data_2O2V
# 
_entry.id   2O2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2O2V         
RCSB  RCSB040617   
WWPDB D_1000040617 
# 
_pdbx_database_status.entry_id                        2O2V 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-11-30 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1 
'Savitsky, P.'                         2 
'Ugochukwu, E.'                        3 
'Edwards, A.'                          4 
'Arrowsmith, C.'                       5 
'Sundstrom, M.'                        6 
'von Delft, F.'                        7 
'Knapp, S.'                            8 
'Structural Genomics Consortium (SGC)' 9 
# 
_citation.id                        primary 
_citation.title                     
;Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1 
primary 'Savitsky, P.'        2 
primary 'Ugochukwu, E.'       3 
primary 'Edwards, A.'         4 
primary 'Arrowsmith, C.'      5 
primary 'Sundstrom, M.'       6 
primary 'von Delft, F.'       7 
primary 'Knapp, S.'           8 
# 
_cell.length_a           87.654 
_cell.length_b           87.654 
_cell.length_c           55.408 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2O2V 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.entry_id                         2O2V 
_symmetry.Int_Tables_number                92 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 5' 11941.498 1   2.7.12.2  ? MAP2K5-phox  ? 
2 polymer man 'Mitogen-activated protein kinase kinase kinase 3'           10484.896 1   2.7.11.25 ? MAP3K3B-phox ? 
3 water   nat water                                                        18.015    141 ?         ? ?            ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MAP kinase kinase 5, MAPKK 5, MAPK/ERK kinase 5' 
2 'MAPK/ERK kinase kinase 3, MEK kinase 3, MEKK 3'  
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SMALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAML
SYYYSTVMEQQVNGQLIEPLQIFPRA
;
;SMALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAML
SYYYSTVMEQQVNGQLIEPLQIFPRA
;
A ? 
2 'polypeptide(L)' no no 
;SMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMK
SLRILLLSQD
;
;SMGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMK
SLRILLLSQD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ALA n 
1 4   LEU n 
1 5   GLY n 
1 6   PRO n 
1 7   PHE n 
1 8   PRO n 
1 9   ALA n 
1 10  MET n 
1 11  GLU n 
1 12  ASN n 
1 13  GLN n 
1 14  VAL n 
1 15  LEU n 
1 16  VAL n 
1 17  ILE n 
1 18  ARG n 
1 19  ILE n 
1 20  LYS n 
1 21  ILE n 
1 22  PRO n 
1 23  ASN n 
1 24  SER n 
1 25  GLY n 
1 26  ALA n 
1 27  VAL n 
1 28  ASP n 
1 29  TRP n 
1 30  THR n 
1 31  VAL n 
1 32  HIS n 
1 33  SER n 
1 34  GLY n 
1 35  PRO n 
1 36  GLN n 
1 37  LEU n 
1 38  LEU n 
1 39  PHE n 
1 40  ARG n 
1 41  ASP n 
1 42  VAL n 
1 43  LEU n 
1 44  ASP n 
1 45  VAL n 
1 46  ILE n 
1 47  GLY n 
1 48  GLN n 
1 49  VAL n 
1 50  LEU n 
1 51  PRO n 
1 52  GLU n 
1 53  ALA n 
1 54  THR n 
1 55  THR n 
1 56  THR n 
1 57  ALA n 
1 58  PHE n 
1 59  GLU n 
1 60  TYR n 
1 61  GLU n 
1 62  ASP n 
1 63  GLU n 
1 64  ASP n 
1 65  GLY n 
1 66  ASP n 
1 67  ARG n 
1 68  ILE n 
1 69  THR n 
1 70  VAL n 
1 71  ARG n 
1 72  SER n 
1 73  ASP n 
1 74  GLU n 
1 75  GLU n 
1 76  MET n 
1 77  LYS n 
1 78  ALA n 
1 79  MET n 
1 80  LEU n 
1 81  SER n 
1 82  TYR n 
1 83  TYR n 
1 84  TYR n 
1 85  SER n 
1 86  THR n 
1 87  VAL n 
1 88  MET n 
1 89  GLU n 
1 90  GLN n 
1 91  GLN n 
1 92  VAL n 
1 93  ASN n 
1 94  GLY n 
1 95  GLN n 
1 96  LEU n 
1 97  ILE n 
1 98  GLU n 
1 99  PRO n 
1 100 LEU n 
1 101 GLN n 
1 102 ILE n 
1 103 PHE n 
1 104 PRO n 
1 105 ARG n 
1 106 ALA n 
2 1   SER n 
2 2   MET n 
2 3   GLY n 
2 4   HIS n 
2 5   SER n 
2 6   ASN n 
2 7   ARG n 
2 8   GLN n 
2 9   SER n 
2 10  ASP n 
2 11  VAL n 
2 12  ARG n 
2 13  ILE n 
2 14  LYS n 
2 15  PHE n 
2 16  GLU n 
2 17  HIS n 
2 18  ASN n 
2 19  GLY n 
2 20  GLU n 
2 21  ARG n 
2 22  ARG n 
2 23  ILE n 
2 24  ILE n 
2 25  ALA n 
2 26  PHE n 
2 27  SER n 
2 28  ARG n 
2 29  PRO n 
2 30  VAL n 
2 31  LYS n 
2 32  TYR n 
2 33  GLU n 
2 34  ASP n 
2 35  VAL n 
2 36  GLU n 
2 37  HIS n 
2 38  LYS n 
2 39  VAL n 
2 40  THR n 
2 41  THR n 
2 42  VAL n 
2 43  PHE n 
2 44  GLY n 
2 45  GLN n 
2 46  PRO n 
2 47  LEU n 
2 48  ASP n 
2 49  LEU n 
2 50  HIS n 
2 51  TYR n 
2 52  MET n 
2 53  ASN n 
2 54  ASN n 
2 55  GLU n 
2 56  LEU n 
2 57  SER n 
2 58  ILE n 
2 59  LEU n 
2 60  LEU n 
2 61  LYS n 
2 62  ASN n 
2 63  GLN n 
2 64  ASP n 
2 65  ASP n 
2 66  LEU n 
2 67  ASP n 
2 68  LYS n 
2 69  ALA n 
2 70  ILE n 
2 71  ASP n 
2 72  ILE n 
2 73  LEU n 
2 74  ASP n 
2 75  ARG n 
2 76  SER n 
2 77  SER n 
2 78  SER n 
2 79  MET n 
2 80  LYS n 
2 81  SER n 
2 82  LEU n 
2 83  ARG n 
2 84  ILE n 
2 85  LEU n 
2 86  LEU n 
2 87  LEU n 
2 88  SER n 
2 89  GLN n 
2 90  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo 'MAP2K5, MEK5, MKK5, PRKMK5' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? 'BL21(DE3)-R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
2 1 sample ? ? ? human Homo 'MAP3K3, MAPKKK3, MEKK3'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? 'BL21(DE3)-R3' ? ? ? ? ? ? ? PLASMID ? ? ? pNIC28-Bsa4 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP MP2K5_HUMAN Q13163 1 5  ? ? 
2 UNP M3K3_HUMAN  Q99759 2 37 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O2V A 3 ? 106 ? Q13163 5  ? 108 ? 5  108 
2 2 2O2V B 3 ? 90  ? Q99759 37 ? 124 ? 37 124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O2V SER A 1 ? UNP Q13163 ? ? 'CLONING ARTIFACT' 3  1 
1 2O2V MET A 2 ? UNP Q13163 ? ? 'CLONING ARTIFACT' 4  2 
2 2O2V SER B 1 ? UNP Q99759 ? ? 'CLONING ARTIFACT' 35 3 
2 2O2V MET B 2 ? UNP Q99759 ? ? 'CLONING ARTIFACT' 36 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O2V 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.37 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   48.14 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'0.02M CaCl2, 0.1M Na(CH3COO), 30% MPD, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   2006-11-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        RIGAKU 
_diffrn_source.pdbx_wavelength             1.54 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2O2V 
_reflns.d_resolution_high            1.830 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   19523 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_netI_over_sigmaI        12.100 
_reflns.pdbx_chi_squared             1.027 
_reflns.pdbx_redundancy              6.100 
_reflns.percent_possible_obs         99.300 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   19661 
_reflns.pdbx_Rsym_value              0.075 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.83 
_reflns_shell.d_res_low              1.90 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.578 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        0.578 
_reflns_shell.pdbx_chi_squared       0.869 
_reflns_shell.pdbx_redundancy        3.70 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1836 
_reflns_shell.percent_possible_all   96.50 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O2V 
_refine.ls_d_res_high                            1.830 
_refine.ls_d_res_low                             46.83 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.310 
_refine.ls_number_reflns_obs                     19483 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.196 
_refine.ls_R_factor_R_work                       0.194 
_refine.ls_R_factor_R_free                       0.224 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  997 
_refine.B_iso_mean                               16.491 
_refine.aniso_B[1][1]                            -0.020 
_refine.aniso_B[2][2]                            -0.020 
_refine.aniso_B[3][3]                            0.040 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.955 
_refine.correlation_coeff_Fo_to_Fc_free          0.944 
_refine.pdbx_overall_ESU_R                       0.127 
_refine.pdbx_overall_ESU_R_Free                  0.120 
_refine.overall_SU_ML                            0.082 
_refine.overall_SU_B                             5.099 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          0.196 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'pdb entries 2C60, 1WI0' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1371 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               1512 
_refine_hist.d_res_high                       1.830 
_refine_hist.d_res_low                        46.83 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1402 0.016  0.022  ? 'X-RAY DIFFRACTION' ? 
r_bond_other_d           934  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1903 1.577  1.968  ? 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        2288 1.005  3.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   175  5.802  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   65   30.369 24.308 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   245  12.093 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   10   19.166 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           225  0.086  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     1543 0.006  0.020  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       274  0.001  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            211  0.207  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbd_other              945  0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          654  0.167  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_other            760  0.087  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    86   0.122  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   14   0.227  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     22   0.231  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 12   0.155  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              898  1.005  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_other           347  0.259  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1419 1.566  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              562  2.524  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             482  3.552  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.830 
_refine_ls_shell.d_res_low                        1.876 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.660 
_refine_ls_shell.number_reflns_R_work             1278 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.328 
_refine_ls_shell.R_factor_R_free                  0.422 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1345 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O2V 
_struct.title                     
;Crystal Structure of the Complex of Human Mitogen Activated Protein Kinase Kinase 5 Phox Domain (MAP2K5-phox) with Human Mitogen Activated Protein Kinase Kinase Kinase 3 (MAP3K3B-phox)
;
_struct.pdbx_descriptor           
;Dual specificity mitogen-activated protein kinase kinase 5 (E.C.2.7.12.2), Mitogen-activated protein kinase kinase kinase 3 (E.C.2.7.11.25)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O2V 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;mitogen activated protein kinase kinase 5, MAP2K5, MEK5, MKK5, PRKMK5, MAP kinase 5, phox, phox-domain, mitogen activated protein kinase kinase kinase 3, MEKK3, MAPKKK3, MAP/ERK kinase kinase 3, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 38 ? LEU A 50 ? LEU A 40 LEU A 52  1 ? 13 
HELX_P HELX_P2 2 SER A 72 ? GLY A 94 ? SER A 74 GLY A 96  1 ? 23 
HELX_P HELX_P3 3 LYS B 31 ? GLY B 44 ? LYS B 65 GLY B 78  1 ? 14 
HELX_P HELX_P4 4 ASN B 62 ? SER B 76 ? ASN B 96 SER B 110 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           28 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            62 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    29 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     63 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLY A 25  ? VAL A 31  ? GLY A 27  VAL A 33  
A 2 LEU A 15  ? ILE A 21  ? LEU A 17  ILE A 23  
A 3 LEU A 100 ? ARG A 105 ? LEU A 102 ARG A 107 
A 4 ALA A 57  ? GLU A 61  ? ALA A 59  GLU A 63  
A 5 ARG A 67  ? VAL A 70  ? ARG A 69  VAL A 72  
B 1 GLU B 20  ? PHE B 26  ? GLU B 54  PHE B 60  
B 2 VAL B 11  ? HIS B 17  ? VAL B 45  HIS B 51  
B 3 LEU B 82  ? LEU B 87  ? LEU B 116 LEU B 121 
B 4 ASP B 48  ? ASN B 53  ? ASP B 82  ASN B 87  
B 5 LEU B 56  ? LEU B 60  ? LEU B 90  LEU B 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 27  ? O VAL A 29  N ILE A 19  ? N ILE A 21  
A 2 3 N ARG A 18  ? N ARG A 20  O ILE A 102 ? O ILE A 104 
A 3 4 O PHE A 103 ? O PHE A 105 N GLU A 59  ? N GLU A 61  
A 4 5 N PHE A 58  ? N PHE A 60  O VAL A 70  ? O VAL A 72  
B 1 2 O ARG B 22  ? O ARG B 56  N PHE B 15  ? N PHE B 49  
B 2 3 N GLU B 16  ? N GLU B 50  O LEU B 86  ? O LEU B 120 
B 3 4 O LEU B 85  ? O LEU B 119 N HIS B 50  ? N HIS B 84  
B 4 5 N ASN B 53  ? N ASN B 87  O LEU B 56  ? O LEU B 90  
# 
_atom_sites.entry_id                    2O2V 
_atom_sites.fract_transf_matrix[1][1]   0.011408 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011408 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018048 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A 1 14  ? 25.473 39.343 17.899  1.00 26.16 ? 16  VAL A N   1 
ATOM   2    C CA  . VAL A 1 14  ? 24.798 39.464 16.542  1.00 25.44 ? 16  VAL A CA  1 
ATOM   3    C C   . VAL A 1 14  ? 24.847 38.179 15.662  1.00 24.20 ? 16  VAL A C   1 
ATOM   4    O O   . VAL A 1 14  ? 25.907 37.766 15.205  1.00 25.49 ? 16  VAL A O   1 
ATOM   5    C CB  . VAL A 1 14  ? 25.382 40.632 15.732  1.00 25.83 ? 16  VAL A CB  1 
ATOM   6    C CG1 . VAL A 1 14  ? 24.615 40.829 14.415  1.00 25.34 ? 16  VAL A CG1 1 
ATOM   7    C CG2 . VAL A 1 14  ? 25.365 41.941 16.561  1.00 27.31 ? 16  VAL A CG2 1 
ATOM   8    N N   . LEU A 1 15  ? 23.682 37.603 15.391  1.00 21.90 ? 17  LEU A N   1 
ATOM   9    C CA  . LEU A 1 15  ? 23.532 36.428 14.532  1.00 20.47 ? 17  LEU A CA  1 
ATOM   10   C C   . LEU A 1 15  ? 22.901 36.902 13.228  1.00 18.84 ? 17  LEU A C   1 
ATOM   11   O O   . LEU A 1 15  ? 21.944 37.657 13.278  1.00 18.31 ? 17  LEU A O   1 
ATOM   12   C CB  . LEU A 1 15  ? 22.600 35.402 15.197  1.00 20.05 ? 17  LEU A CB  1 
ATOM   13   C CG  . LEU A 1 15  ? 22.051 34.231 14.371  1.00 20.84 ? 17  LEU A CG  1 
ATOM   14   C CD1 . LEU A 1 15  ? 23.165 33.297 13.880  1.00 22.12 ? 17  LEU A CD1 1 
ATOM   15   C CD2 . LEU A 1 15  ? 21.061 33.454 15.204  1.00 21.59 ? 17  LEU A CD2 1 
ATOM   16   N N   . VAL A 1 16  ? 23.432 36.466 12.078  1.00 16.72 ? 18  VAL A N   1 
ATOM   17   C CA  . VAL A 1 16  ? 22.821 36.749 10.793  1.00 15.85 ? 18  VAL A CA  1 
ATOM   18   C C   . VAL A 1 16  ? 22.310 35.443 10.173  1.00 15.90 ? 18  VAL A C   1 
ATOM   19   O O   . VAL A 1 16  ? 23.083 34.479 10.016  1.00 15.43 ? 18  VAL A O   1 
ATOM   20   C CB  . VAL A 1 16  ? 23.782 37.448 9.768   1.00 16.45 ? 18  VAL A CB  1 
ATOM   21   C CG1 . VAL A 1 16  ? 23.059 37.665 8.410   1.00 15.21 ? 18  VAL A CG1 1 
ATOM   22   C CG2 . VAL A 1 16  ? 24.326 38.791 10.329  1.00 17.37 ? 18  VAL A CG2 1 
ATOM   23   N N   . ILE A 1 17  ? 21.004 35.414 9.898   1.00 16.05 ? 19  ILE A N   1 
ATOM   24   C CA  . ILE A 1 17  ? 20.352 34.276 9.251   1.00 16.62 ? 19  ILE A CA  1 
ATOM   25   C C   . ILE A 1 17  ? 20.057 34.648 7.792   1.00 15.94 ? 19  ILE A C   1 
ATOM   26   O O   . ILE A 1 17  ? 19.367 35.615 7.500   1.00 17.16 ? 19  ILE A O   1 
ATOM   27   C CB  . ILE A 1 17  ? 19.094 33.803 9.971   1.00 17.36 ? 19  ILE A CB  1 
ATOM   28   C CG1 . ILE A 1 17  ? 19.439 33.345 11.392  1.00 16.95 ? 19  ILE A CG1 1 
ATOM   29   C CG2 . ILE A 1 17  ? 18.366 32.719 9.143   1.00 19.50 ? 19  ILE A CG2 1 
ATOM   30   C CD1 . ILE A 1 17  ? 18.196 32.973 12.216  1.00 18.81 ? 19  ILE A CD1 1 
ATOM   31   N N   . ARG A 1 18  ? 20.646 33.873 6.892   1.00 15.61 ? 20  ARG A N   1 
ATOM   32   C CA  . ARG A 1 18  ? 20.493 34.050 5.473   1.00 15.68 ? 20  ARG A CA  1 
ATOM   33   C C   . ARG A 1 18  ? 19.389 33.125 4.954   1.00 15.85 ? 20  ARG A C   1 
ATOM   34   O O   . ARG A 1 18  ? 19.520 31.889 4.951   1.00 16.78 ? 20  ARG A O   1 
ATOM   35   C CB  . ARG A 1 18  ? 21.816 33.824 4.774   1.00 16.55 ? 20  ARG A CB  1 
ATOM   36   C CG  . ARG A 1 18  ? 21.722 33.834 3.241   1.00 16.39 ? 20  ARG A CG  1 
ATOM   37   C CD  . ARG A 1 18  ? 23.033 34.089 2.570   1.00 17.75 ? 20  ARG A CD  1 
ATOM   38   N NE  . ARG A 1 18  ? 23.486 35.456 2.740   1.00 17.74 ? 20  ARG A NE  1 
ATOM   39   C CZ  . ARG A 1 18  ? 24.675 35.891 2.379   1.00 19.48 ? 20  ARG A CZ  1 
ATOM   40   N NH1 . ARG A 1 18  ? 25.537 35.082 1.767   1.00 23.78 ? 20  ARG A NH1 1 
ATOM   41   N NH2 . ARG A 1 18  ? 24.986 37.146 2.589   1.00 20.62 ? 20  ARG A NH2 1 
ATOM   42   N N   . ILE A 1 19  ? 18.297 33.732 4.537   1.00 15.69 ? 21  ILE A N   1 
ATOM   43   C CA  . ILE A 1 19  ? 17.086 32.994 4.163   1.00 16.68 ? 21  ILE A CA  1 
ATOM   44   C C   . ILE A 1 19  ? 17.069 32.937 2.631   1.00 16.30 ? 21  ILE A C   1 
ATOM   45   O O   . ILE A 1 19  ? 16.885 33.964 1.970   1.00 16.24 ? 21  ILE A O   1 
ATOM   46   C CB  . ILE A 1 19  ? 15.813 33.668 4.680   1.00 16.36 ? 21  ILE A CB  1 
ATOM   47   C CG1 . ILE A 1 19  ? 15.838 33.786 6.216   1.00 17.96 ? 21  ILE A CG1 1 
ATOM   48   C CG2 . ILE A 1 19  ? 14.545 32.906 4.201   1.00 16.08 ? 21  ILE A CG2 1 
ATOM   49   C CD1 . ILE A 1 19  ? 14.871 34.785 6.697   1.00 16.93 ? 21  ILE A CD1 1 
ATOM   50   N N   . LYS A 1 20  ? 17.254 31.732 2.102   1.00 15.88 ? 22  LYS A N   1 
ATOM   51   C CA  . LYS A 1 20  ? 17.242 31.500 0.673   1.00 15.56 ? 22  LYS A CA  1 
ATOM   52   C C   . LYS A 1 20  ? 15.857 31.857 0.120   1.00 15.64 ? 22  LYS A C   1 
ATOM   53   O O   . LYS A 1 20  ? 14.792 31.512 0.705   1.00 15.25 ? 22  LYS A O   1 
ATOM   54   C CB  . LYS A 1 20  ? 17.629 30.083 0.292   1.00 16.50 ? 22  LYS A CB  1 
ATOM   55   C CG  . LYS A 1 20  ? 17.893 29.885 -1.168  1.00 18.11 ? 22  LYS A CG  1 
ATOM   56   C CD  . LYS A 1 20  ? 19.155 30.594 -1.656  1.00 19.73 ? 22  LYS A CD  1 
ATOM   57   C CE  . LYS A 1 20  ? 19.393 30.472 -3.185  1.00 20.21 ? 22  LYS A CE  1 
ATOM   58   N NZ  . LYS A 1 20  ? 18.730 31.536 -4.088  1.00 16.32 ? 22  LYS A NZ  1 
ATOM   59   N N   . ILE A 1 21  ? 15.882 32.581 -0.995  1.00 15.62 ? 23  ILE A N   1 
ATOM   60   C CA  . ILE A 1 21  ? 14.670 32.920 -1.737  1.00 15.29 ? 23  ILE A CA  1 
ATOM   61   C C   . ILE A 1 21  ? 14.822 32.501 -3.193  1.00 14.83 ? 23  ILE A C   1 
ATOM   62   O O   . ILE A 1 21  ? 15.939 32.220 -3.662  1.00 14.19 ? 23  ILE A O   1 
ATOM   63   C CB  . ILE A 1 21  ? 14.294 34.473 -1.614  1.00 15.09 ? 23  ILE A CB  1 
ATOM   64   C CG1 . ILE A 1 21  ? 15.346 35.395 -2.280  1.00 16.72 ? 23  ILE A CG1 1 
ATOM   65   C CG2 . ILE A 1 21  ? 14.041 34.857 -0.158  1.00 15.93 ? 23  ILE A CG2 1 
ATOM   66   C CD1 . ILE A 1 21  ? 14.847 36.849 -2.581  1.00 16.07 ? 23  ILE A CD1 1 
ATOM   67   N N   . PRO A 1 22  ? 13.694 32.419 -3.933  1.00 15.56 ? 24  PRO A N   1 
ATOM   68   C CA  . PRO A 1 22  ? 13.782 31.944 -5.300  1.00 16.52 ? 24  PRO A CA  1 
ATOM   69   C C   . PRO A 1 22  ? 14.620 32.888 -6.178  1.00 17.84 ? 24  PRO A C   1 
ATOM   70   O O   . PRO A 1 22  ? 14.767 34.064 -5.845  1.00 17.61 ? 24  PRO A O   1 
ATOM   71   C CB  . PRO A 1 22  ? 12.311 31.883 -5.761  1.00 16.53 ? 24  PRO A CB  1 
ATOM   72   C CG  . PRO A 1 22  ? 11.516 31.907 -4.547  1.00 17.30 ? 24  PRO A CG  1 
ATOM   73   C CD  . PRO A 1 22  ? 12.294 32.685 -3.542  1.00 15.63 ? 24  PRO A CD  1 
ATOM   74   N N   . ASN A 1 23  ? 15.245 32.343 -7.216  1.00 18.80 ? 25  ASN A N   1 
ATOM   75   C CA  . ASN A 1 23  ? 15.918 33.135 -8.261  1.00 20.89 ? 25  ASN A CA  1 
ATOM   76   C C   . ASN A 1 23  ? 17.226 33.919 -7.908  1.00 22.07 ? 25  ASN A C   1 
ATOM   77   O O   . ASN A 1 23  ? 17.400 35.103 -8.239  1.00 22.95 ? 25  ASN A O   1 
ATOM   78   C CB  . ASN A 1 23  ? 14.845 34.002 -8.931  1.00 21.76 ? 25  ASN A CB  1 
ATOM   79   C CG  . ASN A 1 23  ? 13.655 33.160 -9.419  1.00 24.65 ? 25  ASN A CG  1 
ATOM   80   O OD1 . ASN A 1 23  ? 13.841 32.218 -10.191 1.00 30.50 ? 25  ASN A OD1 1 
ATOM   81   N ND2 . ASN A 1 23  ? 12.440 33.491 -8.973  1.00 27.79 ? 25  ASN A ND2 1 
ATOM   82   N N   . SER A 1 24  ? 18.148 33.218 -7.247  1.00 23.14 ? 26  SER A N   1 
ATOM   83   C CA  . SER A 1 24  ? 19.548 33.641 -6.977  1.00 23.76 ? 26  SER A CA  1 
ATOM   84   C C   . SER A 1 24  ? 19.689 34.644 -5.827  1.00 23.93 ? 26  SER A C   1 
ATOM   85   O O   . SER A 1 24  ? 20.731 35.280 -5.694  1.00 26.85 ? 26  SER A O   1 
ATOM   86   C CB  . SER A 1 24  ? 20.272 34.172 -8.228  1.00 24.33 ? 26  SER A CB  1 
ATOM   87   O OG  . SER A 1 24  ? 20.275 33.235 -9.301  1.00 26.51 ? 26  SER A OG  1 
ATOM   88   N N   . GLY A 1 25  ? 18.652 34.810 -5.025  1.00 21.55 ? 27  GLY A N   1 
ATOM   89   C CA  . GLY A 1 25  ? 18.752 35.673 -3.877  1.00 20.93 ? 27  GLY A CA  1 
ATOM   90   C C   . GLY A 1 25  ? 18.785 34.953 -2.552  1.00 18.36 ? 27  GLY A C   1 
ATOM   91   O O   . GLY A 1 25  ? 18.512 33.760 -2.453  1.00 16.63 ? 27  GLY A O   1 
ATOM   92   N N   . ALA A 1 26  ? 19.149 35.714 -1.528  1.00 17.55 ? 28  ALA A N   1 
ATOM   93   C CA  . ALA A 1 26  ? 18.860 35.365 -0.153  1.00 16.88 ? 28  ALA A CA  1 
ATOM   94   C C   . ALA A 1 26  ? 18.641 36.676 0.618   1.00 16.61 ? 28  ALA A C   1 
ATOM   95   O O   . ALA A 1 26  ? 19.273 37.688 0.299   1.00 17.93 ? 28  ALA A O   1 
ATOM   96   C CB  . ALA A 1 26  ? 19.967 34.565 0.451   1.00 17.49 ? 28  ALA A CB  1 
ATOM   97   N N   . VAL A 1 27  ? 17.752 36.641 1.608   1.00 16.07 ? 29  VAL A N   1 
ATOM   98   C CA  . VAL A 1 27  ? 17.497 37.786 2.479   1.00 15.78 ? 29  VAL A CA  1 
ATOM   99   C C   . VAL A 1 27  ? 18.193 37.510 3.807   1.00 15.43 ? 29  VAL A C   1 
ATOM   100  O O   . VAL A 1 27  ? 17.972 36.459 4.437   1.00 17.48 ? 29  VAL A O   1 
ATOM   101  C CB  . VAL A 1 27  ? 15.972 38.079 2.642   1.00 16.06 ? 29  VAL A CB  1 
ATOM   102  C CG1 . VAL A 1 27  ? 15.734 39.151 3.728   1.00 16.70 ? 29  VAL A CG1 1 
ATOM   103  C CG2 . VAL A 1 27  ? 15.344 38.463 1.254   1.00 17.04 ? 29  VAL A CG2 1 
ATOM   104  N N   . ASP A 1 28  ? 19.062 38.426 4.198   1.00 16.30 ? 30  ASP A N   1 
ATOM   105  C CA  . ASP A 1 28  ? 19.777 38.355 5.449   1.00 15.98 ? 30  ASP A CA  1 
ATOM   106  C C   . ASP A 1 28  ? 18.995 39.073 6.548   1.00 16.14 ? 30  ASP A C   1 
ATOM   107  O O   . ASP A 1 28  ? 18.689 40.279 6.449   1.00 15.49 ? 30  ASP A O   1 
ATOM   108  C CB  . ASP A 1 28  ? 21.171 38.932 5.298   1.00 16.15 ? 30  ASP A CB  1 
ATOM   109  C CG  . ASP A 1 28  ? 22.001 38.164 4.268   1.00 17.18 ? 30  ASP A CG  1 
ATOM   110  O OD1 . ASP A 1 28  ? 22.033 36.924 4.337   1.00 18.31 ? 30  ASP A OD1 1 
ATOM   111  O OD2 . ASP A 1 28  ? 22.617 38.793 3.395   1.00 20.40 ? 30  ASP A OD2 1 
ATOM   112  N N   . TRP A 1 29  ? 18.724 38.308 7.593   1.00 16.14 ? 31  TRP A N   1 
ATOM   113  C CA  . TRP A 1 29  ? 18.068 38.795 8.782   1.00 16.89 ? 31  TRP A CA  1 
ATOM   114  C C   . TRP A 1 29  ? 19.088 38.892 9.925   1.00 16.31 ? 31  TRP A C   1 
ATOM   115  O O   . TRP A 1 29  ? 19.714 37.891 10.319  1.00 14.73 ? 31  TRP A O   1 
ATOM   116  C CB  . TRP A 1 29  ? 16.888 37.889 9.142   1.00 18.32 ? 31  TRP A CB  1 
ATOM   117  C CG  . TRP A 1 29  ? 16.227 38.245 10.465  1.00 18.58 ? 31  TRP A CG  1 
ATOM   118  C CD1 . TRP A 1 29  ? 16.085 39.477 11.018  1.00 19.75 ? 31  TRP A CD1 1 
ATOM   119  C CD2 . TRP A 1 29  ? 15.586 37.333 11.346  1.00 20.77 ? 31  TRP A CD2 1 
ATOM   120  N NE1 . TRP A 1 29  ? 15.418 39.388 12.235  1.00 20.80 ? 31  TRP A NE1 1 
ATOM   121  C CE2 . TRP A 1 29  ? 15.109 38.075 12.455  1.00 20.74 ? 31  TRP A CE2 1 
ATOM   122  C CE3 . TRP A 1 29  ? 15.392 35.956 11.323  1.00 20.65 ? 31  TRP A CE3 1 
ATOM   123  C CZ2 . TRP A 1 29  ? 14.421 37.476 13.515  1.00 22.27 ? 31  TRP A CZ2 1 
ATOM   124  C CZ3 . TRP A 1 29  ? 14.713 35.358 12.409  1.00 21.19 ? 31  TRP A CZ3 1 
ATOM   125  C CH2 . TRP A 1 29  ? 14.248 36.118 13.464  1.00 21.29 ? 31  TRP A CH2 1 
ATOM   126  N N   . THR A 1 30  ? 19.258 40.122 10.412  1.00 15.78 ? 32  THR A N   1 
ATOM   127  C CA  . THR A 1 30  ? 20.153 40.415 11.522  1.00 16.41 ? 32  THR A CA  1 
ATOM   128  C C   . THR A 1 30  ? 19.380 40.321 12.818  1.00 16.71 ? 32  THR A C   1 
ATOM   129  O O   . THR A 1 30  ? 18.503 41.151 13.113  1.00 16.37 ? 32  THR A O   1 
ATOM   130  C CB  . THR A 1 30  ? 20.871 41.771 11.334  1.00 16.40 ? 32  THR A CB  1 
ATOM   131  O OG1 . THR A 1 30  ? 21.710 41.652 10.191  1.00 18.15 ? 32  THR A OG1 1 
ATOM   132  C CG2 . THR A 1 30  ? 21.733 42.111 12.529  1.00 17.43 ? 32  THR A CG2 1 
ATOM   133  N N   . VAL A 1 31  ? 19.706 39.274 13.575  1.00 18.03 ? 33  VAL A N   1 
ATOM   134  C CA  . VAL A 1 31  ? 19.011 38.922 14.806  1.00 20.69 ? 33  VAL A CA  1 
ATOM   135  C C   . VAL A 1 31  ? 19.796 39.494 15.995  1.00 23.13 ? 33  VAL A C   1 
ATOM   136  O O   . VAL A 1 31  ? 20.990 39.225 16.162  1.00 23.20 ? 33  VAL A O   1 
ATOM   137  C CB  . VAL A 1 31  ? 18.946 37.377 14.968  1.00 20.32 ? 33  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 31  ? 18.285 36.975 16.311  1.00 21.96 ? 33  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 31  ? 18.301 36.685 13.736  1.00 19.70 ? 33  VAL A CG2 1 
ATOM   140  N N   . HIS A 1 32  ? 19.149 40.288 16.829  1.00 26.53 ? 34  HIS A N   1 
ATOM   141  C CA  . HIS A 1 32  ? 19.850 40.839 18.004  1.00 28.79 ? 34  HIS A CA  1 
ATOM   142  C C   . HIS A 1 32  ? 19.533 40.049 19.268  1.00 29.71 ? 34  HIS A C   1 
ATOM   143  O O   . HIS A 1 32  ? 18.530 39.325 19.319  1.00 30.55 ? 34  HIS A O   1 
ATOM   144  C CB  . HIS A 1 32  ? 19.547 42.332 18.147  1.00 29.77 ? 34  HIS A CB  1 
ATOM   145  C CG  . HIS A 1 32  ? 20.063 43.142 17.001  1.00 31.96 ? 34  HIS A CG  1 
ATOM   146  N ND1 . HIS A 1 32  ? 21.247 43.852 17.063  1.00 34.86 ? 34  HIS A ND1 1 
ATOM   147  C CD2 . HIS A 1 32  ? 19.533 43.397 15.782  1.00 34.13 ? 34  HIS A CD2 1 
ATOM   148  C CE1 . HIS A 1 32  ? 21.429 44.497 15.925  1.00 35.18 ? 34  HIS A CE1 1 
ATOM   149  N NE2 . HIS A 1 32  ? 20.409 44.228 15.126  1.00 34.78 ? 34  HIS A NE2 1 
ATOM   150  N N   . SER A 1 33  ? 20.426 40.133 20.255  1.00 31.44 ? 35  SER A N   1 
ATOM   151  C CA  . SER A 1 33  ? 20.190 39.565 21.599  1.00 31.95 ? 35  SER A CA  1 
ATOM   152  C C   . SER A 1 33  ? 19.686 40.661 22.529  1.00 32.46 ? 35  SER A C   1 
ATOM   153  O O   . SER A 1 33  ? 18.813 41.447 22.155  1.00 33.16 ? 35  SER A O   1 
ATOM   154  C CB  . SER A 1 33  ? 21.469 38.950 22.190  1.00 32.33 ? 35  SER A CB  1 
ATOM   155  N N   . PRO A 1 35  ? 16.658 38.193 24.630  1.00 29.51 ? 37  PRO A N   1 
ATOM   156  C CA  . PRO A 1 35  ? 15.403 37.580 24.194  1.00 29.27 ? 37  PRO A CA  1 
ATOM   157  C C   . PRO A 1 35  ? 15.624 36.317 23.350  1.00 28.52 ? 37  PRO A C   1 
ATOM   158  O O   . PRO A 1 35  ? 16.390 36.334 22.387  1.00 28.60 ? 37  PRO A O   1 
ATOM   159  C CB  . PRO A 1 35  ? 14.764 38.685 23.349  1.00 29.48 ? 37  PRO A CB  1 
ATOM   160  C CG  . PRO A 1 35  ? 15.958 39.357 22.689  1.00 30.09 ? 37  PRO A CG  1 
ATOM   161  C CD  . PRO A 1 35  ? 17.156 39.154 23.632  1.00 29.68 ? 37  PRO A CD  1 
ATOM   162  N N   . GLN A 1 36  ? 14.951 35.230 23.720  1.00 27.51 ? 38  GLN A N   1 
ATOM   163  C CA  . GLN A 1 36  ? 15.167 33.931 23.077  1.00 26.53 ? 38  GLN A CA  1 
ATOM   164  C C   . GLN A 1 36  ? 14.638 33.970 21.654  1.00 24.90 ? 38  GLN A C   1 
ATOM   165  O O   . GLN A 1 36  ? 13.520 34.416 21.400  1.00 24.50 ? 38  GLN A O   1 
ATOM   166  C CB  . GLN A 1 36  ? 14.498 32.794 23.890  1.00 26.62 ? 38  GLN A CB  1 
ATOM   167  N N   . LEU A 1 37  ? 15.477 33.558 20.714  1.00 23.73 ? 39  LEU A N   1 
ATOM   168  C CA  . LEU A 1 37  ? 15.026 33.328 19.350  1.00 22.36 ? 39  LEU A CA  1 
ATOM   169  C C   . LEU A 1 37  ? 14.253 32.010 19.379  1.00 20.33 ? 39  LEU A C   1 
ATOM   170  O O   . LEU A 1 37  ? 14.777 30.989 19.856  1.00 19.13 ? 39  LEU A O   1 
ATOM   171  C CB  . LEU A 1 37  ? 16.206 33.222 18.398  1.00 23.14 ? 39  LEU A CB  1 
ATOM   172  C CG  . LEU A 1 37  ? 15.829 33.047 16.914  1.00 22.74 ? 39  LEU A CG  1 
ATOM   173  C CD1 . LEU A 1 37  ? 15.024 34.231 16.390  1.00 23.37 ? 39  LEU A CD1 1 
ATOM   174  C CD2 . LEU A 1 37  ? 17.089 32.806 16.078  1.00 24.77 ? 39  LEU A CD2 1 
ATOM   175  N N   . LEU A 1 38  ? 13.007 32.062 18.916  1.00 17.51 ? 40  LEU A N   1 
ATOM   176  C CA  . LEU A 1 38  ? 12.146 30.898 18.843  1.00 16.70 ? 40  LEU A CA  1 
ATOM   177  C C   . LEU A 1 38  ? 11.989 30.432 17.399  1.00 15.33 ? 40  LEU A C   1 
ATOM   178  O O   . LEU A 1 38  ? 12.057 31.227 16.459  1.00 13.40 ? 40  LEU A O   1 
ATOM   179  C CB  . LEU A 1 38  ? 10.754 31.208 19.425  1.00 16.23 ? 40  LEU A CB  1 
ATOM   180  C CG  . LEU A 1 38  ? 10.678 31.541 20.915  1.00 17.91 ? 40  LEU A CG  1 
ATOM   181  C CD1 . LEU A 1 38  ? 9.255  31.949 21.236  1.00 18.76 ? 40  LEU A CD1 1 
ATOM   182  C CD2 . LEU A 1 38  ? 11.114 30.357 21.786  1.00 17.73 ? 40  LEU A CD2 1 
ATOM   183  N N   . PHE A 1 39  ? 11.756 29.129 17.251  1.00 14.68 ? 41  PHE A N   1 
ATOM   184  C CA  . PHE A 1 39  ? 11.452 28.515 15.961  1.00 15.55 ? 41  PHE A CA  1 
ATOM   185  C C   . PHE A 1 39  ? 10.290 29.246 15.264  1.00 16.08 ? 41  PHE A C   1 
ATOM   186  O O   . PHE A 1 39  ? 10.369 29.543 14.077  1.00 15.28 ? 41  PHE A O   1 
ATOM   187  C CB  . PHE A 1 39  ? 11.160 27.019 16.167  1.00 15.77 ? 41  PHE A CB  1 
ATOM   188  C CG  . PHE A 1 39  ? 10.668 26.324 14.948  1.00 14.95 ? 41  PHE A CG  1 
ATOM   189  C CD1 . PHE A 1 39  ? 11.540 26.078 13.869  1.00 16.59 ? 41  PHE A CD1 1 
ATOM   190  C CD2 . PHE A 1 39  ? 9.379  25.885 14.874  1.00 15.39 ? 41  PHE A CD2 1 
ATOM   191  C CE1 . PHE A 1 39  ? 11.088 25.415 12.732  1.00 15.62 ? 41  PHE A CE1 1 
ATOM   192  C CE2 . PHE A 1 39  ? 8.903  25.224 13.741  1.00 17.59 ? 41  PHE A CE2 1 
ATOM   193  C CZ  . PHE A 1 39  ? 9.751  24.999 12.665  1.00 16.62 ? 41  PHE A CZ  1 
ATOM   194  N N   . ARG A 1 40  ? 9.268  29.584 16.029  1.00 20.00 ? 42  ARG A N   1 
ATOM   195  C CA  . ARG A 1 40  ? 8.140  30.333 15.527  1.00 20.00 ? 42  ARG A CA  1 
ATOM   196  C C   . ARG A 1 40  ? 8.483  31.715 14.969  1.00 20.00 ? 42  ARG A C   1 
ATOM   197  O O   . ARG A 1 40  ? 7.895  32.156 14.022  1.00 18.71 ? 42  ARG A O   1 
ATOM   198  C CB  . ARG A 1 40  ? 7.060  30.438 16.597  1.00 20.00 ? 42  ARG A CB  1 
ATOM   199  C CG  . ARG A 1 40  ? 5.763  30.940 16.091  1.00 20.00 ? 42  ARG A CG  1 
ATOM   200  C CD  . ARG A 1 40  ? 5.208  30.084 14.992  1.00 20.00 ? 42  ARG A CD  1 
ATOM   201  N NE  . ARG A 1 40  ? 5.049  30.828 13.750  1.00 20.00 ? 42  ARG A NE  1 
ATOM   202  N N   . ASP A 1 41  ? 9.412  32.389 15.606  1.00 17.71 ? 43  ASP A N   1 
ATOM   203  C CA  . ASP A 1 41  ? 9.885  33.702 15.163  1.00 18.30 ? 43  ASP A CA  1 
ATOM   204  C C   . ASP A 1 41  ? 10.578 33.592 13.780  1.00 17.58 ? 43  ASP A C   1 
ATOM   205  O O   . ASP A 1 41  ? 10.429 34.486 12.946  1.00 16.29 ? 43  ASP A O   1 
ATOM   206  C CB  . ASP A 1 41  ? 10.905 34.302 16.129  1.00 18.56 ? 43  ASP A CB  1 
ATOM   207  C CG  . ASP A 1 41  ? 10.374 34.510 17.542  1.00 20.89 ? 43  ASP A CG  1 
ATOM   208  O OD1 . ASP A 1 41  ? 9.148  34.745 17.729  1.00 21.12 ? 43  ASP A OD1 1 
ATOM   209  O OD2 . ASP A 1 41  ? 11.223 34.457 18.474  1.00 22.01 ? 43  ASP A OD2 1 
ATOM   210  N N   . VAL A 1 42  ? 11.354 32.521 13.572  1.00 17.58 ? 44  VAL A N   1 
ATOM   211  C CA  . VAL A 1 42  ? 12.045 32.303 12.292  1.00 17.61 ? 44  VAL A CA  1 
ATOM   212  C C   . VAL A 1 42  ? 11.003 32.079 11.209  1.00 17.02 ? 44  VAL A C   1 
ATOM   213  O O   . VAL A 1 42  ? 11.093 32.669 10.132  1.00 17.24 ? 44  VAL A O   1 
ATOM   214  C CB  . VAL A 1 42  ? 13.104 31.139 12.352  1.00 17.99 ? 44  VAL A CB  1 
ATOM   215  C CG1 . VAL A 1 42  ? 13.738 30.895 11.005  1.00 16.59 ? 44  VAL A CG1 1 
ATOM   216  C CG2 . VAL A 1 42  ? 14.185 31.435 13.433  1.00 18.54 ? 44  VAL A CG2 1 
ATOM   217  N N   . LEU A 1 43  ? 10.008 31.232 11.499  1.00 17.18 ? 45  LEU A N   1 
ATOM   218  C CA  . LEU A 1 43  ? 8.899  30.990 10.553  1.00 16.78 ? 45  LEU A CA  1 
ATOM   219  C C   . LEU A 1 43  ? 8.138  32.270 10.245  1.00 16.72 ? 45  LEU A C   1 
ATOM   220  O O   . LEU A 1 43  ? 7.748  32.493 9.110   1.00 17.00 ? 45  LEU A O   1 
ATOM   221  C CB  . LEU A 1 43  ? 7.932  29.922 11.086  1.00 17.07 ? 45  LEU A CB  1 
ATOM   222  C CG  . LEU A 1 43  ? 8.519  28.522 11.236  1.00 17.19 ? 45  LEU A CG  1 
ATOM   223  C CD1 . LEU A 1 43  ? 7.431  27.550 11.627  1.00 14.28 ? 45  LEU A CD1 1 
ATOM   224  C CD2 . LEU A 1 43  ? 9.246  28.077 9.951   1.00 19.34 ? 45  LEU A CD2 1 
ATOM   225  N N   . ASP A 1 44  ? 7.949  33.116 11.254  1.00 16.08 ? 46  ASP A N   1 
ATOM   226  C CA  . ASP A 1 44  ? 7.275  34.397 11.077  1.00 16.21 ? 46  ASP A CA  1 
ATOM   227  C C   . ASP A 1 44  ? 8.021  35.290 10.102  1.00 16.03 ? 46  ASP A C   1 
ATOM   228  O O   . ASP A 1 44  ? 7.405  35.833 9.182   1.00 15.93 ? 46  ASP A O   1 
ATOM   229  C CB  . ASP A 1 44  ? 7.038  35.080 12.432  1.00 16.86 ? 46  ASP A CB  1 
ATOM   230  C CG  . ASP A 1 44  ? 5.857  34.470 13.193  1.00 19.67 ? 46  ASP A CG  1 
ATOM   231  O OD1 . ASP A 1 44  ? 5.093  33.663 12.600  1.00 25.78 ? 46  ASP A OD1 1 
ATOM   232  O OD2 . ASP A 1 44  ? 5.709  34.747 14.403  1.00 22.92 ? 46  ASP A OD2 1 
ATOM   233  N N   . VAL A 1 45  ? 9.338  35.374 10.246  1.00 16.24 ? 47  VAL A N   1 
ATOM   234  C CA  . VAL A 1 45  ? 10.174 36.196 9.371   1.00 16.51 ? 47  VAL A CA  1 
ATOM   235  C C   . VAL A 1 45  ? 10.159 35.622 7.939   1.00 15.75 ? 47  VAL A C   1 
ATOM   236  O O   . VAL A 1 45  ? 9.996  36.367 7.013   1.00 15.60 ? 47  VAL A O   1 
ATOM   237  C CB  . VAL A 1 45  ? 11.601 36.388 9.922   1.00 16.33 ? 47  VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 45  ? 12.497 37.114 8.906   1.00 19.01 ? 47  VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 45  ? 11.547 37.139 11.243  1.00 17.26 ? 47  VAL A CG2 1 
ATOM   240  N N   . ILE A 1 46  ? 10.269 34.305 7.802   1.00 15.37 ? 48  ILE A N   1 
ATOM   241  C CA  . ILE A 1 46  ? 10.197 33.656 6.495   1.00 15.85 ? 48  ILE A CA  1 
ATOM   242  C C   . ILE A 1 46  ? 8.831  33.995 5.819   1.00 15.45 ? 48  ILE A C   1 
ATOM   243  O O   . ILE A 1 46  ? 8.789  34.307 4.644   1.00 15.06 ? 48  ILE A O   1 
ATOM   244  C CB  . ILE A 1 46  ? 10.445 32.111 6.542   1.00 15.61 ? 48  ILE A CB  1 
ATOM   245  C CG1 . ILE A 1 46  ? 11.840 31.737 7.157   1.00 16.70 ? 48  ILE A CG1 1 
ATOM   246  C CG2 . ILE A 1 46  ? 10.296 31.573 5.115   1.00 17.01 ? 48  ILE A CG2 1 
ATOM   247  C CD1 . ILE A 1 46  ? 12.067 30.254 7.485   1.00 15.92 ? 48  ILE A CD1 1 
ATOM   248  N N   . GLY A 1 47  ? 7.733  33.931 6.575   1.00 15.32 ? 49  GLY A N   1 
ATOM   249  C CA  . GLY A 1 47  ? 6.415  34.313 6.045   1.00 16.37 ? 49  GLY A CA  1 
ATOM   250  C C   . GLY A 1 47  ? 6.320  35.756 5.537   1.00 17.25 ? 49  GLY A C   1 
ATOM   251  O O   . GLY A 1 47  ? 5.580  36.050 4.601   1.00 17.31 ? 49  GLY A O   1 
ATOM   252  N N   . GLN A 1 48  ? 7.073  36.650 6.163   1.00 17.15 ? 50  GLN A N   1 
ATOM   253  C CA  . GLN A 1 48  ? 7.165  38.040 5.705   1.00 19.07 ? 50  GLN A CA  1 
ATOM   254  C C   . GLN A 1 48  ? 7.965  38.124 4.405   1.00 17.77 ? 50  GLN A C   1 
ATOM   255  O O   . GLN A 1 48  ? 7.589  38.829 3.485   1.00 17.40 ? 50  GLN A O   1 
ATOM   256  C CB  . GLN A 1 48  ? 7.841  38.919 6.757   1.00 18.97 ? 50  GLN A CB  1 
ATOM   257  C CG  . GLN A 1 48  ? 7.194  38.890 8.138   1.00 21.93 ? 50  GLN A CG  1 
ATOM   258  C CD  . GLN A 1 48  ? 7.951  39.740 9.150   1.00 23.78 ? 50  GLN A CD  1 
ATOM   259  O OE1 . GLN A 1 48  ? 8.305  40.892 8.859   1.00 31.60 ? 50  GLN A OE1 1 
ATOM   260  N NE2 . GLN A 1 48  ? 8.197  39.186 10.342  1.00 30.69 ? 50  GLN A NE2 1 
ATOM   261  N N   . VAL A 1 49  ? 9.056  37.381 4.340   1.00 17.37 ? 51  VAL A N   1 
ATOM   262  C CA  . VAL A 1 49  ? 9.981  37.439 3.220   1.00 18.19 ? 51  VAL A CA  1 
ATOM   263  C C   . VAL A 1 49  ? 9.395  36.709 1.994   1.00 18.05 ? 51  VAL A C   1 
ATOM   264  O O   . VAL A 1 49  ? 9.574  37.167 0.867   1.00 19.25 ? 51  VAL A O   1 
ATOM   265  C CB  . VAL A 1 49  ? 11.360 36.855 3.633   1.00 18.60 ? 51  VAL A CB  1 
ATOM   266  C CG1 . VAL A 1 49  ? 12.252 36.596 2.412   1.00 21.60 ? 51  VAL A CG1 1 
ATOM   267  C CG2 . VAL A 1 49  ? 12.052 37.793 4.637   1.00 20.76 ? 51  VAL A CG2 1 
ATOM   268  N N   . LEU A 1 50  ? 8.666  35.622 2.249   1.00 18.04 ? 52  LEU A N   1 
ATOM   269  C CA  . LEU A 1 50  ? 8.011  34.798 1.232   1.00 18.07 ? 52  LEU A CA  1 
ATOM   270  C C   . LEU A 1 50  ? 6.488  34.693 1.463   1.00 18.43 ? 52  LEU A C   1 
ATOM   271  O O   . LEU A 1 50  ? 5.979  33.632 1.831   1.00 16.97 ? 52  LEU A O   1 
ATOM   272  C CB  . LEU A 1 50  ? 8.649  33.409 1.214   1.00 18.54 ? 52  LEU A CB  1 
ATOM   273  C CG  . LEU A 1 50  ? 10.141 33.361 0.857   1.00 18.39 ? 52  LEU A CG  1 
ATOM   274  C CD1 . LEU A 1 50  ? 10.696 31.959 1.093   1.00 21.38 ? 52  LEU A CD1 1 
ATOM   275  C CD2 . LEU A 1 50  ? 10.343 33.773 -0.594  1.00 19.32 ? 52  LEU A CD2 1 
ATOM   276  N N   . PRO A 1 51  ? 5.752  35.787 1.219   1.00 19.02 ? 53  PRO A N   1 
ATOM   277  C CA  . PRO A 1 51  ? 4.336  35.829 1.595   1.00 20.15 ? 53  PRO A CA  1 
ATOM   278  C C   . PRO A 1 51  ? 3.404  34.970 0.736   1.00 20.45 ? 53  PRO A C   1 
ATOM   279  O O   . PRO A 1 51  ? 2.274  34.712 1.139   1.00 20.37 ? 53  PRO A O   1 
ATOM   280  C CB  . PRO A 1 51  ? 3.981  37.307 1.429   1.00 20.89 ? 53  PRO A CB  1 
ATOM   281  C CG  . PRO A 1 51  ? 4.914  37.796 0.421   1.00 20.59 ? 53  PRO A CG  1 
ATOM   282  C CD  . PRO A 1 51  ? 6.185  37.065 0.614   1.00 19.68 ? 53  PRO A CD  1 
ATOM   283  N N   . GLU A 1 52  ? 3.861  34.552 -0.446  1.00 21.00 ? 54  GLU A N   1 
ATOM   284  C CA  . GLU A 1 52  ? 3.063  33.676 -1.308  1.00 21.30 ? 54  GLU A CA  1 
ATOM   285  C C   . GLU A 1 52  ? 3.366  32.192 -1.049  1.00 21.30 ? 54  GLU A C   1 
ATOM   286  O O   . GLU A 1 52  ? 2.768  31.339 -1.682  1.00 20.23 ? 54  GLU A O   1 
ATOM   287  C CB  . GLU A 1 52  ? 3.332  34.006 -2.794  1.00 21.65 ? 54  GLU A CB  1 
ATOM   288  C CG  . GLU A 1 52  ? 3.058  35.463 -3.177  1.00 22.25 ? 54  GLU A CG  1 
ATOM   289  C CD  . GLU A 1 52  ? 2.884  35.669 -4.679  1.00 23.40 ? 54  GLU A CD  1 
ATOM   290  N N   . ALA A 1 53  ? 4.300  31.887 -0.148  1.00 21.48 ? 55  ALA A N   1 
ATOM   291  C CA  . ALA A 1 53  ? 4.672  30.503 0.124   1.00 22.62 ? 55  ALA A CA  1 
ATOM   292  C C   . ALA A 1 53  ? 4.041  30.070 1.449   1.00 23.75 ? 55  ALA A C   1 
ATOM   293  O O   . ALA A 1 53  ? 3.802  30.902 2.318   1.00 24.50 ? 55  ALA A O   1 
ATOM   294  C CB  . ALA A 1 53  ? 6.178  30.361 0.183   1.00 22.23 ? 55  ALA A CB  1 
ATOM   295  N N   . THR A 1 54  ? 3.769  28.779 1.582   1.00 24.46 ? 56  THR A N   1 
ATOM   296  C CA  . THR A 1 54  ? 3.483  28.168 2.888   1.00 25.34 ? 56  THR A CA  1 
ATOM   297  C C   . THR A 1 54  ? 4.788  27.539 3.377   1.00 23.49 ? 56  THR A C   1 
ATOM   298  O O   . THR A 1 54  ? 5.322  26.634 2.732   1.00 23.47 ? 56  THR A O   1 
ATOM   299  C CB  . THR A 1 54  ? 2.414  27.061 2.819   1.00 26.47 ? 56  THR A CB  1 
ATOM   300  O OG1 . THR A 1 54  ? 2.141  26.576 4.152   1.00 28.65 ? 56  THR A OG1 1 
ATOM   301  C CG2 . THR A 1 54  ? 2.895  25.878 1.933   1.00 28.57 ? 56  THR A CG2 1 
ATOM   302  N N   . THR A 1 55  ? 5.321  28.064 4.473   1.00 22.18 ? 57  THR A N   1 
ATOM   303  C CA  . THR A 1 55  ? 6.572  27.566 5.054   1.00 20.33 ? 57  THR A CA  1 
ATOM   304  C C   . THR A 1 55  ? 6.260  27.103 6.446   1.00 20.12 ? 57  THR A C   1 
ATOM   305  O O   . THR A 1 55  ? 5.807  27.919 7.272   1.00 20.42 ? 57  THR A O   1 
ATOM   306  C CB  . THR A 1 55  ? 7.634  28.660 5.165   1.00 21.08 ? 57  THR A CB  1 
ATOM   307  O OG1 . THR A 1 55  ? 7.922  29.141 3.853   1.00 19.17 ? 57  THR A OG1 1 
ATOM   308  C CG2 . THR A 1 55  ? 8.954  28.081 5.843   1.00 20.81 ? 57  THR A CG2 1 
ATOM   309  N N   . THR A 1 56  ? 6.480  25.819 6.708   1.00 17.75 ? 58  THR A N   1 
ATOM   310  C CA  . THR A 1 56  ? 6.301  25.254 8.048   1.00 18.41 ? 58  THR A CA  1 
ATOM   311  C C   . THR A 1 56  ? 7.607  24.677 8.676   1.00 16.57 ? 58  THR A C   1 
ATOM   312  O O   . THR A 1 56  ? 7.607  24.191 9.826   1.00 14.92 ? 58  THR A O   1 
ATOM   313  C CB  . THR A 1 56  ? 5.142  24.223 8.031   1.00 19.31 ? 58  THR A CB  1 
ATOM   314  O OG1 . THR A 1 56  ? 5.271  23.373 6.902   1.00 22.97 ? 58  THR A OG1 1 
ATOM   315  C CG2 . THR A 1 56  ? 3.764  24.920 7.927   1.00 21.51 ? 58  THR A CG2 1 
ATOM   316  N N   . ALA A 1 57  ? 8.712  24.771 7.925   1.00 16.16 ? 59  ALA A N   1 
ATOM   317  C CA  . ALA A 1 57  ? 10.019 24.257 8.347   1.00 16.00 ? 59  ALA A CA  1 
ATOM   318  C C   . ALA A 1 57  ? 11.088 24.904 7.469   1.00 15.42 ? 59  ALA A C   1 
ATOM   319  O O   . ALA A 1 57  ? 10.801 25.657 6.536   1.00 14.74 ? 59  ALA A O   1 
ATOM   320  C CB  . ALA A 1 57  ? 10.091 22.717 8.234   1.00 14.95 ? 59  ALA A CB  1 
ATOM   321  N N   . PHE A 1 58  ? 12.317 24.570 7.770   1.00 15.62 ? 60  PHE A N   1 
ATOM   322  C CA  . PHE A 1 58  ? 13.438 24.964 6.973   1.00 16.23 ? 60  PHE A CA  1 
ATOM   323  C C   . PHE A 1 58  ? 14.565 23.940 7.145   1.00 15.97 ? 60  PHE A C   1 
ATOM   324  O O   . PHE A 1 58  ? 14.589 23.187 8.134   1.00 16.90 ? 60  PHE A O   1 
ATOM   325  C CB  . PHE A 1 58  ? 13.912 26.371 7.286   1.00 16.27 ? 60  PHE A CB  1 
ATOM   326  C CG  . PHE A 1 58  ? 14.182 26.615 8.730   1.00 16.46 ? 60  PHE A CG  1 
ATOM   327  C CD1 . PHE A 1 58  ? 15.432 26.298 9.289   1.00 16.56 ? 60  PHE A CD1 1 
ATOM   328  C CD2 . PHE A 1 58  ? 13.189 27.168 9.560   1.00 18.60 ? 60  PHE A CD2 1 
ATOM   329  C CE1 . PHE A 1 58  ? 15.669 26.519 10.636  1.00 17.25 ? 60  PHE A CE1 1 
ATOM   330  C CE2 . PHE A 1 58  ? 13.448 27.387 10.905  1.00 18.64 ? 60  PHE A CE2 1 
ATOM   331  C CZ  . PHE A 1 58  ? 14.657 27.042 11.445  1.00 17.29 ? 60  PHE A CZ  1 
ATOM   332  N N   . GLU A 1 59  ? 15.463 23.933 6.172   1.00 15.89 ? 61  GLU A N   1 
ATOM   333  C CA  . GLU A 1 59  ? 16.664 23.095 6.186   1.00 16.33 ? 61  GLU A CA  1 
ATOM   334  C C   . GLU A 1 59  ? 17.912 23.938 6.363   1.00 16.55 ? 61  GLU A C   1 
ATOM   335  O O   . GLU A 1 59  ? 17.989 25.105 5.917   1.00 16.01 ? 61  GLU A O   1 
ATOM   336  C CB  . GLU A 1 59  ? 16.801 22.269 4.885   1.00 16.44 ? 61  GLU A CB  1 
ATOM   337  C CG  . GLU A 1 59  ? 15.646 21.313 4.594   1.00 16.90 ? 61  GLU A CG  1 
ATOM   338  C CD  . GLU A 1 59  ? 15.705 20.629 3.241   1.00 18.69 ? 61  GLU A CD  1 
ATOM   339  O OE1 . GLU A 1 59  ? 16.645 20.805 2.438   1.00 17.63 ? 61  GLU A OE1 1 
ATOM   340  O OE2 . GLU A 1 59  ? 14.789 19.851 2.956   1.00 18.44 ? 61  GLU A OE2 1 
ATOM   341  N N   . TYR A 1 60  ? 18.937 23.301 6.938   1.00 15.98 ? 62  TYR A N   1 
ATOM   342  C CA  . TYR A 1 60  ? 20.288 23.803 6.899   1.00 14.82 ? 62  TYR A CA  1 
ATOM   343  C C   . TYR A 1 60  ? 21.220 22.648 6.505   1.00 14.82 ? 62  TYR A C   1 
ATOM   344  O O   . TYR A 1 60  ? 20.805 21.483 6.490   1.00 14.98 ? 62  TYR A O   1 
ATOM   345  C CB  . TYR A 1 60  ? 20.708 24.400 8.227   1.00 15.73 ? 62  TYR A CB  1 
ATOM   346  C CG  . TYR A 1 60  ? 20.824 23.413 9.375   1.00 15.70 ? 62  TYR A CG  1 
ATOM   347  C CD1 . TYR A 1 60  ? 22.081 22.912 9.772   1.00 16.01 ? 62  TYR A CD1 1 
ATOM   348  C CD2 . TYR A 1 60  ? 19.680 23.030 10.119  1.00 16.41 ? 62  TYR A CD2 1 
ATOM   349  C CE1 . TYR A 1 60  ? 22.209 22.042 10.848  1.00 14.97 ? 62  TYR A CE1 1 
ATOM   350  C CE2 . TYR A 1 60  ? 19.786 22.164 11.200  1.00 14.72 ? 62  TYR A CE2 1 
ATOM   351  C CZ  . TYR A 1 60  ? 21.069 21.661 11.560  1.00 14.79 ? 62  TYR A CZ  1 
ATOM   352  O OH  . TYR A 1 60  ? 21.178 20.811 12.652  1.00 15.28 ? 62  TYR A OH  1 
ATOM   353  N N   . GLU A 1 61  ? 22.444 22.980 6.154   1.00 15.09 ? 63  GLU A N   1 
ATOM   354  C CA  . GLU A 1 61  ? 23.473 21.981 5.789   1.00 15.32 ? 63  GLU A CA  1 
ATOM   355  C C   . GLU A 1 61  ? 24.390 21.712 6.956   1.00 14.78 ? 63  GLU A C   1 
ATOM   356  O O   . GLU A 1 61  ? 24.951 22.625 7.575   1.00 14.66 ? 63  GLU A O   1 
ATOM   357  C CB  . GLU A 1 61  ? 24.259 22.395 4.546   1.00 16.17 ? 63  GLU A CB  1 
ATOM   358  C CG  . GLU A 1 61  ? 23.449 22.212 3.301   1.00 22.06 ? 63  GLU A CG  1 
ATOM   359  C CD  . GLU A 1 61  ? 24.066 22.842 2.057   1.00 25.18 ? 63  GLU A CD  1 
ATOM   360  O OE1 . GLU A 1 61  ? 25.271 23.337 2.085   1.00 27.15 ? 63  GLU A OE1 1 
ATOM   361  O OE2 . GLU A 1 61  ? 23.319 22.817 1.071   1.00 21.36 ? 63  GLU A OE2 1 
ATOM   362  N N   . ASP A 1 62  ? 24.517 20.445 7.308   1.00 14.78 ? 64  ASP A N   1 
ATOM   363  C CA  . ASP A 1 62  ? 25.442 20.064 8.353   1.00 14.79 ? 64  ASP A CA  1 
ATOM   364  C C   . ASP A 1 62  ? 26.897 19.904 7.825   1.00 14.70 ? 64  ASP A C   1 
ATOM   365  O O   . ASP A 1 62  ? 27.191 20.197 6.671   1.00 13.79 ? 64  ASP A O   1 
ATOM   366  C CB  . ASP A 1 62  ? 24.909 18.868 9.160   1.00 14.15 ? 64  ASP A CB  1 
ATOM   367  C CG  . ASP A 1 62  ? 25.120 17.511 8.471   1.00 16.08 ? 64  ASP A CG  1 
ATOM   368  O OD1 . ASP A 1 62  ? 25.614 17.442 7.319   1.00 14.88 ? 64  ASP A OD1 1 
ATOM   369  O OD2 . ASP A 1 62  ? 24.786 16.502 9.141   1.00 17.99 ? 64  ASP A OD2 1 
ATOM   370  N N   . GLU A 1 63  ? 27.786 19.467 8.699   1.00 14.23 ? 65  GLU A N   1 
ATOM   371  C CA  . GLU A 1 63  ? 29.203 19.344 8.380   1.00 15.14 ? 65  GLU A CA  1 
ATOM   372  C C   . GLU A 1 63  ? 29.468 18.288 7.292   1.00 14.24 ? 65  GLU A C   1 
ATOM   373  O O   . GLU A 1 63  ? 30.522 18.311 6.685   1.00 14.82 ? 65  GLU A O   1 
ATOM   374  C CB  . GLU A 1 63  ? 29.995 19.023 9.633   1.00 14.86 ? 65  GLU A CB  1 
ATOM   375  C CG  . GLU A 1 63  ? 29.690 17.635 10.230  1.00 14.91 ? 65  GLU A CG  1 
ATOM   376  C CD  . GLU A 1 63  ? 28.520 17.568 11.220  1.00 17.80 ? 65  GLU A CD  1 
ATOM   377  O OE1 . GLU A 1 63  ? 27.715 18.523 11.375  1.00 14.75 ? 65  GLU A OE1 1 
ATOM   378  O OE2 . GLU A 1 63  ? 28.429 16.495 11.860  1.00 19.19 ? 65  GLU A OE2 1 
ATOM   379  N N   . ASP A 1 64  ? 28.508 17.380 7.072   1.00 13.92 ? 66  ASP A N   1 
ATOM   380  C CA  . ASP A 1 64  ? 28.594 16.375 6.036   1.00 14.58 ? 66  ASP A CA  1 
ATOM   381  C C   . ASP A 1 64  ? 28.021 16.869 4.682   1.00 13.61 ? 66  ASP A C   1 
ATOM   382  O O   . ASP A 1 64  ? 28.098 16.163 3.677   1.00 12.83 ? 66  ASP A O   1 
ATOM   383  C CB  . ASP A 1 64  ? 27.867 15.075 6.473   1.00 15.78 ? 66  ASP A CB  1 
ATOM   384  C CG  . ASP A 1 64  ? 28.525 14.367 7.622   1.00 17.03 ? 66  ASP A CG  1 
ATOM   385  O OD1 . ASP A 1 64  ? 29.728 14.602 7.893   1.00 17.88 ? 66  ASP A OD1 1 
ATOM   386  O OD2 . ASP A 1 64  ? 27.792 13.562 8.277   1.00 21.32 ? 66  ASP A OD2 1 
ATOM   387  N N   . GLY A 1 65  ? 27.437 18.072 4.669   1.00 14.52 ? 67  GLY A N   1 
ATOM   388  C CA  . GLY A 1 65  ? 26.727 18.606 3.488   1.00 14.95 ? 67  GLY A CA  1 
ATOM   389  C C   . GLY A 1 65  ? 25.292 18.103 3.409   1.00 15.54 ? 67  GLY A C   1 
ATOM   390  O O   . GLY A 1 65  ? 24.627 18.360 2.402   1.00 16.20 ? 67  GLY A O   1 
ATOM   391  N N   . ASP A 1 66  ? 24.844 17.345 4.416   1.00 13.15 ? 68  ASP A N   1 
ATOM   392  C CA  . ASP A 1 66  ? 23.457 16.819 4.441   1.00 14.48 ? 68  ASP A CA  1 
ATOM   393  C C   . ASP A 1 66  ? 22.445 17.888 4.777   1.00 13.61 ? 68  ASP A C   1 
ATOM   394  O O   . ASP A 1 66  ? 22.686 18.715 5.669   1.00 13.53 ? 68  ASP A O   1 
ATOM   395  C CB  . ASP A 1 66  ? 23.261 15.634 5.415   1.00 13.97 ? 68  ASP A CB  1 
ATOM   396  C CG  . ASP A 1 66  ? 23.983 14.355 5.007   1.00 17.75 ? 68  ASP A CG  1 
ATOM   397  O OD1 . ASP A 1 66  ? 24.398 14.150 3.826   1.00 14.52 ? 68  ASP A OD1 1 
ATOM   398  O OD2 . ASP A 1 66  ? 24.095 13.532 5.941   1.00 19.65 ? 68  ASP A OD2 1 
ATOM   399  N N   . ARG A 1 67  ? 21.299 17.864 4.083   1.00 13.34 ? 69  ARG A N   1 
ATOM   400  C CA  . ARG A 1 67  ? 20.226 18.794 4.408   1.00 13.68 ? 69  ARG A CA  1 
ATOM   401  C C   . ARG A 1 67  ? 19.456 18.258 5.619   1.00 13.49 ? 69  ARG A C   1 
ATOM   402  O O   . ARG A 1 67  ? 18.940 17.154 5.598   1.00 14.06 ? 69  ARG A O   1 
ATOM   403  C CB  . ARG A 1 67  ? 19.276 19.054 3.227   1.00 14.61 ? 69  ARG A CB  1 
ATOM   404  C CG  . ARG A 1 67  ? 19.915 19.817 1.989   1.00 15.34 ? 69  ARG A CG  1 
ATOM   405  C CD  . ARG A 1 67  ? 20.215 21.371 2.127   1.00 21.41 ? 69  ARG A CD  1 
ATOM   406  N NE  . ARG A 1 67  ? 19.019 21.993 1.604   1.00 30.42 ? 69  ARG A NE  1 
ATOM   407  C CZ  . ARG A 1 67  ? 18.850 22.752 0.543   1.00 18.11 ? 69  ARG A CZ  1 
ATOM   408  N NH1 . ARG A 1 67  ? 19.828 23.333 -0.230  1.00 17.69 ? 69  ARG A NH1 1 
ATOM   409  N NH2 . ARG A 1 67  ? 17.623 23.062 0.353   1.00 30.33 ? 69  ARG A NH2 1 
ATOM   410  N N   . ILE A 1 68  ? 19.390 19.085 6.644   1.00 12.83 ? 70  ILE A N   1 
ATOM   411  C CA  . ILE A 1 68  ? 18.794 18.769 7.933   1.00 13.65 ? 70  ILE A CA  1 
ATOM   412  C C   . ILE A 1 68  ? 17.537 19.651 8.072   1.00 14.03 ? 70  ILE A C   1 
ATOM   413  O O   . ILE A 1 68  ? 17.606 20.914 7.992   1.00 15.12 ? 70  ILE A O   1 
ATOM   414  C CB  . ILE A 1 68  ? 19.741 19.100 9.095   1.00 13.67 ? 70  ILE A CB  1 
ATOM   415  C CG1 . ILE A 1 68  ? 21.139 18.483 8.874   1.00 14.39 ? 70  ILE A CG1 1 
ATOM   416  C CG2 . ILE A 1 68  ? 19.079 18.701 10.471  1.00 11.40 ? 70  ILE A CG2 1 
ATOM   417  C CD1 . ILE A 1 68  ? 21.197 16.915 8.725   1.00 13.91 ? 70  ILE A CD1 1 
ATOM   418  N N   . THR A 1 69  ? 16.412 18.996 8.266   1.00 13.54 ? 71  THR A N   1 
ATOM   419  C CA  . THR A 1 69  ? 15.126 19.703 8.434   1.00 13.42 ? 71  THR A CA  1 
ATOM   420  C C   . THR A 1 69  ? 14.906 20.062 9.914   1.00 14.45 ? 71  THR A C   1 
ATOM   421  O O   . THR A 1 69  ? 15.118 19.212 10.828  1.00 14.79 ? 71  THR A O   1 
ATOM   422  C CB  . THR A 1 69  ? 13.978 18.887 7.833   1.00 13.84 ? 71  THR A CB  1 
ATOM   423  O OG1 . THR A 1 69  ? 14.249 18.663 6.454   1.00 13.15 ? 71  THR A OG1 1 
ATOM   424  C CG2 . THR A 1 69  ? 12.605 19.599 8.027   1.00 14.15 ? 71  THR A CG2 1 
ATOM   425  N N   . VAL A 1 70  ? 14.489 21.303 10.141  1.00 13.39 ? 72  VAL A N   1 
ATOM   426  C CA  . VAL A 1 70  ? 14.178 21.826 11.485  1.00 14.58 ? 72  VAL A CA  1 
ATOM   427  C C   . VAL A 1 70  ? 12.677 22.077 11.611  1.00 14.18 ? 72  VAL A C   1 
ATOM   428  O O   . VAL A 1 70  ? 12.110 22.865 10.860  1.00 13.32 ? 72  VAL A O   1 
ATOM   429  C CB  . VAL A 1 70  ? 14.961 23.128 11.773  1.00 14.56 ? 72  VAL A CB  1 
ATOM   430  C CG1 . VAL A 1 70  ? 14.527 23.782 13.111  1.00 13.49 ? 72  VAL A CG1 1 
ATOM   431  C CG2 . VAL A 1 70  ? 16.485 22.851 11.710  1.00 13.91 ? 72  VAL A CG2 1 
ATOM   432  N N   . ARG A 1 71  ? 12.067 21.406 12.601  1.00 14.61 ? 73  ARG A N   1 
ATOM   433  C CA  . ARG A 1 71  ? 10.629 21.484 12.865  1.00 15.40 ? 73  ARG A CA  1 
ATOM   434  C C   . ARG A 1 71  ? 10.259 21.884 14.302  1.00 15.34 ? 73  ARG A C   1 
ATOM   435  O O   . ARG A 1 71  ? 9.088  21.887 14.636  1.00 14.61 ? 73  ARG A O   1 
ATOM   436  C CB  . ARG A 1 71  ? 9.924  20.168 12.516  1.00 15.75 ? 73  ARG A CB  1 
ATOM   437  C CG  . ARG A 1 71  ? 10.010 19.796 11.041  1.00 16.82 ? 73  ARG A CG  1 
ATOM   438  C CD  . ARG A 1 71  ? 9.165  18.614 10.683  1.00 16.13 ? 73  ARG A CD  1 
ATOM   439  N NE  . ARG A 1 71  ? 9.307  18.220 9.301   1.00 16.32 ? 73  ARG A NE  1 
ATOM   440  C CZ  . ARG A 1 71  ? 8.736  18.835 8.271   1.00 17.36 ? 73  ARG A CZ  1 
ATOM   441  N NH1 . ARG A 1 71  ? 7.872  19.834 8.456   1.00 16.54 ? 73  ARG A NH1 1 
ATOM   442  N NH2 . ARG A 1 71  ? 8.962  18.382 7.050   1.00 17.24 ? 73  ARG A NH2 1 
ATOM   443  N N   . SER A 1 72  ? 11.229 22.295 15.111  1.00 14.37 ? 74  SER A N   1 
ATOM   444  C CA  . SER A 1 72  ? 10.987 22.576 16.525  1.00 14.41 ? 74  SER A CA  1 
ATOM   445  C C   . SER A 1 72  ? 12.105 23.388 17.101  1.00 14.16 ? 74  SER A C   1 
ATOM   446  O O   . SER A 1 72  ? 13.194 23.498 16.522  1.00 15.11 ? 74  SER A O   1 
ATOM   447  C CB  . SER A 1 72  ? 10.912 21.283 17.344  1.00 13.79 ? 74  SER A CB  1 
ATOM   448  O OG  . SER A 1 72  ? 12.186 20.663 17.394  1.00 14.39 ? 74  SER A OG  1 
ATOM   449  N N   . ASP A 1 73  ? 11.839 23.924 18.279  1.00 14.14 ? 75  ASP A N   1 
ATOM   450  C CA  . ASP A 1 73  ? 12.877 24.629 19.023  1.00 14.79 ? 75  ASP A CA  1 
ATOM   451  C C   . ASP A 1 73  ? 14.083 23.782 19.401  1.00 15.46 ? 75  ASP A C   1 
ATOM   452  O O   . ASP A 1 73  ? 15.214 24.266 19.308  1.00 16.04 ? 75  ASP A O   1 
ATOM   453  C CB  . ASP A 1 73  ? 12.271 25.267 20.245  1.00 14.67 ? 75  ASP A CB  1 
ATOM   454  C CG  . ASP A 1 73  ? 11.428 26.480 19.895  1.00 17.14 ? 75  ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 73  ? 12.045 27.509 19.552  1.00 15.97 ? 75  ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 73  ? 10.173 26.374 19.946  1.00 15.94 ? 75  ASP A OD2 1 
ATOM   457  N N   . GLU A 1 74  ? 13.870 22.540 19.835  1.00 15.70 ? 76  GLU A N   1 
ATOM   458  C CA  . GLU A 1 74  ? 15.020 21.686 20.186  1.00 17.77 ? 76  GLU A CA  1 
ATOM   459  C C   . GLU A 1 74  ? 15.938 21.444 18.990  1.00 16.48 ? 76  GLU A C   1 
ATOM   460  O O   . GLU A 1 74  ? 17.150 21.461 19.132  1.00 16.70 ? 76  GLU A O   1 
ATOM   461  C CB  . GLU A 1 74  ? 14.629 20.352 20.866  1.00 18.43 ? 76  GLU A CB  1 
ATOM   462  C CG  . GLU A 1 74  ? 13.773 19.418 20.074  1.00 21.50 ? 76  GLU A CG  1 
ATOM   463  C CD  . GLU A 1 74  ? 13.370 18.150 20.858  1.00 21.08 ? 76  GLU A CD  1 
ATOM   464  O OE1 . GLU A 1 74  ? 13.851 17.980 22.013  1.00 20.57 ? 76  GLU A OE1 1 
ATOM   465  O OE2 . GLU A 1 74  ? 12.513 17.373 20.327  1.00 24.96 ? 76  GLU A OE2 1 
ATOM   466  N N   . GLU A 1 75  ? 15.358 21.232 17.811  1.00 15.46 ? 77  GLU A N   1 
ATOM   467  C CA  . GLU A 1 75  ? 16.138 21.071 16.572  1.00 17.17 ? 77  GLU A CA  1 
ATOM   468  C C   . GLU A 1 75  ? 16.846 22.375 16.182  1.00 16.95 ? 77  GLU A C   1 
ATOM   469  O O   . GLU A 1 75  ? 18.010 22.371 15.751  1.00 17.38 ? 77  GLU A O   1 
ATOM   470  C CB  . GLU A 1 75  ? 15.238 20.559 15.451  1.00 15.83 ? 77  GLU A CB  1 
ATOM   471  C CG  . GLU A 1 75  ? 14.762 19.138 15.727  1.00 15.72 ? 77  GLU A CG  1 
ATOM   472  C CD  . GLU A 1 75  ? 13.600 18.643 14.844  1.00 18.66 ? 77  GLU A CD  1 
ATOM   473  O OE1 . GLU A 1 75  ? 13.457 19.152 13.703  1.00 16.73 ? 77  GLU A OE1 1 
ATOM   474  O OE2 . GLU A 1 75  ? 12.858 17.698 15.272  1.00 19.69 ? 77  GLU A OE2 1 
ATOM   475  N N   . MET A 1 76  ? 16.157 23.494 16.362  1.00 17.67 ? 78  MET A N   1 
ATOM   476  C CA  . MET A 1 76  ? 16.759 24.791 16.090  1.00 18.39 ? 78  MET A CA  1 
ATOM   477  C C   . MET A 1 76  ? 17.967 25.055 17.019  1.00 17.39 ? 78  MET A C   1 
ATOM   478  O O   . MET A 1 76  ? 18.954 25.582 16.588  1.00 17.00 ? 78  MET A O   1 
ATOM   479  C CB  . MET A 1 76  ? 15.705 25.920 16.164  1.00 18.04 ? 78  MET A CB  1 
ATOM   480  C CG  . MET A 1 76  ? 16.145 27.198 15.382  1.00 19.37 ? 78  MET A CG  1 
ATOM   481  S SD  . MET A 1 76  ? 15.182 28.636 15.725  1.00 23.72 ? 78  MET A SD  1 
ATOM   482  C CE  . MET A 1 76  ? 15.298 28.702 17.500  1.00 20.11 ? 78  MET A CE  1 
ATOM   483  N N   . LYS A 1 77  ? 17.893 24.654 18.278  1.00 18.05 ? 79  LYS A N   1 
ATOM   484  C CA  . LYS A 1 77  ? 18.999 24.788 19.216  1.00 18.66 ? 79  LYS A CA  1 
ATOM   485  C C   . LYS A 1 77  ? 20.220 23.974 18.798  1.00 17.99 ? 79  LYS A C   1 
ATOM   486  O O   . LYS A 1 77  ? 21.340 24.469 18.878  1.00 17.01 ? 79  LYS A O   1 
ATOM   487  C CB  . LYS A 1 77  ? 18.552 24.386 20.633  1.00 20.25 ? 79  LYS A CB  1 
ATOM   488  C CG  . LYS A 1 77  ? 17.723 25.433 21.404  1.00 24.02 ? 79  LYS A CG  1 
ATOM   489  C CD  . LYS A 1 77  ? 16.788 26.303 20.550  1.00 27.76 ? 79  LYS A CD  1 
ATOM   490  N N   . ALA A 1 78  ? 20.013 22.737 18.343  1.00 16.90 ? 80  ALA A N   1 
ATOM   491  C CA  . ALA A 1 78  ? 21.122 21.948 17.805  1.00 17.12 ? 80  ALA A CA  1 
ATOM   492  C C   . ALA A 1 78  ? 21.756 22.587 16.552  1.00 15.95 ? 80  ALA A C   1 
ATOM   493  O O   . ALA A 1 78  ? 22.971 22.497 16.341  1.00 16.14 ? 80  ALA A O   1 
ATOM   494  C CB  . ALA A 1 78  ? 20.634 20.509 17.477  1.00 16.87 ? 80  ALA A CB  1 
ATOM   495  N N   . MET A 1 79  ? 20.923 23.179 15.700  1.00 15.86 ? 81  MET A N   1 
ATOM   496  C CA  . MET A 1 79  ? 21.397 23.964 14.571  1.00 16.11 ? 81  MET A CA  1 
ATOM   497  C C   . MET A 1 79  ? 22.303 25.113 15.029  1.00 15.74 ? 81  MET A C   1 
ATOM   498  O O   . MET A 1 79  ? 23.415 25.291 14.491  1.00 14.93 ? 81  MET A O   1 
ATOM   499  C CB  . MET A 1 79  ? 20.231 24.486 13.740  1.00 14.81 ? 81  MET A CB  1 
ATOM   500  C CG  . MET A 1 79  ? 20.644 25.323 12.545  1.00 16.62 ? 81  MET A CG  1 
ATOM   501  S SD  . MET A 1 79  ? 19.269 26.023 11.642  1.00 15.91 ? 81  MET A SD  1 
ATOM   502  C CE  . MET A 1 79  ? 18.830 27.381 12.766  1.00 16.71 ? 81  MET A CE  1 
ATOM   503  N N   . LEU A 1 80  ? 21.814 25.902 15.973  1.00 16.10 ? 82  LEU A N   1 
ATOM   504  C CA  . LEU A 1 80  ? 22.537 27.091 16.441  1.00 16.92 ? 82  LEU A CA  1 
ATOM   505  C C   . LEU A 1 80  ? 23.875 26.709 17.086  1.00 16.74 ? 82  LEU A C   1 
ATOM   506  O O   . LEU A 1 80  ? 24.895 27.375 16.841  1.00 16.27 ? 82  LEU A O   1 
ATOM   507  C CB  . LEU A 1 80  ? 21.653 27.931 17.357  1.00 16.69 ? 82  LEU A CB  1 
ATOM   508  C CG  . LEU A 1 80  ? 20.444 28.630 16.692  1.00 17.12 ? 82  LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 80  ? 19.476 29.219 17.763  1.00 16.62 ? 82  LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 80  ? 20.909 29.689 15.719  1.00 18.83 ? 82  LEU A CD2 1 
ATOM   511  N N   . SER A 1 81  ? 23.888 25.618 17.865  1.00 18.03 ? 83  SER A N   1 
ATOM   512  C CA  A SER A 1 81  ? 25.116 25.156 18.525  0.50 18.53 ? 83  SER A CA  1 
ATOM   513  C CA  B SER A 1 81  ? 25.106 25.137 18.520  0.50 18.91 ? 83  SER A CA  1 
ATOM   514  C C   . SER A 1 81  ? 26.166 24.781 17.487  1.00 19.32 ? 83  SER A C   1 
ATOM   515  O O   . SER A 1 81  ? 27.297 25.184 17.590  1.00 18.79 ? 83  SER A O   1 
ATOM   516  C CB  A SER A 1 81  ? 24.819 23.968 19.443  0.50 19.15 ? 83  SER A CB  1 
ATOM   517  C CB  B SER A 1 81  ? 24.797 23.901 19.360  0.50 19.54 ? 83  SER A CB  1 
ATOM   518  O OG  A SER A 1 81  ? 23.989 24.379 20.516  0.50 17.67 ? 83  SER A OG  1 
ATOM   519  O OG  B SER A 1 81  ? 25.929 23.559 20.122  0.50 20.56 ? 83  SER A OG  1 
ATOM   520  N N   . TYR A 1 82  ? 25.749 24.031 16.468  1.00 21.90 ? 84  TYR A N   1 
ATOM   521  C CA  . TYR A 1 82  ? 26.573 23.720 15.306  1.00 23.11 ? 84  TYR A CA  1 
ATOM   522  C C   . TYR A 1 82  ? 27.137 24.985 14.639  1.00 24.09 ? 84  TYR A C   1 
ATOM   523  O O   . TYR A 1 82  ? 28.357 25.084 14.431  1.00 24.67 ? 84  TYR A O   1 
ATOM   524  C CB  . TYR A 1 82  ? 25.784 22.849 14.323  1.00 23.31 ? 84  TYR A CB  1 
ATOM   525  C CG  . TYR A 1 82  ? 26.478 22.731 12.980  1.00 24.91 ? 84  TYR A CG  1 
ATOM   526  C CD1 . TYR A 1 82  ? 27.734 22.167 12.890  1.00 24.99 ? 84  TYR A CD1 1 
ATOM   527  C CD2 . TYR A 1 82  ? 25.899 23.252 11.809  1.00 26.24 ? 84  TYR A CD2 1 
ATOM   528  C CE1 . TYR A 1 82  ? 28.401 22.095 11.658  1.00 27.42 ? 84  TYR A CE1 1 
ATOM   529  C CE2 . TYR A 1 82  ? 26.569 23.197 10.592  1.00 26.28 ? 84  TYR A CE2 1 
ATOM   530  C CZ  . TYR A 1 82  ? 27.809 22.595 10.523  1.00 25.24 ? 84  TYR A CZ  1 
ATOM   531  O OH  . TYR A 1 82  ? 28.500 22.526 9.334   1.00 25.02 ? 84  TYR A OH  1 
ATOM   532  N N   . TYR A 1 83  ? 26.254 25.937 14.315  1.00 24.80 ? 85  TYR A N   1 
ATOM   533  C CA  . TYR A 1 83  ? 26.650 27.191 13.701  1.00 25.65 ? 85  TYR A CA  1 
ATOM   534  C C   . TYR A 1 83  ? 27.688 27.923 14.538  1.00 26.56 ? 85  TYR A C   1 
ATOM   535  O O   . TYR A 1 83  ? 28.723 28.311 14.001  1.00 26.38 ? 85  TYR A O   1 
ATOM   536  C CB  . TYR A 1 83  ? 25.455 28.107 13.431  1.00 24.04 ? 85  TYR A CB  1 
ATOM   537  C CG  . TYR A 1 83  ? 25.858 29.422 12.818  1.00 24.54 ? 85  TYR A CG  1 
ATOM   538  C CD1 . TYR A 1 83  ? 26.362 29.477 11.539  1.00 23.41 ? 85  TYR A CD1 1 
ATOM   539  C CD2 . TYR A 1 83  ? 25.780 30.620 13.541  1.00 23.06 ? 85  TYR A CD2 1 
ATOM   540  C CE1 . TYR A 1 83  ? 26.737 30.689 10.971  1.00 20.96 ? 85  TYR A CE1 1 
ATOM   541  C CE2 . TYR A 1 83  ? 26.173 31.841 12.976  1.00 21.94 ? 85  TYR A CE2 1 
ATOM   542  C CZ  . TYR A 1 83  ? 26.645 31.858 11.689  1.00 22.64 ? 85  TYR A CZ  1 
ATOM   543  O OH  . TYR A 1 83  ? 27.017 33.029 11.101  1.00 21.16 ? 85  TYR A OH  1 
ATOM   544  N N   . TYR A 1 84  ? 27.422 28.082 15.838  1.00 27.87 ? 86  TYR A N   1 
ATOM   545  C CA  . TYR A 1 84  ? 28.339 28.836 16.716  1.00 29.93 ? 86  TYR A CA  1 
ATOM   546  C C   . TYR A 1 84  ? 29.734 28.177 16.768  1.00 29.96 ? 86  TYR A C   1 
ATOM   547  O O   . TYR A 1 84  ? 30.761 28.857 16.638  1.00 30.63 ? 86  TYR A O   1 
ATOM   548  C CB  . TYR A 1 84  ? 27.713 29.011 18.089  1.00 30.80 ? 86  TYR A CB  1 
ATOM   549  C CG  . TYR A 1 84  ? 26.475 29.925 18.088  1.00 33.63 ? 86  TYR A CG  1 
ATOM   550  C CD1 . TYR A 1 84  ? 26.451 31.134 17.384  1.00 35.41 ? 86  TYR A CD1 1 
ATOM   551  C CD2 . TYR A 1 84  ? 25.368 29.616 18.874  1.00 35.73 ? 86  TYR A CD2 1 
ATOM   552  C CE1 . TYR A 1 84  ? 25.315 31.973 17.424  1.00 36.35 ? 86  TYR A CE1 1 
ATOM   553  C CE2 . TYR A 1 84  ? 24.242 30.441 18.909  1.00 36.43 ? 86  TYR A CE2 1 
ATOM   554  C CZ  . TYR A 1 84  ? 24.222 31.601 18.177  1.00 34.67 ? 86  TYR A CZ  1 
ATOM   555  O OH  . TYR A 1 84  ? 23.092 32.387 18.240  1.00 35.42 ? 86  TYR A OH  1 
ATOM   556  N N   . SER A 1 85  ? 29.759 26.848 16.880  1.00 30.52 ? 87  SER A N   1 
ATOM   557  C CA  . SER A 1 85  ? 30.993 26.076 16.815  1.00 30.19 ? 87  SER A CA  1 
ATOM   558  C C   . SER A 1 85  ? 31.770 26.345 15.552  1.00 30.04 ? 87  SER A C   1 
ATOM   559  O O   . SER A 1 85  ? 32.994 26.499 15.607  1.00 28.64 ? 87  SER A O   1 
ATOM   560  C CB  . SER A 1 85  ? 30.696 24.594 16.929  1.00 29.75 ? 87  SER A CB  1 
ATOM   561  O OG  . SER A 1 85  ? 30.344 24.330 18.265  1.00 33.46 ? 87  SER A OG  1 
ATOM   562  N N   . THR A 1 86  ? 31.050 26.422 14.427  1.00 30.77 ? 88  THR A N   1 
ATOM   563  C CA  . THR A 1 86  ? 31.644 26.677 13.116  1.00 31.92 ? 88  THR A CA  1 
ATOM   564  C C   . THR A 1 86  ? 32.239 28.108 13.042  1.00 32.76 ? 88  THR A C   1 
ATOM   565  O O   . THR A 1 86  ? 33.372 28.274 12.583  1.00 33.42 ? 88  THR A O   1 
ATOM   566  C CB  . THR A 1 86  ? 30.629 26.451 11.958  1.00 31.95 ? 88  THR A CB  1 
ATOM   567  O OG1 . THR A 1 86  ? 30.115 25.110 12.018  1.00 33.47 ? 88  THR A OG1 1 
ATOM   568  C CG2 . THR A 1 86  ? 31.321 26.622 10.615  1.00 33.67 ? 88  THR A CG2 1 
ATOM   569  N N   . VAL A 1 87  ? 31.471 29.109 13.494  1.00 32.74 ? 89  VAL A N   1 
ATOM   570  C CA  . VAL A 1 87  ? 31.914 30.500 13.592  1.00 32.91 ? 89  VAL A CA  1 
ATOM   571  C C   . VAL A 1 87  ? 33.164 30.629 14.460  1.00 32.68 ? 89  VAL A C   1 
ATOM   572  O O   . VAL A 1 87  ? 34.140 31.264 14.066  1.00 32.60 ? 89  VAL A O   1 
ATOM   573  C CB  . VAL A 1 87  ? 30.819 31.425 14.180  1.00 33.42 ? 89  VAL A CB  1 
ATOM   574  C CG1 . VAL A 1 87  ? 31.392 32.842 14.449  1.00 33.81 ? 89  VAL A CG1 1 
ATOM   575  C CG2 . VAL A 1 87  ? 29.639 31.510 13.244  1.00 33.94 ? 89  VAL A CG2 1 
ATOM   576  N N   . MET A 1 88  ? 33.128 30.029 15.639  1.00 32.62 ? 90  MET A N   1 
ATOM   577  C CA  . MET A 1 88  ? 34.272 30.018 16.543  1.00 32.57 ? 90  MET A CA  1 
ATOM   578  C C   . MET A 1 88  ? 35.546 29.490 15.881  1.00 32.69 ? 90  MET A C   1 
ATOM   579  O O   . MET A 1 88  ? 36.593 30.106 15.988  1.00 31.98 ? 90  MET A O   1 
ATOM   580  C CB  . MET A 1 88  ? 33.945 29.195 17.790  1.00 32.89 ? 90  MET A CB  1 
ATOM   581  C CG  . MET A 1 88  ? 32.913 29.872 18.706  1.00 33.65 ? 90  MET A CG  1 
ATOM   582  N N   . GLU A 1 89  ? 35.441 28.364 15.181  1.00 32.50 ? 91  GLU A N   1 
ATOM   583  C CA  . GLU A 1 89  ? 36.593 27.775 14.493  1.00 32.72 ? 91  GLU A CA  1 
ATOM   584  C C   . GLU A 1 89  ? 37.106 28.691 13.384  1.00 32.65 ? 91  GLU A C   1 
ATOM   585  O O   . GLU A 1 89  ? 38.313 28.853 13.209  1.00 32.79 ? 91  GLU A O   1 
ATOM   586  C CB  . GLU A 1 89  ? 36.214 26.409 13.916  1.00 32.80 ? 91  GLU A CB  1 
ATOM   587  N N   . GLN A 1 90  ? 36.181 29.294 12.640  1.00 32.77 ? 92  GLN A N   1 
ATOM   588  C CA  . GLN A 1 90  ? 36.543 30.258 11.597  1.00 32.88 ? 92  GLN A CA  1 
ATOM   589  C C   . GLN A 1 90  ? 37.275 31.489 12.123  1.00 32.44 ? 92  GLN A C   1 
ATOM   590  O O   . GLN A 1 90  ? 38.238 31.933 11.514  1.00 31.40 ? 92  GLN A O   1 
ATOM   591  C CB  . GLN A 1 90  ? 35.301 30.685 10.829  1.00 33.02 ? 92  GLN A CB  1 
ATOM   592  C CG  . GLN A 1 90  ? 34.779 29.603 9.904   1.00 35.15 ? 92  GLN A CG  1 
ATOM   593  C CD  . GLN A 1 90  ? 33.356 29.853 9.441   1.00 37.73 ? 92  GLN A CD  1 
ATOM   594  O OE1 . GLN A 1 90  ? 32.655 30.737 9.959   1.00 39.79 ? 92  GLN A OE1 1 
ATOM   595  N NE2 . GLN A 1 90  ? 32.921 29.079 8.458   1.00 40.19 ? 92  GLN A NE2 1 
ATOM   596  N N   . GLN A 1 91  ? 36.811 32.052 13.239  1.00 32.32 ? 93  GLN A N   1 
ATOM   597  C CA  . GLN A 1 91  ? 37.477 33.202 13.845  1.00 32.62 ? 93  GLN A CA  1 
ATOM   598  C C   . GLN A 1 91  ? 38.901 32.830 14.230  1.00 31.44 ? 93  GLN A C   1 
ATOM   599  O O   . GLN A 1 91  ? 39.845 33.515 13.834  1.00 30.64 ? 93  GLN A O   1 
ATOM   600  C CB  . GLN A 1 91  ? 36.742 33.692 15.090  1.00 33.01 ? 93  GLN A CB  1 
ATOM   601  C CG  . GLN A 1 91  ? 35.356 34.221 14.818  1.00 34.75 ? 93  GLN A CG  1 
ATOM   602  C CD  . GLN A 1 91  ? 34.550 34.479 16.101  1.00 36.06 ? 93  GLN A CD  1 
ATOM   603  O OE1 . GLN A 1 91  ? 34.720 33.789 17.126  1.00 42.36 ? 93  GLN A OE1 1 
ATOM   604  N NE2 . GLN A 1 91  ? 33.655 35.451 16.035  1.00 38.75 ? 93  GLN A NE2 1 
ATOM   605  N N   . VAL A 1 92  ? 39.039 31.747 14.997  1.00 30.35 ? 94  VAL A N   1 
ATOM   606  C CA  . VAL A 1 92  ? 40.352 31.255 15.440  1.00 30.07 ? 94  VAL A CA  1 
ATOM   607  C C   . VAL A 1 92  ? 41.295 31.058 14.253  1.00 29.26 ? 94  VAL A C   1 
ATOM   608  O O   . VAL A 1 92  ? 42.379 31.654 14.212  1.00 29.14 ? 94  VAL A O   1 
ATOM   609  C CB  . VAL A 1 92  ? 40.221 29.941 16.240  1.00 30.11 ? 94  VAL A CB  1 
ATOM   610  C CG1 . VAL A 1 92  ? 41.568 29.316 16.473  1.00 30.58 ? 94  VAL A CG1 1 
ATOM   611  C CG2 . VAL A 1 92  ? 39.496 30.200 17.572  1.00 31.16 ? 94  VAL A CG2 1 
ATOM   612  N N   . ASN A 1 93  ? 40.860 30.269 13.270  1.00 28.49 ? 95  ASN A N   1 
ATOM   613  C CA  . ASN A 1 93  ? 41.712 29.917 12.116  1.00 27.89 ? 95  ASN A CA  1 
ATOM   614  C C   . ASN A 1 93  ? 41.772 30.994 11.019  1.00 27.81 ? 95  ASN A C   1 
ATOM   615  O O   . ASN A 1 93  ? 42.441 30.803 9.997   1.00 27.82 ? 95  ASN A O   1 
ATOM   616  C CB  . ASN A 1 93  ? 41.280 28.572 11.517  1.00 27.48 ? 95  ASN A CB  1 
ATOM   617  C CG  . ASN A 1 93  ? 41.466 27.417 12.481  1.00 26.39 ? 95  ASN A CG  1 
ATOM   618  O OD1 . ASN A 1 93  ? 42.568 27.132 12.911  1.00 25.61 ? 95  ASN A OD1 1 
ATOM   619  N ND2 . ASN A 1 93  ? 40.378 26.758 12.836  1.00 27.98 ? 95  ASN A ND2 1 
ATOM   620  N N   . GLY A 1 94  ? 41.079 32.114 11.230  1.00 27.41 ? 96  GLY A N   1 
ATOM   621  C CA  . GLY A 1 94  ? 41.179 33.278 10.352  1.00 27.14 ? 96  GLY A CA  1 
ATOM   622  C C   . GLY A 1 94  ? 40.507 33.105 9.005   1.00 26.89 ? 96  GLY A C   1 
ATOM   623  O O   . GLY A 1 94  ? 40.982 33.638 8.006   1.00 26.87 ? 96  GLY A O   1 
ATOM   624  N N   . GLN A 1 95  ? 39.407 32.352 8.971   1.00 26.43 ? 97  GLN A N   1 
ATOM   625  C CA  . GLN A 1 95  ? 38.584 32.217 7.766   1.00 26.07 ? 97  GLN A CA  1 
ATOM   626  C C   . GLN A 1 95  ? 37.445 33.231 7.794   1.00 25.41 ? 97  GLN A C   1 
ATOM   627  O O   . GLN A 1 95  ? 37.077 33.743 8.858   1.00 25.43 ? 97  GLN A O   1 
ATOM   628  C CB  . GLN A 1 95  ? 37.997 30.802 7.657   1.00 26.31 ? 97  GLN A CB  1 
ATOM   629  N N   . LEU A 1 96  ? 36.888 33.506 6.619   1.00 24.69 ? 98  LEU A N   1 
ATOM   630  C CA  . LEU A 1 96  ? 35.736 34.397 6.488   1.00 24.09 ? 98  LEU A CA  1 
ATOM   631  C C   . LEU A 1 96  ? 34.536 33.808 7.226   1.00 23.19 ? 98  LEU A C   1 
ATOM   632  O O   . LEU A 1 96  ? 34.206 32.640 7.015   1.00 23.45 ? 98  LEU A O   1 
ATOM   633  C CB  . LEU A 1 96  ? 35.381 34.593 5.006   1.00 24.05 ? 98  LEU A CB  1 
ATOM   634  N N   . ILE A 1 97  ? 33.889 34.602 8.086   1.00 22.05 ? 99  ILE A N   1 
ATOM   635  C CA  . ILE A 1 97  ? 32.673 34.156 8.794   1.00 21.33 ? 99  ILE A CA  1 
ATOM   636  C C   . ILE A 1 97  ? 31.446 34.348 7.902   1.00 20.28 ? 99  ILE A C   1 
ATOM   637  O O   . ILE A 1 97  ? 31.219 35.444 7.409   1.00 21.27 ? 99  ILE A O   1 
ATOM   638  C CB  . ILE A 1 97  ? 32.447 34.926 10.121  1.00 21.20 ? 99  ILE A CB  1 
ATOM   639  C CG1 . ILE A 1 97  ? 33.630 34.710 11.087  1.00 21.95 ? 99  ILE A CG1 1 
ATOM   640  C CG2 . ILE A 1 97  ? 31.140 34.490 10.777  1.00 19.16 ? 99  ILE A CG2 1 
ATOM   641  N N   . GLU A 1 98  ? 30.669 33.291 7.699   1.00 18.69 ? 100 GLU A N   1 
ATOM   642  C CA  . GLU A 1 98  ? 29.502 33.338 6.837   1.00 17.54 ? 100 GLU A CA  1 
ATOM   643  C C   . GLU A 1 98  ? 28.244 33.339 7.703   1.00 16.02 ? 100 GLU A C   1 
ATOM   644  O O   . GLU A 1 98  ? 28.288 32.858 8.821   1.00 14.89 ? 100 GLU A O   1 
ATOM   645  C CB  . GLU A 1 98  ? 29.505 32.123 5.912   1.00 18.53 ? 100 GLU A CB  1 
ATOM   646  C CG  . GLU A 1 98  ? 30.613 32.179 4.852   1.00 17.89 ? 100 GLU A CG  1 
ATOM   647  N N   . PRO A 1 99  ? 27.136 33.894 7.202   1.00 14.92 ? 101 PRO A N   1 
ATOM   648  C CA  . PRO A 1 99  ? 25.891 33.760 7.971   1.00 15.37 ? 101 PRO A CA  1 
ATOM   649  C C   . PRO A 1 99  ? 25.373 32.319 8.014   1.00 15.46 ? 101 PRO A C   1 
ATOM   650  O O   . PRO A 1 99  ? 25.844 31.476 7.260   1.00 15.16 ? 101 PRO A O   1 
ATOM   651  C CB  . PRO A 1 99  ? 24.890 34.630 7.216   1.00 15.81 ? 101 PRO A CB  1 
ATOM   652  C CG  . PRO A 1 99  ? 25.459 34.840 5.890   1.00 17.28 ? 101 PRO A CG  1 
ATOM   653  C CD  . PRO A 1 99  ? 26.943 34.624 5.948   1.00 15.95 ? 101 PRO A CD  1 
ATOM   654  N N   . LEU A 1 100 ? 24.367 32.084 8.843   1.00 16.08 ? 102 LEU A N   1 
ATOM   655  C CA  . LEU A 1 100 ? 23.715 30.759 8.898   1.00 16.91 ? 102 LEU A CA  1 
ATOM   656  C C   . LEU A 1 100 ? 22.642 30.676 7.785   1.00 16.80 ? 102 LEU A C   1 
ATOM   657  O O   . LEU A 1 100 ? 21.627 31.365 7.815   1.00 15.42 ? 102 LEU A O   1 
ATOM   658  C CB  . LEU A 1 100 ? 23.126 30.529 10.270  1.00 18.36 ? 102 LEU A CB  1 
ATOM   659  C CG  . LEU A 1 100 ? 22.396 29.205 10.592  1.00 19.21 ? 102 LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 100 ? 23.091 27.986 10.149  1.00 26.64 ? 102 LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 100 ? 22.179 29.205 12.119  1.00 23.45 ? 102 LEU A CD2 1 
ATOM   662  N N   . GLN A 1 101 ? 22.907 29.857 6.773   1.00 16.41 ? 103 GLN A N   1 
ATOM   663  C CA  . GLN A 1 101 ? 22.010 29.799 5.654   1.00 17.03 ? 103 GLN A CA  1 
ATOM   664  C C   . GLN A 1 101 ? 20.937 28.761 5.925   1.00 16.59 ? 103 GLN A C   1 
ATOM   665  O O   . GLN A 1 101 ? 21.238 27.592 6.276   1.00 16.60 ? 103 GLN A O   1 
ATOM   666  C CB  . GLN A 1 101 ? 22.752 29.405 4.376   1.00 18.46 ? 103 GLN A CB  1 
ATOM   667  C CG  . GLN A 1 101 ? 21.834 29.540 3.156   1.00 22.05 ? 103 GLN A CG  1 
ATOM   668  C CD  . GLN A 1 101 ? 22.588 29.611 1.868   1.00 26.34 ? 103 GLN A CD  1 
ATOM   669  O OE1 . GLN A 1 101 ? 23.473 28.774 1.586   1.00 31.41 ? 103 GLN A OE1 1 
ATOM   670  N NE2 . GLN A 1 101 ? 22.267 30.601 1.077   1.00 26.93 ? 103 GLN A NE2 1 
ATOM   671  N N   . ILE A 1 102 ? 19.705 29.159 5.705   1.00 15.46 ? 104 ILE A N   1 
ATOM   672  C CA  . ILE A 1 102 ? 18.578 28.256 5.793   1.00 15.36 ? 104 ILE A CA  1 
ATOM   673  C C   . ILE A 1 102 ? 17.741 28.297 4.509   1.00 14.98 ? 104 ILE A C   1 
ATOM   674  O O   . ILE A 1 102 ? 17.747 29.283 3.755   1.00 15.77 ? 104 ILE A O   1 
ATOM   675  C CB  . ILE A 1 102 ? 17.693 28.529 7.014   1.00 14.86 ? 104 ILE A CB  1 
ATOM   676  C CG1 . ILE A 1 102 ? 17.002 29.897 6.962   1.00 15.87 ? 104 ILE A CG1 1 
ATOM   677  C CG2 . ILE A 1 102 ? 18.515 28.316 8.347   1.00 17.49 ? 104 ILE A CG2 1 
ATOM   678  C CD1 . ILE A 1 102 ? 16.054 30.126 8.108   1.00 15.98 ? 104 ILE A CD1 1 
ATOM   679  N N   . PHE A 1 103 ? 17.015 27.211 4.263   1.00 13.96 ? 105 PHE A N   1 
ATOM   680  C CA  . PHE A 1 103 ? 16.215 27.083 3.050   1.00 13.42 ? 105 PHE A CA  1 
ATOM   681  C C   . PHE A 1 103 ? 14.772 26.715 3.378   1.00 13.78 ? 105 PHE A C   1 
ATOM   682  O O   . PHE A 1 103 ? 14.472 25.566 3.701   1.00 13.17 ? 105 PHE A O   1 
ATOM   683  C CB  . PHE A 1 103 ? 16.825 26.036 2.115   1.00 13.31 ? 105 PHE A CB  1 
ATOM   684  C CG  . PHE A 1 103 ? 18.280 26.262 1.819   1.00 14.48 ? 105 PHE A CG  1 
ATOM   685  C CD1 . PHE A 1 103 ? 18.675 26.841 0.624   1.00 14.27 ? 105 PHE A CD1 1 
ATOM   686  C CD2 . PHE A 1 103 ? 19.252 25.895 2.734   1.00 14.04 ? 105 PHE A CD2 1 
ATOM   687  C CE1 . PHE A 1 103 ? 20.013 27.050 0.349   1.00 13.86 ? 105 PHE A CE1 1 
ATOM   688  C CE2 . PHE A 1 103 ? 20.592 26.102 2.464   1.00 15.38 ? 105 PHE A CE2 1 
ATOM   689  C CZ  . PHE A 1 103 ? 20.972 26.680 1.270   1.00 12.85 ? 105 PHE A CZ  1 
ATOM   690  N N   . PRO A 1 104 ? 13.883 27.699 3.294   1.00 13.99 ? 106 PRO A N   1 
ATOM   691  C CA  . PRO A 1 104 ? 12.491 27.517 3.719   1.00 13.59 ? 106 PRO A CA  1 
ATOM   692  C C   . PRO A 1 104 ? 11.850 26.303 3.054   1.00 13.72 ? 106 PRO A C   1 
ATOM   693  O O   . PRO A 1 104 ? 12.315 25.858 2.006   1.00 12.88 ? 106 PRO A O   1 
ATOM   694  C CB  . PRO A 1 104 ? 11.812 28.800 3.236   1.00 14.75 ? 106 PRO A CB  1 
ATOM   695  C CG  . PRO A 1 104 ? 12.900 29.814 3.229   1.00 14.59 ? 106 PRO A CG  1 
ATOM   696  C CD  . PRO A 1 104 ? 14.149 29.075 2.839   1.00 14.08 ? 106 PRO A CD  1 
ATOM   697  N N   . ARG A 1 105 ? 10.792 25.779 3.664   1.00 13.17 ? 107 ARG A N   1 
ATOM   698  C CA  . ARG A 1 105 ? 10.351 24.415 3.396   1.00 16.06 ? 107 ARG A CA  1 
ATOM   699  C C   . ARG A 1 105 ? 8.849  24.268 3.615   1.00 16.84 ? 107 ARG A C   1 
ATOM   700  O O   . ARG A 1 105 ? 8.316  24.700 4.637   1.00 14.94 ? 107 ARG A O   1 
ATOM   701  C CB  . ARG A 1 105 ? 11.111 23.423 4.279   1.00 16.52 ? 107 ARG A CB  1 
ATOM   702  C CG  . ARG A 1 105 ? 11.891 22.373 3.505   1.00 20.32 ? 107 ARG A CG  1 
ATOM   703  C CD  . ARG A 1 105 ? 11.991 21.073 4.285   1.00 17.72 ? 107 ARG A CD  1 
ATOM   704  N NE  . ARG A 1 105 ? 10.857 20.191 4.027   1.00 16.52 ? 107 ARG A NE  1 
ATOM   705  C CZ  . ARG A 1 105 ? 10.929 18.864 4.020   1.00 13.64 ? 107 ARG A CZ  1 
ATOM   706  N NH1 . ARG A 1 105 ? 12.085 18.259 4.259   1.00 15.28 ? 107 ARG A NH1 1 
ATOM   707  N NH2 . ARG A 1 105 ? 9.845  18.140 3.775   1.00 12.57 ? 107 ARG A NH2 1 
ATOM   708  N N   . ALA A 1 106 ? 8.173  23.656 2.649   1.00 18.54 ? 108 ALA A N   1 
ATOM   709  C CA  . ALA A 1 106 ? 6.751  23.358 2.779   1.00 19.87 ? 108 ALA A CA  1 
ATOM   710  C C   . ALA A 1 106 ? 6.490  22.423 3.955   1.00 20.56 ? 108 ALA A C   1 
ATOM   711  O O   . ALA A 1 106 ? 7.413  21.812 4.493   1.00 22.70 ? 108 ALA A O   1 
ATOM   712  C CB  . ALA A 1 106 ? 6.216  22.755 1.490   1.00 19.64 ? 108 ALA A CB  1 
ATOM   713  N N   . GLN B 2 8   ? 33.900 15.531 24.687  1.00 22.95 ? 42  GLN B N   1 
ATOM   714  C CA  . GLN B 2 8   ? 32.754 15.323 25.625  1.00 23.43 ? 42  GLN B CA  1 
ATOM   715  C C   . GLN B 2 8   ? 31.963 16.618 25.920  1.00 23.24 ? 42  GLN B C   1 
ATOM   716  O O   . GLN B 2 8   ? 32.075 17.206 27.014  1.00 24.87 ? 42  GLN B O   1 
ATOM   717  C CB  . GLN B 2 8   ? 33.203 14.640 26.912  1.00 23.25 ? 42  GLN B CB  1 
ATOM   718  N N   . SER B 2 9   ? 31.225 17.033 24.881  1.00 22.66 ? 43  SER B N   1 
ATOM   719  C CA  . SER B 2 9   ? 30.055 17.933 24.904  1.00 21.43 ? 43  SER B CA  1 
ATOM   720  C C   . SER B 2 9   ? 28.843 17.080 24.477  1.00 19.83 ? 43  SER B C   1 
ATOM   721  O O   . SER B 2 9   ? 29.013 15.881 24.317  1.00 19.50 ? 43  SER B O   1 
ATOM   722  C CB  . SER B 2 9   ? 30.269 19.038 23.890  1.00 21.69 ? 43  SER B CB  1 
ATOM   723  O OG  . SER B 2 9   ? 30.427 18.467 22.609  1.00 24.18 ? 43  SER B OG  1 
ATOM   724  N N   . ASP B 2 10  ? 27.656 17.672 24.239  1.00 17.44 ? 44  ASP B N   1 
ATOM   725  C CA  . ASP B 2 10  ? 26.452 16.889 23.928  1.00 16.07 ? 44  ASP B CA  1 
ATOM   726  C C   . ASP B 2 10  ? 26.651 15.950 22.693  1.00 15.16 ? 44  ASP B C   1 
ATOM   727  O O   . ASP B 2 10  ? 27.339 16.292 21.742  1.00 14.77 ? 44  ASP B O   1 
ATOM   728  C CB  . ASP B 2 10  ? 25.238 17.798 23.641  1.00 15.74 ? 44  ASP B CB  1 
ATOM   729  C CG  . ASP B 2 10  ? 24.765 18.596 24.820  1.00 16.59 ? 44  ASP B CG  1 
ATOM   730  O OD1 . ASP B 2 10  ? 25.111 18.299 25.998  1.00 12.79 ? 44  ASP B OD1 1 
ATOM   731  O OD2 . ASP B 2 10  ? 24.021 19.583 24.542  1.00 17.56 ? 44  ASP B OD2 1 
ATOM   732  N N   . VAL B 2 11  ? 26.006 14.787 22.715  1.00 14.54 ? 45  VAL B N   1 
ATOM   733  C CA  . VAL B 2 11  ? 26.007 13.856 21.592  1.00 14.60 ? 45  VAL B CA  1 
ATOM   734  C C   . VAL B 2 11  ? 24.937 14.282 20.599  1.00 14.63 ? 45  VAL B C   1 
ATOM   735  O O   . VAL B 2 11  ? 23.756 14.430 20.947  1.00 14.99 ? 45  VAL B O   1 
ATOM   736  C CB  . VAL B 2 11  ? 25.778 12.390 22.057  1.00 13.38 ? 45  VAL B CB  1 
ATOM   737  C CG1 . VAL B 2 11  ? 25.602 11.431 20.818  1.00 14.77 ? 45  VAL B CG1 1 
ATOM   738  C CG2 . VAL B 2 11  ? 26.887 11.966 23.008  1.00 13.76 ? 45  VAL B CG2 1 
ATOM   739  N N   . ARG B 2 12  ? 25.375 14.540 19.368  1.00 14.69 ? 46  ARG B N   1 
ATOM   740  C CA  . ARG B 2 12  ? 24.465 14.939 18.308  1.00 15.12 ? 46  ARG B CA  1 
ATOM   741  C C   . ARG B 2 12  ? 24.082 13.649 17.590  1.00 15.29 ? 46  ARG B C   1 
ATOM   742  O O   . ARG B 2 12  ? 24.945 12.885 17.118  1.00 16.23 ? 46  ARG B O   1 
ATOM   743  C CB  . ARG B 2 12  ? 25.134 15.880 17.323  1.00 15.58 ? 46  ARG B CB  1 
ATOM   744  C CG  . ARG B 2 12  ? 25.526 17.196 17.962  1.00 13.91 ? 46  ARG B CG  1 
ATOM   745  C CD  . ARG B 2 12  ? 26.558 17.858 17.142  1.00 15.66 ? 46  ARG B CD  1 
ATOM   746  N NE  . ARG B 2 12  ? 26.027 18.461 15.902  1.00 14.30 ? 46  ARG B NE  1 
ATOM   747  C CZ  . ARG B 2 12  ? 26.460 18.182 14.680  1.00 16.34 ? 46  ARG B CZ  1 
ATOM   748  N NH1 . ARG B 2 12  ? 27.435 17.299 14.481  1.00 15.52 ? 46  ARG B NH1 1 
ATOM   749  N NH2 . ARG B 2 12  ? 25.939 18.835 13.635  1.00 13.50 ? 46  ARG B NH2 1 
ATOM   750  N N   . ILE B 2 13  ? 22.786 13.434 17.501  1.00 16.27 ? 47  ILE B N   1 
ATOM   751  C CA  . ILE B 2 13  ? 22.231 12.298 16.762  1.00 15.93 ? 47  ILE B CA  1 
ATOM   752  C C   . ILE B 2 13  ? 21.509 12.882 15.541  1.00 16.31 ? 47  ILE B C   1 
ATOM   753  O O   . ILE B 2 13  ? 20.634 13.754 15.665  1.00 16.91 ? 47  ILE B O   1 
ATOM   754  C CB  . ILE B 2 13  ? 21.292 11.397 17.621  1.00 15.64 ? 47  ILE B CB  1 
ATOM   755  C CG1 . ILE B 2 13  ? 22.046 10.793 18.825  1.00 17.29 ? 47  ILE B CG1 1 
ATOM   756  C CG2 . ILE B 2 13  ? 20.689 10.264 16.770  1.00 14.70 ? 47  ILE B CG2 1 
ATOM   757  C CD1 . ILE B 2 13  ? 21.203 9.817  19.673  1.00 14.98 ? 47  ILE B CD1 1 
ATOM   758  N N   . LYS B 2 14  ? 21.907 12.382 14.383  1.00 15.95 ? 48  LYS B N   1 
ATOM   759  C CA  . LYS B 2 14  ? 21.312 12.678 13.087  1.00 15.41 ? 48  LYS B CA  1 
ATOM   760  C C   . LYS B 2 14  ? 20.373 11.537 12.718  1.00 16.08 ? 48  LYS B C   1 
ATOM   761  O O   . LYS B 2 14  ? 20.784 10.462 12.222  1.00 16.73 ? 48  LYS B O   1 
ATOM   762  C CB  . LYS B 2 14  ? 22.393 12.930 12.029  1.00 14.67 ? 48  LYS B CB  1 
ATOM   763  C CG  . LYS B 2 14  ? 21.883 13.058 10.583  1.00 12.98 ? 48  LYS B CG  1 
ATOM   764  C CD  . LYS B 2 14  ? 22.833 13.820 9.668   1.00 14.96 ? 48  LYS B CD  1 
ATOM   765  C CE  . LYS B 2 14  ? 24.162 13.192 9.517   1.00 14.37 ? 48  LYS B CE  1 
ATOM   766  N NZ  . LYS B 2 14  ? 24.931 13.958 8.465   1.00 10.95 ? 48  LYS B NZ  1 
ATOM   767  N N   . PHE B 2 15  ? 19.094 11.756 13.008  1.00 15.96 ? 49  PHE B N   1 
ATOM   768  C CA  . PHE B 2 15  ? 18.074 10.793 12.717  1.00 16.16 ? 49  PHE B CA  1 
ATOM   769  C C   . PHE B 2 15  ? 17.703 10.888 11.245  1.00 16.55 ? 49  PHE B C   1 
ATOM   770  O O   . PHE B 2 15  ? 17.623 12.006 10.680  1.00 16.86 ? 49  PHE B O   1 
ATOM   771  C CB  . PHE B 2 15  ? 16.832 11.047 13.552  1.00 16.68 ? 49  PHE B CB  1 
ATOM   772  C CG  . PHE B 2 15  ? 17.015 10.808 15.016  1.00 17.29 ? 49  PHE B CG  1 
ATOM   773  C CD1 . PHE B 2 15  ? 17.117 9.516  15.504  1.00 18.06 ? 49  PHE B CD1 1 
ATOM   774  C CD2 . PHE B 2 15  ? 17.019 11.865 15.915  1.00 18.95 ? 49  PHE B CD2 1 
ATOM   775  C CE1 . PHE B 2 15  ? 17.225 9.285  16.860  1.00 18.43 ? 49  PHE B CE1 1 
ATOM   776  C CE2 . PHE B 2 15  ? 17.142 11.644 17.239  1.00 20.55 ? 49  PHE B CE2 1 
ATOM   777  C CZ  . PHE B 2 15  ? 17.255 10.341 17.719  1.00 17.73 ? 49  PHE B CZ  1 
ATOM   778  N N   . GLU B 2 16  ? 17.474 9.742  10.615  1.00 15.36 ? 50  GLU B N   1 
ATOM   779  C CA  . GLU B 2 16  ? 16.971 9.734  9.236   1.00 15.68 ? 50  GLU B CA  1 
ATOM   780  C C   . GLU B 2 16  ? 15.681 8.929  9.216   1.00 15.09 ? 50  GLU B C   1 
ATOM   781  O O   . GLU B 2 16  ? 15.638 7.819  9.719   1.00 14.77 ? 50  GLU B O   1 
ATOM   782  C CB  . GLU B 2 16  ? 18.000 9.137  8.281   1.00 15.19 ? 50  GLU B CB  1 
ATOM   783  C CG  . GLU B 2 16  ? 19.381 9.665  8.514   1.00 20.41 ? 50  GLU B CG  1 
ATOM   784  C CD  . GLU B 2 16  ? 20.369 9.236  7.436   1.00 24.48 ? 50  GLU B CD  1 
ATOM   785  O OE1 . GLU B 2 16  ? 20.290 8.087  6.993   1.00 28.14 ? 50  GLU B OE1 1 
ATOM   786  O OE2 . GLU B 2 16  ? 21.223 10.061 7.052   1.00 29.78 ? 50  GLU B OE2 1 
ATOM   787  N N   . HIS B 2 17  ? 14.636 9.514  8.640   1.00 15.12 ? 51  HIS B N   1 
ATOM   788  C CA  . HIS B 2 17  ? 13.354 8.856  8.579   1.00 16.56 ? 51  HIS B CA  1 
ATOM   789  C C   . HIS B 2 17  ? 12.567 9.377  7.400   1.00 16.86 ? 51  HIS B C   1 
ATOM   790  O O   . HIS B 2 17  ? 12.320 10.578 7.304   1.00 16.14 ? 51  HIS B O   1 
ATOM   791  C CB  . HIS B 2 17  ? 12.595 9.039  9.906   1.00 15.85 ? 51  HIS B CB  1 
ATOM   792  C CG  . HIS B 2 17  ? 11.270 8.341  9.939   1.00 18.18 ? 51  HIS B CG  1 
ATOM   793  N ND1 . HIS B 2 17  ? 11.142 6.967  9.864   1.00 19.35 ? 51  HIS B ND1 1 
ATOM   794  C CD2 . HIS B 2 17  ? 10.010 8.827  10.027  1.00 19.70 ? 51  HIS B CD2 1 
ATOM   795  C CE1 . HIS B 2 17  ? 9.863  6.639  9.893   1.00 19.85 ? 51  HIS B CE1 1 
ATOM   796  N NE2 . HIS B 2 17  ? 9.157  7.748  10.005  1.00 19.80 ? 51  HIS B NE2 1 
ATOM   797  N N   . ASN B 2 18  ? 12.247 8.477  6.473   1.00 18.20 ? 52  ASN B N   1 
ATOM   798  C CA  . ASN B 2 18  ? 11.381 8.800  5.327   1.00 19.59 ? 52  ASN B CA  1 
ATOM   799  C C   . ASN B 2 18  ? 11.813 10.030 4.533   1.00 18.98 ? 52  ASN B C   1 
ATOM   800  O O   . ASN B 2 18  ? 11.021 10.954 4.305   1.00 18.97 ? 52  ASN B O   1 
ATOM   801  C CB  . ASN B 2 18  ? 9.929  8.990  5.792   1.00 19.99 ? 52  ASN B CB  1 
ATOM   802  C CG  . ASN B 2 18  ? 9.265  7.675  6.178   1.00 23.57 ? 52  ASN B CG  1 
ATOM   803  O OD1 . ASN B 2 18  ? 9.728  6.565  5.816   1.00 25.38 ? 52  ASN B OD1 1 
ATOM   804  N ND2 . ASN B 2 18  ? 8.166  7.788  6.917   1.00 26.55 ? 52  ASN B ND2 1 
ATOM   805  N N   . GLY B 2 19  ? 13.071 10.023 4.127   1.00 18.84 ? 53  GLY B N   1 
ATOM   806  C CA  . GLY B 2 19  ? 13.606 11.051 3.269   1.00 18.38 ? 53  GLY B CA  1 
ATOM   807  C C   . GLY B 2 19  ? 13.938 12.365 3.938   1.00 17.55 ? 53  GLY B C   1 
ATOM   808  O O   . GLY B 2 19  ? 14.235 13.324 3.245   1.00 18.39 ? 53  GLY B O   1 
ATOM   809  N N   . GLU B 2 20  ? 13.874 12.411 5.271   1.00 15.50 ? 54  GLU B N   1 
ATOM   810  C CA  . GLU B 2 20  ? 14.170 13.583 6.039   1.00 16.20 ? 54  GLU B CA  1 
ATOM   811  C C   . GLU B 2 20  ? 15.216 13.288 7.083   1.00 15.35 ? 54  GLU B C   1 
ATOM   812  O O   . GLU B 2 20  ? 15.234 12.204 7.650   1.00 16.57 ? 54  GLU B O   1 
ATOM   813  C CB  . GLU B 2 20  ? 12.896 14.036 6.760   1.00 17.22 ? 54  GLU B CB  1 
ATOM   814  C CG  . GLU B 2 20  ? 12.892 15.371 7.268   1.00 19.83 ? 54  GLU B CG  1 
ATOM   815  C CD  . GLU B 2 20  ? 11.453 15.839 7.598   1.00 18.84 ? 54  GLU B CD  1 
ATOM   816  O OE1 . GLU B 2 20  ? 10.584 15.915 6.713   1.00 22.39 ? 54  GLU B OE1 1 
ATOM   817  O OE2 . GLU B 2 20  ? 11.208 16.112 8.758   1.00 18.11 ? 54  GLU B OE2 1 
ATOM   818  N N   . ARG B 2 21  ? 16.070 14.265 7.372   1.00 14.65 ? 55  ARG B N   1 
ATOM   819  C CA  . ARG B 2 21  ? 17.080 14.139 8.436   1.00 15.32 ? 55  ARG B CA  1 
ATOM   820  C C   . ARG B 2 21  ? 16.824 15.200 9.519   1.00 14.85 ? 55  ARG B C   1 
ATOM   821  O O   . ARG B 2 21  ? 16.379 16.336 9.215   1.00 14.73 ? 55  ARG B O   1 
ATOM   822  C CB  . ARG B 2 21  ? 18.469 14.351 7.873   1.00 15.08 ? 55  ARG B CB  1 
ATOM   823  C CG  . ARG B 2 21  ? 18.788 13.354 6.769   1.00 17.26 ? 55  ARG B CG  1 
ATOM   824  C CD  . ARG B 2 21  ? 20.174 13.584 6.299   1.00 21.68 ? 55  ARG B CD  1 
ATOM   825  N NE  . ARG B 2 21  ? 20.349 13.089 4.953   1.00 25.41 ? 55  ARG B NE  1 
ATOM   826  C CZ  . ARG B 2 21  ? 19.878 13.712 3.874   1.00 25.19 ? 55  ARG B CZ  1 
ATOM   827  N NH1 . ARG B 2 21  ? 19.163 14.873 3.934   1.00 19.22 ? 55  ARG B NH1 1 
ATOM   828  N NH2 . ARG B 2 21  ? 20.109 13.163 2.703   1.00 27.86 ? 55  ARG B NH2 1 
ATOM   829  N N   . ARG B 2 22  ? 17.073 14.818 10.764  1.00 13.41 ? 56  ARG B N   1 
ATOM   830  C CA  . ARG B 2 22  ? 16.809 15.698 11.915  1.00 15.87 ? 56  ARG B CA  1 
ATOM   831  C C   . ARG B 2 22  ? 17.971 15.489 12.855  1.00 15.97 ? 56  ARG B C   1 
ATOM   832  O O   . ARG B 2 22  ? 18.377 14.334 13.078  1.00 18.92 ? 56  ARG B O   1 
ATOM   833  C CB  . ARG B 2 22  ? 15.536 15.298 12.646  1.00 16.74 ? 56  ARG B CB  1 
ATOM   834  C CG  . ARG B 2 22  ? 14.330 15.263 11.816  1.00 19.19 ? 56  ARG B CG  1 
ATOM   835  C CD  . ARG B 2 22  ? 13.647 16.677 11.847  1.00 23.35 ? 56  ARG B CD  1 
ATOM   836  N NE  . ARG B 2 22  ? 12.361 16.312 11.461  1.00 27.88 ? 56  ARG B NE  1 
ATOM   837  C CZ  . ARG B 2 22  ? 11.296 16.148 12.192  1.00 21.00 ? 56  ARG B CZ  1 
ATOM   838  N NH1 . ARG B 2 22  ? 11.103 16.682 13.406  1.00 16.90 ? 56  ARG B NH1 1 
ATOM   839  N NH2 . ARG B 2 22  ? 10.307 15.625 11.530  1.00 27.43 ? 56  ARG B NH2 1 
ATOM   840  N N   . ILE B 2 23  ? 18.529 16.580 13.373  1.00 15.69 ? 57  ILE B N   1 
ATOM   841  C CA  . ILE B 2 23  ? 19.601 16.497 14.361  1.00 15.48 ? 57  ILE B CA  1 
ATOM   842  C C   . ILE B 2 23  ? 19.082 17.009 15.713  1.00 15.78 ? 57  ILE B C   1 
ATOM   843  O O   . ILE B 2 23  ? 18.599 18.164 15.812  1.00 14.27 ? 57  ILE B O   1 
ATOM   844  C CB  . ILE B 2 23  ? 20.881 17.239 13.913  1.00 14.82 ? 57  ILE B CB  1 
ATOM   845  C CG1 . ILE B 2 23  ? 21.463 16.614 12.623  1.00 13.67 ? 57  ILE B CG1 1 
ATOM   846  C CG2 . ILE B 2 23  ? 21.940 17.299 15.045  1.00 14.22 ? 57  ILE B CG2 1 
ATOM   847  C CD1 . ILE B 2 23  ? 22.689 17.344 12.071  1.00 13.72 ? 57  ILE B CD1 1 
ATOM   848  N N   . ILE B 2 24  ? 19.165 16.125 16.714  1.00 16.32 ? 58  ILE B N   1 
ATOM   849  C CA  . ILE B 2 24  ? 18.853 16.452 18.095  1.00 16.09 ? 58  ILE B CA  1 
ATOM   850  C C   . ILE B 2 24  ? 20.053 16.104 19.007  1.00 16.09 ? 58  ILE B C   1 
ATOM   851  O O   . ILE B 2 24  ? 20.693 15.058 18.836  1.00 16.36 ? 58  ILE B O   1 
ATOM   852  C CB  . ILE B 2 24  ? 17.550 15.760 18.570  1.00 16.48 ? 58  ILE B CB  1 
ATOM   853  C CG1 . ILE B 2 24  ? 16.387 16.237 17.699  1.00 18.75 ? 58  ILE B CG1 1 
ATOM   854  C CG2 . ILE B 2 24  ? 17.306 16.012 20.083  1.00 17.78 ? 58  ILE B CG2 1 
ATOM   855  C CD1 . ILE B 2 24  ? 15.130 15.411 17.748  1.00 21.44 ? 58  ILE B CD1 1 
ATOM   856  N N   . ALA B 2 25  ? 20.374 17.034 19.909  1.00 16.04 ? 59  ALA B N   1 
ATOM   857  C CA  . ALA B 2 25  ? 21.489 16.871 20.860  1.00 15.78 ? 59  ALA B CA  1 
ATOM   858  C C   . ALA B 2 25  ? 21.030 16.238 22.172  1.00 16.84 ? 59  ALA B C   1 
ATOM   859  O O   . ALA B 2 25  ? 19.960 16.576 22.719  1.00 17.26 ? 59  ALA B O   1 
ATOM   860  C CB  . ALA B 2 25  ? 22.190 18.184 21.109  1.00 17.00 ? 59  ALA B CB  1 
ATOM   861  N N   . PHE B 2 26  ? 21.839 15.298 22.665  1.00 16.89 ? 60  PHE B N   1 
ATOM   862  C CA  . PHE B 2 26  ? 21.556 14.592 23.916  1.00 16.99 ? 60  PHE B CA  1 
ATOM   863  C C   . PHE B 2 26  ? 22.673 14.862 24.938  1.00 17.06 ? 60  PHE B C   1 
ATOM   864  O O   . PHE B 2 26  ? 23.859 14.716 24.610  1.00 15.30 ? 60  PHE B O   1 
ATOM   865  C CB  . PHE B 2 26  ? 21.395 13.090 23.643  1.00 16.86 ? 60  PHE B CB  1 
ATOM   866  C CG  . PHE B 2 26  ? 20.133 12.737 22.867  1.00 17.57 ? 60  PHE B CG  1 
ATOM   867  C CD1 . PHE B 2 26  ? 18.995 12.334 23.526  1.00 18.70 ? 60  PHE B CD1 1 
ATOM   868  C CD2 . PHE B 2 26  ? 20.100 12.834 21.503  1.00 17.71 ? 60  PHE B CD2 1 
ATOM   869  C CE1 . PHE B 2 26  ? 17.833 12.034 22.828  1.00 17.69 ? 60  PHE B CE1 1 
ATOM   870  C CE2 . PHE B 2 26  ? 18.943 12.532 20.793  1.00 17.69 ? 60  PHE B CE2 1 
ATOM   871  C CZ  . PHE B 2 26  ? 17.823 12.120 21.445  1.00 18.54 ? 60  PHE B CZ  1 
ATOM   872  N N   . SER B 2 27  ? 22.288 15.288 26.140  1.00 16.23 ? 61  SER B N   1 
ATOM   873  C CA  . SER B 2 27  ? 23.242 15.489 27.275  1.00 17.77 ? 61  SER B CA  1 
ATOM   874  C C   . SER B 2 27  ? 23.882 14.177 27.678  1.00 16.32 ? 61  SER B C   1 
ATOM   875  O O   . SER B 2 27  ? 23.195 13.185 27.827  1.00 16.87 ? 61  SER B O   1 
ATOM   876  C CB  . SER B 2 27  ? 22.557 16.101 28.508  1.00 18.40 ? 61  SER B CB  1 
ATOM   877  O OG  . SER B 2 27  ? 22.179 17.405 28.202  1.00 25.04 ? 61  SER B OG  1 
ATOM   878  N N   . ARG B 2 28  ? 25.194 14.175 27.841  1.00 16.67 ? 62  ARG B N   1 
ATOM   879  C CA  . ARG B 2 28  ? 25.905 13.032 28.398  1.00 16.98 ? 62  ARG B CA  1 
ATOM   880  C C   . ARG B 2 28  ? 25.716 12.908 29.912  1.00 17.83 ? 62  ARG B C   1 
ATOM   881  O O   . ARG B 2 28  ? 25.616 13.918 30.600  1.00 18.20 ? 62  ARG B O   1 
ATOM   882  C CB  . ARG B 2 28  ? 27.404 13.147 28.149  1.00 17.90 ? 62  ARG B CB  1 
ATOM   883  C CG  . ARG B 2 28  ? 27.799 12.997 26.718  1.00 16.80 ? 62  ARG B CG  1 
ATOM   884  C CD  . ARG B 2 28  ? 29.244 13.384 26.509  1.00 19.22 ? 62  ARG B CD  1 
ATOM   885  N NE  . ARG B 2 28  ? 29.580 13.363 25.095  1.00 19.36 ? 62  ARG B NE  1 
ATOM   886  C CZ  . ARG B 2 28  ? 30.108 12.329 24.444  1.00 19.07 ? 62  ARG B CZ  1 
ATOM   887  N NH1 . ARG B 2 28  ? 30.378 11.170 25.061  1.00 17.54 ? 62  ARG B NH1 1 
ATOM   888  N NH2 . ARG B 2 28  ? 30.368 12.464 23.150  1.00 20.88 ? 62  ARG B NH2 1 
ATOM   889  N N   . PRO B 2 29  ? 25.681 11.669 30.438  1.00 17.88 ? 63  PRO B N   1 
ATOM   890  C CA  . PRO B 2 29  ? 25.621 10.365 29.736  1.00 17.89 ? 63  PRO B CA  1 
ATOM   891  C C   . PRO B 2 29  ? 24.268 10.125 29.078  1.00 18.28 ? 63  PRO B C   1 
ATOM   892  O O   . PRO B 2 29  ? 23.227 10.379 29.687  1.00 16.79 ? 63  PRO B O   1 
ATOM   893  C CB  . PRO B 2 29  ? 25.846 9.340  30.855  1.00 17.41 ? 63  PRO B CB  1 
ATOM   894  C CG  . PRO B 2 29  ? 25.499 10.054 32.105  1.00 18.21 ? 63  PRO B CG  1 
ATOM   895  C CD  . PRO B 2 29  ? 25.751 11.497 31.904  1.00 17.58 ? 63  PRO B CD  1 
ATOM   896  N N   . VAL B 2 30  ? 24.301 9.646  27.836  1.00 18.46 ? 64  VAL B N   1 
ATOM   897  C CA  . VAL B 2 30  ? 23.108 9.488  27.019  1.00 18.75 ? 64  VAL B CA  1 
ATOM   898  C C   . VAL B 2 30  ? 22.508 8.131  27.343  1.00 20.04 ? 64  VAL B C   1 
ATOM   899  O O   . VAL B 2 30  ? 23.226 7.140  27.397  1.00 18.70 ? 64  VAL B O   1 
ATOM   900  C CB  . VAL B 2 30  ? 23.436 9.579  25.489  1.00 18.54 ? 64  VAL B CB  1 
ATOM   901  C CG1 . VAL B 2 30  ? 22.163 9.428  24.671  1.00 18.35 ? 64  VAL B CG1 1 
ATOM   902  C CG2 . VAL B 2 30  ? 24.181 10.859 25.183  1.00 16.94 ? 64  VAL B CG2 1 
ATOM   903  N N   . LYS B 2 31  ? 21.208 8.120  27.625  1.00 20.60 ? 65  LYS B N   1 
ATOM   904  C CA  . LYS B 2 31  ? 20.491 6.913  27.976  1.00 21.61 ? 65  LYS B CA  1 
ATOM   905  C C   . LYS B 2 31  ? 19.658 6.424  26.799  1.00 21.44 ? 65  LYS B C   1 
ATOM   906  O O   . LYS B 2 31  ? 18.982 7.211  26.127  1.00 22.42 ? 65  LYS B O   1 
ATOM   907  C CB  . LYS B 2 31  ? 19.576 7.147  29.200  1.00 22.14 ? 65  LYS B CB  1 
ATOM   908  C CG  . LYS B 2 31  ? 20.295 7.631  30.476  1.00 24.49 ? 65  LYS B CG  1 
ATOM   909  C CD  . LYS B 2 31  ? 21.358 6.647  30.947  1.00 28.21 ? 65  LYS B CD  1 
ATOM   910  C CE  . LYS B 2 31  ? 21.945 7.015  32.333  1.00 30.93 ? 65  LYS B CE  1 
ATOM   911  N NZ  . LYS B 2 31  ? 22.529 8.410  32.357  1.00 34.72 ? 65  LYS B NZ  1 
ATOM   912  N N   . TYR B 2 32  ? 19.691 5.113  26.583  1.00 22.52 ? 66  TYR B N   1 
ATOM   913  C CA  . TYR B 2 32  ? 18.909 4.463  25.539  1.00 21.92 ? 66  TYR B CA  1 
ATOM   914  C C   . TYR B 2 32  ? 17.435 4.815  25.651  1.00 21.64 ? 66  TYR B C   1 
ATOM   915  O O   . TYR B 2 32  ? 16.776 5.117  24.657  1.00 21.99 ? 66  TYR B O   1 
ATOM   916  C CB  . TYR B 2 32  ? 19.068 2.962  25.639  1.00 21.70 ? 66  TYR B CB  1 
ATOM   917  C CG  . TYR B 2 32  ? 18.342 2.198  24.540  1.00 21.46 ? 66  TYR B CG  1 
ATOM   918  C CD1 . TYR B 2 32  ? 18.894 2.052  23.268  1.00 20.68 ? 66  TYR B CD1 1 
ATOM   919  C CD2 . TYR B 2 32  ? 17.099 1.625  24.779  1.00 20.29 ? 66  TYR B CD2 1 
ATOM   920  C CE1 . TYR B 2 32  ? 18.215 1.331  22.277  1.00 21.44 ? 66  TYR B CE1 1 
ATOM   921  C CE2 . TYR B 2 32  ? 16.424 0.927  23.798  1.00 20.33 ? 66  TYR B CE2 1 
ATOM   922  C CZ  . TYR B 2 32  ? 16.982 0.784  22.548  1.00 20.36 ? 66  TYR B CZ  1 
ATOM   923  O OH  . TYR B 2 32  ? 16.285 0.062  21.602  1.00 21.29 ? 66  TYR B OH  1 
ATOM   924  N N   . GLU B 2 33  ? 16.920 4.764  26.870  1.00 20.93 ? 67  GLU B N   1 
ATOM   925  C CA  . GLU B 2 33  ? 15.505 5.030  27.080  1.00 21.15 ? 67  GLU B CA  1 
ATOM   926  C C   . GLU B 2 33  ? 15.154 6.442  26.610  1.00 20.23 ? 67  GLU B C   1 
ATOM   927  O O   . GLU B 2 33  ? 14.058 6.666  26.078  1.00 20.17 ? 67  GLU B O   1 
ATOM   928  C CB  . GLU B 2 33  ? 15.141 4.836  28.551  1.00 21.87 ? 67  GLU B CB  1 
ATOM   929  C CG  . GLU B 2 33  ? 13.653 4.871  28.824  1.00 24.99 ? 67  GLU B CG  1 
ATOM   930  C CD  . GLU B 2 33  ? 13.059 6.267  28.828  1.00 28.56 ? 67  GLU B CD  1 
ATOM   931  O OE1 . GLU B 2 33  ? 13.797 7.245  29.144  1.00 29.92 ? 67  GLU B OE1 1 
ATOM   932  O OE2 . GLU B 2 33  ? 11.853 6.369  28.517  1.00 29.14 ? 67  GLU B OE2 1 
ATOM   933  N N   . ASP B 2 34  ? 16.067 7.387  26.838  0.60 18.03 ? 68  ASP B N   1 
ATOM   934  C CA  . ASP B 2 34  ? 15.844 8.765  26.464  0.60 17.82 ? 68  ASP B CA  1 
ATOM   935  C C   . ASP B 2 34  ? 15.870 8.984  24.977  0.60 17.48 ? 68  ASP B C   1 
ATOM   936  O O   . ASP B 2 34  ? 15.101 9.781  24.464  0.60 13.87 ? 68  ASP B O   1 
ATOM   937  C CB  . ASP B 2 34  ? 16.871 9.651  27.127  0.60 18.23 ? 68  ASP B CB  1 
ATOM   938  C CG  . ASP B 2 34  ? 16.602 9.836  28.595  0.60 19.89 ? 68  ASP B CG  1 
ATOM   939  O OD1 . ASP B 2 34  ? 15.427 9.730  29.067  0.60 23.56 ? 68  ASP B OD1 1 
ATOM   940  O OD2 . ASP B 2 34  ? 17.574 10.141 29.289  0.60 24.08 ? 68  ASP B OD2 1 
ATOM   941  N N   . VAL B 2 35  ? 16.755 8.263  24.285  1.00 19.05 ? 69  VAL B N   1 
ATOM   942  C CA  . VAL B 2 35  ? 16.810 8.305  22.822  1.00 19.75 ? 69  VAL B CA  1 
ATOM   943  C C   . VAL B 2 35  ? 15.534 7.722  22.247  1.00 20.53 ? 69  VAL B C   1 
ATOM   944  O O   . VAL B 2 35  ? 14.937 8.322  21.357  1.00 19.80 ? 69  VAL B O   1 
ATOM   945  C CB  . VAL B 2 35  ? 18.034 7.614  22.253  1.00 20.93 ? 69  VAL B CB  1 
ATOM   946  C CG1 . VAL B 2 35  ? 18.002 7.649  20.725  1.00 20.56 ? 69  VAL B CG1 1 
ATOM   947  C CG2 . VAL B 2 35  ? 19.353 8.302  22.839  1.00 20.62 ? 69  VAL B CG2 1 
ATOM   948  N N   . GLU B 2 36  ? 15.099 6.571  22.763  1.00 20.55 ? 70  GLU B N   1 
ATOM   949  C CA  . GLU B 2 36  ? 13.886 5.940  22.250  1.00 21.11 ? 70  GLU B CA  1 
ATOM   950  C C   . GLU B 2 36  ? 12.635 6.804  22.501  1.00 19.84 ? 70  GLU B C   1 
ATOM   951  O O   . GLU B 2 36  ? 11.769 6.936  21.633  1.00 18.19 ? 70  GLU B O   1 
ATOM   952  C CB  . GLU B 2 36  ? 13.700 4.530  22.807  1.00 21.47 ? 70  GLU B CB  1 
ATOM   953  C CG  . GLU B 2 36  ? 14.206 3.491  21.865  1.00 25.70 ? 70  GLU B CG  1 
ATOM   954  C CD  . GLU B 2 36  ? 13.538 3.559  20.463  1.00 27.10 ? 70  GLU B CD  1 
ATOM   955  O OE1 . GLU B 2 36  ? 14.248 3.200  19.531  1.00 31.30 ? 70  GLU B OE1 1 
ATOM   956  O OE2 . GLU B 2 36  ? 12.332 3.947  20.293  1.00 27.96 ? 70  GLU B OE2 1 
ATOM   957  N N   . HIS B 2 37  ? 12.565 7.401  23.673  1.00 19.81 ? 71  HIS B N   1 
ATOM   958  C CA  . HIS B 2 37  ? 11.469 8.299  23.997  1.00 19.94 ? 71  HIS B CA  1 
ATOM   959  C C   . HIS B 2 37  ? 11.442 9.520  23.068  1.00 19.52 ? 71  HIS B C   1 
ATOM   960  O O   . HIS B 2 37  ? 10.358 9.935  22.631  1.00 17.03 ? 71  HIS B O   1 
ATOM   961  C CB  . HIS B 2 37  ? 11.564 8.746  25.453  1.00 20.08 ? 71  HIS B CB  1 
ATOM   962  C CG  . HIS B 2 37  ? 10.518 9.756  25.838  1.00 22.72 ? 71  HIS B CG  1 
ATOM   963  N ND1 . HIS B 2 37  ? 10.796 11.102 25.972  1.00 26.13 ? 71  HIS B ND1 1 
ATOM   964  C CD2 . HIS B 2 37  ? 9.191  9.622  26.039  1.00 23.93 ? 71  HIS B CD2 1 
ATOM   965  C CE1 . HIS B 2 37  ? 9.686  11.746 26.287  1.00 26.48 ? 71  HIS B CE1 1 
ATOM   966  N NE2 . HIS B 2 37  ? 8.694  10.868 26.330  1.00 23.12 ? 71  HIS B NE2 1 
ATOM   967  N N   . LYS B 2 38  ? 12.614 10.096 22.795  1.00 19.55 ? 72  LYS B N   1 
ATOM   968  C CA  . LYS B 2 38  ? 12.720 11.243 21.854  1.00 19.71 ? 72  LYS B CA  1 
ATOM   969  C C   . LYS B 2 38  ? 12.223 10.849 20.458  1.00 19.54 ? 72  LYS B C   1 
ATOM   970  O O   . LYS B 2 38  ? 11.450 11.561 19.827  1.00 19.22 ? 72  LYS B O   1 
ATOM   971  C CB  . LYS B 2 38  ? 14.178 11.739 21.764  1.00 20.32 ? 72  LYS B CB  1 
ATOM   972  C CG  . LYS B 2 38  ? 14.337 13.061 20.976  1.00 21.66 ? 72  LYS B CG  1 
ATOM   973  C CD  . LYS B 2 38  ? 13.544 14.233 21.576  1.00 23.67 ? 72  LYS B CD  1 
ATOM   974  C CE  . LYS B 2 38  ? 13.969 14.635 23.010  1.00 23.92 ? 72  LYS B CE  1 
ATOM   975  N NZ  . LYS B 2 38  ? 13.208 15.791 23.657  1.00 22.44 ? 72  LYS B NZ  1 
ATOM   976  N N   . VAL B 2 39  ? 12.621 9.668  20.002  1.00 20.08 ? 73  VAL B N   1 
ATOM   977  C CA  . VAL B 2 39  ? 12.135 9.147  18.724  1.00 20.47 ? 73  VAL B CA  1 
ATOM   978  C C   . VAL B 2 39  ? 10.595 9.064  18.728  1.00 20.11 ? 73  VAL B C   1 
ATOM   979  O O   . VAL B 2 39  ? 9.942  9.497  17.768  1.00 20.27 ? 73  VAL B O   1 
ATOM   980  C CB  . VAL B 2 39  ? 12.788 7.789  18.396  1.00 20.49 ? 73  VAL B CB  1 
ATOM   981  C CG1 . VAL B 2 39  ? 12.016 7.073  17.275  1.00 21.09 ? 73  VAL B CG1 1 
ATOM   982  C CG2 . VAL B 2 39  ? 14.259 8.007  18.036  1.00 21.06 ? 73  VAL B CG2 1 
ATOM   983  N N   . THR B 2 40  ? 10.011 8.553  19.814  1.00 20.70 ? 74  THR B N   1 
ATOM   984  C CA  . THR B 2 40  ? 8.553  8.454  19.920  1.00 21.08 ? 74  THR B CA  1 
ATOM   985  C C   . THR B 2 40  ? 7.856  9.821  19.873  1.00 20.49 ? 74  THR B C   1 
ATOM   986  O O   . THR B 2 40  ? 6.835  9.969  19.198  1.00 20.77 ? 74  THR B O   1 
ATOM   987  C CB  . THR B 2 40  ? 8.091  7.584  21.151  1.00 21.13 ? 74  THR B CB  1 
ATOM   988  O OG1 . THR B 2 40  ? 8.810  6.346  21.128  1.00 22.03 ? 74  THR B OG1 1 
ATOM   989  C CG2 . THR B 2 40  ? 6.629  7.261  21.069  1.00 22.96 ? 74  THR B CG2 1 
ATOM   990  N N   . THR B 2 41  ? 8.390  10.821 20.569  1.00 20.48 ? 75  THR B N   1 
ATOM   991  C CA  . THR B 2 41  ? 7.737  12.132 20.612  1.00 20.63 ? 75  THR B CA  1 
ATOM   992  C C   . THR B 2 41  ? 7.947  12.941 19.307  1.00 20.33 ? 75  THR B C   1 
ATOM   993  O O   . THR B 2 41  ? 7.059  13.698 18.882  1.00 20.26 ? 75  THR B O   1 
ATOM   994  C CB  . THR B 2 41  ? 8.161  12.962 21.866  1.00 20.95 ? 75  THR B CB  1 
ATOM   995  O OG1 . THR B 2 41  ? 9.536  13.359 21.758  1.00 23.35 ? 75  THR B OG1 1 
ATOM   996  C CG2 . THR B 2 41  ? 7.959  12.154 23.138  1.00 21.32 ? 75  THR B CG2 1 
ATOM   997  N N   . VAL B 2 42  ? 9.098  12.760 18.665  1.00 19.01 ? 76  VAL B N   1 
ATOM   998  C CA  . VAL B 2 42  ? 9.431  13.530 17.457  1.00 19.36 ? 76  VAL B CA  1 
ATOM   999  C C   . VAL B 2 42  ? 8.742  12.907 16.242  1.00 19.78 ? 76  VAL B C   1 
ATOM   1000 O O   . VAL B 2 42  ? 8.144  13.629 15.435  1.00 19.76 ? 76  VAL B O   1 
ATOM   1001 C CB  . VAL B 2 42  ? 10.959 13.639 17.250  1.00 19.44 ? 76  VAL B CB  1 
ATOM   1002 C CG1 . VAL B 2 42  ? 11.288 14.250 15.856  1.00 21.20 ? 76  VAL B CG1 1 
ATOM   1003 C CG2 . VAL B 2 42  ? 11.579 14.477 18.364  1.00 20.65 ? 76  VAL B CG2 1 
ATOM   1004 N N   . PHE B 2 43  ? 8.794  11.576 16.133  1.00 19.73 ? 77  PHE B N   1 
ATOM   1005 C CA  . PHE B 2 43  ? 8.318  10.863 14.936  1.00 21.34 ? 77  PHE B CA  1 
ATOM   1006 C C   . PHE B 2 43  ? 6.963  10.179 15.111  1.00 22.52 ? 77  PHE B C   1 
ATOM   1007 O O   . PHE B 2 43  ? 6.389  9.690  14.145  1.00 22.56 ? 77  PHE B O   1 
ATOM   1008 C CB  . PHE B 2 43  ? 9.381  9.895  14.423  1.00 20.69 ? 77  PHE B CB  1 
ATOM   1009 C CG  . PHE B 2 43  ? 10.660 10.583 14.008  1.00 21.33 ? 77  PHE B CG  1 
ATOM   1010 C CD1 . PHE B 2 43  ? 10.754 11.218 12.773  1.00 21.98 ? 77  PHE B CD1 1 
ATOM   1011 C CD2 . PHE B 2 43  ? 11.743 10.637 14.863  1.00 20.12 ? 77  PHE B CD2 1 
ATOM   1012 C CE1 . PHE B 2 43  ? 11.938 11.851 12.397  1.00 21.03 ? 77  PHE B CE1 1 
ATOM   1013 C CE2 . PHE B 2 43  ? 12.931 11.291 14.491  1.00 21.80 ? 77  PHE B CE2 1 
ATOM   1014 C CZ  . PHE B 2 43  ? 13.018 11.883 13.267  1.00 21.21 ? 77  PHE B CZ  1 
ATOM   1015 N N   . GLY B 2 44  ? 6.456  10.174 16.334  1.00 24.28 ? 78  GLY B N   1 
ATOM   1016 C CA  . GLY B 2 44  ? 5.070  9.818  16.591  1.00 26.06 ? 78  GLY B CA  1 
ATOM   1017 C C   . GLY B 2 44  ? 4.876  8.344  16.853  1.00 27.11 ? 78  GLY B C   1 
ATOM   1018 O O   . GLY B 2 44  ? 3.748  7.901  16.975  1.00 28.44 ? 78  GLY B O   1 
ATOM   1019 N N   . GLN B 2 45  ? 5.968  7.598  16.961  1.00 27.90 ? 79  GLN B N   1 
ATOM   1020 C CA  . GLN B 2 45  ? 5.900  6.168  17.129  1.00 29.46 ? 79  GLN B CA  1 
ATOM   1021 C C   . GLN B 2 45  ? 7.253  5.603  17.482  1.00 28.83 ? 79  GLN B C   1 
ATOM   1022 O O   . GLN B 2 45  ? 8.286  6.177  17.130  1.00 27.32 ? 79  GLN B O   1 
ATOM   1023 C CB  . GLN B 2 45  ? 5.350  5.463  15.869  1.00 29.38 ? 79  GLN B CB  1 
ATOM   1024 C CG  . GLN B 2 45  ? 6.146  5.680  14.595  1.00 32.08 ? 79  GLN B CG  1 
ATOM   1025 C CD  . GLN B 2 45  ? 5.534  4.974  13.389  1.00 32.67 ? 79  GLN B CD  1 
ATOM   1026 O OE1 . GLN B 2 45  ? 4.489  4.317  13.497  1.00 38.30 ? 79  GLN B OE1 1 
ATOM   1027 N NE2 . GLN B 2 45  ? 6.174  5.117  12.234  1.00 36.03 ? 79  GLN B NE2 1 
ATOM   1028 N N   . PRO B 2 46  ? 7.262  4.472  18.199  1.00 28.93 ? 80  PRO B N   1 
ATOM   1029 C CA  . PRO B 2 46  ? 8.551  3.843  18.508  1.00 28.66 ? 80  PRO B CA  1 
ATOM   1030 C C   . PRO B 2 46  ? 9.164  3.338  17.208  1.00 27.88 ? 80  PRO B C   1 
ATOM   1031 O O   . PRO B 2 46  ? 8.426  2.899  16.329  1.00 28.21 ? 80  PRO B O   1 
ATOM   1032 C CB  . PRO B 2 46  ? 8.171  2.687  19.458  1.00 29.10 ? 80  PRO B CB  1 
ATOM   1033 C CG  . PRO B 2 46  ? 6.738  2.955  19.880  1.00 29.77 ? 80  PRO B CG  1 
ATOM   1034 C CD  . PRO B 2 46  ? 6.118  3.721  18.758  1.00 29.88 ? 80  PRO B CD  1 
ATOM   1035 N N   . LEU B 2 47  ? 10.481 3.469  17.051  1.00 27.19 ? 81  LEU B N   1 
ATOM   1036 C CA  . LEU B 2 47  ? 11.164 3.014  15.832  1.00 26.41 ? 81  LEU B CA  1 
ATOM   1037 C C   . LEU B 2 47  ? 12.541 2.444  16.207  1.00 26.16 ? 81  LEU B C   1 
ATOM   1038 O O   . LEU B 2 47  ? 13.198 2.937  17.125  1.00 26.81 ? 81  LEU B O   1 
ATOM   1039 C CB  . LEU B 2 47  ? 11.318 4.173  14.809  1.00 26.54 ? 81  LEU B CB  1 
ATOM   1040 C CG  . LEU B 2 47  ? 10.123 4.918  14.152  1.00 24.07 ? 81  LEU B CG  1 
ATOM   1041 C CD1 . LEU B 2 47  ? 10.489 6.282  13.594  1.00 27.48 ? 81  LEU B CD1 1 
ATOM   1042 C CD2 . LEU B 2 47  ? 9.510  4.096  13.038  1.00 27.27 ? 81  LEU B CD2 1 
ATOM   1043 N N   . ASP B 2 48  ? 12.971 1.429  15.460  1.00 26.39 ? 82  ASP B N   1 
ATOM   1044 C CA  . ASP B 2 48  ? 14.275 0.764  15.655  1.00 25.86 ? 82  ASP B CA  1 
ATOM   1045 C C   . ASP B 2 48  ? 15.404 1.680  15.248  1.00 24.73 ? 82  ASP B C   1 
ATOM   1046 O O   . ASP B 2 48  ? 15.307 2.378  14.246  1.00 24.12 ? 82  ASP B O   1 
ATOM   1047 C CB  . ASP B 2 48  ? 14.383 -0.502 14.805  1.00 26.39 ? 82  ASP B CB  1 
ATOM   1048 C CG  . ASP B 2 48  ? 13.517 -1.649 15.305  1.00 28.63 ? 82  ASP B CG  1 
ATOM   1049 O OD1 . ASP B 2 48  ? 13.102 -1.706 16.498  1.00 30.32 ? 82  ASP B OD1 1 
ATOM   1050 O OD2 . ASP B 2 48  ? 13.261 -2.513 14.463  1.00 31.47 ? 82  ASP B OD2 1 
ATOM   1051 N N   . LEU B 2 49  ? 16.469 1.668  16.039  1.00 24.16 ? 83  LEU B N   1 
ATOM   1052 C CA  . LEU B 2 49  ? 17.626 2.541  15.833  1.00 24.29 ? 83  LEU B CA  1 
ATOM   1053 C C   . LEU B 2 49  ? 18.714 1.781  15.086  1.00 23.72 ? 83  LEU B C   1 
ATOM   1054 O O   . LEU B 2 49  ? 19.294 0.852  15.634  1.00 24.21 ? 83  LEU B O   1 
ATOM   1055 C CB  . LEU B 2 49  ? 18.215 2.974  17.179  1.00 24.55 ? 83  LEU B CB  1 
ATOM   1056 C CG  . LEU B 2 49  ? 17.304 3.616  18.238  1.00 27.13 ? 83  LEU B CG  1 
ATOM   1057 C CD1 . LEU B 2 49  ? 18.151 3.980  19.484  1.00 26.99 ? 83  LEU B CD1 1 
ATOM   1058 C CD2 . LEU B 2 49  ? 16.648 4.826  17.647  1.00 25.99 ? 83  LEU B CD2 1 
ATOM   1059 N N   . HIS B 2 50  ? 18.962 2.173  13.847  1.00 22.41 ? 84  HIS B N   1 
ATOM   1060 C CA  . HIS B 2 50  ? 20.046 1.577  13.038  1.00 22.17 ? 84  HIS B CA  1 
ATOM   1061 C C   . HIS B 2 50  ? 21.175 2.571  12.870  1.00 21.74 ? 84  HIS B C   1 
ATOM   1062 O O   . HIS B 2 50  ? 21.055 3.532  12.126  1.00 20.88 ? 84  HIS B O   1 
ATOM   1063 C CB  . HIS B 2 50  ? 19.543 1.156  11.668  1.00 22.38 ? 84  HIS B CB  1 
ATOM   1064 C CG  . HIS B 2 50  ? 18.483 0.103  11.698  1.00 24.02 ? 84  HIS B CG  1 
ATOM   1065 N ND1 . HIS B 2 50  ? 18.772 -1.238 11.568  1.00 23.06 ? 84  HIS B ND1 1 
ATOM   1066 C CD2 . HIS B 2 50  ? 17.132 0.192  11.791  1.00 26.21 ? 84  HIS B CD2 1 
ATOM   1067 C CE1 . HIS B 2 50  ? 17.645 -1.933 11.632  1.00 27.37 ? 84  HIS B CE1 1 
ATOM   1068 N NE2 . HIS B 2 50  ? 16.636 -1.089 11.769  1.00 25.85 ? 84  HIS B NE2 1 
ATOM   1069 N N   . TYR B 2 51  ? 22.262 2.304  13.567  1.00 21.72 ? 85  TYR B N   1 
ATOM   1070 C CA  . TYR B 2 51  ? 23.469 3.098  13.497  1.00 22.35 ? 85  TYR B CA  1 
ATOM   1071 C C   . TYR B 2 51  ? 24.150 2.784  12.165  1.00 22.55 ? 85  TYR B C   1 
ATOM   1072 O O   . TYR B 2 51  ? 24.442 1.619  11.886  1.00 21.15 ? 85  TYR B O   1 
ATOM   1073 C CB  . TYR B 2 51  ? 24.397 2.792  14.678  1.00 24.24 ? 85  TYR B CB  1 
ATOM   1074 C CG  . TYR B 2 51  ? 25.774 3.371  14.466  1.00 25.98 ? 85  TYR B CG  1 
ATOM   1075 C CD1 . TYR B 2 51  ? 25.951 4.739  14.269  1.00 26.53 ? 85  TYR B CD1 1 
ATOM   1076 C CD2 . TYR B 2 51  ? 26.887 2.549  14.380  1.00 30.01 ? 85  TYR B CD2 1 
ATOM   1077 C CE1 . TYR B 2 51  ? 27.211 5.283  14.026  1.00 28.90 ? 85  TYR B CE1 1 
ATOM   1078 C CE2 . TYR B 2 51  ? 28.155 3.082  14.136  1.00 30.28 ? 85  TYR B CE2 1 
ATOM   1079 C CZ  . TYR B 2 51  ? 28.309 4.447  13.961  1.00 29.45 ? 85  TYR B CZ  1 
ATOM   1080 O OH  . TYR B 2 51  ? 29.571 4.951  13.715  1.00 30.50 ? 85  TYR B OH  1 
ATOM   1081 N N   . MET B 2 52  ? 24.361 3.821  11.362  1.00 22.55 ? 86  MET B N   1 
ATOM   1082 C CA  . MET B 2 52  ? 24.809 3.691  9.978   1.00 23.06 ? 86  MET B CA  1 
ATOM   1083 C C   . MET B 2 52  ? 26.210 4.214  9.761   1.00 23.78 ? 86  MET B C   1 
ATOM   1084 O O   . MET B 2 52  ? 26.539 5.348  10.168  1.00 23.27 ? 86  MET B O   1 
ATOM   1085 C CB  . MET B 2 52  ? 23.930 4.539  9.052   1.00 25.10 ? 86  MET B CB  1 
ATOM   1086 C CG  . MET B 2 52  ? 22.461 4.388  9.198   1.00 26.33 ? 86  MET B CG  1 
ATOM   1087 S SD  . MET B 2 52  ? 21.881 2.808  8.635   1.00 32.62 ? 86  MET B SD  1 
ATOM   1088 C CE  . MET B 2 52  ? 22.127 3.050  6.861   1.00 33.20 ? 86  MET B CE  1 
ATOM   1089 N N   . ASN B 2 53  ? 27.015 3.427  9.055   1.00 23.55 ? 87  ASN B N   1 
ATOM   1090 C CA  . ASN B 2 53  ? 28.269 3.906  8.492   1.00 24.08 ? 87  ASN B CA  1 
ATOM   1091 C C   . ASN B 2 53  ? 28.412 3.360  7.054   1.00 22.54 ? 87  ASN B C   1 
ATOM   1092 O O   . ASN B 2 53  ? 28.836 2.213  6.827   1.00 20.98 ? 87  ASN B O   1 
ATOM   1093 C CB  . ASN B 2 53  ? 29.445 3.493  9.368   1.00 24.94 ? 87  ASN B CB  1 
ATOM   1094 C CG  . ASN B 2 53  ? 30.761 4.186  8.953   1.00 29.38 ? 87  ASN B CG  1 
ATOM   1095 O OD1 . ASN B 2 53  ? 30.945 4.583  7.800   1.00 33.66 ? 87  ASN B OD1 1 
ATOM   1096 N ND2 . ASN B 2 53  ? 31.675 4.333  9.905   1.00 35.61 ? 87  ASN B ND2 1 
ATOM   1097 N N   . ASN B 2 54  ? 28.058 4.214  6.099   1.00 21.90 ? 88  ASN B N   1 
ATOM   1098 C CA  . ASN B 2 54  ? 28.066 3.860  4.680   1.00 21.77 ? 88  ASN B CA  1 
ATOM   1099 C C   . ASN B 2 54  ? 27.237 2.610  4.442   1.00 21.02 ? 88  ASN B C   1 
ATOM   1100 O O   . ASN B 2 54  ? 26.067 2.647  4.749   1.00 21.82 ? 88  ASN B O   1 
ATOM   1101 C CB  . ASN B 2 54  ? 29.489 3.834  4.138   1.00 21.94 ? 88  ASN B CB  1 
ATOM   1102 C CG  . ASN B 2 54  ? 30.061 5.250  3.960   1.00 23.20 ? 88  ASN B CG  1 
ATOM   1103 O OD1 . ASN B 2 54  ? 29.376 6.149  3.434   1.00 22.58 ? 88  ASN B OD1 1 
ATOM   1104 N ND2 . ASN B 2 54  ? 31.306 5.452  4.385   1.00 23.14 ? 88  ASN B ND2 1 
ATOM   1105 N N   . GLU B 2 55  ? 27.821 1.515  3.964   1.00 20.59 ? 89  GLU B N   1 
ATOM   1106 C CA  . GLU B 2 55  ? 27.050 0.309  3.588   1.00 21.05 ? 89  GLU B CA  1 
ATOM   1107 C C   . GLU B 2 55  ? 26.828 -0.677 4.766   1.00 19.74 ? 89  GLU B C   1 
ATOM   1108 O O   . GLU B 2 55  ? 26.232 -1.717 4.592   1.00 20.32 ? 89  GLU B O   1 
ATOM   1109 C CB  . GLU B 2 55  ? 27.758 -0.419 2.462   1.00 21.64 ? 89  GLU B CB  1 
ATOM   1110 C CG  . GLU B 2 55  ? 27.965 0.416  1.188   1.00 24.59 ? 89  GLU B CG  1 
ATOM   1111 C CD  . GLU B 2 55  ? 28.811 -0.323 0.124   1.00 26.56 ? 89  GLU B CD  1 
ATOM   1112 O OE1 . GLU B 2 55  ? 28.638 -1.560 -0.067  1.00 33.85 ? 89  GLU B OE1 1 
ATOM   1113 O OE2 . GLU B 2 55  ? 29.662 0.358  -0.531  1.00 36.64 ? 89  GLU B OE2 1 
ATOM   1114 N N   . LEU B 2 56  ? 27.373 -0.344 5.927   1.00 19.47 ? 90  LEU B N   1 
ATOM   1115 C CA  . LEU B 2 56  ? 27.266 -1.153 7.141   1.00 19.25 ? 90  LEU B CA  1 
ATOM   1116 C C   . LEU B 2 56  ? 26.412 -0.423 8.165   1.00 20.29 ? 90  LEU B C   1 
ATOM   1117 O O   . LEU B 2 56  ? 26.441 0.827  8.236   1.00 21.47 ? 90  LEU B O   1 
ATOM   1118 C CB  . LEU B 2 56  ? 28.661 -1.403 7.696   1.00 19.55 ? 90  LEU B CB  1 
ATOM   1119 C CG  . LEU B 2 56  ? 29.636 -2.166 6.792   1.00 19.27 ? 90  LEU B CG  1 
ATOM   1120 C CD1 . LEU B 2 56  ? 30.986 -2.303 7.501   1.00 20.68 ? 90  LEU B CD1 1 
ATOM   1121 C CD2 . LEU B 2 56  ? 29.057 -3.531 6.418   1.00 18.54 ? 90  LEU B CD2 1 
ATOM   1122 N N   . SER B 2 57  ? 25.626 -1.194 8.914   1.00 19.74 ? 91  SER B N   1 
ATOM   1123 C CA  . SER B 2 57  ? 24.800 -0.653 9.966   1.00 19.71 ? 91  SER B CA  1 
ATOM   1124 C C   . SER B 2 57  ? 24.592 -1.690 11.041  1.00 19.02 ? 91  SER B C   1 
ATOM   1125 O O   . SER B 2 57  ? 24.754 -2.902 10.809  1.00 18.11 ? 91  SER B O   1 
ATOM   1126 C CB  . SER B 2 57  ? 23.437 -0.215 9.452   1.00 18.87 ? 91  SER B CB  1 
ATOM   1127 O OG  . SER B 2 57  ? 22.717 -1.225 8.795   1.00 21.96 ? 91  SER B OG  1 
ATOM   1128 N N   . ILE B 2 58  ? 24.165 -1.230 12.203  1.00 19.41 ? 92  ILE B N   1 
ATOM   1129 C CA  . ILE B 2 58  ? 23.857 -2.155 13.267  1.00 19.60 ? 92  ILE B CA  1 
ATOM   1130 C C   . ILE B 2 58  ? 22.657 -1.628 14.065  1.00 19.43 ? 92  ILE B C   1 
ATOM   1131 O O   . ILE B 2 58  ? 22.556 -0.417 14.343  1.00 18.86 ? 92  ILE B O   1 
ATOM   1132 C CB  . ILE B 2 58  ? 25.114 -2.433 14.136  1.00 20.94 ? 92  ILE B CB  1 
ATOM   1133 C CG1 . ILE B 2 58  ? 24.805 -3.435 15.235  1.00 22.58 ? 92  ILE B CG1 1 
ATOM   1134 C CG2 . ILE B 2 58  ? 25.608 -1.181 14.731  1.00 22.02 ? 92  ILE B CG2 1 
ATOM   1135 C CD1 . ILE B 2 58  ? 26.040 -4.245 15.677  1.00 25.61 ? 92  ILE B CD1 1 
ATOM   1136 N N   . LEU B 2 59  ? 21.745 -2.544 14.373  1.00 20.03 ? 93  LEU B N   1 
ATOM   1137 C CA  . LEU B 2 59  ? 20.633 -2.291 15.298  1.00 21.98 ? 93  LEU B CA  1 
ATOM   1138 C C   . LEU B 2 59  ? 21.182 -2.047 16.701  1.00 22.51 ? 93  LEU B C   1 
ATOM   1139 O O   . LEU B 2 59  ? 21.902 -2.900 17.237  1.00 21.92 ? 93  LEU B O   1 
ATOM   1140 C CB  . LEU B 2 59  ? 19.673 -3.477 15.281  1.00 23.29 ? 93  LEU B CB  1 
ATOM   1141 C CG  . LEU B 2 59  ? 18.367 -3.326 16.074  1.00 25.53 ? 93  LEU B CG  1 
ATOM   1142 C CD1 . LEU B 2 59  ? 17.522 -2.211 15.414  1.00 25.82 ? 93  LEU B CD1 1 
ATOM   1143 C CD2 . LEU B 2 59  ? 17.656 -4.654 16.148  1.00 27.46 ? 93  LEU B CD2 1 
ATOM   1144 N N   . LEU B 2 60  ? 20.852 -0.884 17.281  1.00 22.82 ? 94  LEU B N   1 
ATOM   1145 C CA  . LEU B 2 60  ? 21.151 -0.576 18.678  1.00 23.73 ? 94  LEU B CA  1 
ATOM   1146 C C   . LEU B 2 60  ? 19.918 -0.952 19.504  1.00 24.31 ? 94  LEU B C   1 
ATOM   1147 O O   . LEU B 2 60  ? 18.854 -0.337 19.366  1.00 26.48 ? 94  LEU B O   1 
ATOM   1148 C CB  . LEU B 2 60  ? 21.517 0.900  18.862  1.00 24.62 ? 94  LEU B CB  1 
ATOM   1149 C CG  . LEU B 2 60  ? 22.552 1.507  17.903  1.00 23.79 ? 94  LEU B CG  1 
ATOM   1150 C CD1 . LEU B 2 60  ? 22.698 2.997  18.205  1.00 26.50 ? 94  LEU B CD1 1 
ATOM   1151 C CD2 . LEU B 2 60  ? 23.911 0.756  17.965  1.00 24.47 ? 94  LEU B CD2 1 
ATOM   1152 N N   . LYS B 2 61  ? 20.086 -1.987 20.322  1.00 23.48 ? 95  LYS B N   1 
ATOM   1153 C CA  . LYS B 2 61  ? 18.989 -2.717 20.984  1.00 24.25 ? 95  LYS B CA  1 
ATOM   1154 C C   . LYS B 2 61  ? 18.866 -2.366 22.454  1.00 22.93 ? 95  LYS B C   1 
ATOM   1155 O O   . LYS B 2 61  ? 17.904 -2.775 23.116  1.00 22.23 ? 95  LYS B O   1 
ATOM   1156 C CB  . LYS B 2 61  ? 19.244 -4.215 20.920  1.00 24.65 ? 95  LYS B CB  1 
ATOM   1157 C CG  . LYS B 2 61  ? 19.139 -4.811 19.548  1.00 27.90 ? 95  LYS B CG  1 
ATOM   1158 C CD  . LYS B 2 61  ? 19.233 -6.333 19.648  1.00 31.69 ? 95  LYS B CD  1 
ATOM   1159 C CE  . LYS B 2 61  ? 20.644 -6.882 19.482  1.00 33.55 ? 95  LYS B CE  1 
ATOM   1160 N NZ  . LYS B 2 61  ? 21.755 -6.124 20.148  1.00 34.34 ? 95  LYS B NZ  1 
ATOM   1161 N N   . ASN B 2 62  ? 19.860 -1.641 22.966  1.00 22.21 ? 96  ASN B N   1 
ATOM   1162 C CA  . ASN B 2 62  ? 20.023 -1.468 24.400  1.00 22.04 ? 96  ASN B CA  1 
ATOM   1163 C C   . ASN B 2 62  ? 21.101 -0.450 24.748  1.00 21.76 ? 96  ASN B C   1 
ATOM   1164 O O   . ASN B 2 62  ? 21.811 0.045  23.855  1.00 19.76 ? 96  ASN B O   1 
ATOM   1165 C CB  . ASN B 2 62  ? 20.307 -2.819 25.080  1.00 22.39 ? 96  ASN B CB  1 
ATOM   1166 C CG  . ASN B 2 62  ? 21.495 -3.563 24.491  1.00 23.27 ? 96  ASN B CG  1 
ATOM   1167 O OD1 . ASN B 2 62  ? 22.573 -3.013 24.300  1.00 21.68 ? 96  ASN B OD1 1 
ATOM   1168 N ND2 . ASN B 2 62  ? 21.303 -4.832 24.243  1.00 24.05 ? 96  ASN B ND2 1 
ATOM   1169 N N   . GLN B 2 63  ? 21.233 -0.175 26.048  1.00 21.07 ? 97  GLN B N   1 
ATOM   1170 C CA  . GLN B 2 63  ? 22.239 0.774  26.530  1.00 21.62 ? 97  GLN B CA  1 
ATOM   1171 C C   . GLN B 2 63  ? 23.678 0.426  26.095  1.00 21.59 ? 97  GLN B C   1 
ATOM   1172 O O   . GLN B 2 63  ? 24.410 1.333  25.716  1.00 20.56 ? 97  GLN B O   1 
ATOM   1173 C CB  . GLN B 2 63  ? 22.201 0.891  28.061  1.00 20.66 ? 97  GLN B CB  1 
ATOM   1174 C CG  . GLN B 2 63  ? 23.076 2.026  28.606  1.00 20.07 ? 97  GLN B CG  1 
ATOM   1175 C CD  . GLN B 2 63  ? 22.592 3.380  28.149  1.00 22.04 ? 97  GLN B CD  1 
ATOM   1176 O OE1 . GLN B 2 63  ? 21.423 3.711  28.324  1.00 21.35 ? 97  GLN B OE1 1 
ATOM   1177 N NE2 . GLN B 2 63  ? 23.485 4.169  27.533  1.00 21.48 ? 97  GLN B NE2 1 
ATOM   1178 N N   . ASP B 2 64  ? 24.072 -0.844 26.216  1.00 21.93 ? 98  ASP B N   1 
ATOM   1179 C CA  A ASP B 2 64  ? 25.423 -1.306 25.840  0.50 22.47 ? 98  ASP B CA  1 
ATOM   1180 C CA  B ASP B 2 64  ? 25.446 -1.242 25.850  0.50 22.74 ? 98  ASP B CA  1 
ATOM   1181 C C   . ASP B 2 64  ? 25.726 -0.980 24.383  1.00 22.52 ? 98  ASP B C   1 
ATOM   1182 O O   . ASP B 2 64  ? 26.802 -0.447 24.056  1.00 23.12 ? 98  ASP B O   1 
ATOM   1183 C CB  A ASP B 2 64  ? 25.565 -2.823 26.031  0.50 22.54 ? 98  ASP B CB  1 
ATOM   1184 C CB  B ASP B 2 64  ? 25.774 -2.704 26.149  0.50 22.98 ? 98  ASP B CB  1 
ATOM   1185 C CG  A ASP B 2 64  ? 25.593 -3.248 27.503  0.50 23.06 ? 98  ASP B CG  1 
ATOM   1186 C CG  B ASP B 2 64  ? 27.281 -2.998 26.023  0.50 24.58 ? 98  ASP B CG  1 
ATOM   1187 O OD1 A ASP B 2 64  ? 25.635 -2.383 28.401  0.50 23.43 ? 98  ASP B OD1 1 
ATOM   1188 O OD1 B ASP B 2 64  ? 28.090 -2.273 26.665  0.50 25.60 ? 98  ASP B OD1 1 
ATOM   1189 O OD2 A ASP B 2 64  ? 25.556 -4.471 27.748  0.50 23.50 ? 98  ASP B OD2 1 
ATOM   1190 O OD2 B ASP B 2 64  ? 27.662 -3.932 25.274  0.50 24.50 ? 98  ASP B OD2 1 
ATOM   1191 N N   . ASP B 2 65  ? 24.774 -1.338 23.507  1.00 21.57 ? 99  ASP B N   1 
ATOM   1192 C CA  . ASP B 2 65  ? 24.892 -1.053 22.088  1.00 21.43 ? 99  ASP B CA  1 
ATOM   1193 C C   . ASP B 2 65  ? 25.101 0.451  21.834  1.00 21.14 ? 99  ASP B C   1 
ATOM   1194 O O   . ASP B 2 65  ? 25.976 0.855  21.064  1.00 20.73 ? 99  ASP B O   1 
ATOM   1195 C CB  . ASP B 2 65  ? 23.644 -1.508 21.314  1.00 21.60 ? 99  ASP B CB  1 
ATOM   1196 C CG  . ASP B 2 65  ? 23.502 -3.032 21.218  1.00 22.65 ? 99  ASP B CG  1 
ATOM   1197 O OD1 . ASP B 2 65  ? 24.473 -3.779 21.535  1.00 21.48 ? 99  ASP B OD1 1 
ATOM   1198 O OD2 . ASP B 2 65  ? 22.400 -3.462 20.778  1.00 21.46 ? 99  ASP B OD2 1 
ATOM   1199 N N   . LEU B 2 66  ? 24.285 1.281  22.479  1.00 20.49 ? 100 LEU B N   1 
ATOM   1200 C CA  . LEU B 2 66  ? 24.388 2.748  22.309  1.00 19.98 ? 100 LEU B CA  1 
ATOM   1201 C C   . LEU B 2 66  ? 25.738 3.275  22.787  1.00 20.50 ? 100 LEU B C   1 
ATOM   1202 O O   . LEU B 2 66  ? 26.374 4.094  22.117  1.00 20.27 ? 100 LEU B O   1 
ATOM   1203 C CB  . LEU B 2 66  ? 23.234 3.424  23.062  1.00 20.19 ? 100 LEU B CB  1 
ATOM   1204 C CG  . LEU B 2 66  ? 23.160 4.938  23.028  1.00 19.69 ? 100 LEU B CG  1 
ATOM   1205 C CD1 . LEU B 2 66  ? 23.018 5.443  21.564  1.00 19.06 ? 100 LEU B CD1 1 
ATOM   1206 C CD2 . LEU B 2 66  ? 22.033 5.478  23.958  1.00 19.90 ? 100 LEU B CD2 1 
ATOM   1207 N N   . ASP B 2 67  ? 26.175 2.792  23.954  1.00 20.28 ? 101 ASP B N   1 
ATOM   1208 C CA  . ASP B 2 67  ? 27.461 3.185  24.541  1.00 20.36 ? 101 ASP B CA  1 
ATOM   1209 C C   . ASP B 2 67  ? 28.610 2.887  23.584  1.00 19.68 ? 101 ASP B C   1 
ATOM   1210 O O   . ASP B 2 67  ? 29.550 3.692  23.432  1.00 20.34 ? 101 ASP B O   1 
ATOM   1211 C CB  . ASP B 2 67  ? 27.699 2.414  25.844  1.00 20.58 ? 101 ASP B CB  1 
ATOM   1212 C CG  . ASP B 2 67  ? 26.845 2.904  27.007  1.00 23.03 ? 101 ASP B CG  1 
ATOM   1213 O OD1 . ASP B 2 67  ? 26.216 3.976  26.915  1.00 24.73 ? 101 ASP B OD1 1 
ATOM   1214 O OD2 . ASP B 2 67  ? 26.830 2.198  28.045  1.00 26.57 ? 101 ASP B OD2 1 
ATOM   1215 N N   . LYS B 2 68  ? 28.571 1.706  22.971  1.00 19.31 ? 102 LYS B N   1 
ATOM   1216 C CA  . LYS B 2 68  ? 29.596 1.338  21.987  1.00 19.81 ? 102 LYS B CA  1 
ATOM   1217 C C   . LYS B 2 68  ? 29.603 2.240  20.759  1.00 18.43 ? 102 LYS B C   1 
ATOM   1218 O O   . LYS B 2 68  ? 30.669 2.594  20.244  1.00 17.37 ? 102 LYS B O   1 
ATOM   1219 C CB  . LYS B 2 68  ? 29.462 -0.133 21.566  1.00 20.48 ? 102 LYS B CB  1 
ATOM   1220 C CG  . LYS B 2 68  ? 29.760 -1.160 22.665  1.00 22.40 ? 102 LYS B CG  1 
ATOM   1221 C CD  . LYS B 2 68  ? 30.643 -0.607 23.784  1.00 24.09 ? 102 LYS B CD  1 
ATOM   1222 N N   . ALA B 2 69  ? 28.416 2.614  20.294  1.00 17.63 ? 103 ALA B N   1 
ATOM   1223 C CA  . ALA B 2 69  ? 28.280 3.560  19.174  1.00 17.48 ? 103 ALA B CA  1 
ATOM   1224 C C   . ALA B 2 69  ? 28.875 4.937  19.521  1.00 16.99 ? 103 ALA B C   1 
ATOM   1225 O O   . ALA B 2 69  ? 29.593 5.538  18.734  1.00 17.56 ? 103 ALA B O   1 
ATOM   1226 C CB  . ALA B 2 69  ? 26.799 3.717  18.795  1.00 17.49 ? 103 ALA B CB  1 
ATOM   1227 N N   . ILE B 2 70  ? 28.595 5.393  20.732  1.00 16.58 ? 104 ILE B N   1 
ATOM   1228 C CA  . ILE B 2 70  ? 29.135 6.680  21.248  1.00 17.07 ? 104 ILE B CA  1 
ATOM   1229 C C   . ILE B 2 70  ? 30.654 6.614  21.431  1.00 16.37 ? 104 ILE B C   1 
ATOM   1230 O O   . ILE B 2 70  ? 31.372 7.579  21.171  1.00 15.93 ? 104 ILE B O   1 
ATOM   1231 C CB  . ILE B 2 70  ? 28.390 7.093  22.515  1.00 16.38 ? 104 ILE B CB  1 
ATOM   1232 C CG1 . ILE B 2 70  ? 26.933 7.445  22.162  1.00 16.49 ? 104 ILE B CG1 1 
ATOM   1233 C CG2 . ILE B 2 70  ? 29.087 8.281  23.267  1.00 17.27 ? 104 ILE B CG2 1 
ATOM   1234 C CD1 . ILE B 2 70  ? 26.053 7.684  23.384  1.00 15.57 ? 104 ILE B CD1 1 
ATOM   1235 N N   . ASP B 2 71  ? 31.152 5.452  21.839  1.00 16.15 ? 105 ASP B N   1 
ATOM   1236 C CA  . ASP B 2 71  ? 32.586 5.227  21.920  1.00 17.57 ? 105 ASP B CA  1 
ATOM   1237 C C   . ASP B 2 71  ? 33.233 5.374  20.532  1.00 17.00 ? 105 ASP B C   1 
ATOM   1238 O O   . ASP B 2 71  ? 34.303 5.964  20.402  1.00 16.87 ? 105 ASP B O   1 
ATOM   1239 C CB  . ASP B 2 71  ? 32.836 3.846  22.514  1.00 16.89 ? 105 ASP B CB  1 
ATOM   1240 C CG  . ASP B 2 71  ? 34.307 3.497  22.610  1.00 22.87 ? 105 ASP B CG  1 
ATOM   1241 O OD1 . ASP B 2 71  ? 34.988 4.002  23.531  1.00 27.24 ? 105 ASP B OD1 1 
ATOM   1242 O OD2 . ASP B 2 71  ? 34.766 2.677  21.787  1.00 27.89 ? 105 ASP B OD2 1 
ATOM   1243 N N   . ILE B 2 72  ? 32.585 4.838  19.499  1.00 17.77 ? 106 ILE B N   1 
ATOM   1244 C CA  . ILE B 2 72  ? 33.107 4.963  18.128  1.00 18.21 ? 106 ILE B CA  1 
ATOM   1245 C C   . ILE B 2 72  ? 33.166 6.446  17.765  1.00 17.76 ? 106 ILE B C   1 
ATOM   1246 O O   . ILE B 2 72  ? 34.177 6.917  17.229  1.00 17.62 ? 106 ILE B O   1 
ATOM   1247 C CB  . ILE B 2 72  ? 32.263 4.166  17.079  1.00 18.28 ? 106 ILE B CB  1 
ATOM   1248 C CG1 . ILE B 2 72  ? 32.487 2.657  17.255  1.00 19.14 ? 106 ILE B CG1 1 
ATOM   1249 C CG2 . ILE B 2 72  ? 32.595 4.644  15.663  1.00 21.17 ? 106 ILE B CG2 1 
ATOM   1250 C CD1 . ILE B 2 72  ? 31.386 1.724  16.671  1.00 19.63 ? 106 ILE B CD1 1 
ATOM   1251 N N   . LEU B 2 73  ? 32.079 7.163  18.065  1.00 18.14 ? 107 LEU B N   1 
ATOM   1252 C CA  . LEU B 2 73  ? 31.981 8.592  17.801  1.00 18.19 ? 107 LEU B CA  1 
ATOM   1253 C C   . LEU B 2 73  ? 33.109 9.329  18.516  1.00 18.01 ? 107 LEU B C   1 
ATOM   1254 O O   . LEU B 2 73  ? 33.739 10.201 17.944  1.00 17.21 ? 107 LEU B O   1 
ATOM   1255 C CB  . LEU B 2 73  ? 30.632 9.153  18.290  1.00 18.17 ? 107 LEU B CB  1 
ATOM   1256 C CG  . LEU B 2 73  ? 30.428 10.688 18.246  1.00 19.25 ? 107 LEU B CG  1 
ATOM   1257 C CD1 . LEU B 2 73  ? 30.234 11.171 16.775  1.00 21.64 ? 107 LEU B CD1 1 
ATOM   1258 C CD2 . LEU B 2 73  ? 29.241 11.111 19.119  1.00 20.00 ? 107 LEU B CD2 1 
ATOM   1259 N N   . ASP B 2 74  ? 33.335 9.000  19.781  1.00 18.63 ? 108 ASP B N   1 
ATOM   1260 C CA  . ASP B 2 74  ? 34.314 9.730  20.601  1.00 19.56 ? 108 ASP B CA  1 
ATOM   1261 C C   . ASP B 2 74  ? 35.769 9.447  20.215  1.00 20.26 ? 108 ASP B C   1 
ATOM   1262 O O   . ASP B 2 74  ? 36.638 10.295 20.414  1.00 20.42 ? 108 ASP B O   1 
ATOM   1263 C CB  . ASP B 2 74  ? 34.118 9.419  22.077  1.00 19.89 ? 108 ASP B CB  1 
ATOM   1264 C CG  . ASP B 2 74  ? 32.849 10.047 22.652  1.00 20.72 ? 108 ASP B CG  1 
ATOM   1265 O OD1 . ASP B 2 74  ? 32.244 10.949 22.021  1.00 20.96 ? 108 ASP B OD1 1 
ATOM   1266 O OD2 . ASP B 2 74  ? 32.456 9.601  23.742  1.00 21.89 ? 108 ASP B OD2 1 
ATOM   1267 N N   . ARG B 2 75  ? 36.029 8.260  19.676  1.00 21.19 ? 109 ARG B N   1 
ATOM   1268 C CA  . ARG B 2 75  ? 37.373 7.875  19.239  1.00 22.49 ? 109 ARG B CA  1 
ATOM   1269 C C   . ARG B 2 75  ? 37.678 8.351  17.829  1.00 23.24 ? 109 ARG B C   1 
ATOM   1270 O O   . ARG B 2 75  ? 38.830 8.313  17.398  1.00 23.80 ? 109 ARG B O   1 
ATOM   1271 C CB  . ARG B 2 75  ? 37.528 6.364  19.281  1.00 22.86 ? 109 ARG B CB  1 
ATOM   1272 C CG  . ARG B 2 75  ? 37.696 5.819  20.677  1.00 24.45 ? 109 ARG B CG  1 
ATOM   1273 C CD  . ARG B 2 75  ? 37.646 4.304  20.672  1.00 28.81 ? 109 ARG B CD  1 
ATOM   1274 N NE  . ARG B 2 75  ? 37.666 3.777  22.039  1.00 31.29 ? 109 ARG B NE  1 
ATOM   1275 C CZ  . ARG B 2 75  ? 38.757 3.674  22.799  1.00 33.49 ? 109 ARG B CZ  1 
ATOM   1276 N NH1 . ARG B 2 75  ? 39.962 4.030  22.344  1.00 34.67 ? 109 ARG B NH1 1 
ATOM   1277 N NH2 . ARG B 2 75  ? 38.645 3.185  24.031  1.00 33.97 ? 109 ARG B NH2 1 
ATOM   1278 N N   . SER B 2 76  ? 36.646 8.778  17.117  1.00 24.65 ? 110 SER B N   1 
ATOM   1279 C CA  . SER B 2 76  ? 36.752 9.173  15.730  1.00 25.68 ? 110 SER B CA  1 
ATOM   1280 C C   . SER B 2 76  ? 37.296 10.596 15.632  1.00 27.09 ? 110 SER B C   1 
ATOM   1281 O O   . SER B 2 76  ? 36.829 11.521 16.318  1.00 26.89 ? 110 SER B O   1 
ATOM   1282 C CB  . SER B 2 76  ? 35.378 9.080  15.046  1.00 25.70 ? 110 SER B CB  1 
ATOM   1283 O OG  . SER B 2 76  ? 35.449 9.535  13.713  1.00 25.37 ? 110 SER B OG  1 
ATOM   1284 N N   . SER B 2 77  ? 38.297 10.758 14.777  1.00 28.63 ? 111 SER B N   1 
ATOM   1285 C CA  . SER B 2 77  ? 38.868 12.062 14.492  1.00 29.59 ? 111 SER B CA  1 
ATOM   1286 C C   . SER B 2 77  ? 37.963 12.808 13.508  1.00 30.30 ? 111 SER B C   1 
ATOM   1287 O O   . SER B 2 77  ? 38.061 14.033 13.369  1.00 31.48 ? 111 SER B O   1 
ATOM   1288 C CB  . SER B 2 77  ? 40.257 11.887 13.882  1.00 29.90 ? 111 SER B CB  1 
ATOM   1289 O OG  . SER B 2 77  ? 40.184 11.000 12.774  1.00 30.19 ? 111 SER B OG  1 
ATOM   1290 N N   . SER B 2 78  ? 37.091 12.060 12.833  1.00 30.36 ? 112 SER B N   1 
ATOM   1291 C CA  . SER B 2 78  ? 36.261 12.590 11.755  1.00 30.42 ? 112 SER B CA  1 
ATOM   1292 C C   . SER B 2 78  ? 34.840 12.966 12.208  1.00 29.75 ? 112 SER B C   1 
ATOM   1293 O O   . SER B 2 78  ? 34.417 14.133 12.093  1.00 29.97 ? 112 SER B O   1 
ATOM   1294 C CB  . SER B 2 78  ? 36.141 11.537 10.637  1.00 30.42 ? 112 SER B CB  1 
ATOM   1295 N N   . MET B 2 79  ? 34.135 11.951 12.710  1.00 28.62 ? 113 MET B N   1 
ATOM   1296 C CA  . MET B 2 79  ? 32.697 11.987 12.979  1.00 28.55 ? 113 MET B CA  1 
ATOM   1297 C C   . MET B 2 79  ? 32.315 12.994 14.064  1.00 24.90 ? 113 MET B C   1 
ATOM   1298 O O   . MET B 2 79  ? 32.975 13.070 15.101  1.00 23.54 ? 113 MET B O   1 
ATOM   1299 C CB  . MET B 2 79  ? 32.198 10.600 13.429  1.00 28.75 ? 113 MET B CB  1 
ATOM   1300 C CG  . MET B 2 79  ? 32.055 9.535  12.320  1.00 31.86 ? 113 MET B CG  1 
ATOM   1301 S SD  . MET B 2 79  ? 31.849 7.876  13.057  1.00 36.40 ? 113 MET B SD  1 
ATOM   1302 C CE  . MET B 2 79  ? 30.535 8.325  14.189  1.00 24.35 ? 113 MET B CE  1 
ATOM   1303 N N   . LYS B 2 80  ? 31.221 13.730 13.832  1.00 21.98 ? 114 LYS B N   1 
ATOM   1304 C CA  . LYS B 2 80  ? 30.695 14.705 14.791  1.00 19.68 ? 114 LYS B CA  1 
ATOM   1305 C C   . LYS B 2 80  ? 29.222 14.454 15.191  1.00 18.14 ? 114 LYS B C   1 
ATOM   1306 O O   . LYS B 2 80  ? 28.694 15.161 16.011  1.00 16.06 ? 114 LYS B O   1 
ATOM   1307 C CB  . LYS B 2 80  ? 30.828 16.131 14.259  1.00 19.58 ? 114 LYS B CB  1 
ATOM   1308 C CG  . LYS B 2 80  ? 32.217 16.499 13.729  1.00 21.36 ? 114 LYS B CG  1 
ATOM   1309 C CD  . LYS B 2 80  ? 33.107 17.066 14.845  1.00 24.94 ? 114 LYS B CD  1 
ATOM   1310 C CE  . LYS B 2 80  ? 34.604 16.770 14.673  1.00 26.46 ? 114 LYS B CE  1 
ATOM   1311 N NZ  . LYS B 2 80  ? 35.134 16.770 13.271  1.00 27.93 ? 114 LYS B NZ  1 
ATOM   1312 N N   . SER B 2 81  ? 28.590 13.456 14.597  1.00 17.46 ? 115 SER B N   1 
ATOM   1313 C CA  . SER B 2 81  ? 27.265 13.017 14.967  1.00 16.96 ? 115 SER B CA  1 
ATOM   1314 C C   . SER B 2 81  ? 27.152 11.495 14.750  1.00 17.73 ? 115 SER B C   1 
ATOM   1315 O O   . SER B 2 81  ? 27.981 10.880 14.040  1.00 17.60 ? 115 SER B O   1 
ATOM   1316 C CB  . SER B 2 81  ? 26.202 13.764 14.160  1.00 17.02 ? 115 SER B CB  1 
ATOM   1317 O OG  . SER B 2 81  ? 26.242 13.371 12.783  1.00 17.18 ? 115 SER B OG  1 
ATOM   1318 N N   . LEU B 2 82  ? 26.164 10.906 15.415  1.00 18.00 ? 116 LEU B N   1 
ATOM   1319 C CA  . LEU B 2 82  ? 25.761 9.522  15.223  1.00 19.41 ? 116 LEU B CA  1 
ATOM   1320 C C   . LEU B 2 82  ? 24.639 9.475  14.212  1.00 18.58 ? 116 LEU B C   1 
ATOM   1321 O O   . LEU B 2 82  ? 23.540 9.991  14.480  1.00 18.71 ? 116 LEU B O   1 
ATOM   1322 C CB  . LEU B 2 82  ? 25.173 8.942  16.503  1.00 20.76 ? 116 LEU B CB  1 
ATOM   1323 C CG  . LEU B 2 82  ? 25.963 8.394  17.652  1.00 25.37 ? 116 LEU B CG  1 
ATOM   1324 C CD1 . LEU B 2 82  ? 24.943 7.664  18.600  1.00 25.53 ? 116 LEU B CD1 1 
ATOM   1325 C CD2 . LEU B 2 82  ? 27.078 7.513  17.129  1.00 26.12 ? 116 LEU B CD2 1 
ATOM   1326 N N   . ARG B 2 83  ? 24.872 8.799  13.090  1.00 17.46 ? 117 ARG B N   1 
ATOM   1327 C CA  . ARG B 2 83  ? 23.856 8.726  12.028  1.00 18.36 ? 117 ARG B CA  1 
ATOM   1328 C C   . ARG B 2 83  ? 22.995 7.500  12.342  1.00 17.50 ? 117 ARG B C   1 
ATOM   1329 O O   . ARG B 2 83  ? 23.512 6.376  12.410  1.00 17.49 ? 117 ARG B O   1 
ATOM   1330 C CB  . ARG B 2 83  ? 24.494 8.572  10.651  1.00 18.99 ? 117 ARG B CB  1 
ATOM   1331 C CG  . ARG B 2 83  ? 23.466 8.693  9.521   1.00 20.95 ? 117 ARG B CG  1 
ATOM   1332 C CD  . ARG B 2 83  ? 24.072 8.462  8.158   1.00 23.99 ? 117 ARG B CD  1 
ATOM   1333 N NE  . ARG B 2 83  ? 25.184 9.370  7.835   1.00 23.82 ? 117 ARG B NE  1 
ATOM   1334 C CZ  . ARG B 2 83  ? 25.080 10.449 7.047   1.00 25.00 ? 117 ARG B CZ  1 
ATOM   1335 N NH1 . ARG B 2 83  ? 23.908 10.787 6.518   1.00 26.45 ? 117 ARG B NH1 1 
ATOM   1336 N NH2 . ARG B 2 83  ? 26.136 11.211 6.804   1.00 22.98 ? 117 ARG B NH2 1 
ATOM   1337 N N   . ILE B 2 84  ? 21.709 7.735  12.544  1.00 16.91 ? 118 ILE B N   1 
ATOM   1338 C CA  . ILE B 2 84  ? 20.765 6.709  12.948  1.00 17.51 ? 118 ILE B CA  1 
ATOM   1339 C C   . ILE B 2 84  ? 19.581 6.725  11.997  1.00 16.86 ? 118 ILE B C   1 
ATOM   1340 O O   . ILE B 2 84  ? 18.803 7.691  11.979  1.00 17.54 ? 118 ILE B O   1 
ATOM   1341 C CB  . ILE B 2 84  ? 20.297 6.892  14.395  1.00 18.11 ? 118 ILE B CB  1 
ATOM   1342 C CG1 . ILE B 2 84  ? 21.520 6.736  15.336  1.00 20.17 ? 118 ILE B CG1 1 
ATOM   1343 C CG2 . ILE B 2 84  ? 19.183 5.858  14.737  1.00 20.13 ? 118 ILE B CG2 1 
ATOM   1344 C CD1 . ILE B 2 84  ? 21.171 6.646  16.778  1.00 24.20 ? 118 ILE B CD1 1 
ATOM   1345 N N   . LEU B 2 85  ? 19.460 5.644  11.240  1.00 16.03 ? 119 LEU B N   1 
ATOM   1346 C CA  . LEU B 2 85  ? 18.333 5.388  10.347  1.00 17.13 ? 119 LEU B CA  1 
ATOM   1347 C C   . LEU B 2 85  ? 17.213 4.760  11.172  1.00 17.22 ? 119 LEU B C   1 
ATOM   1348 O O   . LEU B 2 85  ? 17.433 3.767  11.875  1.00 17.21 ? 119 LEU B O   1 
ATOM   1349 C CB  . LEU B 2 85  ? 18.718 4.443  9.228   1.00 17.57 ? 119 LEU B CB  1 
ATOM   1350 C CG  . LEU B 2 85  ? 17.587 3.931  8.308   1.00 17.74 ? 119 LEU B CG  1 
ATOM   1351 C CD1 . LEU B 2 85  ? 16.949 5.146  7.602   1.00 18.21 ? 119 LEU B CD1 1 
ATOM   1352 C CD2 . LEU B 2 85  ? 18.082 2.905  7.340   1.00 18.90 ? 119 LEU B CD2 1 
ATOM   1353 N N   . LEU B 2 86  ? 16.029 5.370  11.079  1.00 16.91 ? 120 LEU B N   1 
ATOM   1354 C CA  . LEU B 2 86  ? 14.842 4.909  11.793  1.00 16.71 ? 120 LEU B CA  1 
ATOM   1355 C C   . LEU B 2 86  ? 13.945 4.130  10.873  1.00 17.34 ? 120 LEU B C   1 
ATOM   1356 O O   . LEU B 2 86  ? 13.532 4.646  9.822   1.00 15.51 ? 120 LEU B O   1 
ATOM   1357 C CB  . LEU B 2 86  ? 14.050 6.104  12.372  1.00 16.34 ? 120 LEU B CB  1 
ATOM   1358 C CG  . LEU B 2 86  ? 14.806 6.995  13.377  1.00 16.03 ? 120 LEU B CG  1 
ATOM   1359 C CD1 . LEU B 2 86  ? 13.999 8.255  13.789  1.00 16.49 ? 120 LEU B CD1 1 
ATOM   1360 C CD2 . LEU B 2 86  ? 15.235 6.183  14.663  1.00 16.15 ? 120 LEU B CD2 1 
ATOM   1361 N N   . LEU B 2 87  ? 13.618 2.913  11.312  1.00 18.07 ? 121 LEU B N   1 
ATOM   1362 C CA  . LEU B 2 87  ? 12.732 2.002  10.587  1.00 19.67 ? 121 LEU B CA  1 
ATOM   1363 C C   . LEU B 2 87  ? 11.693 1.398  11.559  1.00 20.96 ? 121 LEU B C   1 
ATOM   1364 O O   . LEU B 2 87  ? 11.961 1.250  12.761  1.00 20.90 ? 121 LEU B O   1 
ATOM   1365 C CB  . LEU B 2 87  ? 13.536 0.868  9.934   1.00 19.25 ? 121 LEU B CB  1 
ATOM   1366 C CG  . LEU B 2 87  ? 14.504 1.279  8.821   1.00 19.44 ? 121 LEU B CG  1 
ATOM   1367 C CD1 . LEU B 2 87  ? 15.419 0.132  8.483   1.00 19.62 ? 121 LEU B CD1 1 
ATOM   1368 C CD2 . LEU B 2 87  ? 13.788 1.824  7.606   1.00 18.00 ? 121 LEU B CD2 1 
ATOM   1369 N N   . SER B 2 88  ? 10.515 1.087  11.029  1.00 23.18 ? 122 SER B N   1 
ATOM   1370 C CA  . SER B 2 88  ? 9.448  0.447  11.818  1.00 25.26 ? 122 SER B CA  1 
ATOM   1371 C C   . SER B 2 88  ? 9.880  -0.943 12.262  1.00 26.14 ? 122 SER B C   1 
ATOM   1372 O O   . SER B 2 88  ? 10.496 -1.671 11.481  1.00 26.14 ? 122 SER B O   1 
ATOM   1373 C CB  . SER B 2 88  ? 8.146  0.349  11.004  1.00 25.48 ? 122 SER B CB  1 
ATOM   1374 O OG  . SER B 2 88  ? 7.667  1.653  10.687  1.00 28.18 ? 122 SER B OG  1 
ATOM   1375 N N   . GLN B 2 89  ? 9.570  -1.304 13.513  1.00 27.44 ? 123 GLN B N   1 
ATOM   1376 C CA  . GLN B 2 89  ? 9.883  -2.639 14.018  1.00 28.23 ? 123 GLN B CA  1 
ATOM   1377 C C   . GLN B 2 89  ? 9.131  -3.679 13.202  1.00 28.85 ? 123 GLN B C   1 
ATOM   1378 O O   . GLN B 2 89  ? 9.634  -4.783 12.990  1.00 30.65 ? 123 GLN B O   1 
ATOM   1379 C CB  . GLN B 2 89  ? 9.518  -2.783 15.498  1.00 28.35 ? 123 GLN B CB  1 
HETATM 1380 O O   . HOH C 3 .   ? 16.803 18.894 13.006  1.00 18.29 ? 109 HOH A O   1 
HETATM 1381 O O   . HOH C 3 .   ? 21.045 16.178 1.779   1.00 19.13 ? 110 HOH A O   1 
HETATM 1382 O O   . HOH C 3 .   ? 16.217 16.711 5.800   1.00 17.70 ? 111 HOH A O   1 
HETATM 1383 O O   . HOH C 3 .   ? 15.483 16.918 3.087   1.00 26.59 ? 112 HOH A O   1 
HETATM 1384 O O   . HOH C 3 .   ? 29.371 13.868 3.282   1.00 24.59 ? 113 HOH A O   1 
HETATM 1385 O O   . HOH C 3 .   ? 26.127 35.460 12.059  1.00 26.97 ? 114 HOH A O   1 
HETATM 1386 O O   . HOH C 3 .   ? 18.772 19.579 20.441  1.00 24.10 ? 115 HOH A O   1 
HETATM 1387 O O   . HOH C 3 .   ? 23.468 20.406 14.184  1.00 22.64 ? 116 HOH A O   1 
HETATM 1388 O O   . HOH C 3 .   ? 25.955 15.337 2.007   1.00 20.28 ? 117 HOH A O   1 
HETATM 1389 O O   . HOH C 3 .   ? 18.896 20.450 14.172  1.00 20.88 ? 118 HOH A O   1 
HETATM 1390 O O   . HOH C 3 .   ? 11.771 18.098 17.613  1.00 26.11 ? 119 HOH A O   1 
HETATM 1391 O O   . HOH C 3 .   ? 13.082 29.664 -0.594  1.00 24.44 ? 120 HOH A O   1 
HETATM 1392 O O   . HOH C 3 .   ? 16.981 19.052 0.124   1.00 25.53 ? 121 HOH A O   1 
HETATM 1393 O O   . HOH C 3 .   ? 14.167 27.161 0.158   1.00 24.62 ? 122 HOH A O   1 
HETATM 1394 O O   . HOH C 3 .   ? 11.213 22.001 21.100  1.00 25.06 ? 123 HOH A O   1 
HETATM 1395 O O   . HOH C 3 .   ? 6.509  31.518 3.664   1.00 29.03 ? 124 HOH A O   1 
HETATM 1396 O O   . HOH C 3 .   ? 23.110 25.747 5.716   1.00 24.13 ? 125 HOH A O   1 
HETATM 1397 O O   . HOH C 3 .   ? 21.894 38.473 0.639   1.00 24.78 ? 126 HOH A O   1 
HETATM 1398 O O   . HOH C 3 .   ? 27.432 21.943 2.857   1.00 26.08 ? 127 HOH A O   1 
HETATM 1399 O O   . HOH C 3 .   ? 14.330 29.695 -11.321 1.00 30.58 ? 128 HOH A O   1 
HETATM 1400 O O   . HOH C 3 .   ? 24.370 26.213 3.326   1.00 30.47 ? 129 HOH A O   1 
HETATM 1401 O O   . HOH C 3 .   ? 8.734  28.306 18.646  1.00 27.64 ? 130 HOH A O   1 
HETATM 1402 O O   . HOH C 3 .   ? 8.902  27.549 1.835   1.00 32.78 ? 131 HOH A O   1 
HETATM 1403 O O   . HOH C 3 .   ? 8.963  23.858 19.114  1.00 36.73 ? 132 HOH A O   1 
HETATM 1404 O O   . HOH C 3 .   ? 13.378 19.434 0.532   1.00 36.68 ? 133 HOH A O   1 
HETATM 1405 O O   . HOH C 3 .   ? 14.112 28.321 20.899  1.00 35.30 ? 134 HOH A O   1 
HETATM 1406 O O   . HOH C 3 .   ? 24.764 20.709 17.343  1.00 25.35 ? 135 HOH A O   1 
HETATM 1407 O O   . HOH C 3 .   ? 22.614 36.862 -1.266  1.00 35.09 ? 136 HOH A O   1 
HETATM 1408 O O   . HOH C 3 .   ? 26.455 24.714 0.289   1.00 32.77 ? 137 HOH A O   1 
HETATM 1409 O O   . HOH C 3 .   ? 4.537  31.047 5.631   1.00 35.86 ? 138 HOH A O   1 
HETATM 1410 O O   . HOH C 3 .   ? 24.811 20.171 19.893  1.00 32.36 ? 139 HOH A O   1 
HETATM 1411 O O   . HOH C 3 .   ? 9.015  17.661 17.180  1.00 37.34 ? 140 HOH A O   1 
HETATM 1412 O O   . HOH C 3 .   ? 29.836 19.642 13.589  1.00 40.07 ? 141 HOH A O   1 
HETATM 1413 O O   . HOH C 3 .   ? 0.801  30.565 -3.441  1.00 33.19 ? 142 HOH A O   1 
HETATM 1414 O O   . HOH C 3 .   ? 10.353 28.871 -0.831  1.00 35.20 ? 143 HOH A O   1 
HETATM 1415 O O   . HOH C 3 .   ? 14.056 23.590 1.357   1.00 39.00 ? 144 HOH A O   1 
HETATM 1416 O O   . HOH C 3 .   ? 27.660 36.619 9.856   1.00 43.71 ? 145 HOH A O   1 
HETATM 1417 O O   . HOH C 3 .   ? 28.747 21.767 5.078   1.00 32.21 ? 146 HOH A O   1 
HETATM 1418 O O   . HOH C 3 .   ? 6.522  34.626 -1.725  1.00 31.68 ? 147 HOH A O   1 
HETATM 1419 O O   . HOH C 3 .   ? 12.793 35.771 -5.358  1.00 35.91 ? 148 HOH A O   1 
HETATM 1420 O O   . HOH C 3 .   ? 7.113  21.653 10.757  1.00 34.36 ? 149 HOH A O   1 
HETATM 1421 O O   . HOH C 3 .   ? 29.704 19.644 16.183  1.00 39.55 ? 150 HOH A O   1 
HETATM 1422 O O   . HOH C 3 .   ? 23.077 29.460 -1.672  1.00 36.11 ? 151 HOH A O   1 
HETATM 1423 O O   . HOH C 3 .   ? 5.618  24.427 11.649  1.00 40.75 ? 152 HOH A O   1 
HETATM 1424 O O   . HOH C 3 .   ? 27.041 38.859 1.886   1.00 41.68 ? 153 HOH A O   1 
HETATM 1425 O O   . HOH C 3 .   ? 25.649 11.878 3.529   1.00 35.49 ? 154 HOH A O   1 
HETATM 1426 O O   . HOH C 3 .   ? 6.773  21.893 13.367  1.00 36.66 ? 155 HOH A O   1 
HETATM 1427 O O   . HOH C 3 .   ? 30.272 30.285 8.665   1.00 54.68 ? 156 HOH A O   1 
HETATM 1428 O O   . HOH C 3 .   ? 25.172 28.083 7.028   1.00 41.25 ? 157 HOH A O   1 
HETATM 1429 O O   . HOH C 3 .   ? 18.305 36.586 20.000  1.00 50.11 ? 158 HOH A O   1 
HETATM 1430 O O   . HOH C 3 .   ? 7.782  36.522 15.552  1.00 50.38 ? 159 HOH A O   1 
HETATM 1431 O O   . HOH C 3 .   ? 3.823  27.210 -1.259  1.00 48.69 ? 160 HOH A O   1 
HETATM 1432 O O   . HOH C 3 .   ? 5.898  30.969 7.767   1.00 44.84 ? 161 HOH A O   1 
HETATM 1433 O O   . HOH C 3 .   ? 26.070 30.881 4.354   1.00 47.21 ? 162 HOH A O   1 
HETATM 1434 O O   . HOH C 3 .   ? 4.806  36.078 8.901   1.00 42.95 ? 163 HOH A O   1 
HETATM 1435 O O   . HOH C 3 .   ? 27.594 21.627 17.494  1.00 40.82 ? 164 HOH A O   1 
HETATM 1436 O O   . HOH C 3 .   ? 6.840  26.031 0.764   1.00 46.26 ? 165 HOH A O   1 
HETATM 1437 O O   . HOH C 3 .   ? 18.671 33.374 -11.264 1.00 51.04 ? 166 HOH A O   1 
HETATM 1438 O O   . HOH C 3 .   ? 19.721 37.412 -8.617  1.00 54.71 ? 167 HOH A O   1 
HETATM 1439 O O   . HOH C 3 .   ? 24.997 25.850 8.532   1.00 62.04 ? 168 HOH A O   1 
HETATM 1440 O O   . HOH C 3 .   ? 8.515  24.057 -0.467  1.00 56.81 ? 169 HOH A O   1 
HETATM 1441 O O   . HOH C 3 .   ? 40.322 29.096 8.451   1.00 65.49 ? 170 HOH A O   1 
HETATM 1442 O O   . HOH C 3 .   ? 11.066 25.602 -0.943  1.00 43.15 ? 171 HOH A O   1 
HETATM 1443 O O   . HOH C 3 .   ? 3.726  33.709 4.157   1.00 54.06 ? 172 HOH A O   1 
HETATM 1444 O O   . HOH C 3 .   ? 27.791 36.391 0.159   1.00 47.42 ? 173 HOH A O   1 
HETATM 1445 O O   . HOH C 3 .   ? 21.841 32.199 -1.929  1.00 66.19 ? 174 HOH A O   1 
HETATM 1446 O O   . HOH C 3 .   ? 45.029 26.886 14.807  1.00 61.98 ? 175 HOH A O   1 
HETATM 1447 O O   . HOH C 3 .   ? 30.029 17.853 18.405  1.00 50.47 ? 176 HOH A O   1 
HETATM 1448 O O   . HOH C 3 .   ? 26.191 32.003 2.080   1.00 53.02 ? 177 HOH A O   1 
HETATM 1449 O O   . HOH D 3 .   ? 21.061 -2.309 10.674  1.00 24.88 ? 125 HOH B O   1 
HETATM 1450 O O   . HOH D 3 .   ? 28.202 14.543 18.707  1.00 24.19 ? 126 HOH B O   1 
HETATM 1451 O O   . HOH D 3 .   ? 23.487 -1.641 6.174   1.00 22.82 ? 127 HOH B O   1 
HETATM 1452 O O   . HOH D 3 .   ? 26.983 9.124  26.877  1.00 25.84 ? 128 HOH B O   1 
HETATM 1453 O O   . HOH D 3 .   ? 25.796 15.654 11.538  1.00 26.36 ? 129 HOH B O   1 
HETATM 1454 O O   . HOH D 3 .   ? 13.960 -2.140 11.914  1.00 34.36 ? 130 HOH B O   1 
HETATM 1455 O O   . HOH D 3 .   ? 26.771 16.589 27.536  1.00 30.13 ? 131 HOH B O   1 
HETATM 1456 O O   . HOH D 3 .   ? 22.576 -5.474 17.088  1.00 29.66 ? 132 HOH B O   1 
HETATM 1457 O O   . HOH D 3 .   ? 16.348 0.164  18.497  1.00 30.89 ? 133 HOH B O   1 
HETATM 1458 O O   . HOH D 3 .   ? 12.899 15.761 2.965   1.00 35.25 ? 134 HOH B O   1 
HETATM 1459 O O   . HOH D 3 .   ? 19.506 15.738 26.647  1.00 40.65 ? 135 HOH B O   1 
HETATM 1460 O O   . HOH D 3 .   ? 19.697 10.563 28.041  1.00 34.83 ? 136 HOH B O   1 
HETATM 1461 O O   . HOH D 3 .   ? 29.514 10.001 27.435  1.00 30.23 ? 137 HOH B O   1 
HETATM 1462 O O   . HOH D 3 .   ? 22.499 -2.914 27.801  1.00 36.42 ? 138 HOH B O   1 
HETATM 1463 O O   . HOH D 3 .   ? 19.221 -0.898 28.014  1.00 36.16 ? 139 HOH B O   1 
HETATM 1464 O O   . HOH D 3 .   ? 17.397 15.756 23.768  1.00 34.25 ? 140 HOH B O   1 
HETATM 1465 O O   . HOH D 3 .   ? 27.210 7.032  6.357   1.00 36.64 ? 141 HOH B O   1 
HETATM 1466 O O   . HOH D 3 .   ? 27.309 18.863 20.655  1.00 37.79 ? 142 HOH B O   1 
HETATM 1467 O O   . HOH D 3 .   ? 14.127 15.860 26.108  1.00 40.01 ? 143 HOH B O   1 
HETATM 1468 O O   . HOH D 3 .   ? 18.220 3.491  29.134  1.00 36.64 ? 144 HOH B O   1 
HETATM 1469 O O   . HOH D 3 .   ? 10.885 14.218 24.000  1.00 45.76 ? 145 HOH B O   1 
HETATM 1470 O O   . HOH D 3 .   ? 32.715 0.791  20.444  1.00 35.13 ? 146 HOH B O   1 
HETATM 1471 O O   . HOH D 3 .   ? 23.957 0.843  5.334   1.00 30.21 ? 147 HOH B O   1 
HETATM 1472 O O   . HOH D 3 .   ? 8.407  16.255 14.806  1.00 41.87 ? 148 HOH B O   1 
HETATM 1473 O O   . HOH D 3 .   ? 16.853 14.199 25.931  1.00 38.71 ? 149 HOH B O   1 
HETATM 1474 O O   . HOH D 3 .   ? 10.065 15.999 21.156  1.00 41.10 ? 150 HOH B O   1 
HETATM 1475 O O   . HOH D 3 .   ? 27.645 8.564  12.358  1.00 35.19 ? 151 HOH B O   1 
HETATM 1476 O O   . HOH D 3 .   ? 32.673 7.208  24.794  1.00 48.28 ? 152 HOH B O   1 
HETATM 1477 O O   . HOH D 3 .   ? 11.821 16.882 0.766   1.00 35.77 ? 153 HOH B O   1 
HETATM 1478 O O   . HOH D 3 .   ? 31.308 3.280  12.489  1.00 39.40 ? 154 HOH B O   1 
HETATM 1479 O O   . HOH D 3 .   ? 30.438 8.769  2.987   1.00 44.75 ? 155 HOH B O   1 
HETATM 1480 O O   . HOH D 3 .   ? 22.508 12.010 31.673  1.00 44.06 ? 156 HOH B O   1 
HETATM 1481 O O   . HOH D 3 .   ? 13.339 5.577  7.184   1.00 36.24 ? 157 HOH B O   1 
HETATM 1482 O O   . HOH D 3 .   ? 17.273 15.523 1.446   1.00 31.14 ? 158 HOH B O   1 
HETATM 1483 O O   . HOH D 3 .   ? 30.142 5.404  25.338  1.00 36.65 ? 159 HOH B O   1 
HETATM 1484 O O   . HOH D 3 .   ? 21.503 12.168 0.411   1.00 43.57 ? 160 HOH B O   1 
HETATM 1485 O O   . HOH D 3 .   ? 28.970 6.754  11.120  1.00 42.42 ? 161 HOH B O   1 
HETATM 1486 O O   . HOH D 3 .   ? 13.516 11.884 25.596  1.00 34.51 ? 162 HOH B O   1 
HETATM 1487 O O   . HOH D 3 .   ? 32.698 3.891  5.821   1.00 40.66 ? 163 HOH B O   1 
HETATM 1488 O O   . HOH D 3 .   ? 32.676 7.802  3.055   1.00 37.87 ? 164 HOH B O   1 
HETATM 1489 O O   . HOH D 3 .   ? 22.215 15.852 31.820  1.00 41.98 ? 165 HOH B O   1 
HETATM 1490 O O   . HOH D 3 .   ? 11.016 13.370 2.914   1.00 37.88 ? 166 HOH B O   1 
HETATM 1491 O O   . HOH D 3 .   ? 29.078 9.101  5.271   1.00 40.64 ? 167 HOH B O   1 
HETATM 1492 O O   . HOH D 3 .   ? 27.112 11.801 10.756  1.00 40.57 ? 168 HOH B O   1 
HETATM 1493 O O   . HOH D 3 .   ? 28.218 11.646 4.387   1.00 46.06 ? 169 HOH B O   1 
HETATM 1494 O O   . HOH D 3 .   ? 18.157 18.657 22.823  1.00 39.61 ? 170 HOH B O   1 
HETATM 1495 O O   . HOH D 3 .   ? 31.660 1.268  6.396   1.00 51.18 ? 171 HOH B O   1 
HETATM 1496 O O   . HOH D 3 .   ? 25.253 -6.281 25.026  1.00 49.37 ? 172 HOH B O   1 
HETATM 1497 O O   . HOH D 3 .   ? 29.730 15.051 21.223  1.00 50.88 ? 173 HOH B O   1 
HETATM 1498 O O   . HOH D 3 .   ? 9.929  15.404 4.121   1.00 39.20 ? 174 HOH B O   1 
HETATM 1499 O O   . HOH D 3 .   ? 15.102 11.785 27.740  1.00 46.66 ? 175 HOH B O   1 
HETATM 1500 O O   . HOH D 3 .   ? 20.772 13.339 30.713  1.00 48.31 ? 176 HOH B O   1 
HETATM 1501 O O   . HOH D 3 .   ? 31.290 8.091  27.220  1.00 50.73 ? 177 HOH B O   1 
HETATM 1502 O O   . HOH D 3 .   ? 31.786 1.490  9.135   1.00 54.54 ? 178 HOH B O   1 
HETATM 1503 O O   . HOH D 3 .   ? 6.573  17.661 13.186  1.00 48.18 ? 179 HOH B O   1 
HETATM 1504 O O   . HOH D 3 .   ? 26.087 3.361  30.196  1.00 44.35 ? 180 HOH B O   1 
HETATM 1505 O O   . HOH D 3 .   ? 26.848 -4.146 22.774  1.00 41.27 ? 181 HOH B O   1 
HETATM 1506 O O   . HOH D 3 .   ? 21.688 10.940 3.782   1.00 40.87 ? 182 HOH B O   1 
HETATM 1507 O O   . HOH D 3 .   ? 22.500 1.775  3.257   1.00 47.22 ? 183 HOH B O   1 
HETATM 1508 O O   . HOH D 3 .   ? 10.713 4.402  6.949   1.00 48.39 ? 184 HOH B O   1 
HETATM 1509 O O   . HOH D 3 .   ? 25.109 8.989  4.296   1.00 54.97 ? 185 HOH B O   1 
HETATM 1510 O O   . HOH D 3 .   ? 7.945  15.016 8.208   1.00 45.68 ? 186 HOH B O   1 
HETATM 1511 O O   . HOH D 3 .   ? 10.228 11.992 9.338   1.00 45.84 ? 187 HOH B O   1 
HETATM 1512 O O   . HOH D 3 .   ? 8.451  14.130 12.411  1.00 39.50 ? 188 HOH B O   1 
HETATM 1513 O O   . HOH D 3 .   ? 21.651 6.273  6.000   1.00 47.79 ? 189 HOH B O   1 
HETATM 1514 O O   . HOH D 3 .   ? 16.001 7.608  30.756  1.00 47.17 ? 190 HOH B O   1 
HETATM 1515 O O   . HOH D 3 .   ? 15.198 13.608 0.898   1.00 39.26 ? 191 HOH B O   1 
HETATM 1516 O O   . HOH D 3 .   ? 18.135 -6.092 24.436  1.00 59.45 ? 192 HOH B O   1 
HETATM 1517 O O   . HOH D 3 .   ? 24.627 4.596  3.818   1.00 51.22 ? 193 HOH B O   1 
HETATM 1518 O O   . HOH D 3 .   ? 32.788 -1.463 19.135  1.00 43.83 ? 194 HOH B O   1 
HETATM 1519 O O   . HOH D 3 .   ? 17.672 4.680  31.357  1.00 55.62 ? 195 HOH B O   1 
HETATM 1520 O O   . HOH D 3 .   ? 36.112 5.620  16.180  1.00 43.38 ? 196 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   3   ?   ?   ?   A . n 
A 1 2   MET 2   4   ?   ?   ?   A . n 
A 1 3   ALA 3   5   ?   ?   ?   A . n 
A 1 4   LEU 4   6   ?   ?   ?   A . n 
A 1 5   GLY 5   7   ?   ?   ?   A . n 
A 1 6   PRO 6   8   ?   ?   ?   A . n 
A 1 7   PHE 7   9   ?   ?   ?   A . n 
A 1 8   PRO 8   10  ?   ?   ?   A . n 
A 1 9   ALA 9   11  ?   ?   ?   A . n 
A 1 10  MET 10  12  ?   ?   ?   A . n 
A 1 11  GLU 11  13  ?   ?   ?   A . n 
A 1 12  ASN 12  14  ?   ?   ?   A . n 
A 1 13  GLN 13  15  ?   ?   ?   A . n 
A 1 14  VAL 14  16  16  VAL VAL A . n 
A 1 15  LEU 15  17  17  LEU LEU A . n 
A 1 16  VAL 16  18  18  VAL VAL A . n 
A 1 17  ILE 17  19  19  ILE ILE A . n 
A 1 18  ARG 18  20  20  ARG ARG A . n 
A 1 19  ILE 19  21  21  ILE ILE A . n 
A 1 20  LYS 20  22  22  LYS LYS A . n 
A 1 21  ILE 21  23  23  ILE ILE A . n 
A 1 22  PRO 22  24  24  PRO PRO A . n 
A 1 23  ASN 23  25  25  ASN ASN A . n 
A 1 24  SER 24  26  26  SER SER A . n 
A 1 25  GLY 25  27  27  GLY GLY A . n 
A 1 26  ALA 26  28  28  ALA ALA A . n 
A 1 27  VAL 27  29  29  VAL VAL A . n 
A 1 28  ASP 28  30  30  ASP ASP A . n 
A 1 29  TRP 29  31  31  TRP TRP A . n 
A 1 30  THR 30  32  32  THR THR A . n 
A 1 31  VAL 31  33  33  VAL VAL A . n 
A 1 32  HIS 32  34  34  HIS HIS A . n 
A 1 33  SER 33  35  35  SER SER A . n 
A 1 34  GLY 34  36  ?   ?   ?   A . n 
A 1 35  PRO 35  37  37  PRO PRO A . n 
A 1 36  GLN 36  38  38  GLN GLN A . n 
A 1 37  LEU 37  39  39  LEU LEU A . n 
A 1 38  LEU 38  40  40  LEU LEU A . n 
A 1 39  PHE 39  41  41  PHE PHE A . n 
A 1 40  ARG 40  42  42  ARG ARG A . n 
A 1 41  ASP 41  43  43  ASP ASP A . n 
A 1 42  VAL 42  44  44  VAL VAL A . n 
A 1 43  LEU 43  45  45  LEU LEU A . n 
A 1 44  ASP 44  46  46  ASP ASP A . n 
A 1 45  VAL 45  47  47  VAL VAL A . n 
A 1 46  ILE 46  48  48  ILE ILE A . n 
A 1 47  GLY 47  49  49  GLY GLY A . n 
A 1 48  GLN 48  50  50  GLN GLN A . n 
A 1 49  VAL 49  51  51  VAL VAL A . n 
A 1 50  LEU 50  52  52  LEU LEU A . n 
A 1 51  PRO 51  53  53  PRO PRO A . n 
A 1 52  GLU 52  54  54  GLU GLU A . n 
A 1 53  ALA 53  55  55  ALA ALA A . n 
A 1 54  THR 54  56  56  THR THR A . n 
A 1 55  THR 55  57  57  THR THR A . n 
A 1 56  THR 56  58  58  THR THR A . n 
A 1 57  ALA 57  59  59  ALA ALA A . n 
A 1 58  PHE 58  60  60  PHE PHE A . n 
A 1 59  GLU 59  61  61  GLU GLU A . n 
A 1 60  TYR 60  62  62  TYR TYR A . n 
A 1 61  GLU 61  63  63  GLU GLU A . n 
A 1 62  ASP 62  64  64  ASP ASP A . n 
A 1 63  GLU 63  65  65  GLU GLU A . n 
A 1 64  ASP 64  66  66  ASP ASP A . n 
A 1 65  GLY 65  67  67  GLY GLY A . n 
A 1 66  ASP 66  68  68  ASP ASP A . n 
A 1 67  ARG 67  69  69  ARG ARG A . n 
A 1 68  ILE 68  70  70  ILE ILE A . n 
A 1 69  THR 69  71  71  THR THR A . n 
A 1 70  VAL 70  72  72  VAL VAL A . n 
A 1 71  ARG 71  73  73  ARG ARG A . n 
A 1 72  SER 72  74  74  SER SER A . n 
A 1 73  ASP 73  75  75  ASP ASP A . n 
A 1 74  GLU 74  76  76  GLU GLU A . n 
A 1 75  GLU 75  77  77  GLU GLU A . n 
A 1 76  MET 76  78  78  MET MET A . n 
A 1 77  LYS 77  79  79  LYS LYS A . n 
A 1 78  ALA 78  80  80  ALA ALA A . n 
A 1 79  MET 79  81  81  MET MET A . n 
A 1 80  LEU 80  82  82  LEU LEU A . n 
A 1 81  SER 81  83  83  SER SER A . n 
A 1 82  TYR 82  84  84  TYR TYR A . n 
A 1 83  TYR 83  85  85  TYR TYR A . n 
A 1 84  TYR 84  86  86  TYR TYR A . n 
A 1 85  SER 85  87  87  SER SER A . n 
A 1 86  THR 86  88  88  THR THR A . n 
A 1 87  VAL 87  89  89  VAL VAL A . n 
A 1 88  MET 88  90  90  MET MET A . n 
A 1 89  GLU 89  91  91  GLU GLU A . n 
A 1 90  GLN 90  92  92  GLN GLN A . n 
A 1 91  GLN 91  93  93  GLN GLN A . n 
A 1 92  VAL 92  94  94  VAL VAL A . n 
A 1 93  ASN 93  95  95  ASN ASN A . n 
A 1 94  GLY 94  96  96  GLY GLY A . n 
A 1 95  GLN 95  97  97  GLN GLN A . n 
A 1 96  LEU 96  98  98  LEU LEU A . n 
A 1 97  ILE 97  99  99  ILE ILE A . n 
A 1 98  GLU 98  100 100 GLU GLU A . n 
A 1 99  PRO 99  101 101 PRO PRO A . n 
A 1 100 LEU 100 102 102 LEU LEU A . n 
A 1 101 GLN 101 103 103 GLN GLN A . n 
A 1 102 ILE 102 104 104 ILE ILE A . n 
A 1 103 PHE 103 105 105 PHE PHE A . n 
A 1 104 PRO 104 106 106 PRO PRO A . n 
A 1 105 ARG 105 107 107 ARG ARG A . n 
A 1 106 ALA 106 108 108 ALA ALA A . n 
B 2 1   SER 1   35  ?   ?   ?   B . n 
B 2 2   MET 2   36  ?   ?   ?   B . n 
B 2 3   GLY 3   37  ?   ?   ?   B . n 
B 2 4   HIS 4   38  ?   ?   ?   B . n 
B 2 5   SER 5   39  ?   ?   ?   B . n 
B 2 6   ASN 6   40  ?   ?   ?   B . n 
B 2 7   ARG 7   41  ?   ?   ?   B . n 
B 2 8   GLN 8   42  42  GLN GLN B . n 
B 2 9   SER 9   43  43  SER SER B . n 
B 2 10  ASP 10  44  44  ASP ASP B . n 
B 2 11  VAL 11  45  45  VAL VAL B . n 
B 2 12  ARG 12  46  46  ARG ARG B . n 
B 2 13  ILE 13  47  47  ILE ILE B . n 
B 2 14  LYS 14  48  48  LYS LYS B . n 
B 2 15  PHE 15  49  49  PHE PHE B . n 
B 2 16  GLU 16  50  50  GLU GLU B . n 
B 2 17  HIS 17  51  51  HIS HIS B . n 
B 2 18  ASN 18  52  52  ASN ASN B . n 
B 2 19  GLY 19  53  53  GLY GLY B . n 
B 2 20  GLU 20  54  54  GLU GLU B . n 
B 2 21  ARG 21  55  55  ARG ARG B . n 
B 2 22  ARG 22  56  56  ARG ARG B . n 
B 2 23  ILE 23  57  57  ILE ILE B . n 
B 2 24  ILE 24  58  58  ILE ILE B . n 
B 2 25  ALA 25  59  59  ALA ALA B . n 
B 2 26  PHE 26  60  60  PHE PHE B . n 
B 2 27  SER 27  61  61  SER SER B . n 
B 2 28  ARG 28  62  62  ARG ARG B . n 
B 2 29  PRO 29  63  63  PRO PRO B . n 
B 2 30  VAL 30  64  64  VAL VAL B . n 
B 2 31  LYS 31  65  65  LYS LYS B . n 
B 2 32  TYR 32  66  66  TYR TYR B . n 
B 2 33  GLU 33  67  67  GLU GLU B . n 
B 2 34  ASP 34  68  68  ASP ASP B . n 
B 2 35  VAL 35  69  69  VAL VAL B . n 
B 2 36  GLU 36  70  70  GLU GLU B . n 
B 2 37  HIS 37  71  71  HIS HIS B . n 
B 2 38  LYS 38  72  72  LYS LYS B . n 
B 2 39  VAL 39  73  73  VAL VAL B . n 
B 2 40  THR 40  74  74  THR THR B . n 
B 2 41  THR 41  75  75  THR THR B . n 
B 2 42  VAL 42  76  76  VAL VAL B . n 
B 2 43  PHE 43  77  77  PHE PHE B . n 
B 2 44  GLY 44  78  78  GLY GLY B . n 
B 2 45  GLN 45  79  79  GLN GLN B . n 
B 2 46  PRO 46  80  80  PRO PRO B . n 
B 2 47  LEU 47  81  81  LEU LEU B . n 
B 2 48  ASP 48  82  82  ASP ASP B . n 
B 2 49  LEU 49  83  83  LEU LEU B . n 
B 2 50  HIS 50  84  84  HIS HIS B . n 
B 2 51  TYR 51  85  85  TYR TYR B . n 
B 2 52  MET 52  86  86  MET MET B . n 
B 2 53  ASN 53  87  87  ASN ASN B . n 
B 2 54  ASN 54  88  88  ASN ASN B . n 
B 2 55  GLU 55  89  89  GLU GLU B . n 
B 2 56  LEU 56  90  90  LEU LEU B . n 
B 2 57  SER 57  91  91  SER SER B . n 
B 2 58  ILE 58  92  92  ILE ILE B . n 
B 2 59  LEU 59  93  93  LEU LEU B . n 
B 2 60  LEU 60  94  94  LEU LEU B . n 
B 2 61  LYS 61  95  95  LYS LYS B . n 
B 2 62  ASN 62  96  96  ASN ASN B . n 
B 2 63  GLN 63  97  97  GLN GLN B . n 
B 2 64  ASP 64  98  98  ASP ASP B . n 
B 2 65  ASP 65  99  99  ASP ASP B . n 
B 2 66  LEU 66  100 100 LEU LEU B . n 
B 2 67  ASP 67  101 101 ASP ASP B . n 
B 2 68  LYS 68  102 102 LYS LYS B . n 
B 2 69  ALA 69  103 103 ALA ALA B . n 
B 2 70  ILE 70  104 104 ILE ILE B . n 
B 2 71  ASP 71  105 105 ASP ASP B . n 
B 2 72  ILE 72  106 106 ILE ILE B . n 
B 2 73  LEU 73  107 107 LEU LEU B . n 
B 2 74  ASP 74  108 108 ASP ASP B . n 
B 2 75  ARG 75  109 109 ARG ARG B . n 
B 2 76  SER 76  110 110 SER SER B . n 
B 2 77  SER 77  111 111 SER SER B . n 
B 2 78  SER 78  112 112 SER SER B . n 
B 2 79  MET 79  113 113 MET MET B . n 
B 2 80  LYS 80  114 114 LYS LYS B . n 
B 2 81  SER 81  115 115 SER SER B . n 
B 2 82  LEU 82  116 116 LEU LEU B . n 
B 2 83  ARG 83  117 117 ARG ARG B . n 
B 2 84  ILE 84  118 118 ILE ILE B . n 
B 2 85  LEU 85  119 119 LEU LEU B . n 
B 2 86  LEU 86  120 120 LEU LEU B . n 
B 2 87  LEU 87  121 121 LEU LEU B . n 
B 2 88  SER 88  122 122 SER SER B . n 
B 2 89  GLN 89  123 123 GLN GLN B . n 
B 2 90  ASP 90  124 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  109 1   HOH HOH A . 
C 3 HOH 2  110 2   HOH HOH A . 
C 3 HOH 3  111 3   HOH HOH A . 
C 3 HOH 4  112 4   HOH HOH A . 
C 3 HOH 5  113 5   HOH HOH A . 
C 3 HOH 6  114 6   HOH HOH A . 
C 3 HOH 7  115 7   HOH HOH A . 
C 3 HOH 8  116 8   HOH HOH A . 
C 3 HOH 9  117 9   HOH HOH A . 
C 3 HOH 10 118 11  HOH HOH A . 
C 3 HOH 11 119 13  HOH HOH A . 
C 3 HOH 12 120 14  HOH HOH A . 
C 3 HOH 13 121 16  HOH HOH A . 
C 3 HOH 14 122 17  HOH HOH A . 
C 3 HOH 15 123 18  HOH HOH A . 
C 3 HOH 16 124 19  HOH HOH A . 
C 3 HOH 17 125 20  HOH HOH A . 
C 3 HOH 18 126 21  HOH HOH A . 
C 3 HOH 19 127 22  HOH HOH A . 
C 3 HOH 20 128 23  HOH HOH A . 
C 3 HOH 21 129 29  HOH HOH A . 
C 3 HOH 22 130 30  HOH HOH A . 
C 3 HOH 23 131 31  HOH HOH A . 
C 3 HOH 24 132 33  HOH HOH A . 
C 3 HOH 25 133 34  HOH HOH A . 
C 3 HOH 26 134 35  HOH HOH A . 
C 3 HOH 27 135 40  HOH HOH A . 
C 3 HOH 28 136 42  HOH HOH A . 
C 3 HOH 29 137 43  HOH HOH A . 
C 3 HOH 30 138 45  HOH HOH A . 
C 3 HOH 31 139 47  HOH HOH A . 
C 3 HOH 32 140 49  HOH HOH A . 
C 3 HOH 33 141 50  HOH HOH A . 
C 3 HOH 34 142 51  HOH HOH A . 
C 3 HOH 35 143 52  HOH HOH A . 
C 3 HOH 36 144 53  HOH HOH A . 
C 3 HOH 37 145 56  HOH HOH A . 
C 3 HOH 38 146 58  HOH HOH A . 
C 3 HOH 39 147 59  HOH HOH A . 
C 3 HOH 40 148 60  HOH HOH A . 
C 3 HOH 41 149 61  HOH HOH A . 
C 3 HOH 42 150 62  HOH HOH A . 
C 3 HOH 43 151 64  HOH HOH A . 
C 3 HOH 44 152 73  HOH HOH A . 
C 3 HOH 45 153 74  HOH HOH A . 
C 3 HOH 46 154 81  HOH HOH A . 
C 3 HOH 47 155 85  HOH HOH A . 
C 3 HOH 48 156 91  HOH HOH A . 
C 3 HOH 49 157 92  HOH HOH A . 
C 3 HOH 50 158 93  HOH HOH A . 
C 3 HOH 51 159 94  HOH HOH A . 
C 3 HOH 52 160 100 HOH HOH A . 
C 3 HOH 53 161 101 HOH HOH A . 
C 3 HOH 54 162 102 HOH HOH A . 
C 3 HOH 55 163 103 HOH HOH A . 
C 3 HOH 56 164 105 HOH HOH A . 
C 3 HOH 57 165 108 HOH HOH A . 
C 3 HOH 58 166 110 HOH HOH A . 
C 3 HOH 59 167 117 HOH HOH A . 
C 3 HOH 60 168 119 HOH HOH A . 
C 3 HOH 61 169 121 HOH HOH A . 
C 3 HOH 62 170 122 HOH HOH A . 
C 3 HOH 63 171 125 HOH HOH A . 
C 3 HOH 64 172 130 HOH HOH A . 
C 3 HOH 65 173 132 HOH HOH A . 
C 3 HOH 66 174 133 HOH HOH A . 
C 3 HOH 67 175 135 HOH HOH A . 
C 3 HOH 68 176 138 HOH HOH A . 
C 3 HOH 69 177 152 HOH HOH A . 
D 3 HOH 1  125 10  HOH HOH B . 
D 3 HOH 2  126 12  HOH HOH B . 
D 3 HOH 3  127 15  HOH HOH B . 
D 3 HOH 4  128 24  HOH HOH B . 
D 3 HOH 5  129 25  HOH HOH B . 
D 3 HOH 6  130 26  HOH HOH B . 
D 3 HOH 7  131 27  HOH HOH B . 
D 3 HOH 8  132 28  HOH HOH B . 
D 3 HOH 9  133 32  HOH HOH B . 
D 3 HOH 10 134 36  HOH HOH B . 
D 3 HOH 11 135 37  HOH HOH B . 
D 3 HOH 12 136 38  HOH HOH B . 
D 3 HOH 13 137 39  HOH HOH B . 
D 3 HOH 14 138 41  HOH HOH B . 
D 3 HOH 15 139 44  HOH HOH B . 
D 3 HOH 16 140 46  HOH HOH B . 
D 3 HOH 17 141 48  HOH HOH B . 
D 3 HOH 18 142 54  HOH HOH B . 
D 3 HOH 19 143 55  HOH HOH B . 
D 3 HOH 20 144 57  HOH HOH B . 
D 3 HOH 21 145 63  HOH HOH B . 
D 3 HOH 22 146 65  HOH HOH B . 
D 3 HOH 23 147 66  HOH HOH B . 
D 3 HOH 24 148 67  HOH HOH B . 
D 3 HOH 25 149 68  HOH HOH B . 
D 3 HOH 26 150 69  HOH HOH B . 
D 3 HOH 27 151 70  HOH HOH B . 
D 3 HOH 28 152 71  HOH HOH B . 
D 3 HOH 29 153 72  HOH HOH B . 
D 3 HOH 30 154 75  HOH HOH B . 
D 3 HOH 31 155 76  HOH HOH B . 
D 3 HOH 32 156 77  HOH HOH B . 
D 3 HOH 33 157 78  HOH HOH B . 
D 3 HOH 34 158 79  HOH HOH B . 
D 3 HOH 35 159 80  HOH HOH B . 
D 3 HOH 36 160 82  HOH HOH B . 
D 3 HOH 37 161 83  HOH HOH B . 
D 3 HOH 38 162 84  HOH HOH B . 
D 3 HOH 39 163 86  HOH HOH B . 
D 3 HOH 40 164 89  HOH HOH B . 
D 3 HOH 41 165 90  HOH HOH B . 
D 3 HOH 42 166 95  HOH HOH B . 
D 3 HOH 43 167 96  HOH HOH B . 
D 3 HOH 44 168 97  HOH HOH B . 
D 3 HOH 45 169 98  HOH HOH B . 
D 3 HOH 46 170 99  HOH HOH B . 
D 3 HOH 47 171 104 HOH HOH B . 
D 3 HOH 48 172 106 HOH HOH B . 
D 3 HOH 49 173 107 HOH HOH B . 
D 3 HOH 50 174 109 HOH HOH B . 
D 3 HOH 51 175 111 HOH HOH B . 
D 3 HOH 52 176 112 HOH HOH B . 
D 3 HOH 53 177 113 HOH HOH B . 
D 3 HOH 54 178 114 HOH HOH B . 
D 3 HOH 55 179 115 HOH HOH B . 
D 3 HOH 56 180 116 HOH HOH B . 
D 3 HOH 57 181 118 HOH HOH B . 
D 3 HOH 58 182 120 HOH HOH B . 
D 3 HOH 59 183 123 HOH HOH B . 
D 3 HOH 60 184 124 HOH HOH B . 
D 3 HOH 61 185 126 HOH HOH B . 
D 3 HOH 62 186 127 HOH HOH B . 
D 3 HOH 63 187 134 HOH HOH B . 
D 3 HOH 64 188 136 HOH HOH B . 
D 3 HOH 65 189 137 HOH HOH B . 
D 3 HOH 66 190 139 HOH HOH B . 
D 3 HOH 67 191 140 HOH HOH B . 
D 3 HOH 68 192 141 HOH HOH B . 
D 3 HOH 69 193 142 HOH HOH B . 
D 3 HOH 70 194 147 HOH HOH B . 
D 3 HOH 71 195 148 HOH HOH B . 
D 3 HOH 72 196 149 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-12 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_diffrn_reflns.diffrn_id                   1 
_diffrn_reflns.pdbx_d_res_high             1.830 
_diffrn_reflns.pdbx_d_res_low              50.000 
_diffrn_reflns.pdbx_number_obs             19523 
_diffrn_reflns.pdbx_Rmerge_I_obs           0.075 
_diffrn_reflns.pdbx_Rsym_value             ? 
_diffrn_reflns.pdbx_chi_squared            1.03 
_diffrn_reflns.av_sigmaI_over_netI         12.10 
_diffrn_reflns.pdbx_redundancy             6.10 
_diffrn_reflns.pdbx_percent_possible_obs   99.30 
_diffrn_reflns.number                      118834 
_diffrn_reflns.pdbx_observed_criterion     ? 
_diffrn_reflns.limit_h_max                 ? 
_diffrn_reflns.limit_h_min                 ? 
_diffrn_reflns.limit_k_max                 ? 
_diffrn_reflns.limit_k_min                 ? 
_diffrn_reflns.limit_l_max                 ? 
_diffrn_reflns.limit_l_min                 ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
1 3.94 50.00 ? ? 0.053 ? 1.004 6.00 98.50 
1 3.13 3.94  ? ? 0.058 ? 1.000 6.40 99.50 
1 2.73 3.13  ? ? 0.077 ? 1.031 6.50 99.40 
1 2.48 2.73  ? ? 0.105 ? 1.052 6.40 99.70 
1 2.31 2.48  ? ? 0.128 ? 1.074 6.50 99.90 
1 2.17 2.31  ? ? 0.170 ? 1.080 6.50 99.80 
1 2.06 2.17  ? ? 0.215 ? 1.073 6.40 99.80 
1 1.97 2.06  ? ? 0.321 ? 1.062 6.40 99.80 
1 1.90 1.97  ? ? 0.431 ? 0.936 6.00 99.80 
1 1.83 1.90  ? ? 0.578 ? 0.869 3.70 96.50 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1  ? refined 16.2280 34.9870 9.4390  0.1411  0.0126  0.0390 0.0210  0.0119 -0.0053 3.4679  5.4799  2.3429  0.7376  -1.0590 -0.5813 
0.0697  -0.0696 -0.0001 -0.2181 0.0824  -0.0507 0.3407  -0.4286 -0.0464 'X-RAY DIFFRACTION' 
2  ? refined 10.9080 29.2550 4.9630  0.0909  0.0418  0.0603 0.0140  0.0082 -0.0107 3.5321  3.7450  3.3749  -2.2183 1.4394  -1.2593 
-0.1897 0.0906  0.0992  0.0414  -0.0672 0.3126  0.0761  -0.2834 -0.3642 'X-RAY DIFFRACTION' 
3  ? refined 19.2440 21.3150 12.4210 0.1025  0.0219  0.0385 0.0054  0.0224 -0.0011 1.1359  1.7997  2.4198  0.5396  -0.0619 0.2743  
-0.0007 -0.0233 0.0240  -0.0182 0.0707  0.1202  0.2096  -0.0402 -0.0018 'X-RAY DIFFRACTION' 
4  ? refined 31.6420 28.9550 14.4500 -0.0161 -0.0258 0.0268 0.0109  0.0351 -0.0608 20.1207 12.6090 10.7534 11.8219 3.5702  0.0038  
-0.1861 0.3456  -0.1595 0.1802  -0.3403 -0.9372 -0.3071 -0.0534 0.6510  'X-RAY DIFFRACTION' 
5  ? refined 23.9230 29.2050 6.2830  0.0931  0.0745  0.0425 0.0067  0.0520 0.0272  8.5487  2.8751  8.6240  -2.8748 4.4875  1.3342  
-0.2856 0.2285  0.0571  0.5362  0.3241  -0.2302 -0.1080 -0.1759 0.8156  'X-RAY DIFFRACTION' 
6  ? refined 24.8930 14.8610 18.6300 0.0957  0.0616  0.0471 0.0335  0.0218 0.0068  5.6838  7.4825  14.6558 -1.3648 -2.5442 -2.7483 
0.0284  0.0466  -0.0750 -0.5045 0.2142  -0.2102 0.4378  -0.1920 0.6789  'X-RAY DIFFRACTION' 
7  ? refined 18.2140 12.9080 15.1180 0.0637  0.0386  0.0371 0.0279  0.0450 0.0010  2.8653  4.4066  8.6285  0.7344  2.6050  0.0139  
-0.0355 0.1611  -0.1256 -0.1598 -0.0849 0.2388  -0.0045 0.0552  -0.0663 'X-RAY DIFFRACTION' 
8  ? refined 16.4460 6.8460  25.4480 0.1378  -0.0012 0.0020 0.0325  0.0539 0.0278  15.1748 4.9564  9.5783  -0.8107 -0.6827 -4.7037 
-0.2940 0.2464  0.0476  -0.4036 -0.4302 0.1797  0.1217  0.5168  -0.0717 'X-RAY DIFFRACTION' 
9  ? refined 19.2180 3.0550  16.5930 0.0699  -0.0374 0.0424 -0.0226 0.0294 0.0398  1.4169  3.7314  3.2890  -1.4564 -1.0238 0.9221  
-0.1368 0.0816  0.0552  -0.0764 -0.2017 0.1142  0.1731  0.2553  -0.0413 'X-RAY DIFFRACTION' 
10 ? refined 27.8610 7.5020  15.6790 0.1028  0.0692  0.0724 0.0551  0.0443 0.0174  4.6746  4.1047  5.4669  -0.8297 1.2977  -0.0768 
-0.0728 0.0028  0.0700  -0.0292 -0.0406 -0.3854 0.0573  0.1715  0.6024  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1  1  A 14 A 43  ALL A 16  A 45  'X-RAY DIFFRACTION' ? 
2  2  A 44 A 59  ALL A 46  A 61  'X-RAY DIFFRACTION' ? 
3  3  A 60 A 79  ALL A 62  A 81  'X-RAY DIFFRACTION' ? 
4  4  A 80 A 90  ALL A 82  A 92  'X-RAY DIFFRACTION' ? 
5  5  A 91 A 104 ALL A 93  A 106 'X-RAY DIFFRACTION' ? 
6  6  B 8  B 14  ALL B 42  B 48  'X-RAY DIFFRACTION' ? 
7  7  B 15 B 29  ALL B 49  B 63  'X-RAY DIFFRACTION' ? 
8  8  B 30 B 37  ALL B 64  B 71  'X-RAY DIFFRACTION' ? 
9  9  B 38 B 67  ALL B 72  B 101 'X-RAY DIFFRACTION' ? 
10 10 B 68 B 89  ALL B 102 B 123 'X-RAY DIFFRACTION' ? 
# 
_pdbx_phasing_MR.entry_id                     2O2V 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          3.500 
_pdbx_phasing_MR.d_res_low_rotation           46.840 
_pdbx_phasing_MR.d_res_high_translation       3.500 
_pdbx_phasing_MR.d_res_low_translation        46.840 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO        .              ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK    .              ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER       .              ?                other   'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
REFMAC       .              ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk               refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 4 
PDB_EXTRACT  2.000          'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
CrystalClear '(MSC/RIGAKU)' ?                ?       ?                    ?                           'data collection' ? ? ? 6 
HKL-2000     .              ?                ?       ?                    ?                           'data reduction'  ? ? ? 7 
HKL-2000     .              ?                ?       ?                    ?                           'data scaling'    ? ? ? 8 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 69 ? ? CZ A ARG 69 ? ? NH1 A ARG 69 ? ? 127.28 120.30 6.98  0.50 N 
2 1 NE A ARG 69 ? ? CZ A ARG 69 ? ? NH2 A ARG 69 ? ? 112.50 120.30 -7.80 0.50 N 
3 1 NE B ARG 56 ? ? CZ B ARG 56 ? ? NH1 B ARG 56 ? ? 125.18 120.30 4.88  0.50 N 
4 1 NE B ARG 56 ? ? CZ B ARG 56 ? ? NH2 B ARG 56 ? ? 112.77 120.30 -7.53 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN B 88  ? ? 54.42  -117.66 
2 1 SER B 112 ? ? -97.69 -60.05  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A SER 35  ? OG  ? A SER 33 OG  
2  1 Y 1 A GLN 38  ? CG  ? A GLN 36 CG  
3  1 Y 1 A GLN 38  ? CD  ? A GLN 36 CD  
4  1 Y 1 A GLN 38  ? OE1 ? A GLN 36 OE1 
5  1 Y 1 A GLN 38  ? NE2 ? A GLN 36 NE2 
6  1 Y 1 A ARG 42  ? CZ  ? A ARG 40 CZ  
7  1 Y 1 A ARG 42  ? NH1 ? A ARG 40 NH1 
8  1 Y 1 A ARG 42  ? NH2 ? A ARG 40 NH2 
9  1 Y 1 A GLU 54  ? OE1 ? A GLU 52 OE1 
10 1 Y 1 A GLU 54  ? OE2 ? A GLU 52 OE2 
11 1 Y 1 A LYS 79  ? CE  ? A LYS 77 CE  
12 1 Y 1 A LYS 79  ? NZ  ? A LYS 77 NZ  
13 1 Y 1 A MET 90  ? SD  ? A MET 88 SD  
14 1 Y 1 A MET 90  ? CE  ? A MET 88 CE  
15 1 Y 1 A GLU 91  ? CG  ? A GLU 89 CG  
16 1 Y 1 A GLU 91  ? CD  ? A GLU 89 CD  
17 1 Y 1 A GLU 91  ? OE1 ? A GLU 89 OE1 
18 1 Y 1 A GLU 91  ? OE2 ? A GLU 89 OE2 
19 1 Y 1 A GLN 97  ? CG  ? A GLN 95 CG  
20 1 Y 1 A GLN 97  ? CD  ? A GLN 95 CD  
21 1 Y 1 A GLN 97  ? OE1 ? A GLN 95 OE1 
22 1 Y 1 A GLN 97  ? NE2 ? A GLN 95 NE2 
23 1 Y 1 A LEU 98  ? CG  ? A LEU 96 CG  
24 1 Y 1 A LEU 98  ? CD1 ? A LEU 96 CD1 
25 1 Y 1 A LEU 98  ? CD2 ? A LEU 96 CD2 
26 1 Y 1 A ILE 99  ? CD1 ? A ILE 97 CD1 
27 1 Y 1 A GLU 100 ? CD  ? A GLU 98 CD  
28 1 Y 1 A GLU 100 ? OE1 ? A GLU 98 OE1 
29 1 Y 1 A GLU 100 ? OE2 ? A GLU 98 OE2 
30 1 Y 1 B GLN 42  ? CG  ? B GLN 8  CG  
31 1 Y 1 B GLN 42  ? CD  ? B GLN 8  CD  
32 1 Y 1 B GLN 42  ? OE1 ? B GLN 8  OE1 
33 1 Y 1 B GLN 42  ? NE2 ? B GLN 8  NE2 
34 1 Y 1 B LYS 102 ? CE  ? B LYS 68 CE  
35 1 Y 1 B LYS 102 ? NZ  ? B LYS 68 NZ  
36 1 Y 1 B SER 112 ? OG  ? B SER 78 OG  
37 1 Y 1 B GLN 123 ? CG  ? B GLN 89 CG  
38 1 Y 1 B GLN 123 ? CD  ? B GLN 89 CD  
39 1 Y 1 B GLN 123 ? OE1 ? B GLN 89 OE1 
40 1 Y 1 B GLN 123 ? NE2 ? B GLN 89 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 3   ? A SER 1  
2  1 Y 1 A MET 4   ? A MET 2  
3  1 Y 1 A ALA 5   ? A ALA 3  
4  1 Y 1 A LEU 6   ? A LEU 4  
5  1 Y 1 A GLY 7   ? A GLY 5  
6  1 Y 1 A PRO 8   ? A PRO 6  
7  1 Y 1 A PHE 9   ? A PHE 7  
8  1 Y 1 A PRO 10  ? A PRO 8  
9  1 Y 1 A ALA 11  ? A ALA 9  
10 1 Y 1 A MET 12  ? A MET 10 
11 1 Y 1 A GLU 13  ? A GLU 11 
12 1 Y 1 A ASN 14  ? A ASN 12 
13 1 Y 1 A GLN 15  ? A GLN 13 
14 1 Y 1 A GLY 36  ? A GLY 34 
15 1 Y 1 B SER 35  ? B SER 1  
16 1 Y 1 B MET 36  ? B MET 2  
17 1 Y 1 B GLY 37  ? B GLY 3  
18 1 Y 1 B HIS 38  ? B HIS 4  
19 1 Y 1 B SER 39  ? B SER 5  
20 1 Y 1 B ASN 40  ? B ASN 6  
21 1 Y 1 B ARG 41  ? B ARG 7  
22 1 Y 1 B ASP 124 ? B ASP 90 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#