ATOM   5493  N N   . LYS B 1 172 ? 20.754  -22.169 32.751  1.00 13.93 ? 172  LYS B N   1 
ATOM   5494  C CA  . LYS B 1 172 ? 20.551  -20.714 32.816  1.00 13.13 ? 172  LYS B CA  1 
ATOM   5495  C C   . LYS B 1 172 ? 20.734  -20.250 34.264  1.00 13.22 ? 172  LYS B C   1 
ATOM   5496  O O   . LYS B 1 172 ? 21.383  -19.230 34.517  1.00 13.92 ? 172  LYS B O   1 
ATOM   5497  C CB  . LYS B 1 172 ? 19.159  -20.315 32.307  1.00 15.30 ? 172  LYS B CB  1 
ATOM   5498  C CG  . LYS B 1 172 ? 18.958  -18.801 32.171  1.00 17.79 ? 172  LYS B CG  1 
ATOM   5499  C CD  . LYS B 1 172 ? 17.563  -18.433 31.694  1.00 20.24 ? 172  LYS B CD  1 
ATOM   5500  C CE  . LYS B 1 172 ? 17.405  -16.914 31.649  1.00 22.55 ? 172  LYS B CE  1 
ATOM   5501  N NZ  . LYS B 1 172 ? 16.075  -16.477 31.139  1.00 25.73 ? 172  LYS B NZ  1 
ATOM   5502  N N   . VAL B 1 173 ? 20.215  -21.041 35.209  1.00 12.42 ? 173  VAL B N   1 
ATOM   5503  C CA  . VAL B 1 173 ? 20.341  -20.724 36.632  1.00 11.08 ? 173  VAL B CA  1 
ATOM   5504  C C   . VAL B 1 173 ? 21.792  -20.902 37.089  1.00 10.31 ? 173  VAL B C   1 
ATOM   5505  O O   . VAL B 1 173 ? 22.295  -20.075 37.847  1.00 10.09 ? 173  VAL B O   1 
ATOM   5506  C CB  . VAL B 1 173 ? 19.352  -21.542 37.513  1.00 11.06 ? 173  VAL B CB  1 
ATOM   5507  C CG1 . VAL B 1 173 ? 19.547  -21.229 39.009  1.00 11.72 ? 173  VAL B CG1 1 
ATOM   5508  C CG2 . VAL B 1 173 ? 17.927  -21.185 37.126  1.00 11.34 ? 173  VAL B CG2 1 
ATOM   5509  N N   . LEU B 1 174 ? 22.472  -21.942 36.593  1.00 10.02 ? 174  LEU B N   1 
ATOM   5510  C CA  . LEU B 1 174 ? 23.883  -22.169 36.941  1.00 11.18 ? 174  LEU B CA  1 
ATOM   5511  C C   . LEU B 1 174 ? 24.776  -21.021 36.462  1.00 12.04 ? 174  LEU B C   1 
ATOM   5512  O O   . LEU B 1 174 ? 25.716  -20.637 37.161  1.00 13.05 ? 174  LEU B O   1 
ATOM   5513  C CB  . LEU B 1 174 ? 24.392  -23.503 36.391  1.00 11.62 ? 174  LEU B CB  1 
ATOM   5514  C CG  . LEU B 1 174 ? 23.939  -24.777 37.112  1.00 11.37 ? 174  LEU B CG  1 
ATOM   5515  C CD1 . LEU B 1 174 ? 24.368  -25.984 36.296  1.00 12.40 ? 174  LEU B CD1 1 
ATOM   5516  C CD2 . LEU B 1 174 ? 24.523  -24.846 38.531  1.00 11.17 ? 174  LEU B CD2 1 
ATOM   5517  N N   . ASP B 1 175 ? 24.418  -20.430 35.316  1.00 13.46 ? 175  ASP B N   1 
ATOM   5518  C CA  . ASP B 1 175 ? 25.154  -19.292 34.744  1.00 14.14 ? 175  ASP B CA  1 
ATOM   5519  C C   . ASP B 1 175 ? 24.892  -18.037 35.586  1.00 12.74 ? 175  ASP B C   1 
ATOM   5520  O O   . ASP B 1 175 ? 25.806  -17.244 35.815  1.00 13.63 ? 175  ASP B O   1 
ATOM   5521  C CB  . ASP B 1 175 ? 24.748  -19.053 33.280  1.00 16.80 ? 175  ASP B CB  1 
ATOM   5522  C CG  . ASP B 1 175 ? 25.472  -17.863 32.653  1.00 21.15 ? 175  ASP B CG  1 
ATOM   5523  O OD1 . ASP B 1 175 ? 26.692  -17.961 32.409  1.00 24.34 ? 175  ASP B OD1 1 
ATOM   5524  O OD2 . ASP B 1 175 ? 24.817  -16.819 32.439  1.00 24.69 ? 175  ASP B OD2 1 
ATOM   5525  N N   . GLN B 1 176 ? 23.647  -17.890 36.050  1.00 12.96 ? 176  GLN B N   1 
ATOM   5526  C CA  . GLN B 1 176 ? 23.223  -16.766 36.893  1.00 12.19 ? 176  GLN B CA  1 
ATOM   5527  C C   . GLN B 1 176 ? 23.971  -16.851 38.232  1.00 12.21 ? 176  GLN B C   1 
ATOM   5528  O O   . GLN B 1 176 ? 24.464  -15.840 38.740  1.00 12.43 ? 176  GLN B O   1 
ATOM   5529  C CB  . GLN B 1 176 ? 21.711  -16.828 37.131  1.00 12.59 ? 176  GLN B CB  1 
ATOM   5530  C CG  . GLN B 1 176 ? 21.099  -15.588 37.776  1.00 13.91 ? 176  GLN B CG  1 
ATOM   5531  C CD  . GLN B 1 176 ? 19.691  -15.822 38.308  1.00 15.23 ? 176  GLN B CD  1 
ATOM   5532  O OE1 . GLN B 1 176 ? 19.029  -16.803 37.969  1.00 15.54 ? 176  GLN B OE1 1 
ATOM   5533  N NE2 . GLN B 1 176 ? 19.238  -14.921 39.171  1.00 15.45 ? 176  GLN B NE2 1 
ATOM   5534  N N   . MET B 1 177 ? 24.097  -18.075 38.753  1.00 11.23 ? 177  MET B N   1 
ATOM   5535  C CA  . MET B 1 177 ? 24.809  -18.346 40.005  1.00 11.70 ? 177  MET B CA  1 
ATOM   5536  C C   . MET B 1 177 ? 26.298  -18.031 39.846  1.00 10.98 ? 177  MET B C   1 
ATOM   5537  O O   . MET B 1 177 ? 26.900  -17.445 40.741  1.00 10.82 ? 177  MET B O   1 
ATOM   5538  C CB  . MET B 1 177 ? 24.626  -19.806 40.428  1.00 11.13 ? 177  MET B CB  1 
ATOM   5539  C CG  . MET B 1 177 ? 23.237  -20.160 40.918  1.00 10.65 ? 177  MET B CG  1 
ATOM   5540  S SD  . MET B 1 177 ? 22.979  -21.942 41.021  1.00 12.25 ? 177  MET B SD  1 
ATOM   5541  C CE  . MET B 1 177 ? 23.884  -22.337 42.494  1.00 12.81 ? 177  MET B CE  1 
ATOM   5542  N N   . ARG B 1 178 ? 26.864  -18.378 38.686  1.00 12.08 ? 178  ARG B N   1 
ATOM   5543  C CA  . ARG B 1 178 ? 28.279  -18.117 38.376  1.00 11.78 ? 178  ARG B CA  1 
ATOM   5544  C C   . ARG B 1 178 ? 28.570  -16.618 38.419  1.00 12.51 ? 178  ARG B C   1 
ATOM   5545  O O   . ARG B 1 178 ? 29.466  -16.181 39.136  1.00 12.72 ? 178  ARG B O   1 
ATOM   5546  C CB  . ARG B 1 178 ? 28.639  -18.641 36.977  1.00 12.76 ? 178  ARG B CB  1 
ATOM   5547  C CG  . ARG B 1 178 ? 30.093  -18.394 36.556  1.00 14.78 ? 178  ARG B CG  1 
ATOM   5548  C CD  . ARG B 1 178 ? 30.383  -18.940 35.175  1.00 17.19 ? 178  ARG B CD  1 
ATOM   5549  N NE  . ARG B 1 178 ? 31.819  -19.031 34.918  1.00 19.76 ? 178  ARG B NE  1 
ATOM   5550  C CZ  . ARG B 1 178 ? 32.366  -19.614 33.852  1.00 21.05 ? 178  ARG B CZ  1 
ATOM   5551  N NH1 . ARG B 1 178 ? 31.608  -20.169 32.915  1.00 22.66 ? 178  ARG B NH1 1 
ATOM   5552  N NH2 . ARG B 1 178 ? 33.688  -19.665 33.734  1.00 23.55 ? 178  ARG B NH2 1 
ATOM   5553  N N   . SER B 1 179 ? 27.771  -15.853 37.676  1.00 12.28 ? 179  SER B N   1 
ATOM   5554  C CA  . SER B 1 179 ? 27.914  -14.398 37.586  1.00 12.30 ? 179  SER B CA  1 
ATOM   5555  C C   . SER B 1 179 ? 27.778  -13.700 38.935  1.00 12.90 ? 179  SER B C   1 
ATOM   5556  O O   . SER B 1 179 ? 28.636  -12.895 39.311  1.00 13.11 ? 179  SER B O   1 
ATOM   5557  C CB  . SER B 1 179 ? 26.895  -13.831 36.594  1.00 13.64 ? 179  SER B CB  1 
ATOM   5558  O OG  . SER B 1 179 ? 26.961  -12.414 36.537  1.00 18.10 ? 179  SER B OG  1 
ATOM   5559  N N   . PHE B 1 180 ? 26.730  -14.054 39.679  1.00 12.21 ? 180  PHE B N   1 
ATOM   5560  C CA  . PHE B 1 180 ? 26.479  -13.460 40.990  1.00 11.49 ? 180  PHE B CA  1 
ATOM   5561  C C   . PHE B 1 180 ? 27.531  -13.837 42.028  1.00 12.29 ? 180  PHE B C   1 
ATOM   5562  O O   . PHE B 1 180 ? 28.015  -12.965 42.756  1.00 11.49 ? 180  PHE B O   1 
ATOM   5563  C CB  . PHE B 1 180 ? 25.081  -13.832 41.494  1.00 10.40 ? 180  PHE B CB  1 
ATOM   5564  C CG  . PHE B 1 180 ? 24.723  -13.213 42.826  1.00 11.30 ? 180  PHE B CG  1 
ATOM   5565  C CD1 . PHE B 1 180 ? 24.476  -11.833 42.931  1.00 12.45 ? 180  PHE B CD1 1 
ATOM   5566  C CD2 . PHE B 1 180 ? 24.667  -14.008 43.991  1.00 11.90 ? 180  PHE B CD2 1 
ATOM   5567  C CE1 . PHE B 1 180 ? 24.179  -11.243 44.186  1.00 13.23 ? 180  PHE B CE1 1 
ATOM   5568  C CE2 . PHE B 1 180 ? 24.372  -13.432 45.250  1.00 13.57 ? 180  PHE B CE2 1 
ATOM   5569  C CZ  . PHE B 1 180 ? 24.129  -12.039 45.345  1.00 12.93 ? 180  PHE B CZ  1 
ATOM   5570  N N   . SER B 1 181 ? 27.855  -15.132 42.114  1.00 10.93 ? 181  SER B N   1 
ATOM   5571  C CA  . SER B 1 181 ? 28.851  -15.612 43.073  1.00 11.45 ? 181  SER B CA  1 
ATOM   5572  C C   . SER B 1 181 ? 30.202  -14.951 42.839  1.00 10.83 ? 181  SER B C   1 
ATOM   5573  O O   . SER B 1 181 ? 30.881  -14.598 43.796  1.00 10.96 ? 181  SER B O   1 
ATOM   5574  C CB  . SER B 1 181 ? 28.986  -17.140 43.040  1.00 11.79 ? 181  SER B CB  1 
ATOM   5575  O OG  . SER B 1 181 ? 29.475  -17.600 41.796  1.00 13.14 ? 181  SER B OG  1 
ATOM   5576  N N   . GLU B 1 182 ? 30.530  -14.698 41.567  1.00 12.21 ? 182  GLU B N   1 
ATOM   5577  C CA  . GLU B 1 182 ? 31.784  -14.034 41.221  1.00 13.08 ? 182  GLU B CA  1 
ATOM   5578  C C   . GLU B 1 182 ? 31.786  -12.577 41.668  1.00 12.22 ? 182  GLU B C   1 
ATOM   5579  O O   . GLU B 1 182 ? 32.779  -12.115 42.215  1.00 14.03 ? 182  GLU B O   1 
ATOM   5580  C CB  . GLU B 1 182 ? 32.104  -14.139 39.722  1.00 14.95 ? 182  GLU B CB  1 
ATOM   5581  C CG  . GLU B 1 182 ? 32.606  -15.523 39.264  1.00 19.21 ? 182  GLU B CG  1 
ATOM   5582  C CD  . GLU B 1 182 ? 33.895  -15.983 39.943  1.00 23.06 ? 182  GLU B CD  1 
ATOM   5583  O OE1 . GLU B 1 182 ? 34.756  -15.137 40.279  1.00 23.41 ? 182  GLU B OE1 1 
ATOM   5584  O OE2 . GLU B 1 182 ? 34.053  -17.211 40.131  1.00 25.53 ? 182  GLU B OE2 1 
ATOM   5585  N N   . LYS B 1 183 ? 30.647  -11.895 41.521  1.00 12.24 ? 183  LYS B N   1 
ATOM   5586  C CA  . LYS B 1 183 ? 30.515  -10.493 41.948  1.00 12.25 ? 183  LYS B CA  1 
ATOM   5587  C C   . LYS B 1 183 ? 30.701  -10.363 43.466  1.00 12.89 ? 183  LYS B C   1 
ATOM   5588  O O   . LYS B 1 183 ? 31.376  -9.445  43.935  1.00 13.96 ? 183  LYS B O   1 
ATOM   5589  C CB  . LYS B 1 183 ? 29.160  -9.911  41.538  1.00 12.17 ? 183  LYS B CB  1 
ATOM   5590  C CG  . LYS B 1 183 ? 29.026  -9.581  40.056  1.00 14.66 ? 183  LYS B CG  1 
ATOM   5591  C CD  . LYS B 1 183 ? 27.581  -9.275  39.704  1.00 16.99 ? 183  LYS B CD  1 
ATOM   5592  C CE  . LYS B 1 183 ? 27.397  -9.074  38.208  1.00 18.77 ? 183  LYS B CE  1 
ATOM   5593  N NZ  . LYS B 1 183 ? 25.996  -8.691  37.868  1.00 21.58 ? 183  LYS B NZ  1 
ATOM   5594  N N   . VAL B 1 184 ? 30.162  -11.331 44.214  1.00 11.43 ? 184  VAL B N   1 
ATOM   5595  C CA  . VAL B 1 184 ? 30.273  -11.355 45.677  1.00 11.31 ? 184  VAL B CA  1 
ATOM   5596  C C   . VAL B 1 184 ? 31.707  -11.655 46.132  1.00 11.50 ? 184  VAL B C   1 
ATOM   5597  O O   . VAL B 1 184 ? 32.278  -10.901 46.919  1.00 12.02 ? 184  VAL B O   1 
ATOM   5598  C CB  . VAL B 1 184 ? 29.271  -12.385 46.304  1.00 11.30 ? 184  VAL B CB  1 
ATOM   5599  C CG1 . VAL B 1 184 ? 29.493  -12.545 47.815  1.00 11.14 ? 184  VAL B CG1 1 
ATOM   5600  C CG2 . VAL B 1 184 ? 27.845  -11.931 46.058  1.00 11.57 ? 184  VAL B CG2 1 
ATOM   5601  N N   . ARG B 1 185 ? 32.284  -12.724 45.584  1.00 10.81 ? 185  ARG B N   1 
ATOM   5602  C CA  . ARG B 1 185 ? 33.639  -13.177 45.914  1.00 11.30 ? 185  ARG B CA  1 
ATOM   5603  C C   . ARG B 1 185 ? 34.764  -12.192 45.600  1.00 11.26 ? 185  ARG B C   1 
ATOM   5604  O O   . ARG B 1 185 ? 35.700  -12.046 46.383  1.00 12.54 ? 185  ARG B O   1 
ATOM   5605  C CB  . ARG B 1 185 ? 33.930  -14.502 45.211  1.00 11.25 ? 185  ARG B CB  1 
ATOM   5606  C CG  . ARG B 1 185 ? 33.147  -15.684 45.755  1.00 11.44 ? 185  ARG B CG  1 
ATOM   5607  C CD  . ARG B 1 185 ? 33.205  -16.886 44.810  1.00 11.79 ? 185  ARG B CD  1 
ATOM   5608  N NE  . ARG B 1 185 ? 34.560  -17.393 44.582  1.00 11.98 ? 185  ARG B NE  1 
ATOM   5609  C CZ  . ARG B 1 185 ? 35.215  -18.217 45.399  1.00 12.60 ? 185  ARG B CZ  1 
ATOM   5610  N NH1 . ARG B 1 185 ? 34.653  -18.639 46.528  1.00 11.85 ? 185  ARG B NH1 1 
ATOM   5611  N NH2 . ARG B 1 185 ? 36.405  -18.687 45.045  1.00 11.81 ? 185  ARG B NH2 1 
ATOM   5612  N N   . THR B 1 186 ? 34.645  -11.506 44.466  1.00 12.74 ? 186  THR B N   1 
ATOM   5613  C CA  . THR B 1 186 ? 35.658  -10.546 44.030  1.00 13.85 ? 186  THR B CA  1 
ATOM   5614  C C   . THR B 1 186 ? 35.545  -9.173  44.685  1.00 15.48 ? 186  THR B C   1 
ATOM   5615  O O   . THR B 1 186 ? 36.426  -8.323  44.517  1.00 16.37 ? 186  THR B O   1 
ATOM   5616  C CB  . THR B 1 186 ? 35.630  -10.368 42.505  1.00 13.84 ? 186  THR B CB  1 
ATOM   5617  O OG1 . THR B 1 186 ? 34.347  -9.869  42.094  1.00 15.00 ? 186  THR B OG1 1 
ATOM   5618  C CG2 . THR B 1 186 ? 35.926  -11.699 41.810  1.00 13.04 ? 186  THR B CG2 1 
ATOM   5619  N N   . GLY B 1 187 ? 34.450  -8.964  45.413  1.00 15.69 ? 187  GLY B N   1 
ATOM   5620  C CA  . GLY B 1 187 ? 34.217  -7.700  46.088  1.00 15.64 ? 187  GLY B CA  1 
ATOM   5621  C C   . GLY B 1 187 ? 33.500  -6.660  45.250  1.00 16.48 ? 187  GLY B C   1 
ATOM   5622  O O   . GLY B 1 187 ? 33.332  -5.528  45.702  1.00 17.67 ? 187  GLY B O   1 
ATOM   5623  N N   . GLU B 1 188 ? 33.056  -7.047  44.050  1.00 16.76 ? 188  GLU B N   1 
ATOM   5624  C CA  . GLU B 1 188 ? 32.347  -6.150  43.129  1.00 17.81 ? 188  GLU B CA  1 
ATOM   5625  C C   . GLU B 1 188 ? 30.933  -5.818  43.624  1.00 16.51 ? 188  GLU B C   1 
ATOM   5626  O O   . GLU B 1 188 ? 30.461  -4.692  43.433  1.00 17.42 ? 188  GLU B O   1 
ATOM   5627  C CB  . GLU B 1 188 ? 32.287  -6.763  41.722  1.00 20.34 ? 188  GLU B CB  1 
ATOM   5628  C CG  . GLU B 1 188 ? 32.023  -5.762  40.589  1.00 26.21 ? 188  GLU B CG  1 
ATOM   5629  C CD  . GLU B 1 188 ? 31.332  -6.388  39.390  1.00 27.50 ? 188  GLU B CD  1 
ATOM   5630  O OE1 . GLU B 1 188 ? 31.946  -7.239  38.705  1.00 28.84 ? 188  GLU B OE1 1 
ATOM   5631  O OE2 . GLU B 1 188 ? 30.167  -6.015  39.118  1.00 30.21 ? 188  GLU B OE2 1 
ATOM   5632  N N   . TRP B 1 189 ? 30.264  -6.796  44.247  1.00 14.21 ? 189  TRP B N   1 
ATOM   5633  C CA  . TRP B 1 189 ? 28.919  -6.591  44.795  1.00 13.84 ? 189  TRP B CA  1 
ATOM   5634  C C   . TRP B 1 189 ? 29.052  -5.792  46.087  1.00 13.95 ? 189  TRP B C   1 
ATOM   5635  O O   . TRP B 1 189 ? 29.704  -6.229  47.039  1.00 14.56 ? 189  TRP B O   1 
ATOM   5636  C CB  . TRP B 1 189 ? 28.209  -7.923  45.072  1.00 12.14 ? 189  TRP B CB  1 
ATOM   5637  C CG  . TRP B 1 189 ? 26.728  -7.779  45.365  1.00 12.95 ? 189  TRP B CG  1 
ATOM   5638  C CD1 . TRP B 1 189 ? 26.145  -7.548  46.589  1.00 12.88 ? 189  TRP B CD1 1 
ATOM   5639  C CD2 . TRP B 1 189 ? 25.658  -7.829  44.417  1.00 12.82 ? 189  TRP B CD2 1 
ATOM   5640  N NE1 . TRP B 1 189 ? 24.786  -7.443  46.456  1.00 12.77 ? 189  TRP B NE1 1 
ATOM   5641  C CE2 . TRP B 1 189 ? 24.450  -7.614  45.140  1.00 13.53 ? 189  TRP B CE2 1 
ATOM   5642  C CE3 . TRP B 1 189 ? 25.592  -8.039  43.020  1.00 14.29 ? 189  TRP B CE3 1 
ATOM   5643  C CZ2 . TRP B 1 189 ? 23.180  -7.600  44.514  1.00 13.16 ? 189  TRP B CZ2 1 
ATOM   5644  C CZ3 . TRP B 1 189 ? 24.319  -8.026  42.388  1.00 14.86 ? 189  TRP B CZ3 1 
ATOM   5645  C CH2 . TRP B 1 189 ? 23.133  -7.806  43.146  1.00 15.14 ? 189  TRP B CH2 1 
ATOM   5646  N N   . LYS B 1 190 ? 28.424  -4.621  46.099  1.00 14.49 ? 190  LYS B N   1 
ATOM   5647  C CA  . LYS B 1 190 ? 28.485  -3.735  47.251  1.00 14.75 ? 190  LYS B CA  1 
ATOM   5648  C C   . LYS B 1 190 ? 27.203  -3.666  48.058  1.00 13.50 ? 190  LYS B C   1 
ATOM   5649  O O   . LYS B 1 190 ? 26.101  -3.803  47.524  1.00 14.53 ? 190  LYS B O   1 
ATOM   5650  C CB  . LYS B 1 190 ? 28.849  -2.306  46.813  1.00 15.33 ? 190  LYS B CB  1 
ATOM   5651  C CG  . LYS B 1 190 ? 30.088  -2.157  45.927  1.00 16.16 ? 190  LYS B CG  1 
ATOM   5652  C CD  . LYS B 1 190 ? 31.376  -2.618  46.594  1.00 16.94 ? 190  LYS B CD  1 
ATOM   5653  C CE  . LYS B 1 190 ? 32.568  -2.306  45.708  1.00 16.98 ? 190  LYS B CE  1 
ATOM   5654  N NZ  . LYS B 1 190 ? 33.833  -2.829  46.277  1.00 17.39 ? 190  LYS B NZ  1 
ATOM   5655  N N   . GLY B 1 191 ? 27.374  -3.411  49.356  1.00 14.55 ? 191  GLY B N   1 
ATOM   5656  C CA  . GLY B 1 191 ? 26.248  -3.230  50.256  1.00 13.47 ? 191  GLY B CA  1 
ATOM   5657  C C   . GLY B 1 191 ? 25.747  -1.803  50.064  1.00 14.15 ? 191  GLY B C   1 
ATOM   5658  O O   . GLY B 1 191 ? 26.346  -1.045  49.296  1.00 14.45 ? 191  GLY B O   1 
ATOM   5659  N N   . HIS B 1 192 ? 24.700  -1.418  50.792  1.00 14.05 ? 192  HIS B N   1 
ATOM   5660  C CA  . HIS B 1 192 ? 24.100  -0.081  50.675  1.00 14.65 ? 192  HIS B CA  1 
ATOM   5661  C C   . HIS B 1 192 ? 25.027  1.113   50.920  1.00 14.76 ? 192  HIS B C   1 
ATOM   5662  O O   . HIS B 1 192 ? 24.840  2.176   50.324  1.00 16.26 ? 192  HIS B O   1 
ATOM   5663  C CB  . HIS B 1 192 ? 22.863  0.026   51.572  1.00 14.79 ? 192  HIS B CB  1 
ATOM   5664  C CG  . HIS B 1 192 ? 21.930  1.134   51.188  1.00 15.15 ? 192  HIS B CG  1 
ATOM   5665  N ND1 . HIS B 1 192 ? 21.426  1.275   49.912  1.00 14.58 ? 192  HIS B ND1 1 
ATOM   5666  C CD2 . HIS B 1 192 ? 21.395  2.142   51.916  1.00 14.36 ? 192  HIS B CD2 1 
ATOM   5667  C CE1 . HIS B 1 192 ? 20.620  2.320   49.872  1.00 15.97 ? 192  HIS B CE1 1 
ATOM   5668  N NE2 . HIS B 1 192 ? 20.583  2.863   51.076  1.00 15.02 ? 192  HIS B NE2 1 
ATOM   5669  N N   . THR B 1 193 ? 26.027  0.918   51.775  1.00 14.52 ? 193  THR B N   1 
ATOM   5670  C CA  . THR B 1 193 ? 26.987  1.972   52.105  1.00 14.85 ? 193  THR B CA  1 
ATOM   5671  C C   . THR B 1 193 ? 28.305  1.843   51.329  1.00 15.37 ? 193  THR B C   1 
ATOM   5672  O O   . THR B 1 193 ? 29.305  2.489   51.665  1.00 16.75 ? 193  THR B O   1 
ATOM   5673  C CB  . THR B 1 193 ? 27.251  2.033   53.621  1.00 14.86 ? 193  THR B CB  1 
ATOM   5674  O OG1 . THR B 1 193 ? 27.800  0.782   54.059  1.00 17.26 ? 193  THR B OG1 1 
ATOM   5675  C CG2 . THR B 1 193 ? 25.958  2.313   54.398  1.00 15.91 ? 193  THR B CG2 1 
ATOM   5676  N N   . GLY B 1 194 ? 28.303  0.976   50.315  1.00 15.71 ? 194  GLY B N   1 
ATOM   5677  C CA  . GLY B 1 194 ? 29.466  0.776   49.464  1.00 15.58 ? 194  GLY B CA  1 
ATOM   5678  C C   . GLY B 1 194 ? 30.527  -0.225  49.882  1.00 15.76 ? 194  GLY B C   1 
ATOM   5679  O O   . GLY B 1 194 ? 31.580  -0.291  49.248  1.00 17.23 ? 194  GLY B O   1 
ATOM   5680  N N   . LYS B 1 195 ? 30.261  -1.012  50.924  1.00 14.67 ? 195  LYS B N   1 
ATOM   5681  C CA  . LYS B 1 195 ? 31.229  -2.008  51.394  1.00 15.16 ? 195  LYS B CA  1 
ATOM   5682  C C   . LYS B 1 195 ? 31.102  -3.330  50.651  1.00 14.79 ? 195  LYS B C   1 
ATOM   5683  O O   . LYS B 1 195 ? 29.997  -3.724  50.268  1.00 15.32 ? 195  LYS B O   1 
ATOM   5684  C CB  . LYS B 1 195 ? 31.051  -2.298  52.891  1.00 16.74 ? 195  LYS B CB  1 
ATOM   5685  C CG  . LYS B 1 195 ? 31.374  -1.157  53.841  1.00 18.96 ? 195  LYS B CG  1 
ATOM   5686  C CD  . LYS B 1 195 ? 31.394  -1.687  55.268  1.00 22.29 ? 195  LYS B CD  1 
ATOM   5687  C CE  . LYS B 1 195 ? 31.191  -0.586  56.296  1.00 23.28 ? 195  LYS B CE  1 
ATOM   5688  N NZ  . LYS B 1 195 ? 31.539  -1.060  57.667  1.00 26.16 ? 195  LYS B NZ  1 
ATOM   5689  N N   . ALA B 1 196 ? 32.233  -4.015  50.474  1.00 14.80 ? 196  ALA B N   1 
ATOM   5690  C CA  . ALA B 1 196 ? 32.268  -5.334  49.837  1.00 13.95 ? 196  ALA B CA  1 
ATOM   5691  C C   . ALA B 1 196 ? 31.664  -6.325  50.847  1.00 14.30 ? 196  ALA B C   1 
ATOM   5692  O O   . ALA B 1 196 ? 31.705  -6.081  52.056  1.00 13.66 ? 196  ALA B O   1 
ATOM   5693  C CB  . ALA B 1 196 ? 33.704  -5.726  49.511  1.00 14.37 ? 196  ALA B CB  1 
ATOM   5694  N N   . ILE B 1 197 ? 31.091  -7.420  50.345  1.00 13.01 ? 197  ILE B N   1 
ATOM   5695  C CA  . ILE B 1 197 ? 30.470  -8.439  51.200  1.00 13.13 ? 197  ILE B CA  1 
ATOM   5696  C C   . ILE B 1 197 ? 31.514  -9.276  51.953  1.00 12.71 ? 197  ILE B C   1 
ATOM   5697  O O   . ILE B 1 197 ? 32.448  -9.812  51.350  1.00 13.25 ? 197  ILE B O   1 
ATOM   5698  C CB  . ILE B 1 197 ? 29.518  -9.369  50.368  1.00 13.68 ? 197  ILE B CB  1 
ATOM   5699  C CG1 . ILE B 1 197 ? 28.424  -8.549  49.660  1.00 13.81 ? 197  ILE B CG1 1 
ATOM   5700  C CG2 . ILE B 1 197 ? 28.887  -10.471 51.253  1.00 14.14 ? 197  ILE B CG2 1 
ATOM   5701  C CD1 . ILE B 1 197 ? 27.498  -7.716  50.569  1.00 15.59 ? 197  ILE B CD1 1 
ATOM   5702  N N   . ARG B 1 198 ? 31.363  -9.327  53.279  1.00 12.12 ? 198  ARG B N   1 
ATOM   5703  C CA  . ARG B 1 198 ? 32.247  -10.088 54.160  1.00 13.47 ? 198  ARG B CA  1 
ATOM   5704  C C   . ARG B 1 198 ? 31.498  -11.200 54.880  1.00 11.38 ? 198  ARG B C   1 
ATOM   5705  O O   . ARG B 1 198 ? 32.113  -12.148 55.369  1.00 12.07 ? 198  ARG B O   1 
ATOM   5706  C CB  . ARG B 1 198 ? 32.904  -9.175  55.208  1.00 15.29 ? 198  ARG B CB  1 
ATOM   5707  C CG  . ARG B 1 198 ? 33.934  -8.179  54.673  1.00 16.83 ? 198  ARG B CG  1 
ATOM   5708  C CD  . ARG B 1 198 ? 35.362  -8.750  54.616  1.00 18.93 ? 198  ARG B CD  1 
ATOM   5709  N NE  . ARG B 1 198 ? 35.537  -9.828  53.641  1.00 20.31 ? 198  ARG B NE  1 
ATOM   5710  C CZ  . ARG B 1 198 ? 35.546  -9.675  52.315  1.00 23.08 ? 198  ARG B CZ  1 
ATOM   5711  N NH1 . ARG B 1 198 ? 35.396  -8.474  51.765  1.00 23.37 ? 198  ARG B NH1 1 
ATOM   5712  N NH2 . ARG B 1 198 ? 35.653  -10.738 51.530  1.00 23.06 ? 198  ARG B NH2 1 
ATOM   5713  N N   . HIS B 1 199 ? 30.179  -11.045 54.985  1.00 11.09 ? 199  HIS B N   1 
ATOM   5714  C CA  . HIS B 1 199 ? 29.318  -12.015 55.667  1.00 10.69 ? 199  HIS B CA  1 
ATOM   5715  C C   . HIS B 1 199 ? 28.193  -12.474 54.761  1.00 9.97  ? 199  HIS B C   1 
ATOM   5716  O O   . HIS B 1 199 ? 27.538  -11.660 54.120  1.00 10.38 ? 199  HIS B O   1 
ATOM   5717  C CB  . HIS B 1 199 ? 28.722  -11.401 56.938  1.00 11.45 ? 199  HIS B CB  1 
ATOM   5718  C CG  . HIS B 1 199 ? 29.747  -10.945 57.929  1.00 13.92 ? 199  HIS B CG  1 
ATOM   5719  N ND1 . HIS B 1 199 ? 30.340  -11.799 58.831  1.00 14.69 ? 199  HIS B ND1 1 
ATOM   5720  C CD2 . HIS B 1 199 ? 30.312  -9.730  58.130  1.00 16.66 ? 199  HIS B CD2 1 
ATOM   5721  C CE1 . HIS B 1 199 ? 31.232  -11.132 59.543  1.00 17.15 ? 199  HIS B CE1 1 
ATOM   5722  N NE2 . HIS B 1 199 ? 31.234  -9.875  59.138  1.00 15.18 ? 199  HIS B NE2 1 
ATOM   5723  N N   . VAL B 1 200 ? 28.003  -13.791 54.687  1.00 10.11 ? 200  VAL B N   1 
ATOM   5724  C CA  . VAL B 1 200 ? 26.956  -14.394 53.864  1.00 10.96 ? 200  VAL B CA  1 
ATOM   5725  C C   . VAL B 1 200 ? 26.063  -15.180 54.825  1.00 11.43 ? 200  VAL B C   1 
ATOM   5726  O O   . VAL B 1 200 ? 26.513  -16.123 55.472  1.00 12.54 ? 200  VAL B O   1 
ATOM   5727  C CB  . VAL B 1 200 ? 27.561  -15.327 52.766  1.00 10.78 ? 200  VAL B CB  1 
ATOM   5728  C CG1 . VAL B 1 200 ? 26.464  -15.930 51.903  1.00 12.24 ? 200  VAL B CG1 1 
ATOM   5729  C CG2 . VAL B 1 200 ? 28.540  -14.553 51.880  1.00 12.58 ? 200  VAL B CG2 1 
ATOM   5730  N N   . VAL B 1 201 ? 24.809  -14.750 54.934  1.00 9.98  ? 201  VAL B N   1 
ATOM   5731  C CA  . VAL B 1 201 ? 23.847  -15.372 55.837  1.00 9.93  ? 201  VAL B CA  1 
ATOM   5732  C C   . VAL B 1 201 ? 22.735  -16.088 55.077  1.00 9.94  ? 201  VAL B C   1 
ATOM   5733  O O   . VAL B 1 201 ? 21.901  -15.452 54.431  1.00 10.85 ? 201  VAL B O   1 
ATOM   5734  C CB  . VAL B 1 201 ? 23.227  -14.312 56.814  1.00 9.99  ? 201  VAL B CB  1 
ATOM   5735  C CG1 . VAL B 1 201 ? 22.231  -14.946 57.782  1.00 10.48 ? 201  VAL B CG1 1 
ATOM   5736  C CG2 . VAL B 1 201 ? 24.312  -13.599 57.601  1.00 10.65 ? 201  VAL B CG2 1 
ATOM   5737  N N   . ASN B 1 202 ? 22.735  -17.417 55.165  1.00 9.41  ? 202  ASN B N   1 
ATOM   5738  C CA  . ASN B 1 202 ? 21.709  -18.232 54.529  1.00 10.07 ? 202  ASN B CA  1 
ATOM   5739  C C   . ASN B 1 202 ? 20.564  -18.367 55.532  1.00 10.17 ? 202  ASN B C   1 
ATOM   5740  O O   . ASN B 1 202 ? 20.791  -18.638 56.712  1.00 12.06 ? 202  ASN B O   1 
ATOM   5741  C CB  . ASN B 1 202 ? 22.266  -19.615 54.161  1.00 10.58 ? 202  ASN B CB  1 
ATOM   5742  C CG  . ASN B 1 202 ? 21.316  -20.421 53.287  1.00 11.51 ? 202  ASN B CG  1 
ATOM   5743  O OD1 . ASN B 1 202 ? 21.212  -20.183 52.086  1.00 13.08 ? 202  ASN B OD1 1 
ATOM   5744  N ND2 . ASN B 1 202 ? 20.616  -21.381 53.893  1.00 12.64 ? 202  ASN B ND2 1 
ATOM   5745  N N   . ILE B 1 203 ? 19.352  -18.067 55.069  1.00 8.77  ? 203  ILE B N   1 
ATOM   5746  C CA  . ILE B 1 203 ? 18.149  -18.161 55.886  1.00 9.35  ? 203  ILE B CA  1 
ATOM   5747  C C   . ILE B 1 203 ? 17.268  -19.225 55.235  1.00 9.74  ? 203  ILE B C   1 
ATOM   5748  O O   . ILE B 1 203 ? 16.751  -19.023 54.142  1.00 9.57  ? 203  ILE B O   1 
ATOM   5749  C CB  . ILE B 1 203 ? 17.378  -16.808 55.967  1.00 9.68  ? 203  ILE B CB  1 
ATOM   5750  C CG1 . ILE B 1 203 ? 18.297  -15.691 56.481  1.00 11.16 ? 203  ILE B CG1 1 
ATOM   5751  C CG2 . ILE B 1 203 ? 16.177  -16.957 56.890  1.00 10.04 ? 203  ILE B CG2 1 
ATOM   5752  C CD1 . ILE B 1 203 ? 17.684  -14.299 56.456  1.00 11.18 ? 203  ILE B CD1 1 
ATOM   5753  N N   . GLY B 1 204 ? 17.135  -20.364 55.909  1.00 10.45 ? 204  GLY B N   1 
ATOM   5754  C CA  . GLY B 1 204 ? 16.330  -21.458 55.392  1.00 10.79 ? 204  GLY B CA  1 
ATOM   5755  C C   . GLY B 1 204 ? 16.344  -22.607 56.367  1.00 10.10 ? 204  GLY B C   1 
ATOM   5756  O O   . GLY B 1 204 ? 17.207  -22.648 57.234  1.00 9.68  ? 204  GLY B O   1 
ATOM   5757  N N   . ILE B 1 205 ? 15.436  -23.567 56.197  1.00 9.70  ? 205  ILE B N   1 
ATOM   5758  C CA  . ILE B 1 205 ? 15.363  -24.704 57.111  1.00 9.37  ? 205  ILE B CA  1 
ATOM   5759  C C   . ILE B 1 205 ? 15.228  -26.033 56.365  1.00 9.07  ? 205  ILE B C   1 
ATOM   5760  O O   . ILE B 1 205 ? 14.757  -26.061 55.222  1.00 9.62  ? 205  ILE B O   1 
ATOM   5761  C CB  . ILE B 1 205 ? 14.230  -24.481 58.166  1.00 9.50  ? 205  ILE B CB  1 
ATOM   5762  C CG1 . ILE B 1 205 ? 14.390  -25.436 59.354  1.00 9.04  ? 205  ILE B CG1 1 
ATOM   5763  C CG2 . ILE B 1 205 ? 12.847  -24.554 57.513  1.00 9.19  ? 205  ILE B CG2 1 
ATOM   5764  C CD1 . ILE B 1 205 ? 13.702  -24.960 60.615  1.00 10.40 ? 205  ILE B CD1 1 
ATOM   5765  N N   . GLY B 1 206 ? 15.722  -27.105 56.997  1.00 9.21  ? 206  GLY B N   1 
ATOM   5766  C CA  . GLY B 1 206 ? 15.664  -28.448 56.434  1.00 9.29  ? 206  GLY B CA  1 
ATOM   5767  C C   . GLY B 1 206 ? 16.452  -28.604 55.153  1.00 7.59  ? 206  GLY B C   1 
ATOM   5768  O O   . GLY B 1 206 ? 17.670  -28.441 55.147  1.00 8.46  ? 206  GLY B O   1 
ATOM   5769  N N   . GLY B 1 207 ? 15.738  -28.856 54.056  1.00 8.19  ? 207  GLY B N   1 
ATOM   5770  C CA  . GLY B 1 207 ? 16.376  -29.015 52.760  1.00 9.61  ? 207  GLY B CA  1 
ATOM   5771  C C   . GLY B 1 207 ? 17.003  -27.736 52.229  1.00 8.67  ? 207  GLY B C   1 
ATOM   5772  O O   . GLY B 1 207 ? 17.848  -27.768 51.334  1.00 9.96  ? 207  GLY B O   1 
ATOM   5773  N N   . SER B 1 208 ? 16.586  -26.610 52.802  1.00 10.31 ? 208  SER B N   1 
ATOM   5774  C CA  . SER B 1 208 ? 17.110  -25.300 52.429  1.00 11.48 ? 208  SER B CA  1 
ATOM   5775  C C   . SER B 1 208 ? 18.179  -24.832 53.434  1.00 12.81 ? 208  SER B C   1 
ATOM   5776  O O   . SER B 1 208 ? 18.509  -23.639 53.496  1.00 13.94 ? 208  SER B O   1 
ATOM   5777  C CB  . SER B 1 208 ? 15.962  -24.292 52.354  1.00 10.29 ? 208  SER B CB  1 
ATOM   5778  O OG  . SER B 1 208 ? 15.139  -24.516 51.218  1.00 12.03 ? 208  SER B OG  1 
ATOM   5779  N N   . ASP B 1 209 ? 18.737  -25.787 54.187  1.00 10.93 ? 209  ASP B N   1 
ATOM   5780  C CA  . ASP B 1 209 ? 19.753  -25.512 55.209  1.00 11.79 ? 209  ASP B CA  1 
ATOM   5781  C C   . ASP B 1 209 ? 20.830  -26.588 55.333  1.00 11.60 ? 209  ASP B C   1 
ATOM   5782  O O   . ASP B 1 209 ? 22.016  -26.275 55.247  1.00 12.21 ? 209  ASP B O   1 
ATOM   5783  C CB  . ASP B 1 209 ? 19.076  -25.313 56.580  1.00 12.07 ? 209  ASP B CB  1 
ATOM   5784  C CG  . ASP B 1 209 ? 20.061  -25.255 57.750  1.00 14.10 ? 209  ASP B CG  1 
ATOM   5785  O OD1 . ASP B 1 209 ? 20.784  -24.248 57.888  1.00 13.01 ? 209  ASP B OD1 1 
ATOM   5786  O OD2 . ASP B 1 209 ? 20.084  -26.221 58.548  1.00 14.04 ? 209  ASP B OD2 1 
ATOM   5787  N N   . LEU B 1 210 ? 20.412  -27.836 55.557  1.00 11.11 ? 210  LEU B N   1 
ATOM   5788  C CA  . LEU B 1 210 ? 21.347  -28.949 55.772  1.00 10.60 ? 210  LEU B CA  1 
ATOM   5789  C C   . LEU B 1 210 ? 22.390  -29.224 54.695  1.00 10.37 ? 210  LEU B C   1 
ATOM   5790  O O   . LEU B 1 210 ? 23.539  -29.493 55.026  1.00 10.13 ? 210  LEU B O   1 
ATOM   5791  C CB  . LEU B 1 210 ? 20.604  -30.232 56.165  1.00 12.29 ? 210  LEU B CB  1 
ATOM   5792  C CG  . LEU B 1 210 ? 19.796  -30.240 57.472  1.00 15.54 ? 210  LEU B CG  1 
ATOM   5793  C CD1 . LEU B 1 210 ? 19.359  -31.664 57.753  1.00 16.50 ? 210  LEU B CD1 1 
ATOM   5794  C CD2 . LEU B 1 210 ? 20.595  -29.717 58.668  1.00 17.97 ? 210  LEU B CD2 1 
ATOM   5795  N N   . GLY B 1 211 ? 21.989  -29.119 53.423  1.00 9.96  ? 211  GLY B N   1 
ATOM   5796  C CA  . GLY B 1 211 ? 22.905  -29.307 52.299  1.00 11.11 ? 211  GLY B CA  1 
ATOM   5797  C C   . GLY B 1 211 ? 23.966  -28.228 52.329  1.00 9.99  ? 211  GLY B C   1 
ATOM   5798  O O   . GLY B 1 211 ? 25.159  -28.549 52.314  1.00 11.27 ? 211  GLY B O   1 
ATOM   5799  N N   . PRO B 1 212 ? 23.560  -26.938 52.344  1.00 9.87  ? 212  PRO B N   1 
ATOM   5800  C CA  . PRO B 1 212 ? 24.496  -25.815 52.398  1.00 10.06 ? 212  PRO B CA  1 
ATOM   5801  C C   . PRO B 1 212 ? 25.469  -25.897 53.585  1.00 9.44  ? 212  PRO B C   1 
ATOM   5802  O O   . PRO B 1 212 ? 26.665  -25.690 53.407  1.00 9.66  ? 212  PRO B O   1 
ATOM   5803  C CB  . PRO B 1 212 ? 23.558  -24.625 52.492  1.00 10.42 ? 212  PRO B CB  1 
ATOM   5804  C CG  . PRO B 1 212 ? 22.493  -25.011 51.534  1.00 10.46 ? 212  PRO B CG  1 
ATOM   5805  C CD  . PRO B 1 212 ? 22.233  -26.458 51.889  1.00 11.01 ? 212  PRO B CD  1 
ATOM   5806  N N   . VAL B 1 213 ? 24.962  -26.280 54.764  1.00 8.96  ? 213  VAL B N   1 
ATOM   5807  C CA  . VAL B 1 213 ? 25.784  -26.436 55.977  1.00 9.34  ? 213  VAL B CA  1 
ATOM   5808  C C   . VAL B 1 213 ? 26.795  -27.576 55.794  1.00 9.13  ? 213  VAL B C   1 
ATOM   5809  O O   . VAL B 1 213 ? 27.999  -27.366 55.937  1.00 10.29 ? 213  VAL B O   1 
ATOM   5810  C CB  . VAL B 1 213 ? 24.909  -26.746 57.248  1.00 9.71  ? 213  VAL B CB  1 
ATOM   5811  C CG1 . VAL B 1 213 ? 25.769  -27.206 58.430  1.00 11.60 ? 213  VAL B CG1 1 
ATOM   5812  C CG2 . VAL B 1 213 ? 24.150  -25.521 57.674  1.00 10.90 ? 213  VAL B CG2 1 
ATOM   5813  N N   . MET B 1 214 ? 26.295  -28.759 55.439  1.00 8.65  ? 214  MET B N   1 
ATOM   5814  C CA  . MET B 1 214 ? 27.139  -29.941 55.260  1.00 8.58  ? 214  MET B CA  1 
ATOM   5815  C C   . MET B 1 214 ? 28.241  -29.754 54.225  1.00 8.41  ? 214  MET B C   1 
ATOM   5816  O O   . MET B 1 214 ? 29.403  -30.045 54.509  1.00 9.18  ? 214  MET B O   1 
ATOM   5817  C CB  . MET B 1 214 ? 26.271  -31.164 54.921  1.00 8.33  ? 214  MET B CB  1 
ATOM   5818  C CG  . MET B 1 214 ? 27.011  -32.480 54.650  1.00 9.36  ? 214  MET B CG  1 
ATOM   5819  S SD  . MET B 1 214 ? 27.737  -32.642 53.008  1.00 10.85 ? 214  MET B SD  1 
ATOM   5820  C CE  . MET B 1 214 ? 26.260  -32.492 51.973  1.00 12.36 ? 214  MET B CE  1 
ATOM   5821  N N   . ALA B 1 215 ? 27.870  -29.225 53.059  1.00 8.76  ? 215  ALA B N   1 
ATOM   5822  C CA  . ALA B 1 215 ? 28.809  -29.022 51.962  1.00 9.02  ? 215  ALA B CA  1 
ATOM   5823  C C   . ALA B 1 215 ? 29.854  -27.951 52.220  1.00 9.01  ? 215  ALA B C   1 
ATOM   5824  O O   . ALA B 1 215 ? 31.023  -28.160 51.893  1.00 10.19 ? 215  ALA B O   1 
ATOM   5825  C CB  . ALA B 1 215 ? 28.073  -28.755 50.665  1.00 9.01  ? 215  ALA B CB  1 
ATOM   5826  N N   . THR B 1 216 ? 29.458  -26.831 52.836  1.00 9.28  ? 216  THR B N   1 
ATOM   5827  C CA  . THR B 1 216 ? 30.429  -25.767 53.137  1.00 9.16  ? 216  THR B CA  1 
ATOM   5828  C C   . THR B 1 216 ? 31.406  -26.194 54.228  1.00 9.88  ? 216  THR B C   1 
ATOM   5829  O O   . THR B 1 216 ? 32.572  -25.802 54.203  1.00 11.45 ? 216  THR B O   1 
ATOM   5830  C CB  . THR B 1 216 ? 29.785  -24.410 53.510  1.00 9.52  ? 216  THR B CB  1 
ATOM   5831  O OG1 . THR B 1 216 ? 28.889  -24.571 54.615  1.00 9.82  ? 216  THR B OG1 1 
ATOM   5832  C CG2 . THR B 1 216 ? 29.046  -23.828 52.322  1.00 10.93 ? 216  THR B CG2 1 
ATOM   5833  N N   . GLU B 1 217 ? 30.938  -27.031 55.157  1.00 9.67  ? 217  GLU B N   1 
ATOM   5834  C CA  . GLU B 1 217 ? 31.798  -27.555 56.219  1.00 10.32 ? 217  GLU B CA  1 
ATOM   5835  C C   . GLU B 1 217 ? 32.746  -28.605 55.640  1.00 11.24 ? 217  GLU B C   1 
ATOM   5836  O O   . GLU B 1 217 ? 33.943  -28.605 55.939  1.00 11.49 ? 217  GLU B O   1 
ATOM   5837  C CB  . GLU B 1 217 ? 30.973  -28.180 57.355  1.00 11.74 ? 217  GLU B CB  1 
ATOM   5838  C CG  . GLU B 1 217 ? 30.276  -27.179 58.275  1.00 13.25 ? 217  GLU B CG  1 
ATOM   5839  C CD  . GLU B 1 217 ? 31.240  -26.255 59.005  1.00 13.67 ? 217  GLU B CD  1 
ATOM   5840  O OE1 . GLU B 1 217 ? 32.112  -26.755 59.747  1.00 12.86 ? 217  GLU B OE1 1 
ATOM   5841  O OE2 . GLU B 1 217 ? 31.127  -25.023 58.828  1.00 18.41 ? 217  GLU B OE2 1 
ATOM   5842  N N   . ALA B 1 218 ? 32.206  -29.452 54.762  1.00 9.73  ? 218  ALA B N   1 
ATOM   5843  C CA  . ALA B 1 218 ? 32.965  -30.523 54.114  1.00 9.46  ? 218  ALA B CA  1 
ATOM   5844  C C   . ALA B 1 218 ? 34.062  -30.032 53.186  1.00 10.13 ? 218  ALA B C   1 
ATOM   5845  O O   . ALA B 1 218 ? 35.139  -30.631 53.101  1.00 9.93  ? 218  ALA B O   1 
ATOM   5846  C CB  . ALA B 1 218 ? 32.021  -31.447 53.357  1.00 8.69  ? 218  ALA B CB  1 
ATOM   5847  N N   . LEU B 1 219 ? 33.767  -28.927 52.502  1.00 9.06  ? 219  LEU B N   1 
ATOM   5848  C CA  . LEU B 1 219 ? 34.673  -28.341 51.521  1.00 10.28 ? 219  LEU B CA  1 
ATOM   5849  C C   . LEU B 1 219 ? 35.368  -27.052 51.936  1.00 10.40 ? 219  LEU B C   1 
ATOM   5850  O O   . LEU B 1 219 ? 35.820  -26.278 51.085  1.00 11.45 ? 219  LEU B O   1 
ATOM   5851  C CB  . LEU B 1 219 ? 33.940  -28.169 50.184  1.00 9.26  ? 219  LEU B CB  1 
ATOM   5852  C CG  . LEU B 1 219 ? 33.309  -29.456 49.639  1.00 8.83  ? 219  LEU B CG  1 
ATOM   5853  C CD1 . LEU B 1 219 ? 32.515  -29.176 48.397  1.00 9.45  ? 219  LEU B CD1 1 
ATOM   5854  C CD2 . LEU B 1 219 ? 34.366  -30.538 49.419  1.00 10.54 ? 219  LEU B CD2 1 
ATOM   5855  N N   . LYS B 1 220 ? 35.572  -26.901 53.248  1.00 10.54 ? 220  LYS B N   1 
ATOM   5856  C CA  . LYS B 1 220 ? 36.259  -25.736 53.810  1.00 11.36 ? 220  LYS B CA  1 
ATOM   5857  C C   . LYS B 1 220 ? 37.690  -25.485 53.253  1.00 12.43 ? 220  LYS B C   1 
ATOM   5858  O O   . LYS B 1 220 ? 38.076  -24.321 53.108  1.00 12.28 ? 220  LYS B O   1 
ATOM   5859  C CB  . LYS B 1 220 ? 36.238  -25.766 55.351  1.00 13.04 ? 220  LYS B CB  1 
ATOM   5860  C CG  . LYS B 1 220 ? 36.950  -24.575 56.013  1.00 16.82 ? 220  LYS B CG  1 
ATOM   5861  C CD  . LYS B 1 220 ? 36.863  -24.582 57.527  1.00 18.84 ? 220  LYS B CD  1 
ATOM   5862  C CE  . LYS B 1 220 ? 35.515  -24.085 58.032  1.00 22.74 ? 220  LYS B CE  1 
ATOM   5863  N NZ  . LYS B 1 220 ? 35.434  -24.178 59.521  1.00 24.37 ? 220  LYS B NZ  1 
ATOM   5864  N N   . PRO B 1 221 ? 38.480  -26.548 52.907  1.00 11.94 ? 221  PRO B N   1 
ATOM   5865  C CA  . PRO B 1 221 ? 39.826  -26.271 52.369  1.00 12.35 ? 221  PRO B CA  1 
ATOM   5866  C C   . PRO B 1 221 ? 39.811  -25.560 51.014  1.00 13.34 ? 221  PRO B C   1 
ATOM   5867  O O   . PRO B 1 221 ? 40.793  -24.921 50.625  1.00 16.20 ? 221  PRO B O   1 
ATOM   5868  C CB  . PRO B 1 221 ? 40.408  -27.668 52.164  1.00 13.50 ? 221  PRO B CB  1 
ATOM   5869  C CG  . PRO B 1 221 ? 39.777  -28.441 53.163  1.00 13.00 ? 221  PRO B CG  1 
ATOM   5870  C CD  . PRO B 1 221 ? 38.359  -27.998 53.167  1.00 12.80 ? 221  PRO B CD  1 
ATOM   5871  N N   . PHE B 1 222 ? 38.687  -25.694 50.313  1.00 11.75 ? 222  PHE B N   1 
ATOM   5872  C CA  . PHE B 1 222 ? 38.480  -25.127 48.978  1.00 11.19 ? 222  PHE B CA  1 
ATOM   5873  C C   . PHE B 1 222 ? 37.705  -23.813 49.013  1.00 11.27 ? 222  PHE B C   1 
ATOM   5874  O O   . PHE B 1 222 ? 37.318  -23.283 47.965  1.00 12.63 ? 222  PHE B O   1 
ATOM   5875  C CB  . PHE B 1 222 ? 37.736  -26.156 48.103  1.00 10.99 ? 222  PHE B CB  1 
ATOM   5876  C CG  . PHE B 1 222 ? 38.365  -27.522 48.113  1.00 12.04 ? 222  PHE B CG  1 
ATOM   5877  C CD1 . PHE B 1 222 ? 39.410  -27.833 47.220  1.00 13.98 ? 222  PHE B CD1 1 
ATOM   5878  C CD2 . PHE B 1 222 ? 37.976  -28.483 49.069  1.00 11.79 ? 222  PHE B CD2 1 
ATOM   5879  C CE1 . PHE B 1 222 ? 40.075  -29.089 47.282  1.00 14.53 ? 222  PHE B CE1 1 
ATOM   5880  C CE2 . PHE B 1 222 ? 38.629  -29.742 49.147  1.00 14.47 ? 222  PHE B CE2 1 
ATOM   5881  C CZ  . PHE B 1 222 ? 39.685  -30.043 48.250  1.00 14.44 ? 222  PHE B CZ  1 
ATOM   5882  N N   . SER B 1 223 ? 37.518  -23.276 50.218  1.00 10.29 ? 223  SER B N   1 
ATOM   5883  C CA  . SER B 1 223 ? 36.765  -22.041 50.410  1.00 11.10 ? 223  SER B CA  1 
ATOM   5884  C C   . SER B 1 223 ? 37.572  -20.755 50.401  1.00 10.55 ? 223  SER B C   1 
ATOM   5885  O O   . SER B 1 223 ? 38.788  -20.767 50.592  1.00 12.44 ? 223  SER B O   1 
ATOM   5886  C CB  . SER B 1 223 ? 35.968  -22.100 51.716  1.00 12.13 ? 223  SER B CB  1 
ATOM   5887  O OG  . SER B 1 223 ? 36.812  -21.943 52.850  1.00 12.95 ? 223  SER B OG  1 
ATOM   5888  N N   . GLN B 1 224 ? 36.867  -19.652 50.155  1.00 10.92 ? 224  GLN B N   1 
ATOM   5889  C CA  . GLN B 1 224 ? 37.462  -18.318 50.186  1.00 11.86 ? 224  GLN B CA  1 
ATOM   5890  C C   . GLN B 1 224 ? 37.302  -17.925 51.655  1.00 11.83 ? 224  GLN B C   1 
ATOM   5891  O O   . GLN B 1 224 ? 36.190  -17.667 52.130  1.00 12.92 ? 224  GLN B O   1 
ATOM   5892  C CB  . GLN B 1 224 ? 36.718  -17.354 49.262  1.00 11.92 ? 224  GLN B CB  1 
ATOM   5893  C CG  . GLN B 1 224 ? 37.389  -15.985 49.181  1.00 13.13 ? 224  GLN B CG  1 
ATOM   5894  C CD  . GLN B 1 224 ? 36.832  -15.110 48.082  1.00 13.62 ? 224  GLN B CD  1 
ATOM   5895  O OE1 . GLN B 1 224 ? 36.787  -15.510 46.919  1.00 15.10 ? 224  GLN B OE1 1 
ATOM   5896  N NE2 . GLN B 1 224 ? 36.428  -13.896 48.441  1.00 15.08 ? 224  GLN B NE2 1 
ATOM   5897  N N   . ARG B 1 225 ? 38.429  -17.925 52.362  1.00 13.16 ? 225  ARG B N   1 
ATOM   5898  C CA  . ARG B 1 225 ? 38.493  -17.649 53.798  1.00 14.26 ? 225  ARG B CA  1 
ATOM   5899  C C   . ARG B 1 225 ? 38.040  -16.285 54.328  1.00 15.44 ? 225  ARG B C   1 
ATOM   5900  O O   . ARG B 1 225 ? 37.641  -16.192 55.493  1.00 17.74 ? 225  ARG B O   1 
ATOM   5901  C CB  . ARG B 1 225 ? 39.895  -17.978 54.326  1.00 15.08 ? 225  ARG B CB  1 
ATOM   5902  C CG  . ARG B 1 225 ? 40.366  -19.417 54.071  1.00 17.21 ? 225  ARG B CG  1 
ATOM   5903  C CD  . ARG B 1 225 ? 39.588  -20.439 54.890  1.00 17.33 ? 225  ARG B CD  1 
ATOM   5904  N NE  . ARG B 1 225 ? 40.166  -21.778 54.763  1.00 15.81 ? 225  ARG B NE  1 
ATOM   5905  C CZ  . ARG B 1 225 ? 40.182  -22.692 55.731  1.00 15.39 ? 225  ARG B CZ  1 
ATOM   5906  N NH1 . ARG B 1 225 ? 39.649  -22.429 56.921  1.00 16.08 ? 225  ARG B NH1 1 
ATOM   5907  N NH2 . ARG B 1 225 ? 40.727  -23.879 55.505  1.00 15.81 ? 225  ARG B NH2 1 
ATOM   5908  N N   . ASP B 1 226 ? 38.068  -15.246 53.488  1.00 15.41 ? 226  ASP B N   1 
ATOM   5909  C CA  . ASP B 1 226 ? 37.644  -13.911 53.934  1.00 16.65 ? 226  ASP B CA  1 
ATOM   5910  C C   . ASP B 1 226 ? 36.124  -13.682 53.929  1.00 16.58 ? 226  ASP B C   1 
ATOM   5911  O O   . ASP B 1 226 ? 35.647  -12.582 54.229  1.00 18.42 ? 226  ASP B O   1 
ATOM   5912  C CB  . ASP B 1 226 ? 38.414  -12.788 53.201  1.00 18.09 ? 226  ASP B CB  1 
ATOM   5913  C CG  . ASP B 1 226 ? 38.094  -12.688 51.706  1.00 20.29 ? 226  ASP B CG  1 
ATOM   5914  O OD1 . ASP B 1 226 ? 37.186  -13.378 51.199  1.00 18.89 ? 226  ASP B OD1 1 
ATOM   5915  O OD2 . ASP B 1 226 ? 38.749  -11.861 51.033  1.00 22.54 ? 226  ASP B OD2 1 
ATOM   5916  N N   . LEU B 1 227 ? 35.382  -14.723 53.550  1.00 15.98 ? 227  LEU B N   1 
ATOM   5917  C CA  . LEU B 1 227 ? 33.922  -14.693 53.524  1.00 16.12 ? 227  LEU B CA  1 
ATOM   5918  C C   . LEU B 1 227 ? 33.402  -15.575 54.654  1.00 16.88 ? 227  LEU B C   1 
ATOM   5919  O O   . LEU B 1 227 ? 33.620  -16.791 54.643  1.00 19.81 ? 227  LEU B O   1 
ATOM   5920  C CB  . LEU B 1 227 ? 33.381  -15.207 52.183  1.00 16.89 ? 227  LEU B CB  1 
ATOM   5921  C CG  . LEU B 1 227 ? 33.499  -14.336 50.928  1.00 17.37 ? 227  LEU B CG  1 
ATOM   5922  C CD1 . LEU B 1 227 ? 32.996  -15.114 49.727  1.00 17.96 ? 227  LEU B CD1 1 
ATOM   5923  C CD2 . LEU B 1 227 ? 32.705  -13.047 51.092  1.00 19.70 ? 227  LEU B CD2 1 
ATOM   5924  N N   . SER B 1 228 ? 32.732  -14.961 55.628  1.00 14.40 ? 228  SER B N   1 
ATOM   5925  C CA  . SER B 1 228 ? 32.172  -15.685 56.771  1.00 13.67 ? 228  SER B CA  1 
ATOM   5926  C C   . SER B 1 228 ? 30.757  -16.154 56.460  1.00 13.06 ? 228  SER B C   1 
ATOM   5927  O O   . SER B 1 228 ? 29.907  -15.354 56.070  1.00 13.27 ? 228  SER B O   1 
ATOM   5928  C CB  . SER B 1 228 ? 32.164  -14.804 58.025  1.00 15.47 ? 228  SER B CB  1 
ATOM   5929  O OG  . SER B 1 228 ? 33.477  -14.406 58.375  1.00 17.63 ? 228  SER B OG  1 
ATOM   5930  N N   . LEU B 1 229 ? 30.527  -17.457 56.609  1.00 12.01 ? 229  LEU B N   1 
ATOM   5931  C CA  . LEU B 1 229 ? 29.223  -18.066 56.351  1.00 13.65 ? 229  LEU B CA  1 
ATOM   5932  C C   . LEU B 1 229 ? 28.435  -18.269 57.638  1.00 12.50 ? 229  LEU B C   1 
ATOM   5933  O O   . LEU B 1 229 ? 28.980  -18.718 58.642  1.00 13.95 ? 229  LEU B O   1 
ATOM   5934  C CB  . LEU B 1 229 ? 29.395  -19.402 55.615  1.00 16.89 ? 229  LEU B CB  1 
ATOM   5935  C CG  . LEU B 1 229 ? 29.372  -19.486 54.077  1.00 22.08 ? 229  LEU B CG  1 
ATOM   5936  C CD1 . LEU B 1 229 ? 27.951  -19.304 53.567  1.00 23.40 ? 229  LEU B CD1 1 
ATOM   5937  C CD2 . LEU B 1 229 ? 30.318  -18.491 53.415  1.00 21.45 ? 229  LEU B CD2 1 
ATOM   5938  N N   . HIS B 1 230 ? 27.161  -17.872 57.611  1.00 11.18 ? 230  HIS B N   1 
ATOM   5939  C CA  . HIS B 1 230 ? 26.262  -18.000 58.763  1.00 12.08 ? 230  HIS B CA  1 
ATOM   5940  C C   . HIS B 1 230 ? 24.989  -18.676 58.276  1.00 11.95 ? 230  HIS B C   1 
ATOM   5941  O O   . HIS B 1 230 ? 24.557  -18.457 57.141  1.00 11.59 ? 230  HIS B O   1 
ATOM   5942  C CB  . HIS B 1 230 ? 25.910  -16.625 59.352  1.00 12.26 ? 230  HIS B CB  1 
ATOM   5943  C CG  . HIS B 1 230 ? 27.101  -15.780 59.685  1.00 14.07 ? 230  HIS B CG  1 
ATOM   5944  N ND1 . HIS B 1 230 ? 27.698  -15.788 60.927  1.00 14.89 ? 230  HIS B ND1 1 
ATOM   5945  C CD2 . HIS B 1 230 ? 27.817  -14.913 58.928  1.00 13.92 ? 230  HIS B CD2 1 
ATOM   5946  C CE1 . HIS B 1 230 ? 28.733  -14.965 60.920  1.00 15.60 ? 230  HIS B CE1 1 
ATOM   5947  N NE2 . HIS B 1 230 ? 28.827  -14.423 59.719  1.00 15.20 ? 230  HIS B NE2 1 
ATOM   5948  N N   . PHE B 1 231 ? 24.435  -19.555 59.109  1.00 12.29 ? 231  PHE B N   1 
ATOM   5949  C CA  . PHE B 1 231 ? 23.221  -20.286 58.762  1.00 12.16 ? 231  PHE B CA  1 
ATOM   5950  C C   . PHE B 1 231 ? 22.111  -20.131 59.794  1.00 12.91 ? 231  PHE B C   1 
ATOM   5951  O O   . PHE B 1 231 ? 22.176  -20.701 60.886  1.00 16.03 ? 231  PHE B O   1 
ATOM   5952  C CB  . PHE B 1 231 ? 23.538  -21.775 58.530  1.00 12.90 ? 231  PHE B CB  1 
ATOM   5953  C CG  . PHE B 1 231 ? 24.517  -22.021 57.415  1.00 13.16 ? 231  PHE B CG  1 
ATOM   5954  C CD1 . PHE B 1 231 ? 24.069  -22.182 56.091  1.00 13.50 ? 231  PHE B CD1 1 
ATOM   5955  C CD2 . PHE B 1 231 ? 25.906  -22.043 57.672  1.00 13.57 ? 231  PHE B CD2 1 
ATOM   5956  C CE1 . PHE B 1 231 ? 24.987  -22.355 55.023  1.00 13.72 ? 231  PHE B CE1 1 
ATOM   5957  C CE2 . PHE B 1 231 ? 26.840  -22.215 56.616  1.00 13.65 ? 231  PHE B CE2 1 
ATOM   5958  C CZ  . PHE B 1 231 ? 26.378  -22.370 55.286  1.00 13.99 ? 231  PHE B CZ  1 
ATOM   5959  N N   . VAL B 1 232 ? 21.114  -19.316 59.445  1.00 11.14 ? 232  VAL B N   1 
ATOM   5960  C CA  . VAL B 1 232 ? 19.949  -19.068 60.297  1.00 11.09 ? 232  VAL B CA  1 
ATOM   5961  C C   . VAL B 1 232 ? 18.860  -20.030 59.814  1.00 10.75 ? 232  VAL B C   1 
ATOM   5962  O O   . VAL B 1 232 ? 18.424  -19.954 58.668  1.00 12.75 ? 232  VAL B O   1 
ATOM   5963  C CB  . VAL B 1 232 ? 19.466  -17.591 60.187  1.00 9.67  ? 232  VAL B CB  1 
ATOM   5964  C CG1 . VAL B 1 232 ? 18.224  -17.357 61.033  1.00 11.29 ? 232  VAL B CG1 1 
ATOM   5965  C CG2 . VAL B 1 232 ? 20.552  -16.657 60.656  1.00 10.87 ? 232  VAL B CG2 1 
ATOM   5966  N N   . SER B 1 233 ? 18.428  -20.927 60.697  1.00 9.46  ? 233  SER B N   1 
ATOM   5967  C CA  . SER B 1 233 ? 17.418  -21.920 60.346  1.00 9.09  ? 233  SER B CA  1 
ATOM   5968  C C   . SER B 1 233 ? 16.267  -22.022 61.322  1.00 7.79  ? 233  SER B C   1 
ATOM   5969  O O   . SER B 1 233 ? 15.103  -21.959 60.933  1.00 9.76  ? 233  SER B O   1 
ATOM   5970  C CB  . SER B 1 233 ? 18.071  -23.294 60.175  1.00 9.01  ? 233  SER B CB  1 
ATOM   5971  O OG  . SER B 1 233 ? 18.836  -23.661 61.311  1.00 10.50 ? 233  SER B OG  1 
ATOM   5972  N N   . ASN B 1 234 ? 16.603  -22.168 62.598  1.00 9.30  ? 234  ASN B N   1 
ATOM   5973  C CA  . ASN B 1 234 ? 15.618  -22.296 63.666  1.00 9.57  ? 234  ASN B CA  1 
ATOM   5974  C C   . ASN B 1 234 ? 14.825  -21.002 63.841  1.00 9.42  ? 234  ASN B C   1 
ATOM   5975  O O   . ASN B 1 234 ? 15.374  -19.910 63.666  1.00 9.62  ? 234  ASN B O   1 
ATOM   5976  C CB  . ASN B 1 234 ? 16.350  -22.619 64.973  1.00 9.01  ? 234  ASN B CB  1 
ATOM   5977  C CG  . ASN B 1 234 ? 15.506  -23.406 65.950  1.00 9.07  ? 234  ASN B CG  1 
ATOM   5978  O OD1 . ASN B 1 234 ? 14.275  -23.425 65.867  1.00 10.05 ? 234  ASN B OD1 1 
ATOM   5979  N ND2 . ASN B 1 234 ? 16.170  -24.043 66.910  1.00 9.44  ? 234  ASN B ND2 1 
ATOM   5980  N N   . VAL B 1 235 ? 13.533  -21.130 64.151  1.00 8.89  ? 235  VAL B N   1 
ATOM   5981  C CA  . VAL B 1 235 ? 12.699  -19.949 64.395  1.00 8.69  ? 235  VAL B CA  1 
ATOM   5982  C C   . VAL B 1 235 ? 12.997  -19.409 65.797  1.00 8.98  ? 235  VAL B C   1 
ATOM   5983  O O   . VAL B 1 235 ? 12.639  -18.281 66.112  1.00 10.42 ? 235  VAL B O   1 
ATOM   5984  C CB  . VAL B 1 235 ? 11.184  -20.211 64.173  1.00 9.37  ? 235  VAL B CB  1 
ATOM   5985  C CG1 . VAL B 1 235 ? 10.655  -21.266 65.094  1.00 11.33 ? 235  VAL B CG1 1 
ATOM   5986  C CG2 . VAL B 1 235 ? 10.379  -18.920 64.216  1.00 11.33 ? 235  VAL B CG2 1 
ATOM   5987  N N   . ASP B 1 236 ? 13.659  -20.220 66.628  1.00 9.77  ? 236  ASP B N   1 
ATOM   5988  C CA  . ASP B 1 236 ? 14.086  -19.792 67.967  1.00 8.03  ? 236  ASP B CA  1 
ATOM   5989  C C   . ASP B 1 236 ? 14.848  -18.481 67.749  1.00 8.62  ? 236  ASP B C   1 
ATOM   5990  O O   . ASP B 1 236 ? 15.798  -18.449 66.957  1.00 10.13 ? 236  ASP B O   1 
ATOM   5991  C CB  . ASP B 1 236 ? 15.049  -20.830 68.558  1.00 9.29  ? 236  ASP B CB  1 
ATOM   5992  C CG  . ASP B 1 236 ? 15.473  -20.522 69.992  1.00 9.69  ? 236  ASP B CG  1 
ATOM   5993  O OD1 . ASP B 1 236 ? 15.210  -19.413 70.510  1.00 11.02 ? 236  ASP B OD1 1 
ATOM   5994  O OD2 . ASP B 1 236 ? 16.105  -21.400 70.605  1.00 11.48 ? 236  ASP B OD2 1 
ATOM   5995  N N   . GLY B 1 237 ? 14.371  -17.410 68.394  1.00 8.78  ? 237  GLY B N   1 
ATOM   5996  C CA  . GLY B 1 237 ? 14.966  -16.078 68.277  1.00 9.68  ? 237  GLY B CA  1 
ATOM   5997  C C   . GLY B 1 237 ? 16.465  -16.006 68.450  1.00 9.94  ? 237  GLY B C   1 
ATOM   5998  O O   . GLY B 1 237 ? 17.129  -15.131 67.899  1.00 10.43 ? 237  GLY B O   1 
ATOM   5999  N N   . THR B 1 238 ? 16.988  -16.994 69.165  1.00 8.97  ? 238  THR B N   1 
ATOM   6000  C CA  . THR B 1 238 ? 18.411  -17.144 69.426  1.00 9.57  ? 238  THR B CA  1 
ATOM   6001  C C   . THR B 1 238 ? 19.245  -17.228 68.147  1.00 10.27 ? 238  THR B C   1 
ATOM   6002  O O   . THR B 1 238 ? 20.304  -16.609 68.067  1.00 11.27 ? 238  THR B O   1 
ATOM   6003  C CB  . THR B 1 238 ? 18.625  -18.407 70.275  1.00 10.92 ? 238  THR B CB  1 
ATOM   6004  O OG1 . THR B 1 238 ? 18.183  -18.151 71.612  1.00 11.47 ? 238  THR B OG1 1 
ATOM   6005  C CG2 . THR B 1 238 ? 20.078  -18.877 70.269  1.00 10.72 ? 238  THR B CG2 1 
ATOM   6006  N N   . HIS B 1 239 ? 18.748  -17.967 67.153  1.00 10.46 ? 239  HIS B N   1 
ATOM   6007  C CA  . HIS B 1 239 ? 19.476  -18.150 65.898  1.00 10.36 ? 239  HIS B CA  1 
ATOM   6008  C C   . HIS B 1 239 ? 19.767  -16.853 65.150  1.00 10.14 ? 239  HIS B C   1 
ATOM   6009  O O   . HIS B 1 239 ? 20.936  -16.561 64.877  1.00 10.53 ? 239  HIS B O   1 
ATOM   6010  C CB  . HIS B 1 239 ? 18.786  -19.180 65.000  1.00 11.41 ? 239  HIS B CB  1 
ATOM   6011  C CG  . HIS B 1 239 ? 19.705  -20.257 64.501  1.00 11.47 ? 239  HIS B CG  1 
ATOM   6012  N ND1 . HIS B 1 239 ? 19.323  -21.203 63.571  1.00 11.72 ? 239  HIS B ND1 1 
ATOM   6013  C CD2 . HIS B 1 239 ? 20.993  -20.534 64.804  1.00 15.29 ? 239  HIS B CD2 1 
ATOM   6014  C CE1 . HIS B 1 239 ? 20.338  -22.013 63.327  1.00 13.52 ? 239  HIS B CE1 1 
ATOM   6015  N NE2 . HIS B 1 239 ? 21.364  -21.627 64.062  1.00 16.30 ? 239  HIS B NE2 1 
ATOM   6016  N N   . ILE B 1 240 ? 18.736  -16.034 64.929  1.00 10.37 ? 240  ILE B N   1 
ATOM   6017  C CA  . ILE B 1 240 ? 18.929  -14.758 64.243  1.00 11.61 ? 240  ILE B CA  1 
ATOM   6018  C C   . ILE B 1 240 ? 19.652  -13.750 65.151  1.00 11.43 ? 240  ILE B C   1 
ATOM   6019  O O   . ILE B 1 240 ? 20.519  -13.025 64.673  1.00 11.56 ? 240  ILE B O   1 
ATOM   6020  C CB  . ILE B 1 240 ? 17.585  -14.180 63.638  1.00 12.36 ? 240  ILE B CB  1 
ATOM   6021  C CG1 . ILE B 1 240 ? 17.856  -12.974 62.719  1.00 16.00 ? 240  ILE B CG1 1 
ATOM   6022  C CG2 . ILE B 1 240 ? 16.586  -13.813 64.739  1.00 12.96 ? 240  ILE B CG2 1 
ATOM   6023  C CD1 . ILE B 1 240 ? 18.871  -13.219 61.601  1.00 17.82 ? 240  ILE B CD1 1 
ATOM   6024  N N   . ALA B 1 241 ? 19.377  -13.796 66.459  1.00 10.97 ? 241  ALA B N   1 
ATOM   6025  C CA  . ALA B 1 241 ? 20.010  -12.885 67.425  1.00 10.51 ? 241  ALA B CA  1 
ATOM   6026  C C   . ALA B 1 241 ? 21.529  -13.042 67.511  1.00 10.56 ? 241  ALA B C   1 
ATOM   6027  O O   . ALA B 1 241 ? 22.252  -12.044 67.479  1.00 11.73 ? 241  ALA B O   1 
ATOM   6028  C CB  . ALA B 1 241 ? 19.399  -13.047 68.800  1.00 11.73 ? 241  ALA B CB  1 
ATOM   6029  N N   . GLU B 1 242 ? 22.008  -14.285 67.568  1.00 9.30  ? 242  GLU B N   1 
ATOM   6030  C CA  . GLU B 1 242 ? 23.448  -14.545 67.641  1.00 9.75  ? 242  GLU B CA  1 
ATOM   6031  C C   . GLU B 1 242 ? 24.178  -14.195 66.343  1.00 10.52 ? 242  GLU B C   1 
ATOM   6032  O O   . GLU B 1 242 ? 25.331  -13.758 66.376  1.00 12.46 ? 242  GLU B O   1 
ATOM   6033  C CB  . GLU B 1 242 ? 23.737  -15.991 68.070  1.00 10.77 ? 242  GLU B CB  1 
ATOM   6034  C CG  . GLU B 1 242 ? 23.392  -16.298 69.541  1.00 11.77 ? 242  GLU B CG  1 
ATOM   6035  C CD  . GLU B 1 242 ? 24.301  -15.608 70.568  1.00 12.95 ? 242  GLU B CD  1 
ATOM   6036  O OE1 . GLU B 1 242 ? 25.430  -15.199 70.228  1.00 15.22 ? 242  GLU B OE1 1 
ATOM   6037  O OE2 . GLU B 1 242 ? 23.886  -15.490 71.738  1.00 11.44 ? 242  GLU B OE2 1 
ATOM   6038  N N   . VAL B 1 243 ? 23.480  -14.328 65.213  1.00 10.16 ? 243  VAL B N   1 
ATOM   6039  C CA  . VAL B 1 243 ? 24.051  -13.978 63.914  1.00 11.00 ? 243  VAL B CA  1 
ATOM   6040  C C   . VAL B 1 243 ? 24.129  -12.448 63.790  1.00 11.04 ? 243  VAL B C   1 
ATOM   6041  O O   . VAL B 1 243 ? 25.137  -11.927 63.317  1.00 11.71 ? 243  VAL B O   1 
ATOM   6042  C CB  . VAL B 1 243 ? 23.275  -14.639 62.745  1.00 11.95 ? 243  VAL B CB  1 
ATOM   6043  C CG1 . VAL B 1 243 ? 23.621  -13.996 61.398  1.00 14.07 ? 243  VAL B CG1 1 
ATOM   6044  C CG2 . VAL B 1 243 ? 23.636  -16.118 62.685  1.00 12.85 ? 243  VAL B CG2 1 
ATOM   6045  N N   . LEU B 1 244 ? 23.113  -11.737 64.290  1.00 11.39 ? 244  LEU B N   1 
ATOM   6046  C CA  . LEU B 1 244 ? 23.111  -10.268 64.248  1.00 11.29 ? 244  LEU B CA  1 
ATOM   6047  C C   . LEU B 1 244 ? 24.221  -9.671  65.126  1.00 13.58 ? 244  LEU B C   1 
ATOM   6048  O O   . LEU B 1 244 ? 24.769  -8.614  64.806  1.00 14.31 ? 244  LEU B O   1 
ATOM   6049  C CB  . LEU B 1 244 ? 21.742  -9.694  64.634  1.00 11.91 ? 244  LEU B CB  1 
ATOM   6050  C CG  . LEU B 1 244 ? 20.559  -9.909  63.682  1.00 11.12 ? 244  LEU B CG  1 
ATOM   6051  C CD1 . LEU B 1 244 ? 19.291  -9.353  64.314  1.00 11.62 ? 244  LEU B CD1 1 
ATOM   6052  C CD2 . LEU B 1 244 ? 20.807  -9.293  62.308  1.00 11.76 ? 244  LEU B CD2 1 
ATOM   6053  N N   . LYS B 1 245 ? 24.595  -10.405 66.178  1.00 13.88 ? 245  LYS B N   1 
ATOM   6054  C CA  . LYS B 1 245 ? 25.665  -10.009 67.104  1.00 15.42 ? 245  LYS B CA  1 
ATOM   6055  C C   . LYS B 1 245 ? 27.059  -10.290 66.526  1.00 16.64 ? 245  LYS B C   1 
ATOM   6056  O O   . LYS B 1 245 ? 28.052  -9.713  66.979  1.00 19.01 ? 245  LYS B O   1 
ATOM   6057  C CB  . LYS B 1 245 ? 25.539  -10.772 68.429  1.00 14.39 ? 245  LYS B CB  1 
ATOM   6058  C CG  . LYS B 1 245 ? 24.382  -10.344 69.299  1.00 15.94 ? 245  LYS B CG  1 
ATOM   6059  C CD  . LYS B 1 245 ? 24.475  -10.915 70.705  1.00 17.27 ? 245  LYS B CD  1 
ATOM   6060  C CE  . LYS B 1 245 ? 23.323  -10.402 71.558  1.00 19.53 ? 245  LYS B CE  1 
ATOM   6061  N NZ  . LYS B 1 245 ? 23.358  -10.899 72.960  1.00 19.98 ? 245  LYS B NZ  1 
ATOM   6062  N N   . SER B 1 246 ? 27.113  -11.172 65.528  1.00 17.70 ? 246  SER B N   1 
ATOM   6063  C CA  . SER B 1 246 ? 28.365  -11.593 64.887  1.00 19.51 ? 246  SER B CA  1 
ATOM   6064  C C   . SER B 1 246 ? 28.705  -10.895 63.564  1.00 19.95 ? 246  SER B C   1 
ATOM   6065  O O   . SER B 1 246 ? 29.870  -10.879 63.136  1.00 23.05 ? 246  SER B O   1 
ATOM   6066  C CB  . SER B 1 246 ? 28.319  -13.102 64.631  1.00 20.39 ? 246  SER B CB  1 
ATOM   6067  O OG  . SER B 1 246 ? 28.027  -13.792 65.837  1.00 24.20 ? 246  SER B OG  1 
ATOM   6068  N N   . ILE B 1 247 ? 27.725  -10.312 62.917  1.00 18.85 ? 247  ILE B N   1 
ATOM   6069  C CA  . ILE B 1 247 ? 27.961  -9.698  61.598  1.00 17.86 ? 247  ILE B CA  1 
ATOM   6070  C C   . ILE B 1 247 ? 28.038  -8.167  61.629  1.00 18.57 ? 247  ILE B C   1 
ATOM   6071  O O   . ILE B 1 247 ? 27.656  -7.526  62.620  1.00 19.95 ? 247  ILE B O   1 
ATOM   6072  C CB  . ILE B 1 247 ? 26.821  -10.034 60.632  1.00 16.30 ? 247  ILE B CB  1 
ATOM   6073  C CG1 . ILE B 1 247 ? 25.461  -9.518  61.110  1.00 15.92 ? 247  ILE B CG1 1 
ATOM   6074  C CG2 . ILE B 1 247 ? 26.646  -11.537 60.412  1.00 16.35 ? 247  ILE B CG2 1 
ATOM   6075  C CD1 . ILE B 1 247 ? 24.386  -9.551  60.020  1.00 15.32 ? 247  ILE B CD1 1 
ATOM   6076  N N   . ASP B 1 248 ? 28.556  -7.704  60.502  1.00 18.61 ? 248  ASP B N   1 
ATOM   6077  C CA  . ASP B 1 248 ? 28.656  -6.292  60.113  1.00 17.86 ? 248  ASP B CA  1 
ATOM   6078  C C   . ASP B 1 248 ? 27.643  -6.152  58.979  1.00 16.14 ? 248  ASP B C   1 
ATOM   6079  O O   . ASP B 1 248 ? 27.970  -6.354  57.803  1.00 16.04 ? 248  ASP B O   1 
ATOM   6080  C CB  . ASP B 1 248 ? 30.094  -5.986  59.656  1.00 20.69 ? 248  ASP B CB  1 
ATOM   6081  C CG  . ASP B 1 248 ? 30.248  -4.630  58.954  1.00 23.58 ? 248  ASP B CG  1 
ATOM   6082  O OD1 . ASP B 1 248 ? 29.245  -3.824  58.874  1.00 26.15 ? 248  ASP B OD1 1 
ATOM   6083  O OD2 . ASP B 1 248 ? 31.385  -4.292  58.441  1.00 25.78 ? 248  ASP B OD2 1 
ATOM   6084  N N   . ILE B 1 249 ? 26.432  -5.837  59.387  1.00 14.96 ? 249  ILE B N   1 
ATOM   6085  C CA  . ILE B 1 249 ? 25.262  -5.812  58.496  1.00 13.82 ? 249  ILE B CA  1 
ATOM   6086  C C   . ILE B 1 249 ? 25.460  -4.993  57.210  1.00 14.52 ? 249  ILE B C   1 
ATOM   6087  O O   . ILE B 1 249 ? 24.814  -5.250  56.196  1.00 13.81 ? 249  ILE B O   1 
ATOM   6088  C CB  . ILE B 1 249 ? 24.020  -5.341  59.255  1.00 15.49 ? 249  ILE B CB  1 
ATOM   6089  C CG1 . ILE B 1 249 ? 22.720  -5.868  58.632  1.00 16.13 ? 249  ILE B CG1 1 
ATOM   6090  C CG2 . ILE B 1 249 ? 23.882  -3.826  59.313  1.00 15.92 ? 249  ILE B CG2 1 
ATOM   6091  C CD1 . ILE B 1 249 ? 21.610  -6.109  59.656  1.00 17.10 ? 249  ILE B CD1 1 
ATOM   6092  N N   . GLU B 1 250 ? 26.368  -4.017  57.258  1.00 14.12 ? 250  GLU B N   1 
ATOM   6093  C CA  . GLU B 1 250 ? 26.659  -3.181  56.089  1.00 15.04 ? 250  GLU B CA  1 
ATOM   6094  C C   . GLU B 1 250 ? 27.356  -3.991  54.995  1.00 13.36 ? 250  GLU B C   1 
ATOM   6095  O O   . GLU B 1 250 ? 27.251  -3.689  53.802  1.00 14.03 ? 250  GLU B O   1 
ATOM   6096  C CB  . GLU B 1 250 ? 27.568  -2.014  56.471  1.00 17.05 ? 250  GLU B CB  1 
ATOM   6097  C CG  . GLU B 1 250 ? 26.863  -0.844  57.118  1.00 20.88 ? 250  GLU B CG  1 
ATOM   6098  C CD  . GLU B 1 250 ? 27.811  0.306   57.489  1.00 23.50 ? 250  GLU B CD  1 
ATOM   6099  O OE1 . GLU B 1 250 ? 28.287  1.013   56.585  1.00 24.29 ? 250  GLU B OE1 1 
ATOM   6100  O OE2 . GLU B 1 250 ? 28.095  0.500   58.695  1.00 26.85 ? 250  GLU B OE2 1 
ATOM   6101  N N   . ALA B 1 251 ? 28.062  -5.029  55.440  1.00 13.16 ? 251  ALA B N   1 
ATOM   6102  C CA  . ALA B 1 251 ? 28.820  -5.926  54.570  1.00 11.51 ? 251  ALA B CA  1 
ATOM   6103  C C   . ALA B 1 251 ? 28.210  -7.327  54.576  1.00 10.28 ? 251  ALA B C   1 
ATOM   6104  O O   . ALA B 1 251 ? 28.925  -8.327  54.423  1.00 10.56 ? 251  ALA B O   1 
ATOM   6105  C CB  . ALA B 1 251 ? 30.269  -5.992  55.051  1.00 12.96 ? 251  ALA B CB  1 
ATOM   6106  N N   . THR B 1 252 ? 26.891  -7.403  54.735  1.00 10.25 ? 252  THR B N   1 
ATOM   6107  C CA  . THR B 1 252 ? 26.210  -8.695  54.787  1.00 10.66 ? 252  THR B CA  1 
ATOM   6108  C C   . THR B 1 252 ? 25.209  -8.941  53.674  1.00 9.86  ? 252  THR B C   1 
ATOM   6109  O O   . THR B 1 252 ? 24.384  -8.082  53.359  1.00 10.63 ? 252  THR B O   1 
ATOM   6110  C CB  . THR B 1 252 ? 25.482  -8.890  56.145  1.00 8.51  ? 252  THR B CB  1 
ATOM   6111  O OG1 . THR B 1 252 ? 26.435  -8.815  57.210  1.00 9.60  ? 252  THR B OG1 1 
ATOM   6112  C CG2 . THR B 1 252 ? 24.778  -10.242 56.241  1.00 9.51  ? 252  THR B CG2 1 
ATOM   6113  N N   . LEU B 1 253 ? 25.302  -10.133 53.091  1.00 10.19 ? 253  LEU B N   1 
ATOM   6114  C CA  . LEU B 1 253 ? 24.375  -10.575 52.062  1.00 9.64  ? 253  LEU B CA  1 
ATOM   6115  C C   . LEU B 1 253 ? 23.493  -11.629 52.724  1.00 9.68  ? 253  LEU B C   1 
ATOM   6116  O O   . LEU B 1 253 ? 23.998  -12.587 53.317  1.00 10.75 ? 253  LEU B O   1 
ATOM   6117  C CB  . LEU B 1 253 ? 25.106  -11.206 50.864  1.00 11.11 ? 253  LEU B CB  1 
ATOM   6118  C CG  . LEU B 1 253 ? 24.229  -11.959 49.845  1.00 10.44 ? 253  LEU B CG  1 
ATOM   6119  C CD1 . LEU B 1 253 ? 23.244  -11.022 49.144  1.00 13.07 ? 253  LEU B CD1 1 
ATOM   6120  C CD2 . LEU B 1 253 ? 25.115  -12.669 48.852  1.00 12.35 ? 253  LEU B CD2 1 
ATOM   6121  N N   . PHE B 1 254 ? 22.185  -11.411 52.658  1.00 9.21  ? 254  PHE B N   1 
ATOM   6122  C CA  . PHE B 1 254 ? 21.215  -12.353 53.199  1.00 10.03 ? 254  PHE B CA  1 
ATOM   6123  C C   . PHE B 1 254 ? 20.628  -13.140 52.035  1.00 10.29 ? 254  PHE B C   1 
ATOM   6124  O O   . PHE B 1 254 ? 20.212  -12.568 51.024  1.00 10.76 ? 254  PHE B O   1 
ATOM   6125  C CB  . PHE B 1 254 ? 20.092  -11.631 53.936  1.00 9.59  ? 254  PHE B CB  1 
ATOM   6126  C CG  . PHE B 1 254 ? 20.528  -10.929 55.188  1.00 10.59 ? 254  PHE B CG  1 
ATOM   6127  C CD1 . PHE B 1 254 ? 20.725  -11.650 56.376  1.00 10.87 ? 254  PHE B CD1 1 
ATOM   6128  C CD2 . PHE B 1 254 ? 20.718  -9.535  55.197  1.00 11.54 ? 254  PHE B CD2 1 
ATOM   6129  C CE1 . PHE B 1 254 ? 21.109  -10.999 57.578  1.00 10.69 ? 254  PHE B CE1 1 
ATOM   6130  C CE2 . PHE B 1 254 ? 21.099  -8.862  56.387  1.00 12.38 ? 254  PHE B CE2 1 
ATOM   6131  C CZ  . PHE B 1 254 ? 21.293  -9.601  57.583  1.00 11.98 ? 254  PHE B CZ  1 
ATOM   6132  N N   . ILE B 1 255 ? 20.643  -14.461 52.173  1.00 9.43  ? 255  ILE B N   1 
ATOM   6133  C CA  . ILE B 1 255 ? 20.120  -15.363 51.154  1.00 10.16 ? 255  ILE B CA  1 
ATOM   6134  C C   . ILE B 1 255 ? 18.893  -16.066 51.742  1.00 10.02 ? 255  ILE B C   1 
ATOM   6135  O O   . ILE B 1 255 ? 19.026  -16.844 52.684  1.00 11.04 ? 255  ILE B O   1 
ATOM   6136  C CB  . ILE B 1 255 ? 21.187  -16.428 50.748  1.00 9.28  ? 255  ILE B CB  1 
ATOM   6137  C CG1 . ILE B 1 255 ? 22.406  -15.773 50.088  1.00 9.73  ? 255  ILE B CG1 1 
ATOM   6138  C CG2 . ILE B 1 255 ? 20.585  -17.441 49.808  1.00 8.79  ? 255  ILE B CG2 1 
ATOM   6139  C CD1 . ILE B 1 255 ? 23.561  -16.717 49.809  1.00 10.48 ? 255  ILE B CD1 1 
ATOM   6140  N N   . VAL B 1 256 ? 17.711  -15.784 51.192  1.00 8.90  ? 256  VAL B N   1 
ATOM   6141  C CA  . VAL B 1 256 ? 16.481  -16.417 51.674  1.00 8.79  ? 256  VAL B CA  1 
ATOM   6142  C C   . VAL B 1 256 ? 16.202  -17.649 50.801  1.00 9.01  ? 256  VAL B C   1 
ATOM   6143  O O   . VAL B 1 256 ? 15.784  -17.537 49.646  1.00 9.62  ? 256  VAL B O   1 
ATOM   6144  C CB  . VAL B 1 256 ? 15.275  -15.436 51.692  1.00 9.68  ? 256  VAL B CB  1 
ATOM   6145  C CG1 . VAL B 1 256 ? 14.114  -16.047 52.482  1.00 9.97  ? 256  VAL B CG1 1 
ATOM   6146  C CG2 . VAL B 1 256 ? 15.675  -14.107 52.324  1.00 10.84 ? 256  VAL B CG2 1 
ATOM   6147  N N   . ALA B 1 257 ? 16.465  -18.817 51.382  1.00 9.60  ? 257  ALA B N   1 
ATOM   6148  C CA  . ALA B 1 257 ? 16.312  -20.103 50.714  1.00 9.66  ? 257  ALA B CA  1 
ATOM   6149  C C   . ALA B 1 257 ? 15.053  -20.816 51.168  1.00 9.67  ? 257  ALA B C   1 
ATOM   6150  O O   . ALA B 1 257 ? 14.924  -21.175 52.338  1.00 10.25 ? 257  ALA B O   1 
ATOM   6151  C CB  . ALA B 1 257 ? 17.541  -20.962 50.987  1.00 9.73  ? 257  ALA B CB  1 
ATOM   6152  N N   . SER B 1 258 ? 14.122  -21.004 50.234  1.00 10.25 ? 258  SER B N   1 
ATOM   6153  C CA  . SER B 1 258 ? 12.856  -21.659 50.532  1.00 11.52 ? 258  SER B CA  1 
ATOM   6154  C C   . SER B 1 258 ? 12.122  -22.042 49.255  1.00 11.59 ? 258  SER B C   1 
ATOM   6155  O O   . SER B 1 258 ? 11.784  -21.172 48.461  1.00 11.92 ? 258  SER B O   1 
ATOM   6156  C CB  . SER B 1 258 ? 11.987  -20.722 51.382  1.00 10.84 ? 258  SER B CB  1 
ATOM   6157  O OG  . SER B 1 258 ? 10.733  -21.299 51.685  1.00 12.33 ? 258  SER B OG  1 
ATOM   6158  N N   . LYS B 1 259 ? 11.862  -23.341 49.077  1.00 12.06 ? 259  LYS B N   1 
ATOM   6159  C CA  . LYS B 1 259 ? 11.149  -23.863 47.903  1.00 13.20 ? 259  LYS B CA  1 
ATOM   6160  C C   . LYS B 1 259 ? 9.774   -23.238 47.708  1.00 13.32 ? 259  LYS B C   1 
ATOM   6161  O O   . LYS B 1 259 ? 9.467   -22.704 46.646  1.00 12.99 ? 259  LYS B O   1 
ATOM   6162  C CB  . LYS B 1 259 ? 11.032  -25.401 47.980  1.00 11.98 ? 259  LYS B CB  1 
ATOM   6163  C CG  . LYS B 1 259 ? 10.450  -26.064 46.728  1.00 12.26 ? 259  LYS B CG  1 
ATOM   6164  C CD  . LYS B 1 259 ? 10.536  -27.575 46.778  1.00 11.66 ? 259  LYS B CD  1 
ATOM   6165  C CE  . LYS B 1 259 ? 9.876   -28.176 45.550  1.00 12.94 ? 259  LYS B CE  1 
ATOM   6166  N NZ  . LYS B 1 259 ? 9.894   -29.668 45.531  1.00 12.07 ? 259  LYS B NZ  1 
ATOM   6167  N N   . THR B 1 260 ? 8.998   -23.250 48.784  1.00 14.63 ? 260  THR B N   1 
ATOM   6168  C CA  . THR B 1 260 ? 7.643   -22.716 48.799  1.00 14.32 ? 260  THR B CA  1 
ATOM   6169  C C   . THR B 1 260 ? 7.579   -21.213 49.041  1.00 14.99 ? 260  THR B C   1 
ATOM   6170  O O   . THR B 1 260 ? 6.653   -20.545 48.580  1.00 14.90 ? 260  THR B O   1 
ATOM   6171  C CB  . THR B 1 260 ? 6.819   -23.389 49.913  1.00 14.93 ? 260  THR B CB  1 
ATOM   6172  O OG1 . THR B 1 260 ? 7.488   -23.215 51.174  1.00 14.74 ? 260  THR B OG1 1 
ATOM   6173  C CG2 . THR B 1 260 ? 6.630   -24.875 49.633  1.00 16.31 ? 260  THR B CG2 1 
ATOM   6174  N N   . PHE B 1 261 ? 8.561   -20.708 49.797  1.00 14.28 ? 261  PHE B N   1 
ATOM   6175  C CA  . PHE B 1 261 ? 8.668   -19.303 50.220  1.00 14.54 ? 261  PHE B CA  1 
ATOM   6176  C C   . PHE B 1 261 ? 7.511   -18.926 51.147  1.00 14.65 ? 261  PHE B C   1 
ATOM   6177  O O   . PHE B 1 261 ? 7.110   -17.765 51.231  1.00 15.62 ? 261  PHE B O   1 
ATOM   6178  C CB  . PHE B 1 261 ? 8.829   -18.330 49.040  1.00 14.06 ? 261  PHE B CB  1 
ATOM   6179  C CG  . PHE B 1 261 ? 9.850   -17.257 49.284  1.00 13.75 ? 261  PHE B CG  1 
ATOM   6180  C CD1 . PHE B 1 261 ? 11.221  -17.551 49.193  1.00 13.97 ? 261  PHE B CD1 1 
ATOM   6181  C CD2 . PHE B 1 261 ? 9.454   -15.948 49.605  1.00 13.14 ? 261  PHE B CD2 1 
ATOM   6182  C CE1 . PHE B 1 261 ? 12.199  -16.555 49.411  1.00 14.59 ? 261  PHE B CE1 1 
ATOM   6183  C CE2 . PHE B 1 261 ? 10.416  -14.930 49.832  1.00 13.53 ? 261  PHE B CE2 1 
ATOM   6184  C CZ  . PHE B 1 261 ? 11.793  -15.230 49.732  1.00 14.29 ? 261  PHE B CZ  1 
ATOM   6185  N N   . THR B 1 262 ? 6.977   -19.943 51.832  1.00 14.71 ? 262  THR B N   1 
ATOM   6186  C CA  . THR B 1 262 ? 5.868   -19.778 52.773  1.00 15.27 ? 262  THR B CA  1 
ATOM   6187  C C   . THR B 1 262 ? 6.133   -20.440 54.130  1.00 14.74 ? 262  THR B C   1 
ATOM   6188  O O   . THR B 1 262 ? 5.341   -20.256 55.063  1.00 16.40 ? 262  THR B O   1 
ATOM   6189  C CB  . THR B 1 262 ? 4.516   -20.337 52.218  1.00 16.76 ? 262  THR B CB  1 
ATOM   6190  O OG1 . THR B 1 262 ? 4.659   -21.726 51.906  1.00 17.28 ? 262  THR B OG1 1 
ATOM   6191  C CG2 . THR B 1 262 ? 4.047   -19.569 50.979  1.00 17.37 ? 262  THR B CG2 1 
ATOM   6192  N N   . THR B 1 263 ? 7.240   -21.189 54.244  1.00 13.86 ? 263  THR B N   1 
ATOM   6193  C CA  . THR B 1 263 ? 7.617   -21.882 55.493  1.00 12.21 ? 263  THR B CA  1 
ATOM   6194  C C   . THR B 1 263 ? 7.730   -20.868 56.632  1.00 11.15 ? 263  THR B C   1 
ATOM   6195  O O   . THR B 1 263 ? 8.509   -19.917 56.540  1.00 12.56 ? 263  THR B O   1 
ATOM   6196  C CB  . THR B 1 263 ? 8.949   -22.651 55.331  1.00 12.93 ? 263  THR B CB  1 
ATOM   6197  O OG1 . THR B 1 263 ? 8.820   -23.580 54.250  1.00 14.59 ? 263  THR B OG1 1 
ATOM   6198  C CG2 . THR B 1 263 ? 9.309   -23.420 56.607  1.00 13.58 ? 263  THR B CG2 1 
ATOM   6199  N N   . GLN B 1 264 ? 6.940   -21.087 57.687  1.00 11.39 ? 264  GLN B N   1 
ATOM   6200  C CA  . GLN B 1 264 ? 6.878   -20.177 58.833  1.00 12.34 ? 264  GLN B CA  1 
ATOM   6201  C C   . GLN B 1 264 ? 8.213   -19.760 59.434  1.00 11.21 ? 264  GLN B C   1 
ATOM   6202  O O   . GLN B 1 264 ? 8.445   -18.569 59.603  1.00 11.98 ? 264  GLN B O   1 
ATOM   6203  C CB  . GLN B 1 264 ? 5.933   -20.702 59.921  1.00 14.18 ? 264  GLN B CB  1 
ATOM   6204  C CG  . GLN B 1 264 ? 5.628   -19.641 60.987  1.00 16.00 ? 264  GLN B CG  1 
ATOM   6205  C CD  . GLN B 1 264 ? 4.523   -20.038 61.930  1.00 18.31 ? 264  GLN B CD  1 
ATOM   6206  O OE1 . GLN B 1 264 ? 3.465   -19.416 61.964  1.00 19.40 ? 264  GLN B OE1 1 
ATOM   6207  N NE2 . GLN B 1 264 ? 4.767   -21.079 62.714  1.00 21.32 ? 264  GLN B NE2 1 
ATOM   6208  N N   . GLU B 1 265 ? 9.103   -20.722 59.673  1.00 11.02 ? 265  GLU B N   1 
ATOM   6209  C CA  . GLU B 1 265 ? 10.428  -20.447 60.244  1.00 10.75 ? 265  GLU B CA  1 
ATOM   6210  C C   . GLU B 1 265 ? 11.269  -19.492 59.407  1.00 11.36 ? 265  GLU B C   1 
ATOM   6211  O O   . GLU B 1 265 ? 11.784  -18.494 59.916  1.00 9.48  ? 265  GLU B O   1 
ATOM   6212  C CB  . GLU B 1 265 ? 11.224  -21.746 60.426  1.00 11.50 ? 265  GLU B CB  1 
ATOM   6213  C CG  . GLU B 1 265 ? 10.724  -22.664 61.526  1.00 13.36 ? 265  GLU B CG  1 
ATOM   6214  C CD  . GLU B 1 265 ? 9.822   -23.770 61.053  1.00 13.97 ? 265  GLU B CD  1 
ATOM   6215  O OE1 . GLU B 1 265 ? 9.065   -23.577 60.077  1.00 14.06 ? 265  GLU B OE1 1 
ATOM   6216  O OE2 . GLU B 1 265 ? 9.872   -24.849 61.679  1.00 14.16 ? 265  GLU B OE2 1 
ATOM   6217  N N   . THR B 1 266 ? 11.325  -19.785 58.108  1.00 9.90  ? 266  THR B N   1 
ATOM   6218  C CA  . THR B 1 266 ? 12.114  -19.025 57.144  1.00 9.87  ? 266  THR B CA  1 
ATOM   6219  C C   . THR B 1 266 ? 11.598  -17.622 56.891  1.00 10.74 ? 266  THR B C   1 
ATOM   6220  O O   . THR B 1 266 ? 12.388  -16.683 56.864  1.00 10.36 ? 266  THR B O   1 
ATOM   6221  C CB  . THR B 1 266 ? 12.262  -19.815 55.830  1.00 10.01 ? 266  THR B CB  1 
ATOM   6222  O OG1 . THR B 1 266 ? 12.790  -21.111 56.138  1.00 10.46 ? 266  THR B OG1 1 
ATOM   6223  C CG2 . THR B 1 266 ? 13.224  -19.118 54.857  1.00 10.52 ? 266  THR B CG2 1 
ATOM   6224  N N   . ILE B 1 267 ? 10.281  -17.481 56.751  1.00 9.98  ? 267  ILE B N   1 
ATOM   6225  C CA  . ILE B 1 267 ? 9.682   -16.167 56.522  1.00 11.64 ? 267  ILE B CA  1 
ATOM   6226  C C   . ILE B 1 267 ? 9.812   -15.289 57.767  1.00 11.02 ? 267  ILE B C   1 
ATOM   6227  O O   . ILE B 1 267 ? 10.157  -14.115 57.644  1.00 11.04 ? 267  ILE B O   1 
ATOM   6228  C CB  . ILE B 1 267 ? 8.211   -16.286 56.020  1.00 12.32 ? 267  ILE B CB  1 
ATOM   6229  C CG1 . ILE B 1 267 ? 8.193   -17.005 54.662  1.00 15.15 ? 267  ILE B CG1 1 
ATOM   6230  C CG2 . ILE B 1 267 ? 7.540   -14.899 55.881  1.00 13.93 ? 267  ILE B CG2 1 
ATOM   6231  C CD1 . ILE B 1 267 ? 9.022   -16.340 53.537  1.00 16.32 ? 267  ILE B CD1 1 
ATOM   6232  N N   . THR B 1 268 ? 9.639   -15.883 58.953  1.00 10.45 ? 268  THR B N   1 
ATOM   6233  C CA  . THR B 1 268 ? 9.769   -15.152 60.226  1.00 10.14 ? 268  THR B CA  1 
ATOM   6234  C C   . THR B 1 268 ? 11.204  -14.638 60.378  1.00 9.90  ? 268  THR B C   1 
ATOM   6235  O O   . THR B 1 268 ? 11.415  -13.472 60.708  1.00 11.17 ? 268  THR B O   1 
ATOM   6236  C CB  . THR B 1 268 ? 9.402   -16.045 61.445  1.00 11.03 ? 268  THR B CB  1 
ATOM   6237  O OG1 . THR B 1 268 ? 8.060   -16.517 61.296  1.00 12.17 ? 268  THR B OG1 1 
ATOM   6238  C CG2 . THR B 1 268 ? 9.496   -15.267 62.761  1.00 9.99  ? 268  THR B CG2 1 
ATOM   6239  N N   . ASN B 1 269 ? 12.173  -15.501 60.071  1.00 9.09  ? 269  ASN B N   1 
ATOM   6240  C CA  . ASN B 1 269 ? 13.592  -15.147 60.146  1.00 8.37  ? 269  ASN B CA  1 
ATOM   6241  C C   . ASN B 1 269 ? 13.969  -14.103 59.095  1.00 8.19  ? 269  ASN B C   1 
ATOM   6242  O O   . ASN B 1 269 ? 14.693  -13.156 59.402  1.00 8.99  ? 269  ASN B O   1 
ATOM   6243  C CB  . ASN B 1 269 ? 14.468  -16.387 59.972  1.00 9.04  ? 269  ASN B CB  1 
ATOM   6244  C CG  . ASN B 1 269 ? 14.585  -17.210 61.232  1.00 10.24 ? 269  ASN B CG  1 
ATOM   6245  O OD1 . ASN B 1 269 ? 14.601  -16.683 62.341  1.00 10.50 ? 269  ASN B OD1 1 
ATOM   6246  N ND2 . ASN B 1 269 ? 14.729  -18.518 61.059  1.00 8.62  ? 269  ASN B ND2 1 
ATOM   6247  N N   . ALA B 1 270 ? 13.438  -14.267 57.879  1.00 8.35  ? 270  ALA B N   1 
ATOM   6248  C CA  . ALA B 1 270 ? 13.690  -13.344 56.763  1.00 9.46  ? 270  ALA B CA  1 
ATOM   6249  C C   . ALA B 1 270 ? 13.146  -11.947 57.063  1.00 10.61 ? 270  ALA B C   1 
ATOM   6250  O O   . ALA B 1 270 ? 13.812  -10.951 56.776  1.00 10.99 ? 270  ALA B O   1 
ATOM   6251  C CB  . ALA B 1 270 ? 13.085  -13.883 55.479  1.00 10.91 ? 270  ALA B CB  1 
ATOM   6252  N N   . LEU B 1 271 ? 11.960  -11.891 57.676  1.00 9.51  ? 271  LEU B N   1 
ATOM   6253  C CA  . LEU B 1 271 ? 11.333  -10.618 58.056  1.00 10.56 ? 271  LEU B CA  1 
ATOM   6254  C C   . LEU B 1 271 ? 12.132  -9.915  59.154  1.00 11.03 ? 271  LEU B C   1 
ATOM   6255  O O   . LEU B 1 271 ? 12.270  -8.693  59.129  1.00 11.23 ? 271  LEU B O   1 
ATOM   6256  C CB  . LEU B 1 271 ? 9.879   -10.820 58.514  1.00 12.06 ? 271  LEU B CB  1 
ATOM   6257  C CG  . LEU B 1 271 ? 8.832   -11.112 57.431  1.00 13.95 ? 271  LEU B CG  1 
ATOM   6258  C CD1 . LEU B 1 271 ? 7.518   -11.490 58.086  1.00 15.37 ? 271  LEU B CD1 1 
ATOM   6259  C CD2 . LEU B 1 271 ? 8.646   -9.920  56.498  1.00 14.50 ? 271  LEU B CD2 1 
ATOM   6260  N N   . SER B 1 272 ? 12.705  -10.694 60.076  1.00 9.91  ? 272  SER B N   1 
ATOM   6261  C CA  . SER B 1 272 ? 13.514  -10.134 61.164  1.00 9.55  ? 272  SER B CA  1 
ATOM   6262  C C   . SER B 1 272 ? 14.857  -9.622  60.673  1.00 9.48  ? 272  SER B C   1 
ATOM   6263  O O   . SER B 1 272 ? 15.362  -8.624  61.184  1.00 10.01 ? 272  SER B O   1 
ATOM   6264  C CB  . SER B 1 272 ? 13.713  -11.153 62.279  1.00 10.43 ? 272  SER B CB  1 
ATOM   6265  O OG  . SER B 1 272 ? 12.476  -11.408 62.907  1.00 12.01 ? 272  SER B OG  1 
ATOM   6266  N N   . ALA B 1 273 ? 15.410  -10.299 59.663  1.00 10.37 ? 273  ALA B N   1 
ATOM   6267  C CA  . ALA B 1 273 ? 16.683  -9.919  59.049  1.00 9.91  ? 273  ALA B CA  1 
ATOM   6268  C C   . ALA B 1 273 ? 16.483  -8.632  58.253  1.00 9.79  ? 273  ALA B C   1 
ATOM   6269  O O   . ALA B 1 273 ? 17.341  -7.743  58.278  1.00 11.83 ? 273  ALA B O   1 
ATOM   6270  C CB  . ALA B 1 273 ? 17.185  -11.027 58.136  1.00 10.05 ? 273  ALA B CB  1 
ATOM   6271  N N   . ARG B 1 274 ? 15.327  -8.528  57.585  1.00 10.27 ? 274  ARG B N   1 
ATOM   6272  C CA  . ARG B 1 274 ? 14.981  -7.340  56.797  1.00 10.82 ? 274  ARG B CA  1 
ATOM   6273  C C   . ARG B 1 274 ? 14.748  -6.151  57.711  1.00 11.31 ? 274  ARG B C   1 
ATOM   6274  O O   . ARG B 1 274 ? 15.209  -5.045  57.416  1.00 11.25 ? 274  ARG B O   1 
ATOM   6275  C CB  . ARG B 1 274 ? 13.757  -7.588  55.904  1.00 12.80 ? 274  ARG B CB  1 
ATOM   6276  C CG  . ARG B 1 274 ? 13.560  -6.527  54.808  1.00 16.84 ? 274  ARG B CG  1 
ATOM   6277  C CD  . ARG B 1 274 ? 12.288  -6.754  54.018  1.00 17.84 ? 274  ARG B CD  1 
ATOM   6278  N NE  . ARG B 1 274 ? 11.097  -6.584  54.848  1.00 21.72 ? 274  ARG B NE  1 
ATOM   6279  C CZ  . ARG B 1 274 ? 9.858   -6.900  54.475  1.00 22.60 ? 274  ARG B CZ  1 
ATOM   6280  N NH1 . ARG B 1 274 ? 9.621   -7.414  53.275  1.00 24.83 ? 274  ARG B NH1 1 
ATOM   6281  N NH2 . ARG B 1 274 ? 8.849   -6.702  55.310  1.00 24.11 ? 274  ARG B NH2 1 
ATOM   6282  N N   . ARG B 1 275 ? 14.093  -6.407  58.848  1.00 10.78 ? 275  ARG B N   1 
ATOM   6283  C CA  . ARG B 1 275 ? 13.815  -5.367  59.840  1.00 11.48 ? 275  ARG B CA  1 
ATOM   6284  C C   . ARG B 1 275 ? 15.136  -4.875  60.436  1.00 11.53 ? 275  ARG B C   1 
ATOM   6285  O O   . ARG B 1 275 ? 15.313  -3.672  60.626  1.00 12.47 ? 275  ARG B O   1 
ATOM   6286  C CB  . ARG B 1 275 ? 12.884  -5.885  60.947  1.00 13.25 ? 275  ARG B CB  1 
ATOM   6287  C CG  . ARG B 1 275 ? 12.378  -4.788  61.889  1.00 16.55 ? 275  ARG B CG  1 
ATOM   6288  C CD  . ARG B 1 275 ? 11.526  -5.321  63.026  1.00 20.40 ? 275  ARG B CD  1 
ATOM   6289  N NE  . ARG B 1 275 ? 11.149  -4.235  63.932  1.00 25.13 ? 275  ARG B NE  1 
ATOM   6290  C CZ  . ARG B 1 275 ? 10.413  -4.375  65.032  1.00 26.62 ? 275  ARG B CZ  1 
ATOM   6291  N NH1 . ARG B 1 275 ? 9.948   -5.565  65.395  1.00 28.32 ? 275  ARG B NH1 1 
ATOM   6292  N NH2 . ARG B 1 275 ? 10.153  -3.313  65.785  1.00 28.17 ? 275  ARG B NH2 1 
ATOM   6293  N N   . ALA B 1 276 ? 16.087  -5.794  60.607  1.00 10.16 ? 276  ALA B N   1 
ATOM   6294  C CA  . ALA B 1 276 ? 17.406  -5.476  61.159  1.00 11.50 ? 276  ALA B CA  1 
ATOM   6295  C C   . ALA B 1 276 ? 18.218  -4.554  60.255  1.00 11.61 ? 276  ALA B C   1 
ATOM   6296  O O   . ALA B 1 276 ? 18.860  -3.624  60.741  1.00 12.63 ? 276  ALA B O   1 
ATOM   6297  C CB  . ALA B 1 276 ? 18.180  -6.749  61.455  1.00 12.18 ? 276  ALA B CB  1 
ATOM   6298  N N   . LEU B 1 277 ? 18.167  -4.802  58.943  1.00 11.22 ? 277  LEU B N   1 
ATOM   6299  C CA  . LEU B 1 277 ? 18.878  -3.976  57.965  1.00 11.00 ? 277  LEU B CA  1 
ATOM   6300  C C   . LEU B 1 277 ? 18.329  -2.552  57.982  1.00 11.15 ? 277  LEU B C   1 
ATOM   6301  O O   . LEU B 1 277 ? 19.094  -1.593  58.107  1.00 11.74 ? 277  LEU B O   1 
ATOM   6302  C CB  . LEU B 1 277 ? 18.766  -4.565  56.549  1.00 11.93 ? 277  LEU B CB  1 
ATOM   6303  C CG  . LEU B 1 277 ? 19.284  -3.689  55.390  1.00 13.19 ? 277  LEU B CG  1 
ATOM   6304  C CD1 . LEU B 1 277 ? 20.802  -3.509  55.472  1.00 13.20 ? 277  LEU B CD1 1 
ATOM   6305  C CD2 . LEU B 1 277 ? 18.874  -4.277  54.065  1.00 13.12 ? 277  LEU B CD2 1 
ATOM   6306  N N   . LEU B 1 278 ? 17.002  -2.441  57.916  1.00 12.26 ? 278  LEU B N   1 
ATOM   6307  C CA  . LEU B 1 278 ? 16.328  -1.146  57.912  1.00 12.04 ? 278  LEU B CA  1 
ATOM   6308  C C   . LEU B 1 278 ? 16.493  -0.393  59.234  1.00 13.08 ? 278  LEU B C   1 
ATOM   6309  O O   . LEU B 1 278 ? 16.690  0.823   59.221  1.00 13.92 ? 278  LEU B O   1 
ATOM   6310  C CB  . LEU B 1 278 ? 14.849  -1.297  57.531  1.00 13.77 ? 278  LEU B CB  1 
ATOM   6311  C CG  . LEU B 1 278 ? 14.516  -1.968  56.183  1.00 14.21 ? 278  LEU B CG  1 
ATOM   6312  C CD1 . LEU B 1 278 ? 13.012  -1.971  55.973  1.00 18.32 ? 278  LEU B CD1 1 
ATOM   6313  C CD2 . LEU B 1 278 ? 15.219  -1.296  55.009  1.00 16.64 ? 278  LEU B CD2 1 
ATOM   6314  N N   . ASP B 1 279 ? 16.502  -1.130  60.351  1.00 13.00 ? 279  ASP B N   1 
ATOM   6315  C CA  . ASP B 1 279 ? 16.687  -0.544  61.686  1.00 12.13 ? 279  ASP B CA  1 
ATOM   6316  C C   . ASP B 1 279 ? 18.091  0.035   61.839  1.00 12.91 ? 279  ASP B C   1 
ATOM   6317  O O   . ASP B 1 279 ? 18.253  1.111   62.413  1.00 12.25 ? 279  ASP B O   1 
ATOM   6318  C CB  . ASP B 1 279 ? 16.464  -1.583  62.800  1.00 14.29 ? 279  ASP B CB  1 
ATOM   6319  C CG  . ASP B 1 279 ? 14.992  -1.790  63.153  1.00 15.96 ? 279  ASP B CG  1 
ATOM   6320  O OD1 . ASP B 1 279 ? 14.112  -1.091  62.609  1.00 16.91 ? 279  ASP B OD1 1 
ATOM   6321  O OD2 . ASP B 1 279 ? 14.720  -2.677  63.994  1.00 17.47 ? 279  ASP B OD2 1 
ATOM   6322  N N   . TYR B 1 280 ? 19.095  -0.661  61.296  1.00 11.64 ? 280  TYR B N   1 
ATOM   6323  C CA  . TYR B 1 280 ? 20.483  -0.195  61.369  1.00 11.60 ? 280  TYR B CA  1 
ATOM   6324  C C   . TYR B 1 280 ? 20.667  1.098   60.596  1.00 12.90 ? 280  TYR B C   1 
ATOM   6325  O O   . TYR B 1 280 ? 21.281  2.037   61.095  1.00 13.36 ? 280  TYR B O   1 
ATOM   6326  C CB  . TYR B 1 280 ? 21.462  -1.251  60.835  1.00 14.31 ? 280  TYR B CB  1 
ATOM   6327  C CG  . TYR B 1 280 ? 22.920  -0.826  60.903  1.00 17.67 ? 280  TYR B CG  1 
ATOM   6328  C CD1 . TYR B 1 280 ? 23.655  -0.936  62.104  1.00 19.92 ? 280  TYR B CD1 1 
ATOM   6329  C CD2 . TYR B 1 280 ? 23.567  -0.277  59.771  1.00 18.98 ? 280  TYR B CD2 1 
ATOM   6330  C CE1 . TYR B 1 280 ? 25.011  -0.506  62.177  1.00 22.78 ? 280  TYR B CE1 1 
ATOM   6331  C CE2 . TYR B 1 280 ? 24.907  0.158   59.837  1.00 22.19 ? 280  TYR B CE2 1 
ATOM   6332  C CZ  . TYR B 1 280 ? 25.622  0.040   61.037  1.00 23.55 ? 280  TYR B CZ  1 
ATOM   6333  O OH  . TYR B 1 280 ? 26.926  0.479   61.094  1.00 27.70 ? 280  TYR B OH  1 
ATOM   6334  N N   . LEU B 1 281 ? 20.167  1.113   59.362  1.00 12.73 ? 281  LEU B N   1 
ATOM   6335  C CA  . LEU B 1 281 ? 20.272  2.286   58.502  1.00 13.45 ? 281  LEU B CA  1 
ATOM   6336  C C   . LEU B 1 281 ? 19.536  3.484   59.090  1.00 13.10 ? 281  LEU B C   1 
ATOM   6337  O O   . LEU B 1 281 ? 20.082  4.591   59.120  1.00 14.26 ? 281  LEU B O   1 
ATOM   6338  C CB  . LEU B 1 281 ? 19.754  1.966   57.099  1.00 13.70 ? 281  LEU B CB  1 
ATOM   6339  C CG  . LEU B 1 281 ? 20.569  0.926   56.320  1.00 13.37 ? 281  LEU B CG  1 
ATOM   6340  C CD1 . LEU B 1 281 ? 19.813  0.544   55.072  1.00 14.14 ? 281  LEU B CD1 1 
ATOM   6341  C CD2 . LEU B 1 281 ? 21.963  1.441   55.980  1.00 13.93 ? 281  LEU B CD2 1 
ATOM   6342  N N   . ARG B 1 282 ? 18.361  3.229   59.670  1.00 12.19 ? 282  ARG B N   1 
ATOM   6343  C CA  . ARG B 1 282 ? 17.543  4.283   60.280  1.00 13.39 ? 282  ARG B CA  1 
ATOM   6344  C C   . ARG B 1 282 ? 18.204  4.853   61.538  1.00 13.74 ? 282  ARG B C   1 
ATOM   6345  O O   . ARG B 1 282 ? 18.142  6.063   61.775  1.00 14.23 ? 282  ARG B O   1 
ATOM   6346  C CB  . ARG B 1 282 ? 16.151  3.751   60.621  1.00 14.96 ? 282  ARG B CB  1 
ATOM   6347  C CG  . ARG B 1 282 ? 15.047  4.808   60.648  1.00 17.46 ? 282  ARG B CG  1 
ATOM   6348  C CD  . ARG B 1 282 ? 13.722  4.230   61.136  1.00 19.61 ? 282  ARG B CD  1 
ATOM   6349  N NE  . ARG B 1 282 ? 13.183  3.195   60.249  1.00 20.76 ? 282  ARG B NE  1 
ATOM   6350  C CZ  . ARG B 1 282 ? 13.126  1.893   60.536  1.00 22.28 ? 282  ARG B CZ  1 
ATOM   6351  N NH1 . ARG B 1 282 ? 13.576  1.437   61.700  1.00 21.11 ? 282  ARG B NH1 1 
ATOM   6352  N NH2 . ARG B 1 282 ? 12.641  1.043   59.641  1.00 21.56 ? 282  ARG B NH2 1 
ATOM   6353  N N   . SER B 1 283 ? 18.899  3.995   62.289  1.00 12.90 ? 283  SER B N   1 
ATOM   6354  C CA  . SER B 1 283 ? 19.584  4.409   63.520  1.00 13.30 ? 283  SER B CA  1 
ATOM   6355  C C   . SER B 1 283 ? 20.775  5.327   63.272  1.00 13.59 ? 283  SER B C   1 
ATOM   6356  O O   . SER B 1 283 ? 21.211  6.052   64.172  1.00 13.39 ? 283  SER B O   1 
ATOM   6357  C CB  . SER B 1 283 ? 20.051  3.199   64.322  1.00 11.66 ? 283  SER B CB  1 
ATOM   6358  O OG  . SER B 1 283 ? 21.203  2.584   63.767  1.00 15.26 ? 283  SER B OG  1 
ATOM   6359  N N   . ARG B 1 284 ? 21.310  5.246   62.054  1.00 13.94 ? 284  ARG B N   1 
ATOM   6360  C CA  . ARG B 1 284 ? 22.448  6.056   61.641  1.00 15.45 ? 284  ARG B CA  1 
ATOM   6361  C C   . ARG B 1 284 ? 22.033  7.191   60.703  1.00 15.02 ? 284  ARG B C   1 
ATOM   6362  O O   . ARG B 1 284 ? 22.889  7.901   60.171  1.00 17.25 ? 284  ARG B O   1 
ATOM   6363  C CB  . ARG B 1 284 ? 23.528  5.179   61.008  1.00 17.88 ? 284  ARG B CB  1 
ATOM   6364  C CG  . ARG B 1 284 ? 24.273  4.300   62.007  1.00 22.22 ? 284  ARG B CG  1 
ATOM   6365  C CD  . ARG B 1 284 ? 25.508  3.684   61.390  1.00 25.71 ? 284  ARG B CD  1 
ATOM   6366  N NE  . ARG B 1 284 ? 26.519  4.680   61.044  1.00 28.04 ? 284  ARG B NE  1 
ATOM   6367  C CZ  . ARG B 1 284 ? 27.365  4.588   60.017  1.00 30.27 ? 284  ARG B CZ  1 
ATOM   6368  N NH1 . ARG B 1 284 ? 27.337  3.536   59.205  1.00 29.53 ? 284  ARG B NH1 1 
ATOM   6369  N NH2 . ARG B 1 284 ? 28.245  5.558   59.803  1.00 30.86 ? 284  ARG B NH2 1 
ATOM   6370  N N   . GLY B 1 285 ? 20.718  7.371   60.538  1.00 14.22 ? 285  GLY B N   1 
ATOM   6371  C CA  . GLY B 1 285 ? 20.168  8.425   59.690  1.00 15.93 ? 285  GLY B CA  1 
ATOM   6372  C C   . GLY B 1 285 ? 20.434  8.291   58.200  1.00 16.82 ? 285  GLY B C   1 
ATOM   6373  O O   . GLY B 1 285 ? 20.420  9.288   57.471  1.00 17.24 ? 285  GLY B O   1 
ATOM   6374  N N   . ILE B 1 286 ? 20.684  7.061   57.755  1.00 16.05 ? 286  ILE B N   1 
ATOM   6375  C CA  . ILE B 1 286 ? 20.970  6.760   56.349  1.00 17.17 ? 286  ILE B CA  1 
ATOM   6376  C C   . ILE B 1 286 ? 19.683  6.397   55.607  1.00 18.07 ? 286  ILE B C   1 
ATOM   6377  O O   . ILE B 1 286 ? 18.869  5.613   56.107  1.00 16.59 ? 286  ILE B O   1 
ATOM   6378  C CB  . ILE B 1 286 ? 22.016  5.596   56.225  1.00 17.11 ? 286  ILE B CB  1 
ATOM   6379  C CG1 . ILE B 1 286 ? 23.386  6.054   56.746  1.00 17.91 ? 286  ILE B CG1 1 
ATOM   6380  C CG2 . ILE B 1 286 ? 22.150  5.115   54.762  1.00 17.55 ? 286  ILE B CG2 1 
ATOM   6381  C CD1 . ILE B 1 286 ? 24.287  4.929   57.251  1.00 18.50 ? 286  ILE B CD1 1 
ATOM   6382  N N   . ASP B 1 287 ? 19.525  6.957   54.403  1.00 18.52 ? 287  ASP B N   1 
ATOM   6383  C CA  . ASP B 1 287 ? 18.361  6.709   53.548  1.00 19.70 ? 287  ASP B CA  1 
ATOM   6384  C C   . ASP B 1 287 ? 18.339  5.230   53.135  1.00 19.02 ? 287  ASP B C   1 
ATOM   6385  O O   . ASP B 1 287 ? 19.326  4.716   52.605  1.00 19.79 ? 287  ASP B O   1 
ATOM   6386  C CB  . ASP B 1 287 ? 18.409  7.615   52.312  1.00 22.27 ? 287  ASP B CB  1 
ATOM   6387  C CG  . ASP B 1 287 ? 17.165  7.494   51.449  1.00 26.18 ? 287  ASP B CG  1 
ATOM   6388  O OD1 . ASP B 1 287 ? 16.178  8.214   51.718  1.00 29.44 ? 287  ASP B OD1 1 
ATOM   6389  O OD2 . ASP B 1 287 ? 17.172  6.677   50.508  1.00 28.84 ? 287  ASP B OD2 1 
ATOM   6390  N N   . GLU B 1 288 ? 17.211  4.573   53.403  1.00 19.67 ? 288  GLU B N   1 
ATOM   6391  C CA  . GLU B 1 288 ? 17.025  3.146   53.128  1.00 20.55 ? 288  GLU B CA  1 
ATOM   6392  C C   . GLU B 1 288 ? 16.586  2.715   51.725  1.00 20.38 ? 288  GLU B C   1 
ATOM   6393  O O   . GLU B 1 288 ? 16.588  1.517   51.438  1.00 19.60 ? 288  GLU B O   1 
ATOM   6394  C CB  . GLU B 1 288 ? 16.064  2.538   54.163  1.00 23.67 ? 288  GLU B CB  1 
ATOM   6395  C CG  . GLU B 1 288 ? 14.566  2.743   53.868  1.00 28.87 ? 288  GLU B CG  1 
ATOM   6396  C CD  . GLU B 1 288 ? 13.657  1.928   54.766  1.00 32.46 ? 288  GLU B CD  1 
ATOM   6397  O OE1 . GLU B 1 288 ? 13.824  1.978   56.003  1.00 34.82 ? 288  GLU B OE1 1 
ATOM   6398  O OE2 . GLU B 1 288 ? 12.761  1.230   54.237  1.00 34.82 ? 288  GLU B OE2 1 
ATOM   6399  N N   . LYS B 1 289 ? 16.206  3.663   50.864  1.00 20.02 ? 289  LYS B N   1 
ATOM   6400  C CA  . LYS B 1 289 ? 15.735  3.337   49.508  1.00 20.22 ? 289  LYS B CA  1 
ATOM   6401  C C   . LYS B 1 289 ? 16.717  2.545   48.636  1.00 19.44 ? 289  LYS B C   1 
ATOM   6402  O O   . LYS B 1 289 ? 17.841  2.985   48.378  1.00 18.53 ? 289  LYS B O   1 
ATOM   6403  C CB  . LYS B 1 289 ? 15.241  4.598   48.770  1.00 22.15 ? 289  LYS B CB  1 
ATOM   6404  C CG  . LYS B 1 289 ? 14.702  4.328   47.357  1.00 25.15 ? 289  LYS B CG  1 
ATOM   6405  C CD  . LYS B 1 289 ? 13.694  5.361   46.891  1.00 28.98 ? 289  LYS B CD  1 
ATOM   6406  C CE  . LYS B 1 289 ? 13.158  4.978   45.519  1.00 30.66 ? 289  LYS B CE  1 
ATOM   6407  N NZ  . LYS B 1 289 ? 11.946  5.759   45.148  1.00 34.06 ? 289  LYS B NZ  1 
ATOM   6408  N N   . GLY B 1 290 ? 16.269  1.354   48.230  1.00 18.44 ? 290  GLY B N   1 
ATOM   6409  C CA  . GLY B 1 290 ? 17.063  0.473   47.390  1.00 17.31 ? 290  GLY B CA  1 
ATOM   6410  C C   . GLY B 1 290 ? 18.025  -0.451  48.115  1.00 16.28 ? 290  GLY B C   1 
ATOM   6411  O O   . GLY B 1 290 ? 18.766  -1.186  47.462  1.00 16.30 ? 290  GLY B O   1 
ATOM   6412  N N   . SER B 1 291 ? 17.992  -0.438  49.452  1.00 14.94 ? 291  SER B N   1 
ATOM   6413  C CA  . SER B 1 291 ? 18.874  -1.272  50.275  1.00 13.54 ? 291  SER B CA  1 
ATOM   6414  C C   . SER B 1 291 ? 18.607  -2.766  50.225  1.00 12.76 ? 291  SER B C   1 
ATOM   6415  O O   . SER B 1 291 ? 19.552  -3.557  50.191  1.00 13.28 ? 291  SER B O   1 
ATOM   6416  C CB  . SER B 1 291 ? 18.865  -0.812  51.736  1.00 12.68 ? 291  SER B CB  1 
ATOM   6417  O OG  . SER B 1 291 ? 17.563  -0.771  52.284  1.00 12.73 ? 291  SER B OG  1 
ATOM   6418  N N   . VAL B 1 292 ? 17.327  -3.139  50.214  1.00 14.40 ? 292  VAL B N   1 
ATOM   6419  C CA  . VAL B 1 292 ? 16.910  -4.546  50.183  1.00 15.66 ? 292  VAL B CA  1 
ATOM   6420  C C   . VAL B 1 292 ? 17.399  -5.267  48.921  1.00 16.36 ? 292  VAL B C   1 
ATOM   6421  O O   . VAL B 1 292 ? 17.838  -6.414  49.000  1.00 16.69 ? 292  VAL B O   1 
ATOM   6422  C CB  . VAL B 1 292 ? 15.363  -4.682  50.373  1.00 16.11 ? 292  VAL B CB  1 
ATOM   6423  C CG1 . VAL B 1 292 ? 14.908  -6.150  50.303  1.00 16.31 ? 292  VAL B CG1 1 
ATOM   6424  C CG2 . VAL B 1 292 ? 14.961  -4.104  51.725  1.00 16.35 ? 292  VAL B CG2 1 
ATOM   6425  N N   . ALA B 1 293 ? 17.428  -4.546  47.797  1.00 15.79 ? 293  ALA B N   1 
ATOM   6426  C CA  . ALA B 1 293 ? 17.877  -5.084  46.504  1.00 16.48 ? 293  ALA B CA  1 
ATOM   6427  C C   . ALA B 1 293 ? 19.379  -5.389  46.448  1.00 16.46 ? 293  ALA B C   1 
ATOM   6428  O O   . ALA B 1 293 ? 19.838  -6.151  45.594  1.00 19.26 ? 293  ALA B O   1 
ATOM   6429  C CB  . ALA B 1 293 ? 17.499  -4.123  45.381  1.00 17.79 ? 293  ALA B CB  1 
ATOM   6430  N N   . LYS B 1 294 ? 20.130  -4.804  47.379  1.00 13.74 ? 294  LYS B N   1 
ATOM   6431  C CA  . LYS B 1 294 ? 21.575  -4.988  47.460  1.00 13.64 ? 294  LYS B CA  1 
ATOM   6432  C C   . LYS B 1 294 ? 21.960  -6.019  48.519  1.00 12.85 ? 294  LYS B C   1 
ATOM   6433  O O   . LYS B 1 294 ? 22.994  -6.679  48.409  1.00 13.52 ? 294  LYS B O   1 
ATOM   6434  C CB  . LYS B 1 294 ? 22.247  -3.651  47.796  1.00 15.17 ? 294  LYS B CB  1 
ATOM   6435  C CG  . LYS B 1 294 ? 21.851  -2.508  46.872  1.00 16.93 ? 294  LYS B CG  1 
ATOM   6436  C CD  . LYS B 1 294 ? 22.431  -1.205  47.362  1.00 18.49 ? 294  LYS B CD  1 
ATOM   6437  C CE  . LYS B 1 294 ? 22.161  -0.060  46.409  1.00 18.99 ? 294  LYS B CE  1 
ATOM   6438  N NZ  . LYS B 1 294 ? 22.730  1.200   46.962  1.00 21.73 ? 294  LYS B NZ  1 
ATOM   6439  N N   . HIS B 1 295 ? 21.102  -6.179  49.525  1.00 12.19 ? 295  HIS B N   1 
ATOM   6440  C CA  . HIS B 1 295 ? 21.379  -7.096  50.627  1.00 10.93 ? 295  HIS B CA  1 
ATOM   6441  C C   . HIS B 1 295 ? 20.606  -8.406  50.664  1.00 11.25 ? 295  HIS B C   1 
ATOM   6442  O O   . HIS B 1 295 ? 20.905  -9.256  51.501  1.00 11.36 ? 295  HIS B O   1 
ATOM   6443  C CB  . HIS B 1 295 ? 21.178  -6.368  51.959  1.00 10.64 ? 295  HIS B CB  1 
ATOM   6444  C CG  . HIS B 1 295 ? 22.194  -5.304  52.229  1.00 10.91 ? 295  HIS B CG  1 
ATOM   6445  N ND1 . HIS B 1 295 ? 23.397  -5.569  52.845  1.00 10.71 ? 295  HIS B ND1 1 
ATOM   6446  C CD2 . HIS B 1 295 ? 22.185  -3.971  51.977  1.00 11.72 ? 295  HIS B CD2 1 
ATOM   6447  C CE1 . HIS B 1 295 ? 24.085  -4.447  52.962  1.00 12.56 ? 295  HIS B CE1 1 
ATOM   6448  N NE2 . HIS B 1 295 ? 23.372  -3.463  52.443  1.00 11.12 ? 295  HIS B NE2 1 
ATOM   6449  N N   . PHE B 1 296 ? 19.579  -8.541  49.825  1.00 11.28 ? 296  PHE B N   1 
ATOM   6450  C CA  . PHE B 1 296 ? 18.747  -9.749  49.809  1.00 11.12 ? 296  PHE B CA  1 
ATOM   6451  C C   . PHE B 1 296 ? 18.563  -10.399 48.456  1.00 11.82 ? 296  PHE B C   1 
ATOM   6452  O O   . PHE B 1 296 ? 18.289  -9.726  47.460  1.00 12.49 ? 296  PHE B O   1 
ATOM   6453  C CB  . PHE B 1 296 ? 17.339  -9.454  50.350  1.00 10.82 ? 296  PHE B CB  1 
ATOM   6454  C CG  . PHE B 1 296 ? 17.260  -9.333  51.836  1.00 11.04 ? 296  PHE B CG  1 
ATOM   6455  C CD1 . PHE B 1 296 ? 17.639  -8.137  52.480  1.00 11.00 ? 296  PHE B CD1 1 
ATOM   6456  C CD2 . PHE B 1 296 ? 16.820  -10.420 52.612  1.00 11.74 ? 296  PHE B CD2 1 
ATOM   6457  C CE1 . PHE B 1 296 ? 17.592  -8.027  53.884  1.00 11.23 ? 296  PHE B CE1 1 
ATOM   6458  C CE2 . PHE B 1 296 ? 16.764  -10.328 54.019  1.00 12.00 ? 296  PHE B CE2 1 
ATOM   6459  C CZ  . PHE B 1 296 ? 17.153  -9.135  54.652  1.00 12.67 ? 296  PHE B CZ  1 
ATOM   6460  N N   . VAL B 1 297 ? 18.729  -11.720 48.437  1.00 10.76 ? 297  VAL B N   1 
ATOM   6461  C CA  . VAL B 1 297 ? 18.504  -12.536 47.242  1.00 10.71 ? 297  VAL B CA  1 
ATOM   6462  C C   . VAL B 1 297 ? 17.639  -13.713 47.686  1.00 10.54 ? 297  VAL B C   1 
ATOM   6463  O O   . VAL B 1 297 ? 17.574  -14.022 48.881  1.00 10.13 ? 297  VAL B O   1 
ATOM   6464  C CB  . VAL B 1 297 ? 19.813  -13.028 46.536  1.00 11.50 ? 297  VAL B CB  1 
ATOM   6465  C CG1 . VAL B 1 297 ? 20.603  -11.849 46.009  1.00 11.52 ? 297  VAL B CG1 1 
ATOM   6466  C CG2 . VAL B 1 297 ? 20.668  -13.884 47.446  1.00 12.77 ? 297  VAL B CG2 1 
ATOM   6467  N N   . ALA B 1 298 ? 16.964  -14.347 46.730  1.00 10.53 ? 298  ALA B N   1 
ATOM   6468  C CA  . ALA B 1 298 ? 16.084  -15.471 47.033  1.00 9.83  ? 298  ALA B CA  1 
ATOM   6469  C C   . ALA B 1 298 ? 16.305  -16.691 46.163  1.00 10.25 ? 298  ALA B C   1 
ATOM   6470  O O   . ALA B 1 298 ? 16.613  -16.575 44.981  1.00 10.86 ? 298  ALA B O   1 
ATOM   6471  C CB  . ALA B 1 298 ? 14.634  -15.037 46.937  1.00 10.74 ? 298  ALA B CB  1 
ATOM   6472  N N   . LEU B 1 299 ? 16.222  -17.867 46.792  1.00 10.32 ? 299  LEU B N   1 
ATOM   6473  C CA  . LEU B 1 299 ? 16.366  -19.159 46.106  1.00 9.70  ? 299  LEU B CA  1 
ATOM   6474  C C   . LEU B 1 299 ? 14.999  -19.801 46.314  1.00 11.05 ? 299  LEU B C   1 
ATOM   6475  O O   . LEU B 1 299 ? 14.667  -20.219 47.430  1.00 11.17 ? 299  LEU B O   1 
ATOM   6476  C CB  . LEU B 1 299 ? 17.473  -20.008 46.743  1.00 10.11 ? 299  LEU B CB  1 
ATOM   6477  C CG  . LEU B 1 299 ? 18.715  -19.285 47.272  1.00 11.00 ? 299  LEU B CG  1 
ATOM   6478  C CD1 . LEU B 1 299 ? 19.688  -20.256 47.875  1.00 11.19 ? 299  LEU B CD1 1 
ATOM   6479  C CD2 . LEU B 1 299 ? 19.392  -18.466 46.194  1.00 10.52 ? 299  LEU B CD2 1 
ATOM   6480  N N   . SER B 1 300 ? 14.199  -19.854 45.245  1.00 11.33 ? 300  SER B N   1 
ATOM   6481  C CA  . SER B 1 300 ? 12.827  -20.360 45.345  1.00 12.50 ? 300  SER B CA  1 
ATOM   6482  C C   . SER B 1 300 ? 12.210  -20.840 44.035  1.00 13.76 ? 300  SER B C   1 
ATOM   6483  O O   . SER B 1 300 ? 12.848  -20.793 42.979  1.00 12.73 ? 300  SER B O   1 
ATOM   6484  C CB  . SER B 1 300 ? 11.944  -19.251 45.925  1.00 11.61 ? 300  SER B CB  1 
ATOM   6485  O OG  . SER B 1 300 ? 10.703  -19.740 46.389  1.00 12.14 ? 300  SER B OG  1 
ATOM   6486  N N   . THR B 1 301 ? 10.979  -21.351 44.139  1.00 16.09 ? 301  THR B N   1 
ATOM   6487  C CA  . THR B 1 301 ? 10.186  -21.793 42.987  1.00 17.02 ? 301  THR B CA  1 
ATOM   6488  C C   . THR B 1 301 ? 8.979   -20.853 42.887  1.00 18.63 ? 301  THR B C   1 
ATOM   6489  O O   . THR B 1 301 ? 8.318   -20.784 41.853  1.00 18.90 ? 301  THR B O   1 
ATOM   6490  C CB  . THR B 1 301 ? 9.625   -23.251 43.130  1.00 17.40 ? 301  THR B CB  1 
ATOM   6491  O OG1 . THR B 1 301 ? 8.630   -23.308 44.160  1.00 18.25 ? 301  THR B OG1 1 
ATOM   6492  C CG2 . THR B 1 301 ? 10.722  -24.240 43.449  1.00 18.05 ? 301  THR B CG2 1 
ATOM   6493  N N   . ASN B 1 302 ? 8.707   -20.142 43.984  1.00 19.32 ? 302  ASN B N   1 
ATOM   6494  C CA  . ASN B 1 302 ? 7.570   -19.232 44.091  1.00 20.16 ? 302  ASN B CA  1 
ATOM   6495  C C   . ASN B 1 302 ? 7.919   -17.783 43.749  1.00 20.05 ? 302  ASN B C   1 
ATOM   6496  O O   . ASN B 1 302 ? 8.229   -16.975 44.630  1.00 20.25 ? 302  ASN B O   1 
ATOM   6497  C CB  . ASN B 1 302 ? 6.972   -19.335 45.502  1.00 21.62 ? 302  ASN B CB  1 
ATOM   6498  C CG  . ASN B 1 302 ? 5.509   -18.917 45.564  1.00 23.93 ? 302  ASN B CG  1 
ATOM   6499  O OD1 . ASN B 1 302 ? 5.067   -18.014 44.848  1.00 24.36 ? 302  ASN B OD1 1 
ATOM   6500  N ND2 . ASN B 1 302 ? 4.761   -19.542 46.468  1.00 26.12 ? 302  ASN B ND2 1 
ATOM   6501  N N   . ASN B 1 303 ? 7.764   -17.448 42.467  1.00 20.60 ? 303  ASN B N   1 
ATOM   6502  C CA  . ASN B 1 303 ? 8.053   -16.110 41.938  1.00 21.00 ? 303  ASN B CA  1 
ATOM   6503  C C   . ASN B 1 303 ? 7.198   -15.001 42.545  1.00 21.14 ? 303  ASN B C   1 
ATOM   6504  O O   . ASN B 1 303 ? 7.705   -13.912 42.823  1.00 21.14 ? 303  ASN B O   1 
ATOM   6505  C CB  . ASN B 1 303 ? 7.906   -16.107 40.411  1.00 21.35 ? 303  ASN B CB  1 
ATOM   6506  C CG  . ASN B 1 303 ? 8.794   -17.132 39.737  1.00 21.52 ? 303  ASN B CG  1 
ATOM   6507  O OD1 . ASN B 1 303 ? 8.538   -18.335 39.807  1.00 22.81 ? 303  ASN B OD1 1 
ATOM   6508  N ND2 . ASN B 1 303 ? 9.859   -16.664 39.098  1.00 22.44 ? 303  ASN B ND2 1 
ATOM   6509  N N   . GLN B 1 304 ? 5.932   -15.321 42.813  1.00 23.26 ? 304  GLN B N   1 
ATOM   6510  C CA  . GLN B 1 304 ? 4.964   -14.386 43.390  1.00 25.18 ? 304  GLN B CA  1 
ATOM   6511  C C   . GLN B 1 304 ? 5.284   -13.974 44.830  1.00 24.68 ? 304  GLN B C   1 
ATOM   6512  O O   . GLN B 1 304 ? 5.279   -12.780 45.142  1.00 24.34 ? 304  GLN B O   1 
ATOM   6513  C CB  . GLN B 1 304 ? 3.543   -14.972 43.287  1.00 27.20 ? 304  GLN B CB  1 
ATOM   6514  C CG  . GLN B 1 304 ? 2.380   -13.987 43.502  1.00 30.97 ? 304  GLN B CG  1 
ATOM   6515  C CD  . GLN B 1 304 ? 2.514   -12.698 42.704  1.00 33.63 ? 304  GLN B CD  1 
ATOM   6516  O OE1 . GLN B 1 304 ? 2.705   -12.717 41.486  1.00 36.00 ? 304  GLN B OE1 1 
ATOM   6517  N NE2 . GLN B 1 304 ? 2.418   -11.567 43.397  1.00 35.14 ? 304  GLN B NE2 1 
ATOM   6518  N N   . LYS B 1 305 ? 5.612   -14.949 45.681  1.00 24.48 ? 305  LYS B N   1 
ATOM   6519  C CA  . LYS B 1 305 ? 5.940   -14.677 47.087  1.00 24.98 ? 305  LYS B CA  1 
ATOM   6520  C C   . LYS B 1 305 ? 7.281   -13.974 47.279  1.00 24.10 ? 305  LYS B C   1 
ATOM   6521  O O   . LYS B 1 305 ? 7.473   -13.255 48.264  1.00 24.88 ? 305  LYS B O   1 
ATOM   6522  C CB  . LYS B 1 305 ? 5.858   -15.950 47.936  1.00 25.88 ? 305  LYS B CB  1 
ATOM   6523  C CG  . LYS B 1 305 ? 4.441   -16.516 48.107  1.00 28.24 ? 305  LYS B CG  1 
ATOM   6524  C CD  . LYS B 1 305 ? 3.510   -15.580 48.868  1.00 30.34 ? 305  LYS B CD  1 
ATOM   6525  C CE  . LYS B 1 305 ? 2.133   -16.195 49.034  1.00 31.36 ? 305  LYS B CE  1 
ATOM   6526  N NZ  . LYS B 1 305 ? 1.196   -15.285 49.751  1.00 32.96 ? 305  LYS B NZ  1 
ATOM   6527  N N   . VAL B 1 306 ? 8.190   -14.155 46.317  1.00 22.31 ? 306  VAL B N   1 
ATOM   6528  C CA  . VAL B 1 306 ? 9.505   -13.510 46.327  1.00 21.93 ? 306  VAL B CA  1 
ATOM   6529  C C   . VAL B 1 306 ? 9.311   -12.018 46.024  1.00 23.08 ? 306  VAL B C   1 
ATOM   6530  O O   . VAL B 1 306 ? 9.926   -11.161 46.667  1.00 22.68 ? 306  VAL B O   1 
ATOM   6531  C CB  . VAL B 1 306 ? 10.469  -14.182 45.302  1.00 19.54 ? 306  VAL B CB  1 
ATOM   6532  C CG1 . VAL B 1 306 ? 11.667  -13.300 44.988  1.00 19.90 ? 306  VAL B CG1 1 
ATOM   6533  C CG2 . VAL B 1 306 ? 10.972  -15.493 45.864  1.00 19.69 ? 306  VAL B CG2 1 
ATOM   6534  N N   . LYS B 1 307 ? 8.408   -11.733 45.081  1.00 24.88 ? 307  LYS B N   1 
ATOM   6535  C CA  . LYS B 1 307 ? 8.079   -10.368 44.666  1.00 27.52 ? 307  LYS B CA  1 
ATOM   6536  C C   . LYS B 1 307 ? 7.346   -9.631  45.796  1.00 27.39 ? 307  LYS B C   1 
ATOM   6537  O O   . LYS B 1 307 ? 7.640   -8.461  46.066  1.00 29.09 ? 307  LYS B O   1 
ATOM   6538  C CB  . LYS B 1 307 ? 7.213   -10.408 43.398  1.00 29.51 ? 307  LYS B CB  1 
ATOM   6539  C CG  . LYS B 1 307 ? 6.909   -9.036  42.775  1.00 33.34 ? 307  LYS B CG  1 
ATOM   6540  C CD  . LYS B 1 307 ? 5.694   -9.082  41.849  1.00 35.77 ? 307  LYS B CD  1 
ATOM   6541  C CE  . LYS B 1 307 ? 4.390   -9.249  42.624  1.00 38.33 ? 307  LYS B CE  1 
ATOM   6542  N NZ  . LYS B 1 307 ? 3.206   -9.364  41.724  1.00 40.05 ? 307  LYS B NZ  1 
ATOM   6543  N N   . GLU B 1 308 ? 6.454   -10.348 46.488  1.00 28.05 ? 308  GLU B N   1 
ATOM   6544  C CA  . GLU B 1 308 ? 5.667   -9.810  47.610  1.00 28.97 ? 308  GLU B CA  1 
ATOM   6545  C C   . GLU B 1 308 ? 6.523   -9.473  48.837  1.00 29.02 ? 308  GLU B C   1 
ATOM   6546  O O   . GLU B 1 308 ? 6.116   -8.671  49.685  1.00 28.54 ? 308  GLU B O   1 
ATOM   6547  C CB  . GLU B 1 308 ? 4.558   -10.792 48.010  1.00 30.92 ? 308  GLU B CB  1 
ATOM   6548  C CG  . GLU B 1 308 ? 3.342   -10.813 47.079  1.00 33.43 ? 308  GLU B CG  1 
ATOM   6549  C CD  . GLU B 1 308 ? 2.336   -11.911 47.419  1.00 35.15 ? 308  GLU B CD  1 
ATOM   6550  O OE1 . GLU B 1 308 ? 2.370   -12.456 48.544  1.00 36.85 ? 308  GLU B OE1 1 
ATOM   6551  O OE2 . GLU B 1 308 ? 1.491   -12.232 46.555  1.00 36.26 ? 308  GLU B OE2 1 
ATOM   6552  N N   . PHE B 1 309 ? 7.712   -10.078 48.909  1.00 28.42 ? 309  PHE B N   1 
ATOM   6553  C CA  . PHE B 1 309 ? 8.662   -9.848  50.001  1.00 28.26 ? 309  PHE B CA  1 
ATOM   6554  C C   . PHE B 1 309 ? 9.480   -8.576  49.726  1.00 28.71 ? 309  PHE B C   1 
ATOM   6555  O O   . PHE B 1 309 ? 9.965   -7.932  50.662  1.00 29.33 ? 309  PHE B O   1 
ATOM   6556  C CB  . PHE B 1 309 ? 9.586   -11.074 50.168  1.00 27.59 ? 309  PHE B CB  1 
ATOM   6557  C CG  . PHE B 1 309 ? 10.521  -10.993 51.358  1.00 25.82 ? 309  PHE B CG  1 
ATOM   6558  C CD1 . PHE B 1 309 ? 10.122  -11.466 52.621  1.00 26.17 ? 309  PHE B CD1 1 
ATOM   6559  C CD2 . PHE B 1 309 ? 11.803  -10.420 51.222  1.00 25.93 ? 309  PHE B CD2 1 
ATOM   6560  C CE1 . PHE B 1 309 ? 10.991  -11.365 53.741  1.00 24.97 ? 309  PHE B CE1 1 
ATOM   6561  C CE2 . PHE B 1 309 ? 12.683  -10.306 52.327  1.00 25.87 ? 309  PHE B CE2 1 
ATOM   6562  C CZ  . PHE B 1 309 ? 12.275  -10.779 53.589  1.00 24.39 ? 309  PHE B CZ  1 
ATOM   6563  N N   . GLY B 1 310 ? 9.655   -8.243  48.448  1.00 28.97 ? 310  GLY B N   1 
ATOM   6564  C CA  . GLY B 1 310 ? 10.407  -7.058  48.077  1.00 29.08 ? 310  GLY B CA  1 
ATOM   6565  C C   . GLY B 1 310 ? 11.724  -7.322  47.378  1.00 29.25 ? 310  GLY B C   1 
ATOM   6566  O O   . GLY B 1 310 ? 12.509  -6.397  47.161  1.00 30.23 ? 310  GLY B O   1 
ATOM   6567  N N   . ILE B 1 311 ? 11.976  -8.584  47.028  1.00 28.59 ? 311  ILE B N   1 
ATOM   6568  C CA  . ILE B 1 311 ? 13.203  -8.963  46.332  1.00 27.93 ? 311  ILE B CA  1 
ATOM   6569  C C   . ILE B 1 311 ? 12.985  -8.852  44.824  1.00 29.07 ? 311  ILE B C   1 
ATOM   6570  O O   . ILE B 1 311 ? 11.958  -9.302  44.303  1.00 28.75 ? 311  ILE B O   1 
ATOM   6571  C CB  . ILE B 1 311 ? 13.679  -10.404 46.739  1.00 26.01 ? 311  ILE B CB  1 
ATOM   6572  C CG1 . ILE B 1 311 ? 14.155  -10.386 48.197  1.00 25.52 ? 311  ILE B CG1 1 
ATOM   6573  C CG2 . ILE B 1 311 ? 14.820  -10.917 45.823  1.00 25.41 ? 311  ILE B CG2 1 
ATOM   6574  C CD1 . ILE B 1 311 ? 14.439  -11.754 48.798  1.00 23.45 ? 311  ILE B CD1 1 
ATOM   6575  N N   . ASP B 1 312 ? 13.965  -8.252  44.148  1.00 29.87 ? 312  ASP B N   1 
ATOM   6576  C CA  . ASP B 1 312 ? 13.957  -8.054  42.696  1.00 31.47 ? 312  ASP B CA  1 
ATOM   6577  C C   . ASP B 1 312 ? 13.959  -9.386  41.943  1.00 31.45 ? 312  ASP B C   1 
ATOM   6578  O O   . ASP B 1 312 ? 14.532  -10.373 42.418  1.00 30.65 ? 312  ASP B O   1 
ATOM   6579  C CB  . ASP B 1 312 ? 15.184  -7.235  42.272  1.00 32.51 ? 312  ASP B CB  1 
ATOM   6580  C CG  . ASP B 1 312 ? 15.150  -5.784  42.751  1.00 34.30 ? 312  ASP B CG  1 
ATOM   6581  O OD1 . ASP B 1 312 ? 14.201  -5.374  43.457  1.00 35.13 ? 312  ASP B OD1 1 
ATOM   6582  O OD2 . ASP B 1 312 ? 16.100  -5.041  42.416  1.00 34.72 ? 312  ASP B OD2 1 
ATOM   6583  N N   . GLU B 1 313 ? 13.313  -9.399  40.776  1.00 31.86 ? 313  GLU B N   1 
ATOM   6584  C CA  . GLU B 1 313 ? 13.208  -10.582 39.910  1.00 31.66 ? 313  GLU B CA  1 
ATOM   6585  C C   . GLU B 1 313 ? 14.588  -11.065 39.435  1.00 30.48 ? 313  GLU B C   1 
ATOM   6586  O O   . GLU B 1 313 ? 14.845  -12.268 39.362  1.00 29.65 ? 313  GLU B O   1 
ATOM   6587  C CB  . GLU B 1 313 ? 12.297  -10.253 38.713  1.00 34.41 ? 313  GLU B CB  1 
ATOM   6588  C CG  . GLU B 1 313 ? 11.974  -11.418 37.775  1.00 37.92 ? 313  GLU B CG  1 
ATOM   6589  C CD  . GLU B 1 313 ? 10.883  -11.102 36.765  1.00 40.93 ? 313  GLU B CD  1 
ATOM   6590  O OE1 . GLU B 1 313 ? 10.859  -9.972  36.225  1.00 41.82 ? 313  GLU B OE1 1 
ATOM   6591  O OE2 . GLU B 1 313 ? 10.043  -11.996 36.506  1.00 42.61 ? 313  GLU B OE2 1 
ATOM   6592  N N   . GLU B 1 314 ? 15.491  -10.111 39.220  1.00 29.25 ? 314  GLU B N   1 
ATOM   6593  C CA  . GLU B 1 314 ? 16.865  -10.354 38.768  1.00 28.84 ? 314  GLU B CA  1 
ATOM   6594  C C   . GLU B 1 314 ? 17.692  -11.033 39.866  1.00 26.92 ? 314  GLU B C   1 
ATOM   6595  O O   . GLU B 1 314 ? 18.687  -11.712 39.585  1.00 27.71 ? 314  GLU B O   1 
ATOM   6596  C CB  . GLU B 1 314 ? 17.540  -9.028  38.370  1.00 31.67 ? 314  GLU B CB  1 
ATOM   6597  C CG  . GLU B 1 314 ? 16.655  -8.018  37.614  1.00 34.67 ? 314  GLU B CG  1 
ATOM   6598  C CD  . GLU B 1 314 ? 15.498  -7.477  38.451  1.00 36.75 ? 314  GLU B CD  1 
ATOM   6599  O OE1 . GLU B 1 314 ? 15.755  -6.830  39.482  1.00 38.69 ? 314  GLU B OE1 1 
ATOM   6600  O OE2 . GLU B 1 314 ? 14.330  -7.727  38.083  1.00 38.42 ? 314  GLU B OE2 1 
ATOM   6601  N N   . ASN B 1 315 ? 17.241  -10.865 41.110  1.00 24.59 ? 315  ASN B N   1 
ATOM   6602  C CA  . ASN B 1 315 ? 17.900  -11.429 42.285  1.00 22.65 ? 315  ASN B CA  1 
ATOM   6603  C C   . ASN B 1 315 ? 17.221  -12.696 42.816  1.00 19.40 ? 315  ASN B C   1 
ATOM   6604  O O   . ASN B 1 315 ? 17.413  -13.080 43.974  1.00 17.19 ? 315  ASN B O   1 
ATOM   6605  C CB  . ASN B 1 315 ? 18.028  -10.360 43.378  1.00 25.92 ? 315  ASN B CB  1 
ATOM   6606  C CG  . ASN B 1 315 ? 18.769  -9.116  42.897  1.00 27.78 ? 315  ASN B CG  1 
ATOM   6607  O OD1 . ASN B 1 315 ? 19.832  -9.214  42.279  1.00 30.31 ? 315  ASN B OD1 1 
ATOM   6608  N ND2 . ASN B 1 315 ? 18.205  -7.947  43.173  1.00 31.31 ? 315  ASN B ND2 1 
ATOM   6609  N N   . MET B 1 316 ? 16.407  -13.325 41.969  1.00 17.32 ? 316  MET B N   1 
ATOM   6610  C CA  . MET B 1 316 ? 15.741  -14.570 42.328  1.00 15.65 ? 316  MET B CA  1 
ATOM   6611  C C   . MET B 1 316 ? 16.365  -15.697 41.507  1.00 15.17 ? 316  MET B C   1 
ATOM   6612  O O   . MET B 1 316 ? 16.442  -15.621 40.276  1.00 16.00 ? 316  MET B O   1 
ATOM   6613  C CB  . MET B 1 316 ? 14.234  -14.522 42.066  1.00 15.74 ? 316  MET B CB  1 
ATOM   6614  C CG  . MET B 1 316 ? 13.484  -15.693 42.723  1.00 17.51 ? 316  MET B CG  1 
ATOM   6615  S SD  . MET B 1 316 ? 11.861  -15.960 41.992  1.00 20.13 ? 316  MET B SD  1 
ATOM   6616  C CE  . MET B 1 316 ? 11.498  -17.702 42.249  1.00 17.15 ? 316  MET B CE  1 
ATOM   6617  N N   . PHE B 1 317 ? 16.837  -16.722 42.218  1.00 12.87 ? 317  PHE B N   1 
ATOM   6618  C CA  . PHE B 1 317 ? 17.459  -17.900 41.622  1.00 11.27 ? 317  PHE B CA  1 
ATOM   6619  C C   . PHE B 1 317 ? 16.439  -19.027 41.688  1.00 11.69 ? 317  PHE B C   1 
ATOM   6620  O O   . PHE B 1 317 ? 16.126  -19.561 42.757  1.00 12.52 ? 317  PHE B O   1 
ATOM   6621  C CB  . PHE B 1 317 ? 18.750  -18.251 42.363  1.00 10.61 ? 317  PHE B CB  1 
ATOM   6622  C CG  . PHE B 1 317 ? 19.771  -17.147 42.351  1.00 11.44 ? 317  PHE B CG  1 
ATOM   6623  C CD1 . PHE B 1 317 ? 19.573  -15.979 43.117  1.00 11.91 ? 317  PHE B CD1 1 
ATOM   6624  C CD2 . PHE B 1 317 ? 20.926  -17.254 41.566  1.00 11.82 ? 317  PHE B CD2 1 
ATOM   6625  C CE1 . PHE B 1 317 ? 20.506  -14.936 43.095  1.00 11.73 ? 317  PHE B CE1 1 
ATOM   6626  C CE2 . PHE B 1 317 ? 21.875  -16.212 41.537  1.00 11.95 ? 317  PHE B CE2 1 
ATOM   6627  C CZ  . PHE B 1 317 ? 21.658  -15.055 42.304  1.00 11.27 ? 317  PHE B CZ  1 
ATOM   6628  N N   . GLN B 1 318 ? 15.930  -19.349 40.504  1.00 12.27 ? 318  GLN B N   1 
ATOM   6629  C CA  . GLN B 1 318 ? 14.886  -20.335 40.285  1.00 12.50 ? 318  GLN B CA  1 
ATOM   6630  C C   . GLN B 1 318 ? 15.335  -21.801 40.301  1.00 11.19 ? 318  GLN B C   1 
ATOM   6631  O O   . GLN B 1 318 ? 16.435  -22.139 39.856  1.00 13.06 ? 318  GLN B O   1 
ATOM   6632  C CB  . GLN B 1 318 ? 14.259  -20.086 38.910  1.00 14.10 ? 318  GLN B CB  1 
ATOM   6633  C CG  . GLN B 1 318 ? 12.854  -20.662 38.772  1.00 18.55 ? 318  GLN B CG  1 
ATOM   6634  C CD  . GLN B 1 318 ? 11.766  -19.608 38.953  1.00 21.35 ? 318  GLN B CD  1 
ATOM   6635  O OE1 . GLN B 1 318 ? 12.014  -18.425 38.723  1.00 24.02 ? 318  GLN B OE1 1 
ATOM   6636  N NE2 . GLN B 1 318 ? 10.566  -19.970 39.360  1.00 24.23 ? 318  GLN B NE2 1 
ATOM   6637  N N   . PHE B 1 319 ? 14.416  -22.608 40.832  1.00 11.99 ? 319  PHE B N   1 
ATOM   6638  C CA  . PHE B 1 319 ? 14.502  -24.084 40.825  1.00 11.43 ? 319  PHE B CA  1 
ATOM   6639  C C   . PHE B 1 319 ? 13.056  -24.594 40.701  1.00 13.17 ? 319  PHE B C   1 
ATOM   6640  O O   . PHE B 1 319 ? 12.093  -23.815 40.783  1.00 14.47 ? 319  PHE B O   1 
ATOM   6641  C CB  . PHE B 1 319 ? 15.382  -24.624 41.978  1.00 12.08 ? 319  PHE B CB  1 
ATOM   6642  C CG  . PHE B 1 319 ? 14.819  -24.605 43.406  1.00 11.96 ? 319  PHE B CG  1 
ATOM   6643  C CD1 . PHE B 1 319 ? 14.876  -23.431 44.165  1.00 12.25 ? 319  PHE B CD1 1 
ATOM   6644  C CD2 . PHE B 1 319 ? 14.293  -25.778 43.969  1.00 12.15 ? 319  PHE B CD2 1 
ATOM   6645  C CE1 . PHE B 1 319 ? 14.419  -23.430 45.489  1.00 13.27 ? 319  PHE B CE1 1 
ATOM   6646  C CE2 . PHE B 1 319 ? 13.842  -25.778 45.295  1.00 13.29 ? 319  PHE B CE2 1 
ATOM   6647  C CZ  . PHE B 1 319 ? 13.907  -24.605 46.055  1.00 14.12 ? 319  PHE B CZ  1 
ATOM   6648  N N   . TRP B 1 320 ? 12.901  -25.891 40.492  1.00 12.26 ? 320  TRP B N   1 
ATOM   6649  C CA  . TRP B 1 320 ? 11.580  -26.435 40.128  1.00 12.63 ? 320  TRP B CA  1 
ATOM   6650  C C   . TRP B 1 320 ? 11.005  -27.442 41.099  1.00 12.03 ? 320  TRP B C   1 
ATOM   6651  O O   . TRP B 1 320 ? 11.705  -27.931 41.988  1.00 12.13 ? 320  TRP B O   1 
ATOM   6652  C CB  . TRP B 1 320 ? 11.716  -27.005 38.719  1.00 12.55 ? 320  TRP B CB  1 
ATOM   6653  C CG  . TRP B 1 320 ? 12.400  -25.981 37.795  1.00 13.67 ? 320  TRP B CG  1 
ATOM   6654  C CD1 . TRP B 1 320 ? 11.801  -25.120 36.961  1.00 14.74 ? 320  TRP B CD1 1 
ATOM   6655  C CD2 . TRP B 1 320 ? 13.807  -25.773 37.691  1.00 14.21 ? 320  TRP B CD2 1 
ATOM   6656  N NE1 . TRP B 1 320 ? 12.831  -24.343 36.338  1.00 14.54 ? 320  TRP B NE1 1 
ATOM   6657  C CE2 . TRP B 1 320 ? 13.998  -24.735 36.786  1.00 15.33 ? 320  TRP B CE2 1 
ATOM   6658  C CE3 . TRP B 1 320 ? 14.926  -26.366 38.290  1.00 13.41 ? 320  TRP B CE3 1 
ATOM   6659  C CZ2 . TRP B 1 320 ? 15.262  -24.229 36.452  1.00 15.08 ? 320  TRP B CZ2 1 
ATOM   6660  C CZ3 . TRP B 1 320 ? 16.196  -25.858 37.938  1.00 14.70 ? 320  TRP B CZ3 1 
ATOM   6661  C CH2 . TRP B 1 320 ? 16.354  -24.838 37.064  1.00 15.10 ? 320  TRP B CH2 1 
ATOM   6662  N N   . ASP B 1 321 ? 9.715   -27.730 40.910  1.00 14.48 ? 321  ASP B N   1 
ATOM   6663  C CA  . ASP B 1 321 ? 8.951   -28.648 41.755  1.00 13.64 ? 321  ASP B CA  1 
ATOM   6664  C C   . ASP B 1 321 ? 9.496   -30.078 41.769  1.00 13.32 ? 321  ASP B C   1 
ATOM   6665  O O   . ASP B 1 321 ? 9.267   -30.821 42.721  1.00 13.35 ? 321  ASP B O   1 
ATOM   6666  C CB  . ASP B 1 321 ? 7.441   -28.629 41.386  1.00 16.88 ? 321  ASP B CB  1 
ATOM   6667  C CG  . ASP B 1 321 ? 7.124   -29.256 39.998  1.00 20.29 ? 321  ASP B CG  1 
ATOM   6668  O OD1 . ASP B 1 321 ? 8.055   -29.646 39.254  1.00 22.96 ? 321  ASP B OD1 1 
ATOM   6669  O OD2 . ASP B 1 321 ? 5.917   -29.347 39.647  1.00 24.93 ? 321  ASP B OD2 1 
ATOM   6670  N N   . TRP B 1 322 ? 10.222  -30.453 40.715  1.00 11.82 ? 322  TRP B N   1 
ATOM   6671  C CA  . TRP B 1 322 ? 10.796  -31.801 40.641  1.00 11.71 ? 322  TRP B CA  1 
ATOM   6672  C C   . TRP B 1 322 ? 12.099  -31.940 41.425  1.00 11.54 ? 322  TRP B C   1 
ATOM   6673  O O   . TRP B 1 322 ? 12.770  -32.975 41.362  1.00 11.50 ? 322  TRP B O   1 
ATOM   6674  C CB  . TRP B 1 322 ? 10.968  -32.303 39.193  1.00 11.02 ? 322  TRP B CB  1 
ATOM   6675  C CG  . TRP B 1 322 ? 11.350  -31.277 38.150  1.00 10.49 ? 322  TRP B CG  1 
ATOM   6676  C CD1 . TRP B 1 322 ? 10.518  -30.669 37.250  1.00 12.02 ? 322  TRP B CD1 1 
ATOM   6677  C CD2 . TRP B 1 322 ? 12.666  -30.808 37.852  1.00 11.72 ? 322  TRP B CD2 1 
ATOM   6678  N NE1 . TRP B 1 322 ? 11.238  -29.859 36.405  1.00 12.54 ? 322  TRP B NE1 1 
ATOM   6679  C CE2 . TRP B 1 322 ? 12.555  -29.929 36.747  1.00 11.91 ? 322  TRP B CE2 1 
ATOM   6680  C CE3 . TRP B 1 322 ? 13.929  -31.045 38.406  1.00 11.67 ? 322  TRP B CE3 1 
ATOM   6681  C CZ2 . TRP B 1 322 ? 13.675  -29.293 36.187  1.00 12.23 ? 322  TRP B CZ2 1 
ATOM   6682  C CZ3 . TRP B 1 322 ? 15.045  -30.411 37.844  1.00 12.36 ? 322  TRP B CZ3 1 
ATOM   6683  C CH2 . TRP B 1 322 ? 14.904  -29.546 36.744  1.00 10.60 ? 322  TRP B CH2 1 
ATOM   6684  N N   . VAL B 1 323 ? 12.478  -30.862 42.109  1.00 10.91 ? 323  VAL B N   1 
ATOM   6685  C CA  . VAL B 1 323 ? 13.677  -30.842 42.942  1.00 10.32 ? 323  VAL B CA  1 
ATOM   6686  C C   . VAL B 1 323 ? 13.165  -30.929 44.383  1.00 9.98  ? 323  VAL B C   1 
ATOM   6687  O O   . VAL B 1 323 ? 12.611  -29.961 44.904  1.00 10.48 ? 323  VAL B O   1 
ATOM   6688  C CB  . VAL B 1 323 ? 14.497  -29.514 42.789  1.00 9.98  ? 323  VAL B CB  1 
ATOM   6689  C CG1 . VAL B 1 323 ? 15.735  -29.554 43.633  1.00 12.42 ? 323  VAL B CG1 1 
ATOM   6690  C CG2 . VAL B 1 323 ? 14.883  -29.254 41.358  1.00 10.53 ? 323  VAL B CG2 1 
ATOM   6691  N N   . GLY B 1 324 ? 13.339  -32.090 45.019  1.00 9.87  ? 324  GLY B N   1 
ATOM   6692  C CA  . GLY B 1 324 ? 12.913  -32.246 46.404  1.00 9.86  ? 324  GLY B CA  1 
ATOM   6693  C C   . GLY B 1 324 ? 13.866  -31.473 47.300  1.00 9.63  ? 324  GLY B C   1 
ATOM   6694  O O   . GLY B 1 324 ? 15.040  -31.345 46.956  1.00 10.00 ? 324  GLY B O   1 
ATOM   6695  N N   . GLY B 1 325 ? 13.374  -30.930 48.415  1.00 10.66 ? 325  GLY B N   1 
ATOM   6696  C CA  . GLY B 1 325 ? 14.224  -30.164 49.319  1.00 9.93  ? 325  GLY B CA  1 
ATOM   6697  C C   . GLY B 1 325 ? 15.464  -30.900 49.815  1.00 9.29  ? 325  GLY B C   1 
ATOM   6698  O O   . GLY B 1 325 ? 16.565  -30.356 49.792  1.00 9.97  ? 325  GLY B O   1 
ATOM   6699  N N   . ARG B 1 326 ? 15.298  -32.165 50.196  1.00 9.62  ? 326  ARG B N   1 
ATOM   6700  C CA  . ARG B 1 326 ? 16.416  -32.984 50.677  1.00 9.33  ? 326  ARG B CA  1 
ATOM   6701  C C   . ARG B 1 326 ? 17.314  -33.495 49.540  1.00 9.49  ? 326  ARG B C   1 
ATOM   6702  O O   . ARG B 1 326 ? 18.226  -34.288 49.761  1.00 10.35 ? 326  ARG B O   1 
ATOM   6703  C CB  . ARG B 1 326 ? 15.897  -34.141 51.535  1.00 9.61  ? 326  ARG B CB  1 
ATOM   6704  C CG  . ARG B 1 326 ? 14.822  -34.979 50.866  1.00 9.71  ? 326  ARG B CG  1 
ATOM   6705  C CD  . ARG B 1 326 ? 14.235  -36.020 51.804  1.00 9.61  ? 326  ARG B CD  1 
ATOM   6706  N NE  . ARG B 1 326 ? 13.175  -36.814 51.169  1.00 9.17  ? 326  ARG B NE  1 
ATOM   6707  C CZ  . ARG B 1 326 ? 11.891  -36.448 51.097  1.00 9.58  ? 326  ARG B CZ  1 
ATOM   6708  N NH1 . ARG B 1 326 ? 11.495  -35.303 51.622  1.00 9.16  ? 326  ARG B NH1 1 
ATOM   6709  N NH2 . ARG B 1 326 ? 10.988  -37.225 50.508  1.00 8.89  ? 326  ARG B NH2 1 
ATOM   6710  N N   . TYR B 1 327 ? 17.034  -33.015 48.327  1.00 9.15  ? 327  TYR B N   1 
ATOM   6711  C CA  . TYR B 1 327 ? 17.788  -33.351 47.111  1.00 9.47  ? 327  TYR B CA  1 
ATOM   6712  C C   . TYR B 1 327 ? 18.072  -32.054 46.333  1.00 9.67  ? 327  TYR B C   1 
ATOM   6713  O O   . TYR B 1 327 ? 18.308  -32.093 45.124  1.00 9.26  ? 327  TYR B O   1 
ATOM   6714  C CB  . TYR B 1 327 ? 16.942  -34.241 46.188  1.00 8.75  ? 327  TYR B CB  1 
ATOM   6715  C CG  . TYR B 1 327 ? 16.571  -35.602 46.715  1.00 9.15  ? 327  TYR B CG  1 
ATOM   6716  C CD1 . TYR B 1 327 ? 17.470  -36.679 46.635  1.00 10.84 ? 327  TYR B CD1 1 
ATOM   6717  C CD2 . TYR B 1 327 ? 15.309  -35.826 47.295  1.00 9.35  ? 327  TYR B CD2 1 
ATOM   6718  C CE1 . TYR B 1 327 ? 17.121  -37.958 47.118  1.00 10.94 ? 327  TYR B CE1 1 
ATOM   6719  C CE2 . TYR B 1 327 ? 14.952  -37.099 47.794  1.00 9.29  ? 327  TYR B CE2 1 
ATOM   6720  C CZ  . TYR B 1 327 ? 15.865  -38.154 47.700  1.00 10.29 ? 327  TYR B CZ  1 
ATOM   6721  O OH  . TYR B 1 327 ? 15.531  -39.390 48.195  1.00 10.38 ? 327  TYR B OH  1 
ATOM   6722  N N   . SER B 1 328 ? 18.084  -30.921 47.035  1.00 9.19  ? 328  SER B N   1 
ATOM   6723  C CA  . SER B 1 328 ? 18.236  -29.601 46.404  1.00 8.45  ? 328  SER B CA  1 
ATOM   6724  C C   . SER B 1 328 ? 19.584  -28.889 46.463  1.00 8.36  ? 328  SER B C   1 
ATOM   6725  O O   . SER B 1 328 ? 19.718  -27.795 45.918  1.00 9.64  ? 328  SER B O   1 
ATOM   6726  C CB  . SER B 1 328 ? 17.189  -28.650 46.998  1.00 9.22  ? 328  SER B CB  1 
ATOM   6727  O OG  . SER B 1 328 ? 17.516  -28.359 48.352  1.00 10.99 ? 328  SER B OG  1 
ATOM   6728  N N   . MET B 1 329 ? 20.586  -29.470 47.113  1.00 8.39  ? 329  MET B N   1 
ATOM   6729  C CA  . MET B 1 329 ? 21.888  -28.788 47.231  1.00 10.15 ? 329  MET B CA  1 
ATOM   6730  C C   . MET B 1 329 ? 22.584  -28.542 45.889  1.00 10.44 ? 329  MET B C   1 
ATOM   6731  O O   . MET B 1 329 ? 23.453  -27.676 45.772  1.00 11.12 ? 329  MET B O   1 
ATOM   6732  C CB  . MET B 1 329 ? 22.826  -29.558 48.166  1.00 10.66 ? 329  MET B CB  1 
ATOM   6733  C CG  . MET B 1 329 ? 23.169  -30.956 47.673  1.00 9.50  ? 329  MET B CG  1 
ATOM   6734  S SD  . MET B 1 329 ? 24.366  -31.793 48.739  1.00 12.94 ? 329  MET B SD  1 
ATOM   6735  C CE  . MET B 1 329 ? 25.991  -31.243 48.196  1.00 14.66 ? 329  MET B CE  1 
ATOM   6736  N N   . TRP B 1 330 ? 22.133  -29.283 44.876  1.00 10.45 ? 330  TRP B N   1 
ATOM   6737  C CA  . TRP B 1 330 ? 22.665  -29.223 43.516  1.00 9.77  ? 330  TRP B CA  1 
ATOM   6738  C C   . TRP B 1 330 ? 22.064  -28.108 42.671  1.00 10.52 ? 330  TRP B C   1 
ATOM   6739  O O   . TRP B 1 330 ? 22.588  -27.781 41.605  1.00 10.82 ? 330  TRP B O   1 
ATOM   6740  C CB  . TRP B 1 330 ? 22.404  -30.555 42.801  1.00 8.94  ? 330  TRP B CB  1 
ATOM   6741  C CG  . TRP B 1 330 ? 22.558  -31.758 43.670  1.00 8.77  ? 330  TRP B CG  1 
ATOM   6742  C CD1 . TRP B 1 330 ? 21.555  -32.476 44.257  1.00 9.86  ? 330  TRP B CD1 1 
ATOM   6743  C CD2 . TRP B 1 330 ? 23.784  -32.373 44.070  1.00 8.34  ? 330  TRP B CD2 1 
ATOM   6744  N NE1 . TRP B 1 330 ? 22.077  -33.505 45.001  1.00 7.77  ? 330  TRP B NE1 1 
ATOM   6745  C CE2 . TRP B 1 330 ? 23.443  -33.471 44.905  1.00 9.37  ? 330  TRP B CE2 1 
ATOM   6746  C CE3 . TRP B 1 330 ? 25.147  -32.110 43.807  1.00 10.30 ? 330  TRP B CE3 1 
ATOM   6747  C CZ2 . TRP B 1 330 ? 24.412  -34.308 45.480  1.00 7.93  ? 330  TRP B CZ2 1 
ATOM   6748  C CZ3 . TRP B 1 330 ? 26.119  -32.945 44.385  1.00 10.70 ? 330  TRP B CZ3 1 
ATOM   6749  C CH2 . TRP B 1 330 ? 25.739  -34.034 45.214  1.00 10.66 ? 330  TRP B CH2 1 
ATOM   6750  N N   . SER B 1 331 ? 20.958  -27.548 43.152  1.00 9.30  ? 331  SER B N   1 
ATOM   6751  C CA  . SER B 1 331 ? 20.230  -26.488 42.459  1.00 9.06  ? 331  SER B CA  1 
ATOM   6752  C C   . SER B 1 331 ? 20.658  -25.106 42.931  1.00 8.26  ? 331  SER B C   1 
ATOM   6753  O O   . SER B 1 331 ? 21.752  -24.932 43.472  1.00 9.49  ? 331  SER B O   1 
ATOM   6754  C CB  . SER B 1 331 ? 18.723  -26.662 42.716  1.00 9.18  ? 331  SER B CB  1 
ATOM   6755  O OG  . SER B 1 331 ? 18.374  -26.359 44.066  1.00 10.35 ? 331  SER B OG  1 
ATOM   6756  N N   . ALA B 1 332 ? 19.742  -24.150 42.762  1.00 9.82  ? 332  ALA B N   1 
ATOM   6757  C CA  . ALA B 1 332 ? 19.901  -22.765 43.190  1.00 8.61  ? 332  ALA B CA  1 
ATOM   6758  C C   . ALA B 1 332 ? 20.150  -22.704 44.703  1.00 9.57  ? 332  ALA B C   1 
ATOM   6759  O O   . ALA B 1 332 ? 20.851  -21.816 45.170  1.00 9.49  ? 332  ALA B O   1 
ATOM   6760  C CB  . ALA B 1 332 ? 18.660  -21.980 42.837  1.00 9.60  ? 332  ALA B CB  1 
ATOM   6761  N N   . ILE B 1 333 ? 19.645  -23.710 45.436  1.00 8.51  ? 333  ILE B N   1 
ATOM   6762  C CA  . ILE B 1 333 ? 19.814  -23.830 46.900  1.00 8.92  ? 333  ILE B CA  1 
ATOM   6763  C C   . ILE B 1 333 ? 21.299  -23.903 47.269  1.00 9.06  ? 333  ILE B C   1 
ATOM   6764  O O   . ILE B 1 333 ? 21.706  -23.475 48.351  1.00 9.92  ? 333  ILE B O   1 
ATOM   6765  C CB  . ILE B 1 333 ? 19.017  -25.059 47.456  1.00 7.99  ? 333  ILE B CB  1 
ATOM   6766  C CG1 . ILE B 1 333 ? 17.515  -24.775 47.411  1.00 8.84  ? 333  ILE B CG1 1 
ATOM   6767  C CG2 . ILE B 1 333 ? 19.436  -25.472 48.887  1.00 9.43  ? 333  ILE B CG2 1 
ATOM   6768  C CD1 . ILE B 1 333 ? 17.006  -23.696 48.387  1.00 8.95  ? 333  ILE B CD1 1 
ATOM   6769  N N   . GLY B 1 334 ? 22.097  -24.365 46.309  1.00 9.18  ? 334  GLY B N   1 
ATOM   6770  C CA  . GLY B 1 334 ? 23.528  -24.463 46.495  1.00 9.00  ? 334  GLY B CA  1 
ATOM   6771  C C   . GLY B 1 334 ? 24.291  -23.167 46.291  1.00 9.27  ? 334  GLY B C   1 
ATOM   6772  O O   . GLY B 1 334 ? 25.515  -23.200 46.283  1.00 10.21 ? 334  GLY B O   1 
ATOM   6773  N N   . LEU B 1 335 ? 23.593  -22.028 46.159  1.00 9.44  ? 335  LEU B N   1 
ATOM   6774  C CA  . LEU B 1 335 ? 24.270  -20.729 45.981  1.00 9.37  ? 335  LEU B CA  1 
ATOM   6775  C C   . LEU B 1 335 ? 25.281  -20.408 47.101  1.00 8.65  ? 335  LEU B C   1 
ATOM   6776  O O   . LEU B 1 335 ? 26.395  -19.989 46.784  1.00 9.74  ? 335  LEU B O   1 
ATOM   6777  C CB  . LEU B 1 335 ? 23.282  -19.569 45.722  1.00 9.61  ? 335  LEU B CB  1 
ATOM   6778  C CG  . LEU B 1 335 ? 23.880  -18.172 45.474  1.00 11.28 ? 335  LEU B CG  1 
ATOM   6779  C CD1 . LEU B 1 335 ? 24.596  -18.098 44.128  1.00 12.16 ? 335  LEU B CD1 1 
ATOM   6780  C CD2 . LEU B 1 335 ? 22.808  -17.116 45.576  1.00 11.48 ? 335  LEU B CD2 1 
ATOM   6781  N N   . PRO B 1 336 ? 24.931  -20.625 48.406  1.00 10.64 ? 336  PRO B N   1 
ATOM   6782  C CA  . PRO B 1 336 ? 25.933  -20.325 49.441  1.00 10.45 ? 336  PRO B CA  1 
ATOM   6783  C C   . PRO B 1 336 ? 27.173  -21.230 49.338  1.00 9.78  ? 336  PRO B C   1 
ATOM   6784  O O   . PRO B 1 336 ? 28.267  -20.813 49.712  1.00 10.40 ? 336  PRO B O   1 
ATOM   6785  C CB  . PRO B 1 336 ? 25.167  -20.543 50.752  1.00 10.46 ? 336  PRO B CB  1 
ATOM   6786  C CG  . PRO B 1 336 ? 24.036  -21.439 50.366  1.00 12.01 ? 336  PRO B CG  1 
ATOM   6787  C CD  . PRO B 1 336 ? 23.626  -20.881 49.051  1.00 10.52 ? 336  PRO B CD  1 
ATOM   6788  N N   . ILE B 1 337 ? 26.999  -22.434 48.771  1.00 9.56  ? 337  ILE B N   1 
ATOM   6789  C CA  . ILE B 1 337 ? 28.119  -23.369 48.573  1.00 9.41  ? 337  ILE B CA  1 
ATOM   6790  C C   . ILE B 1 337 ? 29.013  -22.782 47.475  1.00 10.42 ? 337  ILE B C   1 
ATOM   6791  O O   . ILE B 1 337 ? 30.223  -22.675 47.661  1.00 10.36 ? 337  ILE B O   1 
ATOM   6792  C CB  . ILE B 1 337 ? 27.664  -24.804 48.151  1.00 9.46  ? 337  ILE B CB  1 
ATOM   6793  C CG1 . ILE B 1 337 ? 26.645  -25.361 49.148  1.00 9.24  ? 337  ILE B CG1 1 
ATOM   6794  C CG2 . ILE B 1 337 ? 28.880  -25.754 48.064  1.00 10.07 ? 337  ILE B CG2 1 
ATOM   6795  C CD1 . ILE B 1 337 ? 25.904  -26.616 48.657  1.00 9.63  ? 337  ILE B CD1 1 
ATOM   6796  N N   . MET B 1 338 ? 28.391  -22.332 46.380  1.00 9.72  ? 338  MET B N   1 
ATOM   6797  C CA  . MET B 1 338 ? 29.125  -21.727 45.265  1.00 9.73  ? 338  MET B CA  1 
ATOM   6798  C C   . MET B 1 338 ? 29.834  -20.426 45.669  1.00 9.38  ? 338  MET B C   1 
ATOM   6799  O O   . MET B 1 338 ? 30.943  -20.164 45.210  1.00 9.82  ? 338  MET B O   1 
ATOM   6800  C CB  . MET B 1 338 ? 28.211  -21.479 44.064  1.00 9.73  ? 338  MET B CB  1 
ATOM   6801  C CG  . MET B 1 338 ? 29.005  -21.156 42.804  1.00 11.45 ? 338  MET B CG  1 
ATOM   6802  S SD  . MET B 1 338 ? 28.059  -20.687 41.373  1.00 12.20 ? 338  MET B SD  1 
ATOM   6803  C CE  . MET B 1 338 ? 27.312  -22.224 40.910  1.00 12.44 ? 338  MET B CE  1 
ATOM   6804  N N   . ILE B 1 339 ? 29.213  -19.636 46.548  1.00 10.16 ? 339  ILE B N   1 
ATOM   6805  C CA  . ILE B 1 339 ? 29.831  -18.392 47.019  1.00 9.42  ? 339  ILE B CA  1 
ATOM   6806  C C   . ILE B 1 339 ? 31.067  -18.722 47.867  1.00 10.01 ? 339  ILE B C   1 
ATOM   6807  O O   . ILE B 1 339 ? 32.096  -18.056 47.760  1.00 10.60 ? 339  ILE B O   1 
ATOM   6808  C CB  . ILE B 1 339 ? 28.822  -17.503 47.808  1.00 9.94  ? 339  ILE B CB  1 
ATOM   6809  C CG1 . ILE B 1 339 ? 27.772  -16.943 46.845  1.00 12.52 ? 339  ILE B CG1 1 
ATOM   6810  C CG2 . ILE B 1 339 ? 29.540  -16.337 48.523  1.00 10.87 ? 339  ILE B CG2 1 
ATOM   6811  C CD1 . ILE B 1 339 ? 26.644  -16.170 47.507  1.00 10.94 ? 339  ILE B CD1 1 
ATOM   6812  N N   . SER B 1 340 ? 30.981  -19.805 48.635  1.00 8.86  ? 340  SER B N   1 
ATOM   6813  C CA  . SER B 1 340 ? 32.087  -20.229 49.483  1.00 10.31 ? 340  SER B CA  1 
ATOM   6814  C C   . SER B 1 340 ? 33.251  -20.860 48.710  1.00 10.24 ? 340  SER B C   1 
ATOM   6815  O O   . SER B 1 340 ? 34.399  -20.441 48.872  1.00 10.13 ? 340  SER B O   1 
ATOM   6816  C CB  . SER B 1 340 ? 31.587  -21.205 50.555  1.00 10.17 ? 340  SER B CB  1 
ATOM   6817  O OG  . SER B 1 340 ? 32.623  -21.542 51.462  1.00 12.98 ? 340  SER B OG  1 
ATOM   6818  N N   . ILE B 1 341 ? 32.942  -21.815 47.831  1.00 10.47 ? 341  ILE B N   1 
ATOM   6819  C CA  . ILE B 1 341 ? 33.974  -22.539 47.084  1.00 10.64 ? 341  ILE B CA  1 
ATOM   6820  C C   . ILE B 1 341 ? 34.268  -22.140 45.634  1.00 10.99 ? 341  ILE B C   1 
ATOM   6821  O O   . ILE B 1 341 ? 35.269  -22.580 45.063  1.00 11.24 ? 341  ILE B O   1 
ATOM   6822  C CB  . ILE B 1 341 ? 33.750  -24.086 47.180  1.00 11.17 ? 341  ILE B CB  1 
ATOM   6823  C CG1 . ILE B 1 341 ? 32.498  -24.512 46.393  1.00 10.43 ? 341  ILE B CG1 1 
ATOM   6824  C CG2 . ILE B 1 341 ? 33.682  -24.510 48.657  1.00 12.83 ? 341  ILE B CG2 1 
ATOM   6825  C CD1 . ILE B 1 341 ? 32.291  -26.026 46.289  1.00 11.50 ? 341  ILE B CD1 1 
ATOM   6826  N N   . GLY B 1 342 ? 33.399  -21.316 45.050  1.00 10.30 ? 342  GLY B N   1 
ATOM   6827  C CA  . GLY B 1 342 ? 33.587  -20.874 43.673  1.00 10.25 ? 342  GLY B CA  1 
ATOM   6828  C C   . GLY B 1 342 ? 32.926  -21.767 42.650  1.00 11.15 ? 342  GLY B C   1 
ATOM   6829  O O   . GLY B 1 342 ? 32.704  -22.956 42.902  1.00 11.69 ? 342  GLY B O   1 
ATOM   6830  N N   . TYR B 1 343 ? 32.639  -21.189 41.484  1.00 10.94 ? 343  TYR B N   1 
ATOM   6831  C CA  . TYR B 1 343 ? 31.997  -21.895 40.373  1.00 11.26 ? 343  TYR B CA  1 
ATOM   6832  C C   . TYR B 1 343 ? 32.682  -23.192 39.953  1.00 11.87 ? 343  TYR B C   1 
ATOM   6833  O O   . TYR B 1 343 ? 32.010  -24.214 39.818  1.00 11.54 ? 343  TYR B O   1 
ATOM   6834  C CB  . TYR B 1 343 ? 31.858  -20.971 39.154  1.00 11.37 ? 343  TYR B CB  1 
ATOM   6835  C CG  . TYR B 1 343 ? 31.240  -21.639 37.932  1.00 10.92 ? 343  TYR B CG  1 
ATOM   6836  C CD1 . TYR B 1 343 ? 29.850  -21.862 37.857  1.00 11.60 ? 343  TYR B CD1 1 
ATOM   6837  C CD2 . TYR B 1 343 ? 32.045  -22.050 36.842  1.00 11.01 ? 343  TYR B CD2 1 
ATOM   6838  C CE1 . TYR B 1 343 ? 29.262  -22.470 36.716  1.00 13.20 ? 343  TYR B CE1 1 
ATOM   6839  C CE2 . TYR B 1 343 ? 31.472  -22.671 35.701  1.00 11.75 ? 343  TYR B CE2 1 
ATOM   6840  C CZ  . TYR B 1 343 ? 30.080  -22.871 35.650  1.00 11.96 ? 343  TYR B CZ  1 
ATOM   6841  O OH  . TYR B 1 343 ? 29.515  -23.477 34.558  1.00 14.68 ? 343  TYR B OH  1 
ATOM   6842  N N   . GLU B 1 344 ? 33.994  -23.123 39.700  1.00 12.09 ? 344  GLU B N   1 
ATOM   6843  C CA  . GLU B 1 344 ? 34.793  -24.275 39.264  1.00 13.94 ? 344  GLU B CA  1 
ATOM   6844  C C   . GLU B 1 344 ? 34.671  -25.474 40.204  1.00 13.68 ? 344  GLU B C   1 
ATOM   6845  O O   . GLU B 1 344 ? 34.460  -26.605 39.752  1.00 13.27 ? 344  GLU B O   1 
ATOM   6846  C CB  . GLU B 1 344 ? 36.268  -23.881 39.102  1.00 17.55 ? 344  GLU B CB  1 
ATOM   6847  C CG  . GLU B 1 344 ? 36.532  -22.851 38.004  1.00 25.26 ? 344  GLU B CG  1 
ATOM   6848  C CD  . GLU B 1 344 ? 37.935  -22.235 38.047  1.00 29.50 ? 344  GLU B CD  1 
ATOM   6849  O OE1 . GLU B 1 344 ? 38.633  -22.346 39.081  1.00 33.46 ? 344  GLU B OE1 1 
ATOM   6850  O OE2 . GLU B 1 344 ? 38.341  -21.616 37.036  1.00 32.90 ? 344  GLU B OE2 1 
ATOM   6851  N N   . ASN B 1 345 ? 34.719  -25.203 41.509  1.00 11.69 ? 345  ASN B N   1 
ATOM   6852  C CA  . ASN B 1 345 ? 34.597  -26.246 42.526  1.00 11.77 ? 345  ASN B CA  1 
ATOM   6853  C C   . ASN B 1 345 ? 33.163  -26.760 42.652  1.00 11.15 ? 345  ASN B C   1 
ATOM   6854  O O   . ASN B 1 345 ? 32.949  -27.937 42.953  1.00 10.12 ? 345  ASN B O   1 
ATOM   6855  C CB  . ASN B 1 345 ? 35.111  -25.754 43.873  1.00 11.22 ? 345  ASN B CB  1 
ATOM   6856  C CG  . ASN B 1 345 ? 36.623  -25.715 43.950  1.00 12.79 ? 345  ASN B CG  1 
ATOM   6857  O OD1 . ASN B 1 345 ? 37.310  -26.524 43.329  1.00 13.73 ? 345  ASN B OD1 1 
ATOM   6858  N ND2 . ASN B 1 345 ? 37.146  -24.783 44.737  1.00 12.83 ? 345  ASN B ND2 1 
ATOM   6859  N N   . PHE B 1 346 ? 32.186  -25.887 42.388  1.00 10.91 ? 346  PHE B N   1 
ATOM   6860  C CA  . PHE B 1 346 ? 30.777  -26.288 42.432  1.00 10.37 ? 346  PHE B CA  1 
ATOM   6861  C C   . PHE B 1 346 ? 30.497  -27.217 41.242  1.00 10.70 ? 346  PHE B C   1 
ATOM   6862  O O   . PHE B 1 346 ? 29.722  -28.161 41.371  1.00 11.03 ? 346  PHE B O   1 
ATOM   6863  C CB  . PHE B 1 346 ? 29.833  -25.077 42.415  1.00 9.94  ? 346  PHE B CB  1 
ATOM   6864  C CG  . PHE B 1 346 ? 28.389  -25.417 42.745  1.00 10.05 ? 346  PHE B CG  1 
ATOM   6865  C CD1 . PHE B 1 346 ? 27.964  -25.490 44.083  1.00 11.10 ? 346  PHE B CD1 1 
ATOM   6866  C CD2 . PHE B 1 346 ? 27.450  -25.677 41.723  1.00 9.36  ? 346  PHE B CD2 1 
ATOM   6867  C CE1 . PHE B 1 346 ? 26.615  -25.820 44.406  1.00 11.59 ? 346  PHE B CE1 1 
ATOM   6868  C CE2 . PHE B 1 346 ? 26.099  -26.006 42.028  1.00 10.06 ? 346  PHE B CE2 1 
ATOM   6869  C CZ  . PHE B 1 346 ? 25.683  -26.078 43.375  1.00 11.12 ? 346  PHE B CZ  1 
ATOM   6870  N N   . VAL B 1 347 ? 31.137  -26.944 40.101  1.00 10.84 ? 347  VAL B N   1 
ATOM   6871  C CA  . VAL B 1 347 ? 30.995  -27.779 38.901  1.00 11.09 ? 347  VAL B CA  1 
ATOM   6872  C C   . VAL B 1 347 ? 31.605  -29.151 39.193  1.00 11.16 ? 347  VAL B C   1 
ATOM   6873  O O   . VAL B 1 347 ? 31.044  -30.163 38.787  1.00 11.24 ? 347  VAL B O   1 
ATOM   6874  C CB  . VAL B 1 347 ? 31.636  -27.115 37.644  1.00 10.51 ? 347  VAL B CB  1 
ATOM   6875  C CG1 . VAL B 1 347 ? 31.742  -28.093 36.457  1.00 12.64 ? 347  VAL B CG1 1 
ATOM   6876  C CG2 . VAL B 1 347 ? 30.778  -25.960 37.225  1.00 11.32 ? 347  VAL B CG2 1 
ATOM   6877  N N   . GLU B 1 348 ? 32.703  -29.173 39.957  1.00 11.41 ? 348  GLU B N   1 
ATOM   6878  C CA  . GLU B 1 348 ? 33.353  -30.425 40.351  1.00 10.54 ? 348  GLU B CA  1 
ATOM   6879  C C   . GLU B 1 348 ? 32.412  -31.231 41.253  1.00 10.79 ? 348  GLU B C   1 
ATOM   6880  O O   . GLU B 1 348 ? 32.289  -32.446 41.082  1.00 11.39 ? 348  GLU B O   1 
ATOM   6881  C CB  . GLU B 1 348 ? 34.692  -30.168 41.053  1.00 11.96 ? 348  GLU B CB  1 
ATOM   6882  C CG  . GLU B 1 348 ? 35.869  -29.936 40.104  1.00 13.19 ? 348  GLU B CG  1 
ATOM   6883  C CD  . GLU B 1 348 ? 36.269  -31.195 39.354  1.00 14.96 ? 348  GLU B CD  1 
ATOM   6884  O OE1 . GLU B 1 348 ? 36.645  -32.188 40.009  1.00 15.29 ? 348  GLU B OE1 1 
ATOM   6885  O OE2 . GLU B 1 348 ? 36.194  -31.194 38.108  1.00 18.63 ? 348  GLU B OE2 1 
ATOM   6886  N N   . LEU B 1 349 ? 31.692  -30.532 42.141  1.00 9.67  ? 349  LEU B N   1 
ATOM   6887  C CA  . LEU B 1 349 ? 30.706  -31.151 43.046  1.00 10.14 ? 349  LEU B CA  1 
ATOM   6888  C C   . LEU B 1 349 ? 29.576  -31.797 42.229  1.00 10.67 ? 349  LEU B C   1 
ATOM   6889  O O   . LEU B 1 349 ? 29.228  -32.961 42.455  1.00 11.09 ? 349  LEU B O   1 
ATOM   6890  C CB  . LEU B 1 349 ? 30.149  -30.107 44.038  1.00 9.64  ? 349  LEU B CB  1 
ATOM   6891  C CG  . LEU B 1 349 ? 29.005  -30.456 45.006  1.00 9.74  ? 349  LEU B CG  1 
ATOM   6892  C CD1 . LEU B 1 349 ? 29.454  -31.460 46.039  1.00 10.58 ? 349  LEU B CD1 1 
ATOM   6893  C CD2 . LEU B 1 349 ? 28.507  -29.204 45.696  1.00 12.38 ? 349  LEU B CD2 1 
ATOM   6894  N N   . LEU B 1 350 ? 29.080  -31.064 41.229  1.00 9.55  ? 350  LEU B N   1 
ATOM   6895  C CA  . LEU B 1 350 ? 28.026  -31.555 40.340  1.00 9.37  ? 350  LEU B CA  1 
ATOM   6896  C C   . LEU B 1 350 ? 28.512  -32.742 39.502  1.00 9.56  ? 350  LEU B C   1 
ATOM   6897  O O   . LEU B 1 350 ? 27.785  -33.721 39.331  1.00 10.85 ? 350  LEU B O   1 
ATOM   6898  C CB  . LEU B 1 350 ? 27.553  -30.451 39.391  1.00 8.34  ? 350  LEU B CB  1 
ATOM   6899  C CG  . LEU B 1 350 ? 26.837  -29.224 39.947  1.00 10.16 ? 350  LEU B CG  1 
ATOM   6900  C CD1 . LEU B 1 350 ? 26.655  -28.223 38.821  1.00 11.29 ? 350  LEU B CD1 1 
ATOM   6901  C CD2 . LEU B 1 350 ? 25.499  -29.575 40.580  1.00 10.31 ? 350  LEU B CD2 1 
ATOM   6902  N N   . THR B 1 351 ? 29.761  -32.659 39.038  1.00 10.87 ? 351  THR B N   1 
ATOM   6903  C CA  . THR B 1 351 ? 30.376  -33.706 38.215  1.00 10.39 ? 351  THR B CA  1 
ATOM   6904  C C   . THR B 1 351 ? 30.548  -35.014 38.981  1.00 11.25 ? 351  THR B C   1 
ATOM   6905  O O   . THR B 1 351 ? 30.343  -36.081 38.412  1.00 11.42 ? 351  THR B O   1 
ATOM   6906  C CB  . THR B 1 351 ? 31.724  -33.245 37.595  1.00 12.27 ? 351  THR B CB  1 
ATOM   6907  O OG1 . THR B 1 351 ? 31.504  -32.053 36.834  1.00 12.72 ? 351  THR B OG1 1 
ATOM   6908  C CG2 . THR B 1 351 ? 32.302  -34.318 36.661  1.00 12.27 ? 351  THR B CG2 1 
ATOM   6909  N N   . GLY B 1 352 ? 30.871  -34.920 40.274  1.00 11.66 ? 352  GLY B N   1 
ATOM   6910  C CA  . GLY B 1 352 ? 31.023  -36.111 41.102  1.00 11.65 ? 352  GLY B CA  1 
ATOM   6911  C C   . GLY B 1 352 ? 29.714  -36.860 41.212  1.00 10.75 ? 352  GLY B C   1 
ATOM   6912  O O   . GLY B 1 352 ? 29.674  -38.094 41.144  1.00 10.73 ? 352  GLY B O   1 
ATOM   6913  N N   . ALA B 1 353 ? 28.632  -36.095 41.333  1.00 10.87 ? 353  ALA B N   1 
ATOM   6914  C CA  . ALA B 1 353 ? 27.296  -36.660 41.409  1.00 10.46 ? 353  ALA B CA  1 
ATOM   6915  C C   . ALA B 1 353 ? 26.898  -37.291 40.080  1.00 10.89 ? 353  ALA B C   1 
ATOM   6916  O O   . ALA B 1 353 ? 26.390  -38.411 40.062  1.00 10.58 ? 353  ALA B O   1 
ATOM   6917  C CB  . ALA B 1 353 ? 26.303  -35.607 41.816  1.00 10.95 ? 353  ALA B CB  1 
ATOM   6918  N N   . HIS B 1 354 ? 27.249  -36.615 38.983  1.00 10.75 ? 354  HIS B N   1 
ATOM   6919  C CA  . HIS B 1 354 ? 26.954  -37.086 37.627  1.00 11.34 ? 354  HIS B CA  1 
ATOM   6920  C C   . HIS B 1 354 ? 27.643  -38.416 37.325  1.00 11.05 ? 354  HIS B C   1 
ATOM   6921  O O   . HIS B 1 354 ? 27.022  -39.311 36.749  1.00 12.37 ? 354  HIS B O   1 
ATOM   6922  C CB  . HIS B 1 354 ? 27.366  -36.034 36.592  1.00 10.27 ? 354  HIS B CB  1 
ATOM   6923  C CG  . HIS B 1 354 ? 26.965  -36.374 35.188  1.00 11.73 ? 354  HIS B CG  1 
ATOM   6924  N ND1 . HIS B 1 354 ? 25.659  -36.623 34.828  1.00 11.18 ? 354  HIS B ND1 1 
ATOM   6925  C CD2 . HIS B 1 354 ? 27.704  -36.535 34.065  1.00 12.55 ? 354  HIS B CD2 1 
ATOM   6926  C CE1 . HIS B 1 354 ? 25.610  -36.924 33.541  1.00 12.10 ? 354  HIS B CE1 1 
ATOM   6927  N NE2 . HIS B 1 354 ? 26.837  -36.877 33.056  1.00 14.54 ? 354  HIS B NE2 1 
ATOM   6928  N N   . VAL B 1 355 ? 28.906  -38.546 37.742  1.00 11.68 ? 355  VAL B N   1 
ATOM   6929  C CA  . VAL B 1 355 ? 29.683  -39.776 37.533  1.00 12.21 ? 355  VAL B CA  1 
ATOM   6930  C C   . VAL B 1 355 ? 29.008  -40.959 38.240  1.00 13.07 ? 355  VAL B C   1 
ATOM   6931  O O   . VAL B 1 355 ? 28.896  -42.046 37.666  1.00 11.75 ? 355  VAL B O   1 
ATOM   6932  C CB  . VAL B 1 355 ? 31.172  -39.607 37.990  1.00 13.26 ? 355  VAL B CB  1 
ATOM   6933  C CG1 . VAL B 1 355 ? 31.941  -40.926 37.885  1.00 15.28 ? 355  VAL B CG1 1 
ATOM   6934  C CG2 . VAL B 1 355 ? 31.864  -38.566 37.118  1.00 14.39 ? 355  VAL B CG2 1 
ATOM   6935  N N   . ILE B 1 356 ? 28.485  -40.715 39.441  1.00 11.55 ? 356  ILE B N   1 
ATOM   6936  C CA  . ILE B 1 356 ? 27.791  -41.763 40.188  1.00 11.39 ? 356  ILE B CA  1 
ATOM   6937  C C   . ILE B 1 356 ? 26.390  -42.025 39.619  1.00 11.28 ? 356  ILE B C   1 
ATOM   6938  O O   . ILE B 1 356 ? 25.928  -43.164 39.654  1.00 11.62 ? 356  ILE B O   1 
ATOM   6939  C CB  . ILE B 1 356 ? 27.814  -41.494 41.724  1.00 12.46 ? 356  ILE B CB  1 
ATOM   6940  C CG1 . ILE B 1 356 ? 29.251  -41.633 42.241  1.00 12.95 ? 356  ILE B CG1 1 
ATOM   6941  C CG2 . ILE B 1 356 ? 26.886  -42.450 42.497  1.00 13.83 ? 356  ILE B CG2 1 
ATOM   6942  C CD1 . ILE B 1 356 ? 29.938  -42.989 42.036  1.00 13.77 ? 356  ILE B CD1 1 
ATOM   6943  N N   . ASP B 1 357 ? 25.759  -40.999 39.030  1.00 10.72 ? 357  ASP B N   1 
ATOM   6944  C CA  . ASP B 1 357 ? 24.434  -41.156 38.401  1.00 10.96 ? 357  ASP B CA  1 
ATOM   6945  C C   . ASP B 1 357 ? 24.576  -42.105 37.208  1.00 11.85 ? 357  ASP B C   1 
ATOM   6946  O O   . ASP B 1 357 ? 23.759  -43.010 37.025  1.00 12.03 ? 357  ASP B O   1 
ATOM   6947  C CB  . ASP B 1 357 ? 23.882  -39.826 37.870  1.00 11.01 ? 357  ASP B CB  1 
ATOM   6948  C CG  . ASP B 1 357 ? 23.516  -38.845 38.964  1.00 12.28 ? 357  ASP B CG  1 
ATOM   6949  O OD1 . ASP B 1 357 ? 23.313  -39.254 40.126  1.00 9.83  ? 357  ASP B OD1 1 
ATOM   6950  O OD2 . ASP B 1 357 ? 23.424  -37.643 38.636  1.00 11.29 ? 357  ASP B OD2 1 
ATOM   6951  N N   . GLU B 1 358 ? 25.653  -41.909 36.441  1.00 13.01 ? 358  GLU B N   1 
ATOM   6952  C CA  . GLU B 1 358 ? 25.955  -42.728 35.266  1.00 13.04 ? 358  GLU B CA  1 
ATOM   6953  C C   . GLU B 1 358 ? 26.339  -44.148 35.666  1.00 14.21 ? 358  GLU B C   1 
ATOM   6954  O O   . GLU B 1 358 ? 25.903  -45.109 35.027  1.00 14.30 ? 358  GLU B O   1 
ATOM   6955  C CB  . GLU B 1 358 ? 27.062  -42.087 34.416  1.00 15.85 ? 358  GLU B CB  1 
ATOM   6956  C CG  . GLU B 1 358 ? 26.646  -40.810 33.669  1.00 19.13 ? 358  GLU B CG  1 
ATOM   6957  C CD  . GLU B 1 358 ? 25.541  -41.038 32.641  1.00 23.24 ? 358  GLU B CD  1 
ATOM   6958  O OE1 . GLU B 1 358 ? 25.820  -41.644 31.586  1.00 26.91 ? 358  GLU B OE1 1 
ATOM   6959  O OE2 . GLU B 1 358 ? 24.396  -40.604 32.894  1.00 26.57 ? 358  GLU B OE2 1 
ATOM   6960  N N   . HIS B 1 359 ? 27.108  -44.268 36.753  1.00 12.53 ? 359  HIS B N   1 
ATOM   6961  C CA  . HIS B 1 359 ? 27.522  -45.570 37.291  1.00 13.08 ? 359  HIS B CA  1 
ATOM   6962  C C   . HIS B 1 359 ? 26.271  -46.339 37.746  1.00 13.00 ? 359  HIS B C   1 
ATOM   6963  O O   . HIS B 1 359 ? 26.096  -47.504 37.404  1.00 13.11 ? 359  HIS B O   1 
ATOM   6964  C CB  . HIS B 1 359 ? 28.513  -45.379 38.465  1.00 12.14 ? 359  HIS B CB  1 
ATOM   6965  C CG  . HIS B 1 359 ? 28.670  -46.581 39.351  1.00 13.27 ? 359  HIS B CG  1 
ATOM   6966  N ND1 . HIS B 1 359 ? 29.530  -47.618 39.057  1.00 13.34 ? 359  HIS B ND1 1 
ATOM   6967  C CD2 . HIS B 1 359 ? 28.039  -46.932 40.499  1.00 13.71 ? 359  HIS B CD2 1 
ATOM   6968  C CE1 . HIS B 1 359 ? 29.414  -48.557 39.979  1.00 14.42 ? 359  HIS B CE1 1 
ATOM   6969  N NE2 . HIS B 1 359 ? 28.516  -48.167 40.865  1.00 13.61 ? 359  HIS B NE2 1 
ATOM   6970  N N   . PHE B 1 360 ? 25.396  -45.657 38.485  1.00 12.69 ? 360  PHE B N   1 
ATOM   6971  C CA  . PHE B 1 360 ? 24.169  -46.260 39.010  1.00 11.86 ? 360  PHE B CA  1 
ATOM   6972  C C   . PHE B 1 360 ? 23.212  -46.761 37.923  1.00 13.00 ? 360  PHE B C   1 
ATOM   6973  O O   . PHE B 1 360 ? 22.650  -47.855 38.041  1.00 14.41 ? 360  PHE B O   1 
ATOM   6974  C CB  . PHE B 1 360 ? 23.462  -45.258 39.941  1.00 11.31 ? 360  PHE B CB  1 
ATOM   6975  C CG  . PHE B 1 360 ? 22.152  -45.744 40.503  1.00 10.72 ? 360  PHE B CG  1 
ATOM   6976  C CD1 . PHE B 1 360 ? 22.092  -46.910 41.293  1.00 11.07 ? 360  PHE B CD1 1 
ATOM   6977  C CD2 . PHE B 1 360 ? 20.970  -45.017 40.266  1.00 10.37 ? 360  PHE B CD2 1 
ATOM   6978  C CE1 . PHE B 1 360 ? 20.873  -47.345 41.847  1.00 10.79 ? 360  PHE B CE1 1 
ATOM   6979  C CE2 . PHE B 1 360 ? 19.739  -45.437 40.816  1.00 12.66 ? 360  PHE B CE2 1 
ATOM   6980  C CZ  . PHE B 1 360 ? 19.691  -46.605 41.610  1.00 12.33 ? 360  PHE B CZ  1 
ATOM   6981  N N   . ALA B 1 361 ? 23.035  -45.961 36.879  1.00 13.96 ? 361  ALA B N   1 
ATOM   6982  C CA  . ALA B 1 361 ? 22.140  -46.308 35.782  1.00 15.34 ? 361  ALA B CA  1 
ATOM   6983  C C   . ALA B 1 361 ? 22.687  -47.351 34.795  1.00 17.16 ? 361  ALA B C   1 
ATOM   6984  O O   . ALA B 1 361 ? 21.910  -48.069 34.167  1.00 19.06 ? 361  ALA B O   1 
ATOM   6985  C CB  . ALA B 1 361 ? 21.764  -45.038 35.014  1.00 15.75 ? 361  ALA B CB  1 
ATOM   6986  N N   . ASN B 1 362 ? 24.009  -47.464 34.676  1.00 17.36 ? 362  ASN B N   1 
ATOM   6987  C CA  . ASN B 1 362 ? 24.600  -48.360 33.668  1.00 18.53 ? 362  ASN B CA  1 
ATOM   6988  C C   . ASN B 1 362 ? 25.464  -49.535 34.139  1.00 18.55 ? 362  ASN B C   1 
ATOM   6989  O O   . ASN B 1 362 ? 25.711  -50.474 33.378  1.00 18.93 ? 362  ASN B O   1 
ATOM   6990  C CB  . ASN B 1 362 ? 25.425  -47.513 32.677  1.00 19.80 ? 362  ASN B CB  1 
ATOM   6991  C CG  . ASN B 1 362 ? 24.629  -46.357 32.067  1.00 20.97 ? 362  ASN B CG  1 
ATOM   6992  O OD1 . ASN B 1 362 ? 23.470  -46.522 31.704  1.00 23.45 ? 362  ASN B OD1 1 
ATOM   6993  N ND2 . ASN B 1 362 ? 25.248  -45.187 31.957  1.00 22.52 ? 362  ASN B ND2 1 
ATOM   6994  N N   . ALA B 1 363 ? 25.952  -49.489 35.375  1.00 17.18 ? 363  ALA B N   1 
ATOM   6995  C CA  . ALA B 1 363 ? 26.813  -50.562 35.889  1.00 16.95 ? 363  ALA B CA  1 
ATOM   6996  C C   . ALA B 1 363 ? 26.060  -51.864 36.155  1.00 17.60 ? 363  ALA B C   1 
ATOM   6997  O O   . ALA B 1 363 ? 24.914  -51.832 36.605  1.00 17.41 ? 363  ALA B O   1 
ATOM   6998  C CB  . ALA B 1 363 ? 27.506  -50.121 37.174  1.00 16.47 ? 363  ALA B CB  1 
ATOM   6999  N N   . PRO B 1 364 ? 26.695  -53.026 35.884  1.00 18.54 ? 364  PRO B N   1 
ATOM   7000  C CA  . PRO B 1 364 ? 26.052  -54.328 36.122  1.00 19.38 ? 364  PRO B CA  1 
ATOM   7001  C C   . PRO B 1 364 ? 25.711  -54.411 37.623  1.00 18.96 ? 364  PRO B C   1 
ATOM   7002  O O   . PRO B 1 364 ? 26.466  -53.893 38.458  1.00 18.16 ? 364  PRO B O   1 
ATOM   7003  C CB  . PRO B 1 364 ? 27.106  -55.353 35.697  1.00 19.55 ? 364  PRO B CB  1 
ATOM   7004  C CG  . PRO B 1 364 ? 28.274  -54.587 35.168  1.00 20.62 ? 364  PRO B CG  1 
ATOM   7005  C CD  . PRO B 1 364 ? 28.033  -53.137 35.275  1.00 18.95 ? 364  PRO B CD  1 
ATOM   7006  N N   . PRO B 1 365 ? 24.576  -55.050 37.972  1.00 18.76 ? 365  PRO B N   1 
ATOM   7007  C CA  . PRO B 1 365 ? 24.149  -55.167 39.375  1.00 19.37 ? 365  PRO B CA  1 
ATOM   7008  C C   . PRO B 1 365 ? 25.146  -55.688 40.396  1.00 19.14 ? 365  PRO B C   1 
ATOM   7009  O O   . PRO B 1 365 ? 25.235  -55.156 41.507  1.00 18.71 ? 365  PRO B O   1 
ATOM   7010  C CB  . PRO B 1 365 ? 22.882  -56.019 39.323  1.00 19.73 ? 365  PRO B CB  1 
ATOM   7011  C CG  . PRO B 1 365 ? 22.640  -56.369 37.890  1.00 20.58 ? 365  PRO B CG  1 
ATOM   7012  C CD  . PRO B 1 365 ? 23.701  -55.797 37.040  1.00 20.21 ? 365  PRO B CD  1 
ATOM   7013  N N   . GLU B 1 366 ? 25.930  -56.690 40.031  1.00 19.36 ? 366  GLU B N   1 
ATOM   7014  C CA  . GLU B 1 366 ? 26.921  -57.229 40.970  1.00 20.32 ? 366  GLU B CA  1 
ATOM   7015  C C   . GLU B 1 366 ? 28.095  -56.266 41.205  1.00 18.57 ? 366  GLU B C   1 
ATOM   7016  O O   . GLU B 1 366 ? 28.934  -56.501 42.075  1.00 19.07 ? 366  GLU B O   1 
ATOM   7017  C CB  . GLU B 1 366 ? 27.443  -58.592 40.504  1.00 23.77 ? 366  GLU B CB  1 
ATOM   7018  C CG  . GLU B 1 366 ? 27.707  -58.675 39.007  1.00 28.62 ? 366  GLU B CG  1 
ATOM   7019  C CD  . GLU B 1 366 ? 26.415  -58.657 38.170  1.00 30.02 ? 366  GLU B CD  1 
ATOM   7020  O OE1 . GLU B 1 366 ? 25.774  -59.724 38.014  1.00 34.52 ? 366  GLU B OE1 1 
ATOM   7021  O OE2 . GLU B 1 366 ? 26.033  -57.575 37.680  1.00 33.88 ? 366  GLU B OE2 1 
ATOM   7022  N N   . GLN B 1 367 ? 28.149  -55.183 40.420  1.00 17.14 ? 367  GLN B N   1 
ATOM   7023  C CA  . GLN B 1 367 ? 29.213  -54.168 40.517  1.00 16.52 ? 367  GLN B CA  1 
ATOM   7024  C C   . GLN B 1 367 ? 28.658  -52.742 40.628  1.00 15.35 ? 367  GLN B C   1 
ATOM   7025  O O   . GLN B 1 367 ? 29.350  -51.763 40.323  1.00 15.25 ? 367  GLN B O   1 
ATOM   7026  C CB  . GLN B 1 367 ? 30.136  -54.237 39.292  1.00 20.00 ? 367  GLN B CB  1 
ATOM   7027  C CG  . GLN B 1 367 ? 30.823  -55.580 39.064  1.00 23.12 ? 367  GLN B CG  1 
ATOM   7028  C CD  . GLN B 1 367 ? 31.779  -55.996 40.191  1.00 25.92 ? 367  GLN B CD  1 
ATOM   7029  O OE1 . GLN B 1 367 ? 31.918  -57.182 40.473  1.00 29.69 ? 367  GLN B OE1 1 
ATOM   7030  N NE2 . GLN B 1 367 ? 32.445  -55.031 40.818  1.00 28.09 ? 367  GLN B NE2 1 
ATOM   7031  N N   . ASN B 1 368 ? 27.403  -52.647 41.068  1.00 14.70 ? 368  ASN B N   1 
ATOM   7032  C CA  . ASN B 1 368 ? 26.680  -51.374 41.219  1.00 13.93 ? 368  ASN B CA  1 
ATOM   7033  C C   . ASN B 1 368 ? 26.694  -50.973 42.703  1.00 14.25 ? 368  ASN B C   1 
ATOM   7034  O O   . ASN B 1 368 ? 25.982  -51.564 43.519  1.00 14.55 ? 368  ASN B O   1 
ATOM   7035  C CB  . ASN B 1 368 ? 25.248  -51.560 40.693  1.00 14.33 ? 368  ASN B CB  1 
ATOM   7036  C CG  . ASN B 1 368 ? 24.531  -50.244 40.433  1.00 14.73 ? 368  ASN B CG  1 
ATOM   7037  O OD1 . ASN B 1 368 ? 24.348  -49.449 41.343  1.00 14.26 ? 368  ASN B OD1 1 
ATOM   7038  N ND2 . ASN B 1 368 ? 24.099  -50.026 39.193  1.00 14.39 ? 368  ASN B ND2 1 
ATOM   7039  N N   . VAL B 1 369 ? 27.461  -49.927 43.023  1.00 13.46 ? 369  VAL B N   1 
ATOM   7040  C CA  . VAL B 1 369 ? 27.646  -49.467 44.405  1.00 13.62 ? 369  VAL B CA  1 
ATOM   7041  C C   . VAL B 1 369 ? 26.373  -49.073 45.173  1.00 11.84 ? 369  VAL B C   1 
ATOM   7042  O O   . VAL B 1 369 ? 26.125  -49.637 46.246  1.00 11.93 ? 369  VAL B O   1 
ATOM   7043  C CB  . VAL B 1 369 ? 28.767  -48.361 44.505  1.00 13.06 ? 369  VAL B CB  1 
ATOM   7044  C CG1 . VAL B 1 369 ? 28.819  -47.739 45.887  1.00 14.79 ? 369  VAL B CG1 1 
ATOM   7045  C CG2 . VAL B 1 369 ? 30.125  -48.940 44.208  1.00 14.54 ? 369  VAL B CG2 1 
ATOM   7046  N N   . PRO B 1 370 ? 25.529  -48.157 44.625  1.00 11.93 ? 370  PRO B N   1 
ATOM   7047  C CA  . PRO B 1 370 ? 24.330  -47.816 45.401  1.00 11.34 ? 370  PRO B CA  1 
ATOM   7048  C C   . PRO B 1 370 ? 23.329  -48.961 45.548  1.00 11.39 ? 370  PRO B C   1 
ATOM   7049  O O   . PRO B 1 370 ? 22.662  -49.063 46.580  1.00 10.16 ? 370  PRO B O   1 
ATOM   7050  C CB  . PRO B 1 370 ? 23.734  -46.658 44.612  1.00 10.66 ? 370  PRO B CB  1 
ATOM   7051  C CG  . PRO B 1 370 ? 24.901  -46.072 43.886  1.00 10.41 ? 370  PRO B CG  1 
ATOM   7052  C CD  . PRO B 1 370 ? 25.583  -47.307 43.416  1.00 12.35 ? 370  PRO B CD  1 
ATOM   7053  N N   . LEU B 1 371 ? 23.271  -49.844 44.543  1.00 11.32 ? 371  LEU B N   1 
ATOM   7054  C CA  . LEU B 1 371 ? 22.371  -51.001 44.586  1.00 12.95 ? 371  LEU B CA  1 
ATOM   7055  C C   . LEU B 1 371 ? 22.818  -51.975 45.681  1.00 12.35 ? 371  LEU B C   1 
ATOM   7056  O O   . LEU B 1 371 ? 22.001  -52.405 46.491  1.00 12.10 ? 371  LEU B O   1 
ATOM   7057  C CB  . LEU B 1 371 ? 22.318  -51.719 43.231  1.00 13.17 ? 371  LEU B CB  1 
ATOM   7058  C CG  . LEU B 1 371 ? 21.372  -52.925 43.099  1.00 14.62 ? 371  LEU B CG  1 
ATOM   7059  C CD1 . LEU B 1 371 ? 19.926  -52.497 43.050  1.00 15.23 ? 371  LEU B CD1 1 
ATOM   7060  C CD2 . LEU B 1 371 ? 21.696  -53.692 41.872  1.00 14.68 ? 371  LEU B CD2 1 
ATOM   7061  N N   . LEU B 1 372 ? 24.124  -52.253 45.732  1.00 11.99 ? 372  LEU B N   1 
ATOM   7062  C CA  . LEU B 1 372 ? 24.696  -53.160 46.730  1.00 12.59 ? 372  LEU B CA  1 
ATOM   7063  C C   . LEU B 1 372 ? 24.560  -52.629 48.156  1.00 12.64 ? 372  LEU B C   1 
ATOM   7064  O O   . LEU B 1 372 ? 24.170  -53.369 49.051  1.00 11.39 ? 372  LEU B O   1 
ATOM   7065  C CB  . LEU B 1 372 ? 26.158  -53.475 46.401  1.00 13.32 ? 372  LEU B CB  1 
ATOM   7066  C CG  . LEU B 1 372 ? 26.360  -54.375 45.171  1.00 14.59 ? 372  LEU B CG  1 
ATOM   7067  C CD1 . LEU B 1 372 ? 27.774  -54.225 44.639  1.00 15.16 ? 372  LEU B CD1 1 
ATOM   7068  C CD2 . LEU B 1 372 ? 26.036  -55.833 45.498  1.00 14.15 ? 372  LEU B CD2 1 
ATOM   7069  N N   . LEU B 1 373 ? 24.767  -51.320 48.330  1.00 12.87 ? 373  LEU B N   1 
ATOM   7070  C CA  . LEU B 1 373 ? 24.651  -50.669 49.639  1.00 12.70 ? 373  LEU B CA  1 
ATOM   7071  C C   . LEU B 1 373 ? 23.202  -50.752 50.133  1.00 12.48 ? 373  LEU B C   1 
ATOM   7072  O O   . LEU B 1 373 ? 22.940  -51.015 51.309  1.00 12.79 ? 373  LEU B O   1 
ATOM   7073  C CB  . LEU B 1 373 ? 25.101  -49.205 49.525  1.00 14.78 ? 373  LEU B CB  1 
ATOM   7074  C CG  . LEU B 1 373 ? 25.443  -48.417 50.790  1.00 17.29 ? 373  LEU B CG  1 
ATOM   7075  C CD1 . LEU B 1 373 ? 26.585  -49.069 51.561  1.00 17.10 ? 373  LEU B CD1 1 
ATOM   7076  C CD2 . LEU B 1 373 ? 25.791  -46.986 50.410  1.00 17.03 ? 373  LEU B CD2 1 
ATOM   7077  N N   . ALA B 1 374 ? 22.274  -50.605 49.190  1.00 11.59 ? 374  ALA B N   1 
ATOM   7078  C CA  . ALA B 1 374 ? 20.846  -50.678 49.469  1.00 9.71  ? 374  ALA B CA  1 
ATOM   7079  C C   . ALA B 1 374 ? 20.390  -52.083 49.842  1.00 10.32 ? 374  ALA B C   1 
ATOM   7080  O O   . ALA B 1 374 ? 19.640  -52.254 50.801  1.00 10.13 ? 374  ALA B O   1 
ATOM   7081  C CB  . ALA B 1 374 ? 20.080  -50.189 48.290  1.00 11.60 ? 374  ALA B CB  1 
ATOM   7082  N N   . LEU B 1 375 ? 20.896  -53.075 49.107  1.00 11.22 ? 375  LEU B N   1 
ATOM   7083  C CA  . LEU B 1 375 ? 20.557  -54.478 49.341  1.00 12.43 ? 375  LEU B CA  1 
ATOM   7084  C C   . LEU B 1 375 ? 21.118  -55.030 50.646  1.00 12.26 ? 375  LEU B C   1 
ATOM   7085  O O   . LEU B 1 375 ? 20.446  -55.814 51.320  1.00 11.89 ? 375  LEU B O   1 
ATOM   7086  C CB  . LEU B 1 375 ? 20.959  -55.346 48.150  1.00 12.18 ? 375  LEU B CB  1 
ATOM   7087  C CG  . LEU B 1 375 ? 20.206  -55.025 46.854  1.00 12.47 ? 375  LEU B CG  1 
ATOM   7088  C CD1 . LEU B 1 375 ? 20.790  -55.833 45.729  1.00 12.84 ? 375  LEU B CD1 1 
ATOM   7089  C CD2 . LEU B 1 375 ? 18.722  -55.287 46.994  1.00 14.17 ? 375  LEU B CD2 1 
ATOM   7090  N N   . VAL B 1 376 ? 22.323  -54.585 51.017  1.00 11.18 ? 376  VAL B N   1 
ATOM   7091  C CA  . VAL B 1 376 ? 22.966  -54.976 52.287  1.00 11.42 ? 376  VAL B CA  1 
ATOM   7092  C C   . VAL B 1 376 ? 22.100  -54.397 53.425  1.00 11.48 ? 376  VAL B C   1 
ATOM   7093  O O   . VAL B 1 376 ? 21.866  -55.061 54.438  1.00 11.96 ? 376  VAL B O   1 
ATOM   7094  C CB  . VAL B 1 376 ? 24.441  -54.441 52.385  1.00 11.98 ? 376  VAL B CB  1 
ATOM   7095  C CG1 . VAL B 1 376 ? 25.000  -54.559 53.815  1.00 12.03 ? 376  VAL B CG1 1 
ATOM   7096  C CG2 . VAL B 1 376 ? 25.340  -55.213 51.433  1.00 13.39 ? 376  VAL B CG2 1 
ATOM   7097  N N   . GLY B 1 377 ? 21.571  -53.191 53.194  1.00 11.09 ? 377  GLY B N   1 
ATOM   7098  C CA  . GLY B 1 377 ? 20.709  -52.523 54.159  1.00 11.76 ? 377  GLY B CA  1 
ATOM   7099  C C   . GLY B 1 377 ? 19.370  -53.224 54.338  1.00 11.45 ? 377  GLY B C   1 
ATOM   7100  O O   . GLY B 1 377 ? 18.930  -53.410 55.471  1.00 11.62 ? 377  GLY B O   1 
ATOM   7101  N N   . VAL B 1 378 ? 18.755  -53.649 53.228  1.00 10.76 ? 378  VAL B N   1 
ATOM   7102  C CA  . VAL B 1 378 ? 17.470  -54.375 53.230  1.00 11.01 ? 378  VAL B CA  1 
ATOM   7103  C C   . VAL B 1 378 ? 17.634  -55.717 53.964  1.00 10.58 ? 378  VAL B C   1 
ATOM   7104  O O   . VAL B 1 378 ? 16.748  -56.143 54.707  1.00 10.43 ? 378  VAL B O   1 
ATOM   7105  C CB  . VAL B 1 378 ? 16.936  -54.574 51.763  1.00 11.40 ? 378  VAL B CB  1 
ATOM   7106  C CG1 . VAL B 1 378 ? 15.992  -55.797 51.637  1.00 12.72 ? 378  VAL B CG1 1 
ATOM   7107  C CG2 . VAL B 1 378 ? 16.189  -53.322 51.322  1.00 12.08 ? 378  VAL B CG2 1 
ATOM   7108  N N   . TRP B 1 379 ? 18.807  -56.328 53.802  1.00 11.01 ? 379  TRP B N   1 
ATOM   7109  C CA  . TRP B 1 379 ? 19.118  -57.597 54.453  1.00 10.45 ? 379  TRP B CA  1 
ATOM   7110  C C   . TRP B 1 379 ? 19.101  -57.440 55.978  1.00 11.09 ? 379  TRP B C   1 
ATOM   7111  O O   . TRP B 1 379 ? 18.454  -58.218 56.680  1.00 12.33 ? 379  TRP B O   1 
ATOM   7112  C CB  . TRP B 1 379 ? 20.471  -58.124 53.943  1.00 10.69 ? 379  TRP B CB  1 
ATOM   7113  C CG  . TRP B 1 379 ? 20.971  -59.421 54.540  1.00 11.36 ? 379  TRP B CG  1 
ATOM   7114  C CD1 . TRP B 1 379 ? 22.145  -59.599 55.217  1.00 12.14 ? 379  TRP B CD1 1 
ATOM   7115  C CD2 . TRP B 1 379 ? 20.350  -60.716 54.470  1.00 12.14 ? 379  TRP B CD2 1 
ATOM   7116  N NE1 . TRP B 1 379 ? 22.305  -60.921 55.564  1.00 11.93 ? 379  TRP B NE1 1 
ATOM   7117  C CE2 . TRP B 1 379 ? 21.220  -61.630 55.123  1.00 11.43 ? 379  TRP B CE2 1 
ATOM   7118  C CE3 . TRP B 1 379 ? 19.142  -61.201 53.916  1.00 12.18 ? 379  TRP B CE3 1 
ATOM   7119  C CZ2 . TRP B 1 379 ? 20.925  -63.004 55.243  1.00 12.48 ? 379  TRP B CZ2 1 
ATOM   7120  C CZ3 . TRP B 1 379 ? 18.844  -62.578 54.033  1.00 12.96 ? 379  TRP B CZ3 1 
ATOM   7121  C CH2 . TRP B 1 379 ? 19.741  -63.456 54.692  1.00 12.85 ? 379  TRP B CH2 1 
ATOM   7122  N N   . TYR B 1 380 ? 19.723  -56.371 56.471  1.00 10.35 ? 380  TYR B N   1 
ATOM   7123  C CA  . TYR B 1 380 ? 19.762  -56.118 57.906  1.00 10.49 ? 380  TYR B CA  1 
ATOM   7124  C C   . TYR B 1 380 ? 18.473  -55.590 58.519  1.00 10.96 ? 380  TYR B C   1 
ATOM   7125  O O   . TYR B 1 380 ? 18.099  -56.003 59.614  1.00 11.38 ? 380  TYR B O   1 
ATOM   7126  C CB  . TYR B 1 380 ? 20.948  -55.229 58.267  1.00 11.64 ? 380  TYR B CB  1 
ATOM   7127  C CG  . TYR B 1 380 ? 22.232  -56.015 58.307  1.00 12.44 ? 380  TYR B CG  1 
ATOM   7128  C CD1 . TYR B 1 380 ? 22.422  -57.029 59.269  1.00 12.79 ? 380  TYR B CD1 1 
ATOM   7129  C CD2 . TYR B 1 380 ? 23.228  -55.823 57.332  1.00 12.79 ? 380  TYR B CD2 1 
ATOM   7130  C CE1 . TYR B 1 380 ? 23.571  -57.850 59.254  1.00 12.33 ? 380  TYR B CE1 1 
ATOM   7131  C CE2 . TYR B 1 380 ? 24.390  -56.635 57.307  1.00 13.20 ? 380  TYR B CE2 1 
ATOM   7132  C CZ  . TYR B 1 380 ? 24.544  -57.645 58.274  1.00 12.22 ? 380  TYR B CZ  1 
ATOM   7133  O OH  . TYR B 1 380 ? 25.665  -58.433 58.273  1.00 13.88 ? 380  TYR B OH  1 
ATOM   7134  N N   . ILE B 1 381 ? 17.772  -54.727 57.790  1.00 10.72 ? 381  ILE B N   1 
ATOM   7135  C CA  . ILE B 1 381 ? 16.516  -54.152 58.268  1.00 10.54 ? 381  ILE B CA  1 
ATOM   7136  C C   . ILE B 1 381 ? 15.376  -55.175 58.296  1.00 11.16 ? 381  ILE B C   1 
ATOM   7137  O O   . ILE B 1 381 ? 14.758  -55.403 59.333  1.00 12.30 ? 381  ILE B O   1 
ATOM   7138  C CB  . ILE B 1 381 ? 16.077  -52.932 57.386  1.00 11.24 ? 381  ILE B CB  1 
ATOM   7139  C CG1 . ILE B 1 381 ? 17.074  -51.781 57.542  1.00 11.45 ? 381  ILE B CG1 1 
ATOM   7140  C CG2 . ILE B 1 381 ? 14.671  -52.431 57.769  1.00 11.54 ? 381  ILE B CG2 1 
ATOM   7141  C CD1 . ILE B 1 381 ? 17.001  -50.767 56.416  1.00 12.49 ? 381  ILE B CD1 1 
ATOM   7142  N N   . ASN B 1 382 ? 15.149  -55.813 57.154  1.00 12.08 ? 382  ASN B N   1 
ATOM   7143  C CA  . ASN B 1 382 ? 14.041  -56.748 57.007  1.00 11.91 ? 382  ASN B CA  1 
ATOM   7144  C C   . ASN B 1 382 ? 14.218  -58.193 57.451  1.00 13.43 ? 382  ASN B C   1 
ATOM   7145  O O   . ASN B 1 382 ? 13.228  -58.872 57.732  1.00 14.50 ? 382  ASN B O   1 
ATOM   7146  C CB  . ASN B 1 382 ? 13.541  -56.696 55.569  1.00 12.41 ? 382  ASN B CB  1 
ATOM   7147  C CG  . ASN B 1 382 ? 13.117  -55.297 55.148  1.00 13.00 ? 382  ASN B CG  1 
ATOM   7148  O OD1 . ASN B 1 382 ? 13.693  -54.714 54.230  1.00 14.16 ? 382  ASN B OD1 1 
ATOM   7149  N ND2 . ASN B 1 382 ? 12.114  -54.751 55.827  1.00 14.35 ? 382  ASN B ND2 1 
ATOM   7150  N N   . PHE B 1 383 ? 15.458  -58.671 57.496  1.00 13.05 ? 383  PHE B N   1 
ATOM   7151  C CA  . PHE B 1 383 ? 15.701  -60.052 57.906  1.00 13.26 ? 383  PHE B CA  1 
ATOM   7152  C C   . PHE B 1 383 ? 16.316  -60.191 59.288  1.00 14.04 ? 383  PHE B C   1 
ATOM   7153  O O   . PHE B 1 383 ? 15.877  -61.038 60.063  1.00 15.64 ? 383  PHE B O   1 
ATOM   7154  C CB  . PHE B 1 383 ? 16.423  -60.817 56.797  1.00 13.10 ? 383  PHE B CB  1 
ATOM   7155  C CG  . PHE B 1 383 ? 15.612  -60.901 55.535  1.00 13.90 ? 383  PHE B CG  1 
ATOM   7156  C CD1 . PHE B 1 383 ? 14.712  -61.958 55.337  1.00 14.36 ? 383  PHE B CD1 1 
ATOM   7157  C CD2 . PHE B 1 383 ? 15.688  -59.880 54.566  1.00 12.79 ? 383  PHE B CD2 1 
ATOM   7158  C CE1 . PHE B 1 383 ? 13.891  -62.000 54.193  1.00 14.15 ? 383  PHE B CE1 1 
ATOM   7159  C CE2 . PHE B 1 383 ? 14.875  -59.910 53.422  1.00 13.07 ? 383  PHE B CE2 1 
ATOM   7160  C CZ  . PHE B 1 383 ? 13.973  -60.975 53.235  1.00 14.52 ? 383  PHE B CZ  1 
ATOM   7161  N N   . PHE B 1 384 ? 17.251  -59.302 59.630  1.00 12.48 ? 384  PHE B N   1 
ATOM   7162  C CA  . PHE B 1 384 ? 17.864  -59.301 60.961  1.00 12.91 ? 384  PHE B CA  1 
ATOM   7163  C C   . PHE B 1 384 ? 17.056  -58.451 61.944  1.00 13.34 ? 384  PHE B C   1 
ATOM   7164  O O   . PHE B 1 384 ? 17.196  -58.599 63.160  1.00 14.87 ? 384  PHE B O   1 
ATOM   7165  C CB  . PHE B 1 384 ? 19.308  -58.792 60.914  1.00 13.75 ? 384  PHE B CB  1 
ATOM   7166  C CG  . PHE B 1 384 ? 20.305  -59.830 60.507  1.00 13.97 ? 384  PHE B CG  1 
ATOM   7167  C CD1 . PHE B 1 384 ? 20.405  -60.249 59.163  1.00 15.22 ? 384  PHE B CD1 1 
ATOM   7168  C CD2 . PHE B 1 384 ? 21.150  -60.412 61.470  1.00 15.04 ? 384  PHE B CD2 1 
ATOM   7169  C CE1 . PHE B 1 384 ? 21.338  -61.250 58.785  1.00 15.84 ? 384  PHE B CE1 1 
ATOM   7170  C CE2 . PHE B 1 384 ? 22.086  -61.410 61.112  1.00 16.41 ? 384  PHE B CE2 1 
ATOM   7171  C CZ  . PHE B 1 384 ? 22.178  -61.832 59.765  1.00 16.14 ? 384  PHE B CZ  1 
ATOM   7172  N N   . GLY B 1 385 ? 16.229  -57.550 61.407  1.00 13.81 ? 385  GLY B N   1 
ATOM   7173  C CA  . GLY B 1 385 ? 15.410  -56.683 62.240  1.00 14.13 ? 385  GLY B CA  1 
ATOM   7174  C C   . GLY B 1 385 ? 16.163  -55.516 62.860  1.00 13.76 ? 385  GLY B C   1 
ATOM   7175  O O   . GLY B 1 385 ? 15.760  -55.014 63.911  1.00 14.41 ? 385  GLY B O   1 
ATOM   7176  N N   . ALA B 1 386 ? 17.260  -55.105 62.219  1.00 14.36 ? 386  ALA B N   1 
ATOM   7177  C CA  . ALA B 1 386 ? 18.086  -53.987 62.689  1.00 14.33 ? 386  ALA B CA  1 
ATOM   7178  C C   . ALA B 1 386 ? 17.444  -52.685 62.211  1.00 14.52 ? 386  ALA B C   1 
ATOM   7179  O O   . ALA B 1 386 ? 17.451  -52.383 61.018  1.00 15.87 ? 386  ALA B O   1 
ATOM   7180  C CB  . ALA B 1 386 ? 19.505  -54.120 62.149  1.00 15.91 ? 386  ALA B CB  1 
ATOM   7181  N N   . VAL B 1 387 ? 16.874  -51.932 63.152  1.00 12.96 ? 387  VAL B N   1 
ATOM   7182  C CA  . VAL B 1 387 ? 16.181  -50.684 62.831  1.00 14.25 ? 387  VAL B CA  1 
ATOM   7183  C C   . VAL B 1 387 ? 17.015  -49.407 62.911  1.00 12.83 ? 387  VAL B C   1 
ATOM   7184  O O   . VAL B 1 387 ? 16.476  -48.307 62.763  1.00 12.92 ? 387  VAL B O   1 
ATOM   7185  C CB  . VAL B 1 387 ? 14.860  -50.519 63.649  1.00 14.54 ? 387  VAL B CB  1 
ATOM   7186  C CG1 . VAL B 1 387 ? 13.907  -51.670 63.352  1.00 17.03 ? 387  VAL B CG1 1 
ATOM   7187  C CG2 . VAL B 1 387 ? 15.136  -50.432 65.139  1.00 15.71 ? 387  VAL B CG2 1 
ATOM   7188  N N   . THR B 1 388 ? 18.306  -49.546 63.209  1.00 11.98 ? 388  THR B N   1 
ATOM   7189  C CA  . THR B 1 388 ? 19.209  -48.393 63.278  1.00 11.90 ? 388  THR B CA  1 
ATOM   7190  C C   . THR B 1 388 ? 20.364  -48.583 62.306  1.00 11.51 ? 388  THR B C   1 
ATOM   7191  O O   . THR B 1 388 ? 20.680  -49.708 61.923  1.00 12.28 ? 388  THR B O   1 
ATOM   7192  C CB  . THR B 1 388 ? 19.784  -48.125 64.706  1.00 13.79 ? 388  THR B CB  1 
ATOM   7193  O OG1 . THR B 1 388 ? 20.642  -49.196 65.112  1.00 15.71 ? 388  THR B OG1 1 
ATOM   7194  C CG2 . THR B 1 388 ? 18.677  -47.972 65.711  1.00 13.65 ? 388  THR B CG2 1 
ATOM   7195  N N   . HIS B 1 389 ? 20.979  -47.470 61.914  1.00 11.83 ? 389  HIS B N   1 
ATOM   7196  C CA  . HIS B 1 389 ? 22.102  -47.473 60.983  1.00 11.43 ? 389  HIS B CA  1 
ATOM   7197  C C   . HIS B 1 389 ? 22.990  -46.278 61.329  1.00 10.55 ? 389  HIS B C   1 
ATOM   7198  O O   . HIS B 1 389 ? 22.527  -45.139 61.358  1.00 10.59 ? 389  HIS B O   1 
ATOM   7199  C CB  . HIS B 1 389 ? 21.576  -47.383 59.542  1.00 11.46 ? 389  HIS B CB  1 
ATOM   7200  C CG  . HIS B 1 389 ? 22.637  -47.486 58.491  1.00 13.84 ? 389  HIS B CG  1 
ATOM   7201  N ND1 . HIS B 1 389 ? 23.115  -48.692 58.032  1.00 15.96 ? 389  HIS B ND1 1 
ATOM   7202  C CD2 . HIS B 1 389 ? 23.305  -46.529 57.803  1.00 16.96 ? 389  HIS B CD2 1 
ATOM   7203  C CE1 . HIS B 1 389 ? 24.034  -48.476 57.108  1.00 15.89 ? 389  HIS B CE1 1 
ATOM   7204  N NE2 . HIS B 1 389 ? 24.167  -47.170 56.949  1.00 16.30 ? 389  HIS B NE2 1 
ATOM   7205  N N   . ALA B 1 390 ? 24.270  -46.552 61.570  1.00 9.34  ? 390  ALA B N   1 
ATOM   7206  C CA  . ALA B 1 390 ? 25.221  -45.510 61.925  1.00 9.62  ? 390  ALA B CA  1 
ATOM   7207  C C   . ALA B 1 390 ? 26.058  -45.014 60.750  1.00 9.99  ? 390  ALA B C   1 
ATOM   7208  O O   . ALA B 1 390 ? 26.545  -45.810 59.955  1.00 11.53 ? 390  ALA B O   1 
ATOM   7209  C CB  . ALA B 1 390 ? 26.132  -45.991 63.059  1.00 8.68  ? 390  ALA B CB  1 
ATOM   7210  N N   . ILE B 1 391 ? 26.159  -43.688 60.622  1.00 8.84  ? 391  ILE B N   1 
ATOM   7211  C CA  . ILE B 1 391 ? 26.974  -43.043 59.586  1.00 11.09 ? 391  ILE B CA  1 
ATOM   7212  C C   . ILE B 1 391 ? 28.155  -42.469 60.369  1.00 9.79  ? 391  ILE B C   1 
ATOM   7213  O O   . ILE B 1 391 ? 28.001  -41.542 61.174  1.00 9.58  ? 391  ILE B O   1 
ATOM   7214  C CB  . ILE B 1 391 ? 26.204  -41.907 58.837  1.00 11.22 ? 391  ILE B CB  1 
ATOM   7215  C CG1 . ILE B 1 391 ? 24.982  -42.467 58.083  1.00 12.59 ? 391  ILE B CG1 1 
ATOM   7216  C CG2 . ILE B 1 391 ? 27.152  -41.137 57.887  1.00 13.73 ? 391  ILE B CG2 1 
ATOM   7217  C CD1 . ILE B 1 391 ? 25.277  -43.471 56.970  1.00 13.39 ? 391  ILE B CD1 1 
ATOM   7218  N N   . LEU B 1 392 ? 29.329  -43.070 60.162  1.00 10.02 ? 392  LEU B N   1 
ATOM   7219  C CA  . LEU B 1 392 ? 30.546  -42.693 60.879  1.00 9.73  ? 392  LEU B CA  1 
ATOM   7220  C C   . LEU B 1 392 ? 31.667  -42.195 59.958  1.00 10.14 ? 392  LEU B C   1 
ATOM   7221  O O   . LEU B 1 392 ? 32.554  -42.967 59.553  1.00 11.01 ? 392  LEU B O   1 
ATOM   7222  C CB  . LEU B 1 392 ? 31.019  -43.886 61.734  1.00 10.38 ? 392  LEU B CB  1 
ATOM   7223  C CG  . LEU B 1 392 ? 29.922  -44.590 62.552  1.00 10.75 ? 392  LEU B CG  1 
ATOM   7224  C CD1 . LEU B 1 392 ? 30.363  -45.932 63.067  1.00 9.77  ? 392  LEU B CD1 1 
ATOM   7225  C CD2 . LEU B 1 392 ? 29.439  -43.690 63.673  1.00 10.58 ? 392  LEU B CD2 1 
ATOM   7226  N N   . PRO B 1 393 ? 31.651  -40.888 59.624  1.00 10.13 ? 393  PRO B N   1 
ATOM   7227  C CA  . PRO B 1 393 ? 32.687  -40.350 58.750  1.00 10.65 ? 393  PRO B CA  1 
ATOM   7228  C C   . PRO B 1 393 ? 33.988  -39.989 59.454  1.00 10.55 ? 393  PRO B C   1 
ATOM   7229  O O   . PRO B 1 393 ? 34.011  -39.189 60.389  1.00 10.94 ? 393  PRO B O   1 
ATOM   7230  C CB  . PRO B 1 393 ? 32.001  -39.141 58.128  1.00 11.02 ? 393  PRO B CB  1 
ATOM   7231  C CG  . PRO B 1 393 ? 31.155  -38.624 59.235  1.00 10.40 ? 393  PRO B CG  1 
ATOM   7232  C CD  . PRO B 1 393 ? 30.629  -39.861 59.919  1.00 10.05 ? 393  PRO B CD  1 
ATOM   7233  N N   . TYR B 1 394 ? 35.061  -40.651 59.038  1.00 10.58 ? 394  TYR B N   1 
ATOM   7234  C CA  . TYR B 1 394 ? 36.367  -40.381 59.595  1.00 10.18 ? 394  TYR B CA  1 
ATOM   7235  C C   . TYR B 1 394 ? 37.017  -39.257 58.806  1.00 10.53 ? 394  TYR B C   1 
ATOM   7236  O O   . TYR B 1 394 ? 37.950  -39.453 58.024  1.00 11.92 ? 394  TYR B O   1 
ATOM   7237  C CB  . TYR B 1 394 ? 37.228  -41.647 59.649  1.00 9.10  ? 394  TYR B CB  1 
ATOM   7238  C CG  . TYR B 1 394 ? 36.928  -42.503 60.859  1.00 9.14  ? 394  TYR B CG  1 
ATOM   7239  C CD1 . TYR B 1 394 ? 35.644  -43.054 61.052  1.00 10.66 ? 394  TYR B CD1 1 
ATOM   7240  C CD2 . TYR B 1 394 ? 37.917  -42.755 61.834  1.00 10.00 ? 394  TYR B CD2 1 
ATOM   7241  C CE1 . TYR B 1 394 ? 35.345  -43.830 62.189  1.00 10.30 ? 394  TYR B CE1 1 
ATOM   7242  C CE2 . TYR B 1 394 ? 37.628  -43.542 62.983  1.00 9.48  ? 394  TYR B CE2 1 
ATOM   7243  C CZ  . TYR B 1 394 ? 36.333  -44.070 63.148  1.00 11.89 ? 394  TYR B CZ  1 
ATOM   7244  O OH  . TYR B 1 394 ? 36.001  -44.810 64.257  1.00 12.38 ? 394  TYR B OH  1 
ATOM   7245  N N   . ASP B 1 395 ? 36.471  -38.067 59.038  1.00 11.24 ? 395  ASP B N   1 
ATOM   7246  C CA  . ASP B 1 395 ? 36.913  -36.817 58.437  1.00 12.48 ? 395  ASP B CA  1 
ATOM   7247  C C   . ASP B 1 395 ? 36.151  -35.756 59.220  1.00 12.78 ? 395  ASP B C   1 
ATOM   7248  O O   . ASP B 1 395 ? 34.914  -35.716 59.186  1.00 12.94 ? 395  ASP B O   1 
ATOM   7249  C CB  . ASP B 1 395 ? 36.558  -36.754 56.939  1.00 13.62 ? 395  ASP B CB  1 
ATOM   7250  C CG  . ASP B 1 395 ? 37.256  -35.609 56.217  1.00 15.79 ? 395  ASP B CG  1 
ATOM   7251  O OD1 . ASP B 1 395 ? 37.018  -34.441 56.578  1.00 16.61 ? 395  ASP B OD1 1 
ATOM   7252  O OD2 . ASP B 1 395 ? 38.042  -35.872 55.285  1.00 17.72 ? 395  ASP B OD2 1 
ATOM   7253  N N   . GLN B 1 396 ? 36.894  -34.902 59.923  1.00 11.70 ? 396  GLN B N   1 
ATOM   7254  C CA  . GLN B 1 396 ? 36.308  -33.834 60.731  1.00 11.65 ? 396  GLN B CA  1 
ATOM   7255  C C   . GLN B 1 396 ? 35.488  -32.824 59.917  1.00 10.34 ? 396  GLN B C   1 
ATOM   7256  O O   . GLN B 1 396 ? 34.493  -32.302 60.414  1.00 11.13 ? 396  GLN B O   1 
ATOM   7257  C CB  . GLN B 1 396 ? 37.399  -33.144 61.564  1.00 11.89 ? 396  GLN B CB  1 
ATOM   7258  C CG  . GLN B 1 396 ? 36.911  -32.146 62.620  1.00 14.95 ? 396  GLN B CG  1 
ATOM   7259  C CD  . GLN B 1 396 ? 35.895  -32.726 63.602  1.00 14.98 ? 396  GLN B CD  1 
ATOM   7260  O OE1 . GLN B 1 396 ? 35.997  -33.876 64.018  1.00 16.15 ? 396  GLN B OE1 1 
ATOM   7261  N NE2 . GLN B 1 396 ? 34.901  -31.921 63.964  1.00 19.40 ? 396  GLN B NE2 1 
ATOM   7262  N N   . TYR B 1 397 ? 35.858  -32.614 58.654  1.00 10.31 ? 397  TYR B N   1 
ATOM   7263  C CA  . TYR B 1 397 ? 35.123  -31.696 57.777  1.00 10.63 ? 397  TYR B CA  1 
ATOM   7264  C C   . TYR B 1 397 ? 33.717  -32.245 57.472  1.00 9.95  ? 397  TYR B C   1 
ATOM   7265  O O   . TYR B 1 397 ? 32.781  -31.480 57.234  1.00 10.69 ? 397  TYR B O   1 
ATOM   7266  C CB  . TYR B 1 397 ? 35.886  -31.462 56.468  1.00 10.82 ? 397  TYR B CB  1 
ATOM   7267  C CG  . TYR B 1 397 ? 37.119  -30.598 56.577  1.00 9.39  ? 397  TYR B CG  1 
ATOM   7268  C CD1 . TYR B 1 397 ? 37.068  -29.319 57.181  1.00 11.00 ? 397  TYR B CD1 1 
ATOM   7269  C CD2 . TYR B 1 397 ? 38.345  -31.037 56.041  1.00 11.61 ? 397  TYR B CD2 1 
ATOM   7270  C CE1 . TYR B 1 397 ? 38.216  -28.491 57.242  1.00 11.38 ? 397  TYR B CE1 1 
ATOM   7271  C CE2 . TYR B 1 397 ? 39.499  -30.225 56.101  1.00 12.11 ? 397  TYR B CE2 1 
ATOM   7272  C CZ  . TYR B 1 397 ? 39.425  -28.953 56.699  1.00 13.59 ? 397  TYR B CZ  1 
ATOM   7273  O OH  . TYR B 1 397 ? 40.542  -28.157 56.732  1.00 13.24 ? 397  TYR B OH  1 
ATOM   7274  N N   . LEU B 1 398 ? 33.575  -33.569 57.542  1.00 10.74 ? 398  LEU B N   1 
ATOM   7275  C CA  . LEU B 1 398 ? 32.298  -34.238 57.303  1.00 10.51 ? 398  LEU B CA  1 
ATOM   7276  C C   . LEU B 1 398 ? 31.458  -34.405 58.572  1.00 10.27 ? 398  LEU B C   1 
ATOM   7277  O O   . LEU B 1 398 ? 30.538  -35.226 58.603  1.00 11.47 ? 398  LEU B O   1 
ATOM   7278  C CB  . LEU B 1 398 ? 32.529  -35.617 56.676  1.00 11.09 ? 398  LEU B CB  1 
ATOM   7279  C CG  . LEU B 1 398 ? 32.865  -35.736 55.195  1.00 14.40 ? 398  LEU B CG  1 
ATOM   7280  C CD1 . LEU B 1 398 ? 33.113  -37.191 54.835  1.00 11.34 ? 398  LEU B CD1 1 
ATOM   7281  C CD2 . LEU B 1 398 ? 31.751  -35.157 54.338  1.00 14.38 ? 398  LEU B CD2 1 
ATOM   7282  N N   . TRP B 1 399 ? 31.721  -33.581 59.590  1.00 10.07 ? 399  TRP B N   1 
ATOM   7283  C CA  . TRP B 1 399 ? 30.998  -33.672 60.861  1.00 10.55 ? 399  TRP B CA  1 
ATOM   7284  C C   . TRP B 1 399 ? 29.481  -33.446 60.760  1.00 10.31 ? 399  TRP B C   1 
ATOM   7285  O O   . TRP B 1 399 ? 28.734  -33.867 61.645  1.00 12.19 ? 399  TRP B O   1 
ATOM   7286  C CB  . TRP B 1 399 ? 31.640  -32.771 61.936  1.00 11.67 ? 399  TRP B CB  1 
ATOM   7287  C CG  . TRP B 1 399 ? 31.356  -31.296 61.810  1.00 12.47 ? 399  TRP B CG  1 
ATOM   7288  C CD1 . TRP B 1 399 ? 31.983  -30.399 60.988  1.00 12.09 ? 399  TRP B CD1 1 
ATOM   7289  C CD2 . TRP B 1 399 ? 30.355  -30.559 62.518  1.00 16.46 ? 399  TRP B CD2 1 
ATOM   7290  N NE1 . TRP B 1 399 ? 31.432  -29.149 61.134  1.00 14.17 ? 399  TRP B NE1 1 
ATOM   7291  C CE2 . TRP B 1 399 ? 30.429  -29.211 62.063  1.00 15.76 ? 399  TRP B CE2 1 
ATOM   7292  C CE3 . TRP B 1 399 ? 29.392  -30.904 63.494  1.00 18.33 ? 399  TRP B CE3 1 
ATOM   7293  C CZ2 . TRP B 1 399 ? 29.572  -28.196 62.548  1.00 19.21 ? 399  TRP B CZ2 1 
ATOM   7294  C CZ3 . TRP B 1 399 ? 28.531  -29.890 63.984  1.00 20.20 ? 399  TRP B CZ3 1 
ATOM   7295  C CH2 . TRP B 1 399 ? 28.631  -28.550 63.501  1.00 20.27 ? 399  TRP B CH2 1 
ATOM   7296  N N   . ARG B 1 400 ? 29.045  -32.773 59.691  1.00 9.79  ? 400  ARG B N   1 
ATOM   7297  C CA  . ARG B 1 400 ? 27.619  -32.535 59.474  1.00 11.00 ? 400  ARG B CA  1 
ATOM   7298  C C   . ARG B 1 400 ? 26.960  -33.486 58.480  1.00 10.79 ? 400  ARG B C   1 
ATOM   7299  O O   . ARG B 1 400 ? 25.761  -33.369 58.200  1.00 10.85 ? 400  ARG B O   1 
ATOM   7300  C CB  . ARG B 1 400 ? 27.315  -31.067 59.132  1.00 11.99 ? 400  ARG B CB  1 
ATOM   7301  C CG  . ARG B 1 400 ? 27.251  -30.127 60.337  1.00 17.28 ? 400  ARG B CG  1 
ATOM   7302  C CD  . ARG B 1 400 ? 26.535  -30.748 61.537  1.00 22.28 ? 400  ARG B CD  1 
ATOM   7303  N NE  . ARG B 1 400 ? 25.214  -30.219 61.825  1.00 24.91 ? 400  ARG B NE  1 
ATOM   7304  C CZ  . ARG B 1 400 ? 24.432  -30.666 62.806  1.00 23.79 ? 400  ARG B CZ  1 
ATOM   7305  N NH1 . ARG B 1 400 ? 24.841  -31.649 63.601  1.00 24.92 ? 400  ARG B NH1 1 
ATOM   7306  N NH2 . ARG B 1 400 ? 23.231  -30.135 62.989  1.00 28.09 ? 400  ARG B NH2 1 
ATOM   7307  N N   . LEU B 1 401 ? 27.731  -34.472 58.007  1.00 8.66  ? 401  LEU B N   1 
ATOM   7308  C CA  . LEU B 1 401 ? 27.216  -35.489 57.085  1.00 9.28  ? 401  LEU B CA  1 
ATOM   7309  C C   . LEU B 1 401 ? 26.150  -36.398 57.739  1.00 9.61  ? 401  LEU B C   1 
ATOM   7310  O O   . LEU B 1 401 ? 25.136  -36.682 57.095  1.00 9.26  ? 401  LEU B O   1 
ATOM   7311  C CB  . LEU B 1 401 ? 28.354  -36.301 56.432  1.00 10.43 ? 401  LEU B CB  1 
ATOM   7312  C CG  . LEU B 1 401 ? 27.977  -37.379 55.411  1.00 12.34 ? 401  LEU B CG  1 
ATOM   7313  C CD1 . LEU B 1 401 ? 27.362  -36.741 54.181  1.00 12.51 ? 401  LEU B CD1 1 
ATOM   7314  C CD2 . LEU B 1 401 ? 29.180  -38.202 55.037  1.00 13.02 ? 401  LEU B CD2 1 
ATOM   7315  N N   . PRO B 1 402 ? 26.334  -36.828 59.024  1.00 9.40  ? 402  PRO B N   1 
ATOM   7316  C CA  . PRO B 1 402 ? 25.291  -37.680 59.617  1.00 9.50  ? 402  PRO B CA  1 
ATOM   7317  C C   . PRO B 1 402 ? 23.922  -36.991 59.698  1.00 9.19  ? 402  PRO B C   1 
ATOM   7318  O O   . PRO B 1 402 ? 22.910  -37.602 59.364  1.00 9.76  ? 402  PRO B O   1 
ATOM   7319  C CB  . PRO B 1 402 ? 25.844  -37.971 61.007  1.00 9.34  ? 402  PRO B CB  1 
ATOM   7320  C CG  . PRO B 1 402 ? 27.305  -38.008 60.770  1.00 8.42  ? 402  PRO B CG  1 
ATOM   7321  C CD  . PRO B 1 402 ? 27.505  -36.789 59.931  1.00 9.47  ? 402  PRO B CD  1 
ATOM   7322  N N   . ALA B 1 403 ? 23.915  -35.699 60.045  1.00 8.64  ? 403  ALA B N   1 
ATOM   7323  C CA  . ALA B 1 403 ? 22.673  -34.917 60.133  1.00 8.46  ? 403  ALA B CA  1 
ATOM   7324  C C   . ALA B 1 403 ? 22.020  -34.774 58.753  1.00 8.52  ? 403  ALA B C   1 
ATOM   7325  O O   . ALA B 1 403 ? 20.797  -34.861 58.628  1.00 9.00  ? 403  ALA B O   1 
ATOM   7326  C CB  . ALA B 1 403 ? 22.942  -33.549 60.738  1.00 9.81  ? 403  ALA B CB  1 
ATOM   7327  N N   . TYR B 1 404 ? 22.849  -34.624 57.718  1.00 8.48  ? 404  TYR B N   1 
ATOM   7328  C CA  . TYR B 1 404 ? 22.363  -34.504 56.340  1.00 7.96  ? 404  TYR B CA  1 
ATOM   7329  C C   . TYR B 1 404 ? 21.720  -35.817 55.869  1.00 8.13  ? 404  TYR B C   1 
ATOM   7330  O O   . TYR B 1 404 ? 20.641  -35.804 55.270  1.00 8.90  ? 404  TYR B O   1 
ATOM   7331  C CB  . TYR B 1 404 ? 23.506  -34.114 55.391  1.00 8.46  ? 404  TYR B CB  1 
ATOM   7332  C CG  . TYR B 1 404 ? 23.066  -33.933 53.954  1.00 8.30  ? 404  TYR B CG  1 
ATOM   7333  C CD1 . TYR B 1 404 ? 22.508  -32.722 53.523  1.00 8.99  ? 404  TYR B CD1 1 
ATOM   7334  C CD2 . TYR B 1 404 ? 23.148  -34.998 53.027  1.00 9.32  ? 404  TYR B CD2 1 
ATOM   7335  C CE1 . TYR B 1 404 ? 22.034  -32.568 52.195  1.00 9.36  ? 404  TYR B CE1 1 
ATOM   7336  C CE2 . TYR B 1 404 ? 22.673  -34.852 51.702  1.00 9.45  ? 404  TYR B CE2 1 
ATOM   7337  C CZ  . TYR B 1 404 ? 22.124  -33.628 51.298  1.00 8.89  ? 404  TYR B CZ  1 
ATOM   7338  O OH  . TYR B 1 404 ? 21.705  -33.450 50.003  1.00 9.74  ? 404  TYR B OH  1 
ATOM   7339  N N   . LEU B 1 405 ? 22.417  -36.932 56.103  1.00 10.14 ? 405  LEU B N   1 
ATOM   7340  C CA  . LEU B 1 405 ? 21.923  -38.253 55.710  1.00 11.04 ? 405  LEU B CA  1 
ATOM   7341  C C   . LEU B 1 405 ? 20.724  -38.702 56.524  1.00 12.06 ? 405  LEU B C   1 
ATOM   7342  O O   . LEU B 1 405 ? 19.920  -39.513 56.062  1.00 11.57 ? 405  LEU B O   1 
ATOM   7343  C CB  . LEU B 1 405 ? 23.039  -39.295 55.740  1.00 11.16 ? 405  LEU B CB  1 
ATOM   7344  C CG  . LEU B 1 405 ? 24.168  -39.037 54.738  1.00 11.80 ? 405  LEU B CG  1 
ATOM   7345  C CD1 . LEU B 1 405 ? 25.169  -40.144 54.849  1.00 12.06 ? 405  LEU B CD1 1 
ATOM   7346  C CD2 . LEU B 1 405 ? 23.668  -38.920 53.306  1.00 12.82 ? 405  LEU B CD2 1 
ATOM   7347  N N   . GLN B 1 406 ? 20.577  -38.098 57.702  1.00 11.94 ? 406  GLN B N   1 
ATOM   7348  C CA  . GLN B 1 406 ? 19.457  -38.343 58.602  1.00 12.38 ? 406  GLN B CA  1 
ATOM   7349  C C   . GLN B 1 406 ? 18.199  -37.812 57.913  1.00 12.45 ? 406  GLN B C   1 
ATOM   7350  O O   . GLN B 1 406 ? 17.194  -38.510 57.857  1.00 13.05 ? 406  GLN B O   1 
ATOM   7351  C CB  . GLN B 1 406 ? 19.710  -37.632 59.925  1.00 14.70 ? 406  GLN B CB  1 
ATOM   7352  C CG  . GLN B 1 406 ? 18.933  -38.108 61.112  1.00 16.64 ? 406  GLN B CG  1 
ATOM   7353  C CD  . GLN B 1 406 ? 19.458  -37.500 62.391  1.00 15.98 ? 406  GLN B CD  1 
ATOM   7354  O OE1 . GLN B 1 406 ? 19.609  -36.279 62.495  1.00 16.27 ? 406  GLN B OE1 1 
ATOM   7355  N NE2 . GLN B 1 406 ? 19.768  -38.345 63.366  1.00 13.69 ? 406  GLN B NE2 1 
ATOM   7356  N N   . GLN B 1 407 ? 18.290  -36.628 57.300  1.00 11.20 ? 407  GLN B N   1 
ATOM   7357  C CA  . GLN B 1 407 ? 17.148  -36.077 56.573  1.00 10.81 ? 407  GLN B CA  1 
ATOM   7358  C C   . GLN B 1 407 ? 16.909  -36.859 55.286  1.00 9.78  ? 407  GLN B C   1 
ATOM   7359  O O   . GLN B 1 407 ? 15.790  -37.299 55.028  1.00 11.52 ? 407  GLN B O   1 
ATOM   7360  C CB  . GLN B 1 407 ? 17.315  -34.586 56.226  1.00 12.66 ? 407  GLN B CB  1 
ATOM   7361  C CG  . GLN B 1 407 ? 16.119  -34.060 55.405  1.00 13.88 ? 407  GLN B CG  1 
ATOM   7362  C CD  . GLN B 1 407 ? 16.091  -32.569 55.160  1.00 15.74 ? 407  GLN B CD  1 
ATOM   7363  O OE1 . GLN B 1 407 ? 17.065  -31.862 55.376  1.00 18.31 ? 407  GLN B OE1 1 
ATOM   7364  N NE2 . GLN B 1 407 ? 14.951  -32.090 54.682  1.00 17.30 ? 407  GLN B NE2 1 
ATOM   7365  N N   . LEU B 1 408 ? 17.976  -37.068 54.517  1.00 9.29  ? 408  LEU B N   1 
ATOM   7366  C CA  . LEU B 1 408 ? 17.892  -37.779 53.246  1.00 8.76  ? 408  LEU B CA  1 
ATOM   7367  C C   . LEU B 1 408 ? 17.214  -39.142 53.352  1.00 9.53  ? 408  LEU B C   1 
ATOM   7368  O O   . LEU B 1 408 ? 16.268  -39.409 52.626  1.00 10.70 ? 408  LEU B O   1 
ATOM   7369  C CB  . LEU B 1 408 ? 19.287  -37.933 52.616  1.00 8.82  ? 408  LEU B CB  1 
ATOM   7370  C CG  . LEU B 1 408 ? 19.375  -38.665 51.268  1.00 10.94 ? 408  LEU B CG  1 
ATOM   7371  C CD1 . LEU B 1 408 ? 18.532  -37.949 50.243  1.00 12.00 ? 408  LEU B CD1 1 
ATOM   7372  C CD2 . LEU B 1 408 ? 20.805  -38.742 50.805  1.00 9.64  ? 408  LEU B CD2 1 
ATOM   7373  N N   . ASP B 1 409 ? 17.662  -39.953 54.305  1.00 9.07  ? 409  ASP B N   1 
ATOM   7374  C CA  . ASP B 1 409 ? 17.118  -41.292 54.492  1.00 9.77  ? 409  ASP B CA  1 
ATOM   7375  C C   . ASP B 1 409 ? 15.787  -41.319 55.241  1.00 9.64  ? 409  ASP B C   1 
ATOM   7376  O O   . ASP B 1 409 ? 14.804  -41.856 54.726  1.00 10.82 ? 409  ASP B O   1 
ATOM   7377  C CB  . ASP B 1 409 ? 18.160  -42.168 55.208  1.00 10.71 ? 409  ASP B CB  1 
ATOM   7378  C CG  . ASP B 1 409 ? 17.919  -43.672 55.030  1.00 13.36 ? 409  ASP B CG  1 
ATOM   7379  O OD1 . ASP B 1 409 ? 16.753  -44.111 54.961  1.00 13.95 ? 409  ASP B OD1 1 
ATOM   7380  O OD2 . ASP B 1 409 ? 18.917  -44.418 54.974  1.00 15.09 ? 409  ASP B OD2 1 
ATOM   7381  N N   . MET B 1 410 ? 15.747  -40.701 56.420  1.00 9.03  ? 410  MET B N   1 
ATOM   7382  C CA  . MET B 1 410 ? 14.542  -40.722 57.250  1.00 9.35  ? 410  MET B CA  1 
ATOM   7383  C C   . MET B 1 410 ? 13.319  -40.003 56.706  1.00 8.87  ? 410  MET B C   1 
ATOM   7384  O O   . MET B 1 410 ? 12.204  -40.513 56.831  1.00 9.26  ? 410  MET B O   1 
ATOM   7385  C CB  . MET B 1 410 ? 14.858  -40.288 58.680  1.00 8.88  ? 410  MET B CB  1 
ATOM   7386  C CG  . MET B 1 410 ? 15.891  -41.183 59.363  1.00 10.01 ? 410  MET B CG  1 
ATOM   7387  S SD  . MET B 1 410 ? 16.401  -40.616 60.987  1.00 10.48 ? 410  MET B SD  1 
ATOM   7388  C CE  . MET B 1 410 ? 14.975  -41.038 61.980  1.00 13.27 ? 410  MET B CE  1 
ATOM   7389  N N   . GLU B 1 411 ? 13.521  -38.859 56.055  1.00 8.26  ? 411  GLU B N   1 
ATOM   7390  C CA  . GLU B 1 411 ? 12.384  -38.136 55.492  1.00 7.97  ? 411  GLU B CA  1 
ATOM   7391  C C   . GLU B 1 411 ? 11.907  -38.787 54.193  1.00 7.86  ? 411  GLU B C   1 
ATOM   7392  O O   . GLU B 1 411 ? 10.726  -38.707 53.847  1.00 9.63  ? 411  GLU B O   1 
ATOM   7393  C CB  . GLU B 1 411 ? 12.695  -36.650 55.297  1.00 10.32 ? 411  GLU B CB  1 
ATOM   7394  C CG  . GLU B 1 411 ? 11.456  -35.778 55.121  1.00 15.03 ? 411  GLU B CG  1 
ATOM   7395  C CD  . GLU B 1 411 ? 11.766  -34.306 55.128  1.00 18.81 ? 411  GLU B CD  1 
ATOM   7396  O OE1 . GLU B 1 411 ? 12.468  -33.849 54.209  1.00 21.02 ? 411  GLU B OE1 1 
ATOM   7397  O OE2 . GLU B 1 411 ? 11.308  -33.608 56.057  1.00 21.34 ? 411  GLU B OE2 1 
ATOM   7398  N N   . SER B 1 412 ? 12.822  -39.466 53.504  1.00 8.22  ? 412  SER B N   1 
ATOM   7399  C CA  . SER B 1 412 ? 12.475  -40.154 52.270  1.00 8.51  ? 412  SER B CA  1 
ATOM   7400  C C   . SER B 1 412 ? 11.775  -41.474 52.524  1.00 8.36  ? 412  SER B C   1 
ATOM   7401  O O   . SER B 1 412 ? 10.672  -41.709 52.029  1.00 9.01  ? 412  SER B O   1 
ATOM   7402  C CB  . SER B 1 412 ? 13.708  -40.448 51.420  1.00 9.94  ? 412  SER B CB  1 
ATOM   7403  O OG  . SER B 1 412 ? 14.285  -39.295 50.830  1.00 9.06  ? 412  SER B OG  1 
ATOM   7404  N N   . ASN B 1 413 ? 12.405  -42.308 53.345  1.00 9.26  ? 413  ASN B N   1 
ATOM   7405  C CA  . ASN B 1 413 ? 11.892  -43.644 53.598  1.00 8.73  ? 413  ASN B CA  1 
ATOM   7406  C C   . ASN B 1 413 ? 11.156  -43.954 54.889  1.00 9.21  ? 413  ASN B C   1 
ATOM   7407  O O   . ASN B 1 413 ? 10.824  -45.112 55.150  1.00 8.27  ? 413  ASN B O   1 
ATOM   7408  C CB  . ASN B 1 413 ? 12.986  -44.672 53.290  1.00 8.79  ? 413  ASN B CB  1 
ATOM   7409  C CG  . ASN B 1 413 ? 13.397  -44.662 51.818  1.00 9.75  ? 413  ASN B CG  1 
ATOM   7410  O OD1 . ASN B 1 413 ? 12.687  -44.122 50.968  1.00 12.16 ? 413  ASN B OD1 1 
ATOM   7411  N ND2 . ASN B 1 413 ? 14.550  -45.239 51.519  1.00 10.93 ? 413  ASN B ND2 1 
ATOM   7412  N N   . GLY B 1 414 ? 10.839  -42.914 55.657  1.00 9.70  ? 414  GLY B N   1 
ATOM   7413  C CA  . GLY B 1 414 ? 10.086  -43.097 56.888  1.00 10.08 ? 414  GLY B CA  1 
ATOM   7414  C C   . GLY B 1 414 ? 8.616   -43.033 56.545  1.00 10.14 ? 414  GLY B C   1 
ATOM   7415  O O   . GLY B 1 414 ? 7.919   -42.076 56.883  1.00 10.40 ? 414  GLY B O   1 
ATOM   7416  N N   . LYS B 1 415 ? 8.166   -44.063 55.827  1.00 10.38 ? 415  LYS B N   1 
ATOM   7417  C CA  . LYS B 1 415 ? 6.796   -44.163 55.328  1.00 10.45 ? 415  LYS B CA  1 
ATOM   7418  C C   . LYS B 1 415 ? 6.174   -45.511 55.672  1.00 10.90 ? 415  LYS B C   1 
ATOM   7419  O O   . LYS B 1 415 ? 6.887   -46.499 55.868  1.00 10.66 ? 415  LYS B O   1 
ATOM   7420  C CB  . LYS B 1 415 ? 6.787   -44.031 53.792  1.00 10.98 ? 415  LYS B CB  1 
ATOM   7421  C CG  . LYS B 1 415 ? 7.625   -42.893 53.183  1.00 12.18 ? 415  LYS B CG  1 
ATOM   7422  C CD  . LYS B 1 415 ? 7.020   -41.530 53.449  1.00 12.55 ? 415  LYS B CD  1 
ATOM   7423  C CE  . LYS B 1 415 ? 7.996   -40.412 53.109  1.00 11.47 ? 415  LYS B CE  1 
ATOM   7424  N NZ  . LYS B 1 415 ? 8.315   -40.267 51.663  1.00 10.31 ? 415  LYS B NZ  1 
ATOM   7425  N N   . TYR B 1 416 ? 4.844   -45.544 55.756  1.00 12.15 ? 416  TYR B N   1 
ATOM   7426  C CA  . TYR B 1 416 ? 4.148   -46.798 56.024  1.00 13.76 ? 416  TYR B CA  1 
ATOM   7427  C C   . TYR B 1 416 ? 3.057   -47.167 55.019  1.00 14.61 ? 416  TYR B C   1 
ATOM   7428  O O   . TYR B 1 416 ? 2.345   -48.158 55.198  1.00 14.58 ? 416  TYR B O   1 
ATOM   7429  C CB  . TYR B 1 416 ? 3.680   -46.932 57.491  1.00 15.49 ? 416  TYR B CB  1 
ATOM   7430  C CG  . TYR B 1 416 ? 2.871   -45.813 58.129  1.00 19.18 ? 416  TYR B CG  1 
ATOM   7431  C CD1 . TYR B 1 416 ? 2.070   -44.931 57.369  1.00 18.75 ? 416  TYR B CD1 1 
ATOM   7432  C CD2 . TYR B 1 416 ? 2.881   -45.655 59.531  1.00 21.04 ? 416  TYR B CD2 1 
ATOM   7433  C CE1 . TYR B 1 416 ? 1.296   -43.924 57.991  1.00 19.41 ? 416  TYR B CE1 1 
ATOM   7434  C CE2 . TYR B 1 416 ? 2.113   -44.658 60.162  1.00 22.16 ? 416  TYR B CE2 1 
ATOM   7435  C CZ  . TYR B 1 416 ? 1.323   -43.799 59.389  1.00 22.20 ? 416  TYR B CZ  1 
ATOM   7436  O OH  . TYR B 1 416 ? 0.567   -42.834 60.007  1.00 25.10 ? 416  TYR B OH  1 
ATOM   7437  N N   . VAL B 1 417 ? 2.941   -46.361 53.963  1.00 14.08 ? 417  VAL B N   1 
ATOM   7438  C CA  . VAL B 1 417 ? 1.959   -46.588 52.902  1.00 15.29 ? 417  VAL B CA  1 
ATOM   7439  C C   . VAL B 1 417 ? 2.690   -46.737 51.562  1.00 15.54 ? 417  VAL B C   1 
ATOM   7440  O O   . VAL B 1 417 ? 3.617   -45.982 51.262  1.00 16.29 ? 417  VAL B O   1 
ATOM   7441  C CB  . VAL B 1 417 ? 0.907   -45.427 52.809  1.00 16.43 ? 417  VAL B CB  1 
ATOM   7442  C CG1 . VAL B 1 417 ? -0.156  -45.750 51.766  1.00 16.21 ? 417  VAL B CG1 1 
ATOM   7443  C CG2 . VAL B 1 417 ? 0.216   -45.213 54.145  1.00 17.13 ? 417  VAL B CG2 1 
ATOM   7444  N N   . THR B 1 418 ? 2.275   -47.731 50.776  1.00 15.64 ? 418  THR B N   1 
ATOM   7445  C CA  . THR B 1 418 ? 2.855   -47.986 49.455  1.00 15.45 ? 418  THR B CA  1 
ATOM   7446  C C   . THR B 1 418 ? 2.248   -47.026 48.427  1.00 15.73 ? 418  THR B C   1 
ATOM   7447  O O   . THR B 1 418 ? 1.215   -46.409 48.696  1.00 15.32 ? 418  THR B O   1 
ATOM   7448  C CB  . THR B 1 418 ? 2.587   -49.439 48.976  1.00 16.16 ? 418  THR B CB  1 
ATOM   7449  O OG1 . THR B 1 418 ? 1.177   -49.655 48.832  1.00 17.20 ? 418  THR B OG1 1 
ATOM   7450  C CG2 . THR B 1 418 ? 3.157   -50.441 49.955  1.00 14.71 ? 418  THR B CG2 1 
ATOM   7451  N N   . ARG B 1 419 ? 2.861   -46.941 47.243  1.00 17.00 ? 419  ARG B N   1 
ATOM   7452  C CA  . ARG B 1 419 ? 2.367   -46.079 46.153  1.00 18.97 ? 419  ARG B CA  1 
ATOM   7453  C C   . ARG B 1 419 ? 0.993   -46.526 45.634  1.00 20.63 ? 419  ARG B C   1 
ATOM   7454  O O   . ARG B 1 419 ? 0.252   -45.731 45.046  1.00 21.07 ? 419  ARG B O   1 
ATOM   7455  C CB  . ARG B 1 419 ? 3.359   -46.036 44.987  1.00 19.59 ? 419  ARG B CB  1 
ATOM   7456  C CG  . ARG B 1 419 ? 4.672   -45.344 45.309  1.00 21.65 ? 419  ARG B CG  1 
ATOM   7457  C CD  . ARG B 1 419 ? 5.451   -44.969 44.054  1.00 24.10 ? 419  ARG B CD  1 
ATOM   7458  N NE  . ARG B 1 419 ? 5.760   -46.123 43.212  1.00 25.40 ? 419  ARG B NE  1 
ATOM   7459  C CZ  . ARG B 1 419 ? 6.005   -46.068 41.904  1.00 27.76 ? 419  ARG B CZ  1 
ATOM   7460  N NH1 . ARG B 1 419 ? 5.984   -44.911 41.251  1.00 27.67 ? 419  ARG B NH1 1 
ATOM   7461  N NH2 . ARG B 1 419 ? 6.271   -47.186 41.238  1.00 28.65 ? 419  ARG B NH2 1 
ATOM   7462  N N   . SER B 1 420 ? 0.659   -47.792 45.888  1.00 22.43 ? 420  SER B N   1 
ATOM   7463  C CA  . SER B 1 420 ? -0.621  -48.377 45.487  1.00 24.19 ? 420  SER B CA  1 
ATOM   7464  C C   . SER B 1 420 ? -1.737  -48.062 46.496  1.00 24.27 ? 420  SER B C   1 
ATOM   7465  O O   . SER B 1 420 ? -2.913  -48.343 46.241  1.00 26.24 ? 420  SER B O   1 
ATOM   7466  C CB  . SER B 1 420 ? -0.476  -49.893 45.290  1.00 24.43 ? 420  SER B CB  1 
ATOM   7467  O OG  . SER B 1 420 ? 0.071   -50.522 46.438  1.00 26.65 ? 420  SER B OG  1 
ATOM   7468  N N   . GLY B 1 421 ? -1.355  -47.473 47.632  1.00 23.97 ? 421  GLY B N   1 
ATOM   7469  C CA  . GLY B 1 421 ? -2.308  -47.101 48.668  1.00 23.69 ? 421  GLY B CA  1 
ATOM   7470  C C   . GLY B 1 421 ? -2.544  -48.111 49.776  1.00 23.37 ? 421  GLY B C   1 
ATOM   7471  O O   . GLY B 1 421 ? -3.518  -47.990 50.525  1.00 24.16 ? 421  GLY B O   1 
ATOM   7472  N N   . LYS B 1 422 ? -1.658  -49.102 49.891  1.00 21.93 ? 422  LYS B N   1 
ATOM   7473  C CA  . LYS B 1 422 ? -1.779  -50.142 50.916  1.00 21.53 ? 422  LYS B CA  1 
ATOM   7474  C C   . LYS B 1 422 ? -0.768  -49.928 52.036  1.00 20.00 ? 422  LYS B C   1 
ATOM   7475  O O   . LYS B 1 422 ? 0.246   -49.265 51.834  1.00 19.52 ? 422  LYS B O   1 
ATOM   7476  C CB  . LYS B 1 422 ? -1.527  -51.533 50.312  1.00 23.26 ? 422  LYS B CB  1 
ATOM   7477  C CG  . LYS B 1 422 ? -2.301  -51.908 49.052  1.00 27.36 ? 422  LYS B CG  1 
ATOM   7478  C CD  . LYS B 1 422 ? -3.789  -51.598 49.143  1.00 29.86 ? 422  LYS B CD  1 
ATOM   7479  C CE  . LYS B 1 422 ? -4.594  -52.501 48.227  1.00 32.57 ? 422  LYS B CE  1 
ATOM   7480  N NZ  . LYS B 1 422 ? -3.832  -52.955 47.029  1.00 34.20 ? 422  LYS B NZ  1 
ATOM   7481  N N   . THR B 1 423 ? -1.027  -50.513 53.207  1.00 18.58 ? 423  THR B N   1 
ATOM   7482  C CA  . THR B 1 423 ? -0.096  -50.404 54.333  1.00 17.89 ? 423  THR B CA  1 
ATOM   7483  C C   . THR B 1 423 ? 1.045   -51.398 54.098  1.00 16.51 ? 423  THR B C   1 
ATOM   7484  O O   . THR B 1 423 ? 0.809   -52.503 53.597  1.00 16.82 ? 423  THR B O   1 
ATOM   7485  C CB  . THR B 1 423 ? -0.772  -50.694 55.701  1.00 18.41 ? 423  THR B CB  1 
ATOM   7486  O OG1 . THR B 1 423 ? -1.195  -52.063 55.765  1.00 22.24 ? 423  THR B OG1 1 
ATOM   7487  C CG2 . THR B 1 423 ? -1.969  -49.783 55.912  1.00 20.78 ? 423  THR B CG2 1 
ATOM   7488  N N   . VAL B 1 424 ? 2.277   -50.994 54.408  1.00 14.57 ? 424  VAL B N   1 
ATOM   7489  C CA  . VAL B 1 424 ? 3.435   -51.874 54.221  1.00 14.92 ? 424  VAL B CA  1 
ATOM   7490  C C   . VAL B 1 424 ? 3.397   -53.071 55.171  1.00 14.73 ? 424  VAL B C   1 
ATOM   7491  O O   . VAL B 1 424 ? 2.884   -52.973 56.290  1.00 15.87 ? 424  VAL B O   1 
ATOM   7492  C CB  . VAL B 1 424 ? 4.796   -51.130 54.388  1.00 13.83 ? 424  VAL B CB  1 
ATOM   7493  C CG1 . VAL B 1 424 ? 4.911   -50.011 53.373  1.00 14.72 ? 424  VAL B CG1 1 
ATOM   7494  C CG2 . VAL B 1 424 ? 4.965   -50.595 55.807  1.00 14.28 ? 424  VAL B CG2 1 
ATOM   7495  N N   . SER B 1 425 ? 3.891   -54.207 54.690  1.00 16.90 ? 425  SER B N   1 
ATOM   7496  C CA  . SER B 1 425 ? 3.932   -55.421 55.496  1.00 16.96 ? 425  SER B CA  1 
ATOM   7497  C C   . SER B 1 425 ? 5.344   -55.697 56.000  1.00 16.97 ? 425  SER B C   1 
ATOM   7498  O O   . SER B 1 425 ? 5.594   -56.712 56.652  1.00 18.32 ? 425  SER B O   1 
ATOM   7499  C CB  . SER B 1 425 ? 3.383   -56.608 54.700  1.00 18.91 ? 425  SER B CB  1 
ATOM   7500  O OG  . SER B 1 425 ? 1.978   -56.486 54.543  1.00 20.76 ? 425  SER B OG  1 
ATOM   7501  N N   . THR B 1 426 ? 6.268   -54.791 55.668  1.00 15.33 ? 426  THR B N   1 
ATOM   7502  C CA  . THR B 1 426 ? 7.664   -54.897 56.087  1.00 13.96 ? 426  THR B CA  1 
ATOM   7503  C C   . THR B 1 426 ? 8.085   -53.597 56.756  1.00 13.06 ? 426  THR B C   1 
ATOM   7504  O O   . THR B 1 426 ? 7.404   -52.572 56.633  1.00 13.05 ? 426  THR B O   1 
ATOM   7505  C CB  . THR B 1 426 ? 8.646   -55.130 54.883  1.00 14.37 ? 426  THR B CB  1 
ATOM   7506  O OG1 . THR B 1 426 ? 8.752   -53.936 54.088  1.00 15.80 ? 426  THR B OG1 1 
ATOM   7507  C CG2 . THR B 1 426 ? 8.179   -56.271 54.001  1.00 15.33 ? 426  THR B CG2 1 
ATOM   7508  N N   . LEU B 1 427 ? 9.222   -53.642 57.445  1.00 11.92 ? 427  LEU B N   1 
ATOM   7509  C CA  . LEU B 1 427 ? 9.790   -52.451 58.066  1.00 12.31 ? 427  LEU B CA  1 
ATOM   7510  C C   . LEU B 1 427 ? 10.363  -51.612 56.932  1.00 11.19 ? 427  LEU B C   1 
ATOM   7511  O O   . LEU B 1 427 ? 10.729  -52.151 55.876  1.00 11.97 ? 427  LEU B O   1 
ATOM   7512  C CB  . LEU B 1 427 ? 10.911  -52.812 59.040  1.00 13.52 ? 427  LEU B CB  1 
ATOM   7513  C CG  . LEU B 1 427 ? 10.542  -53.453 60.378  1.00 15.26 ? 427  LEU B CG  1 
ATOM   7514  C CD1 . LEU B 1 427 ? 11.819  -53.693 61.157  1.00 16.84 ? 427  LEU B CD1 1 
ATOM   7515  C CD2 . LEU B 1 427 ? 9.588   -52.571 61.178  1.00 17.18 ? 427  LEU B CD2 1 
ATOM   7516  N N   . THR B 1 428 ? 10.328  -50.294 57.101  1.00 9.79  ? 428  THR B N   1 
ATOM   7517  C CA  . THR B 1 428 ? 10.867  -49.413 56.087  1.00 11.27 ? 428  THR B CA  1 
ATOM   7518  C C   . THR B 1 428 ? 12.146  -48.731 56.571  1.00 10.28 ? 428  THR B C   1 
ATOM   7519  O O   . THR B 1 428 ? 13.016  -49.399 57.132  1.00 10.15 ? 428  THR B O   1 
ATOM   7520  C CB  . THR B 1 428 ? 9.813   -48.414 55.526  1.00 11.37 ? 428  THR B CB  1 
ATOM   7521  O OG1 . THR B 1 428 ? 9.242   -47.660 56.598  1.00 10.67 ? 428  THR B OG1 1 
ATOM   7522  C CG2 . THR B 1 428 ? 8.716   -49.154 54.748  1.00 12.91 ? 428  THR B CG2 1 
ATOM   7523  N N   . GLY B 1 429 ? 12.267  -47.420 56.349  1.00 9.99  ? 429  GLY B N   1 
ATOM   7524  C CA  . GLY B 1 429 ? 13.462  -46.679 56.731  1.00 10.27 ? 429  GLY B CA  1 
ATOM   7525  C C   . GLY B 1 429 ? 13.939  -46.793 58.167  1.00 10.44 ? 429  GLY B C   1 
ATOM   7526  O O   . GLY B 1 429 ? 13.117  -46.791 59.088  1.00 10.88 ? 429  GLY B O   1 
ATOM   7527  N N   . PRO B 1 430 ? 15.263  -46.938 58.384  1.00 11.48 ? 430  PRO B N   1 
ATOM   7528  C CA  . PRO B 1 430 ? 15.801  -47.052 59.740  1.00 12.07 ? 430  PRO B CA  1 
ATOM   7529  C C   . PRO B 1 430 ? 16.108  -45.686 60.365  1.00 11.89 ? 430  PRO B C   1 
ATOM   7530  O O   . PRO B 1 430 ? 16.010  -44.648 59.700  1.00 11.75 ? 430  PRO B O   1 
ATOM   7531  C CB  . PRO B 1 430 ? 17.082  -47.852 59.510  1.00 12.14 ? 430  PRO B CB  1 
ATOM   7532  C CG  . PRO B 1 430 ? 17.589  -47.296 58.223  1.00 12.73 ? 430  PRO B CG  1 
ATOM   7533  C CD  . PRO B 1 430 ? 16.330  -47.147 57.379  1.00 12.55 ? 430  PRO B CD  1 
ATOM   7534  N N   . ILE B 1 431 ? 16.451  -45.699 61.651  1.00 10.86 ? 431  ILE B N   1 
ATOM   7535  C CA  . ILE B 1 431 ? 16.842  -44.481 62.351  1.00 9.96  ? 431  ILE B CA  1 
ATOM   7536  C C   . ILE B 1 431 ? 18.329  -44.315 62.047  1.00 10.62 ? 431  ILE B C   1 
ATOM   7537  O O   . ILE B 1 431 ? 19.117  -45.241 62.230  1.00 11.60 ? 431  ILE B O   1 
ATOM   7538  C CB  . ILE B 1 431 ? 16.629  -44.577 63.896  1.00 9.64  ? 431  ILE B CB  1 
ATOM   7539  C CG1 . ILE B 1 431 ? 15.142  -44.510 64.235  1.00 12.29 ? 431  ILE B CG1 1 
ATOM   7540  C CG2 . ILE B 1 431 ? 17.348  -43.441 64.623  1.00 11.50 ? 431  ILE B CG2 1 
ATOM   7541  C CD1 . ILE B 1 431 ? 14.422  -45.828 64.117  1.00 13.86 ? 431  ILE B CD1 1 
ATOM   7542  N N   . ILE B 1 432 ? 18.684  -43.135 61.550  1.00 9.96  ? 432  ILE B N   1 
ATOM   7543  C CA  . ILE B 1 432 ? 20.066  -42.807 61.218  1.00 10.14 ? 432  ILE B CA  1 
ATOM   7544  C C   . ILE B 1 432 ? 20.648  -41.950 62.338  1.00 10.72 ? 432  ILE B C   1 
ATOM   7545  O O   . ILE B 1 432 ? 19.978  -41.063 62.861  1.00 11.23 ? 432  ILE B O   1 
ATOM   7546  C CB  . ILE B 1 432 ? 20.154  -42.011 59.880  1.00 9.63  ? 432  ILE B CB  1 
ATOM   7547  C CG1 . ILE B 1 432 ? 19.532  -42.798 58.717  1.00 11.67 ? 432  ILE B CG1 1 
ATOM   7548  C CG2 . ILE B 1 432 ? 21.604  -41.589 59.568  1.00 11.01 ? 432  ILE B CG2 1 
ATOM   7549  C CD1 . ILE B 1 432 ? 20.279  -44.049 58.276  1.00 15.08 ? 432  ILE B CD1 1 
ATOM   7550  N N   . PHE B 1 433 ? 21.892  -42.251 62.708  1.00 10.79 ? 433  PHE B N   1 
ATOM   7551  C CA  . PHE B 1 433 ? 22.623  -41.501 63.726  1.00 10.24 ? 433  PHE B CA  1 
ATOM   7552  C C   . PHE B 1 433 ? 24.119  -41.633 63.463  1.00 10.31 ? 433  PHE B C   1 
ATOM   7553  O O   . PHE B 1 433 ? 24.546  -42.449 62.647  1.00 10.58 ? 433  PHE B O   1 
ATOM   7554  C CB  . PHE B 1 433 ? 22.281  -41.974 65.159  1.00 10.07 ? 433  PHE B CB  1 
ATOM   7555  C CG  . PHE B 1 433 ? 22.931  -43.278 65.567  1.00 10.87 ? 433  PHE B CG  1 
ATOM   7556  C CD1 . PHE B 1 433 ? 22.449  -44.504 65.075  1.00 11.43 ? 433  PHE B CD1 1 
ATOM   7557  C CD2 . PHE B 1 433 ? 24.026  -43.280 66.454  1.00 11.62 ? 433  PHE B CD2 1 
ATOM   7558  C CE1 . PHE B 1 433 ? 23.043  -45.719 65.461  1.00 12.92 ? 433  PHE B CE1 1 
ATOM   7559  C CE2 . PHE B 1 433 ? 24.631  -44.489 66.849  1.00 13.10 ? 433  PHE B CE2 1 
ATOM   7560  C CZ  . PHE B 1 433 ? 24.140  -45.710 66.353  1.00 12.44 ? 433  PHE B CZ  1 
ATOM   7561  N N   . GLY B 1 434 ? 24.893  -40.835 64.191  1.00 10.39 ? 434  GLY B N   1 
ATOM   7562  C CA  . GLY B 1 434 ? 26.332  -40.872 64.069  1.00 10.34 ? 434  GLY B CA  1 
ATOM   7563  C C   . GLY B 1 434 ? 26.976  -39.531 64.294  1.00 10.81 ? 434  GLY B C   1 
ATOM   7564  O O   . GLY B 1 434 ? 26.310  -38.484 64.358  1.00 11.78 ? 434  GLY B O   1 
ATOM   7565  N N   . GLU B 1 435 ? 28.301  -39.602 64.432  1.00 11.33 ? 435  GLU B N   1 
ATOM   7566  C CA  . GLU B 1 435 ? 29.202  -38.478 64.646  1.00 12.38 ? 435  GLU B CA  1 
ATOM   7567  C C   . GLU B 1 435 ? 30.530  -38.812 63.973  1.00 12.06 ? 435  GLU B C   1 
ATOM   7568  O O   . GLU B 1 435 ? 30.832  -39.984 63.716  1.00 11.58 ? 435  GLU B O   1 
ATOM   7569  C CB  . GLU B 1 435 ? 29.425  -38.249 66.148  1.00 15.22 ? 435  GLU B CB  1 
ATOM   7570  C CG  . GLU B 1 435 ? 28.197  -37.690 66.887  1.00 18.79 ? 435  GLU B CG  1 
ATOM   7571  C CD  . GLU B 1 435 ? 27.891  -36.225 66.535  1.00 22.41 ? 435  GLU B CD  1 
ATOM   7572  O OE1 . GLU B 1 435 ? 28.765  -35.549 65.941  1.00 26.61 ? 435  GLU B OE1 1 
ATOM   7573  O OE2 . GLU B 1 435 ? 26.785  -35.738 66.871  1.00 24.88 ? 435  GLU B OE2 1 
ATOM   7574  N N   . ALA B 1 436 ? 31.320  -37.779 63.692  1.00 11.30 ? 436  ALA B N   1 
ATOM   7575  C CA  . ALA B 1 436 ? 32.623  -37.938 63.054  1.00 12.05 ? 436  ALA B CA  1 
ATOM   7576  C C   . ALA B 1 436 ? 33.613  -38.713 63.924  1.00 12.60 ? 436  ALA B C   1 
ATOM   7577  O O   . ALA B 1 436 ? 33.699  -38.475 65.133  1.00 13.61 ? 436  ALA B O   1 
ATOM   7578  C CB  . ALA B 1 436 ? 33.208  -36.565 62.715  1.00 11.70 ? 436  ALA B CB  1 
ATOM   7579  N N   . GLY B 1 437 ? 34.331  -39.647 63.288  1.00 11.15 ? 437  GLY B N   1 
ATOM   7580  C CA  . GLY B 1 437 ? 35.372  -40.448 63.940  1.00 11.66 ? 437  GLY B CA  1 
ATOM   7581  C C   . GLY B 1 437 ? 36.576  -39.523 64.125  1.00 11.57 ? 437  GLY B C   1 
ATOM   7582  O O   . GLY B 1 437 ? 36.676  -38.577 63.377  1.00 13.31 ? 437  GLY B O   1 
ATOM   7583  N N   . THR B 1 438 ? 37.424  -39.709 65.140  1.00 12.12 ? 438  THR B N   1 
ATOM   7584  C CA  . THR B 1 438 ? 37.317  -40.777 66.139  1.00 12.17 ? 438  THR B CA  1 
ATOM   7585  C C   . THR B 1 438 ? 36.485  -40.459 67.373  1.00 13.89 ? 438  THR B C   1 
ATOM   7586  O O   . THR B 1 438 ? 36.396  -41.279 68.286  1.00 13.55 ? 438  THR B O   1 
ATOM   7587  C CB  . THR B 1 438 ? 38.715  -41.129 66.717  1.00 13.28 ? 438  THR B CB  1 
ATOM   7588  O OG1 . THR B 1 438 ? 39.164  -40.044 67.534  1.00 14.05 ? 438  THR B OG1 1 
ATOM   7589  C CG2 . THR B 1 438 ? 39.752  -41.393 65.653  1.00 13.94 ? 438  THR B CG2 1 
ATOM   7590  N N   . ASN B 1 439 ? 35.901  -39.266 67.427  1.00 13.94 ? 439  ASN B N   1 
ATOM   7591  C CA  . ASN B 1 439 ? 35.122  -38.838 68.594  1.00 15.51 ? 439  ASN B CA  1 
ATOM   7592  C C   . ASN B 1 439 ? 34.074  -39.844 69.067  1.00 15.03 ? 439  ASN B C   1 
ATOM   7593  O O   . ASN B 1 439 ? 33.904  -40.066 70.273  1.00 15.84 ? 439  ASN B O   1 
ATOM   7594  C CB  . ASN B 1 439 ? 34.444  -37.500 68.305  1.00 16.22 ? 439  ASN B CB  1 
ATOM   7595  C CG  . ASN B 1 439 ? 35.442  -36.385 68.026  1.00 17.53 ? 439  ASN B CG  1 
ATOM   7596  O OD1 . ASN B 1 439 ? 36.165  -36.433 67.044  1.00 17.84 ? 439  ASN B OD1 1 
ATOM   7597  N ND2 . ASN B 1 439 ? 35.466  -35.375 68.883  1.00 17.90 ? 439  ASN B ND2 1 
ATOM   7598  N N   . GLY B 1 440 ? 33.422  -40.481 68.094  1.00 14.93 ? 440  GLY B N   1 
ATOM   7599  C CA  . GLY B 1 440 ? 32.381  -41.461 68.365  1.00 14.95 ? 440  GLY B CA  1 
ATOM   7600  C C   . GLY B 1 440 ? 32.842  -42.634 69.207  1.00 14.56 ? 440  GLY B C   1 
ATOM   7601  O O   . GLY B 1 440 ? 32.063  -43.224 69.968  1.00 14.56 ? 440  GLY B O   1 
ATOM   7602  N N   . GLN B 1 441 ? 34.126  -42.964 69.066  1.00 13.78 ? 441  GLN B N   1 
ATOM   7603  C CA  . GLN B 1 441 ? 34.773  -44.055 69.798  1.00 14.42 ? 441  GLN B CA  1 
ATOM   7604  C C   . GLN B 1 441 ? 34.751  -43.864 71.303  1.00 15.16 ? 441  GLN B C   1 
ATOM   7605  O O   . GLN B 1 441 ? 34.717  -44.825 72.075  1.00 16.47 ? 441  GLN B O   1 
ATOM   7606  C CB  . GLN B 1 441 ? 36.216  -44.230 69.329  1.00 13.54 ? 441  GLN B CB  1 
ATOM   7607  C CG  . GLN B 1 441 ? 36.357  -44.722 67.904  1.00 12.88 ? 441  GLN B CG  1 
ATOM   7608  C CD  . GLN B 1 441 ? 37.772  -44.668 67.340  1.00 12.20 ? 441  GLN B CD  1 
ATOM   7609  O OE1 . GLN B 1 441 ? 38.728  -44.585 68.099  1.00 12.60 ? 441  GLN B OE1 1 
ATOM   7610  N NE2 . GLN B 1 441 ? 37.909  -44.736 66.019  1.00 13.38 ? 441  GLN B NE2 1 
ATOM   7611  N N   . HIS B 1 442 ? 34.758  -42.597 71.698  1.00 15.77 ? 442  HIS B N   1 
ATOM   7612  C CA  . HIS B 1 442 ? 34.766  -42.202 73.101  1.00 17.63 ? 442  HIS B CA  1 
ATOM   7613  C C   . HIS B 1 442 ? 33.394  -41.670 73.510  1.00 19.00 ? 442  HIS B C   1 
ATOM   7614  O O   . HIS B 1 442 ? 33.253  -40.995 74.538  1.00 22.06 ? 442  HIS B O   1 
ATOM   7615  C CB  . HIS B 1 442 ? 35.805  -41.093 73.321  1.00 17.11 ? 442  HIS B CB  1 
ATOM   7616  C CG  . HIS B 1 442 ? 37.165  -41.406 72.782  1.00 16.64 ? 442  HIS B CG  1 
ATOM   7617  N ND1 . HIS B 1 442 ? 38.207  -41.810 73.586  1.00 17.36 ? 442  HIS B ND1 1 
ATOM   7618  C CD2 . HIS B 1 442 ? 37.652  -41.372 71.520  1.00 17.06 ? 442  HIS B CD2 1 
ATOM   7619  C CE1 . HIS B 1 442 ? 39.280  -42.012 72.842  1.00 16.43 ? 442  HIS B CE1 1 
ATOM   7620  N NE2 . HIS B 1 442 ? 38.970  -41.752 71.586  1.00 17.72 ? 442  HIS B NE2 1 
ATOM   7621  N N   . ALA B 1 443 ? 32.386  -41.987 72.700  1.00 18.88 ? 443  ALA B N   1 
ATOM   7622  C CA  . ALA B 1 443 ? 31.028  -41.528 72.934  1.00 17.74 ? 443  ALA B CA  1 
ATOM   7623  C C   . ALA B 1 443 ? 29.996  -42.643 73.019  1.00 17.06 ? 443  ALA B C   1 
ATOM   7624  O O   . ALA B 1 443 ? 29.404  -42.880 74.073  1.00 17.86 ? 443  ALA B O   1 
ATOM   7625  C CB  . ALA B 1 443 ? 30.616  -40.547 71.837  1.00 19.39 ? 443  ALA B CB  1 
ATOM   7626  N N   . PHE B 1 444 ? 29.787  -43.337 71.906  1.00 14.31 ? 444  PHE B N   1 
ATOM   7627  C CA  . PHE B 1 444 ? 28.767  -44.383 71.836  1.00 13.17 ? 444  PHE B CA  1 
ATOM   7628  C C   . PHE B 1 444 ? 29.185  -45.731 71.239  1.00 13.00 ? 444  PHE B C   1 
ATOM   7629  O O   . PHE B 1 444 ? 28.339  -46.612 71.049  1.00 13.12 ? 444  PHE B O   1 
ATOM   7630  C CB  . PHE B 1 444 ? 27.549  -43.848 71.057  1.00 13.17 ? 444  PHE B CB  1 
ATOM   7631  C CG  . PHE B 1 444 ? 27.894  -43.254 69.707  1.00 11.68 ? 444  PHE B CG  1 
ATOM   7632  C CD1 . PHE B 1 444 ? 28.115  -44.077 68.585  1.00 11.21 ? 444  PHE B CD1 1 
ATOM   7633  C CD2 . PHE B 1 444 ? 28.002  -41.863 69.557  1.00 12.88 ? 444  PHE B CD2 1 
ATOM   7634  C CE1 . PHE B 1 444 ? 28.442  -43.526 67.338  1.00 12.71 ? 444  PHE B CE1 1 
ATOM   7635  C CE2 . PHE B 1 444 ? 28.328  -41.296 68.312  1.00 12.96 ? 444  PHE B CE2 1 
ATOM   7636  C CZ  . PHE B 1 444 ? 28.549  -42.126 67.201  1.00 12.59 ? 444  PHE B CZ  1 
ATOM   7637  N N   . TYR B 1 445 ? 30.465  -45.892 70.908  1.00 12.58 ? 445  TYR B N   1 
ATOM   7638  C CA  . TYR B 1 445 ? 30.943  -47.155 70.322  1.00 11.88 ? 445  TYR B CA  1 
ATOM   7639  C C   . TYR B 1 445 ? 30.867  -48.297 71.314  1.00 12.59 ? 445  TYR B C   1 
ATOM   7640  O O   . TYR B 1 445 ? 30.840  -49.463 70.926  1.00 12.05 ? 445  TYR B O   1 
ATOM   7641  C CB  . TYR B 1 445 ? 32.375  -47.034 69.806  1.00 12.27 ? 445  TYR B CB  1 
ATOM   7642  C CG  . TYR B 1 445 ? 32.511  -46.452 68.413  1.00 12.08 ? 445  TYR B CG  1 
ATOM   7643  C CD1 . TYR B 1 445 ? 31.631  -45.455 67.944  1.00 11.72 ? 445  TYR B CD1 1 
ATOM   7644  C CD2 . TYR B 1 445 ? 33.557  -46.861 67.566  1.00 11.52 ? 445  TYR B CD2 1 
ATOM   7645  C CE1 . TYR B 1 445 ? 31.798  -44.871 66.672  1.00 12.85 ? 445  TYR B CE1 1 
ATOM   7646  C CE2 . TYR B 1 445 ? 33.730  -46.284 66.281  1.00 11.52 ? 445  TYR B CE2 1 
ATOM   7647  C CZ  . TYR B 1 445 ? 32.848  -45.290 65.854  1.00 12.43 ? 445  TYR B CZ  1 
ATOM   7648  O OH  . TYR B 1 445 ? 33.033  -44.705 64.628  1.00 15.22 ? 445  TYR B OH  1 
ATOM   7649  N N   . GLN B 1 446 ? 30.816  -47.941 72.597  1.00 12.25 ? 446  GLN B N   1 
ATOM   7650  C CA  . GLN B 1 446 ? 30.686  -48.908 73.684  1.00 11.82 ? 446  GLN B CA  1 
ATOM   7651  C C   . GLN B 1 446 ? 29.423  -49.743 73.439  1.00 12.89 ? 446  GLN B C   1 
ATOM   7652  O O   . GLN B 1 446 ? 29.465  -50.969 73.536  1.00 13.01 ? 446  GLN B O   1 
ATOM   7653  C CB  . GLN B 1 446 ? 30.589  -48.171 75.024  1.00 12.58 ? 446  GLN B CB  1 
ATOM   7654  C CG  . GLN B 1 446 ? 30.063  -48.985 76.223  1.00 12.38 ? 446  GLN B CG  1 
ATOM   7655  C CD  . GLN B 1 446 ? 30.969  -50.126 76.612  1.00 12.29 ? 446  GLN B CD  1 
ATOM   7656  O OE1 . GLN B 1 446 ? 32.163  -49.936 76.806  1.00 12.77 ? 446  GLN B OE1 1 
ATOM   7657  N NE2 . GLN B 1 446 ? 30.403  -51.325 76.715  1.00 11.91 ? 446  GLN B NE2 1 
ATOM   7658  N N   . LEU B 1 447 ? 28.339  -49.068 73.046  1.00 11.57 ? 447  LEU B N   1 
ATOM   7659  C CA  . LEU B 1 447 ? 27.064  -49.724 72.761  1.00 12.13 ? 447  LEU B CA  1 
ATOM   7660  C C   . LEU B 1 447 ? 27.119  -50.530 71.464  1.00 12.05 ? 447  LEU B C   1 
ATOM   7661  O O   . LEU B 1 447 ? 26.551  -51.620 71.392  1.00 12.73 ? 447  LEU B O   1 
ATOM   7662  C CB  . LEU B 1 447 ? 25.911  -48.701 72.713  1.00 12.38 ? 447  LEU B CB  1 
ATOM   7663  C CG  . LEU B 1 447 ? 24.459  -49.226 72.666  1.00 12.81 ? 447  LEU B CG  1 
ATOM   7664  C CD1 . LEU B 1 447 ? 23.551  -48.334 73.452  1.00 13.34 ? 447  LEU B CD1 1 
ATOM   7665  C CD2 . LEU B 1 447 ? 23.928  -49.349 71.260  1.00 15.56 ? 447  LEU B CD2 1 
ATOM   7666  N N   . ILE B 1 448 ? 27.792  -50.000 70.443  1.00 12.00 ? 448  ILE B N   1 
ATOM   7667  C CA  . ILE B 1 448 ? 27.896  -50.706 69.162  1.00 11.90 ? 448  ILE B CA  1 
ATOM   7668  C C   . ILE B 1 448 ? 28.664  -52.028 69.328  1.00 12.95 ? 448  ILE B C   1 
ATOM   7669  O O   . ILE B 1 448 ? 28.259  -53.043 68.767  1.00 13.74 ? 448  ILE B O   1 
ATOM   7670  C CB  . ILE B 1 448 ? 28.522  -49.807 68.040  1.00 12.37 ? 448  ILE B CB  1 
ATOM   7671  C CG1 . ILE B 1 448 ? 27.665  -48.550 67.836  1.00 12.37 ? 448  ILE B CG1 1 
ATOM   7672  C CG2 . ILE B 1 448 ? 28.602  -50.572 66.709  1.00 13.14 ? 448  ILE B CG2 1 
ATOM   7673  C CD1 . ILE B 1 448 ? 28.247  -47.521 66.856  1.00 12.59 ? 448  ILE B CD1 1 
ATOM   7674  N N   . HIS B 1 449 ? 29.679  -52.022 70.194  1.00 12.61 ? 449  HIS B N   1 
ATOM   7675  C CA  . HIS B 1 449 ? 30.504  -53.207 70.462  1.00 13.19 ? 449  HIS B CA  1 
ATOM   7676  C C   . HIS B 1 449 ? 29.935  -54.167 71.506  1.00 13.50 ? 449  HIS B C   1 
ATOM   7677  O O   . HIS B 1 449 ? 29.998  -55.389 71.333  1.00 15.04 ? 449  HIS B O   1 
ATOM   7678  C CB  . HIS B 1 449 ? 31.906  -52.803 70.939  1.00 12.51 ? 449  HIS B CB  1 
ATOM   7679  C CG  . HIS B 1 449 ? 32.801  -52.276 69.863  1.00 13.88 ? 449  HIS B CG  1 
ATOM   7680  N ND1 . HIS B 1 449 ? 33.417  -53.092 68.939  1.00 15.08 ? 449  HIS B ND1 1 
ATOM   7681  C CD2 . HIS B 1 449 ? 33.230  -51.019 69.599  1.00 13.85 ? 449  HIS B CD2 1 
ATOM   7682  C CE1 . HIS B 1 449 ? 34.189  -52.360 68.156  1.00 15.00 ? 449  HIS B CE1 1 
ATOM   7683  N NE2 . HIS B 1 449 ? 34.091  -51.098 68.534  1.00 14.95 ? 449  HIS B NE2 1 
ATOM   7684  N N   . GLN B 1 450 ? 29.430  -53.616 72.611  1.00 13.27 ? 450  GLN B N   1 
ATOM   7685  C CA  . GLN B 1 450 ? 28.922  -54.433 73.715  1.00 13.13 ? 450  GLN B CA  1 
ATOM   7686  C C   . GLN B 1 450 ? 27.464  -54.259 74.141  1.00 14.56 ? 450  GLN B C   1 
ATOM   7687  O O   . GLN B 1 450 ? 27.084  -54.684 75.235  1.00 13.78 ? 450  GLN B O   1 
ATOM   7688  C CB  . GLN B 1 450 ? 29.831  -54.282 74.944  1.00 12.93 ? 450  GLN B CB  1 
ATOM   7689  C CG  . GLN B 1 450 ? 31.217  -54.910 74.812  1.00 14.39 ? 450  GLN B CG  1 
ATOM   7690  C CD  . GLN B 1 450 ? 31.996  -54.880 76.111  1.00 13.40 ? 450  GLN B CD  1 
ATOM   7691  O OE1 . GLN B 1 450 ? 31.946  -53.900 76.859  1.00 13.99 ? 450  GLN B OE1 1 
ATOM   7692  N NE2 . GLN B 1 450 ? 32.732  -55.953 76.384  1.00 14.74 ? 450  GLN B NE2 1 
ATOM   7693  N N   . GLY B 1 451 ? 26.647  -53.671 73.271  1.00 14.04 ? 451  GLY B N   1 
ATOM   7694  C CA  . GLY B 1 451 ? 25.240  -53.474 73.580  1.00 14.18 ? 451  GLY B CA  1 
ATOM   7695  C C   . GLY B 1 451 ? 24.372  -54.626 73.115  1.00 14.76 ? 451  GLY B C   1 
ATOM   7696  O O   . GLY B 1 451 ? 24.862  -55.595 72.529  1.00 14.91 ? 451  GLY B O   1 
ATOM   7697  N N   . THR B 1 452 ? 23.069  -54.490 73.340  1.00 14.47 ? 452  THR B N   1 
ATOM   7698  C CA  . THR B 1 452 ? 22.100  -55.522 72.976  1.00 15.98 ? 452  THR B CA  1 
ATOM   7699  C C   . THR B 1 452 ? 21.425  -55.320 71.614  1.00 16.91 ? 452  THR B C   1 
ATOM   7700  O O   . THR B 1 452 ? 20.438  -55.995 71.294  1.00 18.85 ? 452  THR B O   1 
ATOM   7701  C CB  . THR B 1 452 ? 21.019  -55.652 74.067  1.00 16.39 ? 452  THR B CB  1 
ATOM   7702  O OG1 . THR B 1 452 ? 20.402  -54.378 74.293  1.00 15.00 ? 452  THR B OG1 1 
ATOM   7703  C CG2 . THR B 1 452 ? 21.625  -56.157 75.365  1.00 16.91 ? 452  THR B CG2 1 
ATOM   7704  N N   . ASN B 1 453 ? 21.976  -54.410 70.813  1.00 18.04 ? 453  ASN B N   1 
ATOM   7705  C CA  . ASN B 1 453 ? 21.439  -54.095 69.490  1.00 19.16 ? 453  ASN B CA  1 
ATOM   7706  C C   . ASN B 1 453 ? 22.450  -54.311 68.379  1.00 18.80 ? 453  ASN B C   1 
ATOM   7707  O O   . ASN B 1 453 ? 23.631  -53.983 68.527  1.00 17.26 ? 453  ASN B O   1 
ATOM   7708  C CB  . ASN B 1 453 ? 20.981  -52.629 69.436  1.00 21.91 ? 453  ASN B CB  1 
ATOM   7709  C CG  . ASN B 1 453 ? 19.823  -52.343 70.359  1.00 24.36 ? 453  ASN B CG  1 
ATOM   7710  O OD1 . ASN B 1 453 ? 18.705  -52.789 70.117  1.00 28.29 ? 453  ASN B OD1 1 
ATOM   7711  N ND2 . ASN B 1 453 ? 20.085  -51.611 71.439  1.00 26.58 ? 453  ASN B ND2 1 
ATOM   7712  N N   . LEU B 1 454 ? 21.967  -54.845 67.257  1.00 18.29 ? 454  LEU B N   1 
ATOM   7713  C CA  . LEU B 1 454 ? 22.792  -55.073 66.072  1.00 19.25 ? 454  LEU B CA  1 
ATOM   7714  C C   . LEU B 1 454 ? 22.669  -53.765 65.283  1.00 17.01 ? 454  LEU B C   1 
ATOM   7715  O O   . LEU B 1 454 ? 21.565  -53.370 64.890  1.00 16.66 ? 454  LEU B O   1 
ATOM   7716  C CB  . LEU B 1 454 ? 22.253  -56.275 65.277  1.00 23.20 ? 454  LEU B CB  1 
ATOM   7717  C CG  . LEU B 1 454 ? 23.115  -57.066 64.278  1.00 26.67 ? 454  LEU B CG  1 
ATOM   7718  C CD1 . LEU B 1 454 ? 23.200  -56.352 62.947  1.00 29.72 ? 454  LEU B CD1 1 
ATOM   7719  C CD2 . LEU B 1 454 ? 24.502  -57.386 64.848  1.00 28.51 ? 454  LEU B CD2 1 
ATOM   7720  N N   . ILE B 1 455 ? 23.793  -53.058 65.145  1.00 13.84 ? 455  ILE B N   1 
ATOM   7721  C CA  . ILE B 1 455 ? 23.820  -51.762 64.458  1.00 12.41 ? 455  ILE B CA  1 
ATOM   7722  C C   . ILE B 1 455 ? 24.757  -51.706 63.249  1.00 11.58 ? 455  ILE B C   1 
ATOM   7723  O O   . ILE B 1 455 ? 25.977  -51.584 63.418  1.00 12.58 ? 455  ILE B O   1 
ATOM   7724  C CB  . ILE B 1 455 ? 24.225  -50.600 65.431  1.00 12.20 ? 455  ILE B CB  1 
ATOM   7725  C CG1 . ILE B 1 455 ? 23.321  -50.567 66.665  1.00 13.91 ? 455  ILE B CG1 1 
ATOM   7726  C CG2 . ILE B 1 455 ? 24.140  -49.235 64.717  1.00 12.09 ? 455  ILE B CG2 1 
ATOM   7727  C CD1 . ILE B 1 455 ? 23.884  -49.747 67.771  1.00 14.24 ? 455  ILE B CD1 1 
ATOM   7728  N N   . PRO B 1 456 ? 24.205  -51.793 62.016  1.00 11.00 ? 456  PRO B N   1 
ATOM   7729  C CA  . PRO B 1 456 ? 25.020  -51.726 60.792  1.00 12.01 ? 456  PRO B CA  1 
ATOM   7730  C C   . PRO B 1 456 ? 25.685  -50.343 60.751  1.00 12.06 ? 456  PRO B C   1 
ATOM   7731  O O   . PRO B 1 456 ? 25.053  -49.334 61.086  1.00 12.89 ? 456  PRO B O   1 
ATOM   7732  C CB  . PRO B 1 456 ? 23.978  -51.868 59.687  1.00 12.57 ? 456  PRO B CB  1 
ATOM   7733  C CG  . PRO B 1 456 ? 22.965  -52.745 60.309  1.00 12.49 ? 456  PRO B CG  1 
ATOM   7734  C CD  . PRO B 1 456 ? 22.812  -52.137 61.674  1.00 10.93 ? 456  PRO B CD  1 
ATOM   7735  N N   . CYS B 1 457 ? 26.975  -50.325 60.439  1.00 12.34 ? 457  CYS B N   1 
ATOM   7736  C CA  . CYS B 1 457 ? 27.750  -49.090 60.396  1.00 12.57 ? 457  CYS B CA  1 
ATOM   7737  C C   . CYS B 1 457 ? 28.407  -48.814 59.054  1.00 12.63 ? 457  CYS B C   1 
ATOM   7738  O O   . CYS B 1 457 ? 28.902  -49.728 58.404  1.00 14.33 ? 457  CYS B O   1 
ATOM   7739  C CB  . CYS B 1 457 ? 28.863  -49.143 61.440  1.00 13.53 ? 457  CYS B CB  1 
ATOM   7740  S SG  . CYS B 1 457 ? 28.399  -49.146 63.177  1.00 14.52 ? 457  CYS B SG  1 
ATOM   7741  N N   . ASP B 1 458 ? 28.397  -47.547 58.644  1.00 11.58 ? 458  ASP B N   1 
ATOM   7742  C CA  . ASP B 1 458 ? 29.058  -47.112 57.415  1.00 12.07 ? 458  ASP B CA  1 
ATOM   7743  C C   . ASP B 1 458 ? 30.241  -46.252 57.840  1.00 10.99 ? 458  ASP B C   1 
ATOM   7744  O O   . ASP B 1 458 ? 30.065  -45.201 58.458  1.00 11.27 ? 458  ASP B O   1 
ATOM   7745  C CB  . ASP B 1 458 ? 28.132  -46.275 56.525  1.00 11.92 ? 458  ASP B CB  1 
ATOM   7746  C CG  . ASP B 1 458 ? 27.190  -47.115 55.680  1.00 13.93 ? 458  ASP B CG  1 
ATOM   7747  O OD1 . ASP B 1 458 ? 27.168  -48.359 55.803  1.00 14.36 ? 458  ASP B OD1 1 
ATOM   7748  O OD2 . ASP B 1 458 ? 26.450  -46.508 54.879  1.00 14.95 ? 458  ASP B OD2 1 
ATOM   7749  N N   . PHE B 1 459 ? 31.443  -46.743 57.554  1.00 10.90 ? 459  PHE B N   1 
ATOM   7750  C CA  . PHE B 1 459 ? 32.685  -46.045 57.873  1.00 10.97 ? 459  PHE B CA  1 
ATOM   7751  C C   . PHE B 1 459 ? 33.188  -45.380 56.596  1.00 10.78 ? 459  PHE B C   1 
ATOM   7752  O O   . PHE B 1 459 ? 33.445  -46.059 55.607  1.00 11.90 ? 459  PHE B O   1 
ATOM   7753  C CB  . PHE B 1 459 ? 33.723  -47.039 58.409  1.00 11.55 ? 459  PHE B CB  1 
ATOM   7754  C CG  . PHE B 1 459 ? 33.529  -47.407 59.852  1.00 10.21 ? 459  PHE B CG  1 
ATOM   7755  C CD1 . PHE B 1 459 ? 32.484  -48.264 60.248  1.00 10.63 ? 459  PHE B CD1 1 
ATOM   7756  C CD2 . PHE B 1 459 ? 34.417  -46.928 60.828  1.00 11.23 ? 459  PHE B CD2 1 
ATOM   7757  C CE1 . PHE B 1 459 ? 32.332  -48.644 61.611  1.00 10.79 ? 459  PHE B CE1 1 
ATOM   7758  C CE2 . PHE B 1 459 ? 34.276  -47.295 62.192  1.00 10.77 ? 459  PHE B CE2 1 
ATOM   7759  C CZ  . PHE B 1 459 ? 33.231  -48.158 62.586  1.00 10.39 ? 459  PHE B CZ  1 
ATOM   7760  N N   . ILE B 1 460 ? 33.278  -44.049 56.613  1.00 10.37 ? 460  ILE B N   1 
ATOM   7761  C CA  . ILE B 1 460 ? 33.720  -43.270 55.445  1.00 11.59 ? 460  ILE B CA  1 
ATOM   7762  C C   . ILE B 1 460 ? 35.052  -42.575 55.745  1.00 11.44 ? 460  ILE B C   1 
ATOM   7763  O O   . ILE B 1 460 ? 35.177  -41.884 56.751  1.00 12.51 ? 460  ILE B O   1 
ATOM   7764  C CB  . ILE B 1 460 ? 32.647  -42.202 55.031  1.00 11.10 ? 460  ILE B CB  1 
ATOM   7765  C CG1 . ILE B 1 460 ? 31.270  -42.859 54.868  1.00 12.42 ? 460  ILE B CG1 1 
ATOM   7766  C CG2 . ILE B 1 460 ? 33.051  -41.501 53.724  1.00 12.30 ? 460  ILE B CG2 1 
ATOM   7767  C CD1 . ILE B 1 460 ? 30.100  -41.889 54.796  1.00 13.37 ? 460  ILE B CD1 1 
ATOM   7768  N N   . GLY B 1 461 ? 36.042  -42.775 54.877  1.00 11.43 ? 461  GLY B N   1 
ATOM   7769  C CA  . GLY B 1 461 ? 37.345  -42.160 55.090  1.00 11.22 ? 461  GLY B CA  1 
ATOM   7770  C C   . GLY B 1 461 ? 38.092  -41.803 53.828  1.00 11.67 ? 461  GLY B C   1 
ATOM   7771  O O   . GLY B 1 461 ? 37.730  -42.241 52.734  1.00 12.11 ? 461  GLY B O   1 
ATOM   7772  N N   . ALA B 1 462 ? 39.154  -41.018 54.000  1.00 11.39 ? 462  ALA B N   1 
ATOM   7773  C CA  . ALA B 1 462 ? 39.995  -40.565 52.898  1.00 12.25 ? 462  ALA B CA  1 
ATOM   7774  C C   . ALA B 1 462 ? 41.430  -41.004 53.111  1.00 12.99 ? 462  ALA B C   1 
ATOM   7775  O O   . ALA B 1 462 ? 41.923  -40.984 54.237  1.00 13.00 ? 462  ALA B O   1 
ATOM   7776  C CB  . ALA B 1 462 ? 39.927  -39.047 52.772  1.00 13.32 ? 462  ALA B CB  1 
ATOM   7777  N N   . ILE B 1 463 ? 42.092  -41.404 52.026  1.00 12.50 ? 463  ILE B N   1 
ATOM   7778  C CA  . ILE B 1 463 ? 43.492  -41.840 52.081  1.00 12.08 ? 463  ILE B CA  1 
ATOM   7779  C C   . ILE B 1 463 ? 44.414  -40.645 52.329  1.00 13.15 ? 463  ILE B C   1 
ATOM   7780  O O   . ILE B 1 463 ? 45.355  -40.732 53.123  1.00 13.58 ? 463  ILE B O   1 
ATOM   7781  C CB  . ILE B 1 463 ? 43.912  -42.596 50.781  1.00 12.07 ? 463  ILE B CB  1 
ATOM   7782  C CG1 . ILE B 1 463 ? 43.114  -43.895 50.656  1.00 12.84 ? 463  ILE B CG1 1 
ATOM   7783  C CG2 . ILE B 1 463 ? 45.396  -42.948 50.805  1.00 12.26 ? 463  ILE B CG2 1 
ATOM   7784  C CD1 . ILE B 1 463 ? 43.337  -44.678 49.362  1.00 12.58 ? 463  ILE B CD1 1 
ATOM   7785  N N   . GLN B 1 464 ? 44.102  -39.529 51.673  1.00 13.57 ? 464  GLN B N   1 
ATOM   7786  C CA  . GLN B 1 464 ? 44.885  -38.302 51.789  1.00 14.93 ? 464  GLN B CA  1 
ATOM   7787  C C   . GLN B 1 464 ? 44.107  -37.194 52.486  1.00 14.99 ? 464  GLN B C   1 
ATOM   7788  O O   . GLN B 1 464 ? 42.934  -36.959 52.185  1.00 16.63 ? 464  GLN B O   1 
ATOM   7789  C CB  . GLN B 1 464 ? 45.318  -37.816 50.401  1.00 15.98 ? 464  GLN B CB  1 
ATOM   7790  C CG  . GLN B 1 464 ? 46.112  -38.838 49.579  1.00 16.31 ? 464  GLN B CG  1 
ATOM   7791  C CD  . GLN B 1 464 ? 46.416  -38.375 48.162  1.00 19.11 ? 464  GLN B CD  1 
ATOM   7792  O OE1 . GLN B 1 464 ? 45.949  -37.327 47.714  1.00 19.55 ? 464  GLN B OE1 1 
ATOM   7793  N NE2 . GLN B 1 464 ? 47.207  -39.168 47.448  1.00 19.96 ? 464  GLN B NE2 1 
ATOM   7794  N N   . SER B 1 465 ? 44.773  -36.527 53.424  1.00 15.70 ? 465  SER B N   1 
ATOM   7795  C CA  . SER B 1 465 ? 44.193  -35.410 54.167  1.00 15.23 ? 465  SER B CA  1 
ATOM   7796  C C   . SER B 1 465 ? 44.515  -34.120 53.431  1.00 15.78 ? 465  SER B C   1 
ATOM   7797  O O   . SER B 1 465 ? 45.476  -34.058 52.667  1.00 16.82 ? 465  SER B O   1 
ATOM   7798  C CB  . SER B 1 465 ? 44.804  -35.337 55.571  1.00 15.07 ? 465  SER B CB  1 
ATOM   7799  O OG  . SER B 1 465 ? 44.339  -34.209 56.303  1.00 15.25 ? 465  SER B OG  1 
ATOM   7800  N N   . GLN B 1 466 ? 43.701  -33.093 53.659  1.00 14.93 ? 466  GLN B N   1 
ATOM   7801  C CA  . GLN B 1 466 ? 43.936  -31.783 53.060  1.00 15.18 ? 466  GLN B CA  1 
ATOM   7802  C C   . GLN B 1 466 ? 44.885  -30.983 53.956  1.00 16.29 ? 466  GLN B C   1 
ATOM   7803  O O   . GLN B 1 466 ? 45.402  -29.934 53.556  1.00 18.23 ? 466  GLN B O   1 
ATOM   7804  C CB  . GLN B 1 466 ? 42.619  -31.025 52.882  1.00 15.50 ? 466  GLN B CB  1 
ATOM   7805  C CG  . GLN B 1 466 ? 41.618  -31.680 51.922  1.00 15.41 ? 466  GLN B CG  1 
ATOM   7806  C CD  . GLN B 1 466 ? 42.153  -31.844 50.509  1.00 16.63 ? 466  GLN B CD  1 
ATOM   7807  O OE1 . GLN B 1 466 ? 42.683  -30.903 49.912  1.00 17.44 ? 466  GLN B OE1 1 
ATOM   7808  N NE2 . GLN B 1 466 ? 42.017  -33.048 49.968  1.00 16.61 ? 466  GLN B NE2 1 
ATOM   7809  N N   . ASN B 1 467 ? 45.124  -31.515 55.156  1.00 16.46 ? 467  ASN B N   1 
ATOM   7810  C CA  . ASN B 1 467 ? 45.995  -30.899 56.156  1.00 17.38 ? 467  ASN B CA  1 
ATOM   7811  C C   . ASN B 1 467 ? 47.129  -31.835 56.555  1.00 19.92 ? 467  ASN B C   1 
ATOM   7812  O O   . ASN B 1 467 ? 46.897  -32.903 57.127  1.00 21.58 ? 467  ASN B O   1 
ATOM   7813  C CB  . ASN B 1 467 ? 45.187  -30.514 57.399  1.00 15.78 ? 467  ASN B CB  1 
ATOM   7814  C CG  . ASN B 1 467 ? 44.158  -29.443 57.113  1.00 15.25 ? 467  ASN B CG  1 
ATOM   7815  O OD1 . ASN B 1 467 ? 44.505  -28.291 56.867  1.00 16.05 ? 467  ASN B OD1 1 
ATOM   7816  N ND2 . ASN B 1 467 ? 42.884  -29.824 57.113  1.00 14.73 ? 467  ASN B ND2 1 
ATOM   7817  N N   . LYS B 1 468 ? 48.356  -31.437 56.222  1.00 21.08 ? 468  LYS B N   1 
ATOM   7818  C CA  . LYS B 1 468 ? 49.558  -32.216 56.534  1.00 24.18 ? 468  LYS B CA  1 
ATOM   7819  C C   . LYS B 1 468 ? 50.139  -31.792 57.875  1.00 23.94 ? 468  LYS B C   1 
ATOM   7820  O O   . LYS B 1 468 ? 51.008  -30.918 57.939  1.00 25.77 ? 468  LYS B O   1 
ATOM   7821  C CB  . LYS B 1 468 ? 50.598  -32.068 55.405  1.00 26.81 ? 468  LYS B CB  1 
ATOM   7822  C CG  . LYS B 1 468 ? 50.089  -32.284 53.970  1.00 30.22 ? 468  LYS B CG  1 
ATOM   7823  C CD  . LYS B 1 468 ? 49.595  -33.708 53.707  1.00 33.36 ? 468  LYS B CD  1 
ATOM   7824  C CE  . LYS B 1 468 ? 48.094  -33.817 53.791  1.00 34.58 ? 468  LYS B CE  1 
ATOM   7825  N NZ  . LYS B 1 468 ? 47.418  -32.557 53.339  1.00 37.77 ? 468  LYS B NZ  1 
ATOM   7826  N N   . ILE B 1 469 ? 49.594  -32.363 58.951  1.00 22.52 ? 469  ILE B N   1 
ATOM   7827  C CA  . ILE B 1 469 ? 50.037  -32.056 60.317  1.00 22.15 ? 469  ILE B CA  1 
ATOM   7828  C C   . ILE B 1 469 ? 50.707  -33.292 60.916  1.00 21.82 ? 469  ILE B C   1 
ATOM   7829  O O   . ILE B 1 469 ? 50.022  -34.251 61.277  1.00 20.46 ? 469  ILE B O   1 
ATOM   7830  C CB  . ILE B 1 469 ? 48.844  -31.623 61.252  1.00 23.32 ? 469  ILE B CB  1 
ATOM   7831  C CG1 . ILE B 1 469 ? 47.989  -30.511 60.612  1.00 23.81 ? 469  ILE B CG1 1 
ATOM   7832  C CG2 . ILE B 1 469 ? 49.369  -31.180 62.633  1.00 23.40 ? 469  ILE B CG2 1 
ATOM   7833  C CD1 . ILE B 1 469 ? 48.667  -29.134 60.471  1.00 24.37 ? 469  ILE B CD1 1 
ATOM   7834  N N   . GLY B 1 470 ? 52.042  -33.271 60.982  1.00 21.24 ? 470  GLY B N   1 
ATOM   7835  C CA  . GLY B 1 470 ? 52.824  -34.373 61.538  1.00 20.21 ? 470  GLY B CA  1 
ATOM   7836  C C   . GLY B 1 470 ? 52.438  -35.771 61.080  1.00 19.15 ? 470  GLY B C   1 
ATOM   7837  O O   . GLY B 1 470 ? 52.306  -36.026 59.883  1.00 20.62 ? 470  GLY B O   1 
ATOM   7838  N N   . ASP B 1 471 ? 52.186  -36.643 62.055  1.00 18.87 ? 471  ASP B N   1 
ATOM   7839  C CA  . ASP B 1 471 ? 51.782  -38.027 61.806  1.00 18.47 ? 471  ASP B CA  1 
ATOM   7840  C C   . ASP B 1 471 ? 50.299  -38.238 62.132  1.00 16.81 ? 471  ASP B C   1 
ATOM   7841  O O   . ASP B 1 471 ? 49.848  -39.379 62.261  1.00 15.33 ? 471  ASP B O   1 
ATOM   7842  C CB  . ASP B 1 471 ? 52.631  -38.995 62.646  1.00 21.87 ? 471  ASP B CB  1 
ATOM   7843  C CG  . ASP B 1 471 ? 54.062  -39.126 62.146  1.00 24.50 ? 471  ASP B CG  1 
ATOM   7844  O OD1 . ASP B 1 471 ? 54.293  -39.053 60.917  1.00 25.15 ? 471  ASP B OD1 1 
ATOM   7845  O OD2 . ASP B 1 471 ? 54.958  -39.331 62.993  1.00 28.19 ? 471  ASP B OD2 1 
ATOM   7846  N N   . HIS B 1 472 ? 49.541  -37.143 62.231  1.00 14.04 ? 472  HIS B N   1 
ATOM   7847  C CA  . HIS B 1 472 ? 48.110  -37.201 62.554  1.00 13.48 ? 472  HIS B CA  1 
ATOM   7848  C C   . HIS B 1 472 ? 47.256  -38.107 61.690  1.00 12.58 ? 472  HIS B C   1 
ATOM   7849  O O   . HIS B 1 472 ? 46.461  -38.876 62.225  1.00 13.73 ? 472  HIS B O   1 
ATOM   7850  C CB  . HIS B 1 472 ? 47.483  -35.815 62.529  1.00 12.80 ? 472  HIS B CB  1 
ATOM   7851  C CG  . HIS B 1 472 ? 47.734  -35.016 63.766  1.00 13.85 ? 472  HIS B CG  1 
ATOM   7852  N ND1 . HIS B 1 472 ? 46.755  -34.770 64.703  1.00 13.65 ? 472  HIS B ND1 1 
ATOM   7853  C CD2 . HIS B 1 472 ? 48.858  -34.425 64.231  1.00 14.12 ? 472  HIS B CD2 1 
ATOM   7854  C CE1 . HIS B 1 472 ? 47.267  -34.062 65.693  1.00 14.61 ? 472  HIS B CE1 1 
ATOM   7855  N NE2 . HIS B 1 472 ? 48.541  -33.840 65.432  1.00 14.28 ? 472  HIS B NE2 1 
ATOM   7856  N N   . HIS B 1 473 ? 47.447  -38.052 60.371  1.00 12.71 ? 473  HIS B N   1 
ATOM   7857  C CA  . HIS B 1 473 ? 46.637  -38.875 59.482  1.00 12.66 ? 473  HIS B CA  1 
ATOM   7858  C C   . HIS B 1 473 ? 46.793  -40.381 59.609  1.00 12.85 ? 473  HIS B C   1 
ATOM   7859  O O   . HIS B 1 473 ? 45.789  -41.090 59.564  1.00 13.17 ? 473  HIS B O   1 
ATOM   7860  C CB  . HIS B 1 473 ? 46.725  -38.442 58.023  1.00 12.39 ? 473  HIS B CB  1 
ATOM   7861  C CG  . HIS B 1 473 ? 45.466  -38.722 57.263  1.00 12.85 ? 473  HIS B CG  1 
ATOM   7862  N ND1 . HIS B 1 473 ? 45.412  -39.593 56.198  1.00 14.08 ? 473  HIS B ND1 1 
ATOM   7863  C CD2 . HIS B 1 473 ? 44.199  -38.290 57.461  1.00 11.63 ? 473  HIS B CD2 1 
ATOM   7864  C CE1 . HIS B 1 473 ? 44.163  -39.682 55.775  1.00 11.26 ? 473  HIS B CE1 1 
ATOM   7865  N NE2 . HIS B 1 473 ? 43.408  -38.902 56.524  1.00 14.66 ? 473  HIS B NE2 1 
ATOM   7866  N N   . LYS B 1 474 ? 48.021  -40.871 59.798  1.00 13.69 ? 474  LYS B N   1 
ATOM   7867  C CA  . LYS B 1 474 ? 48.215  -42.314 59.957  1.00 14.81 ? 474  LYS B CA  1 
ATOM   7868  C C   . LYS B 1 474 ? 47.696  -42.813 61.313  1.00 14.07 ? 474  LYS B C   1 
ATOM   7869  O O   . LYS B 1 474 ? 47.124  -43.895 61.392  1.00 14.39 ? 474  LYS B O   1 
ATOM   7870  C CB  . LYS B 1 474 ? 49.665  -42.756 59.672  1.00 17.46 ? 474  LYS B CB  1 
ATOM   7871  C CG  . LYS B 1 474 ? 50.701  -42.567 60.769  1.00 21.15 ? 474  LYS B CG  1 
ATOM   7872  C CD  . LYS B 1 474 ? 51.939  -43.393 60.427  1.00 22.94 ? 474  LYS B CD  1 
ATOM   7873  C CE  . LYS B 1 474 ? 53.122  -43.068 61.317  1.00 26.27 ? 474  LYS B CE  1 
ATOM   7874  N NZ  . LYS B 1 474 ? 54.296  -43.931 60.991  1.00 26.66 ? 474  LYS B NZ  1 
ATOM   7875  N N   . ILE B 1 475 ? 47.810  -41.972 62.347  1.00 13.84 ? 475  ILE B N   1 
ATOM   7876  C CA  . ILE B 1 475 ? 47.318  -42.290 63.697  1.00 12.82 ? 475  ILE B CA  1 
ATOM   7877  C C   . ILE B 1 475 ? 45.785  -42.344 63.627  1.00 12.07 ? 475  ILE B C   1 
ATOM   7878  O O   . ILE B 1 475 ? 45.157  -43.273 64.136  1.00 12.93 ? 475  ILE B O   1 
ATOM   7879  C CB  . ILE B 1 475 ? 47.783  -41.229 64.742  1.00 14.58 ? 475  ILE B CB  1 
ATOM   7880  C CG1 . ILE B 1 475 ? 49.305  -41.312 64.927  1.00 14.48 ? 475  ILE B CG1 1 
ATOM   7881  C CG2 . ILE B 1 475 ? 47.094  -41.446 66.095  1.00 14.74 ? 475  ILE B CG2 1 
ATOM   7882  C CD1 . ILE B 1 475 ? 49.924  -40.147 65.693  1.00 16.65 ? 475  ILE B CD1 1 
ATOM   7883  N N   . PHE B 1 476 ? 45.223  -41.379 62.904  1.00 12.36 ? 476  PHE B N   1 
ATOM   7884  C CA  . PHE B 1 476 ? 43.786  -41.254 62.685  1.00 11.99 ? 476  PHE B CA  1 
ATOM   7885  C C   . PHE B 1 476 ? 43.236  -42.463 61.937  1.00 12.60 ? 476  PHE B C   1 
ATOM   7886  O O   . PHE B 1 476 ? 42.294  -43.114 62.403  1.00 14.27 ? 476  PHE B O   1 
ATOM   7887  C CB  . PHE B 1 476 ? 43.538  -39.962 61.889  1.00 11.42 ? 476  PHE B CB  1 
ATOM   7888  C CG  . PHE B 1 476 ? 42.104  -39.694 61.533  1.00 11.67 ? 476  PHE B CG  1 
ATOM   7889  C CD1 . PHE B 1 476 ? 41.079  -39.790 62.493  1.00 11.50 ? 476  PHE B CD1 1 
ATOM   7890  C CD2 . PHE B 1 476 ? 41.786  -39.266 60.234  1.00 12.42 ? 476  PHE B CD2 1 
ATOM   7891  C CE1 . PHE B 1 476 ? 39.753  -39.452 62.168  1.00 11.16 ? 476  PHE B CE1 1 
ATOM   7892  C CE2 . PHE B 1 476 ? 40.472  -38.923 59.895  1.00 13.39 ? 476  PHE B CE2 1 
ATOM   7893  C CZ  . PHE B 1 476 ? 39.459  -39.016 60.875  1.00 11.05 ? 476  PHE B CZ  1 
ATOM   7894  N N   . MET B 1 477 ? 43.875  -42.788 60.819  1.00 12.53 ? 477  MET B N   1 
ATOM   7895  C CA  . MET B 1 477 ? 43.443  -43.894 59.985  1.00 12.77 ? 477  MET B CA  1 
ATOM   7896  C C   . MET B 1 477 ? 43.671  -45.286 60.545  1.00 12.76 ? 477  MET B C   1 
ATOM   7897  O O   . MET B 1 477 ? 43.027  -46.231 60.102  1.00 13.56 ? 477  MET B O   1 
ATOM   7898  C CB  . MET B 1 477 ? 43.968  -43.741 58.564  1.00 13.08 ? 477  MET B CB  1 
ATOM   7899  C CG  . MET B 1 477 ? 43.367  -42.529 57.862  1.00 12.59 ? 477  MET B CG  1 
ATOM   7900  S SD  . MET B 1 477 ? 41.567  -42.600 57.654  1.00 14.30 ? 477  MET B SD  1 
ATOM   7901  C CE  . MET B 1 477 ? 41.478  -43.524 56.143  1.00 15.67 ? 477  MET B CE  1 
ATOM   7902  N N   . SER B 1 478 ? 44.515  -45.394 61.578  1.00 13.40 ? 478  SER B N   1 
ATOM   7903  C CA  . SER B 1 478 ? 44.762  -46.680 62.234  1.00 13.98 ? 478  SER B CA  1 
ATOM   7904  C C   . SER B 1 478 ? 43.479  -47.097 62.956  1.00 13.54 ? 478  SER B C   1 
ATOM   7905  O O   . SER B 1 478 ? 43.159  -48.279 63.017  1.00 13.74 ? 478  SER B O   1 
ATOM   7906  C CB  . SER B 1 478 ? 45.948  -46.609 63.207  1.00 13.70 ? 478  SER B CB  1 
ATOM   7907  O OG  . SER B 1 478 ? 45.676  -45.841 64.365  1.00 15.62 ? 478  SER B OG  1 
ATOM   7908  N N   . ASN B 1 479 ? 42.724  -46.097 63.422  1.00 12.63 ? 479  ASN B N   1 
ATOM   7909  C CA  . ASN B 1 479 ? 41.444  -46.295 64.104  1.00 12.97 ? 479  ASN B CA  1 
ATOM   7910  C C   . ASN B 1 479 ? 40.359  -46.703 63.111  1.00 12.13 ? 479  ASN B C   1 
ATOM   7911  O O   . ASN B 1 479 ? 39.531  -47.559 63.412  1.00 13.59 ? 479  ASN B O   1 
ATOM   7912  C CB  . ASN B 1 479 ? 40.997  -45.011 64.804  1.00 12.75 ? 479  ASN B CB  1 
ATOM   7913  C CG  . ASN B 1 479 ? 41.830  -44.685 66.019  1.00 13.34 ? 479  ASN B CG  1 
ATOM   7914  O OD1 . ASN B 1 479 ? 41.645  -45.266 67.086  1.00 13.72 ? 479  ASN B OD1 1 
ATOM   7915  N ND2 . ASN B 1 479 ? 42.749  -43.739 65.868  1.00 16.23 ? 479  ASN B ND2 1 
ATOM   7916  N N   . PHE B 1 480 ? 40.388  -46.083 61.928  1.00 12.18 ? 480  PHE B N   1 
ATOM   7917  C CA  . PHE B 1 480 ? 39.431  -46.337 60.846  1.00 12.41 ? 480  PHE B CA  1 
ATOM   7918  C C   . PHE B 1 480 ? 39.397  -47.809 60.415  1.00 13.16 ? 480  PHE B C   1 
ATOM   7919  O O   . PHE B 1 480 ? 38.320  -48.395 60.280  1.00 14.35 ? 480  PHE B O   1 
ATOM   7920  C CB  . PHE B 1 480 ? 39.761  -45.413 59.661  1.00 12.22 ? 480  PHE B CB  1 
ATOM   7921  C CG  . PHE B 1 480 ? 38.863  -45.574 58.466  1.00 13.37 ? 480  PHE B CG  1 
ATOM   7922  C CD1 . PHE B 1 480 ? 37.546  -45.101 58.497  1.00 13.86 ? 480  PHE B CD1 1 
ATOM   7923  C CD2 . PHE B 1 480 ? 39.347  -46.153 57.282  1.00 14.87 ? 480  PHE B CD2 1 
ATOM   7924  C CE1 . PHE B 1 480 ? 36.722  -45.191 57.368  1.00 12.90 ? 480  PHE B CE1 1 
ATOM   7925  C CE2 . PHE B 1 480 ? 38.535  -46.254 56.136  1.00 13.97 ? 480  PHE B CE2 1 
ATOM   7926  C CZ  . PHE B 1 480 ? 37.209  -45.766 56.178  1.00 13.93 ? 480  PHE B CZ  1 
ATOM   7927  N N   . PHE B 1 481 ? 40.580  -48.393 60.224  1.00 13.07 ? 481  PHE B N   1 
ATOM   7928  C CA  . PHE B 1 481 ? 40.705  -49.790 59.816  1.00 14.22 ? 481  PHE B CA  1 
ATOM   7929  C C   . PHE B 1 481 ? 40.473  -50.752 60.978  1.00 13.22 ? 481  PHE B C   1 
ATOM   7930  O O   . PHE B 1 481 ? 39.865  -51.808 60.801  1.00 15.15 ? 481  PHE B O   1 
ATOM   7931  C CB  . PHE B 1 481 ? 42.085  -50.048 59.196  1.00 13.57 ? 481  PHE B CB  1 
ATOM   7932  C CG  . PHE B 1 481 ? 42.393  -49.179 58.005  1.00 14.37 ? 481  PHE B CG  1 
ATOM   7933  C CD1 . PHE B 1 481 ? 41.525  -49.144 56.895  1.00 15.62 ? 481  PHE B CD1 1 
ATOM   7934  C CD2 . PHE B 1 481 ? 43.544  -48.370 57.996  1.00 15.32 ? 481  PHE B CD2 1 
ATOM   7935  C CE1 . PHE B 1 481 ? 41.799  -48.304 55.782  1.00 15.68 ? 481  PHE B CE1 1 
ATOM   7936  C CE2 . PHE B 1 481 ? 43.833  -47.524 56.894  1.00 16.00 ? 481  PHE B CE2 1 
ATOM   7937  C CZ  . PHE B 1 481 ? 42.952  -47.494 55.787  1.00 15.89 ? 481  PHE B CZ  1 
ATOM   7938  N N   . ALA B 1 482 ? 40.905  -50.343 62.171  1.00 12.69 ? 482  ALA B N   1 
ATOM   7939  C CA  . ALA B 1 482 ? 40.784  -51.152 63.384  1.00 12.87 ? 482  ALA B CA  1 
ATOM   7940  C C   . ALA B 1 482 ? 39.390  -51.375 63.921  1.00 13.33 ? 482  ALA B C   1 
ATOM   7941  O O   . ALA B 1 482 ? 39.079  -52.470 64.385  1.00 13.57 ? 482  ALA B O   1 
ATOM   7942  C CB  . ALA B 1 482 ? 41.618  -50.582 64.455  1.00 12.69 ? 482  ALA B CB  1 
ATOM   7943  N N   . GLN B 1 483 ? 38.559  -50.337 63.871  1.00 13.42 ? 483  GLN B N   1 
ATOM   7944  C CA  . GLN B 1 483 ? 37.194  -50.425 64.379  1.00 13.07 ? 483  GLN B CA  1 
ATOM   7945  C C   . GLN B 1 483 ? 36.307  -51.410 63.631  1.00 12.92 ? 483  GLN B C   1 
ATOM   7946  O O   . GLN B 1 483 ? 35.564  -52.163 64.256  1.00 12.61 ? 483  GLN B O   1 
ATOM   7947  C CB  . GLN B 1 483 ? 36.553  -49.042 64.433  1.00 13.36 ? 483  GLN B CB  1 
ATOM   7948  C CG  . GLN B 1 483 ? 37.126  -48.128 65.519  1.00 14.75 ? 483  GLN B CG  1 
ATOM   7949  C CD  . GLN B 1 483 ? 36.781  -48.562 66.940  1.00 14.43 ? 483  GLN B CD  1 
ATOM   7950  O OE1 . GLN B 1 483 ? 35.759  -49.209 67.185  1.00 15.95 ? 483  GLN B OE1 1 
ATOM   7951  N NE2 . GLN B 1 483 ? 37.624  -48.178 67.886  1.00 15.00 ? 483  GLN B NE2 1 
ATOM   7952  N N   . THR B 1 484 ? 36.446  -51.446 62.303  1.00 12.44 ? 484  THR B N   1 
ATOM   7953  C CA  . THR B 1 484 ? 35.677  -52.365 61.464  1.00 12.51 ? 484  THR B CA  1 
ATOM   7954  C C   . THR B 1 484 ? 36.164  -53.797 61.681  1.00 12.12 ? 484  THR B C   1 
ATOM   7955  O O   . THR B 1 484 ? 35.360  -54.725 61.723  1.00 12.73 ? 484  THR B O   1 
ATOM   7956  C CB  . THR B 1 484 ? 35.762  -51.999 59.969  1.00 13.63 ? 484  THR B CB  1 
ATOM   7957  O OG1 . THR B 1 484 ? 37.128  -51.893 59.564  1.00 14.45 ? 484  THR B OG1 1 
ATOM   7958  C CG2 . THR B 1 484 ? 35.073  -50.693 59.707  1.00 13.11 ? 484  THR B CG2 1 
ATOM   7959  N N   . GLU B 1 485 ? 37.479  -53.946 61.876  1.00 12.53 ? 485  GLU B N   1 
ATOM   7960  C CA  . GLU B 1 485 ? 38.093  -55.248 62.145  1.00 12.18 ? 485  GLU B CA  1 
ATOM   7961  C C   . GLU B 1 485 ? 37.599  -55.742 63.512  1.00 12.81 ? 485  GLU B C   1 
ATOM   7962  O O   . GLU B 1 485 ? 37.180  -56.891 63.643  1.00 11.85 ? 485  GLU B O   1 
ATOM   7963  C CB  . GLU B 1 485 ? 39.624  -55.144 62.146  1.00 13.40 ? 485  GLU B CB  1 
ATOM   7964  C CG  . GLU B 1 485 ? 40.342  -56.498 62.325  1.00 15.42 ? 485  GLU B CG  1 
ATOM   7965  C CD  . GLU B 1 485 ? 41.862  -56.394 62.399  1.00 17.28 ? 485  GLU B CD  1 
ATOM   7966  O OE1 . GLU B 1 485 ? 42.396  -55.311 62.732  1.00 16.83 ? 485  GLU B OE1 1 
ATOM   7967  O OE2 . GLU B 1 485 ? 42.526  -57.425 62.146  1.00 16.82 ? 485  GLU B OE2 1 
ATOM   7968  N N   . ALA B 1 486 ? 37.578  -54.830 64.490  1.00 13.25 ? 486  ALA B N   1 
ATOM   7969  C CA  . ALA B 1 486 ? 37.129  -55.113 65.858  1.00 12.89 ? 486  ALA B CA  1 
ATOM   7970  C C   . ALA B 1 486 ? 35.675  -55.564 65.932  1.00 14.00 ? 486  ALA B C   1 
ATOM   7971  O O   . ALA B 1 486 ? 35.355  -56.540 66.616  1.00 12.05 ? 486  ALA B O   1 
ATOM   7972  C CB  . ALA B 1 486 ? 37.343  -53.893 66.742  1.00 13.79 ? 486  ALA B CB  1 
ATOM   7973  N N   . LEU B 1 487 ? 34.816  -54.875 65.178  1.00 13.30 ? 487  LEU B N   1 
ATOM   7974  C CA  . LEU B 1 487 ? 33.388  -55.187 65.118  1.00 13.80 ? 487  LEU B CA  1 
ATOM   7975  C C   . LEU B 1 487 ? 33.148  -56.592 64.574  1.00 13.84 ? 487  LEU B C   1 
ATOM   7976  O O   . LEU B 1 487 ? 32.294  -57.319 65.073  1.00 13.83 ? 487  LEU B O   1 
ATOM   7977  C CB  . LEU B 1 487 ? 32.653  -54.162 64.244  1.00 14.59 ? 487  LEU B CB  1 
ATOM   7978  C CG  . LEU B 1 487 ? 32.326  -52.798 64.854  1.00 14.94 ? 487  LEU B CG  1 
ATOM   7979  C CD1 . LEU B 1 487 ? 31.791  -51.864 63.782  1.00 14.23 ? 487  LEU B CD1 1 
ATOM   7980  C CD2 . LEU B 1 487 ? 31.325  -52.940 65.994  1.00 14.75 ? 487  LEU B CD2 1 
ATOM   7981  N N   . MET B 1 488 ? 33.977  -56.991 63.613  1.00 14.86 ? 488  MET B N   1 
ATOM   7982  C CA  . MET B 1 488 ? 33.859  -58.300 62.995  1.00 15.29 ? 488  MET B CA  1 
ATOM   7983  C C   . MET B 1 488 ? 34.472  -59.476 63.766  1.00 15.94 ? 488  MET B C   1 
ATOM   7984  O O   . MET B 1 488 ? 33.793  -60.483 63.982  1.00 16.11 ? 488  MET B O   1 
ATOM   7985  C CB  . MET B 1 488 ? 34.427  -58.262 61.575  1.00 17.68 ? 488  MET B CB  1 
ATOM   7986  C CG  . MET B 1 488 ? 34.259  -59.572 60.830  1.00 21.77 ? 488  MET B CG  1 
ATOM   7987  S SD  . MET B 1 488 ? 34.989  -59.611 59.230  1.00 26.99 ? 488  MET B SD  1 
ATOM   7988  C CE  . MET B 1 488 ? 36.682  -59.487 59.685  1.00 25.11 ? 488  MET B CE  1 
ATOM   7989  N N   . ILE B 1 489 ? 35.742  -59.356 64.156  1.00 15.82 ? 489  ILE B N   1 
ATOM   7990  C CA  . ILE B 1 489 ? 36.431  -60.458 64.841  1.00 15.58 ? 489  ILE B CA  1 
ATOM   7991  C C   . ILE B 1 489 ? 36.132  -60.667 66.318  1.00 16.48 ? 489  ILE B C   1 
ATOM   7992  O O   . ILE B 1 489 ? 36.095  -61.808 66.788  1.00 16.99 ? 489  ILE B O   1 
ATOM   7993  C CB  . ILE B 1 489 ? 37.987  -60.449 64.599  1.00 15.97 ? 489  ILE B CB  1 
ATOM   7994  C CG1 . ILE B 1 489 ? 38.674  -59.275 65.319  1.00 16.00 ? 489  ILE B CG1 1 
ATOM   7995  C CG2 . ILE B 1 489 ? 38.282  -60.425 63.096  1.00 16.35 ? 489  ILE B CG2 1 
ATOM   7996  C CD1 . ILE B 1 489 ? 40.204  -59.359 65.363  1.00 19.60 ? 489  ILE B CD1 1 
ATOM   7997  N N   . GLY B 1 490 ? 35.912  -59.572 67.043  1.00 15.91 ? 490  GLY B N   1 
ATOM   7998  C CA  . GLY B 1 490 ? 35.648  -59.662 68.468  1.00 15.64 ? 490  GLY B CA  1 
ATOM   7999  C C   . GLY B 1 490 ? 36.858  -60.115 69.269  1.00 15.45 ? 490  GLY B C   1 
ATOM   8000  O O   . GLY B 1 490 ? 37.999  -59.970 68.819  1.00 16.25 ? 490  GLY B O   1 
ATOM   8001  N N   . LYS B 1 491 ? 36.598  -60.646 70.462  1.00 16.46 ? 491  LYS B N   1 
ATOM   8002  C CA  . LYS B 1 491 ? 37.634  -61.141 71.366  1.00 18.75 ? 491  LYS B CA  1 
ATOM   8003  C C   . LYS B 1 491 ? 36.965  -62.172 72.274  1.00 19.79 ? 491  LYS B C   1 
ATOM   8004  O O   . LYS B 1 491 ? 36.073  -61.845 73.056  1.00 18.51 ? 491  LYS B O   1 
ATOM   8005  C CB  . LYS B 1 491 ? 38.251  -59.977 72.173  1.00 19.50 ? 491  LYS B CB  1 
ATOM   8006  C CG  . LYS B 1 491 ? 39.382  -60.373 73.122  1.00 22.87 ? 491  LYS B CG  1 
ATOM   8007  C CD  . LYS B 1 491 ? 40.271  -59.197 73.505  1.00 25.92 ? 491  LYS B CD  1 
ATOM   8008  C CE  . LYS B 1 491 ? 41.494  -59.108 72.598  1.00 27.96 ? 491  LYS B CE  1 
ATOM   8009  N NZ  . LYS B 1 491 ? 42.321  -57.896 72.874  1.00 29.51 ? 491  LYS B NZ  1 
ATOM   8010  N N   . SER B 1 492 ? 37.400  -63.425 72.135  1.00 22.11 ? 492  SER B N   1 
ATOM   8011  C CA  . SER B 1 492 ? 36.872  -64.564 72.893  1.00 24.22 ? 492  SER B CA  1 
ATOM   8012  C C   . SER B 1 492 ? 37.311  -64.557 74.371  1.00 25.29 ? 492  SER B C   1 
ATOM   8013  O O   . SER B 1 492 ? 38.304  -63.901 74.703  1.00 25.03 ? 492  SER B O   1 
ATOM   8014  C CB  . SER B 1 492 ? 37.334  -65.865 72.213  1.00 24.84 ? 492  SER B CB  1 
ATOM   8015  O OG  . SER B 1 492 ? 38.743  -66.016 72.272  1.00 25.53 ? 492  SER B OG  1 
ATOM   8016  N N   . PRO B 1 493 ? 36.572  -65.260 75.276  1.00 26.27 ? 493  PRO B N   1 
ATOM   8017  C CA  . PRO B 1 493 ? 36.976  -65.279 76.693  1.00 27.65 ? 493  PRO B CA  1 
ATOM   8018  C C   . PRO B 1 493 ? 38.346  -65.936 76.934  1.00 28.42 ? 493  PRO B C   1 
ATOM   8019  O O   . PRO B 1 493 ? 38.966  -65.714 77.974  1.00 29.24 ? 493  PRO B O   1 
ATOM   8020  C CB  . PRO B 1 493 ? 35.842  -66.059 77.369  1.00 27.21 ? 493  PRO B CB  1 
ATOM   8021  C CG  . PRO B 1 493 ? 35.292  -66.909 76.271  1.00 28.89 ? 493  PRO B CG  1 
ATOM   8022  C CD  . PRO B 1 493 ? 35.269  -65.941 75.129  1.00 27.03 ? 493  PRO B CD  1 
ATOM   8023  N N   . SER B 1 494 ? 38.815  -66.705 75.945  1.00 29.49 ? 494  SER B N   1 
ATOM   8024  C CA  . SER B 1 494 ? 40.117  -67.380 75.990  1.00 30.36 ? 494  SER B CA  1 
ATOM   8025  C C   . SER B 1 494 ? 41.229  -66.363 75.711  1.00 30.01 ? 494  SER B C   1 
ATOM   8026  O O   . SER B 1 494 ? 42.289  -66.410 76.342  1.00 29.73 ? 494  SER B O   1 
ATOM   8027  C CB  . SER B 1 494 ? 40.175  -68.520 74.964  1.00 31.73 ? 494  SER B CB  1 
ATOM   8028  O OG  . SER B 1 494 ? 41.361  -69.282 75.097  1.00 34.91 ? 494  SER B OG  1 
ATOM   8029  N N   . GLU B 1 495 ? 40.961  -65.434 74.789  1.00 28.65 ? 495  GLU B N   1 
ATOM   8030  C CA  . GLU B 1 495 ? 41.901  -64.369 74.423  1.00 28.90 ? 495  GLU B CA  1 
ATOM   8031  C C   . GLU B 1 495 ? 42.034  -63.358 75.559  1.00 28.10 ? 495  GLU B C   1 
ATOM   8032  O O   . GLU B 1 495 ? 43.117  -62.805 75.781  1.00 27.80 ? 495  GLU B O   1 
ATOM   8033  C CB  . GLU B 1 495 ? 41.439  -63.646 73.156  1.00 29.98 ? 495  GLU B CB  1 
ATOM   8034  C CG  . GLU B 1 495 ? 41.623  -64.414 71.865  1.00 32.19 ? 495  GLU B CG  1 
ATOM   8035  C CD  . GLU B 1 495 ? 41.100  -63.645 70.666  1.00 33.73 ? 495  GLU B CD  1 
ATOM   8036  O OE1 . GLU B 1 495 ? 39.900  -63.782 70.345  1.00 33.98 ? 495  GLU B OE1 1 
ATOM   8037  O OE2 . GLU B 1 495 ? 41.887  -62.890 70.049  1.00 35.64 ? 495  GLU B OE2 1 
ATOM   8038  N N   . VAL B 1 496 ? 40.931  -63.142 76.285  1.00 27.09 ? 496  VAL B N   1 
ATOM   8039  C CA  . VAL B 1 496 ? 40.884  -62.228 77.429  1.00 27.24 ? 496  VAL B CA  1 
ATOM   8040  C C   . VAL B 1 496 ? 41.705  -62.827 78.585  1.00 27.96 ? 496  VAL B C   1 
ATOM   8041  O O   . VAL B 1 496 ? 42.411  -62.101 79.283  1.00 27.56 ? 496  VAL B O   1 
ATOM   8042  C CB  . VAL B 1 496 ? 39.419  -61.950 77.892  1.00 26.29 ? 496  VAL B CB  1 
ATOM   8043  C CG1 . VAL B 1 496 ? 39.389  -61.024 79.108  1.00 25.89 ? 496  VAL B CG1 1 
ATOM   8044  C CG2 . VAL B 1 496 ? 38.617  -61.328 76.772  1.00 25.57 ? 496  VAL B CG2 1 
ATOM   8045  N N   . ARG B 1 497 ? 41.640  -64.150 78.730  1.00 29.42 ? 497  ARG B N   1 
ATOM   8046  C CA  . ARG B 1 497 ? 42.375  -64.879 79.770  1.00 30.80 ? 497  ARG B CA  1 
ATOM   8047  C C   . ARG B 1 497 ? 43.887  -64.765 79.572  1.00 31.84 ? 497  ARG B C   1 
ATOM   8048  O O   . ARG B 1 497 ? 44.600  -64.443 80.520  1.00 31.27 ? 497  ARG B O   1 
ATOM   8049  C CB  . ARG B 1 497 ? 41.940  -66.351 79.808  1.00 31.28 ? 497  ARG B CB  1 
ATOM   8050  C CG  . ARG B 1 497 ? 42.453  -67.123 81.021  1.00 33.64 ? 497  ARG B CG  1 
ATOM   8051  C CD  . ARG B 1 497 ? 42.005  -68.580 81.027  1.00 34.27 ? 497  ARG B CD  1 
ATOM   8052  N NE  . ARG B 1 497 ? 40.589  -68.757 81.361  1.00 35.66 ? 497  ARG B NE  1 
ATOM   8053  C CZ  . ARG B 1 497 ? 40.065  -68.625 82.579  1.00 36.50 ? 497  ARG B CZ  1 
ATOM   8054  N NH1 . ARG B 1 497 ? 40.821  -68.296 83.622  1.00 38.10 ? 497  ARG B NH1 1 
ATOM   8055  N NH2 . ARG B 1 497 ? 38.768  -68.846 82.762  1.00 38.04 ? 497  ARG B NH2 1 
ATOM   8056  N N   . ARG B 1 498 ? 44.346  -64.945 78.329  1.00 32.97 ? 498  ARG B N   1 
ATOM   8057  C CA  . ARG B 1 498 ? 45.771  -64.850 77.971  1.00 34.94 ? 498  ARG B CA  1 
ATOM   8058  C C   . ARG B 1 498 ? 46.284  -63.410 78.075  1.00 36.18 ? 498  ARG B C   1 
ATOM   8059  O O   . ARG B 1 498 ? 47.494  -63.171 78.206  1.00 36.90 ? 498  ARG B O   1 
ATOM   8060  C CB  . ARG B 1 498 ? 46.006  -65.351 76.540  1.00 35.95 ? 498  ARG B CB  1 
ATOM   8061  C CG  . ARG B 1 498 ? 45.825  -66.860 76.372  1.00 37.94 ? 498  ARG B CG  1 
ATOM   8062  C CD  . ARG B 1 498 ? 46.094  -67.330 74.938  1.00 39.44 ? 498  ARG B CD  1 
ATOM   8063  N NE  . ARG B 1 498 ? 44.892  -67.848 74.267  1.00 41.45 ? 498  ARG B NE  1 
ATOM   8064  C CZ  . ARG B 1 498 ? 44.451  -67.424 73.072  1.00 41.85 ? 498  ARG B CZ  1 
ATOM   8065  N NH1 . ARG B 1 498 ? 45.101  -66.469 72.393  1.00 42.70 ? 498  ARG B NH1 1 
ATOM   8066  N NH2 . ARG B 1 498 ? 43.355  -67.902 72.465  1.00 42.48 ? 498  ARG B NH2 1 
ATOM   8067  N N   . GLU B 1 499 ? 45.352  -62.481 78.020  1.00 36.80 ? 499  GLU B N   1 
ATOM   8068  C CA  . GLU B 1 499 ? 45.666  -61.045 78.079  1.00 37.74 ? 499  GLU B CA  1 
ATOM   8069  C C   . GLU B 1 499 ? 45.819  -60.573 79.531  1.00 37.50 ? 499  GLU B C   1 
ATOM   8070  O O   . GLU B 1 499 ? 46.675  -59.733 79.844  1.00 37.60 ? 499  GLU B O   1 
ATOM   8071  C CB  . GLU B 1 499 ? 44.547  -60.236 77.421  1.00 38.94 ? 499  GLU B CB  1 
ATOM   8072  C CG  . GLU B 1 499 ? 44.771  -58.726 77.508  1.00 41.69 ? 499  GLU B CG  1 
ATOM   8073  C CD  . GLU B 1 499 ? 43.635  -57.996 78.226  1.00 43.14 ? 499  GLU B CD  1 
ATOM   8074  O OE1 . GLU B 1 499 ? 42.440  -58.481 78.201  1.00 45.13 ? 499  GLU B OE1 1 
ATOM   8075  O OE2 . GLU B 1 499 ? 43.872  -56.896 78.856  1.00 44.64 ? 499  GLU B OE2 1 
ATOM   8076  N N   . LEU B 1 500 ? 44.982  -61.131 80.383  1.00 36.92 ? 500  LEU B N   1 
ATOM   8077  C CA  . LEU B 1 500 ? 44.949  -60.781 81.814  1.00 37.08 ? 500  LEU B CA  1 
ATOM   8078  C C   . LEU B 1 500 ? 46.094  -61.451 82.583  1.00 38.13 ? 500  LEU B C   1 
ATOM   8079  O O   . LEU B 1 500 ? 46.469  -61.015 83.681  1.00 38.19 ? 500  LEU B O   1 
ATOM   8080  C CB  . LEU B 1 500 ? 43.632  -61.243 82.440  1.00 35.95 ? 500  LEU B CB  1 
ATOM   8081  C CG  . LEU B 1 500 ? 42.454  -60.326 82.107  1.00 35.03 ? 500  LEU B CG  1 
ATOM   8082  C CD1 . LEU B 1 500 ? 41.167  -60.718 82.836  1.00 34.51 ? 500  LEU B CD1 1 
ATOM   8083  C CD2 . LEU B 1 500 ? 42.710  -58.863 82.475  1.00 34.97 ? 500  LEU B CD2 1 
ATOM   8084  N N   . GLU B 1 501 ? 46.630  -62.502 81.994  1.00 39.05 ? 501  GLU B N   1 
ATOM   8085  C CA  . GLU B 1 501 ? 47.712  -63.283 82.617  1.00 40.45 ? 501  GLU B CA  1 
ATOM   8086  C C   . GLU B 1 501 ? 49.075  -62.652 82.320  1.00 41.40 ? 501  GLU B C   1 
ATOM   8087  O O   . GLU B 1 501 ? 49.848  -62.334 83.235  1.00 41.57 ? 501  GLU B O   1 
ATOM   8088  C CB  . GLU B 1 501 ? 47.675  -64.721 82.107  1.00 40.70 ? 501  GLU B CB  1 
ATOM   8089  C CG  . GLU B 1 501 ? 46.750  -65.604 82.946  1.00 41.37 ? 501  GLU B CG  1 
ATOM   8090  C CD  . GLU B 1 501 ? 46.459  -66.961 82.306  1.00 42.23 ? 501  GLU B CD  1 
ATOM   8091  O OE1 . GLU B 1 501 ? 46.949  -67.247 81.149  1.00 42.97 ? 501  GLU B OE1 1 
ATOM   8092  O OE2 . GLU B 1 501 ? 45.725  -67.821 82.928  1.00 42.83 ? 501  GLU B OE2 1 
ATOM   8093  N N   . ALA B 1 502 ? 49.346  -62.487 81.045  1.00 41.96 ? 502  ALA B N   1 
ATOM   8094  C CA  . ALA B 1 502 ? 50.600  -61.879 80.588  1.00 42.98 ? 502  ALA B CA  1 
ATOM   8095  C C   . ALA B 1 502 ? 50.570  -60.377 80.881  1.00 43.46 ? 502  ALA B C   1 
ATOM   8096  O O   . ALA B 1 502 ? 50.969  -59.554 80.045  1.00 44.10 ? 502  ALA B O   1 
ATOM   8097  C CB  . ALA B 1 502 ? 50.765  -62.095 79.080  1.00 43.15 ? 502  ALA B CB  1 
ATOM   8098  N N   . ALA B 1 503 ? 50.096  -60.047 82.080  1.00 43.73 ? 503  ALA B N   1 
ATOM   8099  C CA  . ALA B 1 503 ? 49.950  -58.639 82.499  1.00 44.24 ? 503  ALA B CA  1 
ATOM   8100  C C   . ALA B 1 503 ? 50.362  -58.407 83.963  1.00 44.31 ? 503  ALA B C   1 
ATOM   8101  O O   . ALA B 1 503 ? 50.970  -57.382 84.303  1.00 45.34 ? 503  ALA B O   1 
ATOM   8102  C CB  . ALA B 1 503 ? 48.498  -58.195 82.345  1.00 44.40 ? 503  ALA B CB  1 
ATOM   8103  N N   . GLY B 1 504 ? 50.011  -59.340 84.837  1.00 44.22 ? 504  GLY B N   1 
ATOM   8104  C CA  . GLY B 1 504 ? 50.378  -59.222 86.264  1.00 44.08 ? 504  GLY B CA  1 
ATOM   8105  C C   . GLY B 1 504 ? 49.281  -59.754 87.200  1.00 44.19 ? 504  GLY B C   1 
ATOM   8106  O O   . GLY B 1 504 ? 49.300  -59.510 88.415  1.00 44.36 ? 504  GLY B O   1 
ATOM   8107  N N   . GLU B 1 505 ? 48.328  -60.478 86.645  1.00 43.91 ? 505  GLU B N   1 
ATOM   8108  C CA  . GLU B 1 505 ? 47.251  -61.069 87.461  1.00 43.80 ? 505  GLU B CA  1 
ATOM   8109  C C   . GLU B 1 505 ? 47.510  -62.565 87.649  1.00 43.42 ? 505  GLU B C   1 
ATOM   8110  O O   . GLU B 1 505 ? 47.733  -63.302 86.677  1.00 43.24 ? 505  GLU B O   1 
ATOM   8111  C CB  . GLU B 1 505 ? 45.885  -60.867 86.810  1.00 44.40 ? 505  GLU B CB  1 
ATOM   8112  C CG  . GLU B 1 505 ? 44.737  -60.943 87.827  1.00 44.87 ? 505  GLU B CG  1 
ATOM   8113  C CD  . GLU B 1 505 ? 45.042  -60.208 89.138  1.00 45.21 ? 505  GLU B CD  1 
ATOM   8114  O OE1 . GLU B 1 505 ? 44.951  -58.921 89.193  1.00 45.90 ? 505  GLU B OE1 1 
ATOM   8115  O OE2 . GLU B 1 505 ? 45.389  -60.871 90.191  1.00 45.40 ? 505  GLU B OE2 1 
ATOM   8116  N N   . ARG B 1 506 ? 47.473  -62.959 88.913  1.00 43.30 ? 506  ARG B N   1 
ATOM   8117  C CA  . ARG B 1 506 ? 47.709  -64.352 89.333  1.00 43.13 ? 506  ARG B CA  1 
ATOM   8118  C C   . ARG B 1 506 ? 46.442  -64.947 89.961  1.00 42.96 ? 506  ARG B C   1 
ATOM   8119  O O   . ARG B 1 506 ? 46.167  -66.149 89.827  1.00 43.36 ? 506  ARG B O   1 
ATOM   8120  C CB  . ARG B 1 506 ? 48.837  -64.406 90.369  1.00 43.07 ? 506  ARG B CB  1 
ATOM   8121  C CG  . ARG B 1 506 ? 49.899  -63.322 90.164  1.00 42.96 ? 506  ARG B CG  1 
ATOM   8122  C CD  . ARG B 1 506 ? 50.998  -63.351 91.232  1.00 43.46 ? 506  ARG B CD  1 
ATOM   8123  N NE  . ARG B 1 506 ? 51.861  -64.538 91.137  1.00 43.56 ? 506  ARG B NE  1 
ATOM   8124  C CZ  . ARG B 1 506 ? 53.092  -64.617 91.664  1.00 43.43 ? 506  ARG B CZ  1 
ATOM   8125  N NH1 . ARG B 1 506 ? 53.625  -63.584 92.330  1.00 43.55 ? 506  ARG B NH1 1 
ATOM   8126  N NH2 . ARG B 1 506 ? 53.877  -65.699 91.575  1.00 43.90 ? 506  ARG B NH2 1 
ATOM   8127  N N   . SER B 1 507 ? 45.703  -64.082 90.639  1.00 43.21 ? 507  SER B N   1 
ATOM   8128  C CA  . SER B 1 507 ? 44.442  -64.463 91.303  1.00 43.07 ? 507  SER B CA  1 
ATOM   8129  C C   . SER B 1 507 ? 43.422  -64.889 90.248  1.00 42.62 ? 507  SER B C   1 
ATOM   8130  O O   . SER B 1 507 ? 43.008  -64.086 89.400  1.00 43.01 ? 507  SER B O   1 
ATOM   8131  C CB  . SER B 1 507 ? 43.882  -63.285 92.100  1.00 43.28 ? 507  SER B CB  1 
ATOM   8132  O OG  . SER B 1 507 ? 42.775  -63.714 92.883  1.00 43.97 ? 507  SER B OG  1 
ATOM   8133  N N   . ALA B 1 508 ? 43.047  -66.146 90.345  1.00 42.03 ? 508  ALA B N   1 
ATOM   8134  C CA  . ALA B 1 508 ? 42.119  -66.786 89.402  1.00 41.27 ? 508  ALA B CA  1 
ATOM   8135  C C   . ALA B 1 508 ? 40.697  -66.185 89.472  1.00 40.92 ? 508  ALA B C   1 
ATOM   8136  O O   . ALA B 1 508 ? 39.975  -66.141 88.467  1.00 41.06 ? 508  ALA B O   1 
ATOM   8137  C CB  . ALA B 1 508 ? 42.019  -68.282 89.705  1.00 41.37 ? 508  ALA B CB  1 
ATOM   8138  N N   . GLU B 1 509 ? 40.293  -65.725 90.657  1.00 40.24 ? 509  GLU B N   1 
ATOM   8139  C CA  . GLU B 1 509 ? 38.922  -65.169 90.864  1.00 39.58 ? 509  GLU B CA  1 
ATOM   8140  C C   . GLU B 1 509 ? 38.759  -63.773 90.237  1.00 38.55 ? 509  GLU B C   1 
ATOM   8141  O O   . GLU B 1 509 ? 37.672  -63.407 89.765  1.00 37.77 ? 509  GLU B O   1 
ATOM   8142  C CB  . GLU B 1 509 ? 38.581  -65.037 92.356  1.00 40.37 ? 509  GLU B CB  1 
ATOM   8143  C CG  . GLU B 1 509 ? 37.069  -65.138 92.637  1.00 41.63 ? 509  GLU B CG  1 
ATOM   8144  C CD  . GLU B 1 509 ? 36.366  -63.774 92.728  1.00 42.62 ? 509  GLU B CD  1 
ATOM   8145  O OE1 . GLU B 1 509 ? 37.026  -62.728 93.096  1.00 43.57 ? 509  GLU B OE1 1 
ATOM   8146  O OE2 . GLU B 1 509 ? 35.111  -63.669 92.438  1.00 43.56 ? 509  GLU B OE2 1 
ATOM   8147  N N   . LYS B 1 510 ? 39.839  -63.011 90.248  1.00 37.55 ? 510  LYS B N   1 
ATOM   8148  C CA  . LYS B 1 510 ? 39.846  -61.640 89.693  1.00 37.34 ? 510  LYS B CA  1 
ATOM   8149  C C   . LYS B 1 510 ? 39.842  -61.696 88.163  1.00 36.61 ? 510  LYS B C   1 
ATOM   8150  O O   . LYS B 1 510 ? 39.368  -60.765 87.506  1.00 37.02 ? 510  LYS B O   1 
ATOM   8151  C CB  . LYS B 1 510 ? 41.080  -60.882 90.186  1.00 37.70 ? 510  LYS B CB  1 
ATOM   8152  C CG  . LYS B 1 510 ? 40.924  -60.375 91.623  1.00 38.97 ? 510  LYS B CG  1 
ATOM   8153  C CD  . LYS B 1 510 ? 41.918  -59.270 91.985  1.00 39.81 ? 510  LYS B CD  1 
ATOM   8154  C CE  . LYS B 1 510 ? 41.791  -58.806 93.438  1.00 40.85 ? 510  LYS B CE  1 
ATOM   8155  N NZ  . LYS B 1 510 ? 40.464  -58.257 93.753  1.00 40.55 ? 510  LYS B NZ  1 
ATOM   8156  N N   . ILE B 1 511 ? 40.360  -62.800 87.616  1.00 35.39 ? 511  ILE B N   1 
ATOM   8157  C CA  . ILE B 1 511 ? 40.396  -63.044 86.170  1.00 34.79 ? 511  ILE B CA  1 
ATOM   8158  C C   . ILE B 1 511 ? 38.994  -63.497 85.761  1.00 34.01 ? 511  ILE B C   1 
ATOM   8159  O O   . ILE B 1 511 ? 38.416  -62.939 84.828  1.00 33.20 ? 511  ILE B O   1 
ATOM   8160  C CB  . ILE B 1 511 ? 41.456  -64.132 85.776  1.00 35.04 ? 511  ILE B CB  1 
ATOM   8161  C CG1 . ILE B 1 511 ? 42.865  -63.634 86.098  1.00 36.57 ? 511  ILE B CG1 1 
ATOM   8162  C CG2 . ILE B 1 511 ? 41.384  -64.466 84.267  1.00 35.30 ? 511  ILE B CG2 1 
ATOM   8163  C CD1 . ILE B 1 511 ? 43.730  -63.315 84.896  1.00 37.64 ? 511  ILE B CD1 1 
ATOM   8164  N N   . ASN B 1 512 ? 38.437  -64.447 86.520  1.00 32.94 ? 512  ASN B N   1 
ATOM   8165  C CA  . ASN B 1 512 ? 37.097  -65.007 86.281  1.00 32.64 ? 512  ASN B CA  1 
ATOM   8166  C C   . ASN B 1 512 ? 35.965  -63.992 86.417  1.00 31.25 ? 512  ASN B C   1 
ATOM   8167  O O   . ASN B 1 512 ? 34.925  -64.125 85.759  1.00 31.62 ? 512  ASN B O   1 
ATOM   8168  C CB  . ASN B 1 512 ? 36.834  -66.189 87.218  1.00 34.62 ? 512  ASN B CB  1 
ATOM   8169  C CG  . ASN B 1 512 ? 36.858  -67.520 86.497  1.00 36.52 ? 512  ASN B CG  1 
ATOM   8170  O OD1 . ASN B 1 512 ? 37.917  -67.986 86.065  1.00 38.10 ? 512  ASN B OD1 1 
ATOM   8171  N ND2 . ASN B 1 512 ? 35.696  -68.141 86.358  1.00 37.91 ? 512  ASN B ND2 1 
ATOM   8172  N N   . ALA B 1 513 ? 36.177  -62.984 87.263  1.00 29.63 ? 513  ALA B N   1 
ATOM   8173  C CA  . ALA B 1 513 ? 35.199  -61.921 87.489  1.00 28.30 ? 513  ALA B CA  1 
ATOM   8174  C C   . ALA B 1 513 ? 35.213  -60.923 86.332  1.00 27.27 ? 513  ALA B C   1 
ATOM   8175  O O   . ALA B 1 513 ? 34.158  -60.444 85.920  1.00 27.19 ? 513  ALA B O   1 
ATOM   8176  C CB  . ALA B 1 513 ? 35.479  -61.205 88.804  1.00 28.24 ? 513  ALA B CB  1 
ATOM   8177  N N   . LEU B 1 514 ? 36.405  -60.649 85.803  1.00 26.08 ? 514  LEU B N   1 
ATOM   8178  C CA  . LEU B 1 514 ? 36.580  -59.712 84.693  1.00 25.33 ? 514  LEU B CA  1 
ATOM   8179  C C   . LEU B 1 514 ? 36.345  -60.265 83.291  1.00 24.42 ? 514  LEU B C   1 
ATOM   8180  O O   . LEU B 1 514 ? 35.969  -59.498 82.396  1.00 23.01 ? 514  LEU B O   1 
ATOM   8181  C CB  . LEU B 1 514 ? 37.959  -59.040 84.743  1.00 26.75 ? 514  LEU B CB  1 
ATOM   8182  C CG  . LEU B 1 514 ? 38.098  -57.643 85.364  1.00 28.50 ? 514  LEU B CG  1 
ATOM   8183  C CD1 . LEU B 1 514 ? 39.465  -57.071 85.011  1.00 29.44 ? 514  LEU B CD1 1 
ATOM   8184  C CD2 . LEU B 1 514 ? 37.001  -56.709 84.854  1.00 28.35 ? 514  LEU B CD2 1 
ATOM   8185  N N   . LEU B 1 515 ? 36.519  -61.581 83.108  1.00 22.62 ? 515  LEU B N   1 
ATOM   8186  C CA  . LEU B 1 515 ? 36.346  -62.244 81.801  1.00 22.90 ? 515  LEU B CA  1 
ATOM   8187  C C   . LEU B 1 515 ? 35.135  -61.873 80.942  1.00 21.85 ? 515  LEU B C   1 
ATOM   8188  O O   . LEU B 1 515 ? 35.339  -61.347 79.840  1.00 21.21 ? 515  LEU B O   1 
ATOM   8189  C CB  . LEU B 1 515 ? 36.471  -63.786 81.889  1.00 25.25 ? 515  LEU B CB  1 
ATOM   8190  C CG  . LEU B 1 515 ? 37.889  -64.356 82.006  1.00 28.07 ? 515  LEU B CG  1 
ATOM   8191  C CD1 . LEU B 1 515 ? 37.883  -65.858 82.086  1.00 28.81 ? 515  LEU B CD1 1 
ATOM   8192  C CD2 . LEU B 1 515 ? 38.756  -63.966 80.855  1.00 29.07 ? 515  LEU B CD2 1 
ATOM   8193  N N   . PRO B 1 516 ? 33.877  -62.043 81.448  1.00 20.40 ? 516  PRO B N   1 
ATOM   8194  C CA  . PRO B 1 516 ? 32.753  -61.674 80.575  1.00 19.33 ? 516  PRO B CA  1 
ATOM   8195  C C   . PRO B 1 516 ? 32.628  -60.192 80.209  1.00 17.90 ? 516  PRO B C   1 
ATOM   8196  O O   . PRO B 1 516 ? 32.154  -59.864 79.119  1.00 18.12 ? 516  PRO B O   1 
ATOM   8197  C CB  . PRO B 1 516 ? 31.539  -62.165 81.358  1.00 19.41 ? 516  PRO B CB  1 
ATOM   8198  C CG  . PRO B 1 516 ? 31.967  -61.998 82.783  1.00 20.89 ? 516  PRO B CG  1 
ATOM   8199  C CD  . PRO B 1 516 ? 33.361  -62.532 82.751  1.00 19.70 ? 516  PRO B CD  1 
ATOM   8200  N N   . HIS B 1 517 ? 33.109  -59.321 81.095  1.00 16.61 ? 517  HIS B N   1 
ATOM   8201  C CA  . HIS B 1 517 ? 33.049  -57.869 80.891  1.00 16.46 ? 517  HIS B CA  1 
ATOM   8202  C C   . HIS B 1 517 ? 33.963  -57.359 79.785  1.00 17.13 ? 517  HIS B C   1 
ATOM   8203  O O   . HIS B 1 517 ? 33.670  -56.339 79.156  1.00 16.77 ? 517  HIS B O   1 
ATOM   8204  C CB  . HIS B 1 517 ? 33.371  -57.133 82.192  1.00 16.49 ? 517  HIS B CB  1 
ATOM   8205  C CG  . HIS B 1 517 ? 32.362  -57.354 83.273  1.00 17.47 ? 517  HIS B CG  1 
ATOM   8206  N ND1 . HIS B 1 517 ? 31.197  -56.624 83.363  1.00 17.51 ? 517  HIS B ND1 1 
ATOM   8207  C CD2 . HIS B 1 517 ? 32.335  -58.235 84.301  1.00 18.71 ? 517  HIS B CD2 1 
ATOM   8208  C CE1 . HIS B 1 517 ? 30.494  -57.048 84.398  1.00 18.31 ? 517  HIS B CE1 1 
ATOM   8209  N NE2 . HIS B 1 517 ? 31.162  -58.025 84.985  1.00 18.23 ? 517  HIS B NE2 1 
ATOM   8210  N N   . LYS B 1 518 ? 35.055  -58.084 79.549  1.00 16.11 ? 518  LYS B N   1 
ATOM   8211  C CA  . LYS B 1 518 ? 36.040  -57.725 78.535  1.00 16.43 ? 518  LYS B CA  1 
ATOM   8212  C C   . LYS B 1 518 ? 35.918  -58.576 77.263  1.00 15.74 ? 518  LYS B C   1 
ATOM   8213  O O   . LYS B 1 518 ? 36.747  -58.468 76.357  1.00 16.73 ? 518  LYS B O   1 
ATOM   8214  C CB  . LYS B 1 518 ? 37.454  -57.823 79.125  1.00 16.72 ? 518  LYS B CB  1 
ATOM   8215  C CG  . LYS B 1 518 ? 37.696  -56.919 80.338  1.00 19.79 ? 518  LYS B CG  1 
ATOM   8216  C CD  . LYS B 1 518 ? 39.146  -56.940 80.827  1.00 22.97 ? 518  LYS B CD  1 
ATOM   8217  C CE  . LYS B 1 518 ? 40.035  -56.001 80.030  1.00 25.66 ? 518  LYS B CE  1 
ATOM   8218  N NZ  . LYS B 1 518 ? 41.432  -55.973 80.539  1.00 28.55 ? 518  LYS B NZ  1 
ATOM   8219  N N   . THR B 1 519 ? 34.872  -59.401 77.198  1.00 15.60 ? 519  THR B N   1 
ATOM   8220  C CA  . THR B 1 519 ? 34.611  -60.266 76.039  1.00 15.65 ? 519  THR B CA  1 
ATOM   8221  C C   . THR B 1 519 ? 33.803  -59.507 74.980  1.00 15.92 ? 519  THR B C   1 
ATOM   8222  O O   . THR B 1 519 ? 32.858  -58.786 75.307  1.00 15.91 ? 519  THR B O   1 
ATOM   8223  C CB  . THR B 1 519 ? 33.861  -61.572 76.465  1.00 17.33 ? 519  THR B CB  1 
ATOM   8224  O OG1 . THR B 1 519 ? 34.714  -62.346 77.319  1.00 18.85 ? 519  THR B OG1 1 
ATOM   8225  C CG2 . THR B 1 519 ? 33.465  -62.435 75.259  1.00 18.42 ? 519  THR B CG2 1 
ATOM   8226  N N   . PHE B 1 520 ? 34.223  -59.653 73.722  1.00 15.36 ? 520  PHE B N   1 
ATOM   8227  C CA  . PHE B 1 520 ? 33.564  -59.019 72.578  1.00 16.18 ? 520  PHE B CA  1 
ATOM   8228  C C   . PHE B 1 520 ? 33.034  -60.135 71.685  1.00 15.95 ? 520  PHE B C   1 
ATOM   8229  O O   . PHE B 1 520 ? 33.816  -60.913 71.134  1.00 17.80 ? 520  PHE B O   1 
ATOM   8230  C CB  . PHE B 1 520 ? 34.550  -58.155 71.782  1.00 16.00 ? 520  PHE B CB  1 
ATOM   8231  C CG  . PHE B 1 520 ? 35.011  -56.920 72.496  1.00 16.38 ? 520  PHE B CG  1 
ATOM   8232  C CD1 . PHE B 1 520 ? 35.921  -57.000 73.570  1.00 15.85 ? 520  PHE B CD1 1 
ATOM   8233  C CD2 . PHE B 1 520 ? 34.558  -55.658 72.079  1.00 16.52 ? 520  PHE B CD2 1 
ATOM   8234  C CE1 . PHE B 1 520 ? 36.381  -55.838 74.229  1.00 16.07 ? 520  PHE B CE1 1 
ATOM   8235  C CE2 . PHE B 1 520 ? 35.006  -54.485 72.720  1.00 15.62 ? 520  PHE B CE2 1 
ATOM   8236  C CZ  . PHE B 1 520 ? 35.922  -54.575 73.802  1.00 16.13 ? 520  PHE B CZ  1 
ATOM   8237  N N   . ILE B 1 521 ? 31.711  -60.212 71.540  1.00 16.27 ? 521  ILE B N   1 
ATOM   8238  C CA  . ILE B 1 521 ? 31.086  -61.254 70.714  1.00 16.17 ? 521  ILE B CA  1 
ATOM   8239  C C   . ILE B 1 521 ? 31.444  -61.166 69.231  1.00 15.99 ? 521  ILE B C   1 
ATOM   8240  O O   . ILE B 1 521 ? 31.542  -62.189 68.548  1.00 16.27 ? 521  ILE B O   1 
ATOM   8241  C CB  . ILE B 1 521 ? 29.535  -61.309 70.885  1.00 17.42 ? 521  ILE B CB  1 
ATOM   8242  C CG1 . ILE B 1 521 ? 28.869  -59.987 70.458  1.00 18.68 ? 521  ILE B CG1 1 
ATOM   8243  C CG2 . ILE B 1 521 ? 29.186  -61.695 72.327  1.00 19.07 ? 521  ILE B CG2 1 
ATOM   8244  C CD1 . ILE B 1 521 ? 27.344  -59.974 70.604  1.00 20.55 ? 521  ILE B CD1 1 
ATOM   8245  N N   . GLY B 1 522 ? 31.680  -59.939 68.763  1.00 15.71 ? 522  GLY B N   1 
ATOM   8246  C CA  . GLY B 1 522 ? 32.020  -59.706 67.370  1.00 14.38 ? 522  GLY B CA  1 
ATOM   8247  C C   . GLY B 1 522 ? 30.861  -60.022 66.452  1.00 15.18 ? 522  GLY B C   1 
ATOM   8248  O O   . GLY B 1 522 ? 29.703  -60.016 66.890  1.00 15.38 ? 522  GLY B O   1 
ATOM   8249  N N   . GLY B 1 523 ? 31.175  -60.335 65.193  1.00 15.61 ? 523  GLY B N   1 
ATOM   8250  C CA  . GLY B 1 523 ? 30.152  -60.655 64.209  1.00 16.19 ? 523  GLY B CA  1 
ATOM   8251  C C   . GLY B 1 523 ? 29.214  -59.491 63.947  1.00 16.06 ? 523  GLY B C   1 
ATOM   8252  O O   . GLY B 1 523 ? 28.047  -59.686 63.616  1.00 16.60 ? 523  GLY B O   1 
ATOM   8253  N N   . ARG B 1 524 ? 29.717  -58.282 64.185  1.00 15.35 ? 524  ARG B N   1 
ATOM   8254  C CA  . ARG B 1 524 ? 28.960  -57.055 63.984  1.00 15.58 ? 524  ARG B CA  1 
ATOM   8255  C C   . ARG B 1 524 ? 29.393  -56.476 62.638  1.00 14.28 ? 524  ARG B C   1 
ATOM   8256  O O   . ARG B 1 524 ? 30.590  -56.319 62.370  1.00 14.35 ? 524  ARG B O   1 
ATOM   8257  C CB  . ARG B 1 524 ? 29.187  -56.103 65.153  1.00 16.06 ? 524  ARG B CB  1 
ATOM   8258  C CG  . ARG B 1 524 ? 28.753  -56.718 66.474  1.00 17.78 ? 524  ARG B CG  1 
ATOM   8259  C CD  . ARG B 1 524 ? 29.013  -55.792 67.622  1.00 20.06 ? 524  ARG B CD  1 
ATOM   8260  N NE  . ARG B 1 524 ? 28.632  -56.352 68.922  1.00 21.77 ? 524  ARG B NE  1 
ATOM   8261  C CZ  . ARG B 1 524 ? 27.451  -56.191 69.521  1.00 22.63 ? 524  ARG B CZ  1 
ATOM   8262  N NH1 . ARG B 1 524 ? 26.482  -55.484 68.951  1.00 25.06 ? 524  ARG B NH1 1 
ATOM   8263  N NH2 . ARG B 1 524 ? 27.268  -56.682 70.736  1.00 23.24 ? 524  ARG B NH2 1 
ATOM   8264  N N   . PRO B 1 525 ? 28.416  -56.186 61.756  1.00 13.17 ? 525  PRO B N   1 
ATOM   8265  C CA  . PRO B 1 525 ? 28.680  -55.651 60.420  1.00 11.75 ? 525  PRO B CA  1 
ATOM   8266  C C   . PRO B 1 525 ? 29.081  -54.209 60.236  1.00 11.27 ? 525  PRO B C   1 
ATOM   8267  O O   . PRO B 1 525 ? 28.779  -53.346 61.059  1.00 12.62 ? 525  PRO B O   1 
ATOM   8268  C CB  . PRO B 1 525 ? 27.376  -55.924 59.703  1.00 11.68 ? 525  PRO B CB  1 
ATOM   8269  C CG  . PRO B 1 525 ? 26.374  -55.633 60.765  1.00 12.20 ? 525  PRO B CG  1 
ATOM   8270  C CD  . PRO B 1 525 ? 26.961  -56.347 61.959  1.00 12.25 ? 525  PRO B CD  1 
ATOM   8271  N N   . SER B 1 526 ? 29.735  -53.974 59.102  1.00 11.36 ? 526  SER B N   1 
ATOM   8272  C CA  . SER B 1 526 ? 30.163  -52.647 58.704  1.00 10.83 ? 526  SER B CA  1 
ATOM   8273  C C   . SER B 1 526 ? 30.485  -52.604 57.226  1.00 10.67 ? 526  SER B C   1 
ATOM   8274  O O   . SER B 1 526 ? 30.812  -53.622 56.614  1.00 11.16 ? 526  SER B O   1 
ATOM   8275  C CB  . SER B 1 526 ? 31.392  -52.181 59.497  1.00 11.54 ? 526  SER B CB  1 
ATOM   8276  O OG  . SER B 1 526 ? 32.537  -52.945 59.171  1.00 12.50 ? 526  SER B OG  1 
ATOM   8277  N N   . ASN B 1 527 ? 30.287  -51.425 56.648  1.00 10.85 ? 527  ASN B N   1 
ATOM   8278  C CA  . ASN B 1 527 ? 30.624  -51.162 55.259  1.00 10.91 ? 527  ASN B CA  1 
ATOM   8279  C C   . ASN B 1 527 ? 31.720  -50.117 55.365  1.00 10.76 ? 527  ASN B C   1 
ATOM   8280  O O   . ASN B 1 527 ? 31.662  -49.250 56.242  1.00 12.53 ? 527  ASN B O   1 
ATOM   8281  C CB  . ASN B 1 527 ? 29.455  -50.545 54.485  1.00 11.37 ? 527  ASN B CB  1 
ATOM   8282  C CG  . ASN B 1 527 ? 28.317  -51.509 54.265  1.00 13.54 ? 527  ASN B CG  1 
ATOM   8283  O OD1 . ASN B 1 527 ? 28.521  -52.677 53.928  1.00 13.20 ? 527  ASN B OD1 1 
ATOM   8284  N ND2 . ASN B 1 527 ? 27.098  -51.019 54.441  1.00 13.98 ? 527  ASN B ND2 1 
ATOM   8285  N N   . THR B 1 528 ? 32.738  -50.236 54.521  1.00 11.71 ? 528  THR B N   1 
ATOM   8286  C CA  . THR B 1 528 ? 33.824  -49.267 54.506  1.00 12.17 ? 528  THR B CA  1 
ATOM   8287  C C   . THR B 1 528 ? 33.837  -48.577 53.146  1.00 12.39 ? 528  THR B C   1 
ATOM   8288  O O   . THR B 1 528 ? 33.849  -49.230 52.101  1.00 12.15 ? 528  THR B O   1 
ATOM   8289  C CB  . THR B 1 528 ? 35.204  -49.916 54.821  1.00 12.35 ? 528  THR B CB  1 
ATOM   8290  O OG1 . THR B 1 528 ? 35.222  -50.364 56.181  1.00 13.51 ? 528  THR B OG1 1 
ATOM   8291  C CG2 . THR B 1 528 ? 36.341  -48.907 54.639  1.00 13.48 ? 528  THR B CG2 1 
ATOM   8292  N N   . LEU B 1 529 ? 33.749  -47.250 53.188  1.00 11.41 ? 529  LEU B N   1 
ATOM   8293  C CA  . LEU B 1 529 ? 33.776  -46.406 52.001  1.00 12.28 ? 529  LEU B CA  1 
ATOM   8294  C C   . LEU B 1 529 ? 35.081  -45.625 52.054  1.00 12.72 ? 529  LEU B C   1 
ATOM   8295  O O   . LEU B 1 529 ? 35.314  -44.861 52.986  1.00 12.87 ? 529  LEU B O   1 
ATOM   8296  C CB  . LEU B 1 529 ? 32.564  -45.468 51.982  1.00 13.34 ? 529  LEU B CB  1 
ATOM   8297  C CG  . LEU B 1 529 ? 31.249  -46.172 51.638  1.00 16.04 ? 529  LEU B CG  1 
ATOM   8298  C CD1 . LEU B 1 529 ? 30.066  -45.501 52.303  1.00 20.31 ? 529  LEU B CD1 1 
ATOM   8299  C CD2 . LEU B 1 529 ? 31.098  -46.243 50.131  1.00 16.98 ? 529  LEU B CD2 1 
ATOM   8300  N N   . LEU B 1 530 ? 35.949  -45.873 51.078  1.00 13.06 ? 530  LEU B N   1 
ATOM   8301  C CA  . LEU B 1 530 ? 37.251  -45.222 51.015  1.00 13.53 ? 530  LEU B CA  1 
ATOM   8302  C C   . LEU B 1 530 ? 37.434  -44.434 49.724  1.00 14.26 ? 530  LEU B C   1 
ATOM   8303  O O   . LEU B 1 530 ? 37.142  -44.928 48.638  1.00 15.01 ? 530  LEU B O   1 
ATOM   8304  C CB  . LEU B 1 530 ? 38.357  -46.278 51.168  1.00 15.22 ? 530  LEU B CB  1 
ATOM   8305  C CG  . LEU B 1 530 ? 39.818  -45.865 51.380  1.00 16.09 ? 530  LEU B CG  1 
ATOM   8306  C CD1 . LEU B 1 530 ? 39.986  -45.058 52.667  1.00 16.70 ? 530  LEU B CD1 1 
ATOM   8307  C CD2 . LEU B 1 530 ? 40.696  -47.109 51.426  1.00 17.59 ? 530  LEU B CD2 1 
ATOM   8308  N N   . ILE B 1 531 ? 37.847  -43.176 49.870  1.00 13.48 ? 531  ILE B N   1 
ATOM   8309  C CA  . ILE B 1 531 ? 38.108  -42.292 48.732  1.00 12.49 ? 531  ILE B CA  1 
ATOM   8310  C C   . ILE B 1 531 ? 39.586  -41.904 48.789  1.00 11.89 ? 531  ILE B C   1 
ATOM   8311  O O   . ILE B 1 531 ? 40.220  -42.079 49.832  1.00 12.02 ? 531  ILE B O   1 
ATOM   8312  C CB  . ILE B 1 531 ? 37.199  -41.009 48.739  1.00 12.56 ? 531  ILE B CB  1 
ATOM   8313  C CG1 . ILE B 1 531 ? 37.378  -40.208 50.032  1.00 11.64 ? 531  ILE B CG1 1 
ATOM   8314  C CG2 . ILE B 1 531 ? 35.738  -41.395 48.530  1.00 13.06 ? 531  ILE B CG2 1 
ATOM   8315  C CD1 . ILE B 1 531 ? 36.532  -38.975 50.147  1.00 12.76 ? 531  ILE B CD1 1 
ATOM   8316  N N   . LYS B 1 532 ? 40.140  -41.396 47.686  1.00 12.43 ? 532  LYS B N   1 
ATOM   8317  C CA  . LYS B 1 532 ? 41.554  -40.988 47.683  1.00 12.14 ? 532  LYS B CA  1 
ATOM   8318  C C   . LYS B 1 532 ? 41.723  -39.710 48.515  1.00 12.73 ? 532  LYS B C   1 
ATOM   8319  O O   . LYS B 1 532 ? 42.628  -39.624 49.337  1.00 13.61 ? 532  LYS B O   1 
ATOM   8320  C CB  . LYS B 1 532 ? 42.093  -40.794 46.259  1.00 12.97 ? 532  LYS B CB  1 
ATOM   8321  C CG  . LYS B 1 532 ? 43.620  -40.782 46.172  1.00 14.52 ? 532  LYS B CG  1 
ATOM   8322  C CD  . LYS B 1 532 ? 44.113  -40.413 44.782  1.00 16.32 ? 532  LYS B CD  1 
ATOM   8323  C CE  . LYS B 1 532 ? 45.631  -40.325 44.757  1.00 19.44 ? 532  LYS B CE  1 
ATOM   8324  N NZ  . LYS B 1 532 ? 46.160  -40.043 43.398  1.00 21.95 ? 532  LYS B NZ  1 
ATOM   8325  N N   . SER B 1 533 ? 40.813  -38.755 48.320  1.00 12.99 ? 533  SER B N   1 
ATOM   8326  C CA  . SER B 1 533 ? 40.804  -37.488 49.059  1.00 12.55 ? 533  SER B CA  1 
ATOM   8327  C C   . SER B 1 533 ? 39.427  -36.849 48.956  1.00 12.45 ? 533  SER B C   1 
ATOM   8328  O O   . SER B 1 533 ? 38.703  -37.088 47.984  1.00 11.51 ? 533  SER B O   1 
ATOM   8329  C CB  . SER B 1 533 ? 41.864  -36.515 48.525  1.00 14.05 ? 533  SER B CB  1 
ATOM   8330  O OG  . SER B 1 533 ? 41.503  -35.992 47.262  1.00 15.22 ? 533  SER B OG  1 
ATOM   8331  N N   . LEU B 1 534 ? 39.073  -36.033 49.952  1.00 11.49 ? 534  LEU B N   1 
ATOM   8332  C CA  . LEU B 1 534 ? 37.780  -35.355 49.957  1.00 10.90 ? 534  LEU B CA  1 
ATOM   8333  C C   . LEU B 1 534 ? 37.799  -34.021 49.212  1.00 11.72 ? 534  LEU B C   1 
ATOM   8334  O O   . LEU B 1 534 ? 37.919  -32.939 49.796  1.00 12.18 ? 534  LEU B O   1 
ATOM   8335  C CB  . LEU B 1 534 ? 37.229  -35.210 51.382  1.00 10.32 ? 534  LEU B CB  1 
ATOM   8336  C CG  . LEU B 1 534 ? 35.812  -34.635 51.550  1.00 9.07  ? 534  LEU B CG  1 
ATOM   8337  C CD1 . LEU B 1 534 ? 34.748  -35.496 50.879  1.00 12.40 ? 534  LEU B CD1 1 
ATOM   8338  C CD2 . LEU B 1 534 ? 35.544  -34.501 53.019  1.00 9.69  ? 534  LEU B CD2 1 
ATOM   8339  N N   . THR B 1 535 ? 37.687  -34.147 47.894  1.00 11.61 ? 535  THR B N   1 
ATOM   8340  C CA  . THR B 1 535 ? 37.648  -33.029 46.961  1.00 11.31 ? 535  THR B CA  1 
ATOM   8341  C C   . THR B 1 535 ? 36.162  -32.747 46.684  1.00 10.64 ? 535  THR B C   1 
ATOM   8342  O O   . THR B 1 535 ? 35.306  -33.552 47.092  1.00 10.31 ? 535  THR B O   1 
ATOM   8343  C CB  . THR B 1 535 ? 38.308  -33.443 45.619  1.00 12.00 ? 535  THR B CB  1 
ATOM   8344  O OG1 . THR B 1 535 ? 37.623  -34.583 45.083  1.00 12.70 ? 535  THR B OG1 1 
ATOM   8345  C CG2 . THR B 1 535 ? 39.786  -33.740 45.797  1.00 12.61 ? 535  THR B CG2 1 
ATOM   8346  N N   . PRO B 1 536 ? 35.823  -31.594 46.043  1.00 10.16 ? 536  PRO B N   1 
ATOM   8347  C CA  . PRO B 1 536 ? 34.403  -31.343 45.759  1.00 10.12 ? 536  PRO B CA  1 
ATOM   8348  C C   . PRO B 1 536 ? 33.758  -32.467 44.945  1.00 9.54  ? 536  PRO B C   1 
ATOM   8349  O O   . PRO B 1 536 ? 32.622  -32.857 45.221  1.00 9.71  ? 536  PRO B O   1 
ATOM   8350  C CB  . PRO B 1 536 ? 34.446  -30.025 44.998  1.00 9.52  ? 536  PRO B CB  1 
ATOM   8351  C CG  . PRO B 1 536 ? 35.508  -29.293 45.716  1.00 9.88  ? 536  PRO B CG  1 
ATOM   8352  C CD  . PRO B 1 536 ? 36.589  -30.341 45.842  1.00 10.69 ? 536  PRO B CD  1 
ATOM   8353  N N   . ARG B 1 537 ? 34.542  -33.056 44.036  1.00 10.54 ? 537  ARG B N   1 
ATOM   8354  C CA  . ARG B 1 537 ? 34.091  -34.168 43.196  1.00 10.27 ? 537  ARG B CA  1 
ATOM   8355  C C   . ARG B 1 537 ? 33.762  -35.410 44.029  1.00 10.66 ? 537  ARG B C   1 
ATOM   8356  O O   . ARG B 1 537 ? 32.730  -36.046 43.806  1.00 10.80 ? 537  ARG B O   1 
ATOM   8357  C CB  . ARG B 1 537 ? 35.123  -34.493 42.107  1.00 11.77 ? 537  ARG B CB  1 
ATOM   8358  C CG  . ARG B 1 537 ? 34.632  -35.506 41.073  1.00 13.68 ? 537  ARG B CG  1 
ATOM   8359  C CD  . ARG B 1 537 ? 35.609  -35.766 39.956  1.00 13.59 ? 537  ARG B CD  1 
ATOM   8360  N NE  . ARG B 1 537 ? 35.729  -34.652 39.020  1.00 14.09 ? 537  ARG B NE  1 
ATOM   8361  C CZ  . ARG B 1 537 ? 35.695  -34.769 37.693  1.00 15.16 ? 537  ARG B CZ  1 
ATOM   8362  N NH1 . ARG B 1 537 ? 35.531  -35.955 37.116  1.00 15.08 ? 537  ARG B NH1 1 
ATOM   8363  N NH2 . ARG B 1 537 ? 35.842  -33.694 36.933  1.00 15.31 ? 537  ARG B NH2 1 
ATOM   8364  N N   . ALA B 1 538 ? 34.602  -35.702 45.025  1.00 10.76 ? 538  ALA B N   1 
ATOM   8365  C CA  . ALA B 1 538 ? 34.388  -36.852 45.908  1.00 10.06 ? 538  ALA B CA  1 
ATOM   8366  C C   . ALA B 1 538 ? 33.147  -36.694 46.777  1.00 10.13 ? 538  ALA B C   1 
ATOM   8367  O O   . ALA B 1 538 ? 32.433  -37.670 47.002  1.00 10.14 ? 538  ALA B O   1 
ATOM   8368  C CB  . ALA B 1 538 ? 35.607  -37.112 46.766  1.00 10.89 ? 538  ALA B CB  1 
ATOM   8369  N N   . LEU B 1 539 ? 32.875  -35.469 47.235  1.00 9.28  ? 539  LEU B N   1 
ATOM   8370  C CA  . LEU B 1 539 ? 31.683  -35.222 48.055  1.00 9.18  ? 539  LEU B CA  1 
ATOM   8371  C C   . LEU B 1 539 ? 30.420  -35.436 47.227  1.00 9.59  ? 539  LEU B C   1 
ATOM   8372  O O   . LEU B 1 539 ? 29.474  -36.068 47.697  1.00 9.91  ? 539  LEU B O   1 
ATOM   8373  C CB  . LEU B 1 539 ? 31.673  -33.809 48.664  1.00 9.90  ? 539  LEU B CB  1 
ATOM   8374  C CG  . LEU B 1 539 ? 30.442  -33.517 49.547  1.00 9.34  ? 539  LEU B CG  1 
ATOM   8375  C CD1 . LEU B 1 539 ? 30.447  -34.377 50.811  1.00 9.75  ? 539  LEU B CD1 1 
ATOM   8376  C CD2 . LEU B 1 539 ? 30.363  -32.059 49.894  1.00 10.83 ? 539  LEU B CD2 1 
ATOM   8377  N N   . GLY B 1 540 ? 30.442  -34.955 45.981  1.00 9.90  ? 540  GLY B N   1 
ATOM   8378  C CA  . GLY B 1 540 ? 29.307  -35.112 45.084  1.00 9.73  ? 540  GLY B CA  1 
ATOM   8379  C C   . GLY B 1 540 ? 28.999  -36.576 44.842  1.00 9.32  ? 540  GLY B C   1 
ATOM   8380  O O   . GLY B 1 540 ? 27.837  -36.987 44.816  1.00 9.45  ? 540  GLY B O   1 
ATOM   8381  N N   . ALA B 1 541 ? 30.069  -37.360 44.741  1.00 9.96  ? 541  ALA B N   1 
ATOM   8382  C CA  . ALA B 1 541 ? 29.995  -38.797 44.538  1.00 9.30  ? 541  ALA B CA  1 
ATOM   8383  C C   . ALA B 1 541 ? 29.356  -39.508 45.724  1.00 10.05 ? 541  ALA B C   1 
ATOM   8384  O O   . ALA B 1 541 ? 28.460  -40.335 45.545  1.00 10.79 ? 541  ALA B O   1 
ATOM   8385  C CB  . ALA B 1 541 ? 31.380  -39.356 44.288  1.00 9.63  ? 541  ALA B CB  1 
ATOM   8386  N N   . ILE B 1 542 ? 29.785  -39.129 46.928  1.00 9.72  ? 542  ILE B N   1 
ATOM   8387  C CA  . ILE B 1 542 ? 29.276  -39.708 48.176  1.00 9.33  ? 542  ILE B CA  1 
ATOM   8388  C C   . ILE B 1 542 ? 27.789  -39.420 48.388  1.00 8.62  ? 542  ILE B C   1 
ATOM   8389  O O   . ILE B 1 542 ? 27.028  -40.334 48.695  1.00 8.72  ? 542  ILE B O   1 
ATOM   8390  C CB  . ILE B 1 542 ? 30.117  -39.228 49.409  1.00 9.63  ? 542  ILE B CB  1 
ATOM   8391  C CG1 . ILE B 1 542 ? 31.537  -39.807 49.317  1.00 9.63  ? 542  ILE B CG1 1 
ATOM   8392  C CG2 . ILE B 1 542 ? 29.473  -39.670 50.746  1.00 11.07 ? 542  ILE B CG2 1 
ATOM   8393  C CD1 . ILE B 1 542 ? 32.543  -39.175 50.278  1.00 12.13 ? 542  ILE B CD1 1 
ATOM   8394  N N   . ILE B 1 543 ? 27.378  -38.169 48.180  1.00 8.91  ? 543  ILE B N   1 
ATOM   8395  C CA  . ILE B 1 543 ? 25.974  -37.803 48.367  1.00 8.46  ? 543  ILE B CA  1 
ATOM   8396  C C   . ILE B 1 543 ? 25.070  -38.484 47.341  1.00 8.16  ? 543  ILE B C   1 
ATOM   8397  O O   . ILE B 1 543 ? 24.033  -39.034 47.715  1.00 9.38  ? 543  ILE B O   1 
ATOM   8398  C CB  . ILE B 1 543 ? 25.751  -36.268 48.347  1.00 9.32  ? 543  ILE B CB  1 
ATOM   8399  C CG1 . ILE B 1 543 ? 26.668  -35.555 49.349  1.00 9.74  ? 543  ILE B CG1 1 
ATOM   8400  C CG2 . ILE B 1 543 ? 24.276  -35.934 48.629  1.00 8.99  ? 543  ILE B CG2 1 
ATOM   8401  C CD1 . ILE B 1 543 ? 26.545  -36.021 50.782  1.00 10.76 ? 543  ILE B CD1 1 
ATOM   8402  N N   . ALA B 1 544 ? 25.500  -38.507 46.076  1.00 8.90  ? 544  ALA B N   1 
ATOM   8403  C CA  . ALA B 1 544 ? 24.725  -39.151 45.007  1.00 9.47  ? 544  ALA B CA  1 
ATOM   8404  C C   . ALA B 1 544 ? 24.553  -40.647 45.266  1.00 9.08  ? 544  ALA B C   1 
ATOM   8405  O O   . ALA B 1 544 ? 23.488  -41.199 45.005  1.00 9.93  ? 544  ALA B O   1 
ATOM   8406  C CB  . ALA B 1 544 ? 25.378  -38.933 43.672  1.00 10.34 ? 544  ALA B CB  1 
ATOM   8407  N N   . MET B 1 545 ? 25.590  -41.271 45.834  1.00 9.27  ? 545  MET B N   1 
ATOM   8408  C CA  . MET B 1 545 ? 25.563  -42.697 46.181  1.00 9.45  ? 545  MET B CA  1 
ATOM   8409  C C   . MET B 1 545 ? 24.453  -42.962 47.203  1.00 8.51  ? 545  MET B C   1 
ATOM   8410  O O   . MET B 1 545 ? 23.653  -43.886 47.029  1.00 9.49  ? 545  MET B O   1 
ATOM   8411  C CB  . MET B 1 545 ? 26.922  -43.138 46.738  1.00 9.24  ? 545  MET B CB  1 
ATOM   8412  C CG  . MET B 1 545 ? 26.977  -44.594 47.184  1.00 11.13 ? 545  MET B CG  1 
ATOM   8413  S SD  . MET B 1 545 ? 28.431  -44.955 48.155  1.00 12.30 ? 545  MET B SD  1 
ATOM   8414  C CE  . MET B 1 545 ? 28.055  -44.067 49.642  1.00 13.95 ? 545  MET B CE  1 
ATOM   8415  N N   . TYR B 1 546 ? 24.379  -42.114 48.232  1.00 8.07  ? 546  TYR B N   1 
ATOM   8416  C CA  . TYR B 1 546 ? 23.350  -42.255 49.256  1.00 7.46  ? 546  TYR B CA  1 
ATOM   8417  C C   . TYR B 1 546 ? 21.952  -41.928 48.750  1.00 8.55  ? 546  TYR B C   1 
ATOM   8418  O O   . TYR B 1 546 ? 20.994  -42.560 49.174  1.00 9.51  ? 546  TYR B O   1 
ATOM   8419  C CB  . TYR B 1 546 ? 23.683  -41.440 50.499  1.00 7.91  ? 546  TYR B CB  1 
ATOM   8420  C CG  . TYR B 1 546 ? 24.631  -42.148 51.434  1.00 8.26  ? 546  TYR B CG  1 
ATOM   8421  C CD1 . TYR B 1 546 ? 24.204  -43.259 52.195  1.00 9.56  ? 546  TYR B CD1 1 
ATOM   8422  C CD2 . TYR B 1 546 ? 25.965  -41.723 51.561  1.00 9.13  ? 546  TYR B CD2 1 
ATOM   8423  C CE1 . TYR B 1 546 ? 25.095  -43.936 53.068  1.00 11.28 ? 546  TYR B CE1 1 
ATOM   8424  C CE2 . TYR B 1 546 ? 26.868  -42.388 52.433  1.00 10.30 ? 546  TYR B CE2 1 
ATOM   8425  C CZ  . TYR B 1 546 ? 26.424  -43.491 53.176  1.00 9.99  ? 546  TYR B CZ  1 
ATOM   8426  O OH  . TYR B 1 546 ? 27.310  -44.137 54.001  1.00 11.64 ? 546  TYR B OH  1 
ATOM   8427  N N   . GLU B 1 547 ? 21.845  -40.973 47.819  1.00 8.50  ? 547  GLU B N   1 
ATOM   8428  C CA  . GLU B 1 547 ? 20.549  -40.612 47.224  1.00 9.37  ? 547  GLU B CA  1 
ATOM   8429  C C   . GLU B 1 547 ? 20.000  -41.811 46.451  1.00 8.89  ? 547  GLU B C   1 
ATOM   8430  O O   . GLU B 1 547 ? 18.817  -42.135 46.546  1.00 9.51  ? 547  GLU B O   1 
ATOM   8431  C CB  . GLU B 1 547 ? 20.692  -39.426 46.270  1.00 10.27 ? 547  GLU B CB  1 
ATOM   8432  C CG  . GLU B 1 547 ? 20.972  -38.094 46.959  1.00 9.76  ? 547  GLU B CG  1 
ATOM   8433  C CD  . GLU B 1 547 ? 21.104  -36.932 45.989  1.00 12.09 ? 547  GLU B CD  1 
ATOM   8434  O OE1 . GLU B 1 547 ? 21.324  -37.174 44.788  1.00 12.00 ? 547  GLU B OE1 1 
ATOM   8435  O OE2 . GLU B 1 547 ? 20.985  -35.770 46.433  1.00 10.60 ? 547  GLU B OE2 1 
ATOM   8436  N N   . HIS B 1 548 ? 20.897  -42.509 45.757  1.00 9.21  ? 548  HIS B N   1 
ATOM   8437  C CA  . HIS B 1 548 ? 20.519  -43.676 44.980  1.00 9.24  ? 548  HIS B CA  1 
ATOM   8438  C C   . HIS B 1 548 ? 20.288  -44.934 45.822  1.00 10.32 ? 548  HIS B C   1 
ATOM   8439  O O   . HIS B 1 548 ? 19.457  -45.770 45.457  1.00 10.24 ? 548  HIS B O   1 
ATOM   8440  C CB  . HIS B 1 548 ? 21.508  -43.883 43.851  1.00 9.99  ? 548  HIS B CB  1 
ATOM   8441  C CG  . HIS B 1 548 ? 21.522  -42.759 42.864  1.00 9.88  ? 548  HIS B CG  1 
ATOM   8442  N ND1 . HIS B 1 548 ? 20.387  -42.048 42.534  1.00 11.57 ? 548  HIS B ND1 1 
ATOM   8443  C CD2 . HIS B 1 548 ? 22.524  -42.233 42.122  1.00 11.58 ? 548  HIS B CD2 1 
ATOM   8444  C CE1 . HIS B 1 548 ? 20.689  -41.136 41.628  1.00 11.47 ? 548  HIS B CE1 1 
ATOM   8445  N NE2 . HIS B 1 548 ? 21.980  -41.227 41.361  1.00 11.24 ? 548  HIS B NE2 1 
ATOM   8446  N N   . LYS B 1 549 ? 20.967  -45.021 46.973  1.00 8.98  ? 549  LYS B N   1 
ATOM   8447  C CA  . LYS B 1 549 ? 20.783  -46.131 47.925  1.00 8.45  ? 549  LYS B CA  1 
ATOM   8448  C C   . LYS B 1 549 ? 19.339  -46.009 48.452  1.00 8.51  ? 549  LYS B C   1 
ATOM   8449  O O   . LYS B 1 549 ? 18.596  -46.988 48.506  1.00 8.89  ? 549  LYS B O   1 
ATOM   8450  C CB  . LYS B 1 549 ? 21.762  -46.008 49.109  1.00 10.23 ? 549  LYS B CB  1 
ATOM   8451  C CG  . LYS B 1 549 ? 21.521  -47.025 50.228  1.00 10.50 ? 549  LYS B CG  1 
ATOM   8452  C CD  . LYS B 1 549 ? 21.953  -46.558 51.600  1.00 11.27 ? 549  LYS B CD  1 
ATOM   8453  C CE  . LYS B 1 549 ? 21.563  -47.596 52.649  1.00 12.06 ? 549  LYS B CE  1 
ATOM   8454  N NZ  . LYS B 1 549 ? 21.983  -47.217 54.027  1.00 13.47 ? 549  LYS B NZ  1 
ATOM   8455  N N   . VAL B 1 550 ? 18.958  -44.777 48.794  1.00 8.67  ? 550  VAL B N   1 
ATOM   8456  C CA  . VAL B 1 550 ? 17.624  -44.453 49.297  1.00 8.80  ? 550  VAL B CA  1 
ATOM   8457  C C   . VAL B 1 550 ? 16.536  -44.758 48.249  1.00 9.14  ? 550  VAL B C   1 
ATOM   8458  O O   . VAL B 1 550 ? 15.472  -45.293 48.596  1.00 10.18 ? 550  VAL B O   1 
ATOM   8459  C CB  . VAL B 1 550 ? 17.594  -42.974 49.780  1.00 9.47  ? 550  VAL B CB  1 
ATOM   8460  C CG1 . VAL B 1 550 ? 16.192  -42.496 50.037  1.00 8.75  ? 550  VAL B CG1 1 
ATOM   8461  C CG2 . VAL B 1 550 ? 18.413  -42.846 51.054  1.00 10.65 ? 550  VAL B CG2 1 
ATOM   8462  N N   . LEU B 1 551 ? 16.844  -44.486 46.976  1.00 8.97  ? 551  LEU B N   1 
ATOM   8463  C CA  . LEU B 1 551 ? 15.931  -44.742 45.853  1.00 8.18  ? 551  LEU B CA  1 
ATOM   8464  C C   . LEU B 1 551 ? 15.618  -46.234 45.760  1.00 9.42  ? 551  LEU B C   1 
ATOM   8465  O O   . LEU B 1 551 ? 14.452  -46.621 45.681  1.00 10.02 ? 551  LEU B O   1 
ATOM   8466  C CB  . LEU B 1 551 ? 16.547  -44.258 44.519  1.00 9.92  ? 551  LEU B CB  1 
ATOM   8467  C CG  . LEU B 1 551 ? 15.795  -44.302 43.165  1.00 10.81 ? 551  LEU B CG  1 
ATOM   8468  C CD1 . LEU B 1 551 ? 16.436  -43.326 42.212  1.00 10.30 ? 551  LEU B CD1 1 
ATOM   8469  C CD2 . LEU B 1 551 ? 15.765  -45.694 42.521  1.00 11.91 ? 551  LEU B CD2 1 
ATOM   8470  N N   . VAL B 1 552 ? 16.672  -47.049 45.766  1.00 9.62  ? 552  VAL B N   1 
ATOM   8471  C CA  . VAL B 1 552 ? 16.536  -48.501 45.659  1.00 9.57  ? 552  VAL B CA  1 
ATOM   8472  C C   . VAL B 1 552 ? 15.748  -49.099 46.821  1.00 9.66  ? 552  VAL B C   1 
ATOM   8473  O O   . VAL B 1 552 ? 14.821  -49.878 46.590  1.00 10.93 ? 552  VAL B O   1 
ATOM   8474  C CB  . VAL B 1 552 ? 17.904  -49.201 45.517  1.00 8.66  ? 552  VAL B CB  1 
ATOM   8475  C CG1 . VAL B 1 552 ? 17.740  -50.724 45.413  1.00 9.91  ? 552  VAL B CG1 1 
ATOM   8476  C CG2 . VAL B 1 552 ? 18.611  -48.708 44.301  1.00 9.63  ? 552  VAL B CG2 1 
ATOM   8477  N N   . GLN B 1 553 ? 16.067  -48.687 48.048  1.00 9.92  ? 553  GLN B N   1 
ATOM   8478  C CA  . GLN B 1 553 ? 15.361  -49.195 49.228  1.00 9.44  ? 553  GLN B CA  1 
ATOM   8479  C C   . GLN B 1 553 ? 13.880  -48.845 49.189  1.00 10.44 ? 553  GLN B C   1 
ATOM   8480  O O   . GLN B 1 553 ? 13.032  -49.708 49.423  1.00 10.85 ? 553  GLN B O   1 
ATOM   8481  C CB  . GLN B 1 553 ? 16.004  -48.689 50.516  1.00 8.67  ? 553  GLN B CB  1 
ATOM   8482  C CG  . GLN B 1 553 ? 17.362  -49.304 50.775  1.00 9.14  ? 553  GLN B CG  1 
ATOM   8483  C CD  . GLN B 1 553 ? 17.924  -49.012 52.151  1.00 11.34 ? 553  GLN B CD  1 
ATOM   8484  O OE1 . GLN B 1 553 ? 17.646  -47.972 52.749  1.00 12.90 ? 553  GLN B OE1 1 
ATOM   8485  N NE2 . GLN B 1 553 ? 18.749  -49.932 52.654  1.00 9.24  ? 553  GLN B NE2 1 
ATOM   8486  N N   . GLY B 1 554 ? 13.582  -47.611 48.777  1.00 8.86  ? 554  GLY B N   1 
ATOM   8487  C CA  . GLY B 1 554 ? 12.204  -47.160 48.665  1.00 9.88  ? 554  GLY B CA  1 
ATOM   8488  C C   . GLY B 1 554 ? 11.425  -47.910 47.593  1.00 9.36  ? 554  GLY B C   1 
ATOM   8489  O O   . GLY B 1 554 ? 10.250  -48.243 47.786  1.00 10.59 ? 554  GLY B O   1 
ATOM   8490  N N   . ALA B 1 555 ? 12.103  -48.225 46.488  1.00 10.87 ? 555  ALA B N   1 
ATOM   8491  C CA  . ALA B 1 555 ? 11.487  -48.956 45.380  1.00 11.13 ? 555  ALA B CA  1 
ATOM   8492  C C   . ALA B 1 555 ? 11.252  -50.429 45.734  1.00 11.94 ? 555  ALA B C   1 
ATOM   8493  O O   . ALA B 1 555 ? 10.243  -51.007 45.319  1.00 12.63 ? 555  ALA B O   1 
ATOM   8494  C CB  . ALA B 1 555 ? 12.324  -48.826 44.130  1.00 11.76 ? 555  ALA B CB  1 
ATOM   8495  N N   . ILE B 1 556 ? 12.143  -51.005 46.551  1.00 11.64 ? 556  ILE B N   1 
ATOM   8496  C CA  . ILE B 1 556 ? 12.011  -52.399 47.009  1.00 12.25 ? 556  ILE B CA  1 
ATOM   8497  C C   . ILE B 1 556 ? 10.789  -52.493 47.934  1.00 11.99 ? 556  ILE B C   1 
ATOM   8498  O O   . ILE B 1 556 ? 9.957   -53.387 47.776  1.00 13.20 ? 556  ILE B O   1 
ATOM   8499  C CB  . ILE B 1 556 ? 13.305  -52.904 47.747  1.00 12.25 ? 556  ILE B CB  1 
ATOM   8500  C CG1 . ILE B 1 556 ? 14.414  -53.139 46.719  1.00 14.53 ? 556  ILE B CG1 1 
ATOM   8501  C CG2 . ILE B 1 556 ? 13.046  -54.218 48.543  1.00 13.91 ? 556  ILE B CG2 1 
ATOM   8502  C CD1 . ILE B 1 556 ? 15.771  -53.360 47.313  1.00 16.94 ? 556  ILE B CD1 1 
ATOM   8503  N N   . TRP B 1 557 ? 10.654  -51.516 48.832  1.00 11.20 ? 557  TRP B N   1 
ATOM   8504  C CA  . TRP B 1 557 ? 9.542   -51.465 49.782  1.00 11.03 ? 557  TRP B CA  1 
ATOM   8505  C C   . TRP B 1 557 ? 8.213   -51.042 49.155  1.00 10.79 ? 557  TRP B C   1 
ATOM   8506  O O   . TRP B 1 557 ? 7.149   -51.284 49.728  1.00 12.57 ? 557  TRP B O   1 
ATOM   8507  C CB  . TRP B 1 557 ? 9.899   -50.565 50.970  1.00 11.65 ? 557  TRP B CB  1 
ATOM   8508  C CG  . TRP B 1 557 ? 11.044  -51.103 51.806  1.00 10.74 ? 557  TRP B CG  1 
ATOM   8509  C CD1 . TRP B 1 557 ? 11.324  -52.424 52.076  1.00 10.92 ? 557  TRP B CD1 1 
ATOM   8510  C CD2 . TRP B 1 557 ? 12.057  -50.340 52.472  1.00 10.38 ? 557  TRP B CD2 1 
ATOM   8511  N NE1 . TRP B 1 557 ? 12.443  -52.526 52.861  1.00 10.10 ? 557  TRP B NE1 1 
ATOM   8512  C CE2 . TRP B 1 557 ? 12.918  -51.268 53.127  1.00 10.93 ? 557  TRP B CE2 1 
ATOM   8513  C CE3 . TRP B 1 557 ? 12.331  -48.957 52.582  1.00 10.94 ? 557  TRP B CE3 1 
ATOM   8514  C CZ2 . TRP B 1 557 ? 14.037  -50.864 53.892  1.00 10.45 ? 557  TRP B CZ2 1 
ATOM   8515  C CZ3 . TRP B 1 557 ? 13.454  -48.545 53.346  1.00 11.13 ? 557  TRP B CZ3 1 
ATOM   8516  C CH2 . TRP B 1 557 ? 14.292  -49.506 53.991  1.00 10.95 ? 557  TRP B CH2 1 
ATOM   8517  N N   . GLY B 1 558 ? 8.297   -50.450 47.963  1.00 10.57 ? 558  GLY B N   1 
ATOM   8518  C CA  . GLY B 1 558 ? 7.124   -50.001 47.228  1.00 11.68 ? 558  GLY B CA  1 
ATOM   8519  C C   . GLY B 1 558 ? 6.529   -48.683 47.685  1.00 12.03 ? 558  GLY B C   1 
ATOM   8520  O O   . GLY B 1 558 ? 5.386   -48.382 47.351  1.00 13.43 ? 558  GLY B O   1 
ATOM   8521  N N   . ILE B 1 559 ? 7.316   -47.894 48.416  1.00 12.18 ? 559  ILE B N   1 
ATOM   8522  C CA  . ILE B 1 559 ? 6.881   -46.597 48.945  1.00 11.15 ? 559  ILE B CA  1 
ATOM   8523  C C   . ILE B 1 559 ? 7.298   -45.415 48.061  1.00 10.68 ? 559  ILE B C   1 
ATOM   8524  O O   . ILE B 1 559 ? 8.011   -45.592 47.071  1.00 12.19 ? 559  ILE B O   1 
ATOM   8525  C CB  . ILE B 1 559 ? 7.412   -46.374 50.399  1.00 11.28 ? 559  ILE B CB  1 
ATOM   8526  C CG1 . ILE B 1 559 ? 8.947   -46.401 50.430  1.00 10.47 ? 559  ILE B CG1 1 
ATOM   8527  C CG2 . ILE B 1 559 ? 6.826   -47.434 51.336  1.00 10.86 ? 559  ILE B CG2 1 
ATOM   8528  C CD1 . ILE B 1 559 ? 9.569   -46.089 51.778  1.00 11.96 ? 559  ILE B CD1 1 
ATOM   8529  N N   . ASP B 1 560 ? 6.791   -44.226 48.401  1.00 12.20 ? 560  ASP B N   1 
ATOM   8530  C CA  . ASP B 1 560 ? 7.119   -42.991 47.689  1.00 11.30 ? 560  ASP B CA  1 
ATOM   8531  C C   . ASP B 1 560 ? 8.206   -42.318 48.526  1.00 10.26 ? 560  ASP B C   1 
ATOM   8532  O O   . ASP B 1 560 ? 7.927   -41.716 49.561  1.00 12.18 ? 560  ASP B O   1 
ATOM   8533  C CB  . ASP B 1 560 ? 5.873   -42.090 47.567  1.00 11.25 ? 560  ASP B CB  1 
ATOM   8534  C CG  . ASP B 1 560 ? 6.088   -40.867 46.661  1.00 12.99 ? 560  ASP B CG  1 
ATOM   8535  O OD1 . ASP B 1 560 ? 7.239   -40.423 46.463  1.00 13.49 ? 560  ASP B OD1 1 
ATOM   8536  O OD2 . ASP B 1 560 ? 5.080   -40.329 46.157  1.00 12.63 ? 560  ASP B OD2 1 
ATOM   8537  N N   . SER B 1 561 ? 9.445   -42.420 48.048  1.00 10.14 ? 561  SER B N   1 
ATOM   8538  C CA  . SER B 1 561 ? 10.601  -41.841 48.733  1.00 10.12 ? 561  SER B CA  1 
ATOM   8539  C C   . SER B 1 561 ? 10.714  -40.334 48.542  1.00 10.54 ? 561  SER B C   1 
ATOM   8540  O O   . SER B 1 561 ? 11.593  -39.698 49.118  1.00 10.24 ? 561  SER B O   1 
ATOM   8541  C CB  . SER B 1 561 ? 11.897  -42.459 48.201  1.00 10.79 ? 561  SER B CB  1 
ATOM   8542  O OG  . SER B 1 561 ? 11.946  -43.858 48.405  1.00 10.99 ? 561  SER B OG  1 
ATOM   8543  N N   . TYR B 1 562 ? 9.805   -39.766 47.754  1.00 10.40 ? 562  TYR B N   1 
ATOM   8544  C CA  . TYR B 1 562 ? 9.895   -38.355 47.391  1.00 9.40  ? 562  TYR B CA  1 
ATOM   8545  C C   . TYR B 1 562 ? 8.893   -37.352 47.925  1.00 10.10 ? 562  TYR B C   1 
ATOM   8546  O O   . TYR B 1 562 ? 8.992   -36.151 47.636  1.00 10.80 ? 562  TYR B O   1 
ATOM   8547  C CB  . TYR B 1 562 ? 10.055  -38.281 45.873  1.00 10.15 ? 562  TYR B CB  1 
ATOM   8548  C CG  . TYR B 1 562 ? 11.198  -39.171 45.440  1.00 9.06  ? 562  TYR B CG  1 
ATOM   8549  C CD1 . TYR B 1 562 ? 12.530  -38.776 45.662  1.00 9.47  ? 562  TYR B CD1 1 
ATOM   8550  C CD2 . TYR B 1 562 ? 10.959  -40.447 44.886  1.00 11.14 ? 562  TYR B CD2 1 
ATOM   8551  C CE1 . TYR B 1 562 ? 13.605  -39.627 45.347  1.00 9.52  ? 562  TYR B CE1 1 
ATOM   8552  C CE2 . TYR B 1 562 ? 12.028  -41.309 44.563  1.00 10.47 ? 562  TYR B CE2 1 
ATOM   8553  C CZ  . TYR B 1 562 ? 13.345  -40.887 44.800  1.00 10.82 ? 562  TYR B CZ  1 
ATOM   8554  O OH  . TYR B 1 562 ? 14.389  -41.714 44.507  1.00 12.83 ? 562  TYR B OH  1 
ATOM   8555  N N   . ASP B 1 563 ? 7.946   -37.840 48.722  1.00 11.18 ? 563  ASP B N   1 
ATOM   8556  C CA  . ASP B 1 563 ? 6.957   -36.970 49.344  1.00 10.27 ? 563  ASP B CA  1 
ATOM   8557  C C   . ASP B 1 563 ? 7.277   -36.841 50.840  1.00 10.07 ? 563  ASP B C   1 
ATOM   8558  O O   . ASP B 1 563 ? 8.244   -37.435 51.322  1.00 10.63 ? 563  ASP B O   1 
ATOM   8559  C CB  . ASP B 1 563 ? 5.518   -37.472 49.097  1.00 10.96 ? 563  ASP B CB  1 
ATOM   8560  C CG  . ASP B 1 563 ? 5.251   -38.876 49.656  1.00 13.18 ? 563  ASP B CG  1 
ATOM   8561  O OD1 . ASP B 1 563 ? 6.031   -39.391 50.477  1.00 11.58 ? 563  ASP B OD1 1 
ATOM   8562  O OD2 . ASP B 1 563 ? 4.226   -39.465 49.277  1.00 12.62 ? 563  ASP B OD2 1 
ATOM   8563  N N   . GLN B 1 564 ? 6.498   -36.021 51.542  1.00 9.50  ? 564  GLN B N   1 
ATOM   8564  C CA  . GLN B 1 564 ? 6.670   -35.794 52.978  1.00 10.08 ? 564  GLN B CA  1 
ATOM   8565  C C   . GLN B 1 564 ? 5.373   -35.311 53.627  1.00 10.20 ? 564  GLN B C   1 
ATOM   8566  O O   . GLN B 1 564 ? 5.301   -34.225 54.208  1.00 10.68 ? 564  GLN B O   1 
ATOM   8567  C CB  . GLN B 1 564 ? 7.867   -34.848 53.283  1.00 11.30 ? 564  GLN B CB  1 
ATOM   8568  C CG  . GLN B 1 564 ? 7.873   -33.455 52.607  1.00 12.39 ? 564  GLN B CG  1 
ATOM   8569  C CD  . GLN B 1 564 ? 8.159   -33.494 51.114  1.00 12.46 ? 564  GLN B CD  1 
ATOM   8570  O OE1 . GLN B 1 564 ? 9.065   -34.191 50.660  1.00 12.02 ? 564  GLN B OE1 1 
ATOM   8571  N NE2 . GLN B 1 564 ? 7.360   -32.772 50.342  1.00 12.25 ? 564  GLN B NE2 1 
ATOM   8572  N N   . TRP B 1 565 ? 4.355   -36.167 53.575  1.00 10.76 ? 565  TRP B N   1 
ATOM   8573  C CA  . TRP B 1 565 ? 3.047   -35.843 54.150  1.00 11.66 ? 565  TRP B CA  1 
ATOM   8574  C C   . TRP B 1 565 ? 3.028   -35.852 55.673  1.00 12.69 ? 565  TRP B C   1 
ATOM   8575  O O   . TRP B 1 565 ? 2.156   -35.239 56.292  1.00 12.70 ? 565  TRP B O   1 
ATOM   8576  C CB  . TRP B 1 565 ? 1.969   -36.793 53.614  1.00 11.96 ? 565  TRP B CB  1 
ATOM   8577  C CG  . TRP B 1 565 ? 1.775   -36.731 52.127  1.00 13.20 ? 565  TRP B CG  1 
ATOM   8578  C CD1 . TRP B 1 565 ? 2.125   -37.689 51.224  1.00 13.48 ? 565  TRP B CD1 1 
ATOM   8579  C CD2 . TRP B 1 565 ? 1.208   -35.651 51.369  1.00 14.16 ? 565  TRP B CD2 1 
ATOM   8580  N NE1 . TRP B 1 565 ? 1.821   -37.279 49.948  1.00 14.70 ? 565  TRP B NE1 1 
ATOM   8581  C CE2 . TRP B 1 565 ? 1.257   -36.033 50.002  1.00 15.09 ? 565  TRP B CE2 1 
ATOM   8582  C CE3 . TRP B 1 565 ? 0.662   -34.392 51.708  1.00 16.43 ? 565  TRP B CE3 1 
ATOM   8583  C CZ2 . TRP B 1 565 ? 0.778   -35.199 48.963  1.00 15.87 ? 565  TRP B CZ2 1 
ATOM   8584  C CZ3 . TRP B 1 565 ? 0.184   -33.553 50.672  1.00 18.61 ? 565  TRP B CZ3 1 
ATOM   8585  C CH2 . TRP B 1 565 ? 0.248   -33.968 49.315  1.00 18.20 ? 565  TRP B CH2 1 
ATOM   8586  N N   . GLY B 1 566 ? 4.048   -36.486 56.254  1.00 13.13 ? 566  GLY B N   1 
ATOM   8587  C CA  . GLY B 1 566 ? 4.180   -36.608 57.694  1.00 14.56 ? 566  GLY B CA  1 
ATOM   8588  C C   . GLY B 1 566 ? 4.473   -35.369 58.507  1.00 14.87 ? 566  GLY B C   1 
ATOM   8589  O O   . GLY B 1 566 ? 4.371   -35.407 59.733  1.00 16.79 ? 566  GLY B O   1 
ATOM   8590  N N   . VAL B 1 567 ? 4.801   -34.273 57.832  1.00 16.14 ? 567  VAL B N   1 
ATOM   8591  C CA  . VAL B 1 567 ? 5.102   -33.014 58.506  1.00 17.11 ? 567  VAL B CA  1 
ATOM   8592  C C   . VAL B 1 567 ? 3.886   -32.090 58.644  1.00 17.09 ? 567  VAL B C   1 
ATOM   8593  O O   . VAL B 1 567 ? 3.922   -31.131 59.422  1.00 16.87 ? 567  VAL B O   1 
ATOM   8594  C CB  . VAL B 1 567 ? 6.269   -32.254 57.804  1.00 17.57 ? 567  VAL B CB  1 
ATOM   8595  C CG1 . VAL B 1 567 ? 7.510   -33.139 57.743  1.00 20.93 ? 567  VAL B CG1 1 
ATOM   8596  C CG2 . VAL B 1 567 ? 5.870   -31.781 56.403  1.00 18.55 ? 567  VAL B CG2 1 
ATOM   8597  N N   . GLU B 1 568 ? 2.803   -32.421 57.937  1.00 16.97 ? 568  GLU B N   1 
ATOM   8598  C CA  . GLU B 1 568 ? 1.587   -31.605 57.935  1.00 17.53 ? 568  GLU B CA  1 
ATOM   8599  C C   . GLU B 1 568 ? 0.790   -31.469 59.230  1.00 16.17 ? 568  GLU B C   1 
ATOM   8600  O O   . GLU B 1 568 ? 0.396   -30.354 59.575  1.00 15.82 ? 568  GLU B O   1 
ATOM   8601  C CB  . GLU B 1 568 ? 0.658   -32.013 56.789  1.00 20.00 ? 568  GLU B CB  1 
ATOM   8602  C CG  . GLU B 1 568 ? 1.233   -31.718 55.401  1.00 24.95 ? 568  GLU B CG  1 
ATOM   8603  C CD  . GLU B 1 568 ? 0.200   -31.791 54.284  1.00 28.07 ? 568  GLU B CD  1 
ATOM   8604  O OE1 . GLU B 1 568 ? -0.778  -32.563 54.392  1.00 29.90 ? 568  GLU B OE1 1 
ATOM   8605  O OE2 . GLU B 1 568 ? 0.375   -31.073 53.275  1.00 32.14 ? 568  GLU B OE2 1 
ATOM   8606  N N   . LEU B 1 569 ? 0.595   -32.567 59.968  1.00 13.55 ? 569  LEU B N   1 
ATOM   8607  C CA  . LEU B 1 569 ? -0.178  -32.519 61.219  1.00 13.83 ? 569  LEU B CA  1 
ATOM   8608  C C   . LEU B 1 569 ? 0.401   -31.575 62.275  1.00 13.91 ? 569  LEU B C   1 
ATOM   8609  O O   . LEU B 1 569 ? -0.341  -30.787 62.870  1.00 13.90 ? 569  LEU B O   1 
ATOM   8610  C CB  . LEU B 1 569 ? -0.382  -33.918 61.810  1.00 14.08 ? 569  LEU B CB  1 
ATOM   8611  C CG  . LEU B 1 569 ? -1.243  -34.087 63.069  1.00 15.79 ? 569  LEU B CG  1 
ATOM   8612  C CD1 . LEU B 1 569 ? -2.681  -33.634 62.867  1.00 16.53 ? 569  LEU B CD1 1 
ATOM   8613  C CD2 . LEU B 1 569 ? -1.203  -35.522 63.495  1.00 15.00 ? 569  LEU B CD2 1 
ATOM   8614  N N   . GLY B 1 570 ? 1.723   -31.629 62.453  1.00 13.46 ? 570  GLY B N   1 
ATOM   8615  C CA  . GLY B 1 570 ? 2.402   -30.770 63.415  1.00 13.63 ? 570  GLY B CA  1 
ATOM   8616  C C   . GLY B 1 570 ? 2.281   -29.292 63.073  1.00 14.02 ? 570  GLY B C   1 
ATOM   8617  O O   . GLY B 1 570 ? 2.116   -28.461 63.969  1.00 14.45 ? 570  GLY B O   1 
ATOM   8618  N N   . LYS B 1 571 ? 2.285   -28.983 61.773  1.00 14.27 ? 571  LYS B N   1 
ATOM   8619  C CA  . LYS B 1 571 ? 2.157   -27.604 61.283  1.00 14.82 ? 571  LYS B CA  1 
ATOM   8620  C C   . LYS B 1 571 ? 0.758   -27.044 61.521  1.00 14.48 ? 571  LYS B C   1 
ATOM   8621  O O   . LYS B 1 571 ? 0.612   -25.901 61.956  1.00 14.86 ? 571  LYS B O   1 
ATOM   8622  C CB  . LYS B 1 571 ? 2.480   -27.524 59.787  1.00 15.54 ? 571  LYS B CB  1 
ATOM   8623  C CG  . LYS B 1 571 ? 3.949   -27.692 59.432  1.00 16.52 ? 571  LYS B CG  1 
ATOM   8624  C CD  . LYS B 1 571 ? 4.137   -27.590 57.929  1.00 18.15 ? 571  LYS B CD  1 
ATOM   8625  C CE  . LYS B 1 571 ? 5.606   -27.649 57.540  1.00 19.84 ? 571  LYS B CE  1 
ATOM   8626  N NZ  . LYS B 1 571 ? 5.780   -27.516 56.065  1.00 22.73 ? 571  LYS B NZ  1 
ATOM   8627  N N   . VAL B 1 572 ? -0.255  -27.877 61.264  1.00 15.37 ? 572  VAL B N   1 
ATOM   8628  C CA  . VAL B 1 572 ? -1.673  -27.523 61.429  1.00 16.57 ? 572  VAL B CA  1 
ATOM   8629  C C   . VAL B 1 572 ? -2.011  -27.304 62.913  1.00 14.35 ? 572  VAL B C   1 
ATOM   8630  O O   . VAL B 1 572 ? -2.631  -26.296 63.268  1.00 14.48 ? 572  VAL B O   1 
ATOM   8631  C CB  . VAL B 1 572 ? -2.599  -28.618 60.782  1.00 18.75 ? 572  VAL B CB  1 
ATOM   8632  C CG1 . VAL B 1 572 ? -4.079  -28.219 60.838  1.00 21.60 ? 572  VAL B CG1 1 
ATOM   8633  C CG2 . VAL B 1 572 ? -2.201  -28.838 59.327  1.00 21.35 ? 572  VAL B CG2 1 
ATOM   8634  N N   . LEU B 1 573 ? -1.543  -28.207 63.777  1.00 12.94 ? 573  LEU B N   1 
ATOM   8635  C CA  . LEU B 1 573 ? -1.794  -28.080 65.212  1.00 12.25 ? 573  LEU B CA  1 
ATOM   8636  C C   . LEU B 1 573 ? -1.049  -26.905 65.842  1.00 12.28 ? 573  LEU B C   1 
ATOM   8637  O O   . LEU B 1 573 ? -1.527  -26.326 66.817  1.00 13.36 ? 573  LEU B O   1 
ATOM   8638  C CB  . LEU B 1 573 ? -1.511  -29.392 65.948  1.00 13.21 ? 573  LEU B CB  1 
ATOM   8639  C CG  . LEU B 1 573 ? -2.443  -30.566 65.609  1.00 14.91 ? 573  LEU B CG  1 
ATOM   8640  C CD1 . LEU B 1 573 ? -2.050  -31.744 66.442  1.00 15.82 ? 573  LEU B CD1 1 
ATOM   8641  C CD2 . LEU B 1 573 ? -3.917  -30.238 65.852  1.00 16.43 ? 573  LEU B CD2 1 
ATOM   8642  N N   . ALA B 1 574 ? 0.090   -26.529 65.246  1.00 13.26 ? 574  ALA B N   1 
ATOM   8643  C CA  . ALA B 1 574 ? 0.891   -25.385 65.707  1.00 12.72 ? 574  ALA B CA  1 
ATOM   8644  C C   . ALA B 1 574 ? 0.195   -24.075 65.369  1.00 13.09 ? 574  ALA B C   1 
ATOM   8645  O O   . ALA B 1 574 ? 0.195   -23.145 66.179  1.00 13.15 ? 574  ALA B O   1 
ATOM   8646  C CB  . ALA B 1 574 ? 2.294   -25.418 65.097  1.00 13.88 ? 574  ALA B CB  1 
ATOM   8647  N N   . LYS B 1 575 ? -0.453  -24.043 64.200  1.00 14.10 ? 575  LYS B N   1 
ATOM   8648  C CA  . LYS B 1 575 ? -1.197  -22.870 63.720  1.00 15.55 ? 575  LYS B CA  1 
ATOM   8649  C C   . LYS B 1 575 ? -2.359  -22.595 64.678  1.00 15.09 ? 575  LYS B C   1 
ATOM   8650  O O   . LYS B 1 575 ? -2.664  -21.438 64.959  1.00 15.94 ? 575  LYS B O   1 
ATOM   8651  C CB  . LYS B 1 575 ? -1.735  -23.118 62.292  1.00 18.85 ? 575  LYS B CB  1 
ATOM   8652  C CG  . LYS B 1 575 ? -2.182  -21.869 61.465  1.00 24.65 ? 575  LYS B CG  1 
ATOM   8653  C CD  . LYS B 1 575 ? -3.603  -21.320 61.769  1.00 28.91 ? 575  LYS B CD  1 
ATOM   8654  C CE  . LYS B 1 575 ? -4.714  -22.333 61.507  1.00 30.87 ? 575  LYS B CE  1 
ATOM   8655  N NZ  . LYS B 1 575 ? -5.951  -22.031 62.282  1.00 32.65 ? 575  LYS B NZ  1 
ATOM   8656  N N   . SER B 1 576 ? -2.987  -23.665 65.166  1.00 15.26 ? 576  SER B N   1 
ATOM   8657  C CA  . SER B 1 576 ? -4.118  -23.581 66.091  1.00 15.64 ? 576  SER B CA  1 
ATOM   8658  C C   . SER B 1 576 ? -3.702  -23.148 67.502  1.00 14.93 ? 576  SER B C   1 
ATOM   8659  O O   . SER B 1 576 ? -4.448  -22.441 68.182  1.00 15.78 ? 576  SER B O   1 
ATOM   8660  C CB  . SER B 1 576 ? -4.842  -24.930 66.143  1.00 17.91 ? 576  SER B CB  1 
ATOM   8661  O OG  . SER B 1 576 ? -6.029  -24.852 66.910  1.00 24.64 ? 576  SER B OG  1 
ATOM   8662  N N   . ILE B 1 577 ? -2.495  -23.543 67.911  1.00 12.54 ? 577  ILE B N   1 
ATOM   8663  C CA  . ILE B 1 577 ? -1.963  -23.212 69.236  1.00 11.69 ? 577  ILE B CA  1 
ATOM   8664  C C   . ILE B 1 577 ? -1.373  -21.804 69.332  1.00 11.60 ? 577  ILE B C   1 
ATOM   8665  O O   . ILE B 1 577 ? -1.473  -21.181 70.384  1.00 10.45 ? 577  ILE B O   1 
ATOM   8666  C CB  . ILE B 1 577 ? -0.937  -24.302 69.717  1.00 11.96 ? 577  ILE B CB  1 
ATOM   8667  C CG1 . ILE B 1 577 ? -1.704  -25.584 70.046  1.00 12.19 ? 577  ILE B CG1 1 
ATOM   8668  C CG2 . ILE B 1 577 ? -0.132  -23.853 70.965  1.00 11.69 ? 577  ILE B CG2 1 
ATOM   8669  C CD1 . ILE B 1 577 ? -0.842  -26.799 70.329  1.00 13.29 ? 577  ILE B CD1 1 
ATOM   8670  N N   . LEU B 1 578 ? -0.818  -21.289 68.232  1.00 12.19 ? 578  LEU B N   1 
ATOM   8671  C CA  . LEU B 1 578 ? -0.207  -19.949 68.220  1.00 12.30 ? 578  LEU B CA  1 
ATOM   8672  C C   . LEU B 1 578 ? -1.071  -18.798 68.799  1.00 12.68 ? 578  LEU B C   1 
ATOM   8673  O O   . LEU B 1 578 ? -0.579  -18.071 69.670  1.00 13.08 ? 578  LEU B O   1 
ATOM   8674  C CB  . LEU B 1 578 ? 0.391   -19.621 66.832  1.00 13.77 ? 578  LEU B CB  1 
ATOM   8675  C CG  . LEU B 1 578 ? 1.209   -18.339 66.613  1.00 16.06 ? 578  LEU B CG  1 
ATOM   8676  C CD1 . LEU B 1 578 ? 2.308   -18.208 67.652  1.00 16.55 ? 578  LEU B CD1 1 
ATOM   8677  C CD2 . LEU B 1 578 ? 1.795   -18.343 65.210  1.00 17.55 ? 578  LEU B CD2 1 
ATOM   8678  N N   . PRO B 1 579 ? -2.369  -18.668 68.397  1.00 13.89 ? 579  PRO B N   1 
ATOM   8679  C CA  . PRO B 1 579 ? -3.154  -17.567 68.983  1.00 14.62 ? 579  PRO B CA  1 
ATOM   8680  C C   . PRO B 1 579 ? -3.559  -17.789 70.450  1.00 14.99 ? 579  PRO B C   1 
ATOM   8681  O O   . PRO B 1 579 ? -4.087  -16.884 71.102  1.00 15.87 ? 579  PRO B O   1 
ATOM   8682  C CB  . PRO B 1 579 ? -4.367  -17.476 68.054  1.00 15.40 ? 579  PRO B CB  1 
ATOM   8683  C CG  . PRO B 1 579 ? -4.540  -18.858 67.571  1.00 16.69 ? 579  PRO B CG  1 
ATOM   8684  C CD  . PRO B 1 579 ? -3.128  -19.271 67.280  1.00 14.29 ? 579  PRO B CD  1 
ATOM   8685  N N   . GLN B 1 580 ? -3.272  -18.991 70.956  1.00 13.48 ? 580  GLN B N   1 
ATOM   8686  C CA  . GLN B 1 580 ? -3.564  -19.367 72.339  1.00 13.36 ? 580  GLN B CA  1 
ATOM   8687  C C   . GLN B 1 580 ? -2.391  -19.072 73.280  1.00 13.58 ? 580  GLN B C   1 
ATOM   8688  O O   . GLN B 1 580 ? -2.518  -19.223 74.500  1.00 13.52 ? 580  GLN B O   1 
ATOM   8689  C CB  . GLN B 1 580 ? -3.942  -20.848 72.438  1.00 14.35 ? 580  GLN B CB  1 
ATOM   8690  C CG  . GLN B 1 580 ? -5.201  -21.241 71.677  1.00 13.99 ? 580  GLN B CG  1 
ATOM   8691  C CD  . GLN B 1 580 ? -5.611  -22.678 71.930  1.00 16.49 ? 580  GLN B CD  1 
ATOM   8692  O OE1 . GLN B 1 580 ? -4.801  -23.598 71.817  1.00 16.45 ? 580  GLN B OE1 1 
ATOM   8693  N NE2 . GLN B 1 580 ? -6.873  -22.875 72.303  1.00 15.68 ? 580  GLN B NE2 1 
ATOM   8694  N N   . LEU B 1 581 ? -1.245  -18.687 72.710  1.00 13.60 ? 581  LEU B N   1 
ATOM   8695  C CA  . LEU B 1 581 ? -0.064  -18.355 73.509  1.00 14.28 ? 581  LEU B CA  1 
ATOM   8696  C C   . LEU B 1 581 ? -0.010  -16.858 73.820  1.00 15.67 ? 581  LEU B C   1 
ATOM   8697  O O   . LEU B 1 581 ? 0.709   -16.084 73.182  1.00 17.11 ? 581  LEU B O   1 
ATOM   8698  C CB  . LEU B 1 581 ? 1.227   -18.844 72.834  1.00 13.42 ? 581  LEU B CB  1 
ATOM   8699  C CG  . LEU B 1 581 ? 1.329   -20.344 72.525  1.00 13.20 ? 581  LEU B CG  1 
ATOM   8700  C CD1 . LEU B 1 581 ? 2.735   -20.656 72.065  1.00 13.16 ? 581  LEU B CD1 1 
ATOM   8701  C CD2 . LEU B 1 581 ? 0.981   -21.206 73.744  1.00 14.41 ? 581  LEU B CD2 1 
ATOM   8702  N N   . ARG B 1 582 ? -0.848  -16.469 74.780  1.00 16.75 ? 582  ARG B N   1 
ATOM   8703  C CA  . ARG B 1 582 ? -0.989  -15.086 75.245  1.00 17.73 ? 582  ARG B CA  1 
ATOM   8704  C C   . ARG B 1 582 ? -0.897  -15.097 76.781  1.00 17.45 ? 582  ARG B C   1 
ATOM   8705  O O   . ARG B 1 582 ? -1.393  -16.034 77.406  1.00 16.59 ? 582  ARG B O   1 
ATOM   8706  C CB  . ARG B 1 582 ? -2.359  -14.536 74.809  1.00 19.49 ? 582  ARG B CB  1 
ATOM   8707  C CG  . ARG B 1 582 ? -2.599  -14.532 73.303  1.00 24.53 ? 582  ARG B CG  1 
ATOM   8708  C CD  . ARG B 1 582 ? -3.932  -13.905 72.963  1.00 28.86 ? 582  ARG B CD  1 
ATOM   8709  N NE  . ARG B 1 582 ? -4.051  -13.626 71.534  1.00 34.58 ? 582  ARG B NE  1 
ATOM   8710  C CZ  . ARG B 1 582 ? -4.076  -12.409 70.997  1.00 36.86 ? 582  ARG B CZ  1 
ATOM   8711  N NH1 . ARG B 1 582 ? -3.994  -11.324 71.761  1.00 38.16 ? 582  ARG B NH1 1 
ATOM   8712  N NH2 . ARG B 1 582 ? -4.167  -12.277 69.678  1.00 38.93 ? 582  ARG B NH2 1 
ATOM   8713  N N   . PRO B 1 583 ? -0.281  -14.058 77.409  1.00 17.89 ? 583  PRO B N   1 
ATOM   8714  C CA  . PRO B 1 583 ? -0.145  -13.989 78.877  1.00 18.18 ? 583  PRO B CA  1 
ATOM   8715  C C   . PRO B 1 583 ? -1.456  -14.148 79.645  1.00 17.56 ? 583  PRO B C   1 
ATOM   8716  O O   . PRO B 1 583 ? -2.429  -13.444 79.366  1.00 18.64 ? 583  PRO B O   1 
ATOM   8717  C CB  . PRO B 1 583 ? 0.425   -12.589 79.105  1.00 19.88 ? 583  PRO B CB  1 
ATOM   8718  C CG  . PRO B 1 583 ? 1.150   -12.326 77.894  1.00 21.64 ? 583  PRO B CG  1 
ATOM   8719  C CD  . PRO B 1 583 ? 0.325   -12.863 76.792  1.00 19.79 ? 583  PRO B CD  1 
ATOM   8720  N N   . GLY B 1 584 ? -1.492  -15.136 80.539  1.00 16.44 ? 584  GLY B N   1 
ATOM   8721  C CA  . GLY B 1 584 ? -2.670  -15.394 81.357  1.00 16.50 ? 584  GLY B CA  1 
ATOM   8722  C C   . GLY B 1 584 ? -3.815  -16.165 80.724  1.00 15.83 ? 584  GLY B C   1 
ATOM   8723  O O   . GLY B 1 584 ? -4.802  -16.452 81.404  1.00 17.30 ? 584  GLY B O   1 
ATOM   8724  N N   . MET B 1 585 ? -3.688  -16.513 79.442  1.00 14.84 ? 585  MET B N   1 
ATOM   8725  C CA  . MET B 1 585 ? -4.735  -17.249 78.723  1.00 14.56 ? 585  MET B CA  1 
ATOM   8726  C C   . MET B 1 585 ? -4.825  -18.722 79.126  1.00 15.37 ? 585  MET B C   1 
ATOM   8727  O O   . MET B 1 585 ? -3.808  -19.373 79.359  1.00 14.92 ? 585  MET B O   1 
ATOM   8728  C CB  . MET B 1 585 ? -4.538  -17.126 77.205  1.00 14.83 ? 585  MET B CB  1 
ATOM   8729  C CG  . MET B 1 585 ? -5.704  -17.646 76.369  1.00 15.68 ? 585  MET B CG  1 
ATOM   8730  S SD  . MET B 1 585 ? -5.622  -17.205 74.635  1.00 14.88 ? 585  MET B SD  1 
ATOM   8731  C CE  . MET B 1 585 ? -6.943  -18.277 73.987  1.00 16.25 ? 585  MET B CE  1 
ATOM   8732  N N   . ARG B 1 586 ? -6.060  -19.204 79.262  1.00 16.25 ? 586  ARG B N   1 
ATOM   8733  C CA  . ARG B 1 586 ? -6.341  -20.592 79.623  1.00 16.99 ? 586  ARG B CA  1 
ATOM   8734  C C   . ARG B 1 586 ? -7.021  -21.311 78.463  1.00 16.27 ? 586  ARG B C   1 
ATOM   8735  O O   . ARG B 1 586 ? -7.814  -20.712 77.730  1.00 17.20 ? 586  ARG B O   1 
ATOM   8736  C CB  . ARG B 1 586 ? -7.238  -20.678 80.863  1.00 20.42 ? 586  ARG B CB  1 
ATOM   8737  C CG  . ARG B 1 586 ? -6.653  -20.085 82.143  1.00 24.65 ? 586  ARG B CG  1 
ATOM   8738  C CD  . ARG B 1 586 ? -7.532  -20.390 83.359  1.00 29.27 ? 586  ARG B CD  1 
ATOM   8739  N NE  . ARG B 1 586 ? -7.084  -21.575 84.100  1.00 32.87 ? 586  ARG B NE  1 
ATOM   8740  C CZ  . ARG B 1 586 ? -7.562  -22.810 83.948  1.00 35.31 ? 586  ARG B CZ  1 
ATOM   8741  N NH1 . ARG B 1 586 ? -8.526  -23.066 83.067  1.00 37.44 ? 586  ARG B NH1 1 
ATOM   8742  N NH2 . ARG B 1 586 ? -7.075  -23.800 84.685  1.00 36.50 ? 586  ARG B NH2 1 
ATOM   8743  N N   . VAL B 1 587 ? -6.658  -22.576 78.254  1.00 14.62 ? 587  VAL B N   1 
ATOM   8744  C CA  . VAL B 1 587 ? -7.249  -23.387 77.186  1.00 14.76 ? 587  VAL B CA  1 
ATOM   8745  C C   . VAL B 1 587 ? -7.855  -24.668 77.752  1.00 14.83 ? 587  VAL B C   1 
ATOM   8746  O O   . VAL B 1 587 ? -7.392  -25.178 78.779  1.00 15.31 ? 587  VAL B O   1 
ATOM   8747  C CB  . VAL B 1 587 ? -6.231  -23.732 76.047  1.00 13.18 ? 587  VAL B CB  1 
ATOM   8748  C CG1 . VAL B 1 587 ? -5.665  -22.462 75.447  1.00 15.33 ? 587  VAL B CG1 1 
ATOM   8749  C CG2 . VAL B 1 587 ? -5.102  -24.612 76.551  1.00 13.59 ? 587  VAL B CG2 1 
ATOM   8750  N N   . ASN B 1 588 ? -8.883  -25.177 77.072  1.00 15.06 ? 588  ASN B N   1 
ATOM   8751  C CA  . ASN B 1 588 ? -9.577  -26.401 77.480  1.00 16.02 ? 588  ASN B CA  1 
ATOM   8752  C C   . ASN B 1 588 ? -9.999  -27.300 76.312  1.00 15.87 ? 588  ASN B C   1 
ATOM   8753  O O   . ASN B 1 588 ? -10.650 -28.325 76.522  1.00 18.19 ? 588  ASN B O   1 
ATOM   8754  C CB  . ASN B 1 588 ? -10.793 -26.070 78.385  1.00 17.69 ? 588  ASN B CB  1 
ATOM   8755  C CG  . ASN B 1 588 ? -11.805 -25.102 77.740  1.00 19.72 ? 588  ASN B CG  1 
ATOM   8756  O OD1 . ASN B 1 588 ? -12.673 -24.561 78.434  1.00 24.63 ? 588  ASN B OD1 1 
ATOM   8757  N ND2 . ASN B 1 588 ? -11.715 -24.900 76.430  1.00 19.52 ? 588  ASN B ND2 1 
ATOM   8758  N N   . ASN B 1 589 ? -9.596  -26.928 75.093  1.00 15.89 ? 589  ASN B N   1 
ATOM   8759  C CA  . ASN B 1 589 ? -9.967  -27.664 73.875  1.00 15.39 ? 589  ASN B CA  1 
ATOM   8760  C C   . ASN B 1 589 ? -9.124  -28.882 73.483  1.00 15.44 ? 589  ASN B C   1 
ATOM   8761  O O   . ASN B 1 589 ? -9.541  -29.683 72.643  1.00 18.07 ? 589  ASN B O   1 
ATOM   8762  C CB  . ASN B 1 589 ? -10.078 -26.699 72.684  1.00 16.27 ? 589  ASN B CB  1 
ATOM   8763  C CG  . ASN B 1 589 ? -8.735  -26.120 72.258  1.00 15.75 ? 589  ASN B CG  1 
ATOM   8764  O OD1 . ASN B 1 589 ? -8.102  -25.372 73.005  1.00 16.84 ? 589  ASN B OD1 1 
ATOM   8765  N ND2 . ASN B 1 589 ? -8.294  -26.476 71.056  1.00 17.44 ? 589  ASN B ND2 1 
ATOM   8766  N N   . HIS B 1 590 ? -7.934  -29.004 74.064  1.00 14.38 ? 590  HIS B N   1 
ATOM   8767  C CA  . HIS B 1 590 ? -7.043  -30.125 73.762  1.00 14.08 ? 590  HIS B CA  1 
ATOM   8768  C C   . HIS B 1 590 ? -7.164  -31.173 74.868  1.00 15.38 ? 590  HIS B C   1 
ATOM   8769  O O   . HIS B 1 590 ? -8.034  -31.077 75.742  1.00 15.80 ? 590  HIS B O   1 
ATOM   8770  C CB  . HIS B 1 590 ? -5.582  -29.660 73.732  1.00 13.54 ? 590  HIS B CB  1 
ATOM   8771  C CG  . HIS B 1 590 ? -5.332  -28.411 72.946  1.00 13.67 ? 590  HIS B CG  1 
ATOM   8772  N ND1 . HIS B 1 590 ? -4.855  -28.432 71.655  1.00 14.27 ? 590  HIS B ND1 1 
ATOM   8773  C CD2 . HIS B 1 590 ? -5.444  -27.106 73.287  1.00 13.20 ? 590  HIS B CD2 1 
ATOM   8774  C CE1 . HIS B 1 590 ? -4.689  -27.192 71.230  1.00 13.33 ? 590  HIS B CE1 1 
ATOM   8775  N NE2 . HIS B 1 590 ? -5.040  -26.368 72.201  1.00 14.08 ? 590  HIS B NE2 1 
ATOM   8776  N N   . ASP B 1 591 ? -6.262  -32.156 74.834  1.00 15.45 ? 591  ASP B N   1 
ATOM   8777  C CA  . ASP B 1 591 ? -6.176  -33.200 75.857  1.00 14.91 ? 591  ASP B CA  1 
ATOM   8778  C C   . ASP B 1 591 ? -5.620  -32.505 77.115  1.00 14.88 ? 591  ASP B C   1 
ATOM   8779  O O   . ASP B 1 591 ? -5.009  -31.439 76.995  1.00 14.54 ? 591  ASP B O   1 
ATOM   8780  C CB  . ASP B 1 591 ? -5.241  -34.321 75.389  1.00 16.14 ? 591  ASP B CB  1 
ATOM   8781  C CG  . ASP B 1 591 ? -3.813  -33.837 75.143  1.00 15.78 ? 591  ASP B CG  1 
ATOM   8782  O OD1 . ASP B 1 591 ? -3.032  -33.801 76.109  1.00 16.21 ? 591  ASP B OD1 1 
ATOM   8783  O OD2 . ASP B 1 591 ? -3.457  -33.527 73.985  1.00 16.38 ? 591  ASP B OD2 1 
ATOM   8784  N N   . SER B 1 592 ? -5.778  -33.116 78.290  1.00 14.52 ? 592  SER B N   1 
ATOM   8785  C CA  . SER B 1 592 ? -5.312  -32.502 79.543  1.00 13.95 ? 592  SER B CA  1 
ATOM   8786  C C   . SER B 1 592 ? -3.820  -32.176 79.658  1.00 13.01 ? 592  SER B C   1 
ATOM   8787  O O   . SER B 1 592 ? -3.454  -31.238 80.369  1.00 14.25 ? 592  SER B O   1 
ATOM   8788  C CB  . SER B 1 592 ? -5.781  -33.297 80.765  1.00 15.89 ? 592  SER B CB  1 
ATOM   8789  O OG  . SER B 1 592 ? -5.376  -34.645 80.693  1.00 17.57 ? 592  SER B OG  1 
ATOM   8790  N N   . SER B 1 593 ? -2.975  -32.920 78.940  1.00 13.22 ? 593  SER B N   1 
ATOM   8791  C CA  . SER B 1 593 ? -1.526  -32.679 78.954  1.00 12.05 ? 593  SER B CA  1 
ATOM   8792  C C   . SER B 1 593 ? -1.210  -31.388 78.214  1.00 11.55 ? 593  SER B C   1 
ATOM   8793  O O   . SER B 1 593 ? -0.599  -30.487 78.783  1.00 11.27 ? 593  SER B O   1 
ATOM   8794  C CB  . SER B 1 593 ? -0.760  -33.837 78.309  1.00 12.98 ? 593  SER B CB  1 
ATOM   8795  O OG  . SER B 1 593 ? 0.614   -33.524 78.131  1.00 13.75 ? 593  SER B OG  1 
ATOM   8796  N N   . THR B 1 594 ? -1.695  -31.293 76.973  1.00 12.09 ? 594  THR B N   1 
ATOM   8797  C CA  . THR B 1 594 ? -1.487  -30.114 76.128  1.00 11.98 ? 594  THR B CA  1 
ATOM   8798  C C   . THR B 1 594 ? -2.111  -28.871 76.787  1.00 12.21 ? 594  THR B C   1 
ATOM   8799  O O   . THR B 1 594 ? -1.477  -27.820 76.818  1.00 12.62 ? 594  THR B O   1 
ATOM   8800  C CB  . THR B 1 594 ? -2.035  -30.349 74.698  1.00 12.51 ? 594  THR B CB  1 
ATOM   8801  O OG1 . THR B 1 594 ? -1.405  -31.504 74.130  1.00 12.77 ? 594  THR B OG1 1 
ATOM   8802  C CG2 . THR B 1 594 ? -1.765  -29.149 73.788  1.00 13.03 ? 594  THR B CG2 1 
ATOM   8803  N N   . ASN B 1 595 ? -3.293  -29.034 77.397  1.00 12.62 ? 595  ASN B N   1 
ATOM   8804  C CA  . ASN B 1 595 ? -3.965  -27.935 78.108  1.00 12.66 ? 595  ASN B CA  1 
ATOM   8805  C C   . ASN B 1 595 ? -3.117  -27.416 79.268  1.00 12.20 ? 595  ASN B C   1 
ATOM   8806  O O   . ASN B 1 595 ? -2.874  -26.215 79.372  1.00 12.41 ? 595  ASN B O   1 
ATOM   8807  C CB  . ASN B 1 595 ? -5.321  -28.368 78.688  1.00 13.08 ? 595  ASN B CB  1 
ATOM   8808  C CG  . ASN B 1 595 ? -6.416  -28.479 77.645  1.00 13.41 ? 595  ASN B CG  1 
ATOM   8809  O OD1 . ASN B 1 595 ? -6.312  -27.954 76.535  1.00 13.89 ? 595  ASN B OD1 1 
ATOM   8810  N ND2 . ASN B 1 595 ? -7.499  -29.158 78.016  1.00 13.78 ? 595  ASN B ND2 1 
ATOM   8811  N N   . GLY B 1 596 ? -2.623  -28.351 80.089  1.00 13.29 ? 596  GLY B N   1 
ATOM   8812  C CA  . GLY B 1 596 ? -1.804  -28.029 81.250  1.00 13.17 ? 596  GLY B CA  1 
ATOM   8813  C C   . GLY B 1 596 ? -0.486  -27.359 80.908  1.00 11.84 ? 596  GLY B C   1 
ATOM   8814  O O   . GLY B 1 596 ? -0.070  -26.428 81.592  1.00 12.81 ? 596  GLY B O   1 
ATOM   8815  N N   . LEU B 1 597 ? 0.130   -27.809 79.813  1.00 11.61 ? 597  LEU B N   1 
ATOM   8816  C CA  . LEU B 1 597 ? 1.397   -27.269 79.328  1.00 11.95 ? 597  LEU B CA  1 
ATOM   8817  C C   . LEU B 1 597 ? 1.251   -25.843 78.798  1.00 11.91 ? 597  LEU B C   1 
ATOM   8818  O O   . LEU B 1 597 ? 2.049   -24.971 79.148  1.00 12.66 ? 597  LEU B O   1 
ATOM   8819  C CB  . LEU B 1 597 ? 1.974   -28.185 78.252  1.00 12.26 ? 597  LEU B CB  1 
ATOM   8820  C CG  . LEU B 1 597 ? 2.600   -29.493 78.733  1.00 13.08 ? 597  LEU B CG  1 
ATOM   8821  C CD1 . LEU B 1 597 ? 2.778   -30.431 77.550  1.00 13.13 ? 597  LEU B CD1 1 
ATOM   8822  C CD2 . LEU B 1 597 ? 3.925   -29.214 79.435  1.00 12.83 ? 597  LEU B CD2 1 
ATOM   8823  N N   . ILE B 1 598 ? 0.201   -25.605 78.005  1.00 11.82 ? 598  ILE B N   1 
ATOM   8824  C CA  . ILE B 1 598 ? -0.082  -24.277 77.445  1.00 11.54 ? 598  ILE B CA  1 
ATOM   8825  C C   . ILE B 1 598 ? -0.468  -23.306 78.571  1.00 11.68 ? 598  ILE B C   1 
ATOM   8826  O O   . ILE B 1 598 ? -0.013  -22.163 78.580  1.00 12.53 ? 598  ILE B O   1 
ATOM   8827  C CB  . ILE B 1 598 ? -1.204  -24.333 76.352  1.00 11.56 ? 598  ILE B CB  1 
ATOM   8828  C CG1 . ILE B 1 598 ? -0.685  -25.057 75.103  1.00 12.29 ? 598  ILE B CG1 1 
ATOM   8829  C CG2 . ILE B 1 598 ? -1.702  -22.914 75.970  1.00 12.60 ? 598  ILE B CG2 1 
ATOM   8830  C CD1 . ILE B 1 598 ? -1.767  -25.400 74.087  1.00 13.63 ? 598  ILE B CD1 1 
ATOM   8831  N N   . ASN B 1 599 ? -1.263  -23.783 79.533  1.00 13.21 ? 599  ASN B N   1 
ATOM   8832  C CA  . ASN B 1 599 ? -1.692  -22.957 80.670  1.00 12.75 ? 599  ASN B CA  1 
ATOM   8833  C C   . ASN B 1 599 ? -0.518  -22.517 81.541  1.00 13.32 ? 599  ASN B C   1 
ATOM   8834  O O   . ASN B 1 599 ? -0.458  -21.357 81.958  1.00 13.91 ? 599  ASN B O   1 
ATOM   8835  C CB  . ASN B 1 599 ? -2.745  -23.682 81.522  1.00 13.86 ? 599  ASN B CB  1 
ATOM   8836  C CG  . ASN B 1 599 ? -4.089  -23.818 80.814  1.00 14.53 ? 599  ASN B CG  1 
ATOM   8837  O OD1 . ASN B 1 599 ? -4.350  -23.162 79.806  1.00 14.73 ? 599  ASN B OD1 1 
ATOM   8838  N ND2 . ASN B 1 599 ? -4.943  -24.687 81.339  1.00 15.65 ? 599  ASN B ND2 1 
ATOM   8839  N N   . MET B 1 600 ? 0.443   -23.426 81.738  1.00 12.86 ? 600  MET B N   1 
ATOM   8840  C CA  . MET B 1 600 ? 1.647   -23.148 82.532  1.00 13.54 ? 600  MET B CA  1 
ATOM   8841  C C   . MET B 1 600 ? 2.540   -22.139 81.801  1.00 13.76 ? 600  MET B C   1 
ATOM   8842  O O   . MET B 1 600 ? 3.099   -21.232 82.426  1.00 13.94 ? 600  MET B O   1 
ATOM   8843  C CB  . MET B 1 600 ? 2.426   -24.439 82.796  1.00 15.11 ? 600  MET B CB  1 
ATOM   8844  C CG  . MET B 1 600 ? 3.626   -24.272 83.728  1.00 18.15 ? 600  MET B CG  1 
ATOM   8845  S SD  . MET B 1 600 ? 4.432   -25.834 84.071  1.00 21.77 ? 600  MET B SD  1 
ATOM   8846  C CE  . MET B 1 600 ? 3.215   -26.560 85.168  1.00 23.62 ? 600  MET B CE  1 
ATOM   8847  N N   . PHE B 1 601 ? 2.642   -22.301 80.477  1.00 12.43 ? 601  PHE B N   1 
ATOM   8848  C CA  . PHE B 1 601 ? 3.431   -21.413 79.617  1.00 12.31 ? 601  PHE B CA  1 
ATOM   8849  C C   . PHE B 1 601 ? 2.897   -19.981 79.722  1.00 13.36 ? 601  PHE B C   1 
ATOM   8850  O O   . PHE B 1 601 ? 3.661   -19.054 79.972  1.00 13.49 ? 601  PHE B O   1 
ATOM   8851  C CB  . PHE B 1 601 ? 3.384   -21.896 78.150  1.00 11.72 ? 601  PHE B CB  1 
ATOM   8852  C CG  . PHE B 1 601 ? 4.165   -21.028 77.173  1.00 11.28 ? 601  PHE B CG  1 
ATOM   8853  C CD1 . PHE B 1 601 ? 5.534   -21.257 76.957  1.00 11.52 ? 601  PHE B CD1 1 
ATOM   8854  C CD2 . PHE B 1 601 ? 3.540   -19.961 76.487  1.00 12.63 ? 601  PHE B CD2 1 
ATOM   8855  C CE1 . PHE B 1 601 ? 6.279   -20.431 76.073  1.00 11.53 ? 601  PHE B CE1 1 
ATOM   8856  C CE2 . PHE B 1 601 ? 4.270   -19.126 75.602  1.00 12.01 ? 601  PHE B CE2 1 
ATOM   8857  C CZ  . PHE B 1 601 ? 5.647   -19.362 75.395  1.00 13.27 ? 601  PHE B CZ  1 
ATOM   8858  N N   . ASN B 1 602 ? 1.582   -19.832 79.552  1.00 14.30 ? 602  ASN B N   1 
ATOM   8859  C CA  . ASN B 1 602 ? 0.898   -18.534 79.594  1.00 15.29 ? 602  ASN B CA  1 
ATOM   8860  C C   . ASN B 1 602 ? 0.910   -17.829 80.948  1.00 17.24 ? 602  ASN B C   1 
ATOM   8861  O O   . ASN B 1 602 ? 0.825   -16.602 81.022  1.00 17.79 ? 602  ASN B O   1 
ATOM   8862  C CB  . ASN B 1 602 ? -0.551  -18.691 79.109  1.00 13.21 ? 602  ASN B CB  1 
ATOM   8863  C CG  . ASN B 1 602 ? -0.642  -19.047 77.625  1.00 15.19 ? 602  ASN B CG  1 
ATOM   8864  O OD1 . ASN B 1 602 ? 0.291   -18.804 76.871  1.00 14.90 ? 602  ASN B OD1 1 
ATOM   8865  N ND2 . ASN B 1 602 ? -1.770  -19.614 77.207  1.00 12.35 ? 602  ASN B ND2 1 
ATOM   8866  N N   . GLU B 1 603 ? 1.018   -18.611 82.015  1.00 19.39 ? 603  GLU B N   1 
ATOM   8867  C CA  . GLU B 1 603 ? 1.052   -18.069 83.372  1.00 23.43 ? 603  GLU B CA  1 
ATOM   8868  C C   . GLU B 1 603 ? 2.374   -17.373 83.670  1.00 24.60 ? 603  GLU B C   1 
ATOM   8869  O O   . GLU B 1 603 ? 2.413   -16.373 84.386  1.00 25.31 ? 603  GLU B O   1 
ATOM   8870  C CB  . GLU B 1 603 ? 0.890   -19.195 84.384  1.00 25.59 ? 603  GLU B CB  1 
ATOM   8871  C CG  . GLU B 1 603 ? -0.523  -19.460 84.875  1.00 31.76 ? 603  GLU B CG  1 
ATOM   8872  C CD  . GLU B 1 603 ? -0.635  -20.779 85.659  1.00 34.50 ? 603  GLU B CD  1 
ATOM   8873  O OE1 . GLU B 1 603 ? 0.406   -21.291 86.146  1.00 37.40 ? 603  GLU B OE1 1 
ATOM   8874  O OE2 . GLU B 1 603 ? -1.766  -21.314 85.789  1.00 37.72 ? 603  GLU B OE2 1 
ATOM   8875  N N   . LEU B 1 604 ? 3.457   -17.910 83.099  1.00 26.69 ? 604  LEU B N   1 
ATOM   8876  C CA  . LEU B 1 604 ? 4.812   -17.415 83.342  1.00 28.80 ? 604  LEU B CA  1 
ATOM   8877  C C   . LEU B 1 604 ? 5.611   -16.847 82.161  1.00 30.01 ? 604  LEU B C   1 
ATOM   8878  O O   . LEU B 1 604 ? 6.776   -16.468 82.338  1.00 29.95 ? 604  LEU B O   1 
ATOM   8879  C CB  . LEU B 1 604 ? 5.630   -18.533 84.020  1.00 29.74 ? 604  LEU B CB  1 
ATOM   8880  C CG  . LEU B 1 604 ? 5.029   -19.181 85.275  1.00 30.57 ? 604  LEU B CG  1 
ATOM   8881  C CD1 . LEU B 1 604 ? 5.685   -20.494 85.567  1.00 31.72 ? 604  LEU B CD1 1 
ATOM   8882  C CD2 . LEU B 1 604 ? 5.092   -18.234 86.459  1.00 31.38 ? 604  LEU B CD2 1 
ATOM   8883  N N   . SER B 1 605 ? 4.994   -16.748 80.979  1.00 30.97 ? 605  SER B N   1 
ATOM   8884  C CA  . SER B 1 605 ? 5.679   -16.248 79.782  1.00 33.02 ? 605  SER B CA  1 
ATOM   8885  C C   . SER B 1 605 ? 6.208   -14.810 79.840  1.00 34.99 ? 605  SER B C   1 
ATOM   8886  O O   . SER B 1 605 ? 7.286   -14.543 79.284  1.00 34.89 ? 605  SER B O   1 
ATOM   8887  C CB  . SER B 1 605 ? 4.761   -16.403 78.539  1.00 32.19 ? 605  SER B CB  1 
ATOM   8888  O OG  . SER B 1 605 ? 3.549   -15.684 78.695  1.00 31.46 ? 605  SER B OG  1 
ATOM   8889  N N   . HIS B 1 606 ? 5.607   -13.998 80.706  1.00 37.02 ? 606  HIS B N   1 
ATOM   8890  C CA  . HIS B 1 606 ? 5.844   -12.549 80.678  1.00 39.56 ? 606  HIS B CA  1 
ATOM   8891  C C   . HIS B 1 606 ? 6.056   -11.951 82.060  1.00 40.65 ? 606  HIS B C   1 
ATOM   8892  O O   . HIS B 1 606 ? 6.881   -11.016 82.170  1.00 42.29 ? 606  HIS B O   1 
ATOM   8893  C CB  . HIS B 1 606 ? 4.621   -11.879 79.974  1.00 40.19 ? 606  HIS B CB  1 
ATOM   8894  C CG  . HIS B 1 606 ? 4.446   -12.281 78.537  1.00 41.38 ? 606  HIS B CG  1 
ATOM   8895  N ND1 . HIS B 1 606 ? 5.083   -11.653 77.497  1.00 42.18 ? 606  HIS B ND1 1 
ATOM   8896  C CD2 . HIS B 1 606 ? 3.725   -13.270 77.975  1.00 41.94 ? 606  HIS B CD2 1 
ATOM   8897  C CE1 . HIS B 1 606 ? 4.752   -12.236 76.355  1.00 42.29 ? 606  HIS B CE1 1 
ATOM   8898  N NE2 . HIS B 1 606 ? 3.919   -13.220 76.619  1.00 42.16 ? 606  HIS B NE2 1 
ATOM   8899  N N   . ALA C 1 46  ? 23.105  -67.261 81.708  1.00 28.70 ? 46   ALA C N   1 
ATOM   8900  C CA  . ALA C 1 46  ? 22.182  -66.104 81.524  1.00 28.51 ? 46   ALA C CA  1 
ATOM   8901  C C   . ALA C 1 46  ? 21.531  -65.695 82.842  1.00 29.02 ? 46   ALA C C   1 
ATOM   8902  O O   . ALA C 1 46  ? 21.144  -66.550 83.645  1.00 28.97 ? 46   ALA C O   1 
ATOM   8903  C CB  . ALA C 1 46  ? 21.115  -66.432 80.484  1.00 29.93 ? 46   ALA C CB  1 
ATOM   8904  N N   . ASP C 1 47  ? 21.420  -64.383 83.053  1.00 27.99 ? 47   ASP C N   1 
ATOM   8905  C CA  . ASP C 1 47  ? 20.828  -63.802 84.263  1.00 28.11 ? 47   ASP C CA  1 
ATOM   8906  C C   . ASP C 1 47  ? 19.318  -64.030 84.336  1.00 28.40 ? 47   ASP C C   1 
ATOM   8907  O O   . ASP C 1 47  ? 18.604  -63.855 83.349  1.00 29.04 ? 47   ASP C O   1 
ATOM   8908  C CB  . ASP C 1 47  ? 21.145  -62.295 84.327  1.00 27.63 ? 47   ASP C CB  1 
ATOM   8909  C CG  . ASP C 1 47  ? 20.597  -61.618 85.578  1.00 28.52 ? 47   ASP C CG  1 
ATOM   8910  O OD1 . ASP C 1 47  ? 20.787  -62.151 86.692  1.00 27.07 ? 47   ASP C OD1 1 
ATOM   8911  O OD2 . ASP C 1 47  ? 19.967  -60.546 85.438  1.00 27.56 ? 47   ASP C OD2 1 
ATOM   8912  N N   . THR C 1 48  ? 18.852  -64.442 85.514  1.00 28.26 ? 48   THR C N   1 
ATOM   8913  C CA  . THR C 1 48  ? 17.432  -64.694 85.741  1.00 28.01 ? 48   THR C CA  1 
ATOM   8914  C C   . THR C 1 48  ? 16.859  -63.872 86.896  1.00 27.44 ? 48   THR C C   1 
ATOM   8915  O O   . THR C 1 48  ? 15.657  -63.920 87.137  1.00 26.78 ? 48   THR C O   1 
ATOM   8916  C CB  . THR C 1 48  ? 17.140  -66.210 85.985  1.00 29.24 ? 48   THR C CB  1 
ATOM   8917  O OG1 . THR C 1 48  ? 17.898  -66.682 87.105  1.00 29.92 ? 48   THR C OG1 1 
ATOM   8918  C CG2 . THR C 1 48  ? 17.477  -67.043 84.748  1.00 29.52 ? 48   THR C CG2 1 
ATOM   8919  N N   . THR C 1 49  ? 17.702  -63.071 87.557  1.00 27.00 ? 49   THR C N   1 
ATOM   8920  C CA  . THR C 1 49  ? 17.281  -62.244 88.704  1.00 27.47 ? 49   THR C CA  1 
ATOM   8921  C C   . THR C 1 49  ? 16.242  -61.159 88.395  1.00 26.97 ? 49   THR C C   1 
ATOM   8922  O O   . THR C 1 49  ? 15.404  -60.840 89.243  1.00 27.08 ? 49   THR C O   1 
ATOM   8923  C CB  . THR C 1 49  ? 18.486  -61.590 89.435  1.00 27.58 ? 49   THR C CB  1 
ATOM   8924  O OG1 . THR C 1 49  ? 19.202  -60.740 88.534  1.00 27.00 ? 49   THR C OG1 1 
ATOM   8925  C CG2 . THR C 1 49  ? 19.427  -62.658 89.992  1.00 27.30 ? 49   THR C CG2 1 
ATOM   8926  N N   . LEU C 1 50  ? 16.302  -60.600 87.185  1.00 26.93 ? 50   LEU C N   1 
ATOM   8927  C CA  . LEU C 1 50  ? 15.354  -59.569 86.759  1.00 26.14 ? 50   LEU C CA  1 
ATOM   8928  C C   . LEU C 1 50  ? 14.059  -60.190 86.223  1.00 26.68 ? 50   LEU C C   1 
ATOM   8929  O O   . LEU C 1 50  ? 12.964  -59.800 86.642  1.00 26.07 ? 50   LEU C O   1 
ATOM   8930  C CB  . LEU C 1 50  ? 15.990  -58.640 85.711  1.00 25.05 ? 50   LEU C CB  1 
ATOM   8931  C CG  . LEU C 1 50  ? 15.134  -57.554 85.033  1.00 24.17 ? 50   LEU C CG  1 
ATOM   8932  C CD1 . LEU C 1 50  ? 14.330  -56.742 86.048  1.00 23.70 ? 50   LEU C CD1 1 
ATOM   8933  C CD2 . LEU C 1 50  ? 16.021  -56.638 84.222  1.00 23.95 ? 50   LEU C CD2 1 
ATOM   8934  N N   . THR C 1 51  ? 14.197  -61.167 85.328  1.00 27.66 ? 51   THR C N   1 
ATOM   8935  C CA  . THR C 1 51  ? 13.053  -61.847 84.721  1.00 30.00 ? 51   THR C CA  1 
ATOM   8936  C C   . THR C 1 51  ? 12.197  -62.679 85.688  1.00 30.79 ? 51   THR C C   1 
ATOM   8937  O O   . THR C 1 51  ? 11.016  -62.918 85.422  1.00 31.48 ? 51   THR C O   1 
ATOM   8938  C CB  . THR C 1 51  ? 13.481  -62.714 83.509  1.00 30.02 ? 51   THR C CB  1 
ATOM   8939  O OG1 . THR C 1 51  ? 14.569  -63.568 83.878  1.00 30.36 ? 51   THR C OG1 1 
ATOM   8940  C CG2 . THR C 1 51  ? 13.902  -61.828 82.337  1.00 31.22 ? 51   THR C CG2 1 
ATOM   8941  N N   . SER C 1 52  ? 12.780  -63.057 86.828  1.00 32.33 ? 52   SER C N   1 
ATOM   8942  C CA  . SER C 1 52  ? 12.077  -63.844 87.848  1.00 33.03 ? 52   SER C CA  1 
ATOM   8943  C C   . SER C 1 52  ? 11.375  -62.994 88.907  1.00 32.96 ? 52   SER C C   1 
ATOM   8944  O O   . SER C 1 52  ? 10.708  -63.541 89.795  1.00 33.81 ? 52   SER C O   1 
ATOM   8945  C CB  . SER C 1 52  ? 13.020  -64.844 88.523  1.00 33.27 ? 52   SER C CB  1 
ATOM   8946  O OG  . SER C 1 52  ? 13.522  -65.780 87.586  1.00 35.76 ? 52   SER C OG  1 
ATOM   8947  N N   . CYS C 1 53  ? 11.526  -61.667 88.817  1.00 31.75 ? 53   CYS C N   1 
ATOM   8948  C CA  . CYS C 1 53  ? 10.884  -60.731 89.754  1.00 30.72 ? 53   CYS C CA  1 
ATOM   8949  C C   . CYS C 1 53  ? 9.372   -60.809 89.560  1.00 29.72 ? 53   CYS C C   1 
ATOM   8950  O O   . CYS C 1 53  ? 8.895   -60.933 88.423  1.00 29.53 ? 53   CYS C O   1 
ATOM   8951  C CB  . CYS C 1 53  ? 11.346  -59.284 89.512  1.00 30.77 ? 53   CYS C CB  1 
ATOM   8952  S SG  . CYS C 1 53  ? 12.971  -58.834 90.173  1.00 33.92 ? 53   CYS C SG  1 
ATOM   8953  N N   . ALA C 1 54  ? 8.634   -60.759 90.672  1.00 28.87 ? 54   ALA C N   1 
ATOM   8954  C CA  . ALA C 1 54  ? 7.169   -60.827 90.672  1.00 28.34 ? 54   ALA C CA  1 
ATOM   8955  C C   . ALA C 1 54  ? 6.546   -59.710 89.840  1.00 27.98 ? 54   ALA C C   1 
ATOM   8956  O O   . ALA C 1 54  ? 5.612   -59.944 89.074  1.00 27.99 ? 54   ALA C O   1 
ATOM   8957  C CB  . ALA C 1 54  ? 6.643   -60.775 92.101  1.00 28.45 ? 54   ALA C CB  1 
ATOM   8958  N N   . SER C 1 55  ? 7.143   -58.524 89.937  1.00 27.65 ? 55   SER C N   1 
ATOM   8959  C CA  . SER C 1 55  ? 6.695   -57.342 89.211  1.00 27.50 ? 55   SER C CA  1 
ATOM   8960  C C   . SER C 1 55  ? 6.973   -57.386 87.710  1.00 25.96 ? 55   SER C C   1 
ATOM   8961  O O   . SER C 1 55  ? 6.257   -56.750 86.941  1.00 25.95 ? 55   SER C O   1 
ATOM   8962  C CB  . SER C 1 55  ? 7.296   -56.091 89.829  1.00 28.60 ? 55   SER C CB  1 
ATOM   8963  O OG  . SER C 1 55  ? 8.682   -56.267 90.055  1.00 32.25 ? 55   SER C OG  1 
ATOM   8964  N N   . TRP C 1 56  ? 7.981   -58.161 87.299  1.00 25.55 ? 56   TRP C N   1 
ATOM   8965  C CA  . TRP C 1 56  ? 8.324   -58.304 85.877  1.00 25.10 ? 56   TRP C CA  1 
ATOM   8966  C C   . TRP C 1 56  ? 7.270   -59.143 85.156  1.00 25.77 ? 56   TRP C C   1 
ATOM   8967  O O   . TRP C 1 56  ? 6.894   -58.831 84.021  1.00 24.84 ? 56   TRP C O   1 
ATOM   8968  C CB  . TRP C 1 56  ? 9.709   -58.942 85.698  1.00 24.83 ? 56   TRP C CB  1 
ATOM   8969  C CG  . TRP C 1 56  ? 10.262  -58.831 84.287  1.00 23.95 ? 56   TRP C CG  1 
ATOM   8970  C CD1 . TRP C 1 56  ? 10.184  -59.771 83.291  1.00 23.84 ? 56   TRP C CD1 1 
ATOM   8971  C CD2 . TRP C 1 56  ? 10.971  -57.720 83.732  1.00 23.22 ? 56   TRP C CD2 1 
ATOM   8972  N NE1 . TRP C 1 56  ? 10.808  -59.316 82.152  1.00 23.27 ? 56   TRP C NE1 1 
ATOM   8973  C CE2 . TRP C 1 56  ? 11.302  -58.061 82.391  1.00 22.99 ? 56   TRP C CE2 1 
ATOM   8974  C CE3 . TRP C 1 56  ? 11.364  -56.461 84.232  1.00 23.63 ? 56   TRP C CE3 1 
ATOM   8975  C CZ2 . TRP C 1 56  ? 12.012  -57.187 81.541  1.00 22.64 ? 56   TRP C CZ2 1 
ATOM   8976  C CZ3 . TRP C 1 56  ? 12.077  -55.582 83.385  1.00 23.33 ? 56   TRP C CZ3 1 
ATOM   8977  C CH2 . TRP C 1 56  ? 12.392  -55.959 82.055  1.00 22.46 ? 56   TRP C CH2 1 
ATOM   8978  N N   . THR C 1 57  ? 6.817   -60.213 85.820  1.00 25.75 ? 57   THR C N   1 
ATOM   8979  C CA  . THR C 1 57  ? 5.794   -61.110 85.283  1.00 26.44 ? 57   THR C CA  1 
ATOM   8980  C C   . THR C 1 57  ? 4.464   -60.355 85.195  1.00 25.58 ? 57   THR C C   1 
ATOM   8981  O O   . THR C 1 57  ? 3.731   -60.505 84.217  1.00 25.73 ? 57   THR C O   1 
ATOM   8982  C CB  . THR C 1 57  ? 5.643   -62.386 86.162  1.00 26.93 ? 57   THR C CB  1 
ATOM   8983  O OG1 . THR C 1 57  ? 6.916   -63.035 86.266  1.00 27.69 ? 57   THR C OG1 1 
ATOM   8984  C CG2 . THR C 1 57  ? 4.654   -63.377 85.537  1.00 28.17 ? 57   THR C CG2 1 
ATOM   8985  N N   . GLN C 1 58  ? 4.220   -59.489 86.184  1.00 25.28 ? 58   GLN C N   1 
ATOM   8986  C CA  . GLN C 1 58  ? 3.012   -58.655 86.257  1.00 25.35 ? 58   GLN C CA  1 
ATOM   8987  C C   . GLN C 1 58  ? 2.995   -57.623 85.130  1.00 24.03 ? 58   GLN C C   1 
ATOM   8988  O O   . GLN C 1 58  ? 1.960   -57.401 84.515  1.00 22.78 ? 58   GLN C O   1 
ATOM   8989  C CB  . GLN C 1 58  ? 2.931   -57.932 87.604  1.00 27.84 ? 58   GLN C CB  1 
ATOM   8990  C CG  . GLN C 1 58  ? 2.729   -58.842 88.810  1.00 32.78 ? 58   GLN C CG  1 
ATOM   8991  C CD  . GLN C 1 58  ? 3.044   -58.159 90.136  1.00 35.53 ? 58   GLN C CD  1 
ATOM   8992  O OE1 . GLN C 1 58  ? 2.810   -56.959 90.307  1.00 37.94 ? 58   GLN C OE1 1 
ATOM   8993  N NE2 . GLN C 1 58  ? 3.591   -58.923 91.079  1.00 37.69 ? 58   GLN C NE2 1 
ATOM   8994  N N   . LEU C 1 59  ? 4.159   -57.038 84.840  1.00 23.65 ? 59   LEU C N   1 
ATOM   8995  C CA  . LEU C 1 59  ? 4.301   -56.043 83.774  1.00 22.93 ? 59   LEU C CA  1 
ATOM   8996  C C   . LEU C 1 59  ? 4.130   -56.643 82.380  1.00 23.11 ? 59   LEU C C   1 
ATOM   8997  O O   . LEU C 1 59  ? 3.621   -55.975 81.478  1.00 22.40 ? 59   LEU C O   1 
ATOM   8998  C CB  . LEU C 1 59  ? 5.649   -55.326 83.881  1.00 21.92 ? 59   LEU C CB  1 
ATOM   8999  C CG  . LEU C 1 59  ? 5.809   -54.207 84.906  1.00 22.67 ? 59   LEU C CG  1 
ATOM   9000  C CD1 . LEU C 1 59  ? 7.277   -53.881 85.105  1.00 22.73 ? 59   LEU C CD1 1 
ATOM   9001  C CD2 . LEU C 1 59  ? 5.035   -52.985 84.464  1.00 22.24 ? 59   LEU C CD2 1 
ATOM   9002  N N   . GLN C 1 60  ? 4.529   -57.908 82.222  1.00 23.84 ? 60   GLN C N   1 
ATOM   9003  C CA  . GLN C 1 60  ? 4.394   -58.623 80.950  1.00 25.23 ? 60   GLN C CA  1 
ATOM   9004  C C   . GLN C 1 60  ? 2.917   -58.929 80.697  1.00 24.88 ? 60   GLN C C   1 
ATOM   9005  O O   . GLN C 1 60  ? 2.443   -58.836 79.560  1.00 23.97 ? 60   GLN C O   1 
ATOM   9006  C CB  . GLN C 1 60  ? 5.239   -59.910 80.945  1.00 27.02 ? 60   GLN C CB  1 
ATOM   9007  C CG  . GLN C 1 60  ? 5.388   -60.601 79.573  1.00 31.44 ? 60   GLN C CG  1 
ATOM   9008  C CD  . GLN C 1 60  ? 5.635   -59.627 78.422  1.00 33.92 ? 60   GLN C CD  1 
ATOM   9009  O OE1 . GLN C 1 60  ? 6.762   -59.198 78.186  1.00 36.36 ? 60   GLN C OE1 1 
ATOM   9010  N NE2 . GLN C 1 60  ? 4.569   -59.272 77.710  1.00 35.54 ? 60   GLN C NE2 1 
ATOM   9011  N N   . LYS C 1 61  ? 2.197   -59.232 81.781  1.00 25.56 ? 61   LYS C N   1 
ATOM   9012  C CA  . LYS C 1 61  ? 0.761   -59.517 81.740  1.00 25.98 ? 61   LYS C CA  1 
ATOM   9013  C C   . LYS C 1 61  ? -0.005  -58.234 81.414  1.00 25.27 ? 61   LYS C C   1 
ATOM   9014  O O   . LYS C 1 61  ? -0.969  -58.262 80.646  1.00 25.06 ? 61   LYS C O   1 
ATOM   9015  C CB  . LYS C 1 61  ? 0.277   -60.071 83.086  1.00 27.69 ? 61   LYS C CB  1 
ATOM   9016  C CG  . LYS C 1 61  ? 0.891   -61.404 83.492  1.00 30.62 ? 61   LYS C CG  1 
ATOM   9017  C CD  . LYS C 1 61  ? 0.334   -61.855 84.832  1.00 32.71 ? 61   LYS C CD  1 
ATOM   9018  C CE  . LYS C 1 61  ? 0.592   -63.332 85.077  1.00 33.86 ? 61   LYS C CE  1 
ATOM   9019  N NZ  . LYS C 1 61  ? 0.392   -63.683 86.513  1.00 35.76 ? 61   LYS C NZ  1 
ATOM   9020  N N   . LEU C 1 62  ? 0.478   -57.110 81.954  1.00 23.84 ? 62   LEU C N   1 
ATOM   9021  C CA  . LEU C 1 62  ? -0.129  -55.797 81.728  1.00 23.27 ? 62   LEU C CA  1 
ATOM   9022  C C   . LEU C 1 62  ? 0.145   -55.258 80.320  1.00 22.54 ? 62   LEU C C   1 
ATOM   9023  O O   . LEU C 1 62  ? -0.612  -54.428 79.810  1.00 22.92 ? 62   LEU C O   1 
ATOM   9024  C CB  . LEU C 1 62  ? 0.314   -54.794 82.801  1.00 22.92 ? 62   LEU C CB  1 
ATOM   9025  C CG  . LEU C 1 62  ? -0.227  -55.055 84.224  1.00 22.84 ? 62   LEU C CG  1 
ATOM   9026  C CD1 . LEU C 1 62  ? 0.332   -54.070 85.220  1.00 23.89 ? 62   LEU C CD1 1 
ATOM   9027  C CD2 . LEU C 1 62  ? -1.742  -54.985 84.279  1.00 23.92 ? 62   LEU C CD2 1 
ATOM   9028  N N   . TYR C 1 63  ? 1.213   -55.752 79.690  1.00 23.03 ? 63   TYR C N   1 
ATOM   9029  C CA  . TYR C 1 63  ? 1.559   -55.348 78.324  1.00 23.21 ? 63   TYR C CA  1 
ATOM   9030  C C   . TYR C 1 63  ? 0.603   -56.001 77.323  1.00 24.30 ? 63   TYR C C   1 
ATOM   9031  O O   . TYR C 1 63  ? 0.144   -55.351 76.387  1.00 23.61 ? 63   TYR C O   1 
ATOM   9032  C CB  . TYR C 1 63  ? 3.016   -55.700 77.982  1.00 21.60 ? 63   TYR C CB  1 
ATOM   9033  C CG  . TYR C 1 63  ? 3.392   -55.421 76.537  1.00 19.96 ? 63   TYR C CG  1 
ATOM   9034  C CD1 . TYR C 1 63  ? 3.506   -54.097 76.058  1.00 19.82 ? 63   TYR C CD1 1 
ATOM   9035  C CD2 . TYR C 1 63  ? 3.576   -56.481 75.622  1.00 19.55 ? 63   TYR C CD2 1 
ATOM   9036  C CE1 . TYR C 1 63  ? 3.786   -53.840 74.700  1.00 18.48 ? 63   TYR C CE1 1 
ATOM   9037  C CE2 . TYR C 1 63  ? 3.854   -56.233 74.265  1.00 20.77 ? 63   TYR C CE2 1 
ATOM   9038  C CZ  . TYR C 1 63  ? 3.956   -54.910 73.812  1.00 19.49 ? 63   TYR C CZ  1 
ATOM   9039  O OH  . TYR C 1 63  ? 4.203   -54.662 72.485  1.00 21.41 ? 63   TYR C OH  1 
ATOM   9040  N N   . GLU C 1 64  ? 0.332   -57.293 77.512  1.00 26.31 ? 64   GLU C N   1 
ATOM   9041  C CA  . GLU C 1 64  ? -0.578  -58.036 76.632  1.00 28.61 ? 64   GLU C CA  1 
ATOM   9042  C C   . GLU C 1 64  ? -2.026  -57.580 76.830  1.00 28.46 ? 64   GLU C C   1 
ATOM   9043  O O   . GLU C 1 64  ? -2.853  -57.679 75.921  1.00 29.23 ? 64   GLU C O   1 
ATOM   9044  C CB  . GLU C 1 64  ? -0.471  -59.546 76.894  1.00 31.31 ? 64   GLU C CB  1 
ATOM   9045  C CG  . GLU C 1 64  ? 0.874   -60.194 76.518  1.00 36.12 ? 64   GLU C CG  1 
ATOM   9046  C CD  . GLU C 1 64  ? 1.112   -60.337 75.007  1.00 38.66 ? 64   GLU C CD  1 
ATOM   9047  O OE1 . GLU C 1 64  ? 0.137   -60.366 74.216  1.00 40.60 ? 64   GLU C OE1 1 
ATOM   9048  O OE2 . GLU C 1 64  ? 2.292   -60.448 74.608  1.00 41.15 ? 64   GLU C OE2 1 
ATOM   9049  N N   . GLN C 1 65  ? -2.278  -57.014 78.009  1.00 28.81 ? 65   GLN C N   1 
ATOM   9050  C CA  . GLN C 1 65  ? -3.582  -56.513 78.429  1.00 29.17 ? 65   GLN C CA  1 
ATOM   9051  C C   . GLN C 1 65  ? -3.892  -55.098 77.924  1.00 28.91 ? 65   GLN C C   1 
ATOM   9052  O O   . GLN C 1 65  ? -4.955  -54.870 77.340  1.00 28.84 ? 65   GLN C O   1 
ATOM   9053  C CB  . GLN C 1 65  ? -3.643  -56.549 79.960  1.00 31.14 ? 65   GLN C CB  1 
ATOM   9054  C CG  . GLN C 1 65  ? -5.016  -56.390 80.587  1.00 34.41 ? 65   GLN C CG  1 
ATOM   9055  C CD  . GLN C 1 65  ? -5.075  -56.879 82.018  1.00 36.38 ? 65   GLN C CD  1 
ATOM   9056  O OE1 . GLN C 1 65  ? -4.081  -56.855 82.751  1.00 37.11 ? 65   GLN C OE1 1 
ATOM   9057  N NE2 . GLN C 1 65  ? -6.252  -57.336 82.426  1.00 37.79 ? 65   GLN C NE2 1 
ATOM   9058  N N   . TYR C 1 66  ? -2.960  -54.164 78.137  1.00 28.17 ? 66   TYR C N   1 
ATOM   9059  C CA  . TYR C 1 66  ? -3.151  -52.756 77.756  1.00 27.82 ? 66   TYR C CA  1 
ATOM   9060  C C   . TYR C 1 66  ? -2.178  -52.149 76.735  1.00 27.56 ? 66   TYR C C   1 
ATOM   9061  O O   . TYR C 1 66  ? -2.271  -50.950 76.444  1.00 26.72 ? 66   TYR C O   1 
ATOM   9062  C CB  . TYR C 1 66  ? -3.136  -51.865 79.012  1.00 28.38 ? 66   TYR C CB  1 
ATOM   9063  C CG  . TYR C 1 66  ? -4.107  -52.253 80.105  1.00 28.97 ? 66   TYR C CG  1 
ATOM   9064  C CD1 . TYR C 1 66  ? -5.487  -51.974 79.989  1.00 29.59 ? 66   TYR C CD1 1 
ATOM   9065  C CD2 . TYR C 1 66  ? -3.649  -52.887 81.278  1.00 29.61 ? 66   TYR C CD2 1 
ATOM   9066  C CE1 . TYR C 1 66  ? -6.400  -52.321 81.030  1.00 30.58 ? 66   TYR C CE1 1 
ATOM   9067  C CE2 . TYR C 1 66  ? -4.546  -53.235 82.325  1.00 30.46 ? 66   TYR C CE2 1 
ATOM   9068  C CZ  . TYR C 1 66  ? -5.917  -52.949 82.189  1.00 30.72 ? 66   TYR C CZ  1 
ATOM   9069  O OH  . TYR C 1 66  ? -6.784  -53.292 83.197  1.00 32.21 ? 66   TYR C OH  1 
ATOM   9070  N N   . GLY C 1 67  ? -1.273  -52.960 76.183  1.00 27.11 ? 67   GLY C N   1 
ATOM   9071  C CA  . GLY C 1 67  ? -0.288  -52.475 75.215  1.00 27.96 ? 67   GLY C CA  1 
ATOM   9072  C C   . GLY C 1 67  ? -0.798  -51.952 73.885  1.00 28.52 ? 67   GLY C C   1 
ATOM   9073  O O   . GLY C 1 67  ? -0.195  -51.039 73.308  1.00 29.01 ? 67   GLY C O   1 
ATOM   9074  N N   . ASP C 1 68  ? -1.912  -52.512 73.409  1.00 28.88 ? 68   ASP C N   1 
ATOM   9075  C CA  . ASP C 1 68  ? -2.523  -52.111 72.139  1.00 29.87 ? 68   ASP C CA  1 
ATOM   9076  C C   . ASP C 1 68  ? -3.557  -50.991 72.278  1.00 28.96 ? 68   ASP C C   1 
ATOM   9077  O O   . ASP C 1 68  ? -4.099  -50.508 71.277  1.00 28.38 ? 68   ASP C O   1 
ATOM   9078  C CB  . ASP C 1 68  ? -3.141  -53.323 71.428  1.00 32.31 ? 68   ASP C CB  1 
ATOM   9079  C CG  . ASP C 1 68  ? -2.115  -54.151 70.667  1.00 35.41 ? 68   ASP C CG  1 
ATOM   9080  O OD1 . ASP C 1 68  ? -1.221  -53.562 70.016  1.00 37.92 ? 68   ASP C OD1 1 
ATOM   9081  O OD2 . ASP C 1 68  ? -2.210  -55.398 70.707  1.00 37.01 ? 68   ASP C OD2 1 
ATOM   9082  N N   . GLU C 1 69  ? -3.817  -50.577 73.520  1.00 27.44 ? 69   GLU C N   1 
ATOM   9083  C CA  . GLU C 1 69  ? -4.770  -49.506 73.817  1.00 27.44 ? 69   GLU C CA  1 
ATOM   9084  C C   . GLU C 1 69  ? -4.083  -48.167 73.501  1.00 26.03 ? 69   GLU C C   1 
ATOM   9085  O O   . GLU C 1 69  ? -3.014  -47.884 74.057  1.00 25.74 ? 69   GLU C O   1 
ATOM   9086  C CB  . GLU C 1 69  ? -5.182  -49.558 75.293  1.00 29.27 ? 69   GLU C CB  1 
ATOM   9087  C CG  . GLU C 1 69  ? -6.465  -48.797 75.626  1.00 34.31 ? 69   GLU C CG  1 
ATOM   9088  C CD  . GLU C 1 69  ? -6.805  -48.811 77.110  1.00 36.96 ? 69   GLU C CD  1 
ATOM   9089  O OE1 . GLU C 1 69  ? -6.600  -49.852 77.774  1.00 38.20 ? 69   GLU C OE1 1 
ATOM   9090  O OE2 . GLU C 1 69  ? -7.282  -47.773 77.618  1.00 39.85 ? 69   GLU C OE2 1 
ATOM   9091  N N   . PRO C 1 70  ? -4.665  -47.348 72.588  1.00 24.01 ? 70   PRO C N   1 
ATOM   9092  C CA  . PRO C 1 70  ? -4.064  -46.051 72.232  1.00 22.61 ? 70   PRO C CA  1 
ATOM   9093  C C   . PRO C 1 70  ? -3.974  -45.085 73.413  1.00 20.43 ? 70   PRO C C   1 
ATOM   9094  O O   . PRO C 1 70  ? -4.809  -45.130 74.320  1.00 19.50 ? 70   PRO C O   1 
ATOM   9095  C CB  . PRO C 1 70  ? -4.984  -45.532 71.124  1.00 23.44 ? 70   PRO C CB  1 
ATOM   9096  C CG  . PRO C 1 70  ? -6.299  -46.163 71.428  1.00 25.04 ? 70   PRO C CG  1 
ATOM   9097  C CD  . PRO C 1 70  ? -5.910  -47.563 71.819  1.00 24.67 ? 70   PRO C CD  1 
ATOM   9098  N N   . ILE C 1 71  ? -2.943  -44.240 73.403  1.00 18.08 ? 71   ILE C N   1 
ATOM   9099  C CA  . ILE C 1 71  ? -2.697  -43.269 74.474  1.00 17.92 ? 71   ILE C CA  1 
ATOM   9100  C C   . ILE C 1 71  ? -3.876  -42.333 74.755  1.00 17.86 ? 71   ILE C C   1 
ATOM   9101  O O   . ILE C 1 71  ? -4.177  -42.056 75.920  1.00 17.13 ? 71   ILE C O   1 
ATOM   9102  C CB  . ILE C 1 71  ? -1.432  -42.412 74.195  1.00 16.35 ? 71   ILE C CB  1 
ATOM   9103  C CG1 . ILE C 1 71  ? -0.225  -43.313 73.939  1.00 18.04 ? 71   ILE C CG1 1 
ATOM   9104  C CG2 . ILE C 1 71  ? -1.133  -41.500 75.397  1.00 15.74 ? 71   ILE C CG2 1 
ATOM   9105  C CD1 . ILE C 1 71  ? 1.048   -42.565 73.622  1.00 16.79 ? 71   ILE C CD1 1 
ATOM   9106  N N   . LYS C 1 72  ? -4.563  -41.910 73.691  1.00 19.92 ? 72   LYS C N   1 
ATOM   9107  C CA  . LYS C 1 72  ? -5.711  -41.003 73.796  1.00 21.84 ? 72   LYS C CA  1 
ATOM   9108  C C   . LYS C 1 72  ? -6.859  -41.534 74.658  1.00 22.32 ? 72   LYS C C   1 
ATOM   9109  O O   . LYS C 1 72  ? -7.610  -40.750 75.229  1.00 22.20 ? 72   LYS C O   1 
ATOM   9110  C CB  . LYS C 1 72  ? -6.228  -40.593 72.405  1.00 24.08 ? 72   LYS C CB  1 
ATOM   9111  C CG  . LYS C 1 72  ? -6.801  -41.719 71.539  1.00 26.83 ? 72   LYS C CG  1 
ATOM   9112  C CD  . LYS C 1 72  ? -7.626  -41.172 70.371  1.00 29.05 ? 72   LYS C CD  1 
ATOM   9113  C CE  . LYS C 1 72  ? -6.748  -40.600 69.265  1.00 30.27 ? 72   LYS C CE  1 
ATOM   9114  N NZ  . LYS C 1 72  ? -7.452  -39.562 68.457  1.00 31.87 ? 72   LYS C NZ  1 
ATOM   9115  N N   . LYS C 1 73  ? -6.945  -42.860 74.785  1.00 23.03 ? 73   LYS C N   1 
ATOM   9116  C CA  . LYS C 1 73  ? -7.977  -43.498 75.598  1.00 23.80 ? 73   LYS C CA  1 
ATOM   9117  C C   . LYS C 1 73  ? -7.798  -43.303 77.095  1.00 22.91 ? 73   LYS C C   1 
ATOM   9118  O O   . LYS C 1 73  ? -8.779  -43.234 77.833  1.00 23.86 ? 73   LYS C O   1 
ATOM   9119  C CB  . LYS C 1 73  ? -8.121  -44.985 75.267  1.00 25.67 ? 73   LYS C CB  1 
ATOM   9120  C CG  . LYS C 1 73  ? -9.567  -45.474 75.246  1.00 29.05 ? 73   LYS C CG  1 
ATOM   9121  C CD  . LYS C 1 73  ? -10.465 -44.756 76.264  1.00 31.10 ? 73   LYS C CD  1 
ATOM   9122  C CE  . LYS C 1 73  ? -11.882 -44.461 75.765  1.00 32.71 ? 73   LYS C CE  1 
ATOM   9123  N NZ  . LYS C 1 73  ? -12.758 -43.929 76.831  1.00 33.75 ? 73   LYS C NZ  1 
ATOM   9124  N N   . HIS C 1 74  ? -6.542  -43.161 77.530  1.00 21.46 ? 74   HIS C N   1 
ATOM   9125  C CA  . HIS C 1 74  ? -6.222  -42.942 78.942  1.00 20.00 ? 74   HIS C CA  1 
ATOM   9126  C C   . HIS C 1 74  ? -6.645  -41.527 79.359  1.00 19.83 ? 74   HIS C C   1 
ATOM   9127  O O   . HIS C 1 74  ? -6.990  -41.287 80.518  1.00 20.21 ? 74   HIS C O   1 
ATOM   9128  C CB  . HIS C 1 74  ? -4.724  -43.146 79.200  1.00 21.00 ? 74   HIS C CB  1 
ATOM   9129  C CG  . HIS C 1 74  ? -4.231  -44.525 78.882  1.00 21.40 ? 74   HIS C CG  1 
ATOM   9130  N ND1 . HIS C 1 74  ? -4.914  -45.666 79.245  1.00 21.09 ? 74   HIS C ND1 1 
ATOM   9131  C CD2 . HIS C 1 74  ? -3.120  -44.944 78.230  1.00 20.80 ? 74   HIS C CD2 1 
ATOM   9132  C CE1 . HIS C 1 74  ? -4.245  -46.728 78.830  1.00 21.29 ? 74   HIS C CE1 1 
ATOM   9133  N NE2 . HIS C 1 74  ? -3.153  -46.316 78.211  1.00 21.38 ? 74   HIS C NE2 1 
ATOM   9134  N N   . PHE C 1 75  ? -6.632  -40.610 78.386  1.00 19.68 ? 75   PHE C N   1 
ATOM   9135  C CA  . PHE C 1 75  ? -7.031  -39.216 78.582  1.00 19.66 ? 75   PHE C CA  1 
ATOM   9136  C C   . PHE C 1 75  ? -8.550  -39.071 78.577  1.00 20.93 ? 75   PHE C C   1 
ATOM   9137  O O   . PHE C 1 75  ? -9.088  -38.170 79.215  1.00 22.25 ? 75   PHE C O   1 
ATOM   9138  C CB  . PHE C 1 75  ? -6.425  -38.324 77.496  1.00 18.17 ? 75   PHE C CB  1 
ATOM   9139  C CG  . PHE C 1 75  ? -4.974  -38.021 77.707  1.00 16.49 ? 75   PHE C CG  1 
ATOM   9140  C CD1 . PHE C 1 75  ? -4.588  -36.934 78.510  1.00 14.83 ? 75   PHE C CD1 1 
ATOM   9141  C CD2 . PHE C 1 75  ? -3.981  -38.824 77.118  1.00 16.32 ? 75   PHE C CD2 1 
ATOM   9142  C CE1 . PHE C 1 75  ? -3.222  -36.638 78.730  1.00 14.69 ? 75   PHE C CE1 1 
ATOM   9143  C CE2 . PHE C 1 75  ? -2.605  -38.543 77.328  1.00 15.12 ? 75   PHE C CE2 1 
ATOM   9144  C CZ  . PHE C 1 75  ? -2.229  -37.448 78.133  1.00 13.04 ? 75   PHE C CZ  1 
ATOM   9145  N N   . GLU C 1 76  ? -9.219  -39.971 77.852  1.00 23.27 ? 76   GLU C N   1 
ATOM   9146  C CA  . GLU C 1 76  ? -10.680 -39.996 77.748  1.00 25.20 ? 76   GLU C CA  1 
ATOM   9147  C C   . GLU C 1 76  ? -11.318 -40.626 78.991  1.00 26.82 ? 76   GLU C C   1 
ATOM   9148  O O   . GLU C 1 76  ? -12.455 -40.304 79.341  1.00 27.40 ? 76   GLU C O   1 
ATOM   9149  C CB  . GLU C 1 76  ? -11.109 -40.757 76.491  1.00 26.87 ? 76   GLU C CB  1 
ATOM   9150  C CG  . GLU C 1 76  ? -10.666 -40.099 75.181  1.00 29.55 ? 76   GLU C CG  1 
ATOM   9151  C CD  . GLU C 1 76  ? -10.768 -41.009 73.962  1.00 31.82 ? 76   GLU C CD  1 
ATOM   9152  O OE1 . GLU C 1 76  ? -11.177 -42.171 74.090  1.00 34.29 ? 76   GLU C OE1 1 
ATOM   9153  O OE2 . GLU C 1 76  ? -10.438 -40.550 72.851  1.00 33.23 ? 76   GLU C OE2 1 
ATOM   9154  N N   . THR C 1 77  ? -10.557 -41.488 79.670  1.00 27.51 ? 77   THR C N   1 
ATOM   9155  C CA  . THR C 1 77  ? -11.010 -42.172 80.888  1.00 28.83 ? 77   THR C CA  1 
ATOM   9156  C C   . THR C 1 77  ? -10.727 -41.316 82.132  1.00 28.59 ? 77   THR C C   1 
ATOM   9157  O O   . THR C 1 77  ? -11.557 -41.241 83.046  1.00 29.03 ? 77   THR C O   1 
ATOM   9158  C CB  . THR C 1 77  ? -10.320 -43.561 81.041  1.00 28.97 ? 77   THR C CB  1 
ATOM   9159  O OG1 . THR C 1 77  ? -10.403 -44.278 79.803  1.00 30.47 ? 77   THR C OG1 1 
ATOM   9160  C CG2 . THR C 1 77  ? -11.001 -44.401 82.127  1.00 30.62 ? 77   THR C CG2 1 
ATOM   9161  N N   . ASP C 1 78  ? -9.562  -40.667 82.145  1.00 28.00 ? 78   ASP C N   1 
ATOM   9162  C CA  . ASP C 1 78  ? -9.135  -39.820 83.258  1.00 26.91 ? 78   ASP C CA  1 
ATOM   9163  C C   . ASP C 1 78  ? -8.982  -38.373 82.782  1.00 26.89 ? 78   ASP C C   1 
ATOM   9164  O O   . ASP C 1 78  ? -8.045  -38.043 82.049  1.00 25.30 ? 78   ASP C O   1 
ATOM   9165  C CB  . ASP C 1 78  ? -7.813  -40.367 83.832  1.00 27.99 ? 78   ASP C CB  1 
ATOM   9166  C CG  . ASP C 1 78  ? -7.268  -39.553 85.012  1.00 29.09 ? 78   ASP C CG  1 
ATOM   9167  O OD1 . ASP C 1 78  ? -8.028  -38.809 85.675  1.00 31.20 ? 78   ASP C OD1 1 
ATOM   9168  O OD2 . ASP C 1 78  ? -6.052  -39.670 85.276  1.00 29.53 ? 78   ASP C OD2 1 
ATOM   9169  N N   . SER C 1 79  ? -9.891  -37.513 83.248  1.00 25.77 ? 79   SER C N   1 
ATOM   9170  C CA  . SER C 1 79  ? -9.908  -36.088 82.902  1.00 25.40 ? 79   SER C CA  1 
ATOM   9171  C C   . SER C 1 79  ? -8.819  -35.272 83.609  1.00 24.56 ? 79   SER C C   1 
ATOM   9172  O O   . SER C 1 79  ? -8.584  -34.109 83.270  1.00 24.12 ? 79   SER C O   1 
ATOM   9173  C CB  . SER C 1 79  ? -11.290 -35.495 83.193  1.00 27.00 ? 79   SER C CB  1 
ATOM   9174  O OG  . SER C 1 79  ? -11.802 -35.954 84.435  1.00 30.08 ? 79   SER C OG  1 
ATOM   9175  N N   . GLU C 1 80  ? -8.172  -35.894 84.594  1.00 23.55 ? 80   GLU C N   1 
ATOM   9176  C CA  . GLU C 1 80  ? -7.099  -35.263 85.363  1.00 23.68 ? 80   GLU C CA  1 
ATOM   9177  C C   . GLU C 1 80  ? -5.736  -35.909 85.096  1.00 21.38 ? 80   GLU C C   1 
ATOM   9178  O O   . GLU C 1 80  ? -4.796  -35.713 85.875  1.00 21.47 ? 80   GLU C O   1 
ATOM   9179  C CB  . GLU C 1 80  ? -7.411  -35.330 86.862  1.00 26.76 ? 80   GLU C CB  1 
ATOM   9180  C CG  . GLU C 1 80  ? -8.523  -34.405 87.325  1.00 31.65 ? 80   GLU C CG  1 
ATOM   9181  C CD  . GLU C 1 80  ? -8.416  -34.070 88.801  1.00 35.00 ? 80   GLU C CD  1 
ATOM   9182  O OE1 . GLU C 1 80  ? -7.331  -33.620 89.240  1.00 38.18 ? 80   GLU C OE1 1 
ATOM   9183  O OE2 . GLU C 1 80  ? -9.419  -34.252 89.526  1.00 36.81 ? 80   GLU C OE2 1 
ATOM   9184  N N   . ARG C 1 81  ? -5.616  -36.623 83.972  1.00 19.09 ? 81   ARG C N   1 
ATOM   9185  C CA  . ARG C 1 81  ? -4.375  -37.321 83.608  1.00 17.24 ? 81   ARG C CA  1 
ATOM   9186  C C   . ARG C 1 81  ? -3.133  -36.439 83.509  1.00 16.76 ? 81   ARG C C   1 
ATOM   9187  O O   . ARG C 1 81  ? -2.077  -36.807 84.029  1.00 16.78 ? 81   ARG C O   1 
ATOM   9188  C CB  . ARG C 1 81  ? -4.552  -38.146 82.327  1.00 16.13 ? 81   ARG C CB  1 
ATOM   9189  C CG  . ARG C 1 81  ? -3.306  -38.959 81.974  1.00 14.00 ? 81   ARG C CG  1 
ATOM   9190  C CD  . ARG C 1 81  ? -3.509  -39.902 80.838  1.00 15.54 ? 81   ARG C CD  1 
ATOM   9191  N NE  . ARG C 1 81  ? -2.253  -40.543 80.450  1.00 16.18 ? 81   ARG C NE  1 
ATOM   9192  C CZ  . ARG C 1 81  ? -1.744  -41.636 81.018  1.00 16.83 ? 81   ARG C CZ  1 
ATOM   9193  N NH1 . ARG C 1 81  ? -2.379  -42.242 82.016  1.00 16.95 ? 81   ARG C NH1 1 
ATOM   9194  N NH2 . ARG C 1 81  ? -0.595  -42.129 80.584  1.00 16.11 ? 81   ARG C NH2 1 
ATOM   9195  N N   . GLY C 1 82  ? -3.286  -35.267 82.890  1.00 17.56 ? 82   GLY C N   1 
ATOM   9196  C CA  . GLY C 1 82  ? -2.179  -34.330 82.734  1.00 17.73 ? 82   GLY C CA  1 
ATOM   9197  C C   . GLY C 1 82  ? -1.535  -33.916 84.046  1.00 18.91 ? 82   GLY C C   1 
ATOM   9198  O O   . GLY C 1 82  ? -0.313  -33.888 84.145  1.00 18.87 ? 82   GLY C O   1 
ATOM   9199  N N   . GLN C 1 83  ? -2.364  -33.687 85.066  1.00 19.58 ? 83   GLN C N   1 
ATOM   9200  C CA  . GLN C 1 83  ? -1.914  -33.289 86.401  1.00 20.75 ? 83   GLN C CA  1 
ATOM   9201  C C   . GLN C 1 83  ? -1.379  -34.469 87.224  1.00 19.79 ? 83   GLN C C   1 
ATOM   9202  O O   . GLN C 1 83  ? -0.357  -34.345 87.900  1.00 20.39 ? 83   GLN C O   1 
ATOM   9203  C CB  . GLN C 1 83  ? -3.062  -32.617 87.167  1.00 24.58 ? 83   GLN C CB  1 
ATOM   9204  C CG  . GLN C 1 83  ? -3.722  -31.435 86.448  1.00 30.22 ? 83   GLN C CG  1 
ATOM   9205  C CD  . GLN C 1 83  ? -3.169  -30.066 86.830  1.00 33.72 ? 83   GLN C CD  1 
ATOM   9206  O OE1 . GLN C 1 83  ? -3.753  -29.037 86.477  1.00 35.74 ? 83   GLN C OE1 1 
ATOM   9207  N NE2 . GLN C 1 83  ? -2.058  -30.042 87.564  1.00 36.35 ? 83   GLN C NE2 1 
ATOM   9208  N N   . ARG C 1 84  ? -2.059  -35.614 87.135  1.00 18.96 ? 84   ARG C N   1 
ATOM   9209  C CA  . ARG C 1 84  ? -1.684  -36.827 87.875  1.00 18.22 ? 84   ARG C CA  1 
ATOM   9210  C C   . ARG C 1 84  ? -0.411  -37.500 87.366  1.00 17.33 ? 84   ARG C C   1 
ATOM   9211  O O   . ARG C 1 84  ? 0.277   -38.205 88.116  1.00 17.26 ? 84   ARG C O   1 
ATOM   9212  C CB  . ARG C 1 84  ? -2.831  -37.843 87.859  1.00 19.84 ? 84   ARG C CB  1 
ATOM   9213  C CG  . ARG C 1 84  ? -4.071  -37.426 88.642  1.00 21.16 ? 84   ARG C CG  1 
ATOM   9214  C CD  . ARG C 1 84  ? -5.192  -38.464 88.533  1.00 23.37 ? 84   ARG C CD  1 
ATOM   9215  N NE  . ARG C 1 84  ? -4.965  -39.638 89.381  1.00 25.15 ? 84   ARG C NE  1 
ATOM   9216  C CZ  . ARG C 1 84  ? -4.787  -40.884 88.939  1.00 25.73 ? 84   ARG C CZ  1 
ATOM   9217  N NH1 . ARG C 1 84  ? -4.803  -41.157 87.639  1.00 26.25 ? 84   ARG C NH1 1 
ATOM   9218  N NH2 . ARG C 1 84  ? -4.576  -41.865 89.807  1.00 27.06 ? 84   ARG C NH2 1 
ATOM   9219  N N   . TYR C 1 85  ? -0.128  -37.308 86.079  1.00 15.81 ? 85   TYR C N   1 
ATOM   9220  C CA  . TYR C 1 85  ? 1.047   -37.888 85.445  1.00 14.31 ? 85   TYR C CA  1 
ATOM   9221  C C   . TYR C 1 85  ? 2.092   -36.834 85.094  1.00 14.71 ? 85   TYR C C   1 
ATOM   9222  O O   . TYR C 1 85  ? 2.689   -36.842 84.006  1.00 14.14 ? 85   TYR C O   1 
ATOM   9223  C CB  . TYR C 1 85  ? 0.644   -38.695 84.211  1.00 15.55 ? 85   TYR C CB  1 
ATOM   9224  C CG  . TYR C 1 85  ? 0.106   -40.077 84.476  1.00 15.76 ? 85   TYR C CG  1 
ATOM   9225  C CD1 . TYR C 1 85  ? -1.040  -40.273 85.277  1.00 18.29 ? 85   TYR C CD1 1 
ATOM   9226  C CD2 . TYR C 1 85  ? 0.749   -41.207 83.940  1.00 17.75 ? 85   TYR C CD2 1 
ATOM   9227  C CE1 . TYR C 1 85  ? -1.527  -41.565 85.543  1.00 17.46 ? 85   TYR C CE1 1 
ATOM   9228  C CE2 . TYR C 1 85  ? 0.270   -42.508 84.199  1.00 18.32 ? 85   TYR C CE2 1 
ATOM   9229  C CZ  . TYR C 1 85  ? -0.866  -42.669 85.003  1.00 18.62 ? 85   TYR C CZ  1 
ATOM   9230  O OH  . TYR C 1 85  ? -1.327  -43.918 85.280  1.00 19.94 ? 85   TYR C OH  1 
ATOM   9231  N N   . SER C 1 86  ? 2.342   -35.959 86.062  1.00 14.14 ? 86   SER C N   1 
ATOM   9232  C CA  . SER C 1 86  ? 3.319   -34.889 85.930  1.00 14.45 ? 86   SER C CA  1 
ATOM   9233  C C   . SER C 1 86  ? 3.811   -34.434 87.295  1.00 14.99 ? 86   SER C C   1 
ATOM   9234  O O   . SER C 1 86  ? 3.093   -34.561 88.284  1.00 15.53 ? 86   SER C O   1 
ATOM   9235  C CB  . SER C 1 86  ? 2.735   -33.708 85.157  1.00 15.03 ? 86   SER C CB  1 
ATOM   9236  O OG  . SER C 1 86  ? 1.684   -33.067 85.857  1.00 15.64 ? 86   SER C OG  1 
ATOM   9237  N N   . VAL C 1 87  ? 5.066   -33.979 87.351  1.00 14.90 ? 87   VAL C N   1 
ATOM   9238  C CA  . VAL C 1 87  ? 5.687   -33.502 88.595  1.00 15.63 ? 87   VAL C CA  1 
ATOM   9239  C C   . VAL C 1 87  ? 6.503   -32.225 88.347  1.00 16.05 ? 87   VAL C C   1 
ATOM   9240  O O   . VAL C 1 87  ? 7.274   -32.154 87.382  1.00 14.61 ? 87   VAL C O   1 
ATOM   9241  C CB  . VAL C 1 87  ? 6.665   -34.571 89.233  1.00 16.73 ? 87   VAL C CB  1 
ATOM   9242  C CG1 . VAL C 1 87  ? 7.142   -34.122 90.625  1.00 17.64 ? 87   VAL C CG1 1 
ATOM   9243  C CG2 . VAL C 1 87  ? 6.030   -35.953 89.331  1.00 18.11 ? 87   VAL C CG2 1 
ATOM   9244  N N   . LYS C 1 88  ? 6.322   -31.233 89.222  1.00 15.95 ? 88   LYS C N   1 
ATOM   9245  C CA  . LYS C 1 88  ? 7.062   -29.970 89.160  1.00 17.47 ? 88   LYS C CA  1 
ATOM   9246  C C   . LYS C 1 88  ? 8.044   -29.930 90.332  1.00 17.28 ? 88   LYS C C   1 
ATOM   9247  O O   . LYS C 1 88  ? 7.642   -30.060 91.492  1.00 18.58 ? 88   LYS C O   1 
ATOM   9248  C CB  . LYS C 1 88  ? 6.120   -28.754 89.229  1.00 19.14 ? 88   LYS C CB  1 
ATOM   9249  C CG  . LYS C 1 88  ? 6.849   -27.404 89.111  1.00 22.48 ? 88   LYS C CG  1 
ATOM   9250  C CD  . LYS C 1 88  ? 5.968   -26.198 89.403  1.00 25.19 ? 88   LYS C CD  1 
ATOM   9251  C CE  . LYS C 1 88  ? 5.604   -25.453 88.132  1.00 26.66 ? 88   LYS C CE  1 
ATOM   9252  N NZ  . LYS C 1 88  ? 4.909   -24.161 88.418  1.00 29.28 ? 88   LYS C NZ  1 
ATOM   9253  N N   . VAL C 1 89  ? 9.327   -29.769 90.013  1.00 16.22 ? 89   VAL C N   1 
ATOM   9254  C CA  . VAL C 1 89  ? 10.393  -29.694 91.013  1.00 16.24 ? 89   VAL C CA  1 
ATOM   9255  C C   . VAL C 1 89  ? 10.992  -28.290 90.996  1.00 16.48 ? 89   VAL C C   1 
ATOM   9256  O O   . VAL C 1 89  ? 11.563  -27.869 89.986  1.00 15.48 ? 89   VAL C O   1 
ATOM   9257  C CB  . VAL C 1 89  ? 11.544  -30.717 90.735  1.00 16.52 ? 89   VAL C CB  1 
ATOM   9258  C CG1 . VAL C 1 89  ? 12.606  -30.658 91.842  1.00 16.72 ? 89   VAL C CG1 1 
ATOM   9259  C CG2 . VAL C 1 89  ? 11.001  -32.113 90.603  1.00 17.05 ? 89   VAL C CG2 1 
ATOM   9260  N N   . SER C 1 90  ? 10.877  -27.587 92.123  1.00 16.28 ? 90   SER C N   1 
ATOM   9261  C CA  . SER C 1 90  ? 11.426  -26.238 92.272  1.00 17.07 ? 90   SER C CA  1 
ATOM   9262  C C   . SER C 1 90  ? 12.953  -26.294 92.306  1.00 17.23 ? 90   SER C C   1 
ATOM   9263  O O   . SER C 1 90  ? 13.533  -27.225 92.868  1.00 18.08 ? 90   SER C O   1 
ATOM   9264  C CB  . SER C 1 90  ? 10.912  -25.596 93.565  1.00 18.34 ? 90   SER C CB  1 
ATOM   9265  O OG  . SER C 1 90  ? 11.626  -24.408 93.873  1.00 20.76 ? 90   SER C OG  1 
ATOM   9266  N N   . LEU C 1 91  ? 13.597  -25.310 91.679  1.00 17.28 ? 91   LEU C N   1 
ATOM   9267  C CA  . LEU C 1 91  ? 15.056  -25.262 91.666  1.00 17.58 ? 91   LEU C CA  1 
ATOM   9268  C C   . LEU C 1 91  ? 15.667  -24.488 92.830  1.00 18.00 ? 91   LEU C C   1 
ATOM   9269  O O   . LEU C 1 91  ? 16.888  -24.440 92.970  1.00 17.44 ? 91   LEU C O   1 
ATOM   9270  C CB  . LEU C 1 91  ? 15.583  -24.761 90.320  1.00 17.82 ? 91   LEU C CB  1 
ATOM   9271  C CG  . LEU C 1 91  ? 15.169  -25.601 89.110  1.00 18.19 ? 91   LEU C CG  1 
ATOM   9272  C CD1 . LEU C 1 91  ? 15.903  -25.112 87.894  1.00 18.67 ? 91   LEU C CD1 1 
ATOM   9273  C CD2 . LEU C 1 91  ? 15.376  -27.096 89.326  1.00 18.27 ? 91   LEU C CD2 1 
ATOM   9274  N N   . GLY C 1 92  ? 14.801  -23.912 93.668  1.00 19.75 ? 92   GLY C N   1 
ATOM   9275  C CA  . GLY C 1 92  ? 15.228  -23.169 94.845  1.00 21.19 ? 92   GLY C CA  1 
ATOM   9276  C C   . GLY C 1 92  ? 15.812  -21.782 94.642  1.00 22.25 ? 92   GLY C C   1 
ATOM   9277  O O   . GLY C 1 92  ? 16.360  -21.203 95.586  1.00 23.56 ? 92   GLY C O   1 
ATOM   9278  N N   . SER C 1 93  ? 15.695  -21.249 93.427  1.00 21.80 ? 93   SER C N   1 
ATOM   9279  C CA  . SER C 1 93  ? 16.217  -19.922 93.107  1.00 22.63 ? 93   SER C CA  1 
ATOM   9280  C C   . SER C 1 93  ? 15.174  -18.819 93.233  1.00 22.69 ? 93   SER C C   1 
ATOM   9281  O O   . SER C 1 93  ? 13.968  -19.084 93.215  1.00 23.01 ? 93   SER C O   1 
ATOM   9282  C CB  . SER C 1 93  ? 16.845  -19.908 91.709  1.00 23.14 ? 93   SER C CB  1 
ATOM   9283  O OG  . SER C 1 93  ? 16.062  -20.635 90.777  1.00 24.65 ? 93   SER C OG  1 
ATOM   9284  N N   . LYS C 1 94  ? 15.662  -17.583 93.339  1.00 23.21 ? 94   LYS C N   1 
ATOM   9285  C CA  . LYS C 1 94  ? 14.836  -16.378 93.484  1.00 23.56 ? 94   LYS C CA  1 
ATOM   9286  C C   . LYS C 1 94  ? 13.939  -16.061 92.282  1.00 22.45 ? 94   LYS C C   1 
ATOM   9287  O O   . LYS C 1 94  ? 12.904  -15.402 92.431  1.00 22.43 ? 94   LYS C O   1 
ATOM   9288  C CB  . LYS C 1 94  ? 15.724  -15.167 93.815  1.00 25.93 ? 94   LYS C CB  1 
ATOM   9289  C CG  . LYS C 1 94  ? 16.130  -15.036 95.291  1.00 30.29 ? 94   LYS C CG  1 
ATOM   9290  C CD  . LYS C 1 94  ? 17.165  -16.069 95.745  1.00 32.93 ? 94   LYS C CD  1 
ATOM   9291  C CE  . LYS C 1 94  ? 18.496  -15.424 96.123  1.00 34.78 ? 94   LYS C CE  1 
ATOM   9292  N NZ  . LYS C 1 94  ? 18.327  -14.294 97.080  1.00 36.61 ? 94   LYS C NZ  1 
ATOM   9293  N N   . ASP C 1 95  ? 14.320  -16.565 91.106  1.00 21.36 ? 95   ASP C N   1 
ATOM   9294  C CA  . ASP C 1 95  ? 13.554  -16.360 89.869  1.00 20.38 ? 95   ASP C CA  1 
ATOM   9295  C C   . ASP C 1 95  ? 12.390  -17.358 89.737  1.00 19.91 ? 95   ASP C C   1 
ATOM   9296  O O   . ASP C 1 95  ? 11.663  -17.353 88.739  1.00 20.02 ? 95   ASP C O   1 
ATOM   9297  C CB  . ASP C 1 95  ? 14.485  -16.424 88.635  1.00 19.98 ? 95   ASP C CB  1 
ATOM   9298  C CG  . ASP C 1 95  ? 15.126  -17.805 88.416  1.00 20.20 ? 95   ASP C CG  1 
ATOM   9299  O OD1 . ASP C 1 95  ? 14.989  -18.696 89.276  1.00 18.58 ? 95   ASP C OD1 1 
ATOM   9300  O OD2 . ASP C 1 95  ? 15.760  -18.001 87.356  1.00 18.93 ? 95   ASP C OD2 1 
ATOM   9301  N N   . GLU C 1 96  ? 12.256  -18.219 90.753  1.00 20.22 ? 96   GLU C N   1 
ATOM   9302  C CA  . GLU C 1 96  ? 11.232  -19.269 90.852  1.00 20.36 ? 96   GLU C CA  1 
ATOM   9303  C C   . GLU C 1 96  ? 11.282  -20.291 89.707  1.00 17.75 ? 96   GLU C C   1 
ATOM   9304  O O   . GLU C 1 96  ? 10.252  -20.819 89.272  1.00 18.03 ? 96   GLU C O   1 
ATOM   9305  C CB  . GLU C 1 96  ? 9.818   -18.676 91.027  1.00 23.92 ? 96   GLU C CB  1 
ATOM   9306  C CG  . GLU C 1 96  ? 9.591   -17.961 92.363  1.00 29.06 ? 96   GLU C CG  1 
ATOM   9307  C CD  . GLU C 1 96  ? 8.251   -17.239 92.444  1.00 31.94 ? 96   GLU C CD  1 
ATOM   9308  O OE1 . GLU C 1 96  ? 7.602   -17.025 91.396  1.00 34.20 ? 96   GLU C OE1 1 
ATOM   9309  O OE2 . GLU C 1 96  ? 7.852   -16.869 93.570  1.00 34.28 ? 96   GLU C OE2 1 
ATOM   9310  N N   . ASN C 1 97  ? 12.503  -20.588 89.252  1.00 16.57 ? 97   ASN C N   1 
ATOM   9311  C CA  . ASN C 1 97  ? 12.735  -21.550 88.170  1.00 14.85 ? 97   ASN C CA  1 
ATOM   9312  C C   . ASN C 1 97  ? 12.379  -22.960 88.644  1.00 15.42 ? 97   ASN C C   1 
ATOM   9313  O O   . ASN C 1 97  ? 12.411  -23.251 89.849  1.00 15.12 ? 97   ASN C O   1 
ATOM   9314  C CB  . ASN C 1 97  ? 14.199  -21.498 87.700  1.00 14.56 ? 97   ASN C CB  1 
ATOM   9315  C CG  . ASN C 1 97  ? 14.371  -21.877 86.224  1.00 13.22 ? 97   ASN C CG  1 
ATOM   9316  O OD1 . ASN C 1 97  ? 13.454  -22.380 85.578  1.00 12.53 ? 97   ASN C OD1 1 
ATOM   9317  N ND2 . ASN C 1 97  ? 15.560  -21.632 85.692  1.00 12.19 ? 97   ASN C ND2 1 
ATOM   9318  N N   . PHE C 1 98  ? 12.025  -23.821 87.692  1.00 14.48 ? 98   PHE C N   1 
ATOM   9319  C CA  . PHE C 1 98  ? 11.621  -25.192 87.984  1.00 14.97 ? 98   PHE C CA  1 
ATOM   9320  C C   . PHE C 1 98  ? 11.949  -26.153 86.845  1.00 14.99 ? 98   PHE C C   1 
ATOM   9321  O O   . PHE C 1 98  ? 12.314  -25.724 85.755  1.00 14.31 ? 98   PHE C O   1 
ATOM   9322  C CB  . PHE C 1 98  ? 10.109  -25.246 88.283  1.00 15.30 ? 98   PHE C CB  1 
ATOM   9323  C CG  . PHE C 1 98  ? 9.238   -24.718 87.163  1.00 14.57 ? 98   PHE C CG  1 
ATOM   9324  C CD1 . PHE C 1 98  ? 8.889   -25.540 86.066  1.00 15.19 ? 98   PHE C CD1 1 
ATOM   9325  C CD2 . PHE C 1 98  ? 8.806   -23.383 87.170  1.00 17.39 ? 98   PHE C CD2 1 
ATOM   9326  C CE1 . PHE C 1 98  ? 8.130   -25.038 84.988  1.00 15.24 ? 98   PHE C CE1 1 
ATOM   9327  C CE2 . PHE C 1 98  ? 8.046   -22.870 86.101  1.00 17.04 ? 98   PHE C CE2 1 
ATOM   9328  C CZ  . PHE C 1 98  ? 7.709   -23.698 85.005  1.00 16.70 ? 98   PHE C CZ  1 
ATOM   9329  N N   . LEU C 1 99  ? 11.753  -27.441 87.112  1.00 14.97 ? 99   LEU C N   1 
ATOM   9330  C CA  . LEU C 1 99  ? 11.920  -28.510 86.130  1.00 16.01 ? 99   LEU C CA  1 
ATOM   9331  C C   . LEU C 1 99  ? 10.592  -29.271 86.219  1.00 16.20 ? 99   LEU C C   1 
ATOM   9332  O O   . LEU C 1 99  ? 10.257  -29.826 87.271  1.00 17.37 ? 99   LEU C O   1 
ATOM   9333  C CB  . LEU C 1 99  ? 13.118  -29.413 86.471  1.00 19.04 ? 99   LEU C CB  1 
ATOM   9334  C CG  . LEU C 1 99  ? 13.424  -30.662 85.619  1.00 21.38 ? 99   LEU C CG  1 
ATOM   9335  C CD1 . LEU C 1 99  ? 13.469  -30.352 84.123  1.00 22.97 ? 99   LEU C CD1 1 
ATOM   9336  C CD2 . LEU C 1 99  ? 14.747  -31.256 86.066  1.00 21.72 ? 99   LEU C CD2 1 
ATOM   9337  N N   . PHE C 1 100 ? 9.814   -29.215 85.138  1.00 14.20 ? 100  PHE C N   1 
ATOM   9338  C CA  . PHE C 1 100 ? 8.505   -29.869 85.063  1.00 14.39 ? 100  PHE C CA  1 
ATOM   9339  C C   . PHE C 1 100 ? 8.527   -31.031 84.081  1.00 14.46 ? 100  PHE C C   1 
ATOM   9340  O O   . PHE C 1 100 ? 8.784   -30.835 82.896  1.00 15.65 ? 100  PHE C O   1 
ATOM   9341  C CB  . PHE C 1 100 ? 7.435   -28.834 84.644  1.00 13.92 ? 100  PHE C CB  1 
ATOM   9342  C CG  . PHE C 1 100 ? 6.026   -29.387 84.514  1.00 15.43 ? 100  PHE C CG  1 
ATOM   9343  C CD1 . PHE C 1 100 ? 5.265   -29.697 85.658  1.00 15.80 ? 100  PHE C CD1 1 
ATOM   9344  C CD2 . PHE C 1 100 ? 5.436   -29.546 83.244  1.00 15.36 ? 100  PHE C CD2 1 
ATOM   9345  C CE1 . PHE C 1 100 ? 3.924   -30.155 85.545  1.00 17.32 ? 100  PHE C CE1 1 
ATOM   9346  C CE2 . PHE C 1 100 ? 4.093   -30.004 83.108  1.00 15.68 ? 100  PHE C CE2 1 
ATOM   9347  C CZ  . PHE C 1 100 ? 3.337   -30.306 84.259  1.00 17.26 ? 100  PHE C CZ  1 
ATOM   9348  N N   . LEU C 1 101 ? 8.239   -32.230 84.582  1.00 12.68 ? 101  LEU C N   1 
ATOM   9349  C CA  . LEU C 1 101 ? 8.177   -33.421 83.742  1.00 12.28 ? 101  LEU C CA  1 
ATOM   9350  C C   . LEU C 1 101 ? 6.725   -33.838 83.563  1.00 13.35 ? 101  LEU C C   1 
ATOM   9351  O O   . LEU C 1 101 ? 6.019   -34.040 84.541  1.00 14.53 ? 101  LEU C O   1 
ATOM   9352  C CB  . LEU C 1 101 ? 8.972   -34.598 84.350  1.00 13.18 ? 101  LEU C CB  1 
ATOM   9353  C CG  . LEU C 1 101 ? 8.643   -36.024 83.845  1.00 14.95 ? 101  LEU C CG  1 
ATOM   9354  C CD1 . LEU C 1 101 ? 8.967   -36.196 82.362  1.00 17.08 ? 101  LEU C CD1 1 
ATOM   9355  C CD2 . LEU C 1 101 ? 9.349   -37.077 84.667  1.00 17.13 ? 101  LEU C CD2 1 
ATOM   9356  N N   . ASP C 1 102 ? 6.306   -33.953 82.304  1.00 12.27 ? 102  ASP C N   1 
ATOM   9357  C CA  . ASP C 1 102 ? 4.975   -34.417 81.944  1.00 11.66 ? 102  ASP C CA  1 
ATOM   9358  C C   . ASP C 1 102 ? 5.231   -35.722 81.185  1.00 12.25 ? 102  ASP C C   1 
ATOM   9359  O O   . ASP C 1 102 ? 5.772   -35.705 80.079  1.00 12.23 ? 102  ASP C O   1 
ATOM   9360  C CB  . ASP C 1 102 ? 4.248   -33.384 81.056  1.00 12.03 ? 102  ASP C CB  1 
ATOM   9361  C CG  . ASP C 1 102 ? 2.834   -33.824 80.643  1.00 13.96 ? 102  ASP C CG  1 
ATOM   9362  O OD1 . ASP C 1 102 ? 2.587   -35.037 80.478  1.00 14.75 ? 102  ASP C OD1 1 
ATOM   9363  O OD2 . ASP C 1 102 ? 1.967   -32.953 80.443  1.00 14.61 ? 102  ASP C OD2 1 
ATOM   9364  N N   . TYR C 1 103 ? 4.858   -36.845 81.800  1.00 11.90 ? 103  TYR C N   1 
ATOM   9365  C CA  . TYR C 1 103 ? 5.034   -38.163 81.187  1.00 12.14 ? 103  TYR C CA  1 
ATOM   9366  C C   . TYR C 1 103 ? 3.686   -38.824 80.863  1.00 12.92 ? 103  TYR C C   1 
ATOM   9367  O O   . TYR C 1 103 ? 3.606   -40.044 80.679  1.00 13.03 ? 103  TYR C O   1 
ATOM   9368  C CB  . TYR C 1 103 ? 5.921   -39.069 82.078  1.00 12.94 ? 103  TYR C CB  1 
ATOM   9369  C CG  . TYR C 1 103 ? 5.386   -39.347 83.474  1.00 13.07 ? 103  TYR C CG  1 
ATOM   9370  C CD1 . TYR C 1 103 ? 5.553   -38.411 84.516  1.00 14.48 ? 103  TYR C CD1 1 
ATOM   9371  C CD2 . TYR C 1 103 ? 4.681   -40.538 83.752  1.00 13.28 ? 103  TYR C CD2 1 
ATOM   9372  C CE1 . TYR C 1 103 ? 5.020   -38.650 85.809  1.00 14.86 ? 103  TYR C CE1 1 
ATOM   9373  C CE2 . TYR C 1 103 ? 4.141   -40.787 85.040  1.00 14.71 ? 103  TYR C CE2 1 
ATOM   9374  C CZ  . TYR C 1 103 ? 4.312   -39.839 86.053  1.00 14.81 ? 103  TYR C CZ  1 
ATOM   9375  O OH  . TYR C 1 103 ? 3.733   -40.050 87.277  1.00 16.67 ? 103  TYR C OH  1 
ATOM   9376  N N   . SER C 1 104 ? 2.645   -37.999 80.748  1.00 11.98 ? 104  SER C N   1 
ATOM   9377  C CA  . SER C 1 104 ? 1.285   -38.468 80.469  1.00 12.36 ? 104  SER C CA  1 
ATOM   9378  C C   . SER C 1 104 ? 1.006   -39.013 79.080  1.00 12.88 ? 104  SER C C   1 
ATOM   9379  O O   . SER C 1 104 ? 0.101   -39.834 78.908  1.00 13.30 ? 104  SER C O   1 
ATOM   9380  C CB  . SER C 1 104 ? 0.268   -37.380 80.814  1.00 13.56 ? 104  SER C CB  1 
ATOM   9381  O OG  . SER C 1 104 ? 0.386   -36.273 79.948  1.00 14.35 ? 104  SER C OG  1 
ATOM   9382  N N   . LYS C 1 105 ? 1.754   -38.541 78.085  1.00 12.37 ? 105  LYS C N   1 
ATOM   9383  C CA  . LYS C 1 105 ? 1.574   -39.015 76.717  1.00 12.20 ? 105  LYS C CA  1 
ATOM   9384  C C   . LYS C 1 105 ? 2.355   -40.320 76.561  1.00 13.16 ? 105  LYS C C   1 
ATOM   9385  O O   . LYS C 1 105 ? 3.394   -40.383 75.907  1.00 13.13 ? 105  LYS C O   1 
ATOM   9386  C CB  . LYS C 1 105 ? 1.999   -37.946 75.707  1.00 11.95 ? 105  LYS C CB  1 
ATOM   9387  C CG  . LYS C 1 105 ? 1.219   -36.644 75.842  1.00 12.27 ? 105  LYS C CG  1 
ATOM   9388  C CD  . LYS C 1 105 ? 1.375   -35.792 74.597  1.00 11.05 ? 105  LYS C CD  1 
ATOM   9389  C CE  . LYS C 1 105 ? 0.760   -34.408 74.753  1.00 12.84 ? 105  LYS C CE  1 
ATOM   9390  N NZ  . LYS C 1 105 ? 1.602   -33.500 75.584  1.00 15.56 ? 105  LYS C NZ  1 
ATOM   9391  N N   . SER C 1 106 ? 1.826   -41.355 77.216  1.00 13.83 ? 106  SER C N   1 
ATOM   9392  C CA  . SER C 1 106 ? 2.415   -42.689 77.248  1.00 14.08 ? 106  SER C CA  1 
ATOM   9393  C C   . SER C 1 106 ? 1.336   -43.759 77.400  1.00 14.28 ? 106  SER C C   1 
ATOM   9394  O O   . SER C 1 106 ? 0.224   -43.464 77.844  1.00 14.09 ? 106  SER C O   1 
ATOM   9395  C CB  . SER C 1 106 ? 3.394   -42.788 78.423  1.00 15.18 ? 106  SER C CB  1 
ATOM   9396  O OG  . SER C 1 106 ? 2.745   -42.474 79.649  1.00 16.72 ? 106  SER C OG  1 
ATOM   9397  N N   . HIS C 1 107 ? 1.691   -44.999 77.051  1.00 14.62 ? 107  HIS C N   1 
ATOM   9398  C CA  . HIS C 1 107 ? 0.792   -46.161 77.150  1.00 15.51 ? 107  HIS C CA  1 
ATOM   9399  C C   . HIS C 1 107 ? 0.874   -46.715 78.581  1.00 15.87 ? 107  HIS C C   1 
ATOM   9400  O O   . HIS C 1 107 ? 1.196   -47.893 78.798  1.00 16.49 ? 107  HIS C O   1 
ATOM   9401  C CB  . HIS C 1 107 ? 1.234   -47.264 76.183  1.00 15.27 ? 107  HIS C CB  1 
ATOM   9402  C CG  . HIS C 1 107 ? 1.205   -46.879 74.738  1.00 15.53 ? 107  HIS C CG  1 
ATOM   9403  N ND1 . HIS C 1 107 ? 2.268   -46.264 74.112  1.00 15.81 ? 107  HIS C ND1 1 
ATOM   9404  C CD2 . HIS C 1 107 ? 0.281   -47.104 73.776  1.00 16.52 ? 107  HIS C CD2 1 
ATOM   9405  C CE1 . HIS C 1 107 ? 2.002   -46.133 72.826  1.00 15.41 ? 107  HIS C CE1 1 
ATOM   9406  N NE2 . HIS C 1 107 ? 0.801   -46.634 72.595  1.00 16.82 ? 107  HIS C NE2 1 
ATOM   9407  N N   . ILE C 1 108 ? 0.624   -45.845 79.558  1.00 15.51 ? 108  ILE C N   1 
ATOM   9408  C CA  . ILE C 1 108 ? 0.711   -46.198 80.972  1.00 16.90 ? 108  ILE C CA  1 
ATOM   9409  C C   . ILE C 1 108 ? -0.549  -45.808 81.746  1.00 18.27 ? 108  ILE C C   1 
ATOM   9410  O O   . ILE C 1 108 ? -0.927  -44.638 81.765  1.00 18.70 ? 108  ILE C O   1 
ATOM   9411  C CB  . ILE C 1 108 ? 1.973   -45.504 81.645  1.00 16.22 ? 108  ILE C CB  1 
ATOM   9412  C CG1 . ILE C 1 108 ? 3.275   -45.991 80.994  1.00 16.40 ? 108  ILE C CG1 1 
ATOM   9413  C CG2 . ILE C 1 108 ? 2.049   -45.802 83.151  1.00 16.38 ? 108  ILE C CG2 1 
ATOM   9414  C CD1 . ILE C 1 108 ? 4.522   -45.206 81.361  1.00 16.08 ? 108  ILE C CD1 1 
ATOM   9415  N N   . ASN C 1 109 ? -1.206  -46.801 82.355  1.00 18.98 ? 109  ASN C N   1 
ATOM   9416  C CA  . ASN C 1 109 ? -2.375  -46.549 83.195  1.00 19.12 ? 109  ASN C CA  1 
ATOM   9417  C C   . ASN C 1 109 ? -1.934  -46.712 84.658  1.00 19.56 ? 109  ASN C C   1 
ATOM   9418  O O   . ASN C 1 109 ? -0.749  -46.972 84.909  1.00 19.35 ? 109  ASN C O   1 
ATOM   9419  C CB  . ASN C 1 109 ? -3.586  -47.439 82.820  1.00 19.14 ? 109  ASN C CB  1 
ATOM   9420  C CG  . ASN C 1 109 ? -3.299  -48.941 82.892  1.00 19.61 ? 109  ASN C CG  1 
ATOM   9421  O OD1 . ASN C 1 109 ? -2.417  -49.402 83.616  1.00 19.75 ? 109  ASN C OD1 1 
ATOM   9422  N ND2 . ASN C 1 109 ? -4.086  -49.709 82.156  1.00 20.06 ? 109  ASN C ND2 1 
ATOM   9423  N N   . ASP C 1 110 ? -2.854  -46.542 85.612  1.00 20.39 ? 110  ASP C N   1 
ATOM   9424  C CA  . ASP C 1 110 ? -2.529  -46.657 87.043  1.00 21.24 ? 110  ASP C CA  1 
ATOM   9425  C C   . ASP C 1 110 ? -1.936  -47.999 87.475  1.00 21.06 ? 110  ASP C C   1 
ATOM   9426  O O   . ASP C 1 110 ? -1.024  -48.025 88.307  1.00 20.81 ? 110  ASP C O   1 
ATOM   9427  C CB  . ASP C 1 110 ? -3.735  -46.292 87.914  1.00 23.56 ? 110  ASP C CB  1 
ATOM   9428  C CG  . ASP C 1 110 ? -3.960  -44.786 88.021  1.00 25.70 ? 110  ASP C CG  1 
ATOM   9429  O OD1 . ASP C 1 110 ? -3.090  -43.991 87.593  1.00 25.90 ? 110  ASP C OD1 1 
ATOM   9430  O OD2 . ASP C 1 110 ? -5.023  -44.390 88.549  1.00 26.90 ? 110  ASP C OD2 1 
ATOM   9431  N N   . GLU C 1 111 ? -2.400  -49.086 86.852  1.00 22.07 ? 111  GLU C N   1 
ATOM   9432  C CA  . GLU C 1 111 ? -1.915  -50.443 87.139  1.00 22.49 ? 111  GLU C CA  1 
ATOM   9433  C C   . GLU C 1 111 ? -0.469  -50.635 86.688  1.00 21.20 ? 111  GLU C C   1 
ATOM   9434  O O   . GLU C 1 111 ? 0.333   -51.242 87.400  1.00 19.98 ? 111  GLU C O   1 
ATOM   9435  C CB  . GLU C 1 111 ? -2.786  -51.495 86.455  1.00 25.62 ? 111  GLU C CB  1 
ATOM   9436  C CG  . GLU C 1 111 ? -4.115  -51.765 87.126  1.00 31.82 ? 111  GLU C CG  1 
ATOM   9437  C CD  . GLU C 1 111 ? -4.806  -52.978 86.538  1.00 33.83 ? 111  GLU C CD  1 
ATOM   9438  O OE1 . GLU C 1 111 ? -4.389  -54.113 86.854  1.00 37.41 ? 111  GLU C OE1 1 
ATOM   9439  O OE2 . GLU C 1 111 ? -5.757  -52.795 85.747  1.00 37.14 ? 111  GLU C OE2 1 
ATOM   9440  N N   . ILE C 1 112 ? -0.149  -50.099 85.508  1.00 20.06 ? 112  ILE C N   1 
ATOM   9441  C CA  . ILE C 1 112 ? 1.195   -50.179 84.935  1.00 18.93 ? 112  ILE C CA  1 
ATOM   9442  C C   . ILE C 1 112 ? 2.169   -49.308 85.736  1.00 19.29 ? 112  ILE C C   1 
ATOM   9443  O O   . ILE C 1 112 ? 3.275   -49.750 86.036  1.00 18.81 ? 112  ILE C O   1 
ATOM   9444  C CB  . ILE C 1 112 ? 1.193   -49.790 83.424  1.00 18.81 ? 112  ILE C CB  1 
ATOM   9445  C CG1 . ILE C 1 112 ? 0.372   -50.814 82.627  1.00 18.31 ? 112  ILE C CG1 1 
ATOM   9446  C CG2 . ILE C 1 112 ? 2.621   -49.740 82.864  1.00 17.67 ? 112  ILE C CG2 1 
ATOM   9447  C CD1 . ILE C 1 112 ? -0.097  -50.332 81.264  1.00 19.68 ? 112  ILE C CD1 1 
ATOM   9448  N N   . LYS C 1 113 ? 1.722   -48.107 86.123  1.00 19.26 ? 113  LYS C N   1 
ATOM   9449  C CA  . LYS C 1 113 ? 2.523   -47.160 86.912  1.00 20.12 ? 113  LYS C CA  1 
ATOM   9450  C C   . LYS C 1 113 ? 2.915   -47.772 88.254  1.00 20.32 ? 113  LYS C C   1 
ATOM   9451  O O   . LYS C 1 113 ? 4.095   -47.788 88.603  1.00 19.08 ? 113  LYS C O   1 
ATOM   9452  C CB  . LYS C 1 113 ? 1.748   -45.850 87.119  1.00 20.59 ? 113  LYS C CB  1 
ATOM   9453  C CG  . LYS C 1 113 ? 2.479   -44.771 87.919  1.00 21.49 ? 113  LYS C CG  1 
ATOM   9454  C CD  . LYS C 1 113 ? 1.753   -43.447 87.796  1.00 23.80 ? 113  LYS C CD  1 
ATOM   9455  C CE  . LYS C 1 113 ? 2.278   -42.417 88.766  1.00 25.85 ? 113  LYS C CE  1 
ATOM   9456  N NZ  . LYS C 1 113 ? 1.476   -41.163 88.671  1.00 25.42 ? 113  LYS C NZ  1 
ATOM   9457  N N   . CYS C 1 114 ? 1.931   -48.363 88.939  1.00 20.44 ? 114  CYS C N   1 
ATOM   9458  C CA  . CYS C 1 114 ? 2.146   -49.012 90.235  1.00 21.93 ? 114  CYS C CA  1 
ATOM   9459  C C   . CYS C 1 114 ? 3.075   -50.215 90.119  1.00 19.38 ? 114  CYS C C   1 
ATOM   9460  O O   . CYS C 1 114 ? 3.939   -50.407 90.972  1.00 20.22 ? 114  CYS C O   1 
ATOM   9461  C CB  . CYS C 1 114 ? 0.811   -49.441 90.857  1.00 24.42 ? 114  CYS C CB  1 
ATOM   9462  S SG  . CYS C 1 114 ? -0.098  -48.098 91.653  1.00 33.29 ? 114  CYS C SG  1 
ATOM   9463  N N   . ALA C 1 115 ? 2.940   -50.966 89.024  1.00 18.39 ? 115  ALA C N   1 
ATOM   9464  C CA  . ALA C 1 115 ? 3.771   -52.146 88.763  1.00 17.61 ? 115  ALA C CA  1 
ATOM   9465  C C   . ALA C 1 115 ? 5.220   -51.789 88.421  1.00 18.28 ? 115  ALA C C   1 
ATOM   9466  O O   . ALA C 1 115 ? 6.144   -52.531 88.773  1.00 19.17 ? 115  ALA C O   1 
ATOM   9467  C CB  . ALA C 1 115 ? 3.154   -52.995 87.679  1.00 17.43 ? 115  ALA C CB  1 
ATOM   9468  N N   . LEU C 1 116 ? 5.415   -50.644 87.759  1.00 18.68 ? 116  LEU C N   1 
ATOM   9469  C CA  . LEU C 1 116 ? 6.754   -50.154 87.409  1.00 17.36 ? 116  LEU C CA  1 
ATOM   9470  C C   . LEU C 1 116 ? 7.460   -49.684 88.685  1.00 17.67 ? 116  LEU C C   1 
ATOM   9471  O O   . LEU C 1 116 ? 8.663   -49.894 88.851  1.00 17.95 ? 116  LEU C O   1 
ATOM   9472  C CB  . LEU C 1 116 ? 6.677   -49.004 86.390  1.00 15.78 ? 116  LEU C CB  1 
ATOM   9473  C CG  . LEU C 1 116 ? 6.427   -49.340 84.913  1.00 16.10 ? 116  LEU C CG  1 
ATOM   9474  C CD1 . LEU C 1 116 ? 6.021   -48.089 84.150  1.00 13.97 ? 116  LEU C CD1 1 
ATOM   9475  C CD2 . LEU C 1 116 ? 7.653   -49.987 84.279  1.00 14.31 ? 116  LEU C CD2 1 
ATOM   9476  N N   . LEU C 1 117 ? 6.688   -49.094 89.601  1.00 18.59 ? 117  LEU C N   1 
ATOM   9477  C CA  . LEU C 1 117 ? 7.211   -48.616 90.886  1.00 19.52 ? 117  LEU C CA  1 
ATOM   9478  C C   . LEU C 1 117 ? 7.559   -49.797 91.795  1.00 20.25 ? 117  LEU C C   1 
ATOM   9479  O O   . LEU C 1 117 ? 8.543   -49.740 92.541  1.00 20.33 ? 117  LEU C O   1 
ATOM   9480  C CB  . LEU C 1 117 ? 6.210   -47.679 91.569  1.00 20.07 ? 117  LEU C CB  1 
ATOM   9481  C CG  . LEU C 1 117 ? 5.987   -46.306 90.916  1.00 21.81 ? 117  LEU C CG  1 
ATOM   9482  C CD1 . LEU C 1 117 ? 4.784   -45.629 91.548  1.00 21.97 ? 117  LEU C CD1 1 
ATOM   9483  C CD2 . LEU C 1 117 ? 7.223   -45.428 91.028  1.00 21.61 ? 117  LEU C CD2 1 
ATOM   9484  N N   . ARG C 1 118 ? 6.787   -50.884 91.672  1.00 20.85 ? 118  ARG C N   1 
ATOM   9485  C CA  . ARG C 1 118 ? 7.019   -52.112 92.443  1.00 21.69 ? 118  ARG C CA  1 
ATOM   9486  C C   . ARG C 1 118 ? 8.307   -52.793 91.975  1.00 21.02 ? 118  ARG C C   1 
ATOM   9487  O O   . ARG C 1 118 ? 9.016   -53.396 92.785  1.00 21.95 ? 118  ARG C O   1 
ATOM   9488  C CB  . ARG C 1 118 ? 5.843   -53.090 92.323  1.00 23.71 ? 118  ARG C CB  1 
ATOM   9489  C CG  . ARG C 1 118 ? 4.639   -52.750 93.188  1.00 28.12 ? 118  ARG C CG  1 
ATOM   9490  C CD  . ARG C 1 118 ? 3.680   -53.942 93.338  1.00 30.82 ? 118  ARG C CD  1 
ATOM   9491  N NE  . ARG C 1 118 ? 3.072   -54.373 92.074  1.00 33.64 ? 118  ARG C NE  1 
ATOM   9492  C CZ  . ARG C 1 118 ? 1.911   -53.923 91.593  1.00 33.85 ? 118  ARG C CZ  1 
ATOM   9493  N NH1 . ARG C 1 118 ? 1.205   -53.015 92.255  1.00 35.53 ? 118  ARG C NH1 1 
ATOM   9494  N NH2 . ARG C 1 118 ? 1.460   -54.381 90.432  1.00 34.53 ? 118  ARG C NH2 1 
ATOM   9495  N N   . LEU C 1 119 ? 8.618   -52.653 90.678  1.00 19.93 ? 119  LEU C N   1 
ATOM   9496  C CA  . LEU C 1 119 ? 9.837   -53.211 90.074  1.00 19.27 ? 119  LEU C CA  1 
ATOM   9497  C C   . LEU C 1 119 ? 11.054  -52.507 90.647  1.00 19.58 ? 119  LEU C C   1 
ATOM   9498  O O   . LEU C 1 119 ? 12.048  -53.154 90.986  1.00 20.16 ? 119  LEU C O   1 
ATOM   9499  C CB  . LEU C 1 119 ? 9.813   -53.086 88.540  1.00 19.51 ? 119  LEU C CB  1 
ATOM   9500  C CG  . LEU C 1 119 ? 11.009  -53.640 87.744  1.00 19.19 ? 119  LEU C CG  1 
ATOM   9501  C CD1 . LEU C 1 119 ? 11.071  -55.171 87.834  1.00 20.10 ? 119  LEU C CD1 1 
ATOM   9502  C CD2 . LEU C 1 119 ? 10.927  -53.189 86.299  1.00 18.82 ? 119  LEU C CD2 1 
ATOM   9503  N N   . ALA C 1 120 ? 10.930  -51.190 90.818  1.00 19.61 ? 120  ALA C N   1 
ATOM   9504  C CA  . ALA C 1 120 ? 11.988  -50.363 91.384  1.00 20.18 ? 120  ALA C CA  1 
ATOM   9505  C C   . ALA C 1 120 ? 12.261  -50.742 92.848  1.00 21.13 ? 120  ALA C C   1 
ATOM   9506  O O   . ALA C 1 120 ? 13.413  -50.753 93.285  1.00 20.97 ? 120  ALA C O   1 
ATOM   9507  C CB  . ALA C 1 120 ? 11.623  -48.884 91.269  1.00 19.75 ? 120  ALA C CB  1 
ATOM   9508  N N   . GLU C 1 121 ? 11.202  -51.126 93.564  1.00 22.61 ? 121  GLU C N   1 
ATOM   9509  C CA  . GLU C 1 121 ? 11.291  -51.543 94.967  1.00 24.83 ? 121  GLU C CA  1 
ATOM   9510  C C   . GLU C 1 121 ? 11.925  -52.939 95.081  1.00 24.87 ? 121  GLU C C   1 
ATOM   9511  O O   . GLU C 1 121 ? 12.798  -53.154 95.928  1.00 25.26 ? 121  GLU C O   1 
ATOM   9512  C CB  . GLU C 1 121 ? 9.894   -51.506 95.622  1.00 27.51 ? 121  GLU C CB  1 
ATOM   9513  C CG  . GLU C 1 121 ? 9.813   -51.888 97.118  1.00 32.09 ? 121  GLU C CG  1 
ATOM   9514  C CD  . GLU C 1 121 ? 10.586  -50.954 98.044  1.00 34.81 ? 121  GLU C CD  1 
ATOM   9515  O OE1 . GLU C 1 121 ? 10.439  -49.717 97.927  1.00 36.75 ? 121  GLU C OE1 1 
ATOM   9516  O OE2 . GLU C 1 121 ? 11.340  -51.467 98.907  1.00 37.33 ? 121  GLU C OE2 1 
ATOM   9517  N N   . GLU C 1 122 ? 11.529  -53.849 94.182  1.00 24.76 ? 122  GLU C N   1 
ATOM   9518  C CA  . GLU C 1 122 ? 12.042  -55.227 94.148  1.00 25.02 ? 122  GLU C CA  1 
ATOM   9519  C C   . GLU C 1 122 ? 13.509  -55.343 93.732  1.00 23.83 ? 122  GLU C C   1 
ATOM   9520  O O   . GLU C 1 122 ? 14.217  -56.253 94.175  1.00 23.90 ? 122  GLU C O   1 
ATOM   9521  C CB  . GLU C 1 122 ? 11.186  -56.101 93.230  1.00 27.56 ? 122  GLU C CB  1 
ATOM   9522  C CG  . GLU C 1 122 ? 9.919   -56.635 93.879  1.00 32.87 ? 122  GLU C CG  1 
ATOM   9523  C CD  . GLU C 1 122 ? 9.236   -57.700 93.038  1.00 35.38 ? 122  GLU C CD  1 
ATOM   9524  O OE1 . GLU C 1 122 ? 9.891   -58.713 92.696  1.00 37.19 ? 122  GLU C OE1 1 
ATOM   9525  O OE2 . GLU C 1 122 ? 8.039   -57.531 92.725  1.00 37.88 ? 122  GLU C OE2 1 
ATOM   9526  N N   . ARG C 1 123 ? 13.953  -54.415 92.884  1.00 22.00 ? 123  ARG C N   1 
ATOM   9527  C CA  . ARG C 1 123 ? 15.335  -54.382 92.407  1.00 21.57 ? 123  ARG C CA  1 
ATOM   9528  C C   . ARG C 1 123 ? 16.247  -53.556 93.321  1.00 20.95 ? 123  ARG C C   1 
ATOM   9529  O O   . ARG C 1 123 ? 17.443  -53.395 93.045  1.00 21.95 ? 123  ARG C O   1 
ATOM   9530  C CB  . ARG C 1 123 ? 15.389  -53.871 90.957  1.00 20.50 ? 123  ARG C CB  1 
ATOM   9531  C CG  . ARG C 1 123 ? 14.775  -54.834 89.944  1.00 21.12 ? 123  ARG C CG  1 
ATOM   9532  C CD  . ARG C 1 123 ? 15.576  -56.126 89.825  1.00 22.24 ? 123  ARG C CD  1 
ATOM   9533  N NE  . ARG C 1 123 ? 16.785  -55.956 89.019  1.00 22.31 ? 123  ARG C NE  1 
ATOM   9534  C CZ  . ARG C 1 123 ? 17.750  -56.863 88.895  1.00 23.40 ? 123  ARG C CZ  1 
ATOM   9535  N NH1 . ARG C 1 123 ? 17.677  -58.026 89.536  1.00 23.75 ? 123  ARG C NH1 1 
ATOM   9536  N NH2 . ARG C 1 123 ? 18.772  -56.626 88.084  1.00 22.93 ? 123  ARG C NH2 1 
ATOM   9537  N N   . GLY C 1 124 ? 15.659  -53.034 94.400  1.00 20.60 ? 124  GLY C N   1 
ATOM   9538  C CA  . GLY C 1 124 ? 16.382  -52.252 95.390  1.00 20.45 ? 124  GLY C CA  1 
ATOM   9539  C C   . GLY C 1 124 ? 17.029  -50.953 94.945  1.00 20.07 ? 124  GLY C C   1 
ATOM   9540  O O   . GLY C 1 124 ? 18.192  -50.711 95.277  1.00 20.93 ? 124  GLY C O   1 
ATOM   9541  N N   . ILE C 1 125 ? 16.276  -50.116 94.227  1.00 21.06 ? 125  ILE C N   1 
ATOM   9542  C CA  . ILE C 1 125 ? 16.775  -48.821 93.736  1.00 21.49 ? 125  ILE C CA  1 
ATOM   9543  C C   . ILE C 1 125 ? 17.138  -47.876 94.874  1.00 21.80 ? 125  ILE C C   1 
ATOM   9544  O O   . ILE C 1 125 ? 18.223  -47.299 94.860  1.00 21.42 ? 125  ILE C O   1 
ATOM   9545  C CB  . ILE C 1 125 ? 15.760  -48.131 92.750  1.00 21.89 ? 125  ILE C CB  1 
ATOM   9546  C CG1 . ILE C 1 125 ? 15.569  -48.981 91.487  1.00 23.34 ? 125  ILE C CG1 1 
ATOM   9547  C CG2 . ILE C 1 125 ? 16.208  -46.703 92.359  1.00 22.01 ? 125  ILE C CG2 1 
ATOM   9548  C CD1 . ILE C 1 125 ? 16.813  -49.573 90.877  1.00 25.37 ? 125  ILE C CD1 1 
ATOM   9549  N N   . ARG C 1 126 ? 16.261  -47.784 95.880  1.00 22.89 ? 126  ARG C N   1 
ATOM   9550  C CA  . ARG C 1 126 ? 16.457  -46.919 97.053  1.00 23.21 ? 126  ARG C CA  1 
ATOM   9551  C C   . ARG C 1 126 ? 17.800  -47.182 97.736  1.00 22.84 ? 126  ARG C C   1 
ATOM   9552  O O   . ARG C 1 126 ? 18.563  -46.248 97.988  1.00 22.55 ? 126  ARG C O   1 
ATOM   9553  C CB  . ARG C 1 126 ? 15.313  -47.112 98.061  1.00 25.20 ? 126  ARG C CB  1 
ATOM   9554  C CG  . ARG C 1 126 ? 15.210  -46.009 99.122  1.00 29.58 ? 126  ARG C CG  1 
ATOM   9555  C CD  . ARG C 1 126 ? 14.146  -46.311 100.174 1.00 32.82 ? 126  ARG C CD  1 
ATOM   9556  N NE  . ARG C 1 126 ? 14.703  -46.930 101.379 1.00 37.32 ? 126  ARG C NE  1 
ATOM   9557  C CZ  . ARG C 1 126 ? 14.209  -48.008 101.986 1.00 38.87 ? 126  ARG C CZ  1 
ATOM   9558  N NH1 . ARG C 1 126 ? 13.128  -48.620 101.513 1.00 40.50 ? 126  ARG C NH1 1 
ATOM   9559  N NH2 . ARG C 1 126 ? 14.801  -48.481 103.078 1.00 40.52 ? 126  ARG C NH2 1 
ATOM   9560  N N   . GLN C 1 127 ? 18.106  -48.463 97.935  1.00 23.32 ? 127  GLN C N   1 
ATOM   9561  C CA  . GLN C 1 127 ? 19.340  -48.931 98.572  1.00 24.17 ? 127  GLN C CA  1 
ATOM   9562  C C   . GLN C 1 127 ? 20.571  -48.676 97.707  1.00 23.24 ? 127  GLN C C   1 
ATOM   9563  O O   . GLN C 1 127 ? 21.625  -48.287 98.224  1.00 23.40 ? 127  GLN C O   1 
ATOM   9564  C CB  . GLN C 1 127 ? 19.250  -50.435 98.885  1.00 26.12 ? 127  GLN C CB  1 
ATOM   9565  C CG  . GLN C 1 127 ? 18.144  -50.847 99.871  1.00 29.67 ? 127  GLN C CG  1 
ATOM   9566  C CD  . GLN C 1 127 ? 16.764  -50.967 99.234  1.00 32.19 ? 127  GLN C CD  1 
ATOM   9567  O OE1 . GLN C 1 127 ? 16.566  -50.607 98.078  1.00 32.16 ? 127  GLN C OE1 1 
ATOM   9568  N NE2 . GLN C 1 127 ? 15.804  -51.497 99.987  1.00 34.54 ? 127  GLN C NE2 1 
ATOM   9569  N N   . PHE C 1 128 ? 20.421  -48.879 96.393  1.00 21.86 ? 128  PHE C N   1 
ATOM   9570  C CA  . PHE C 1 128 ? 21.502  -48.673 95.424  1.00 20.03 ? 128  PHE C CA  1 
ATOM   9571  C C   . PHE C 1 128 ? 21.911  -47.199 95.376  1.00 19.39 ? 128  PHE C C   1 
ATOM   9572  O O   . PHE C 1 128 ? 23.102  -46.892 95.347  1.00 18.97 ? 128  PHE C O   1 
ATOM   9573  C CB  . PHE C 1 128 ? 21.078  -49.158 94.026  1.00 20.96 ? 128  PHE C CB  1 
ATOM   9574  C CG  . PHE C 1 128 ? 22.188  -49.137 93.004  1.00 21.23 ? 128  PHE C CG  1 
ATOM   9575  C CD1 . PHE C 1 128 ? 23.191  -50.125 93.020  1.00 23.38 ? 128  PHE C CD1 1 
ATOM   9576  C CD2 . PHE C 1 128 ? 22.249  -48.119 92.031  1.00 22.59 ? 128  PHE C CD2 1 
ATOM   9577  C CE1 . PHE C 1 128 ? 24.251  -50.101 92.074  1.00 23.61 ? 128  PHE C CE1 1 
ATOM   9578  C CE2 . PHE C 1 128 ? 23.301  -48.078 91.077  1.00 21.88 ? 128  PHE C CE2 1 
ATOM   9579  C CZ  . PHE C 1 128 ? 24.306  -49.071 91.099  1.00 23.28 ? 128  PHE C CZ  1 
ATOM   9580  N N   . VAL C 1 129 ? 20.914  -46.312 95.399  1.00 19.96 ? 129  VAL C N   1 
ATOM   9581  C CA  . VAL C 1 129 ? 21.121  -44.858 95.368  1.00 20.01 ? 129  VAL C CA  1 
ATOM   9582  C C   . VAL C 1 129 ? 21.897  -44.390 96.598  1.00 20.71 ? 129  VAL C C   1 
ATOM   9583  O O   . VAL C 1 129 ? 22.862  -43.633 96.471  1.00 19.95 ? 129  VAL C O   1 
ATOM   9584  C CB  . VAL C 1 129 ? 19.767  -44.096 95.270  1.00 19.02 ? 129  VAL C CB  1 
ATOM   9585  C CG1 . VAL C 1 129 ? 19.967  -42.579 95.344  1.00 20.35 ? 129  VAL C CG1 1 
ATOM   9586  C CG2 . VAL C 1 129 ? 19.069  -44.464 93.978  1.00 20.17 ? 129  VAL C CG2 1 
ATOM   9587  N N   . GLN C 1 130 ? 21.498  -44.880 97.775  1.00 21.42 ? 130  GLN C N   1 
ATOM   9588  C CA  . GLN C 1 130 ? 22.165  -44.528 99.029  1.00 22.05 ? 130  GLN C CA  1 
ATOM   9589  C C   . GLN C 1 130 ? 23.615  -45.009 99.044  1.00 20.75 ? 130  GLN C C   1 
ATOM   9590  O O   . GLN C 1 130 ? 24.496  -44.300 99.530  1.00 20.47 ? 130  GLN C O   1 
ATOM   9591  C CB  . GLN C 1 130 ? 21.392  -45.068 100.241 1.00 23.85 ? 130  GLN C CB  1 
ATOM   9592  C CG  . GLN C 1 130 ? 20.027  -44.401 100.487 1.00 27.17 ? 130  GLN C CG  1 
ATOM   9593  C CD  . GLN C 1 130 ? 20.112  -42.891 100.729 1.00 29.17 ? 130  GLN C CD  1 
ATOM   9594  O OE1 . GLN C 1 130 ? 20.903  -42.419 101.552 1.00 30.04 ? 130  GLN C OE1 1 
ATOM   9595  N NE2 . GLN C 1 130 ? 19.290  -42.129 100.009 1.00 30.38 ? 130  GLN C NE2 1 
ATOM   9596  N N   . SER C 1 131 ? 23.854  -46.166 98.416  1.00 19.84 ? 131  SER C N   1 
ATOM   9597  C CA  . SER C 1 131 ? 25.189  -46.759 98.304  1.00 20.46 ? 131  SER C CA  1 
ATOM   9598  C C   . SER C 1 131 ? 26.089  -45.902 97.412  1.00 19.87 ? 131  SER C C   1 
ATOM   9599  O O   . SER C 1 131 ? 27.257  -45.676 97.736  1.00 20.55 ? 131  SER C O   1 
ATOM   9600  C CB  . SER C 1 131 ? 25.105  -48.179 97.741  1.00 21.12 ? 131  SER C CB  1 
ATOM   9601  O OG  . SER C 1 131 ? 24.596  -49.082 98.705  1.00 24.37 ? 131  SER C OG  1 
ATOM   9602  N N   . VAL C 1 132 ? 25.516  -45.388 96.320  1.00 19.17 ? 132  VAL C N   1 
ATOM   9603  C CA  . VAL C 1 132 ? 26.232  -44.525 95.371  1.00 18.19 ? 132  VAL C CA  1 
ATOM   9604  C C   . VAL C 1 132 ? 26.584  -43.195 96.050  1.00 18.01 ? 132  VAL C C   1 
ATOM   9605  O O   . VAL C 1 132 ? 27.743  -42.778 96.036  1.00 17.76 ? 132  VAL C O   1 
ATOM   9606  C CB  . VAL C 1 132 ? 25.377  -44.258 94.076  1.00 18.34 ? 132  VAL C CB  1 
ATOM   9607  C CG1 . VAL C 1 132 ? 26.045  -43.229 93.155  1.00 17.84 ? 132  VAL C CG1 1 
ATOM   9608  C CG2 . VAL C 1 132 ? 25.174  -45.546 93.306  1.00 17.99 ? 132  VAL C CG2 1 
ATOM   9609  N N   . PHE C 1 133 ? 25.588  -42.594 96.703  1.00 18.74 ? 133  PHE C N   1 
ATOM   9610  C CA  . PHE C 1 133 ? 25.733  -41.308 97.389  1.00 20.16 ? 133  PHE C CA  1 
ATOM   9611  C C   . PHE C 1 133 ? 26.703  -41.270 98.575  1.00 21.00 ? 133  PHE C C   1 
ATOM   9612  O O   . PHE C 1 133 ? 27.321  -40.231 98.830  1.00 20.79 ? 133  PHE C O   1 
ATOM   9613  C CB  . PHE C 1 133 ? 24.358  -40.766 97.814  1.00 19.33 ? 133  PHE C CB  1 
ATOM   9614  C CG  . PHE C 1 133 ? 23.603  -40.036 96.715  1.00 19.84 ? 133  PHE C CG  1 
ATOM   9615  C CD1 . PHE C 1 133 ? 23.367  -40.636 95.456  1.00 19.81 ? 133  PHE C CD1 1 
ATOM   9616  C CD2 . PHE C 1 133 ? 23.092  -38.744 96.953  1.00 20.00 ? 133  PHE C CD2 1 
ATOM   9617  C CE1 . PHE C 1 133 ? 22.628  -39.957 94.440  1.00 19.59 ? 133  PHE C CE1 1 
ATOM   9618  C CE2 . PHE C 1 133 ? 22.348  -38.048 95.952  1.00 20.05 ? 133  PHE C CE2 1 
ATOM   9619  C CZ  . PHE C 1 133 ? 22.114  -38.657 94.692  1.00 19.08 ? 133  PHE C CZ  1 
ATOM   9620  N N   . ARG C 1 134 ? 26.854  -42.397 99.278  1.00 22.03 ? 134  ARG C N   1 
ATOM   9621  C CA  . ARG C 1 134 ? 27.759  -42.453 100.431 1.00 22.96 ? 134  ARG C CA  1 
ATOM   9622  C C   . ARG C 1 134 ? 29.203  -42.848 100.081 1.00 22.69 ? 134  ARG C C   1 
ATOM   9623  O O   . ARG C 1 134 ? 30.084  -42.835 100.948 1.00 22.93 ? 134  ARG C O   1 
ATOM   9624  C CB  . ARG C 1 134 ? 27.186  -43.338 101.555 1.00 25.64 ? 134  ARG C CB  1 
ATOM   9625  C CG  . ARG C 1 134 ? 27.420  -44.840 101.420 1.00 29.56 ? 134  ARG C CG  1 
ATOM   9626  C CD  . ARG C 1 134 ? 27.025  -45.575 102.690 1.00 33.51 ? 134  ARG C CD  1 
ATOM   9627  N NE  . ARG C 1 134 ? 26.487  -46.904 102.404 1.00 36.14 ? 134  ARG C NE  1 
ATOM   9628  C CZ  . ARG C 1 134 ? 25.190  -47.187 102.292 1.00 37.44 ? 134  ARG C CZ  1 
ATOM   9629  N NH1 . ARG C 1 134 ? 24.272  -46.240 102.437 1.00 38.76 ? 134  ARG C NH1 1 
ATOM   9630  N NH2 . ARG C 1 134 ? 24.808  -48.435 102.056 1.00 38.44 ? 134  ARG C NH2 1 
ATOM   9631  N N   . GLY C 1 135 ? 29.430  -43.223 98.825  1.00 20.99 ? 135  GLY C N   1 
ATOM   9632  C CA  . GLY C 1 135 ? 30.768  -43.586 98.393  1.00 20.39 ? 135  GLY C CA  1 
ATOM   9633  C C   . GLY C 1 135 ? 31.134  -45.048 98.272  1.00 20.37 ? 135  GLY C C   1 
ATOM   9634  O O   . GLY C 1 135 ? 32.325  -45.354 98.175  1.00 20.12 ? 135  GLY C O   1 
ATOM   9635  N N   . GLU C 1 136 ? 30.147  -45.945 98.262  1.00 20.91 ? 136  GLU C N   1 
ATOM   9636  C CA  . GLU C 1 136 ? 30.431  -47.381 98.119  1.00 21.38 ? 136  GLU C CA  1 
ATOM   9637  C C   . GLU C 1 136 ? 30.885  -47.691 96.697  1.00 21.10 ? 136  GLU C C   1 
ATOM   9638  O O   . GLU C 1 136 ? 30.498  -47.001 95.741  1.00 19.75 ? 136  GLU C O   1 
ATOM   9639  C CB  . GLU C 1 136 ? 29.223  -48.245 98.485  1.00 23.53 ? 136  GLU C CB  1 
ATOM   9640  C CG  . GLU C 1 136 ? 28.765  -48.096 99.929  1.00 28.75 ? 136  GLU C CG  1 
ATOM   9641  C CD  . GLU C 1 136 ? 27.809  -49.189 100.377 1.00 32.17 ? 136  GLU C CD  1 
ATOM   9642  O OE1 . GLU C 1 136 ? 27.419  -50.042 99.552  1.00 34.87 ? 136  GLU C OE1 1 
ATOM   9643  O OE2 . GLU C 1 136 ? 27.445  -49.202 101.572 1.00 36.62 ? 136  GLU C OE2 1 
ATOM   9644  N N   . ARG C 1 137 ? 31.731  -48.710 96.578  1.00 20.55 ? 137  ARG C N   1 
ATOM   9645  C CA  . ARG C 1 137 ? 32.293  -49.130 95.298  1.00 20.49 ? 137  ARG C CA  1 
ATOM   9646  C C   . ARG C 1 137 ? 31.326  -49.948 94.440  1.00 21.41 ? 137  ARG C C   1 
ATOM   9647  O O   . ARG C 1 137 ? 31.520  -51.149 94.216  1.00 21.33 ? 137  ARG C O   1 
ATOM   9648  C CB  . ARG C 1 137 ? 33.640  -49.835 95.530  1.00 21.39 ? 137  ARG C CB  1 
ATOM   9649  C CG  . ARG C 1 137 ? 34.653  -48.915 96.204  1.00 21.78 ? 137  ARG C CG  1 
ATOM   9650  C CD  . ARG C 1 137 ? 35.983  -49.574 96.523  1.00 23.69 ? 137  ARG C CD  1 
ATOM   9651  N NE  . ARG C 1 137 ? 36.845  -48.683 97.315  1.00 25.56 ? 137  ARG C NE  1 
ATOM   9652  C CZ  . ARG C 1 137 ? 37.770  -47.867 96.801  1.00 27.28 ? 137  ARG C CZ  1 
ATOM   9653  N NH1 . ARG C 1 137 ? 37.967  -47.819 95.493  1.00 26.60 ? 137  ARG C NH1 1 
ATOM   9654  N NH2 . ARG C 1 137 ? 38.488  -47.066 97.581  1.00 28.43 ? 137  ARG C NH2 1 
ATOM   9655  N N   . VAL C 1 138 ? 30.301  -49.251 93.931  1.00 19.46 ? 138  VAL C N   1 
ATOM   9656  C CA  . VAL C 1 138 ? 29.246  -49.833 93.090  1.00 20.54 ? 138  VAL C CA  1 
ATOM   9657  C C   . VAL C 1 138 ? 29.747  -50.150 91.668  1.00 19.68 ? 138  VAL C C   1 
ATOM   9658  O O   . VAL C 1 138 ? 29.164  -50.975 90.958  1.00 21.66 ? 138  VAL C O   1 
ATOM   9659  C CB  . VAL C 1 138 ? 27.967  -48.934 93.051  1.00 21.47 ? 138  VAL C CB  1 
ATOM   9660  C CG1 . VAL C 1 138 ? 27.556  -48.503 94.450  1.00 22.97 ? 138  VAL C CG1 1 
ATOM   9661  C CG2 . VAL C 1 138 ? 28.184  -47.693 92.222  1.00 22.67 ? 138  VAL C CG2 1 
ATOM   9662  N N   . ASN C 1 139 ? 30.817  -49.468 91.254  1.00 17.99 ? 139  ASN C N   1 
ATOM   9663  C CA  . ASN C 1 139 ? 31.462  -49.733 89.960  1.00 17.29 ? 139  ASN C CA  1 
ATOM   9664  C C   . ASN C 1 139 ? 32.378  -50.928 90.293  1.00 17.01 ? 139  ASN C C   1 
ATOM   9665  O O   . ASN C 1 139 ? 33.588  -50.784 90.473  1.00 17.02 ? 139  ASN C O   1 
ATOM   9666  C CB  . ASN C 1 139 ? 32.271  -48.508 89.485  1.00 16.23 ? 139  ASN C CB  1 
ATOM   9667  C CG  . ASN C 1 139 ? 33.007  -48.747 88.156  1.00 16.74 ? 139  ASN C CG  1 
ATOM   9668  O OD1 . ASN C 1 139 ? 32.923  -49.826 87.577  1.00 16.35 ? 139  ASN C OD1 1 
ATOM   9669  N ND2 . ASN C 1 139 ? 33.738  -47.745 87.688  1.00 16.65 ? 139  ASN C ND2 1 
ATOM   9670  N N   . THR C 1 140 ? 31.747  -52.097 90.356  1.00 17.86 ? 140  THR C N   1 
ATOM   9671  C CA  . THR C 1 140 ? 32.372  -53.363 90.745  1.00 18.76 ? 140  THR C CA  1 
ATOM   9672  C C   . THR C 1 140 ? 33.487  -53.918 89.853  1.00 18.62 ? 140  THR C C   1 
ATOM   9673  O O   . THR C 1 140 ? 34.431  -54.541 90.345  1.00 19.07 ? 140  THR C O   1 
ATOM   9674  C CB  . THR C 1 140 ? 31.288  -54.463 90.899  1.00 19.24 ? 140  THR C CB  1 
ATOM   9675  O OG1 . THR C 1 140 ? 30.515  -54.516 89.698  1.00 21.40 ? 140  THR C OG1 1 
ATOM   9676  C CG2 . THR C 1 140 ? 30.335  -54.187 92.063  1.00 21.73 ? 140  THR C CG2 1 
ATOM   9677  N N   . THR C 1 141 ? 33.397  -53.685 88.545  1.00 17.89 ? 141  THR C N   1 
ATOM   9678  C CA  . THR C 1 141 ? 34.397  -54.210 87.609  1.00 17.72 ? 141  THR C CA  1 
ATOM   9679  C C   . THR C 1 141 ? 35.755  -53.512 87.729  1.00 18.13 ? 141  THR C C   1 
ATOM   9680  O O   . THR C 1 141 ? 36.806  -54.106 87.458  1.00 20.50 ? 141  THR C O   1 
ATOM   9681  C CB  . THR C 1 141 ? 33.915  -54.098 86.149  1.00 18.05 ? 141  THR C CB  1 
ATOM   9682  O OG1 . THR C 1 141 ? 33.799  -52.716 85.802  1.00 14.91 ? 141  THR C OG1 1 
ATOM   9683  C CG2 . THR C 1 141 ? 32.553  -54.747 85.961  1.00 16.63 ? 141  THR C CG2 1 
ATOM   9684  N N   . GLU C 1 142 ? 35.707  -52.239 88.113  1.00 18.32 ? 142  GLU C N   1 
ATOM   9685  C CA  . GLU C 1 142 ? 36.901  -51.418 88.296  1.00 18.42 ? 142  GLU C CA  1 
ATOM   9686  C C   . GLU C 1 142 ? 37.184  -51.160 89.782  1.00 18.44 ? 142  GLU C C   1 
ATOM   9687  O O   . GLU C 1 142 ? 38.223  -50.584 90.123  1.00 19.61 ? 142  GLU C O   1 
ATOM   9688  C CB  . GLU C 1 142 ? 36.753  -50.085 87.548  1.00 18.87 ? 142  GLU C CB  1 
ATOM   9689  C CG  . GLU C 1 142 ? 36.626  -50.219 86.031  1.00 20.00 ? 142  GLU C CG  1 
ATOM   9690  C CD  . GLU C 1 142 ? 36.560  -48.884 85.311  1.00 20.67 ? 142  GLU C CD  1 
ATOM   9691  O OE1 . GLU C 1 142 ? 35.711  -48.046 85.672  1.00 21.78 ? 142  GLU C OE1 1 
ATOM   9692  O OE2 . GLU C 1 142 ? 37.355  -48.679 84.369  1.00 23.37 ? 142  GLU C OE2 1 
ATOM   9693  N N   . ASN C 1 143 ? 36.255  -51.598 90.645  1.00 18.30 ? 143  ASN C N   1 
ATOM   9694  C CA  . ASN C 1 143 ? 36.307  -51.446 92.118  1.00 18.70 ? 143  ASN C CA  1 
ATOM   9695  C C   . ASN C 1 143 ? 36.515  -49.974 92.516  1.00 18.23 ? 143  ASN C C   1 
ATOM   9696  O O   . ASN C 1 143 ? 37.473  -49.618 93.207  1.00 18.49 ? 143  ASN C O   1 
ATOM   9697  C CB  . ASN C 1 143 ? 37.376  -52.378 92.727  1.00 19.94 ? 143  ASN C CB  1 
ATOM   9698  C CG  . ASN C 1 143 ? 37.291  -52.468 94.247  1.00 21.02 ? 143  ASN C CG  1 
ATOM   9699  O OD1 . ASN C 1 143 ? 36.201  -52.470 94.824  1.00 20.95 ? 143  ASN C OD1 1 
ATOM   9700  N ND2 . ASN C 1 143 ? 38.447  -52.511 94.899  1.00 22.59 ? 143  ASN C ND2 1 
ATOM   9701  N N   . ARG C 1 144 ? 35.620  -49.121 92.019  1.00 16.44 ? 144  ARG C N   1 
ATOM   9702  C CA  . ARG C 1 144 ? 35.699  -47.677 92.250  1.00 17.04 ? 144  ARG C CA  1 
ATOM   9703  C C   . ARG C 1 144 ? 34.389  -47.063 92.733  1.00 15.76 ? 144  ARG C C   1 
ATOM   9704  O O   . ARG C 1 144 ? 33.313  -47.601 92.453  1.00 15.78 ? 144  ARG C O   1 
ATOM   9705  C CB  . ARG C 1 144 ? 36.049  -46.959 90.932  1.00 18.53 ? 144  ARG C CB  1 
ATOM   9706  C CG  . ARG C 1 144 ? 37.427  -47.198 90.350  1.00 20.75 ? 144  ARG C CG  1 
ATOM   9707  C CD  . ARG C 1 144 ? 37.548  -46.440 89.044  1.00 24.08 ? 144  ARG C CD  1 
ATOM   9708  N NE  . ARG C 1 144 ? 38.817  -46.673 88.365  1.00 26.92 ? 144  ARG C NE  1 
ATOM   9709  C CZ  . ARG C 1 144 ? 39.131  -46.182 87.169  1.00 27.92 ? 144  ARG C CZ  1 
ATOM   9710  N NH1 . ARG C 1 144 ? 38.268  -45.419 86.504  1.00 28.45 ? 144  ARG C NH1 1 
ATOM   9711  N NH2 . ARG C 1 144 ? 40.310  -46.463 86.632  1.00 30.32 ? 144  ARG C NH2 1 
ATOM   9712  N N   . PRO C 1 145 ? 34.459  -45.958 93.523  1.00 15.04 ? 145  PRO C N   1 
ATOM   9713  C CA  . PRO C 1 145 ? 33.211  -45.326 93.973  1.00 15.26 ? 145  PRO C CA  1 
ATOM   9714  C C   . PRO C 1 145 ? 32.677  -44.534 92.764  1.00 14.13 ? 145  PRO C C   1 
ATOM   9715  O O   . PRO C 1 145 ? 33.374  -44.392 91.749  1.00 14.66 ? 145  PRO C O   1 
ATOM   9716  C CB  . PRO C 1 145 ? 33.684  -44.377 95.081  1.00 15.79 ? 145  PRO C CB  1 
ATOM   9717  C CG  . PRO C 1 145 ? 34.931  -45.021 95.584  1.00 16.87 ? 145  PRO C CG  1 
ATOM   9718  C CD  . PRO C 1 145 ? 35.595  -45.426 94.304  1.00 15.91 ? 145  PRO C CD  1 
ATOM   9719  N N   . VAL C 1 146 ? 31.427  -44.098 92.841  1.00 14.25 ? 146  VAL C N   1 
ATOM   9720  C CA  . VAL C 1 146 ? 30.795  -43.327 91.765  1.00 15.05 ? 146  VAL C CA  1 
ATOM   9721  C C   . VAL C 1 146 ? 30.284  -42.086 92.467  1.00 14.16 ? 146  VAL C C   1 
ATOM   9722  O O   . VAL C 1 146 ? 29.186  -42.070 93.035  1.00 15.26 ? 146  VAL C O   1 
ATOM   9723  C CB  . VAL C 1 146 ? 29.654  -44.130 91.109  1.00 14.79 ? 146  VAL C CB  1 
ATOM   9724  C CG1 . VAL C 1 146 ? 28.945  -43.298 90.071  1.00 14.73 ? 146  VAL C CG1 1 
ATOM   9725  C CG2 . VAL C 1 146 ? 30.220  -45.374 90.461  1.00 13.99 ? 146  VAL C CG2 1 
ATOM   9726  N N   . LEU C 1 147 ? 31.121  -41.050 92.463  1.00 15.31 ? 147  LEU C N   1 
ATOM   9727  C CA  . LEU C 1 147 ? 30.793  -39.831 93.178  1.00 14.52 ? 147  LEU C CA  1 
ATOM   9728  C C   . LEU C 1 147 ? 30.779  -38.496 92.453  1.00 14.06 ? 147  LEU C C   1 
ATOM   9729  O O   . LEU C 1 147 ? 31.335  -37.509 92.947  1.00 14.76 ? 147  LEU C O   1 
ATOM   9730  C CB  . LEU C 1 147 ? 31.654  -39.736 94.444  1.00 15.96 ? 147  LEU C CB  1 
ATOM   9731  C CG  . LEU C 1 147 ? 31.442  -40.732 95.575  1.00 16.41 ? 147  LEU C CG  1 
ATOM   9732  C CD1 . LEU C 1 147 ? 32.591  -40.623 96.533  1.00 17.40 ? 147  LEU C CD1 1 
ATOM   9733  C CD2 . LEU C 1 147 ? 30.103  -40.477 96.250  1.00 17.01 ? 147  LEU C CD2 1 
ATOM   9734  N N   . HIS C 1 148 ? 30.094  -38.437 91.311  1.00 13.72 ? 148  HIS C N   1 
ATOM   9735  C CA  . HIS C 1 148 ? 29.970  -37.166 90.603  1.00 13.17 ? 148  HIS C CA  1 
ATOM   9736  C C   . HIS C 1 148 ? 29.081  -36.218 91.414  1.00 13.58 ? 148  HIS C C   1 
ATOM   9737  O O   . HIS C 1 148 ? 29.202  -35.000 91.292  1.00 14.08 ? 148  HIS C O   1 
ATOM   9738  C CB  . HIS C 1 148 ? 29.452  -37.323 89.169  1.00 12.47 ? 148  HIS C CB  1 
ATOM   9739  C CG  . HIS C 1 148 ? 28.340  -38.311 89.024  1.00 12.84 ? 148  HIS C CG  1 
ATOM   9740  N ND1 . HIS C 1 148 ? 28.563  -39.669 88.944  1.00 13.59 ? 148  HIS C ND1 1 
ATOM   9741  C CD2 . HIS C 1 148 ? 27.001  -38.141 88.932  1.00 12.20 ? 148  HIS C CD2 1 
ATOM   9742  C CE1 . HIS C 1 148 ? 27.407  -40.292 88.809  1.00 13.40 ? 148  HIS C CE1 1 
ATOM   9743  N NE2 . HIS C 1 148 ? 26.443  -39.390 88.798  1.00 13.00 ? 148  HIS C NE2 1 
ATOM   9744  N N   . ILE C 1 149 ? 28.267  -36.788 92.310  1.00 13.86 ? 149  ILE C N   1 
ATOM   9745  C CA  . ILE C 1 149 ? 27.388  -36.003 93.183  1.00 14.25 ? 149  ILE C CA  1 
ATOM   9746  C C   . ILE C 1 149 ? 28.184  -35.215 94.233  1.00 14.31 ? 149  ILE C C   1 
ATOM   9747  O O   . ILE C 1 149 ? 27.701  -34.211 94.753  1.00 15.10 ? 149  ILE C O   1 
ATOM   9748  C CB  . ILE C 1 149 ? 26.251  -36.858 93.855  1.00 15.52 ? 149  ILE C CB  1 
ATOM   9749  C CG1 . ILE C 1 149 ? 26.811  -37.967 94.758  1.00 15.70 ? 149  ILE C CG1 1 
ATOM   9750  C CG2 . ILE C 1 149 ? 25.345  -37.447 92.791  1.00 14.58 ? 149  ILE C CG2 1 
ATOM   9751  C CD1 . ILE C 1 149 ? 26.761  -37.630 96.244  1.00 16.36 ? 149  ILE C CD1 1 
ATOM   9752  N N   . ALA C 1 150 ? 29.402  -35.685 94.527  1.00 14.65 ? 150  ALA C N   1 
ATOM   9753  C CA  . ALA C 1 150 ? 30.300  -35.036 95.490  1.00 13.66 ? 150  ALA C CA  1 
ATOM   9754  C C   . ALA C 1 150 ? 30.862  -33.733 94.930  1.00 14.13 ? 150  ALA C C   1 
ATOM   9755  O O   . ALA C 1 150 ? 31.090  -32.780 95.672  1.00 14.88 ? 150  ALA C O   1 
ATOM   9756  C CB  . ALA C 1 150 ? 31.440  -35.971 95.873  1.00 15.23 ? 150  ALA C CB  1 
ATOM   9757  N N   . LEU C 1 151 ? 31.018  -33.686 93.607  1.00 13.80 ? 151  LEU C N   1 
ATOM   9758  C CA  . LEU C 1 151 ? 31.552  -32.515 92.906  1.00 13.52 ? 151  LEU C CA  1 
ATOM   9759  C C   . LEU C 1 151 ? 30.661  -31.282 93.021  1.00 13.21 ? 151  LEU C C   1 
ATOM   9760  O O   . LEU C 1 151 ? 31.155  -30.147 93.001  1.00 13.09 ? 151  LEU C O   1 
ATOM   9761  C CB  . LEU C 1 151 ? 31.771  -32.840 91.432  1.00 13.56 ? 151  LEU C CB  1 
ATOM   9762  C CG  . LEU C 1 151 ? 32.568  -34.098 91.097  1.00 12.85 ? 151  LEU C CG  1 
ATOM   9763  C CD1 . LEU C 1 151 ? 32.425  -34.387 89.618  1.00 13.84 ? 151  LEU C CD1 1 
ATOM   9764  C CD2 . LEU C 1 151 ? 34.030  -33.949 91.497  1.00 14.37 ? 151  LEU C CD2 1 
ATOM   9765  N N   . ARG C 1 152 ? 29.361  -31.525 93.186  1.00 14.20 ? 152  ARG C N   1 
ATOM   9766  C CA  . ARG C 1 152 ? 28.359  -30.469 93.304  1.00 14.26 ? 152  ARG C CA  1 
ATOM   9767  C C   . ARG C 1 152 ? 27.636  -30.452 94.657  1.00 15.28 ? 152  ARG C C   1 
ATOM   9768  O O   . ARG C 1 152 ? 26.570  -29.852 94.787  1.00 14.55 ? 152  ARG C O   1 
ATOM   9769  C CB  . ARG C 1 152 ? 27.346  -30.589 92.155  1.00 14.52 ? 152  ARG C CB  1 
ATOM   9770  C CG  . ARG C 1 152 ? 26.492  -31.845 92.165  1.00 13.84 ? 152  ARG C CG  1 
ATOM   9771  C CD  . ARG C 1 152 ? 26.780  -32.733 90.984  1.00 14.43 ? 152  ARG C CD  1 
ATOM   9772  N NE  . ARG C 1 152 ? 25.728  -33.737 90.832  1.00 12.27 ? 152  ARG C NE  1 
ATOM   9773  C CZ  . ARG C 1 152 ? 25.591  -34.531 89.776  1.00 13.01 ? 152  ARG C CZ  1 
ATOM   9774  N NH1 . ARG C 1 152 ? 26.445  -34.458 88.762  1.00 13.53 ? 152  ARG C NH1 1 
ATOM   9775  N NH2 . ARG C 1 152 ? 24.563  -35.366 89.706  1.00 12.69 ? 152  ARG C NH2 1 
ATOM   9776  N N   . ASN C 1 153 ? 28.231  -31.097 95.660  1.00 16.50 ? 153  ASN C N   1 
ATOM   9777  C CA  . ASN C 1 153 ? 27.652  -31.175 97.006  1.00 15.99 ? 153  ASN C CA  1 
ATOM   9778  C C   . ASN C 1 153 ? 27.829  -29.840 97.756  1.00 17.51 ? 153  ASN C C   1 
ATOM   9779  O O   . ASN C 1 153 ? 28.761  -29.666 98.550  1.00 17.42 ? 153  ASN C O   1 
ATOM   9780  C CB  . ASN C 1 153 ? 28.284  -32.371 97.749  1.00 17.31 ? 153  ASN C CB  1 
ATOM   9781  C CG  . ASN C 1 153 ? 27.809  -32.521 99.192  1.00 16.90 ? 153  ASN C CG  1 
ATOM   9782  O OD1 . ASN C 1 153 ? 26.680  -32.171 99.543  1.00 19.79 ? 153  ASN C OD1 1 
ATOM   9783  N ND2 . ASN C 1 153 ? 28.689  -33.051 100.036 1.00 18.70 ? 153  ASN C ND2 1 
ATOM   9784  N N   . ARG C 1 154 ? 26.899  -28.917 97.503  1.00 17.21 ? 154  ARG C N   1 
ATOM   9785  C CA  . ARG C 1 154 ? 26.913  -27.577 98.103  1.00 19.38 ? 154  ARG C CA  1 
ATOM   9786  C C   . ARG C 1 154 ? 26.611  -27.544 99.601  1.00 20.27 ? 154  ARG C C   1 
ATOM   9787  O O   . ARG C 1 154 ? 26.963  -26.580 100.288 1.00 22.34 ? 154  ARG C O   1 
ATOM   9788  C CB  . ARG C 1 154 ? 25.958  -26.641 97.352  1.00 17.97 ? 154  ARG C CB  1 
ATOM   9789  C CG  . ARG C 1 154 ? 26.140  -26.633 95.830  1.00 18.88 ? 154  ARG C CG  1 
ATOM   9790  C CD  . ARG C 1 154 ? 27.556  -26.253 95.393  1.00 17.39 ? 154  ARG C CD  1 
ATOM   9791  N NE  . ARG C 1 154 ? 28.003  -24.946 95.896  1.00 17.99 ? 154  ARG C NE  1 
ATOM   9792  C CZ  . ARG C 1 154 ? 29.264  -24.505 95.836  1.00 19.06 ? 154  ARG C CZ  1 
ATOM   9793  N NH1 . ARG C 1 154 ? 30.209  -25.258 95.295  1.00 20.00 ? 154  ARG C NH1 1 
ATOM   9794  N NH2 . ARG C 1 154 ? 29.604  -23.311 96.309  1.00 19.48 ? 154  ARG C NH2 1 
ATOM   9795  N N   . SER C 1 155 ? 25.982  -28.603 100.110 1.00 21.89 ? 155  SER C N   1 
ATOM   9796  C CA  . SER C 1 155 ? 25.659  -28.691 101.536 1.00 22.91 ? 155  SER C CA  1 
ATOM   9797  C C   . SER C 1 155 ? 26.929  -29.021 102.316 1.00 24.08 ? 155  SER C C   1 
ATOM   9798  O O   . SER C 1 155 ? 26.996  -28.853 103.545 1.00 24.39 ? 155  SER C O   1 
ATOM   9799  C CB  . SER C 1 155 ? 24.612  -29.752 101.771 1.00 23.62 ? 155  SER C CB  1 
ATOM   9800  O OG  . SER C 1 155 ? 25.180  -31.047 101.633 1.00 24.60 ? 155  SER C OG  1 
ATOM   9801  N N   . ASN C 1 156 ? 27.924  -29.505 101.565 1.00 24.05 ? 156  ASN C N   1 
ATOM   9802  C CA  . ASN C 1 156 ? 29.246  -29.858 102.075 1.00 26.43 ? 156  ASN C CA  1 
ATOM   9803  C C   . ASN C 1 156 ? 29.208  -30.912 103.165 1.00 27.40 ? 156  ASN C C   1 
ATOM   9804  O O   . ASN C 1 156 ? 30.018  -30.892 104.100 1.00 28.35 ? 156  ASN C O   1 
ATOM   9805  C CB  . ASN C 1 156 ? 29.973  -28.607 102.604 1.00 26.70 ? 156  ASN C CB  1 
ATOM   9806  C CG  . ASN C 1 156 ? 30.631  -27.787 101.500 1.00 26.83 ? 156  ASN C CG  1 
ATOM   9807  O OD1 . ASN C 1 156 ? 31.232  -28.348 100.596 1.00 26.39 ? 156  ASN C OD1 1 
ATOM   9808  N ND2 . ASN C 1 156 ? 30.532  -26.463 101.577 1.00 27.16 ? 156  ASN C ND2 1 
ATOM   9809  N N   . ARG C 1 157 ? 28.243  -31.820 103.056 1.00 27.88 ? 157  ARG C N   1 
ATOM   9810  C CA  . ARG C 1 157 ? 28.114  -32.910 104.008 1.00 29.28 ? 157  ARG C CA  1 
ATOM   9811  C C   . ARG C 1 157 ? 29.202  -33.929 103.656 1.00 28.59 ? 157  ARG C C   1 
ATOM   9812  O O   . ARG C 1 157 ? 29.370  -34.297 102.496 1.00 28.50 ? 157  ARG C O   1 
ATOM   9813  C CB  . ARG C 1 157 ? 26.711  -33.501 103.949 1.00 31.82 ? 157  ARG C CB  1 
ATOM   9814  C CG  . ARG C 1 157 ? 25.853  -33.058 105.135 1.00 35.42 ? 157  ARG C CG  1 
ATOM   9815  C CD  . ARG C 1 157 ? 24.385  -32.842 104.772 1.00 38.39 ? 157  ARG C CD  1 
ATOM   9816  N NE  . ARG C 1 157 ? 24.146  -32.569 103.347 1.00 41.03 ? 157  ARG C NE  1 
ATOM   9817  C CZ  . ARG C 1 157 ? 22.944  -32.652 102.756 1.00 41.97 ? 157  ARG C CZ  1 
ATOM   9818  N NH1 . ARG C 1 157 ? 21.881  -32.987 103.455 1.00 43.65 ? 157  ARG C NH1 1 
ATOM   9819  N NH2 . ARG C 1 157 ? 22.777  -32.403 101.456 1.00 43.28 ? 157  ARG C NH2 1 
ATOM   9820  N N   . PRO C 1 158 ? 29.953  -34.400 104.658 1.00 27.17 ? 158  PRO C N   1 
ATOM   9821  C CA  . PRO C 1 158 ? 31.024  -35.361 104.404 1.00 26.28 ? 158  PRO C CA  1 
ATOM   9822  C C   . PRO C 1 158 ? 30.612  -36.622 103.708 1.00 25.11 ? 158  PRO C C   1 
ATOM   9823  O O   . PRO C 1 158 ? 29.568  -37.214 104.046 1.00 25.58 ? 158  PRO C O   1 
ATOM   9824  C CB  . PRO C 1 158 ? 31.603  -35.662 105.782 1.00 27.09 ? 158  PRO C CB  1 
ATOM   9825  C CG  . PRO C 1 158 ? 30.797  -34.877 106.781 1.00 28.04 ? 158  PRO C CG  1 
ATOM   9826  C CD  . PRO C 1 158 ? 29.755  -34.097 106.087 1.00 27.66 ? 158  PRO C CD  1 
ATOM   9827  N N   . ILE C 1 159 ? 31.438  -36.963 102.709 1.00 23.84 ? 159  ILE C N   1 
ATOM   9828  C CA  . ILE C 1 159 ? 31.361  -38.158 101.859 1.00 23.64 ? 159  ILE C CA  1 
ATOM   9829  C C   . ILE C 1 159 ? 32.793  -38.739 101.895 1.00 23.49 ? 159  ILE C C   1 
ATOM   9830  O O   . ILE C 1 159 ? 33.761  -38.083 101.492 1.00 23.33 ? 159  ILE C O   1 
ATOM   9831  C CB  . ILE C 1 159 ? 30.939  -37.780 100.415 1.00 23.25 ? 159  ILE C CB  1 
ATOM   9832  C CG1 . ILE C 1 159 ? 29.458  -37.409 100.350 1.00 23.23 ? 159  ILE C CG1 1 
ATOM   9833  C CG2 . ILE C 1 159 ? 31.149  -38.926 99.444  1.00 23.29 ? 159  ILE C CG2 1 
ATOM   9834  C CD1 . ILE C 1 159 ? 29.157  -36.406 99.236  1.00 23.96 ? 159  ILE C CD1 1 
ATOM   9835  N N   . TYR C 1 160 ? 32.907  -39.980 102.356 1.00 24.02 ? 160  TYR C N   1 
ATOM   9836  C CA  . TYR C 1 160 ? 34.198  -40.627 102.543 1.00 25.05 ? 160  TYR C CA  1 
ATOM   9837  C C   . TYR C 1 160 ? 34.652  -41.620 101.507 1.00 24.64 ? 160  TYR C C   1 
ATOM   9838  O O   . TYR C 1 160 ? 33.869  -42.446 101.023 1.00 25.21 ? 160  TYR C O   1 
ATOM   9839  C CB  . TYR C 1 160 ? 34.225  -41.320 103.911 1.00 26.47 ? 160  TYR C CB  1 
ATOM   9840  C CG  . TYR C 1 160 ? 33.981  -40.399 105.080 1.00 28.12 ? 160  TYR C CG  1 
ATOM   9841  C CD1 . TYR C 1 160 ? 35.059  -39.816 105.770 1.00 28.78 ? 160  TYR C CD1 1 
ATOM   9842  C CD2 . TYR C 1 160 ? 32.668  -40.089 105.495 1.00 28.69 ? 160  TYR C CD2 1 
ATOM   9843  C CE1 . TYR C 1 160 ? 34.843  -38.940 106.852 1.00 30.24 ? 160  TYR C CE1 1 
ATOM   9844  C CE2 . TYR C 1 160 ? 32.436  -39.214 106.576 1.00 30.90 ? 160  TYR C CE2 1 
ATOM   9845  C CZ  . TYR C 1 160 ? 33.532  -38.646 107.245 1.00 29.99 ? 160  TYR C CZ  1 
ATOM   9846  O OH  . TYR C 1 160 ? 33.314  -37.792 108.293 1.00 32.04 ? 160  TYR C OH  1 
ATOM   9847  N N   . VAL C 1 161 ? 35.948  -41.504 101.200 1.00 24.08 ? 161  VAL C N   1 
ATOM   9848  C CA  . VAL C 1 161 ? 36.702  -42.366 100.289 1.00 24.39 ? 161  VAL C CA  1 
ATOM   9849  C C   . VAL C 1 161 ? 38.065  -42.578 100.969 1.00 24.54 ? 161  VAL C C   1 
ATOM   9850  O O   . VAL C 1 161 ? 38.817  -41.617 101.212 1.00 23.35 ? 161  VAL C O   1 
ATOM   9851  C CB  . VAL C 1 161 ? 36.922  -41.724 98.878  1.00 23.67 ? 161  VAL C CB  1 
ATOM   9852  C CG1 . VAL C 1 161 ? 37.774  -42.615 97.979  1.00 23.37 ? 161  VAL C CG1 1 
ATOM   9853  C CG2 . VAL C 1 161 ? 35.603  -41.499 98.169  1.00 22.01 ? 161  VAL C CG2 1 
ATOM   9854  N N   . ASP C 1 162 ? 38.353  -43.845 101.284 1.00 26.28 ? 162  ASP C N   1 
ATOM   9855  C CA  . ASP C 1 162 ? 39.598  -44.274 101.939 1.00 28.24 ? 162  ASP C CA  1 
ATOM   9856  C C   . ASP C 1 162 ? 39.775  -43.658 103.335 1.00 28.99 ? 162  ASP C C   1 
ATOM   9857  O O   . ASP C 1 162 ? 40.899  -43.406 103.787 1.00 30.48 ? 162  ASP C O   1 
ATOM   9858  C CB  . ASP C 1 162 ? 40.818  -43.981 101.039 1.00 28.75 ? 162  ASP C CB  1 
ATOM   9859  C CG  . ASP C 1 162 ? 40.873  -44.881 99.795  1.00 29.30 ? 162  ASP C CG  1 
ATOM   9860  O OD1 . ASP C 1 162 ? 40.325  -46.013 99.832  1.00 31.21 ? 162  ASP C OD1 1 
ATOM   9861  O OD2 . ASP C 1 162 ? 41.472  -44.462 98.776  1.00 30.37 ? 162  ASP C OD2 1 
ATOM   9862  N N   . GLY C 1 163 ? 38.640  -43.392 103.981 1.00 29.66 ? 163  GLY C N   1 
ATOM   9863  C CA  . GLY C 1 163 ? 38.617  -42.810 105.315 1.00 29.44 ? 163  GLY C CA  1 
ATOM   9864  C C   . GLY C 1 163 ? 38.803  -41.306 105.401 1.00 29.77 ? 163  GLY C C   1 
ATOM   9865  O O   . GLY C 1 163 ? 38.920  -40.755 106.499 1.00 30.24 ? 163  GLY C O   1 
ATOM   9866  N N   . LYS C 1 164 ? 38.810  -40.642 104.246 1.00 28.05 ? 164  LYS C N   1 
ATOM   9867  C CA  . LYS C 1 164 ? 38.990  -39.199 104.183 1.00 26.67 ? 164  LYS C CA  1 
ATOM   9868  C C   . LYS C 1 164 ? 37.816  -38.551 103.458 1.00 25.33 ? 164  LYS C C   1 
ATOM   9869  O O   . LYS C 1 164 ? 37.369  -39.043 102.413 1.00 23.45 ? 164  LYS C O   1 
ATOM   9870  C CB  . LYS C 1 164 ? 40.310  -38.871 103.467 1.00 29.19 ? 164  LYS C CB  1 
ATOM   9871  C CG  . LYS C 1 164 ? 40.706  -37.388 103.452 1.00 32.28 ? 164  LYS C CG  1 
ATOM   9872  C CD  . LYS C 1 164 ? 42.025  -37.139 102.713 1.00 34.65 ? 164  LYS C CD  1 
ATOM   9873  C CE  . LYS C 1 164 ? 43.248  -37.608 103.502 1.00 36.77 ? 164  LYS C CE  1 
ATOM   9874  N NZ  . LYS C 1 164 ? 43.419  -36.879 104.792 1.00 38.73 ? 164  LYS C NZ  1 
ATOM   9875  N N   . ASP C 1 165 ? 37.319  -37.453 104.033 1.00 23.20 ? 165  ASP C N   1 
ATOM   9876  C CA  . ASP C 1 165 ? 36.219  -36.671 103.465 1.00 22.55 ? 165  ASP C CA  1 
ATOM   9877  C C   . ASP C 1 165 ? 36.773  -36.016 102.196 1.00 21.35 ? 165  ASP C C   1 
ATOM   9878  O O   . ASP C 1 165 ? 37.813  -35.357 102.233 1.00 20.77 ? 165  ASP C O   1 
ATOM   9879  C CB  . ASP C 1 165 ? 35.751  -35.607 104.477 1.00 23.07 ? 165  ASP C CB  1 
ATOM   9880  C CG  . ASP C 1 165 ? 34.591  -34.746 103.965 1.00 24.67 ? 165  ASP C CG  1 
ATOM   9881  O OD1 . ASP C 1 165 ? 34.006  -35.032 102.891 1.00 22.55 ? 165  ASP C OD1 1 
ATOM   9882  O OD2 . ASP C 1 165 ? 34.232  -33.777 104.666 1.00 24.38 ? 165  ASP C OD2 1 
ATOM   9883  N N   . VAL C 1 166 ? 36.087  -36.249 101.078 1.00 20.50 ? 166  VAL C N   1 
ATOM   9884  C CA  . VAL C 1 166 ? 36.505  -35.719 99.783  1.00 18.28 ? 166  VAL C CA  1 
ATOM   9885  C C   . VAL C 1 166 ? 36.160  -34.263 99.543  1.00 18.54 ? 166  VAL C C   1 
ATOM   9886  O O   . VAL C 1 166 ? 36.736  -33.636 98.652  1.00 17.62 ? 166  VAL C O   1 
ATOM   9887  C CB  . VAL C 1 166 ? 35.944  -36.558 98.606  1.00 18.42 ? 166  VAL C CB  1 
ATOM   9888  C CG1 . VAL C 1 166 ? 36.384  -37.984 98.739  1.00 16.92 ? 166  VAL C CG1 1 
ATOM   9889  C CG2 . VAL C 1 166 ? 34.415  -36.460 98.508  1.00 18.39 ? 166  VAL C CG2 1 
ATOM   9890  N N   . MET C 1 167 ? 35.254  -33.727 100.363 1.00 17.45 ? 167  MET C N   1 
ATOM   9891  C CA  . MET C 1 167 ? 34.818  -32.341 100.219 1.00 17.84 ? 167  MET C CA  1 
ATOM   9892  C C   . MET C 1 167 ? 35.876  -31.233 100.287 1.00 19.10 ? 167  MET C C   1 
ATOM   9893  O O   . MET C 1 167 ? 35.802  -30.302 99.483  1.00 19.76 ? 167  MET C O   1 
ATOM   9894  C CB  . MET C 1 167 ? 33.565  -32.037 101.057 1.00 17.69 ? 167  MET C CB  1 
ATOM   9895  C CG  . MET C 1 167 ? 32.322  -32.853 100.665 1.00 17.14 ? 167  MET C CG  1 
ATOM   9896  S SD  . MET C 1 167 ? 31.955  -32.958 98.868  1.00 17.25 ? 167  MET C SD  1 
ATOM   9897  C CE  . MET C 1 167 ? 31.898  -31.203 98.405  1.00 17.50 ? 167  MET C CE  1 
ATOM   9898  N N   . PRO C 1 168 ? 36.874  -31.314 101.214 1.00 19.45 ? 168  PRO C N   1 
ATOM   9899  C CA  . PRO C 1 168 ? 37.886  -30.245 101.238 1.00 19.48 ? 168  PRO C CA  1 
ATOM   9900  C C   . PRO C 1 168 ? 38.718  -30.229 99.948  1.00 18.83 ? 168  PRO C C   1 
ATOM   9901  O O   . PRO C 1 168 ? 39.072  -29.160 99.457  1.00 19.42 ? 168  PRO C O   1 
ATOM   9902  C CB  . PRO C 1 168 ? 38.746  -30.618 102.445 1.00 19.23 ? 168  PRO C CB  1 
ATOM   9903  C CG  . PRO C 1 168 ? 37.755  -31.182 103.371 1.00 19.59 ? 168  PRO C CG  1 
ATOM   9904  C CD  . PRO C 1 168 ? 36.977  -32.102 102.462 1.00 19.37 ? 168  PRO C CD  1 
ATOM   9905  N N   . ALA C 1 169 ? 38.936  -31.417 99.370  1.00 18.22 ? 169  ALA C N   1 
ATOM   9906  C CA  . ALA C 1 169 ? 39.693  -31.578 98.124  1.00 17.82 ? 169  ALA C CA  1 
ATOM   9907  C C   . ALA C 1 169 ? 38.898  -31.055 96.919  1.00 17.42 ? 169  ALA C C   1 
ATOM   9908  O O   . ALA C 1 169 ? 39.464  -30.408 96.029  1.00 17.72 ? 169  ALA C O   1 
ATOM   9909  C CB  . ALA C 1 169 ? 40.073  -33.039 97.916  1.00 18.23 ? 169  ALA C CB  1 
ATOM   9910  N N   . VAL C 1 170 ? 37.586  -31.313 96.920  1.00 17.13 ? 170  VAL C N   1 
ATOM   9911  C CA  . VAL C 1 170 ? 36.667  -30.863 95.861  1.00 16.49 ? 170  VAL C CA  1 
ATOM   9912  C C   . VAL C 1 170 ? 36.612  -29.331 95.851  1.00 16.76 ? 170  VAL C C   1 
ATOM   9913  O O   . VAL C 1 170 ? 36.770  -28.703 94.799  1.00 15.40 ? 170  VAL C O   1 
ATOM   9914  C CB  . VAL C 1 170 ? 35.230  -31.452 96.067  1.00 17.04 ? 170  VAL C CB  1 
ATOM   9915  C CG1 . VAL C 1 170 ? 34.193  -30.758 95.165  1.00 16.73 ? 170  VAL C CG1 1 
ATOM   9916  C CG2 . VAL C 1 170 ? 35.228  -32.941 95.775  1.00 16.82 ? 170  VAL C CG2 1 
ATOM   9917  N N   . ASN C 1 171 ? 36.448  -28.758 97.042  1.00 16.22 ? 171  ASN C N   1 
ATOM   9918  C CA  . ASN C 1 171 ? 36.373  -27.310 97.228  1.00 16.97 ? 171  ASN C CA  1 
ATOM   9919  C C   . ASN C 1 171 ? 37.690  -26.581 96.975  1.00 17.07 ? 171  ASN C C   1 
ATOM   9920  O O   . ASN C 1 171 ? 37.674  -25.423 96.546  1.00 17.46 ? 171  ASN C O   1 
ATOM   9921  C CB  . ASN C 1 171 ? 35.830  -26.970 98.620  1.00 17.25 ? 171  ASN C CB  1 
ATOM   9922  C CG  . ASN C 1 171 ? 34.369  -27.359 98.791  1.00 18.81 ? 171  ASN C CG  1 
ATOM   9923  O OD1 . ASN C 1 171 ? 33.595  -27.372 97.830  1.00 19.31 ? 171  ASN C OD1 1 
ATOM   9924  N ND2 . ASN C 1 171 ? 33.987  -27.683 100.020 1.00 18.78 ? 171  ASN C ND2 1 
ATOM   9925  N N   . LYS C 1 172 ? 38.817  -27.266 97.207  1.00 18.08 ? 172  LYS C N   1 
ATOM   9926  C CA  . LYS C 1 172 ? 40.152  -26.694 96.977  1.00 18.31 ? 172  LYS C CA  1 
ATOM   9927  C C   . LYS C 1 172 ? 40.366  -26.482 95.475  1.00 17.53 ? 172  LYS C C   1 
ATOM   9928  O O   . LYS C 1 172 ? 40.867  -25.435 95.063  1.00 18.14 ? 172  LYS C O   1 
ATOM   9929  C CB  . LYS C 1 172 ? 41.259  -27.603 97.540  1.00 20.26 ? 172  LYS C CB  1 
ATOM   9930  C CG  . LYS C 1 172 ? 42.651  -26.968 97.536  1.00 24.37 ? 172  LYS C CG  1 
ATOM   9931  C CD  . LYS C 1 172 ? 43.730  -27.914 98.045  1.00 27.05 ? 172  LYS C CD  1 
ATOM   9932  C CE  . LYS C 1 172 ? 45.109  -27.424 97.618  1.00 29.42 ? 172  LYS C CE  1 
ATOM   9933  N NZ  . LYS C 1 172 ? 46.160  -27.701 98.639  1.00 31.98 ? 172  LYS C NZ  1 
ATOM   9934  N N   . VAL C 1 173 ? 39.942  -27.463 94.674  1.00 16.93 ? 173  VAL C N   1 
ATOM   9935  C CA  . VAL C 1 173 ? 40.062  -27.392 93.213  1.00 16.16 ? 173  VAL C CA  1 
ATOM   9936  C C   . VAL C 1 173 ? 39.121  -26.325 92.655  1.00 15.35 ? 173  VAL C C   1 
ATOM   9937  O O   . VAL C 1 173 ? 39.514  -25.581 91.759  1.00 15.91 ? 173  VAL C O   1 
ATOM   9938  C CB  . VAL C 1 173 ? 39.829  -28.776 92.533  1.00 16.33 ? 173  VAL C CB  1 
ATOM   9939  C CG1 . VAL C 1 173 ? 39.913  -28.665 90.996  1.00 16.26 ? 173  VAL C CG1 1 
ATOM   9940  C CG2 . VAL C 1 173 ? 40.882  -29.754 93.010  1.00 15.58 ? 173  VAL C CG2 1 
ATOM   9941  N N   . LEU C 1 174 ? 37.916  -26.217 93.224  1.00 15.68 ? 174  LEU C N   1 
ATOM   9942  C CA  . LEU C 1 174 ? 36.943  -25.202 92.798  1.00 16.60 ? 174  LEU C CA  1 
ATOM   9943  C C   . LEU C 1 174 ? 37.460  -23.792 93.088  1.00 16.43 ? 174  LEU C C   1 
ATOM   9944  O O   . LEU C 1 174 ? 37.253  -22.878 92.286  1.00 16.02 ? 174  LEU C O   1 
ATOM   9945  C CB  . LEU C 1 174 ? 35.577  -25.413 93.459  1.00 15.21 ? 174  LEU C CB  1 
ATOM   9946  C CG  . LEU C 1 174 ? 34.678  -26.531 92.917  1.00 16.14 ? 174  LEU C CG  1 
ATOM   9947  C CD1 . LEU C 1 174 ? 33.461  -26.666 93.813  1.00 14.58 ? 174  LEU C CD1 1 
ATOM   9948  C CD2 . LEU C 1 174 ? 34.252  -26.254 91.471  1.00 15.95 ? 174  LEU C CD2 1 
ATOM   9949  N N   . ASP C 1 175 ? 38.201  -23.653 94.194  1.00 18.20 ? 175  ASP C N   1 
ATOM   9950  C CA  . ASP C 1 175 ? 38.808  -22.381 94.603  1.00 18.96 ? 175  ASP C CA  1 
ATOM   9951  C C   . ASP C 1 175 ? 39.996  -22.050 93.682  1.00 18.13 ? 175  ASP C C   1 
ATOM   9952  O O   . ASP C 1 175 ? 40.231  -20.878 93.366  1.00 18.58 ? 175  ASP C O   1 
ATOM   9953  C CB  . ASP C 1 175 ? 39.256  -22.445 96.074  1.00 20.97 ? 175  ASP C CB  1 
ATOM   9954  C CG  . ASP C 1 175 ? 39.875  -21.140 96.568  1.00 25.23 ? 175  ASP C CG  1 
ATOM   9955  O OD1 . ASP C 1 175 ? 39.167  -20.115 96.615  1.00 28.00 ? 175  ASP C OD1 1 
ATOM   9956  O OD2 . ASP C 1 175 ? 41.083  -21.148 96.893  1.00 28.37 ? 175  ASP C OD2 1 
ATOM   9957  N N   . GLN C 1 176 ? 40.716  -23.091 93.248  1.00 17.14 ? 176  GLN C N   1 
ATOM   9958  C CA  . GLN C 1 176 ? 41.866  -22.957 92.340  1.00 16.99 ? 176  GLN C CA  1 
ATOM   9959  C C   . GLN C 1 176 ? 41.328  -22.548 90.963  1.00 16.17 ? 176  GLN C C   1 
ATOM   9960  O O   . GLN C 1 176 ? 41.912  -21.695 90.290  1.00 16.24 ? 176  GLN C O   1 
ATOM   9961  C CB  . GLN C 1 176 ? 42.626  -24.285 92.237  1.00 17.75 ? 176  GLN C CB  1 
ATOM   9962  C CG  . GLN C 1 176 ? 43.977  -24.217 91.515  1.00 18.65 ? 176  GLN C CG  1 
ATOM   9963  C CD  . GLN C 1 176 ? 44.464  -25.576 91.017  1.00 19.21 ? 176  GLN C CD  1 
ATOM   9964  O OE1 . GLN C 1 176 ? 43.953  -26.625 91.417  1.00 20.23 ? 176  GLN C OE1 1 
ATOM   9965  N NE2 . GLN C 1 176 ? 45.442  -25.557 90.117  1.00 19.33 ? 176  GLN C NE2 1 
ATOM   9966  N N   . MET C 1 177 ? 40.185  -23.134 90.590  1.00 16.58 ? 177  MET C N   1 
ATOM   9967  C CA  . MET C 1 177 ? 39.502  -22.838 89.328  1.00 15.75 ? 177  MET C CA  1 
ATOM   9968  C C   . MET C 1 177 ? 38.994  -21.396 89.342  1.00 16.32 ? 177  MET C C   1 
ATOM   9969  O O   . MET C 1 177 ? 39.092  -20.702 88.331  1.00 16.87 ? 177  MET C O   1 
ATOM   9970  C CB  . MET C 1 177 ? 38.328  -23.796 89.107  1.00 16.01 ? 177  MET C CB  1 
ATOM   9971  C CG  . MET C 1 177 ? 38.706  -25.204 88.684  1.00 15.47 ? 177  MET C CG  1 
ATOM   9972  S SD  . MET C 1 177 ? 37.330  -26.358 88.865  1.00 16.78 ? 177  MET C SD  1 
ATOM   9973  C CE  . MET C 1 177 ? 36.348  -25.972 87.422  1.00 16.58 ? 177  MET C CE  1 
ATOM   9974  N N   . ARG C 1 178 ? 38.515  -20.944 90.508  1.00 16.25 ? 178  ARG C N   1 
ATOM   9975  C CA  . ARG C 1 178 ? 38.006  -19.575 90.710  1.00 16.27 ? 178  ARG C CA  1 
ATOM   9976  C C   . ARG C 1 178 ? 39.113  -18.548 90.470  1.00 16.87 ? 178  ARG C C   1 
ATOM   9977  O O   . ARG C 1 178 ? 38.961  -17.656 89.633  1.00 17.01 ? 178  ARG C O   1 
ATOM   9978  C CB  . ARG C 1 178 ? 37.463  -19.403 92.141  1.00 17.57 ? 178  ARG C CB  1 
ATOM   9979  C CG  . ARG C 1 178 ? 36.979  -17.988 92.498  1.00 18.71 ? 178  ARG C CG  1 
ATOM   9980  C CD  . ARG C 1 178 ? 36.475  -17.893 93.932  1.00 21.65 ? 178  ARG C CD  1 
ATOM   9981  N NE  . ARG C 1 178 ? 35.799  -16.613 94.166  1.00 25.49 ? 178  ARG C NE  1 
ATOM   9982  C CZ  . ARG C 1 178 ? 35.055  -16.321 95.233  1.00 27.73 ? 178  ARG C CZ  1 
ATOM   9983  N NH1 . ARG C 1 178 ? 34.866  -17.210 96.201  1.00 28.08 ? 178  ARG C NH1 1 
ATOM   9984  N NH2 . ARG C 1 178 ? 34.482  -15.125 95.325  1.00 27.99 ? 178  ARG C NH2 1 
ATOM   9985  N N   . SER C 1 179 ? 40.229  -18.728 91.182  1.00 17.22 ? 179  SER C N   1 
ATOM   9986  C CA  . SER C 1 179 ? 41.399  -17.853 91.107  1.00 17.53 ? 179  SER C CA  1 
ATOM   9987  C C   . SER C 1 179 ? 41.997  -17.757 89.705  1.00 16.87 ? 179  SER C C   1 
ATOM   9988  O O   . SER C 1 179 ? 42.228  -16.651 89.208  1.00 17.53 ? 179  SER C O   1 
ATOM   9989  C CB  . SER C 1 179 ? 42.463  -18.315 92.110  1.00 18.50 ? 179  SER C CB  1 
ATOM   9990  O OG  . SER C 1 179 ? 43.649  -17.546 91.998  1.00 22.60 ? 179  SER C OG  1 
ATOM   9991  N N   . PHE C 1 180 ? 42.174  -18.909 89.056  1.00 15.51 ? 180  PHE C N   1 
ATOM   9992  C CA  . PHE C 1 180 ? 42.734  -18.970 87.705  1.00 15.96 ? 180  PHE C CA  1 
ATOM   9993  C C   . PHE C 1 180 ? 41.803  -18.380 86.645  1.00 15.46 ? 180  PHE C C   1 
ATOM   9994  O O   . PHE C 1 180 ? 42.255  -17.589 85.816  1.00 16.50 ? 180  PHE C O   1 
ATOM   9995  C CB  . PHE C 1 180 ? 43.110  -20.412 87.339  1.00 15.83 ? 180  PHE C CB  1 
ATOM   9996  C CG  . PHE C 1 180 ? 43.724  -20.558 85.966  1.00 16.47 ? 180  PHE C CG  1 
ATOM   9997  C CD1 . PHE C 1 180 ? 45.025  -20.083 85.709  1.00 16.66 ? 180  PHE C CD1 1 
ATOM   9998  C CD2 . PHE C 1 180 ? 42.991  -21.147 84.912  1.00 16.57 ? 180  PHE C CD2 1 
ATOM   9999  C CE1 . PHE C 1 180 ? 45.589  -20.186 84.416  1.00 17.16 ? 180  PHE C CE1 1 
ATOM   10000 C CE2 . PHE C 1 180 ? 43.542  -21.255 83.615  1.00 17.74 ? 180  PHE C CE2 1 
ATOM   10001 C CZ  . PHE C 1 180 ? 44.852  -20.769 83.368  1.00 17.19 ? 180  PHE C CZ  1 
ATOM   10002 N N   . SER C 1 181 ? 40.525  -18.778 86.668  1.00 15.84 ? 181  SER C N   1 
ATOM   10003 C CA  . SER C 1 181 ? 39.534  -18.283 85.704  1.00 15.56 ? 181  SER C CA  1 
ATOM   10004 C C   . SER C 1 181 ? 39.390  -16.770 85.771  1.00 15.99 ? 181  SER C C   1 
ATOM   10005 O O   . SER C 1 181 ? 39.260  -16.123 84.738  1.00 16.54 ? 181  SER C O   1 
ATOM   10006 C CB  . SER C 1 181 ? 38.166  -18.953 85.893  1.00 15.75 ? 181  SER C CB  1 
ATOM   10007 O OG  . SER C 1 181 ? 37.608  -18.684 87.166  1.00 17.68 ? 181  SER C OG  1 
ATOM   10008 N N   . GLU C 1 182 ? 39.504  -16.216 86.981  1.00 16.81 ? 182  GLU C N   1 
ATOM   10009 C CA  . GLU C 1 182 ? 39.428  -14.770 87.187  1.00 17.91 ? 182  GLU C CA  1 
ATOM   10010 C C   . GLU C 1 182 ? 40.632  -14.056 86.582  1.00 18.01 ? 182  GLU C C   1 
ATOM   10011 O O   . GLU C 1 182 ? 40.463  -13.020 85.949  1.00 18.06 ? 182  GLU C O   1 
ATOM   10012 C CB  . GLU C 1 182 ? 39.275  -14.413 88.670  1.00 20.20 ? 182  GLU C CB  1 
ATOM   10013 C CG  . GLU C 1 182 ? 37.843  -14.547 89.212  1.00 22.23 ? 182  GLU C CG  1 
ATOM   10014 C CD  . GLU C 1 182 ? 36.828  -13.682 88.466  1.00 24.97 ? 182  GLU C CD  1 
ATOM   10015 O OE1 . GLU C 1 182 ? 36.961  -12.442 88.479  1.00 27.03 ? 182  GLU C OE1 1 
ATOM   10016 O OE2 . GLU C 1 182 ? 35.900  -14.252 87.856  1.00 27.15 ? 182  GLU C OE2 1 
ATOM   10017 N N   . LYS C 1 183 ? 41.819  -14.666 86.696  1.00 17.90 ? 183  LYS C N   1 
ATOM   10018 C CA  . LYS C 1 183 ? 43.054  -14.100 86.128  1.00 17.28 ? 183  LYS C CA  1 
ATOM   10019 C C   . LYS C 1 183 ? 42.980  -14.071 84.597  1.00 16.54 ? 183  LYS C C   1 
ATOM   10020 O O   . LYS C 1 183 ? 43.431  -13.114 83.967  1.00 17.03 ? 183  LYS C O   1 
ATOM   10021 C CB  . LYS C 1 183 ? 44.288  -14.894 86.574  1.00 19.15 ? 183  LYS C CB  1 
ATOM   10022 C CG  . LYS C 1 183 ? 44.664  -14.718 88.039  1.00 20.46 ? 183  LYS C CG  1 
ATOM   10023 C CD  . LYS C 1 183 ? 45.892  -15.550 88.390  1.00 22.97 ? 183  LYS C CD  1 
ATOM   10024 C CE  . LYS C 1 183 ? 46.114  -15.603 89.896  1.00 24.85 ? 183  LYS C CE  1 
ATOM   10025 N NZ  . LYS C 1 183 ? 47.018  -16.725 90.284  1.00 26.55 ? 183  LYS C NZ  1 
ATOM   10026 N N   . VAL C 1 184 ? 42.353  -15.095 84.015  1.00 15.97 ? 184  VAL C N   1 
ATOM   10027 C CA  . VAL C 1 184 ? 42.183  -15.193 82.562  1.00 15.70 ? 184  VAL C CA  1 
ATOM   10028 C C   . VAL C 1 184 ? 41.145  -14.177 82.059  1.00 15.86 ? 184  VAL C C   1 
ATOM   10029 O O   . VAL C 1 184 ? 41.421  -13.423 81.125  1.00 16.53 ? 184  VAL C O   1 
ATOM   10030 C CB  . VAL C 1 184 ? 41.798  -16.651 82.137  1.00 15.49 ? 184  VAL C CB  1 
ATOM   10031 C CG1 . VAL C 1 184 ? 41.499  -16.742 80.631  1.00 16.44 ? 184  VAL C CG1 1 
ATOM   10032 C CG2 . VAL C 1 184 ? 42.930  -17.601 82.477  1.00 15.60 ? 184  VAL C CG2 1 
ATOM   10033 N N   . ARG C 1 185 ? 39.995  -14.121 82.736  1.00 16.52 ? 185  ARG C N   1 
ATOM   10034 C CA  . ARG C 1 185 ? 38.885  -13.227 82.389  1.00 17.24 ? 185  ARG C CA  1 
ATOM   10035 C C   . ARG C 1 185 ? 39.169  -11.726 82.495  1.00 17.37 ? 185  ARG C C   1 
ATOM   10036 O O   . ARG C 1 185 ? 38.748  -10.960 81.628  1.00 18.23 ? 185  ARG C O   1 
ATOM   10037 C CB  . ARG C 1 185 ? 37.652  -13.568 83.227  1.00 17.16 ? 185  ARG C CB  1 
ATOM   10038 C CG  . ARG C 1 185 ? 37.008  -14.907 82.873  1.00 16.99 ? 185  ARG C CG  1 
ATOM   10039 C CD  . ARG C 1 185 ? 36.049  -15.387 83.966  1.00 16.64 ? 185  ARG C CD  1 
ATOM   10040 N NE  . ARG C 1 185 ? 34.901  -14.504 84.168  1.00 16.25 ? 185  ARG C NE  1 
ATOM   10041 C CZ  . ARG C 1 185 ? 33.802  -14.497 83.415  1.00 16.08 ? 185  ARG C CZ  1 
ATOM   10042 N NH1 . ARG C 1 185 ? 33.682  -15.325 82.384  1.00 14.02 ? 185  ARG C NH1 1 
ATOM   10043 N NH2 . ARG C 1 185 ? 32.793  -13.696 83.735  1.00 17.29 ? 185  ARG C NH2 1 
ATOM   10044 N N   . THR C 1 186 ? 39.905  -11.326 83.533  1.00 18.43 ? 186  THR C N   1 
ATOM   10045 C CA  . THR C 1 186 ? 40.247  -9.914  83.773  1.00 18.59 ? 186  THR C CA  1 
ATOM   10046 C C   . THR C 1 186 ? 41.424  -9.407  82.936  1.00 19.48 ? 186  THR C C   1 
ATOM   10047 O O   . THR C 1 186 ? 41.662  -8.194  82.857  1.00 19.98 ? 186  THR C O   1 
ATOM   10048 C CB  . THR C 1 186 ? 40.582  -9.650  85.262  1.00 18.84 ? 186  THR C CB  1 
ATOM   10049 O OG1 . THR C 1 186 ? 41.733  -10.416 85.635  1.00 20.82 ? 186  THR C OG1 1 
ATOM   10050 C CG2 . THR C 1 186 ? 39.403  -10.013 86.158  1.00 20.08 ? 186  THR C CG2 1 
ATOM   10051 N N   . GLY C 1 187 ? 42.162  -10.341 82.342  1.00 18.31 ? 187  GLY C N   1 
ATOM   10052 C CA  . GLY C 1 187 ? 43.310  -9.994  81.524  1.00 19.76 ? 187  GLY C CA  1 
ATOM   10053 C C   . GLY C 1 187 ? 44.624  -9.995  82.281  1.00 20.56 ? 187  GLY C C   1 
ATOM   10054 O O   . GLY C 1 187 ? 45.652  -9.612  81.719  1.00 21.86 ? 187  GLY C O   1 
ATOM   10055 N N   . GLU C 1 188 ? 44.598  -10.447 83.537  1.00 20.63 ? 188  GLU C N   1 
ATOM   10056 C CA  . GLU C 1 188 ? 45.797  -10.510 84.380  1.00 22.64 ? 188  GLU C CA  1 
ATOM   10057 C C   . GLU C 1 188 ? 46.783  -11.601 83.981  1.00 21.48 ? 188  GLU C C   1 
ATOM   10058 O O   . GLU C 1 188 ? 48.001  -11.412 84.086  1.00 20.39 ? 188  GLU C O   1 
ATOM   10059 C CB  . GLU C 1 188 ? 45.423  -10.623 85.866  1.00 25.28 ? 188  GLU C CB  1 
ATOM   10060 C CG  . GLU C 1 188 ? 44.796  -9.361  86.477  1.00 31.71 ? 188  GLU C CG  1 
ATOM   10061 C CD  . GLU C 1 188 ? 45.760  -8.180  86.559  1.00 35.09 ? 188  GLU C CD  1 
ATOM   10062 O OE1 . GLU C 1 188 ? 46.358  -7.799  85.525  1.00 38.00 ? 188  GLU C OE1 1 
ATOM   10063 O OE2 . GLU C 1 188 ? 45.917  -7.614  87.663  1.00 37.95 ? 188  GLU C OE2 1 
ATOM   10064 N N   . TRP C 1 189 ? 46.257  -12.735 83.509  1.00 20.46 ? 189  TRP C N   1 
ATOM   10065 C CA  . TRP C 1 189 ? 47.097  -13.847 83.059  1.00 19.43 ? 189  TRP C CA  1 
ATOM   10066 C C   . TRP C 1 189 ? 47.629  -13.472 81.676  1.00 19.83 ? 189  TRP C C   1 
ATOM   10067 O O   . TRP C 1 189 ? 46.858  -13.219 80.741  1.00 19.56 ? 189  TRP C O   1 
ATOM   10068 C CB  . TRP C 1 189 ? 46.310  -15.167 82.997  1.00 18.88 ? 189  TRP C CB  1 
ATOM   10069 C CG  . TRP C 1 189 ? 47.181  -16.395 82.785  1.00 19.00 ? 189  TRP C CG  1 
ATOM   10070 C CD1 . TRP C 1 189 ? 47.643  -16.882 81.588  1.00 18.85 ? 189  TRP C CD1 1 
ATOM   10071 C CD2 . TRP C 1 189 ? 47.715  -17.258 83.796  1.00 18.63 ? 189  TRP C CD2 1 
ATOM   10072 N NE1 . TRP C 1 189 ? 48.435  -17.984 81.790  1.00 18.51 ? 189  TRP C NE1 1 
ATOM   10073 C CE2 . TRP C 1 189 ? 48.500  -18.245 83.132  1.00 19.61 ? 189  TRP C CE2 1 
ATOM   10074 C CE3 . TRP C 1 189 ? 47.613  -17.301 85.204  1.00 19.78 ? 189  TRP C CE3 1 
ATOM   10075 C CZ2 . TRP C 1 189 ? 49.185  -19.273 83.829  1.00 19.34 ? 189  TRP C CZ2 1 
ATOM   10076 C CZ3 . TRP C 1 189 ? 48.299  -18.332 85.910  1.00 21.54 ? 189  TRP C CZ3 1 
ATOM   10077 C CH2 . TRP C 1 189 ? 49.074  -19.300 85.209  1.00 21.42 ? 189  TRP C CH2 1 
ATOM   10078 N N   . LYS C 1 190 ? 48.956  -13.423 81.569  1.00 19.91 ? 190  LYS C N   1 
ATOM   10079 C CA  . LYS C 1 190 ? 49.618  -13.056 80.325  1.00 20.25 ? 190  LYS C CA  1 
ATOM   10080 C C   . LYS C 1 190 ? 50.299  -14.228 79.636  1.00 20.17 ? 190  LYS C C   1 
ATOM   10081 O O   . LYS C 1 190 ? 50.703  -15.200 80.287  1.00 20.60 ? 190  LYS C O   1 
ATOM   10082 C CB  . LYS C 1 190 ? 50.679  -11.970 80.577  1.00 21.11 ? 190  LYS C CB  1 
ATOM   10083 C CG  . LYS C 1 190 ? 50.241  -10.760 81.411  1.00 21.31 ? 190  LYS C CG  1 
ATOM   10084 C CD  . LYS C 1 190 ? 49.193  -9.907  80.715  1.00 22.89 ? 190  LYS C CD  1 
ATOM   10085 C CE  . LYS C 1 190 ? 48.846  -8.689  81.549  1.00 23.10 ? 190  LYS C CE  1 
ATOM   10086 N NZ  . LYS C 1 190 ? 47.760  -7.904  80.913  1.00 24.65 ? 190  LYS C NZ  1 
ATOM   10087 N N   . GLY C 1 191 ? 50.445  -14.108 78.315  1.00 19.76 ? 191  GLY C N   1 
ATOM   10088 C CA  . GLY C 1 191 ? 51.134  -15.109 77.517  1.00 19.79 ? 191  GLY C CA  1 
ATOM   10089 C C   . GLY C 1 191 ? 52.631  -14.826 77.589  1.00 19.79 ? 191  GLY C C   1 
ATOM   10090 O O   . GLY C 1 191 ? 53.044  -13.912 78.312  1.00 21.02 ? 191  GLY C O   1 
ATOM   10091 N N   . HIS C 1 192 ? 53.434  -15.559 76.819  1.00 19.54 ? 192  HIS C N   1 
ATOM   10092 C CA  . HIS C 1 192 ? 54.896  -15.392 76.822  1.00 19.42 ? 192  HIS C CA  1 
ATOM   10093 C C   . HIS C 1 192 ? 55.416  -14.023 76.373  1.00 20.66 ? 192  HIS C C   1 
ATOM   10094 O O   . HIS C 1 192 ? 56.445  -13.552 76.876  1.00 21.53 ? 192  HIS C O   1 
ATOM   10095 C CB  . HIS C 1 192 ? 55.565  -16.505 76.012  1.00 19.53 ? 192  HIS C CB  1 
ATOM   10096 C CG  . HIS C 1 192 ? 57.004  -16.731 76.365  1.00 19.57 ? 192  HIS C CG  1 
ATOM   10097 N ND1 . HIS C 1 192 ? 57.426  -16.956 77.657  1.00 20.56 ? 192  HIS C ND1 1 
ATOM   10098 C CD2 . HIS C 1 192 ? 58.113  -16.789 75.591  1.00 19.54 ? 192  HIS C CD2 1 
ATOM   10099 C CE1 . HIS C 1 192 ? 58.734  -17.145 77.664  1.00 20.50 ? 192  HIS C CE1 1 
ATOM   10100 N NE2 . HIS C 1 192 ? 59.174  -17.051 76.423  1.00 19.58 ? 192  HIS C NE2 1 
ATOM   10101 N N   . THR C 1 193 ? 54.697  -13.385 75.452  1.00 21.53 ? 193  THR C N   1 
ATOM   10102 C CA  . THR C 1 193 ? 55.080  -12.069 74.937  1.00 22.15 ? 193  THR C CA  1 
ATOM   10103 C C   . THR C 1 193 ? 54.381  -10.908 75.657  1.00 22.84 ? 193  THR C C   1 
ATOM   10104 O O   . THR C 1 193 ? 54.501  -9.749  75.241  1.00 23.91 ? 193  THR C O   1 
ATOM   10105 C CB  . THR C 1 193 ? 54.857  -11.969 73.411  1.00 23.08 ? 193  THR C CB  1 
ATOM   10106 O OG1 . THR C 1 193 ? 53.475  -12.204 73.107  1.00 23.76 ? 193  THR C OG1 1 
ATOM   10107 C CG2 . THR C 1 193 ? 55.720  -12.988 72.672  1.00 22.90 ? 193  THR C CG2 1 
ATOM   10108 N N   . GLY C 1 194 ? 53.641  -11.234 76.720  1.00 23.27 ? 194  GLY C N   1 
ATOM   10109 C CA  . GLY C 1 194 ? 52.949  -10.229 77.516  1.00 22.83 ? 194  GLY C CA  1 
ATOM   10110 C C   . GLY C 1 194 ? 51.510  -9.879  77.174  1.00 23.43 ? 194  GLY C C   1 
ATOM   10111 O O   . GLY C 1 194 ? 50.945  -8.956  77.770  1.00 23.54 ? 194  GLY C O   1 
ATOM   10112 N N   . LYS C 1 195 ? 50.910  -10.612 76.239  1.00 23.06 ? 195  LYS C N   1 
ATOM   10113 C CA  . LYS C 1 195 ? 49.527  -10.364 75.824  1.00 22.81 ? 195  LYS C CA  1 
ATOM   10114 C C   . LYS C 1 195 ? 48.504  -11.070 76.706  1.00 21.74 ? 195  LYS C C   1 
ATOM   10115 O O   . LYS C 1 195 ? 48.749  -12.183 77.182  1.00 20.48 ? 195  LYS C O   1 
ATOM   10116 C CB  . LYS C 1 195 ? 49.296  -10.811 74.377  1.00 25.56 ? 195  LYS C CB  1 
ATOM   10117 C CG  . LYS C 1 195 ? 50.194  -10.172 73.331  1.00 28.99 ? 195  LYS C CG  1 
ATOM   10118 C CD  . LYS C 1 195 ? 49.457  -10.135 72.003  1.00 32.06 ? 195  LYS C CD  1 
ATOM   10119 C CE  . LYS C 1 195 ? 50.277  -9.491  70.902  1.00 33.76 ? 195  LYS C CE  1 
ATOM   10120 N NZ  . LYS C 1 195 ? 49.501  -9.475  69.630  1.00 35.69 ? 195  LYS C NZ  1 
ATOM   10121 N N   . ALA C 1 196 ? 47.347  -10.428 76.885  1.00 19.83 ? 196  ALA C N   1 
ATOM   10122 C CA  . ALA C 1 196 ? 46.240  -10.985 77.663  1.00 19.12 ? 196  ALA C CA  1 
ATOM   10123 C C   . ALA C 1 196 ? 45.616  -12.105 76.831  1.00 18.62 ? 196  ALA C C   1 
ATOM   10124 O O   . ALA C 1 196 ? 45.694  -12.082 75.599  1.00 18.48 ? 196  ALA C O   1 
ATOM   10125 C CB  . ALA C 1 196 ? 45.204  -9.910  77.959  1.00 18.58 ? 196  ALA C CB  1 
ATOM   10126 N N   . ILE C 1 197 ? 45.020  -13.087 77.504  1.00 17.20 ? 197  ILE C N   1 
ATOM   10127 C CA  . ILE C 1 197 ? 44.397  -14.228 76.832  1.00 16.94 ? 197  ILE C CA  1 
ATOM   10128 C C   . ILE C 1 197 ? 43.085  -13.844 76.138  1.00 15.83 ? 197  ILE C C   1 
ATOM   10129 O O   . ILE C 1 197 ? 42.194  -13.258 76.755  1.00 17.38 ? 197  ILE C O   1 
ATOM   10130 C CB  . ILE C 1 197 ? 44.182  -15.412 77.832  1.00 16.46 ? 197  ILE C CB  1 
ATOM   10131 C CG1 . ILE C 1 197 ? 45.514  -15.824 78.485  1.00 15.26 ? 197  ILE C CG1 1 
ATOM   10132 C CG2 . ILE C 1 197 ? 43.507  -16.611 77.147  1.00 17.16 ? 197  ILE C CG2 1 
ATOM   10133 C CD1 . ILE C 1 197 ? 46.637  -16.273 77.525  1.00 17.25 ? 197  ILE C CD1 1 
ATOM   10134 N N   . ARG C 1 198 ? 43.015  -14.140 74.839  1.00 15.46 ? 198  ARG C N   1 
ATOM   10135 C CA  . ARG C 1 198 ? 41.838  -13.858 74.015  1.00 16.01 ? 198  ARG C CA  1 
ATOM   10136 C C   . ARG C 1 198 ? 41.214  -15.145 73.475  1.00 15.15 ? 198  ARG C C   1 
ATOM   10137 O O   . ARG C 1 198 ? 40.036  -15.162 73.102  1.00 15.36 ? 198  ARG C O   1 
ATOM   10138 C CB  . ARG C 1 198 ? 42.205  -12.937 72.840  1.00 18.96 ? 198  ARG C CB  1 
ATOM   10139 C CG  . ARG C 1 198 ? 42.553  -11.490 73.211  1.00 21.68 ? 198  ARG C CG  1 
ATOM   10140 C CD  . ARG C 1 198 ? 41.331  -10.561 73.251  1.00 24.53 ? 198  ARG C CD  1 
ATOM   10141 N NE  . ARG C 1 198 ? 40.383  -10.847 74.334  1.00 26.02 ? 198  ARG C NE  1 
ATOM   10142 C CZ  . ARG C 1 198 ? 40.519  -10.447 75.600  1.00 27.35 ? 198  ARG C CZ  1 
ATOM   10143 N NH1 . ARG C 1 198 ? 41.567  -9.722  75.977  1.00 27.89 ? 198  ARG C NH1 1 
ATOM   10144 N NH2 . ARG C 1 198 ? 39.618  -10.811 76.503  1.00 27.87 ? 198  ARG C NH2 1 
ATOM   10145 N N   . HIS C 1 199 ? 42.025  -16.199 73.398  1.00 13.90 ? 199  HIS C N   1 
ATOM   10146 C CA  . HIS C 1 199 ? 41.597  -17.506 72.889  1.00 14.19 ? 199  HIS C CA  1 
ATOM   10147 C C   . HIS C 1 199 ? 41.862  -18.605 73.909  1.00 13.96 ? 199  HIS C C   1 
ATOM   10148 O O   . HIS C 1 199 ? 42.956  -18.695 74.467  1.00 14.44 ? 199  HIS C O   1 
ATOM   10149 C CB  . HIS C 1 199 ? 42.326  -17.857 71.583  1.00 14.77 ? 199  HIS C CB  1 
ATOM   10150 C CG  . HIS C 1 199 ? 42.120  -16.864 70.481  1.00 16.60 ? 199  HIS C CG  1 
ATOM   10151 N ND1 . HIS C 1 199 ? 41.048  -16.921 69.618  1.00 16.53 ? 199  HIS C ND1 1 
ATOM   10152 C CD2 . HIS C 1 199 ? 42.843  -15.779 70.113  1.00 17.59 ? 199  HIS C CD2 1 
ATOM   10153 C CE1 . HIS C 1 199 ? 41.116  -15.912 68.767  1.00 18.52 ? 199  HIS C CE1 1 
ATOM   10154 N NE2 . HIS C 1 199 ? 42.196  -15.205 69.045  1.00 18.02 ? 199  HIS C NE2 1 
ATOM   10155 N N   . VAL C 1 200 ? 40.843  -19.424 74.159  1.00 12.88 ? 200  VAL C N   1 
ATOM   10156 C CA  . VAL C 1 200 ? 40.938  -20.537 75.103  1.00 12.41 ? 200  VAL C CA  1 
ATOM   10157 C C   . VAL C 1 200 ? 40.681  -21.812 74.298  1.00 12.30 ? 200  VAL C C   1 
ATOM   10158 O O   . VAL C 1 200 ? 39.584  -22.010 73.774  1.00 13.58 ? 200  VAL C O   1 
ATOM   10159 C CB  . VAL C 1 200 ? 39.901  -20.392 76.261  1.00 13.59 ? 200  VAL C CB  1 
ATOM   10160 C CG1 . VAL C 1 200 ? 39.992  -21.560 77.223  1.00 14.95 ? 200  VAL C CG1 1 
ATOM   10161 C CG2 . VAL C 1 200 ? 40.129  -19.095 77.027  1.00 15.83 ? 200  VAL C CG2 1 
ATOM   10162 N N   . VAL C 1 201 ? 41.704  -22.658 74.193  1.00 12.06 ? 201  VAL C N   1 
ATOM   10163 C CA  . VAL C 1 201 ? 41.601  -23.903 73.430  1.00 12.54 ? 201  VAL C CA  1 
ATOM   10164 C C   . VAL C 1 201 ? 41.608  -25.143 74.326  1.00 12.48 ? 201  VAL C C   1 
ATOM   10165 O O   . VAL C 1 201 ? 42.612  -25.454 74.960  1.00 13.83 ? 201  VAL C O   1 
ATOM   10166 C CB  . VAL C 1 201 ? 42.752  -24.021 72.369  1.00 12.11 ? 201  VAL C CB  1 
ATOM   10167 C CG1 . VAL C 1 201 ? 42.627  -25.308 71.554  1.00 12.72 ? 201  VAL C CG1 1 
ATOM   10168 C CG2 . VAL C 1 201 ? 42.748  -22.830 71.429  1.00 12.86 ? 201  VAL C CG2 1 
ATOM   10169 N N   . ASN C 1 202 ? 40.480  -25.850 74.353  1.00 11.83 ? 202  ASN C N   1 
ATOM   10170 C CA  . ASN C 1 202 ? 40.363  -27.082 75.126  1.00 12.12 ? 202  ASN C CA  1 
ATOM   10171 C C   . ASN C 1 202 ? 40.803  -28.230 74.216  1.00 11.94 ? 202  ASN C C   1 
ATOM   10172 O O   . ASN C 1 202 ? 40.460  -28.266 73.031  1.00 13.42 ? 202  ASN C O   1 
ATOM   10173 C CB  . ASN C 1 202 ? 38.920  -27.291 75.603  1.00 11.54 ? 202  ASN C CB  1 
ATOM   10174 C CG  . ASN C 1 202 ? 38.789  -28.407 76.631  1.00 13.60 ? 202  ASN C CG  1 
ATOM   10175 O OD1 . ASN C 1 202 ? 39.160  -28.240 77.791  1.00 14.42 ? 202  ASN C OD1 1 
ATOM   10176 N ND2 . ASN C 1 202 ? 38.257  -29.552 76.204  1.00 14.27 ? 202  ASN C ND2 1 
ATOM   10177 N N   . ILE C 1 203 ? 41.668  -29.086 74.753  1.00 10.79 ? 203  ILE C N   1 
ATOM   10178 C CA  . ILE C 1 203 ? 42.185  -30.248 74.035  1.00 10.75 ? 203  ILE C CA  1 
ATOM   10179 C C   . ILE C 1 203 ? 41.776  -31.478 74.846  1.00 11.18 ? 203  ILE C C   1 
ATOM   10180 O O   . ILE C 1 203 ? 42.305  -31.723 75.928  1.00 11.52 ? 203  ILE C O   1 
ATOM   10181 C CB  . ILE C 1 203 ? 43.739  -30.197 73.877  1.00 11.03 ? 203  ILE C CB  1 
ATOM   10182 C CG1 . ILE C 1 203 ? 44.181  -28.861 73.259  1.00 12.92 ? 203  ILE C CG1 1 
ATOM   10183 C CG2 . ILE C 1 203 ? 44.217  -31.368 73.015  1.00 13.79 ? 203  ILE C CG2 1 
ATOM   10184 C CD1 . ILE C 1 203 ? 45.688  -28.700 73.120  1.00 13.65 ? 203  ILE C CD1 1 
ATOM   10185 N N   . GLY C 1 204 ? 40.823  -32.234 74.311  1.00 11.95 ? 204  GLY C N   1 
ATOM   10186 C CA  . GLY C 1 204 ? 40.331  -33.423 74.989  1.00 12.49 ? 204  GLY C CA  1 
ATOM   10187 C C   . GLY C 1 204 ? 39.297  -34.108 74.130  1.00 12.30 ? 204  GLY C C   1 
ATOM   10188 O O   . GLY C 1 204 ? 38.774  -33.488 73.215  1.00 11.68 ? 204  GLY C O   1 
ATOM   10189 N N   . ILE C 1 205 ? 38.973  -35.360 74.442  1.00 12.28 ? 205  ILE C N   1 
ATOM   10190 C CA  . ILE C 1 205 ? 38.001  -36.119 73.655  1.00 12.71 ? 205  ILE C CA  1 
ATOM   10191 C C   . ILE C 1 205 ? 36.995  -36.845 74.560  1.00 12.18 ? 205  ILE C C   1 
ATOM   10192 O O   . ILE C 1 205 ? 37.287  -37.106 75.728  1.00 12.42 ? 205  ILE C O   1 
ATOM   10193 C CB  . ILE C 1 205 ? 38.742  -37.081 72.661  1.00 12.36 ? 205  ILE C CB  1 
ATOM   10194 C CG1 . ILE C 1 205 ? 37.801  -37.561 71.551  1.00 12.02 ? 205  ILE C CG1 1 
ATOM   10195 C CG2 . ILE C 1 205 ? 39.425  -38.229 73.406  1.00 12.26 ? 205  ILE C CG2 1 
ATOM   10196 C CD1 . ILE C 1 205 ? 38.524  -38.061 70.311  1.00 12.59 ? 205  ILE C CD1 1 
ATOM   10197 N N   . GLY C 1 206 ? 35.783  -37.064 74.035  1.00 12.13 ? 206  GLY C N   1 
ATOM   10198 C CA  . GLY C 1 206 ? 34.728  -37.754 74.772  1.00 12.22 ? 206  GLY C CA  1 
ATOM   10199 C C   . GLY C 1 206 ? 34.278  -37.011 76.012  1.00 12.17 ? 206  GLY C C   1 
ATOM   10200 O O   . GLY C 1 206 ? 33.798  -35.884 75.914  1.00 12.56 ? 206  GLY C O   1 
ATOM   10201 N N   . GLY C 1 207 ? 34.513  -37.616 77.176  1.00 11.80 ? 207  GLY C N   1 
ATOM   10202 C CA  . GLY C 1 207 ? 34.145  -37.000 78.444  1.00 12.18 ? 207  GLY C CA  1 
ATOM   10203 C C   . GLY C 1 207 ? 34.916  -35.735 78.792  1.00 12.81 ? 207  GLY C C   1 
ATOM   10204 O O   . GLY C 1 207 ? 34.486  -34.942 79.636  1.00 13.35 ? 207  GLY C O   1 
ATOM   10205 N N   . SER C 1 208 ? 36.049  -35.544 78.121  1.00 13.26 ? 208  SER C N   1 
ATOM   10206 C CA  . SER C 1 208 ? 36.889  -34.371 78.317  1.00 13.85 ? 208  SER C CA  1 
ATOM   10207 C C   . SER C 1 208 ? 36.663  -33.349 77.190  1.00 14.75 ? 208  SER C C   1 
ATOM   10208 O O   . SER C 1 208 ? 37.500  -32.468 76.963  1.00 16.18 ? 208  SER C O   1 
ATOM   10209 C CB  . SER C 1 208 ? 38.354  -34.798 78.371  1.00 13.84 ? 208  SER C CB  1 
ATOM   10210 O OG  . SER C 1 208 ? 38.609  -35.614 79.502  1.00 13.95 ? 208  SER C OG  1 
ATOM   10211 N N   . ASP C 1 209 ? 35.522  -33.471 76.507  1.00 13.49 ? 209  ASP C N   1 
ATOM   10212 C CA  . ASP C 1 209 ? 35.155  -32.587 75.393  1.00 13.08 ? 209  ASP C CA  1 
ATOM   10213 C C   . ASP C 1 209 ? 33.672  -32.250 75.339  1.00 12.73 ? 209  ASP C C   1 
ATOM   10214 O O   . ASP C 1 209 ? 33.312  -31.073 75.341  1.00 12.69 ? 209  ASP C O   1 
ATOM   10215 C CB  . ASP C 1 209 ? 35.580  -33.216 74.054  1.00 13.19 ? 209  ASP C CB  1 
ATOM   10216 C CG  . ASP C 1 209 ? 35.086  -32.444 72.830  1.00 15.13 ? 209  ASP C CG  1 
ATOM   10217 O OD1 . ASP C 1 209 ? 35.625  -31.356 72.533  1.00 14.88 ? 209  ASP C OD1 1 
ATOM   10218 O OD2 . ASP C 1 209 ? 34.153  -32.941 72.164  1.00 16.86 ? 209  ASP C OD2 1 
ATOM   10219 N N   . LEU C 1 210 ? 32.825  -33.278 75.250  1.00 12.86 ? 210  LEU C N   1 
ATOM   10220 C CA  . LEU C 1 210 ? 31.373  -33.102 75.125  1.00 12.23 ? 210  LEU C CA  1 
ATOM   10221 C C   . LEU C 1 210 ? 30.677  -32.223 76.156  1.00 12.10 ? 210  LEU C C   1 
ATOM   10222 O O   . LEU C 1 210 ? 29.826  -31.417 75.784  1.00 12.40 ? 210  LEU C O   1 
ATOM   10223 C CB  . LEU C 1 210 ? 30.663  -34.453 74.984  1.00 14.25 ? 210  LEU C CB  1 
ATOM   10224 C CG  . LEU C 1 210 ? 30.859  -35.206 73.656  1.00 17.46 ? 210  LEU C CG  1 
ATOM   10225 C CD1 . LEU C 1 210 ? 30.163  -36.543 73.736  1.00 18.79 ? 210  LEU C CD1 1 
ATOM   10226 C CD2 . LEU C 1 210 ? 30.316  -34.423 72.463  1.00 21.33 ? 210  LEU C CD2 1 
ATOM   10227 N N   . GLY C 1 211 ? 31.072  -32.355 77.426  1.00 11.94 ? 211  GLY C N   1 
ATOM   10228 C CA  . GLY C 1 211 ? 30.523  -31.544 78.512  1.00 11.50 ? 211  GLY C CA  1 
ATOM   10229 C C   . GLY C 1 211 ? 30.869  -30.087 78.306  1.00 11.45 ? 211  GLY C C   1 
ATOM   10230 O O   . GLY C 1 211 ? 29.971  -29.239 78.320  1.00 13.38 ? 211  GLY C O   1 
ATOM   10231 N N   . PRO C 1 212 ? 32.169  -29.760 78.155  1.00 12.08 ? 212  PRO C N   1 
ATOM   10232 C CA  . PRO C 1 212 ? 32.612  -28.385 77.926  1.00 11.82 ? 212  PRO C CA  1 
ATOM   10233 C C   . PRO C 1 212 ? 31.950  -27.738 76.701  1.00 11.69 ? 212  PRO C C   1 
ATOM   10234 O O   . PRO C 1 212 ? 31.485  -26.606 76.790  1.00 11.88 ? 212  PRO C O   1 
ATOM   10235 C CB  . PRO C 1 212 ? 34.111  -28.559 77.764  1.00 11.98 ? 212  PRO C CB  1 
ATOM   10236 C CG  . PRO C 1 212 ? 34.402  -29.537 78.826  1.00 12.21 ? 212  PRO C CG  1 
ATOM   10237 C CD  . PRO C 1 212 ? 33.315  -30.572 78.625  1.00 13.97 ? 212  PRO C CD  1 
ATOM   10238 N N   . VAL C 1 213 ? 31.812  -28.501 75.610  1.00 11.10 ? 213  VAL C N   1 
ATOM   10239 C CA  . VAL C 1 213 ? 31.168  -28.016 74.374  1.00 10.77 ? 213  VAL C CA  1 
ATOM   10240 C C   . VAL C 1 213 ? 29.678  -27.736 74.617  1.00 10.74 ? 213  VAL C C   1 
ATOM   10241 O O   . VAL C 1 213 ? 29.209  -26.628 74.368  1.00 10.75 ? 213  VAL C O   1 
ATOM   10242 C CB  . VAL C 1 213 ? 31.303  -29.049 73.198  1.00 11.18 ? 213  VAL C CB  1 
ATOM   10243 C CG1 . VAL C 1 213 ? 30.495  -28.615 71.965  1.00 10.89 ? 213  VAL C CG1 1 
ATOM   10244 C CG2 . VAL C 1 213 ? 32.743  -29.203 72.798  1.00 13.38 ? 213  VAL C CG2 1 
ATOM   10245 N N   . MET C 1 214 ? 28.967  -28.738 75.134  1.00 10.18 ? 214  MET C N   1 
ATOM   10246 C CA  . MET C 1 214 ? 27.532  -28.638 75.410  1.00 9.91  ? 214  MET C CA  1 
ATOM   10247 C C   . MET C 1 214 ? 27.171  -27.486 76.344  1.00 10.36 ? 214  MET C C   1 
ATOM   10248 O O   . MET C 1 214 ? 26.289  -26.693 76.021  1.00 10.14 ? 214  MET C O   1 
ATOM   10249 C CB  . MET C 1 214 ? 27.012  -29.973 75.967  1.00 9.20  ? 214  MET C CB  1 
ATOM   10250 C CG  . MET C 1 214 ? 25.512  -30.039 76.311  1.00 11.36 ? 214  MET C CG  1 
ATOM   10251 S SD  . MET C 1 214 ? 25.041  -29.260 77.873  1.00 12.20 ? 214  MET C SD  1 
ATOM   10252 C CE  . MET C 1 214 ? 25.947  -30.301 79.057  1.00 13.68 ? 214  MET C CE  1 
ATOM   10253 N N   . ALA C 1 215 ? 27.883  -27.387 77.468  1.00 10.14 ? 215  ALA C N   1 
ATOM   10254 C CA  . ALA C 1 215 ? 27.625  -26.354 78.467  1.00 10.83 ? 215  ALA C CA  1 
ATOM   10255 C C   . ALA C 1 215 ? 27.973  -24.934 78.050  1.00 10.93 ? 215  ALA C C   1 
ATOM   10256 O O   . ALA C 1 215 ? 27.217  -24.015 78.363  1.00 11.26 ? 215  ALA C O   1 
ATOM   10257 C CB  . ALA C 1 215 ? 28.276  -26.706 79.785  1.00 11.62 ? 215  ALA C CB  1 
ATOM   10258 N N   . THR C 1 216 ? 29.083  -24.749 77.327  1.00 10.66 ? 216  THR C N   1 
ATOM   10259 C CA  . THR C 1 216 ? 29.455  -23.401 76.869  1.00 10.84 ? 216  THR C CA  1 
ATOM   10260 C C   . THR C 1 216 ? 28.505  -22.919 75.772  1.00 11.12 ? 216  THR C C   1 
ATOM   10261 O O   . THR C 1 216 ? 28.217  -21.729 75.682  1.00 11.92 ? 216  THR C O   1 
ATOM   10262 C CB  . THR C 1 216 ? 30.912  -23.290 76.385  1.00 11.56 ? 216  THR C CB  1 
ATOM   10263 O OG1 . THR C 1 216 ? 31.193  -24.297 75.407  1.00 12.62 ? 216  THR C OG1 1 
ATOM   10264 C CG2 . THR C 1 216 ? 31.879  -23.418 77.550  1.00 12.68 ? 216  THR C CG2 1 
ATOM   10265 N N   . GLU C 1 217 ? 27.986  -23.860 74.976  1.00 10.96 ? 217  GLU C N   1 
ATOM   10266 C CA  . GLU C 1 217 ? 27.023  -23.526 73.925  1.00 10.82 ? 217  GLU C CA  1 
ATOM   10267 C C   . GLU C 1 217 ? 25.670  -23.205 74.565  1.00 11.02 ? 217  GLU C C   1 
ATOM   10268 O O   . GLU C 1 217 ? 25.037  -22.207 74.217  1.00 11.39 ? 217  GLU C O   1 
ATOM   10269 C CB  . GLU C 1 217 ? 26.857  -24.681 72.923  1.00 11.34 ? 217  GLU C CB  1 
ATOM   10270 C CG  . GLU C 1 217 ? 28.024  -24.868 71.946  1.00 12.76 ? 217  GLU C CG  1 
ATOM   10271 C CD  . GLU C 1 217 ? 28.258  -23.663 71.042  1.00 16.77 ? 217  GLU C CD  1 
ATOM   10272 O OE1 . GLU C 1 217 ? 27.349  -23.304 70.260  1.00 14.85 ? 217  GLU C OE1 1 
ATOM   10273 O OE2 . GLU C 1 217 ? 29.355  -23.072 71.122  1.00 19.69 ? 217  GLU C OE2 1 
ATOM   10274 N N   . ALA C 1 218 ? 25.302  -24.006 75.569  1.00 9.13  ? 218  ALA C N   1 
ATOM   10275 C CA  . ALA C 1 218 ? 24.039  -23.865 76.291  1.00 10.11 ? 218  ALA C CA  1 
ATOM   10276 C C   . ALA C 1 218 ? 23.915  -22.579 77.080  1.00 9.87  ? 218  ALA C C   1 
ATOM   10277 O O   . ALA C 1 218 ? 22.841  -21.970 77.135  1.00 10.70 ? 218  ALA C O   1 
ATOM   10278 C CB  . ALA C 1 218 ? 23.826  -25.058 77.222  1.00 9.90  ? 218  ALA C CB  1 
ATOM   10279 N N   . LEU C 1 219 ? 25.040  -22.175 77.670  1.00 10.17 ? 219  LEU C N   1 
ATOM   10280 C CA  . LEU C 1 219 ? 25.108  -20.999 78.526  1.00 10.52 ? 219  LEU C CA  1 
ATOM   10281 C C   . LEU C 1 219 ? 25.809  -19.785 77.939  1.00 10.66 ? 219  LEU C C   1 
ATOM   10282 O O   . LEU C 1 219 ? 26.275  -18.911 78.677  1.00 12.45 ? 219  LEU C O   1 
ATOM   10283 C CB  . LEU C 1 219 ? 25.712  -21.384 79.886  1.00 10.93 ? 219  LEU C CB  1 
ATOM   10284 C CG  . LEU C 1 219 ? 25.027  -22.562 80.592  1.00 10.38 ? 219  LEU C CG  1 
ATOM   10285 C CD1 . LEU C 1 219 ? 25.779  -22.956 81.840  1.00 11.65 ? 219  LEU C CD1 1 
ATOM   10286 C CD2 . LEU C 1 219 ? 23.561  -22.247 80.878  1.00 11.18 ? 219  LEU C CD2 1 
ATOM   10287 N N   . LYS C 1 220 ? 25.755  -19.671 76.609  1.00 10.45 ? 220  LYS C N   1 
ATOM   10288 C CA  . LYS C 1 220 ? 26.347  -18.541 75.884  1.00 11.64 ? 220  LYS C CA  1 
ATOM   10289 C C   . LYS C 1 220 ? 25.830  -17.141 76.334  1.00 13.01 ? 220  LYS C C   1 
ATOM   10290 O O   . LYS C 1 220 ? 26.622  -16.204 76.371  1.00 12.18 ? 220  LYS C O   1 
ATOM   10291 C CB  . LYS C 1 220 ? 26.234  -18.739 74.359  1.00 12.86 ? 220  LYS C CB  1 
ATOM   10292 C CG  . LYS C 1 220 ? 27.024  -17.727 73.521  1.00 16.47 ? 220  LYS C CG  1 
ATOM   10293 C CD  . LYS C 1 220 ? 26.892  -17.956 72.021  1.00 19.25 ? 220  LYS C CD  1 
ATOM   10294 C CE  . LYS C 1 220 ? 27.686  -19.157 71.542  1.00 21.49 ? 220  LYS C CE  1 
ATOM   10295 N NZ  . LYS C 1 220 ? 27.682  -19.244 70.055  1.00 23.70 ? 220  LYS C NZ  1 
ATOM   10296 N N   . PRO C 1 221 ? 24.522  -16.986 76.711  1.00 13.18 ? 221  PRO C N   1 
ATOM   10297 C CA  . PRO C 1 221 ? 24.074  -15.647 77.144  1.00 13.18 ? 221  PRO C CA  1 
ATOM   10298 C C   . PRO C 1 221 ? 24.750  -15.145 78.423  1.00 13.73 ? 221  PRO C C   1 
ATOM   10299 O O   . PRO C 1 221 ? 24.791  -13.943 78.680  1.00 14.84 ? 221  PRO C O   1 
ATOM   10300 C CB  . PRO C 1 221 ? 22.592  -15.860 77.430  1.00 14.33 ? 221  PRO C CB  1 
ATOM   10301 C CG  . PRO C 1 221 ? 22.227  -16.853 76.508  1.00 14.10 ? 221  PRO C CG  1 
ATOM   10302 C CD  . PRO C 1 221 ? 23.332  -17.850 76.564  1.00 14.71 ? 221  PRO C CD  1 
ATOM   10303 N N   . PHE C 1 222 ? 25.283  -16.087 79.200  1.00 13.26 ? 222  PHE C N   1 
ATOM   10304 C CA  . PHE C 1 222 ? 25.943  -15.804 80.473  1.00 13.99 ? 222  PHE C CA  1 
ATOM   10305 C C   . PHE C 1 222 ? 27.466  -15.780 80.358  1.00 13.56 ? 222  PHE C C   1 
ATOM   10306 O O   . PHE C 1 222 ? 28.167  -15.705 81.369  1.00 15.55 ? 222  PHE C O   1 
ATOM   10307 C CB  . PHE C 1 222 ? 25.492  -16.850 81.502  1.00 14.27 ? 222  PHE C CB  1 
ATOM   10308 C CG  . PHE C 1 222 ? 24.002  -17.029 81.559  1.00 14.78 ? 222  PHE C CG  1 
ATOM   10309 C CD1 . PHE C 1 222 ? 23.211  -16.172 82.344  1.00 16.82 ? 222  PHE C CD1 1 
ATOM   10310 C CD2 . PHE C 1 222 ? 23.378  -18.043 80.809  1.00 15.01 ? 222  PHE C CD2 1 
ATOM   10311 C CE1 . PHE C 1 222 ? 21.810  -16.320 82.386  1.00 17.85 ? 222  PHE C CE1 1 
ATOM   10312 C CE2 . PHE C 1 222 ? 21.979  -18.203 80.840  1.00 15.67 ? 222  PHE C CE2 1 
ATOM   10313 C CZ  . PHE C 1 222 ? 21.194  -17.338 81.632  1.00 16.53 ? 222  PHE C CZ  1 
ATOM   10314 N N   . SER C 1 223 ? 27.960  -15.781 79.120  1.00 14.43 ? 223  SER C N   1 
ATOM   10315 C CA  . SER C 1 223 ? 29.394  -15.793 78.842  1.00 13.82 ? 223  SER C CA  1 
ATOM   10316 C C   . SER C 1 223 ? 30.054  -14.438 78.637  1.00 15.02 ? 223  SER C C   1 
ATOM   10317 O O   . SER C 1 223 ? 29.385  -13.440 78.354  1.00 14.01 ? 223  SER C O   1 
ATOM   10318 C CB  . SER C 1 223 ? 29.690  -16.664 77.616  1.00 14.87 ? 223  SER C CB  1 
ATOM   10319 O OG  . SER C 1 223 ? 29.272  -16.036 76.411  1.00 15.37 ? 223  SER C OG  1 
ATOM   10320 N N   . GLN C 1 224 ? 31.380  -14.429 78.778  1.00 14.48 ? 224  GLN C N   1 
ATOM   10321 C CA  . GLN C 1 224 ? 32.187  -13.234 78.545  1.00 14.85 ? 224  GLN C CA  1 
ATOM   10322 C C   . GLN C 1 224 ? 32.527  -13.332 77.054  1.00 14.83 ? 224  GLN C C   1 
ATOM   10323 O O   . GLN C 1 224 ? 33.292  -14.205 76.622  1.00 14.91 ? 224  GLN C O   1 
ATOM   10324 C CB  . GLN C 1 224 ? 33.447  -13.229 79.409  1.00 15.15 ? 224  GLN C CB  1 
ATOM   10325 C CG  . GLN C 1 224 ? 34.211  -11.911 79.333  1.00 16.58 ? 224  GLN C CG  1 
ATOM   10326 C CD  . GLN C 1 224 ? 35.327  -11.814 80.343  1.00 15.70 ? 224  GLN C CD  1 
ATOM   10327 O OE1 . GLN C 1 224 ? 35.094  -11.896 81.548  1.00 18.32 ? 224  GLN C OE1 1 
ATOM   10328 N NE2 . GLN C 1 224 ? 36.549  -11.607 79.859  1.00 16.86 ? 224  GLN C NE2 1 
ATOM   10329 N N   . ARG C 1 225 ? 31.897  -12.449 76.286  1.00 14.99 ? 225  ARG C N   1 
ATOM   10330 C CA  . ARG C 1 225 ? 32.008  -12.393 74.832  1.00 16.20 ? 225  ARG C CA  1 
ATOM   10331 C C   . ARG C 1 225 ? 33.362  -12.101 74.192  1.00 17.23 ? 225  ARG C C   1 
ATOM   10332 O O   . ARG C 1 225 ? 33.583  -12.486 73.040  1.00 18.41 ? 225  ARG C O   1 
ATOM   10333 C CB  . ARG C 1 225 ? 30.944  -11.441 74.274  1.00 16.64 ? 225  ARG C CB  1 
ATOM   10334 C CG  . ARG C 1 225 ? 29.499  -11.773 74.679  1.00 18.13 ? 225  ARG C CG  1 
ATOM   10335 C CD  . ARG C 1 225 ? 28.995  -13.061 74.043  1.00 17.14 ? 225  ARG C CD  1 
ATOM   10336 N NE  . ARG C 1 225 ? 27.567  -13.270 74.295  1.00 17.77 ? 225  ARG C NE  1 
ATOM   10337 C CZ  . ARG C 1 225 ? 26.719  -13.824 73.428  1.00 15.88 ? 225  ARG C CZ  1 
ATOM   10338 N NH1 . ARG C 1 225 ? 27.144  -14.234 72.239  1.00 15.73 ? 225  ARG C NH1 1 
ATOM   10339 N NH2 . ARG C 1 225 ? 25.440  -13.963 73.749  1.00 13.29 ? 225  ARG C NH2 1 
ATOM   10340 N N   . ASP C 1 226 ? 34.282  -11.471 74.929  1.00 17.30 ? 226  ASP C N   1 
ATOM   10341 C CA  . ASP C 1 226 ? 35.601  -11.162 74.365  1.00 18.44 ? 226  ASP C CA  1 
ATOM   10342 C C   . ASP C 1 226 ? 36.593  -12.332 74.362  1.00 19.53 ? 226  ASP C C   1 
ATOM   10343 O O   . ASP C 1 226 ? 37.730  -12.194 73.908  1.00 19.78 ? 226  ASP C O   1 
ATOM   10344 C CB  . ASP C 1 226 ? 36.210  -9.878  74.973  1.00 19.88 ? 226  ASP C CB  1 
ATOM   10345 C CG  . ASP C 1 226 ? 36.471  -9.962  76.481  1.00 21.70 ? 226  ASP C CG  1 
ATOM   10346 O OD1 . ASP C 1 226 ? 36.537  -11.066 77.059  1.00 21.53 ? 226  ASP C OD1 1 
ATOM   10347 O OD2 . ASP C 1 226 ? 36.648  -8.883  77.092  1.00 24.53 ? 226  ASP C OD2 1 
ATOM   10348 N N   . LEU C 1 227 ? 36.151  -13.474 74.896  1.00 18.80 ? 227  LEU C N   1 
ATOM   10349 C CA  . LEU C 1 227 ? 36.959  -14.689 74.942  1.00 19.34 ? 227  LEU C CA  1 
ATOM   10350 C C   . LEU C 1 227 ? 36.436  -15.678 73.901  1.00 20.02 ? 227  LEU C C   1 
ATOM   10351 O O   . LEU C 1 227 ? 35.251  -16.008 73.898  1.00 23.26 ? 227  LEU C O   1 
ATOM   10352 C CB  . LEU C 1 227 ? 36.912  -15.328 76.336  1.00 19.06 ? 227  LEU C CB  1 
ATOM   10353 C CG  . LEU C 1 227 ? 37.570  -14.599 77.512  1.00 19.86 ? 227  LEU C CG  1 
ATOM   10354 C CD1 . LEU C 1 227 ? 37.165  -15.265 78.817  1.00 20.30 ? 227  LEU C CD1 1 
ATOM   10355 C CD2 . LEU C 1 227 ? 39.089  -14.594 77.362  1.00 19.26 ? 227  LEU C CD2 1 
ATOM   10356 N N   . SER C 1 228 ? 37.316  -16.105 72.999  1.00 18.08 ? 228  SER C N   1 
ATOM   10357 C CA  . SER C 1 228 ? 36.953  -17.064 71.955  1.00 17.67 ? 228  SER C CA  1 
ATOM   10358 C C   . SER C 1 228 ? 37.311  -18.473 72.414  1.00 16.89 ? 228  SER C C   1 
ATOM   10359 O O   . SER C 1 228 ? 38.461  -18.742 72.763  1.00 16.48 ? 228  SER C O   1 
ATOM   10360 C CB  . SER C 1 228 ? 37.673  -16.736 70.645  1.00 17.96 ? 228  SER C CB  1 
ATOM   10361 O OG  . SER C 1 228 ? 37.265  -15.473 70.143  1.00 22.15 ? 228  SER C OG  1 
ATOM   10362 N N   . LEU C 1 229 ? 36.307  -19.345 72.458  1.00 16.50 ? 229  LEU C N   1 
ATOM   10363 C CA  . LEU C 1 229 ? 36.482  -20.737 72.883  1.00 15.80 ? 229  LEU C CA  1 
ATOM   10364 C C   . LEU C 1 229 ? 36.615  -21.658 71.679  1.00 14.98 ? 229  LEU C C   1 
ATOM   10365 O O   . LEU C 1 229 ? 35.862  -21.542 70.707  1.00 15.61 ? 229  LEU C O   1 
ATOM   10366 C CB  . LEU C 1 229 ? 35.299  -21.188 73.741  1.00 17.58 ? 229  LEU C CB  1 
ATOM   10367 C CG  . LEU C 1 229 ? 34.836  -20.244 74.851  1.00 20.74 ? 229  LEU C CG  1 
ATOM   10368 C CD1 . LEU C 1 229 ? 33.583  -20.798 75.447  1.00 21.49 ? 229  LEU C CD1 1 
ATOM   10369 C CD2 . LEU C 1 229 ? 35.918  -20.020 75.903  1.00 21.13 ? 229  LEU C CD2 1 
ATOM   10370 N N   . HIS C 1 230 ? 37.623  -22.528 71.728  1.00 13.56 ? 230  HIS C N   1 
ATOM   10371 C CA  . HIS C 1 230 ? 37.911  -23.494 70.661  1.00 13.10 ? 230  HIS C CA  1 
ATOM   10372 C C   . HIS C 1 230 ? 38.024  -24.874 71.296  1.00 13.01 ? 230  HIS C C   1 
ATOM   10373 O O   . HIS C 1 230 ? 38.474  -25.001 72.439  1.00 12.34 ? 230  HIS C O   1 
ATOM   10374 C CB  . HIS C 1 230 ? 39.223  -23.146 69.946  1.00 14.21 ? 230  HIS C CB  1 
ATOM   10375 C CG  . HIS C 1 230 ? 39.301  -21.727 69.470  1.00 13.78 ? 230  HIS C CG  1 
ATOM   10376 N ND1 . HIS C 1 230 ? 38.908  -21.340 68.209  1.00 15.36 ? 230  HIS C ND1 1 
ATOM   10377 C CD2 . HIS C 1 230 ? 39.699  -20.597 70.105  1.00 14.70 ? 230  HIS C CD2 1 
ATOM   10378 C CE1 . HIS C 1 230 ? 39.055  -20.032 68.087  1.00 15.55 ? 230  HIS C CE1 1 
ATOM   10379 N NE2 . HIS C 1 230 ? 39.533  -19.558 69.223  1.00 16.17 ? 230  HIS C NE2 1 
ATOM   10380 N N   . PHE C 1 231 ? 37.555  -25.898 70.580  1.00 13.07 ? 231  PHE C N   1 
ATOM   10381 C CA  . PHE C 1 231 ? 37.573  -27.272 71.081  1.00 13.46 ? 231  PHE C CA  1 
ATOM   10382 C C   . PHE C 1 231 ? 38.224  -28.260 70.114  1.00 15.07 ? 231  PHE C C   1 
ATOM   10383 O O   . PHE C 1 231 ? 37.642  -28.618 69.081  1.00 17.58 ? 231  PHE C O   1 
ATOM   10384 C CB  . PHE C 1 231 ? 36.144  -27.732 71.443  1.00 14.14 ? 231  PHE C CB  1 
ATOM   10385 C CG  . PHE C 1 231 ? 35.487  -26.902 72.524  1.00 14.45 ? 231  PHE C CG  1 
ATOM   10386 C CD1 . PHE C 1 231 ? 35.641  -27.238 73.880  1.00 14.39 ? 231  PHE C CD1 1 
ATOM   10387 C CD2 . PHE C 1 231 ? 34.747  -25.745 72.191  1.00 14.71 ? 231  PHE C CD2 1 
ATOM   10388 C CE1 . PHE C 1 231 ? 35.076  -26.429 74.906  1.00 15.17 ? 231  PHE C CE1 1 
ATOM   10389 C CE2 . PHE C 1 231 ? 34.176  -24.925 73.202  1.00 15.42 ? 231  PHE C CE2 1 
ATOM   10390 C CZ  . PHE C 1 231 ? 34.343  -25.269 74.568  1.00 15.96 ? 231  PHE C CZ  1 
ATOM   10391 N N   . VAL C 1 232 ? 39.453  -28.662 70.445  1.00 13.06 ? 232  VAL C N   1 
ATOM   10392 C CA  . VAL C 1 232 ? 40.222  -29.626 69.655  1.00 12.73 ? 232  VAL C CA  1 
ATOM   10393 C C   . VAL C 1 232 ? 39.974  -30.988 70.299  1.00 13.20 ? 232  VAL C C   1 
ATOM   10394 O O   . VAL C 1 232 ? 40.235  -31.175 71.487  1.00 15.50 ? 232  VAL C O   1 
ATOM   10395 C CB  . VAL C 1 232 ? 41.743  -29.286 69.661  1.00 12.85 ? 232  VAL C CB  1 
ATOM   10396 C CG1 . VAL C 1 232 ? 42.557  -30.377 68.971  1.00 13.43 ? 232  VAL C CG1 1 
ATOM   10397 C CG2 . VAL C 1 232 ? 41.979  -27.989 68.946  1.00 12.97 ? 232  VAL C CG2 1 
ATOM   10398 N N   . SER C 1 233 ? 39.459  -31.929 69.514  1.00 12.13 ? 233  SER C N   1 
ATOM   10399 C CA  . SER C 1 233 ? 39.154  -33.252 70.041  1.00 11.15 ? 233  SER C CA  1 
ATOM   10400 C C   . SER C 1 233 ? 39.588  -34.402 69.165  1.00 11.83 ? 233  SER C C   1 
ATOM   10401 O O   . SER C 1 233 ? 40.233  -35.341 69.637  1.00 12.19 ? 233  SER C O   1 
ATOM   10402 C CB  . SER C 1 233 ? 37.656  -33.366 70.351  1.00 11.80 ? 233  SER C CB  1 
ATOM   10403 O OG  . SER C 1 233 ? 36.859  -33.060 69.227  1.00 13.25 ? 233  SER C OG  1 
ATOM   10404 N N   . ASN C 1 234 ? 39.225  -34.325 67.890  1.00 10.98 ? 234  ASN C N   1 
ATOM   10405 C CA  . ASN C 1 234 ? 39.559  -35.352 66.908  1.00 11.16 ? 234  ASN C CA  1 
ATOM   10406 C C   . ASN C 1 234 ? 41.067  -35.376 66.647  1.00 11.86 ? 234  ASN C C   1 
ATOM   10407 O O   . ASN C 1 234 ? 41.710  -34.328 66.672  1.00 11.53 ? 234  ASN C O   1 
ATOM   10408 C CB  . ASN C 1 234 ? 38.828  -35.041 65.599  1.00 11.52 ? 234  ASN C CB  1 
ATOM   10409 C CG  . ASN C 1 234 ? 38.538  -36.276 64.771  1.00 11.36 ? 234  ASN C CG  1 
ATOM   10410 O OD1 . ASN C 1 234 ? 39.220  -37.299 64.879  1.00 12.24 ? 234  ASN C OD1 1 
ATOM   10411 N ND2 . ASN C 1 234 ? 37.528  -36.176 63.915  1.00 11.02 ? 234  ASN C ND2 1 
ATOM   10412 N N   . VAL C 1 235 ? 41.620  -36.574 66.434  1.00 11.77 ? 235  VAL C N   1 
ATOM   10413 C CA  . VAL C 1 235 ? 43.049  -36.715 66.122  1.00 11.83 ? 235  VAL C CA  1 
ATOM   10414 C C   . VAL C 1 235 ? 43.281  -36.372 64.648  1.00 12.64 ? 235  VAL C C   1 
ATOM   10415 O O   . VAL C 1 235 ? 44.421  -36.237 64.209  1.00 13.13 ? 235  VAL C O   1 
ATOM   10416 C CB  . VAL C 1 235 ? 43.613  -38.121 66.480  1.00 12.68 ? 235  VAL C CB  1 
ATOM   10417 C CG1 . VAL C 1 235 ? 42.947  -39.214 65.697  1.00 13.69 ? 235  VAL C CG1 1 
ATOM   10418 C CG2 . VAL C 1 235 ? 45.138  -38.168 66.375  1.00 13.40 ? 235  VAL C CG2 1 
ATOM   10419 N N   . ASP C 1 236 ? 42.189  -36.244 63.892  1.00 11.05 ? 236  ASP C N   1 
ATOM   10420 C CA  . ASP C 1 236 ? 42.251  -35.838 62.485  1.00 12.02 ? 236  ASP C CA  1 
ATOM   10421 C C   . ASP C 1 236 ? 42.978  -34.488 62.516  1.00 11.45 ? 236  ASP C C   1 
ATOM   10422 O O   . ASP C 1 236 ? 42.558  -33.581 63.240  1.00 12.23 ? 236  ASP C O   1 
ATOM   10423 C CB  . ASP C 1 236 ? 40.827  -35.636 61.944  1.00 10.53 ? 236  ASP C CB  1 
ATOM   10424 C CG  . ASP C 1 236 ? 40.780  -35.287 60.457  1.00 12.90 ? 236  ASP C CG  1 
ATOM   10425 O OD1 . ASP C 1 236 ? 41.823  -35.002 59.829  1.00 12.34 ? 236  ASP C OD1 1 
ATOM   10426 O OD2 . ASP C 1 236 ? 39.658  -35.285 59.914  1.00 13.08 ? 236  ASP C OD2 1 
ATOM   10427 N N   . GLY C 1 237 ? 44.093  -34.409 61.779  1.00 11.83 ? 237  GLY C N   1 
ATOM   10428 C CA  . GLY C 1 237 ? 44.923  -33.206 61.708  1.00 12.24 ? 237  GLY C CA  1 
ATOM   10429 C C   . GLY C 1 237 ? 44.179  -31.918 61.438  1.00 12.05 ? 237  GLY C C   1 
ATOM   10430 O O   . GLY C 1 237 ? 44.607  -30.841 61.831  1.00 12.27 ? 237  GLY C O   1 
ATOM   10431 N N   . THR C 1 238 ? 43.017  -32.073 60.814  1.00 11.80 ? 238  THR C N   1 
ATOM   10432 C CA  . THR C 1 238 ? 42.117  -30.984 60.489  1.00 11.80 ? 238  THR C CA  1 
ATOM   10433 C C   . THR C 1 238 ? 41.685  -30.177 61.716  1.00 11.53 ? 238  THR C C   1 
ATOM   10434 O O   . THR C 1 238 ? 41.613  -28.947 61.641  1.00 12.76 ? 238  THR C O   1 
ATOM   10435 C CB  . THR C 1 238 ? 40.888  -31.559 59.770  1.00 10.89 ? 238  THR C CB  1 
ATOM   10436 O OG1 . THR C 1 238 ? 41.258  -31.924 58.435  1.00 12.82 ? 238  THR C OG1 1 
ATOM   10437 C CG2 . THR C 1 238 ? 39.709  -30.596 59.757  1.00 11.55 ? 238  THR C CG2 1 
ATOM   10438 N N   . HIS C 1 239 ? 41.424  -30.865 62.834  1.00 12.09 ? 239  HIS C N   1 
ATOM   10439 C CA  . HIS C 1 239 ? 40.975  -30.196 64.054  1.00 13.20 ? 239  HIS C CA  1 
ATOM   10440 C C   . HIS C 1 239 ? 41.999  -29.211 64.620  1.00 13.25 ? 239  HIS C C   1 
ATOM   10441 O O   . HIS C 1 239 ? 41.674  -28.055 64.922  1.00 14.70 ? 239  HIS C O   1 
ATOM   10442 C CB  . HIS C 1 239 ? 40.504  -31.193 65.117  1.00 13.30 ? 239  HIS C CB  1 
ATOM   10443 C CG  . HIS C 1 239 ? 39.106  -30.886 65.643  1.00 13.28 ? 239  HIS C CG  1 
ATOM   10444 N ND1 . HIS C 1 239 ? 38.504  -31.665 66.626  1.00 13.22 ? 239  HIS C ND1 1 
ATOM   10445 C CD2 . HIS C 1 239 ? 38.217  -29.910 65.329  1.00 16.84 ? 239  HIS C CD2 1 
ATOM   10446 C CE1 . HIS C 1 239 ? 37.310  -31.160 66.873  1.00 14.71 ? 239  HIS C CE1 1 
ATOM   10447 N NE2 . HIS C 1 239 ? 37.123  -30.114 66.108  1.00 17.00 ? 239  HIS C NE2 1 
ATOM   10448 N N   . ILE C 1 240 ? 43.230  -29.629 64.774  1.00 14.65 ? 240  ILE C N   1 
ATOM   10449 C CA  . ILE C 1 240 ? 44.249  -28.719 65.320  1.00 15.27 ? 240  ILE C CA  1 
ATOM   10450 C C   . ILE C 1 240 ? 44.635  -27.666 64.260  1.00 14.51 ? 240  ILE C C   1 
ATOM   10451 O O   . ILE C 1 240 ? 44.920  -26.504 64.583  1.00 15.76 ? 240  ILE C O   1 
ATOM   10452 C CB  . ILE C 1 240 ? 45.479  -29.504 65.787  1.00 16.50 ? 240  ILE C CB  1 
ATOM   10453 C CG1 . ILE C 1 240 ? 46.589  -28.603 66.342  1.00 21.46 ? 240  ILE C CG1 1 
ATOM   10454 C CG2 . ILE C 1 240 ? 46.128  -30.328 64.678  1.00 18.14 ? 240  ILE C CG2 1 
ATOM   10455 C CD1 . ILE C 1 240 ? 46.737  -28.694 67.864  1.00 23.71 ? 240  ILE C CD1 1 
ATOM   10456 N N   . ALA C 1 241 ? 44.617  -28.093 63.007  1.00 13.74 ? 241  ALA C N   1 
ATOM   10457 C CA  . ALA C 1 241 ? 44.986  -27.234 61.860  1.00 13.91 ? 241  ALA C CA  1 
ATOM   10458 C C   . ALA C 1 241 ? 44.055  -26.014 61.743  1.00 14.04 ? 241  ALA C C   1 
ATOM   10459 O O   . ALA C 1 241 ? 44.509  -24.873 61.580  1.00 14.28 ? 241  ALA C O   1 
ATOM   10460 C CB  . ALA C 1 241 ? 44.900  -28.024 60.552  1.00 14.95 ? 241  ALA C CB  1 
ATOM   10461 N N   . GLU C 1 242 ? 42.758  -26.271 61.831  1.00 13.42 ? 242  GLU C N   1 
ATOM   10462 C CA  . GLU C 1 242 ? 41.741  -25.210 61.686  1.00 12.52 ? 242  GLU C CA  1 
ATOM   10463 C C   . GLU C 1 242 ? 41.742  -24.262 62.880  1.00 12.95 ? 242  GLU C C   1 
ATOM   10464 O O   . GLU C 1 242 ? 41.491  -23.066 62.723  1.00 13.89 ? 242  GLU C O   1 
ATOM   10465 C CB  . GLU C 1 242 ? 40.347  -25.812 61.491  1.00 13.39 ? 242  GLU C CB  1 
ATOM   10466 C CG  . GLU C 1 242 ? 40.157  -26.457 60.106  1.00 12.97 ? 242  GLU C CG  1 
ATOM   10467 C CD  . GLU C 1 242 ? 40.172  -25.457 58.936  1.00 14.40 ? 242  GLU C CD  1 
ATOM   10468 O OE1 . GLU C 1 242 ? 39.901  -24.214 59.137  1.00 15.77 ? 242  GLU C OE1 1 
ATOM   10469 O OE2 . GLU C 1 242 ? 40.456  -25.865 57.742  1.00 14.10 ? 242  GLU C OE2 1 
ATOM   10470 N N   . VAL C 1 243 ? 42.072  -24.789 64.060  1.00 12.72 ? 243  VAL C N   1 
ATOM   10471 C CA  . VAL C 1 243 ? 42.150  -23.970 65.267  1.00 12.95 ? 243  VAL C CA  1 
ATOM   10472 C C   . VAL C 1 243 ? 43.398  -23.076 65.202  1.00 12.50 ? 243  VAL C C   1 
ATOM   10473 O O   . VAL C 1 243 ? 43.332  -21.910 65.587  1.00 14.03 ? 243  VAL C O   1 
ATOM   10474 C CB  . VAL C 1 243 ? 42.084  -24.841 66.556  1.00 12.52 ? 243  VAL C CB  1 
ATOM   10475 C CG1 . VAL C 1 243 ? 42.505  -24.058 67.799  1.00 14.00 ? 243  VAL C CG1 1 
ATOM   10476 C CG2 . VAL C 1 243 ? 40.653  -25.321 66.756  1.00 13.53 ? 243  VAL C CG2 1 
ATOM   10477 N N   . LEU C 1 244 ? 44.490  -23.593 64.630  1.00 14.07 ? 244  LEU C N   1 
ATOM   10478 C CA  . LEU C 1 244 ? 45.727  -22.816 64.481  1.00 14.54 ? 244  LEU C CA  1 
ATOM   10479 C C   . LEU C 1 244 ? 45.552  -21.647 63.505  1.00 15.91 ? 244  LEU C C   1 
ATOM   10480 O O   . LEU C 1 244 ? 46.194  -20.607 63.652  1.00 16.62 ? 244  LEU C O   1 
ATOM   10481 C CB  . LEU C 1 244 ? 46.908  -23.703 64.063  1.00 15.48 ? 244  LEU C CB  1 
ATOM   10482 C CG  . LEU C 1 244 ? 47.446  -24.708 65.093  1.00 15.12 ? 244  LEU C CG  1 
ATOM   10483 C CD1 . LEU C 1 244 ? 48.633  -25.453 64.505  1.00 16.85 ? 244  LEU C CD1 1 
ATOM   10484 C CD2 . LEU C 1 244 ? 47.823  -24.031 66.406  1.00 16.28 ? 244  LEU C CD2 1 
ATOM   10485 N N   . LYS C 1 245 ? 44.608  -21.801 62.575  1.00 16.07 ? 245  LYS C N   1 
ATOM   10486 C CA  . LYS C 1 245 ? 44.283  -20.768 61.585  1.00 18.44 ? 245  LYS C CA  1 
ATOM   10487 C C   . LYS C 1 245 ? 43.352  -19.703 62.176  1.00 19.52 ? 245  LYS C C   1 
ATOM   10488 O O   . LYS C 1 245 ? 43.331  -18.564 61.707  1.00 20.93 ? 245  LYS C O   1 
ATOM   10489 C CB  . LYS C 1 245 ? 43.605  -21.386 60.351  1.00 18.29 ? 245  LYS C CB  1 
ATOM   10490 C CG  . LYS C 1 245 ? 44.436  -22.414 59.594  1.00 20.16 ? 245  LYS C CG  1 
ATOM   10491 C CD  . LYS C 1 245 ? 43.797  -22.764 58.254  1.00 22.65 ? 245  LYS C CD  1 
ATOM   10492 C CE  . LYS C 1 245 ? 44.676  -23.715 57.444  1.00 23.84 ? 245  LYS C CE  1 
ATOM   10493 N NZ  . LYS C 1 245 ? 44.420  -23.634 55.978  1.00 26.29 ? 245  LYS C NZ  1 
ATOM   10494 N N   . SER C 1 246 ? 42.618  -20.079 63.226  1.00 20.16 ? 246  SER C N   1 
ATOM   10495 C CA  . SER C 1 246 ? 41.646  -19.203 63.892  1.00 21.82 ? 246  SER C CA  1 
ATOM   10496 C C   . SER C 1 246 ? 42.156  -18.428 65.112  1.00 22.10 ? 246  SER C C   1 
ATOM   10497 O O   . SER C 1 246 ? 41.520  -17.465 65.551  1.00 24.32 ? 246  SER C O   1 
ATOM   10498 C CB  . SER C 1 246 ? 40.425  -20.030 64.312  1.00 23.43 ? 246  SER C CB  1 
ATOM   10499 O OG  . SER C 1 246 ? 39.894  -20.749 63.213  1.00 26.29 ? 246  SER C OG  1 
ATOM   10500 N N   . ILE C 1 247 ? 43.299  -18.828 65.654  1.00 21.30 ? 247  ILE C N   1 
ATOM   10501 C CA  . ILE C 1 247 ? 43.826  -18.173 66.844  1.00 20.70 ? 247  ILE C CA  1 
ATOM   10502 C C   . ILE C 1 247 ? 45.065  -17.303 66.601  1.00 20.98 ? 247  ILE C C   1 
ATOM   10503 O O   . ILE C 1 247 ? 45.705  -17.377 65.544  1.00 22.15 ? 247  ILE C O   1 
ATOM   10504 C CB  . ILE C 1 247 ? 44.250  -19.222 67.932  1.00 20.05 ? 247  ILE C CB  1 
ATOM   10505 C CG1 . ILE C 1 247 ? 45.356  -20.154 67.429  1.00 19.60 ? 247  ILE C CG1 1 
ATOM   10506 C CG2 . ILE C 1 247 ? 43.094  -20.123 68.371  1.00 19.81 ? 247  ILE C CG2 1 
ATOM   10507 C CD1 . ILE C 1 247 ? 45.972  -21.011 68.531  1.00 19.71 ? 247  ILE C CD1 1 
ATOM   10508 N N   . ASP C 1 248 ? 45.297  -16.508 67.637  1.00 21.43 ? 248  ASP C N   1 
ATOM   10509 C CA  . ASP C 1 248 ? 46.479  -15.650 67.818  1.00 21.67 ? 248  ASP C CA  1 
ATOM   10510 C C   . ASP C 1 248 ? 47.217  -16.303 68.982  1.00 20.41 ? 248  ASP C C   1 
ATOM   10511 O O   . ASP C 1 248 ? 46.939  -16.019 70.152  1.00 20.33 ? 248  ASP C O   1 
ATOM   10512 C CB  . ASP C 1 248 ? 46.036  -14.212 68.138  1.00 24.74 ? 248  ASP C CB  1 
ATOM   10513 C CG  . ASP C 1 248 ? 47.189  -13.295 68.574  1.00 28.56 ? 248  ASP C CG  1 
ATOM   10514 O OD1 . ASP C 1 248 ? 48.410  -13.700 68.483  1.00 30.25 ? 248  ASP C OD1 1 
ATOM   10515 O OD2 . ASP C 1 248 ? 46.938  -12.113 69.031  1.00 31.05 ? 248  ASP C OD2 1 
ATOM   10516 N N   . ILE C 1 249 ? 48.119  -17.185 68.613  1.00 20.50 ? 249  ILE C N   1 
ATOM   10517 C CA  . ILE C 1 249 ? 48.809  -18.069 69.563  1.00 18.92 ? 249  ILE C CA  1 
ATOM   10518 C C   . ILE C 1 249 ? 49.484  -17.348 70.744  1.00 19.35 ? 249  ILE C C   1 
ATOM   10519 O O   . ILE C 1 249 ? 49.645  -17.925 71.825  1.00 17.34 ? 249  ILE C O   1 
ATOM   10520 C CB  . ILE C 1 249 ? 49.790  -18.986 68.824  1.00 19.83 ? 249  ILE C CB  1 
ATOM   10521 C CG1 . ILE C 1 249 ? 50.215  -20.197 69.667  1.00 20.70 ? 249  ILE C CG1 1 
ATOM   10522 C CG2 . ILE C 1 249 ? 51.072  -18.290 68.395  1.00 21.06 ? 249  ILE C CG2 1 
ATOM   10523 C CD1 . ILE C 1 249 ? 50.389  -21.479 68.849  1.00 20.94 ? 249  ILE C CD1 1 
ATOM   10524 N N   . GLU C 1 250 ? 49.832  -16.077 70.545  1.00 19.81 ? 250  GLU C N   1 
ATOM   10525 C CA  . GLU C 1 250 ? 50.456  -15.256 71.597  1.00 20.73 ? 250  GLU C CA  1 
ATOM   10526 C C   . GLU C 1 250 ? 49.492  -15.012 72.751  1.00 18.89 ? 250  GLU C C   1 
ATOM   10527 O O   . GLU C 1 250 ? 49.898  -14.873 73.913  1.00 19.15 ? 250  GLU C O   1 
ATOM   10528 C CB  . GLU C 1 250 ? 50.837  -13.881 71.051  1.00 23.11 ? 250  GLU C CB  1 
ATOM   10529 C CG  . GLU C 1 250 ? 52.229  -13.773 70.487  1.00 27.17 ? 250  GLU C CG  1 
ATOM   10530 C CD  . GLU C 1 250 ? 52.528  -12.381 69.919  1.00 28.89 ? 250  GLU C CD  1 
ATOM   10531 O OE1 . GLU C 1 250 ? 51.837  -11.958 68.959  1.00 31.21 ? 250  GLU C OE1 1 
ATOM   10532 O OE2 . GLU C 1 250 ? 53.444  -11.698 70.438  1.00 30.08 ? 250  GLU C OE2 1 
ATOM   10533 N N   . ALA C 1 251 ? 48.211  -14.947 72.388  1.00 17.54 ? 251  ALA C N   1 
ATOM   10534 C CA  . ALA C 1 251 ? 47.110  -14.699 73.309  1.00 15.92 ? 251  ALA C CA  1 
ATOM   10535 C C   . ALA C 1 251 ? 46.247  -15.940 73.497  1.00 15.70 ? 251  ALA C C   1 
ATOM   10536 O O   . ALA C 1 251 ? 45.043  -15.827 73.739  1.00 15.97 ? 251  ALA C O   1 
ATOM   10537 C CB  . ALA C 1 251 ? 46.254  -13.549 72.774  1.00 17.07 ? 251  ALA C CB  1 
ATOM   10538 N N   . THR C 1 252 ? 46.864  -17.117 73.397  1.00 14.60 ? 252  THR C N   1 
ATOM   10539 C CA  . THR C 1 252 ? 46.127  -18.373 73.542  1.00 15.41 ? 252  THR C CA  1 
ATOM   10540 C C   . THR C 1 252 ? 46.534  -19.219 74.740  1.00 14.89 ? 252  THR C C   1 
ATOM   10541 O O   . THR C 1 252 ? 47.720  -19.408 75.019  1.00 16.53 ? 252  THR C O   1 
ATOM   10542 C CB  . THR C 1 252 ? 46.227  -19.251 72.253  1.00 14.01 ? 252  THR C CB  1 
ATOM   10543 O OG1 . THR C 1 252 ? 45.713  -18.519 71.133  1.00 13.53 ? 252  THR C OG1 1 
ATOM   10544 C CG2 . THR C 1 252 ? 45.443  -20.557 72.381  1.00 14.68 ? 252  THR C CG2 1 
ATOM   10545 N N   . LEU C 1 253 ? 45.514  -19.710 75.440  1.00 14.96 ? 253  LEU C N   1 
ATOM   10546 C CA  . LEU C 1 253 ? 45.691  -20.611 76.566  1.00 15.23 ? 253  LEU C CA  1 
ATOM   10547 C C   . LEU C 1 253 ? 45.204  -21.970 76.080  1.00 15.08 ? 253  LEU C C   1 
ATOM   10548 O O   . LEU C 1 253 ? 44.083  -22.094 75.575  1.00 14.57 ? 253  LEU C O   1 
ATOM   10549 C CB  . LEU C 1 253 ? 44.864  -20.175 77.781  1.00 15.62 ? 253  LEU C CB  1 
ATOM   10550 C CG  . LEU C 1 253 ? 44.752  -21.182 78.940  1.00 16.13 ? 253  LEU C CG  1 
ATOM   10551 C CD1 . LEU C 1 253 ? 46.131  -21.504 79.532  1.00 16.82 ? 253  LEU C CD1 1 
ATOM   10552 C CD2 . LEU C 1 253 ? 43.813  -20.631 79.987  1.00 18.05 ? 253  LEU C CD2 1 
ATOM   10553 N N   . PHE C 1 254 ? 46.069  -22.970 76.206  1.00 14.37 ? 254  PHE C N   1 
ATOM   10554 C CA  . PHE C 1 254 ? 45.736  -24.334 75.825  1.00 13.91 ? 254  PHE C CA  1 
ATOM   10555 C C   . PHE C 1 254 ? 45.439  -25.111 77.096  1.00 14.71 ? 254  PHE C C   1 
ATOM   10556 O O   . PHE C 1 254 ? 46.195  -25.056 78.069  1.00 15.19 ? 254  PHE C O   1 
ATOM   10557 C CB  . PHE C 1 254 ? 46.884  -25.001 75.081  1.00 14.04 ? 254  PHE C CB  1 
ATOM   10558 C CG  . PHE C 1 254 ? 47.184  -24.398 73.743  1.00 14.43 ? 254  PHE C CG  1 
ATOM   10559 C CD1 . PHE C 1 254 ? 46.458  -24.791 72.605  1.00 15.15 ? 254  PHE C CD1 1 
ATOM   10560 C CD2 . PHE C 1 254 ? 48.223  -23.455 73.601  1.00 14.76 ? 254  PHE C CD2 1 
ATOM   10561 C CE1 . PHE C 1 254 ? 46.756  -24.257 71.326  1.00 15.87 ? 254  PHE C CE1 1 
ATOM   10562 C CE2 . PHE C 1 254 ? 48.542  -22.910 72.330  1.00 16.62 ? 254  PHE C CE2 1 
ATOM   10563 C CZ  . PHE C 1 254 ? 47.805  -23.313 71.187  1.00 16.54 ? 254  PHE C CZ  1 
ATOM   10564 N N   . ILE C 1 255 ? 44.290  -25.773 77.101  1.00 13.58 ? 255  ILE C N   1 
ATOM   10565 C CA  . ILE C 1 255 ? 43.850  -26.565 78.235  1.00 13.18 ? 255  ILE C CA  1 
ATOM   10566 C C   . ILE C 1 255 ? 43.860  -28.035 77.813  1.00 13.46 ? 255  ILE C C   1 
ATOM   10567 O O   . ILE C 1 255 ? 43.082  -28.432 76.949  1.00 15.02 ? 255  ILE C O   1 
ATOM   10568 C CB  . ILE C 1 255 ? 42.412  -26.160 78.685  1.00 12.47 ? 255  ILE C CB  1 
ATOM   10569 C CG1 . ILE C 1 255 ? 42.340  -24.666 79.037  1.00 12.84 ? 255  ILE C CG1 1 
ATOM   10570 C CG2 . ILE C 1 255 ? 41.998  -26.967 79.880  1.00 15.16 ? 255  ILE C CG2 1 
ATOM   10571 C CD1 . ILE C 1 255 ? 40.967  -24.188 79.491  1.00 13.84 ? 255  ILE C CD1 1 
ATOM   10572 N N   . VAL C 1 256 ? 44.752  -28.829 78.406  1.00 12.40 ? 256  VAL C N   1 
ATOM   10573 C CA  . VAL C 1 256 ? 44.827  -30.256 78.086  1.00 12.88 ? 256  VAL C CA  1 
ATOM   10574 C C   . VAL C 1 256 ? 43.974  -31.023 79.101  1.00 13.01 ? 256  VAL C C   1 
ATOM   10575 O O   . VAL C 1 256 ? 44.340  -31.176 80.271  1.00 13.36 ? 256  VAL C O   1 
ATOM   10576 C CB  . VAL C 1 256 ? 46.291  -30.790 78.046  1.00 13.35 ? 256  VAL C CB  1 
ATOM   10577 C CG1 . VAL C 1 256 ? 46.321  -32.189 77.416  1.00 13.74 ? 256  VAL C CG1 1 
ATOM   10578 C CG2 . VAL C 1 256 ? 47.186  -29.855 77.243  1.00 13.20 ? 256  VAL C CG2 1 
ATOM   10579 N N   . ALA C 1 257 ? 42.814  -31.469 78.626  1.00 12.67 ? 257  ALA C N   1 
ATOM   10580 C CA  . ALA C 1 257 ? 41.838  -32.191 79.430  1.00 12.95 ? 257  ALA C CA  1 
ATOM   10581 C C   . ALA C 1 257 ? 41.852  -33.691 79.154  1.00 12.78 ? 257  ALA C C   1 
ATOM   10582 O O   . ALA C 1 257 ? 41.527  -34.133 78.049  1.00 14.39 ? 257  ALA C O   1 
ATOM   10583 C CB  . ALA C 1 257 ? 40.453  -31.613 79.163  1.00 12.94 ? 257  ALA C CB  1 
ATOM   10584 N N   . SER C 1 258 ? 42.213  -34.472 80.170  1.00 13.61 ? 258  SER C N   1 
ATOM   10585 C CA  . SER C 1 258 ? 42.277  -35.929 80.048  1.00 13.82 ? 258  SER C CA  1 
ATOM   10586 C C   . SER C 1 258 ? 42.403  -36.576 81.423  1.00 15.18 ? 258  SER C C   1 
ATOM   10587 O O   . SER C 1 258 ? 43.358  -36.296 82.141  1.00 15.83 ? 258  SER C O   1 
ATOM   10588 C CB  . SER C 1 258 ? 43.478  -36.323 79.170  1.00 15.65 ? 258  SER C CB  1 
ATOM   10589 O OG  . SER C 1 258 ? 43.577  -37.723 78.991  1.00 15.12 ? 258  SER C OG  1 
ATOM   10590 N N   . LYS C 1 259 ? 41.470  -37.468 81.760  1.00 14.91 ? 259  LYS C N   1 
ATOM   10591 C CA  . LYS C 1 259 ? 41.470  -38.178 83.046  1.00 15.72 ? 259  LYS C CA  1 
ATOM   10592 C C   . LYS C 1 259 ? 42.728  -39.017 83.254  1.00 16.84 ? 259  LYS C C   1 
ATOM   10593 O O   . LYS C 1 259 ? 43.416  -38.881 84.264  1.00 16.90 ? 259  LYS C O   1 
ATOM   10594 C CB  . LYS C 1 259 ? 40.208  -39.052 83.159  1.00 15.61 ? 259  LYS C CB  1 
ATOM   10595 C CG  . LYS C 1 259 ? 39.924  -39.621 84.547  1.00 13.77 ? 259  LYS C CG  1 
ATOM   10596 C CD  . LYS C 1 259 ? 38.585  -40.317 84.615  1.00 15.24 ? 259  LYS C CD  1 
ATOM   10597 C CE  . LYS C 1 259 ? 38.548  -41.227 85.831  1.00 15.66 ? 259  LYS C CE  1 
ATOM   10598 N NZ  . LYS C 1 259 ? 37.260  -41.953 85.963  1.00 14.91 ? 259  LYS C NZ  1 
ATOM   10599 N N   . THR C 1 260 ? 43.058  -39.809 82.239  1.00 16.44 ? 260  THR C N   1 
ATOM   10600 C CA  . THR C 1 260 ? 44.218  -40.693 82.258  1.00 17.74 ? 260  THR C CA  1 
ATOM   10601 C C   . THR C 1 260 ? 45.521  -40.020 81.835  1.00 17.73 ? 260  THR C C   1 
ATOM   10602 O O   . THR C 1 260 ? 46.604  -40.438 82.256  1.00 17.65 ? 260  THR C O   1 
ATOM   10603 C CB  . THR C 1 260 ? 43.998  -41.887 81.307  1.00 18.28 ? 260  THR C CB  1 
ATOM   10604 O OG1 . THR C 1 260 ? 43.742  -41.399 79.979  1.00 19.91 ? 260  THR C OG1 1 
ATOM   10605 C CG2 . THR C 1 260 ? 42.829  -42.748 81.774  1.00 19.29 ? 260  THR C CG2 1 
ATOM   10606 N N   . PHE C 1 261 ? 45.398  -38.996 80.982  1.00 17.65 ? 261  PHE C N   1 
ATOM   10607 C CA  . PHE C 1 261 ? 46.518  -38.246 80.391  1.00 17.72 ? 261  PHE C CA  1 
ATOM   10608 C C   . PHE C 1 261 ? 47.390  -39.140 79.503  1.00 18.39 ? 261  PHE C C   1 
ATOM   10609 O O   . PHE C 1 261 ? 48.580  -38.883 79.300  1.00 19.46 ? 261  PHE C O   1 
ATOM   10610 C CB  . PHE C 1 261 ? 47.334  -37.468 81.440  1.00 17.55 ? 261  PHE C CB  1 
ATOM   10611 C CG  . PHE C 1 261 ? 47.693  -36.073 81.009  1.00 17.13 ? 261  PHE C CG  1 
ATOM   10612 C CD1 . PHE C 1 261 ? 46.731  -35.046 81.045  1.00 17.44 ? 261  PHE C CD1 1 
ATOM   10613 C CD2 . PHE C 1 261 ? 48.991  -35.773 80.559  1.00 17.68 ? 261  PHE C CD2 1 
ATOM   10614 C CE1 . PHE C 1 261 ? 47.056  -33.731 80.641  1.00 16.62 ? 261  PHE C CE1 1 
ATOM   10615 C CE2 . PHE C 1 261 ? 49.336  -34.460 80.147  1.00 16.11 ? 261  PHE C CE2 1 
ATOM   10616 C CZ  . PHE C 1 261 ? 48.368  -33.436 80.191  1.00 16.85 ? 261  PHE C CZ  1 
ATOM   10617 N N   . THR C 1 262 ? 46.770  -40.206 78.986  1.00 18.35 ? 262  THR C N   1 
ATOM   10618 C CA  . THR C 1 262 ? 47.438  -41.176 78.110  1.00 19.00 ? 262  THR C CA  1 
ATOM   10619 C C   . THR C 1 262 ? 46.646  -41.459 76.827  1.00 18.16 ? 262  THR C C   1 
ATOM   10620 O O   . THR C 1 262 ? 47.116  -42.221 75.974  1.00 19.59 ? 262  THR C O   1 
ATOM   10621 C CB  . THR C 1 262 ? 47.708  -42.544 78.822  1.00 19.71 ? 262  THR C CB  1 
ATOM   10622 O OG1 . THR C 1 262 ? 46.466  -43.182 79.137  1.00 19.73 ? 262  THR C OG1 1 
ATOM   10623 C CG2 . THR C 1 262 ? 48.533  -42.366 80.096  1.00 19.98 ? 262  THR C CG2 1 
ATOM   10624 N N   . THR C 1 263 ? 45.454  -40.861 76.692  1.00 16.61 ? 263  THR C N   1 
ATOM   10625 C CA  . THR C 1 263 ? 44.601  -41.049 75.502  1.00 15.52 ? 263  THR C CA  1 
ATOM   10626 C C   . THR C 1 263 ? 45.352  -40.560 74.267  1.00 15.06 ? 263  THR C C   1 
ATOM   10627 O O   . THR C 1 263 ? 45.776  -39.405 74.218  1.00 14.94 ? 263  THR C O   1 
ATOM   10628 C CB  . THR C 1 263 ? 43.254  -40.298 75.647  1.00 15.95 ? 263  THR C CB  1 
ATOM   10629 O OG1 . THR C 1 263 ? 42.539  -40.819 76.770  1.00 17.59 ? 263  THR C OG1 1 
ATOM   10630 C CG2 . THR C 1 263 ? 42.383  -40.463 74.404  1.00 15.79 ? 263  THR C CG2 1 
ATOM   10631 N N   . GLN C 1 264 ? 45.498  -41.448 73.281  1.00 14.89 ? 264  GLN C N   1 
ATOM   10632 C CA  . GLN C 1 264 ? 46.244  -41.153 72.056  1.00 14.74 ? 264  GLN C CA  1 
ATOM   10633 C C   . GLN C 1 264 ? 45.856  -39.873 71.326  1.00 13.94 ? 264  GLN C C   1 
ATOM   10634 O O   . GLN C 1 264 ? 46.729  -39.063 71.028  1.00 14.21 ? 264  GLN C O   1 
ATOM   10635 C CB  . GLN C 1 264 ? 46.243  -42.351 71.098  1.00 16.16 ? 264  GLN C CB  1 
ATOM   10636 C CG  . GLN C 1 264 ? 47.314  -42.234 70.002  1.00 18.95 ? 264  GLN C CG  1 
ATOM   10637 C CD  . GLN C 1 264 ? 47.443  -43.467 69.136  1.00 20.64 ? 264  GLN C CD  1 
ATOM   10638 O OE1 . GLN C 1 264 ? 48.525  -44.050 69.033  1.00 24.66 ? 264  GLN C OE1 1 
ATOM   10639 N NE2 . GLN C 1 264 ? 46.361  -43.844 68.470  1.00 20.59 ? 264  GLN C NE2 1 
ATOM   10640 N N   . GLU C 1 265 ? 44.556  -39.655 71.130  1.00 13.61 ? 265  GLU C N   1 
ATOM   10641 C CA  . GLU C 1 265 ? 44.059  -38.461 70.442  1.00 13.32 ? 265  GLU C CA  1 
ATOM   10642 C C   . GLU C 1 265 ? 44.465  -37.160 71.119  1.00 12.47 ? 265  GLU C C   1 
ATOM   10643 O O   . GLU C 1 265 ? 45.036  -36.269 70.488  1.00 12.62 ? 265  GLU C O   1 
ATOM   10644 C CB  . GLU C 1 265 ? 42.532  -38.501 70.329  1.00 12.76 ? 265  GLU C CB  1 
ATOM   10645 C CG  . GLU C 1 265 ? 42.008  -39.570 69.389  1.00 14.82 ? 265  GLU C CG  1 
ATOM   10646 C CD  . GLU C 1 265 ? 41.496  -40.811 70.069  1.00 16.66 ? 265  GLU C CD  1 
ATOM   10647 O OE1 . GLU C 1 265 ? 42.049  -41.222 71.111  1.00 17.23 ? 265  GLU C OE1 1 
ATOM   10648 O OE2 . GLU C 1 265 ? 40.522  -41.384 69.540  1.00 16.29 ? 265  GLU C OE2 1 
ATOM   10649 N N   . THR C 1 266 ? 44.243  -37.119 72.429  1.00 12.06 ? 266  THR C N   1 
ATOM   10650 C CA  . THR C 1 266 ? 44.532  -35.950 73.251  1.00 12.15 ? 266  THR C CA  1 
ATOM   10651 C C   . THR C 1 266 ? 46.019  -35.643 73.383  1.00 11.54 ? 266  THR C C   1 
ATOM   10652 O O   . THR C 1 266 ? 46.410  -34.488 73.247  1.00 11.84 ? 266  THR C O   1 
ATOM   10653 C CB  . THR C 1 266 ? 43.838  -36.081 74.621  1.00 13.02 ? 266  THR C CB  1 
ATOM   10654 O OG1 . THR C 1 266 ? 42.436  -36.301 74.398  1.00 12.99 ? 266  THR C OG1 1 
ATOM   10655 C CG2 . THR C 1 266 ? 44.004  -34.815 75.460  1.00 12.97 ? 266  THR C CG2 1 
ATOM   10656 N N   . ILE C 1 267 ? 46.836  -36.675 73.593  1.00 12.69 ? 267  ILE C N   1 
ATOM   10657 C CA  . ILE C 1 267 ? 48.285  -36.488 73.713  1.00 12.90 ? 267  ILE C CA  1 
ATOM   10658 C C   . ILE C 1 267 ? 48.900  -36.058 72.379  1.00 13.64 ? 267  ILE C C   1 
ATOM   10659 O O   . ILE C 1 267 ? 49.733  -35.157 72.363  1.00 13.57 ? 267  ILE C O   1 
ATOM   10660 C CB  . ILE C 1 267 ? 48.984  -37.751 74.326  1.00 13.96 ? 267  ILE C CB  1 
ATOM   10661 C CG1 . ILE C 1 267 ? 48.504  -37.953 75.774  1.00 15.88 ? 267  ILE C CG1 1 
ATOM   10662 C CG2 . ILE C 1 267 ? 50.527  -37.634 74.296  1.00 15.04 ? 267  ILE C CG2 1 
ATOM   10663 C CD1 . ILE C 1 267 ? 48.745  -36.762 76.732  1.00 17.34 ? 267  ILE C CD1 1 
ATOM   10664 N N   . THR C 1 268 ? 48.417  -36.631 71.270  1.00 12.55 ? 268  THR C N   1 
ATOM   10665 C CA  . THR C 1 268 ? 48.898  -36.282 69.924  1.00 12.67 ? 268  THR C CA  1 
ATOM   10666 C C   . THR C 1 268 ? 48.570  -34.814 69.624  1.00 12.79 ? 268  THR C C   1 
ATOM   10667 O O   . THR C 1 268 ? 49.430  -34.066 69.151  1.00 13.41 ? 268  THR C O   1 
ATOM   10668 C CB  . THR C 1 268 ? 48.276  -37.203 68.828  1.00 12.66 ? 268  THR C CB  1 
ATOM   10669 O OG1 . THR C 1 268 ? 48.680  -38.559 69.058  1.00 15.40 ? 268  THR C OG1 1 
ATOM   10670 C CG2 . THR C 1 268 ? 48.726  -36.800 67.423  1.00 13.73 ? 268  THR C CG2 1 
ATOM   10671 N N   . ASN C 1 269 ? 47.345  -34.407 69.962  1.00 12.24 ? 269  ASN C N   1 
ATOM   10672 C CA  . ASN C 1 269 ? 46.884  -33.032 69.761  1.00 11.90 ? 269  ASN C CA  1 
ATOM   10673 C C   . ASN C 1 269 ? 47.624  -32.042 70.660  1.00 13.23 ? 269  ASN C C   1 
ATOM   10674 O O   . ASN C 1 269 ? 47.993  -30.956 70.215  1.00 12.78 ? 269  ASN C O   1 
ATOM   10675 C CB  . ASN C 1 269 ? 45.379  -32.927 70.013  1.00 12.27 ? 269  ASN C CB  1 
ATOM   10676 C CG  . ASN C 1 269 ? 44.546  -33.405 68.842  1.00 10.97 ? 269  ASN C CG  1 
ATOM   10677 O OD1 . ASN C 1 269 ? 44.929  -33.244 67.685  1.00 12.91 ? 269  ASN C OD1 1 
ATOM   10678 N ND2 . ASN C 1 269 ? 43.366  -33.950 69.140  1.00 10.37 ? 269  ASN C ND2 1 
ATOM   10679 N N   . ALA C 1 270 ? 47.865  -32.447 71.911  1.00 13.47 ? 270  ALA C N   1 
ATOM   10680 C CA  . ALA C 1 270 ? 48.573  -31.620 72.891  1.00 14.56 ? 270  ALA C CA  1 
ATOM   10681 C C   . ALA C 1 270 ? 50.028  -31.408 72.480  1.00 14.12 ? 270  ALA C C   1 
ATOM   10682 O O   . ALA C 1 270 ? 50.542  -30.293 72.580  1.00 13.94 ? 270  ALA C O   1 
ATOM   10683 C CB  . ALA C 1 270 ? 48.497  -32.251 74.263  1.00 14.82 ? 270  ALA C CB  1 
ATOM   10684 N N   . LEU C 1 271 ? 50.653  -32.466 71.955  1.00 14.75 ? 271  LEU C N   1 
ATOM   10685 C CA  . LEU C 1 271 ? 52.043  -32.408 71.485  1.00 14.55 ? 271  LEU C CA  1 
ATOM   10686 C C   . LEU C 1 271 ? 52.159  -31.496 70.265  1.00 14.96 ? 271  LEU C C   1 
ATOM   10687 O O   . LEU C 1 271 ? 53.136  -30.758 70.130  1.00 15.48 ? 271  LEU C O   1 
ATOM   10688 C CB  . LEU C 1 271 ? 52.575  -33.807 71.149  1.00 15.34 ? 271  LEU C CB  1 
ATOM   10689 C CG  . LEU C 1 271 ? 52.945  -34.742 72.308  1.00 16.89 ? 271  LEU C CG  1 
ATOM   10690 C CD1 . LEU C 1 271 ? 53.244  -36.130 71.770  1.00 17.63 ? 271  LEU C CD1 1 
ATOM   10691 C CD2 . LEU C 1 271 ? 54.136  -34.198 73.073  1.00 17.96 ? 271  LEU C CD2 1 
ATOM   10692 N N   . SER C 1 272 ? 51.124  -31.498 69.422  1.00 13.80 ? 272  SER C N   1 
ATOM   10693 C CA  . SER C 1 272 ? 51.095  -30.649 68.230  1.00 13.76 ? 272  SER C CA  1 
ATOM   10694 C C   . SER C 1 272 ? 50.861  -29.183 68.563  1.00 14.18 ? 272  SER C C   1 
ATOM   10695 O O   . SER C 1 272 ? 51.369  -28.303 67.865  1.00 14.79 ? 272  SER C O   1 
ATOM   10696 C CB  . SER C 1 272 ? 50.044  -31.130 67.239  1.00 14.04 ? 272  SER C CB  1 
ATOM   10697 O OG  . SER C 1 272 ? 50.512  -32.290 66.587  1.00 14.41 ? 272  SER C OG  1 
ATOM   10698 N N   . ALA C 1 273 ? 50.099  -28.939 69.632  1.00 14.03 ? 273  ALA C N   1 
ATOM   10699 C CA  . ALA C 1 273 ? 49.805  -27.582 70.105  1.00 14.06 ? 273  ALA C CA  1 
ATOM   10700 C C   . ALA C 1 273 ? 51.061  -27.000 70.743  1.00 14.77 ? 273  ALA C C   1 
ATOM   10701 O O   . ALA C 1 273 ? 51.345  -25.808 70.589  1.00 14.80 ? 273  ALA C O   1 
ATOM   10702 C CB  . ALA C 1 273 ? 48.665  -27.604 71.106  1.00 13.29 ? 273  ALA C CB  1 
ATOM   10703 N N   . ARG C 1 274 ? 51.820  -27.864 71.426  1.00 15.12 ? 274  ARG C N   1 
ATOM   10704 C CA  . ARG C 1 274 ? 53.076  -27.473 72.076  1.00 16.75 ? 274  ARG C CA  1 
ATOM   10705 C C   . ARG C 1 274 ? 54.124  -27.167 71.023  1.00 16.41 ? 274  ARG C C   1 
ATOM   10706 O O   . ARG C 1 274 ? 54.817  -26.158 71.128  1.00 15.75 ? 274  ARG C O   1 
ATOM   10707 C CB  . ARG C 1 274 ? 53.569  -28.559 73.036  1.00 18.66 ? 274  ARG C CB  1 
ATOM   10708 C CG  . ARG C 1 274 ? 54.183  -28.008 74.332  1.00 24.69 ? 274  ARG C CG  1 
ATOM   10709 C CD  . ARG C 1 274 ? 54.902  -29.087 75.124  1.00 25.43 ? 274  ARG C CD  1 
ATOM   10710 N NE  . ARG C 1 274 ? 55.559  -30.052 74.243  1.00 27.99 ? 274  ARG C NE  1 
ATOM   10711 C CZ  . ARG C 1 274 ? 56.067  -31.216 74.634  1.00 29.21 ? 274  ARG C CZ  1 
ATOM   10712 N NH1 . ARG C 1 274 ? 56.012  -31.586 75.906  1.00 30.14 ? 274  ARG C NH1 1 
ATOM   10713 N NH2 . ARG C 1 274 ? 56.636  -32.017 73.745  1.00 30.96 ? 274  ARG C NH2 1 
ATOM   10714 N N   . ARG C 1 275 ? 54.148  -27.981 69.962  1.00 16.72 ? 275  ARG C N   1 
ATOM   10715 C CA  . ARG C 1 275 ? 55.082  -27.806 68.845  1.00 18.04 ? 275  ARG C CA  1 
ATOM   10716 C C   . ARG C 1 275 ? 54.767  -26.491 68.135  1.00 17.00 ? 275  ARG C C   1 
ATOM   10717 O O   . ARG C 1 275 ? 55.678  -25.767 67.758  1.00 17.38 ? 275  ARG C O   1 
ATOM   10718 C CB  . ARG C 1 275 ? 54.988  -28.974 67.849  1.00 21.22 ? 275  ARG C CB  1 
ATOM   10719 C CG  . ARG C 1 275 ? 56.066  -28.948 66.758  1.00 25.74 ? 275  ARG C CG  1 
ATOM   10720 C CD  . ARG C 1 275 ? 55.805  -29.944 65.643  1.00 30.22 ? 275  ARG C CD  1 
ATOM   10721 N NE  . ARG C 1 275 ? 56.840  -29.859 64.608  1.00 33.78 ? 275  ARG C NE  1 
ATOM   10722 C CZ  . ARG C 1 275 ? 56.873  -30.596 63.498  1.00 34.96 ? 275  ARG C CZ  1 
ATOM   10723 N NH1 . ARG C 1 275 ? 55.926  -31.491 63.244  1.00 35.94 ? 275  ARG C NH1 1 
ATOM   10724 N NH2 . ARG C 1 275 ? 57.869  -30.433 62.634  1.00 36.33 ? 275  ARG C NH2 1 
ATOM   10725 N N   . ALA C 1 276 ? 53.476  -26.164 68.034  1.00 15.04 ? 276  ALA C N   1 
ATOM   10726 C CA  . ALA C 1 276 ? 53.019  -24.930 67.396  1.00 15.13 ? 276  ALA C CA  1 
ATOM   10727 C C   . ALA C 1 276 ? 53.487  -23.688 68.155  1.00 14.65 ? 276  ALA C C   1 
ATOM   10728 O O   . ALA C 1 276 ? 53.946  -22.723 67.543  1.00 14.59 ? 276  ALA C O   1 
ATOM   10729 C CB  . ALA C 1 276 ? 51.510  -24.932 67.267  1.00 15.08 ? 276  ALA C CB  1 
ATOM   10730 N N   . LEU C 1 277 ? 53.409  -23.741 69.487  1.00 14.22 ? 277  LEU C N   1 
ATOM   10731 C CA  . LEU C 1 277 ? 53.845  -22.633 70.343  1.00 14.87 ? 277  LEU C CA  1 
ATOM   10732 C C   . LEU C 1 277 ? 55.352  -22.419 70.207  1.00 15.62 ? 277  LEU C C   1 
ATOM   10733 O O   . LEU C 1 277 ? 55.799  -21.295 69.976  1.00 15.48 ? 277  LEU C O   1 
ATOM   10734 C CB  . LEU C 1 277 ? 53.487  -22.883 71.816  1.00 14.54 ? 277  LEU C CB  1 
ATOM   10735 C CG  . LEU C 1 277 ? 53.960  -21.826 72.836  1.00 14.85 ? 277  LEU C CG  1 
ATOM   10736 C CD1 . LEU C 1 277 ? 53.280  -20.478 72.593  1.00 16.39 ? 277  LEU C CD1 1 
ATOM   10737 C CD2 . LEU C 1 277 ? 53.736  -22.313 74.246  1.00 15.52 ? 277  LEU C CD2 1 
ATOM   10738 N N   . LEU C 1 278 ? 56.105  -23.515 70.276  1.00 15.70 ? 278  LEU C N   1 
ATOM   10739 C CA  . LEU C 1 278 ? 57.563  -23.473 70.165  1.00 16.58 ? 278  LEU C CA  1 
ATOM   10740 C C   . LEU C 1 278 ? 58.040  -23.077 68.768  1.00 16.91 ? 278  LEU C C   1 
ATOM   10741 O O   . LEU C 1 278 ? 59.019  -22.348 68.646  1.00 16.76 ? 278  LEU C O   1 
ATOM   10742 C CB  . LEU C 1 278 ? 58.193  -24.798 70.615  1.00 18.84 ? 278  LEU C CB  1 
ATOM   10743 C CG  . LEU C 1 278 ? 57.796  -25.349 71.998  1.00 20.94 ? 278  LEU C CG  1 
ATOM   10744 C CD1 . LEU C 1 278 ? 58.746  -26.465 72.392  1.00 22.74 ? 278  LEU C CD1 1 
ATOM   10745 C CD2 . LEU C 1 278 ? 57.756  -24.267 73.074  1.00 22.66 ? 278  LEU C CD2 1 
ATOM   10746 N N   . ASP C 1 279 ? 57.305  -23.502 67.734  1.00 16.29 ? 279  ASP C N   1 
ATOM   10747 C CA  . ASP C 1 279 ? 57.620  -23.163 66.337  1.00 16.30 ? 279  ASP C CA  1 
ATOM   10748 C C   . ASP C 1 279 ? 57.434  -21.662 66.113  1.00 15.79 ? 279  ASP C C   1 
ATOM   10749 O O   . ASP C 1 279 ? 58.241  -21.032 65.433  1.00 16.71 ? 279  ASP C O   1 
ATOM   10750 C CB  . ASP C 1 279 ? 56.719  -23.922 65.351  1.00 17.26 ? 279  ASP C CB  1 
ATOM   10751 C CG  . ASP C 1 279 ? 57.202  -25.340 65.051  1.00 19.14 ? 279  ASP C CG  1 
ATOM   10752 O OD1 . ASP C 1 279 ? 58.307  -25.738 65.479  1.00 19.70 ? 279  ASP C OD1 1 
ATOM   10753 O OD2 . ASP C 1 279 ? 56.453  -26.064 64.363  1.00 19.90 ? 279  ASP C OD2 1 
ATOM   10754 N N   . TYR C 1 280 ? 56.387  -21.097 66.721  1.00 16.32 ? 280  TYR C N   1 
ATOM   10755 C CA  . TYR C 1 280 ? 56.094  -19.665 66.612  1.00 16.35 ? 280  TYR C CA  1 
ATOM   10756 C C   . TYR C 1 280 ? 57.197  -18.823 67.248  1.00 17.31 ? 280  TYR C C   1 
ATOM   10757 O O   . TYR C 1 280 ? 57.690  -17.878 66.632  1.00 16.66 ? 280  TYR C O   1 
ATOM   10758 C CB  . TYR C 1 280 ? 54.744  -19.327 67.272  1.00 17.95 ? 280  TYR C CB  1 
ATOM   10759 C CG  . TYR C 1 280 ? 54.364  -17.864 67.169  1.00 20.37 ? 280  TYR C CG  1 
ATOM   10760 C CD1 . TYR C 1 280 ? 53.888  -17.324 65.955  1.00 21.52 ? 280  TYR C CD1 1 
ATOM   10761 C CD2 . TYR C 1 280 ? 54.529  -16.994 68.269  1.00 21.59 ? 280  TYR C CD2 1 
ATOM   10762 C CE1 . TYR C 1 280 ? 53.586  -15.942 65.836  1.00 24.57 ? 280  TYR C CE1 1 
ATOM   10763 C CE2 . TYR C 1 280 ? 54.238  -15.616 68.156  1.00 23.62 ? 280  TYR C CE2 1 
ATOM   10764 C CZ  . TYR C 1 280 ? 53.767  -15.101 66.941  1.00 24.78 ? 280  TYR C CZ  1 
ATOM   10765 O OH  . TYR C 1 280 ? 53.491  -13.753 66.830  1.00 29.35 ? 280  TYR C OH  1 
ATOM   10766 N N   . LEU C 1 281 ? 57.538  -19.153 68.493  1.00 17.35 ? 281  LEU C N   1 
ATOM   10767 C CA  . LEU C 1 281 ? 58.569  -18.430 69.236  1.00 17.70 ? 281  LEU C CA  1 
ATOM   10768 C C   . LEU C 1 281 ? 59.941  -18.522 68.585  1.00 18.89 ? 281  LEU C C   1 
ATOM   10769 O O   . LEU C 1 281 ? 60.646  -17.514 68.485  1.00 19.60 ? 281  LEU C O   1 
ATOM   10770 C CB  . LEU C 1 281 ? 58.627  -18.922 70.684  1.00 17.21 ? 281  LEU C CB  1 
ATOM   10771 C CG  . LEU C 1 281 ? 57.348  -18.742 71.512  1.00 17.50 ? 281  LEU C CG  1 
ATOM   10772 C CD1 . LEU C 1 281 ? 57.544  -19.409 72.844  1.00 18.52 ? 281  LEU C CD1 1 
ATOM   10773 C CD2 . LEU C 1 281 ? 56.967  -17.271 71.681  1.00 16.92 ? 281  LEU C CD2 1 
ATOM   10774 N N   . ARG C 1 282 ? 60.262  -19.706 68.056  1.00 18.26 ? 282  ARG C N   1 
ATOM   10775 C CA  . ARG C 1 282 ? 61.542  -19.958 67.383  1.00 18.30 ? 282  ARG C CA  1 
ATOM   10776 C C   . ARG C 1 282 ? 61.648  -19.159 66.085  1.00 17.94 ? 282  ARG C C   1 
ATOM   10777 O O   . ARG C 1 282 ? 62.726  -18.655 65.756  1.00 17.36 ? 282  ARG C O   1 
ATOM   10778 C CB  . ARG C 1 282 ? 61.699  -21.446 67.077  1.00 20.01 ? 282  ARG C CB  1 
ATOM   10779 C CG  . ARG C 1 282 ? 63.142  -21.929 66.937  1.00 23.99 ? 282  ARG C CG  1 
ATOM   10780 C CD  . ARG C 1 282 ? 63.213  -23.388 66.494  1.00 25.68 ? 282  ARG C CD  1 
ATOM   10781 N NE  . ARG C 1 282 ? 62.580  -24.309 67.441  1.00 27.59 ? 282  ARG C NE  1 
ATOM   10782 C CZ  . ARG C 1 282 ? 61.532  -25.087 67.160  1.00 28.07 ? 282  ARG C CZ  1 
ATOM   10783 N NH1 . ARG C 1 282 ? 60.978  -25.069 65.953  1.00 27.52 ? 282  ARG C NH1 1 
ATOM   10784 N NH2 . ARG C 1 282 ? 61.029  -25.873 68.099  1.00 29.32 ? 282  ARG C NH2 1 
ATOM   10785 N N   . SER C 1 283 ? 60.515  -18.997 65.396  1.00 16.56 ? 283  SER C N   1 
ATOM   10786 C CA  . SER C 1 283 ? 60.452  -18.249 64.134  1.00 16.87 ? 283  SER C CA  1 
ATOM   10787 C C   . SER C 1 283 ? 60.671  -16.752 64.326  1.00 16.76 ? 283  SER C C   1 
ATOM   10788 O O   . SER C 1 283 ? 61.059  -16.044 63.391  1.00 16.15 ? 283  SER C O   1 
ATOM   10789 C CB  . SER C 1 283 ? 59.121  -18.486 63.423  1.00 17.75 ? 283  SER C CB  1 
ATOM   10790 O OG  . SER C 1 283 ? 58.044  -17.765 64.006  1.00 18.03 ? 283  SER C OG  1 
ATOM   10791 N N   . ARG C 1 284 ? 60.385  -16.287 65.540  1.00 16.74 ? 284  ARG C N   1 
ATOM   10792 C CA  . ARG C 1 284 ? 60.560  -14.887 65.900  1.00 18.14 ? 284  ARG C CA  1 
ATOM   10793 C C   . ARG C 1 284 ? 61.811  -14.690 66.759  1.00 17.54 ? 284  ARG C C   1 
ATOM   10794 O O   . ARG C 1 284 ? 62.055  -13.590 67.248  1.00 18.96 ? 284  ARG C O   1 
ATOM   10795 C CB  . ARG C 1 284 ? 59.323  -14.352 66.625  1.00 18.97 ? 284  ARG C CB  1 
ATOM   10796 C CG  . ARG C 1 284 ? 58.046  -14.380 65.800  1.00 22.10 ? 284  ARG C CG  1 
ATOM   10797 C CD  . ARG C 1 284 ? 56.962  -13.544 66.447  1.00 24.04 ? 284  ARG C CD  1 
ATOM   10798 N NE  . ARG C 1 284 ? 57.351  -12.144 66.625  1.00 26.13 ? 284  ARG C NE  1 
ATOM   10799 C CZ  . ARG C 1 284 ? 56.844  -11.327 67.547  1.00 28.85 ? 284  ARG C CZ  1 
ATOM   10800 N NH1 . ARG C 1 284 ? 55.913  -11.749 68.396  1.00 30.08 ? 284  ARG C NH1 1 
ATOM   10801 N NH2 . ARG C 1 284 ? 57.276  -10.073 67.623  1.00 30.12 ? 284  ARG C NH2 1 
ATOM   10802 N N   . GLY C 1 285 ? 62.594  -15.759 66.932  1.00 18.57 ? 285  GLY C N   1 
ATOM   10803 C CA  . GLY C 1 285 ? 63.826  -15.708 67.715  1.00 18.97 ? 285  GLY C CA  1 
ATOM   10804 C C   . GLY C 1 285 ? 63.678  -15.462 69.210  1.00 19.95 ? 285  GLY C C   1 
ATOM   10805 O O   . GLY C 1 285 ? 64.637  -15.058 69.875  1.00 20.14 ? 285  GLY C O   1 
ATOM   10806 N N   . ILE C 1 286 ? 62.475  -15.703 69.732  1.00 18.57 ? 286  ILE C N   1 
ATOM   10807 C CA  . ILE C 1 286 ? 62.164  -15.510 71.151  1.00 19.04 ? 286  ILE C CA  1 
ATOM   10808 C C   . ILE C 1 286 ? 62.524  -16.760 71.955  1.00 20.22 ? 286  ILE C C   1 
ATOM   10809 O O   . ILE C 1 286 ? 62.241  -17.884 71.528  1.00 20.09 ? 286  ILE C O   1 
ATOM   10810 C CB  . ILE C 1 286 ? 60.647  -15.153 71.342  1.00 19.26 ? 286  ILE C CB  1 
ATOM   10811 C CG1 . ILE C 1 286 ? 60.312  -13.870 70.572  1.00 19.30 ? 286  ILE C CG1 1 
ATOM   10812 C CG2 . ILE C 1 286 ? 60.295  -14.966 72.835  1.00 18.99 ? 286  ILE C CG2 1 
ATOM   10813 C CD1 . ILE C 1 286 ? 58.831  -13.610 70.387  1.00 19.17 ? 286  ILE C CD1 1 
ATOM   10814 N N   . ASP C 1 287 ? 63.149  -16.545 73.118  1.00 20.79 ? 287  ASP C N   1 
ATOM   10815 C CA  . ASP C 1 287 ? 63.549  -17.617 74.035  1.00 22.13 ? 287  ASP C CA  1 
ATOM   10816 C C   . ASP C 1 287 ? 62.294  -18.345 74.541  1.00 22.38 ? 287  ASP C C   1 
ATOM   10817 O O   . ASP C 1 287 ? 61.361  -17.709 75.030  1.00 22.72 ? 287  ASP C O   1 
ATOM   10818 C CB  . ASP C 1 287 ? 64.359  -17.026 75.204  1.00 25.63 ? 287  ASP C CB  1 
ATOM   10819 C CG  . ASP C 1 287 ? 64.567  -18.012 76.350  1.00 27.72 ? 287  ASP C CG  1 
ATOM   10820 O OD1 . ASP C 1 287 ? 64.839  -19.204 76.092  1.00 30.31 ? 287  ASP C OD1 1 
ATOM   10821 O OD2 . ASP C 1 287 ? 64.456  -17.583 77.517  1.00 32.40 ? 287  ASP C OD2 1 
ATOM   10822 N N   . GLU C 1 288 ? 62.299  -19.670 74.397  1.00 22.96 ? 288  GLU C N   1 
ATOM   10823 C CA  . GLU C 1 288 ? 61.172  -20.528 74.785  1.00 25.10 ? 288  GLU C CA  1 
ATOM   10824 C C   . GLU C 1 288 ? 61.044  -20.903 76.263  1.00 24.63 ? 288  GLU C C   1 
ATOM   10825 O O   . GLU C 1 288 ? 60.000  -21.420 76.670  1.00 23.81 ? 288  GLU C O   1 
ATOM   10826 C CB  . GLU C 1 288 ? 61.171  -21.803 73.927  1.00 27.08 ? 288  GLU C CB  1 
ATOM   10827 C CG  . GLU C 1 288 ? 61.859  -23.019 74.558  1.00 32.44 ? 288  GLU C CG  1 
ATOM   10828 C CD  . GLU C 1 288 ? 62.430  -23.967 73.536  1.00 35.35 ? 288  GLU C CD  1 
ATOM   10829 O OE1 . GLU C 1 288 ? 63.574  -23.736 73.087  1.00 38.13 ? 288  GLU C OE1 1 
ATOM   10830 O OE2 . GLU C 1 288 ? 61.744  -24.948 73.180  1.00 38.46 ? 288  GLU C OE2 1 
ATOM   10831 N N   . LYS C 1 289 ? 62.095  -20.661 77.049  1.00 24.03 ? 289  LYS C N   1 
ATOM   10832 C CA  . LYS C 1 289 ? 62.118  -20.993 78.482  1.00 24.26 ? 289  LYS C CA  1 
ATOM   10833 C C   . LYS C 1 289 ? 60.981  -20.341 79.283  1.00 22.90 ? 289  LYS C C   1 
ATOM   10834 O O   . LYS C 1 289 ? 60.825  -19.116 79.285  1.00 22.41 ? 289  LYS C O   1 
ATOM   10835 C CB  . LYS C 1 289 ? 63.481  -20.624 79.093  1.00 26.41 ? 289  LYS C CB  1 
ATOM   10836 C CG  . LYS C 1 289 ? 63.697  -21.116 80.529  1.00 28.95 ? 289  LYS C CG  1 
ATOM   10837 C CD  . LYS C 1 289 ? 64.915  -20.465 81.171  1.00 31.72 ? 289  LYS C CD  1 
ATOM   10838 C CE  . LYS C 1 289 ? 65.011  -20.808 82.651  1.00 33.26 ? 289  LYS C CE  1 
ATOM   10839 N NZ  . LYS C 1 289 ? 66.151  -20.109 83.316  1.00 35.31 ? 289  LYS C NZ  1 
ATOM   10840 N N   . GLY C 1 290 ? 60.160  -21.193 79.896  1.00 22.83 ? 290  GLY C N   1 
ATOM   10841 C CA  . GLY C 1 290 ? 59.037  -20.739 80.704  1.00 22.28 ? 290  GLY C CA  1 
ATOM   10842 C C   . GLY C 1 290 ? 57.735  -20.467 79.968  1.00 22.05 ? 290  GLY C C   1 
ATOM   10843 O O   . GLY C 1 290 ? 56.755  -20.066 80.599  1.00 21.57 ? 290  GLY C O   1 
ATOM   10844 N N   . SER C 1 291 ? 57.705  -20.709 78.654  1.00 20.82 ? 291  SER C N   1 
ATOM   10845 C CA  . SER C 1 291 ? 56.508  -20.468 77.839  1.00 19.23 ? 291  SER C CA  1 
ATOM   10846 C C   . SER C 1 291 ? 55.352  -21.433 78.073  1.00 19.21 ? 291  SER C C   1 
ATOM   10847 O O   . SER C 1 291 ? 54.192  -21.018 78.068  1.00 18.17 ? 291  SER C O   1 
ATOM   10848 C CB  . SER C 1 291 ? 56.856  -20.443 76.345  1.00 18.57 ? 291  SER C CB  1 
ATOM   10849 O OG  . SER C 1 291 ? 57.381  -21.673 75.889  1.00 18.56 ? 291  SER C OG  1 
ATOM   10850 N N   . VAL C 1 292 ? 55.682  -22.705 78.306  1.00 19.96 ? 292  VAL C N   1 
ATOM   10851 C CA  . VAL C 1 292 ? 54.689  -23.761 78.544  1.00 20.56 ? 292  VAL C CA  1 
ATOM   10852 C C   . VAL C 1 292 ? 53.891  -23.526 79.838  1.00 21.16 ? 292  VAL C C   1 
ATOM   10853 O O   . VAL C 1 292 ? 52.691  -23.793 79.882  1.00 20.72 ? 292  VAL C O   1 
ATOM   10854 C CB  . VAL C 1 292 ? 55.366  -25.177 78.508  1.00 19.70 ? 292  VAL C CB  1 
ATOM   10855 C CG1 . VAL C 1 292 ? 54.348  -26.306 78.723  1.00 19.51 ? 292  VAL C CG1 1 
ATOM   10856 C CG2 . VAL C 1 292 ? 56.057  -25.384 77.162  1.00 20.44 ? 292  VAL C CG2 1 
ATOM   10857 N N   . ALA C 1 293 ? 54.538  -22.926 80.838  1.00 21.15 ? 293  ALA C N   1 
ATOM   10858 C CA  . ALA C 1 293 ? 53.910  -22.624 82.132  1.00 20.46 ? 293  ALA C CA  1 
ATOM   10859 C C   . ALA C 1 293 ? 52.922  -21.453 82.051  1.00 21.03 ? 293  ALA C C   1 
ATOM   10860 O O   . ALA C 1 293 ? 52.117  -21.235 82.959  1.00 21.30 ? 293  ALA C O   1 
ATOM   10861 C CB  . ALA C 1 293 ? 54.985  -22.329 83.174  1.00 22.38 ? 293  ALA C CB  1 
ATOM   10862 N N   . LYS C 1 294 ? 52.990  -20.714 80.946  1.00 19.97 ? 294  LYS C N   1 
ATOM   10863 C CA  . LYS C 1 294 ? 52.129  -19.560 80.711  1.00 19.34 ? 294  LYS C CA  1 
ATOM   10864 C C   . LYS C 1 294 ? 51.004  -19.868 79.721  1.00 18.92 ? 294  LYS C C   1 
ATOM   10865 O O   . LYS C 1 294 ? 49.938  -19.248 79.771  1.00 19.13 ? 294  LYS C O   1 
ATOM   10866 C CB  . LYS C 1 294 ? 52.962  -18.390 80.179  1.00 21.48 ? 294  LYS C CB  1 
ATOM   10867 C CG  . LYS C 1 294 ? 54.284  -18.164 80.908  1.00 23.54 ? 294  LYS C CG  1 
ATOM   10868 C CD  . LYS C 1 294 ? 55.029  -16.994 80.310  1.00 25.60 ? 294  LYS C CD  1 
ATOM   10869 C CE  . LYS C 1 294 ? 56.402  -16.799 80.926  1.00 27.20 ? 294  LYS C CE  1 
ATOM   10870 N NZ  . LYS C 1 294 ? 56.977  -15.482 80.528  1.00 27.77 ? 294  LYS C NZ  1 
ATOM   10871 N N   . HIS C 1 295 ? 51.238  -20.840 78.841  1.00 17.62 ? 295  HIS C N   1 
ATOM   10872 C CA  . HIS C 1 295 ? 50.262  -21.201 77.812  1.00 16.06 ? 295  HIS C CA  1 
ATOM   10873 C C   . HIS C 1 295 ? 49.537  -22.536 77.973  1.00 16.27 ? 295  HIS C C   1 
ATOM   10874 O O   . HIS C 1 295 ? 48.596  -22.814 77.225  1.00 15.80 ? 295  HIS C O   1 
ATOM   10875 C CB  . HIS C 1 295 ? 50.930  -21.163 76.435  1.00 15.39 ? 295  HIS C CB  1 
ATOM   10876 C CG  . HIS C 1 295 ? 51.307  -19.788 75.980  1.00 15.80 ? 295  HIS C CG  1 
ATOM   10877 N ND1 . HIS C 1 295 ? 50.463  -19.001 75.228  1.00 15.86 ? 295  HIS C ND1 1 
ATOM   10878 C CD2 . HIS C 1 295 ? 52.436  -19.063 76.161  1.00 15.91 ? 295  HIS C CD2 1 
ATOM   10879 C CE1 . HIS C 1 295 ? 51.056  -17.850 74.965  1.00 16.69 ? 295  HIS C CE1 1 
ATOM   10880 N NE2 . HIS C 1 295 ? 52.254  -17.862 75.521  1.00 16.81 ? 295  HIS C NE2 1 
ATOM   10881 N N   . PHE C 1 296 ? 49.996  -23.373 78.904  1.00 15.99 ? 296  PHE C N   1 
ATOM   10882 C CA  . PHE C 1 296 ? 49.406  -24.696 79.121  1.00 15.23 ? 296  PHE C CA  1 
ATOM   10883 C C   . PHE C 1 296 ? 49.013  -25.029 80.553  1.00 15.47 ? 296  PHE C C   1 
ATOM   10884 O O   . PHE C 1 296 ? 49.764  -24.771 81.498  1.00 15.85 ? 296  PHE C O   1 
ATOM   10885 C CB  . PHE C 1 296 ? 50.370  -25.801 78.653  1.00 15.24 ? 296  PHE C CB  1 
ATOM   10886 C CG  . PHE C 1 296 ? 50.456  -25.964 77.166  1.00 15.22 ? 296  PHE C CG  1 
ATOM   10887 C CD1 . PHE C 1 296 ? 51.256  -25.100 76.392  1.00 15.62 ? 296  PHE C CD1 1 
ATOM   10888 C CD2 . PHE C 1 296 ? 49.730  -26.981 76.525  1.00 15.47 ? 296  PHE C CD2 1 
ATOM   10889 C CE1 . PHE C 1 296 ? 51.329  -25.238 74.989  1.00 17.12 ? 296  PHE C CE1 1 
ATOM   10890 C CE2 . PHE C 1 296 ? 49.792  -27.141 75.123  1.00 15.47 ? 296  PHE C CE2 1 
ATOM   10891 C CZ  . PHE C 1 296 ? 50.588  -26.265 74.356  1.00 15.05 ? 296  PHE C CZ  1 
ATOM   10892 N N   . VAL C 1 297 ? 47.807  -25.581 80.694  1.00 15.03 ? 297  VAL C N   1 
ATOM   10893 C CA  . VAL C 1 297 ? 47.287  -26.055 81.976  1.00 14.75 ? 297  VAL C CA  1 
ATOM   10894 C C   . VAL C 1 297 ? 46.723  -27.457 81.725  1.00 15.32 ? 297  VAL C C   1 
ATOM   10895 O O   . VAL C 1 297 ? 46.407  -27.800 80.579  1.00 15.00 ? 297  VAL C O   1 
ATOM   10896 C CB  . VAL C 1 297 ? 46.211  -25.119 82.622  1.00 15.24 ? 297  VAL C CB  1 
ATOM   10897 C CG1 . VAL C 1 297 ? 46.791  -23.739 82.883  1.00 15.01 ? 297  VAL C CG1 1 
ATOM   10898 C CG2 . VAL C 1 297 ? 44.959  -25.027 81.779  1.00 15.47 ? 297  VAL C CG2 1 
ATOM   10899 N N   . ALA C 1 298 ? 46.638  -28.265 82.781  1.00 14.15 ? 298  ALA C N   1 
ATOM   10900 C CA  . ALA C 1 298 ? 46.128  -29.630 82.668  1.00 15.10 ? 298  ALA C CA  1 
ATOM   10901 C C   . ALA C 1 298 ? 45.009  -29.957 83.646  1.00 14.07 ? 298  ALA C C   1 
ATOM   10902 O O   . ALA C 1 298 ? 45.016  -29.499 84.786  1.00 14.26 ? 298  ALA C O   1 
ATOM   10903 C CB  . ALA C 1 298 ? 47.260  -30.625 82.841  1.00 15.07 ? 298  ALA C CB  1 
ATOM   10904 N N   . LEU C 1 299 ? 44.017  -30.705 83.157  1.00 13.67 ? 299  LEU C N   1 
ATOM   10905 C CA  . LEU C 1 299 ? 42.873  -31.154 83.957  1.00 12.75 ? 299  LEU C CA  1 
ATOM   10906 C C   . LEU C 1 299 ? 43.008  -32.671 83.902  1.00 14.13 ? 299  LEU C C   1 
ATOM   10907 O O   . LEU C 1 299 ? 42.704  -33.285 82.873  1.00 13.58 ? 299  LEU C O   1 
ATOM   10908 C CB  . LEU C 1 299 ? 41.541  -30.706 83.328  1.00 13.95 ? 299  LEU C CB  1 
ATOM   10909 C CG  . LEU C 1 299 ? 41.448  -29.297 82.729  1.00 13.14 ? 299  LEU C CG  1 
ATOM   10910 C CD1 . LEU C 1 299 ? 40.118  -29.074 82.053  1.00 13.35 ? 299  LEU C CD1 1 
ATOM   10911 C CD2 . LEU C 1 299 ? 41.688  -28.228 83.770  1.00 14.35 ? 299  LEU C CD2 1 
ATOM   10912 N N   . SER C 1 300 ? 43.490  -33.265 84.998  1.00 14.62 ? 300  SER C N   1 
ATOM   10913 C CA  . SER C 1 300 ? 43.750  -34.711 85.049  1.00 14.98 ? 300  SER C CA  1 
ATOM   10914 C C   . SER C 1 300 ? 43.744  -35.328 86.451  1.00 15.40 ? 300  SER C C   1 
ATOM   10915 O O   . SER C 1 300 ? 43.566  -34.628 87.449  1.00 14.92 ? 300  SER C O   1 
ATOM   10916 C CB  . SER C 1 300 ? 45.118  -34.977 84.410  1.00 14.15 ? 300  SER C CB  1 
ATOM   10917 O OG  . SER C 1 300 ? 45.324  -36.349 84.137  1.00 13.91 ? 300  SER C OG  1 
ATOM   10918 N N   . THR C 1 301 ? 43.912  -36.652 86.498  1.00 17.71 ? 301  THR C N   1 
ATOM   10919 C CA  . THR C 1 301 ? 44.009  -37.418 87.750  1.00 19.25 ? 301  THR C CA  1 
ATOM   10920 C C   . THR C 1 301 ? 45.443  -37.947 87.846  1.00 20.69 ? 301  THR C C   1 
ATOM   10921 O O   . THR C 1 301 ? 45.925  -38.291 88.928  1.00 21.39 ? 301  THR C O   1 
ATOM   10922 C CB  . THR C 1 301 ? 43.059  -38.665 87.795  1.00 18.18 ? 301  THR C CB  1 
ATOM   10923 O OG1 . THR C 1 301 ? 43.512  -39.676 86.881  1.00 20.16 ? 301  THR C OG1 1 
ATOM   10924 C CG2 . THR C 1 301 ? 41.636  -38.290 87.445  1.00 20.48 ? 301  THR C CG2 1 
ATOM   10925 N N   . ASN C 1 302 ? 46.098  -38.025 86.686  1.00 22.24 ? 302  ASN C N   1 
ATOM   10926 C CA  . ASN C 1 302 ? 47.455  -38.545 86.558  1.00 22.30 ? 302  ASN C CA  1 
ATOM   10927 C C   . ASN C 1 302 ? 48.523  -37.462 86.718  1.00 22.34 ? 302  ASN C C   1 
ATOM   10928 O O   . ASN C 1 302 ? 48.973  -36.869 85.737  1.00 21.86 ? 302  ASN C O   1 
ATOM   10929 C CB  . ASN C 1 302 ? 47.590  -39.250 85.201  1.00 23.76 ? 302  ASN C CB  1 
ATOM   10930 C CG  . ASN C 1 302 ? 48.627  -40.359 85.205  1.00 25.21 ? 302  ASN C CG  1 
ATOM   10931 O OD1 . ASN C 1 302 ? 49.674  -40.259 85.851  1.00 25.75 ? 302  ASN C OD1 1 
ATOM   10932 N ND2 . ASN C 1 302 ? 48.363  -41.409 84.435  1.00 26.07 ? 302  ASN C ND2 1 
ATOM   10933 N N   . ASN C 1 303 ? 48.974  -37.272 87.958  1.00 22.43 ? 303  ASN C N   1 
ATOM   10934 C CA  . ASN C 1 303 ? 49.996  -36.274 88.298  1.00 23.01 ? 303  ASN C CA  1 
ATOM   10935 C C   . ASN C 1 303 ? 51.353  -36.508 87.643  1.00 23.52 ? 303  ASN C C   1 
ATOM   10936 O O   . ASN C 1 303 ? 52.010  -35.553 87.223  1.00 23.77 ? 303  ASN C O   1 
ATOM   10937 C CB  . ASN C 1 303 ? 50.179  -36.193 89.818  1.00 23.15 ? 303  ASN C CB  1 
ATOM   10938 C CG  . ASN C 1 303 ? 48.915  -35.768 90.535  1.00 22.35 ? 303  ASN C CG  1 
ATOM   10939 O OD1 . ASN C 1 303 ? 47.977  -36.553 90.678  1.00 24.48 ? 303  ASN C OD1 1 
ATOM   10940 N ND2 . ASN C 1 303 ? 48.876  -34.517 90.974  1.00 24.57 ? 303  ASN C ND2 1 
ATOM   10941 N N   . GLN C 1 304 ? 51.731  -37.782 87.516  1.00 24.70 ? 304  GLN C N   1 
ATOM   10942 C CA  . GLN C 1 304 ? 53.004  -38.186 86.924  1.00 25.91 ? 304  GLN C CA  1 
ATOM   10943 C C   . GLN C 1 304 ? 53.102  -37.910 85.422  1.00 25.49 ? 304  GLN C C   1 
ATOM   10944 O O   . GLN C 1 304 ? 54.104  -37.356 84.965  1.00 25.56 ? 304  GLN C O   1 
ATOM   10945 C CB  . GLN C 1 304 ? 53.291  -39.669 87.239  1.00 27.29 ? 304  GLN C CB  1 
ATOM   10946 C CG  . GLN C 1 304 ? 54.655  -40.224 86.764  1.00 31.00 ? 304  GLN C CG  1 
ATOM   10947 C CD  . GLN C 1 304 ? 55.867  -39.415 87.239  1.00 32.89 ? 304  GLN C CD  1 
ATOM   10948 O OE1 . GLN C 1 304 ? 55.889  -38.880 88.352  1.00 34.20 ? 304  GLN C OE1 1 
ATOM   10949 N NE2 . GLN C 1 304 ? 56.884  -39.326 86.387  1.00 33.84 ? 304  GLN C NE2 1 
ATOM   10950 N N   . LYS C 1 305 ? 52.048  -38.245 84.677  1.00 25.14 ? 305  LYS C N   1 
ATOM   10951 C CA  . LYS C 1 305 ? 52.025  -38.023 83.225  1.00 24.96 ? 305  LYS C CA  1 
ATOM   10952 C C   . LYS C 1 305 ? 51.927  -36.545 82.848  1.00 23.97 ? 305  LYS C C   1 
ATOM   10953 O O   . LYS C 1 305 ? 52.398  -36.143 81.783  1.00 24.06 ? 305  LYS C O   1 
ATOM   10954 C CB  . LYS C 1 305 ? 50.918  -38.844 82.555  1.00 25.76 ? 305  LYS C CB  1 
ATOM   10955 C CG  . LYS C 1 305 ? 51.106  -40.362 82.662  1.00 27.54 ? 305  LYS C CG  1 
ATOM   10956 C CD  . LYS C 1 305 ? 52.273  -40.875 81.829  1.00 29.60 ? 305  LYS C CD  1 
ATOM   10957 C CE  . LYS C 1 305 ? 52.417  -42.386 81.944  1.00 31.13 ? 305  LYS C CE  1 
ATOM   10958 N NZ  . LYS C 1 305 ? 53.574  -42.880 81.145  1.00 33.94 ? 305  LYS C NZ  1 
ATOM   10959 N N   . VAL C 1 306 ? 51.359  -35.741 83.754  1.00 23.29 ? 306  VAL C N   1 
ATOM   10960 C CA  . VAL C 1 306 ? 51.234  -34.287 83.576  1.00 23.03 ? 306  VAL C CA  1 
ATOM   10961 C C   . VAL C 1 306 ? 52.626  -33.665 83.752  1.00 24.27 ? 306  VAL C C   1 
ATOM   10962 O O   . VAL C 1 306 ? 53.012  -32.774 82.991  1.00 24.48 ? 306  VAL C O   1 
ATOM   10963 C CB  . VAL C 1 306 ? 50.201  -33.679 84.580  1.00 21.26 ? 306  VAL C CB  1 
ATOM   10964 C CG1 . VAL C 1 306 ? 50.254  -32.154 84.599  1.00 20.34 ? 306  VAL C CG1 1 
ATOM   10965 C CG2 . VAL C 1 306 ? 48.809  -34.107 84.189  1.00 20.63 ? 306  VAL C CG2 1 
ATOM   10966 N N   . LYS C 1 307 ? 53.379  -34.199 84.718  1.00 26.09 ? 307  LYS C N   1 
ATOM   10967 C CA  . LYS C 1 307 ? 54.747  -33.760 85.024  1.00 27.40 ? 307  LYS C CA  1 
ATOM   10968 C C   . LYS C 1 307 ? 55.692  -34.121 83.869  1.00 27.69 ? 307  LYS C C   1 
ATOM   10969 O O   . LYS C 1 307 ? 56.493  -33.286 83.439  1.00 27.46 ? 307  LYS C O   1 
ATOM   10970 C CB  . LYS C 1 307 ? 55.221  -34.404 86.341  1.00 29.28 ? 307  LYS C CB  1 
ATOM   10971 C CG  . LYS C 1 307 ? 56.635  -34.019 86.805  1.00 32.30 ? 307  LYS C CG  1 
ATOM   10972 C CD  . LYS C 1 307 ? 56.968  -34.643 88.158  1.00 33.72 ? 307  LYS C CD  1 
ATOM   10973 C CE  . LYS C 1 307 ? 58.468  -34.629 88.426  1.00 35.56 ? 307  LYS C CE  1 
ATOM   10974 N NZ  . LYS C 1 307 ? 58.764  -34.542 89.886  1.00 37.10 ? 307  LYS C NZ  1 
ATOM   10975 N N   . GLU C 1 308 ? 55.534  -35.337 83.339  1.00 28.58 ? 308  GLU C N   1 
ATOM   10976 C CA  . GLU C 1 308 ? 56.340  -35.856 82.228  1.00 29.90 ? 308  GLU C CA  1 
ATOM   10977 C C   . GLU C 1 308 ? 56.106  -35.119 80.907  1.00 30.29 ? 308  GLU C C   1 
ATOM   10978 O O   . GLU C 1 308 ? 56.986  -35.094 80.040  1.00 31.09 ? 308  GLU C O   1 
ATOM   10979 C CB  . GLU C 1 308 ? 56.091  -37.354 82.036  1.00 31.20 ? 308  GLU C CB  1 
ATOM   10980 C CG  . GLU C 1 308 ? 56.621  -38.231 83.171  1.00 33.56 ? 308  GLU C CG  1 
ATOM   10981 C CD  . GLU C 1 308 ? 56.438  -39.725 82.926  1.00 34.69 ? 308  GLU C CD  1 
ATOM   10982 O OE1 . GLU C 1 308 ? 56.143  -40.134 81.780  1.00 35.67 ? 308  GLU C OE1 1 
ATOM   10983 O OE2 . GLU C 1 308 ? 56.601  -40.502 83.891  1.00 36.18 ? 308  GLU C OE2 1 
ATOM   10984 N N   . PHE C 1 309 ? 54.923  -34.513 80.773  1.00 29.73 ? 309  PHE C N   1 
ATOM   10985 C CA  . PHE C 1 309 ? 54.549  -33.745 79.584  1.00 30.05 ? 309  PHE C CA  1 
ATOM   10986 C C   . PHE C 1 309 ? 55.230  -32.368 79.601  1.00 30.03 ? 309  PHE C C   1 
ATOM   10987 O O   . PHE C 1 309 ? 55.497  -31.794 78.544  1.00 30.72 ? 309  PHE C O   1 
ATOM   10988 C CB  . PHE C 1 309 ? 53.012  -33.610 79.504  1.00 29.58 ? 309  PHE C CB  1 
ATOM   10989 C CG  . PHE C 1 309 ? 52.511  -32.904 78.260  1.00 29.43 ? 309  PHE C CG  1 
ATOM   10990 C CD1 . PHE C 1 309 ? 52.417  -33.585 77.031  1.00 28.61 ? 309  PHE C CD1 1 
ATOM   10991 C CD2 . PHE C 1 309 ? 52.167  -31.539 78.309  1.00 29.57 ? 309  PHE C CD2 1 
ATOM   10992 C CE1 . PHE C 1 309 ? 51.989  -32.911 75.858  1.00 28.73 ? 309  PHE C CE1 1 
ATOM   10993 C CE2 . PHE C 1 309 ? 51.738  -30.846 77.149  1.00 30.05 ? 309  PHE C CE2 1 
ATOM   10994 C CZ  . PHE C 1 309 ? 51.651  -31.532 75.922  1.00 28.45 ? 309  PHE C CZ  1 
ATOM   10995 N N   . GLY C 1 310 ? 55.485  -31.840 80.797  1.00 30.14 ? 310  GLY C N   1 
ATOM   10996 C CA  . GLY C 1 310 ? 56.139  -30.547 80.919  1.00 30.16 ? 310  GLY C CA  1 
ATOM   10997 C C   . GLY C 1 310 ? 55.304  -29.450 81.545  1.00 29.71 ? 310  GLY C C   1 
ATOM   10998 O O   . GLY C 1 310 ? 55.703  -28.286 81.535  1.00 29.81 ? 310  GLY C O   1 
ATOM   10999 N N   . ILE C 1 311 ? 54.128  -29.811 82.056  1.00 29.93 ? 311  ILE C N   1 
ATOM   11000 C CA  . ILE C 1 311 ? 53.236  -28.853 82.712  1.00 30.25 ? 311  ILE C CA  1 
ATOM   11001 C C   . ILE C 1 311 ? 53.552  -28.831 84.210  1.00 31.33 ? 311  ILE C C   1 
ATOM   11002 O O   . ILE C 1 311 ? 53.755  -29.883 84.827  1.00 31.91 ? 311  ILE C O   1 
ATOM   11003 C CB  . ILE C 1 311 ? 51.726  -29.192 82.436  1.00 29.85 ? 311  ILE C CB  1 
ATOM   11004 C CG1 . ILE C 1 311 ? 51.343  -28.724 81.028  1.00 29.11 ? 311  ILE C CG1 1 
ATOM   11005 C CG2 . ILE C 1 311 ? 50.793  -28.528 83.472  1.00 28.43 ? 311  ILE C CG2 1 
ATOM   11006 C CD1 . ILE C 1 311 ? 50.183  -29.485 80.392  1.00 29.37 ? 311  ILE C CD1 1 
ATOM   11007 N N   . ASP C 1 312 ? 53.595  -27.622 84.770  1.00 32.48 ? 312  ASP C N   1 
ATOM   11008 C CA  . ASP C 1 312 ? 53.880  -27.391 86.190  1.00 33.76 ? 312  ASP C CA  1 
ATOM   11009 C C   . ASP C 1 312 ? 52.749  -27.899 87.085  1.00 33.78 ? 312  ASP C C   1 
ATOM   11010 O O   . ASP C 1 312 ? 51.582  -27.912 86.672  1.00 32.32 ? 312  ASP C O   1 
ATOM   11011 C CB  . ASP C 1 312 ? 54.110  -25.890 86.447  1.00 35.78 ? 312  ASP C CB  1 
ATOM   11012 C CG  . ASP C 1 312 ? 55.363  -25.344 85.756  1.00 37.52 ? 312  ASP C CG  1 
ATOM   11013 O OD1 . ASP C 1 312 ? 55.879  -25.971 84.801  1.00 39.06 ? 312  ASP C OD1 1 
ATOM   11014 O OD2 . ASP C 1 312 ? 55.832  -24.259 86.166  1.00 38.41 ? 312  ASP C OD2 1 
ATOM   11015 N N   . GLU C 1 313 ? 53.099  -28.316 88.304  1.00 33.54 ? 313  GLU C N   1 
ATOM   11016 C CA  . GLU C 1 313 ? 52.131  -28.836 89.281  1.00 33.91 ? 313  GLU C CA  1 
ATOM   11017 C C   . GLU C 1 313 ? 51.121  -27.791 89.766  1.00 32.71 ? 313  GLU C C   1 
ATOM   11018 O O   . GLU C 1 313 ? 50.017  -28.143 90.195  1.00 32.26 ? 313  GLU C O   1 
ATOM   11019 C CB  . GLU C 1 313 ? 52.827  -29.515 90.481  1.00 36.53 ? 313  GLU C CB  1 
ATOM   11020 C CG  . GLU C 1 313 ? 54.356  -29.390 90.571  1.00 40.23 ? 313  GLU C CG  1 
ATOM   11021 C CD  . GLU C 1 313 ? 55.101  -30.237 89.544  1.00 42.11 ? 313  GLU C CD  1 
ATOM   11022 O OE1 . GLU C 1 313 ? 54.941  -31.479 89.550  1.00 44.00 ? 313  GLU C OE1 1 
ATOM   11023 O OE2 . GLU C 1 313 ? 55.845  -29.656 88.719  1.00 43.17 ? 313  GLU C OE2 1 
ATOM   11024 N N   . GLU C 1 314 ? 51.492  -26.512 89.653  1.00 31.68 ? 314  GLU C N   1 
ATOM   11025 C CA  . GLU C 1 314 ? 50.627  -25.391 90.031  1.00 31.07 ? 314  GLU C CA  1 
ATOM   11026 C C   . GLU C 1 314 ? 49.574  -25.152 88.947  1.00 28.88 ? 314  GLU C C   1 
ATOM   11027 O O   . GLU C 1 314 ? 48.509  -24.585 89.211  1.00 29.62 ? 314  GLU C O   1 
ATOM   11028 C CB  . GLU C 1 314 ? 51.444  -24.110 90.228  1.00 33.72 ? 314  GLU C CB  1 
ATOM   11029 C CG  . GLU C 1 314 ? 51.912  -23.862 91.659  1.00 36.88 ? 314  GLU C CG  1 
ATOM   11030 C CD  . GLU C 1 314 ? 52.350  -22.415 91.916  1.00 39.29 ? 314  GLU C CD  1 
ATOM   11031 O OE1 . GLU C 1 314 ? 52.179  -21.542 91.031  1.00 40.14 ? 314  GL