data_2O5J
# 
_entry.id   2O5J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2O5J         
NDB   PH0037       
RCSB  RCSB040713   
WWPDB D_1000040713 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2O5J 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vassylyev, D.G.'  1 
'Vassylyeva, M.N.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural basis for substrate loading in bacterial RNA polymerase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            448 
_citation.page_first                163 
_citation.page_last                 168 
_citation.year                      2007 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17581591 
_citation.pdbx_database_id_DOI      10.1038/nature05931 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vassylyev, D.G.'  1 
primary 'Vassylyeva, M.N.' 2 
primary 'Zhang, J.'        3 
primary 'Palangat, M.'     4 
primary 'Artsimovitch, I.' 5 
primary 'Landick, R.'      6 
# 
_cell.entry_id           2O5J 
_cell.length_a           152.340 
_cell.length_b           152.340 
_cell.length_c           524.567 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2O5J 
_symmetry.space_group_name_H-M             'P 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                76 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     syn "5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP*CP*GP*CP*CP*G)-3'" 7001.470   2    ?       ? ? 
'DNA template strand'     
2  polymer     syn "5'-R(P*GP*AP*GP*UP*CP*UP*GP*CP*GP*GP*CP*GP*CP*GP*CP*G)-3'"                      5184.135   2    ?       ? ? 
'RNA transcript'          
3  polymer     syn "5'-D(*AP*AP*CP*GP*CP*CP*AP*GP*AP*CP*AP*GP*GP*G)-3'"                             4323.833   2    ?       ? ? 
'DNA non-template strand' 
4  polymer     nat 'DNA-directed RNA polymerase alpha chain'                                        35056.164  4    2.7.7.6 ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerase beta chain'                                         125436.539 2    2.7.7.6 ? ? ? 
6  polymer     nat 
;DNA-directed RNA polymerase beta' chain
;
170997.391 2    2.7.7.6 ? ? ?                         
7  polymer     nat 'DNA-directed RNA polymerase omega chain'                                        11533.316  2    2.7.7.6 ? ? ? 
8  non-polymer syn 'ZINC ION'                                                                       65.409     4    ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                  24.305     4    ?       ? ? ? 
10 non-polymer syn 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER'                                  505.208    2    ?       ? ? ? 
11 water       nat water                                                                            18.015     2633 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4 'RNAP alpha subunit, Transcriptase alpha chain, RNA polymerase subunit alpha' 
5 'RNAP beta subunit, Transcriptase beta chain, RNA polymerase subunit beta'    
6 
;RNAP beta' subunit, Transcriptase beta' chain, RNA polymerase beta' subunit
;
7 'RNAP omega subunit, Transcriptase omega chain, RNA polymerase omega subunit' 
# 
loop_
_entity_name_sys.entity_id 
_entity_name_sys.name 
4 E.C.2.7.7.6 
5 E.C.2.7.7.6 
6 E.C.2.7.7.6 
7 E.C.2.7.7.6 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DG)(DG)(DC)(DG)(DT)(DT)(DC)(DG)(DC)(DG)(DC)(DG)
(DC)(DC)(DG)
;
CCCTGTCTGGCGTTCGCGCGCCG G,X     ? 
2 polyribonucleotide      no no GAGUCUGCGGCGCGCG GAGUCUGCGGCGCGCG H,Y     ? 
3 polydeoxyribonucleotide no no '(DA)(DA)(DC)(DG)(DC)(DC)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DG)' AACGCCAGACAGGG I,Z     ? 
4 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B,K,L ? 
5 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C,M     ? 
6 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D,N     ? 
7 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E,O     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    DC  n 
1 2    DC  n 
1 3    DC  n 
1 4    DT  n 
1 5    DG  n 
1 6    DT  n 
1 7    DC  n 
1 8    DT  n 
1 9    DG  n 
1 10   DG  n 
1 11   DC  n 
1 12   DG  n 
1 13   DT  n 
1 14   DT  n 
1 15   DC  n 
1 16   DG  n 
1 17   DC  n 
1 18   DG  n 
1 19   DC  n 
1 20   DG  n 
1 21   DC  n 
1 22   DC  n 
1 23   DG  n 
2 1    G   n 
2 2    A   n 
2 3    G   n 
2 4    U   n 
2 5    C   n 
2 6    U   n 
2 7    G   n 
2 8    C   n 
2 9    G   n 
2 10   G   n 
2 11   C   n 
2 12   G   n 
2 13   C   n 
2 14   G   n 
2 15   C   n 
2 16   G   n 
3 1    DA  n 
3 2    DA  n 
3 3    DC  n 
3 4    DG  n 
3 5    DC  n 
3 6    DC  n 
3 7    DA  n 
3 8    DG  n 
3 9    DA  n 
3 10   DC  n 
3 11   DA  n 
3 12   DG  n 
3 13   DG  n 
3 14   DG  n 
4 1    MET n 
4 2    LEU n 
4 3    ASP n 
4 4    SER n 
4 5    LYS n 
4 6    LEU n 
4 7    LYS n 
4 8    ALA n 
4 9    PRO n 
4 10   VAL n 
4 11   PHE n 
4 12   THR n 
4 13   VAL n 
4 14   ARG n 
4 15   THR n 
4 16   GLN n 
4 17   GLY n 
4 18   ARG n 
4 19   GLU n 
4 20   TYR n 
4 21   GLY n 
4 22   GLU n 
4 23   PHE n 
4 24   VAL n 
4 25   LEU n 
4 26   GLU n 
4 27   PRO n 
4 28   LEU n 
4 29   GLU n 
4 30   ARG n 
4 31   GLY n 
4 32   PHE n 
4 33   GLY n 
4 34   VAL n 
4 35   THR n 
4 36   LEU n 
4 37   GLY n 
4 38   ASN n 
4 39   PRO n 
4 40   LEU n 
4 41   ARG n 
4 42   ARG n 
4 43   ILE n 
4 44   LEU n 
4 45   LEU n 
4 46   SER n 
4 47   SER n 
4 48   ILE n 
4 49   PRO n 
4 50   GLY n 
4 51   THR n 
4 52   ALA n 
4 53   VAL n 
4 54   THR n 
4 55   SER n 
4 56   VAL n 
4 57   TYR n 
4 58   ILE n 
4 59   GLU n 
4 60   ASP n 
4 61   VAL n 
4 62   LEU n 
4 63   HIS n 
4 64   GLU n 
4 65   PHE n 
4 66   SER n 
4 67   THR n 
4 68   ILE n 
4 69   PRO n 
4 70   GLY n 
4 71   VAL n 
4 72   LYS n 
4 73   GLU n 
4 74   ASP n 
4 75   VAL n 
4 76   VAL n 
4 77   GLU n 
4 78   ILE n 
4 79   ILE n 
4 80   LEU n 
4 81   ASN n 
4 82   LEU n 
4 83   LYS n 
4 84   GLU n 
4 85   LEU n 
4 86   VAL n 
4 87   VAL n 
4 88   ARG n 
4 89   PHE n 
4 90   LEU n 
4 91   ASN n 
4 92   PRO n 
4 93   SER n 
4 94   LEU n 
4 95   GLN n 
4 96   THR n 
4 97   VAL n 
4 98   THR n 
4 99   LEU n 
4 100  LEU n 
4 101  LEU n 
4 102  LYS n 
4 103  ALA n 
4 104  GLU n 
4 105  GLY n 
4 106  PRO n 
4 107  LYS n 
4 108  GLU n 
4 109  VAL n 
4 110  LYS n 
4 111  ALA n 
4 112  ARG n 
4 113  ASP n 
4 114  PHE n 
4 115  LEU n 
4 116  PRO n 
4 117  VAL n 
4 118  ALA n 
4 119  ASP n 
4 120  VAL n 
4 121  GLU n 
4 122  ILE n 
4 123  MET n 
4 124  ASN n 
4 125  PRO n 
4 126  ASP n 
4 127  LEU n 
4 128  HIS n 
4 129  ILE n 
4 130  ALA n 
4 131  THR n 
4 132  LEU n 
4 133  GLU n 
4 134  GLU n 
4 135  GLY n 
4 136  GLY n 
4 137  ARG n 
4 138  LEU n 
4 139  ASN n 
4 140  MET n 
4 141  GLU n 
4 142  VAL n 
4 143  ARG n 
4 144  VAL n 
4 145  ASP n 
4 146  ARG n 
4 147  GLY n 
4 148  VAL n 
4 149  GLY n 
4 150  TYR n 
4 151  VAL n 
4 152  PRO n 
4 153  ALA n 
4 154  GLU n 
4 155  LYS n 
4 156  HIS n 
4 157  GLY n 
4 158  ILE n 
4 159  LYS n 
4 160  ASP n 
4 161  ARG n 
4 162  ILE n 
4 163  ASN n 
4 164  ALA n 
4 165  ILE n 
4 166  PRO n 
4 167  VAL n 
4 168  ASP n 
4 169  ALA n 
4 170  VAL n 
4 171  PHE n 
4 172  SER n 
4 173  PRO n 
4 174  VAL n 
4 175  ARG n 
4 176  ARG n 
4 177  VAL n 
4 178  ALA n 
4 179  PHE n 
4 180  GLN n 
4 181  VAL n 
4 182  GLU n 
4 183  ASP n 
4 184  THR n 
4 185  ARG n 
4 186  LEU n 
4 187  GLY n 
4 188  GLN n 
4 189  ARG n 
4 190  THR n 
4 191  ASP n 
4 192  LEU n 
4 193  ASP n 
4 194  LYS n 
4 195  LEU n 
4 196  THR n 
4 197  LEU n 
4 198  ARG n 
4 199  ILE n 
4 200  TRP n 
4 201  THR n 
4 202  ASP n 
4 203  GLY n 
4 204  SER n 
4 205  VAL n 
4 206  THR n 
4 207  PRO n 
4 208  LEU n 
4 209  GLU n 
4 210  ALA n 
4 211  LEU n 
4 212  ASN n 
4 213  GLN n 
4 214  ALA n 
4 215  VAL n 
4 216  GLU n 
4 217  ILE n 
4 218  LEU n 
4 219  ARG n 
4 220  GLU n 
4 221  HIS n 
4 222  LEU n 
4 223  THR n 
4 224  TYR n 
4 225  PHE n 
4 226  SER n 
4 227  ASN n 
4 228  PRO n 
4 229  GLN n 
4 230  ALA n 
4 231  ALA n 
4 232  ALA n 
4 233  VAL n 
4 234  ALA n 
4 235  ALA n 
4 236  PRO n 
4 237  GLU n 
4 238  GLU n 
4 239  ALA n 
4 240  LYS n 
4 241  GLU n 
4 242  PRO n 
4 243  GLU n 
4 244  ALA n 
4 245  PRO n 
4 246  PRO n 
4 247  GLU n 
4 248  GLN n 
4 249  GLU n 
4 250  GLU n 
4 251  GLU n 
4 252  LEU n 
4 253  ASP n 
4 254  LEU n 
4 255  PRO n 
4 256  LEU n 
4 257  GLU n 
4 258  GLU n 
4 259  LEU n 
4 260  GLY n 
4 261  LEU n 
4 262  SER n 
4 263  THR n 
4 264  ARG n 
4 265  VAL n 
4 266  LEU n 
4 267  HIS n 
4 268  SER n 
4 269  LEU n 
4 270  LYS n 
4 271  GLU n 
4 272  GLU n 
4 273  GLY n 
4 274  ILE n 
4 275  GLU n 
4 276  SER n 
4 277  VAL n 
4 278  ARG n 
4 279  ALA n 
4 280  LEU n 
4 281  LEU n 
4 282  ALA n 
4 283  LEU n 
4 284  ASN n 
4 285  LEU n 
4 286  LYS n 
4 287  ASP n 
4 288  LEU n 
4 289  LYS n 
4 290  ASN n 
4 291  ILE n 
4 292  PRO n 
4 293  GLY n 
4 294  ILE n 
4 295  GLY n 
4 296  GLU n 
4 297  ARG n 
4 298  SER n 
4 299  LEU n 
4 300  GLU n 
4 301  GLU n 
4 302  ILE n 
4 303  LYS n 
4 304  GLU n 
4 305  ALA n 
4 306  LEU n 
4 307  GLU n 
4 308  LYS n 
4 309  LYS n 
4 310  GLY n 
4 311  PHE n 
4 312  THR n 
4 313  LEU n 
4 314  LYS n 
4 315  GLU n 
5 1    MET n 
5 2    GLU n 
5 3    ILE n 
5 4    LYS n 
5 5    ARG n 
5 6    PHE n 
5 7    GLY n 
5 8    ARG n 
5 9    ILE n 
5 10   ARG n 
5 11   GLU n 
5 12   VAL n 
5 13   ILE n 
5 14   PRO n 
5 15   LEU n 
5 16   PRO n 
5 17   PRO n 
5 18   LEU n 
5 19   THR n 
5 20   GLU n 
5 21   ILE n 
5 22   GLN n 
5 23   VAL n 
5 24   GLU n 
5 25   SER n 
5 26   TYR n 
5 27   ARG n 
5 28   ARG n 
5 29   ALA n 
5 30   LEU n 
5 31   GLN n 
5 32   ALA n 
5 33   ASP n 
5 34   VAL n 
5 35   PRO n 
5 36   PRO n 
5 37   GLU n 
5 38   LYS n 
5 39   ARG n 
5 40   GLU n 
5 41   ASN n 
5 42   VAL n 
5 43   GLY n 
5 44   ILE n 
5 45   GLN n 
5 46   ALA n 
5 47   ALA n 
5 48   PHE n 
5 49   ARG n 
5 50   GLU n 
5 51   THR n 
5 52   PHE n 
5 53   PRO n 
5 54   ILE n 
5 55   GLU n 
5 56   GLU n 
5 57   GLU n 
5 58   ASP n 
5 59   LYS n 
5 60   GLY n 
5 61   LYS n 
5 62   GLY n 
5 63   GLY n 
5 64   LEU n 
5 65   VAL n 
5 66   LEU n 
5 67   ASP n 
5 68   PHE n 
5 69   LEU n 
5 70   GLU n 
5 71   TYR n 
5 72   ARG n 
5 73   LEU n 
5 74   GLY n 
5 75   GLU n 
5 76   PRO n 
5 77   PRO n 
5 78   PHE n 
5 79   PRO n 
5 80   GLN n 
5 81   ASP n 
5 82   GLU n 
5 83   CYS n 
5 84   ARG n 
5 85   GLU n 
5 86   LYS n 
5 87   ASP n 
5 88   LEU n 
5 89   THR n 
5 90   TYR n 
5 91   GLN n 
5 92   ALA n 
5 93   PRO n 
5 94   LEU n 
5 95   TYR n 
5 96   ALA n 
5 97   ARG n 
5 98   LEU n 
5 99   GLN n 
5 100  LEU n 
5 101  ILE n 
5 102  HIS n 
5 103  LYS n 
5 104  ASP n 
5 105  THR n 
5 106  GLY n 
5 107  LEU n 
5 108  ILE n 
5 109  LYS n 
5 110  GLU n 
5 111  ASP n 
5 112  GLU n 
5 113  VAL n 
5 114  PHE n 
5 115  LEU n 
5 116  GLY n 
5 117  HIS n 
5 118  ILE n 
5 119  PRO n 
5 120  LEU n 
5 121  MET n 
5 122  THR n 
5 123  GLU n 
5 124  ASP n 
5 125  GLY n 
5 126  SER n 
5 127  PHE n 
5 128  ILE n 
5 129  ILE n 
5 130  ASN n 
5 131  GLY n 
5 132  ALA n 
5 133  ASP n 
5 134  ARG n 
5 135  VAL n 
5 136  ILE n 
5 137  VAL n 
5 138  SER n 
5 139  GLN n 
5 140  ILE n 
5 141  HIS n 
5 142  ARG n 
5 143  SER n 
5 144  PRO n 
5 145  GLY n 
5 146  VAL n 
5 147  TYR n 
5 148  PHE n 
5 149  THR n 
5 150  PRO n 
5 151  ASP n 
5 152  PRO n 
5 153  ALA n 
5 154  ARG n 
5 155  PRO n 
5 156  GLY n 
5 157  ARG n 
5 158  TYR n 
5 159  ILE n 
5 160  ALA n 
5 161  SER n 
5 162  ILE n 
5 163  ILE n 
5 164  PRO n 
5 165  LEU n 
5 166  PRO n 
5 167  LYS n 
5 168  ARG n 
5 169  GLY n 
5 170  PRO n 
5 171  TRP n 
5 172  ILE n 
5 173  ASP n 
5 174  LEU n 
5 175  GLU n 
5 176  VAL n 
5 177  GLU n 
5 178  PRO n 
5 179  ASN n 
5 180  GLY n 
5 181  VAL n 
5 182  VAL n 
5 183  SER n 
5 184  MET n 
5 185  LYS n 
5 186  VAL n 
5 187  ASN n 
5 188  LYS n 
5 189  ARG n 
5 190  LYS n 
5 191  PHE n 
5 192  PRO n 
5 193  LEU n 
5 194  VAL n 
5 195  LEU n 
5 196  LEU n 
5 197  LEU n 
5 198  ARG n 
5 199  VAL n 
5 200  LEU n 
5 201  GLY n 
5 202  TYR n 
5 203  ASP n 
5 204  GLN n 
5 205  GLU n 
5 206  THR n 
5 207  LEU n 
5 208  ALA n 
5 209  ARG n 
5 210  GLU n 
5 211  LEU n 
5 212  GLY n 
5 213  ALA n 
5 214  TYR n 
5 215  GLY n 
5 216  GLU n 
5 217  LEU n 
5 218  VAL n 
5 219  GLN n 
5 220  GLY n 
5 221  LEU n 
5 222  MET n 
5 223  ASP n 
5 224  GLU n 
5 225  SER n 
5 226  VAL n 
5 227  PHE n 
5 228  ALA n 
5 229  MET n 
5 230  ARG n 
5 231  PRO n 
5 232  GLU n 
5 233  GLU n 
5 234  ALA n 
5 235  LEU n 
5 236  ILE n 
5 237  ARG n 
5 238  LEU n 
5 239  PHE n 
5 240  THR n 
5 241  LEU n 
5 242  LEU n 
5 243  ARG n 
5 244  PRO n 
5 245  GLY n 
5 246  ASP n 
5 247  PRO n 
5 248  PRO n 
5 249  LYS n 
5 250  ARG n 
5 251  ASP n 
5 252  LYS n 
5 253  ALA n 
5 254  VAL n 
5 255  ALA n 
5 256  TYR n 
5 257  VAL n 
5 258  TYR n 
5 259  GLY n 
5 260  LEU n 
5 261  ILE n 
5 262  ALA n 
5 263  ASP n 
5 264  PRO n 
5 265  ARG n 
5 266  ARG n 
5 267  TYR n 
5 268  ASP n 
5 269  LEU n 
5 270  GLY n 
5 271  GLU n 
5 272  ALA n 
5 273  GLY n 
5 274  ARG n 
5 275  TYR n 
5 276  LYS n 
5 277  ALA n 
5 278  GLU n 
5 279  GLU n 
5 280  LYS n 
5 281  LEU n 
5 282  GLY n 
5 283  ILE n 
5 284  ARG n 
5 285  LEU n 
5 286  SER n 
5 287  GLY n 
5 288  ARG n 
5 289  THR n 
5 290  LEU n 
5 291  ALA n 
5 292  ARG n 
5 293  PHE n 
5 294  GLU n 
5 295  ASP n 
5 296  GLY n 
5 297  GLU n 
5 298  PHE n 
5 299  LYS n 
5 300  ASP n 
5 301  GLU n 
5 302  VAL n 
5 303  PHE n 
5 304  LEU n 
5 305  PRO n 
5 306  THR n 
5 307  LEU n 
5 308  ARG n 
5 309  TYR n 
5 310  LEU n 
5 311  PHE n 
5 312  ALA n 
5 313  LEU n 
5 314  THR n 
5 315  ALA n 
5 316  GLY n 
5 317  VAL n 
5 318  PRO n 
5 319  GLY n 
5 320  HIS n 
5 321  GLU n 
5 322  VAL n 
5 323  ASP n 
5 324  ASP n 
5 325  ILE n 
5 326  ASP n 
5 327  HIS n 
5 328  LEU n 
5 329  GLY n 
5 330  ASN n 
5 331  ARG n 
5 332  ARG n 
5 333  ILE n 
5 334  ARG n 
5 335  THR n 
5 336  VAL n 
5 337  GLY n 
5 338  GLU n 
5 339  LEU n 
5 340  MET n 
5 341  THR n 
5 342  ASP n 
5 343  GLN n 
5 344  PHE n 
5 345  ARG n 
5 346  VAL n 
5 347  GLY n 
5 348  LEU n 
5 349  ALA n 
5 350  ARG n 
5 351  LEU n 
5 352  ALA n 
5 353  ARG n 
5 354  GLY n 
5 355  VAL n 
5 356  ARG n 
5 357  GLU n 
5 358  ARG n 
5 359  MET n 
5 360  LEU n 
5 361  MET n 
5 362  GLY n 
5 363  SER n 
5 364  GLU n 
5 365  ASP n 
5 366  SER n 
5 367  LEU n 
5 368  THR n 
5 369  PRO n 
5 370  ALA n 
5 371  LYS n 
5 372  LEU n 
5 373  VAL n 
5 374  ASN n 
5 375  SER n 
5 376  ARG n 
5 377  PRO n 
5 378  LEU n 
5 379  GLU n 
5 380  ALA n 
5 381  ALA n 
5 382  ILE n 
5 383  ARG n 
5 384  GLU n 
5 385  PHE n 
5 386  PHE n 
5 387  SER n 
5 388  ARG n 
5 389  SER n 
5 390  GLN n 
5 391  LEU n 
5 392  SER n 
5 393  GLN n 
5 394  PHE n 
5 395  LYS n 
5 396  ASP n 
5 397  GLU n 
5 398  THR n 
5 399  ASN n 
5 400  PRO n 
5 401  LEU n 
5 402  SER n 
5 403  SER n 
5 404  LEU n 
5 405  ARG n 
5 406  HIS n 
5 407  LYS n 
5 408  ARG n 
5 409  ARG n 
5 410  ILE n 
5 411  SER n 
5 412  ALA n 
5 413  LEU n 
5 414  GLY n 
5 415  PRO n 
5 416  GLY n 
5 417  GLY n 
5 418  LEU n 
5 419  THR n 
5 420  ARG n 
5 421  GLU n 
5 422  ARG n 
5 423  ALA n 
5 424  GLY n 
5 425  PHE n 
5 426  ASP n 
5 427  VAL n 
5 428  ARG n 
5 429  ASP n 
5 430  VAL n 
5 431  HIS n 
5 432  ARG n 
5 433  THR n 
5 434  HIS n 
5 435  TYR n 
5 436  GLY n 
5 437  ARG n 
5 438  ILE n 
5 439  CYS n 
5 440  PRO n 
5 441  VAL n 
5 442  GLU n 
5 443  THR n 
5 444  PRO n 
5 445  GLU n 
5 446  GLY n 
5 447  ALA n 
5 448  ASN n 
5 449  ILE n 
5 450  GLY n 
5 451  LEU n 
5 452  ILE n 
5 453  THR n 
5 454  SER n 
5 455  LEU n 
5 456  ALA n 
5 457  ALA n 
5 458  TYR n 
5 459  ALA n 
5 460  ARG n 
5 461  VAL n 
5 462  ASP n 
5 463  GLU n 
5 464  LEU n 
5 465  GLY n 
5 466  PHE n 
5 467  ILE n 
5 468  ARG n 
5 469  THR n 
5 470  PRO n 
5 471  TYR n 
5 472  ARG n 
5 473  ARG n 
5 474  VAL n 
5 475  VAL n 
5 476  GLY n 
5 477  GLY n 
5 478  VAL n 
5 479  VAL n 
5 480  THR n 
5 481  ASP n 
5 482  GLU n 
5 483  VAL n 
5 484  VAL n 
5 485  TYR n 
5 486  MET n 
5 487  THR n 
5 488  ALA n 
5 489  THR n 
5 490  GLU n 
5 491  GLU n 
5 492  ASP n 
5 493  ARG n 
5 494  TYR n 
5 495  THR n 
5 496  ILE n 
5 497  ALA n 
5 498  GLN n 
5 499  ALA n 
5 500  ASN n 
5 501  THR n 
5 502  PRO n 
5 503  LEU n 
5 504  GLU n 
5 505  GLY n 
5 506  ASN n 
5 507  ARG n 
5 508  ILE n 
5 509  ALA n 
5 510  ALA n 
5 511  GLU n 
5 512  ARG n 
5 513  VAL n 
5 514  VAL n 
5 515  ALA n 
5 516  ARG n 
5 517  ARG n 
5 518  LYS n 
5 519  GLY n 
5 520  GLU n 
5 521  PRO n 
5 522  VAL n 
5 523  ILE n 
5 524  VAL n 
5 525  SER n 
5 526  PRO n 
5 527  GLU n 
5 528  GLU n 
5 529  VAL n 
5 530  GLU n 
5 531  PHE n 
5 532  MET n 
5 533  ASP n 
5 534  VAL n 
5 535  SER n 
5 536  PRO n 
5 537  LYS n 
5 538  GLN n 
5 539  VAL n 
5 540  PHE n 
5 541  SER n 
5 542  VAL n 
5 543  ASN n 
5 544  THR n 
5 545  ASN n 
5 546  LEU n 
5 547  ILE n 
5 548  PRO n 
5 549  PHE n 
5 550  LEU n 
5 551  GLU n 
5 552  HIS n 
5 553  ASP n 
5 554  ASP n 
5 555  ALA n 
5 556  ASN n 
5 557  ARG n 
5 558  ALA n 
5 559  LEU n 
5 560  MET n 
5 561  GLY n 
5 562  SER n 
5 563  ASN n 
5 564  MET n 
5 565  GLN n 
5 566  THR n 
5 567  GLN n 
5 568  ALA n 
5 569  VAL n 
5 570  PRO n 
5 571  LEU n 
5 572  ILE n 
5 573  ARG n 
5 574  ALA n 
5 575  GLN n 
5 576  ALA n 
5 577  PRO n 
5 578  VAL n 
5 579  VAL n 
5 580  MET n 
5 581  THR n 
5 582  GLY n 
5 583  LEU n 
5 584  GLU n 
5 585  GLU n 
5 586  ARG n 
5 587  VAL n 
5 588  VAL n 
5 589  ARG n 
5 590  ASP n 
5 591  SER n 
5 592  LEU n 
5 593  ALA n 
5 594  ALA n 
5 595  LEU n 
5 596  TYR n 
5 597  ALA n 
5 598  GLU n 
5 599  GLU n 
5 600  ASP n 
5 601  GLY n 
5 602  GLU n 
5 603  VAL n 
5 604  ALA n 
5 605  LYS n 
5 606  VAL n 
5 607  ASP n 
5 608  GLY n 
5 609  ASN n 
5 610  ARG n 
5 611  ILE n 
5 612  VAL n 
5 613  VAL n 
5 614  ARG n 
5 615  TYR n 
5 616  GLU n 
5 617  ASP n 
5 618  GLY n 
5 619  ARG n 
5 620  LEU n 
5 621  VAL n 
5 622  GLU n 
5 623  TYR n 
5 624  PRO n 
5 625  LEU n 
5 626  ARG n 
5 627  ARG n 
5 628  PHE n 
5 629  TYR n 
5 630  ARG n 
5 631  SER n 
5 632  ASN n 
5 633  GLN n 
5 634  GLY n 
5 635  THR n 
5 636  ALA n 
5 637  LEU n 
5 638  ASP n 
5 639  GLN n 
5 640  ARG n 
5 641  PRO n 
5 642  ARG n 
5 643  VAL n 
5 644  VAL n 
5 645  VAL n 
5 646  GLY n 
5 647  GLN n 
5 648  ARG n 
5 649  VAL n 
5 650  ARG n 
5 651  LYS n 
5 652  GLY n 
5 653  ASP n 
5 654  LEU n 
5 655  LEU n 
5 656  ALA n 
5 657  ASP n 
5 658  GLY n 
5 659  PRO n 
5 660  ALA n 
5 661  SER n 
5 662  GLU n 
5 663  ASN n 
5 664  GLY n 
5 665  PHE n 
5 666  LEU n 
5 667  ALA n 
5 668  LEU n 
5 669  GLY n 
5 670  GLN n 
5 671  ASN n 
5 672  VAL n 
5 673  LEU n 
5 674  VAL n 
5 675  ALA n 
5 676  ILE n 
5 677  MET n 
5 678  PRO n 
5 679  PHE n 
5 680  ASP n 
5 681  GLY n 
5 682  TYR n 
5 683  ASN n 
5 684  PHE n 
5 685  GLU n 
5 686  ASP n 
5 687  ALA n 
5 688  ILE n 
5 689  VAL n 
5 690  ILE n 
5 691  SER n 
5 692  GLU n 
5 693  GLU n 
5 694  LEU n 
5 695  LEU n 
5 696  LYS n 
5 697  ARG n 
5 698  ASP n 
5 699  PHE n 
5 700  TYR n 
5 701  THR n 
5 702  SER n 
5 703  ILE n 
5 704  HIS n 
5 705  ILE n 
5 706  GLU n 
5 707  ARG n 
5 708  TYR n 
5 709  GLU n 
5 710  ILE n 
5 711  GLU n 
5 712  ALA n 
5 713  ARG n 
5 714  ASP n 
5 715  THR n 
5 716  LYS n 
5 717  LEU n 
5 718  GLY n 
5 719  PRO n 
5 720  GLU n 
5 721  ARG n 
5 722  ILE n 
5 723  THR n 
5 724  ARG n 
5 725  ASP n 
5 726  ILE n 
5 727  PRO n 
5 728  HIS n 
5 729  LEU n 
5 730  SER n 
5 731  GLU n 
5 732  ALA n 
5 733  ALA n 
5 734  LEU n 
5 735  ARG n 
5 736  ASP n 
5 737  LEU n 
5 738  ASP n 
5 739  GLU n 
5 740  GLU n 
5 741  GLY n 
5 742  VAL n 
5 743  VAL n 
5 744  ARG n 
5 745  ILE n 
5 746  GLY n 
5 747  ALA n 
5 748  GLU n 
5 749  VAL n 
5 750  LYS n 
5 751  PRO n 
5 752  GLY n 
5 753  ASP n 
5 754  ILE n 
5 755  LEU n 
5 756  VAL n 
5 757  GLY n 
5 758  ARG n 
5 759  THR n 
5 760  SER n 
5 761  PHE n 
5 762  LYS n 
5 763  GLY n 
5 764  GLU n 
5 765  SER n 
5 766  GLU n 
5 767  PRO n 
5 768  THR n 
5 769  PRO n 
5 770  GLU n 
5 771  GLU n 
5 772  ARG n 
5 773  LEU n 
5 774  LEU n 
5 775  ARG n 
5 776  SER n 
5 777  ILE n 
5 778  PHE n 
5 779  GLY n 
5 780  GLU n 
5 781  LYS n 
5 782  ALA n 
5 783  ARG n 
5 784  ASP n 
5 785  VAL n 
5 786  LYS n 
5 787  ASP n 
5 788  THR n 
5 789  SER n 
5 790  LEU n 
5 791  ARG n 
5 792  VAL n 
5 793  PRO n 
5 794  PRO n 
5 795  GLY n 
5 796  GLU n 
5 797  GLY n 
5 798  GLY n 
5 799  ILE n 
5 800  VAL n 
5 801  VAL n 
5 802  ARG n 
5 803  THR n 
5 804  VAL n 
5 805  ARG n 
5 806  LEU n 
5 807  ARG n 
5 808  ARG n 
5 809  GLY n 
5 810  ASP n 
5 811  PRO n 
5 812  GLY n 
5 813  VAL n 
5 814  GLU n 
5 815  LEU n 
5 816  LYS n 
5 817  PRO n 
5 818  GLY n 
5 819  VAL n 
5 820  ARG n 
5 821  GLU n 
5 822  VAL n 
5 823  VAL n 
5 824  ARG n 
5 825  VAL n 
5 826  TYR n 
5 827  VAL n 
5 828  ALA n 
5 829  GLN n 
5 830  LYS n 
5 831  ARG n 
5 832  LYS n 
5 833  LEU n 
5 834  GLN n 
5 835  VAL n 
5 836  GLY n 
5 837  ASP n 
5 838  LYS n 
5 839  LEU n 
5 840  ALA n 
5 841  ASN n 
5 842  ARG n 
5 843  HIS n 
5 844  GLY n 
5 845  ASN n 
5 846  LYS n 
5 847  GLY n 
5 848  VAL n 
5 849  VAL n 
5 850  ALA n 
5 851  LYS n 
5 852  ILE n 
5 853  LEU n 
5 854  PRO n 
5 855  VAL n 
5 856  GLU n 
5 857  ASP n 
5 858  MET n 
5 859  PRO n 
5 860  HIS n 
5 861  LEU n 
5 862  PRO n 
5 863  ASP n 
5 864  GLY n 
5 865  THR n 
5 866  PRO n 
5 867  VAL n 
5 868  ASP n 
5 869  VAL n 
5 870  ILE n 
5 871  LEU n 
5 872  ASN n 
5 873  PRO n 
5 874  LEU n 
5 875  GLY n 
5 876  VAL n 
5 877  PRO n 
5 878  SER n 
5 879  ARG n 
5 880  MET n 
5 881  ASN n 
5 882  LEU n 
5 883  GLY n 
5 884  GLN n 
5 885  ILE n 
5 886  LEU n 
5 887  GLU n 
5 888  THR n 
5 889  HIS n 
5 890  LEU n 
5 891  GLY n 
5 892  LEU n 
5 893  ALA n 
5 894  GLY n 
5 895  TYR n 
5 896  PHE n 
5 897  LEU n 
5 898  GLY n 
5 899  GLN n 
5 900  ARG n 
5 901  TYR n 
5 902  ILE n 
5 903  SER n 
5 904  PRO n 
5 905  ILE n 
5 906  PHE n 
5 907  ASP n 
5 908  GLY n 
5 909  ALA n 
5 910  LYS n 
5 911  GLU n 
5 912  PRO n 
5 913  GLU n 
5 914  ILE n 
5 915  LYS n 
5 916  GLU n 
5 917  LEU n 
5 918  LEU n 
5 919  ALA n 
5 920  GLN n 
5 921  ALA n 
5 922  PHE n 
5 923  GLU n 
5 924  VAL n 
5 925  TYR n 
5 926  PHE n 
5 927  GLY n 
5 928  LYS n 
5 929  ARG n 
5 930  LYS n 
5 931  GLY n 
5 932  GLU n 
5 933  GLY n 
5 934  PHE n 
5 935  GLY n 
5 936  VAL n 
5 937  ASP n 
5 938  LYS n 
5 939  ARG n 
5 940  GLU n 
5 941  VAL n 
5 942  GLU n 
5 943  VAL n 
5 944  LEU n 
5 945  ARG n 
5 946  ARG n 
5 947  ALA n 
5 948  GLU n 
5 949  LYS n 
5 950  LEU n 
5 951  GLY n 
5 952  LEU n 
5 953  VAL n 
5 954  THR n 
5 955  PRO n 
5 956  GLY n 
5 957  LYS n 
5 958  THR n 
5 959  PRO n 
5 960  GLU n 
5 961  GLU n 
5 962  GLN n 
5 963  LEU n 
5 964  LYS n 
5 965  GLU n 
5 966  LEU n 
5 967  PHE n 
5 968  LEU n 
5 969  GLN n 
5 970  GLY n 
5 971  LYS n 
5 972  VAL n 
5 973  VAL n 
5 974  LEU n 
5 975  TYR n 
5 976  ASP n 
5 977  GLY n 
5 978  ARG n 
5 979  THR n 
5 980  GLY n 
5 981  GLU n 
5 982  PRO n 
5 983  ILE n 
5 984  GLU n 
5 985  GLY n 
5 986  PRO n 
5 987  ILE n 
5 988  VAL n 
5 989  VAL n 
5 990  GLY n 
5 991  GLN n 
5 992  MET n 
5 993  PHE n 
5 994  ILE n 
5 995  MET n 
5 996  LYS n 
5 997  LEU n 
5 998  TYR n 
5 999  HIS n 
5 1000 MET n 
5 1001 VAL n 
5 1002 GLU n 
5 1003 ASP n 
5 1004 LYS n 
5 1005 MET n 
5 1006 HIS n 
5 1007 ALA n 
5 1008 ARG n 
5 1009 SER n 
5 1010 THR n 
5 1011 GLY n 
5 1012 PRO n 
5 1013 TYR n 
5 1014 SER n 
5 1015 LEU n 
5 1016 ILE n 
5 1017 THR n 
5 1018 GLN n 
5 1019 GLN n 
5 1020 PRO n 
5 1021 LEU n 
5 1022 GLY n 
5 1023 GLY n 
5 1024 LYS n 
5 1025 ALA n 
5 1026 GLN n 
5 1027 PHE n 
5 1028 GLY n 
5 1029 GLY n 
5 1030 GLN n 
5 1031 ARG n 
5 1032 PHE n 
5 1033 GLY n 
5 1034 GLU n 
5 1035 MET n 
5 1036 GLU n 
5 1037 VAL n 
5 1038 TRP n 
5 1039 ALA n 
5 1040 LEU n 
5 1041 GLU n 
5 1042 ALA n 
5 1043 TYR n 
5 1044 GLY n 
5 1045 ALA n 
5 1046 ALA n 
5 1047 HIS n 
5 1048 THR n 
5 1049 LEU n 
5 1050 GLN n 
5 1051 GLU n 
5 1052 MET n 
5 1053 LEU n 
5 1054 THR n 
5 1055 LEU n 
5 1056 LYS n 
5 1057 SER n 
5 1058 ASP n 
5 1059 ASP n 
5 1060 ILE n 
5 1061 GLU n 
5 1062 GLY n 
5 1063 ARG n 
5 1064 ASN n 
5 1065 ALA n 
5 1066 ALA n 
5 1067 TYR n 
5 1068 GLU n 
5 1069 ALA n 
5 1070 ILE n 
5 1071 ILE n 
5 1072 LYS n 
5 1073 GLY n 
5 1074 GLU n 
5 1075 ASP n 
5 1076 VAL n 
5 1077 PRO n 
5 1078 GLU n 
5 1079 PRO n 
5 1080 SER n 
5 1081 VAL n 
5 1082 PRO n 
5 1083 GLU n 
5 1084 SER n 
5 1085 PHE n 
5 1086 ARG n 
5 1087 VAL n 
5 1088 LEU n 
5 1089 VAL n 
5 1090 LYS n 
5 1091 GLU n 
5 1092 LEU n 
5 1093 GLN n 
5 1094 ALA n 
5 1095 LEU n 
5 1096 ALA n 
5 1097 LEU n 
5 1098 ASP n 
5 1099 VAL n 
5 1100 GLN n 
5 1101 THR n 
5 1102 LEU n 
5 1103 ASP n 
5 1104 GLU n 
5 1105 LYS n 
5 1106 ASP n 
5 1107 ASN n 
5 1108 PRO n 
5 1109 VAL n 
5 1110 ASP n 
5 1111 ILE n 
5 1112 PHE n 
5 1113 GLU n 
5 1114 GLY n 
5 1115 LEU n 
5 1116 ALA n 
5 1117 SER n 
5 1118 LYS n 
5 1119 ARG n 
6 1    MET n 
6 2    LYS n 
6 3    LYS n 
6 4    GLU n 
6 5    VAL n 
6 6    ARG n 
6 7    LYS n 
6 8    VAL n 
6 9    ARG n 
6 10   ILE n 
6 11   ALA n 
6 12   LEU n 
6 13   ALA n 
6 14   SER n 
6 15   PRO n 
6 16   GLU n 
6 17   LYS n 
6 18   ILE n 
6 19   ARG n 
6 20   SER n 
6 21   TRP n 
6 22   SER n 
6 23   TYR n 
6 24   GLY n 
6 25   GLU n 
6 26   VAL n 
6 27   GLU n 
6 28   LYS n 
6 29   PRO n 
6 30   GLU n 
6 31   THR n 
6 32   ILE n 
6 33   ASN n 
6 34   TYR n 
6 35   ARG n 
6 36   THR n 
6 37   LEU n 
6 38   LYS n 
6 39   PRO n 
6 40   GLU n 
6 41   ARG n 
6 42   ASP n 
6 43   GLY n 
6 44   LEU n 
6 45   PHE n 
6 46   ASP n 
6 47   GLU n 
6 48   ARG n 
6 49   ILE n 
6 50   PHE n 
6 51   GLY n 
6 52   PRO n 
6 53   ILE n 
6 54   LYS n 
6 55   ASP n 
6 56   TYR n 
6 57   GLU n 
6 58   CYS n 
6 59   ALA n 
6 60   CYS n 
6 61   GLY n 
6 62   LYS n 
6 63   TYR n 
6 64   LYS n 
6 65   ARG n 
6 66   GLN n 
6 67   ARG n 
6 68   PHE n 
6 69   GLU n 
6 70   GLY n 
6 71   LYS n 
6 72   VAL n 
6 73   CYS n 
6 74   GLU n 
6 75   ARG n 
6 76   CYS n 
6 77   GLY n 
6 78   VAL n 
6 79   GLU n 
6 80   VAL n 
6 81   THR n 
6 82   LYS n 
6 83   SER n 
6 84   ILE n 
6 85   VAL n 
6 86   ARG n 
6 87   ARG n 
6 88   TYR n 
6 89   ARG n 
6 90   MET n 
6 91   GLY n 
6 92   HIS n 
6 93   ILE n 
6 94   GLU n 
6 95   LEU n 
6 96   ALA n 
6 97   THR n 
6 98   PRO n 
6 99   ALA n 
6 100  ALA n 
6 101  HIS n 
6 102  ILE n 
6 103  TRP n 
6 104  PHE n 
6 105  VAL n 
6 106  LYS n 
6 107  ASP n 
6 108  VAL n 
6 109  PRO n 
6 110  SER n 
6 111  LYS n 
6 112  ILE n 
6 113  GLY n 
6 114  THR n 
6 115  LEU n 
6 116  LEU n 
6 117  ASP n 
6 118  LEU n 
6 119  SER n 
6 120  ALA n 
6 121  THR n 
6 122  GLU n 
6 123  LEU n 
6 124  GLU n 
6 125  GLN n 
6 126  VAL n 
6 127  LEU n 
6 128  TYR n 
6 129  PHE n 
6 130  SER n 
6 131  LYS n 
6 132  TYR n 
6 133  ILE n 
6 134  VAL n 
6 135  LEU n 
6 136  ASP n 
6 137  PRO n 
6 138  LYS n 
6 139  GLY n 
6 140  ALA n 
6 141  ILE n 
6 142  LEU n 
6 143  ASN n 
6 144  GLY n 
6 145  VAL n 
6 146  PRO n 
6 147  VAL n 
6 148  GLU n 
6 149  LYS n 
6 150  ARG n 
6 151  GLN n 
6 152  LEU n 
6 153  LEU n 
6 154  THR n 
6 155  ASP n 
6 156  GLU n 
6 157  GLU n 
6 158  TYR n 
6 159  ARG n 
6 160  GLU n 
6 161  LEU n 
6 162  ARG n 
6 163  TYR n 
6 164  GLY n 
6 165  LYS n 
6 166  GLN n 
6 167  GLU n 
6 168  THR n 
6 169  TYR n 
6 170  PRO n 
6 171  LEU n 
6 172  PRO n 
6 173  PRO n 
6 174  GLY n 
6 175  VAL n 
6 176  ASP n 
6 177  ALA n 
6 178  LEU n 
6 179  VAL n 
6 180  LYS n 
6 181  ASP n 
6 182  GLY n 
6 183  GLU n 
6 184  GLU n 
6 185  VAL n 
6 186  VAL n 
6 187  LYS n 
6 188  GLY n 
6 189  GLN n 
6 190  GLU n 
6 191  LEU n 
6 192  ALA n 
6 193  PRO n 
6 194  GLY n 
6 195  VAL n 
6 196  VAL n 
6 197  SER n 
6 198  ARG n 
6 199  LEU n 
6 200  ASP n 
6 201  GLY n 
6 202  VAL n 
6 203  ALA n 
6 204  LEU n 
6 205  TYR n 
6 206  ARG n 
6 207  PHE n 
6 208  PRO n 
6 209  ARG n 
6 210  ARG n 
6 211  VAL n 
6 212  ARG n 
6 213  VAL n 
6 214  GLU n 
6 215  TYR n 
6 216  VAL n 
6 217  LYS n 
6 218  LYS n 
6 219  GLU n 
6 220  ARG n 
6 221  ALA n 
6 222  GLY n 
6 223  LEU n 
6 224  ARG n 
6 225  LEU n 
6 226  PRO n 
6 227  LEU n 
6 228  ALA n 
6 229  ALA n 
6 230  TRP n 
6 231  VAL n 
6 232  GLU n 
6 233  LYS n 
6 234  GLU n 
6 235  ALA n 
6 236  TYR n 
6 237  LYS n 
6 238  PRO n 
6 239  GLY n 
6 240  GLU n 
6 241  ILE n 
6 242  LEU n 
6 243  ALA n 
6 244  GLU n 
6 245  LEU n 
6 246  PRO n 
6 247  GLU n 
6 248  PRO n 
6 249  TYR n 
6 250  LEU n 
6 251  PHE n 
6 252  ARG n 
6 253  ALA n 
6 254  GLU n 
6 255  GLU n 
6 256  GLU n 
6 257  GLY n 
6 258  VAL n 
6 259  VAL n 
6 260  GLU n 
6 261  LEU n 
6 262  LYS n 
6 263  GLU n 
6 264  LEU n 
6 265  GLU n 
6 266  GLU n 
6 267  GLY n 
6 268  ALA n 
6 269  PHE n 
6 270  LEU n 
6 271  VAL n 
6 272  LEU n 
6 273  ARG n 
6 274  ARG n 
6 275  GLU n 
6 276  ASP n 
6 277  GLU n 
6 278  PRO n 
6 279  VAL n 
6 280  ALA n 
6 281  THR n 
6 282  TYR n 
6 283  PHE n 
6 284  LEU n 
6 285  PRO n 
6 286  VAL n 
6 287  GLY n 
6 288  MET n 
6 289  THR n 
6 290  PRO n 
6 291  LEU n 
6 292  VAL n 
6 293  VAL n 
6 294  HIS n 
6 295  GLY n 
6 296  GLU n 
6 297  ILE n 
6 298  VAL n 
6 299  GLU n 
6 300  LYS n 
6 301  GLY n 
6 302  GLN n 
6 303  PRO n 
6 304  LEU n 
6 305  ALA n 
6 306  GLU n 
6 307  ALA n 
6 308  LYS n 
6 309  GLY n 
6 310  LEU n 
6 311  LEU n 
6 312  ARG n 
6 313  MET n 
6 314  PRO n 
6 315  ARG n 
6 316  GLN n 
6 317  VAL n 
6 318  ARG n 
6 319  ALA n 
6 320  ALA n 
6 321  GLN n 
6 322  VAL n 
6 323  GLU n 
6 324  ALA n 
6 325  GLU n 
6 326  GLU n 
6 327  GLU n 
6 328  GLY n 
6 329  GLU n 
6 330  THR n 
6 331  VAL n 
6 332  TYR n 
6 333  LEU n 
6 334  THR n 
6 335  LEU n 
6 336  PHE n 
6 337  LEU n 
6 338  GLU n 
6 339  TRP n 
6 340  THR n 
6 341  GLU n 
6 342  PRO n 
6 343  LYS n 
6 344  ASP n 
6 345  TYR n 
6 346  ARG n 
6 347  VAL n 
6 348  GLN n 
6 349  PRO n 
6 350  HIS n 
6 351  MET n 
6 352  ASN n 
6 353  VAL n 
6 354  VAL n 
6 355  VAL n 
6 356  PRO n 
6 357  GLU n 
6 358  GLY n 
6 359  ALA n 
6 360  ARG n 
6 361  VAL n 
6 362  GLU n 
6 363  ALA n 
6 364  GLY n 
6 365  ASP n 
6 366  LYS n 
6 367  ILE n 
6 368  VAL n 
6 369  ALA n 
6 370  ALA n 
6 371  ILE n 
6 372  ASP n 
6 373  PRO n 
6 374  GLU n 
6 375  GLU n 
6 376  GLU n 
6 377  VAL n 
6 378  ILE n 
6 379  ALA n 
6 380  GLU n 
6 381  ALA n 
6 382  GLU n 
6 383  GLY n 
6 384  VAL n 
6 385  VAL n 
6 386  HIS n 
6 387  LEU n 
6 388  HIS n 
6 389  GLU n 
6 390  PRO n 
6 391  ALA n 
6 392  SER n 
6 393  ILE n 
6 394  LEU n 
6 395  VAL n 
6 396  VAL n 
6 397  LYS n 
6 398  ALA n 
6 399  ARG n 
6 400  VAL n 
6 401  TYR n 
6 402  PRO n 
6 403  PHE n 
6 404  GLU n 
6 405  ASP n 
6 406  ASP n 
6 407  VAL n 
6 408  GLU n 
6 409  VAL n 
6 410  SER n 
6 411  THR n 
6 412  GLY n 
6 413  ASP n 
6 414  ARG n 
6 415  VAL n 
6 416  ALA n 
6 417  PRO n 
6 418  GLY n 
6 419  ASP n 
6 420  VAL n 
6 421  LEU n 
6 422  ALA n 
6 423  ASP n 
6 424  GLY n 
6 425  GLY n 
6 426  LYS n 
6 427  VAL n 
6 428  LYS n 
6 429  SER n 
6 430  ASP n 
6 431  VAL n 
6 432  TYR n 
6 433  GLY n 
6 434  ARG n 
6 435  VAL n 
6 436  GLU n 
6 437  VAL n 
6 438  ASP n 
6 439  LEU n 
6 440  VAL n 
6 441  ARG n 
6 442  ASN n 
6 443  VAL n 
6 444  VAL n 
6 445  ARG n 
6 446  VAL n 
6 447  VAL n 
6 448  GLU n 
6 449  SER n 
6 450  TYR n 
6 451  ASP n 
6 452  ILE n 
6 453  ASP n 
6 454  ALA n 
6 455  ARG n 
6 456  MET n 
6 457  GLY n 
6 458  ALA n 
6 459  GLU n 
6 460  ALA n 
6 461  ILE n 
6 462  GLN n 
6 463  GLN n 
6 464  LEU n 
6 465  LEU n 
6 466  LYS n 
6 467  GLU n 
6 468  LEU n 
6 469  ASP n 
6 470  LEU n 
6 471  GLU n 
6 472  ALA n 
6 473  LEU n 
6 474  GLU n 
6 475  LYS n 
6 476  GLU n 
6 477  LEU n 
6 478  LEU n 
6 479  GLU n 
6 480  GLU n 
6 481  MET n 
6 482  LYS n 
6 483  HIS n 
6 484  PRO n 
6 485  SER n 
6 486  ARG n 
6 487  ALA n 
6 488  ARG n 
6 489  ARG n 
6 490  ALA n 
6 491  LYS n 
6 492  ALA n 
6 493  ARG n 
6 494  LYS n 
6 495  ARG n 
6 496  LEU n 
6 497  GLU n 
6 498  VAL n 
6 499  VAL n 
6 500  ARG n 
6 501  ALA n 
6 502  PHE n 
6 503  LEU n 
6 504  ASP n 
6 505  SER n 
6 506  GLY n 
6 507  ASN n 
6 508  ARG n 
6 509  PRO n 
6 510  GLU n 
6 511  TRP n 
6 512  MET n 
6 513  ILE n 
6 514  LEU n 
6 515  GLU n 
6 516  ALA n 
6 517  VAL n 
6 518  PRO n 
6 519  VAL n 
6 520  LEU n 
6 521  PRO n 
6 522  PRO n 
6 523  ASP n 
6 524  LEU n 
6 525  ARG n 
6 526  PRO n 
6 527  MET n 
6 528  VAL n 
6 529  GLN n 
6 530  VAL n 
6 531  ASP n 
6 532  GLY n 
6 533  GLY n 
6 534  ARG n 
6 535  PHE n 
6 536  ALA n 
6 537  THR n 
6 538  SER n 
6 539  ASP n 
6 540  LEU n 
6 541  ASN n 
6 542  ASP n 
6 543  LEU n 
6 544  TYR n 
6 545  ARG n 
6 546  ARG n 
6 547  LEU n 
6 548  ILE n 
6 549  ASN n 
6 550  ARG n 
6 551  ASN n 
6 552  ASN n 
6 553  ARG n 
6 554  LEU n 
6 555  LYS n 
6 556  LYS n 
6 557  LEU n 
6 558  LEU n 
6 559  ALA n 
6 560  GLN n 
6 561  GLY n 
6 562  ALA n 
6 563  PRO n 
6 564  GLU n 
6 565  ILE n 
6 566  ILE n 
6 567  ILE n 
6 568  ARG n 
6 569  ASN n 
6 570  GLU n 
6 571  LYS n 
6 572  ARG n 
6 573  MET n 
6 574  LEU n 
6 575  GLN n 
6 576  GLU n 
6 577  ALA n 
6 578  VAL n 
6 579  ASP n 
6 580  ALA n 
6 581  LEU n 
6 582  LEU n 
6 583  ASP n 
6 584  ASN n 
6 585  GLY n 
6 586  ARG n 
6 587  ARG n 
6 588  GLY n 
6 589  ALA n 
6 590  PRO n 
6 591  VAL n 
6 592  THR n 
6 593  ASN n 
6 594  PRO n 
6 595  GLY n 
6 596  SER n 
6 597  ASP n 
6 598  ARG n 
6 599  PRO n 
6 600  LEU n 
6 601  ARG n 
6 602  SER n 
6 603  LEU n 
6 604  THR n 
6 605  ASP n 
6 606  ILE n 
6 607  LEU n 
6 608  SER n 
6 609  GLY n 
6 610  LYS n 
6 611  GLN n 
6 612  GLY n 
6 613  ARG n 
6 614  PHE n 
6 615  ARG n 
6 616  GLN n 
6 617  ASN n 
6 618  LEU n 
6 619  LEU n 
6 620  GLY n 
6 621  LYS n 
6 622  ARG n 
6 623  VAL n 
6 624  ASP n 
6 625  TYR n 
6 626  SER n 
6 627  GLY n 
6 628  ARG n 
6 629  SER n 
6 630  VAL n 
6 631  ILE n 
6 632  VAL n 
6 633  VAL n 
6 634  GLY n 
6 635  PRO n 
6 636  GLN n 
6 637  LEU n 
6 638  LYS n 
6 639  LEU n 
6 640  HIS n 
6 641  GLN n 
6 642  CYS n 
6 643  GLY n 
6 644  LEU n 
6 645  PRO n 
6 646  LYS n 
6 647  ARG n 
6 648  MET n 
6 649  ALA n 
6 650  LEU n 
6 651  GLU n 
6 652  LEU n 
6 653  PHE n 
6 654  LYS n 
6 655  PRO n 
6 656  PHE n 
6 657  LEU n 
6 658  LEU n 
6 659  LYS n 
6 660  LYS n 
6 661  MET n 
6 662  GLU n 
6 663  GLU n 
6 664  LYS n 
6 665  GLY n 
6 666  ILE n 
6 667  ALA n 
6 668  PRO n 
6 669  ASN n 
6 670  VAL n 
6 671  LYS n 
6 672  ALA n 
6 673  ALA n 
6 674  ARG n 
6 675  ARG n 
6 676  MET n 
6 677  LEU n 
6 678  GLU n 
6 679  ARG n 
6 680  GLN n 
6 681  ARG n 
6 682  ASP n 
6 683  ILE n 
6 684  LYS n 
6 685  ASP n 
6 686  GLU n 
6 687  VAL n 
6 688  TRP n 
6 689  ASP n 
6 690  ALA n 
6 691  LEU n 
6 692  GLU n 
6 693  GLU n 
6 694  VAL n 
6 695  ILE n 
6 696  HIS n 
6 697  GLY n 
6 698  LYS n 
6 699  VAL n 
6 700  VAL n 
6 701  LEU n 
6 702  LEU n 
6 703  ASN n 
6 704  ARG n 
6 705  ALA n 
6 706  PRO n 
6 707  THR n 
6 708  LEU n 
6 709  HIS n 
6 710  ARG n 
6 711  LEU n 
6 712  GLY n 
6 713  ILE n 
6 714  GLN n 
6 715  ALA n 
6 716  PHE n 
6 717  GLN n 
6 718  PRO n 
6 719  VAL n 
6 720  LEU n 
6 721  VAL n 
6 722  GLU n 
6 723  GLY n 
6 724  GLN n 
6 725  SER n 
6 726  ILE n 
6 727  GLN n 
6 728  LEU n 
6 729  HIS n 
6 730  PRO n 
6 731  LEU n 
6 732  VAL n 
6 733  CYS n 
6 734  GLU n 
6 735  ALA n 
6 736  PHE n 
6 737  ASN n 
6 738  ALA n 
6 739  ASP n 
6 740  PHE n 
6 741  ASP n 
6 742  GLY n 
6 743  ASP n 
6 744  GLN n 
6 745  MET n 
6 746  ALA n 
6 747  VAL n 
6 748  HIS n 
6 749  VAL n 
6 750  PRO n 
6 751  LEU n 
6 752  SER n 
6 753  SER n 
6 754  PHE n 
6 755  ALA n 
6 756  GLN n 
6 757  ALA n 
6 758  GLU n 
6 759  ALA n 
6 760  ARG n 
6 761  ILE n 
6 762  GLN n 
6 763  MET n 
6 764  LEU n 
6 765  SER n 
6 766  ALA n 
6 767  HIS n 
6 768  ASN n 
6 769  LEU n 
6 770  LEU n 
6 771  SER n 
6 772  PRO n 
6 773  ALA n 
6 774  SER n 
6 775  GLY n 
6 776  GLU n 
6 777  PRO n 
6 778  LEU n 
6 779  ALA n 
6 780  LYS n 
6 781  PRO n 
6 782  SER n 
6 783  ARG n 
6 784  ASP n 
6 785  ILE n 
6 786  ILE n 
6 787  LEU n 
6 788  GLY n 
6 789  LEU n 
6 790  TYR n 
6 791  TYR n 
6 792  ILE n 
6 793  THR n 
6 794  GLN n 
6 795  VAL n 
6 796  ARG n 
6 797  LYS n 
6 798  GLU n 
6 799  LYS n 
6 800  LYS n 
6 801  GLY n 
6 802  ALA n 
6 803  GLY n 
6 804  LEU n 
6 805  GLU n 
6 806  PHE n 
6 807  ALA n 
6 808  THR n 
6 809  PRO n 
6 810  GLU n 
6 811  GLU n 
6 812  ALA n 
6 813  LEU n 
6 814  ALA n 
6 815  ALA n 
6 816  HIS n 
6 817  GLU n 
6 818  ARG n 
6 819  GLY n 
6 820  GLU n 
6 821  VAL n 
6 822  ALA n 
6 823  LEU n 
6 824  ASN n 
6 825  ALA n 
6 826  PRO n 
6 827  ILE n 
6 828  LYS n 
6 829  VAL n 
6 830  ALA n 
6 831  GLY n 
6 832  ARG n 
6 833  GLU n 
6 834  THR n 
6 835  SER n 
6 836  VAL n 
6 837  GLY n 
6 838  ARG n 
6 839  LEU n 
6 840  LYS n 
6 841  TYR n 
6 842  VAL n 
6 843  PHE n 
6 844  ALA n 
6 845  ASN n 
6 846  PRO n 
6 847  ASP n 
6 848  GLU n 
6 849  ALA n 
6 850  LEU n 
6 851  LEU n 
6 852  ALA n 
6 853  VAL n 
6 854  ALA n 
6 855  HIS n 
6 856  GLY n 
6 857  ILE n 
6 858  VAL n 
6 859  ASP n 
6 860  LEU n 
6 861  GLN n 
6 862  ASP n 
6 863  VAL n 
6 864  VAL n 
6 865  THR n 
6 866  VAL n 
6 867  ARG n 
6 868  TYR n 
6 869  MET n 
6 870  GLY n 
6 871  LYS n 
6 872  ARG n 
6 873  LEU n 
6 874  GLU n 
6 875  THR n 
6 876  SER n 
6 877  PRO n 
6 878  GLY n 
6 879  ARG n 
6 880  ILE n 
6 881  LEU n 
6 882  PHE n 
6 883  ALA n 
6 884  ARG n 
6 885  ILE n 
6 886  VAL n 
6 887  ALA n 
6 888  GLU n 
6 889  ALA n 
6 890  VAL n 
6 891  GLU n 
6 892  ASP n 
6 893  GLU n 
6 894  LYS n 
6 895  VAL n 
6 896  ALA n 
6 897  TRP n 
6 898  GLU n 
6 899  LEU n 
6 900  ILE n 
6 901  GLN n 
6 902  LEU n 
6 903  ASP n 
6 904  VAL n 
6 905  PRO n 
6 906  GLN n 
6 907  GLU n 
6 908  LYS n 
6 909  ASN n 
6 910  SER n 
6 911  LEU n 
6 912  LYS n 
6 913  ASP n 
6 914  LEU n 
6 915  VAL n 
6 916  TYR n 
6 917  GLN n 
6 918  ALA n 
6 919  PHE n 
6 920  LEU n 
6 921  ARG n 
6 922  LEU n 
6 923  GLY n 
6 924  MET n 
6 925  GLU n 
6 926  LYS n 
6 927  THR n 
6 928  ALA n 
6 929  ARG n 
6 930  LEU n 
6 931  LEU n 
6 932  ASP n 
6 933  ALA n 
6 934  LEU n 
6 935  LYS n 
6 936  TYR n 
6 937  TYR n 
6 938  GLY n 
6 939  PHE n 
6 940  THR n 
6 941  PHE n 
6 942  SER n 
6 943  THR n 
6 944  THR n 
6 945  SER n 
6 946  GLY n 
6 947  ILE n 
6 948  THR n 
6 949  ILE n 
6 950  GLY n 
6 951  ILE n 
6 952  ASP n 
6 953  ASP n 
6 954  ALA n 
6 955  VAL n 
6 956  ILE n 
6 957  PRO n 
6 958  GLU n 
6 959  GLU n 
6 960  LYS n 
6 961  LYS n 
6 962  GLN n 
6 963  TYR n 
6 964  LEU n 
6 965  GLU n 
6 966  GLU n 
6 967  ALA n 
6 968  ASP n 
6 969  ARG n 
6 970  LYS n 
6 971  LEU n 
6 972  LEU n 
6 973  GLN n 
6 974  ILE n 
6 975  GLU n 
6 976  GLN n 
6 977  ALA n 
6 978  TYR n 
6 979  GLU n 
6 980  MET n 
6 981  GLY n 
6 982  PHE n 
6 983  LEU n 
6 984  THR n 
6 985  ASP n 
6 986  ARG n 
6 987  GLU n 
6 988  ARG n 
6 989  TYR n 
6 990  ASP n 
6 991  GLN n 
6 992  ILE n 
6 993  LEU n 
6 994  GLN n 
6 995  LEU n 
6 996  TRP n 
6 997  THR n 
6 998  GLU n 
6 999  THR n 
6 1000 THR n 
6 1001 GLU n 
6 1002 LYS n 
6 1003 VAL n 
6 1004 THR n 
6 1005 GLN n 
6 1006 ALA n 
6 1007 VAL n 
6 1008 PHE n 
6 1009 LYS n 
6 1010 ASN n 
6 1011 PHE n 
6 1012 GLU n 
6 1013 GLU n 
6 1014 ASN n 
6 1015 TYR n 
6 1016 PRO n 
6 1017 PHE n 
6 1018 ASN n 
6 1019 PRO n 
6 1020 LEU n 
6 1021 TYR n 
6 1022 VAL n 
6 1023 MET n 
6 1024 ALA n 
6 1025 GLN n 
6 1026 SER n 
6 1027 GLY n 
6 1028 ALA n 
6 1029 ARG n 
6 1030 GLY n 
6 1031 ASN n 
6 1032 PRO n 
6 1033 GLN n 
6 1034 GLN n 
6 1035 ILE n 
6 1036 ARG n 
6 1037 GLN n 
6 1038 LEU n 
6 1039 CYS n 
6 1040 GLY n 
6 1041 LEU n 
6 1042 ARG n 
6 1043 GLY n 
6 1044 LEU n 
6 1045 MET n 
6 1046 GLN n 
6 1047 LYS n 
6 1048 PRO n 
6 1049 SER n 
6 1050 GLY n 
6 1051 GLU n 
6 1052 THR n 
6 1053 PHE n 
6 1054 GLU n 
6 1055 VAL n 
6 1056 PRO n 
6 1057 VAL n 
6 1058 ARG n 
6 1059 SER n 
6 1060 SER n 
6 1061 PHE n 
6 1062 ARG n 
6 1063 GLU n 
6 1064 GLY n 
6 1065 LEU n 
6 1066 THR n 
6 1067 VAL n 
6 1068 LEU n 
6 1069 GLU n 
6 1070 TYR n 
6 1071 PHE n 
6 1072 ILE n 
6 1073 SER n 
6 1074 SER n 
6 1075 HIS n 
6 1076 GLY n 
6 1077 ALA n 
6 1078 ARG n 
6 1079 LYS n 
6 1080 GLY n 
6 1081 GLY n 
6 1082 ALA n 
6 1083 ASP n 
6 1084 THR n 
6 1085 ALA n 
6 1086 LEU n 
6 1087 ARG n 
6 1088 THR n 
6 1089 ALA n 
6 1090 ASP n 
6 1091 SER n 
6 1092 GLY n 
6 1093 TYR n 
6 1094 LEU n 
6 1095 THR n 
6 1096 ARG n 
6 1097 LYS n 
6 1098 LEU n 
6 1099 VAL n 
6 1100 ASP n 
6 1101 VAL n 
6 1102 THR n 
6 1103 HIS n 
6 1104 GLU n 
6 1105 ILE n 
6 1106 VAL n 
6 1107 VAL n 
6 1108 ARG n 
6 1109 GLU n 
6 1110 ALA n 
6 1111 ASP n 
6 1112 CYS n 
6 1113 GLY n 
6 1114 THR n 
6 1115 THR n 
6 1116 ASN n 
6 1117 TYR n 
6 1118 ILE n 
6 1119 SER n 
6 1120 VAL n 
6 1121 PRO n 
6 1122 LEU n 
6 1123 PHE n 
6 1124 GLN n 
6 1125 PRO n 
6 1126 ASP n 
6 1127 GLU n 
6 1128 VAL n 
6 1129 THR n 
6 1130 ARG n 
6 1131 SER n 
6 1132 LEU n 
6 1133 ARG n 
6 1134 LEU n 
6 1135 ARG n 
6 1136 LYS n 
6 1137 ARG n 
6 1138 ALA n 
6 1139 ASP n 
6 1140 ILE n 
6 1141 GLU n 
6 1142 ALA n 
6 1143 GLY n 
6 1144 LEU n 
6 1145 TYR n 
6 1146 GLY n 
6 1147 ARG n 
6 1148 VAL n 
6 1149 LEU n 
6 1150 ALA n 
6 1151 ARG n 
6 1152 GLU n 
6 1153 VAL n 
6 1154 GLU n 
6 1155 VAL n 
6 1156 LEU n 
6 1157 GLY n 
6 1158 VAL n 
6 1159 ARG n 
6 1160 LEU n 
6 1161 GLU n 
6 1162 GLU n 
6 1163 GLY n 
6 1164 ARG n 
6 1165 TYR n 
6 1166 LEU n 
6 1167 SER n 
6 1168 MET n 
6 1169 ASP n 
6 1170 ASP n 
6 1171 VAL n 
6 1172 HIS n 
6 1173 LEU n 
6 1174 LEU n 
6 1175 ILE n 
6 1176 LYS n 
6 1177 ALA n 
6 1178 ALA n 
6 1179 GLU n 
6 1180 ALA n 
6 1181 GLY n 
6 1182 GLU n 
6 1183 ILE n 
6 1184 GLN n 
6 1185 GLU n 
6 1186 VAL n 
6 1187 PRO n 
6 1188 VAL n 
6 1189 ARG n 
6 1190 SER n 
6 1191 PRO n 
6 1192 LEU n 
6 1193 THR n 
6 1194 CYS n 
6 1195 GLN n 
6 1196 THR n 
6 1197 ARG n 
6 1198 TYR n 
6 1199 GLY n 
6 1200 VAL n 
6 1201 CYS n 
6 1202 GLN n 
6 1203 LYS n 
6 1204 CYS n 
6 1205 TYR n 
6 1206 GLY n 
6 1207 TYR n 
6 1208 ASP n 
6 1209 LEU n 
6 1210 SER n 
6 1211 MET n 
6 1212 ALA n 
6 1213 ARG n 
6 1214 PRO n 
6 1215 VAL n 
6 1216 SER n 
6 1217 ILE n 
6 1218 GLY n 
6 1219 GLU n 
6 1220 ALA n 
6 1221 VAL n 
6 1222 GLY n 
6 1223 ILE n 
6 1224 VAL n 
6 1225 ALA n 
6 1226 ALA n 
6 1227 GLN n 
6 1228 SER n 
6 1229 ILE n 
6 1230 GLY n 
6 1231 GLU n 
6 1232 PRO n 
6 1233 GLY n 
6 1234 THR n 
6 1235 GLN n 
6 1236 LEU n 
6 1237 THR n 
6 1238 MET n 
6 1239 ARG n 
6 1240 THR n 
6 1241 PHE n 
6 1242 HIS n 
6 1243 THR n 
6 1244 GLY n 
6 1245 GLY n 
6 1246 VAL n 
6 1247 ALA n 
6 1248 GLY n 
6 1249 ALA n 
6 1250 ALA n 
6 1251 ASP n 
6 1252 ILE n 
6 1253 THR n 
6 1254 GLN n 
6 1255 GLY n 
6 1256 LEU n 
6 1257 PRO n 
6 1258 ARG n 
6 1259 VAL n 
6 1260 ILE n 
6 1261 GLU n 
6 1262 LEU n 
6 1263 PHE n 
6 1264 GLU n 
6 1265 ALA n 
6 1266 ARG n 
6 1267 ARG n 
6 1268 PRO n 
6 1269 LYS n 
6 1270 ALA n 
6 1271 LYS n 
6 1272 ALA n 
6 1273 VAL n 
6 1274 ILE n 
6 1275 SER n 
6 1276 GLU n 
6 1277 ILE n 
6 1278 ASP n 
6 1279 GLY n 
6 1280 VAL n 
6 1281 VAL n 
6 1282 ARG n 
6 1283 ILE n 
6 1284 GLU n 
6 1285 GLU n 
6 1286 THR n 
6 1287 GLU n 
6 1288 GLU n 
6 1289 LYS n 
6 1290 LEU n 
6 1291 SER n 
6 1292 VAL n 
6 1293 PHE n 
6 1294 VAL n 
6 1295 GLU n 
6 1296 SER n 
6 1297 GLU n 
6 1298 GLY n 
6 1299 PHE n 
6 1300 SER n 
6 1301 LYS n 
6 1302 GLU n 
6 1303 TYR n 
6 1304 LYS n 
6 1305 LEU n 
6 1306 PRO n 
6 1307 LYS n 
6 1308 GLU n 
6 1309 ALA n 
6 1310 ARG n 
6 1311 LEU n 
6 1312 LEU n 
6 1313 VAL n 
6 1314 LYS n 
6 1315 ASP n 
6 1316 GLY n 
6 1317 ASP n 
6 1318 TYR n 
6 1319 VAL n 
6 1320 GLU n 
6 1321 ALA n 
6 1322 GLY n 
6 1323 GLN n 
6 1324 PRO n 
6 1325 LEU n 
6 1326 THR n 
6 1327 ARG n 
6 1328 GLY n 
6 1329 ALA n 
6 1330 ILE n 
6 1331 ASP n 
6 1332 PRO n 
6 1333 HIS n 
6 1334 GLN n 
6 1335 LEU n 
6 1336 LEU n 
6 1337 GLU n 
6 1338 ALA n 
6 1339 LYS n 
6 1340 GLY n 
6 1341 PRO n 
6 1342 GLU n 
6 1343 ALA n 
6 1344 VAL n 
6 1345 GLU n 
6 1346 ARG n 
6 1347 TYR n 
6 1348 LEU n 
6 1349 VAL n 
6 1350 GLU n 
6 1351 GLU n 
6 1352 ILE n 
6 1353 GLN n 
6 1354 LYS n 
6 1355 VAL n 
6 1356 TYR n 
6 1357 ARG n 
6 1358 ALA n 
6 1359 GLN n 
6 1360 GLY n 
6 1361 VAL n 
6 1362 LYS n 
6 1363 LEU n 
6 1364 HIS n 
6 1365 ASP n 
6 1366 LYS n 
6 1367 HIS n 
6 1368 ILE n 
6 1369 GLU n 
6 1370 ILE n 
6 1371 VAL n 
6 1372 VAL n 
6 1373 ARG n 
6 1374 GLN n 
6 1375 MET n 
6 1376 MET n 
6 1377 LYS n 
6 1378 TYR n 
6 1379 VAL n 
6 1380 GLU n 
6 1381 VAL n 
6 1382 THR n 
6 1383 ASP n 
6 1384 PRO n 
6 1385 GLY n 
6 1386 ASP n 
6 1387 SER n 
6 1388 ARG n 
6 1389 LEU n 
6 1390 LEU n 
6 1391 GLU n 
6 1392 GLY n 
6 1393 GLN n 
6 1394 VAL n 
6 1395 LEU n 
6 1396 GLU n 
6 1397 LYS n 
6 1398 TRP n 
6 1399 ASP n 
6 1400 VAL n 
6 1401 GLU n 
6 1402 ALA n 
6 1403 LEU n 
6 1404 ASN n 
6 1405 GLU n 
6 1406 ARG n 
6 1407 LEU n 
6 1408 ILE n 
6 1409 ALA n 
6 1410 GLU n 
6 1411 GLY n 
6 1412 LYS n 
6 1413 THR n 
6 1414 PRO n 
6 1415 VAL n 
6 1416 ALA n 
6 1417 TRP n 
6 1418 LYS n 
6 1419 PRO n 
6 1420 LEU n 
6 1421 LEU n 
6 1422 MET n 
6 1423 GLY n 
6 1424 VAL n 
6 1425 THR n 
6 1426 LYS n 
6 1427 SER n 
6 1428 ALA n 
6 1429 LEU n 
6 1430 SER n 
6 1431 THR n 
6 1432 LYS n 
6 1433 SER n 
6 1434 TRP n 
6 1435 LEU n 
6 1436 SER n 
6 1437 ALA n 
6 1438 ALA n 
6 1439 SER n 
6 1440 PHE n 
6 1441 GLN n 
6 1442 ASN n 
6 1443 THR n 
6 1444 THR n 
6 1445 HIS n 
6 1446 VAL n 
6 1447 LEU n 
6 1448 THR n 
6 1449 GLU n 
6 1450 ALA n 
6 1451 ALA n 
6 1452 ILE n 
6 1453 ALA n 
6 1454 GLY n 
6 1455 LYS n 
6 1456 LYS n 
6 1457 ASP n 
6 1458 GLU n 
6 1459 LEU n 
6 1460 ILE n 
6 1461 GLY n 
6 1462 LEU n 
6 1463 LYS n 
6 1464 GLU n 
6 1465 ASN n 
6 1466 VAL n 
6 1467 ILE n 
6 1468 LEU n 
6 1469 GLY n 
6 1470 ARG n 
6 1471 LEU n 
6 1472 ILE n 
6 1473 PRO n 
6 1474 ALA n 
6 1475 GLY n 
6 1476 THR n 
6 1477 GLY n 
6 1478 SER n 
6 1479 ASP n 
6 1480 PHE n 
6 1481 VAL n 
6 1482 ARG n 
6 1483 PHE n 
6 1484 THR n 
6 1485 GLN n 
6 1486 VAL n 
6 1487 VAL n 
6 1488 ASP n 
6 1489 GLN n 
6 1490 LYS n 
6 1491 THR n 
6 1492 LEU n 
6 1493 LYS n 
6 1494 ALA n 
6 1495 ILE n 
6 1496 GLU n 
6 1497 GLU n 
6 1498 ALA n 
6 1499 ARG n 
6 1500 LYS n 
6 1501 GLU n 
6 1502 ALA n 
6 1503 VAL n 
6 1504 GLU n 
6 1505 ALA n 
6 1506 LYS n 
6 1507 GLU n 
6 1508 ARG n 
6 1509 PRO n 
6 1510 ALA n 
6 1511 ALA n 
6 1512 ARG n 
6 1513 ARG n 
6 1514 GLY n 
6 1515 VAL n 
6 1516 LYS n 
6 1517 ARG n 
6 1518 GLU n 
6 1519 GLN n 
6 1520 PRO n 
6 1521 GLY n 
6 1522 LYS n 
6 1523 GLN n 
6 1524 ALA n 
7 1    MET n 
7 2    ALA n 
7 3    GLU n 
7 4    PRO n 
7 5    GLY n 
7 6    ILE n 
7 7    ASP n 
7 8    LYS n 
7 9    LEU n 
7 10   PHE n 
7 11   GLY n 
7 12   MET n 
7 13   VAL n 
7 14   ASP n 
7 15   SER n 
7 16   LYS n 
7 17   TYR n 
7 18   ARG n 
7 19   LEU n 
7 20   THR n 
7 21   VAL n 
7 22   VAL n 
7 23   VAL n 
7 24   ALA n 
7 25   LYS n 
7 26   ARG n 
7 27   ALA n 
7 28   GLN n 
7 29   GLN n 
7 30   LEU n 
7 31   LEU n 
7 32   ARG n 
7 33   HIS n 
7 34   GLY n 
7 35   PHE n 
7 36   LYS n 
7 37   ASN n 
7 38   THR n 
7 39   VAL n 
7 40   LEU n 
7 41   GLU n 
7 42   PRO n 
7 43   GLU n 
7 44   GLU n 
7 45   ARG n 
7 46   PRO n 
7 47   LYS n 
7 48   MET n 
7 49   GLN n 
7 50   THR n 
7 51   LEU n 
7 52   GLU n 
7 53   GLY n 
7 54   LEU n 
7 55   PHE n 
7 56   ASP n 
7 57   ASP n 
7 58   PRO n 
7 59   ASN n 
7 60   ALA n 
7 61   VAL n 
7 62   THR n 
7 63   TRP n 
7 64   ALA n 
7 65   MET n 
7 66   LYS n 
7 67   GLU n 
7 68   LEU n 
7 69   LEU n 
7 70   THR n 
7 71   GLY n 
7 72   ARG n 
7 73   LEU n 
7 74   VAL n 
7 75   PHE n 
7 76   GLY n 
7 77   GLU n 
7 78   ASN n 
7 79   LEU n 
7 80   VAL n 
7 81   PRO n 
7 82   GLU n 
7 83   ASP n 
7 84   ARG n 
7 85   LEU n 
7 86   GLN n 
7 87   LYS n 
7 88   GLU n 
7 89   MET n 
7 90   GLU n 
7 91   ARG n 
7 92   LEU n 
7 93   TYR n 
7 94   PRO n 
7 95   VAL n 
7 96   GLU n 
7 97   ARG n 
7 98   GLU n 
7 99   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample ? ? ? 'Thermus thermophilus' 300852 Thermus 'Thermus thermophilus' HB8 ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RPOA_THET8 Q5SHR6 4 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 ? 
2 UNP RPOB_THET8 Q8RQE9 5 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 ? 
3 UNP RPOC_THET8 Q8RQE8 6 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 ? 
4 UNP RPOZ_THET8 Q8RQE7 7 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 ? 
5 PDB 2O5J       2O5J   1 ? ? ? 
6 PDB 2O5J       2O5J   2 ? ? ? 
7 PDB 2O5J       2O5J   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2O5J A 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
2  1 2O5J B 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
3  1 2O5J K 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
4  1 2O5J L 1 ? 315  ? Q5SHR6 1 ? 315  ? 1 315  
5  2 2O5J C 1 ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
6  2 2O5J M 1 ? 1119 ? Q8RQE9 1 ? 1119 ? 1 1119 
7  3 2O5J D 1 ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
8  3 2O5J N 1 ? 1524 ? Q8RQE8 1 ? 1524 ? 1 1524 
9  4 2O5J E 1 ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
10 4 2O5J O 1 ? 99   ? Q8RQE7 1 ? 99   ? 1 99   
11 5 2O5J G 1 ? 23   ? 2O5J   1 ? 23   ? 1 23   
12 6 2O5J H 1 ? 16   ? 2O5J   1 ? 16   ? 1 16   
13 7 2O5J I 1 ? 14   ? 2O5J   2 ? 15   ? 2 15   
14 5 2O5J X 1 ? 23   ? 2O5J   1 ? 23   ? 1 23   
15 6 2O5J Y 1 ? 16   ? 2O5J   1 ? 16   ? 1 16   
16 7 2O5J Z 1 ? 14   ? 2O5J   2 ? 15   ? 2 15   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                         ?                                               
'C3 H7 N O2'        89.093  
APC non-polymer         . 'DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER' "ALPHA,BETA-METHYLENEADENOSINE-5'-TRIPHOSPHATE" 
'C11 H18 N5 O12 P3' 505.208 
ARG 'L-peptide linking' y ARGININE                                        ?                                               
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                      ?                                               
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                 ?                                               
'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                     ?                                               
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                        ?                                               
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"             ?                                               
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"            ?                                               
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                    ?                                               
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                       ?                                               
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                 ?                                               
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                         ?                                               
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                       ?                                               
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                           ?                                               'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                      ?                                               
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                         ?                                               
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                          ?                                               
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                      ?                                               
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                 ?                                               'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                   ?                                               
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                         ?                                               
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                          ?                                               
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                       ?                                               
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                      ?                                               
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                        ?                                               
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                      ?                                               
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                          ?                                               
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                      ?                                               'Zn 2' 
65.409  
# 
_exptl.entry_id          2O5J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.85 
_exptl_crystal.density_percent_sol   68.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'30% MPD, 0.1M Na cacodylate, 0.2M Mg acetate, 2mM AMPcPP, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 MPD             ? ? ? 
1 2 1 'Na cacodylate' ? ? ? 
1 3 1 'Mg acetate'    ? ? ? 
1 4 1 AMPcPP          ? ? ? 
1 5 1 H2O             ? ? ? 
1 6 2 MPD             ? ? ? 
1 7 2 'Na cacodylate' ? ? ? 
1 8 2 'Mg acetate'    ? ? ? 
1 9 2 H2O             ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2O5J 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.0 
_reflns.d_resolution_low             40.0 
_reflns.number_all                   236997 
_reflns.number_obs                   211633 
_reflns.percent_possible_obs         89.3 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        11.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   75.5 
_reflns_shell.Rmerge_I_obs           0.441 
_reflns_shell.pdbx_Rsym_value        0.441 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        2.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      17916 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O5J 
_refine.ls_d_res_high                            3.0 
_refine.ls_d_res_low                             40.0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          0 
_refine.ls_number_reflns_all                     199490 
_refine.ls_number_reflns_obs                     199490 
_refine.ls_number_reflns_R_free                  12143 
_refine.ls_percent_reflns_obs                    89.3 
_refine.ls_R_factor_all                          0.2293 
_refine.ls_R_factor_obs                          0.2293 
_refine.ls_R_factor_R_work                       0.2254 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2O5I' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             Isotropic 
_refine.B_iso_mean                               63.1 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2O5J 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.84 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.41 
_refine_analyze.Luzzati_sigma_a_free            0.95 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        46342 
_refine_hist.pdbx_number_atoms_nucleic_acid   2168 
_refine_hist.pdbx_number_atoms_ligand         70 
_refine_hist.number_atoms_solvent             2633 
_refine_hist.number_atoms_total               51213 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.0153 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.82   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.4    ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.278 
_refine_ls_shell.percent_reflns_obs               75.5 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             1063 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                17916 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O5J 
_struct.title                     
'Crystal structure of the T. thermophilus RNAP polymerase elongation complex with the NTP substrate analog' 
_struct.pdbx_descriptor           
;DNA-directed RNA polymerase alpha chain, DNA-directed RNA polymerase beta chain, DNA-directed RNA polymerase beta' chain, DNA-directed RNA polymerase omega chain (E.C.2.7.7.6)/DNA/RNA Complex
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O5J 
_struct_keywords.pdbx_keywords   'TRANSFERASE/DNA-RNA HYBRID' 
_struct_keywords.text            
;RNA polymerase, elongation complex, template DNA, non-template DNA, RNA transcript, NTP substrate, TRANSFERASE-DNA-RNA HYBRID COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 1  ? 
E  N N 2  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 4  ? 
M  N N 4  ? 
N  N N 5  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 8  ? 
R  N N 8  ? 
S  N N 9  ? 
T  N N 9  ? 
U  N N 10 ? 
V  N N 8  ? 
W  N N 8  ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 11 ? 
CA N N 11 ? 
DA N N 11 ? 
EA N N 11 ? 
FA N N 11 ? 
GA N N 11 ? 
HA N N 11 ? 
IA N N 11 ? 
JA N N 11 ? 
KA N N 11 ? 
LA N N 11 ? 
MA N N 11 ? 
NA N N 11 ? 
OA N N 11 ? 
PA N N 11 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The asymmetric unit contains the two molecules of the complex. The biological assembly is a monomeric complex.' ? 
2 ?                                                                                                                ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY G 31   ? SER G 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   2   ASP G 74   ? GLU G 84   ? ASP A 74   GLU A 84   1 ? 11 
HELX_P HELX_P3   3   ARG G 112  ? PHE G 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   4   PRO G 152  ? GLY G 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   5   THR G 206  ? THR G 223  ? THR A 206  THR A 223  1 ? 18 
HELX_P HELX_P6   6   GLY H 31   ? SER H 47   ? GLY B 31   SER B 47   1 ? 17 
HELX_P HELX_P7   7   ASP H 74   ? GLU H 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   8   ARG H 112  ? PHE H 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   9   PRO H 152  ? GLY H 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  10  THR H 206  ? THR H 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  11  THR I 19   ? LEU I 30   ? THR C 19   LEU C 30   1 ? 12 
HELX_P HELX_P12  12  GLN I 31   ? VAL I 34   ? GLN C 31   VAL C 34   5 ? 4  
HELX_P HELX_P13  13  GLY I 43   ? PHE I 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P14  14  PRO I 79   ? LYS I 86   ? PRO C 79   LYS C 86   1 ? 8  
HELX_P HELX_P15  15  LEU I 193  ? GLY I 201  ? LEU C 193  GLY C 201  1 ? 9  
HELX_P HELX_P16  16  ASP I 203  ? GLY I 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P17  17  LEU I 217  ? MET I 222  ? LEU C 217  MET C 222  1 ? 6  
HELX_P HELX_P18  18  GLU I 224  ? MET I 229  ? GLU C 224  MET C 229  1 ? 6  
HELX_P HELX_P19  19  ARG I 230  ? LEU I 242  ? ARG C 230  LEU C 242  1 ? 13 
HELX_P HELX_P20  20  ALA I 253  ? TYR I 258  ? ALA C 253  TYR C 258  1 ? 6  
HELX_P HELX_P21  21  GLY I 273  ? GLU I 279  ? GLY C 273  GLU C 279  1 ? 7  
HELX_P HELX_P22  22  VAL I 302  ? THR I 314  ? VAL C 302  THR C 314  1 ? 13 
HELX_P HELX_P23  23  THR I 335  ? GLY I 362  ? THR C 335  GLY C 362  1 ? 28 
HELX_P HELX_P24  24  THR I 368  ? VAL I 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P25  25  SER I 375  ? SER I 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P26  26  ASN I 399  ? ARG I 408  ? ASN C 399  ARG C 408  1 ? 10 
HELX_P HELX_P27  27  GLY I 424  ? ASP I 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P28  28  HIS I 431  ? TYR I 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P29  29  THR I 487  ? ASP I 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P30  30  SER I 535  ? PHE I 540  ? SER C 535  PHE C 540  1 ? 6  
HELX_P HELX_P31  31  SER I 541  ? LEU I 546  ? SER C 541  LEU C 546  1 ? 6  
HELX_P HELX_P32  32  PHE I 549  ? ASP I 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P33  33  ASP I 554  ? THR I 566  ? ASP C 554  THR C 566  1 ? 13 
HELX_P HELX_P34  34  LEU I 583  ? SER I 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P35  35  GLU I 692  ? ARG I 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P36  36  THR I 768  ? GLU I 780  ? THR C 768  GLU C 780  1 ? 13 
HELX_P HELX_P37  37  PRO I 854  ? MET I 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P38  38  ASN I 872  ? VAL I 876  ? ASN C 872  VAL C 876  5 ? 5  
HELX_P HELX_P39  39  ASN I 881  ? GLY I 898  ? ASN C 881  GLY C 898  1 ? 18 
HELX_P HELX_P40  40  LYS I 910  ? GLY I 933  ? LYS C 910  GLY C 933  1 ? 24 
HELX_P HELX_P41  41  ASP I 937  ? LYS I 949  ? ASP C 937  LYS C 949  1 ? 13 
HELX_P HELX_P42  42  THR I 958  ? GLN I 969  ? THR C 958  GLN C 969  1 ? 12 
HELX_P HELX_P43  43  GLY I 1033 ? TYR I 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P44  44  ALA I 1045 ? THR I 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P45  45  ASP I 1059 ? GLY I 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P46  46  PRO I 1082 ? LEU I 1095 ? PRO C 1082 LEU C 1095 1 ? 14 
HELX_P HELX_P47  47  SER J 14   ? SER J 22   ? SER D 14   SER D 22   1 ? 9  
HELX_P HELX_P48  48  LYS J 82   ? ARG J 89   ? LYS D 82   ARG D 89   1 ? 8  
HELX_P HELX_P49  49  HIS J 101  ? LYS J 106  ? HIS D 101  LYS D 106  1 ? 6  
HELX_P HELX_P50  50  SER J 110  ? LEU J 116  ? SER D 110  LEU D 116  1 ? 7  
HELX_P HELX_P51  51  THR J 121  ? SER J 130  ? THR D 121  SER D 130  1 ? 10 
HELX_P HELX_P52  52  THR J 154  ? TYR J 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P53  53  ASP J 423  ? LYS J 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P54  54  GLY J 457  ? GLU J 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P55  55  ASP J 469  ? HIS J 483  ? ASP D 469  HIS D 483  1 ? 15 
HELX_P HELX_P56  56  SER J 485  ? GLY J 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P57  57  ARG J 508  ? TRP J 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P58  58  ASP J 539  ? GLY J 561  ? ASP D 539  GLY D 561  1 ? 23 
HELX_P HELX_P59  59  PRO J 563  ? ASP J 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P60  60  SER J 602  ? SER J 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P61  61  GLY J 612  ? LEU J 619  ? GLY D 612  LEU D 619  1 ? 8  
HELX_P HELX_P62  62  LYS J 646  ? PHE J 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P63  63  PHE J 653  ? LYS J 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P64  64  ASN J 669  ? GLU J 678  ? ASN D 669  GLU D 678  1 ? 10 
HELX_P HELX_P65  65  ARG J 679  ? ILE J 683  ? ARG D 679  ILE D 683  5 ? 5  
HELX_P HELX_P66  66  LYS J 684  ? ILE J 695  ? LYS D 684  ILE D 695  1 ? 12 
HELX_P HELX_P67  67  HIS J 709  ? LEU J 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P68  68  PRO J 730  ? GLU J 734  ? PRO D 730  GLU D 734  5 ? 5  
HELX_P HELX_P69  69  SER J 752  ? GLN J 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P70  70  LEU J 764  ? ASN J 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P71  71  SER J 782  ? ILE J 792  ? SER D 782  ILE D 792  1 ? 11 
HELX_P HELX_P72  72  GLU J 810  ? ALA J 822  ? GLU D 810  ALA D 822  1 ? 13 
HELX_P HELX_P73  73  SER J 835  ? TYR J 841  ? SER D 835  TYR D 841  1 ? 7  
HELX_P HELX_P74  74  ASN J 845  ? HIS J 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P75  75  SER J 876  ? VAL J 890  ? SER D 876  VAL D 890  1 ? 15 
HELX_P HELX_P76  76  ASP J 892  ? LEU J 899  ? ASP D 892  LEU D 899  1 ? 8  
HELX_P HELX_P77  77  GLU J 907  ? GLY J 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P78  78  GLY J 923  ? GLY J 946  ? GLY D 923  GLY D 946  1 ? 24 
HELX_P HELX_P79  79  GLY J 950  ? ALA J 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P80  80  GLU J 958  ? MET J 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P81  81  THR J 984  ? ASN J 1014 ? THR D 984  ASN D 1014 1 ? 31 
HELX_P HELX_P82  82  ASN J 1018 ? SER J 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P83  83  ASN J 1031 ? CYS J 1039 ? ASN D 1031 CYS D 1039 1 ? 9  
HELX_P HELX_P84  84  THR J 1066 ? HIS J 1103 ? THR D 1066 HIS D 1103 1 ? 38 
HELX_P HELX_P85  85  LYS J 1136 ? TYR J 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P86  86  SER J 1167 ? GLY J 1181 ? SER D 1167 GLY D 1181 1 ? 15 
HELX_P HELX_P87  87  SER J 1190 ? CYS J 1194 ? SER D 1190 CYS D 1194 5 ? 5  
HELX_P HELX_P88  88  CYS J 1201 ? GLY J 1206 ? CYS D 1201 GLY D 1206 1 ? 6  
HELX_P HELX_P89  89  ALA J 1220 ? THR J 1237 ? ALA D 1220 THR D 1237 1 ? 18 
HELX_P HELX_P90  90  ARG J 1239 ? GLY J 1244 ? ARG D 1239 GLY D 1244 1 ? 6  
HELX_P HELX_P91  91  VAL J 1246 ? GLU J 1264 ? VAL D 1246 GLU D 1264 1 ? 19 
HELX_P HELX_P92  92  ASP J 1331 ? GLY J 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P93  93  GLY J 1340 ? ALA J 1358 ? GLY D 1340 ALA D 1358 1 ? 19 
HELX_P HELX_P94  94  HIS J 1364 ? MET J 1375 ? HIS D 1364 MET D 1375 1 ? 12 
HELX_P HELX_P95  95  LEU J 1395 ? LEU J 1407 ? LEU D 1395 LEU D 1407 1 ? 13 
HELX_P HELX_P96  96  GLY J 1423 ? SER J 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P97  97  ASN J 1442 ? ALA J 1453 ? ASN D 1442 ALA D 1453 1 ? 12 
HELX_P HELX_P98  98  GLY J 1461 ? LEU J 1468 ? GLY D 1461 LEU D 1468 1 ? 8  
HELX_P HELX_P99  99  ASP J 1488 ? GLU J 1501 ? ASP D 1488 GLU D 1501 1 ? 14 
HELX_P HELX_P100 100 GLY K 5    ? VAL K 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P101 101 SER K 15   ? HIS K 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P102 102 GLU K 52   ? ASP K 56   ? GLU E 52   ASP E 56   5 ? 5  
HELX_P HELX_P103 103 ASN K 59   ? LEU K 69   ? ASN E 59   LEU E 69   1 ? 11 
HELX_P HELX_P104 104 ASP K 83   ? TYR K 93   ? ASP E 83   TYR E 93   1 ? 11 
HELX_P HELX_P105 105 GLY L 31   ? SER L 47   ? GLY K 31   SER K 47   1 ? 17 
HELX_P HELX_P106 106 ASP L 74   ? GLU L 84   ? ASP K 74   GLU K 84   1 ? 11 
HELX_P HELX_P107 107 ARG L 112  ? PHE L 114  ? ARG K 112  PHE K 114  5 ? 3  
HELX_P HELX_P108 108 PRO L 152  ? GLY L 157  ? PRO K 152  GLY K 157  1 ? 6  
HELX_P HELX_P109 109 THR L 206  ? THR L 223  ? THR K 206  THR K 223  1 ? 18 
HELX_P HELX_P110 110 GLY M 31   ? SER M 47   ? GLY L 31   SER L 47   1 ? 17 
HELX_P HELX_P111 111 ASP M 74   ? GLU M 84   ? ASP L 74   GLU L 84   1 ? 11 
HELX_P HELX_P112 112 ARG M 112  ? PHE M 114  ? ARG L 112  PHE L 114  5 ? 3  
HELX_P HELX_P113 113 PRO M 152  ? GLY M 157  ? PRO L 152  GLY L 157  1 ? 6  
HELX_P HELX_P114 114 THR M 206  ? THR M 223  ? THR L 206  THR L 223  1 ? 18 
HELX_P HELX_P115 115 THR N 19   ? LEU N 30   ? THR M 19   LEU M 30   1 ? 12 
HELX_P HELX_P116 116 GLN N 31   ? VAL N 34   ? GLN M 31   VAL M 34   5 ? 4  
HELX_P HELX_P117 117 GLY N 43   ? PHE N 52   ? GLY M 43   PHE M 52   1 ? 10 
HELX_P HELX_P118 118 PRO N 79   ? LYS N 86   ? PRO M 79   LYS M 86   1 ? 8  
HELX_P HELX_P119 119 LEU N 193  ? GLY N 201  ? LEU M 193  GLY M 201  1 ? 9  
HELX_P HELX_P120 120 ASP N 203  ? GLY N 212  ? ASP M 203  GLY M 212  1 ? 10 
HELX_P HELX_P121 121 LEU N 217  ? MET N 222  ? LEU M 217  MET M 222  1 ? 6  
HELX_P HELX_P122 122 GLU N 224  ? MET N 229  ? GLU M 224  MET M 229  1 ? 6  
HELX_P HELX_P123 123 GLU N 232  ? LEU N 242  ? GLU M 232  LEU M 242  1 ? 11 
HELX_P HELX_P124 124 ALA N 253  ? TYR N 258  ? ALA M 253  TYR M 258  1 ? 6  
HELX_P HELX_P125 125 GLY N 273  ? GLU N 279  ? GLY M 273  GLU M 279  1 ? 7  
HELX_P HELX_P126 126 VAL N 302  ? THR N 314  ? VAL M 302  THR M 314  1 ? 13 
HELX_P HELX_P127 127 THR N 335  ? GLY N 362  ? THR M 335  GLY M 362  1 ? 28 
HELX_P HELX_P128 128 THR N 368  ? VAL N 373  ? THR M 368  VAL M 373  1 ? 6  
HELX_P HELX_P129 129 SER N 375  ? SER N 389  ? SER M 375  SER M 389  1 ? 15 
HELX_P HELX_P130 130 ASN N 399  ? ARG N 408  ? ASN M 399  ARG M 408  1 ? 10 
HELX_P HELX_P131 131 GLY N 424  ? ASP N 429  ? GLY M 424  ASP M 429  1 ? 6  
HELX_P HELX_P132 132 HIS N 431  ? TYR N 435  ? HIS M 431  TYR M 435  5 ? 5  
HELX_P HELX_P133 133 THR N 487  ? ASP N 492  ? THR M 487  ASP M 492  1 ? 6  
HELX_P HELX_P134 134 PHE N 549  ? ASP N 553  ? PHE M 549  ASP M 553  5 ? 5  
HELX_P HELX_P135 135 ASP N 554  ? GLN N 567  ? ASP M 554  GLN M 567  1 ? 14 
HELX_P HELX_P136 136 LEU N 583  ? SER N 591  ? LEU M 583  SER M 591  1 ? 9  
HELX_P HELX_P137 137 GLU N 692  ? ARG N 697  ? GLU M 692  ARG M 697  1 ? 6  
HELX_P HELX_P138 138 THR N 768  ? GLU N 780  ? THR M 768  GLU M 780  1 ? 13 
HELX_P HELX_P139 139 ASN N 872  ? VAL N 876  ? ASN M 872  VAL M 876  5 ? 5  
HELX_P HELX_P140 140 ASN N 881  ? GLY N 898  ? ASN M 881  GLY M 898  1 ? 18 
HELX_P HELX_P141 141 LYS N 910  ? GLY N 933  ? LYS M 910  GLY M 933  1 ? 24 
HELX_P HELX_P142 142 ASP N 937  ? LYS N 949  ? ASP M 937  LYS M 949  1 ? 13 
HELX_P HELX_P143 143 THR N 958  ? GLN N 969  ? THR M 958  GLN M 969  1 ? 12 
HELX_P HELX_P144 144 GLY N 1033 ? TYR N 1043 ? GLY M 1033 TYR M 1043 1 ? 11 
HELX_P HELX_P145 145 ALA N 1045 ? THR N 1054 ? ALA M 1045 THR M 1054 1 ? 10 
HELX_P HELX_P146 146 ASP N 1059 ? GLY N 1073 ? ASP M 1059 GLY M 1073 1 ? 15 
HELX_P HELX_P147 147 PRO N 1082 ? LEU N 1095 ? PRO M 1082 LEU M 1095 1 ? 14 
HELX_P HELX_P148 148 SER O 14   ? SER O 22   ? SER N 14   SER N 22   1 ? 9  
HELX_P HELX_P149 149 ASP O 46   ? GLY O 51   ? ASP N 46   GLY N 51   1 ? 6  
HELX_P HELX_P150 150 ILE O 84   ? ARG O 89   ? ILE N 84   ARG N 89   1 ? 6  
HELX_P HELX_P151 151 HIS O 101  ? LYS O 106  ? HIS N 101  LYS N 106  1 ? 6  
HELX_P HELX_P152 152 SER O 110  ? LEU O 116  ? SER N 110  LEU N 116  1 ? 7  
HELX_P HELX_P153 153 THR O 121  ? SER O 130  ? THR N 121  SER N 130  1 ? 10 
HELX_P HELX_P154 154 THR O 154  ? GLY O 164  ? THR N 154  GLY N 164  1 ? 11 
HELX_P HELX_P155 155 ASP O 423  ? LYS O 426  ? ASP N 423  LYS N 426  5 ? 4  
HELX_P HELX_P156 156 GLY O 457  ? GLU O 467  ? GLY N 457  GLU N 467  1 ? 11 
HELX_P HELX_P157 157 ASP O 469  ? HIS O 483  ? ASP N 469  HIS N 483  1 ? 15 
HELX_P HELX_P158 158 SER O 485  ? GLY O 506  ? SER N 485  GLY N 506  1 ? 22 
HELX_P HELX_P159 159 ARG O 508  ? TRP O 511  ? ARG N 508  TRP N 511  5 ? 4  
HELX_P HELX_P160 160 ASP O 539  ? GLY O 561  ? ASP N 539  GLY N 561  1 ? 23 
HELX_P HELX_P161 161 PRO O 563  ? ASP O 583  ? PRO N 563  ASP N 583  1 ? 21 
HELX_P HELX_P162 162 SER O 602  ? SER O 608  ? SER N 602  SER N 608  1 ? 7  
HELX_P HELX_P163 163 GLY O 612  ? LEU O 619  ? GLY N 612  LEU N 619  1 ? 8  
HELX_P HELX_P164 164 LYS O 646  ? PHE O 653  ? LYS N 646  PHE N 653  1 ? 8  
HELX_P HELX_P165 165 PHE O 653  ? LYS O 664  ? PHE N 653  LYS N 664  1 ? 12 
HELX_P HELX_P166 166 ASN O 669  ? GLU O 678  ? ASN N 669  GLU N 678  1 ? 10 
HELX_P HELX_P167 167 ARG O 679  ? ILE O 683  ? ARG N 679  ILE N 683  5 ? 5  
HELX_P HELX_P168 168 LYS O 684  ? ILE O 695  ? LYS N 684  ILE N 695  1 ? 12 
HELX_P HELX_P169 169 HIS O 709  ? LEU O 711  ? HIS N 709  LEU N 711  5 ? 3  
HELX_P HELX_P170 170 PRO O 730  ? GLU O 734  ? PRO N 730  GLU N 734  5 ? 5  
HELX_P HELX_P171 171 SER O 752  ? GLN O 762  ? SER N 752  GLN N 762  1 ? 11 
HELX_P HELX_P172 172 LEU O 764  ? ASN O 768  ? LEU N 764  ASN N 768  5 ? 5  
HELX_P HELX_P173 173 SER O 782  ? GLN O 794  ? SER N 782  GLN N 794  1 ? 13 
HELX_P HELX_P174 174 GLU O 810  ? ALA O 822  ? GLU N 810  ALA N 822  1 ? 13 
HELX_P HELX_P175 175 SER O 835  ? TYR O 841  ? SER N 835  TYR N 841  1 ? 7  
HELX_P HELX_P176 176 ASN O 845  ? HIS O 855  ? ASN N 845  HIS N 855  1 ? 11 
HELX_P HELX_P177 177 SER O 876  ? VAL O 890  ? SER N 876  VAL N 890  1 ? 15 
HELX_P HELX_P178 178 ASP O 892  ? LEU O 899  ? ASP N 892  LEU N 899  1 ? 8  
HELX_P HELX_P179 179 GLU O 907  ? GLY O 923  ? GLU N 907  GLY N 923  1 ? 17 
HELX_P HELX_P180 180 GLY O 923  ? GLY O 946  ? GLY N 923  GLY N 946  1 ? 24 
HELX_P HELX_P181 181 GLU O 958  ? MET O 980  ? GLU N 958  MET N 980  1 ? 23 
HELX_P HELX_P182 182 THR O 984  ? ASN O 1014 ? THR N 984  ASN N 1014 1 ? 31 
HELX_P HELX_P183 183 ASN O 1018 ? SER O 1026 ? ASN N 1018 SER N 1026 1 ? 9  
HELX_P HELX_P184 184 ASN O 1031 ? CYS O 1039 ? ASN N 1031 CYS N 1039 1 ? 9  
HELX_P HELX_P185 185 LEU O 1068 ? HIS O 1103 ? LEU N 1068 HIS N 1103 1 ? 36 
HELX_P HELX_P186 186 LYS O 1136 ? TYR O 1145 ? LYS N 1136 TYR N 1145 1 ? 10 
HELX_P HELX_P187 187 SER O 1167 ? GLY O 1181 ? SER N 1167 GLY N 1181 1 ? 15 
HELX_P HELX_P188 188 SER O 1190 ? CYS O 1194 ? SER N 1190 CYS N 1194 5 ? 5  
HELX_P HELX_P189 189 CYS O 1201 ? GLY O 1206 ? CYS N 1201 GLY N 1206 1 ? 6  
HELX_P HELX_P190 190 ALA O 1220 ? GLY O 1244 ? ALA N 1220 GLY N 1244 1 ? 25 
HELX_P HELX_P191 191 VAL O 1246 ? GLU O 1264 ? VAL N 1246 GLU N 1264 1 ? 19 
HELX_P HELX_P192 192 ASP O 1331 ? GLY O 1340 ? ASP N 1331 GLY N 1340 1 ? 10 
HELX_P HELX_P193 193 GLY O 1340 ? ALA O 1358 ? GLY N 1340 ALA N 1358 1 ? 19 
HELX_P HELX_P194 194 HIS O 1364 ? MET O 1375 ? HIS N 1364 MET N 1375 1 ? 12 
HELX_P HELX_P195 195 LEU O 1395 ? LEU O 1407 ? LEU N 1395 LEU N 1407 1 ? 13 
HELX_P HELX_P196 196 GLY O 1423 ? SER O 1430 ? GLY N 1423 SER N 1430 1 ? 8  
HELX_P HELX_P197 197 ASN O 1442 ? ALA O 1453 ? ASN N 1442 ALA N 1453 1 ? 12 
HELX_P HELX_P198 198 GLY O 1461 ? LEU O 1468 ? GLY N 1461 LEU N 1468 1 ? 8  
HELX_P HELX_P199 199 ASP O 1488 ? GLU O 1501 ? ASP N 1488 GLU N 1501 1 ? 14 
HELX_P HELX_P200 200 GLY P 5    ? VAL P 13   ? GLY O 5    VAL O 13   1 ? 9  
HELX_P HELX_P201 201 SER P 15   ? HIS P 33   ? SER O 15   HIS O 33   1 ? 19 
HELX_P HELX_P202 202 GLU P 52   ? ASP P 56   ? GLU O 52   ASP O 56   5 ? 5  
HELX_P HELX_P203 203 ASN P 59   ? LEU P 69   ? ASN O 59   LEU O 69   1 ? 11 
HELX_P HELX_P204 204 PRO P 81   ? TYR P 93   ? PRO O 81   TYR O 93   1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? Q ZN  .  ZN  ? ? ? 1_555 J  CYS 76   SG    ? ? D ZN  4058 D CYS 76   1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc2   metalc ? ? Q ZN  .  ZN  ? ? ? 1_555 J  CYS 58   SG    ? ? D ZN  4058 D CYS 58   1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc3   metalc ? ? Q ZN  .  ZN  ? ? ? 1_555 J  CYS 60   SG    ? ? D ZN  4058 D CYS 60   1_555 ? ? ? ? ? ? ?            2.368 ? 
metalc4   metalc ? ? Q ZN  .  ZN  ? ? ? 1_555 J  CYS 73   SG    ? ? D ZN  4058 D CYS 73   1_555 ? ? ? ? ? ? ?            2.384 ? 
metalc5   metalc ? ? R ZN  .  ZN  ? ? ? 1_555 J  CYS 1194 SG    ? ? D ZN  6112 D CYS 1194 1_555 ? ? ? ? ? ? ?            2.358 ? 
metalc6   metalc ? ? R ZN  .  ZN  ? ? ? 1_555 J  CYS 1201 SG    ? ? D ZN  6112 D CYS 1201 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc7   metalc ? ? R ZN  .  ZN  ? ? ? 1_555 J  CYS 1204 SG    ? ? D ZN  6112 D CYS 1204 1_555 ? ? ? ? ? ? ?            2.278 ? 
metalc8   metalc ? ? R ZN  .  ZN  ? ? ? 1_555 J  CYS 1112 SG    ? ? D ZN  6112 D CYS 1112 1_555 ? ? ? ? ? ? ?            2.340 ? 
metalc9   metalc ? ? S MG  .  MG  ? ? ? 1_555 U  APC .    O1A   ? ? D MG  8001 D APC 3999 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc10  metalc ? ? S MG  .  MG  ? ? ? 1_555 B  G   16   "O3'" ? ? D MG  8001 H G   16   1_555 ? ? ? ? ? ? ?            2.051 ? 
metalc11  metalc ? ? S MG  .  MG  ? ? ? 1_555 J  ASP 739  OD1   ? ? D MG  8001 D ASP 739  1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc12  metalc ? ? S MG  .  MG  ? ? ? 1_555 J  ASP 741  OD1   ? ? D MG  8001 D ASP 741  1_555 ? ? ? ? ? ? ?            2.262 ? 
metalc13  metalc ? ? S MG  .  MG  ? ? ? 1_555 J  ASP 743  OD1   ? ? D MG  8001 D ASP 743  1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc14  metalc ? ? T MG  .  MG  ? ? ? 1_555 U  APC .    O3G   ? ? D MG  8002 D APC 3999 1_555 ? ? ? ? ? ? ?            2.138 ? 
metalc15  metalc ? ? T MG  .  MG  ? ? ? 1_555 JA HOH .    O     ? ? D MG  8002 D HOH 8003 1_555 ? ? ? ? ? ? ?            2.309 ? 
metalc16  metalc ? ? T MG  .  MG  ? ? ? 1_555 J  ASP 739  OD2   ? ? D MG  8002 D ASP 739  1_555 ? ? ? ? ? ? ?            2.121 ? 
metalc17  metalc ? ? T MG  .  MG  ? ? ? 1_555 U  APC .    O1A   ? ? D MG  8002 D APC 3999 1_555 ? ? ? ? ? ? ?            2.347 ? 
metalc18  metalc ? ? T MG  .  MG  ? ? ? 1_555 U  APC .    O2B   ? ? D MG  8002 D APC 3999 1_555 ? ? ? ? ? ? ?            2.253 ? 
metalc19  metalc ? ? Z APC .  O3G ? ? ? 1_555 Y  MG  .    MG    ? ? N APC 4999 N MG  9002 1_555 ? ? ? ? ? ? ?            2.045 ? 
metalc20  metalc ? ? V ZN  .  ZN  ? ? ? 1_555 O  CYS 76   SG    ? ? N ZN  5058 N CYS 76   1_555 ? ? ? ? ? ? ?            2.426 ? 
metalc21  metalc ? ? V ZN  .  ZN  ? ? ? 1_555 O  CYS 60   SG    ? ? N ZN  5058 N CYS 60   1_555 ? ? ? ? ? ? ?            2.359 ? 
metalc22  metalc ? ? V ZN  .  ZN  ? ? ? 1_555 O  CYS 58   SG    ? ? N ZN  5058 N CYS 58   1_555 ? ? ? ? ? ? ?            2.458 ? 
metalc23  metalc ? ? V ZN  .  ZN  ? ? ? 1_555 O  CYS 73   SG    ? ? N ZN  5058 N CYS 73   1_555 ? ? ? ? ? ? ?            2.386 ? 
metalc24  metalc ? ? W ZN  .  ZN  ? ? ? 1_555 O  CYS 1204 SG    ? ? N ZN  7112 N CYS 1204 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc25  metalc ? ? W ZN  .  ZN  ? ? ? 1_555 O  CYS 1194 SG    ? ? N ZN  7112 N CYS 1194 1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc26  metalc ? ? W ZN  .  ZN  ? ? ? 1_555 O  CYS 1112 SG    ? ? N ZN  7112 N CYS 1112 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc27  metalc ? ? W ZN  .  ZN  ? ? ? 1_555 O  CYS 1201 SG    ? ? N ZN  7112 N CYS 1201 1_555 ? ? ? ? ? ? ?            2.325 ? 
metalc28  metalc ? ? X MG  .  MG  ? ? ? 1_555 O  ASP 739  OD2   ? ? N MG  9001 N ASP 739  1_555 ? ? ? ? ? ? ?            2.749 ? 
metalc29  metalc ? ? X MG  .  MG  ? ? ? 1_555 O  ASP 741  OD1   ? ? N MG  9001 N ASP 741  1_555 ? ? ? ? ? ? ?            2.336 ? 
metalc30  metalc ? ? X MG  .  MG  ? ? ? 1_555 O  ASP 743  OD1   ? ? N MG  9001 N ASP 743  1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc31  metalc ? ? X MG  .  MG  ? ? ? 1_555 Z  APC .    O1A   ? ? N MG  9001 N APC 4999 1_555 ? ? ? ? ? ? ?            2.401 ? 
metalc32  metalc ? ? X MG  .  MG  ? ? ? 1_555 O  ASP 739  OD1   ? ? N MG  9001 N ASP 739  1_555 ? ? ? ? ? ? ?            1.958 ? 
metalc33  metalc ? ? X MG  .  MG  ? ? ? 1_555 E  G   16   "O3'" ? ? N MG  9001 Y G   16   1_555 ? ? ? ? ? ? ?            1.989 ? 
metalc34  metalc ? ? Y MG  .  MG  ? ? ? 1_555 Z  APC .    O3B   ? ? N MG  9002 N APC 4999 1_555 ? ? ? ? ? ? ?            3.078 ? 
metalc35  metalc ? ? Y MG  .  MG  ? ? ? 1_555 NA HOH .    O     ? ? N MG  9002 M HOH 1120 1_555 ? ? ? ? ? ? ?            2.286 ? 
metalc36  metalc ? ? Y MG  .  MG  ? ? ? 1_555 O  ASP 739  OD2   ? ? N MG  9002 N ASP 739  1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc37  metalc ? ? Y MG  .  MG  ? ? ? 1_555 Z  APC .    O1A   ? ? N MG  9002 N APC 4999 1_555 ? ? ? ? ? ? ?            2.367 ? 
metalc38  metalc ? ? Y MG  .  MG  ? ? ? 1_555 Z  APC .    O2B   ? ? N MG  9002 N APC 4999 1_555 ? ? ? ? ? ? ?            2.145 ? 
hydrog1   hydrog ? ? A DC  1  N3  ? ? ? 1_555 C  DG  14   N1    ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? A DC  1  N4  ? ? ? 1_555 C  DG  14   O6    ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? A DC  1  O2  ? ? ? 1_555 C  DG  14   N2    ? ? G DC  1    I DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? A DC  2  N3  ? ? ? 1_555 C  DG  13   N1    ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? A DC  2  N4  ? ? ? 1_555 C  DG  13   O6    ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? A DC  2  O2  ? ? ? 1_555 C  DG  13   N2    ? ? G DC  2    I DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? A DC  3  N3  ? ? ? 1_555 C  DG  12   N1    ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? A DC  3  N4  ? ? ? 1_555 C  DG  12   O6    ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? A DC  3  O2  ? ? ? 1_555 C  DG  12   N2    ? ? G DC  3    I DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? A DT  4  N3  ? ? ? 1_555 C  DA  11   N1    ? ? G DT  4    I DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? A DT  4  O4  ? ? ? 1_555 C  DA  11   N6    ? ? G DT  4    I DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? A DG  5  N1  ? ? ? 1_555 C  DC  10   N3    ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? A DG  5  N2  ? ? ? 1_555 C  DC  10   O2    ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? A DG  5  O6  ? ? ? 1_555 C  DC  10   N4    ? ? G DG  5    I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? A DT  6  N3  ? ? ? 1_555 C  DA  9    N1    ? ? G DT  6    I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? A DT  6  O4  ? ? ? 1_555 C  DA  9    N6    ? ? G DT  6    I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? A DC  7  N3  ? ? ? 1_555 C  DG  8    N1    ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? A DC  7  N4  ? ? ? 1_555 C  DG  8    O6    ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? A DC  7  O2  ? ? ? 1_555 C  DG  8    N2    ? ? G DC  7    I DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? A DT  8  N3  ? ? ? 1_555 C  DA  7    N1    ? ? G DT  8    I DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? A DT  8  O4  ? ? ? 1_555 C  DA  7    N6    ? ? G DT  8    I DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? A DG  9  N1  ? ? ? 1_555 C  DC  6    N3    ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? A DG  9  N2  ? ? ? 1_555 C  DC  6    O2    ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? A DG  9  O6  ? ? ? 1_555 C  DC  6    N4    ? ? G DG  9    I DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? A DG  10 N1  ? ? ? 1_555 C  DC  5    N3    ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? A DG  10 N2  ? ? ? 1_555 C  DC  5    O2    ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? A DG  10 O6  ? ? ? 1_555 C  DC  5    N4    ? ? G DG  10   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? A DC  11 N3  ? ? ? 1_555 C  DG  4    N1    ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? A DC  11 N4  ? ? ? 1_555 C  DG  4    O6    ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? A DC  11 O2  ? ? ? 1_555 C  DG  4    N2    ? ? G DC  11   I DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? A DG  12 N1  ? ? ? 1_555 C  DC  3    N3    ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? A DG  12 N2  ? ? ? 1_555 C  DC  3    O2    ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? A DG  12 O6  ? ? ? 1_555 C  DC  3    N4    ? ? G DG  12   I DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? A DT  13 N3  ? ? ? 1_555 C  DA  2    N1    ? ? G DT  13   I DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? A DT  13 O4  ? ? ? 1_555 C  DA  2    N6    ? ? G DT  13   I DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? A DC  15 N3  ? ? ? 1_555 B  G   16   N1    ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? A DC  15 N4  ? ? ? 1_555 B  G   16   O6    ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? A DC  15 O2  ? ? ? 1_555 B  G   16   N2    ? ? G DC  15   H G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? A DG  16 N1  ? ? ? 1_555 B  C   15   N3    ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? A DG  16 N2  ? ? ? 1_555 B  C   15   O2    ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? A DG  16 O6  ? ? ? 1_555 B  C   15   N4    ? ? G DG  16   H C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? A DC  17 N3  ? ? ? 1_555 B  G   14   N1    ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? A DC  17 N4  ? ? ? 1_555 B  G   14   O6    ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? A DC  17 O2  ? ? ? 1_555 B  G   14   N2    ? ? G DC  17   H G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? A DG  18 N1  ? ? ? 1_555 B  C   13   N3    ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? A DG  18 N2  ? ? ? 1_555 B  C   13   O2    ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? A DG  18 O6  ? ? ? 1_555 B  C   13   N4    ? ? G DG  18   H C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? A DC  19 N3  ? ? ? 1_555 B  G   12   N1    ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? A DC  19 N4  ? ? ? 1_555 B  G   12   O6    ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? A DC  19 O2  ? ? ? 1_555 B  G   12   N2    ? ? G DC  19   H G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? A DG  20 N1  ? ? ? 1_555 B  C   11   N3    ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? A DG  20 N2  ? ? ? 1_555 B  C   11   O2    ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? A DG  20 O6  ? ? ? 1_555 B  C   11   N4    ? ? G DG  20   H C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? A DC  21 N3  ? ? ? 1_555 B  G   10   N1    ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? A DC  21 N4  ? ? ? 1_555 B  G   10   O6    ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? A DC  21 O2  ? ? ? 1_555 B  G   10   N2    ? ? G DC  21   H G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? A DC  22 N3  ? ? ? 1_555 B  G   9    N1    ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? A DC  22 N4  ? ? ? 1_555 B  G   9    O6    ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? A DC  22 O2  ? ? ? 1_555 B  G   9    N2    ? ? G DC  22   H G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? A DG  23 N1  ? ? ? 1_555 B  C   8    N3    ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? A DG  23 N2  ? ? ? 1_555 B  C   8    O2    ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? A DG  23 O6  ? ? ? 1_555 B  C   8    N4    ? ? G DG  23   H C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? D DC  1  N3  ? ? ? 1_555 F  DG  14   N1    ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? D DC  1  N4  ? ? ? 1_555 F  DG  14   O6    ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? D DC  1  O2  ? ? ? 1_555 F  DG  14   N2    ? ? X DC  1    Z DG  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? D DC  2  N3  ? ? ? 1_555 F  DG  13   N1    ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? D DC  2  N4  ? ? ? 1_555 F  DG  13   O6    ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? D DC  2  O2  ? ? ? 1_555 F  DG  13   N2    ? ? X DC  2    Z DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? D DC  3  N3  ? ? ? 1_555 F  DG  12   N1    ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? D DC  3  N4  ? ? ? 1_555 F  DG  12   O6    ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? D DC  3  O2  ? ? ? 1_555 F  DG  12   N2    ? ? X DC  3    Z DG  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? D DT  4  N3  ? ? ? 1_555 F  DA  11   N1    ? ? X DT  4    Z DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? D DT  4  O4  ? ? ? 1_555 F  DA  11   N6    ? ? X DT  4    Z DA  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? D DG  5  N1  ? ? ? 1_555 F  DC  10   N3    ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? D DG  5  N2  ? ? ? 1_555 F  DC  10   O2    ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? D DG  5  O6  ? ? ? 1_555 F  DC  10   N4    ? ? X DG  5    Z DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? D DT  6  N3  ? ? ? 1_555 F  DA  9    N1    ? ? X DT  6    Z DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? D DT  6  O4  ? ? ? 1_555 F  DA  9    N6    ? ? X DT  6    Z DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? D DC  7  N3  ? ? ? 1_555 F  DG  8    N1    ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? D DC  7  N4  ? ? ? 1_555 F  DG  8    O6    ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? D DC  7  O2  ? ? ? 1_555 F  DG  8    N2    ? ? X DC  7    Z DG  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? D DT  8  N3  ? ? ? 1_555 F  DA  7    N1    ? ? X DT  8    Z DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? D DT  8  O4  ? ? ? 1_555 F  DA  7    N6    ? ? X DT  8    Z DA  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? D DG  9  N1  ? ? ? 1_555 F  DC  6    N3    ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? D DG  9  N2  ? ? ? 1_555 F  DC  6    O2    ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? D DG  9  O6  ? ? ? 1_555 F  DC  6    N4    ? ? X DG  9    Z DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? D DG  10 N1  ? ? ? 1_555 F  DC  5    N3    ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? D DG  10 N2  ? ? ? 1_555 F  DC  5    O2    ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? D DG  10 O6  ? ? ? 1_555 F  DC  5    N4    ? ? X DG  10   Z DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? D DC  11 N3  ? ? ? 1_555 F  DG  4    N1    ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? D DC  11 N4  ? ? ? 1_555 F  DG  4    O6    ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? D DC  11 O2  ? ? ? 1_555 F  DG  4    N2    ? ? X DC  11   Z DG  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? D DG  12 N1  ? ? ? 1_555 F  DC  3    N3    ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? D DG  12 N2  ? ? ? 1_555 F  DC  3    O2    ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? D DG  12 O6  ? ? ? 1_555 F  DC  3    N4    ? ? X DG  12   Z DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? D DT  13 N3  ? ? ? 1_555 F  DA  2    N1    ? ? X DT  13   Z DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? D DT  13 O4  ? ? ? 1_555 F  DA  2    N6    ? ? X DT  13   Z DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? D DC  15 N3  ? ? ? 1_555 E  G   16   N1    ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? D DC  15 N4  ? ? ? 1_555 E  G   16   O6    ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? D DC  15 O2  ? ? ? 1_555 E  G   16   N2    ? ? X DC  15   Y G   16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? D DG  16 N1  ? ? ? 1_555 E  C   15   N3    ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? D DG  16 N2  ? ? ? 1_555 E  C   15   O2    ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? D DG  16 O6  ? ? ? 1_555 E  C   15   N4    ? ? X DG  16   Y C   15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? D DC  17 N3  ? ? ? 1_555 E  G   14   N1    ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? D DC  17 N4  ? ? ? 1_555 E  G   14   O6    ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? D DC  17 O2  ? ? ? 1_555 E  G   14   N2    ? ? X DC  17   Y G   14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? D DG  18 N1  ? ? ? 1_555 E  C   13   N3    ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? D DG  18 N2  ? ? ? 1_555 E  C   13   O2    ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? D DG  18 O6  ? ? ? 1_555 E  C   13   N4    ? ? X DG  18   Y C   13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? D DC  19 N3  ? ? ? 1_555 E  G   12   N1    ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? D DC  19 N4  ? ? ? 1_555 E  G   12   O6    ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? D DC  19 O2  ? ? ? 1_555 E  G   12   N2    ? ? X DC  19   Y G   12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? D DG  20 N1  ? ? ? 1_555 E  C   11   N3    ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? D DG  20 N2  ? ? ? 1_555 E  C   11   O2    ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? D DG  20 O6  ? ? ? 1_555 E  C   11   N4    ? ? X DG  20   Y C   11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? D DC  21 N3  ? ? ? 1_555 E  G   10   N1    ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? D DC  21 N4  ? ? ? 1_555 E  G   10   O6    ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? D DC  21 O2  ? ? ? 1_555 E  G   10   N2    ? ? X DC  21   Y G   10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? D DC  22 N3  ? ? ? 1_555 E  G   9    N1    ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? D DC  22 N4  ? ? ? 1_555 E  G   9    O6    ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? D DC  22 O2  ? ? ? 1_555 E  G   9    N2    ? ? X DC  22   Y G   9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? D DG  23 N1  ? ? ? 1_555 E  C   8    N3    ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? D DG  23 N2  ? ? ? 1_555 E  C   8    O2    ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? D DG  23 O6  ? ? ? 1_555 E  C   8    N4    ? ? X DG  23   Y C   8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  G . ? GLU 26  A PRO 27  G ? PRO 27  A 1 -0.30 
2 GLU 26  H . ? GLU 26  B PRO 27  H ? PRO 27  B 1 -0.33 
3 LEU 165 I . ? LEU 165 C PRO 166 I ? PRO 166 C 1 0.96  
4 GLU 26  L . ? GLU 26  K PRO 27  L ? PRO 27  K 1 -0.11 
5 GLU 26  M . ? GLU 26  L PRO 27  M ? PRO 27  L 1 -0.04 
6 LEU 165 N . ? LEU 165 M PRO 166 N ? PRO 166 M 1 6.10  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 4 ? 
C  ? 2 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 3 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 2 ? 
P  ? 4 ? 
Q  ? 2 ? 
R  ? 3 ? 
S  ? 6 ? 
T  ? 3 ? 
U  ? 3 ? 
V  ? 2 ? 
W  ? 6 ? 
X  ? 5 ? 
Y  ? 5 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 8 ? 
AC ? 3 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 4 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 3 ? 
AK ? 3 ? 
AL ? 2 ? 
AM ? 2 ? 
AN ? 3 ? 
AO ? 2 ? 
AP ? 4 ? 
AQ ? 4 ? 
AR ? 2 ? 
AS ? 2 ? 
AT ? 2 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 2 ? 
AX ? 2 ? 
AY ? 2 ? 
AZ ? 3 ? 
BA ? 3 ? 
BB ? 2 ? 
BC ? 3 ? 
BD ? 2 ? 
BE ? 4 ? 
BF ? 2 ? 
BG ? 3 ? 
BH ? 6 ? 
BI ? 3 ? 
BJ ? 3 ? 
BK ? 2 ? 
BL ? 6 ? 
BM ? 5 ? 
BN ? 3 ? 
BO ? 2 ? 
BP ? 3 ? 
BQ ? 2 ? 
BR ? 8 ? 
BS ? 3 ? 
BT ? 2 ? 
BU ? 3 ? 
BV ? 4 ? 
BW ? 4 ? 
BX ? 2 ? 
BY ? 2 ? 
BZ ? 2 ? 
CA ? 3 ? 
CB ? 3 ? 
CC ? 2 ? 
CD ? 2 ? 
CE ? 3 ? 
CF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? parallel      
K  2 3 ? parallel      
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? parallel      
S  4 5 ? anti-parallel 
S  5 6 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? parallel      
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? parallel      
X  1 2 ? parallel      
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Y  4 5 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? parallel      
AB 6 7 ? anti-parallel 
AB 7 8 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AX 1 2 ? anti-parallel 
AY 1 2 ? anti-parallel 
AZ 1 2 ? parallel      
AZ 2 3 ? parallel      
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
BD 1 2 ? anti-parallel 
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? anti-parallel 
BF 1 2 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? parallel      
BH 4 5 ? anti-parallel 
BH 5 6 ? anti-parallel 
BI 1 2 ? anti-parallel 
BI 2 3 ? anti-parallel 
BJ 1 2 ? anti-parallel 
BJ 2 3 ? anti-parallel 
BK 1 2 ? anti-parallel 
BL 1 2 ? parallel      
BL 2 3 ? anti-parallel 
BL 3 4 ? anti-parallel 
BL 4 5 ? anti-parallel 
BL 5 6 ? parallel      
BM 1 2 ? parallel      
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BM 4 5 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BO 1 2 ? anti-parallel 
BP 1 2 ? anti-parallel 
BP 2 3 ? anti-parallel 
BQ 1 2 ? anti-parallel 
BR 1 2 ? anti-parallel 
BR 2 3 ? anti-parallel 
BR 3 4 ? anti-parallel 
BR 4 5 ? anti-parallel 
BR 5 6 ? parallel      
BR 6 7 ? anti-parallel 
BR 7 8 ? parallel      
BS 1 2 ? anti-parallel 
BS 2 3 ? anti-parallel 
BT 1 2 ? anti-parallel 
BU 1 2 ? anti-parallel 
BU 2 3 ? anti-parallel 
BV 1 2 ? anti-parallel 
BV 2 3 ? anti-parallel 
BV 3 4 ? anti-parallel 
BW 1 2 ? anti-parallel 
BW 2 3 ? anti-parallel 
BW 3 4 ? anti-parallel 
BX 1 2 ? anti-parallel 
BY 1 2 ? anti-parallel 
BZ 1 2 ? anti-parallel 
CA 1 2 ? parallel      
CA 2 3 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
CE 1 2 ? anti-parallel 
CE 2 3 ? anti-parallel 
CF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 VAL G 10   ? GLN G 16   ? VAL A 10   GLN A 16   
A  2 TYR G 20   ? LEU G 28   ? TYR A 20   LEU A 28   
A  3 ASP G 193  ? THR G 201  ? ASP A 193  THR A 201  
A  4 VAL G 174  ? VAL G 181  ? VAL A 174  VAL A 181  
B  1 THR G 96   ? GLU G 104  ? THR A 96   GLU A 104  
B  2 ARG G 137  ? VAL G 148  ? ARG A 137  VAL A 148  
B  3 PRO G 49   ? ILE G 58   ? PRO A 49   ILE A 58   
B  4 ILE G 165  ? PRO G 166  ? ILE A 165  PRO A 166  
C  1 VAL G 87   ? PHE G 89   ? VAL A 87   PHE A 89   
C  2 VAL G 120  ? ILE G 122  ? VAL A 120  ILE A 122  
D  1 GLU G 108  ? LYS G 110  ? GLU A 108  LYS A 110  
D  2 HIS G 128  ? THR G 131  ? HIS A 128  THR A 131  
E  1 TYR G 150  ? VAL G 151  ? TYR A 150  VAL A 151  
E  2 ALA G 169  ? VAL G 170  ? ALA A 169  VAL A 170  
F  1 VAL H 10   ? GLN H 16   ? VAL B 10   GLN B 16   
F  2 TYR H 20   ? LEU H 28   ? TYR B 20   LEU B 28   
F  3 ASP H 193  ? THR H 201  ? ASP B 193  THR B 201  
F  4 VAL H 174  ? ASP H 183  ? VAL B 174  ASP B 183  
G  1 THR H 96   ? GLU H 104  ? THR B 96   GLU B 104  
G  2 ARG H 137  ? GLY H 147  ? ARG B 137  GLY B 147  
G  3 GLY H 50   ? ILE H 58   ? GLY B 50   ILE B 58   
G  4 ILE H 165  ? PRO H 166  ? ILE B 165  PRO B 166  
H  1 VAL H 87   ? PHE H 89   ? VAL B 87   PHE B 89   
H  2 VAL H 120  ? ILE H 122  ? VAL B 120  ILE B 122  
I  1 GLU H 108  ? LYS H 110  ? GLU B 108  LYS B 110  
I  2 HIS H 128  ? THR H 131  ? HIS B 128  THR B 131  
J  1 TYR H 150  ? VAL H 151  ? TYR B 150  VAL B 151  
J  2 ALA H 169  ? VAL H 170  ? ALA B 169  VAL B 170  
K  1 GLU I 2    ? ARG I 5    ? GLU C 2    ARG C 5    
K  2 GLN I 899  ? ILE I 902  ? GLN C 899  ILE C 902  
K  3 VAL I 579  ? MET I 580  ? VAL C 579  MET C 580  
L  1 ILE I 54   ? GLU I 56   ? ILE C 54   GLU C 56   
L  2 LEU I 64   ? PHE I 68   ? LEU C 64   PHE C 68   
L  3 LEU I 98   ? ILE I 101  ? LEU C 98   ILE C 101  
M  1 GLN I 91   ? PRO I 93   ? GLN C 91   PRO C 93   
M  2 HIS I 117  ? PRO I 119  ? HIS C 117  PRO C 119  
N  1 PHE I 127  ? ILE I 128  ? PHE C 127  ILE C 128  
N  2 ASP I 133  ? ILE I 136  ? ASP C 133  ILE C 136  
N  3 SER I 392  ? PHE I 394  ? SER C 392  PHE C 394  
O  1 GLN I 139  ? ARG I 142  ? GLN C 139  ARG C 142  
O  2 ARG I 331  ? ARG I 334  ? ARG C 331  ARG C 334  
P  1 VAL I 146  ? THR I 149  ? VAL C 146  THR C 149  
P  2 ILE I 159  ? ILE I 162  ? ILE C 159  ILE C 162  
P  3 ILE I 172  ? GLU I 177  ? ILE C 172  GLU C 177  
P  4 VAL I 181  ? MET I 184  ? VAL C 181  MET C 184  
Q  1 ARG I 409  ? SER I 411  ? ARG C 409  SER C 411  
Q  2 ILE I 452  ? SER I 454  ? ILE C 452  SER C 454  
R  1 ARG I 460  ? VAL I 461  ? ARG C 460  VAL C 461  
R  2 ILE I 467  ? VAL I 475  ? ILE C 467  VAL C 475  
R  3 VAL I 478  ? MET I 486  ? VAL C 478  MET C 486  
S  1 ARG I 460  ? VAL I 461  ? ARG C 460  VAL C 461  
S  2 ILE I 467  ? VAL I 475  ? ILE C 467  VAL C 475  
S  3 PHE I 531  ? ASP I 533  ? PHE C 531  ASP C 533  
S  4 ILE I 496  ? ALA I 497  ? ILE C 496  ALA C 497  
S  5 VAL I 513  ? ARG I 516  ? VAL C 513  ARG C 516  
S  6 PRO I 521  ? VAL I 524  ? PRO C 521  VAL C 524  
T  1 LEU I 595  ? TYR I 596  ? LEU C 595  TYR C 596  
T  2 LEU I 654  ? ASP I 657  ? LEU C 654  ASP C 657  
T  3 ARG I 640  ? PRO I 641  ? ARG C 640  PRO C 641  
U  1 GLY I 601  ? VAL I 606  ? GLY C 601  VAL C 606  
U  2 ARG I 610  ? TYR I 615  ? ARG C 610  TYR C 615  
U  3 LEU I 620  ? PRO I 624  ? LEU C 620  PRO C 624  
V  1 TYR I 629  ? ARG I 630  ? TYR C 629  ARG C 630  
V  2 ALA I 636  ? LEU I 637  ? ALA C 636  LEU C 637  
W  1 ILE I 688  ? SER I 691  ? ILE C 688  SER C 691  
W  2 LYS I 846  ? LEU I 853  ? LYS C 846  LEU C 853  
W  3 LYS I 838  ? ASN I 841  ? LYS C 838  ASN C 841  
W  4 ILE I 987  ? LYS I 996  ? ILE C 987  LYS C 996  
W  5 GLN I 670  ? ALA I 675  ? GLN C 670  ALA C 675  
W  6 VAL I 869  ? ILE I 870  ? VAL C 869  ILE C 870  
X  1 ILE I 688  ? SER I 691  ? ILE C 688  SER C 691  
X  2 LYS I 846  ? LEU I 853  ? LYS C 846  LEU C 853  
X  3 LYS I 838  ? ASN I 841  ? LYS C 838  ASN C 841  
X  4 ILE I 987  ? LYS I 996  ? ILE C 987  LYS C 996  
X  5 LYS I 971  ? VAL I 972  ? LYS C 971  VAL C 972  
Y  1 GLY I 718  ? PRO I 719  ? GLY C 718  PRO C 719  
Y  2 THR I 701  ? THR I 715  ? THR C 701  THR C 715  
Y  3 VAL I 819  ? LYS I 832  ? VAL C 819  LYS C 832  
Y  4 ILE I 799  ? LEU I 806  ? ILE C 799  LEU C 806  
Y  5 ALA I 747  ? GLU I 748  ? ALA C 747  GLU C 748  
Z  1 ILE I 754  ? VAL I 756  ? ILE C 754  VAL C 756  
Z  2 LEU I 790  ? ARG I 791  ? LEU C 790  ARG C 791  
AA 1 THR I 759  ? SER I 760  ? THR C 759  SER C 760  
AA 2 LYS I 786  ? ASP I 787  ? LYS C 786  ASP C 787  
AB 1 HIS I 1006 ? ARG I 1008 ? HIS C 1006 ARG C 1008 
AB 2 SER J 626  ? VAL J 633  ? SER D 626  VAL D 633  
AB 3 GLN J 744  ? HIS J 748  ? GLN D 744  HIS D 748  
AB 4 VAL J 700  ? ASN J 703  ? VAL D 700  ASN D 703  
AB 5 ILE J 713  ? VAL J 721  ? ILE D 713  VAL D 721  
AB 6 GLN J 641  ? PRO J 645  ? GLN D 641  PRO D 645  
AB 7 ILE J 726  ? LEU J 728  ? ILE D 726  LEU D 728  
AB 8 SER J 626  ? VAL J 633  ? SER D 626  VAL D 633  
AC 1 ASP I 1098 ? LEU I 1102 ? ASP C 1098 LEU C 1102 
AC 2 LYS J 7    ? ALA J 11   ? LYS D 7    ALA D 11   
AC 3 LYS J 1455 ? GLU J 1458 ? LYS D 1455 GLU D 1458 
AD 1 GLY J 91   ? ALA J 100  ? GLY D 91   ALA D 100  
AD 2 ILE J 513  ? VAL J 519  ? ILE D 513  VAL D 519  
AE 1 GLU J 167  ? PRO J 170  ? GLU D 167  PRO D 170  
AE 2 SER J 392  ? VAL J 396  ? SER D 392  VAL D 396  
AE 3 GLY J 201  ? ARG J 206  ? GLY D 201  ARG D 206  
AE 4 GLU J 184  ? VAL J 185  ? GLU D 184  VAL D 185  
AF 1 VAL J 400  ? PRO J 402  ? VAL D 400  PRO D 402  
AF 2 VAL J 443  ? VAL J 446  ? VAL D 443  VAL D 446  
AF 3 GLY J 433  ? ASP J 438  ? GLY D 433  ASP D 438  
AF 4 ARG J 414  ? VAL J 415  ? ARG D 414  VAL D 415  
AG 1 VAL J 420  ? ALA J 422  ? VAL D 420  ALA D 422  
AG 2 VAL J 427  ? LYS J 428  ? VAL D 427  LYS D 428  
AH 1 MET J 527  ? GLN J 529  ? MET D 527  GLN D 529  
AH 2 PHE J 535  ? THR J 537  ? PHE D 535  THR D 537  
AI 1 VAL J 591  ? THR J 592  ? VAL D 591  THR D 592  
AI 2 SER J 596  ? PRO J 599  ? SER D 596  PRO D 599  
AJ 1 VAL J 842  ? PHE J 843  ? VAL D 842  PHE D 843  
AJ 2 THR J 865  ? ARG J 867  ? THR D 865  ARG D 867  
AJ 3 ARG J 872  ? GLU J 874  ? ARG D 872  GLU D 874  
AK 1 ILE J 1118 ? SER J 1119 ? ILE D 1118 SER D 1119 
AK 2 PRO J 1187 ? ARG J 1189 ? PRO D 1187 ARG D 1189 
AK 3 VAL J 1148 ? LEU J 1149 ? VAL D 1148 LEU D 1149 
AL 1 PHE J 1123 ? GLN J 1124 ? PHE D 1123 GLN D 1124 
AL 2 ARG J 1133 ? LEU J 1134 ? ARG D 1133 LEU D 1134 
AM 1 VAL J 1153 ? GLU J 1154 ? VAL D 1153 GLU D 1154 
AM 2 ARG J 1159 ? LEU J 1160 ? ARG D 1159 LEU D 1160 
AN 1 GLY J 1392 ? VAL J 1394 ? GLY D 1392 VAL D 1394 
AN 2 TYR J 1378 ? ASP J 1383 ? TYR D 1378 ASP D 1383 
AN 3 ALA J 1416 ? LEU J 1420 ? ALA D 1416 LEU D 1420 
AO 1 GLN J 1485 ? VAL J 1487 ? GLN D 1485 VAL D 1487 
AO 2 VAL K 74   ? GLY K 76   ? VAL E 74   GLY E 76   
AP 1 VAL L 10   ? GLN L 16   ? VAL K 10   GLN K 16   
AP 2 TYR L 20   ? LEU L 28   ? TYR K 20   LEU K 28   
AP 3 ASP L 193  ? THR L 201  ? ASP K 193  THR K 201  
AP 4 VAL L 174  ? ASP L 183  ? VAL K 174  ASP K 183  
AQ 1 THR L 96   ? GLU L 104  ? THR K 96   GLU K 104  
AQ 2 ARG L 137  ? VAL L 148  ? ARG K 137  VAL K 148  
AQ 3 PRO L 49   ? ILE L 58   ? PRO K 49   ILE K 58   
AQ 4 ILE L 165  ? PRO L 166  ? ILE K 165  PRO K 166  
AR 1 VAL L 87   ? PHE L 89   ? VAL K 87   PHE K 89   
AR 2 VAL L 120  ? ILE L 122  ? VAL K 120  ILE K 122  
AS 1 GLU L 108  ? LYS L 110  ? GLU K 108  LYS K 110  
AS 2 HIS L 128  ? THR L 131  ? HIS K 128  THR K 131  
AT 1 TYR L 150  ? VAL L 151  ? TYR K 150  VAL K 151  
AT 2 ALA L 169  ? VAL L 170  ? ALA K 169  VAL K 170  
AU 1 VAL M 10   ? GLN M 16   ? VAL L 10   GLN L 16   
AU 2 TYR M 20   ? LEU M 28   ? TYR L 20   LEU L 28   
AU 3 ASP M 193  ? THR M 201  ? ASP L 193  THR L 201  
AU 4 VAL M 174  ? ASP M 183  ? VAL L 174  ASP L 183  
AV 1 THR M 96   ? GLU M 104  ? THR L 96   GLU L 104  
AV 2 ARG M 137  ? GLY M 147  ? ARG L 137  GLY L 147  
AV 3 GLY M 50   ? ILE M 58   ? GLY L 50   ILE L 58   
AV 4 ILE M 165  ? PRO M 166  ? ILE L 165  PRO L 166  
AW 1 VAL M 87   ? PHE M 89   ? VAL L 87   PHE L 89   
AW 2 VAL M 120  ? ILE M 122  ? VAL L 120  ILE L 122  
AX 1 GLU M 108  ? LYS M 110  ? GLU L 108  LYS L 110  
AX 2 HIS M 128  ? THR M 131  ? HIS L 128  THR L 131  
AY 1 TYR M 150  ? VAL M 151  ? TYR L 150  VAL L 151  
AY 2 ALA M 169  ? VAL M 170  ? ALA L 169  VAL L 170  
AZ 1 ILE N 3    ? ARG N 5    ? ILE M 3    ARG M 5    
AZ 2 ARG N 900  ? ILE N 902  ? ARG M 900  ILE M 902  
AZ 3 VAL N 579  ? MET N 580  ? VAL M 579  MET M 580  
BA 1 ILE N 54   ? GLU N 56   ? ILE M 54   GLU M 56   
BA 2 LEU N 64   ? PHE N 68   ? LEU M 64   PHE M 68   
BA 3 LEU N 98   ? ILE N 101  ? LEU M 98   ILE M 101  
BB 1 GLN N 91   ? PRO N 93   ? GLN M 91   PRO M 93   
BB 2 HIS N 117  ? PRO N 119  ? HIS M 117  PRO M 119  
BC 1 PHE N 127  ? ILE N 128  ? PHE M 127  ILE M 128  
BC 2 ASP N 133  ? VAL N 135  ? ASP M 133  VAL M 135  
BC 3 GLN N 393  ? PHE N 394  ? GLN M 393  PHE M 394  
BD 1 ILE N 140  ? ARG N 142  ? ILE M 140  ARG M 142  
BD 2 ARG N 331  ? ILE N 333  ? ARG M 331  ILE M 333  
BE 1 VAL N 146  ? THR N 149  ? VAL M 146  THR M 149  
BE 2 ILE N 159  ? ILE N 162  ? ILE M 159  ILE M 162  
BE 3 ILE N 172  ? GLU N 177  ? ILE M 172  GLU M 177  
BE 4 VAL N 181  ? MET N 184  ? VAL M 181  MET M 184  
BF 1 ARG N 409  ? ILE N 410  ? ARG M 409  ILE M 410  
BF 2 THR N 453  ? SER N 454  ? THR M 453  SER M 454  
BG 1 ARG N 460  ? VAL N 461  ? ARG M 460  VAL M 461  
BG 2 ILE N 467  ? VAL N 475  ? ILE M 467  VAL M 475  
BG 3 VAL N 478  ? MET N 486  ? VAL M 478  MET M 486  
BH 1 ARG N 460  ? VAL N 461  ? ARG M 460  VAL M 461  
BH 2 ILE N 467  ? VAL N 475  ? ILE M 467  VAL M 475  
BH 3 PHE N 531  ? ASP N 533  ? PHE M 531  ASP M 533  
BH 4 ILE N 496  ? ALA N 497  ? ILE M 496  ALA M 497  
BH 5 VAL N 513  ? ARG N 516  ? VAL M 513  ARG M 516  
BH 6 PRO N 521  ? VAL N 524  ? PRO M 521  VAL M 524  
BI 1 LEU N 595  ? TYR N 596  ? LEU M 595  TYR M 596  
BI 2 LEU N 654  ? ASP N 657  ? LEU M 654  ASP M 657  
BI 3 ARG N 640  ? PRO N 641  ? ARG M 640  PRO M 641  
BJ 1 GLY N 601  ? VAL N 606  ? GLY M 601  VAL M 606  
BJ 2 ARG N 610  ? TYR N 615  ? ARG M 610  TYR M 615  
BJ 3 LEU N 620  ? PRO N 624  ? LEU M 620  PRO M 624  
BK 1 TYR N 629  ? ARG N 630  ? TYR M 629  ARG M 630  
BK 2 ALA N 636  ? LEU N 637  ? ALA M 636  LEU M 637  
BL 1 ILE N 688  ? SER N 691  ? ILE M 688  SER M 691  
BL 2 LYS N 846  ? LEU N 853  ? LYS M 846  LEU M 853  
BL 3 LYS N 838  ? ASN N 841  ? LYS M 838  ASN M 841  
BL 4 ILE N 987  ? LYS N 996  ? ILE M 987  LYS M 996  
BL 5 GLN N 670  ? ALA N 675  ? GLN M 670  ALA M 675  
BL 6 VAL N 869  ? ILE N 870  ? VAL M 869  ILE M 870  
BM 1 ILE N 688  ? SER N 691  ? ILE M 688  SER M 691  
BM 2 LYS N 846  ? LEU N 853  ? LYS M 846  LEU M 853  
BM 3 LYS N 838  ? ASN N 841  ? LYS M 838  ASN M 841  
BM 4 ILE N 987  ? LYS N 996  ? ILE M 987  LYS M 996  
BM 5 LYS N 971  ? VAL N 972  ? LYS M 971  VAL M 972  
BN 1 THR N 701  ? GLU N 711  ? THR M 701  GLU M 711  
BN 2 VAL N 822  ? LYS N 832  ? VAL M 822  LYS M 832  
BN 3 ILE N 799  ? LEU N 806  ? ILE M 799  LEU M 806  
BO 1 ASP N 714  ? THR N 715  ? ASP M 714  THR M 715  
BO 2 GLY N 718  ? PRO N 719  ? GLY M 718  PRO M 719  
BP 1 ARG N 721  ? ILE N 722  ? ARG M 721  ILE M 722  
BP 2 ARG N 758  ? PHE N 761  ? ARG M 758  PHE M 761  
BP 3 VAL N 785  ? ASP N 787  ? VAL M 785  ASP M 787  
BQ 1 ILE N 754  ? VAL N 756  ? ILE M 754  VAL M 756  
BQ 2 LEU N 790  ? ARG N 791  ? LEU M 790  ARG M 791  
BR 1 HIS N 1006 ? ARG N 1008 ? HIS M 1006 ARG M 1008 
BR 2 SER O 626  ? VAL O 633  ? SER N 626  VAL N 633  
BR 3 GLN O 744  ? HIS O 748  ? GLN N 744  HIS N 748  
BR 4 VAL O 700  ? ASN O 703  ? VAL N 700  ASN N 703  
BR 5 ILE O 713  ? VAL O 721  ? ILE N 713  VAL N 721  
BR 6 GLN O 641  ? PRO O 645  ? GLN N 641  PRO N 645  
BR 7 ILE O 726  ? LEU O 728  ? ILE N 726  LEU N 728  
BR 8 SER O 626  ? VAL O 633  ? SER N 626  VAL N 633  
BS 1 ASP N 1098 ? LEU N 1102 ? ASP M 1098 LEU M 1102 
BS 2 LYS O 7    ? ALA O 11   ? LYS N 7    ALA N 11   
BS 3 LYS O 1455 ? GLU O 1458 ? LYS N 1455 GLU N 1458 
BT 1 GLY O 91   ? ALA O 100  ? GLY N 91   ALA N 100  
BT 2 ILE O 513  ? VAL O 519  ? ILE N 513  VAL N 519  
BU 1 LEU O 152  ? LEU O 153  ? LEU N 152  LEU N 153  
BU 2 ILE O 133  ? GLY O 139  ? ILE N 133  GLY N 139  
BU 3 ILE O 452  ? ARG O 455  ? ILE N 452  ARG N 455  
BV 1 GLU O 167  ? PRO O 170  ? GLU N 167  PRO N 170  
BV 2 SER O 392  ? VAL O 396  ? SER N 392  VAL N 396  
BV 3 GLY O 201  ? ARG O 206  ? GLY N 201  ARG N 206  
BV 4 GLU O 184  ? VAL O 185  ? GLU N 184  VAL N 185  
BW 1 TYR O 401  ? PRO O 402  ? TYR N 401  PRO N 402  
BW 2 VAL O 443  ? VAL O 446  ? VAL N 443  VAL N 446  
BW 3 GLY O 433  ? ASP O 438  ? GLY N 433  ASP N 438  
BW 4 ARG O 414  ? VAL O 415  ? ARG N 414  VAL N 415  
BX 1 VAL O 420  ? ALA O 422  ? VAL N 420  ALA N 422  
BX 2 VAL O 427  ? LYS O 428  ? VAL N 427  LYS N 428  
BY 1 MET O 527  ? GLN O 529  ? MET N 527  GLN N 529  
BY 2 PHE O 535  ? THR O 537  ? PHE N 535  THR N 537  
BZ 1 VAL O 591  ? THR O 592  ? VAL N 591  THR N 592  
BZ 2 SER O 596  ? PRO O 599  ? SER N 596  PRO N 599  
CA 1 VAL O 842  ? PHE O 843  ? VAL N 842  PHE N 843  
CA 2 THR O 865  ? ARG O 867  ? THR N 865  ARG N 867  
CA 3 ARG O 872  ? GLU O 874  ? ARG N 872  GLU N 874  
CB 1 ILE O 1118 ? SER O 1119 ? ILE N 1118 SER N 1119 
CB 2 PRO O 1187 ? ARG O 1189 ? PRO N 1187 ARG N 1189 
CB 3 VAL O 1148 ? LEU O 1149 ? VAL N 1148 LEU N 1149 
CC 1 PHE O 1123 ? GLN O 1124 ? PHE N 1123 GLN N 1124 
CC 2 ARG O 1133 ? LEU O 1134 ? ARG N 1133 LEU N 1134 
CD 1 VAL O 1153 ? GLU O 1154 ? VAL N 1153 GLU N 1154 
CD 2 ARG O 1159 ? LEU O 1160 ? ARG N 1159 LEU N 1160 
CE 1 GLY O 1392 ? VAL O 1394 ? GLY N 1392 VAL N 1394 
CE 2 TYR O 1378 ? ASP O 1383 ? TYR N 1378 ASP N 1383 
CE 3 ALA O 1416 ? PRO O 1419 ? ALA N 1416 PRO N 1419 
CF 1 GLN O 1485 ? VAL O 1487 ? GLN N 1485 VAL N 1487 
CF 2 VAL P 74   ? GLY P 76   ? VAL O 74   GLY O 76   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N VAL G 10   ? N VAL A 10   O GLU G 26   ? O GLU A 26   
A  2 3 N LEU G 28   ? N LEU A 28   O ASP G 193  ? O ASP A 193  
A  3 4 O ARG G 198  ? O ARG A 198  N ALA G 178  ? N ALA A 178  
B  1 2 N LEU G 101  ? N LEU A 101  O MET G 140  ? O MET A 140  
B  2 3 O GLY G 147  ? O GLY A 147  N GLY G 50   ? N GLY A 50   
B  3 4 N VAL G 56   ? N VAL A 56   O ILE G 165  ? O ILE A 165  
C  1 2 N ARG G 88   ? N ARG A 88   O GLU G 121  ? O GLU A 121  
D  1 2 N VAL G 109  ? N VAL A 109  O ILE G 129  ? O ILE A 129  
E  1 2 N VAL G 151  ? N VAL A 151  O ALA G 169  ? O ALA A 169  
F  1 2 N VAL H 10   ? N VAL B 10   O GLU H 26   ? O GLU B 26   
F  2 3 N GLY H 21   ? N GLY B 21   O ILE H 199  ? O ILE B 199  
F  3 4 O ARG H 198  ? O ARG B 198  N ALA H 178  ? N ALA B 178  
G  1 2 N LEU H 99   ? N LEU B 99   O VAL H 142  ? O VAL B 142  
G  2 3 O GLY H 147  ? O GLY B 147  N GLY H 50   ? N GLY B 50   
G  3 4 N VAL H 56   ? N VAL B 56   O ILE H 165  ? O ILE B 165  
H  1 2 N ARG H 88   ? N ARG B 88   O GLU H 121  ? O GLU B 121  
I  1 2 N VAL H 109  ? N VAL B 109  O ILE H 129  ? O ILE B 129  
J  1 2 N VAL H 151  ? N VAL B 151  O ALA H 169  ? O ALA B 169  
K  1 2 N GLU I 2    ? N GLU C 2    O ARG I 900  ? O ARG C 900  
K  2 3 O TYR I 901  ? O TYR C 901  N MET I 580  ? N MET C 580  
L  1 2 N GLU I 56   ? N GLU C 56   O LEU I 64   ? O LEU C 64   
L  2 3 N VAL I 65   ? N VAL C 65   O ILE I 101  ? O ILE C 101  
M  1 2 N ALA I 92   ? N ALA C 92   O ILE I 118  ? O ILE C 118  
N  1 2 N PHE I 127  ? N PHE C 127  O ARG I 134  ? O ARG C 134  
N  2 3 N VAL I 135  ? N VAL C 135  O GLN I 393  ? O GLN C 393  
O  1 2 N HIS I 141  ? N HIS C 141  O ARG I 332  ? O ARG C 332  
P  1 2 N TYR I 147  ? N TYR C 147  O SER I 161  ? O SER C 161  
P  2 3 N ILE I 162  ? N ILE C 162  O ILE I 172  ? O ILE C 172  
P  3 4 N GLU I 175  ? N GLU C 175  O SER I 183  ? O SER C 183  
Q  1 2 N ILE I 410  ? N ILE C 410  O THR I 453  ? O THR C 453  
R  1 2 N ARG I 460  ? N ARG C 460  O ARG I 468  ? O ARG C 468  
R  2 3 N ARG I 473  ? N ARG C 473  O THR I 480  ? O THR C 480  
S  1 2 N ARG I 460  ? N ARG C 460  O ARG I 468  ? O ARG C 468  
S  2 3 N ARG I 472  ? N ARG C 472  O MET I 532  ? O MET C 532  
S  3 4 O ASP I 533  ? O ASP C 533  N ALA I 497  ? N ALA C 497  
S  4 5 N ILE I 496  ? N ILE C 496  O ARG I 516  ? O ARG C 516  
S  5 6 N ALA I 515  ? N ALA C 515  O VAL I 522  ? O VAL C 522  
T  1 2 N LEU I 595  ? N LEU C 595  O LEU I 655  ? O LEU C 655  
T  2 3 O ASP I 657  ? O ASP C 657  N ARG I 640  ? N ARG C 640  
U  1 2 N GLU I 602  ? N GLU C 602  O ARG I 614  ? O ARG C 614  
U  2 3 N VAL I 613  ? N VAL C 613  O VAL I 621  ? O VAL C 621  
V  1 2 N TYR I 629  ? N TYR C 629  O LEU I 637  ? O LEU C 637  
W  1 2 N ILE I 688  ? N ILE C 688  O VAL I 848  ? O VAL C 848  
W  2 3 O GLY I 847  ? O GLY C 847  N LEU I 839  ? N LEU C 839  
W  3 4 N ALA I 840  ? N ALA C 840  O MET I 995  ? O MET C 995  
W  4 5 O GLY I 990  ? O GLY C 990  N VAL I 674  ? N VAL C 674  
W  5 6 N ALA I 675  ? N ALA C 675  O VAL I 869  ? O VAL C 869  
X  1 2 N ILE I 688  ? N ILE C 688  O VAL I 848  ? O VAL C 848  
X  2 3 O GLY I 847  ? O GLY C 847  N LEU I 839  ? N LEU C 839  
X  3 4 N ALA I 840  ? N ALA C 840  O MET I 995  ? O MET C 995  
X  4 5 O ILE I 987  ? O ILE C 987  N VAL I 972  ? N VAL C 972  
Y  1 2 O GLY I 718  ? O GLY C 718  N THR I 715  ? N THR C 715  
Y  2 3 N ALA I 712  ? N ALA C 712  O GLU I 821  ? O GLU C 821  
Y  3 4 O ALA I 828  ? O ALA C 828  N ILE I 799  ? N ILE C 799  
Y  4 5 O VAL I 800  ? O VAL C 800  N ALA I 747  ? N ALA C 747  
Z  1 2 N LEU I 755  ? N LEU C 755  O LEU I 790  ? O LEU C 790  
AA 1 2 N SER I 760  ? N SER C 760  O LYS I 786  ? O LYS C 786  
AB 1 2 N ARG I 1008 ? N ARG C 1008 O SER J 626  ? O SER D 626  
AB 2 3 N GLY J 627  ? N GLY D 627  O VAL J 747  ? O VAL D 747  
AB 3 4 O HIS J 748  ? O HIS D 748  N LEU J 701  ? N LEU D 701  
AB 4 5 N VAL J 700  ? N VAL D 700  O PHE J 716  ? O PHE D 716  
AB 5 6 O VAL J 719  ? O VAL D 719  N CYS J 642  ? N CYS D 642  
AB 6 7 N GLY J 643  ? N GLY D 643  O GLN J 727  ? O GLN D 727  
AB 7 8 O ILE J 726  ? O ILE D 726  N VAL J 632  ? N VAL D 632  
AC 1 2 N GLN I 1100 ? N GLN C 1100 O ARG J 9    ? O ARG D 9    
AC 2 3 N VAL J 8    ? N VAL D 8    O ASP J 1457 ? O ASP D 1457 
AD 1 2 N ALA J 99   ? N ALA D 99   O LEU J 514  ? O LEU D 514  
AE 1 2 N TYR J 169  ? N TYR D 169  O ILE J 393  ? O ILE D 393  
AE 2 3 O SER J 392  ? O SER D 392  N ARG J 206  ? N ARG D 206  
AE 3 4 O GLY J 201  ? O GLY D 201  N VAL J 185  ? N VAL D 185  
AF 1 2 N TYR J 401  ? N TYR D 401  O VAL J 444  ? O VAL D 444  
AF 2 3 O VAL J 443  ? O VAL D 443  N ASP J 438  ? N ASP D 438  
AF 3 4 O GLY J 433  ? O GLY D 433  N VAL J 415  ? N VAL D 415  
AG 1 2 N LEU J 421  ? N LEU D 421  O VAL J 427  ? O VAL D 427  
AH 1 2 N VAL J 528  ? N VAL D 528  O ALA J 536  ? O ALA D 536  
AI 1 2 N THR J 592  ? N THR D 592  O ARG J 598  ? O ARG D 598  
AJ 1 2 N PHE J 843  ? N PHE D 843  O ARG J 867  ? O ARG D 867  
AJ 2 3 N VAL J 866  ? N VAL D 866  O LEU J 873  ? O LEU D 873  
AK 1 2 N ILE J 1118 ? N ILE D 1118 O VAL J 1188 ? O VAL D 1188 
AK 2 3 O ARG J 1189 ? O ARG D 1189 N VAL J 1148 ? N VAL D 1148 
AL 1 2 N GLN J 1124 ? N GLN D 1124 O ARG J 1133 ? O ARG D 1133 
AM 1 2 N VAL J 1153 ? N VAL D 1153 O LEU J 1160 ? O LEU D 1160 
AN 1 2 O GLN J 1393 ? O GLN D 1393 N VAL J 1379 ? N VAL D 1379 
AN 2 3 N THR J 1382 ? N THR D 1382 O ALA J 1416 ? O ALA D 1416 
AO 1 2 N VAL J 1487 ? N VAL D 1487 O VAL K 74   ? O VAL E 74   
AP 1 2 N THR L 12   ? N THR K 12   O VAL L 24   ? O VAL K 24   
AP 2 3 N LEU L 28   ? N LEU K 28   O ASP L 193  ? O ASP K 193  
AP 3 4 O ARG L 198  ? O ARG K 198  N ALA L 178  ? N ALA K 178  
AQ 1 2 N LEU L 101  ? N LEU K 101  O MET L 140  ? O MET K 140  
AQ 2 3 O GLY L 147  ? O GLY K 147  N GLY L 50   ? N GLY K 50   
AQ 3 4 N VAL L 56   ? N VAL K 56   O ILE L 165  ? O ILE K 165  
AR 1 2 N ARG L 88   ? N ARG K 88   O GLU L 121  ? O GLU K 121  
AS 1 2 N VAL L 109  ? N VAL K 109  O ILE L 129  ? O ILE K 129  
AT 1 2 N VAL L 151  ? N VAL K 151  O ALA L 169  ? O ALA K 169  
AU 1 2 N THR M 12   ? N THR L 12   O VAL M 24   ? O VAL L 24   
AU 2 3 N GLY M 21   ? N GLY L 21   O ILE M 199  ? O ILE L 199  
AU 3 4 O ARG M 198  ? O ARG L 198  N ALA M 178  ? N ALA L 178  
AV 1 2 N LEU M 101  ? N LEU L 101  O MET M 140  ? O MET L 140  
AV 2 3 O GLY M 147  ? O GLY L 147  N GLY M 50   ? N GLY L 50   
AV 3 4 N VAL M 56   ? N VAL L 56   O ILE M 165  ? O ILE L 165  
AW 1 2 N ARG M 88   ? N ARG L 88   O GLU M 121  ? O GLU L 121  
AX 1 2 N VAL M 109  ? N VAL L 109  O ILE M 129  ? O ILE L 129  
AY 1 2 N VAL M 151  ? N VAL L 151  O ALA M 169  ? O ALA L 169  
AZ 1 2 N LYS N 4    ? N LYS M 4    O ILE N 902  ? O ILE M 902  
AZ 2 3 O TYR N 901  ? O TYR M 901  N MET N 580  ? N MET M 580  
BA 1 2 N GLU N 56   ? N GLU M 56   O LEU N 64   ? O LEU M 64   
BA 2 3 N VAL N 65   ? N VAL M 65   O ILE N 101  ? O ILE M 101  
BB 1 2 N ALA N 92   ? N ALA M 92   O ILE N 118  ? O ILE M 118  
BC 1 2 N PHE N 127  ? N PHE M 127  O ARG N 134  ? O ARG M 134  
BC 2 3 N VAL N 135  ? N VAL M 135  O GLN N 393  ? O GLN M 393  
BD 1 2 N HIS N 141  ? N HIS M 141  O ARG N 332  ? O ARG M 332  
BE 1 2 N TYR N 147  ? N TYR M 147  O SER N 161  ? O SER M 161  
BE 2 3 N ALA N 160  ? N ALA M 160  O LEU N 174  ? O LEU M 174  
BE 3 4 N GLU N 175  ? N GLU M 175  O SER N 183  ? O SER M 183  
BF 1 2 N ILE N 410  ? N ILE M 410  O THR N 453  ? O THR M 453  
BG 1 2 N ARG N 460  ? N ARG M 460  O ARG N 468  ? O ARG M 468  
BG 2 3 N ARG N 473  ? N ARG M 473  O THR N 480  ? O THR M 480  
BH 1 2 N ARG N 460  ? N ARG M 460  O ARG N 468  ? O ARG M 468  
BH 2 3 N ARG N 472  ? N ARG M 472  O MET N 532  ? O MET M 532  
BH 3 4 O ASP N 533  ? O ASP M 533  N ALA N 497  ? N ALA M 497  
BH 4 5 N ILE N 496  ? N ILE M 496  O ARG N 516  ? O ARG M 516  
BH 5 6 N ALA N 515  ? N ALA M 515  O VAL N 522  ? O VAL M 522  
BI 1 2 N LEU N 595  ? N LEU M 595  O LEU N 655  ? O LEU M 655  
BI 2 3 O ASP N 657  ? O ASP M 657  N ARG N 640  ? N ARG M 640  
BJ 1 2 N GLU N 602  ? N GLU M 602  O ARG N 614  ? O ARG M 614  
BJ 2 3 N VAL N 613  ? N VAL M 613  O VAL N 621  ? O VAL M 621  
BK 1 2 N TYR N 629  ? N TYR M 629  O LEU N 637  ? O LEU M 637  
BL 1 2 N ILE N 688  ? N ILE M 688  O VAL N 848  ? O VAL M 848  
BL 2 3 O GLY N 847  ? O GLY M 847  N LEU N 839  ? N LEU M 839  
BL 3 4 N ALA N 840  ? N ALA M 840  O MET N 995  ? O MET M 995  
BL 4 5 O GLY N 990  ? O GLY M 990  N VAL N 674  ? N VAL M 674  
BL 5 6 N ALA N 675  ? N ALA M 675  O VAL N 869  ? O VAL M 869  
BM 1 2 N ILE N 688  ? N ILE M 688  O VAL N 848  ? O VAL M 848  
BM 2 3 O GLY N 847  ? O GLY M 847  N LEU N 839  ? N LEU M 839  
BM 3 4 N ALA N 840  ? N ALA M 840  O MET N 995  ? O MET M 995  
BM 4 5 O ILE N 987  ? O ILE M 987  N VAL N 972  ? N VAL M 972  
BN 1 2 N SER N 702  ? N SER M 702  O ARG N 831  ? O ARG M 831  
BN 2 3 O ALA N 828  ? O ALA M 828  N ILE N 799  ? N ILE M 799  
BO 1 2 N THR N 715  ? N THR M 715  O GLY N 718  ? O GLY M 718  
BP 1 2 N ARG N 721  ? N ARG M 721  O THR N 759  ? O THR M 759  
BP 2 3 N SER N 760  ? N SER M 760  O LYS N 786  ? O LYS M 786  
BQ 1 2 N LEU N 755  ? N LEU M 755  O LEU N 790  ? O LEU M 790  
BR 1 2 N ARG N 1008 ? N ARG M 1008 O SER O 626  ? O SER N 626  
BR 2 3 N GLY O 627  ? N GLY N 627  O VAL O 747  ? O VAL N 747  
BR 3 4 O HIS O 748  ? O HIS N 748  N LEU O 701  ? N LEU N 701  
BR 4 5 N LEU O 702  ? N LEU N 702  O GLN O 714  ? O GLN N 714  
BR 5 6 O VAL O 719  ? O VAL N 719  N CYS O 642  ? N CYS N 642  
BR 6 7 N GLY O 643  ? N GLY N 643  O GLN O 727  ? O GLN N 727  
BR 7 8 O ILE O 726  ? O ILE N 726  N VAL O 632  ? N VAL N 632  
BS 1 2 N ASP N 1098 ? N ASP M 1098 O ALA O 11   ? O ALA N 11   
BS 2 3 N VAL O 8    ? N VAL N 8    O ASP O 1457 ? O ASP N 1457 
BT 1 2 N GLY O 91   ? N GLY N 91   O VAL O 519  ? O VAL N 519  
BU 1 2 O LEU O 153  ? O LEU N 153  N ILE O 133  ? N ILE N 133  
BU 2 3 N VAL O 134  ? N VAL N 134  O ARG O 455  ? O ARG N 455  
BV 1 2 N TYR O 169  ? N TYR N 169  O ILE O 393  ? O ILE N 393  
BV 2 3 O SER O 392  ? O SER N 392  N ARG O 206  ? N ARG N 206  
BV 3 4 O GLY O 201  ? O GLY N 201  N VAL O 185  ? N VAL N 185  
BW 1 2 N TYR O 401  ? N TYR N 401  O VAL O 444  ? O VAL N 444  
BW 2 3 O VAL O 443  ? O VAL N 443  N ASP O 438  ? N ASP N 438  
BW 3 4 O GLY O 433  ? O GLY N 433  N VAL O 415  ? N VAL N 415  
BX 1 2 N LEU O 421  ? N LEU N 421  O VAL O 427  ? O VAL N 427  
BY 1 2 N VAL O 528  ? N VAL N 528  O ALA O 536  ? O ALA N 536  
BZ 1 2 N THR O 592  ? N THR N 592  O ARG O 598  ? O ARG N 598  
CA 1 2 N PHE O 843  ? N PHE N 843  O ARG O 867  ? O ARG N 867  
CA 2 3 N VAL O 866  ? N VAL N 866  O LEU O 873  ? O LEU N 873  
CB 1 2 N ILE O 1118 ? N ILE N 1118 O VAL O 1188 ? O VAL N 1188 
CB 2 3 O ARG O 1189 ? O ARG N 1189 N VAL O 1148 ? N VAL N 1148 
CC 1 2 N GLN O 1124 ? N GLN N 1124 O ARG O 1133 ? O ARG N 1133 
CD 1 2 N VAL O 1153 ? N VAL N 1153 O LEU O 1160 ? O LEU N 1160 
CE 1 2 O GLN O 1393 ? O GLN N 1393 N VAL O 1379 ? N VAL N 1379 
CE 2 3 N THR O 1382 ? N THR N 1382 O ALA O 1416 ? O ALA N 1416 
CF 1 2 N VAL O 1487 ? N VAL N 1487 O VAL P 74   ? O VAL O 74   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 4058'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN D 6112'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN N 5058'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE ZN N 7112'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG D 8001'  
AC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG D 8002'  
AC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG N 9001'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG N 9002'  
AC9 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE APC D 3999' 
BC1 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE APC N 4999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS J  58   ? CYS D 58   . ? 1_555 ? 
2  AC1 4  CYS J  60   ? CYS D 60   . ? 1_555 ? 
3  AC1 4  CYS J  73   ? CYS D 73   . ? 1_555 ? 
4  AC1 4  CYS J  76   ? CYS D 76   . ? 1_555 ? 
5  AC2 4  CYS J  1112 ? CYS D 1112 . ? 1_555 ? 
6  AC2 4  CYS J  1194 ? CYS D 1194 . ? 1_555 ? 
7  AC2 4  CYS J  1201 ? CYS D 1201 . ? 1_555 ? 
8  AC2 4  CYS J  1204 ? CYS D 1204 . ? 1_555 ? 
9  AC3 4  CYS O  58   ? CYS N 58   . ? 1_555 ? 
10 AC3 4  CYS O  60   ? CYS N 60   . ? 1_555 ? 
11 AC3 4  CYS O  73   ? CYS N 73   . ? 1_555 ? 
12 AC3 4  CYS O  76   ? CYS N 76   . ? 1_555 ? 
13 AC4 4  CYS O  1112 ? CYS N 1112 . ? 1_555 ? 
14 AC4 4  CYS O  1194 ? CYS N 1194 . ? 1_555 ? 
15 AC4 4  CYS O  1201 ? CYS N 1201 . ? 1_555 ? 
16 AC4 4  CYS O  1204 ? CYS N 1204 . ? 1_555 ? 
17 AC5 5  ASP J  739  ? ASP D 739  . ? 1_555 ? 
18 AC5 5  ASP J  741  ? ASP D 741  . ? 1_555 ? 
19 AC5 5  ASP J  743  ? ASP D 743  . ? 1_555 ? 
20 AC5 5  APC U  .    ? APC D 3999 . ? 1_555 ? 
21 AC5 5  G   B  16   ? G   H 16   . ? 1_555 ? 
22 AC6 3  ASP J  739  ? ASP D 739  . ? 1_555 ? 
23 AC6 3  APC U  .    ? APC D 3999 . ? 1_555 ? 
24 AC6 3  HOH JA .    ? HOH D 8003 . ? 1_555 ? 
25 AC7 5  ASP O  739  ? ASP N 739  . ? 1_555 ? 
26 AC7 5  ASP O  741  ? ASP N 741  . ? 1_555 ? 
27 AC7 5  ASP O  743  ? ASP N 743  . ? 1_555 ? 
28 AC7 5  APC Z  .    ? APC N 4999 . ? 1_555 ? 
29 AC7 5  G   E  16   ? G   Y 16   . ? 1_555 ? 
30 AC8 4  GLU N  685  ? GLU M 685  . ? 1_555 ? 
31 AC8 4  HOH NA .    ? HOH M 1120 . ? 1_555 ? 
32 AC8 4  ASP O  739  ? ASP N 739  . ? 1_555 ? 
33 AC8 4  APC Z  .    ? APC N 4999 . ? 1_555 ? 
34 AC9 16 ARG I  879  ? ARG C 879  . ? 1_555 ? 
35 AC9 16 ARG J  704  ? ARG D 704  . ? 1_555 ? 
36 AC9 16 PRO J  706  ? PRO D 706  . ? 1_555 ? 
37 AC9 16 ASN J  737  ? ASN D 737  . ? 1_555 ? 
38 AC9 16 ASP J  739  ? ASP D 739  . ? 1_555 ? 
39 AC9 16 ARG J  783  ? ARG D 783  . ? 1_555 ? 
40 AC9 16 ARG J  1029 ? ARG D 1029 . ? 1_555 ? 
41 AC9 16 MET J  1238 ? MET D 1238 . ? 1_555 ? 
42 AC9 16 ARG J  1239 ? ARG D 1239 . ? 1_555 ? 
43 AC9 16 HIS J  1242 ? HIS D 1242 . ? 1_555 ? 
44 AC9 16 MG  S  .    ? MG  D 8001 . ? 1_555 ? 
45 AC9 16 MG  T  .    ? MG  D 8002 . ? 1_555 ? 
46 AC9 16 HOH JA .    ? HOH D 8003 . ? 1_555 ? 
47 AC9 16 HOH JA .    ? HOH D 8354 . ? 1_555 ? 
48 AC9 16 DT  A  14   ? DT  G 14   . ? 1_555 ? 
49 AC9 16 G   B  16   ? G   H 16   . ? 1_555 ? 
50 BC1 18 GLU N  685  ? GLU M 685  . ? 1_555 ? 
51 BC1 18 ARG N  879  ? ARG M 879  . ? 1_555 ? 
52 BC1 18 HOH NA .    ? HOH M 1120 . ? 1_555 ? 
53 BC1 18 ARG O  704  ? ARG N 704  . ? 1_555 ? 
54 BC1 18 ASN O  737  ? ASN N 737  . ? 1_555 ? 
55 BC1 18 ASP O  739  ? ASP N 739  . ? 1_555 ? 
56 BC1 18 ARG O  783  ? ARG N 783  . ? 1_555 ? 
57 BC1 18 ARG O  1029 ? ARG N 1029 . ? 1_555 ? 
58 BC1 18 GLN O  1235 ? GLN N 1235 . ? 1_555 ? 
59 BC1 18 MET O  1238 ? MET N 1238 . ? 1_555 ? 
60 BC1 18 ARG O  1239 ? ARG N 1239 . ? 1_555 ? 
61 BC1 18 MG  X  .    ? MG  N 9001 . ? 1_555 ? 
62 BC1 18 MG  Y  .    ? MG  N 9002 . ? 1_555 ? 
63 BC1 18 HOH OA .    ? HOH N 9165 . ? 1_555 ? 
64 BC1 18 HOH OA .    ? HOH N 9256 . ? 1_555 ? 
65 BC1 18 HOH OA .    ? HOH N 9356 . ? 1_555 ? 
66 BC1 18 DT  D  14   ? DT  X 14   . ? 1_555 ? 
67 BC1 18 G   E  16   ? G   Y 16   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2O5J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2O5J 
_atom_sites.fract_transf_matrix[1][1]   0.006564 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006564 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001906 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . DC  A  1  1    ? 11.501  63.477  42.968  1.00 86.59  ? 1    DC  G OP3   1 
ATOM   2     P  P     . DC  A  1  1    ? 11.744  62.474  41.860  1.00 84.49  ? 1    DC  G P     1 
ATOM   3     O  OP1   . DC  A  1  1    ? 13.194  61.998  41.847  1.00 84.60  ? 1    DC  G OP1   1 
ATOM   4     O  OP2   . DC  A  1  1    ? 10.724  61.341  41.896  1.00 84.25  ? 1    DC  G OP2   1 
ATOM   5     O  "O5'" . DC  A  1  1    ? 11.498  63.311  40.477  1.00 83.31  ? 1    DC  G "O5'" 1 
ATOM   6     C  "C5'" . DC  A  1  1    ? 12.439  63.241  39.392  1.00 81.08  ? 1    DC  G "C5'" 1 
ATOM   7     C  "C4'" . DC  A  1  1    ? 12.553  61.816  38.906  1.00 78.84  ? 1    DC  G "C4'" 1 
ATOM   8     O  "O4'" . DC  A  1  1    ? 11.493  61.530  37.968  1.00 78.30  ? 1    DC  G "O4'" 1 
ATOM   9     C  "C3'" . DC  A  1  1    ? 13.853  61.436  38.201  1.00 77.22  ? 1    DC  G "C3'" 1 
ATOM   10    O  "O3'" . DC  A  1  1    ? 14.127  60.079  38.564  1.00 74.82  ? 1    DC  G "O3'" 1 
ATOM   11    C  "C2'" . DC  A  1  1    ? 13.488  61.565  36.731  1.00 77.24  ? 1    DC  G "C2'" 1 
ATOM   12    C  "C1'" . DC  A  1  1    ? 12.045  61.082  36.746  1.00 77.65  ? 1    DC  G "C1'" 1 
ATOM   13    N  N1    . DC  A  1  1    ? 11.139  61.527  35.677  1.00 77.46  ? 1    DC  G N1    1 
ATOM   14    C  C2    . DC  A  1  1    ? 10.811  60.626  34.663  1.00 77.66  ? 1    DC  G C2    1 
ATOM   15    O  O2    . DC  A  1  1    ? 11.364  59.513  34.638  1.00 78.94  ? 1    DC  G O2    1 
ATOM   16    N  N3    . DC  A  1  1    ? 9.897   60.979  33.738  1.00 77.34  ? 1    DC  G N3    1 
ATOM   17    C  C4    . DC  A  1  1    ? 9.323   62.182  33.789  1.00 76.77  ? 1    DC  G C4    1 
ATOM   18    N  N4    . DC  A  1  1    ? 8.407   62.465  32.858  1.00 76.23  ? 1    DC  G N4    1 
ATOM   19    C  C5    . DC  A  1  1    ? 9.665   63.139  34.791  1.00 76.55  ? 1    DC  G C5    1 
ATOM   20    C  C6    . DC  A  1  1    ? 10.579  62.776  35.700  1.00 76.68  ? 1    DC  G C6    1 
ATOM   21    P  P     . DC  A  1  2    ? 15.625  59.519  38.533  1.00 73.66  ? 2    DC  G P     1 
ATOM   22    O  OP1   . DC  A  1  2    ? 15.779  58.542  39.649  1.00 73.18  ? 2    DC  G OP1   1 
ATOM   23    O  OP2   . DC  A  1  2    ? 16.567  60.656  38.415  1.00 71.91  ? 2    DC  G OP2   1 
ATOM   24    O  "O5'" . DC  A  1  2    ? 15.652  58.714  37.168  1.00 73.69  ? 2    DC  G "O5'" 1 
ATOM   25    C  "C5'" . DC  A  1  2    ? 16.645  58.970  36.207  1.00 72.32  ? 2    DC  G "C5'" 1 
ATOM   26    C  "C4'" . DC  A  1  2    ? 16.629  57.894  35.151  1.00 72.66  ? 2    DC  G "C4'" 1 
ATOM   27    O  "O4'" . DC  A  1  2    ? 15.417  58.002  34.350  1.00 72.56  ? 2    DC  G "O4'" 1 
ATOM   28    C  "C3'" . DC  A  1  2    ? 17.797  58.085  34.196  1.00 72.75  ? 2    DC  G "C3'" 1 
ATOM   29    O  "O3'" . DC  A  1  2    ? 18.419  56.853  33.855  1.00 73.32  ? 2    DC  G "O3'" 1 
ATOM   30    C  "C2'" . DC  A  1  2    ? 17.174  58.763  33.001  1.00 71.59  ? 2    DC  G "C2'" 1 
ATOM   31    C  "C1'" . DC  A  1  2    ? 15.723  58.304  32.991  1.00 71.44  ? 2    DC  G "C1'" 1 
ATOM   32    N  N1    . DC  A  1  2    ? 14.808  59.378  32.550  1.00 70.05  ? 2    DC  G N1    1 
ATOM   33    C  C2    . DC  A  1  2    ? 13.949  59.193  31.423  1.00 69.06  ? 2    DC  G C2    1 
ATOM   34    O  O2    . DC  A  1  2    ? 13.952  58.123  30.793  1.00 69.00  ? 2    DC  G O2    1 
ATOM   35    N  N3    . DC  A  1  2    ? 13.139  60.200  31.058  1.00 68.50  ? 2    DC  G N3    1 
ATOM   36    C  C4    . DC  A  1  2    ? 13.143  61.344  31.747  1.00 68.15  ? 2    DC  G C4    1 
ATOM   37    N  N4    . DC  A  1  2    ? 12.327  62.298  31.348  1.00 68.55  ? 2    DC  G N4    1 
ATOM   38    C  C5    . DC  A  1  2    ? 13.988  61.557  32.874  1.00 67.71  ? 2    DC  G C5    1 
ATOM   39    C  C6    . DC  A  1  2    ? 14.793  60.564  33.237  1.00 68.89  ? 2    DC  G C6    1 
ATOM   40    P  P     . DC  A  1  3    ? 19.907  56.866  33.256  1.00 74.46  ? 3    DC  G P     1 
ATOM   41    O  OP1   . DC  A  1  3    ? 20.622  55.693  33.828  1.00 74.65  ? 3    DC  G OP1   1 
ATOM   42    O  OP2   . DC  A  1  3    ? 20.448  58.234  33.472  1.00 73.17  ? 3    DC  G OP2   1 
ATOM   43    O  "O5'" . DC  A  1  3    ? 19.673  56.624  31.692  1.00 73.27  ? 3    DC  G "O5'" 1 
ATOM   44    C  "C5'" . DC  A  1  3    ? 18.913  55.496  31.244  1.00 72.81  ? 3    DC  G "C5'" 1 
ATOM   45    C  "C4'" . DC  A  1  3    ? 18.507  55.646  29.795  1.00 72.26  ? 3    DC  G "C4'" 1 
ATOM   46    O  "O4'" . DC  A  1  3    ? 17.430  56.611  29.629  1.00 72.28  ? 3    DC  G "O4'" 1 
ATOM   47    C  "C3'" . DC  A  1  3    ? 19.615  56.048  28.820  1.00 73.10  ? 3    DC  G "C3'" 1 
ATOM   48    O  "O3'" . DC  A  1  3    ? 19.621  55.143  27.708  1.00 74.81  ? 3    DC  G "O3'" 1 
ATOM   49    C  "C2'" . DC  A  1  3    ? 19.226  57.458  28.393  1.00 72.56  ? 3    DC  G "C2'" 1 
ATOM   50    C  "C1'" . DC  A  1  3    ? 17.704  57.489  28.539  1.00 72.14  ? 3    DC  G "C1'" 1 
ATOM   51    N  N1    . DC  A  1  3    ? 17.151  58.813  28.897  1.00 71.52  ? 3    DC  G N1    1 
ATOM   52    C  C2    . DC  A  1  3    ? 16.094  59.406  28.132  1.00 71.85  ? 3    DC  G C2    1 
ATOM   53    O  O2    . DC  A  1  3    ? 15.671  58.859  27.092  1.00 71.07  ? 3    DC  G O2    1 
ATOM   54    N  N3    . DC  A  1  3    ? 15.568  60.576  28.564  1.00 71.35  ? 3    DC  G N3    1 
ATOM   55    C  C4    . DC  A  1  3    ? 16.048  61.161  29.666  1.00 71.65  ? 3    DC  G C4    1 
ATOM   56    N  N4    . DC  A  1  3    ? 15.500  62.294  30.069  1.00 70.89  ? 3    DC  G N4    1 
ATOM   57    C  C5    . DC  A  1  3    ? 17.119  60.607  30.412  1.00 71.36  ? 3    DC  G C5    1 
ATOM   58    C  C6    . DC  A  1  3    ? 17.637  59.454  29.994  1.00 70.51  ? 3    DC  G C6    1 
ATOM   59    P  P     . DT  A  1  4    ? 20.671  55.342  26.499  1.00 76.06  ? 4    DT  G P     1 
ATOM   60    O  OP1   . DT  A  1  4    ? 20.937  53.990  25.923  1.00 76.45  ? 4    DT  G OP1   1 
ATOM   61    O  OP2   . DT  A  1  4    ? 21.812  56.149  26.997  1.00 75.15  ? 4    DT  G OP2   1 
ATOM   62    O  "O5'" . DT  A  1  4    ? 19.825  56.182  25.427  1.00 74.62  ? 4    DT  G "O5'" 1 
ATOM   63    C  "C5'" . DT  A  1  4    ? 18.507  55.754  25.048  1.00 73.66  ? 4    DT  G "C5'" 1 
ATOM   64    C  "C4'" . DT  A  1  4    ? 17.975  56.548  23.874  1.00 73.39  ? 4    DT  G "C4'" 1 
ATOM   65    O  "O4'" . DT  A  1  4    ? 17.320  57.765  24.299  1.00 74.01  ? 4    DT  G "O4'" 1 
ATOM   66    C  "C3'" . DT  A  1  4    ? 18.991  56.942  22.804  1.00 75.34  ? 4    DT  G "C3'" 1 
ATOM   67    O  "O3'" . DT  A  1  4    ? 18.490  56.634  21.494  1.00 76.41  ? 4    DT  G "O3'" 1 
ATOM   68    C  "C2'" . DT  A  1  4    ? 19.170  58.440  23.003  1.00 75.29  ? 4    DT  G "C2'" 1 
ATOM   69    C  "C1'" . DT  A  1  4    ? 17.847  58.898  23.610  1.00 75.46  ? 4    DT  G "C1'" 1 
ATOM   70    N  N1    . DT  A  1  4    ? 18.002  59.986  24.607  1.00 76.69  ? 4    DT  G N1    1 
ATOM   71    C  C2    . DT  A  1  4    ? 17.137  61.071  24.595  1.00 76.83  ? 4    DT  G C2    1 
ATOM   72    O  O2    . DT  A  1  4    ? 16.260  61.232  23.755  1.00 77.37  ? 4    DT  G O2    1 
ATOM   73    N  N3    . DT  A  1  4    ? 17.344  61.969  25.621  1.00 77.30  ? 4    DT  G N3    1 
ATOM   74    C  C4    . DT  A  1  4    ? 18.311  61.887  26.619  1.00 78.30  ? 4    DT  G C4    1 
ATOM   75    O  O4    . DT  A  1  4    ? 18.383  62.744  27.487  1.00 78.86  ? 4    DT  G O4    1 
ATOM   76    C  C5    . DT  A  1  4    ? 19.184  60.748  26.550  1.00 77.97  ? 4    DT  G C5    1 
ATOM   77    C  C7    . DT  A  1  4    ? 20.255  60.593  27.586  1.00 77.60  ? 4    DT  G C7    1 
ATOM   78    C  C6    . DT  A  1  4    ? 18.995  59.874  25.561  1.00 77.19  ? 4    DT  G C6    1 
ATOM   79    P  P     . DG  A  1  5    ? 19.303  57.113  20.189  1.00 77.31  ? 5    DG  G P     1 
ATOM   80    O  OP1   . DG  A  1  5    ? 19.017  56.159  19.096  1.00 76.53  ? 5    DG  G OP1   1 
ATOM   81    O  OP2   . DG  A  1  5    ? 20.711  57.367  20.584  1.00 78.20  ? 5    DG  G OP2   1 
ATOM   82    O  "O5'" . DG  A  1  5    ? 18.618  58.513  19.849  1.00 77.99  ? 5    DG  G "O5'" 1 
ATOM   83    C  "C5'" . DG  A  1  5    ? 17.191  58.624  19.829  1.00 77.85  ? 5    DG  G "C5'" 1 
ATOM   84    C  "C4'" . DG  A  1  5    ? 16.765  59.996  19.364  1.00 77.57  ? 5    DG  G "C4'" 1 
ATOM   85    O  "O4'" . DG  A  1  5    ? 16.852  60.959  20.438  1.00 77.40  ? 5    DG  G "O4'" 1 
ATOM   86    C  "C3'" . DG  A  1  5    ? 17.561  60.573  18.197  1.00 78.11  ? 5    DG  G "C3'" 1 
ATOM   87    O  "O3'" . DG  A  1  5    ? 16.654  61.175  17.275  1.00 79.25  ? 5    DG  G "O3'" 1 
ATOM   88    C  "C2'" . DG  A  1  5    ? 18.454  61.607  18.858  1.00 77.10  ? 5    DG  G "C2'" 1 
ATOM   89    C  "C1'" . DG  A  1  5    ? 17.621  62.078  20.034  1.00 77.28  ? 5    DG  G "C1'" 1 
ATOM   90    N  N9    . DG  A  1  5    ? 18.417  62.486  21.184  1.00 77.91  ? 5    DG  G N9    1 
ATOM   91    C  C8    . DG  A  1  5    ? 19.511  61.832  21.697  1.00 77.55  ? 5    DG  G C8    1 
ATOM   92    N  N7    . DG  A  1  5    ? 20.013  62.423  22.744  1.00 77.98  ? 5    DG  G N7    1 
ATOM   93    C  C5    . DG  A  1  5    ? 19.205  63.536  22.937  1.00 78.64  ? 5    DG  G C5    1 
ATOM   94    C  C6    . DG  A  1  5    ? 19.267  64.554  23.927  1.00 78.97  ? 5    DG  G C6    1 
ATOM   95    O  O6    . DG  A  1  5    ? 20.070  64.667  24.849  1.00 79.02  ? 5    DG  G O6    1 
ATOM   96    N  N1    . DG  A  1  5    ? 18.258  65.502  23.764  1.00 79.76  ? 5    DG  G N1    1 
ATOM   97    C  C2    . DG  A  1  5    ? 17.310  65.467  22.768  1.00 80.39  ? 5    DG  G C2    1 
ATOM   98    N  N2    . DG  A  1  5    ? 16.423  66.469  22.778  1.00 81.78  ? 5    DG  G N2    1 
ATOM   99    N  N3    . DG  A  1  5    ? 17.238  64.521  21.834  1.00 80.03  ? 5    DG  G N3    1 
ATOM   100   C  C4    . DG  A  1  5    ? 18.215  63.593  21.981  1.00 78.94  ? 5    DG  G C4    1 
ATOM   101   P  P     . DT  A  1  6    ? 17.213  61.971  16.002  1.00 80.07  ? 6    DT  G P     1 
ATOM   102   O  OP1   . DT  A  1  6    ? 16.293  61.686  14.871  1.00 79.53  ? 6    DT  G OP1   1 
ATOM   103   O  OP2   . DT  A  1  6    ? 18.665  61.689  15.855  1.00 80.08  ? 6    DT  G OP2   1 
ATOM   104   O  "O5'" . DT  A  1  6    ? 17.032  63.489  16.442  1.00 77.37  ? 6    DT  G "O5'" 1 
ATOM   105   C  "C5'" . DT  A  1  6    ? 15.748  63.977  16.832  1.00 74.92  ? 6    DT  G "C5'" 1 
ATOM   106   C  "C4'" . DT  A  1  6    ? 15.774  65.483  16.938  1.00 72.88  ? 6    DT  G "C4'" 1 
ATOM   107   O  "O4'" . DT  A  1  6    ? 16.438  65.889  18.168  1.00 72.45  ? 6    DT  G "O4'" 1 
ATOM   108   C  "C3'" . DT  A  1  6    ? 16.544  66.127  15.789  1.00 72.10  ? 6    DT  G "C3'" 1 
ATOM   109   O  "O3'" . DT  A  1  6    ? 15.914  67.327  15.330  1.00 71.44  ? 6    DT  G "O3'" 1 
ATOM   110   C  "C2'" . DT  A  1  6    ? 17.888  66.425  16.414  1.00 71.71  ? 6    DT  G "C2'" 1 
ATOM   111   C  "C1'" . DT  A  1  6    ? 17.541  66.730  17.870  1.00 72.28  ? 6    DT  G "C1'" 1 
ATOM   112   N  N1    . DT  A  1  6    ? 18.631  66.421  18.832  1.00 72.62  ? 6    DT  G N1    1 
ATOM   113   C  C2    . DT  A  1  6    ? 18.887  67.271  19.904  1.00 72.77  ? 6    DT  G C2    1 
ATOM   114   O  O2    . DT  A  1  6    ? 18.262  68.293  20.115  1.00 73.63  ? 6    DT  G O2    1 
ATOM   115   N  N3    . DT  A  1  6    ? 19.921  66.865  20.722  1.00 72.14  ? 6    DT  G N3    1 
ATOM   116   C  C4    . DT  A  1  6    ? 20.699  65.725  20.564  1.00 72.70  ? 6    DT  G C4    1 
ATOM   117   O  O4    . DT  A  1  6    ? 21.583  65.468  21.352  1.00 72.75  ? 6    DT  G O4    1 
ATOM   118   C  C5    . DT  A  1  6    ? 20.380  64.900  19.430  1.00 72.73  ? 6    DT  G C5    1 
ATOM   119   C  C7    . DT  A  1  6    ? 21.179  63.657  19.189  1.00 71.96  ? 6    DT  G C7    1 
ATOM   120   C  C6    . DT  A  1  6    ? 19.380  65.280  18.638  1.00 72.70  ? 6    DT  G C6    1 
ATOM   121   P  P     . DC  A  1  7    ? 16.340  67.954  13.909  1.00 71.78  ? 7    DC  G P     1 
ATOM   122   O  OP1   . DC  A  1  7    ? 15.173  67.914  12.988  1.00 70.79  ? 7    DC  G OP1   1 
ATOM   123   O  OP2   . DC  A  1  7    ? 17.611  67.285  13.513  1.00 70.58  ? 7    DC  G OP2   1 
ATOM   124   O  "O5'" . DC  A  1  7    ? 16.623  69.488  14.245  1.00 69.38  ? 7    DC  G "O5'" 1 
ATOM   125   C  "C5'" . DC  A  1  7    ? 15.604  70.276  14.847  1.00 66.76  ? 7    DC  G "C5'" 1 
ATOM   126   C  "C4'" . DC  A  1  7    ? 16.167  71.146  15.947  1.00 65.74  ? 7    DC  G "C4'" 1 
ATOM   127   O  "O4'" . DC  A  1  7    ? 17.056  70.402  16.816  1.00 65.18  ? 7    DC  G "O4'" 1 
ATOM   128   C  "C3'" . DC  A  1  7    ? 16.946  72.385  15.513  1.00 66.87  ? 7    DC  G "C3'" 1 
ATOM   129   O  "O3'" . DC  A  1  7    ? 16.493  73.481  16.320  1.00 68.23  ? 7    DC  G "O3'" 1 
ATOM   130   C  "C2'" . DC  A  1  7    ? 18.392  72.029  15.818  1.00 65.56  ? 7    DC  G "C2'" 1 
ATOM   131   C  "C1'" . DC  A  1  7    ? 18.254  71.137  17.028  1.00 64.94  ? 7    DC  G "C1'" 1 
ATOM   132   N  N1    . DC  A  1  7    ? 19.354  70.175  17.225  1.00 64.71  ? 7    DC  G N1    1 
ATOM   133   C  C2    . DC  A  1  7    ? 20.158  70.291  18.354  1.00 64.19  ? 7    DC  G C2    1 
ATOM   134   O  O2    . DC  A  1  7    ? 19.950  71.221  19.135  1.00 64.42  ? 7    DC  G O2    1 
ATOM   135   N  N3    . DC  A  1  7    ? 21.151  69.391  18.561  1.00 63.52  ? 7    DC  G N3    1 
ATOM   136   C  C4    . DC  A  1  7    ? 21.356  68.413  17.687  1.00 64.80  ? 7    DC  G C4    1 
ATOM   137   N  N4    . DC  A  1  7    ? 22.338  67.545  17.930  1.00 64.24  ? 7    DC  G N4    1 
ATOM   138   C  C5    . DC  A  1  7    ? 20.563  68.278  16.519  1.00 65.49  ? 7    DC  G C5    1 
ATOM   139   C  C6    . DC  A  1  7    ? 19.581  69.175  16.329  1.00 65.58  ? 7    DC  G C6    1 
ATOM   140   P  P     . DT  A  1  8    ? 17.078  74.964  16.084  1.00 69.53  ? 8    DT  G P     1 
ATOM   141   O  OP1   . DT  A  1  8    ? 16.017  75.957  16.436  1.00 69.65  ? 8    DT  G OP1   1 
ATOM   142   O  OP2   . DT  A  1  8    ? 17.708  75.020  14.734  1.00 69.45  ? 8    DT  G OP2   1 
ATOM   143   O  "O5'" . DT  A  1  8    ? 18.221  75.054  17.189  1.00 67.14  ? 8    DT  G "O5'" 1 
ATOM   144   C  "C5'" . DT  A  1  8    ? 17.918  74.814  18.560  1.00 62.35  ? 8    DT  G "C5'" 1 
ATOM   145   C  "C4'" . DT  A  1  8    ? 19.126  75.107  19.411  1.00 58.87  ? 8    DT  G "C4'" 1 
ATOM   146   O  "O4'" . DT  A  1  8    ? 20.051  74.000  19.351  1.00 59.21  ? 8    DT  G "O4'" 1 
ATOM   147   C  "C3'" . DT  A  1  8    ? 19.898  76.335  18.936  1.00 58.11  ? 8    DT  G "C3'" 1 
ATOM   148   O  "O3'" . DT  A  1  8    ? 20.356  77.069  20.050  1.00 56.39  ? 8    DT  G "O3'" 1 
ATOM   149   C  "C2'" . DT  A  1  8    ? 21.078  75.743  18.198  1.00 58.19  ? 8    DT  G "C2'" 1 
ATOM   150   C  "C1'" . DT  A  1  8    ? 21.326  74.490  19.007  1.00 59.80  ? 8    DT  G "C1'" 1 
ATOM   151   N  N1    . DT  A  1  8    ? 22.061  73.416  18.322  1.00 61.26  ? 8    DT  G N1    1 
ATOM   152   C  C2    . DT  A  1  8    ? 23.150  72.906  18.980  1.00 62.13  ? 8    DT  G C2    1 
ATOM   153   O  O2    . DT  A  1  8    ? 23.500  73.318  20.080  1.00 63.32  ? 8    DT  G O2    1 
ATOM   154   N  N3    . DT  A  1  8    ? 23.815  71.902  18.306  1.00 62.30  ? 8    DT  G N3    1 
ATOM   155   C  C4    . DT  A  1  8    ? 23.493  71.380  17.067  1.00 61.90  ? 8    DT  G C4    1 
ATOM   156   O  O4    . DT  A  1  8    ? 24.180  70.481  16.588  1.00 62.03  ? 8    DT  G O4    1 
ATOM   157   C  C5    . DT  A  1  8    ? 22.328  71.969  16.431  1.00 62.00  ? 8    DT  G C5    1 
ATOM   158   C  C7    . DT  A  1  8    ? 21.900  71.470  15.087  1.00 62.35  ? 8    DT  G C7    1 
ATOM   159   C  C6    . DT  A  1  8    ? 21.681  72.943  17.082  1.00 61.00  ? 8    DT  G C6    1 
ATOM   160   P  P     . DG  A  1  9    ? 20.576  78.645  19.913  1.00 56.48  ? 9    DG  G P     1 
ATOM   161   O  OP1   . DG  A  1  9    ? 19.649  79.319  20.859  1.00 55.00  ? 9    DG  G OP1   1 
ATOM   162   O  OP2   . DG  A  1  9    ? 20.550  78.994  18.482  1.00 53.56  ? 9    DG  G OP2   1 
ATOM   163   O  "O5'" . DG  A  1  9    ? 22.061  78.844  20.435  1.00 54.73  ? 9    DG  G "O5'" 1 
ATOM   164   C  "C5'" . DG  A  1  9    ? 22.421  78.426  21.743  1.00 52.25  ? 9    DG  G "C5'" 1 
ATOM   165   C  "C4'" . DG  A  1  9    ? 23.918  78.317  21.841  1.00 51.07  ? 9    DG  G "C4'" 1 
ATOM   166   O  "O4'" . DG  A  1  9    ? 24.362  77.098  21.190  1.00 51.81  ? 9    DG  G "O4'" 1 
ATOM   167   C  "C3'" . DG  A  1  9    ? 24.620  79.470  21.120  1.00 51.64  ? 9    DG  G "C3'" 1 
ATOM   168   O  "O3'" . DG  A  1  9    ? 25.759  79.892  21.883  1.00 52.51  ? 9    DG  G "O3'" 1 
ATOM   169   C  "C2'" . DG  A  1  9    ? 25.046  78.837  19.806  1.00 50.54  ? 9    DG  G "C2'" 1 
ATOM   170   C  "C1'" . DG  A  1  9    ? 25.366  77.422  20.246  1.00 50.53  ? 9    DG  G "C1'" 1 
ATOM   171   N  N9    . DG  A  1  9    ? 25.346  76.415  19.195  1.00 49.85  ? 9    DG  G N9    1 
ATOM   172   C  C8    . DG  A  1  9    ? 24.397  76.252  18.222  1.00 50.45  ? 9    DG  G C8    1 
ATOM   173   N  N7    . DG  A  1  9    ? 24.632  75.236  17.438  1.00 50.72  ? 9    DG  G N7    1 
ATOM   174   C  C5    . DG  A  1  9    ? 25.816  74.698  17.921  1.00 50.44  ? 9    DG  G C5    1 
ATOM   175   C  C6    . DG  A  1  9    ? 26.565  73.565  17.477  1.00 50.38  ? 9    DG  G C6    1 
ATOM   176   O  O6    . DG  A  1  9    ? 26.320  72.800  16.544  1.00 49.39  ? 9    DG  G O6    1 
ATOM   177   N  N1    . DG  A  1  9    ? 27.707  73.371  18.250  1.00 52.06  ? 9    DG  G N1    1 
ATOM   178   C  C2    . DG  A  1  9    ? 28.077  74.169  19.312  1.00 53.59  ? 9    DG  G C2    1 
ATOM   179   N  N2    . DG  A  1  9    ? 29.217  73.845  19.927  1.00 53.79  ? 9    DG  G N2    1 
ATOM   180   N  N3    . DG  A  1  9    ? 27.381  75.221  19.736  1.00 51.86  ? 9    DG  G N3    1 
ATOM   181   C  C4    . DG  A  1  9    ? 26.274  75.422  19.001  1.00 50.44  ? 9    DG  G C4    1 
ATOM   182   P  P     . DG  A  1  10   ? 26.539  81.250  21.505  1.00 52.02  ? 10   DG  G P     1 
ATOM   183   O  OP1   . DG  A  1  10   ? 26.426  82.211  22.642  1.00 51.02  ? 10   DG  G OP1   1 
ATOM   184   O  OP2   . DG  A  1  10   ? 26.113  81.663  20.154  1.00 48.99  ? 10   DG  G OP2   1 
ATOM   185   O  "O5'" . DG  A  1  10   ? 28.041  80.749  21.459  1.00 49.12  ? 10   DG  G "O5'" 1 
ATOM   186   C  "C5'" . DG  A  1  10   ? 28.556  79.969  22.524  1.00 48.62  ? 10   DG  G "C5'" 1 
ATOM   187   C  "C4'" . DG  A  1  10   ? 29.878  79.371  22.120  1.00 48.41  ? 10   DG  G "C4'" 1 
ATOM   188   O  "O4'" . DG  A  1  10   ? 29.667  78.237  21.244  1.00 50.44  ? 10   DG  G "O4'" 1 
ATOM   189   C  "C3'" . DG  A  1  10   ? 30.730  80.361  21.337  1.00 47.79  ? 10   DG  G "C3'" 1 
ATOM   190   O  "O3'" . DG  A  1  10   ? 32.090  80.259  21.723  1.00 44.19  ? 10   DG  G "O3'" 1 
ATOM   191   C  "C2'" . DG  A  1  10   ? 30.551  79.916  19.900  1.00 49.32  ? 10   DG  G "C2'" 1 
ATOM   192   C  "C1'" . DG  A  1  10   ? 30.397  78.420  20.045  1.00 52.07  ? 10   DG  G "C1'" 1 
ATOM   193   N  N9    . DG  A  1  10   ? 29.640  77.823  18.951  1.00 55.07  ? 10   DG  G N9    1 
ATOM   194   C  C8    . DG  A  1  10   ? 28.451  78.271  18.429  1.00 57.11  ? 10   DG  G C8    1 
ATOM   195   N  N7    . DG  A  1  10   ? 28.034  77.564  17.418  1.00 57.08  ? 10   DG  G N7    1 
ATOM   196   C  C5    . DG  A  1  10   ? 28.999  76.584  17.270  1.00 57.02  ? 10   DG  G C5    1 
ATOM   197   C  C6    . DG  A  1  10   ? 29.077  75.531  16.349  1.00 58.01  ? 10   DG  G C6    1 
ATOM   198   O  O6    . DG  A  1  10   ? 28.286  75.252  15.446  1.00 59.03  ? 10   DG  G O6    1 
ATOM   199   N  N1    . DG  A  1  10   ? 30.211  74.754  16.556  1.00 59.47  ? 10   DG  G N1    1 
ATOM   200   C  C2    . DG  A  1  10   ? 31.151  74.978  17.539  1.00 58.86  ? 10   DG  G C2    1 
ATOM   201   N  N2    . DG  A  1  10   ? 32.176  74.130  17.597  1.00 58.84  ? 10   DG  G N2    1 
ATOM   202   N  N3    . DG  A  1  10   ? 31.087  75.968  18.408  1.00 58.00  ? 10   DG  G N3    1 
ATOM   203   C  C4    . DG  A  1  10   ? 29.992  76.725  18.218  1.00 56.61  ? 10   DG  G C4    1 
ATOM   204   P  P     . DC  A  1  11   ? 33.195  81.119  20.946  1.00 44.54  ? 11   DC  G P     1 
ATOM   205   O  OP1   . DC  A  1  11   ? 34.183  81.639  21.934  1.00 43.85  ? 11   DC  G OP1   1 
ATOM   206   O  OP2   . DC  A  1  11   ? 32.508  82.072  20.045  1.00 42.33  ? 11   DC  G OP2   1 
ATOM   207   O  "O5'" . DC  A  1  11   ? 33.890  80.044  20.003  1.00 43.68  ? 11   DC  G "O5'" 1 
ATOM   208   C  "C5'" . DC  A  1  11   ? 35.022  79.298  20.447  1.00 45.03  ? 11   DC  G "C5'" 1 
ATOM   209   C  "C4'" . DC  A  1  11   ? 35.980  79.052  19.303  1.00 44.77  ? 11   DC  G "C4'" 1 
ATOM   210   O  "O4'" . DC  A  1  11   ? 35.380  78.043  18.439  1.00 46.45  ? 11   DC  G "O4'" 1 
ATOM   211   C  "C3'" . DC  A  1  11   ? 36.244  80.287  18.433  1.00 44.30  ? 11   DC  G "C3'" 1 
ATOM   212   O  "O3'" . DC  A  1  11   ? 37.545  80.904  18.528  1.00 39.70  ? 11   DC  G "O3'" 1 
ATOM   213   C  "C2'" . DC  A  1  11   ? 35.754  79.942  17.043  1.00 44.34  ? 11   DC  G "C2'" 1 
ATOM   214   C  "C1'" . DC  A  1  11   ? 35.393  78.452  17.077  1.00 47.19  ? 11   DC  G "C1'" 1 
ATOM   215   N  N1    . DC  A  1  11   ? 34.043  78.232  16.494  1.00 48.70  ? 11   DC  G N1    1 
ATOM   216   C  C2    . DC  A  1  11   ? 33.860  77.243  15.522  1.00 49.21  ? 11   DC  G C2    1 
ATOM   217   O  O2    . DC  A  1  11   ? 34.813  76.512  15.216  1.00 49.52  ? 11   DC  G O2    1 
ATOM   218   N  N3    . DC  A  1  11   ? 32.646  77.120  14.929  1.00 49.46  ? 11   DC  G N3    1 
ATOM   219   C  C4    . DC  A  1  11   ? 31.641  77.921  15.280  1.00 50.34  ? 11   DC  G C4    1 
ATOM   220   N  N4    . DC  A  1  11   ? 30.470  77.765  14.673  1.00 49.96  ? 11   DC  G N4    1 
ATOM   221   C  C5    . DC  A  1  11   ? 31.791  78.918  16.279  1.00 50.52  ? 11   DC  G C5    1 
ATOM   222   C  C6    . DC  A  1  11   ? 32.992  79.029  16.862  1.00 50.66  ? 11   DC  G C6    1 
ATOM   223   P  P     . DG  A  1  12   ? 38.882  80.145  18.075  1.00 37.22  ? 12   DG  G P     1 
ATOM   224   O  OP1   . DG  A  1  12   ? 39.250  79.276  19.183  1.00 36.96  ? 12   DG  G OP1   1 
ATOM   225   O  OP2   . DG  A  1  12   ? 39.808  81.219  17.668  1.00 34.46  ? 12   DG  G OP2   1 
ATOM   226   O  "O5'" . DG  A  1  12   ? 38.522  79.196  16.843  1.00 36.10  ? 12   DG  G "O5'" 1 
ATOM   227   C  "C5'" . DG  A  1  12   ? 39.087  77.869  16.762  1.00 37.86  ? 12   DG  G "C5'" 1 
ATOM   228   C  "C4'" . DG  A  1  12   ? 39.556  77.544  15.357  1.00 39.71  ? 12   DG  G "C4'" 1 
ATOM   229   O  "O4'" . DG  A  1  12   ? 38.457  76.936  14.620  1.00 40.92  ? 12   DG  G "O4'" 1 
ATOM   230   C  "C3'" . DG  A  1  12   ? 40.043  78.733  14.521  1.00 41.83  ? 12   DG  G "C3'" 1 
ATOM   231   O  "O3'" . DG  A  1  12   ? 41.489  78.990  14.480  1.00 41.33  ? 12   DG  G "O3'" 1 
ATOM   232   C  "C2'" . DG  A  1  12   ? 39.198  78.749  13.258  1.00 41.40  ? 12   DG  G "C2'" 1 
ATOM   233   C  "C1'" . DG  A  1  12   ? 38.278  77.531  13.334  1.00 44.12  ? 12   DG  G "C1'" 1 
ATOM   234   N  N9    . DG  A  1  12   ? 36.885  77.975  13.220  1.00 49.45  ? 12   DG  G N9    1 
ATOM   235   C  C8    . DG  A  1  12   ? 36.282  78.926  14.006  1.00 51.28  ? 12   DG  G C8    1 
ATOM   236   N  N7    . DG  A  1  12   ? 35.056  79.204  13.646  1.00 52.95  ? 12   DG  G N7    1 
ATOM   237   C  C5    . DG  A  1  12   ? 34.820  78.381  12.558  1.00 52.57  ? 12   DG  G C5    1 
ATOM   238   C  C6    . DG  A  1  12   ? 33.664  78.251  11.757  1.00 53.68  ? 12   DG  G C6    1 
ATOM   239   O  O6    . DG  A  1  12   ? 32.588  78.852  11.867  1.00 54.46  ? 12   DG  G O6    1 
ATOM   240   N  N1    . DG  A  1  12   ? 33.845  77.307  10.747  1.00 54.09  ? 12   DG  G N1    1 
ATOM   241   C  C2    . DG  A  1  12   ? 35.000  76.577  10.552  1.00 53.34  ? 12   DG  G C2    1 
ATOM   242   N  N2    . DG  A  1  12   ? 35.000  75.717  9.540   1.00 53.34  ? 12   DG  G N2    1 
ATOM   243   N  N3    . DG  A  1  12   ? 36.083  76.685  11.303  1.00 53.01  ? 12   DG  G N3    1 
ATOM   244   C  C4    . DG  A  1  12   ? 35.929  77.600  12.281  1.00 51.97  ? 12   DG  G C4    1 
ATOM   245   P  P     . DT  A  1  13   ? 42.485  78.313  13.398  1.00 40.41  ? 13   DT  G P     1 
ATOM   246   O  OP1   . DT  A  1  13   ? 42.719  76.927  13.874  1.00 37.79  ? 13   DT  G OP1   1 
ATOM   247   O  OP2   . DT  A  1  13   ? 43.630  79.263  13.317  1.00 37.13  ? 13   DT  G OP2   1 
ATOM   248   O  "O5'" . DT  A  1  13   ? 41.717  78.268  11.995  1.00 37.28  ? 13   DT  G "O5'" 1 
ATOM   249   C  "C5'" . DT  A  1  13   ? 41.204  77.019  11.497  1.00 35.53  ? 13   DT  G "C5'" 1 
ATOM   250   C  "C4'" . DT  A  1  13   ? 41.175  76.981  9.986   1.00 33.01  ? 13   DT  G "C4'" 1 
ATOM   251   O  "O4'" . DT  A  1  13   ? 39.803  76.900  9.526   1.00 32.57  ? 13   DT  G "O4'" 1 
ATOM   252   C  "C3'" . DT  A  1  13   ? 41.756  78.225  9.368   1.00 32.12  ? 13   DT  G "C3'" 1 
ATOM   253   O  "O3'" . DT  A  1  13   ? 42.684  77.993  8.386   1.00 30.14  ? 13   DT  G "O3'" 1 
ATOM   254   C  "C2'" . DT  A  1  13   ? 40.609  78.898  8.649   1.00 30.69  ? 13   DT  G "C2'" 1 
ATOM   255   C  "C1'" . DT  A  1  13   ? 39.506  77.881  8.550   1.00 30.70  ? 13   DT  G "C1'" 1 
ATOM   256   N  N1    . DT  A  1  13   ? 38.267  78.573  8.943   1.00 31.95  ? 13   DT  G N1    1 
ATOM   257   C  C2    . DT  A  1  13   ? 37.092  78.470  8.211   1.00 32.96  ? 13   DT  G C2    1 
ATOM   258   O  O2    . DT  A  1  13   ? 36.931  77.716  7.279   1.00 34.93  ? 13   DT  G O2    1 
ATOM   259   N  N3    . DT  A  1  13   ? 36.094  79.311  8.624   1.00 34.30  ? 13   DT  G N3    1 
ATOM   260   C  C4    . DT  A  1  13   ? 36.166  80.205  9.677   1.00 36.39  ? 13   DT  G C4    1 
ATOM   261   O  O4    . DT  A  1  13   ? 35.235  80.918  9.929   1.00 39.88  ? 13   DT  G O4    1 
ATOM   262   C  C5    . DT  A  1  13   ? 37.394  80.220  10.415  1.00 35.71  ? 13   DT  G C5    1 
ATOM   263   C  C7    . DT  A  1  13   ? 37.544  81.164  11.565  1.00 35.64  ? 13   DT  G C7    1 
ATOM   264   C  C6    . DT  A  1  13   ? 38.351  79.402  10.037  1.00 33.56  ? 13   DT  G C6    1 
ATOM   265   P  P     . DT  A  1  14   ? 43.263  79.264  7.685   1.00 31.46  ? 14   DT  G P     1 
ATOM   266   O  OP1   . DT  A  1  14   ? 42.784  80.513  8.351   1.00 28.99  ? 14   DT  G OP1   1 
ATOM   267   O  OP2   . DT  A  1  14   ? 42.884  79.012  6.277   1.00 30.06  ? 14   DT  G OP2   1 
ATOM   268   O  "O5'" . DT  A  1  14   ? 44.769  78.993  7.997   1.00 30.24  ? 14   DT  G "O5'" 1 
ATOM   269   C  "C5'" . DT  A  1  14   ? 45.415  77.978  7.271   1.00 31.98  ? 14   DT  G "C5'" 1 
ATOM   270   C  "C4'" . DT  A  1  14   ? 46.859  77.885  7.684   1.00 32.87  ? 14   DT  G "C4'" 1 
ATOM   271   O  "O4'" . DT  A  1  14   ? 47.527  77.239  6.565   1.00 35.13  ? 14   DT  G "O4'" 1 
ATOM   272   C  "C3'" . DT  A  1  14   ? 47.528  79.251  7.886   1.00 34.37  ? 14   DT  G "C3'" 1 
ATOM   273   O  "O3'" . DT  A  1  14   ? 48.369  79.280  9.056   1.00 30.27  ? 14   DT  G "O3'" 1 
ATOM   274   C  "C2'" . DT  A  1  14   ? 48.278  79.499  6.584   1.00 36.60  ? 14   DT  G "C2'" 1 
ATOM   275   C  "C1'" . DT  A  1  14   ? 48.384  78.141  5.859   1.00 36.96  ? 14   DT  G "C1'" 1 
ATOM   276   N  N1    . DT  A  1  14   ? 47.911  78.229  4.428   1.00 36.77  ? 14   DT  G N1    1 
ATOM   277   C  C2    . DT  A  1  14   ? 48.789  78.075  3.359   1.00 37.34  ? 14   DT  G C2    1 
ATOM   278   O  O2    . DT  A  1  14   ? 49.974  77.822  3.485   1.00 37.89  ? 14   DT  G O2    1 
ATOM   279   N  N3    . DT  A  1  14   ? 48.206  78.236  2.109   1.00 37.18  ? 14   DT  G N3    1 
ATOM   280   C  C4    . DT  A  1  14   ? 46.882  78.529  1.840   1.00 37.81  ? 14   DT  G C4    1 
ATOM   281   O  O4    . DT  A  1  14   ? 46.500  78.651  0.666   1.00 40.39  ? 14   DT  G O4    1 
ATOM   282   C  C5    . DT  A  1  14   ? 46.038  78.668  2.999   1.00 35.82  ? 14   DT  G C5    1 
ATOM   283   C  C7    . DT  A  1  14   ? 44.596  78.996  2.803   1.00 32.35  ? 14   DT  G C7    1 
ATOM   284   C  C6    . DT  A  1  14   ? 46.582  78.503  4.204   1.00 34.86  ? 14   DT  G C6    1 
ATOM   285   P  P     . DC  A  1  15   ? 48.650  80.673  9.822   1.00 29.95  ? 15   DC  G P     1 
ATOM   286   O  OP1   . DC  A  1  15   ? 48.365  80.453  11.311  1.00 28.22  ? 15   DC  G OP1   1 
ATOM   287   O  OP2   . DC  A  1  15   ? 47.933  81.746  9.064   1.00 24.03  ? 15   DC  G OP2   1 
ATOM   288   O  "O5'" . DC  A  1  15   ? 50.214  80.846  9.576   1.00 31.25  ? 15   DC  G "O5'" 1 
ATOM   289   C  "C5'" . DC  A  1  15   ? 50.893  79.915  8.723   1.00 30.67  ? 15   DC  G "C5'" 1 
ATOM   290   C  "C4'" . DC  A  1  15   ? 52.017  80.581  7.971   1.00 33.22  ? 15   DC  G "C4'" 1 
ATOM   291   O  "O4'" . DC  A  1  15   ? 51.927  80.179  6.559   1.00 35.77  ? 15   DC  G "O4'" 1 
ATOM   292   C  "C3'" . DC  A  1  15   ? 51.970  82.109  7.999   1.00 34.39  ? 15   DC  G "C3'" 1 
ATOM   293   O  "O3'" . DC  A  1  15   ? 53.019  82.660  8.795   1.00 33.24  ? 15   DC  G "O3'" 1 
ATOM   294   C  "C2'" . DC  A  1  15   ? 52.093  82.525  6.536   1.00 36.66  ? 15   DC  G "C2'" 1 
ATOM   295   C  "C1'" . DC  A  1  15   ? 52.324  81.253  5.695   1.00 36.41  ? 15   DC  G "C1'" 1 
ATOM   296   N  N1    . DC  A  1  15   ? 51.498  81.256  4.415   1.00 36.35  ? 15   DC  G N1    1 
ATOM   297   C  C2    . DC  A  1  15   ? 52.141  81.212  3.135   1.00 37.00  ? 15   DC  G C2    1 
ATOM   298   O  O2    . DC  A  1  15   ? 53.361  81.006  3.058   1.00 39.38  ? 15   DC  G O2    1 
ATOM   299   N  N3    . DC  A  1  15   ? 51.392  81.407  2.015   1.00 36.17  ? 15   DC  G N3    1 
ATOM   300   C  C4    . DC  A  1  15   ? 50.080  81.604  2.110   1.00 34.92  ? 15   DC  G C4    1 
ATOM   301   N  N4    . DC  A  1  15   ? 49.414  81.820  0.980   1.00 35.71  ? 15   DC  G N4    1 
ATOM   302   C  C5    . DC  A  1  15   ? 49.400  81.590  3.359   1.00 32.49  ? 15   DC  G C5    1 
ATOM   303   C  C6    . DC  A  1  15   ? 50.135  81.400  4.470   1.00 34.45  ? 15   DC  G C6    1 
ATOM   304   P  P     . DG  A  1  16   ? 52.877  84.151  9.392   1.00 36.61  ? 16   DG  G P     1 
ATOM   305   O  OP1   . DG  A  1  16   ? 53.496  84.162  10.755  1.00 32.19  ? 16   DG  G OP1   1 
ATOM   306   O  OP2   . DG  A  1  16   ? 51.477  84.627  9.244   1.00 30.73  ? 16   DG  G OP2   1 
ATOM   307   O  "O5'" . DG  A  1  16   ? 53.844  84.987  8.419   1.00 36.87  ? 16   DG  G "O5'" 1 
ATOM   308   C  "C5'" . DG  A  1  16   ? 55.258  84.729  8.426   1.00 37.50  ? 16   DG  G "C5'" 1 
ATOM   309   C  "C4'" . DG  A  1  16   ? 55.925  85.174  7.144   1.00 39.73  ? 16   DG  G "C4'" 1 
ATOM   310   O  "O4'" . DG  A  1  16   ? 55.372  84.414  6.032   1.00 41.77  ? 16   DG  G "O4'" 1 
ATOM   311   C  "C3'" . DG  A  1  16   ? 55.742  86.647  6.784   1.00 41.59  ? 16   DG  G "C3'" 1 
ATOM   312   O  "O3'" . DG  A  1  16   ? 56.919  87.442  6.914   1.00 41.51  ? 16   DG  G "O3'" 1 
ATOM   313   C  "C2'" . DG  A  1  16   ? 55.325  86.646  5.322   1.00 42.33  ? 16   DG  G "C2'" 1 
ATOM   314   C  "C1'" . DG  A  1  16   ? 55.411  85.207  4.850   1.00 44.65  ? 16   DG  G "C1'" 1 
ATOM   315   N  N9    . DG  A  1  16   ? 54.209  84.969  4.044   1.00 47.22  ? 16   DG  G N9    1 
ATOM   316   C  C8    . DG  A  1  16   ? 52.935  84.781  4.503   1.00 47.34  ? 16   DG  G C8    1 
ATOM   317   N  N7    . DG  A  1  16   ? 52.034  84.806  3.563   1.00 47.80  ? 16   DG  G N7    1 
ATOM   318   C  C5    . DG  A  1  16   ? 52.758  84.978  2.404   1.00 49.63  ? 16   DG  G C5    1 
ATOM   319   C  C6    . DG  A  1  16   ? 52.316  85.094  1.079   1.00 51.84  ? 16   DG  G C6    1 
ATOM   320   O  O6    . DG  A  1  16   ? 51.154  85.074  0.659   1.00 53.38  ? 16   DG  G O6    1 
ATOM   321   N  N1    . DG  A  1  16   ? 53.384  85.254  0.195   1.00 52.94  ? 16   DG  G N1    1 
ATOM   322   C  C2    . DG  A  1  16   ? 54.709  85.295  0.567   1.00 51.50  ? 16   DG  G C2    1 
ATOM   323   N  N2    . DG  A  1  16   ? 55.602  85.439  -0.415  1.00 51.14  ? 16   DG  G N2    1 
ATOM   324   N  N3    . DG  A  1  16   ? 55.129  85.197  1.813   1.00 50.14  ? 16   DG  G N3    1 
ATOM   325   C  C4    . DG  A  1  16   ? 54.108  85.042  2.674   1.00 48.80  ? 16   DG  G C4    1 
ATOM   326   P  P     . DC  A  1  17   ? 56.780  89.040  6.788   1.00 43.17  ? 17   DC  G P     1 
ATOM   327   O  OP1   . DC  A  1  17   ? 57.919  89.745  7.433   1.00 40.78  ? 17   DC  G OP1   1 
ATOM   328   O  OP2   . DC  A  1  17   ? 55.395  89.361  7.229   1.00 41.71  ? 17   DC  G OP2   1 
ATOM   329   O  "O5'" . DC  A  1  17   ? 56.812  89.275  5.206   1.00 41.35  ? 17   DC  G "O5'" 1 
ATOM   330   C  "C5'" . DC  A  1  17   ? 57.940  88.879  4.414   1.00 39.08  ? 17   DC  G "C5'" 1 
ATOM   331   C  "C4'" . DC  A  1  17   ? 57.865  89.515  3.046   1.00 37.89  ? 17   DC  G "C4'" 1 
ATOM   332   O  "O4'" . DC  A  1  17   ? 56.983  88.742  2.185   1.00 39.45  ? 17   DC  G "O4'" 1 
ATOM   333   C  "C3'" . DC  A  1  17   ? 57.319  90.948  3.064   1.00 38.02  ? 17   DC  G "C3'" 1 
ATOM   334   O  "O3'" . DC  A  1  17   ? 58.221  91.898  2.536   1.00 35.28  ? 17   DC  G "O3'" 1 
ATOM   335   C  "C2'" . DC  A  1  17   ? 56.078  90.904  2.195   1.00 37.06  ? 17   DC  G "C2'" 1 
ATOM   336   C  "C1'" . DC  A  1  17   ? 56.178  89.617  1.403   1.00 38.41  ? 17   DC  G "C1'" 1 
ATOM   337   N  N1    . DC  A  1  17   ? 54.805  89.085  1.308   1.00 38.22  ? 17   DC  G N1    1 
ATOM   338   C  C2    . DC  A  1  17   ? 54.144  89.169  0.088   1.00 38.76  ? 17   DC  G C2    1 
ATOM   339   O  O2    . DC  A  1  17   ? 54.787  89.474  -0.918  1.00 40.05  ? 17   DC  G O2    1 
ATOM   340   N  N3    . DC  A  1  17   ? 52.814  88.928  0.036   1.00 38.69  ? 17   DC  G N3    1 
ATOM   341   C  C4    . DC  A  1  17   ? 52.157  88.587  1.135   1.00 38.52  ? 17   DC  G C4    1 
ATOM   342   N  N4    . DC  A  1  17   ? 50.836  88.423  1.032   1.00 37.27  ? 17   DC  G N4    1 
ATOM   343   C  C5    . DC  A  1  17   ? 52.820  88.406  2.378   1.00 38.32  ? 17   DC  G C5    1 
ATOM   344   C  C6    . DC  A  1  17   ? 54.140  88.639  2.414   1.00 38.16  ? 17   DC  G C6    1 
ATOM   345   P  P     . DG  A  1  18   ? 57.916  93.464  2.688   1.00 35.53  ? 18   DG  G P     1 
ATOM   346   O  OP1   . DG  A  1  18   ? 59.117  94.074  3.291   1.00 34.24  ? 18   DG  G OP1   1 
ATOM   347   O  OP2   . DG  A  1  18   ? 56.580  93.653  3.333   1.00 34.39  ? 18   DG  G OP2   1 
ATOM   348   O  "O5'" . DG  A  1  18   ? 57.832  93.945  1.178   1.00 33.78  ? 18   DG  G "O5'" 1 
ATOM   349   C  "C5'" . DG  A  1  18   ? 57.280  93.088  0.190   1.00 27.78  ? 18   DG  G "C5'" 1 
ATOM   350   C  "C4'" . DG  A  1  18   ? 57.166  93.813  -1.121  1.00 26.22  ? 18   DG  G "C4'" 1 
ATOM   351   O  "O4'" . DG  A  1  18   ? 56.290  92.974  -1.882  1.00 23.68  ? 18   DG  G "O4'" 1 
ATOM   352   C  "C3'" . DG  A  1  18   ? 56.478  95.170  -1.006  1.00 26.77  ? 18   DG  G "C3'" 1 
ATOM   353   O  "O3'" . DG  A  1  18   ? 57.212  96.235  -1.572  1.00 32.18  ? 18   DG  G "O3'" 1 
ATOM   354   C  "C2'" . DG  A  1  18   ? 55.162  95.046  -1.727  1.00 20.74  ? 18   DG  G "C2'" 1 
ATOM   355   C  "C1'" . DG  A  1  18   ? 55.128  93.660  -2.283  1.00 21.47  ? 18   DG  G "C1'" 1 
ATOM   356   N  N9    . DG  A  1  18   ? 54.014  93.088  -1.574  1.00 21.03  ? 18   DG  G N9    1 
ATOM   357   C  C8    . DG  A  1  18   ? 53.958  92.711  -0.264  1.00 22.50  ? 18   DG  G C8    1 
ATOM   358   N  N7    . DG  A  1  18   ? 52.753  92.413  0.120   1.00 23.82  ? 18   DG  G N7    1 
ATOM   359   C  C5    . DG  A  1  18   ? 51.994  92.563  -1.029  1.00 23.10  ? 18   DG  G C5    1 
ATOM   360   C  C6    . DG  A  1  18   ? 50.619  92.378  -1.256  1.00 23.64  ? 18   DG  G C6    1 
ATOM   361   O  O6    . DG  A  1  18   ? 49.743  92.028  -0.460  1.00 27.07  ? 18   DG  G O6    1 
ATOM   362   N  N1    . DG  A  1  18   ? 50.286  92.646  -2.567  1.00 21.48  ? 18   DG  G N1    1 
ATOM   363   C  C2    . DG  A  1  18   ? 51.164  93.033  -3.527  1.00 22.62  ? 18   DG  G C2    1 
ATOM   364   N  N2    . DG  A  1  18   ? 50.695  93.252  -4.738  1.00 24.26  ? 18   DG  G N2    1 
ATOM   365   N  N3    . DG  A  1  18   ? 52.432  93.200  -3.328  1.00 22.10  ? 18   DG  G N3    1 
ATOM   366   C  C4    . DG  A  1  18   ? 52.777  92.950  -2.074  1.00 21.78  ? 18   DG  G C4    1 
ATOM   367   P  P     . DC  A  1  19   ? 56.856  97.725  -1.125  1.00 38.60  ? 19   DC  G P     1 
ATOM   368   O  OP1   . DC  A  1  19   ? 58.059  98.577  -1.013  1.00 36.37  ? 19   DC  G OP1   1 
ATOM   369   O  OP2   . DC  A  1  19   ? 55.947  97.568  0.032   1.00 39.54  ? 19   DC  G OP2   1 
ATOM   370   O  "O5'" . DC  A  1  19   ? 55.928  98.285  -2.275  1.00 37.27  ? 19   DC  G "O5'" 1 
ATOM   371   C  "C5'" . DC  A  1  19   ? 55.822  97.620  -3.519  1.00 38.94  ? 19   DC  G "C5'" 1 
ATOM   372   C  "C4'" . DC  A  1  19   ? 54.503  97.972  -4.150  1.00 38.49  ? 19   DC  G "C4'" 1 
ATOM   373   O  "O4'" . DC  A  1  19   ? 53.506  97.046  -3.673  1.00 40.68  ? 19   DC  G "O4'" 1 
ATOM   374   C  "C3'" . DC  A  1  19   ? 54.046  99.361  -3.702  1.00 38.72  ? 19   DC  G "C3'" 1 
ATOM   375   O  "O3'" . DC  A  1  19   ? 53.779  100.242 -4.770  1.00 36.86  ? 19   DC  G "O3'" 1 
ATOM   376   C  "C2'" . DC  A  1  19   ? 52.786  99.121  -2.899  1.00 37.28  ? 19   DC  G "C2'" 1 
ATOM   377   C  "C1'" . DC  A  1  19   ? 52.332  97.765  -3.377  1.00 39.17  ? 19   DC  G "C1'" 1 
ATOM   378   N  N1    . DC  A  1  19   ? 51.625  97.062  -2.324  1.00 39.13  ? 19   DC  G N1    1 
ATOM   379   C  C2    . DC  A  1  19   ? 50.302  96.761  -2.520  1.00 39.88  ? 19   DC  G C2    1 
ATOM   380   O  O2    . DC  A  1  19   ? 49.799  96.976  -3.625  1.00 39.68  ? 19   DC  G O2    1 
ATOM   381   N  N3    . DC  A  1  19   ? 49.592  96.254  -1.511  1.00 41.43  ? 19   DC  G N3    1 
ATOM   382   C  C4    . DC  A  1  19   ? 50.174  96.024  -0.341  1.00 42.45  ? 19   DC  G C4    1 
ATOM   383   N  N4    . DC  A  1  19   ? 49.408  95.555  0.637   1.00 44.17  ? 19   DC  G N4    1 
ATOM   384   C  C5    . DC  A  1  19   ? 51.557  96.269  -0.128  1.00 41.04  ? 19   DC  G C5    1 
ATOM   385   C  C6    . DC  A  1  19   ? 52.242  96.771  -1.142  1.00 38.79  ? 19   DC  G C6    1 
ATOM   386   P  P     . DG  A  1  20   ? 53.653  101.801 -4.459  1.00 38.89  ? 20   DG  G P     1 
ATOM   387   O  OP1   . DG  A  1  20   ? 54.045  102.536 -5.682  1.00 38.15  ? 20   DG  G OP1   1 
ATOM   388   O  OP2   . DG  A  1  20   ? 54.315  102.092 -3.172  1.00 37.35  ? 20   DG  G OP2   1 
ATOM   389   O  "O5'" . DG  A  1  20   ? 52.104  101.971 -4.239  1.00 36.38  ? 20   DG  G "O5'" 1 
ATOM   390   C  "C5'" . DG  A  1  20   ? 51.235  101.593 -5.270  1.00 35.62  ? 20   DG  G "C5'" 1 
ATOM   391   C  "C4'" . DG  A  1  20   ? 49.829  101.940 -4.892  1.00 32.73  ? 20   DG  G "C4'" 1 
ATOM   392   O  "O4'" . DG  A  1  20   ? 49.238  100.844 -4.168  1.00 35.94  ? 20   DG  G "O4'" 1 
ATOM   393   C  "C3'" . DG  A  1  20   ? 49.771  103.164 -4.005  1.00 31.08  ? 20   DG  G "C3'" 1 
ATOM   394   O  "O3'" . DG  A  1  20   ? 48.845  104.087 -4.547  1.00 29.74  ? 20   DG  G "O3'" 1 
ATOM   395   C  "C2'" . DG  A  1  20   ? 49.328  102.603 -2.674  1.00 32.80  ? 20   DG  G "C2'" 1 
ATOM   396   C  "C1'" . DG  A  1  20   ? 48.580  101.340 -3.050  1.00 36.62  ? 20   DG  G "C1'" 1 
ATOM   397   N  N9    . DG  A  1  20   ? 48.650  100.320 -2.024  1.00 40.61  ? 20   DG  G N9    1 
ATOM   398   C  C8    . DG  A  1  20   ? 49.778  99.842  -1.418  1.00 42.34  ? 20   DG  G C8    1 
ATOM   399   N  N7    . DG  A  1  20   ? 49.520  99.020  -0.441  1.00 45.07  ? 20   DG  G N7    1 
ATOM   400   C  C5    . DG  A  1  20   ? 48.135  98.931  -0.429  1.00 45.34  ? 20   DG  G C5    1 
ATOM   401   C  C6    . DG  A  1  20   ? 47.273  98.199  0.414   1.00 47.30  ? 20   DG  G C6    1 
ATOM   402   O  O6    . DG  A  1  20   ? 47.566  97.470  1.350   1.00 49.87  ? 20   DG  G O6    1 
ATOM   403   N  N1    . DG  A  1  20   ? 45.934  98.383  0.077   1.00 49.95  ? 20   DG  G N1    1 
ATOM   404   C  C2    . DG  A  1  20   ? 45.488  99.188  -0.944  1.00 50.45  ? 20   DG  G C2    1 
ATOM   405   N  N2    . DG  A  1  20   ? 44.156  99.250  -1.116  1.00 51.44  ? 20   DG  G N2    1 
ATOM   406   N  N3    . DG  A  1  20   ? 46.292  99.884  -1.737  1.00 48.11  ? 20   DG  G N3    1 
ATOM   407   C  C4    . DG  A  1  20   ? 47.590  99.707  -1.422  1.00 44.23  ? 20   DG  G C4    1 
ATOM   408   P  P     . DC  A  1  21   ? 48.471  105.415 -3.727  1.00 31.62  ? 21   DC  G P     1 
ATOM   409   O  OP1   . DC  A  1  21   ? 48.192  106.562 -4.636  1.00 28.25  ? 21   DC  G OP1   1 
ATOM   410   O  OP2   . DC  A  1  21   ? 49.540  105.541 -2.712  1.00 26.48  ? 21   DC  G OP2   1 
ATOM   411   O  "O5'" . DC  A  1  21   ? 47.073  104.989 -3.072  1.00 27.85  ? 21   DC  G "O5'" 1 
ATOM   412   C  "C5'" . DC  A  1  21   ? 46.117  104.228 -3.833  1.00 21.80  ? 21   DC  G "C5'" 1 
ATOM   413   C  "C4'" . DC  A  1  21   ? 44.832  104.066 -3.058  1.00 16.92  ? 21   DC  G "C4'" 1 
ATOM   414   O  "O4'" . DC  A  1  21   ? 44.957  102.980 -2.105  1.00 15.64  ? 21   DC  G "O4'" 1 
ATOM   415   C  "C3'" . DC  A  1  21   ? 44.502  105.311 -2.257  1.00 16.48  ? 21   DC  G "C3'" 1 
ATOM   416   O  "O3'" . DC  A  1  21   ? 43.132  105.646 -2.345  1.00 18.47  ? 21   DC  G "O3'" 1 
ATOM   417   C  "C2'" . DC  A  1  21   ? 44.877  104.917 -0.847  1.00 15.97  ? 21   DC  G "C2'" 1 
ATOM   418   C  "C1'" . DC  A  1  21   ? 44.593  103.433 -0.832  1.00 16.35  ? 21   DC  G "C1'" 1 
ATOM   419   N  N1    . DC  A  1  21   ? 45.368  102.683 0.160   1.00 19.23  ? 21   DC  G N1    1 
ATOM   420   C  C2    . DC  A  1  21   ? 44.685  101.928 1.122   1.00 22.94  ? 21   DC  G C2    1 
ATOM   421   O  O2    . DC  A  1  21   ? 43.446  101.909 1.110   1.00 24.18  ? 21   DC  G O2    1 
ATOM   422   N  N3    . DC  A  1  21   ? 45.398  101.238 2.049   1.00 24.99  ? 21   DC  G N3    1 
ATOM   423   C  C4    . DC  A  1  21   ? 46.732  101.279 2.039   1.00 24.73  ? 21   DC  G C4    1 
ATOM   424   N  N4    . DC  A  1  21   ? 47.376  100.574 2.963   1.00 27.13  ? 21   DC  G N4    1 
ATOM   425   C  C5    . DC  A  1  21   ? 47.452  102.040 1.080   1.00 23.03  ? 21   DC  G C5    1 
ATOM   426   C  C6    . DC  A  1  21   ? 46.735  102.719 0.160   1.00 21.32  ? 21   DC  G C6    1 
ATOM   427   P  P     . DC  A  1  22   ? 42.645  107.078 -1.807  1.00 22.92  ? 22   DC  G P     1 
ATOM   428   O  OP1   . DC  A  1  22   ? 41.531  107.565 -2.662  1.00 20.03  ? 22   DC  G OP1   1 
ATOM   429   O  OP2   . DC  A  1  22   ? 43.857  107.912 -1.623  1.00 17.38  ? 22   DC  G OP2   1 
ATOM   430   O  "O5'" . DC  A  1  22   ? 42.071  106.778 -0.353  1.00 25.78  ? 22   DC  G "O5'" 1 
ATOM   431   C  "C5'" . DC  A  1  22   ? 40.883  106.005 -0.170  1.00 34.97  ? 22   DC  G "C5'" 1 
ATOM   432   C  "C4'" . DC  A  1  22   ? 40.496  105.976 1.293   1.00 40.82  ? 22   DC  G "C4'" 1 
ATOM   433   O  "O4'" . DC  A  1  22   ? 41.188  104.929 2.027   1.00 43.09  ? 22   DC  G "O4'" 1 
ATOM   434   C  "C3'" . DC  A  1  22   ? 40.805  107.286 2.016   1.00 44.72  ? 22   DC  G "C3'" 1 
ATOM   435   O  "O3'" . DC  A  1  22   ? 39.728  107.725 2.844   1.00 49.40  ? 22   DC  G "O3'" 1 
ATOM   436   C  "C2'" . DC  A  1  22   ? 42.007  106.944 2.872   1.00 43.95  ? 22   DC  G "C2'" 1 
ATOM   437   C  "C1'" . DC  A  1  22   ? 41.763  105.488 3.193   1.00 44.05  ? 22   DC  G "C1'" 1 
ATOM   438   N  N1    . DC  A  1  22   ? 42.981  104.737 3.534   1.00 45.45  ? 22   DC  G N1    1 
ATOM   439   C  C2    . DC  A  1  22   ? 42.918  103.847 4.577   1.00 46.49  ? 22   DC  G C2    1 
ATOM   440   O  O2    . DC  A  1  22   ? 41.835  103.681 5.130   1.00 49.05  ? 22   DC  G O2    1 
ATOM   441   N  N3    . DC  A  1  22   ? 44.027  103.195 4.965   1.00 46.69  ? 22   DC  G N3    1 
ATOM   442   C  C4    . DC  A  1  22   ? 45.174  103.410 4.342   1.00 48.12  ? 22   DC  G C4    1 
ATOM   443   N  N4    . DC  A  1  22   ? 46.250  102.758 4.776   1.00 48.26  ? 22   DC  G N4    1 
ATOM   444   C  C5    . DC  A  1  22   ? 45.273  104.306 3.244   1.00 47.76  ? 22   DC  G C5    1 
ATOM   445   C  C6    . DC  A  1  22   ? 44.157  104.936 2.868   1.00 46.01  ? 22   DC  G C6    1 
ATOM   446   P  P     . DG  A  1  23   ? 39.728  109.237 3.375   1.00 53.71  ? 23   DG  G P     1 
ATOM   447   O  OP1   . DG  A  1  23   ? 38.776  110.053 2.577   1.00 51.87  ? 23   DG  G OP1   1 
ATOM   448   O  OP2   . DG  A  1  23   ? 41.168  109.649 3.473   1.00 52.93  ? 23   DG  G OP2   1 
ATOM   449   O  "O5'" . DG  A  1  23   ? 39.170  109.120 4.857   1.00 55.89  ? 23   DG  G "O5'" 1 
ATOM   450   C  "C5'" . DG  A  1  23   ? 37.980  108.393 5.130   1.00 60.30  ? 23   DG  G "C5'" 1 
ATOM   451   C  "C4'" . DG  A  1  23   ? 37.879  108.081 6.603   1.00 62.81  ? 23   DG  G "C4'" 1 
ATOM   452   O  "O4'" . DG  A  1  23   ? 38.992  107.231 6.974   1.00 63.63  ? 23   DG  G "O4'" 1 
ATOM   453   C  "C3'" . DG  A  1  23   ? 37.962  109.309 7.506   1.00 64.05  ? 23   DG  G "C3'" 1 
ATOM   454   O  "O3'" . DG  A  1  23   ? 37.182  109.078 8.679   1.00 65.51  ? 23   DG  G "O3'" 1 
ATOM   455   C  "C2'" . DG  A  1  23   ? 39.441  109.383 7.849   1.00 64.36  ? 23   DG  G "C2'" 1 
ATOM   456   C  "C1'" . DG  A  1  23   ? 39.868  107.917 7.858   1.00 64.11  ? 23   DG  G "C1'" 1 
ATOM   457   N  N9    . DG  A  1  23   ? 41.233  107.689 7.395   1.00 64.14  ? 23   DG  G N9    1 
ATOM   458   C  C8    . DG  A  1  23   ? 41.851  108.261 6.311   1.00 64.76  ? 23   DG  G C8    1 
ATOM   459   N  N7    . DG  A  1  23   ? 43.087  107.869 6.165   1.00 65.31  ? 23   DG  G N7    1 
ATOM   460   C  C5    . DG  A  1  23   ? 43.292  106.989 7.212   1.00 65.12  ? 23   DG  G C5    1 
ATOM   461   C  C6    . DG  A  1  23   ? 44.439  106.252 7.574   1.00 65.36  ? 23   DG  G C6    1 
ATOM   462   O  O6    . DG  A  1  23   ? 45.544  106.244 7.030   1.00 64.94  ? 23   DG  G O6    1 
ATOM   463   N  N1    . DG  A  1  23   ? 44.206  105.469 8.697   1.00 65.75  ? 23   DG  G N1    1 
ATOM   464   C  C2    . DG  A  1  23   ? 43.020  105.415 9.382   1.00 66.00  ? 23   DG  G C2    1 
ATOM   465   N  N2    . DG  A  1  23   ? 42.973  104.614 10.441  1.00 66.87  ? 23   DG  G N2    1 
ATOM   466   N  N3    . DG  A  1  23   ? 41.948  106.102 9.055   1.00 65.33  ? 23   DG  G N3    1 
ATOM   467   C  C4    . DG  A  1  23   ? 42.154  106.862 7.972   1.00 64.49  ? 23   DG  G C4    1 
ATOM   468   O  OP3   . G   B  2  1    ? 83.568  111.269 25.942  1.00 103.75 ? 1    G   H OP3   1 
ATOM   469   P  P     . G   B  2  1    ? 82.705  111.656 24.489  1.00 104.24 ? 1    G   H P     1 
ATOM   470   O  OP1   . G   B  2  1    ? 83.267  112.936 23.994  1.00 103.43 ? 1    G   H OP1   1 
ATOM   471   O  OP2   . G   B  2  1    ? 82.867  110.601 23.458  1.00 103.41 ? 1    G   H OP2   1 
ATOM   472   O  "O5'" . G   B  2  1    ? 81.135  111.843 24.780  1.00 103.52 ? 1    G   H "O5'" 1 
ATOM   473   C  "C5'" . G   B  2  1    ? 80.232  111.647 23.660  1.00 102.90 ? 1    G   H "C5'" 1 
ATOM   474   C  "C4'" . G   B  2  1    ? 78.812  111.754 24.170  1.00 103.32 ? 1    G   H "C4'" 1 
ATOM   475   O  "O4'" . G   B  2  1    ? 78.821  112.518 25.358  1.00 102.91 ? 1    G   H "O4'" 1 
ATOM   476   C  "C3'" . G   B  2  1    ? 77.811  112.529 23.366  1.00 102.90 ? 1    G   H "C3'" 1 
ATOM   477   O  "O3'" . G   B  2  1    ? 77.013  111.572 22.780  1.00 103.88 ? 1    G   H "O3'" 1 
ATOM   478   C  "C2'" . G   B  2  1    ? 76.809  113.114 24.308  1.00 102.17 ? 1    G   H "C2'" 1 
ATOM   479   O  "O2'" . G   B  2  1    ? 75.696  112.265 24.569  1.00 102.18 ? 1    G   H "O2'" 1 
ATOM   480   C  "C1'" . G   B  2  1    ? 77.616  113.221 25.593  1.00 102.02 ? 1    G   H "C1'" 1 
ATOM   481   N  N9    . G   B  2  1    ? 78.092  114.419 26.268  1.00 101.55 ? 1    G   H N9    1 
ATOM   482   C  C8    . G   B  2  1    ? 79.166  115.216 25.924  1.00 101.80 ? 1    G   H C8    1 
ATOM   483   N  N7    . G   B  2  1    ? 79.269  116.264 26.699  1.00 102.16 ? 1    G   H N7    1 
ATOM   484   C  C5    . G   B  2  1    ? 78.226  116.132 27.609  1.00 101.25 ? 1    G   H C5    1 
ATOM   485   C  C6    . G   B  2  1    ? 77.825  116.981 28.685  1.00 100.47 ? 1    G   H C6    1 
ATOM   486   O  O6    . G   B  2  1    ? 78.316  118.054 29.045  1.00 99.83  ? 1    G   H O6    1 
ATOM   487   N  N1    . G   B  2  1    ? 76.727  116.467 29.362  1.00 100.76 ? 1    G   H N1    1 
ATOM   488   C  C2    . G   B  2  1    ? 76.086  115.294 29.051  1.00 100.47 ? 1    G   H C2    1 
ATOM   489   N  N2    . G   B  2  1    ? 75.043  115.001 29.837  1.00 99.51  ? 1    G   H N2    1 
ATOM   490   N  N3    . G   B  2  1    ? 76.441  114.497 28.046  1.00 101.26 ? 1    G   H N3    1 
ATOM   491   C  C4    . G   B  2  1    ? 77.513  115.008 27.369  1.00 101.16 ? 1    G   H C4    1 
ATOM   492   P  P     . A   B  2  2    ? 77.566  110.679 21.622  1.00 104.75 ? 2    A   H P     1 
ATOM   493   O  OP1   . A   B  2  2    ? 77.481  109.221 21.891  1.00 105.44 ? 2    A   H OP1   1 
ATOM   494   O  OP2   . A   B  2  2    ? 78.945  111.038 21.190  1.00 105.57 ? 2    A   H OP2   1 
ATOM   495   O  "O5'" . A   B  2  2    ? 76.473  111.065 20.541  1.00 103.77 ? 2    A   H "O5'" 1 
ATOM   496   C  "C5'" . A   B  2  2    ? 75.168  110.597 20.902  1.00 101.76 ? 2    A   H "C5'" 1 
ATOM   497   C  "C4'" . A   B  2  2    ? 74.193  111.718 21.086  1.00 100.07 ? 2    A   H "C4'" 1 
ATOM   498   O  "O4'" . A   B  2  2    ? 74.008  112.427 19.810  1.00 99.79  ? 2    A   H "O4'" 1 
ATOM   499   C  "C3'" . A   B  2  2    ? 72.828  111.154 21.248  1.00 98.97  ? 2    A   H "C3'" 1 
ATOM   500   O  "O3'" . A   B  2  2    ? 72.579  110.997 22.560  1.00 98.63  ? 2    A   H "O3'" 1 
ATOM   501   C  "C2'" . A   B  2  2    ? 71.820  112.151 20.706  1.00 99.00  ? 2    A   H "C2'" 1 
ATOM   502   O  "O2'" . A   B  2  2    ? 71.431  113.139 21.650  1.00 98.04  ? 2    A   H "O2'" 1 
ATOM   503   C  "C1'" . A   B  2  2    ? 72.648  112.666 19.572  1.00 99.03  ? 2    A   H "C1'" 1 
ATOM   504   N  N9    . A   B  2  2    ? 72.255  111.733 18.476  1.00 98.63  ? 2    A   H N9    1 
ATOM   505   C  C8    . A   B  2  2    ? 72.673  110.457 18.182  1.00 98.13  ? 2    A   H C8    1 
ATOM   506   N  N7    . A   B  2  2    ? 72.187  109.959 17.084  1.00 98.24  ? 2    A   H N7    1 
ATOM   507   C  C5    . A   B  2  2    ? 71.395  110.965 16.573  1.00 98.04  ? 2    A   H C5    1 
ATOM   508   C  C6    . A   B  2  2    ? 70.600  111.102 15.413  1.00 97.63  ? 2    A   H C6    1 
ATOM   509   N  N6    . A   B  2  2    ? 70.469  110.123 14.483  1.00 98.32  ? 2    A   H N6    1 
ATOM   510   N  N1    . A   B  2  2    ? 69.940  112.266 15.236  1.00 97.43  ? 2    A   H N1    1 
ATOM   511   C  C2    . A   B  2  2    ? 70.077  113.219 16.153  1.00 97.61  ? 2    A   H C2    1 
ATOM   512   N  N3    . A   B  2  2    ? 70.783  113.214 17.281  1.00 98.07  ? 2    A   H N3    1 
ATOM   513   C  C4    . A   B  2  2    ? 71.430  112.044 17.436  1.00 98.29  ? 2    A   H C4    1 
ATOM   514   P  P     . G   B  2  3    ? 71.470  109.920 22.728  1.00 98.09  ? 3    G   H P     1 
ATOM   515   O  OP1   . G   B  2  3    ? 71.276  109.612 24.171  1.00 98.92  ? 3    G   H OP1   1 
ATOM   516   O  OP2   . G   B  2  3    ? 71.821  108.689 21.986  1.00 97.29  ? 3    G   H OP2   1 
ATOM   517   O  "O5'" . G   B  2  3    ? 70.138  110.616 22.125  1.00 95.51  ? 3    G   H "O5'" 1 
ATOM   518   C  "C5'" . G   B  2  3    ? 68.905  110.612 22.928  1.00 90.38  ? 3    G   H "C5'" 1 
ATOM   519   C  "C4'" . G   B  2  3    ? 67.711  110.933 22.017  1.00 86.87  ? 3    G   H "C4'" 1 
ATOM   520   O  "O4'" . G   B  2  3    ? 68.284  111.003 20.693  1.00 85.64  ? 3    G   H "O4'" 1 
ATOM   521   C  "C3'" . G   B  2  3    ? 66.557  109.904 21.817  1.00 85.31  ? 3    G   H "C3'" 1 
ATOM   522   O  "O3'" . G   B  2  3    ? 65.425  110.161 22.718  1.00 85.00  ? 3    G   H "O3'" 1 
ATOM   523   C  "C2'" . G   B  2  3    ? 66.080  110.142 20.392  1.00 83.67  ? 3    G   H "C2'" 1 
ATOM   524   O  "O2'" . G   B  2  3    ? 65.168  111.221 20.254  1.00 83.14  ? 3    G   H "O2'" 1 
ATOM   525   C  "C1'" . G   B  2  3    ? 67.387  110.572 19.731  1.00 83.93  ? 3    G   H "C1'" 1 
ATOM   526   N  N9    . G   B  2  3    ? 68.007  109.373 19.101  1.00 83.42  ? 3    G   H N9    1 
ATOM   527   C  C8    . G   B  2  3    ? 68.708  108.355 19.663  1.00 83.09  ? 3    G   H C8    1 
ATOM   528   N  N7    . G   B  2  3    ? 69.011  107.401 18.819  1.00 82.67  ? 3    G   H N7    1 
ATOM   529   C  C5    . G   B  2  3    ? 68.460  107.855 17.616  1.00 81.87  ? 3    G   H C5    1 
ATOM   530   C  C6    . G   B  2  3    ? 68.435  107.241 16.334  1.00 80.63  ? 3    G   H C6    1 
ATOM   531   O  O6    . G   B  2  3    ? 68.886  106.138 15.995  1.00 80.25  ? 3    G   H O6    1 
ATOM   532   N  N1    . G   B  2  3    ? 67.801  108.054 15.393  1.00 80.52  ? 3    G   H N1    1 
ATOM   533   C  C2    . G   B  2  3    ? 67.258  109.303 15.649  1.00 80.86  ? 3    G   H C2    1 
ATOM   534   N  N2    . G   B  2  3    ? 66.691  109.913 14.604  1.00 79.23  ? 3    G   H N2    1 
ATOM   535   N  N3    . G   B  2  3    ? 67.274  109.879 16.842  1.00 81.39  ? 3    G   H N3    1 
ATOM   536   C  C4    . G   B  2  3    ? 67.885  109.074 17.770  1.00 82.55  ? 3    G   H C4    1 
ATOM   537   P  P     . U   B  2  4    ? 64.092  109.237 22.723  1.00 85.13  ? 4    U   H P     1 
ATOM   538   O  OP1   . U   B  2  4    ? 63.609  109.248 24.134  1.00 84.31  ? 4    U   H OP1   1 
ATOM   539   O  OP2   . U   B  2  4    ? 64.490  107.948 22.091  1.00 84.75  ? 4    U   H OP2   1 
ATOM   540   O  "O5'" . U   B  2  4    ? 63.040  109.977 21.784  1.00 84.37  ? 4    U   H "O5'" 1 
ATOM   541   C  "C5'" . U   B  2  4    ? 62.765  111.333 22.060  1.00 83.32  ? 4    U   H "C5'" 1 
ATOM   542   C  "C4'" . U   B  2  4    ? 62.030  112.033 20.946  1.00 83.00  ? 4    U   H "C4'" 1 
ATOM   543   O  "O4'" . U   B  2  4    ? 62.914  112.203 19.790  1.00 82.93  ? 4    U   H "O4'" 1 
ATOM   544   C  "C3'" . U   B  2  4    ? 60.705  111.487 20.429  1.00 83.77  ? 4    U   H "C3'" 1 
ATOM   545   O  "O3'" . U   B  2  4    ? 59.530  112.096 20.942  1.00 85.52  ? 4    U   H "O3'" 1 
ATOM   546   C  "C2'" . U   B  2  4    ? 60.789  111.545 18.900  1.00 82.85  ? 4    U   H "C2'" 1 
ATOM   547   O  "O2'" . U   B  2  4    ? 60.171  112.716 18.415  1.00 82.86  ? 4    U   H "O2'" 1 
ATOM   548   C  "C1'" . U   B  2  4    ? 62.246  111.805 18.603  1.00 82.03  ? 4    U   H "C1'" 1 
ATOM   549   N  N1    . U   B  2  4    ? 62.825  110.624 17.924  1.00 80.40  ? 4    U   H N1    1 
ATOM   550   C  C2    . U   B  2  4    ? 62.988  110.739 16.539  1.00 79.26  ? 4    U   H C2    1 
ATOM   551   O  O2    . U   B  2  4    ? 62.739  111.766 15.918  1.00 79.19  ? 4    U   H O2    1 
ATOM   552   N  N3    . U   B  2  4    ? 63.433  109.605 15.905  1.00 78.02  ? 4    U   H N3    1 
ATOM   553   C  C4    . U   B  2  4    ? 63.739  108.392 16.484  1.00 77.48  ? 4    U   H C4    1 
ATOM   554   O  O4    . U   B  2  4    ? 64.076  107.447 15.763  1.00 77.53  ? 4    U   H O4    1 
ATOM   555   C  C5    . U   B  2  4    ? 63.587  108.353 17.912  1.00 77.31  ? 4    U   H C5    1 
ATOM   556   C  C6    . U   B  2  4    ? 63.151  109.442 18.570  1.00 78.41  ? 4    U   H C6    1 
ATOM   557   P  P     . C   B  2  5    ? 58.207  111.189 21.148  1.00 87.20  ? 5    C   H P     1 
ATOM   558   O  OP1   . C   B  2  5    ? 57.313  111.863 22.124  1.00 86.30  ? 5    C   H OP1   1 
ATOM   559   O  OP2   . C   B  2  5    ? 58.639  109.786 21.396  1.00 86.40  ? 5    C   H OP2   1 
ATOM   560   O  "O5'" . C   B  2  5    ? 57.516  111.224 19.715  1.00 88.60  ? 5    C   H "O5'" 1 
ATOM   561   C  "C5'" . C   B  2  5    ? 57.401  112.461 19.042  1.00 92.22  ? 5    C   H "C5'" 1 
ATOM   562   C  "C4'" . C   B  2  5    ? 57.211  112.305 17.541  1.00 94.52  ? 5    C   H "C4'" 1 
ATOM   563   O  "O4'" . C   B  2  5    ? 58.504  112.035 16.893  1.00 96.61  ? 5    C   H "O4'" 1 
ATOM   564   C  "C3'" . C   B  2  5    ? 56.237  111.266 16.999  1.00 96.11  ? 5    C   H "C3'" 1 
ATOM   565   O  "O3'" . C   B  2  5    ? 54.935  111.633 16.586  1.00 95.76  ? 5    C   H "O3'" 1 
ATOM   566   C  "C2'" . C   B  2  5    ? 56.983  110.527 15.891  1.00 97.04  ? 5    C   H "C2'" 1 
ATOM   567   O  "O2'" . C   B  2  5    ? 56.647  111.061 14.627  1.00 97.40  ? 5    C   H "O2'" 1 
ATOM   568   C  "C1'" . C   B  2  5    ? 58.441  110.830 16.133  1.00 98.26  ? 5    C   H "C1'" 1 
ATOM   569   N  N1    . C   B  2  5    ? 59.049  109.634 16.805  1.00 100.32 ? 5    C   H N1    1 
ATOM   570   C  C2    . C   B  2  5    ? 60.008  108.887 16.090  1.00 101.28 ? 5    C   H C2    1 
ATOM   571   O  O2    . C   B  2  5    ? 60.330  109.257 14.954  1.00 101.77 ? 5    C   H O2    1 
ATOM   572   N  N3    . C   B  2  5    ? 60.543  107.768 16.655  1.00 102.01 ? 5    C   H N3    1 
ATOM   573   C  C4    . C   B  2  5    ? 60.164  107.387 17.878  1.00 101.71 ? 5    C   H C4    1 
ATOM   574   N  N4    . C   B  2  5    ? 60.720  106.283 18.397  1.00 101.59 ? 5    C   H N4    1 
ATOM   575   C  C5    . C   B  2  5    ? 59.201  108.124 18.628  1.00 101.65 ? 5    C   H C5    1 
ATOM   576   C  C6    . C   B  2  5    ? 58.677  109.228 18.061  1.00 100.96 ? 5    C   H C6    1 
ATOM   577   P  P     . U   B  2  6    ? 53.775  110.501 16.626  1.00 96.37  ? 6    U   H P     1 
ATOM   578   O  OP1   . U   B  2  6    ? 52.465  111.179 16.820  1.00 95.57  ? 6    U   H OP1   1 
ATOM   579   O  OP2   . U   B  2  6    ? 54.206  109.453 17.610  1.00 96.93  ? 6    U   H OP2   1 
ATOM   580   O  "O5'" . U   B  2  6    ? 53.834  109.824 15.173  1.00 91.51  ? 6    U   H "O5'" 1 
ATOM   581   C  "C5'" . U   B  2  6    ? 53.602  110.623 14.024  1.00 83.54  ? 6    U   H "C5'" 1 
ATOM   582   C  "C4'" . U   B  2  6    ? 54.148  110.012 12.732  1.00 77.67  ? 6    U   H "C4'" 1 
ATOM   583   O  "O4'" . U   B  2  6    ? 55.591  109.757 12.855  1.00 77.35  ? 6    U   H "O4'" 1 
ATOM   584   C  "C3'" . U   B  2  6    ? 53.524  108.750 12.119  1.00 75.30  ? 6    U   H "C3'" 1 
ATOM   585   O  "O3'" . U   B  2  6    ? 52.769  108.819 10.905  1.00 70.49  ? 6    U   H "O3'" 1 
ATOM   586   C  "C2'" . U   B  2  6    ? 54.659  107.754 11.935  1.00 75.28  ? 6    U   H "C2'" 1 
ATOM   587   O  "O2'" . U   B  2  6    ? 54.872  107.465 10.566  1.00 74.61  ? 6    U   H "O2'" 1 
ATOM   588   C  "C1'" . U   B  2  6    ? 55.891  108.408 12.506  1.00 75.70  ? 6    U   H "C1'" 1 
ATOM   589   N  N1    . U   B  2  6    ? 56.383  107.566 13.627  1.00 74.10  ? 6    U   H N1    1 
ATOM   590   C  C2    . U   B  2  6    ? 57.214  106.497 13.287  1.00 72.86  ? 6    U   H C2    1 
ATOM   591   O  O2    . U   B  2  6    ? 57.476  106.205 12.133  1.00 71.87  ? 6    U   H O2    1 
ATOM   592   N  N3    . U   B  2  6    ? 57.708  105.773 14.348  1.00 72.04  ? 6    U   H N3    1 
ATOM   593   C  C4    . U   B  2  6    ? 57.466  105.988 15.685  1.00 71.51  ? 6    U   H C4    1 
ATOM   594   O  O4    . U   B  2  6    ? 58.008  105.272 16.525  1.00 70.34  ? 6    U   H O4    1 
ATOM   595   C  C5    . U   B  2  6    ? 56.586  107.072 15.956  1.00 71.88  ? 6    U   H C5    1 
ATOM   596   C  C6    . U   B  2  6    ? 56.078  107.797 14.943  1.00 73.19  ? 6    U   H C6    1 
ATOM   597   P  P     . G   B  2  7    ? 51.409  107.930 10.760  1.00 68.28  ? 7    G   H P     1 
ATOM   598   O  OP1   . G   B  2  7    ? 50.472  108.737 9.953   1.00 67.63  ? 7    G   H OP1   1 
ATOM   599   O  OP2   . G   B  2  7    ? 51.006  107.490 12.124  1.00 67.18  ? 7    G   H OP2   1 
ATOM   600   O  "O5'" . G   B  2  7    ? 51.762  106.612 9.910   1.00 63.42  ? 7    G   H "O5'" 1 
ATOM   601   C  "C5'" . G   B  2  7    ? 51.006  105.368 10.082  1.00 59.75  ? 7    G   H "C5'" 1 
ATOM   602   C  "C4'" . G   B  2  7    ? 51.682  104.199 9.339   1.00 55.94  ? 7    G   H "C4'" 1 
ATOM   603   O  "O4'" . G   B  2  7    ? 53.039  104.659 9.094   1.00 53.88  ? 7    G   H "O4'" 1 
ATOM   604   C  "C3'" . G   B  2  7    ? 51.897  102.790 9.973   1.00 56.51  ? 7    G   H "C3'" 1 
ATOM   605   O  "O3'" . G   B  2  7    ? 51.208  101.591 9.583   1.00 60.10  ? 7    G   H "O3'" 1 
ATOM   606   C  "C2'" . G   B  2  7    ? 53.403  102.533 9.925   1.00 53.13  ? 7    G   H "C2'" 1 
ATOM   607   O  "O2'" . G   B  2  7    ? 53.824  101.753 8.822   1.00 52.66  ? 7    G   H "O2'" 1 
ATOM   608   C  "C1'" . G   B  2  7    ? 53.972  103.922 9.885   1.00 50.66  ? 7    G   H "C1'" 1 
ATOM   609   N  N9    . G   B  2  7    ? 53.898  104.261 11.312  1.00 47.19  ? 7    G   H N9    1 
ATOM   610   C  C8    . G   B  2  7    ? 53.266  105.301 11.907  1.00 45.54  ? 7    G   H C8    1 
ATOM   611   N  N7    . G   B  2  7    ? 53.410  105.350 13.194  1.00 44.93  ? 7    G   H N7    1 
ATOM   612   C  C5    . G   B  2  7    ? 54.176  104.246 13.484  1.00 45.18  ? 7    G   H C5    1 
ATOM   613   C  C6    . G   B  2  7    ? 54.638  103.774 14.714  1.00 44.62  ? 7    G   H C6    1 
ATOM   614   O  O6    . G   B  2  7    ? 54.465  104.262 15.828  1.00 45.24  ? 7    G   H O6    1 
ATOM   615   N  N1    . G   B  2  7    ? 55.368  102.602 14.571  1.00 43.00  ? 7    G   H N1    1 
ATOM   616   C  C2    . G   B  2  7    ? 55.606  101.966 13.388  1.00 42.25  ? 7    G   H C2    1 
ATOM   617   N  N2    . G   B  2  7    ? 56.314  100.849 13.457  1.00 40.80  ? 7    G   H N2    1 
ATOM   618   N  N3    . G   B  2  7    ? 55.177  102.398 12.224  1.00 43.97  ? 7    G   H N3    1 
ATOM   619   C  C4    . G   B  2  7    ? 54.476  103.545 12.342  1.00 45.50  ? 7    G   H C4    1 
ATOM   620   P  P     . C   B  2  8    ? 51.343  100.252 10.532  1.00 60.25  ? 8    C   H P     1 
ATOM   621   O  OP1   . C   B  2  8    ? 52.428  100.432 11.546  1.00 59.70  ? 8    C   H OP1   1 
ATOM   622   O  OP2   . C   B  2  8    ? 51.380  99.081  9.630   1.00 60.56  ? 8    C   H OP2   1 
ATOM   623   O  "O5'" . C   B  2  8    ? 50.016  100.169 11.405  1.00 58.24  ? 8    C   H "O5'" 1 
ATOM   624   C  "C5'" . C   B  2  8    ? 50.110  100.278 12.803  1.00 57.28  ? 8    C   H "C5'" 1 
ATOM   625   C  "C4'" . C   B  2  8    ? 48.758  100.235 13.460  1.00 58.17  ? 8    C   H "C4'" 1 
ATOM   626   O  "O4'" . C   B  2  8    ? 48.150  101.552 13.380  1.00 61.25  ? 8    C   H "O4'" 1 
ATOM   627   C  "C3'" . C   B  2  8    ? 47.725  99.251  12.928  1.00 57.47  ? 8    C   H "C3'" 1 
ATOM   628   O  "O3'" . C   B  2  8    ? 47.172  98.325  13.843  1.00 53.93  ? 8    C   H "O3'" 1 
ATOM   629   C  "C2'" . C   B  2  8    ? 46.721  100.079 12.129  1.00 58.85  ? 8    C   H "C2'" 1 
ATOM   630   O  "O2'" . C   B  2  8    ? 45.399  100.004 12.604  1.00 57.25  ? 8    C   H "O2'" 1 
ATOM   631   C  "C1'" . C   B  2  8    ? 47.061  101.513 12.470  1.00 62.07  ? 8    C   H "C1'" 1 
ATOM   632   N  N1    . C   B  2  8    ? 47.276  102.325 11.241  1.00 65.72  ? 8    C   H N1    1 
ATOM   633   C  C2    . C   B  2  8    ? 46.200  103.107 10.759  1.00 66.96  ? 8    C   H C2    1 
ATOM   634   O  O2    . C   B  2  8    ? 45.109  103.072 11.353  1.00 67.47  ? 8    C   H O2    1 
ATOM   635   N  N3    . C   B  2  8    ? 46.382  103.866 9.651   1.00 67.16  ? 8    C   H N3    1 
ATOM   636   C  C4    . C   B  2  8    ? 47.552  103.863 9.026   1.00 67.19  ? 8    C   H C4    1 
ATOM   637   N  N4    . C   B  2  8    ? 47.692  104.628 7.948   1.00 67.10  ? 8    C   H N4    1 
ATOM   638   C  C5    . C   B  2  8    ? 48.636  103.078 9.476   1.00 66.76  ? 8    C   H C5    1 
ATOM   639   C  C6    . C   B  2  8    ? 48.463  102.335 10.579  1.00 65.93  ? 8    C   H C6    1 
ATOM   640   P  P     . G   B  2  9    ? 47.083  96.770  13.416  1.00 54.54  ? 9    G   H P     1 
ATOM   641   O  OP1   . G   B  2  9    ? 46.973  95.882  14.622  1.00 53.19  ? 9    G   H OP1   1 
ATOM   642   O  OP2   . G   B  2  9    ? 48.162  96.549  12.424  1.00 53.40  ? 9    G   H OP2   1 
ATOM   643   O  "O5'" . G   B  2  9    ? 45.705  96.653  12.632  1.00 51.80  ? 9    G   H "O5'" 1 
ATOM   644   C  "C5'" . G   B  2  9    ? 44.658  97.529  12.981  1.00 49.24  ? 9    G   H "C5'" 1 
ATOM   645   C  "C4'" . G   B  2  9    ? 43.315  97.014  12.564  1.00 47.97  ? 9    G   H "C4'" 1 
ATOM   646   O  "O4'" . G   B  2  9    ? 42.629  98.276  12.326  1.00 47.21  ? 9    G   H "O4'" 1 
ATOM   647   C  "C3'" . G   B  2  9    ? 43.081  96.213  11.274  1.00 48.54  ? 9    G   H "C3'" 1 
ATOM   648   O  "O3'" . G   B  2  9    ? 42.665  94.863  11.380  1.00 50.29  ? 9    G   H "O3'" 1 
ATOM   649   C  "C2'" . G   B  2  9    ? 42.173  97.083  10.407  1.00 47.21  ? 9    G   H "C2'" 1 
ATOM   650   O  "O2'" . G   B  2  9    ? 40.814  96.809  10.629  1.00 45.24  ? 9    G   H "O2'" 1 
ATOM   651   C  "C1'" . G   B  2  9    ? 42.415  98.467  10.933  1.00 47.84  ? 9    G   H "C1'" 1 
ATOM   652   N  N9    . G   B  2  9    ? 43.588  98.939  10.171  1.00 50.14  ? 9    G   H N9    1 
ATOM   653   C  C8    . G   B  2  9    ? 44.913  98.535  10.191  1.00 49.35  ? 9    G   H C8    1 
ATOM   654   N  N7    . G   B  2  9    ? 45.657  99.120  9.301   1.00 47.75  ? 9    G   H N7    1 
ATOM   655   C  C5    . G   B  2  9    ? 44.786  99.959  8.642   1.00 47.75  ? 9    G   H C5    1 
ATOM   656   C  C6    . G   B  2  9    ? 45.014  100.795 7.585   1.00 46.44  ? 9    G   H C6    1 
ATOM   657   O  O6    . G   B  2  9    ? 46.067  100.978 6.998   1.00 45.49  ? 9    G   H O6    1 
ATOM   658   N  N1    . G   B  2  9    ? 43.856  101.456 7.199   1.00 47.93  ? 9    G   H N1    1 
ATOM   659   C  C2    . G   B  2  9    ? 42.622  101.299 7.785   1.00 49.95  ? 9    G   H C2    1 
ATOM   660   N  N2    . G   B  2  9    ? 41.609  101.997 7.310   1.00 49.66  ? 9    G   H N2    1 
ATOM   661   N  N3    . G   B  2  9    ? 42.398  100.503 8.785   1.00 50.63  ? 9    G   H N3    1 
ATOM   662   C  C4    . G   B  2  9    ? 43.511  99.869  9.170   1.00 49.80  ? 9    G   H C4    1 
ATOM   663   P  P     . G   B  2  10   ? 43.087  93.828  10.217  1.00 52.23  ? 10   G   H P     1 
ATOM   664   O  OP1   . G   B  2  10   ? 42.439  92.543  10.552  1.00 53.04  ? 10   G   H OP1   1 
ATOM   665   O  OP2   . G   B  2  10   ? 44.563  93.853  10.039  1.00 50.90  ? 10   G   H OP2   1 
ATOM   666   O  "O5'" . G   B  2  10   ? 42.259  94.392  8.985   1.00 52.24  ? 10   G   H "O5'" 1 
ATOM   667   C  "C5'" . G   B  2  10   ? 40.857  94.461  9.174   1.00 54.08  ? 10   G   H "C5'" 1 
ATOM   668   C  "C4'" . G   B  2  10   ? 40.105  95.116  8.045   1.00 54.69  ? 10   G   H "C4'" 1 
ATOM   669   O  "O4'" . G   B  2  10   ? 40.188  96.581  8.111   1.00 56.16  ? 10   G   H "O4'" 1 
ATOM   670   C  "C3'" . G   B  2  10   ? 40.410  94.744  6.624   1.00 55.82  ? 10   G   H "C3'" 1 
ATOM   671   O  "O3'" . G   B  2  10   ? 39.804  93.554  6.180   1.00 53.98  ? 10   G   H "O3'" 1 
ATOM   672   C  "C2'" . G   B  2  10   ? 40.201  96.045  5.830   1.00 56.53  ? 10   G   H "C2'" 1 
ATOM   673   O  "O2'" . G   B  2  10   ? 38.853  96.237  5.434   1.00 55.47  ? 10   G   H "O2'" 1 
ATOM   674   C  "C1'" . G   B  2  10   ? 40.506  97.132  6.834   1.00 57.04  ? 10   G   H "C1'" 1 
ATOM   675   N  N9    . G   B  2  10   ? 41.941  97.420  6.663   1.00 58.59  ? 10   G   H N9    1 
ATOM   676   C  C8    . G   B  2  10   ? 43.019  96.909  7.353   1.00 58.19  ? 10   G   H C8    1 
ATOM   677   N  N7    . G   B  2  10   ? 44.175  97.324  6.893   1.00 57.73  ? 10   G   H N7    1 
ATOM   678   C  C5    . G   B  2  10   ? 43.850  98.167  5.835   1.00 57.72  ? 10   G   H C5    1 
ATOM   679   C  C6    . G   B  2  10   ? 44.693  98.905  4.938   1.00 57.14  ? 10   G   H C6    1 
ATOM   680   O  O6    . G   B  2  10   ? 45.924  98.960  4.910   1.00 55.90  ? 10   G   H O6    1 
ATOM   681   N  N1    . G   B  2  10   ? 43.948  99.630  4.011   1.00 56.96  ? 10   G   H N1    1 
ATOM   682   C  C2    . G   B  2  10   ? 42.576  99.643  3.949   1.00 57.80  ? 10   G   H C2    1 
ATOM   683   N  N2    . G   B  2  10   ? 42.030  100.395 2.995   1.00 57.58  ? 10   G   H N2    1 
ATOM   684   N  N3    . G   B  2  10   ? 41.784  98.965  4.769   1.00 58.19  ? 10   G   H N3    1 
ATOM   685   C  C4    . G   B  2  10   ? 42.479  98.255  5.683   1.00 58.73  ? 10   G   H C4    1 
ATOM   686   P  P     . C   B  2  11   ? 40.625  92.638  5.156   1.00 54.93  ? 11   C   H P     1 
ATOM   687   O  OP1   . C   B  2  11   ? 40.149  91.244  5.201   1.00 56.06  ? 11   C   H OP1   1 
ATOM   688   O  OP2   . C   B  2  11   ? 42.070  92.916  5.364   1.00 55.11  ? 11   C   H OP2   1 
ATOM   689   O  "O5'" . C   B  2  11   ? 40.171  93.309  3.789   1.00 57.51  ? 11   C   H "O5'" 1 
ATOM   690   C  "C5'" . C   B  2  11   ? 38.910  93.967  3.772   1.00 60.65  ? 11   C   H "C5'" 1 
ATOM   691   C  "C4'" . C   B  2  11   ? 38.745  94.919  2.610   1.00 63.32  ? 11   C   H "C4'" 1 
ATOM   692   O  "O4'" . C   B  2  11   ? 39.314  96.254  2.848   1.00 66.11  ? 11   C   H "O4'" 1 
ATOM   693   C  "C3'" . C   B  2  11   ? 39.251  94.454  1.269   1.00 64.25  ? 11   C   H "C3'" 1 
ATOM   694   O  "O3'" . C   B  2  11   ? 38.328  93.748  0.481   1.00 62.72  ? 11   C   H "O3'" 1 
ATOM   695   C  "C2'" . C   B  2  11   ? 40.030  95.621  0.654   1.00 65.51  ? 11   C   H "C2'" 1 
ATOM   696   O  "O2'" . C   B  2  11   ? 39.346  96.246  -0.419  1.00 63.34  ? 11   C   H "O2'" 1 
ATOM   697   C  "C1'" . C   B  2  11   ? 40.217  96.601  1.797   1.00 68.09  ? 11   C   H "C1'" 1 
ATOM   698   N  N1    . C   B  2  11   ? 41.646  96.474  2.194   1.00 72.58  ? 11   C   H N1    1 
ATOM   699   C  C2    . C   B  2  11   ? 42.618  97.183  1.437   1.00 75.05  ? 11   C   H C2    1 
ATOM   700   O  O2    . C   B  2  11   ? 42.250  97.920  0.510   1.00 75.99  ? 11   C   H O2    1 
ATOM   701   N  N3    . C   B  2  11   ? 43.930  97.029  1.735   1.00 76.66  ? 11   C   H N3    1 
ATOM   702   C  C4    . C   B  2  11   ? 44.301  96.229  2.736   1.00 77.62  ? 11   C   H C4    1 
ATOM   703   N  N4    . C   B  2  11   ? 45.608  96.105  2.982   1.00 78.68  ? 11   C   H N4    1 
ATOM   704   C  C5    . C   B  2  11   ? 43.348  95.521  3.532   1.00 76.98  ? 11   C   H C5    1 
ATOM   705   C  C6    . C   B  2  11   ? 42.044  95.676  3.230   1.00 74.80  ? 11   C   H C6    1 
ATOM   706   P  P     . G   B  2  12   ? 38.694  92.243  0.056   1.00 63.12  ? 12   G   H P     1 
ATOM   707   O  OP1   . G   B  2  12   ? 37.470  91.410  0.090   1.00 62.11  ? 12   G   H OP1   1 
ATOM   708   O  OP2   . G   B  2  12   ? 39.877  91.825  0.857   1.00 61.87  ? 12   G   H OP2   1 
ATOM   709   O  "O5'" . G   B  2  12   ? 39.208  92.468  -1.437  1.00 62.48  ? 12   G   H "O5'" 1 
ATOM   710   C  "C5'" . G   B  2  12   ? 39.871  93.686  -1.736  1.00 57.47  ? 12   G   H "C5'" 1 
ATOM   711   C  "C4'" . G   B  2  12   ? 40.056  93.905  -3.193  1.00 53.58  ? 12   G   H "C4'" 1 
ATOM   712   O  "O4'" . G   B  2  12   ? 40.645  95.237  -3.315  1.00 54.23  ? 12   G   H "O4'" 1 
ATOM   713   C  "C3'" . G   B  2  12   ? 41.032  92.973  -3.879  1.00 51.75  ? 12   G   H "C3'" 1 
ATOM   714   O  "O3'" . G   B  2  12   ? 40.515  92.069  -4.810  1.00 47.13  ? 12   G   H "O3'" 1 
ATOM   715   C  "C2'" . G   B  2  12   ? 42.283  93.783  -4.226  1.00 51.67  ? 12   G   H "C2'" 1 
ATOM   716   O  "O2'" . G   B  2  12   ? 42.498  94.010  -5.598  1.00 51.24  ? 12   G   H "O2'" 1 
ATOM   717   C  "C1'" . G   B  2  12   ? 42.046  95.134  -3.582  1.00 52.88  ? 12   G   H "C1'" 1 
ATOM   718   N  N9    . G   B  2  12   ? 42.892  95.130  -2.382  1.00 52.80  ? 12   G   H N9    1 
ATOM   719   C  C8    . G   B  2  12   ? 42.603  94.732  -1.102  1.00 53.14  ? 12   G   H C8    1 
ATOM   720   N  N7    . G   B  2  12   ? 43.636  94.719  -0.315  1.00 52.48  ? 12   G   H N7    1 
ATOM   721   C  C5    . G   B  2  12   ? 44.670  95.168  -1.109  1.00 51.68  ? 12   G   H C5    1 
ATOM   722   C  C6    . G   B  2  12   ? 46.017  95.344  -0.802  1.00 51.16  ? 12   G   H C6    1 
ATOM   723   O  O6    . G   B  2  12   ? 46.584  95.126  0.258   1.00 50.87  ? 12   G   H O6    1 
ATOM   724   N  N1    . G   B  2  12   ? 46.730  95.816  -1.889  1.00 51.46  ? 12   G   H N1    1 
ATOM   725   C  C2    . G   B  2  12   ? 46.193  96.068  -3.126  1.00 53.16  ? 12   G   H C2    1 
ATOM   726   N  N2    . G   B  2  12   ? 47.026  96.509  -4.060  1.00 53.17  ? 12   G   H N2    1 
ATOM   727   N  N3    . G   B  2  12   ? 44.926  95.898  -3.430  1.00 52.91  ? 12   G   H N3    1 
ATOM   728   C  C4    . G   B  2  12   ? 44.225  95.452  -2.380  1.00 52.74  ? 12   G   H C4    1 
ATOM   729   P  P     . C   B  2  13   ? 41.133  90.597  -4.846  1.00 46.45  ? 13   C   H P     1 
ATOM   730   O  OP1   . C   B  2  13   ? 40.280  89.732  -5.674  1.00 44.83  ? 13   C   H OP1   1 
ATOM   731   O  OP2   . C   B  2  13   ? 41.451  90.192  -3.452  1.00 46.50  ? 13   C   H OP2   1 
ATOM   732   O  "O5'" . C   B  2  13   ? 42.476  90.881  -5.634  1.00 43.88  ? 13   C   H "O5'" 1 
ATOM   733   C  "C5'" . C   B  2  13   ? 42.370  91.612  -6.831  1.00 39.97  ? 13   C   H "C5'" 1 
ATOM   734   C  "C4'" . C   B  2  13   ? 43.708  91.895  -7.457  1.00 37.76  ? 13   C   H "C4'" 1 
ATOM   735   O  "O4'" . C   B  2  13   ? 44.393  92.988  -6.788  1.00 36.67  ? 13   C   H "O4'" 1 
ATOM   736   C  "C3'" . C   B  2  13   ? 44.696  90.755  -7.632  1.00 36.80  ? 13   C   H "C3'" 1 
ATOM   737   O  "O3'" . C   B  2  13   ? 44.941  90.246  -8.919  1.00 39.09  ? 13   C   H "O3'" 1 
ATOM   738   C  "C2'" . C   B  2  13   ? 45.971  91.178  -6.948  1.00 35.42  ? 13   C   H "C2'" 1 
ATOM   739   O  "O2'" . C   B  2  13   ? 47.045  91.247  -7.852  1.00 30.88  ? 13   C   H "O2'" 1 
ATOM   740   C  "C1'" . C   B  2  13   ? 45.697  92.585  -6.454  1.00 36.40  ? 13   C   H "C1'" 1 
ATOM   741   N  N1    . C   B  2  13   ? 45.921  92.486  -5.007  1.00 38.06  ? 13   C   H N1    1 
ATOM   742   C  C2    . C   B  2  13   ? 47.206  92.679  -4.576  1.00 36.69  ? 13   C   H C2    1 
ATOM   743   O  O2    . C   B  2  13   ? 48.033  93.033  -5.401  1.00 37.38  ? 13   C   H O2    1 
ATOM   744   N  N3    . C   B  2  13   ? 47.524  92.460  -3.298  1.00 35.39  ? 13   C   H N3    1 
ATOM   745   C  C4    . C   B  2  13   ? 46.594  92.082  -2.446  1.00 38.62  ? 13   C   H C4    1 
ATOM   746   N  N4    . C   B  2  13   ? 46.967  91.850  -1.201  1.00 41.06  ? 13   C   H N4    1 
ATOM   747   C  C5    . C   B  2  13   ? 45.240  91.922  -2.837  1.00 40.45  ? 13   C   H C5    1 
ATOM   748   C  C6    . C   B  2  13   ? 44.947  92.145  -4.122  1.00 39.44  ? 13   C   H C6    1 
ATOM   749   P  P     . G   B  2  14   ? 45.333  88.692  -9.065  1.00 41.24  ? 14   G   H P     1 
ATOM   750   O  OP1   . G   B  2  14   ? 45.305  88.312  -10.497 1.00 41.74  ? 14   G   H OP1   1 
ATOM   751   O  OP2   . G   B  2  14   ? 44.410  88.014  -8.147  1.00 40.89  ? 14   G   H OP2   1 
ATOM   752   O  "O5'" . G   B  2  14   ? 46.877  88.703  -8.699  1.00 38.19  ? 14   G   H "O5'" 1 
ATOM   753   C  "C5'" . G   B  2  14   ? 47.707  89.234  -9.704  1.00 38.77  ? 14   G   H "C5'" 1 
ATOM   754   C  "C4'" . G   B  2  14   ? 49.142  89.320  -9.324  1.00 38.72  ? 14   G   H "C4'" 1 
ATOM   755   O  "O4'" . G   B  2  14   ? 49.296  90.378  -8.339  1.00 40.65  ? 14   G   H "O4'" 1 
ATOM   756   C  "C3'" . G   B  2  14   ? 49.871  88.106  -8.802  1.00 39.47  ? 14   G   H "C3'" 1 
ATOM   757   O  "O3'" . G   B  2  14   ? 50.611  87.364  -9.741  1.00 37.33  ? 14   G   H "O3'" 1 
ATOM   758   C  "C2'" . G   B  2  14   ? 50.744  88.610  -7.658  1.00 40.04  ? 14   G   H "C2'" 1 
ATOM   759   O  "O2'" . G   B  2  14   ? 52.061  88.845  -8.099  1.00 40.52  ? 14   G   H "O2'" 1 
ATOM   760   C  "C1'" . G   B  2  14   ? 50.210  89.991  -7.337  1.00 41.29  ? 14   G   H "C1'" 1 
ATOM   761   N  N9    . G   B  2  14   ? 49.621  89.835  -6.006  1.00 42.37  ? 14   G   H N9    1 
ATOM   762   C  C8    . G   B  2  14   ? 48.324  89.628  -5.613  1.00 43.45  ? 14   G   H C8    1 
ATOM   763   N  N7    . G   B  2  14   ? 48.208  89.365  -4.329  1.00 43.66  ? 14   G   H N7    1 
ATOM   764   C  C5    . G   B  2  14   ? 49.507  89.428  -3.846  1.00 42.66  ? 14   G   H C5    1 
ATOM   765   C  C6    . G   B  2  14   ? 50.035  89.206  -2.529  1.00 41.46  ? 14   G   H C6    1 
ATOM   766   O  O6    . G   B  2  14   ? 49.442  88.891  -1.499  1.00 40.17  ? 14   G   H O6    1 
ATOM   767   N  N1    . G   B  2  14   ? 51.415  89.384  -2.500  1.00 41.61  ? 14   G   H N1    1 
ATOM   768   C  C2    . G   B  2  14   ? 52.188  89.719  -3.591  1.00 42.24  ? 14   G   H C2    1 
ATOM   769   N  N2    . G   B  2  14   ? 53.490  89.850  -3.386  1.00 42.60  ? 14   G   H N2    1 
ATOM   770   N  N3    . G   B  2  14   ? 51.718  89.914  -4.805  1.00 42.42  ? 14   G   H N3    1 
ATOM   771   C  C4    . G   B  2  14   ? 50.384  89.756  -4.862  1.00 43.31  ? 14   G   H C4    1 
ATOM   772   P  P     . C   B  2  15   ? 50.639  85.756  -9.596  1.00 37.89  ? 15   C   H P     1 
ATOM   773   O  OP1   . C   B  2  15   ? 50.692  85.223  -10.974 1.00 36.03  ? 15   C   H OP1   1 
ATOM   774   O  OP2   . C   B  2  15   ? 49.495  85.420  -8.726  1.00 35.46  ? 15   C   H OP2   1 
ATOM   775   O  "O5'" . C   B  2  15   ? 51.993  85.472  -8.792  1.00 34.92  ? 15   C   H "O5'" 1 
ATOM   776   C  "C5'" . C   B  2  15   ? 53.006  86.456  -8.871  1.00 34.06  ? 15   C   H "C5'" 1 
ATOM   777   C  "C4'" . C   B  2  15   ? 54.247  86.109  -8.114  1.00 33.21  ? 15   C   H "C4'" 1 
ATOM   778   O  "O4'" . C   B  2  15   ? 54.333  86.845  -6.874  1.00 35.05  ? 15   C   H "O4'" 1 
ATOM   779   C  "C3'" . C   B  2  15   ? 54.620  84.678  -7.839  1.00 35.54  ? 15   C   H "C3'" 1 
ATOM   780   O  "O3'" . C   B  2  15   ? 55.700  84.212  -8.570  1.00 34.49  ? 15   C   H "O3'" 1 
ATOM   781   C  "C2'" . C   B  2  15   ? 54.862  84.553  -6.347  1.00 36.51  ? 15   C   H "C2'" 1 
ATOM   782   O  "O2'" . C   B  2  15   ? 56.238  84.325  -6.117  1.00 36.69  ? 15   C   H "O2'" 1 
ATOM   783   C  "C1'" . C   B  2  15   ? 54.573  85.942  -5.811  1.00 37.98  ? 15   C   H "C1'" 1 
ATOM   784   N  N1    . C   B  2  15   ? 53.430  85.825  -4.888  1.00 41.80  ? 15   C   H N1    1 
ATOM   785   C  C2    . C   B  2  15   ? 53.719  85.719  -3.509  1.00 43.88  ? 15   C   H C2    1 
ATOM   786   O  O2    . C   B  2  15   ? 54.905  85.754  -3.140  1.00 44.66  ? 15   C   H O2    1 
ATOM   787   N  N3    . C   B  2  15   ? 52.706  85.566  -2.621  1.00 44.76  ? 15   C   H N3    1 
ATOM   788   C  C4    . C   B  2  15   ? 51.443  85.523  -3.051  1.00 45.22  ? 15   C   H C4    1 
ATOM   789   N  N4    . C   B  2  15   ? 50.478  85.369  -2.133  1.00 43.48  ? 15   C   H N4    1 
ATOM   790   C  C5    . C   B  2  15   ? 51.114  85.638  -4.443  1.00 44.59  ? 15   C   H C5    1 
ATOM   791   C  C6    . C   B  2  15   ? 52.134  85.791  -5.321  1.00 43.09  ? 15   C   H C6    1 
ATOM   792   P  P     . G   B  2  16   ? 55.540  82.813  -9.309  1.00 36.90  ? 16   G   H P     1 
ATOM   793   O  OP1   . G   B  2  16   ? 56.607  82.748  -10.346 1.00 33.60  ? 16   G   H OP1   1 
ATOM   794   O  OP2   . G   B  2  16   ? 54.108  82.717  -9.697  1.00 36.90  ? 16   G   H OP2   1 
ATOM   795   O  "O5'" . G   B  2  16   ? 55.820  81.779  -8.148  1.00 32.95  ? 16   G   H "O5'" 1 
ATOM   796   C  "C5'" . G   B  2  16   ? 57.091  81.805  -7.622  1.00 33.61  ? 16   G   H "C5'" 1 
ATOM   797   C  "C4'" . G   B  2  16   ? 57.238  80.954  -6.420  1.00 33.66  ? 16   G   H "C4'" 1 
ATOM   798   O  "O4'" . G   B  2  16   ? 56.608  81.752  -5.377  1.00 33.91  ? 16   G   H "O4'" 1 
ATOM   799   C  "C3'" . G   B  2  16   ? 56.522  79.626  -6.390  1.00 35.26  ? 16   G   H "C3'" 1 
ATOM   800   O  "O3'" . G   B  2  16   ? 57.070  78.518  -7.066  1.00 34.57  ? 16   G   H "O3'" 1 
ATOM   801   C  "C2'" . G   B  2  16   ? 55.966  79.494  -4.975  1.00 36.61  ? 16   G   H "C2'" 1 
ATOM   802   O  "O2'" . G   B  2  16   ? 56.905  78.751  -4.214  1.00 39.64  ? 16   G   H "O2'" 1 
ATOM   803   C  "C1'" . G   B  2  16   ? 56.015  80.910  -4.416  1.00 35.46  ? 16   G   H "C1'" 1 
ATOM   804   N  N9    . G   B  2  16   ? 54.643  81.306  -4.098  1.00 36.40  ? 16   G   H N9    1 
ATOM   805   C  C8    . G   B  2  16   ? 53.597  81.611  -4.941  1.00 37.72  ? 16   G   H C8    1 
ATOM   806   N  N7    . G   B  2  16   ? 52.458  81.765  -4.303  1.00 37.83  ? 16   G   H N7    1 
ATOM   807   C  C5    . G   B  2  16   ? 52.783  81.585  -2.961  1.00 35.93  ? 16   G   H C5    1 
ATOM   808   C  C6    . G   B  2  16   ? 51.972  81.621  -1.781  1.00 35.04  ? 16   G   H C6    1 
ATOM   809   O  O6    . G   B  2  16   ? 50.768  81.817  -1.674  1.00 35.72  ? 16   G   H O6    1 
ATOM   810   N  N1    . G   B  2  16   ? 52.721  81.394  -0.634  1.00 35.06  ? 16   G   H N1    1 
ATOM   811   C  C2    . G   B  2  16   ? 54.065  81.160  -0.621  1.00 36.35  ? 16   G   H C2    1 
ATOM   812   N  N2    . G   B  2  16   ? 54.619  80.973  0.564   1.00 37.38  ? 16   G   H N2    1 
ATOM   813   N  N3    . G   B  2  16   ? 54.824  81.114  -1.695  1.00 36.06  ? 16   G   H N3    1 
ATOM   814   C  C4    . G   B  2  16   ? 54.127  81.334  -2.819  1.00 36.12  ? 16   G   H C4    1 
ATOM   815   P  P     . DA  C  3  2    ? 24.003  81.403  2.041   1.00 61.26  ? 3    DA  I P     1 
ATOM   816   O  OP1   . DA  C  3  2    ? 23.760  82.273  3.260   1.00 58.20  ? 3    DA  I OP1   1 
ATOM   817   O  OP2   . DA  C  3  2    ? 23.709  82.145  0.752   1.00 58.74  ? 3    DA  I OP2   1 
ATOM   818   O  "O5'" . DA  C  3  2    ? 25.593  81.046  2.031   1.00 57.55  ? 3    DA  I "O5'" 1 
ATOM   819   C  "C5'" . DA  C  3  2    ? 26.200  80.378  3.151   1.00 55.57  ? 3    DA  I "C5'" 1 
ATOM   820   C  "C4'" . DA  C  3  2    ? 27.500  79.752  2.725   1.00 55.03  ? 3    DA  I "C4'" 1 
ATOM   821   O  "O4'" . DA  C  3  2    ? 28.580  80.274  3.516   1.00 55.49  ? 3    DA  I "O4'" 1 
ATOM   822   C  "C3'" . DA  C  3  2    ? 27.600  78.240  2.837   1.00 55.35  ? 3    DA  I "C3'" 1 
ATOM   823   O  "O3'" . DA  C  3  2    ? 28.303  77.766  1.690   1.00 56.03  ? 3    DA  I "O3'" 1 
ATOM   824   C  "C2'" . DA  C  3  2    ? 28.408  78.036  4.108   1.00 54.59  ? 3    DA  I "C2'" 1 
ATOM   825   C  "C1'" . DA  C  3  2    ? 29.351  79.204  4.032   1.00 55.76  ? 3    DA  I "C1'" 1 
ATOM   826   N  N9    . DA  C  3  2    ? 29.951  79.677  5.274   1.00 56.53  ? 3    DA  I N9    1 
ATOM   827   C  C8    . DA  C  3  2    ? 29.407  80.614  6.115   1.00 57.06  ? 3    DA  I C8    1 
ATOM   828   N  N7    . DA  C  3  2    ? 30.214  80.998  7.069   1.00 57.17  ? 3    DA  I N7    1 
ATOM   829   C  C5    . DA  C  3  2    ? 31.354  80.229  6.870   1.00 57.66  ? 3    DA  I C5    1 
ATOM   830   C  C6    . DA  C  3  2    ? 32.579  80.185  7.552   1.00 58.29  ? 3    DA  I C6    1 
ATOM   831   N  N6    . DA  C  3  2    ? 32.821  80.971  8.579   1.00 57.81  ? 3    DA  I N6    1 
ATOM   832   N  N1    . DA  C  3  2    ? 33.537  79.311  7.130   1.00 58.53  ? 3    DA  I N1    1 
ATOM   833   C  C2    . DA  C  3  2    ? 33.238  78.545  6.060   1.00 58.71  ? 3    DA  I C2    1 
ATOM   834   N  N3    . DA  C  3  2    ? 32.107  78.505  5.322   1.00 57.20  ? 3    DA  I N3    1 
ATOM   835   C  C4    . DA  C  3  2    ? 31.197  79.386  5.788   1.00 57.11  ? 3    DA  I C4    1 
ATOM   836   P  P     . DC  C  3  3    ? 28.189  76.227  1.279   1.00 57.44  ? 4    DC  I P     1 
ATOM   837   O  OP1   . DC  C  3  3    ? 28.707  76.010  -0.097  1.00 55.24  ? 4    DC  I OP1   1 
ATOM   838   O  OP2   . DC  C  3  3    ? 26.815  75.757  1.642   1.00 57.64  ? 4    DC  I OP2   1 
ATOM   839   O  "O5'" . DC  C  3  3    ? 29.186  75.544  2.293   1.00 55.52  ? 4    DC  I "O5'" 1 
ATOM   840   C  "C5'" . DC  C  3  3    ? 28.709  74.730  3.341   1.00 52.82  ? 4    DC  I "C5'" 1 
ATOM   841   C  "C4'" . DC  C  3  3    ? 29.888  74.101  4.024   1.00 51.69  ? 4    DC  I "C4'" 1 
ATOM   842   O  "O4'" . DC  C  3  3    ? 30.556  75.092  4.846   1.00 50.05  ? 4    DC  I "O4'" 1 
ATOM   843   C  "C3'" . DC  C  3  3    ? 29.555  72.923  4.917   1.00 51.55  ? 4    DC  I "C3'" 1 
ATOM   844   O  "O3'" . DC  C  3  3    ? 30.348  71.828  4.471   1.00 53.85  ? 4    DC  I "O3'" 1 
ATOM   845   C  "C2'" . DC  C  3  3    ? 29.870  73.419  6.322   1.00 48.85  ? 4    DC  I "C2'" 1 
ATOM   846   C  "C1'" . DC  C  3  3    ? 30.849  74.567  6.117   1.00 47.32  ? 4    DC  I "C1'" 1 
ATOM   847   N  N1    . DC  C  3  3    ? 30.710  75.660  7.103   1.00 44.94  ? 4    DC  I N1    1 
ATOM   848   C  C2    . DC  C  3  3    ? 31.774  75.936  7.961   1.00 44.67  ? 4    DC  I C2    1 
ATOM   849   O  O2    . DC  C  3  3    ? 32.831  75.318  7.815   1.00 44.78  ? 4    DC  I O2    1 
ATOM   850   N  N3    . DC  C  3  3    ? 31.623  76.871  8.927   1.00 42.00  ? 4    DC  I N3    1 
ATOM   851   C  C4    . DC  C  3  3    ? 30.474  77.527  9.046   1.00 41.46  ? 4    DC  I C4    1 
ATOM   852   N  N4    . DC  C  3  3    ? 30.367  78.416  10.026  1.00 38.58  ? 4    DC  I N4    1 
ATOM   853   C  C5    . DC  C  3  3    ? 29.386  77.298  8.164   1.00 42.89  ? 4    DC  I C5    1 
ATOM   854   C  C6    . DC  C  3  3    ? 29.548  76.368  7.208   1.00 44.31  ? 4    DC  I C6    1 
ATOM   855   P  P     . DG  C  3  4    ? 30.320  70.449  5.273   1.00 56.30  ? 5    DG  I P     1 
ATOM   856   O  OP1   . DG  C  3  4    ? 31.036  69.394  4.500   1.00 53.03  ? 5    DG  I OP1   1 
ATOM   857   O  OP2   . DG  C  3  4    ? 28.929  70.221  5.715   1.00 53.55  ? 5    DG  I OP2   1 
ATOM   858   O  "O5'" . DG  C  3  4    ? 31.218  70.832  6.516   1.00 56.81  ? 5    DG  I "O5'" 1 
ATOM   859   C  "C5'" . DG  C  3  4    ? 32.595  71.128  6.323   1.00 62.74  ? 5    DG  I "C5'" 1 
ATOM   860   C  "C4'" . DG  C  3  4    ? 33.365  70.676  7.532   1.00 65.46  ? 5    DG  I "C4'" 1 
ATOM   861   O  "O4'" . DG  C  3  4    ? 33.237  71.717  8.524   1.00 66.30  ? 5    DG  I "O4'" 1 
ATOM   862   C  "C3'" . DG  C  3  4    ? 32.755  69.408  8.136   1.00 67.85  ? 5    DG  I "C3'" 1 
ATOM   863   O  "O3'" . DG  C  3  4    ? 33.779  68.495  8.572   1.00 70.35  ? 5    DG  I "O3'" 1 
ATOM   864   C  "C2'" . DG  C  3  4    ? 31.850  69.940  9.238   1.00 66.84  ? 5    DG  I "C2'" 1 
ATOM   865   C  "C1'" . DG  C  3  4    ? 32.547  71.225  9.656   1.00 67.03  ? 5    DG  I "C1'" 1 
ATOM   866   N  N9    . DG  C  3  4    ? 31.687  72.294  10.166  1.00 67.31  ? 5    DG  I N9    1 
ATOM   867   C  C8    . DG  C  3  4    ? 30.371  72.564  9.850   1.00 66.99  ? 5    DG  I C8    1 
ATOM   868   N  N7    . DG  C  3  4    ? 29.878  73.558  10.539  1.00 66.12  ? 5    DG  I N7    1 
ATOM   869   C  C5    . DG  C  3  4    ? 30.936  73.982  11.339  1.00 65.70  ? 5    DG  I C5    1 
ATOM   870   C  C6    . DG  C  3  4    ? 31.004  75.007  12.305  1.00 65.18  ? 5    DG  I C6    1 
ATOM   871   O  O6    . DG  C  3  4    ? 30.116  75.773  12.657  1.00 66.43  ? 5    DG  I O6    1 
ATOM   872   N  N1    . DG  C  3  4    ? 32.266  75.087  12.889  1.00 65.20  ? 5    DG  I N1    1 
ATOM   873   C  C2    . DG  C  3  4    ? 33.324  74.276  12.579  1.00 65.29  ? 5    DG  I C2    1 
ATOM   874   N  N2    . DG  C  3  4    ? 34.469  74.498  13.230  1.00 65.50  ? 5    DG  I N2    1 
ATOM   875   N  N3    . DG  C  3  4    ? 33.271  73.313  11.693  1.00 65.77  ? 5    DG  I N3    1 
ATOM   876   C  C4    . DG  C  3  4    ? 32.056  73.221  11.114  1.00 66.22  ? 5    DG  I C4    1 
ATOM   877   P  P     . DC  C  3  5    ? 33.415  67.256  9.541   1.00 72.37  ? 6    DC  I P     1 
ATOM   878   O  OP1   . DC  C  3  5    ? 34.525  66.260  9.449   1.00 70.07  ? 6    DC  I OP1   1 
ATOM   879   O  OP2   . DC  C  3  5    ? 31.995  66.792  9.369   1.00 71.03  ? 6    DC  I OP2   1 
ATOM   880   O  "O5'" . DC  C  3  5    ? 33.488  67.956  10.969  1.00 71.51  ? 6    DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  C  3  5    ? 34.633  68.728  11.346  1.00 69.21  ? 6    DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  C  3  5    ? 34.691  68.879  12.850  1.00 66.76  ? 6    DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  C  3  5    ? 34.031  70.101  13.270  1.00 66.43  ? 6    DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  C  3  5    ? 34.016  67.730  13.597  1.00 65.82  ? 6    DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  C  3  5    ? 34.855  67.200  14.614  1.00 65.05  ? 6    DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  C  3  5    ? 32.756  68.350  14.168  1.00 64.34  ? 6    DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  C  3  5    ? 33.078  69.831  14.278  1.00 63.83  ? 6    DC  I "C1'" 1 
ATOM   888   N  N1    . DC  C  3  5    ? 31.903  70.701  14.052  1.00 62.07  ? 6    DC  I N1    1 
ATOM   889   C  C2    . DC  C  3  5    ? 31.708  71.791  14.894  1.00 60.38  ? 6    DC  I C2    1 
ATOM   890   O  O2    . DC  C  3  5    ? 32.549  72.026  15.767  1.00 59.67  ? 6    DC  I O2    1 
ATOM   891   N  N3    . DC  C  3  5    ? 30.607  72.554  14.740  1.00 60.26  ? 6    DC  I N3    1 
ATOM   892   C  C4    . DC  C  3  5    ? 29.721  72.266  13.791  1.00 60.86  ? 6    DC  I C4    1 
ATOM   893   N  N4    . DC  C  3  5    ? 28.647  73.041  13.686  1.00 61.23  ? 6    DC  I N4    1 
ATOM   894   C  C5    . DC  C  3  5    ? 29.902  71.171  12.899  1.00 61.35  ? 6    DC  I C5    1 
ATOM   895   C  C6    . DC  C  3  5    ? 31.001  70.429  13.057  1.00 61.59  ? 6    DC  I C6    1 
ATOM   896   P  P     . DC  C  3  6    ? 34.263  66.136  15.653  1.00 65.21  ? 7    DC  I P     1 
ATOM   897   O  OP1   . DC  C  3  6    ? 35.309  65.130  15.913  1.00 64.66  ? 7    DC  I OP1   1 
ATOM   898   O  OP2   . DC  C  3  6    ? 32.923  65.706  15.228  1.00 64.17  ? 7    DC  I OP2   1 
ATOM   899   O  "O5'" . DC  C  3  6    ? 34.106  67.032  16.940  1.00 65.94  ? 7    DC  I "O5'" 1 
ATOM   900   C  "C5'" . DC  C  3  6    ? 35.149  67.945  17.264  1.00 69.82  ? 7    DC  I "C5'" 1 
ATOM   901   C  "C4'" . DC  C  3  6    ? 34.753  68.789  18.446  1.00 72.31  ? 7    DC  I "C4'" 1 
ATOM   902   O  "O4'" . DC  C  3  6    ? 33.724  69.720  18.031  1.00 73.63  ? 7    DC  I "O4'" 1 
ATOM   903   C  "C3'" . DC  C  3  6    ? 34.167  67.970  19.595  1.00 74.09  ? 7    DC  I "C3'" 1 
ATOM   904   O  "O3'" . DC  C  3  6    ? 34.655  68.453  20.849  1.00 75.14  ? 7    DC  I "O3'" 1 
ATOM   905   C  "C2'" . DC  C  3  6    ? 32.671  68.174  19.443  1.00 73.89  ? 7    DC  I "C2'" 1 
ATOM   906   C  "C1'" . DC  C  3  6    ? 32.580  69.574  18.849  1.00 74.66  ? 7    DC  I "C1'" 1 
ATOM   907   N  N1    . DC  C  3  6    ? 31.387  69.819  18.017  1.00 75.73  ? 7    DC  I N1    1 
ATOM   908   C  C2    . DC  C  3  6    ? 30.564  70.929  18.304  1.00 76.24  ? 7    DC  I C2    1 
ATOM   909   O  O2    . DC  C  3  6    ? 30.874  71.696  19.224  1.00 75.52  ? 7    DC  I O2    1 
ATOM   910   N  N3    . DC  C  3  6    ? 29.453  71.130  17.567  1.00 76.76  ? 7    DC  I N3    1 
ATOM   911   C  C4    . DC  C  3  6    ? 29.146  70.293  16.578  1.00 77.09  ? 7    DC  I C4    1 
ATOM   912   N  N4    . DC  C  3  6    ? 28.033  70.540  15.889  1.00 78.06  ? 7    DC  I N4    1 
ATOM   913   C  C5    . DC  C  3  6    ? 29.967  69.169  16.254  1.00 76.72  ? 7    DC  I C5    1 
ATOM   914   C  C6    . DC  C  3  6    ? 31.069  68.975  16.990  1.00 76.01  ? 7    DC  I C6    1 
ATOM   915   P  P     . DA  C  3  7    ? 34.180  67.751  22.220  1.00 76.74  ? 8    DA  I P     1 
ATOM   916   O  OP1   . DA  C  3  7    ? 35.242  67.953  23.226  1.00 77.01  ? 8    DA  I OP1   1 
ATOM   917   O  OP2   . DA  C  3  7    ? 33.657  66.384  21.961  1.00 76.47  ? 8    DA  I OP2   1 
ATOM   918   O  "O5'" . DA  C  3  7    ? 32.974  68.655  22.685  1.00 75.09  ? 8    DA  I "O5'" 1 
ATOM   919   C  "C5'" . DA  C  3  7    ? 33.197  70.015  22.990  1.00 74.01  ? 8    DA  I "C5'" 1 
ATOM   920   C  "C4'" . DA  C  3  7    ? 31.978  70.578  23.668  1.00 73.82  ? 8    DA  I "C4'" 1 
ATOM   921   O  "O4'" . DA  C  3  7    ? 30.927  70.814  22.706  1.00 72.62  ? 8    DA  I "O4'" 1 
ATOM   922   C  "C3'" . DA  C  3  7    ? 31.400  69.612  24.693  1.00 75.04  ? 8    DA  I "C3'" 1 
ATOM   923   O  "O3'" . DA  C  3  7    ? 31.015  70.380  25.843  1.00 79.19  ? 8    DA  I "O3'" 1 
ATOM   924   C  "C2'" . DA  C  3  7    ? 30.265  68.940  23.937  1.00 72.67  ? 8    DA  I "C2'" 1 
ATOM   925   C  "C1'" . DA  C  3  7    ? 29.781  70.045  23.026  1.00 72.04  ? 8    DA  I "C1'" 1 
ATOM   926   N  N9    . DA  C  3  7    ? 29.177  69.608  21.770  1.00 72.22  ? 8    DA  I N9    1 
ATOM   927   C  C8    . DA  C  3  7    ? 29.599  68.626  20.905  1.00 72.72  ? 8    DA  I C8    1 
ATOM   928   N  N7    . DA  C  3  7    ? 28.871  68.528  19.819  1.00 72.63  ? 8    DA  I N7    1 
ATOM   929   C  C5    . DA  C  3  7    ? 27.892  69.499  19.987  1.00 73.05  ? 8    DA  I C5    1 
ATOM   930   C  C6    . DA  C  3  7    ? 26.810  69.910  19.185  1.00 73.23  ? 8    DA  I C6    1 
ATOM   931   N  N6    . DA  C  3  7    ? 26.507  69.382  18.000  1.00 73.01  ? 8    DA  I N6    1 
ATOM   932   N  N1    . DA  C  3  7    ? 26.038  70.905  19.650  1.00 73.05  ? 8    DA  I N1    1 
ATOM   933   C  C2    . DA  C  3  7    ? 26.323  71.450  20.831  1.00 72.99  ? 8    DA  I C2    1 
ATOM   934   N  N3    . DA  C  3  7    ? 27.301  71.153  21.679  1.00 73.24  ? 8    DA  I N3    1 
ATOM   935   C  C4    . DA  C  3  7    ? 28.062  70.160  21.192  1.00 72.73  ? 8    DA  I C4    1 
ATOM   936   P  P     . DG  C  3  8    ? 29.739  69.955  26.725  1.00 80.86  ? 9    DG  I P     1 
ATOM   937   O  OP1   . DG  C  3  8    ? 29.788  70.703  28.014  1.00 80.72  ? 9    DG  I OP1   1 
ATOM   938   O  OP2   . DG  C  3  8    ? 29.646  68.477  26.743  1.00 81.43  ? 9    DG  I OP2   1 
ATOM   939   O  "O5'" . DG  C  3  8    ? 28.540  70.520  25.854  1.00 79.03  ? 9    DG  I "O5'" 1 
ATOM   940   C  "C5'" . DG  C  3  8    ? 28.522  71.888  25.467  1.00 75.65  ? 9    DG  I "C5'" 1 
ATOM   941   C  "C4'" . DG  C  3  8    ? 27.137  72.442  25.663  1.00 73.81  ? 9    DG  I "C4'" 1 
ATOM   942   O  "O4'" . DG  C  3  8    ? 26.277  72.048  24.570  1.00 73.30  ? 9    DG  I "O4'" 1 
ATOM   943   C  "C3'" . DG  C  3  8    ? 26.497  71.889  26.927  1.00 73.53  ? 9    DG  I "C3'" 1 
ATOM   944   O  "O3'" . DG  C  3  8    ? 25.702  72.905  27.522  1.00 72.32  ? 9    DG  I "O3'" 1 
ATOM   945   C  "C2'" . DG  C  3  8    ? 25.671  70.717  26.415  1.00 72.93  ? 9    DG  I "C2'" 1 
ATOM   946   C  "C1'" . DG  C  3  8    ? 25.265  71.159  25.019  1.00 72.34  ? 9    DG  I "C1'" 1 
ATOM   947   N  N9    . DG  C  3  8    ? 25.157  70.108  24.014  1.00 71.12  ? 9    DG  I N9    1 
ATOM   948   C  C8    . DG  C  3  8    ? 25.956  69.005  23.846  1.00 70.25  ? 9    DG  I C8    1 
ATOM   949   N  N7    . DG  C  3  8    ? 25.659  68.321  22.779  1.00 69.98  ? 9    DG  I N7    1 
ATOM   950   C  C5    . DG  C  3  8    ? 24.584  69.001  22.232  1.00 70.47  ? 9    DG  I C5    1 
ATOM   951   C  C6    . DG  C  3  8    ? 23.837  68.744  21.063  1.00 71.73  ? 9    DG  I C6    1 
ATOM   952   O  O6    . DG  C  3  8    ? 23.979  67.829  20.245  1.00 73.02  ? 9    DG  I O6    1 
ATOM   953   N  N1    . DG  C  3  8    ? 22.834  69.690  20.882  1.00 72.50  ? 9    DG  I N1    1 
ATOM   954   C  C2    . DG  C  3  8    ? 22.591  70.744  21.725  1.00 72.30  ? 9    DG  I C2    1 
ATOM   955   N  N2    . DG  C  3  8    ? 21.579  71.553  21.406  1.00 73.06  ? 9    DG  I N2    1 
ATOM   956   N  N3    . DG  C  3  8    ? 23.284  70.991  22.809  1.00 71.45  ? 9    DG  I N3    1 
ATOM   957   C  C4    . DG  C  3  8    ? 24.256  70.089  22.998  1.00 70.64  ? 9    DG  I C4    1 
ATOM   958   P  P     . DA  C  3  9    ? 25.426  72.890  29.102  1.00 71.16  ? 10   DA  I P     1 
ATOM   959   O  OP1   . DA  C  3  9    ? 26.371  73.826  29.763  1.00 69.80  ? 10   DA  I OP1   1 
ATOM   960   O  OP2   . DA  C  3  9    ? 25.365  71.475  29.547  1.00 69.64  ? 10   DA  I OP2   1 
ATOM   961   O  "O5'" . DA  C  3  9    ? 23.962  73.513  29.133  1.00 70.17  ? 10   DA  I "O5'" 1 
ATOM   962   C  "C5'" . DA  C  3  9    ? 23.507  74.338  28.049  1.00 68.09  ? 10   DA  I "C5'" 1 
ATOM   963   C  "C4'" . DA  C  3  9    ? 22.126  73.921  27.595  1.00 66.25  ? 10   DA  I "C4'" 1 
ATOM   964   O  "O4'" . DA  C  3  9    ? 22.149  72.884  26.583  1.00 64.40  ? 10   DA  I "O4'" 1 
ATOM   965   C  "C3'" . DA  C  3  9    ? 21.198  73.421  28.698  1.00 66.90  ? 10   DA  I "C3'" 1 
ATOM   966   O  "O3'" . DA  C  3  9    ? 19.932  74.057  28.549  1.00 69.82  ? 10   DA  I "O3'" 1 
ATOM   967   C  "C2'" . DA  C  3  9    ? 21.075  71.934  28.407  1.00 64.88  ? 10   DA  I "C2'" 1 
ATOM   968   C  "C1'" . DA  C  3  9    ? 21.151  71.925  26.893  1.00 64.42  ? 10   DA  I "C1'" 1 
ATOM   969   N  N9    . DA  C  3  9    ? 21.545  70.651  26.290  1.00 63.72  ? 10   DA  I N9    1 
ATOM   970   C  C8    . DA  C  3  9    ? 22.528  69.806  26.741  1.00 62.80  ? 10   DA  I C8    1 
ATOM   971   N  N7    . DA  C  3  9    ? 22.716  68.760  25.979  1.00 61.94  ? 10   DA  I N7    1 
ATOM   972   C  C5    . DA  C  3  9    ? 21.781  68.914  24.966  1.00 62.01  ? 10   DA  I C5    1 
ATOM   973   C  C6    . DA  C  3  9    ? 21.488  68.128  23.857  1.00 61.96  ? 10   DA  I C6    1 
ATOM   974   N  N6    . DA  C  3  9    ? 22.153  67.015  23.603  1.00 62.24  ? 10   DA  I N6    1 
ATOM   975   N  N1    . DA  C  3  9    ? 20.494  68.525  23.023  1.00 60.91  ? 10   DA  I N1    1 
ATOM   976   C  C2    . DA  C  3  9    ? 19.847  69.662  23.325  1.00 61.21  ? 10   DA  I C2    1 
ATOM   977   N  N3    . DA  C  3  9    ? 20.041  70.500  24.352  1.00 61.44  ? 10   DA  I N3    1 
ATOM   978   C  C4    . DA  C  3  9    ? 21.040  70.064  25.146  1.00 62.45  ? 10   DA  I C4    1 
ATOM   979   P  P     . DC  C  3  10   ? 18.782  73.831  29.651  1.00 73.31  ? 11   DC  I P     1 
ATOM   980   O  OP1   . DC  C  3  10   ? 18.358  75.159  30.168  1.00 72.95  ? 11   DC  I OP1   1 
ATOM   981   O  OP2   . DC  C  3  10   ? 19.233  72.781  30.611  1.00 73.39  ? 11   DC  I OP2   1 
ATOM   982   O  "O5'" . DC  C  3  10   ? 17.583  73.258  28.773  1.00 72.92  ? 11   DC  I "O5'" 1 
ATOM   983   C  "C5'" . DC  C  3  10   ? 17.216  73.916  27.569  1.00 70.81  ? 11   DC  I "C5'" 1 
ATOM   984   C  "C4'" . DC  C  3  10   ? 16.232  73.080  26.793  1.00 70.91  ? 11   DC  I "C4'" 1 
ATOM   985   O  "O4'" . DC  C  3  10   ? 16.878  71.951  26.154  1.00 69.63  ? 11   DC  I "O4'" 1 
ATOM   986   C  "C3'" . DC  C  3  10   ? 15.088  72.517  27.626  1.00 73.03  ? 11   DC  I "C3'" 1 
ATOM   987   O  "O3'" . DC  C  3  10   ? 13.878  72.763  26.897  1.00 79.27  ? 11   DC  I "O3'" 1 
ATOM   988   C  "C2'" . DC  C  3  10   ? 15.449  71.044  27.776  1.00 69.65  ? 11   DC  I "C2'" 1 
ATOM   989   C  "C1'" . DC  C  3  10   ? 16.219  70.742  26.494  1.00 67.34  ? 11   DC  I "C1'" 1 
ATOM   990   N  N1    . DC  C  3  10   ? 17.252  69.687  26.596  1.00 64.09  ? 11   DC  I N1    1 
ATOM   991   C  C2    . DC  C  3  10   ? 17.273  68.652  25.646  1.00 61.20  ? 11   DC  I C2    1 
ATOM   992   O  O2    . DC  C  3  10   ? 16.429  68.636  24.745  1.00 58.66  ? 11   DC  I O2    1 
ATOM   993   N  N3    . DC  C  3  10   ? 18.216  67.695  25.737  1.00 60.73  ? 11   DC  I N3    1 
ATOM   994   C  C4    . DC  C  3  10   ? 19.116  67.735  26.719  1.00 61.47  ? 11   DC  I C4    1 
ATOM   995   N  N4    . DC  C  3  10   ? 20.027  66.769  26.763  1.00 61.67  ? 11   DC  I N4    1 
ATOM   996   C  C5    . DC  C  3  10   ? 19.121  68.771  27.696  1.00 61.33  ? 11   DC  I C5    1 
ATOM   997   C  C6    . DC  C  3  10   ? 18.184  69.716  27.600  1.00 62.45  ? 11   DC  I C6    1 
ATOM   998   P  P     . DA  C  3  11   ? 12.530  71.966  27.256  1.00 84.32  ? 12   DA  I P     1 
ATOM   999   O  OP1   . DA  C  3  11   ? 11.360  72.846  26.952  1.00 83.91  ? 12   DA  I OP1   1 
ATOM   1000  O  OP2   . DA  C  3  11   ? 12.660  71.335  28.607  1.00 83.81  ? 12   DA  I OP2   1 
ATOM   1001  O  "O5'" . DA  C  3  11   ? 12.522  70.822  26.165  1.00 82.89  ? 12   DA  I "O5'" 1 
ATOM   1002  C  "C5'" . DA  C  3  11   ? 12.326  71.146  24.804  1.00 83.28  ? 12   DA  I "C5'" 1 
ATOM   1003  C  "C4'" . DA  C  3  11   ? 11.676  69.982  24.106  1.00 83.39  ? 12   DA  I "C4'" 1 
ATOM   1004  O  "O4'" . DA  C  3  11   ? 12.579  68.859  24.186  1.00 83.94  ? 12   DA  I "O4'" 1 
ATOM   1005  C  "C3'" . DA  C  3  11   ? 10.384  69.521  24.771  1.00 84.24  ? 12   DA  I "C3'" 1 
ATOM   1006  O  "O3'" . DA  C  3  11   ? 9.535   68.966  23.763  1.00 84.36  ? 12   DA  I "O3'" 1 
ATOM   1007  C  "C2'" . DA  C  3  11   ? 10.861  68.468  25.756  1.00 84.15  ? 12   DA  I "C2'" 1 
ATOM   1008  C  "C1'" . DA  C  3  11   ? 12.046  67.852  25.032  1.00 84.43  ? 12   DA  I "C1'" 1 
ATOM   1009  N  N9    . DA  C  3  11   ? 13.132  67.384  25.893  1.00 85.17  ? 12   DA  I N9    1 
ATOM   1010  C  C8    . DA  C  3  11   ? 13.650  67.959  27.034  1.00 84.67  ? 12   DA  I C8    1 
ATOM   1011  N  N7    . DA  C  3  11   ? 14.648  67.288  27.552  1.00 84.66  ? 12   DA  I N7    1 
ATOM   1012  C  C5    . DA  C  3  11   ? 14.795  66.196  26.700  1.00 85.56  ? 12   DA  I C5    1 
ATOM   1013  C  C6    . DA  C  3  11   ? 15.684  65.112  26.700  1.00 86.43  ? 12   DA  I C6    1 
ATOM   1014  N  N6    . DA  C  3  11   ? 16.625  64.954  27.623  1.00 88.17  ? 12   DA  I N6    1 
ATOM   1015  N  N1    . DA  C  3  11   ? 15.571  64.191  25.713  1.00 85.84  ? 12   DA  I N1    1 
ATOM   1016  C  C2    . DA  C  3  11   ? 14.621  64.364  24.791  1.00 85.63  ? 12   DA  I C2    1 
ATOM   1017  N  N3    . DA  C  3  11   ? 13.722  65.345  24.679  1.00 85.60  ? 12   DA  I N3    1 
ATOM   1018  C  C4    . DA  C  3  11   ? 13.867  66.241  25.680  1.00 85.36  ? 12   DA  I C4    1 
ATOM   1019  P  P     . DG  C  3  12   ? 8.064   68.443  24.142  1.00 84.98  ? 13   DG  I P     1 
ATOM   1020  O  OP1   . DG  C  3  12   ? 7.095   69.203  23.305  1.00 85.99  ? 13   DG  I OP1   1 
ATOM   1021  O  OP2   . DG  C  3  12   ? 7.907   68.445  25.621  1.00 85.13  ? 13   DG  I OP2   1 
ATOM   1022  O  "O5'" . DG  C  3  12   ? 8.094   66.934  23.636  1.00 82.51  ? 13   DG  I "O5'" 1 
ATOM   1023  C  "C5'" . DG  C  3  12   ? 8.643   66.624  22.358  1.00 78.57  ? 13   DG  I "C5'" 1 
ATOM   1024  C  "C4'" . DG  C  3  12   ? 8.989   65.155  22.257  1.00 76.67  ? 13   DG  I "C4'" 1 
ATOM   1025  O  "O4'" . DG  C  3  12   ? 10.120  64.816  23.098  1.00 75.29  ? 13   DG  I "O4'" 1 
ATOM   1026  C  "C3'" . DG  C  3  12   ? 7.881   64.159  22.620  1.00 76.71  ? 13   DG  I "C3'" 1 
ATOM   1027  O  "O3'" . DG  C  3  12   ? 7.900   63.072  21.664  1.00 76.90  ? 13   DG  I "O3'" 1 
ATOM   1028  C  "C2'" . DG  C  3  12   ? 8.289   63.683  24.008  1.00 74.90  ? 13   DG  I "C2'" 1 
ATOM   1029  C  "C1'" . DG  C  3  12   ? 9.804   63.673  23.890  1.00 73.45  ? 13   DG  I "C1'" 1 
ATOM   1030  N  N9    . DG  C  3  12   ? 10.518  63.808  25.152  1.00 70.64  ? 13   DG  I N9    1 
ATOM   1031  C  C8    . DG  C  3  12   ? 10.356  64.835  26.045  1.00 70.20  ? 13   DG  I C8    1 
ATOM   1032  N  N7    . DG  C  3  12   ? 11.172  64.767  27.058  1.00 70.11  ? 13   DG  I N7    1 
ATOM   1033  C  C5    . DG  C  3  12   ? 11.909  63.611  26.835  1.00 69.56  ? 13   DG  I C5    1 
ATOM   1034  C  C6    . DG  C  3  12   ? 12.940  63.046  27.606  1.00 69.73  ? 13   DG  I C6    1 
ATOM   1035  O  O6    . DG  C  3  12   ? 13.411  63.482  28.656  1.00 70.49  ? 13   DG  I O6    1 
ATOM   1036  N  N1    . DG  C  3  12   ? 13.424  61.861  27.044  1.00 68.91  ? 13   DG  I N1    1 
ATOM   1037  C  C2    . DG  C  3  12   ? 12.960  61.306  25.879  1.00 67.75  ? 13   DG  I C2    1 
ATOM   1038  N  N2    . DG  C  3  12   ? 13.548  60.162  25.522  1.00 67.97  ? 13   DG  I N2    1 
ATOM   1039  N  N3    . DG  C  3  12   ? 11.991  61.837  25.132  1.00 67.95  ? 13   DG  I N3    1 
ATOM   1040  C  C4    . DG  C  3  12   ? 11.512  62.989  25.672  1.00 69.37  ? 13   DG  I C4    1 
ATOM   1041  P  P     . DG  C  3  13   ? 6.628   62.079  21.526  1.00 77.23  ? 14   DG  I P     1 
ATOM   1042  O  OP1   . DG  C  3  13   ? 6.393   61.754  20.095  1.00 75.57  ? 14   DG  I OP1   1 
ATOM   1043  O  OP2   . DG  C  3  13   ? 5.511   62.631  22.345  1.00 77.62  ? 14   DG  I OP2   1 
ATOM   1044  O  "O5'" . DG  C  3  13   ? 7.123   60.738  22.225  1.00 75.90  ? 14   DG  I "O5'" 1 
ATOM   1045  C  "C5'" . DG  C  3  13   ? 7.877   59.779  21.499  1.00 72.95  ? 14   DG  I "C5'" 1 
ATOM   1046  C  "C4'" . DG  C  3  13   ? 8.106   58.555  22.350  1.00 71.41  ? 14   DG  I "C4'" 1 
ATOM   1047  O  "O4'" . DG  C  3  13   ? 9.024   58.869  23.429  1.00 71.43  ? 14   DG  I "O4'" 1 
ATOM   1048  C  "C3'" . DG  C  3  13   ? 6.846   57.988  23.001  1.00 70.67  ? 14   DG  I "C3'" 1 
ATOM   1049  O  "O3'" . DG  C  3  13   ? 6.844   56.571  22.832  1.00 69.89  ? 14   DG  I "O3'" 1 
ATOM   1050  C  "C2'" . DG  C  3  13   ? 6.966   58.410  24.457  1.00 70.86  ? 14   DG  I "C2'" 1 
ATOM   1051  C  "C1'" . DG  C  3  13   ? 8.470   58.499  24.685  1.00 71.07  ? 14   DG  I "C1'" 1 
ATOM   1052  N  N9    . DG  C  3  13   ? 8.826   59.534  25.656  1.00 70.56  ? 14   DG  I N9    1 
ATOM   1053  C  C8    . DG  C  3  13   ? 8.257   60.783  25.736  1.00 70.07  ? 14   DG  I C8    1 
ATOM   1054  N  N7    . DG  C  3  13   ? 8.725   61.499  26.716  1.00 70.16  ? 14   DG  I N7    1 
ATOM   1055  C  C5    . DG  C  3  13   ? 9.671   60.680  27.325  1.00 70.15  ? 14   DG  I C5    1 
ATOM   1056  C  C6    . DG  C  3  13   ? 10.502  60.930  28.449  1.00 70.59  ? 14   DG  I C6    1 
ATOM   1057  O  O6    . DG  C  3  13   ? 10.556  61.952  29.138  1.00 71.71  ? 14   DG  I O6    1 
ATOM   1058  N  N1    . DG  C  3  13   ? 11.329  59.843  28.746  1.00 70.13  ? 14   DG  I N1    1 
ATOM   1059  C  C2    . DG  C  3  13   ? 11.347  58.668  28.042  1.00 69.91  ? 14   DG  I C2    1 
ATOM   1060  N  N2    . DG  C  3  13   ? 12.214  57.750  28.496  1.00 69.63  ? 14   DG  I N2    1 
ATOM   1061  N  N3    . DG  C  3  13   ? 10.572  58.417  26.979  1.00 68.94  ? 14   DG  I N3    1 
ATOM   1062  C  C4    . DG  C  3  13   ? 9.761   59.466  26.682  1.00 69.57  ? 14   DG  I C4    1 
ATOM   1063  P  P     . DG  C  3  14   ? 5.884   55.652  23.732  1.00 70.92  ? 15   DG  I P     1 
ATOM   1064  O  OP1   . DG  C  3  14   ? 5.558   54.454  22.913  1.00 71.09  ? 15   DG  I OP1   1 
ATOM   1065  O  OP2   . DG  C  3  14   ? 4.773   56.510  24.250  1.00 70.56  ? 15   DG  I OP2   1 
ATOM   1066  O  "O5'" . DG  C  3  14   ? 6.849   55.203  24.935  1.00 69.18  ? 15   DG  I "O5'" 1 
ATOM   1067  C  "C5'" . DG  C  3  14   ? 6.426   54.299  25.973  1.00 64.74  ? 15   DG  I "C5'" 1 
ATOM   1068  C  "C4'" . DG  C  3  14   ? 7.625   53.787  26.746  1.00 62.81  ? 15   DG  I "C4'" 1 
ATOM   1069  O  "O4'" . DG  C  3  14   ? 8.450   54.904  27.156  1.00 60.39  ? 15   DG  I "O4'" 1 
ATOM   1070  C  "C3'" . DG  C  3  14   ? 7.312   53.004  28.024  1.00 62.12  ? 15   DG  I "C3'" 1 
ATOM   1071  O  "O3'" . DG  C  3  14   ? 8.299   52.016  28.347  1.00 63.47  ? 15   DG  I "O3'" 1 
ATOM   1072  C  "C2'" . DG  C  3  14   ? 7.407   54.063  29.105  1.00 60.31  ? 15   DG  I "C2'" 1 
ATOM   1073  C  "C1'" . DG  C  3  14   ? 8.456   55.034  28.572  1.00 59.00  ? 15   DG  I "C1'" 1 
ATOM   1074  N  N9    . DG  C  3  14   ? 8.116   56.419  28.880  1.00 57.23  ? 15   DG  I N9    1 
ATOM   1075  C  C8    . DG  C  3  14   ? 7.203   57.203  28.212  1.00 56.61  ? 15   DG  I C8    1 
ATOM   1076  N  N7    . DG  C  3  14   ? 7.056   58.386  28.742  1.00 55.94  ? 15   DG  I N7    1 
ATOM   1077  C  C5    . DG  C  3  14   ? 7.935   58.392  29.815  1.00 55.40  ? 15   DG  I C5    1 
ATOM   1078  C  C6    . DG  C  3  14   ? 8.205   59.402  30.759  1.00 54.68  ? 15   DG  I C6    1 
ATOM   1079  O  O6    . DG  C  3  14   ? 7.697   60.528  30.839  1.00 53.54  ? 15   DG  I O6    1 
ATOM   1080  N  N1    . DG  C  3  14   ? 9.171   58.998  31.681  1.00 55.39  ? 15   DG  I N1    1 
ATOM   1081  C  C2    . DG  C  3  14   ? 9.789   57.765  31.684  1.00 56.00  ? 15   DG  I C2    1 
ATOM   1082  N  N2    . DG  C  3  14   ? 10.700  57.555  32.647  1.00 57.08  ? 15   DG  I N2    1 
ATOM   1083  N  N3    . DG  C  3  14   ? 9.536   56.809  30.809  1.00 55.44  ? 15   DG  I N3    1 
ATOM   1084  C  C4    . DG  C  3  14   ? 8.607   57.188  29.908  1.00 55.98  ? 15   DG  I C4    1 
ATOM   1085  O  OP3   . DC  D  1  1    ? 66.836  -11.744 18.175  1.00 95.21  ? 1    DC  X OP3   1 
ATOM   1086  P  P     . DC  D  1  1    ? 66.619  -12.736 19.308  1.00 96.55  ? 1    DC  X P     1 
ATOM   1087  O  OP1   . DC  D  1  1    ? 65.153  -13.250 19.382  1.00 95.81  ? 1    DC  X OP1   1 
ATOM   1088  O  OP2   . DC  D  1  1    ? 67.688  -13.838 19.287  1.00 95.77  ? 1    DC  X OP2   1 
ATOM   1089  O  "O5'" . DC  D  1  1    ? 66.898  -11.878 20.671  1.00 93.95  ? 1    DC  X "O5'" 1 
ATOM   1090  C  "C5'" . DC  D  1  1    ? 66.011  -11.981 21.798  1.00 90.27  ? 1    DC  X "C5'" 1 
ATOM   1091  C  "C4'" . DC  D  1  1    ? 65.963  -13.412 22.277  1.00 88.57  ? 1    DC  X "C4'" 1 
ATOM   1092  O  "O4'" . DC  D  1  1    ? 67.050  -13.643 23.195  1.00 88.10  ? 1    DC  X "O4'" 1 
ATOM   1093  C  "C3'" . DC  D  1  1    ? 64.695  -13.842 23.009  1.00 88.06  ? 1    DC  X "C3'" 1 
ATOM   1094  O  "O3'" . DC  D  1  1    ? 64.460  -15.224 22.677  1.00 86.60  ? 1    DC  X "O3'" 1 
ATOM   1095  C  "C2'" . DC  D  1  1    ? 65.085  -13.666 24.467  1.00 88.02  ? 1    DC  X "C2'" 1 
ATOM   1096  C  "C1'" . DC  D  1  1    ? 66.538  -14.102 24.430  1.00 88.59  ? 1    DC  X "C1'" 1 
ATOM   1097  N  N1    . DC  D  1  1    ? 67.436  -13.608 25.481  1.00 88.92  ? 1    DC  X N1    1 
ATOM   1098  C  C2    . DC  D  1  1    ? 67.831  -14.488 26.496  1.00 88.70  ? 1    DC  X C2    1 
ATOM   1099  O  O2    . DC  D  1  1    ? 67.325  -15.619 26.548  1.00 88.49  ? 1    DC  X O2    1 
ATOM   1100  N  N3    . DC  D  1  1    ? 68.755  -14.087 27.392  1.00 88.85  ? 1    DC  X N3    1 
ATOM   1101  C  C4    . DC  D  1  1    ? 69.266  -12.861 27.318  1.00 89.91  ? 1    DC  X C4    1 
ATOM   1102  N  N4    . DC  D  1  1    ? 70.195  -12.528 28.214  1.00 89.92  ? 1    DC  X N4    1 
ATOM   1103  C  C5    . DC  D  1  1    ? 68.851  -11.927 26.323  1.00 89.94  ? 1    DC  X C5    1 
ATOM   1104  C  C6    . DC  D  1  1    ? 67.933  -12.335 25.438  1.00 89.22  ? 1    DC  X C6    1 
ATOM   1105  P  P     . DC  D  1  2    ? 62.973  -15.853 22.736  1.00 85.23  ? 2    DC  X P     1 
ATOM   1106  O  OP1   . DC  D  1  2    ? 62.856  -16.868 21.652  1.00 85.20  ? 2    DC  X OP1   1 
ATOM   1107  O  OP2   . DC  D  1  2    ? 61.941  -14.791 22.850  1.00 83.64  ? 2    DC  X OP2   1 
ATOM   1108  O  "O5'" . DC  D  1  2    ? 63.014  -16.652 24.106  1.00 84.62  ? 2    DC  X "O5'" 1 
ATOM   1109  C  "C5'" . DC  D  1  2    ? 62.029  -16.438 25.095  1.00 82.72  ? 2    DC  X "C5'" 1 
ATOM   1110  C  "C4'" . DC  D  1  2    ? 62.124  -17.498 26.164  1.00 80.73  ? 2    DC  X "C4'" 1 
ATOM   1111  O  "O4'" . DC  D  1  2    ? 63.349  -17.326 26.932  1.00 79.95  ? 2    DC  X "O4'" 1 
ATOM   1112  C  "C3'" . DC  D  1  2    ? 60.972  -17.349 27.141  1.00 80.28  ? 2    DC  X "C3'" 1 
ATOM   1113  O  "O3'" . DC  D  1  2    ? 60.411  -18.606 27.507  1.00 80.31  ? 2    DC  X "O3'" 1 
ATOM   1114  C  "C2'" . DC  D  1  2    ? 61.589  -16.622 28.311  1.00 79.63  ? 2    DC  X "C2'" 1 
ATOM   1115  C  "C1'" . DC  D  1  2    ? 63.063  -17.006 28.285  1.00 80.04  ? 2    DC  X "C1'" 1 
ATOM   1116  N  N1    . DC  D  1  2    ? 63.941  -15.881 28.676  1.00 79.91  ? 2    DC  X N1    1 
ATOM   1117  C  C2    . DC  D  1  2    ? 64.822  -16.005 29.794  1.00 80.34  ? 2    DC  X C2    1 
ATOM   1118  O  O2    . DC  D  1  2    ? 64.866  -17.068 30.450  1.00 81.47  ? 2    DC  X O2    1 
ATOM   1119  N  N3    . DC  D  1  2    ? 65.601  -14.949 30.127  1.00 79.49  ? 2    DC  X N3    1 
ATOM   1120  C  C4    . DC  D  1  2    ? 65.537  -13.815 29.418  1.00 78.23  ? 2    DC  X C4    1 
ATOM   1121  N  N4    . DC  D  1  2    ? 66.318  -12.809 29.787  1.00 77.00  ? 2    DC  X N4    1 
ATOM   1122  C  C5    . DC  D  1  2    ? 64.667  -13.667 28.300  1.00 78.63  ? 2    DC  X C5    1 
ATOM   1123  C  C6    . DC  D  1  2    ? 63.898  -14.712 27.965  1.00 78.92  ? 2    DC  X C6    1 
ATOM   1124  P  P     . DC  D  1  3    ? 58.928  -18.657 28.132  1.00 80.37  ? 3    DC  X P     1 
ATOM   1125  O  OP1   . DC  D  1  3    ? 58.209  -19.871 27.615  1.00 79.05  ? 3    DC  X OP1   1 
ATOM   1126  O  OP2   . DC  D  1  3    ? 58.329  -17.303 27.918  1.00 78.81  ? 3    DC  X OP2   1 
ATOM   1127  O  "O5'" . DC  D  1  3    ? 59.227  -18.862 29.687  1.00 77.49  ? 3    DC  X "O5'" 1 
ATOM   1128  C  "C5'" . DC  D  1  3    ? 60.090  -19.919 30.124  1.00 73.62  ? 3    DC  X "C5'" 1 
ATOM   1129  C  "C4'" . DC  D  1  3    ? 60.496  -19.735 31.570  1.00 71.09  ? 3    DC  X "C4'" 1 
ATOM   1130  O  "O4'" . DC  D  1  3    ? 61.521  -18.717 31.703  1.00 69.74  ? 3    DC  X "O4'" 1 
ATOM   1131  C  "C3'" . DC  D  1  3    ? 59.386  -19.378 32.565  1.00 71.57  ? 3    DC  X "C3'" 1 
ATOM   1132  O  "O3'" . DC  D  1  3    ? 59.445  -20.250 33.703  1.00 72.48  ? 3    DC  X "O3'" 1 
ATOM   1133  C  "C2'" . DC  D  1  3    ? 59.705  -17.946 32.971  1.00 70.59  ? 3    DC  X "C2'" 1 
ATOM   1134  C  "C1'" . DC  D  1  3    ? 61.219  -17.843 32.793  1.00 69.28  ? 3    DC  X "C1'" 1 
ATOM   1135  N  N1    . DC  D  1  3    ? 61.682  -16.485 32.418  1.00 67.81  ? 3    DC  X N1    1 
ATOM   1136  C  C2    . DC  D  1  3    ? 62.712  -15.827 33.152  1.00 66.85  ? 3    DC  X C2    1 
ATOM   1137  O  O2    . DC  D  1  3    ? 63.184  -16.340 34.176  1.00 67.37  ? 3    DC  X O2    1 
ATOM   1138  N  N3    . DC  D  1  3    ? 63.157  -14.633 32.713  1.00 65.49  ? 3    DC  X N3    1 
ATOM   1139  C  C4    . DC  D  1  3    ? 62.625  -14.083 31.622  1.00 66.55  ? 3    DC  X C4    1 
ATOM   1140  N  N4    . DC  D  1  3    ? 63.103  -12.922 31.206  1.00 66.69  ? 3    DC  X N4    1 
ATOM   1141  C  C5    . DC  D  1  3    ? 61.575  -14.700 30.898  1.00 66.78  ? 3    DC  X C5    1 
ATOM   1142  C  C6    . DC  D  1  3    ? 61.133  -15.878 31.329  1.00 67.07  ? 3    DC  X C6    1 
ATOM   1143  P  P     . DT  D  1  4    ? 58.384  -20.097 34.913  1.00 73.26  ? 4    DT  X P     1 
ATOM   1144  O  OP1   . DT  D  1  4    ? 58.189  -21.447 35.513  1.00 73.06  ? 4    DT  X OP1   1 
ATOM   1145  O  OP2   . DT  D  1  4    ? 57.193  -19.346 34.423  1.00 73.47  ? 4    DT  X OP2   1 
ATOM   1146  O  "O5'" . DT  D  1  4    ? 59.194  -19.203 35.961  1.00 70.90  ? 4    DT  X "O5'" 1 
ATOM   1147  C  "C5'" . DT  D  1  4    ? 60.532  -19.564 36.333  1.00 67.51  ? 4    DT  X "C5'" 1 
ATOM   1148  C  "C4'" . DT  D  1  4    ? 61.034  -18.711 37.478  1.00 64.64  ? 4    DT  X "C4'" 1 
ATOM   1149  O  "O4'" . DT  D  1  4    ? 61.605  -17.458 37.022  1.00 64.01  ? 4    DT  X "O4'" 1 
ATOM   1150  C  "C3'" . DT  D  1  4    ? 60.002  -18.355 38.541  1.00 63.44  ? 4    DT  X "C3'" 1 
ATOM   1151  O  "O3'" . DT  D  1  4    ? 60.523  -18.617 39.835  1.00 61.55  ? 4    DT  X "O3'" 1 
ATOM   1152  C  "C2'" . DT  D  1  4    ? 59.749  -16.867 38.335  1.00 62.99  ? 4    DT  X "C2'" 1 
ATOM   1153  C  "C1'" . DT  D  1  4    ? 61.038  -16.348 37.712  1.00 62.39  ? 4    DT  X "C1'" 1 
ATOM   1154  N  N1    . DT  D  1  4    ? 60.820  -15.287 36.708  1.00 60.84  ? 4    DT  X N1    1 
ATOM   1155  C  C2    . DT  D  1  4    ? 61.627  -14.163 36.698  1.00 60.00  ? 4    DT  X C2    1 
ATOM   1156  O  O2    . DT  D  1  4    ? 62.488  -13.946 37.531  1.00 59.89  ? 4    DT  X O2    1 
ATOM   1157  N  N3    . DT  D  1  4    ? 61.378  -13.297 35.653  1.00 59.78  ? 4    DT  X N3    1 
ATOM   1158  C  C4    . DT  D  1  4    ? 60.412  -13.449 34.657  1.00 59.67  ? 4    DT  X C4    1 
ATOM   1159  O  O4    . DT  D  1  4    ? 60.296  -12.617 33.766  1.00 58.76  ? 4    DT  X O4    1 
ATOM   1160  C  C5    . DT  D  1  4    ? 59.596  -14.624 34.759  1.00 59.49  ? 4    DT  X C5    1 
ATOM   1161  C  C7    . DT  D  1  4    ? 58.529  -14.850 33.733  1.00 58.66  ? 4    DT  X C7    1 
ATOM   1162  C  C6    . DT  D  1  4    ? 59.830  -15.465 35.765  1.00 60.05  ? 4    DT  X C6    1 
ATOM   1163  P  P     . DG  D  1  5    ? 59.724  -18.110 41.125  1.00 62.81  ? 5    DG  X P     1 
ATOM   1164  O  OP1   . DG  D  1  5    ? 60.085  -19.023 42.234  1.00 62.88  ? 5    DG  X OP1   1 
ATOM   1165  O  OP2   . DG  D  1  5    ? 58.293  -17.913 40.770  1.00 61.67  ? 5    DG  X OP2   1 
ATOM   1166  O  "O5'" . DG  D  1  5    ? 60.374  -16.685 41.406  1.00 61.06  ? 5    DG  X "O5'" 1 
ATOM   1167  C  "C5'" . DG  D  1  5    ? 61.792  -16.552 41.474  1.00 59.51  ? 5    DG  X "C5'" 1 
ATOM   1168  C  "C4'" . DG  D  1  5    ? 62.176  -15.161 41.913  1.00 57.59  ? 5    DG  X "C4'" 1 
ATOM   1169  O  "O4'" . DG  D  1  5    ? 62.020  -14.227 40.823  1.00 58.05  ? 5    DG  X "O4'" 1 
ATOM   1170  C  "C3'" . DG  D  1  5    ? 61.370  -14.598 43.083  1.00 57.90  ? 5    DG  X "C3'" 1 
ATOM   1171  O  "O3'" . DG  D  1  5    ? 62.261  -13.932 43.970  1.00 56.90  ? 5    DG  X "O3'" 1 
ATOM   1172  C  "C2'" . DG  D  1  5    ? 60.415  -13.621 42.426  1.00 57.19  ? 5    DG  X "C2'" 1 
ATOM   1173  C  "C1'" . DG  D  1  5    ? 61.208  -13.134 41.226  1.00 57.72  ? 5    DG  X "C1'" 1 
ATOM   1174  N  N9    . DG  D  1  5    ? 60.377  -12.773 40.085  1.00 57.80  ? 5    DG  X N9    1 
ATOM   1175  C  C8    . DG  D  1  5    ? 59.295  -13.473 39.610  1.00 57.36  ? 5    DG  X C8    1 
ATOM   1176  N  N7    . DG  D  1  5    ? 58.750  -12.920 38.568  1.00 57.22  ? 5    DG  X N7    1 
ATOM   1177  C  C5    . DG  D  1  5    ? 59.514  -11.782 38.339  1.00 56.09  ? 5    DG  X C5    1 
ATOM   1178  C  C6    . DG  D  1  5    ? 59.393  -10.794 37.344  1.00 54.88  ? 5    DG  X C6    1 
ATOM   1179  O  O6    . DG  D  1  5    ? 58.564  -10.722 36.447  1.00 56.06  ? 5    DG  X O6    1 
ATOM   1180  N  N1    . DG  D  1  5    ? 60.369  -9.815  37.463  1.00 54.86  ? 5    DG  X N1    1 
ATOM   1181  C  C2    . DG  D  1  5    ? 61.338  -9.796  38.431  1.00 56.02  ? 5    DG  X C2    1 
ATOM   1182  N  N2    . DG  D  1  5    ? 62.189  -8.757  38.382  1.00 55.36  ? 5    DG  X N2    1 
ATOM   1183  N  N3    . DG  D  1  5    ? 61.463  -10.718 39.373  1.00 55.89  ? 5    DG  X N3    1 
ATOM   1184  C  C4    . DG  D  1  5    ? 60.521  -11.676 39.265  1.00 56.47  ? 5    DG  X C4    1 
ATOM   1185  P  P     . DT  D  1  6    ? 61.687  -13.148 45.240  1.00 57.64  ? 6    DT  X P     1 
ATOM   1186  O  OP1   . DT  D  1  6    ? 62.617  -13.360 46.387  1.00 55.63  ? 6    DT  X OP1   1 
ATOM   1187  O  OP2   . DT  D  1  6    ? 60.240  -13.472 45.392  1.00 56.75  ? 6    DT  X OP2   1 
ATOM   1188  O  "O5'" . DT  D  1  6    ? 61.800  -11.639 44.762  1.00 56.11  ? 6    DT  X "O5'" 1 
ATOM   1189  C  "C5'" . DT  D  1  6    ? 63.054  -11.092 44.353  1.00 52.81  ? 6    DT  X "C5'" 1 
ATOM   1190  C  "C4'" . DT  D  1  6    ? 62.945  -9.591  44.243  1.00 50.86  ? 6    DT  X "C4'" 1 
ATOM   1191  O  "O4'" . DT  D  1  6    ? 62.219  -9.248  43.037  1.00 50.92  ? 6    DT  X "O4'" 1 
ATOM   1192  C  "C3'" . DT  D  1  6    ? 62.158  -8.985  45.404  1.00 50.75  ? 6    DT  X "C3'" 1 
ATOM   1193  O  "O3'" . DT  D  1  6    ? 62.702  -7.743  45.842  1.00 49.48  ? 6    DT  X "O3'" 1 
ATOM   1194  C  "C2'" . DT  D  1  6    ? 60.784  -8.766  44.817  1.00 50.62  ? 6    DT  X "C2'" 1 
ATOM   1195  C  "C1'" . DT  D  1  6    ? 61.084  -8.453  43.362  1.00 51.70  ? 6    DT  X "C1'" 1 
ATOM   1196  N  N1    . DT  D  1  6    ? 59.985  -8.815  42.433  1.00 53.01  ? 6    DT  X N1    1 
ATOM   1197  C  C2    . DT  D  1  6    ? 59.669  -7.985  41.360  1.00 53.36  ? 6    DT  X C2    1 
ATOM   1198  O  O2    . DT  D  1  6    ? 60.237  -6.928  41.127  1.00 53.15  ? 6    DT  X O2    1 
ATOM   1199  N  N3    . DT  D  1  6    ? 58.649  -8.456  40.558  1.00 54.32  ? 6    DT  X N3    1 
ATOM   1200  C  C4    . DT  D  1  6    ? 57.944  -9.636  40.727  1.00 54.41  ? 6    DT  X C4    1 
ATOM   1201  O  O4    . DT  D  1  6    ? 57.075  -9.948  39.943  1.00 54.86  ? 6    DT  X O4    1 
ATOM   1202  C  C5    . DT  D  1  6    ? 58.318  -10.431 41.864  1.00 54.46  ? 6    DT  X C5    1 
ATOM   1203  C  C7    . DT  D  1  6    ? 57.595  -11.717 42.114  1.00 54.10  ? 6    DT  X C7    1 
ATOM   1204  C  C6    . DT  D  1  6    ? 59.299  -9.989  42.647  1.00 53.25  ? 6    DT  X C6    1 
ATOM   1205  P  P     . DC  D  1  7    ? 62.250  -7.145  47.262  1.00 49.80  ? 7    DC  X P     1 
ATOM   1206  O  OP1   . DC  D  1  7    ? 63.408  -7.179  48.180  1.00 49.55  ? 7    DC  X OP1   1 
ATOM   1207  O  OP2   . DC  D  1  7    ? 61.002  -7.838  47.641  1.00 46.32  ? 7    DC  X OP2   1 
ATOM   1208  O  "O5'" . DC  D  1  7    ? 61.934  -5.620  46.927  1.00 51.90  ? 7    DC  X "O5'" 1 
ATOM   1209  C  "C5'" . DC  D  1  7    ? 62.924  -4.803  46.292  1.00 55.67  ? 7    DC  X "C5'" 1 
ATOM   1210  C  "C4'" . DC  D  1  7    ? 62.313  -3.958  45.193  1.00 59.03  ? 7    DC  X "C4'" 1 
ATOM   1211  O  "O4'" . DC  D  1  7    ? 61.432  -4.746  44.350  1.00 59.37  ? 7    DC  X "O4'" 1 
ATOM   1212  C  "C3'" . DC  D  1  7    ? 61.496  -2.735  45.615  1.00 61.40  ? 7    DC  X "C3'" 1 
ATOM   1213  O  "O3'" . DC  D  1  7    ? 61.900  -1.633  44.791  1.00 66.39  ? 7    DC  X "O3'" 1 
ATOM   1214  C  "C2'" . DC  D  1  7    ? 60.057  -3.143  45.335  1.00 59.83  ? 7    DC  X "C2'" 1 
ATOM   1215  C  "C1'" . DC  D  1  7    ? 60.205  -4.066  44.152  1.00 57.54  ? 7    DC  X "C1'" 1 
ATOM   1216  N  N1    . DC  D  1  7    ? 59.153  -5.081  44.007  1.00 56.49  ? 7    DC  X N1    1 
ATOM   1217  C  C2    . DC  D  1  7    ? 58.330  -5.026  42.898  1.00 56.74  ? 7    DC  X C2    1 
ATOM   1218  O  O2    . DC  D  1  7    ? 58.474  -4.101  42.101  1.00 57.25  ? 7    DC  X O2    1 
ATOM   1219  N  N3    . DC  D  1  7    ? 57.389  -5.977  42.717  1.00 57.42  ? 7    DC  X N3    1 
ATOM   1220  C  C4    . DC  D  1  7    ? 57.252  -6.954  43.608  1.00 57.44  ? 7    DC  X C4    1 
ATOM   1221  N  N4    . DC  D  1  7    ? 56.316  -7.880  43.378  1.00 56.74  ? 7    DC  X N4    1 
ATOM   1222  C  C5    . DC  D  1  7    ? 58.064  -7.024  44.769  1.00 56.99  ? 7    DC  X C5    1 
ATOM   1223  C  C6    . DC  D  1  7    ? 58.996  -6.072  44.930  1.00 56.03  ? 7    DC  X C6    1 
ATOM   1224  P  P     . DT  D  1  8    ? 61.257  -0.173  45.014  1.00 70.43  ? 8    DT  X P     1 
ATOM   1225  O  OP1   . DT  D  1  8    ? 62.268  0.867   44.644  1.00 70.67  ? 8    DT  X OP1   1 
ATOM   1226  O  OP2   . DT  D  1  8    ? 60.642  -0.144  46.368  1.00 70.90  ? 8    DT  X OP2   1 
ATOM   1227  O  "O5'" . DT  D  1  8    ? 60.080  -0.138  43.943  1.00 68.01  ? 8    DT  X "O5'" 1 
ATOM   1228  C  "C5'" . DT  D  1  8    ? 60.356  -0.346  42.568  1.00 65.65  ? 8    DT  X "C5'" 1 
ATOM   1229  C  "C4'" . DT  D  1  8    ? 59.101  -0.140  41.756  1.00 63.60  ? 8    DT  X "C4'" 1 
ATOM   1230  O  "O4'" . DT  D  1  8    ? 58.243  -1.299  41.863  1.00 64.41  ? 8    DT  X "O4'" 1 
ATOM   1231  C  "C3'" . DT  D  1  8    ? 58.262  1.053   42.217  1.00 61.72  ? 8    DT  X "C3'" 1 
ATOM   1232  O  "O3'" . DT  D  1  8    ? 57.741  1.757   41.093  1.00 58.62  ? 8    DT  X "O3'" 1 
ATOM   1233  C  "C2'" . DT  D  1  8    ? 57.122  0.410   42.982  1.00 62.04  ? 8    DT  X "C2'" 1 
ATOM   1234  C  "C1'" . DT  D  1  8    ? 56.938  -0.875  42.202  1.00 62.91  ? 8    DT  X "C1'" 1 
ATOM   1235  N  N1    . DT  D  1  8    ? 56.266  -1.981  42.905  1.00 62.10  ? 8    DT  X N1    1 
ATOM   1236  C  C2    . DT  D  1  8    ? 55.205  -2.555  42.269  1.00 61.24  ? 8    DT  X C2    1 
ATOM   1237  O  O2    . DT  D  1  8    ? 54.818  -2.172  41.173  1.00 60.93  ? 8    DT  X O2    1 
ATOM   1238  N  N3    . DT  D  1  8    ? 54.608  -3.584  42.960  1.00 60.73  ? 8    DT  X N3    1 
ATOM   1239  C  C4    . DT  D  1  8    ? 54.976  -4.073  44.202  1.00 60.83  ? 8    DT  X C4    1 
ATOM   1240  O  O4    . DT  D  1  8    ? 54.348  -4.992  44.710  1.00 61.05  ? 8    DT  X O4    1 
ATOM   1241  C  C5    . DT  D  1  8    ? 56.107  -3.423  44.810  1.00 61.15  ? 8    DT  X C5    1 
ATOM   1242  C  C7    . DT  D  1  8    ? 56.580  -3.894  46.149  1.00 61.10  ? 8    DT  X C7    1 
ATOM   1243  C  C6    . DT  D  1  8    ? 56.687  -2.420  44.142  1.00 61.86  ? 8    DT  X C6    1 
ATOM   1244  P  P     . DG  D  1  9    ? 57.458  3.332   41.208  1.00 56.27  ? 9    DG  X P     1 
ATOM   1245  O  OP1   . DG  D  1  9    ? 58.323  4.059   40.244  1.00 56.21  ? 9    DG  X OP1   1 
ATOM   1246  O  OP2   . DG  D  1  9    ? 57.500  3.679   42.640  1.00 54.84  ? 9    DG  X OP2   1 
ATOM   1247  O  "O5'" . DG  D  1  9    ? 55.974  3.455   40.685  1.00 52.85  ? 9    DG  X "O5'" 1 
ATOM   1248  C  "C5'" . DG  D  1  9    ? 55.644  2.981   39.398  1.00 49.12  ? 9    DG  X "C5'" 1 
ATOM   1249  C  "C4'" . DG  D  1  9    ? 54.158  2.787   39.317  1.00 47.46  ? 9    DG  X "C4'" 1 
ATOM   1250  O  "O4'" . DG  D  1  9    ? 53.785  1.563   39.988  1.00 48.72  ? 9    DG  X "O4'" 1 
ATOM   1251  C  "C3'" . DG  D  1  9    ? 53.424  3.906   40.044  1.00 46.75  ? 9    DG  X "C3'" 1 
ATOM   1252  O  "O3'" . DG  D  1  9    ? 52.264  4.244   39.309  1.00 45.05  ? 9    DG  X "O3'" 1 
ATOM   1253  C  "C2'" . DG  D  1  9    ? 53.049  3.272   41.372  1.00 47.56  ? 9    DG  X "C2'" 1 
ATOM   1254  C  "C1'" . DG  D  1  9    ? 52.790  1.843   40.953  1.00 48.85  ? 9    DG  X "C1'" 1 
ATOM   1255  N  N9    . DG  D  1  9    ? 52.893  0.840   42.006  1.00 49.17  ? 9    DG  X N9    1 
ATOM   1256  C  C8    . DG  D  1  9    ? 53.873  0.727   42.957  1.00 49.19  ? 9    DG  X C8    1 
ATOM   1257  N  N7    . DG  D  1  9    ? 53.702  -0.295  43.749  1.00 49.06  ? 9    DG  X N7    1 
ATOM   1258  C  C5    . DG  D  1  9    ? 52.530  -0.888  43.298  1.00 48.95  ? 9    DG  X C5    1 
ATOM   1259  C  C6    . DG  D  1  9    ? 51.842  -2.043  43.761  1.00 49.62  ? 9    DG  X C6    1 
ATOM   1260  O  O6    . DG  D  1  9    ? 52.133  -2.789  44.703  1.00 51.80  ? 9    DG  X O6    1 
ATOM   1261  N  N1    . DG  D  1  9    ? 50.701  -2.298  43.009  1.00 49.17  ? 9    DG  X N1    1 
ATOM   1262  C  C2    . DG  D  1  9    ? 50.278  -1.536  41.954  1.00 49.20  ? 9    DG  X C2    1 
ATOM   1263  N  N2    . DG  D  1  9    ? 49.157  -1.929  41.368  1.00 50.27  ? 9    DG  X N2    1 
ATOM   1264  N  N3    . DG  D  1  9    ? 50.907  -0.458  41.511  1.00 48.22  ? 9    DG  X N3    1 
ATOM   1265  C  C4    . DG  D  1  9    ? 52.018  -0.198  42.225  1.00 48.68  ? 9    DG  X C4    1 
ATOM   1266  P  P     . DG  D  1  10   ? 51.448  5.561   39.683  1.00 45.53  ? 10   DG  X P     1 
ATOM   1267  O  OP1   . DG  D  1  10   ? 51.544  6.518   38.541  1.00 43.87  ? 10   DG  X OP1   1 
ATOM   1268  O  OP2   . DG  D  1  10   ? 51.857  5.991   41.037  1.00 42.72  ? 10   DG  X OP2   1 
ATOM   1269  O  "O5'" . DG  D  1  10   ? 49.966  5.008   39.768  1.00 42.11  ? 10   DG  X "O5'" 1 
ATOM   1270  C  "C5'" . DG  D  1  10   ? 49.440  4.223   38.719  1.00 39.43  ? 10   DG  X "C5'" 1 
ATOM   1271  C  "C4'" . DG  D  1  10   ? 48.150  3.585   39.162  1.00 39.52  ? 10   DG  X "C4'" 1 
ATOM   1272  O  "O4'" . DG  D  1  10   ? 48.433  2.475   40.042  1.00 40.57  ? 10   DG  X "O4'" 1 
ATOM   1273  C  "C3'" . DG  D  1  10   ? 47.272  4.545   39.953  1.00 39.57  ? 10   DG  X "C3'" 1 
ATOM   1274  O  "O3'" . DG  D  1  10   ? 45.916  4.383   39.581  1.00 40.29  ? 10   DG  X "O3'" 1 
ATOM   1275  C  "C2'" . DG  D  1  10   ? 47.488  4.118   41.391  1.00 37.52  ? 10   DG  X "C2'" 1 
ATOM   1276  C  "C1'" . DG  D  1  10   ? 47.717  2.628   41.249  1.00 38.80  ? 10   DG  X "C1'" 1 
ATOM   1277  N  N9    . DG  D  1  10   ? 48.530  2.061   42.318  1.00 37.97  ? 10   DG  X N9    1 
ATOM   1278  C  C8    . DG  D  1  10   ? 49.730  2.539   42.772  1.00 38.66  ? 10   DG  X C8    1 
ATOM   1279  N  N7    . DG  D  1  10   ? 50.203  1.859   43.776  1.00 38.07  ? 10   DG  X N7    1 
ATOM   1280  C  C5    . DG  D  1  10   ? 49.266  0.863   43.987  1.00 37.78  ? 10   DG  X C5    1 
ATOM   1281  C  C6    . DG  D  1  10   ? 49.250  -0.182  44.933  1.00 38.22  ? 10   DG  X C6    1 
ATOM   1282  O  O6    . DG  D  1  10   ? 50.094  -0.424  45.816  1.00 39.39  ? 10   DG  X O6    1 
ATOM   1283  N  N1    . DG  D  1  10   ? 48.121  -0.991  44.785  1.00 34.61  ? 10   DG  X N1    1 
ATOM   1284  C  C2    . DG  D  1  10   ? 47.145  -0.804  43.849  1.00 33.48  ? 10   DG  X C2    1 
ATOM   1285  N  N2    . DG  D  1  10   ? 46.151  -1.668  43.850  1.00 31.73  ? 10   DG  X N2    1 
ATOM   1286  N  N3    . DG  D  1  10   ? 47.148  0.172   42.965  1.00 35.87  ? 10   DG  X N3    1 
ATOM   1287  C  C4    . DG  D  1  10   ? 48.234  0.963   43.088  1.00 37.17  ? 10   DG  X C4    1 
ATOM   1288  P  P     . DC  D  1  11   ? 44.780  5.183   40.379  1.00 45.01  ? 11   DC  X P     1 
ATOM   1289  O  OP1   . DC  D  1  11   ? 43.694  5.572   39.409  1.00 43.66  ? 11   DC  X OP1   1 
ATOM   1290  O  OP2   . DC  D  1  11   ? 45.437  6.230   41.215  1.00 42.39  ? 11   DC  X OP2   1 
ATOM   1291  O  "O5'" . DC  D  1  11   ? 44.183  4.085   41.362  1.00 39.91  ? 11   DC  X "O5'" 1 
ATOM   1292  C  "C5'" . DC  D  1  11   ? 43.090  3.274   40.942  1.00 38.56  ? 11   DC  X "C5'" 1 
ATOM   1293  C  "C4'" . DC  D  1  11   ? 42.148  3.013   42.097  1.00 35.13  ? 11   DC  X "C4'" 1 
ATOM   1294  O  "O4'" . DC  D  1  11   ? 42.819  2.056   42.961  1.00 35.09  ? 11   DC  X "O4'" 1 
ATOM   1295  C  "C3'" . DC  D  1  11   ? 41.806  4.238   42.962  1.00 33.84  ? 11   DC  X "C3'" 1 
ATOM   1296  O  "O3'" . DC  D  1  11   ? 40.448  4.786   42.889  1.00 27.54  ? 11   DC  X "O3'" 1 
ATOM   1297  C  "C2'" . DC  D  1  11   ? 42.371  3.951   44.335  1.00 32.71  ? 11   DC  X "C2'" 1 
ATOM   1298  C  "C1'" . DC  D  1  11   ? 42.803  2.483   44.312  1.00 34.16  ? 11   DC  X "C1'" 1 
ATOM   1299  N  N1    . DC  D  1  11   ? 44.164  2.334   44.868  1.00 32.96  ? 11   DC  X N1    1 
ATOM   1300  C  C2    . DC  D  1  11   ? 44.408  1.365   45.842  1.00 32.03  ? 11   DC  X C2    1 
ATOM   1301  O  O2    . DC  D  1  11   ? 43.497  0.596   46.186  1.00 32.60  ? 11   DC  X O2    1 
ATOM   1302  N  N3    . DC  D  1  11   ? 45.633  1.295   46.396  1.00 31.98  ? 11   DC  X N3    1 
ATOM   1303  C  C4    . DC  D  1  11   ? 46.590  2.131   46.013  1.00 30.27  ? 11   DC  X C4    1 
ATOM   1304  N  N4    . DC  D  1  11   ? 47.764  2.023   46.592  1.00 29.72  ? 11   DC  X N4    1 
ATOM   1305  C  C5    . DC  D  1  11   ? 46.379  3.107   45.019  1.00 30.60  ? 11   DC  X C5    1 
ATOM   1306  C  C6    . DC  D  1  11   ? 45.169  3.169   44.468  1.00 32.40  ? 11   DC  X C6    1 
ATOM   1307  P  P     . DG  D  1  12   ? 39.148  3.961   43.376  1.00 22.39  ? 12   DG  X P     1 
ATOM   1308  O  OP1   . DG  D  1  12   ? 38.780  3.070   42.281  1.00 21.70  ? 12   DG  X OP1   1 
ATOM   1309  O  OP2   . DG  D  1  12   ? 38.181  4.992   43.815  1.00 20.08  ? 12   DG  X OP2   1 
ATOM   1310  O  "O5'" . DG  D  1  12   ? 39.603  3.048   44.597  1.00 19.45  ? 12   DG  X "O5'" 1 
ATOM   1311  C  "C5'" . DG  D  1  12   ? 39.093  1.715   44.715  1.00 20.05  ? 12   DG  X "C5'" 1 
ATOM   1312  C  "C4'" . DG  D  1  12   ? 38.666  1.399   46.134  1.00 20.47  ? 12   DG  X "C4'" 1 
ATOM   1313  O  "O4'" . DG  D  1  12   ? 39.815  0.857   46.850  1.00 22.85  ? 12   DG  X "O4'" 1 
ATOM   1314  C  "C3'" . DG  D  1  12   ? 38.153  2.585   46.958  1.00 23.25  ? 12   DG  X "C3'" 1 
ATOM   1315  O  "O3'" . DG  D  1  12   ? 36.705  2.828   47.032  1.00 21.19  ? 12   DG  X "O3'" 1 
ATOM   1316  C  "C2'" . DG  D  1  12   ? 39.031  2.654   48.198  1.00 23.50  ? 12   DG  X "C2'" 1 
ATOM   1317  C  "C1'" . DG  D  1  12   ? 40.011  1.475   48.124  1.00 24.85  ? 12   DG  X "C1'" 1 
ATOM   1318  N  N9    . DG  D  1  12   ? 41.389  1.987   48.207  1.00 27.20  ? 12   DG  X N9    1 
ATOM   1319  C  C8    . DG  D  1  12   ? 41.932  2.962   47.409  1.00 28.11  ? 12   DG  X C8    1 
ATOM   1320  N  N7    . DG  D  1  12   ? 43.144  3.306   47.753  1.00 27.84  ? 12   DG  X N7    1 
ATOM   1321  C  C5    . DG  D  1  12   ? 43.436  2.499   48.833  1.00 26.15  ? 12   DG  X C5    1 
ATOM   1322  C  C6    . DG  D  1  12   ? 44.601  2.436   49.614  1.00 25.12  ? 12   DG  X C6    1 
ATOM   1323  O  O6    . DG  D  1  12   ? 45.626  3.087   49.490  1.00 26.04  ? 12   DG  X O6    1 
ATOM   1324  N  N1    . DG  D  1  12   ? 44.492  1.496   50.621  1.00 24.79  ? 12   DG  X N1    1 
ATOM   1325  C  C2    . DG  D  1  12   ? 43.382  0.709   50.833  1.00 27.82  ? 12   DG  X C2    1 
ATOM   1326  N  N2    . DG  D  1  12   ? 43.446  -0.148  51.842  1.00 27.92  ? 12   DG  X N2    1 
ATOM   1327  N  N3    . DG  D  1  12   ? 42.280  0.756   50.101  1.00 28.44  ? 12   DG  X N3    1 
ATOM   1328  C  C4    . DG  D  1  12   ? 42.373  1.665   49.125  1.00 27.48  ? 12   DG  X C4    1 
ATOM   1329  P  P     . DT  D  1  13   ? 35.736  2.125   48.114  1.00 20.98  ? 13   DT  X P     1 
ATOM   1330  O  OP1   . DT  D  1  13   ? 35.560  0.743   47.614  1.00 19.17  ? 13   DT  X OP1   1 
ATOM   1331  O  OP2   . DT  D  1  13   ? 34.571  3.012   48.210  1.00 15.28  ? 13   DT  X OP2   1 
ATOM   1332  O  "O5'" . DT  D  1  13   ? 36.471  2.149   49.536  1.00 18.47  ? 13   DT  X "O5'" 1 
ATOM   1333  C  "C5'" . DT  D  1  13   ? 37.082  0.968   50.050  1.00 22.97  ? 13   DT  X "C5'" 1 
ATOM   1334  C  "C4'" . DT  D  1  13   ? 37.066  0.927   51.561  1.00 24.45  ? 13   DT  X "C4'" 1 
ATOM   1335  O  "O4'" . DT  D  1  13   ? 38.468  0.888   51.982  1.00 25.05  ? 13   DT  X "O4'" 1 
ATOM   1336  C  "C3'" . DT  D  1  13   ? 36.351  2.055   52.337  1.00 26.65  ? 13   DT  X "C3'" 1 
ATOM   1337  O  "O3'" . DT  D  1  13   ? 35.341  1.541   53.314  1.00 27.66  ? 13   DT  X "O3'" 1 
ATOM   1338  C  "C2'" . DT  D  1  13   ? 37.514  2.818   52.975  1.00 25.78  ? 13   DT  X "C2'" 1 
ATOM   1339  C  "C1'" . DT  D  1  13   ? 38.751  1.879   52.953  1.00 24.35  ? 13   DT  X "C1'" 1 
ATOM   1340  N  N1    . DT  D  1  13   ? 39.980  2.604   52.529  1.00 21.46  ? 13   DT  X N1    1 
ATOM   1341  C  C2    . DT  D  1  13   ? 41.167  2.561   53.254  1.00 21.06  ? 13   DT  X C2    1 
ATOM   1342  O  O2    . DT  D  1  13   ? 41.362  1.837   54.201  1.00 17.18  ? 13   DT  X O2    1 
ATOM   1343  N  N3    . DT  D  1  13   ? 42.138  3.432   52.807  1.00 22.47  ? 13   DT  X N3    1 
ATOM   1344  C  C4    . DT  D  1  13   ? 42.026  4.298   51.726  1.00 23.30  ? 13   DT  X C4    1 
ATOM   1345  O  O4    . DT  D  1  13   ? 42.922  5.054   51.452  1.00 23.62  ? 13   DT  X O4    1 
ATOM   1346  C  C5    . DT  D  1  13   ? 40.801  4.237   51.001  1.00 22.87  ? 13   DT  X C5    1 
ATOM   1347  C  C7    . DT  D  1  13   ? 40.623  5.139   49.822  1.00 24.26  ? 13   DT  X C7    1 
ATOM   1348  C  C6    . DT  D  1  13   ? 39.866  3.396   51.415  1.00 20.93  ? 13   DT  X C6    1 
ATOM   1349  P  P     . DT  D  1  14   ? 34.199  2.532   54.017  1.00 30.25  ? 14   DT  X P     1 
ATOM   1350  O  OP1   . DT  D  1  14   ? 34.424  3.859   53.399  1.00 27.86  ? 14   DT  X OP1   1 
ATOM   1351  O  OP2   . DT  D  1  14   ? 34.388  2.404   55.490  1.00 28.19  ? 14   DT  X OP2   1 
ATOM   1352  O  "O5'" . DT  D  1  14   ? 32.688  1.993   53.687  1.00 30.41  ? 14   DT  X "O5'" 1 
ATOM   1353  C  "C5'" . DT  D  1  14   ? 31.844  1.365   54.717  1.00 32.33  ? 14   DT  X "C5'" 1 
ATOM   1354  C  "C4'" . DT  D  1  14   ? 30.391  1.190   54.295  1.00 33.65  ? 14   DT  X "C4'" 1 
ATOM   1355  O  "O4'" . DT  D  1  14   ? 29.678  0.571   55.416  1.00 35.27  ? 14   DT  X "O4'" 1 
ATOM   1356  C  "C3'" . DT  D  1  14   ? 29.643  2.491   54.001  1.00 36.83  ? 14   DT  X "C3'" 1 
ATOM   1357  O  "O3'" . DT  D  1  14   ? 28.801  2.407   52.830  1.00 37.44  ? 14   DT  X "O3'" 1 
ATOM   1358  C  "C2'" . DT  D  1  14   ? 28.863  2.791   55.278  1.00 36.21  ? 14   DT  X "C2'" 1 
ATOM   1359  C  "C1'" . DT  D  1  14   ? 28.743  1.472   56.048  1.00 36.96  ? 14   DT  X "C1'" 1 
ATOM   1360  N  N1    . DT  D  1  14   ? 29.146  1.655   57.499  1.00 36.52  ? 14   DT  X N1    1 
ATOM   1361  C  C2    . DT  D  1  14   ? 28.253  1.546   58.576  1.00 36.38  ? 14   DT  X C2    1 
ATOM   1362  O  O2    . DT  D  1  14   ? 27.075  1.264   58.462  1.00 34.27  ? 14   DT  X O2    1 
ATOM   1363  N  N3    . DT  D  1  14   ? 28.818  1.797   59.820  1.00 37.90  ? 14   DT  X N3    1 
ATOM   1364  C  C4    . DT  D  1  14   ? 30.133  2.134   60.081  1.00 39.06  ? 14   DT  X C4    1 
ATOM   1365  O  O4    . DT  D  1  14   ? 30.508  2.327   61.254  1.00 42.19  ? 14   DT  X O4    1 
ATOM   1366  C  C5    . DT  D  1  14   ? 30.986  2.220   58.911  1.00 38.07  ? 14   DT  X C5    1 
ATOM   1367  C  C7    . DT  D  1  14   ? 32.426  2.588   59.076  1.00 39.16  ? 14   DT  X C7    1 
ATOM   1368  C  C6    . DT  D  1  14   ? 30.457  1.974   57.720  1.00 36.87  ? 14   DT  X C6    1 
ATOM   1369  P  P     . DC  D  1  15   ? 28.420  3.764   52.014  1.00 37.45  ? 15   DC  X P     1 
ATOM   1370  O  OP1   . DC  D  1  15   ? 28.674  3.573   50.535  1.00 38.15  ? 15   DC  X OP1   1 
ATOM   1371  O  OP2   . DC  D  1  15   ? 29.108  4.887   52.738  1.00 34.39  ? 15   DC  X OP2   1 
ATOM   1372  O  "O5'" . DC  D  1  15   ? 26.842  3.892   52.233  1.00 31.39  ? 15   DC  X "O5'" 1 
ATOM   1373  C  "C5'" . DC  D  1  15   ? 26.188  3.010   53.132  1.00 25.72  ? 15   DC  X "C5'" 1 
ATOM   1374  C  "C4'" . DC  D  1  15   ? 25.066  3.716   53.840  1.00 24.03  ? 15   DC  X "C4'" 1 
ATOM   1375  O  "O4'" . DC  D  1  15   ? 25.156  3.374   55.263  1.00 25.18  ? 15   DC  X "O4'" 1 
ATOM   1376  C  "C3'" . DC  D  1  15   ? 25.067  5.240   53.731  1.00 25.09  ? 15   DC  X "C3'" 1 
ATOM   1377  O  "O3'" . DC  D  1  15   ? 23.995  5.752   52.921  1.00 24.30  ? 15   DC  X "O3'" 1 
ATOM   1378  C  "C2'" . DC  D  1  15   ? 24.940  5.709   55.173  1.00 26.72  ? 15   DC  X "C2'" 1 
ATOM   1379  C  "C1'" . DC  D  1  15   ? 24.729  4.468   56.068  1.00 27.27  ? 15   DC  X "C1'" 1 
ATOM   1380  N  N1    . DC  D  1  15   ? 25.551  4.550   57.349  1.00 27.64  ? 15   DC  X N1    1 
ATOM   1381  C  C2    . DC  D  1  15   ? 24.900  4.567   58.639  1.00 27.82  ? 15   DC  X C2    1 
ATOM   1382  O  O2    . DC  D  1  15   ? 23.687  4.338   58.726  1.00 29.03  ? 15   DC  X O2    1 
ATOM   1383  N  N3    . DC  D  1  15   ? 25.641  4.851   59.753  1.00 26.94  ? 15   DC  X N3    1 
ATOM   1384  C  C4    . DC  D  1  15   ? 26.945  5.087   59.648  1.00 28.87  ? 15   DC  X C4    1 
ATOM   1385  N  N4    . DC  D  1  15   ? 27.607  5.408   60.772  1.00 27.03  ? 15   DC  X N4    1 
ATOM   1386  C  C5    . DC  D  1  15   ? 27.631  5.009   58.392  1.00 26.52  ? 15   DC  X C5    1 
ATOM   1387  C  C6    . DC  D  1  15   ? 26.911  4.722   57.289  1.00 27.13  ? 15   DC  X C6    1 
ATOM   1388  P  P     . DG  D  1  16   ? 24.099  7.239   52.248  1.00 24.87  ? 16   DG  X P     1 
ATOM   1389  O  OP1   . DG  D  1  16   ? 23.445  7.198   50.910  1.00 24.77  ? 16   DG  X OP1   1 
ATOM   1390  O  OP2   . DG  D  1  16   ? 25.456  7.852   52.345  1.00 20.84  ? 16   DG  X OP2   1 
ATOM   1391  O  "O5'" . DG  D  1  16   ? 23.107  8.089   53.151  1.00 22.42  ? 16   DG  X "O5'" 1 
ATOM   1392  C  "C5'" . DG  D  1  16   ? 21.722  7.773   53.145  1.00 22.97  ? 16   DG  X "C5'" 1 
ATOM   1393  C  "C4'" . DG  D  1  16   ? 21.034  8.279   54.390  1.00 23.95  ? 16   DG  X "C4'" 1 
ATOM   1394  O  "O4'" . DG  D  1  16   ? 21.604  7.592   55.545  1.00 26.43  ? 16   DG  X "O4'" 1 
ATOM   1395  C  "C3'" . DG  D  1  16   ? 21.212  9.773   54.660  1.00 25.12  ? 16   DG  X "C3'" 1 
ATOM   1396  O  "O3'" . DG  D  1  16   ? 20.053  10.578  54.480  1.00 22.13  ? 16   DG  X "O3'" 1 
ATOM   1397  C  "C2'" . DG  D  1  16   ? 21.609  9.858   56.123  1.00 25.50  ? 16   DG  X "C2'" 1 
ATOM   1398  C  "C1'" . DG  D  1  16   ? 21.548  8.442   56.680  1.00 26.19  ? 16   DG  X "C1'" 1 
ATOM   1399  N  N9    . DG  D  1  16   ? 22.755  8.274   57.494  1.00 27.50  ? 16   DG  X N9    1 
ATOM   1400  C  C8    . DG  D  1  16   ? 24.038  8.081   57.049  1.00 28.39  ? 16   DG  X C8    1 
ATOM   1401  N  N7    . DG  D  1  16   ? 24.936  8.198   57.989  1.00 27.34  ? 16   DG  X N7    1 
ATOM   1402  C  C5    . DG  D  1  16   ? 24.201  8.436   59.132  1.00 26.19  ? 16   DG  X C5    1 
ATOM   1403  C  C6    . DG  D  1  16   ? 24.631  8.653   60.428  1.00 26.97  ? 16   DG  X C6    1 
ATOM   1404  O  O6    . DG  D  1  16   ? 25.790  8.687   60.843  1.00 31.37  ? 16   DG  X O6    1 
ATOM   1405  N  N1    . DG  D  1  16   ? 23.565  8.849   61.293  1.00 25.94  ? 16   DG  X N1    1 
ATOM   1406  C  C2    . DG  D  1  16   ? 22.242  8.837   60.921  1.00 25.92  ? 16   DG  X C2    1 
ATOM   1407  N  N2    . DG  D  1  16   ? 21.335  9.048   61.879  1.00 26.00  ? 16   DG  X N2    1 
ATOM   1408  N  N3    . DG  D  1  16   ? 21.831  8.635   59.699  1.00 25.52  ? 16   DG  X N3    1 
ATOM   1409  C  C4    . DG  D  1  16   ? 22.853  8.444   58.857  1.00 26.54  ? 16   DG  X C4    1 
ATOM   1410  P  P     . DC  D  1  17   ? 20.221  12.179  54.522  1.00 25.75  ? 17   DC  X P     1 
ATOM   1411  O  OP1   . DC  D  1  17   ? 19.134  12.918  53.818  1.00 22.95  ? 17   DC  X OP1   1 
ATOM   1412  O  OP2   . DC  D  1  17   ? 21.615  12.429  54.097  1.00 22.89  ? 17   DC  X OP2   1 
ATOM   1413  O  "O5'" . DC  D  1  17   ? 20.162  12.501  56.088  1.00 24.06  ? 17   DC  X "O5'" 1 
ATOM   1414  C  "C5'" . DC  D  1  17   ? 19.019  12.141  56.886  1.00 22.71  ? 17   DC  X "C5'" 1 
ATOM   1415  C  "C4'" . DC  D  1  17   ? 19.042  12.866  58.213  1.00 20.08  ? 17   DC  X "C4'" 1 
ATOM   1416  O  "O4'" . DC  D  1  17   ? 19.929  12.156  59.117  1.00 19.83  ? 17   DC  X "O4'" 1 
ATOM   1417  C  "C3'" . DC  D  1  17   ? 19.563  14.302  58.116  1.00 23.62  ? 17   DC  X "C3'" 1 
ATOM   1418  O  "O3'" . DC  D  1  17   ? 18.660  15.321  58.564  1.00 23.96  ? 17   DC  X "O3'" 1 
ATOM   1419  C  "C2'" . DC  D  1  17   ? 20.803  14.311  58.981  1.00 21.47  ? 17   DC  X "C2'" 1 
ATOM   1420  C  "C1'" . DC  D  1  17   ? 20.725  13.071  59.839  1.00 21.45  ? 17   DC  X "C1'" 1 
ATOM   1421  N  N1    . DC  D  1  17   ? 22.113  12.565  59.954  1.00 22.36  ? 17   DC  X N1    1 
ATOM   1422  C  C2    . DC  D  1  17   ? 22.787  12.735  61.176  1.00 22.84  ? 17   DC  X C2    1 
ATOM   1423  O  O2    . DC  D  1  17   ? 22.153  13.095  62.162  1.00 21.94  ? 17   DC  X O2    1 
ATOM   1424  N  N3    . DC  D  1  17   ? 24.119  12.508  61.241  1.00 24.44  ? 17   DC  X N3    1 
ATOM   1425  C  C4    . DC  D  1  17   ? 24.781  12.105  60.156  1.00 26.34  ? 17   DC  X C4    1 
ATOM   1426  N  N4    . DC  D  1  17   ? 26.108  11.957  60.272  1.00 27.75  ? 17   DC  X N4    1 
ATOM   1427  C  C5    . DC  D  1  17   ? 24.114  11.847  58.915  1.00 24.28  ? 17   DC  X C5    1 
ATOM   1428  C  C6    . DC  D  1  17   ? 22.784  12.061  58.868  1.00 22.33  ? 17   DC  X C6    1 
ATOM   1429  P  P     . DG  D  1  18   ? 19.025  16.887  58.308  1.00 26.18  ? 18   DG  X P     1 
ATOM   1430  O  OP1   . DG  D  1  18   ? 17.914  17.582  57.622  1.00 25.97  ? 18   DG  X OP1   1 
ATOM   1431  O  OP2   . DG  D  1  18   ? 20.387  16.959  57.709  1.00 24.40  ? 18   DG  X OP2   1 
ATOM   1432  O  "O5'" . DG  D  1  18   ? 19.088  17.467  59.786  1.00 22.91  ? 18   DG  X "O5'" 1 
ATOM   1433  C  "C5'" . DG  D  1  18   ? 19.602  16.652  60.837  1.00 20.91  ? 18   DG  X "C5'" 1 
ATOM   1434  C  "C4'" . DG  D  1  18   ? 19.679  17.417  62.131  1.00 18.22  ? 18   DG  X "C4'" 1 
ATOM   1435  O  "O4'" . DG  D  1  18   ? 20.545  16.609  62.948  1.00 17.49  ? 18   DG  X "O4'" 1 
ATOM   1436  C  "C3'" . DG  D  1  18   ? 20.363  18.768  61.990  1.00 22.15  ? 18   DG  X "C3'" 1 
ATOM   1437  O  "O3'" . DG  D  1  18   ? 19.615  19.862  62.486  1.00 26.28  ? 18   DG  X "O3'" 1 
ATOM   1438  C  "C2'" . DG  D  1  18   ? 21.658  18.672  62.757  1.00 17.33  ? 18   DG  X "C2'" 1 
ATOM   1439  C  "C1'" . DG  D  1  18   ? 21.713  17.292  63.330  1.00 17.86  ? 18   DG  X "C1'" 1 
ATOM   1440  N  N9    . DG  D  1  18   ? 22.833  16.708  62.627  1.00 18.23  ? 18   DG  X N9    1 
ATOM   1441  C  C8    . DG  D  1  18   ? 22.895  16.254  61.329  1.00 18.69  ? 18   DG  X C8    1 
ATOM   1442  N  N7    . DG  D  1  18   ? 24.109  15.960  60.956  1.00 20.55  ? 18   DG  X N7    1 
ATOM   1443  C  C5    . DG  D  1  18   ? 24.867  16.194  62.090  1.00 20.10  ? 18   DG  X C5    1 
ATOM   1444  C  C6    . DG  D  1  18   ? 26.237  16.053  62.307  1.00 21.96  ? 18   DG  X C6    1 
ATOM   1445  O  O6    . DG  D  1  18   ? 27.094  15.698  61.512  1.00 26.11  ? 18   DG  X O6    1 
ATOM   1446  N  N1    . DG  D  1  18   ? 26.584  16.387  63.608  1.00 20.07  ? 18   DG  X N1    1 
ATOM   1447  C  C2    . DG  D  1  18   ? 25.706  16.820  64.554  1.00 20.76  ? 18   DG  X C2    1 
ATOM   1448  N  N2    . DG  D  1  18   ? 26.186  17.116  65.734  1.00 22.89  ? 18   DG  X N2    1 
ATOM   1449  N  N3    . DG  D  1  18   ? 24.427  16.961  64.358  1.00 18.67  ? 18   DG  X N3    1 
ATOM   1450  C  C4    . DG  D  1  18   ? 24.079  16.630  63.122  1.00 18.91  ? 18   DG  X C4    1 
ATOM   1451  P  P     . DC  D  1  19   ? 19.934  21.328  61.909  1.00 30.52  ? 19   DC  X P     1 
ATOM   1452  O  OP1   . DC  D  1  19   ? 18.690  22.115  61.740  1.00 27.87  ? 19   DC  X OP1   1 
ATOM   1453  O  OP2   . DC  D  1  19   ? 20.812  21.117  60.722  1.00 30.50  ? 19   DC  X OP2   1 
ATOM   1454  O  "O5'" . DC  D  1  19   ? 20.844  21.972  63.041  1.00 26.47  ? 19   DC  X "O5'" 1 
ATOM   1455  C  "C5'" . DC  D  1  19   ? 20.980  21.363  64.310  1.00 24.38  ? 19   DC  X "C5'" 1 
ATOM   1456  C  "C4'" . DC  D  1  19   ? 22.298  21.769  64.907  1.00 24.64  ? 19   DC  X "C4'" 1 
ATOM   1457  O  "O4'" . DC  D  1  19   ? 23.314  20.823  64.507  1.00 28.86  ? 19   DC  X "O4'" 1 
ATOM   1458  C  "C3'" . DC  D  1  19   ? 22.745  23.135  64.386  1.00 26.16  ? 19   DC  X "C3'" 1 
ATOM   1459  O  "O3'" . DC  D  1  19   ? 22.970  24.102  65.401  1.00 24.75  ? 19   DC  X "O3'" 1 
ATOM   1460  C  "C2'" . DC  D  1  19   ? 24.031  22.856  63.641  1.00 26.68  ? 19   DC  X "C2'" 1 
ATOM   1461  C  "C1'" . DC  D  1  19   ? 24.492  21.529  64.186  1.00 29.33  ? 19   DC  X "C1'" 1 
ATOM   1462  N  N1    . DC  D  1  19   ? 25.221  20.785  63.156  1.00 33.16  ? 19   DC  X N1    1 
ATOM   1463  C  C2    . DC  D  1  19   ? 26.572  20.512  63.357  1.00 34.70  ? 19   DC  X C2    1 
ATOM   1464  O  O2    . DC  D  1  19   ? 27.077  20.792  64.440  1.00 37.07  ? 19   DC  X O2    1 
ATOM   1465  N  N3    . DC  D  1  19   ? 27.288  19.956  62.362  1.00 35.12  ? 19   DC  X N3    1 
ATOM   1466  C  C4    . DC  D  1  19   ? 26.702  19.655  61.212  1.00 36.44  ? 19   DC  X C4    1 
ATOM   1467  N  N4    . DC  D  1  19   ? 27.454  19.129  60.249  1.00 39.15  ? 19   DC  X N4    1 
ATOM   1468  C  C5    . DC  D  1  19   ? 25.314  19.878  60.993  1.00 36.45  ? 19   DC  X C5    1 
ATOM   1469  C  C6    . DC  D  1  19   ? 24.615  20.428  61.988  1.00 34.23  ? 19   DC  X C6    1 
ATOM   1470  P  P     . DG  D  1  20   ? 23.093  25.656  64.993  1.00 26.23  ? 20   DG  X P     1 
ATOM   1471  O  OP1   . DG  D  1  20   ? 22.697  26.461  66.148  1.00 23.13  ? 20   DG  X OP1   1 
ATOM   1472  O  OP2   . DG  D  1  20   ? 22.406  25.866  63.700  1.00 24.50  ? 20   DG  X OP2   1 
ATOM   1473  O  "O5'" . DG  D  1  20   ? 24.652  25.842  64.778  1.00 22.47  ? 20   DG  X "O5'" 1 
ATOM   1474  C  "C5'" . DG  D  1  20   ? 25.539  25.493  65.815  1.00 25.53  ? 20   DG  X "C5'" 1 
ATOM   1475  C  "C4'" . DG  D  1  20   ? 26.950  25.834  65.422  1.00 28.04  ? 20   DG  X "C4'" 1 
ATOM   1476  O  "O4'" . DG  D  1  20   ? 27.579  24.705  64.772  1.00 32.70  ? 20   DG  X "O4'" 1 
ATOM   1477  C  "C3'" . DG  D  1  20   ? 27.024  27.006  64.457  1.00 29.71  ? 20   DG  X "C3'" 1 
ATOM   1478  O  "O3'" . DG  D  1  20   ? 27.927  27.997  64.944  1.00 29.03  ? 20   DG  X "O3'" 1 
ATOM   1479  C  "C2'" . DG  D  1  20   ? 27.471  26.369  63.154  1.00 33.27  ? 20   DG  X "C2'" 1 
ATOM   1480  C  "C1'" . DG  D  1  20   ? 28.226  25.136  63.600  1.00 36.56  ? 20   DG  X "C1'" 1 
ATOM   1481  N  N9    . DG  D  1  20   ? 28.165  24.061  62.614  1.00 42.89  ? 20   DG  X N9    1 
ATOM   1482  C  C8    . DG  D  1  20   ? 27.040  23.528  62.033  1.00 44.95  ? 20   DG  X C8    1 
ATOM   1483  N  N7    . DG  D  1  20   ? 27.311  22.652  61.100  1.00 47.12  ? 20   DG  X N7    1 
ATOM   1484  C  C5    . DG  D  1  20   ? 28.695  22.586  61.081  1.00 47.91  ? 20   DG  X C5    1 
ATOM   1485  C  C6    . DG  D  1  20   ? 29.566  21.821  60.266  1.00 49.87  ? 20   DG  X C6    1 
ATOM   1486  O  O6    . DG  D  1  20   ? 29.273  21.025  59.359  1.00 50.84  ? 20   DG  X O6    1 
ATOM   1487  N  N1    . DG  D  1  20   ? 30.907  22.058  60.586  1.00 50.95  ? 20   DG  X N1    1 
ATOM   1488  C  C2    . DG  D  1  20   ? 31.341  22.927  61.561  1.00 49.46  ? 20   DG  X C2    1 
ATOM   1489  N  N2    . DG  D  1  20   ? 32.660  23.023  61.727  1.00 49.80  ? 20   DG  X N2    1 
ATOM   1490  N  N3    . DG  D  1  20   ? 30.539  23.650  62.319  1.00 47.52  ? 20   DG  X N3    1 
ATOM   1491  C  C4    . DG  D  1  20   ? 29.238  23.432  62.027  1.00 46.43  ? 20   DG  X C4    1 
ATOM   1492  P  P     . DC  D  1  21   ? 28.279  29.282  64.039  1.00 29.38  ? 21   DC  X P     1 
ATOM   1493  O  OP1   . DC  D  1  21   ? 28.522  30.462  64.881  1.00 25.64  ? 21   DC  X OP1   1 
ATOM   1494  O  OP2   . DC  D  1  21   ? 27.242  29.355  62.995  1.00 27.12  ? 21   DC  X OP2   1 
ATOM   1495  O  "O5'" . DC  D  1  21   ? 29.688  28.861  63.419  1.00 29.91  ? 21   DC  X "O5'" 1 
ATOM   1496  C  "C5'" . DC  D  1  21   ? 30.649  28.127  64.211  1.00 30.01  ? 21   DC  X "C5'" 1 
ATOM   1497  C  "C4'" . DC  D  1  21   ? 31.926  27.923  63.434  1.00 30.71  ? 21   DC  X "C4'" 1 
ATOM   1498  O  "O4'" . DC  D  1  21   ? 31.824  26.767  62.560  1.00 32.18  ? 21   DC  X "O4'" 1 
ATOM   1499  C  "C3'" . DC  D  1  21   ? 32.230  29.119  62.538  1.00 33.10  ? 21   DC  X "C3'" 1 
ATOM   1500  O  "O3'" . DC  D  1  21   ? 33.606  29.484  62.601  1.00 36.50  ? 21   DC  X "O3'" 1 
ATOM   1501  C  "C2'" . DC  D  1  21   ? 31.854  28.624  61.154  1.00 33.53  ? 21   DC  X "C2'" 1 
ATOM   1502  C  "C1'" . DC  D  1  21   ? 32.168  27.139  61.235  1.00 33.11  ? 21   DC  X "C1'" 1 
ATOM   1503  N  N1    . DC  D  1  21   ? 31.410  26.290  60.283  1.00 34.27  ? 21   DC  X N1    1 
ATOM   1504  C  C2    . DC  D  1  21   ? 32.114  25.482  59.365  1.00 34.32  ? 21   DC  X C2    1 
ATOM   1505  O  O2    . DC  D  1  21   ? 33.350  25.491  59.379  1.00 35.62  ? 21   DC  X O2    1 
ATOM   1506  N  N3    . DC  D  1  21   ? 31.421  24.721  58.485  1.00 33.95  ? 21   DC  X N3    1 
ATOM   1507  C  C4    . DC  D  1  21   ? 30.093  24.744  58.485  1.00 35.14  ? 21   DC  X C4    1 
ATOM   1508  N  N4    . DC  D  1  21   ? 29.463  23.984  57.599  1.00 35.35  ? 21   DC  X N4    1 
ATOM   1509  C  C5    . DC  D  1  21   ? 29.353  25.549  59.396  1.00 35.69  ? 21   DC  X C5    1 
ATOM   1510  C  C6    . DC  D  1  21   ? 30.044  26.295  60.274  1.00 35.56  ? 21   DC  X C6    1 
ATOM   1511  P  P     . DC  D  1  22   ? 34.080  30.890  61.973  1.00 40.54  ? 22   DC  X P     1 
ATOM   1512  O  OP1   . DC  D  1  22   ? 35.173  31.467  62.800  1.00 37.53  ? 22   DC  X OP1   1 
ATOM   1513  O  OP2   . DC  D  1  22   ? 32.831  31.658  61.774  1.00 36.65  ? 22   DC  X OP2   1 
ATOM   1514  O  "O5'" . DC  D  1  22   ? 34.680  30.504  60.539  1.00 40.86  ? 22   DC  X "O5'" 1 
ATOM   1515  C  "C5'" . DC  D  1  22   ? 35.863  29.697  60.407  1.00 42.49  ? 22   DC  X "C5'" 1 
ATOM   1516  C  "C4'" . DC  D  1  22   ? 36.261  29.580  58.953  1.00 43.98  ? 22   DC  X "C4'" 1 
ATOM   1517  O  "O4'" . DC  D  1  22   ? 35.575  28.491  58.276  1.00 44.38  ? 22   DC  X "O4'" 1 
ATOM   1518  C  "C3'" . DC  D  1  22   ? 35.928  30.843  58.173  1.00 47.01  ? 22   DC  X "C3'" 1 
ATOM   1519  O  "O3'" . DC  D  1  22   ? 36.976  31.219  57.318  1.00 54.02  ? 22   DC  X "O3'" 1 
ATOM   1520  C  "C2'" . DC  D  1  22   ? 34.736  30.449  57.326  1.00 45.34  ? 22   DC  X "C2'" 1 
ATOM   1521  C  "C1'" . DC  D  1  22   ? 34.990  28.987  57.079  1.00 43.31  ? 22   DC  X "C1'" 1 
ATOM   1522  N  N1    . DC  D  1  22   ? 33.769  28.217  56.778  1.00 40.77  ? 22   DC  X N1    1 
ATOM   1523  C  C2    . DC  D  1  22   ? 33.839  27.281  55.791  1.00 40.76  ? 22   DC  X C2    1 
ATOM   1524  O  O2    . DC  D  1  22   ? 34.923  27.100  55.249  1.00 42.21  ? 22   DC  X O2    1 
ATOM   1525  N  N3    . DC  D  1  22   ? 32.735  26.593  55.438  1.00 39.23  ? 22   DC  X N3    1 
ATOM   1526  C  C4    . DC  D  1  22   ? 31.587  26.826  56.049  1.00 39.69  ? 22   DC  X C4    1 
ATOM   1527  N  N4    . DC  D  1  22   ? 30.528  26.134  55.659  1.00 38.86  ? 22   DC  X N4    1 
ATOM   1528  C  C5    . DC  D  1  22   ? 31.479  27.779  57.089  1.00 39.47  ? 22   DC  X C5    1 
ATOM   1529  C  C6    . DC  D  1  22   ? 32.588  28.442  57.428  1.00 38.83  ? 22   DC  X C6    1 
ATOM   1530  P  P     . DG  D  1  23   ? 36.949  32.681  56.673  1.00 61.87  ? 23   DG  X P     1 
ATOM   1531  O  OP1   . DG  D  1  23   ? 37.865  33.539  57.473  1.00 61.76  ? 23   DG  X OP1   1 
ATOM   1532  O  OP2   . DG  D  1  23   ? 35.519  33.079  56.522  1.00 62.12  ? 23   DG  X OP2   1 
ATOM   1533  O  "O5'" . DG  D  1  23   ? 37.535  32.473  55.202  1.00 62.44  ? 23   DG  X "O5'" 1 
ATOM   1534  C  "C5'" . DG  D  1  23   ? 38.775  31.792  54.983  1.00 65.13  ? 23   DG  X "C5'" 1 
ATOM   1535  C  "C4'" . DG  D  1  23   ? 38.886  31.366  53.540  1.00 65.70  ? 23   DG  X "C4'" 1 
ATOM   1536  O  "O4'" . DG  D  1  23   ? 37.757  30.508  53.251  1.00 67.13  ? 23   DG  X "O4'" 1 
ATOM   1537  C  "C3'" . DG  D  1  23   ? 38.799  32.517  52.540  1.00 67.89  ? 23   DG  X "C3'" 1 
ATOM   1538  O  "O3'" . DG  D  1  23   ? 39.624  32.233  51.391  1.00 68.33  ? 23   DG  X "O3'" 1 
ATOM   1539  C  "C2'" . DG  D  1  23   ? 37.309  32.587  52.222  1.00 69.14  ? 23   DG  X "C2'" 1 
ATOM   1540  C  "C1'" . DG  D  1  23   ? 36.869  31.135  52.328  1.00 68.12  ? 23   DG  X "C1'" 1 
ATOM   1541  N  N9    . DG  D  1  23   ? 35.500  30.923  52.798  1.00 67.53  ? 23   DG  X N9    1 
ATOM   1542  C  C8    . DG  D  1  23   ? 34.867  31.545  53.843  1.00 67.30  ? 23   DG  X C8    1 
ATOM   1543  N  N7    . DG  D  1  23   ? 33.638  31.142  54.011  1.00 67.50  ? 23   DG  X N7    1 
ATOM   1544  C  C5    . DG  D  1  23   ? 33.449  30.198  53.016  1.00 67.41  ? 23   DG  X C5    1 
ATOM   1545  C  C6    . DG  D  1  23   ? 32.315  29.421  52.696  1.00 67.89  ? 23   DG  X C6    1 
ATOM   1546  O  O6    . DG  D  1  23   ? 31.210  29.416  53.243  1.00 65.22  ? 23   DG  X O6    1 
ATOM   1547  N  N1    . DG  D  1  23   ? 32.564  28.583  51.609  1.00 69.75  ? 23   DG  X N1    1 
ATOM   1548  C  C2    . DG  D  1  23   ? 33.756  28.510  50.923  1.00 70.17  ? 23   DG  X C2    1 
ATOM   1549  N  N2    . DG  D  1  23   ? 33.827  27.645  49.893  1.00 70.91  ? 23   DG  X N2    1 
ATOM   1550  N  N3    . DG  D  1  23   ? 34.811  29.234  51.219  1.00 69.25  ? 23   DG  X N3    1 
ATOM   1551  C  C4    . DG  D  1  23   ? 34.591  30.049  52.263  1.00 67.99  ? 23   DG  X C4    1 
ATOM   1552  O  OP3   . G   E  2  1    ? -6.801  32.802  33.879  1.00 84.07  ? 1    G   Y OP3   1 
ATOM   1553  P  P     . G   E  2  1    ? -6.013  33.284  35.273  1.00 84.63  ? 1    G   Y P     1 
ATOM   1554  O  OP1   . G   E  2  1    ? -6.556  34.591  35.715  1.00 83.62  ? 1    G   Y OP1   1 
ATOM   1555  O  OP2   . G   E  2  1    ? -6.217  32.277  36.324  1.00 83.55  ? 1    G   Y OP2   1 
ATOM   1556  O  "O5'" . G   E  2  1    ? -4.444  33.451  34.976  1.00 85.85  ? 1    G   Y "O5'" 1 
ATOM   1557  C  "C5'" . G   E  2  1    ? -3.490  33.282  36.084  1.00 87.51  ? 1    G   Y "C5'" 1 
ATOM   1558  C  "C4'" . G   E  2  1    ? -2.034  33.463  35.638  1.00 88.73  ? 1    G   Y "C4'" 1 
ATOM   1559  O  "O4'" . G   E  2  1    ? -2.024  34.057  34.315  1.00 87.13  ? 1    G   Y "O4'" 1 
ATOM   1560  C  "C3'" . G   E  2  1    ? -1.158  34.486  36.398  1.00 90.59  ? 1    G   Y "C3'" 1 
ATOM   1561  O  "O3'" . G   E  2  1    ? -0.218  33.792  37.211  1.00 95.51  ? 1    G   Y "O3'" 1 
ATOM   1562  C  "C2'" . G   E  2  1    ? -0.165  35.060  35.394  1.00 88.74  ? 1    G   Y "C2'" 1 
ATOM   1563  O  "O2'" . G   E  2  1    ? 1.052   34.341  35.318  1.00 87.76  ? 1    G   Y "O2'" 1 
ATOM   1564  C  "C1'" . G   E  2  1    ? -0.890  34.862  34.078  1.00 86.59  ? 1    G   Y "C1'" 1 
ATOM   1565  N  N9    . G   E  2  1    ? -1.369  36.015  33.370  1.00 83.71  ? 1    G   Y N9    1 
ATOM   1566  C  C8    . G   E  2  1    ? -2.447  36.830  33.662  1.00 82.78  ? 1    G   Y C8    1 
ATOM   1567  N  N7    . G   E  2  1    ? -2.547  37.832  32.825  1.00 81.70  ? 1    G   Y N7    1 
ATOM   1568  C  C5    . G   E  2  1    ? -1.498  37.648  31.929  1.00 80.32  ? 1    G   Y C5    1 
ATOM   1569  C  C6    . G   E  2  1    ? -1.098  38.427  30.811  1.00 78.36  ? 1    G   Y C6    1 
ATOM   1570  O  O6    . G   E  2  1    ? -1.597  39.464  30.390  1.00 77.19  ? 1    G   Y O6    1 
ATOM   1571  N  N1    . G   E  2  1    ? 0.006   37.880  30.166  1.00 77.22  ? 1    G   Y N1    1 
ATOM   1572  C  C2    . G   E  2  1    ? 0.650   36.730  30.542  1.00 78.17  ? 1    G   Y C2    1 
ATOM   1573  N  N2    . G   E  2  1    ? 1.692   36.384  29.778  1.00 76.82  ? 1    G   Y N2    1 
ATOM   1574  N  N3    . G   E  2  1    ? 0.298   35.996  31.591  1.00 80.05  ? 1    G   Y N3    1 
ATOM   1575  C  C4    . G   E  2  1    ? -0.782  36.542  32.238  1.00 81.70  ? 1    G   Y C4    1 
ATOM   1576  P  P     . A   E  2  2    ? -0.566  32.978  38.514  1.00 99.77  ? 2    A   Y P     1 
ATOM   1577  O  OP1   . A   E  2  2    ? -1.837  32.234  38.330  1.00 99.90  ? 2    A   Y OP1   1 
ATOM   1578  O  OP2   . A   E  2  2    ? -0.686  33.866  39.678  1.00 99.89  ? 2    A   Y OP2   1 
ATOM   1579  O  "O5'" . A   E  2  2    ? 0.649   31.937  38.706  1.00 97.97  ? 2    A   Y "O5'" 1 
ATOM   1580  C  "C5'" . A   E  2  2    ? 1.593   32.189  39.737  1.00 96.18  ? 2    A   Y "C5'" 1 
ATOM   1581  C  "C4'" . A   E  2  2    ? 2.669   33.117  39.221  1.00 94.76  ? 2    A   Y "C4'" 1 
ATOM   1582  O  "O4'" . A   E  2  2    ? 2.779   34.226  40.134  1.00 94.27  ? 2    A   Y "O4'" 1 
ATOM   1583  C  "C3'" . A   E  2  2    ? 4.053   32.558  39.228  1.00 94.33  ? 2    A   Y "C3'" 1 
ATOM   1584  O  "O3'" . A   E  2  2    ? 4.117   32.124  37.925  1.00 93.48  ? 2    A   Y "O3'" 1 
ATOM   1585  C  "C2'" . A   E  2  2    ? 5.014   33.722  39.371  1.00 93.51  ? 2    A   Y "C2'" 1 
ATOM   1586  O  "O2'" . A   E  2  2    ? 5.394   34.297  38.132  1.00 92.76  ? 2    A   Y "O2'" 1 
ATOM   1587  C  "C1'" . A   E  2  2    ? 4.112   34.577  40.265  1.00 93.28  ? 2    A   Y "C1'" 1 
ATOM   1588  N  N9    . A   E  2  2    ? 4.487   33.804  41.403  1.00 92.82  ? 2    A   Y N9    1 
ATOM   1589  C  C8    . A   E  2  2    ? 4.099   32.527  41.738  1.00 92.08  ? 2    A   Y C8    1 
ATOM   1590  N  N7    . A   E  2  2    ? 4.593   32.133  42.862  1.00 91.81  ? 2    A   Y N7    1 
ATOM   1591  C  C5    . A   E  2  2    ? 5.356   33.219  43.289  1.00 92.13  ? 2    A   Y C5    1 
ATOM   1592  C  C6    . A   E  2  2    ? 6.144   33.439  44.447  1.00 91.98  ? 2    A   Y C6    1 
ATOM   1593  N  N6    . A   E  2  2    ? 6.293   32.507  45.427  1.00 92.18  ? 2    A   Y N6    1 
ATOM   1594  N  N1    . A   E  2  2    ? 6.778   34.635  44.561  1.00 91.66  ? 2    A   Y N1    1 
ATOM   1595  C  C2    . A   E  2  2    ? 6.627   35.542  43.580  1.00 91.47  ? 2    A   Y C2    1 
ATOM   1596  N  N3    . A   E  2  2    ? 5.919   35.455  42.451  1.00 91.72  ? 2    A   Y N3    1 
ATOM   1597  C  C4    . A   E  2  2    ? 5.300   34.256  42.394  1.00 92.36  ? 2    A   Y C4    1 
ATOM   1598  P  P     . G   E  2  3    ? 5.297   31.257  37.438  1.00 93.36  ? 3    G   Y P     1 
ATOM   1599  O  OP1   . G   E  2  3    ? 5.327   31.252  35.959  1.00 93.33  ? 3    G   Y OP1   1 
ATOM   1600  O  OP2   . G   E  2  3    ? 5.154   29.851  37.918  1.00 92.51  ? 3    G   Y OP2   1 
ATOM   1601  O  "O5'" . G   E  2  3    ? 6.648   31.962  37.984  1.00 92.06  ? 3    G   Y "O5'" 1 
ATOM   1602  C  "C5'" . G   E  2  3    ? 7.793   32.208  37.076  1.00 90.97  ? 3    G   Y "C5'" 1 
ATOM   1603  C  "C4'" . G   E  2  3    ? 8.945   32.785  37.895  1.00 89.73  ? 3    G   Y "C4'" 1 
ATOM   1604  O  "O4'" . G   E  2  3    ? 8.382   32.946  39.210  1.00 89.23  ? 3    G   Y "O4'" 1 
ATOM   1605  C  "C3'" . G   E  2  3    ? 10.206  31.926  38.135  1.00 89.97  ? 3    G   Y "C3'" 1 
ATOM   1606  O  "O3'" . G   E  2  3    ? 11.311  32.119  37.225  1.00 91.02  ? 3    G   Y "O3'" 1 
ATOM   1607  C  "C2'" . G   E  2  3    ? 10.647  32.393  39.515  1.00 89.42  ? 3    G   Y "C2'" 1 
ATOM   1608  O  "O2'" . G   E  2  3    ? 11.481  33.543  39.479  1.00 89.73  ? 3    G   Y "O2'" 1 
ATOM   1609  C  "C1'" . G   E  2  3    ? 9.321   32.689  40.174  1.00 88.69  ? 3    G   Y "C1'" 1 
ATOM   1610  N  N9    . G   E  2  3    ? 8.762   31.539  40.867  1.00 87.99  ? 3    G   Y N9    1 
ATOM   1611  C  C8    . G   E  2  3    ? 8.091   30.445  40.363  1.00 87.68  ? 3    G   Y C8    1 
ATOM   1612  N  N7    . G   E  2  3    ? 7.796   29.541  41.261  1.00 87.27  ? 3    G   Y N7    1 
ATOM   1613  C  C5    . G   E  2  3    ? 8.325   30.078  42.435  1.00 87.82  ? 3    G   Y C5    1 
ATOM   1614  C  C6    . G   E  2  3    ? 8.337   29.552  43.747  1.00 88.15  ? 3    G   Y C6    1 
ATOM   1615  O  O6    . G   E  2  3    ? 7.894   28.491  44.177  1.00 87.55  ? 3    G   Y O6    1 
ATOM   1616  N  N1    . G   E  2  3    ? 8.945   30.432  44.642  1.00 88.79  ? 3    G   Y N1    1 
ATOM   1617  C  C2    . G   E  2  3    ? 9.476   31.665  44.311  1.00 88.62  ? 3    G   Y C2    1 
ATOM   1618  N  N2    . G   E  2  3    ? 10.021  32.351  45.314  1.00 89.05  ? 3    G   Y N2    1 
ATOM   1619  N  N3    . G   E  2  3    ? 9.471   32.161  43.088  1.00 88.35  ? 3    G   Y N3    1 
ATOM   1620  C  C4    . G   E  2  3    ? 8.884   31.291  42.209  1.00 88.05  ? 3    G   Y C4    1 
ATOM   1621  P  P     . U   E  2  4    ? 12.691  31.241  37.294  1.00 91.67  ? 4    U   Y P     1 
ATOM   1622  O  OP1   . U   E  2  4    ? 13.177  31.185  35.887  1.00 91.58  ? 4    U   Y OP1   1 
ATOM   1623  O  OP2   . U   E  2  4    ? 12.331  29.983  38.009  1.00 91.03  ? 4    U   Y OP2   1 
ATOM   1624  O  "O5'" . U   E  2  4    ? 13.731  32.046  38.185  1.00 91.36  ? 4    U   Y "O5'" 1 
ATOM   1625  C  "C5'" . U   E  2  4    ? 13.971  33.385  37.836  1.00 91.50  ? 4    U   Y "C5'" 1 
ATOM   1626  C  "C4'" . U   E  2  4    ? 14.702  34.157  38.900  1.00 92.17  ? 4    U   Y "C4'" 1 
ATOM   1627  O  "O4'" . U   E  2  4    ? 13.818  34.400  40.042  1.00 92.03  ? 4    U   Y "O4'" 1 
ATOM   1628  C  "C3'" . U   E  2  4    ? 16.031  33.657  39.448  1.00 93.54  ? 4    U   Y "C3'" 1 
ATOM   1629  O  "O3'" . U   E  2  4    ? 17.196  34.237  38.886  1.00 97.70  ? 4    U   Y "O3'" 1 
ATOM   1630  C  "C2'" . U   E  2  4    ? 15.948  33.821  40.969  1.00 91.96  ? 4    U   Y "C2'" 1 
ATOM   1631  O  "O2'" . U   E  2  4    ? 16.547  35.030  41.373  1.00 91.29  ? 4    U   Y "O2'" 1 
ATOM   1632  C  "C1'" . U   E  2  4    ? 14.487  34.082  41.251  1.00 90.95  ? 4    U   Y "C1'" 1 
ATOM   1633  N  N1    . U   E  2  4    ? 13.930  32.929  41.995  1.00 89.83  ? 4    U   Y N1    1 
ATOM   1634  C  C2    . U   E  2  4    ? 13.761  33.123  43.370  1.00 88.93  ? 4    U   Y C2    1 
ATOM   1635  O  O2    . U   E  2  4    ? 14.002  34.196  43.928  1.00 88.87  ? 4    U   Y O2    1 
ATOM   1636  N  N3    . U   E  2  4    ? 13.321  32.015  44.067  1.00 87.97  ? 4    U   Y N3    1 
ATOM   1637  C  C4    . U   E  2  4    ? 13.035  30.758  43.559  1.00 87.16  ? 4    U   Y C4    1 
ATOM   1638  O  O4    . U   E  2  4    ? 12.686  29.861  44.325  1.00 86.11  ? 4    U   Y O4    1 
ATOM   1639  C  C5    . U   E  2  4    ? 13.203  30.636  42.143  1.00 87.00  ? 4    U   Y C5    1 
ATOM   1640  C  C6    . U   E  2  4    ? 13.626  31.697  41.420  1.00 88.82  ? 4    U   Y C6    1 
ATOM   1641  P  P     . C   E  2  5    ? 18.520  33.322  38.726  1.00 101.67 ? 5    C   Y P     1 
ATOM   1642  O  OP1   . C   E  2  5    ? 19.406  33.951  37.706  1.00 101.37 ? 5    C   Y OP1   1 
ATOM   1643  O  OP2   . C   E  2  5    ? 18.100  31.894  38.552  1.00 100.77 ? 5    C   Y OP2   1 
ATOM   1644  O  "O5'" . C   E  2  5    ? 19.216  33.456  40.159  1.00 101.76 ? 5    C   Y "O5'" 1 
ATOM   1645  C  "C5'" . C   E  2  5    ? 19.333  34.733  40.759  1.00 102.06 ? 5    C   Y "C5'" 1 
ATOM   1646  C  "C4'" . C   E  2  5    ? 19.525  34.663  42.264  1.00 102.26 ? 5    C   Y "C4'" 1 
ATOM   1647  O  "O4'" . C   E  2  5    ? 18.228  34.425  42.920  1.00 103.39 ? 5    C   Y "O4'" 1 
ATOM   1648  C  "C3'" . C   E  2  5    ? 20.496  33.654  42.872  1.00 102.97 ? 5    C   Y "C3'" 1 
ATOM   1649  O  "O3'" . C   E  2  5    ? 21.811  34.037  43.231  1.00 103.75 ? 5    C   Y "O3'" 1 
ATOM   1650  C  "C2'" . C   E  2  5    ? 19.751  33.010  44.040  1.00 103.04 ? 5    C   Y "C2'" 1 
ATOM   1651  O  "O2'" . C   E  2  5    ? 20.055  33.641  45.269  1.00 102.40 ? 5    C   Y "O2'" 1 
ATOM   1652  C  "C1'" . C   E  2  5    ? 18.294  33.275  43.763  1.00 103.52 ? 5    C   Y "C1'" 1 
ATOM   1653  N  N1    . C   E  2  5    ? 17.698  32.030  43.173  1.00 104.65 ? 5    C   Y N1    1 
ATOM   1654  C  C2    . C   E  2  5    ? 16.736  31.319  43.935  1.00 104.82 ? 5    C   Y C2    1 
ATOM   1655  O  O2    . C   E  2  5    ? 16.401  31.762  45.046  1.00 105.68 ? 5    C   Y O2    1 
ATOM   1656  N  N3    . C   E  2  5    ? 16.209  30.159  43.442  1.00 104.15 ? 5    C   Y N3    1 
ATOM   1657  C  C4    . C   E  2  5    ? 16.598  29.705  42.247  1.00 104.28 ? 5    C   Y C4    1 
ATOM   1658  N  N4    . C   E  2  5    ? 16.052  28.567  41.794  1.00 102.65 ? 5    C   Y N4    1 
ATOM   1659  C  C5    . C   E  2  5    ? 17.562  30.400  41.455  1.00 104.48 ? 5    C   Y C5    1 
ATOM   1660  C  C6    . C   E  2  5    ? 18.079  31.546  41.948  1.00 104.63 ? 5    C   Y C6    1 
ATOM   1661  P  P     . U   E  2  6    ? 22.964  32.895  43.259  1.00 103.97 ? 6    U   Y P     1 
ATOM   1662  O  OP1   . U   E  2  6    ? 24.258  33.588  43.028  1.00 103.53 ? 6    U   Y OP1   1 
ATOM   1663  O  OP2   . U   E  2  6    ? 22.555  31.794  42.336  1.00 102.56 ? 6    U   Y OP2   1 
ATOM   1664  O  "O5'" . U   E  2  6    ? 22.912  32.338  44.764  1.00 103.26 ? 6    U   Y "O5'" 1 
ATOM   1665  C  "C5'" . U   E  2  6    ? 23.095  33.244  45.850  1.00 101.20 ? 6    U   Y "C5'" 1 
ATOM   1666  C  "C4'" . U   E  2  6    ? 22.585  32.718  47.193  1.00 99.10  ? 6    U   Y "C4'" 1 
ATOM   1667  O  "O4'" . U   E  2  6    ? 21.143  32.449  47.113  1.00 100.20 ? 6    U   Y "O4'" 1 
ATOM   1668  C  "C3'" . U   E  2  6    ? 23.229  31.514  47.888  1.00 98.46  ? 6    U   Y "C3'" 1 
ATOM   1669  O  "O3'" . U   E  2  6    ? 23.999  31.693  49.083  1.00 96.44  ? 6    U   Y "O3'" 1 
ATOM   1670  C  "C2'" . U   E  2  6    ? 22.103  30.521  48.146  1.00 98.74  ? 6    U   Y "C2'" 1 
ATOM   1671  O  "O2'" . U   E  2  6    ? 21.874  30.293  49.524  1.00 99.81  ? 6    U   Y "O2'" 1 
ATOM   1672  C  "C1'" . U   E  2  6    ? 20.862  31.131  47.556  1.00 99.49  ? 6    U   Y "C1'" 1 
ATOM   1673  N  N1    . U   E  2  6    ? 20.379  30.221  46.495  1.00 100.25 ? 6    U   Y N1    1 
ATOM   1674  C  C2    . U   E  2  6    ? 19.537  29.184  46.903  1.00 100.70 ? 6    U   Y C2    1 
ATOM   1675  O  O2    . U   E  2  6    ? 19.273  28.966  48.078  1.00 100.12 ? 6    U   Y O2    1 
ATOM   1676  N  N3    . U   E  2  6    ? 19.036  28.399  45.888  1.00 100.82 ? 6    U   Y N3    1 
ATOM   1677  C  C4    . U   E  2  6    ? 19.290  28.523  44.536  1.00 100.68 ? 6    U   Y C4    1 
ATOM   1678  O  O4    . U   E  2  6    ? 18.739  27.761  43.738  1.00 100.50 ? 6    U   Y O4    1 
ATOM   1679  C  C5    . U   E  2  6    ? 20.193  29.581  44.199  1.00 100.72 ? 6    U   Y C5    1 
ATOM   1680  C  C6    . U   E  2  6    ? 20.702  30.364  45.170  1.00 100.52 ? 6    U   Y C6    1 
ATOM   1681  P  P     . G   E  2  7    ? 25.362  30.821  49.295  1.00 96.38  ? 7    G   Y P     1 
ATOM   1682  O  OP1   . G   E  2  7    ? 26.299  31.697  50.030  1.00 96.20  ? 7    G   Y OP1   1 
ATOM   1683  O  OP2   . G   E  2  7    ? 25.755  30.288  47.964  1.00 95.56  ? 7    G   Y OP2   1 
ATOM   1684  O  "O5'" . G   E  2  7    ? 25.015  29.565  50.248  1.00 93.87  ? 7    G   Y "O5'" 1 
ATOM   1685  C  "C5'" . G   E  2  7    ? 25.784  28.314  50.181  1.00 90.45  ? 7    G   Y "C5'" 1 
ATOM   1686  C  "C4'" . G   E  2  7    ? 25.115  27.196  51.006  1.00 87.65  ? 7    G   Y "C4'" 1 
ATOM   1687  O  "O4'" . G   E  2  7    ? 23.753  27.647  51.244  1.00 86.76  ? 7    G   Y "O4'" 1 
ATOM   1688  C  "C3'" . G   E  2  7    ? 24.928  25.758  50.443  1.00 86.99  ? 7    G   Y "C3'" 1 
ATOM   1689  O  "O3'" . G   E  2  7    ? 25.614  24.603  50.918  1.00 85.71  ? 7    G   Y "O3'" 1 
ATOM   1690  C  "C2'" . G   E  2  7    ? 23.431  25.475  50.509  1.00 86.37  ? 7    G   Y "C2'" 1 
ATOM   1691  O  "O2'" . G   E  2  7    ? 23.047  24.722  51.635  1.00 87.68  ? 7    G   Y "O2'" 1 
ATOM   1692  C  "C1'" . G   E  2  7    ? 22.827  26.850  50.504  1.00 86.37  ? 7    G   Y "C1'" 1 
ATOM   1693  N  N9    . G   E  2  7    ? 22.898  27.099  49.063  1.00 86.29  ? 7    G   Y N9    1 
ATOM   1694  C  C8    . G   E  2  7    ? 23.528  28.099  48.407  1.00 86.14  ? 7    G   Y C8    1 
ATOM   1695  N  N7    . G   E  2  7    ? 23.410  28.058  47.121  1.00 86.88  ? 7    G   Y N7    1 
ATOM   1696  C  C5    . G   E  2  7    ? 22.660  26.935  46.902  1.00 86.58  ? 7    G   Y C5    1 
ATOM   1697  C  C6    . G   E  2  7    ? 22.226  26.400  45.731  1.00 86.64  ? 7    G   Y C6    1 
ATOM   1698  O  O6    . G   E  2  7    ? 22.397  26.818  44.597  1.00 86.60  ? 7    G   Y O6    1 
ATOM   1699  N  N1    . G   E  2  7    ? 21.509  25.252  45.947  1.00 86.11  ? 7    G   Y N1    1 
ATOM   1700  C  C2    . G   E  2  7    ? 21.252  24.682  47.149  1.00 85.99  ? 7    G   Y C2    1 
ATOM   1701  N  N2    . G   E  2  7    ? 20.569  23.554  47.098  1.00 86.18  ? 7    G   Y N2    1 
ATOM   1702  N  N3    . G   E  2  7    ? 21.644  25.183  48.284  1.00 85.37  ? 7    G   Y N3    1 
ATOM   1703  C  C4    . G   E  2  7    ? 22.340  26.317  48.089  1.00 86.18  ? 7    G   Y C4    1 
ATOM   1704  P  P     . C   E  2  8    ? 25.477  23.214  50.075  1.00 85.38  ? 8    C   Y P     1 
ATOM   1705  O  OP1   . C   E  2  8    ? 24.403  23.355  49.051  1.00 83.94  ? 8    C   Y OP1   1 
ATOM   1706  O  OP2   . C   E  2  8    ? 25.410  22.086  51.036  1.00 85.00  ? 8    C   Y OP2   1 
ATOM   1707  O  "O5'" . C   E  2  8    ? 26.816  23.087  49.225  1.00 80.99  ? 8    C   Y "O5'" 1 
ATOM   1708  C  "C5'" . C   E  2  8    ? 26.733  23.087  47.818  1.00 76.86  ? 8    C   Y "C5'" 1 
ATOM   1709  C  "C4'" . C   E  2  8    ? 28.088  23.024  47.188  1.00 73.98  ? 8    C   Y "C4'" 1 
ATOM   1710  O  "O4'" . C   E  2  8    ? 28.678  24.347  47.168  1.00 71.99  ? 8    C   Y "O4'" 1 
ATOM   1711  C  "C3'" . C   E  2  8    ? 29.119  22.088  47.801  1.00 74.34  ? 8    C   Y "C3'" 1 
ATOM   1712  O  "O3'" . C   E  2  8    ? 29.692  21.121  46.938  1.00 77.48  ? 8    C   Y "O3'" 1 
ATOM   1713  C  "C2'" . C   E  2  8    ? 30.101  22.985  48.548  1.00 72.80  ? 8    C   Y "C2'" 1 
ATOM   1714  O  "O2'" . C   E  2  8    ? 31.440  22.872  48.138  1.00 72.28  ? 8    C   Y "O2'" 1 
ATOM   1715  C  "C1'" . C   E  2  8    ? 29.769  24.381  48.065  1.00 71.37  ? 8    C   Y "C1'" 1 
ATOM   1716  N  N1    . C   E  2  8    ? 29.540  25.255  49.225  1.00 69.63  ? 8    C   Y N1    1 
ATOM   1717  C  C2    . C   E  2  8    ? 30.590  26.068  49.649  1.00 69.07  ? 8    C   Y C2    1 
ATOM   1718  O  O2    . C   E  2  8    ? 31.674  26.023  49.043  1.00 68.69  ? 8    C   Y O2    1 
ATOM   1719  N  N3    . C   E  2  8    ? 30.412  26.872  50.715  1.00 67.04  ? 8    C   Y N3    1 
ATOM   1720  C  C4    . C   E  2  8    ? 29.258  26.882  51.351  1.00 66.08  ? 8    C   Y C4    1 
ATOM   1721  N  N4    . C   E  2  8    ? 29.129  27.693  52.392  1.00 65.72  ? 8    C   Y N4    1 
ATOM   1722  C  C5    . C   E  2  8    ? 28.181  26.064  50.948  1.00 66.55  ? 8    C   Y C5    1 
ATOM   1723  C  C6    . C   E  2  8    ? 28.357  25.280  49.886  1.00 67.44  ? 8    C   Y C6    1 
ATOM   1724  P  P     . G   E  2  9    ? 29.798  19.590  47.437  1.00 80.86  ? 9    G   Y P     1 
ATOM   1725  O  OP1   . G   E  2  9    ? 29.951  18.656  46.261  1.00 80.83  ? 9    G   Y OP1   1 
ATOM   1726  O  OP2   . G   E  2  9    ? 28.688  19.399  48.414  1.00 79.90  ? 9    G   Y OP2   1 
ATOM   1727  O  "O5'" . G   E  2  9    ? 31.183  19.544  48.220  1.00 79.16  ? 9    G   Y "O5'" 1 
ATOM   1728  C  "C5'" . G   E  2  9    ? 32.231  20.391  47.788  1.00 76.10  ? 9    G   Y "C5'" 1 
ATOM   1729  C  "C4'" . G   E  2  9    ? 33.582  19.921  48.247  1.00 73.23  ? 9    G   Y "C4'" 1 
ATOM   1730  O  "O4'" . G   E  2  9    ? 34.242  21.207  48.421  1.00 71.24  ? 9    G   Y "O4'" 1 
ATOM   1731  C  "C3'" . G   E  2  9    ? 33.820  19.201  49.584  1.00 73.08  ? 9    G   Y "C3'" 1 
ATOM   1732  O  "O3'" . G   E  2  9    ? 34.247  17.847  49.573  1.00 73.43  ? 9    G   Y "O3'" 1 
ATOM   1733  C  "C2'" . G   E  2  9    ? 34.701  20.138  50.410  1.00 71.64  ? 9    G   Y "C2'" 1 
ATOM   1734  O  "O2'" . G   E  2  9    ? 36.070  19.891  50.208  1.00 72.05  ? 9    G   Y "O2'" 1 
ATOM   1735  C  "C1'" . G   E  2  9    ? 34.445  21.479  49.797  1.00 70.79  ? 9    G   Y "C1'" 1 
ATOM   1736  N  N9    . G   E  2  9    ? 33.263  21.967  50.518  1.00 70.16  ? 9    G   Y N9    1 
ATOM   1737  C  C8    . G   E  2  9    ? 31.958  21.532  50.519  1.00 69.71  ? 9    G   Y C8    1 
ATOM   1738  N  N7    . G   E  2  9    ? 31.202  22.153  51.365  1.00 70.86  ? 9    G   Y N7    1 
ATOM   1739  C  C5    . G   E  2  9    ? 32.054  23.052  51.968  1.00 71.10  ? 9    G   Y C5    1 
ATOM   1740  C  C6    . G   E  2  9    ? 31.809  23.969  52.986  1.00 71.55  ? 9    G   Y C6    1 
ATOM   1741  O  O6    . G   E  2  9    ? 30.747  24.186  53.568  1.00 70.80  ? 9    G   Y O6    1 
ATOM   1742  N  N1    . G   E  2  9    ? 32.961  24.669  53.326  1.00 72.05  ? 9    G   Y N1    1 
ATOM   1743  C  C2    . G   E  2  9    ? 34.191  24.490  52.739  1.00 72.09  ? 9    G   Y C2    1 
ATOM   1744  N  N2    . G   E  2  9    ? 35.192  25.241  53.178  1.00 73.13  ? 9    G   Y N2    1 
ATOM   1745  N  N3    . G   E  2  9    ? 34.425  23.631  51.783  1.00 71.77  ? 9    G   Y N3    1 
ATOM   1746  C  C4    . G   E  2  9    ? 33.323  22.953  51.446  1.00 70.86  ? 9    G   Y C4    1 
ATOM   1747  P  P     . G   E  2  10   ? 33.837  16.898  50.819  1.00 73.83  ? 10   G   Y P     1 
ATOM   1748  O  OP1   . G   E  2  10   ? 34.418  15.552  50.577  1.00 73.77  ? 10   G   Y OP1   1 
ATOM   1749  O  OP2   . G   E  2  10   ? 32.381  17.029  51.083  1.00 73.69  ? 10   G   Y OP2   1 
ATOM   1750  O  "O5'" . G   E  2  10   ? 34.669  17.545  52.007  1.00 71.74  ? 10   G   Y "O5'" 1 
ATOM   1751  C  "C5'" . G   E  2  10   ? 36.062  17.594  51.830  1.00 69.32  ? 10   G   Y "C5'" 1 
ATOM   1752  C  "C4'" . G   E  2  10   ? 36.782  18.342  52.910  1.00 67.22  ? 10   G   Y "C4'" 1 
ATOM   1753  O  "O4'" . G   E  2  10   ? 36.659  19.791  52.735  1.00 67.50  ? 10   G   Y "O4'" 1 
ATOM   1754  C  "C3'" . G   E  2  10   ? 36.450  18.075  54.345  1.00 66.08  ? 10   G   Y "C3'" 1 
ATOM   1755  O  "O3'" . G   E  2  10   ? 37.061  16.933  54.865  1.00 66.70  ? 10   G   Y "O3'" 1 
ATOM   1756  C  "C2'" . G   E  2  10   ? 36.664  19.421  55.045  1.00 65.13  ? 10   G   Y "C2'" 1 
ATOM   1757  O  "O2'" . G   E  2  10   ? 38.017  19.622  55.420  1.00 61.06  ? 10   G   Y "O2'" 1 
ATOM   1758  C  "C1'" . G   E  2  10   ? 36.344  20.424  53.964  1.00 66.01  ? 10   G   Y "C1'" 1 
ATOM   1759  N  N9    . G   E  2  10   ? 34.916  20.720  54.100  1.00 66.92  ? 10   G   Y N9    1 
ATOM   1760  C  C8    . G   E  2  10   ? 33.854  20.176  53.425  1.00 67.16  ? 10   G   Y C8    1 
ATOM   1761  N  N7    . G   E  2  10   ? 32.698  20.606  53.853  1.00 67.65  ? 10   G   Y N7    1 
ATOM   1762  C  C5    . G   E  2  10   ? 33.013  21.496  54.871  1.00 67.57  ? 10   G   Y C5    1 
ATOM   1763  C  C6    . G   E  2  10   ? 32.162  22.270  55.723  1.00 68.18  ? 10   G   Y C6    1 
ATOM   1764  O  O6    . G   E  2  10   ? 30.925  22.319  55.738  1.00 69.18  ? 10   G   Y O6    1 
ATOM   1765  N  N1    . G   E  2  10   ? 32.898  23.043  56.619  1.00 68.11  ? 10   G   Y N1    1 
ATOM   1766  C  C2    . G   E  2  10   ? 34.269  23.066  56.688  1.00 67.80  ? 10   G   Y C2    1 
ATOM   1767  N  N2    . G   E  2  10   ? 34.803  23.865  57.616  1.00 67.20  ? 10   G   Y N2    1 
ATOM   1768  N  N3    . G   E  2  10   ? 35.066  22.352  55.902  1.00 67.56  ? 10   G   Y N3    1 
ATOM   1769  C  C4    . G   E  2  10   ? 34.375  21.597  55.024  1.00 67.13  ? 10   G   Y C4    1 
ATOM   1770  P  P     . C   E  2  11   ? 36.242  16.083  55.952  1.00 67.85  ? 11   C   Y P     1 
ATOM   1771  O  OP1   . C   E  2  11   ? 36.753  14.684  55.985  1.00 69.24  ? 11   C   Y OP1   1 
ATOM   1772  O  OP2   . C   E  2  11   ? 34.784  16.323  55.740  1.00 66.15  ? 11   C   Y OP2   1 
ATOM   1773  O  "O5'" . C   E  2  11   ? 36.699  16.860  57.259  1.00 66.79  ? 11   C   Y "O5'" 1 
ATOM   1774  C  "C5'" . C   E  2  11   ? 37.971  17.486  57.236  1.00 61.32  ? 11   C   Y "C5'" 1 
ATOM   1775  C  "C4'" . C   E  2  11   ? 38.125  18.498  58.328  1.00 58.35  ? 11   C   Y "C4'" 1 
ATOM   1776  O  "O4'" . C   E  2  11   ? 37.533  19.796  57.995  1.00 59.32  ? 11   C   Y "O4'" 1 
ATOM   1777  C  "C3'" . C   E  2  11   ? 37.599  18.101  59.681  1.00 56.64  ? 11   C   Y "C3'" 1 
ATOM   1778  O  "O3'" . C   E  2  11   ? 38.520  17.479  60.536  1.00 54.64  ? 11   C   Y "O3'" 1 
ATOM   1779  C  "C2'" . C   E  2  11   ? 36.794  19.284  60.211  1.00 56.50  ? 11   C   Y "C2'" 1 
ATOM   1780  O  "O2'" . C   E  2  11   ? 37.471  19.962  61.255  1.00 56.06  ? 11   C   Y "O2'" 1 
ATOM   1781  C  "C1'" . C   E  2  11   ? 36.617  20.196  59.013  1.00 57.89  ? 11   C   Y "C1'" 1 
ATOM   1782  N  N1    . C   E  2  11   ? 35.191  20.051  58.599  1.00 58.19  ? 11   C   Y N1    1 
ATOM   1783  C  C2    . C   E  2  11   ? 34.213  20.807  59.295  1.00 57.81  ? 11   C   Y C2    1 
ATOM   1784  O  O2    . C   E  2  11   ? 34.574  21.616  60.160  1.00 57.47  ? 11   C   Y O2    1 
ATOM   1785  N  N3    . C   E  2  11   ? 32.902  20.616  59.009  1.00 57.13  ? 11   C   Y N3    1 
ATOM   1786  C  C4    . C   E  2  11   ? 32.539  19.734  58.076  1.00 57.84  ? 11   C   Y C4    1 
ATOM   1787  N  N4    . C   E  2  11   ? 31.234  19.558  57.861  1.00 55.55  ? 11   C   Y N4    1 
ATOM   1788  C  C5    . C   E  2  11   ? 33.498  18.991  57.329  1.00 58.22  ? 11   C   Y C5    1 
ATOM   1789  C  C6    . C   E  2  11   ? 34.801  19.185  57.616  1.00 58.46  ? 11   C   Y C6    1 
ATOM   1790  P  P     . G   E  2  12   ? 38.179  16.001  61.063  1.00 55.45  ? 12   G   Y P     1 
ATOM   1791  O  OP1   . G   E  2  12   ? 39.423  15.187  61.125  1.00 55.83  ? 12   G   Y OP1   1 
ATOM   1792  O  OP2   . G   E  2  12   ? 37.010  15.493  60.294  1.00 52.87  ? 12   G   Y OP2   1 
ATOM   1793  O  "O5'" . G   E  2  12   ? 37.662  16.312  62.530  1.00 53.41  ? 12   G   Y "O5'" 1 
ATOM   1794  C  "C5'" . G   E  2  12   ? 36.987  17.532  62.744  1.00 47.97  ? 12   G   Y "C5'" 1 
ATOM   1795  C  "C4'" . G   E  2  12   ? 36.780  17.821  64.181  1.00 44.92  ? 12   G   Y "C4'" 1 
ATOM   1796  O  "O4'" . G   E  2  12   ? 36.195  19.159  64.240  1.00 45.73  ? 12   G   Y "O4'" 1 
ATOM   1797  C  "C3'" . G   E  2  12   ? 35.798  16.927  64.920  1.00 42.60  ? 12   G   Y "C3'" 1 
ATOM   1798  O  "O3'" . G   E  2  12   ? 36.315  16.076  65.905  1.00 37.80  ? 12   G   Y "O3'" 1 
ATOM   1799  C  "C2'" . G   E  2  12   ? 34.568  17.771  65.261  1.00 41.85  ? 12   G   Y "C2'" 1 
ATOM   1800  O  "O2'" . G   E  2  12   ? 34.428  18.099  66.619  1.00 37.60  ? 12   G   Y "O2'" 1 
ATOM   1801  C  "C1'" . G   E  2  12   ? 34.795  19.071  64.515  1.00 44.90  ? 12   G   Y "C1'" 1 
ATOM   1802  N  N9    . G   E  2  12   ? 33.957  18.956  63.313  1.00 46.68  ? 12   G   Y N9    1 
ATOM   1803  C  C8    . G   E  2  12   ? 34.266  18.477  62.065  1.00 47.24  ? 12   G   Y C8    1 
ATOM   1804  N  N7    . G   E  2  12   ? 33.244  18.408  61.266  1.00 48.43  ? 12   G   Y N7    1 
ATOM   1805  C  C5    . G   E  2  12   ? 32.195  18.903  62.018  1.00 48.34  ? 12   G   Y C5    1 
ATOM   1806  C  C6    . G   E  2  12   ? 30.844  19.059  61.687  1.00 49.63  ? 12   G   Y C6    1 
ATOM   1807  O  O6    . G   E  2  12   ? 30.286  18.784  60.607  1.00 52.82  ? 12   G   Y O6    1 
ATOM   1808  N  N1    . G   E  2  12   ? 30.113  19.585  62.754  1.00 47.18  ? 12   G   Y N1    1 
ATOM   1809  C  C2    . G   E  2  12   ? 30.634  19.905  63.975  1.00 45.33  ? 12   G   Y C2    1 
ATOM   1810  N  N2    . G   E  2  12   ? 29.799  20.383  64.880  1.00 43.50  ? 12   G   Y N2    1 
ATOM   1811  N  N3    . G   E  2  12   ? 31.895  19.763  64.290  1.00 45.41  ? 12   G   Y N3    1 
ATOM   1812  C  C4    . G   E  2  12   ? 32.617  19.262  63.274  1.00 46.82  ? 12   G   Y C4    1 
ATOM   1813  P  P     . C   E  2  13   ? 35.697  14.605  66.033  1.00 35.18  ? 13   C   Y P     1 
ATOM   1814  O  OP1   . C   E  2  13   ? 36.595  13.823  66.910  1.00 31.87  ? 13   C   Y OP1   1 
ATOM   1815  O  OP2   . C   E  2  13   ? 35.387  14.121  64.671  1.00 33.01  ? 13   C   Y OP2   1 
ATOM   1816  O  "O5'" . C   E  2  13   ? 34.361  14.923  66.814  1.00 29.69  ? 13   C   Y "O5'" 1 
ATOM   1817  C  "C5'" . C   E  2  13   ? 34.485  15.726  67.958  1.00 24.99  ? 13   C   Y "C5'" 1 
ATOM   1818  C  "C4'" . C   E  2  13   ? 33.172  16.079  68.567  1.00 19.69  ? 13   C   Y "C4'" 1 
ATOM   1819  O  "O4'" . C   E  2  13   ? 32.499  17.103  67.796  1.00 18.48  ? 13   C   Y "O4'" 1 
ATOM   1820  C  "C3'" . C   E  2  13   ? 32.184  14.964  68.839  1.00 22.29  ? 13   C   Y "C3'" 1 
ATOM   1821  O  "O3'" . C   E  2  13   ? 31.983  14.532  70.159  1.00 25.86  ? 13   C   Y "O3'" 1 
ATOM   1822  C  "C2'" . C   E  2  13   ? 30.888  15.345  68.153  1.00 18.87  ? 13   C   Y "C2'" 1 
ATOM   1823  O  "O2'" . C   E  2  13   ? 29.842  15.535  69.088  1.00 16.39  ? 13   C   Y "O2'" 1 
ATOM   1824  C  "C1'" . C   E  2  13   ? 31.186  16.682  67.503  1.00 17.45  ? 13   C   Y "C1'" 1 
ATOM   1825  N  N1    . C   E  2  13   ? 30.958  16.468  66.073  1.00 15.90  ? 13   C   Y N1    1 
ATOM   1826  C  C2    . C   E  2  13   ? 29.668  16.613  65.633  1.00 16.35  ? 13   C   Y C2    1 
ATOM   1827  O  O2    . C   E  2  13   ? 28.842  17.019  66.428  1.00 17.59  ? 13   C   Y O2    1 
ATOM   1828  N  N3    . C   E  2  13   ? 29.348  16.298  64.366  1.00 15.78  ? 13   C   Y N3    1 
ATOM   1829  C  C4    . C   E  2  13   ? 30.281  15.880  63.542  1.00 16.33  ? 13   C   Y C4    1 
ATOM   1830  N  N4    . C   E  2  13   ? 29.911  15.557  62.315  1.00 16.04  ? 13   C   Y N4    1 
ATOM   1831  C  C5    . C   E  2  13   ? 31.643  15.772  63.944  1.00 17.57  ? 13   C   Y C5    1 
ATOM   1832  C  C6    . C   E  2  13   ? 31.935  16.080  65.213  1.00 16.82  ? 13   C   Y C6    1 
ATOM   1833  P  P     . G   E  2  14   ? 31.650  12.980  70.399  1.00 32.07  ? 14   G   Y P     1 
ATOM   1834  O  OP1   . G   E  2  14   ? 31.694  12.695  71.848  1.00 32.33  ? 14   G   Y OP1   1 
ATOM   1835  O  OP2   . G   E  2  14   ? 32.628  12.297  69.540  1.00 29.06  ? 14   G   Y OP2   1 
ATOM   1836  O  "O5'" . G   E  2  14   ? 30.096  12.933  70.011  1.00 30.90  ? 14   G   Y "O5'" 1 
ATOM   1837  C  "C5'" . G   E  2  14   ? 29.227  13.548  70.948  1.00 31.86  ? 14   G   Y "C5'" 1 
ATOM   1838  C  "C4'" . G   E  2  14   ? 27.791  13.517  70.562  1.00 31.10  ? 14   G   Y "C4'" 1 
ATOM   1839  O  "O4'" . G   E  2  14   ? 27.590  14.523  69.539  1.00 34.17  ? 14   G   Y "O4'" 1 
ATOM   1840  C  "C3'" . G   E  2  14   ? 27.099  12.252  70.116  1.00 34.07  ? 14   G   Y "C3'" 1 
ATOM   1841  O  "O3'" . G   E  2  14   ? 26.344  11.573  71.095  1.00 35.66  ? 14   G   Y "O3'" 1 
ATOM   1842  C  "C2'" . G   E  2  14   ? 26.210  12.672  68.954  1.00 35.39  ? 14   G   Y "C2'" 1 
ATOM   1843  O  "O2'" . G   E  2  14   ? 24.896  12.908  69.405  1.00 35.66  ? 14   G   Y "O2'" 1 
ATOM   1844  C  "C1'" . G   E  2  14   ? 26.696  14.049  68.552  1.00 36.64  ? 14   G   Y "C1'" 1 
ATOM   1845  N  N9    . G   E  2  14   ? 27.288  13.818  67.230  1.00 39.13  ? 14   G   Y N9    1 
ATOM   1846  C  C8    . G   E  2  14   ? 28.584  13.576  66.861  1.00 40.39  ? 14   G   Y C8    1 
ATOM   1847  N  N7    . G   E  2  14   ? 28.701  13.216  65.600  1.00 41.50  ? 14   G   Y N7    1 
ATOM   1848  C  C5    . G   E  2  14   ? 27.409  13.258  65.106  1.00 41.55  ? 14   G   Y C5    1 
ATOM   1849  C  C6    . G   E  2  14   ? 26.899  12.935  63.824  1.00 43.28  ? 14   G   Y C6    1 
ATOM   1850  O  O6    . G   E  2  14   ? 27.509  12.528  62.827  1.00 43.86  ? 14   G   Y O6    1 
ATOM   1851  N  N1    . G   E  2  14   ? 25.519  13.116  63.767  1.00 43.10  ? 14   G   Y N1    1 
ATOM   1852  C  C2    . G   E  2  14   ? 24.745  13.544  64.813  1.00 41.22  ? 14   G   Y C2    1 
ATOM   1853  N  N2    . G   E  2  14   ? 23.449  13.667  64.582  1.00 43.07  ? 14   G   Y N2    1 
ATOM   1854  N  N3    . G   E  2  14   ? 25.206  13.833  66.003  1.00 39.62  ? 14   G   Y N3    1 
ATOM   1855  C  C4    . G   E  2  14   ? 26.532  13.670  66.083  1.00 40.27  ? 14   G   Y C4    1 
ATOM   1856  P  P     . C   E  2  15   ? 26.311  9.952   71.065  1.00 38.62  ? 15   C   Y P     1 
ATOM   1857  O  OP1   . C   E  2  15   ? 26.266  9.478   72.470  1.00 34.88  ? 15   C   Y OP1   1 
ATOM   1858  O  OP2   . C   E  2  15   ? 27.446  9.564   70.196  1.00 35.13  ? 15   C   Y OP2   1 
ATOM   1859  O  "O5'" . C   E  2  15   ? 24.946  9.595   70.325  1.00 36.33  ? 15   C   Y "O5'" 1 
ATOM   1860  C  "C5'" . C   E  2  15   ? 23.924  10.570  70.334  1.00 37.16  ? 15   C   Y "C5'" 1 
ATOM   1861  C  "C4'" . C   E  2  15   ? 22.708  10.168  69.544  1.00 37.04  ? 15   C   Y "C4'" 1 
ATOM   1862  O  "O4'" . C   E  2  15   ? 22.635  10.825  68.250  1.00 37.44  ? 15   C   Y "O4'" 1 
ATOM   1863  C  "C3'" . C   E  2  15   ? 22.364  8.716   69.344  1.00 37.51  ? 15   C   Y "C3'" 1 
ATOM   1864  O  "O3'" . C   E  2  15   ? 21.312  8.281   70.112  1.00 39.00  ? 15   C   Y "O3'" 1 
ATOM   1865  C  "C2'" . C   E  2  15   ? 22.118  8.504   67.860  1.00 37.10  ? 15   C   Y "C2'" 1 
ATOM   1866  O  "O2'" . C   E  2  15   ? 20.751  8.241   67.654  1.00 34.92  ? 15   C   Y "O2'" 1 
ATOM   1867  C  "C1'" . C   E  2  15   ? 22.386  9.864   67.241  1.00 37.66  ? 15   C   Y "C1'" 1 
ATOM   1868  N  N1    . C   E  2  15   ? 23.521  9.715   66.322  1.00 39.37  ? 15   C   Y N1    1 
ATOM   1869  C  C2    . C   E  2  15   ? 23.233  9.519   64.974  1.00 41.48  ? 15   C   Y C2    1 
ATOM   1870  O  O2    . C   E  2  15   ? 22.042  9.513   64.610  1.00 41.42  ? 15   C   Y O2    1 
ATOM   1871  N  N3    . C   E  2  15   ? 24.245  9.326   64.099  1.00 42.31  ? 15   C   Y N3    1 
ATOM   1872  C  C4    . C   E  2  15   ? 25.504  9.328   64.527  1.00 42.12  ? 15   C   Y C4    1 
ATOM   1873  N  N4    . C   E  2  15   ? 26.463  9.123   63.627  1.00 42.17  ? 15   C   Y N4    1 
ATOM   1874  C  C5    . C   E  2  15   ? 25.831  9.544   65.894  1.00 41.25  ? 15   C   Y C5    1 
ATOM   1875  C  C6    . C   E  2  15   ? 24.817  9.738   66.753  1.00 39.97  ? 15   C   Y C6    1 
ATOM   1876  P  P     . G   E  2  16   ? 21.525  6.955   70.948  1.00 43.06  ? 16   G   Y P     1 
ATOM   1877  O  OP1   . G   E  2  16   ? 20.425  6.959   71.955  1.00 41.23  ? 16   G   Y OP1   1 
ATOM   1878  O  OP2   . G   E  2  16   ? 22.949  6.929   71.373  1.00 40.54  ? 16   G   Y OP2   1 
ATOM   1879  O  "O5'" . G   E  2  16   ? 21.257  5.850   69.856  1.00 41.62  ? 16   G   Y "O5'" 1 
ATOM   1880  C  "C5'" . G   E  2  16   ? 19.976  5.833   69.337  1.00 44.37  ? 16   G   Y "C5'" 1 
ATOM   1881  C  "C4'" . G   E  2  16   ? 19.809  4.906   68.188  1.00 45.73  ? 16   G   Y "C4'" 1 
ATOM   1882  O  "O4'" . G   E  2  16   ? 20.376  5.649   67.074  1.00 48.00  ? 16   G   Y "O4'" 1 
ATOM   1883  C  "C3'" . G   E  2  16   ? 20.538  3.589   68.207  1.00 45.66  ? 16   G   Y "C3'" 1 
ATOM   1884  O  "O3'" . G   E  2  16   ? 20.051  2.519   68.953  1.00 45.91  ? 16   G   Y "O3'" 1 
ATOM   1885  C  "C2'" . G   E  2  16   ? 21.029  3.381   66.791  1.00 47.04  ? 16   G   Y "C2'" 1 
ATOM   1886  O  "O2'" . G   E  2  16   ? 20.024  2.658   66.113  1.00 48.31  ? 16   G   Y "O2'" 1 
ATOM   1887  C  "C1'" . G   E  2  16   ? 20.990  4.768   66.169  1.00 48.84  ? 16   G   Y "C1'" 1 
ATOM   1888  N  N9    . G   E  2  16   ? 22.364  5.160   65.832  1.00 51.57  ? 16   G   Y N9    1 
ATOM   1889  C  C8    . G   E  2  16   ? 23.400  5.554   66.652  1.00 51.64  ? 16   G   Y C8    1 
ATOM   1890  N  N7    . G   E  2  16   ? 24.537  5.692   66.008  1.00 51.54  ? 16   G   Y N7    1 
ATOM   1891  C  C5    . G   E  2  16   ? 24.229  5.396   64.681  1.00 51.41  ? 16   G   Y C5    1 
ATOM   1892  C  C6    . G   E  2  16   ? 25.054  5.354   63.495  1.00 51.87  ? 16   G   Y C6    1 
ATOM   1893  O  O6    . G   E  2  16   ? 26.263  5.577   63.369  1.00 53.13  ? 16   G   Y O6    1 
ATOM   1894  N  N1    . G   E  2  16   ? 24.313  5.006   62.373  1.00 49.87  ? 16   G   Y N1    1 
ATOM   1895  C  C2    . G   E  2  16   ? 22.977  4.735   62.377  1.00 50.42  ? 16   G   Y C2    1 
ATOM   1896  N  N2    . G   E  2  16   ? 22.444  4.435   61.224  1.00 50.63  ? 16   G   Y N2    1 
ATOM   1897  N  N3    . G   E  2  16   ? 22.212  4.762   63.441  1.00 49.93  ? 16   G   Y N3    1 
ATOM   1898  C  C4    . G   E  2  16   ? 22.892  5.097   64.551  1.00 51.51  ? 16   G   Y C4    1 
ATOM   1899  P  P     . DA  F  3  2    ? 54.332  6.125   59.052  1.00 72.27  ? 3    DA  Z P     1 
ATOM   1900  O  OP1   . DA  F  3  2    ? 54.459  6.981   57.807  1.00 70.58  ? 3    DA  Z OP1   1 
ATOM   1901  O  OP2   . DA  F  3  2    ? 54.637  6.899   60.331  1.00 71.40  ? 3    DA  Z OP2   1 
ATOM   1902  O  "O5'" . DA  F  3  2    ? 52.763  5.686   59.127  1.00 71.35  ? 3    DA  Z "O5'" 1 
ATOM   1903  C  "C5'" . DA  F  3  2    ? 52.120  5.001   58.024  1.00 67.37  ? 3    DA  Z "C5'" 1 
ATOM   1904  C  "C4'" . DA  F  3  2    ? 50.854  4.334   58.505  1.00 65.33  ? 3    DA  Z "C4'" 1 
ATOM   1905  O  "O4'" . DA  F  3  2    ? 49.708  4.799   57.764  1.00 64.85  ? 3    DA  Z "O4'" 1 
ATOM   1906  C  "C3'" . DA  F  3  2    ? 50.839  2.816   58.397  1.00 63.62  ? 3    DA  Z "C3'" 1 
ATOM   1907  O  "O3'" . DA  F  3  2    ? 50.223  2.305   59.573  1.00 62.45  ? 3    DA  Z "O3'" 1 
ATOM   1908  C  "C2'" . DA  F  3  2    ? 49.979  2.564   57.171  1.00 63.12  ? 3    DA  Z "C2'" 1 
ATOM   1909  C  "C1'" . DA  F  3  2    ? 48.978  3.691   57.278  1.00 63.84  ? 3    DA  Z "C1'" 1 
ATOM   1910  N  N9    . DA  F  3  2    ? 48.330  4.122   56.047  1.00 64.69  ? 3    DA  Z N9    1 
ATOM   1911  C  C8    . DA  F  3  2    ? 48.826  5.060   55.172  1.00 65.20  ? 3    DA  Z C8    1 
ATOM   1912  N  N7    . DA  F  3  2    ? 47.992  5.382   54.220  1.00 66.06  ? 3    DA  Z N7    1 
ATOM   1913  C  C5    . DA  F  3  2    ? 46.879  4.579   54.464  1.00 66.00  ? 3    DA  Z C5    1 
ATOM   1914  C  C6    . DA  F  3  2    ? 45.645  4.465   53.802  1.00 66.02  ? 3    DA  Z C6    1 
ATOM   1915  N  N6    . DA  F  3  2    ? 45.353  5.210   52.748  1.00 67.09  ? 3    DA  Z N6    1 
ATOM   1916  N  N1    . DA  F  3  2    ? 44.728  3.565   54.269  1.00 64.12  ? 3    DA  Z N1    1 
ATOM   1917  C  C2    . DA  F  3  2    ? 45.075  2.847   55.348  1.00 62.84  ? 3    DA  Z C2    1 
ATOM   1918  N  N3    . DA  F  3  2    ? 46.212  2.874   56.064  1.00 63.37  ? 3    DA  Z N3    1 
ATOM   1919  C  C4    . DA  F  3  2    ? 47.082  3.775   55.564  1.00 64.87  ? 3    DA  Z C4    1 
ATOM   1920  P  P     . DC  F  3  3    ? 50.419  0.768   59.958  1.00 63.37  ? 4    DC  Z P     1 
ATOM   1921  O  OP1   . DC  F  3  3    ? 49.951  0.518   61.348  1.00 63.39  ? 4    DC  Z OP1   1 
ATOM   1922  O  OP2   . DC  F  3  3    ? 51.788  0.356   59.544  1.00 62.18  ? 4    DC  Z OP2   1 
ATOM   1923  O  "O5'" . DC  F  3  3    ? 49.398  0.050   58.998  1.00 59.95  ? 4    DC  Z "O5'" 1 
ATOM   1924  C  "C5'" . DC  F  3  3    ? 49.854  -0.792  57.986  1.00 56.05  ? 4    DC  Z "C5'" 1 
ATOM   1925  C  "C4'" . DC  F  3  3    ? 48.663  -1.455  57.363  1.00 53.67  ? 4    DC  Z "C4'" 1 
ATOM   1926  O  "O4'" . DC  F  3  3    ? 47.949  -0.495  56.538  1.00 53.54  ? 4    DC  Z "O4'" 1 
ATOM   1927  C  "C3'" . DC  F  3  3    ? 49.019  -2.638  56.488  1.00 52.82  ? 4    DC  Z "C3'" 1 
ATOM   1928  O  "O3'" . DC  F  3  3    ? 48.258  -3.741  56.957  1.00 50.36  ? 4    DC  Z "O3'" 1 
ATOM   1929  C  "C2'" . DC  F  3  3    ? 48.697  -2.172  55.074  1.00 53.28  ? 4    DC  Z "C2'" 1 
ATOM   1930  C  "C1'" . DC  F  3  3    ? 47.673  -1.051  55.266  1.00 53.56  ? 4    DC  Z "C1'" 1 
ATOM   1931  N  N1    . DC  F  3  3    ? 47.753  0.030   54.245  1.00 52.69  ? 4    DC  Z N1    1 
ATOM   1932  C  C2    . DC  F  3  3    ? 46.653  0.246   53.392  1.00 51.44  ? 4    DC  Z C2    1 
ATOM   1933  O  O2    . DC  F  3  3    ? 45.629  -0.416  53.564  1.00 50.49  ? 4    DC  Z O2    1 
ATOM   1934  N  N3    . DC  F  3  3    ? 46.747  1.172   52.405  1.00 50.60  ? 4    DC  Z N3    1 
ATOM   1935  C  C4    . DC  F  3  3    ? 47.868  1.880   52.255  1.00 51.49  ? 4    DC  Z C4    1 
ATOM   1936  N  N4    . DC  F  3  3    ? 47.909  2.773   51.266  1.00 49.76  ? 4    DC  Z N4    1 
ATOM   1937  C  C5    . DC  F  3  3    ? 48.994  1.705   53.119  1.00 52.39  ? 4    DC  Z C5    1 
ATOM   1938  C  C6    . DC  F  3  3    ? 48.891  0.783   54.097  1.00 53.41  ? 4    DC  Z C6    1 
ATOM   1939  P  P     . DG  F  3  4    ? 48.341  -5.123  56.188  1.00 50.40  ? 5    DG  Z P     1 
ATOM   1940  O  OP1   . DG  F  3  4    ? 47.706  -6.190  56.993  1.00 49.72  ? 5    DG  Z OP1   1 
ATOM   1941  O  OP2   . DG  F  3  4    ? 49.733  -5.303  55.708  1.00 49.74  ? 5    DG  Z OP2   1 
ATOM   1942  O  "O5'" . DG  F  3  4    ? 47.412  -4.808  54.950  1.00 51.14  ? 5    DG  Z "O5'" 1 
ATOM   1943  C  "C5'" . DG  F  3  4    ? 46.026  -4.579  55.144  1.00 51.80  ? 5    DG  Z "C5'" 1 
ATOM   1944  C  "C4'" . DG  F  3  4    ? 45.279  -5.063  53.932  1.00 54.28  ? 5    DG  Z "C4'" 1 
ATOM   1945  O  "O4'" . DG  F  3  4    ? 45.349  -4.037  52.917  1.00 54.72  ? 5    DG  Z "O4'" 1 
ATOM   1946  C  "C3'" . DG  F  3  4    ? 45.951  -6.305  53.345  1.00 56.18  ? 5    DG  Z "C3'" 1 
ATOM   1947  O  "O3'" . DG  F  3  4    ? 44.978  -7.254  52.918  1.00 58.17  ? 5    DG  Z "O3'" 1 
ATOM   1948  C  "C2'" . DG  F  3  4    ? 46.808  -5.753  52.217  1.00 55.78  ? 5    DG  Z "C2'" 1 
ATOM   1949  C  "C1'" . DG  F  3  4    ? 46.029  -4.527  51.772  1.00 55.50  ? 5    DG  Z "C1'" 1 
ATOM   1950  N  N9    . DG  F  3  4    ? 46.835  -3.443  51.213  1.00 54.95  ? 5    DG  Z N9    1 
ATOM   1951  C  C8    . DG  F  3  4    ? 48.146  -3.122  51.493  1.00 54.89  ? 5    DG  Z C8    1 
ATOM   1952  N  N7    . DG  F  3  4    ? 48.589  -2.118  50.783  1.00 54.17  ? 5    DG  Z N7    1 
ATOM   1953  C  C5    . DG  F  3  4    ? 47.502  -1.747  50.006  1.00 53.59  ? 5    DG  Z C5    1 
ATOM   1954  C  C6    . DG  F  3  4    ? 47.380  -0.735  49.044  1.00 53.16  ? 5    DG  Z C6    1 
ATOM   1955  O  O6    . DG  F  3  4    ? 48.237  0.069   48.671  1.00 53.26  ? 5    DG  Z O6    1 
ATOM   1956  N  N1    . DG  F  3  4    ? 46.103  -0.708  48.486  1.00 53.88  ? 5    DG  Z N1    1 
ATOM   1957  C  C2    . DG  F  3  4    ? 45.080  -1.562  48.822  1.00 52.75  ? 5    DG  Z C2    1 
ATOM   1958  N  N2    . DG  F  3  4    ? 43.916  -1.386  48.192  1.00 52.65  ? 5    DG  Z N2    1 
ATOM   1959  N  N3    . DG  F  3  4    ? 45.188  -2.516  49.714  1.00 52.51  ? 5    DG  Z N3    1 
ATOM   1960  C  C4    . DG  F  3  4    ? 46.415  -2.552  50.264  1.00 53.73  ? 5    DG  Z C4    1 
ATOM   1961  P  P     . DC  F  3  5    ? 45.396  -8.447  51.926  1.00 60.38  ? 6    DC  Z P     1 
ATOM   1962  O  OP1   . DC  F  3  5    ? 44.332  -9.480  52.044  1.00 61.12  ? 6    DC  Z OP1   1 
ATOM   1963  O  OP2   . DC  F  3  5    ? 46.818  -8.860  52.073  1.00 59.90  ? 6    DC  Z OP2   1 
ATOM   1964  O  "O5'" . DC  F  3  5    ? 45.273  -7.743  50.511  1.00 59.22  ? 6    DC  Z "O5'" 1 
ATOM   1965  C  "C5'" . DC  F  3  5    ? 44.074  -7.070  50.156  1.00 59.24  ? 6    DC  Z "C5'" 1 
ATOM   1966  C  "C4'" . DC  F  3  5    ? 43.965  -6.966  48.656  1.00 60.33  ? 6    DC  Z "C4'" 1 
ATOM   1967  O  "O4'" . DC  F  3  5    ? 44.571  -5.730  48.215  1.00 60.37  ? 6    DC  Z "O4'" 1 
ATOM   1968  C  "C3'" . DC  F  3  5    ? 44.668  -8.104  47.915  1.00 61.55  ? 6    DC  Z "C3'" 1 
ATOM   1969  O  "O3'" . DC  F  3  5    ? 43.823  -8.683  46.924  1.00 63.32  ? 6    DC  Z "O3'" 1 
ATOM   1970  C  "C2'" . DC  F  3  5    ? 45.895  -7.448  47.314  1.00 60.78  ? 6    DC  Z "C2'" 1 
ATOM   1971  C  "C1'" . DC  F  3  5    ? 45.505  -5.986  47.189  1.00 61.99  ? 6    DC  Z "C1'" 1 
ATOM   1972  N  N1    . DC  F  3  5    ? 46.642  -5.069  47.371  1.00 63.84  ? 6    DC  Z N1    1 
ATOM   1973  C  C2    . DC  F  3  5    ? 46.779  -3.988  46.504  1.00 64.23  ? 6    DC  Z C2    1 
ATOM   1974  O  O2    . DC  F  3  5    ? 45.903  -3.786  45.650  1.00 62.66  ? 6    DC  Z O2    1 
ATOM   1975  N  N3    . DC  F  3  5    ? 47.865  -3.194  46.619  1.00 66.32  ? 6    DC  Z N3    1 
ATOM   1976  C  C4    . DC  F  3  5    ? 48.784  -3.439  47.557  1.00 66.82  ? 6    DC  Z C4    1 
ATOM   1977  N  N4    . DC  F  3  5    ? 49.846  -2.629  47.625  1.00 67.41  ? 6    DC  Z N4    1 
ATOM   1978  C  C5    . DC  F  3  5    ? 48.654  -4.518  48.470  1.00 66.13  ? 6    DC  Z C5    1 
ATOM   1979  C  C6    . DC  F  3  5    ? 47.573  -5.293  48.350  1.00 65.20  ? 6    DC  Z C6    1 
ATOM   1980  P  P     . DC  F  3  6    ? 44.430  -9.746  45.883  1.00 65.33  ? 7    DC  Z P     1 
ATOM   1981  O  OP1   . DC  F  3  6    ? 43.423  -10.798 45.630  1.00 64.55  ? 7    DC  Z OP1   1 
ATOM   1982  O  OP2   . DC  F  3  6    ? 45.797  -10.126 46.300  1.00 65.00  ? 7    DC  Z OP2   1 
ATOM   1983  O  "O5'" . DC  F  3  6    ? 44.538  -8.865  44.576  1.00 65.28  ? 7    DC  Z "O5'" 1 
ATOM   1984  C  "C5'" . DC  F  3  6    ? 43.458  -8.010  44.245  1.00 67.29  ? 7    DC  Z "C5'" 1 
ATOM   1985  C  "C4'" . DC  F  3  6    ? 43.810  -7.165  43.051  1.00 69.39  ? 7    DC  Z "C4'" 1 
ATOM   1986  O  "O4'" . DC  F  3  6    ? 44.814  -6.193  43.438  1.00 71.16  ? 7    DC  Z "O4'" 1 
ATOM   1987  C  "C3'" . DC  F  3  6    ? 44.401  -7.974  41.899  1.00 71.04  ? 7    DC  Z "C3'" 1 
ATOM   1988  O  "O3'" . DC  F  3  6    ? 43.837  -7.537  40.658  1.00 72.05  ? 7    DC  Z "O3'" 1 
ATOM   1989  C  "C2'" . DC  F  3  6    ? 45.895  -7.708  42.006  1.00 70.97  ? 7    DC  Z "C2'" 1 
ATOM   1990  C  "C1'" . DC  F  3  6    ? 45.953  -6.308  42.603  1.00 71.55  ? 7    DC  Z "C1'" 1 
ATOM   1991  N  N1    . DC  F  3  6    ? 47.161  -6.013  43.411  1.00 72.38  ? 7    DC  Z N1    1 
ATOM   1992  C  C2    . DC  F  3  6    ? 47.945  -4.885  43.083  1.00 73.12  ? 7    DC  Z C2    1 
ATOM   1993  O  O2    . DC  F  3  6    ? 47.599  -4.153  42.146  1.00 74.23  ? 7    DC  Z O2    1 
ATOM   1994  N  N3    . DC  F  3  6    ? 49.061  -4.625  43.795  1.00 73.17  ? 7    DC  Z N3    1 
ATOM   1995  C  C4    . DC  F  3  6    ? 49.411  -5.422  44.798  1.00 72.00  ? 7    DC  Z C4    1 
ATOM   1996  N  N4    . DC  F  3  6    ? 50.522  -5.110  45.457  1.00 72.27  ? 7    DC  Z N4    1 
ATOM   1997  C  C5    . DC  F  3  6    ? 48.638  -6.567  45.163  1.00 71.93  ? 7    DC  Z C5    1 
ATOM   1998  C  C6    . DC  F  3  6    ? 47.530  -6.821  44.451  1.00 71.37  ? 7    DC  Z C6    1 
ATOM   1999  P  P     . DA  F  3  7    ? 44.292  -8.226  39.282  1.00 73.49  ? 8    DA  Z P     1 
ATOM   2000  O  OP1   . DA  F  3  7    ? 43.201  -8.100  38.284  1.00 72.08  ? 8    DA  Z OP1   1 
ATOM   2001  O  OP2   . DA  F  3  7    ? 44.871  -9.551  39.573  1.00 72.57  ? 8    DA  Z OP2   1 
ATOM   2002  O  "O5'" . DA  F  3  7    ? 45.477  -7.292  38.793  1.00 75.46  ? 8    DA  Z "O5'" 1 
ATOM   2003  C  "C5'" . DA  F  3  7    ? 45.217  -5.932  38.476  1.00 78.06  ? 8    DA  Z "C5'" 1 
ATOM   2004  C  "C4'" . DA  F  3  7    ? 46.404  -5.335  37.764  1.00 79.61  ? 8    DA  Z "C4'" 1 
ATOM   2005  O  "O4'" . DA  F  3  7    ? 47.462  -5.038  38.704  1.00 80.12  ? 8    DA  Z "O4'" 1 
ATOM   2006  C  "C3'" . DA  F  3  7    ? 47.010  -6.272  36.728  1.00 80.69  ? 8    DA  Z "C3'" 1 
ATOM   2007  O  "O3'" . DA  F  3  7    ? 47.334  -5.496  35.563  1.00 81.47  ? 8    DA  Z "O3'" 1 
ATOM   2008  C  "C2'" . DA  F  3  7    ? 48.186  -6.893  37.473  1.00 80.67  ? 8    DA  Z "C2'" 1 
ATOM   2009  C  "C1'" . DA  F  3  7    ? 48.636  -5.758  38.369  1.00 81.36  ? 8    DA  Z "C1'" 1 
ATOM   2010  N  N9    . DA  F  3  7    ? 49.287  -6.142  39.619  1.00 82.40  ? 8    DA  Z N9    1 
ATOM   2011  C  C8    . DA  F  3  7    ? 48.925  -7.128  40.499  1.00 83.04  ? 8    DA  Z C8    1 
ATOM   2012  N  N7    . DA  F  3  7    ? 49.674  -7.176  41.575  1.00 84.21  ? 8    DA  Z N7    1 
ATOM   2013  C  C5    . DA  F  3  7    ? 50.605  -6.167  41.379  1.00 83.66  ? 8    DA  Z C5    1 
ATOM   2014  C  C6    . DA  F  3  7    ? 51.676  -5.698  42.163  1.00 83.88  ? 8    DA  Z C6    1 
ATOM   2015  N  N6    . DA  F  3  7    ? 52.023  -6.202  43.353  1.00 83.63  ? 8    DA  Z N6    1 
ATOM   2016  N  N1    . DA  F  3  7    ? 52.395  -4.675  41.676  1.00 83.54  ? 8    DA  Z N1    1 
ATOM   2017  C  C2    . DA  F  3  7    ? 52.065  -4.157  40.491  1.00 83.24  ? 8    DA  Z C2    1 
ATOM   2018  N  N3    . DA  F  3  7    ? 51.092  -4.508  39.662  1.00 82.97  ? 8    DA  Z N3    1 
ATOM   2019  C  C4    . DA  F  3  7    ? 50.386  -5.530  40.172  1.00 83.24  ? 8    DA  Z C4    1 
ATOM   2020  P  P     . DG  F  3  8    ? 48.600  -5.881  34.651  1.00 82.71  ? 9    DG  Z P     1 
ATOM   2021  O  OP1   . DG  F  3  8    ? 48.488  -5.142  33.367  1.00 82.24  ? 9    DG  Z OP1   1 
ATOM   2022  O  OP2   . DG  F  3  8    ? 48.778  -7.353  34.635  1.00 82.73  ? 9    DG  Z OP2   1 
ATOM   2023  O  "O5'" . DG  F  3  8    ? 49.806  -5.271  35.485  1.00 81.42  ? 9    DG  Z "O5'" 1 
ATOM   2024  C  "C5'" . DG  F  3  8    ? 49.784  -3.904  35.880  1.00 79.51  ? 9    DG  Z "C5'" 1 
ATOM   2025  C  "C4'" . DG  F  3  8    ? 51.140  -3.290  35.653  1.00 78.18  ? 9    DG  Z "C4'" 1 
ATOM   2026  O  "O4'" . DG  F  3  8    ? 52.039  -3.624  36.733  1.00 78.15  ? 9    DG  Z "O4'" 1 
ATOM   2027  C  "C3'" . DG  F  3  8    ? 51.785  -3.816  34.381  1.00 77.76  ? 9    DG  Z "C3'" 1 
ATOM   2028  O  "O3'" . DG  F  3  8    ? 52.500  -2.756  33.764  1.00 76.16  ? 9    DG  Z "O3'" 1 
ATOM   2029  C  "C2'" . DG  F  3  8    ? 52.674  -4.943  34.884  1.00 77.18  ? 9    DG  Z "C2'" 1 
ATOM   2030  C  "C1'" . DG  F  3  8    ? 53.075  -4.475  36.276  1.00 78.09  ? 9    DG  Z "C1'" 1 
ATOM   2031  N  N9    . DG  F  3  8    ? 53.236  -5.509  37.290  1.00 78.82  ? 9    DG  Z N9    1 
ATOM   2032  C  C8    . DG  F  3  8    ? 52.492  -6.652  37.478  1.00 78.67  ? 9    DG  Z C8    1 
ATOM   2033  N  N7    . DG  F  3  8    ? 52.838  -7.316  38.548  1.00 79.01  ? 9    DG  Z N7    1 
ATOM   2034  C  C5    . DG  F  3  8    ? 53.890  -6.577  39.081  1.00 80.48  ? 9    DG  Z C5    1 
ATOM   2035  C  C6    . DG  F  3  8    ? 54.681  -6.788  40.254  1.00 81.13  ? 9    DG  Z C6    1 
ATOM   2036  O  O6    . DG  F  3  8    ? 54.607  -7.706  41.079  1.00 81.07  ? 9    DG  Z O6    1 
ATOM   2037  N  N1    . DG  F  3  8    ? 55.637  -5.781  40.416  1.00 80.98  ? 9    DG  Z N1    1 
ATOM   2038  C  C2    . DG  F  3  8    ? 55.812  -4.715  39.561  1.00 80.20  ? 9    DG  Z C2    1 
ATOM   2039  N  N2    . DG  F  3  8    ? 56.780  -3.858  39.861  1.00 79.89  ? 9    DG  Z N2    1 
ATOM   2040  N  N3    . DG  F  3  8    ? 55.085  -4.509  38.480  1.00 79.99  ? 9    DG  Z N3    1 
ATOM   2041  C  C4    . DG  F  3  8    ? 54.152  -5.470  38.302  1.00 80.20  ? 9    DG  Z C4    1 
ATOM   2042  P  P     . DA  F  3  9    ? 52.750  -2.771  32.187  1.00 75.72  ? 10   DA  Z P     1 
ATOM   2043  O  OP1   . DA  F  3  9    ? 51.727  -1.935  31.494  1.00 73.14  ? 10   DA  Z OP1   1 
ATOM   2044  O  OP2   . DA  F  3  9    ? 52.905  -4.193  31.795  1.00 75.71  ? 10   DA  Z OP2   1 
ATOM   2045  O  "O5'" . DA  F  3  9    ? 54.185  -2.094  32.120  1.00 76.21  ? 10   DA  Z "O5'" 1 
ATOM   2046  C  "C5'" . DA  F  3  9    ? 54.627  -1.243  33.183  1.00 77.68  ? 10   DA  Z "C5'" 1 
ATOM   2047  C  "C4'" . DA  F  3  9    ? 56.040  -1.588  33.594  1.00 79.88  ? 10   DA  Z "C4'" 1 
ATOM   2048  O  "O4'" . DA  F  3  9    ? 56.078  -2.615  34.618  1.00 81.01  ? 10   DA  Z "O4'" 1 
ATOM   2049  C  "C3'" . DA  F  3  9    ? 56.971  -2.062  32.474  1.00 81.87  ? 10   DA  Z "C3'" 1 
ATOM   2050  O  "O3'" . DA  F  3  9    ? 58.225  -1.377  32.595  1.00 84.04  ? 10   DA  Z "O3'" 1 
ATOM   2051  C  "C2'" . DA  F  3  9    ? 57.143  -3.545  32.773  1.00 81.60  ? 10   DA  Z "C2'" 1 
ATOM   2052  C  "C1'" . DA  F  3  9    ? 57.099  -3.548  34.290  1.00 82.31  ? 10   DA  Z "C1'" 1 
ATOM   2053  N  N9    . DA  F  3  9    ? 56.771  -4.832  34.919  1.00 82.91  ? 10   DA  Z N9    1 
ATOM   2054  C  C8    . DA  F  3  9    ? 55.823  -5.729  34.496  1.00 82.68  ? 10   DA  Z C8    1 
ATOM   2055  N  N7    . DA  F  3  9    ? 55.700  -6.776  35.271  1.00 83.09  ? 10   DA  Z N7    1 
ATOM   2056  C  C5    . DA  F  3  9    ? 56.645  -6.568  36.268  1.00 83.64  ? 10   DA  Z C5    1 
ATOM   2057  C  C6    . DA  F  3  9    ? 57.001  -7.331  37.388  1.00 83.89  ? 10   DA  Z C6    1 
ATOM   2058  N  N6    . DA  F  3  9    ? 56.405  -8.478  37.672  1.00 84.09  ? 10   DA  Z N6    1 
ATOM   2059  N  N1    . DA  F  3  9    ? 57.987  -6.868  38.202  1.00 84.02  ? 10   DA  Z N1    1 
ATOM   2060  C  C2    . DA  F  3  9    ? 58.563  -5.698  37.880  1.00 83.38  ? 10   DA  Z C2    1 
ATOM   2061  N  N3    . DA  F  3  9    ? 58.308  -4.882  36.845  1.00 83.41  ? 10   DA  Z N3    1 
ATOM   2062  C  C4    . DA  F  3  9    ? 57.323  -5.380  36.065  1.00 83.42  ? 10   DA  Z C4    1 
ATOM   2063  P  P     . DC  F  3  10   ? 59.377  -1.585  31.486  1.00 85.17  ? 11   DC  Z P     1 
ATOM   2064  O  OP1   . DC  F  3  10   ? 59.725  -0.245  30.945  1.00 84.94  ? 11   DC  Z OP1   1 
ATOM   2065  O  OP2   . DC  F  3  10   ? 58.970  -2.676  30.552  1.00 85.94  ? 11   DC  Z OP2   1 
ATOM   2066  O  "O5'" . DC  F  3  10   ? 60.612  -2.084  32.350  1.00 82.59  ? 11   DC  Z "O5'" 1 
ATOM   2067  C  "C5'" . DC  F  3  10   ? 60.954  -1.392  33.539  1.00 79.97  ? 11   DC  Z "C5'" 1 
ATOM   2068  C  "C4'" . DC  F  3  10   ? 61.991  -2.166  34.312  1.00 79.38  ? 11   DC  Z "C4'" 1 
ATOM   2069  O  "O4'" . DC  F  3  10   ? 61.417  -3.327  34.967  1.00 79.39  ? 11   DC  Z "O4'" 1 
ATOM   2070  C  "C3'" . DC  F  3  10   ? 63.158  -2.677  33.473  1.00 79.57  ? 11   DC  Z "C3'" 1 
ATOM   2071  O  "O3'" . DC  F  3  10   ? 64.369  -2.359  34.186  1.00 78.55  ? 11   DC  Z "O3'" 1 
ATOM   2072  C  "C2'" . DC  F  3  10   ? 62.860  -4.166  33.319  1.00 78.88  ? 11   DC  Z "C2'" 1 
ATOM   2073  C  "C1'" . DC  F  3  10   ? 62.124  -4.510  34.609  1.00 78.70  ? 11   DC  Z "C1'" 1 
ATOM   2074  N  N1    . DC  F  3  10   ? 61.143  -5.622  34.526  1.00 78.01  ? 11   DC  Z N1    1 
ATOM   2075  C  C2    . DC  F  3  10   ? 61.190  -6.658  35.493  1.00 77.59  ? 11   DC  Z C2    1 
ATOM   2076  O  O2    . DC  F  3  10   ? 62.065  -6.640  36.383  1.00 78.32  ? 11   DC  Z O2    1 
ATOM   2077  N  N3    . DC  F  3  10   ? 60.274  -7.653  35.432  1.00 76.43  ? 11   DC  Z N3    1 
ATOM   2078  C  C4    . DC  F  3  10   ? 59.349  -7.655  34.472  1.00 75.20  ? 11   DC  Z C4    1 
ATOM   2079  N  N4    . DC  F  3  10   ? 58.472  -8.652  34.469  1.00 74.28  ? 11   DC  Z N4    1 
ATOM   2080  C  C5    . DC  F  3  10   ? 59.284  -6.634  33.479  1.00 75.26  ? 11   DC  Z C5    1 
ATOM   2081  C  C6    . DC  F  3  10   ? 60.190  -5.648  33.541  1.00 76.65  ? 11   DC  Z C6    1 
ATOM   2082  P  P     . DA  F  3  11   ? 65.765  -3.057  33.793  1.00 77.34  ? 12   DA  Z P     1 
ATOM   2083  O  OP1   . DA  F  3  11   ? 66.883  -2.113  34.067  1.00 75.91  ? 12   DA  Z OP1   1 
ATOM   2084  O  OP2   . DA  F  3  11   ? 65.641  -3.692  32.451  1.00 77.67  ? 12   DA  Z OP2   1 
ATOM   2085  O  "O5'" . DA  F  3  11   ? 65.876  -4.212  34.872  1.00 74.91  ? 12   DA  Z "O5'" 1 
ATOM   2086  C  "C5'" . DA  F  3  11   ? 66.031  -3.901  36.249  1.00 70.34  ? 12   DA  Z "C5'" 1 
ATOM   2087  C  "C4'" . DA  F  3  11   ? 66.740  -5.039  36.939  1.00 66.59  ? 12   DA  Z "C4'" 1 
ATOM   2088  O  "O4'" . DA  F  3  11   ? 65.895  -6.216  36.896  1.00 66.19  ? 12   DA  Z "O4'" 1 
ATOM   2089  C  "C3'" . DA  F  3  11   ? 68.043  -5.435  36.252  1.00 65.12  ? 12   DA  Z "C3'" 1 
ATOM   2090  O  "O3'" . DA  F  3  11   ? 68.961  -5.886  37.255  1.00 62.87  ? 12   DA  Z "O3'" 1 
ATOM   2091  C  "C2'" . DA  F  3  11   ? 67.608  -6.535  35.292  1.00 64.26  ? 12   DA  Z "C2'" 1 
ATOM   2092  C  "C1'" . DA  F  3  11   ? 66.456  -7.202  36.035  1.00 64.83  ? 12   DA  Z "C1'" 1 
ATOM   2093  N  N9    . DA  F  3  11   ? 65.374  -7.723  35.188  1.00 64.12  ? 12   DA  Z N9    1 
ATOM   2094  C  C8    . DA  F  3  11   ? 64.821  -7.196  34.037  1.00 62.94  ? 12   DA  Z C8    1 
ATOM   2095  N  N7    . DA  F  3  11   ? 63.843  -7.916  33.547  1.00 61.20  ? 12   DA  Z N7    1 
ATOM   2096  C  C5    . DA  F  3  11   ? 63.750  -8.989  34.425  1.00 62.72  ? 12   DA  Z C5    1 
ATOM   2097  C  C6    . DA  F  3  11   ? 62.908  -10.104 34.461  1.00 63.18  ? 12   DA  Z C6    1 
ATOM   2098  N  N6    . DA  F  3  11   ? 61.970  -10.327 33.552  1.00 63.85  ? 12   DA  Z N6    1 
ATOM   2099  N  N1    . DA  F  3  11   ? 63.065  -10.993 35.474  1.00 63.08  ? 12   DA  Z N1    1 
ATOM   2100  C  C2    . DA  F  3  11   ? 64.015  -10.760 36.381  1.00 62.90  ? 12   DA  Z C2    1 
ATOM   2101  N  N3    . DA  F  3  11   ? 64.875  -9.746  36.453  1.00 63.73  ? 12   DA  Z N3    1 
ATOM   2102  C  C4    . DA  F  3  11   ? 64.686  -8.885  35.433  1.00 63.53  ? 12   DA  Z C4    1 
ATOM   2103  P  P     . DG  F  3  12   ? 70.445  -6.349  36.854  1.00 61.41  ? 13   DG  Z P     1 
ATOM   2104  O  OP1   . DG  F  3  12   ? 71.398  -5.538  37.656  1.00 59.88  ? 13   DG  Z OP1   1 
ATOM   2105  O  OP2   . DG  F  3  12   ? 70.561  -6.366  35.375  1.00 60.90  ? 13   DG  Z OP2   1 
ATOM   2106  O  "O5'" . DG  F  3  12   ? 70.478  -7.861  37.369  1.00 63.04  ? 13   DG  Z "O5'" 1 
ATOM   2107  C  "C5'" . DG  F  3  12   ? 69.938  -8.204  38.657  1.00 62.70  ? 13   DG  Z "C5'" 1 
ATOM   2108  C  "C4'" . DG  F  3  12   ? 69.687  -9.694  38.784  1.00 62.71  ? 13   DG  Z "C4'" 1 
ATOM   2109  O  "O4'" . DG  F  3  12   ? 68.541  -10.123 38.009  1.00 61.40  ? 13   DG  Z "O4'" 1 
ATOM   2110  C  "C3'" . DG  F  3  12   ? 70.827  -10.638 38.403  1.00 64.34  ? 13   DG  Z "C3'" 1 
ATOM   2111  O  "O3'" . DG  F  3  12   ? 70.891  -11.704 39.368  1.00 70.43  ? 13   DG  Z "O3'" 1 
ATOM   2112  C  "C2'" . DG  F  3  12   ? 70.389  -11.168 37.047  1.00 60.67  ? 13   DG  Z "C2'" 1 
ATOM   2113  C  "C1'" . DG  F  3  12   ? 68.885  -11.249 37.215  1.00 58.40  ? 13   DG  Z "C1'" 1 
ATOM   2114  N  N9    . DG  F  3  12   ? 68.129  -11.143 35.975  1.00 55.06  ? 13   DG  Z N9    1 
ATOM   2115  C  C8    . DG  F  3  12   ? 68.213  -10.109 35.082  1.00 53.58  ? 13   DG  Z C8    1 
ATOM   2116  N  N7    . DG  F  3  12   ? 67.371  -10.214 34.096  1.00 53.29  ? 13   DG  Z N7    1 
ATOM   2117  C  C5    . DG  F  3  12   ? 66.702  -11.404 34.336  1.00 52.37  ? 13   DG  Z C5    1 
ATOM   2118  C  C6    . DG  F  3  12   ? 65.681  -12.016 33.596  1.00 53.14  ? 13   DG  Z C6    1 
ATOM   2119  O  O6    . DG  F  3  12   ? 65.157  -11.595 32.558  1.00 54.56  ? 13   DG  Z O6    1 
ATOM   2120  N  N1    . DG  F  3  12   ? 65.271  -13.229 34.169  1.00 51.58  ? 13   DG  Z N1    1 
ATOM   2121  C  C2    . DG  F  3  12   ? 65.791  -13.763 35.318  1.00 50.53  ? 13   DG  Z C2    1 
ATOM   2122  N  N2    . DG  F  3  12   ? 65.269  -14.950 35.698  1.00 48.98  ? 13   DG  Z N2    1 
ATOM   2123  N  N3    . DG  F  3  12   ? 66.753  -13.180 36.036  1.00 51.44  ? 13   DG  Z N3    1 
ATOM   2124  C  C4    . DG  F  3  12   ? 67.160  -12.006 35.483  1.00 52.88  ? 13   DG  Z C4    1 
ATOM   2125  P  P     . DG  F  3  13   ? 72.223  -12.627 39.489  1.00 75.41  ? 14   DG  Z P     1 
ATOM   2126  O  OP1   . DG  F  3  13   ? 72.501  -12.885 40.938  1.00 74.11  ? 14   DG  Z OP1   1 
ATOM   2127  O  OP2   . DG  F  3  13   ? 73.291  -12.019 38.644  1.00 74.74  ? 14   DG  Z OP2   1 
ATOM   2128  O  "O5'" . DG  F  3  13   ? 71.785  -14.021 38.829  1.00 75.35  ? 14   DG  Z "O5'" 1 
ATOM   2129  C  "C5'" . DG  F  3  13   ? 71.045  -14.996 39.584  1.00 75.85  ? 14   DG  Z "C5'" 1 
ATOM   2130  C  "C4'" . DG  F  3  13   ? 70.844  -16.256 38.773  1.00 75.47  ? 14   DG  Z "C4'" 1 
ATOM   2131  O  "O4'" . DG  F  3  13   ? 69.878  -16.029 37.713  1.00 76.59  ? 14   DG  Z "O4'" 1 
ATOM   2132  C  "C3'" . DG  F  3  13   ? 72.114  -16.785 38.102  1.00 75.71  ? 14   DG  Z "C3'" 1 
ATOM   2133  O  "O3'" . DG  F  3  13   ? 72.191  -18.203 38.265  1.00 75.60  ? 14   DG  Z "O3'" 1 
ATOM   2134  C  "C2'" . DG  F  3  13   ? 71.944  -16.387 36.648  1.00 76.64  ? 14   DG  Z "C2'" 1 
ATOM   2135  C  "C1'" . DG  F  3  13   ? 70.433  -16.377 36.449  1.00 76.46  ? 14   DG  Z "C1'" 1 
ATOM   2136  N  N9    . DG  F  3  13   ? 70.025  -15.368 35.475  1.00 76.33  ? 14   DG  Z N9    1 
ATOM   2137  C  C8    . DG  F  3  13   ? 70.540  -14.098 35.372  1.00 75.88  ? 14   DG  Z C8    1 
ATOM   2138  N  N7    . DG  F  3  13   ? 70.029  -13.413 34.390  1.00 77.02  ? 14   DG  Z N7    1 
ATOM   2139  C  C5    . DG  F  3  13   ? 69.108  -14.276 33.806  1.00 77.50  ? 14   DG  Z C5    1 
ATOM   2140  C  C6    . DG  F  3  13   ? 68.241  -14.074 32.685  1.00 77.89  ? 14   DG  Z C6    1 
ATOM   2141  O  O6    . DG  F  3  13   ? 68.127  -13.064 31.981  1.00 78.78  ? 14   DG  Z O6    1 
ATOM   2142  N  N1    . DG  F  3  13   ? 67.459  -15.202 32.420  1.00 77.91  ? 14   DG  Z N1    1 
ATOM   2143  C  C2    . DG  F  3  13   ? 67.501  -16.374 33.144  1.00 76.76  ? 14   DG  Z C2    1 
ATOM   2144  N  N2    . DG  F  3  13   ? 66.656  -17.337 32.727  1.00 74.50  ? 14   DG  Z N2    1 
ATOM   2145  N  N3    . DG  F  3  13   ? 68.310  -16.577 34.196  1.00 76.74  ? 14   DG  Z N3    1 
ATOM   2146  C  C4    . DG  F  3  13   ? 69.082  -15.488 34.466  1.00 76.82  ? 14   DG  Z C4    1 
ATOM   2147  P  P     . DG  F  3  14   ? 73.192  -19.072 37.349  1.00 75.34  ? 15   DG  Z P     1 
ATOM   2148  O  OP1   . DG  F  3  14   ? 73.574  -20.270 38.139  1.00 75.12  ? 15   DG  Z OP1   1 
ATOM   2149  O  OP2   . DG  F  3  14   ? 74.257  -18.180 36.810  1.00 73.72  ? 15   DG  Z OP2   1 
ATOM   2150  O  "O5'" . DG  F  3  14   ? 72.233  -19.548 36.165  1.00 76.19  ? 15   DG  Z "O5'" 1 
ATOM   2151  C  "C5'" . DG  F  3  14   ? 72.664  -20.492 35.177  1.00 77.06  ? 15   DG  Z "C5'" 1 
ATOM   2152  C  "C4'" . DG  F  3  14   ? 71.469  -21.064 34.443  1.00 76.36  ? 15   DG  Z "C4'" 1 
ATOM   2153  O  "O4'" . DG  F  3  14   ? 70.608  -19.972 34.033  1.00 76.87  ? 15   DG  Z "O4'" 1 
ATOM   2154  C  "C3'" . DG  F  3  14   ? 71.796  -21.853 33.173  1.00 75.68  ? 15   DG  Z "C3'" 1 
ATOM   2155  O  "O3'" . DG  F  3  14   ? 70.884  -22.921 32.910  1.00 75.28  ? 15   DG  Z "O3'" 1 
ATOM   2156  C  "C2'" . DG  F  3  14   ? 71.633  -20.817 32.074  1.00 75.84  ? 15   DG  Z "C2'" 1 
ATOM   2157  C  "C1'" . DG  F  3  14   ? 70.566  -19.865 32.616  1.00 76.70  ? 15   DG  Z "C1'" 1 
ATOM   2158  N  N9    . DG  F  3  14   ? 70.837  -18.469 32.278  1.00 76.96  ? 15   DG  Z N9    1 
ATOM   2159  C  C8    . DG  F  3  14   ? 71.731  -17.637 32.909  1.00 76.48  ? 15   DG  Z C8    1 
ATOM   2160  N  N7    . DG  F  3  14   ? 71.815  -16.459 32.357  1.00 76.17  ? 15   DG  Z N7    1 
ATOM   2161  C  C5    . DG  F  3  14   ? 70.911  -16.506 31.305  1.00 76.76  ? 15   DG  Z C5    1 
ATOM   2162  C  C6    . DG  F  3  14   ? 70.575  -15.521 30.350  1.00 76.95  ? 15   DG  Z C6    1 
ATOM   2163  O  O6    . DG  F  3  14   ? 71.031  -14.381 30.243  1.00 77.69  ? 15   DG  Z O6    1 
ATOM   2164  N  N1    . DG  F  3  14   ? 69.606  -15.974 29.455  1.00 76.99  ? 15   DG  Z N1    1 
ATOM   2165  C  C2    . DG  F  3  14   ? 69.037  -17.230 29.482  1.00 77.73  ? 15   DG  Z C2    1 
ATOM   2166  N  N2    . DG  F  3  14   ? 68.115  -17.493 28.538  1.00 78.40  ? 15   DG  Z N2    1 
ATOM   2167  N  N3    . DG  F  3  14   ? 69.348  -18.164 30.373  1.00 77.84  ? 15   DG  Z N3    1 
ATOM   2168  C  C4    . DG  F  3  14   ? 70.287  -17.736 31.248  1.00 77.29  ? 15   DG  Z C4    1 
ATOM   2169  N  N     . MET G  4  1    ? 114.267 71.844  -44.914 1.00 95.03  ? 1    MET A N     1 
ATOM   2170  C  CA    . MET G  4  1    ? 114.004 70.486  -44.351 1.00 94.53  ? 1    MET A CA    1 
ATOM   2171  C  C     . MET G  4  1    ? 113.188 69.654  -45.353 1.00 93.84  ? 1    MET A C     1 
ATOM   2172  O  O     . MET G  4  1    ? 112.664 70.229  -46.311 1.00 94.00  ? 1    MET A O     1 
ATOM   2173  C  CB    . MET G  4  1    ? 113.263 70.630  -43.012 1.00 94.72  ? 1    MET A CB    1 
ATOM   2174  C  CG    . MET G  4  1    ? 114.069 71.338  -41.899 1.00 94.69  ? 1    MET A CG    1 
ATOM   2175  S  SD    . MET G  4  1    ? 113.985 73.155  -41.873 1.00 94.31  ? 1    MET A SD    1 
ATOM   2176  C  CE    . MET G  4  1    ? 112.279 73.406  -41.338 1.00 94.16  ? 1    MET A CE    1 
ATOM   2177  N  N     . LEU G  4  2    ? 113.062 68.333  -45.155 1.00 92.79  ? 2    LEU A N     1 
ATOM   2178  C  CA    . LEU G  4  2    ? 112.351 67.518  -46.164 1.00 91.08  ? 2    LEU A CA    1 
ATOM   2179  C  C     . LEU G  4  2    ? 111.293 66.530  -45.576 1.00 89.65  ? 2    LEU A C     1 
ATOM   2180  O  O     . LEU G  4  2    ? 110.167 66.489  -46.080 1.00 89.55  ? 2    LEU A O     1 
ATOM   2181  C  CB    . LEU G  4  2    ? 113.356 66.695  -46.997 1.00 91.40  ? 2    LEU A CB    1 
ATOM   2182  C  CG    . LEU G  4  2    ? 114.183 67.302  -48.137 1.00 91.36  ? 2    LEU A CG    1 
ATOM   2183  C  CD1   . LEU G  4  2    ? 114.825 66.165  -48.923 1.00 91.90  ? 2    LEU A CD1   1 
ATOM   2184  C  CD2   . LEU G  4  2    ? 113.305 68.124  -49.068 1.00 91.44  ? 2    LEU A CD2   1 
ATOM   2185  N  N     . ASP G  4  3    ? 111.626 65.750  -44.545 1.00 88.47  ? 3    ASP A N     1 
ATOM   2186  C  CA    . ASP G  4  3    ? 110.740 64.674  -44.017 1.00 86.71  ? 3    ASP A CA    1 
ATOM   2187  C  C     . ASP G  4  3    ? 109.553 65.187  -43.130 1.00 85.74  ? 3    ASP A C     1 
ATOM   2188  O  O     . ASP G  4  3    ? 108.499 65.578  -43.656 1.00 84.69  ? 3    ASP A O     1 
ATOM   2189  C  CB    . ASP G  4  3    ? 111.661 63.671  -43.264 1.00 86.47  ? 3    ASP A CB    1 
ATOM   2190  C  CG    . ASP G  4  3    ? 110.942 62.425  -42.705 1.00 86.13  ? 3    ASP A CG    1 
ATOM   2191  O  OD1   . ASP G  4  3    ? 110.198 61.738  -43.435 1.00 85.49  ? 3    ASP A OD1   1 
ATOM   2192  O  OD2   . ASP G  4  3    ? 111.149 62.118  -41.509 1.00 85.31  ? 3    ASP A OD2   1 
ATOM   2193  N  N     . SER G  4  4    ? 109.720 65.166  -41.803 1.00 85.53  ? 4    SER A N     1 
ATOM   2194  C  CA    . SER G  4  4    ? 108.649 65.516  -40.852 1.00 85.58  ? 4    SER A CA    1 
ATOM   2195  C  C     . SER G  4  4    ? 108.515 67.026  -40.625 1.00 85.85  ? 4    SER A C     1 
ATOM   2196  O  O     . SER G  4  4    ? 107.408 67.496  -40.346 1.00 86.36  ? 4    SER A O     1 
ATOM   2197  C  CB    . SER G  4  4    ? 108.900 64.820  -39.499 1.00 85.48  ? 4    SER A CB    1 
ATOM   2198  O  OG    . SER G  4  4    ? 107.809 64.945  -38.597 1.00 85.05  ? 4    SER A OG    1 
ATOM   2199  N  N     . LYS G  4  5    ? 109.600 67.793  -40.729 1.00 86.14  ? 5    LYS A N     1 
ATOM   2200  C  CA    . LYS G  4  5    ? 109.489 69.238  -40.501 1.00 86.25  ? 5    LYS A CA    1 
ATOM   2201  C  C     . LYS G  4  5    ? 109.053 69.984  -41.775 1.00 87.38  ? 5    LYS A C     1 
ATOM   2202  O  O     . LYS G  4  5    ? 108.306 70.960  -41.661 1.00 87.39  ? 5    LYS A O     1 
ATOM   2203  C  CB    . LYS G  4  5    ? 110.812 69.817  -39.970 1.00 84.44  ? 5    LYS A CB    1 
ATOM   2204  C  CG    . LYS G  4  5    ? 110.629 70.933  -38.914 1.00 82.04  ? 5    LYS A CG    1 
ATOM   2205  C  CD    . LYS G  4  5    ? 110.306 70.396  -37.503 1.00 80.80  ? 5    LYS A CD    1 
ATOM   2206  C  CE    . LYS G  4  5    ? 108.834 69.984  -37.319 1.00 80.17  ? 5    LYS A CE    1 
ATOM   2207  N  NZ    . LYS G  4  5    ? 108.509 69.398  -35.974 1.00 78.36  ? 5    LYS A NZ    1 
ATOM   2208  N  N     . LEU G  4  6    ? 109.500 69.571  -42.973 1.00 88.65  ? 6    LEU A N     1 
ATOM   2209  C  CA    . LEU G  4  6    ? 108.987 70.244  -44.177 1.00 89.81  ? 6    LEU A CA    1 
ATOM   2210  C  C     . LEU G  4  6    ? 107.492 70.018  -44.261 1.00 90.40  ? 6    LEU A C     1 
ATOM   2211  O  O     . LEU G  4  6    ? 106.737 70.893  -44.691 1.00 90.54  ? 6    LEU A O     1 
ATOM   2212  C  CB    . LEU G  4  6    ? 109.647 69.740  -45.482 1.00 90.25  ? 6    LEU A CB    1 
ATOM   2213  C  CG    . LEU G  4  6    ? 109.455 70.763  -46.640 1.00 90.84  ? 6    LEU A CG    1 
ATOM   2214  C  CD1   . LEU G  4  6    ? 110.224 72.059  -46.302 1.00 90.42  ? 6    LEU A CD1   1 
ATOM   2215  C  CD2   . LEU G  4  6    ? 109.958 70.198  -47.970 1.00 90.72  ? 6    LEU A CD2   1 
ATOM   2216  N  N     . LYS G  4  7    ? 107.089 68.810  -43.843 1.00 90.71  ? 7    LYS A N     1 
ATOM   2217  C  CA    . LYS G  4  7    ? 105.677 68.474  -43.681 1.00 90.50  ? 7    LYS A CA    1 
ATOM   2218  C  C     . LYS G  4  7    ? 105.153 69.273  -42.493 1.00 89.44  ? 7    LYS A C     1 
ATOM   2219  O  O     . LYS G  4  7    ? 104.896 68.749  -41.406 1.00 89.36  ? 7    LYS A O     1 
ATOM   2220  C  CB    . LYS G  4  7    ? 105.512 66.957  -43.417 1.00 90.68  ? 7    LYS A CB    1 
ATOM   2221  C  CG    . LYS G  4  7    ? 104.095 66.488  -43.044 1.00 90.85  ? 7    LYS A CG    1 
ATOM   2222  C  CD    . LYS G  4  7    ? 104.142 65.247  -42.155 1.00 91.27  ? 7    LYS A CD    1 
ATOM   2223  C  CE    . LYS G  4  7    ? 102.820 65.014  -41.432 1.00 91.47  ? 7    LYS A CE    1 
ATOM   2224  N  NZ    . LYS G  4  7    ? 102.873 63.809  -40.558 1.00 91.43  ? 7    LYS A NZ    1 
ATOM   2225  N  N     . ALA G  4  8    ? 105.045 70.576  -42.724 1.00 88.34  ? 8    ALA A N     1 
ATOM   2226  C  CA    . ALA G  4  8    ? 104.656 71.516  -41.698 1.00 87.00  ? 8    ALA A CA    1 
ATOM   2227  C  C     . ALA G  4  8    ? 103.373 72.228  -42.054 1.00 85.80  ? 8    ALA A C     1 
ATOM   2228  O  O     . ALA G  4  8    ? 103.014 72.325  -43.231 1.00 86.16  ? 8    ALA A O     1 
ATOM   2229  C  CB    . ALA G  4  8    ? 105.771 72.537  -41.504 1.00 86.70  ? 8    ALA A CB    1 
ATOM   2230  N  N     . PRO G  4  9    ? 102.660 72.732  -41.030 1.00 84.72  ? 9    PRO A N     1 
ATOM   2231  C  CA    . PRO G  4  9    ? 101.407 73.458  -41.217 1.00 84.05  ? 9    PRO A CA    1 
ATOM   2232  C  C     . PRO G  4  9    ? 101.502 74.547  -42.298 1.00 83.63  ? 9    PRO A C     1 
ATOM   2233  O  O     . PRO G  4  9    ? 102.097 75.615  -42.079 1.00 83.66  ? 9    PRO A O     1 
ATOM   2234  C  CB    . PRO G  4  9    ? 101.136 73.992  -39.825 1.00 84.07  ? 9    PRO A CB    1 
ATOM   2235  C  CG    . PRO G  4  9    ? 101.480 72.794  -38.998 1.00 83.57  ? 9    PRO A CG    1 
ATOM   2236  C  CD    . PRO G  4  9    ? 102.787 72.326  -39.611 1.00 84.11  ? 9    PRO A CD    1 
ATOM   2237  N  N     . VAL G  4  10   ? 100.922 74.262  -43.467 1.00 81.99  ? 10   VAL A N     1 
ATOM   2238  C  CA    . VAL G  4  10   ? 100.889 75.234  -44.554 1.00 80.06  ? 10   VAL A CA    1 
ATOM   2239  C  C     . VAL G  4  10   ? 99.912  76.339  -44.209 1.00 78.90  ? 10   VAL A C     1 
ATOM   2240  O  O     . VAL G  4  10   ? 98.708  76.165  -44.380 1.00 79.87  ? 10   VAL A O     1 
ATOM   2241  C  CB    . VAL G  4  10   ? 100.427 74.595  -45.923 1.00 79.59  ? 10   VAL A CB    1 
ATOM   2242  C  CG1   . VAL G  4  10   ? 100.551 75.617  -47.052 1.00 78.38  ? 10   VAL A CG1   1 
ATOM   2243  C  CG2   . VAL G  4  10   ? 101.260 73.372  -46.251 1.00 79.42  ? 10   VAL A CG2   1 
ATOM   2244  N  N     . PHE G  4  11   ? 100.414 77.458  -43.705 1.00 76.41  ? 11   PHE A N     1 
ATOM   2245  C  CA    . PHE G  4  11   ? 99.546  78.561  -43.342 1.00 74.30  ? 11   PHE A CA    1 
ATOM   2246  C  C     . PHE G  4  11   ? 99.064  79.310  -44.595 1.00 73.78  ? 11   PHE A C     1 
ATOM   2247  O  O     . PHE G  4  11   ? 99.825  80.050  -45.219 1.00 73.86  ? 11   PHE A O     1 
ATOM   2248  C  CB    . PHE G  4  11   ? 100.326 79.468  -42.376 1.00 73.00  ? 11   PHE A CB    1 
ATOM   2249  C  CG    . PHE G  4  11   ? 99.523  80.583  -41.759 1.00 72.30  ? 11   PHE A CG    1 
ATOM   2250  C  CD1   . PHE G  4  11   ? 98.208  80.372  -41.297 1.00 71.93  ? 11   PHE A CD1   1 
ATOM   2251  C  CD2   . PHE G  4  11   ? 100.091 81.866  -41.630 1.00 71.78  ? 11   PHE A CD2   1 
ATOM   2252  C  CE1   . PHE G  4  11   ? 97.459  81.439  -40.711 1.00 70.72  ? 11   PHE A CE1   1 
ATOM   2253  C  CE2   . PHE G  4  11   ? 99.364  82.943  -41.049 1.00 70.42  ? 11   PHE A CE2   1 
ATOM   2254  C  CZ    . PHE G  4  11   ? 98.046  82.728  -40.589 1.00 70.14  ? 11   PHE A CZ    1 
ATOM   2255  N  N     . THR G  4  12   ? 97.800  79.089  -44.970 1.00 72.67  ? 12   THR A N     1 
ATOM   2256  C  CA    . THR G  4  12   ? 97.205  79.757  -46.129 1.00 71.74  ? 12   THR A CA    1 
ATOM   2257  C  C     . THR G  4  12   ? 96.184  80.808  -45.676 1.00 72.28  ? 12   THR A C     1 
ATOM   2258  O  O     . THR G  4  12   ? 95.380  80.560  -44.767 1.00 71.70  ? 12   THR A O     1 
ATOM   2259  C  CB    . THR G  4  12   ? 96.487  78.753  -47.103 1.00 70.65  ? 12   THR A CB    1 
ATOM   2260  O  OG1   . THR G  4  12   ? 95.239  78.342  -46.547 1.00 68.63  ? 12   THR A OG1   1 
ATOM   2261  C  CG2   . THR G  4  12   ? 97.363  77.535  -47.371 1.00 68.77  ? 12   THR A CG2   1 
ATOM   2262  N  N     . VAL G  4  13   ? 96.225  81.978  -46.316 1.00 71.91  ? 13   VAL A N     1 
ATOM   2263  C  CA    . VAL G  4  13   ? 95.355  83.099  -45.962 1.00 71.63  ? 13   VAL A CA    1 
ATOM   2264  C  C     . VAL G  4  13   ? 94.521  83.565  -47.148 1.00 70.86  ? 13   VAL A C     1 
ATOM   2265  O  O     . VAL G  4  13   ? 94.966  83.547  -48.293 1.00 71.52  ? 13   VAL A O     1 
ATOM   2266  C  CB    . VAL G  4  13   ? 96.202  84.329  -45.450 1.00 72.20  ? 13   VAL A CB    1 
ATOM   2267  C  CG1   . VAL G  4  13   ? 95.303  85.518  -45.148 1.00 71.52  ? 13   VAL A CG1   1 
ATOM   2268  C  CG2   . VAL G  4  13   ? 96.973  83.953  -44.201 1.00 74.06  ? 13   VAL A CG2   1 
ATOM   2269  N  N     . ARG G  4  14   ? 93.302  83.981  -46.828 1.00 69.36  ? 14   ARG A N     1 
ATOM   2270  C  CA    . ARG G  4  14   ? 92.328  84.554  -47.756 1.00 69.23  ? 14   ARG A CA    1 
ATOM   2271  C  C     . ARG G  4  14   ? 91.516  85.632  -47.047 1.00 68.54  ? 14   ARG A C     1 
ATOM   2272  O  O     . ARG G  4  14   ? 90.510  85.345  -46.386 1.00 69.80  ? 14   ARG A O     1 
ATOM   2273  C  CB    . ARG G  4  14   ? 91.375  83.483  -48.298 1.00 68.87  ? 14   ARG A CB    1 
ATOM   2274  C  CG    . ARG G  4  14   ? 91.910  82.744  -49.507 1.00 68.35  ? 14   ARG A CG    1 
ATOM   2275  C  CD    . ARG G  4  14   ? 90.964  81.642  -49.943 1.00 67.99  ? 14   ARG A CD    1 
ATOM   2276  N  NE    . ARG G  4  14   ? 90.482  80.850  -48.815 1.00 67.42  ? 14   ARG A NE    1 
ATOM   2277  C  CZ    . ARG G  4  14   ? 91.258  80.241  -47.924 1.00 67.71  ? 14   ARG A CZ    1 
ATOM   2278  N  NH1   . ARG G  4  14   ? 92.582  80.312  -47.999 1.00 68.02  ? 14   ARG A NH1   1 
ATOM   2279  N  NH2   . ARG G  4  14   ? 90.697  79.556  -46.946 1.00 68.36  ? 14   ARG A NH2   1 
ATOM   2280  N  N     . THR G  4  15   ? 91.957  86.875  -47.177 1.00 67.57  ? 15   THR A N     1 
ATOM   2281  C  CA    . THR G  4  15   ? 91.291  87.968  -46.490 1.00 65.99  ? 15   THR A CA    1 
ATOM   2282  C  C     . THR G  4  15   ? 90.841  89.052  -47.454 1.00 64.83  ? 15   THR A C     1 
ATOM   2283  O  O     . THR G  4  15   ? 91.627  89.554  -48.250 1.00 65.59  ? 15   THR A O     1 
ATOM   2284  C  CB    . THR G  4  15   ? 92.241  88.568  -45.403 1.00 65.73  ? 15   THR A CB    1 
ATOM   2285  O  OG1   . THR G  4  15   ? 91.860  89.909  -45.086 1.00 66.03  ? 15   THR A OG1   1 
ATOM   2286  C  CG2   . THR G  4  15   ? 93.660  88.566  -45.890 1.00 66.34  ? 15   THR A CG2   1 
ATOM   2287  N  N     . GLN G  4  16   ? 89.557  89.391  -47.369 1.00 63.39  ? 16   GLN A N     1 
ATOM   2288  C  CA    . GLN G  4  16   ? 88.953  90.445  -48.171 1.00 61.32  ? 16   GLN A CA    1 
ATOM   2289  C  C     . GLN G  4  16   ? 88.526  91.599  -47.269 1.00 60.57  ? 16   GLN A C     1 
ATOM   2290  O  O     . GLN G  4  16   ? 87.709  91.415  -46.366 1.00 60.91  ? 16   GLN A O     1 
ATOM   2291  C  CB    . GLN G  4  16   ? 87.737  89.900  -48.939 1.00 60.41  ? 16   GLN A CB    1 
ATOM   2292  C  CG    . GLN G  4  16   ? 87.041  90.964  -49.802 1.00 59.88  ? 16   GLN A CG    1 
ATOM   2293  C  CD    . GLN G  4  16   ? 85.524  90.955  -49.673 1.00 60.51  ? 16   GLN A CD    1 
ATOM   2294  O  OE1   . GLN G  4  16   ? 84.915  91.954  -49.279 1.00 60.65  ? 16   GLN A OE1   1 
ATOM   2295  N  NE2   . GLN G  4  16   ? 84.909  89.832  -50.008 1.00 60.24  ? 16   GLN A NE2   1 
ATOM   2296  N  N     . GLY G  4  17   ? 89.075  92.786  -47.504 1.00 59.68  ? 17   GLY A N     1 
ATOM   2297  C  CA    . GLY G  4  17   ? 88.757  93.909  -46.646 1.00 57.73  ? 17   GLY A CA    1 
ATOM   2298  C  C     . GLY G  4  17   ? 89.429  93.726  -45.300 1.00 56.85  ? 17   GLY A C     1 
ATOM   2299  O  O     . GLY G  4  17   ? 90.380  92.952  -45.199 1.00 57.75  ? 17   GLY A O     1 
ATOM   2300  N  N     . ARG G  4  18   ? 88.946  94.416  -44.271 1.00 54.94  ? 18   ARG A N     1 
ATOM   2301  C  CA    . ARG G  4  18   ? 89.507  94.310  -42.923 1.00 53.15  ? 18   ARG A CA    1 
ATOM   2302  C  C     . ARG G  4  18   ? 88.531  93.634  -41.989 1.00 55.10  ? 18   ARG A C     1 
ATOM   2303  O  O     . ARG G  4  18   ? 88.792  93.522  -40.791 1.00 55.33  ? 18   ARG A O     1 
ATOM   2304  C  CB    . ARG G  4  18   ? 89.846  95.708  -42.401 1.00 47.29  ? 18   ARG A CB    1 
ATOM   2305  C  CG    . ARG G  4  18   ? 90.724  96.463  -43.407 1.00 40.41  ? 18   ARG A CG    1 
ATOM   2306  C  CD    . ARG G  4  18   ? 91.067  97.869  -43.008 1.00 33.53  ? 18   ARG A CD    1 
ATOM   2307  N  NE    . ARG G  4  18   ? 91.645  97.897  -41.680 1.00 28.76  ? 18   ARG A NE    1 
ATOM   2308  C  CZ    . ARG G  4  18   ? 92.215  98.961  -41.150 1.00 27.98  ? 18   ARG A CZ    1 
ATOM   2309  N  NH1   . ARG G  4  18   ? 92.291  100.076 -41.852 1.00 24.55  ? 18   ARG A NH1   1 
ATOM   2310  N  NH2   . ARG G  4  18   ? 92.694  98.909  -39.916 1.00 28.07  ? 18   ARG A NH2   1 
ATOM   2311  N  N     . GLU G  4  19   ? 87.418  93.177  -42.577 1.00 58.01  ? 19   GLU A N     1 
ATOM   2312  C  CA    . GLU G  4  19   ? 86.299  92.531  -41.872 1.00 60.93  ? 19   GLU A CA    1 
ATOM   2313  C  C     . GLU G  4  19   ? 86.394  90.991  -41.893 1.00 61.35  ? 19   GLU A C     1 
ATOM   2314  O  O     . GLU G  4  19   ? 86.403  90.353  -40.834 1.00 61.92  ? 19   GLU A O     1 
ATOM   2315  C  CB    . GLU G  4  19   ? 84.960  92.959  -42.501 1.00 62.37  ? 19   GLU A CB    1 
ATOM   2316  C  CG    . GLU G  4  19   ? 84.570  94.429  -42.274 1.00 64.75  ? 19   GLU A CG    1 
ATOM   2317  C  CD    . GLU G  4  19   ? 85.415  95.426  -43.078 1.00 66.00  ? 19   GLU A CD    1 
ATOM   2318  O  OE1   . GLU G  4  19   ? 86.389  95.987  -42.523 1.00 65.97  ? 19   GLU A OE1   1 
ATOM   2319  O  OE2   . GLU G  4  19   ? 85.101  95.648  -44.271 1.00 68.00  ? 19   GLU A OE2   1 
ATOM   2320  N  N     . TYR G  4  20   ? 86.456  90.388  -43.078 1.00 60.57  ? 20   TYR A N     1 
ATOM   2321  C  CA    . TYR G  4  20   ? 86.513  88.936  -43.147 1.00 59.06  ? 20   TYR A CA    1 
ATOM   2322  C  C     . TYR G  4  20   ? 87.920  88.446  -43.410 1.00 60.08  ? 20   TYR A C     1 
ATOM   2323  O  O     . TYR G  4  20   ? 88.680  89.090  -44.115 1.00 60.42  ? 20   TYR A O     1 
ATOM   2324  C  CB    . TYR G  4  20   ? 85.582  88.413  -44.244 1.00 55.00  ? 20   TYR A CB    1 
ATOM   2325  C  CG    . TYR G  4  20   ? 85.230  86.937  -44.123 1.00 51.33  ? 20   TYR A CG    1 
ATOM   2326  C  CD1   . TYR G  4  20   ? 84.615  86.263  -45.189 1.00 50.99  ? 20   TYR A CD1   1 
ATOM   2327  C  CD2   . TYR G  4  20   ? 85.480  86.205  -42.937 1.00 50.10  ? 20   TYR A CD2   1 
ATOM   2328  C  CE1   . TYR G  4  20   ? 84.252  84.888  -45.079 1.00 49.16  ? 20   TYR A CE1   1 
ATOM   2329  C  CE2   . TYR G  4  20   ? 85.123  84.841  -42.819 1.00 47.66  ? 20   TYR A CE2   1 
ATOM   2330  C  CZ    . TYR G  4  20   ? 84.513  84.205  -43.894 1.00 48.01  ? 20   TYR A CZ    1 
ATOM   2331  O  OH    . TYR G  4  20   ? 84.164  82.899  -43.793 1.00 47.48  ? 20   TYR A OH    1 
ATOM   2332  N  N     . GLY G  4  21   ? 88.256  87.301  -42.833 1.00 62.07  ? 21   GLY A N     1 
ATOM   2333  C  CA    . GLY G  4  21   ? 89.577  86.735  -43.020 1.00 64.97  ? 21   GLY A CA    1 
ATOM   2334  C  C     . GLY G  4  21   ? 89.629  85.265  -42.691 1.00 66.76  ? 21   GLY A C     1 
ATOM   2335  O  O     . GLY G  4  21   ? 89.607  84.878  -41.527 1.00 66.57  ? 21   GLY A O     1 
ATOM   2336  N  N     . GLU G  4  22   ? 89.691  84.442  -43.725 1.00 69.54  ? 22   GLU A N     1 
ATOM   2337  C  CA    . GLU G  4  22   ? 89.774  82.998  -43.539 1.00 73.89  ? 22   GLU A CA    1 
ATOM   2338  C  C     . GLU G  4  22   ? 91.234  82.581  -43.292 1.00 74.93  ? 22   GLU A C     1 
ATOM   2339  O  O     . GLU G  4  22   ? 92.151  83.222  -43.819 1.00 76.20  ? 22   GLU A O     1 
ATOM   2340  C  CB    . GLU G  4  22   ? 89.235  82.286  -44.789 1.00 75.09  ? 22   GLU A CB    1 
ATOM   2341  C  CG    . GLU G  4  22   ? 88.593  80.939  -44.551 1.00 76.61  ? 22   GLU A CG    1 
ATOM   2342  C  CD    . GLU G  4  22   ? 87.095  81.046  -44.459 1.00 77.44  ? 22   GLU A CD    1 
ATOM   2343  O  OE1   . GLU G  4  22   ? 86.476  81.470  -45.455 1.00 78.22  ? 22   GLU A OE1   1 
ATOM   2344  O  OE2   . GLU G  4  22   ? 86.536  80.710  -43.398 1.00 77.97  ? 22   GLU A OE2   1 
ATOM   2345  N  N     . PHE G  4  23   ? 91.464  81.530  -42.504 1.00 75.08  ? 23   PHE A N     1 
ATOM   2346  C  CA    . PHE G  4  23   ? 92.834  81.095  -42.228 1.00 75.00  ? 23   PHE A CA    1 
ATOM   2347  C  C     . PHE G  4  23   ? 92.925  79.576  -42.122 1.00 77.45  ? 23   PHE A C     1 
ATOM   2348  O  O     . PHE G  4  23   ? 92.486  78.988  -41.129 1.00 78.14  ? 23   PHE A O     1 
ATOM   2349  C  CB    . PHE G  4  23   ? 93.325  81.754  -40.937 1.00 71.60  ? 23   PHE A CB    1 
ATOM   2350  C  CG    . PHE G  4  23   ? 93.509  83.237  -41.061 1.00 68.04  ? 23   PHE A CG    1 
ATOM   2351  C  CD1   . PHE G  4  23   ? 94.675  83.772  -41.643 1.00 66.34  ? 23   PHE A CD1   1 
ATOM   2352  C  CD2   . PHE G  4  23   ? 92.503  84.113  -40.620 1.00 66.62  ? 23   PHE A CD2   1 
ATOM   2353  C  CE1   . PHE G  4  23   ? 94.841  85.163  -41.786 1.00 64.97  ? 23   PHE A CE1   1 
ATOM   2354  C  CE2   . PHE G  4  23   ? 92.646  85.514  -40.754 1.00 66.21  ? 23   PHE A CE2   1 
ATOM   2355  C  CZ    . PHE G  4  23   ? 93.821  86.039  -41.340 1.00 66.03  ? 23   PHE A CZ    1 
ATOM   2356  N  N     . VAL G  4  24   ? 93.500  78.958  -43.156 1.00 78.56  ? 24   VAL A N     1 
ATOM   2357  C  CA    . VAL G  4  24   ? 93.661  77.497  -43.240 1.00 79.72  ? 24   VAL A CA    1 
ATOM   2358  C  C     . VAL G  4  24   ? 95.079  77.073  -42.815 1.00 79.68  ? 24   VAL A C     1 
ATOM   2359  O  O     . VAL G  4  24   ? 96.053  77.760  -43.128 1.00 80.12  ? 24   VAL A O     1 
ATOM   2360  C  CB    . VAL G  4  24   ? 93.385  76.992  -44.717 1.00 80.26  ? 24   VAL A CB    1 
ATOM   2361  C  CG1   . VAL G  4  24   ? 93.473  75.476  -44.802 1.00 80.55  ? 24   VAL A CG1   1 
ATOM   2362  C  CG2   . VAL G  4  24   ? 92.012  77.459  -45.181 1.00 80.11  ? 24   VAL A CG2   1 
ATOM   2363  N  N     . LEU G  4  25   ? 95.185  75.949  -42.104 1.00 78.63  ? 25   LEU A N     1 
ATOM   2364  C  CA    . LEU G  4  25   ? 96.473  75.429  -41.641 1.00 78.12  ? 25   LEU A CA    1 
ATOM   2365  C  C     . LEU G  4  25   ? 96.432  73.903  -41.502 1.00 77.94  ? 25   LEU A C     1 
ATOM   2366  O  O     . LEU G  4  25   ? 95.772  73.366  -40.612 1.00 78.71  ? 25   LEU A O     1 
ATOM   2367  C  CB    . LEU G  4  25   ? 96.843  76.052  -40.292 1.00 76.40  ? 25   LEU A CB    1 
ATOM   2368  C  CG    . LEU G  4  25   ? 98.282  75.784  -39.854 1.00 75.33  ? 25   LEU A CG    1 
ATOM   2369  C  CD1   . LEU G  4  25   ? 99.209  76.791  -40.506 1.00 74.77  ? 25   LEU A CD1   1 
ATOM   2370  C  CD2   . LEU G  4  25   ? 98.386  75.891  -38.360 1.00 75.20  ? 25   LEU A CD2   1 
ATOM   2371  N  N     . GLU G  4  26   ? 97.144  73.213  -42.386 1.00 76.82  ? 26   GLU A N     1 
ATOM   2372  C  CA    . GLU G  4  26   ? 97.184  71.750  -42.395 1.00 75.72  ? 26   GLU A CA    1 
ATOM   2373  C  C     . GLU G  4  26   ? 98.507  71.240  -42.999 1.00 74.83  ? 26   GLU A C     1 
ATOM   2374  O  O     . GLU G  4  26   ? 99.186  71.976  -43.716 1.00 74.34  ? 26   GLU A O     1 
ATOM   2375  C  CB    . GLU G  4  26   ? 95.955  71.216  -43.198 1.00 75.10  ? 26   GLU A CB    1 
ATOM   2376  C  CG    . GLU G  4  26   ? 96.221  70.151  -44.317 1.00 73.02  ? 26   GLU A CG    1 
ATOM   2377  C  CD    . GLU G  4  26   ? 96.071  70.673  -45.757 1.00 72.73  ? 26   GLU A CD    1 
ATOM   2378  O  OE1   . GLU G  4  26   ? 96.278  71.888  -46.001 1.00 72.44  ? 26   GLU A OE1   1 
ATOM   2379  O  OE2   . GLU G  4  26   ? 95.753  69.847  -46.647 1.00 71.15  ? 26   GLU A OE2   1 
ATOM   2380  N  N     . PRO G  4  27   ? 98.894  69.981  -42.711 1.00 74.12  ? 27   PRO A N     1 
ATOM   2381  C  CA    . PRO G  4  27   ? 98.178  69.026  -41.861 1.00 73.21  ? 27   PRO A CA    1 
ATOM   2382  C  C     . PRO G  4  27   ? 98.520  69.194  -40.384 1.00 72.23  ? 27   PRO A C     1 
ATOM   2383  O  O     . PRO G  4  27   ? 99.528  69.821  -40.011 1.00 71.73  ? 27   PRO A O     1 
ATOM   2384  C  CB    . PRO G  4  27   ? 98.594  67.662  -42.425 1.00 74.02  ? 27   PRO A CB    1 
ATOM   2385  C  CG    . PRO G  4  27   ? 98.875  67.963  -43.859 1.00 74.39  ? 27   PRO A CG    1 
ATOM   2386  C  CD    . PRO G  4  27   ? 99.678  69.246  -43.719 1.00 74.40  ? 27   PRO A CD    1 
ATOM   2387  N  N     . LEU G  4  28   ? 97.637  68.625  -39.569 1.00 70.99  ? 28   LEU A N     1 
ATOM   2388  C  CA    . LEU G  4  28   ? 97.745  68.580  -38.118 1.00 69.97  ? 28   LEU A CA    1 
ATOM   2389  C  C     . LEU G  4  28   ? 97.583  67.144  -37.644 1.00 68.81  ? 28   LEU A C     1 
ATOM   2390  O  O     . LEU G  4  28   ? 96.843  66.379  -38.283 1.00 68.34  ? 28   LEU A O     1 
ATOM   2391  C  CB    . LEU G  4  28   ? 96.668  69.470  -37.483 1.00 69.40  ? 28   LEU A CB    1 
ATOM   2392  C  CG    . LEU G  4  28   ? 96.903  70.978  -37.613 1.00 68.42  ? 28   LEU A CG    1 
ATOM   2393  C  CD1   . LEU G  4  28   ? 95.593  71.697  -37.398 1.00 67.45  ? 28   LEU A CD1   1 
ATOM   2394  C  CD2   . LEU G  4  28   ? 97.962  71.434  -36.618 1.00 66.68  ? 28   LEU A CD2   1 
ATOM   2395  N  N     . GLU G  4  29   ? 98.256  66.764  -36.558 1.00 67.23  ? 29   GLU A N     1 
ATOM   2396  C  CA    . GLU G  4  29   ? 98.155  65.382  -36.105 1.00 65.57  ? 29   GLU A CA    1 
ATOM   2397  C  C     . GLU G  4  29   ? 96.732  65.040  -35.666 1.00 63.79  ? 29   GLU A C     1 
ATOM   2398  O  O     . GLU G  4  29   ? 95.776  65.479  -36.303 1.00 64.70  ? 29   GLU A O     1 
ATOM   2399  C  CB    . GLU G  4  29   ? 99.148  65.099  -34.970 1.00 65.39  ? 29   GLU A CB    1 
ATOM   2400  C  CG    . GLU G  4  29   ? 99.855  63.763  -35.192 1.00 62.76  ? 29   GLU A CG    1 
ATOM   2401  C  CD    . GLU G  4  29   ? 98.896  62.691  -35.663 1.00 61.32  ? 29   GLU A CD    1 
ATOM   2402  O  OE1   . GLU G  4  29   ? 98.179  62.121  -34.820 1.00 60.13  ? 29   GLU A OE1   1 
ATOM   2403  O  OE2   . GLU G  4  29   ? 98.859  62.435  -36.881 1.00 60.70  ? 29   GLU A OE2   1 
ATOM   2404  N  N     . ARG G  4  30   ? 96.551  64.273  -34.595 1.00 60.35  ? 30   ARG A N     1 
ATOM   2405  C  CA    . ARG G  4  30   ? 95.185  63.909  -34.244 1.00 57.41  ? 30   ARG A CA    1 
ATOM   2406  C  C     . ARG G  4  30   ? 94.548  64.875  -33.251 1.00 57.38  ? 30   ARG A C     1 
ATOM   2407  O  O     . ARG G  4  30   ? 95.111  65.175  -32.203 1.00 58.20  ? 30   ARG A O     1 
ATOM   2408  C  CB    . ARG G  4  30   ? 95.122  62.493  -33.670 1.00 54.09  ? 30   ARG A CB    1 
ATOM   2409  C  CG    . ARG G  4  30   ? 93.681  61.942  -33.647 1.00 48.76  ? 30   ARG A CG    1 
ATOM   2410  C  CD    . ARG G  4  30   ? 93.020  62.085  -35.033 1.00 43.63  ? 30   ARG A CD    1 
ATOM   2411  N  NE    . ARG G  4  30   ? 91.742  61.394  -35.165 1.00 39.18  ? 30   ARG A NE    1 
ATOM   2412  C  CZ    . ARG G  4  30   ? 91.027  61.342  -36.286 1.00 37.00  ? 30   ARG A CZ    1 
ATOM   2413  N  NH1   . ARG G  4  30   ? 91.456  61.946  -37.381 1.00 34.50  ? 30   ARG A NH1   1 
ATOM   2414  N  NH2   . ARG G  4  30   ? 89.884  60.674  -36.316 1.00 35.94  ? 30   ARG A NH2   1 
ATOM   2415  N  N     . GLY G  4  31   ? 93.354  65.344  -33.620 1.00 56.28  ? 31   GLY A N     1 
ATOM   2416  C  CA    . GLY G  4  31   ? 92.554  66.232  -32.795 1.00 54.40  ? 31   GLY A CA    1 
ATOM   2417  C  C     . GLY G  4  31   ? 93.262  67.487  -32.341 1.00 53.90  ? 31   GLY A C     1 
ATOM   2418  O  O     . GLY G  4  31   ? 93.036  67.944  -31.222 1.00 52.82  ? 31   GLY A O     1 
ATOM   2419  N  N     . PHE G  4  32   ? 94.109  68.055  -33.194 1.00 54.25  ? 32   PHE A N     1 
ATOM   2420  C  CA    . PHE G  4  32   ? 94.824  69.276  -32.835 1.00 54.28  ? 32   PHE A CA    1 
ATOM   2421  C  C     . PHE G  4  32   ? 94.144  70.514  -33.389 1.00 55.46  ? 32   PHE A C     1 
ATOM   2422  O  O     . PHE G  4  32   ? 94.284  71.594  -32.811 1.00 55.93  ? 32   PHE A O     1 
ATOM   2423  C  CB    . PHE G  4  32   ? 96.262  69.200  -33.327 1.00 51.70  ? 32   PHE A CB    1 
ATOM   2424  C  CG    . PHE G  4  32   ? 97.127  68.321  -32.491 1.00 49.07  ? 32   PHE A CG    1 
ATOM   2425  C  CD1   . PHE G  4  32   ? 98.403  67.966  -32.945 1.00 48.52  ? 32   PHE A CD1   1 
ATOM   2426  C  CD2   . PHE G  4  32   ? 96.670  67.828  -31.239 1.00 47.81  ? 32   PHE A CD2   1 
ATOM   2427  C  CE1   . PHE G  4  32   ? 99.227  67.130  -32.175 1.00 47.74  ? 32   PHE A CE1   1 
ATOM   2428  C  CE2   . PHE G  4  32   ? 97.471  66.993  -30.451 1.00 46.99  ? 32   PHE A CE2   1 
ATOM   2429  C  CZ    . PHE G  4  32   ? 98.759  66.638  -30.918 1.00 47.95  ? 32   PHE A CZ    1 
ATOM   2430  N  N     . GLY G  4  33   ? 93.419  70.365  -34.499 1.00 56.85  ? 33   GLY A N     1 
ATOM   2431  C  CA    . GLY G  4  33   ? 92.693  71.495  -35.052 1.00 57.78  ? 33   GLY A CA    1 
ATOM   2432  C  C     . GLY G  4  33   ? 91.727  72.080  -34.017 1.00 58.15  ? 33   GLY A C     1 
ATOM   2433  O  O     . GLY G  4  33   ? 91.539  73.307  -33.907 1.00 58.24  ? 33   GLY A O     1 
ATOM   2434  N  N     . VAL G  4  34   ? 91.115  71.183  -33.247 1.00 57.94  ? 34   VAL A N     1 
ATOM   2435  C  CA    . VAL G  4  34   ? 90.202  71.573  -32.197 1.00 56.26  ? 34   VAL A CA    1 
ATOM   2436  C  C     . VAL G  4  34   ? 90.963  72.154  -31.010 1.00 56.10  ? 34   VAL A C     1 
ATOM   2437  O  O     . VAL G  4  34   ? 90.519  73.118  -30.401 1.00 56.46  ? 34   VAL A O     1 
ATOM   2438  C  CB    . VAL G  4  34   ? 89.371  70.363  -31.721 1.00 55.70  ? 34   VAL A CB    1 
ATOM   2439  C  CG1   . VAL G  4  34   ? 90.291  69.201  -31.367 1.00 54.91  ? 34   VAL A CG1   1 
ATOM   2440  C  CG2   . VAL G  4  34   ? 88.541  70.754  -30.517 1.00 55.63  ? 34   VAL A CG2   1 
ATOM   2441  N  N     . THR G  4  35   ? 92.121  71.562  -30.708 1.00 56.44  ? 35   THR A N     1 
ATOM   2442  C  CA    . THR G  4  35   ? 92.978  71.965  -29.584 1.00 56.91  ? 35   THR A CA    1 
ATOM   2443  C  C     . THR G  4  35   ? 93.513  73.372  -29.760 1.00 57.30  ? 35   THR A C     1 
ATOM   2444  O  O     . THR G  4  35   ? 93.802  74.065  -28.790 1.00 57.13  ? 35   THR A O     1 
ATOM   2445  C  CB    . THR G  4  35   ? 94.205  71.038  -29.421 1.00 56.78  ? 35   THR A CB    1 
ATOM   2446  O  OG1   . THR G  4  35   ? 93.791  69.667  -29.381 1.00 57.84  ? 35   THR A OG1   1 
ATOM   2447  C  CG2   . THR G  4  35   ? 94.935  71.367  -28.121 1.00 56.09  ? 35   THR A CG2   1 
ATOM   2448  N  N     . LEU G  4  36   ? 93.655  73.793  -31.002 1.00 57.95  ? 36   LEU A N     1 
ATOM   2449  C  CA    . LEU G  4  36   ? 94.147  75.122  -31.265 1.00 57.78  ? 36   LEU A CA    1 
ATOM   2450  C  C     . LEU G  4  36   ? 93.000  76.072  -31.542 1.00 57.82  ? 36   LEU A C     1 
ATOM   2451  O  O     . LEU G  4  36   ? 92.946  77.159  -30.974 1.00 57.72  ? 36   LEU A O     1 
ATOM   2452  C  CB    . LEU G  4  36   ? 95.108  75.071  -32.448 1.00 58.43  ? 36   LEU A CB    1 
ATOM   2453  C  CG    . LEU G  4  36   ? 96.256  74.130  -32.094 1.00 58.58  ? 36   LEU A CG    1 
ATOM   2454  C  CD1   . LEU G  4  36   ? 96.826  73.628  -33.390 1.00 58.13  ? 36   LEU A CD1   1 
ATOM   2455  C  CD2   . LEU G  4  36   ? 97.300  74.825  -31.201 1.00 58.23  ? 36   LEU A CD2   1 
ATOM   2456  N  N     . GLY G  4  37   ? 92.079  75.638  -32.398 1.00 58.10  ? 37   GLY A N     1 
ATOM   2457  C  CA    . GLY G  4  37   ? 90.951  76.458  -32.791 1.00 58.35  ? 37   GLY A CA    1 
ATOM   2458  C  C     . GLY G  4  37   ? 90.134  77.042  -31.660 1.00 57.88  ? 37   GLY A C     1 
ATOM   2459  O  O     . GLY G  4  37   ? 89.872  78.251  -31.646 1.00 58.12  ? 37   GLY A O     1 
ATOM   2460  N  N     . ASN G  4  38   ? 89.725  76.213  -30.709 1.00 58.13  ? 38   ASN A N     1 
ATOM   2461  C  CA    . ASN G  4  38   ? 88.886  76.725  -29.632 1.00 59.17  ? 38   ASN A CA    1 
ATOM   2462  C  C     . ASN G  4  38   ? 89.597  77.786  -28.796 1.00 60.52  ? 38   ASN A C     1 
ATOM   2463  O  O     . ASN G  4  38   ? 89.035  78.869  -28.590 1.00 60.30  ? 38   ASN A O     1 
ATOM   2464  C  CB    . ASN G  4  38   ? 88.422  75.634  -28.680 1.00 58.06  ? 38   ASN A CB    1 
ATOM   2465  C  CG    . ASN G  4  38   ? 87.699  76.227  -27.489 1.00 57.02  ? 38   ASN A CG    1 
ATOM   2466  O  OD1   . ASN G  4  38   ? 87.908  75.821  -26.347 1.00 56.52  ? 38   ASN A OD1   1 
ATOM   2467  N  ND2   . ASN G  4  38   ? 86.841  77.213  -27.758 1.00 55.04  ? 38   ASN A ND2   1 
ATOM   2468  N  N     . PRO G  4  39   ? 90.819  77.497  -28.285 1.00 62.03  ? 39   PRO A N     1 
ATOM   2469  C  CA    . PRO G  4  39   ? 91.512  78.513  -27.476 1.00 62.47  ? 39   PRO A CA    1 
ATOM   2470  C  C     . PRO G  4  39   ? 91.647  79.846  -28.215 1.00 62.52  ? 39   PRO A C     1 
ATOM   2471  O  O     . PRO G  4  39   ? 91.366  80.896  -27.652 1.00 62.17  ? 39   PRO A O     1 
ATOM   2472  C  CB    . PRO G  4  39   ? 92.848  77.848  -27.154 1.00 62.42  ? 39   PRO A CB    1 
ATOM   2473  C  CG    . PRO G  4  39   ? 92.447  76.393  -27.043 1.00 61.93  ? 39   PRO A CG    1 
ATOM   2474  C  CD    . PRO G  4  39   ? 91.578  76.227  -28.266 1.00 62.16  ? 39   PRO A CD    1 
ATOM   2475  N  N     . LEU G  4  40   ? 92.072  79.798  -29.472 1.00 62.30  ? 40   LEU A N     1 
ATOM   2476  C  CA    . LEU G  4  40   ? 92.194  81.011  -30.254 1.00 63.05  ? 40   LEU A CA    1 
ATOM   2477  C  C     . LEU G  4  40   ? 90.855  81.718  -30.351 1.00 63.63  ? 40   LEU A C     1 
ATOM   2478  O  O     . LEU G  4  40   ? 90.810  82.942  -30.365 1.00 62.30  ? 40   LEU A O     1 
ATOM   2479  C  CB    . LEU G  4  40   ? 92.734  80.673  -31.647 1.00 63.69  ? 40   LEU A CB    1 
ATOM   2480  C  CG    . LEU G  4  40   ? 94.015  79.798  -31.630 1.00 64.20  ? 40   LEU A CG    1 
ATOM   2481  C  CD1   . LEU G  4  40   ? 94.572  79.752  -33.037 1.00 65.02  ? 40   LEU A CD1   1 
ATOM   2482  C  CD2   . LEU G  4  40   ? 95.083  80.333  -30.674 1.00 63.16  ? 40   LEU A CD2   1 
ATOM   2483  N  N     . ARG G  4  41   ? 89.765  80.946  -30.407 1.00 64.51  ? 41   ARG A N     1 
ATOM   2484  C  CA    . ARG G  4  41   ? 88.419  81.519  -30.457 1.00 65.47  ? 41   ARG A CA    1 
ATOM   2485  C  C     . ARG G  4  41   ? 88.110  82.253  -29.162 1.00 67.17  ? 41   ARG A C     1 
ATOM   2486  O  O     . ARG G  4  41   ? 87.671  83.399  -29.178 1.00 67.47  ? 41   ARG A O     1 
ATOM   2487  C  CB    . ARG G  4  41   ? 87.367  80.416  -30.679 1.00 63.25  ? 41   ARG A CB    1 
ATOM   2488  C  CG    . ARG G  4  41   ? 85.916  80.893  -30.650 1.00 61.64  ? 41   ARG A CG    1 
ATOM   2489  C  CD    . ARG G  4  41   ? 84.955  79.784  -31.075 1.00 60.23  ? 41   ARG A CD    1 
ATOM   2490  N  NE    . ARG G  4  41   ? 83.545  80.058  -30.756 1.00 59.74  ? 41   ARG A NE    1 
ATOM   2491  C  CZ    . ARG G  4  41   ? 82.822  81.086  -31.211 1.00 60.00  ? 41   ARG A CZ    1 
ATOM   2492  N  NH1   . ARG G  4  41   ? 83.351  81.989  -32.028 1.00 59.72  ? 41   ARG A NH1   1 
ATOM   2493  N  NH2   . ARG G  4  41   ? 81.551  81.213  -30.846 1.00 59.98  ? 41   ARG A NH2   1 
ATOM   2494  N  N     . ARG G  4  42   ? 88.354  81.581  -28.040 1.00 69.53  ? 42   ARG A N     1 
ATOM   2495  C  CA    . ARG G  4  42   ? 88.101  82.170  -26.729 1.00 72.31  ? 42   ARG A CA    1 
ATOM   2496  C  C     . ARG G  4  42   ? 88.931  83.443  -26.518 1.00 73.44  ? 42   ARG A C     1 
ATOM   2497  O  O     . ARG G  4  42   ? 88.506  84.343  -25.796 1.00 73.92  ? 42   ARG A O     1 
ATOM   2498  C  CB    . ARG G  4  42   ? 88.394  81.135  -25.615 1.00 72.94  ? 42   ARG A CB    1 
ATOM   2499  C  CG    . ARG G  4  42   ? 87.297  80.042  -25.497 1.00 74.91  ? 42   ARG A CG    1 
ATOM   2500  C  CD    . ARG G  4  42   ? 87.493  78.985  -24.367 1.00 76.39  ? 42   ARG A CD    1 
ATOM   2501  N  NE    . ARG G  4  42   ? 87.359  79.523  -23.005 1.00 78.44  ? 42   ARG A NE    1 
ATOM   2502  C  CZ    . ARG G  4  42   ? 87.018  78.811  -21.924 1.00 78.56  ? 42   ARG A CZ    1 
ATOM   2503  N  NH1   . ARG G  4  42   ? 86.762  77.513  -22.019 1.00 77.32  ? 42   ARG A NH1   1 
ATOM   2504  N  NH2   . ARG G  4  42   ? 86.931  79.405  -20.736 1.00 78.66  ? 42   ARG A NH2   1 
ATOM   2505  N  N     . ILE G  4  43   ? 90.105  83.521  -27.148 1.00 75.42  ? 43   ILE A N     1 
ATOM   2506  C  CA    . ILE G  4  43   ? 90.960  84.709  -27.026 1.00 76.59  ? 43   ILE A CA    1 
ATOM   2507  C  C     . ILE G  4  43   ? 90.463  85.835  -27.939 1.00 77.71  ? 43   ILE A C     1 
ATOM   2508  O  O     . ILE G  4  43   ? 90.342  86.983  -27.510 1.00 78.10  ? 43   ILE A O     1 
ATOM   2509  C  CB    . ILE G  4  43   ? 92.446  84.423  -27.423 1.00 76.90  ? 43   ILE A CB    1 
ATOM   2510  C  CG1   . ILE G  4  43   ? 92.970  83.168  -26.700 1.00 76.84  ? 43   ILE A CG1   1 
ATOM   2511  C  CG2   . ILE G  4  43   ? 93.304  85.667  -27.099 1.00 76.20  ? 43   ILE A CG2   1 
ATOM   2512  C  CD1   . ILE G  4  43   ? 93.178  83.280  -25.203 1.00 77.26  ? 43   ILE A CD1   1 
ATOM   2513  N  N     . LEU G  4  44   ? 90.178  85.467  -29.194 1.00 78.55  ? 44   LEU A N     1 
ATOM   2514  C  CA    . LEU G  4  44   ? 89.705  86.357  -30.269 1.00 79.00  ? 44   LEU A CA    1 
ATOM   2515  C  C     . LEU G  4  44   ? 88.458  87.139  -29.881 1.00 78.84  ? 44   LEU A C     1 
ATOM   2516  O  O     . LEU G  4  44   ? 88.199  88.199  -30.442 1.00 79.73  ? 44   LEU A O     1 
ATOM   2517  C  CB    . LEU G  4  44   ? 89.377  85.553  -31.523 1.00 78.65  ? 44   LEU A CB    1 
ATOM   2518  C  CG    . LEU G  4  44   ? 90.534  85.085  -32.397 1.00 79.03  ? 44   LEU A CG    1 
ATOM   2519  C  CD1   . LEU G  4  44   ? 90.060  83.908  -33.239 1.00 79.09  ? 44   LEU A CD1   1 
ATOM   2520  C  CD2   . LEU G  4  44   ? 91.042  86.247  -33.253 1.00 78.52  ? 44   LEU A CD2   1 
ATOM   2521  N  N     . LEU G  4  45   ? 87.675  86.634  -28.942 1.00 78.56  ? 45   LEU A N     1 
ATOM   2522  C  CA    . LEU G  4  45   ? 86.477  87.352  -28.559 1.00 77.31  ? 45   LEU A CA    1 
ATOM   2523  C  C     . LEU G  4  45   ? 86.704  88.195  -27.300 1.00 76.96  ? 45   LEU A C     1 
ATOM   2524  O  O     . LEU G  4  45   ? 86.218  89.317  -27.203 1.00 76.67  ? 45   LEU A O     1 
ATOM   2525  C  CB    . LEU G  4  45   ? 85.331  86.353  -28.320 1.00 77.62  ? 45   LEU A CB    1 
ATOM   2526  C  CG    . LEU G  4  45   ? 84.590  85.683  -29.496 1.00 77.23  ? 45   LEU A CG    1 
ATOM   2527  C  CD1   . LEU G  4  45   ? 85.535  84.911  -30.375 1.00 77.04  ? 45   LEU A CD1   1 
ATOM   2528  C  CD2   . LEU G  4  45   ? 83.548  84.743  -28.930 1.00 76.82  ? 45   LEU A CD2   1 
ATOM   2529  N  N     . SER G  4  46   ? 87.478  87.657  -26.364 1.00 76.61  ? 46   SER A N     1 
ATOM   2530  C  CA    . SER G  4  46   ? 87.680  88.261  -25.040 1.00 76.36  ? 46   SER A CA    1 
ATOM   2531  C  C     . SER G  4  46   ? 88.886  89.200  -24.940 1.00 77.02  ? 46   SER A C     1 
ATOM   2532  O  O     . SER G  4  46   ? 88.757  90.318  -24.433 1.00 76.66  ? 46   SER A O     1 
ATOM   2533  C  CB    . SER G  4  46   ? 87.885  87.160  -23.994 1.00 76.22  ? 46   SER A CB    1 
ATOM   2534  O  OG    . SER G  4  46   ? 89.164  86.541  -24.139 1.00 72.47  ? 46   SER A OG    1 
ATOM   2535  N  N     . SER G  4  47   ? 90.043  88.747  -25.408 1.00 77.23  ? 47   SER A N     1 
ATOM   2536  C  CA    . SER G  4  47   ? 91.314  89.446  -25.185 1.00 78.53  ? 47   SER A CA    1 
ATOM   2537  C  C     . SER G  4  47   ? 91.585  90.667  -26.111 1.00 78.95  ? 47   SER A C     1 
ATOM   2538  O  O     . SER G  4  47   ? 92.065  91.671  -25.594 1.00 79.06  ? 47   SER A O     1 
ATOM   2539  C  CB    . SER G  4  47   ? 92.453  88.426  -25.303 1.00 77.87  ? 47   SER A CB    1 
ATOM   2540  O  OG    . SER G  4  47   ? 93.323  88.503  -24.184 1.00 76.83  ? 47   SER A OG    1 
ATOM   2541  N  N     . ILE G  4  48   ? 91.311  90.628  -27.418 1.00 81.02  ? 48   ILE A N     1 
ATOM   2542  C  CA    . ILE G  4  48   ? 91.687  91.747  -28.332 1.00 81.96  ? 48   ILE A CA    1 
ATOM   2543  C  C     . ILE G  4  48   ? 91.164  93.129  -27.882 1.00 82.86  ? 48   ILE A C     1 
ATOM   2544  O  O     . ILE G  4  48   ? 89.971  93.316  -27.644 1.00 82.86  ? 48   ILE A O     1 
ATOM   2545  C  CB    . ILE G  4  48   ? 91.165  91.549  -29.789 1.00 82.24  ? 48   ILE A CB    1 
ATOM   2546  C  CG1   . ILE G  4  48   ? 91.757  90.284  -30.393 1.00 82.69  ? 48   ILE A CG1   1 
ATOM   2547  C  CG2   . ILE G  4  48   ? 91.586  92.738  -30.673 1.00 82.06  ? 48   ILE A CG2   1 
ATOM   2548  C  CD1   . ILE G  4  48   ? 91.048  89.846  -31.651 1.00 82.38  ? 48   ILE A CD1   1 
ATOM   2549  N  N     . PRO G  4  49   ? 92.079  94.124  -27.782 1.00 83.31  ? 49   PRO A N     1 
ATOM   2550  C  CA    . PRO G  4  49   ? 91.693  95.483  -27.389 1.00 83.33  ? 49   PRO A CA    1 
ATOM   2551  C  C     . PRO G  4  49   ? 91.124  96.257  -28.589 1.00 83.15  ? 49   PRO A C     1 
ATOM   2552  O  O     . PRO G  4  49   ? 91.399  95.906  -29.744 1.00 83.66  ? 49   PRO A O     1 
ATOM   2553  C  CB    . PRO G  4  49   ? 92.994  96.075  -26.849 1.00 82.68  ? 49   PRO A CB    1 
ATOM   2554  C  CG    . PRO G  4  49   ? 94.014  95.463  -27.729 1.00 83.77  ? 49   PRO A CG    1 
ATOM   2555  C  CD    . PRO G  4  49   ? 93.552  94.001  -27.797 1.00 83.88  ? 49   PRO A CD    1 
ATOM   2556  N  N     . GLY G  4  50   ? 90.335  97.298  -28.327 1.00 83.15  ? 50   GLY A N     1 
ATOM   2557  C  CA    . GLY G  4  50   ? 89.747  98.053  -29.420 1.00 81.30  ? 50   GLY A CA    1 
ATOM   2558  C  C     . GLY G  4  50   ? 89.326  99.466  -29.062 1.00 80.01  ? 50   GLY A C     1 
ATOM   2559  O  O     . GLY G  4  50   ? 90.066  100.239 -28.441 1.00 79.52  ? 50   GLY A O     1 
ATOM   2560  N  N     . THR G  4  51   ? 88.106  99.804  -29.454 1.00 79.12  ? 51   THR A N     1 
ATOM   2561  C  CA    . THR G  4  51   ? 87.612  101.150 -29.243 1.00 79.08  ? 51   THR A CA    1 
ATOM   2562  C  C     . THR G  4  51   ? 86.094  101.181 -29.079 1.00 78.52  ? 51   THR A C     1 
ATOM   2563  O  O     . THR G  4  51   ? 85.390  100.266 -29.515 1.00 78.66  ? 51   THR A O     1 
ATOM   2564  C  CB    . THR G  4  51   ? 88.033  101.992 -30.438 1.00 80.15  ? 51   THR A CB    1 
ATOM   2565  O  OG1   . THR G  4  51   ? 87.966  101.181 -31.622 1.00 81.49  ? 51   THR A OG1   1 
ATOM   2566  C  CG2   . THR G  4  51   ? 89.461  102.489 -30.264 1.00 79.73  ? 51   THR A CG2   1 
ATOM   2567  N  N     . ALA G  4  52   ? 85.599  102.243 -28.449 1.00 76.69  ? 52   ALA A N     1 
ATOM   2568  C  CA    . ALA G  4  52   ? 84.167  102.424 -28.219 1.00 76.35  ? 52   ALA A CA    1 
ATOM   2569  C  C     . ALA G  4  52   ? 83.888  103.793 -27.632 1.00 76.56  ? 52   ALA A C     1 
ATOM   2570  O  O     . ALA G  4  52   ? 84.792  104.396 -27.060 1.00 76.54  ? 52   ALA A O     1 
ATOM   2571  C  CB    . ALA G  4  52   ? 83.658  101.365 -27.271 1.00 76.92  ? 52   ALA A CB    1 
ATOM   2572  N  N     . VAL G  4  53   ? 82.652  104.278 -27.771 1.00 75.33  ? 53   VAL A N     1 
ATOM   2573  C  CA    . VAL G  4  53   ? 82.250  105.591 -27.225 1.00 74.86  ? 53   VAL A CA    1 
ATOM   2574  C  C     . VAL G  4  53   ? 82.125  105.527 -25.695 1.00 74.29  ? 53   VAL A C     1 
ATOM   2575  O  O     . VAL G  4  53   ? 81.265  104.827 -25.160 1.00 75.17  ? 53   VAL A O     1 
ATOM   2576  C  CB    . VAL G  4  53   ? 80.885  106.058 -27.827 1.00 74.68  ? 53   VAL A CB    1 
ATOM   2577  C  CG1   . VAL G  4  53   ? 80.317  107.198 -27.007 1.00 73.86  ? 53   VAL A CG1   1 
ATOM   2578  C  CG2   . VAL G  4  53   ? 81.080  106.540 -29.250 1.00 75.49  ? 53   VAL A CG2   1 
ATOM   2579  N  N     . THR G  4  54   ? 82.974  106.276 -24.997 1.00 72.48  ? 54   THR A N     1 
ATOM   2580  C  CA    . THR G  4  54   ? 83.016  106.226 -23.538 1.00 71.01  ? 54   THR A CA    1 
ATOM   2581  C  C     . THR G  4  54   ? 82.082  107.242 -22.873 1.00 70.42  ? 54   THR A C     1 
ATOM   2582  O  O     . THR G  4  54   ? 81.598  106.988 -21.773 1.00 69.75  ? 54   THR A O     1 
ATOM   2583  C  CB    . THR G  4  54   ? 84.432  106.477 -23.050 1.00 69.89  ? 54   THR A CB    1 
ATOM   2584  O  OG1   . THR G  4  54   ? 85.359  105.771 -23.882 1.00 69.34  ? 54   THR A OG1   1 
ATOM   2585  C  CG2   . THR G  4  54   ? 84.584  105.988 -21.655 1.00 69.12  ? 54   THR A CG2   1 
ATOM   2586  N  N     . SER G  4  55   ? 81.833  108.381 -23.514 1.00 69.93  ? 55   SER A N     1 
ATOM   2587  C  CA    . SER G  4  55   ? 80.967  109.418 -22.936 1.00 69.24  ? 55   SER A CA    1 
ATOM   2588  C  C     . SER G  4  55   ? 80.407  110.328 -24.024 1.00 70.07  ? 55   SER A C     1 
ATOM   2589  O  O     . SER G  4  55   ? 80.921  110.368 -25.140 1.00 70.49  ? 55   SER A O     1 
ATOM   2590  C  CB    . SER G  4  55   ? 81.761  110.257 -21.901 1.00 68.40  ? 55   SER A CB    1 
ATOM   2591  O  OG    . SER G  4  55   ? 81.072  111.414 -21.437 1.00 65.21  ? 55   SER A OG    1 
ATOM   2592  N  N     . VAL G  4  56   ? 79.342  111.054 -23.702 1.00 70.28  ? 56   VAL A N     1 
ATOM   2593  C  CA    . VAL G  4  56   ? 78.718  111.963 -24.661 1.00 69.84  ? 56   VAL A CA    1 
ATOM   2594  C  C     . VAL G  4  56   ? 78.242  113.232 -23.968 1.00 68.98  ? 56   VAL A C     1 
ATOM   2595  O  O     . VAL G  4  56   ? 77.945  113.219 -22.772 1.00 69.55  ? 56   VAL A O     1 
ATOM   2596  C  CB    . VAL G  4  56   ? 77.482  111.313 -25.348 1.00 70.09  ? 56   VAL A CB    1 
ATOM   2597  C  CG1   . VAL G  4  56   ? 77.102  112.108 -26.586 1.00 70.28  ? 56   VAL A CG1   1 
ATOM   2598  C  CG2   . VAL G  4  56   ? 77.767  109.871 -25.692 1.00 70.33  ? 56   VAL A CG2   1 
ATOM   2599  N  N     . TYR G  4  57   ? 78.170  114.331 -24.704 1.00 68.41  ? 57   TYR A N     1 
ATOM   2600  C  CA    . TYR G  4  57   ? 77.686  115.547 -24.089 1.00 68.13  ? 57   TYR A CA    1 
ATOM   2601  C  C     . TYR G  4  57   ? 76.832  116.354 -25.039 1.00 67.23  ? 57   TYR A C     1 
ATOM   2602  O  O     . TYR G  4  57   ? 77.350  116.977 -25.962 1.00 69.36  ? 57   TYR A O     1 
ATOM   2603  C  CB    . TYR G  4  57   ? 78.846  116.425 -23.612 1.00 68.11  ? 57   TYR A CB    1 
ATOM   2604  C  CG    . TYR G  4  57   ? 78.407  117.772 -23.053 1.00 68.85  ? 57   TYR A CG    1 
ATOM   2605  C  CD1   . TYR G  4  57   ? 77.588  117.838 -21.907 1.00 69.17  ? 57   TYR A CD1   1 
ATOM   2606  C  CD2   . TYR G  4  57   ? 78.809  118.993 -23.658 1.00 68.20  ? 57   TYR A CD2   1 
ATOM   2607  C  CE1   . TYR G  4  57   ? 77.175  119.093 -21.365 1.00 69.26  ? 57   TYR A CE1   1 
ATOM   2608  C  CE2   . TYR G  4  57   ? 78.404  120.254 -23.124 1.00 67.37  ? 57   TYR A CE2   1 
ATOM   2609  C  CZ    . TYR G  4  57   ? 77.587  120.285 -21.976 1.00 68.13  ? 57   TYR A CZ    1 
ATOM   2610  O  OH    . TYR G  4  57   ? 77.184  121.474 -21.415 1.00 69.36  ? 57   TYR A OH    1 
ATOM   2611  N  N     . ILE G  4  58   ? 75.524  116.336 -24.826 1.00 66.20  ? 58   ILE A N     1 
ATOM   2612  C  CA    . ILE G  4  58   ? 74.677  117.188 -25.616 1.00 64.73  ? 58   ILE A CA    1 
ATOM   2613  C  C     . ILE G  4  58   ? 74.639  118.550 -24.953 1.00 65.00  ? 58   ILE A C     1 
ATOM   2614  O  O     . ILE G  4  58   ? 74.495  118.617 -23.740 1.00 64.41  ? 58   ILE A O     1 
ATOM   2615  C  CB    . ILE G  4  58   ? 73.246  116.611 -25.724 1.00 64.43  ? 58   ILE A CB    1 
ATOM   2616  C  CG1   . ILE G  4  58   ? 73.306  115.109 -26.037 1.00 63.57  ? 58   ILE A CG1   1 
ATOM   2617  C  CG2   . ILE G  4  58   ? 72.473  117.355 -26.791 1.00 65.00  ? 58   ILE A CG2   1 
ATOM   2618  C  CD1   . ILE G  4  58   ? 73.977  114.741 -27.349 1.00 63.18  ? 58   ILE A CD1   1 
ATOM   2619  N  N     . GLU G  4  59   ? 74.781  119.622 -25.718 1.00 65.29  ? 59   GLU A N     1 
ATOM   2620  C  CA    . GLU G  4  59   ? 74.851  120.969 -25.150 1.00 65.57  ? 59   GLU A CA    1 
ATOM   2621  C  C     . GLU G  4  59   ? 73.651  121.292 -24.229 1.00 66.18  ? 59   GLU A C     1 
ATOM   2622  O  O     . GLU G  4  59   ? 73.857  121.571 -23.043 1.00 67.34  ? 59   GLU A O     1 
ATOM   2623  C  CB    . GLU G  4  59   ? 74.970  122.020 -26.292 1.00 65.05  ? 59   GLU A CB    1 
ATOM   2624  C  CG    . GLU G  4  59   ? 76.122  123.068 -26.163 1.00 63.38  ? 59   GLU A CG    1 
ATOM   2625  C  CD    . GLU G  4  59   ? 76.299  123.983 -27.399 1.00 62.58  ? 59   GLU A CD    1 
ATOM   2626  O  OE1   . GLU G  4  59   ? 77.140  124.913 -27.344 1.00 61.35  ? 59   GLU A OE1   1 
ATOM   2627  O  OE2   . GLU G  4  59   ? 75.602  123.777 -28.419 1.00 60.58  ? 59   GLU A OE2   1 
ATOM   2628  N  N     . ASP G  4  60   ? 72.413  121.256 -24.715 1.00 65.54  ? 60   ASP A N     1 
ATOM   2629  C  CA    . ASP G  4  60   ? 71.323  121.644 -23.822 1.00 65.34  ? 60   ASP A CA    1 
ATOM   2630  C  C     . ASP G  4  60   ? 70.795  120.476 -22.992 1.00 65.23  ? 60   ASP A C     1 
ATOM   2631  O  O     . ASP G  4  60   ? 69.948  120.701 -22.119 1.00 67.58  ? 60   ASP A O     1 
ATOM   2632  C  CB    . ASP G  4  60   ? 70.166  122.273 -24.611 1.00 64.15  ? 60   ASP A CB    1 
ATOM   2633  C  CG    . ASP G  4  60   ? 69.973  123.755 -24.277 1.00 64.43  ? 60   ASP A CG    1 
ATOM   2634  O  OD1   . ASP G  4  60   ? 70.115  124.131 -23.094 1.00 64.02  ? 60   ASP A OD1   1 
ATOM   2635  O  OD2   . ASP G  4  60   ? 69.674  124.550 -25.191 1.00 64.30  ? 60   ASP A OD2   1 
ATOM   2636  N  N     . VAL G  4  61   ? 71.272  119.250 -23.223 1.00 64.32  ? 61   VAL A N     1 
ATOM   2637  C  CA    . VAL G  4  61   ? 70.767  118.097 -22.459 1.00 62.83  ? 61   VAL A CA    1 
ATOM   2638  C  C     . VAL G  4  61   ? 71.520  117.923 -21.119 1.00 59.90  ? 61   VAL A C     1 
ATOM   2639  O  O     . VAL G  4  61   ? 72.728  118.132 -21.041 1.00 59.60  ? 61   VAL A O     1 
ATOM   2640  C  CB    . VAL G  4  61   ? 70.866  116.772 -23.315 1.00 64.12  ? 61   VAL A CB    1 
ATOM   2641  C  CG1   . VAL G  4  61   ? 70.421  115.563 -22.490 1.00 65.00  ? 61   VAL A CG1   1 
ATOM   2642  C  CG2   . VAL G  4  61   ? 69.951  116.860 -24.517 1.00 64.63  ? 61   VAL A CG2   1 
ATOM   2643  N  N     . LEU G  4  62   ? 70.785  117.534 -20.076 1.00 57.31  ? 62   LEU A N     1 
ATOM   2644  C  CA    . LEU G  4  62   ? 71.359  117.344 -18.749 1.00 54.94  ? 62   LEU A CA    1 
ATOM   2645  C  C     . LEU G  4  62   ? 71.409  115.852 -18.339 1.00 54.54  ? 62   LEU A C     1 
ATOM   2646  O  O     . LEU G  4  62   ? 72.432  115.385 -17.824 1.00 53.69  ? 62   LEU A O     1 
ATOM   2647  C  CB    . LEU G  4  62   ? 70.544  118.126 -17.724 1.00 54.69  ? 62   LEU A CB    1 
ATOM   2648  C  CG    . LEU G  4  62   ? 70.443  119.643 -17.919 1.00 54.75  ? 62   LEU A CG    1 
ATOM   2649  C  CD1   . LEU G  4  62   ? 69.329  119.958 -18.876 1.00 54.71  ? 62   LEU A CD1   1 
ATOM   2650  C  CD2   . LEU G  4  62   ? 70.153  120.313 -16.594 1.00 54.04  ? 62   LEU A CD2   1 
ATOM   2651  N  N     . HIS G  4  63   ? 70.317  115.114 -18.558 1.00 53.78  ? 63   HIS A N     1 
ATOM   2652  C  CA    . HIS G  4  63   ? 70.252  113.690 -18.202 1.00 53.14  ? 63   HIS A CA    1 
ATOM   2653  C  C     . HIS G  4  63   ? 70.171  112.798 -19.436 1.00 54.54  ? 63   HIS A C     1 
ATOM   2654  O  O     . HIS G  4  63   ? 69.939  113.270 -20.546 1.00 55.06  ? 63   HIS A O     1 
ATOM   2655  C  CB    . HIS G  4  63   ? 69.034  113.417 -17.332 1.00 50.57  ? 63   HIS A CB    1 
ATOM   2656  C  CG    . HIS G  4  63   ? 67.838  114.230 -17.712 1.00 48.69  ? 63   HIS A CG    1 
ATOM   2657  N  ND1   . HIS G  4  63   ? 67.772  115.590 -17.505 1.00 47.13  ? 63   HIS A ND1   1 
ATOM   2658  C  CD2   . HIS G  4  63   ? 66.679  113.887 -18.319 1.00 48.03  ? 63   HIS A CD2   1 
ATOM   2659  C  CE1   . HIS G  4  63   ? 66.625  116.050 -17.971 1.00 46.60  ? 63   HIS A CE1   1 
ATOM   2660  N  NE2   . HIS G  4  63   ? 65.943  115.038 -18.471 1.00 47.45  ? 63   HIS A NE2   1 
ATOM   2661  N  N     . GLU G  4  64   ? 70.356  111.498 -19.226 1.00 55.70  ? 64   GLU A N     1 
ATOM   2662  C  CA    . GLU G  4  64   ? 70.327  110.534 -20.316 1.00 57.97  ? 64   GLU A CA    1 
ATOM   2663  C  C     . GLU G  4  64   ? 68.905  110.285 -20.800 1.00 58.63  ? 64   GLU A C     1 
ATOM   2664  O  O     . GLU G  4  64   ? 68.727  109.801 -21.920 1.00 60.37  ? 64   GLU A O     1 
ATOM   2665  C  CB    . GLU G  4  64   ? 70.980  109.187 -19.877 1.00 58.85  ? 64   GLU A CB    1 
ATOM   2666  C  CG    . GLU G  4  64   ? 70.925  108.021 -20.947 1.00 61.13  ? 64   GLU A CG    1 
ATOM   2667  C  CD    . GLU G  4  64   ? 71.736  106.732 -20.600 1.00 62.55  ? 64   GLU A CD    1 
ATOM   2668  O  OE1   . GLU G  4  64   ? 71.615  106.209 -19.468 1.00 63.50  ? 64   GLU A OE1   1 
ATOM   2669  O  OE2   . GLU G  4  64   ? 72.492  106.230 -21.474 1.00 61.15  ? 64   GLU A OE2   1 
ATOM   2670  N  N     . PHE G  4  65   ? 67.894  110.623 -19.997 1.00 58.01  ? 65   PHE A N     1 
ATOM   2671  C  CA    . PHE G  4  65   ? 66.511  110.331 -20.394 1.00 57.68  ? 65   PHE A CA    1 
ATOM   2672  C  C     . PHE G  4  65   ? 65.784  111.534 -20.933 1.00 57.95  ? 65   PHE A C     1 
ATOM   2673  O  O     . PHE G  4  65   ? 64.582  111.657 -20.734 1.00 57.77  ? 65   PHE A O     1 
ATOM   2674  C  CB    . PHE G  4  65   ? 65.734  109.783 -19.225 1.00 56.61  ? 65   PHE A CB    1 
ATOM   2675  C  CG    . PHE G  4  65   ? 66.288  108.553 -18.737 1.00 56.05  ? 65   PHE A CG    1 
ATOM   2676  C  CD1   . PHE G  4  65   ? 67.398  108.588 -17.890 1.00 57.29  ? 65   PHE A CD1   1 
ATOM   2677  C  CD2   . PHE G  4  65   ? 65.767  107.329 -19.168 1.00 56.46  ? 65   PHE A CD2   1 
ATOM   2678  C  CE1   . PHE G  4  65   ? 68.012  107.400 -17.463 1.00 58.95  ? 65   PHE A CE1   1 
ATOM   2679  C  CE2   . PHE G  4  65   ? 66.358  106.115 -18.761 1.00 58.31  ? 65   PHE A CE2   1 
ATOM   2680  C  CZ    . PHE G  4  65   ? 67.491  106.143 -17.902 1.00 59.53  ? 65   PHE A CZ    1 
ATOM   2681  N  N     . SER G  4  66   ? 66.490  112.414 -21.623 1.00 58.46  ? 66   SER A N     1 
ATOM   2682  C  CA    . SER G  4  66   ? 65.843  113.582 -22.206 1.00 58.91  ? 66   SER A CA    1 
ATOM   2683  C  C     . SER G  4  66   ? 65.615  113.400 -23.718 1.00 58.56  ? 66   SER A C     1 
ATOM   2684  O  O     . SER G  4  66   ? 66.138  112.484 -24.358 1.00 57.77  ? 66   SER A O     1 
ATOM   2685  C  CB    . SER G  4  66   ? 66.696  114.836 -21.963 1.00 59.70  ? 66   SER A CB    1 
ATOM   2686  O  OG    . SER G  4  66   ? 65.994  116.036 -22.287 1.00 60.12  ? 66   SER A OG    1 
ATOM   2687  N  N     . THR G  4  67   ? 64.807  114.296 -24.271 1.00 58.54  ? 67   THR A N     1 
ATOM   2688  C  CA    . THR G  4  67   ? 64.487  114.324 -25.692 1.00 57.71  ? 67   THR A CA    1 
ATOM   2689  C  C     . THR G  4  67   ? 64.750  115.712 -26.255 1.00 58.99  ? 67   THR A C     1 
ATOM   2690  O  O     . THR G  4  67   ? 64.333  116.710 -25.665 1.00 59.74  ? 67   THR A O     1 
ATOM   2691  C  CB    . THR G  4  67   ? 63.023  113.964 -25.920 1.00 56.12  ? 67   THR A CB    1 
ATOM   2692  O  OG1   . THR G  4  67   ? 62.684  114.210 -27.285 1.00 54.73  ? 67   THR A OG1   1 
ATOM   2693  C  CG2   . THR G  4  67   ? 62.134  114.775 -24.997 1.00 55.44  ? 67   THR A CG2   1 
ATOM   2694  N  N     . ILE G  4  68   ? 65.440  115.792 -27.385 1.00 59.89  ? 68   ILE A N     1 
ATOM   2695  C  CA    . ILE G  4  68   ? 65.772  117.092 -27.946 1.00 60.79  ? 68   ILE A CA    1 
ATOM   2696  C  C     . ILE G  4  68   ? 64.812  117.477 -29.055 1.00 61.93  ? 68   ILE A C     1 
ATOM   2697  O  O     . ILE G  4  68   ? 64.543  116.677 -29.950 1.00 62.46  ? 68   ILE A O     1 
ATOM   2698  C  CB    . ILE G  4  68   ? 67.198  117.116 -28.526 1.00 60.75  ? 68   ILE A CB    1 
ATOM   2699  C  CG1   . ILE G  4  68   ? 68.157  116.367 -27.602 1.00 61.19  ? 68   ILE A CG1   1 
ATOM   2700  C  CG2   . ILE G  4  68   ? 67.661  118.557 -28.666 1.00 61.04  ? 68   ILE A CG2   1 
ATOM   2701  C  CD1   . ILE G  4  68   ? 68.175  114.857 -27.805 1.00 60.34  ? 68   ILE A CD1   1 
ATOM   2702  N  N     . PRO G  4  69   ? 64.273  118.712 -29.007 1.00 62.85  ? 69   PRO A N     1 
ATOM   2703  C  CA    . PRO G  4  69   ? 63.336  119.201 -30.031 1.00 63.43  ? 69   PRO A CA    1 
ATOM   2704  C  C     . PRO G  4  69   ? 63.941  119.171 -31.456 1.00 64.27  ? 69   PRO A C     1 
ATOM   2705  O  O     . PRO G  4  69   ? 65.151  119.335 -31.636 1.00 64.20  ? 69   PRO A O     1 
ATOM   2706  C  CB    . PRO G  4  69   ? 62.996  120.606 -29.534 1.00 63.35  ? 69   PRO A CB    1 
ATOM   2707  C  CG    . PRO G  4  69   ? 62.969  120.404 -28.043 1.00 62.40  ? 69   PRO A CG    1 
ATOM   2708  C  CD    . PRO G  4  69   ? 64.230  119.591 -27.816 1.00 62.37  ? 69   PRO A CD    1 
ATOM   2709  N  N     . GLY G  4  70   ? 63.086  118.962 -32.459 1.00 65.01  ? 70   GLY A N     1 
ATOM   2710  C  CA    . GLY G  4  70   ? 63.543  118.917 -33.834 1.00 65.63  ? 70   GLY A CA    1 
ATOM   2711  C  C     . GLY G  4  70   ? 64.361  117.674 -34.102 1.00 66.45  ? 70   GLY A C     1 
ATOM   2712  O  O     . GLY G  4  70   ? 64.956  117.510 -35.176 1.00 67.41  ? 70   GLY A O     1 
ATOM   2713  N  N     . VAL G  4  71   ? 64.395  116.799 -33.105 1.00 66.28  ? 71   VAL A N     1 
ATOM   2714  C  CA    . VAL G  4  71   ? 65.116  115.552 -33.216 1.00 65.91  ? 71   VAL A CA    1 
ATOM   2715  C  C     . VAL G  4  71   ? 64.225  114.390 -32.826 1.00 66.31  ? 71   VAL A C     1 
ATOM   2716  O  O     . VAL G  4  71   ? 63.862  114.222 -31.665 1.00 65.23  ? 71   VAL A O     1 
ATOM   2717  C  CB    . VAL G  4  71   ? 66.388  115.564 -32.326 1.00 66.02  ? 71   VAL A CB    1 
ATOM   2718  C  CG1   . VAL G  4  71   ? 67.135  114.258 -32.467 1.00 66.12  ? 71   VAL A CG1   1 
ATOM   2719  C  CG2   . VAL G  4  71   ? 67.303  116.730 -32.747 1.00 65.40  ? 71   VAL A CG2   1 
ATOM   2720  N  N     . LYS G  4  72   ? 63.869  113.604 -33.832 1.00 66.91  ? 72   LYS A N     1 
ATOM   2721  C  CA    . LYS G  4  72   ? 63.031  112.420 -33.668 1.00 67.82  ? 72   LYS A CA    1 
ATOM   2722  C  C     . LYS G  4  72   ? 63.526  111.550 -32.511 1.00 67.85  ? 72   LYS A C     1 
ATOM   2723  O  O     . LYS G  4  72   ? 62.828  111.362 -31.511 1.00 68.29  ? 72   LYS A O     1 
ATOM   2724  C  CB    . LYS G  4  72   ? 63.037  111.605 -34.983 1.00 67.33  ? 72   LYS A CB    1 
ATOM   2725  C  CG    . LYS G  4  72   ? 62.524  110.168 -34.877 1.00 66.34  ? 72   LYS A CG    1 
ATOM   2726  C  CD    . LYS G  4  72   ? 62.756  109.412 -36.177 1.00 66.69  ? 72   LYS A CD    1 
ATOM   2727  C  CE    . LYS G  4  72   ? 62.272  107.965 -36.071 1.00 67.63  ? 72   LYS A CE    1 
ATOM   2728  N  NZ    . LYS G  4  72   ? 62.342  107.216 -37.367 1.00 67.34  ? 72   LYS A NZ    1 
ATOM   2729  N  N     . GLU G  4  73   ? 64.741  111.035 -32.662 1.00 68.43  ? 73   GLU A N     1 
ATOM   2730  C  CA    . GLU G  4  73   ? 65.351  110.150 -31.678 1.00 69.20  ? 73   GLU A CA    1 
ATOM   2731  C  C     . GLU G  4  73   ? 65.513  110.815 -30.321 1.00 68.93  ? 73   GLU A C     1 
ATOM   2732  O  O     . GLU G  4  73   ? 65.677  112.034 -30.198 1.00 68.47  ? 73   GLU A O     1 
ATOM   2733  C  CB    . GLU G  4  73   ? 66.728  109.665 -32.162 1.00 70.01  ? 73   GLU A CB    1 
ATOM   2734  C  CG    . GLU G  4  73   ? 67.576  110.709 -32.874 1.00 71.41  ? 73   GLU A CG    1 
ATOM   2735  C  CD    . GLU G  4  73   ? 67.161  110.943 -34.322 1.00 72.05  ? 73   GLU A CD    1 
ATOM   2736  O  OE1   . GLU G  4  73   ? 67.148  109.976 -35.118 1.00 72.91  ? 73   GLU A OE1   1 
ATOM   2737  O  OE2   . GLU G  4  73   ? 66.860  112.104 -34.669 1.00 71.51  ? 73   GLU A OE2   1 
ATOM   2738  N  N     . ASP G  4  74   ? 65.449  109.969 -29.300 1.00 68.63  ? 74   ASP A N     1 
ATOM   2739  C  CA    . ASP G  4  74   ? 65.649  110.389 -27.930 1.00 68.64  ? 74   ASP A CA    1 
ATOM   2740  C  C     . ASP G  4  74   ? 67.101  110.186 -27.535 1.00 68.42  ? 74   ASP A C     1 
ATOM   2741  O  O     . ASP G  4  74   ? 67.782  109.358 -28.141 1.00 68.21  ? 74   ASP A O     1 
ATOM   2742  C  CB    . ASP G  4  74   ? 64.726  109.606 -26.975 1.00 69.30  ? 74   ASP A CB    1 
ATOM   2743  C  CG    . ASP G  4  74   ? 64.296  108.267 -27.514 1.00 69.78  ? 74   ASP A CG    1 
ATOM   2744  O  OD1   . ASP G  4  74   ? 65.034  107.278 -27.332 1.00 69.33  ? 74   ASP A OD1   1 
ATOM   2745  O  OD2   . ASP G  4  74   ? 63.205  108.211 -28.118 1.00 71.17  ? 74   ASP A OD2   1 
ATOM   2746  N  N     . VAL G  4  75   ? 67.575  110.933 -26.543 1.00 67.50  ? 75   VAL A N     1 
ATOM   2747  C  CA    . VAL G  4  75   ? 68.965  110.824 -26.108 1.00 67.11  ? 75   VAL A CA    1 
ATOM   2748  C  C     . VAL G  4  75   ? 69.393  109.362 -25.956 1.00 65.74  ? 75   VAL A C     1 
ATOM   2749  O  O     . VAL G  4  75   ? 70.495  108.997 -26.355 1.00 65.72  ? 75   VAL A O     1 
ATOM   2750  C  CB    . VAL G  4  75   ? 69.180  111.571 -24.756 1.00 68.50  ? 75   VAL A CB    1 
ATOM   2751  C  CG1   . VAL G  4  75   ? 70.604  111.320 -24.230 1.00 69.10  ? 75   VAL A CG1   1 
ATOM   2752  C  CG2   . VAL G  4  75   ? 68.963  113.080 -24.956 1.00 68.59  ? 75   VAL A CG2   1 
ATOM   2753  N  N     . VAL G  4  76   ? 68.513  108.541 -25.396 1.00 64.68  ? 76   VAL A N     1 
ATOM   2754  C  CA    . VAL G  4  76   ? 68.783  107.122 -25.170 1.00 64.72  ? 76   VAL A CA    1 
ATOM   2755  C  C     . VAL G  4  76   ? 68.994  106.358 -26.495 1.00 64.86  ? 76   VAL A C     1 
ATOM   2756  O  O     . VAL G  4  76   ? 69.880  105.493 -26.595 1.00 65.55  ? 76   VAL A O     1 
ATOM   2757  C  CB    . VAL G  4  76   ? 67.621  106.472 -24.407 1.00 64.41  ? 76   VAL A CB    1 
ATOM   2758  C  CG1   . VAL G  4  76   ? 67.938  105.023 -24.105 1.00 65.31  ? 76   VAL A CG1   1 
ATOM   2759  C  CG2   . VAL G  4  76   ? 67.372  107.226 -23.129 1.00 64.71  ? 76   VAL A CG2   1 
ATOM   2760  N  N     . GLU G  4  77   ? 68.175  106.661 -27.503 1.00 63.19  ? 77   GLU A N     1 
ATOM   2761  C  CA    . GLU G  4  77   ? 68.291  106.001 -28.806 1.00 60.59  ? 77   GLU A CA    1 
ATOM   2762  C  C     . GLU G  4  77   ? 69.554  106.447 -29.527 1.00 59.24  ? 77   GLU A C     1 
ATOM   2763  O  O     . GLU G  4  77   ? 70.152  105.685 -30.263 1.00 58.57  ? 77   GLU A O     1 
ATOM   2764  C  CB    . GLU G  4  77   ? 67.046  106.308 -29.661 1.00 60.47  ? 77   GLU A CB    1 
ATOM   2765  C  CG    . GLU G  4  77   ? 65.877  105.283 -29.486 1.00 61.01  ? 77   GLU A CG    1 
ATOM   2766  C  CD    . GLU G  4  77   ? 64.492  105.821 -29.912 1.00 61.81  ? 77   GLU A CD    1 
ATOM   2767  O  OE1   . GLU G  4  77   ? 63.523  105.028 -30.003 1.00 60.64  ? 77   GLU A OE1   1 
ATOM   2768  O  OE2   . GLU G  4  77   ? 64.365  107.041 -30.154 1.00 62.79  ? 77   GLU A OE2   1 
ATOM   2769  N  N     . ILE G  4  78   ? 69.947  107.691 -29.287 1.00 57.79  ? 78   ILE A N     1 
ATOM   2770  C  CA    . ILE G  4  78   ? 71.140  108.292 -29.867 1.00 58.44  ? 78   ILE A CA    1 
ATOM   2771  C  C     . ILE G  4  78   ? 72.398  107.665 -29.300 1.00 60.20  ? 78   ILE A C     1 
ATOM   2772  O  O     . ILE G  4  78   ? 73.226  107.123 -30.038 1.00 60.14  ? 78   ILE A O     1 
ATOM   2773  C  CB    . ILE G  4  78   ? 71.215  109.774 -29.539 1.00 57.17  ? 78   ILE A CB    1 
ATOM   2774  C  CG1   . ILE G  4  78   ? 69.960  110.461 -30.038 1.00 56.35  ? 78   ILE A CG1   1 
ATOM   2775  C  CG2   . ILE G  4  78   ? 72.510  110.356 -30.077 1.00 57.74  ? 78   ILE A CG2   1 
ATOM   2776  C  CD1   . ILE G  4  78   ? 69.732  111.784 -29.376 1.00 54.87  ? 78   ILE A CD1   1 
ATOM   2777  N  N     . ILE G  4  79   ? 72.535  107.773 -27.980 1.00 61.85  ? 79   ILE A N     1 
ATOM   2778  C  CA    . ILE G  4  79   ? 73.684  107.224 -27.268 1.00 64.00  ? 79   ILE A CA    1 
ATOM   2779  C  C     . ILE G  4  79   ? 73.869  105.739 -27.593 1.00 64.68  ? 79   ILE A C     1 
ATOM   2780  O  O     . ILE G  4  79   ? 74.989  105.200 -27.554 1.00 65.29  ? 79   ILE A O     1 
ATOM   2781  C  CB    . ILE G  4  79   ? 73.516  107.429 -25.728 1.00 64.44  ? 79   ILE A CB    1 
ATOM   2782  C  CG1   . ILE G  4  79   ? 72.160  106.907 -25.258 1.00 64.09  ? 79   ILE A CG1   1 
ATOM   2783  C  CG2   . ILE G  4  79   ? 73.587  108.921 -25.399 1.00 64.21  ? 79   ILE A CG2   1 
ATOM   2784  C  CD1   . ILE G  4  79   ? 72.203  105.597 -24.492 1.00 65.88  ? 79   ILE A CD1   1 
ATOM   2785  N  N     . LEU G  4  80   ? 72.753  105.094 -27.914 1.00 65.45  ? 80   LEU A N     1 
ATOM   2786  C  CA    . LEU G  4  80   ? 72.727  103.693 -28.306 1.00 66.14  ? 80   LEU A CA    1 
ATOM   2787  C  C     . LEU G  4  80   ? 73.385  103.516 -29.686 1.00 66.48  ? 80   LEU A C     1 
ATOM   2788  O  O     . LEU G  4  80   ? 74.201  102.614 -29.913 1.00 65.30  ? 80   LEU A O     1 
ATOM   2789  C  CB    . LEU G  4  80   ? 71.257  103.227 -28.321 1.00 66.77  ? 80   LEU A CB    1 
ATOM   2790  C  CG    . LEU G  4  80   ? 70.748  101.923 -28.950 1.00 67.45  ? 80   LEU A CG    1 
ATOM   2791  C  CD1   . LEU G  4  80   ? 69.379  101.626 -28.370 1.00 66.68  ? 80   LEU A CD1   1 
ATOM   2792  C  CD2   . LEU G  4  80   ? 70.664  102.049 -30.472 1.00 67.47  ? 80   LEU A CD2   1 
ATOM   2793  N  N     . ASN G  4  81   ? 73.008  104.407 -30.599 1.00 65.83  ? 81   ASN A N     1 
ATOM   2794  C  CA    . ASN G  4  81   ? 73.534  104.407 -31.944 1.00 66.24  ? 81   ASN A CA    1 
ATOM   2795  C  C     . ASN G  4  81   ? 75.004  104.704 -31.940 1.00 66.98  ? 81   ASN A C     1 
ATOM   2796  O  O     . ASN G  4  81   ? 75.716  104.327 -32.867 1.00 67.48  ? 81   ASN A O     1 
ATOM   2797  C  CB    . ASN G  4  81   ? 72.798  105.435 -32.781 1.00 66.20  ? 81   ASN A CB    1 
ATOM   2798  C  CG    . ASN G  4  81   ? 71.440  104.944 -33.192 1.00 66.40  ? 81   ASN A CG    1 
ATOM   2799  O  OD1   . ASN G  4  81   ? 70.429  105.527 -32.829 1.00 67.45  ? 81   ASN A OD1   1 
ATOM   2800  N  ND2   . ASN G  4  81   ? 71.407  103.856 -33.953 1.00 66.22  ? 81   ASN A ND2   1 
ATOM   2801  N  N     . LEU G  4  82   ? 75.453  105.384 -30.887 1.00 67.41  ? 82   LEU A N     1 
ATOM   2802  C  CA    . LEU G  4  82   ? 76.863  105.731 -30.713 1.00 67.66  ? 82   LEU A CA    1 
ATOM   2803  C  C     . LEU G  4  82   ? 77.696  104.493 -30.399 1.00 68.50  ? 82   LEU A C     1 
ATOM   2804  O  O     . LEU G  4  82   ? 78.815  104.354 -30.879 1.00 68.29  ? 82   LEU A O     1 
ATOM   2805  C  CB    . LEU G  4  82   ? 77.020  106.738 -29.582 1.00 66.45  ? 82   LEU A CB    1 
ATOM   2806  C  CG    . LEU G  4  82   ? 76.882  108.196 -29.971 1.00 66.28  ? 82   LEU A CG    1 
ATOM   2807  C  CD1   . LEU G  4  82   ? 76.544  109.004 -28.749 1.00 66.34  ? 82   LEU A CD1   1 
ATOM   2808  C  CD2   . LEU G  4  82   ? 78.176  108.654 -30.626 1.00 66.64  ? 82   LEU A CD2   1 
ATOM   2809  N  N     . LYS G  4  83   ? 77.148  103.594 -29.589 1.00 70.05  ? 83   LYS A N     1 
ATOM   2810  C  CA    . LYS G  4  83   ? 77.853  102.359 -29.261 1.00 71.87  ? 83   LYS A CA    1 
ATOM   2811  C  C     . LYS G  4  83   ? 78.183  101.575 -30.528 1.00 73.23  ? 83   LYS A C     1 
ATOM   2812  O  O     . LYS G  4  83   ? 79.089  100.742 -30.551 1.00 72.72  ? 83   LYS A O     1 
ATOM   2813  C  CB    . LYS G  4  83   ? 76.991  101.485 -28.343 1.00 71.30  ? 83   LYS A CB    1 
ATOM   2814  C  CG    . LYS G  4  83   ? 77.560  100.083 -28.108 1.00 71.01  ? 83   LYS A CG    1 
ATOM   2815  C  CD    . LYS G  4  83   ? 76.794  99.290  -27.071 1.00 69.62  ? 83   LYS A CD    1 
ATOM   2816  C  CE    . LYS G  4  83   ? 77.267  99.618  -25.677 1.00 68.55  ? 83   LYS A CE    1 
ATOM   2817  N  NZ    . LYS G  4  83   ? 76.664  98.695  -24.684 1.00 68.88  ? 83   LYS A NZ    1 
ATOM   2818  N  N     . GLU G  4  84   ? 77.425  101.872 -31.580 1.00 75.42  ? 84   GLU A N     1 
ATOM   2819  C  CA    . GLU G  4  84   ? 77.569  101.213 -32.868 1.00 77.57  ? 84   GLU A CA    1 
ATOM   2820  C  C     . GLU G  4  84   ? 78.689  101.819 -33.714 1.00 79.03  ? 84   GLU A C     1 
ATOM   2821  O  O     . GLU G  4  84   ? 79.215  101.157 -34.625 1.00 79.29  ? 84   GLU A O     1 
ATOM   2822  C  CB    . GLU G  4  84   ? 76.219  101.253 -33.608 1.00 77.62  ? 84   GLU A CB    1 
ATOM   2823  C  CG    . GLU G  4  84   ? 75.377  100.015 -33.272 1.00 76.64  ? 84   GLU A CG    1 
ATOM   2824  C  CD    . GLU G  4  84   ? 76.194  98.956  -32.527 1.00 76.43  ? 84   GLU A CD    1 
ATOM   2825  O  OE1   . GLU G  4  84   ? 76.198  98.981  -31.280 1.00 76.22  ? 84   GLU A OE1   1 
ATOM   2826  O  OE2   . GLU G  4  84   ? 76.843  98.117  -33.183 1.00 76.26  ? 84   GLU A OE2   1 
ATOM   2827  N  N     . LEU G  4  85   ? 79.062  103.061 -33.419 1.00 79.89  ? 85   LEU A N     1 
ATOM   2828  C  CA    . LEU G  4  85   ? 80.144  103.717 -34.149 1.00 80.20  ? 85   LEU A CA    1 
ATOM   2829  C  C     . LEU G  4  85   ? 81.478  102.997 -33.916 1.00 80.05  ? 85   LEU A C     1 
ATOM   2830  O  O     . LEU G  4  85   ? 81.905  102.800 -32.775 1.00 80.61  ? 85   LEU A O     1 
ATOM   2831  C  CB    . LEU G  4  85   ? 80.278  105.204 -33.713 1.00 81.00  ? 85   LEU A CB    1 
ATOM   2832  C  CG    . LEU G  4  85   ? 81.616  105.987 -33.830 1.00 80.89  ? 85   LEU A CG    1 
ATOM   2833  C  CD1   . LEU G  4  85   ? 81.938  106.280 -35.284 1.00 81.00  ? 85   LEU A CD1   1 
ATOM   2834  C  CD2   . LEU G  4  85   ? 81.520  107.301 -33.063 1.00 79.57  ? 85   LEU A CD2   1 
ATOM   2835  N  N     . VAL G  4  86   ? 82.121  102.592 -35.005 1.00 79.79  ? 86   VAL A N     1 
ATOM   2836  C  CA    . VAL G  4  86   ? 83.423  101.958 -34.914 1.00 79.14  ? 86   VAL A CA    1 
ATOM   2837  C  C     . VAL G  4  86   ? 84.493  102.876 -35.473 1.00 79.48  ? 86   VAL A C     1 
ATOM   2838  O  O     . VAL G  4  86   ? 84.523  103.152 -36.672 1.00 80.18  ? 86   VAL A O     1 
ATOM   2839  C  CB    . VAL G  4  86   ? 83.473  100.598 -35.683 1.00 78.24  ? 86   VAL A CB    1 
ATOM   2840  C  CG1   . VAL G  4  86   ? 82.891  100.749 -37.075 1.00 77.65  ? 86   VAL A CG1   1 
ATOM   2841  C  CG2   . VAL G  4  86   ? 84.915  100.121 -35.790 1.00 76.97  ? 86   VAL A CG2   1 
ATOM   2842  N  N     . VAL G  4  87   ? 85.364  103.364 -34.596 1.00 79.77  ? 87   VAL A N     1 
ATOM   2843  C  CA    . VAL G  4  87   ? 86.454  104.237 -35.017 1.00 79.38  ? 87   VAL A CA    1 
ATOM   2844  C  C     . VAL G  4  87   ? 87.778  103.494 -34.965 1.00 78.29  ? 87   VAL A C     1 
ATOM   2845  O  O     . VAL G  4  87   ? 87.876  102.439 -34.344 1.00 77.68  ? 87   VAL A O     1 
ATOM   2846  C  CB    . VAL G  4  87   ? 86.536  105.520 -34.126 1.00 79.90  ? 87   VAL A CB    1 
ATOM   2847  C  CG1   . VAL G  4  87   ? 85.280  106.401 -34.346 1.00 78.93  ? 87   VAL A CG1   1 
ATOM   2848  C  CG2   . VAL G  4  87   ? 86.667  105.125 -32.681 1.00 80.26  ? 87   VAL A CG2   1 
ATOM   2849  N  N     . ARG G  4  88   ? 88.792  104.032 -35.619 1.00 77.44  ? 88   ARG A N     1 
ATOM   2850  C  CA    . ARG G  4  88   ? 90.071  103.360 -35.626 1.00 77.66  ? 88   ARG A CA    1 
ATOM   2851  C  C     . ARG G  4  88   ? 91.230  104.354 -35.588 1.00 77.96  ? 88   ARG A C     1 
ATOM   2852  O  O     . ARG G  4  88   ? 91.505  104.997 -36.617 1.00 78.30  ? 88   ARG A O     1 
ATOM   2853  C  CB    . ARG G  4  88   ? 90.176  102.488 -36.881 1.00 78.15  ? 88   ARG A CB    1 
ATOM   2854  C  CG    . ARG G  4  88   ? 91.572  101.869 -37.144 1.00 79.15  ? 88   ARG A CG    1 
ATOM   2855  C  CD    . ARG G  4  88   ? 92.407  102.643 -38.187 1.00 78.80  ? 88   ARG A CD    1 
ATOM   2856  N  NE    . ARG G  4  88   ? 93.502  101.836 -38.744 1.00 78.64  ? 88   ARG A NE    1 
ATOM   2857  C  CZ    . ARG G  4  88   ? 94.669  101.589 -38.140 1.00 78.54  ? 88   ARG A CZ    1 
ATOM   2858  N  NH1   . ARG G  4  88   ? 94.930  102.085 -36.941 1.00 77.64  ? 88   ARG A NH1   1 
ATOM   2859  N  NH2   . ARG G  4  88   ? 95.585  100.832 -38.738 1.00 77.63  ? 88   ARG A NH2   1 
ATOM   2860  N  N     . PHE G  4  89   ? 91.904  104.503 -34.431 1.00 77.60  ? 89   PHE A N     1 
ATOM   2861  C  CA    . PHE G  4  89   ? 93.068  105.398 -34.415 1.00 76.32  ? 89   PHE A CA    1 
ATOM   2862  C  C     . PHE G  4  89   ? 94.330  104.670 -34.870 1.00 76.39  ? 89   PHE A C     1 
ATOM   2863  O  O     . PHE G  4  89   ? 94.342  103.445 -34.959 1.00 76.31  ? 89   PHE A O     1 
ATOM   2864  C  CB    . PHE G  4  89   ? 93.411  106.085 -33.058 1.00 75.22  ? 89   PHE A CB    1 
ATOM   2865  C  CG    . PHE G  4  89   ? 92.804  105.524 -31.815 1.00 73.60  ? 89   PHE A CG    1 
ATOM   2866  C  CD1   . PHE G  4  89   ? 91.941  106.332 -31.049 1.00 73.42  ? 89   PHE A CD1   1 
ATOM   2867  C  CD2   . PHE G  4  89   ? 93.167  104.254 -31.322 1.00 73.69  ? 89   PHE A CD2   1 
ATOM   2868  C  CE1   . PHE G  4  89   ? 91.441  105.908 -29.794 1.00 72.76  ? 89   PHE A CE1   1 
ATOM   2869  C  CE2   . PHE G  4  89   ? 92.674  103.809 -30.061 1.00 72.86  ? 89   PHE A CE2   1 
ATOM   2870  C  CZ    . PHE G  4  89   ? 91.810  104.645 -29.301 1.00 72.45  ? 89   PHE A CZ    1 
ATOM   2871  N  N     . LEU G  4  90   ? 95.395  105.426 -35.140 1.00 76.11  ? 90   LEU A N     1 
ATOM   2872  C  CA    . LEU G  4  90   ? 96.601  104.830 -35.695 1.00 76.26  ? 90   LEU A CA    1 
ATOM   2873  C  C     . LEU G  4  90   ? 97.759  104.705 -34.699 1.00 76.92  ? 90   LEU A C     1 
ATOM   2874  O  O     . LEU G  4  90   ? 98.701  103.983 -35.035 1.00 78.03  ? 90   LEU A O     1 
ATOM   2875  C  CB    . LEU G  4  90   ? 97.060  105.641 -36.899 1.00 74.11  ? 90   LEU A CB    1 
ATOM   2876  C  CG    . LEU G  4  90   ? 96.285  105.385 -38.187 1.00 73.63  ? 90   LEU A CG    1 
ATOM   2877  C  CD1   . LEU G  4  90   ? 94.865  105.929 -38.077 1.00 73.34  ? 90   LEU A CD1   1 
ATOM   2878  C  CD2   . LEU G  4  90   ? 97.019  106.052 -39.334 1.00 73.01  ? 90   LEU A CD2   1 
ATOM   2879  N  N     . ASN G  4  91   ? 97.759  105.344 -33.520 1.00 78.02  ? 91   ASN A N     1 
ATOM   2880  C  CA    . ASN G  4  91   ? 98.939  105.175 -32.631 1.00 77.26  ? 91   ASN A CA    1 
ATOM   2881  C  C     . ASN G  4  91   ? 98.616  105.417 -31.142 1.00 77.73  ? 91   ASN A C     1 
ATOM   2882  O  O     . ASN G  4  91   ? 97.680  106.142 -30.811 1.00 77.40  ? 91   ASN A O     1 
ATOM   2883  C  CB    . ASN G  4  91   ? 100.069 106.134 -33.051 1.00 77.48  ? 91   ASN A CB    1 
ATOM   2884  C  CG    . ASN G  4  91   ? 101.317 106.037 -32.136 1.00 77.50  ? 91   ASN A CG    1 
ATOM   2885  O  OD1   . ASN G  4  91   ? 102.091 105.079 -32.207 1.00 76.72  ? 91   ASN A OD1   1 
ATOM   2886  N  ND2   . ASN G  4  91   ? 101.501 107.035 -31.276 1.00 77.40  ? 91   ASN A ND2   1 
ATOM   2887  N  N     . PRO G  4  92   ? 99.405  104.790 -30.228 1.00 77.91  ? 92   PRO A N     1 
ATOM   2888  C  CA    . PRO G  4  92   ? 99.291  104.890 -28.769 1.00 78.48  ? 92   PRO A CA    1 
ATOM   2889  C  C     . PRO G  4  92   ? 99.089  106.324 -28.294 1.00 79.44  ? 92   PRO A C     1 
ATOM   2890  O  O     . PRO G  4  92   ? 98.377  106.539 -27.314 1.00 79.26  ? 92   PRO A O     1 
ATOM   2891  C  CB    . PRO G  4  92   ? 100.594 104.291 -28.286 1.00 78.29  ? 92   PRO A CB    1 
ATOM   2892  C  CG    . PRO G  4  92   ? 100.751 103.134 -29.205 1.00 78.30  ? 92   PRO A CG    1 
ATOM   2893  C  CD    . PRO G  4  92   ? 100.198 103.585 -30.561 1.00 77.83  ? 92   PRO A CD    1 
ATOM   2894  N  N     . SER G  4  93   ? 99.720  107.289 -28.977 1.00 81.08  ? 93   SER A N     1 
ATOM   2895  C  CA    . SER G  4  93   ? 99.596  108.711 -28.621 1.00 82.45  ? 93   SER A CA    1 
ATOM   2896  C  C     . SER G  4  93   ? 98.127  109.112 -28.464 1.00 83.56  ? 93   SER A C     1 
ATOM   2897  O  O     . SER G  4  93   ? 97.810  110.068 -27.744 1.00 83.91  ? 93   SER A O     1 
ATOM   2898  C  CB    . SER G  4  93   ? 100.264 109.595 -29.687 1.00 81.86  ? 93   SER A CB    1 
ATOM   2899  O  OG    . SER G  4  93   ? 99.778  109.325 -30.987 1.00 81.74  ? 93   SER A OG    1 
ATOM   2900  N  N     . LEU G  4  94   ? 97.245  108.371 -29.145 1.00 84.79  ? 94   LEU A N     1 
ATOM   2901  C  CA    . LEU G  4  94   ? 95.798  108.589 -29.084 1.00 85.31  ? 94   LEU A CA    1 
ATOM   2902  C  C     . LEU G  4  94   ? 95.136  107.609 -28.123 1.00 86.22  ? 94   LEU A C     1 
ATOM   2903  O  O     . LEU G  4  94   ? 94.695  106.524 -28.512 1.00 86.37  ? 94   LEU A O     1 
ATOM   2904  C  CB    . LEU G  4  94   ? 95.155  108.430 -30.472 1.00 85.61  ? 94   LEU A CB    1 
ATOM   2905  C  CG    . LEU G  4  94   ? 95.177  109.654 -31.401 1.00 85.40  ? 94   LEU A CG    1 
ATOM   2906  C  CD1   . LEU G  4  94   ? 96.595  109.932 -31.862 1.00 85.51  ? 94   LEU A CD1   1 
ATOM   2907  C  CD2   . LEU G  4  94   ? 94.276  109.400 -32.591 1.00 84.91  ? 94   LEU A CD2   1 
ATOM   2908  N  N     . GLN G  4  95   ? 95.077  108.003 -26.858 1.00 87.25  ? 95   GLN A N     1 
ATOM   2909  C  CA    . GLN G  4  95   ? 94.457  107.189 -25.835 1.00 88.20  ? 95   GLN A CA    1 
ATOM   2910  C  C     . GLN G  4  95   ? 92.988  107.559 -25.691 1.00 87.71  ? 95   GLN A C     1 
ATOM   2911  O  O     . GLN G  4  95   ? 92.115  106.698 -25.596 1.00 88.24  ? 95   GLN A O     1 
ATOM   2912  C  CB    . GLN G  4  95   ? 95.173  107.399 -24.491 1.00 89.03  ? 95   GLN A CB    1 
ATOM   2913  C  CG    . GLN G  4  95   ? 96.713  107.471 -24.535 1.00 89.68  ? 95   GLN A CG    1 
ATOM   2914  C  CD    . GLN G  4  95   ? 97.262  108.910 -24.574 1.00 90.73  ? 95   GLN A CD    1 
ATOM   2915  O  OE1   . GLN G  4  95   ? 96.632  109.847 -24.067 1.00 89.90  ? 95   GLN A OE1   1 
ATOM   2916  N  NE2   . GLN G  4  95   ? 98.447  109.081 -25.172 1.00 91.11  ? 95   GLN A NE2   1 
ATOM   2917  N  N     . THR G  4  96   ? 92.736  108.865 -25.691 1.00 87.69  ? 96   THR A N     1 
ATOM   2918  C  CA    . THR G  4  96   ? 91.391  109.410 -25.555 1.00 86.42  ? 96   THR A CA    1 
ATOM   2919  C  C     . THR G  4  96   ? 91.140  110.541 -26.565 1.00 84.09  ? 96   THR A C     1 
ATOM   2920  O  O     . THR G  4  96   ? 91.682  111.643 -26.439 1.00 84.00  ? 96   THR A O     1 
ATOM   2921  C  CB    . THR G  4  96   ? 91.180  109.942 -24.108 1.00 88.10  ? 96   THR A CB    1 
ATOM   2922  O  OG1   . THR G  4  96   ? 89.988  110.737 -24.057 1.00 89.93  ? 96   THR A OG1   1 
ATOM   2923  C  CG2   . THR G  4  96   ? 92.400  110.793 -23.652 1.00 87.82  ? 96   THR A CG2   1 
ATOM   2924  N  N     . VAL G  4  97   ? 90.315  110.260 -27.565 1.00 81.32  ? 97   VAL A N     1 
ATOM   2925  C  CA    . VAL G  4  97   ? 90.002  111.247 -28.587 1.00 78.71  ? 97   VAL A CA    1 
ATOM   2926  C  C     . VAL G  4  97   ? 88.537  111.659 -28.515 1.00 76.66  ? 97   VAL A C     1 
ATOM   2927  O  O     . VAL G  4  97   ? 87.654  110.805 -28.559 1.00 76.56  ? 97   VAL A O     1 
ATOM   2928  C  CB    . VAL G  4  97   ? 90.300  110.680 -30.009 1.00 79.32  ? 97   VAL A CB    1 
ATOM   2929  C  CG1   . VAL G  4  97   ? 90.074  111.766 -31.069 1.00 78.47  ? 97   VAL A CG1   1 
ATOM   2930  C  CG2   . VAL G  4  97   ? 91.737  110.181 -30.076 1.00 80.24  ? 97   VAL A CG2   1 
ATOM   2931  N  N     . THR G  4  98   ? 88.284  112.963 -28.395 1.00 74.04  ? 98   THR A N     1 
ATOM   2932  C  CA    . THR G  4  98   ? 86.917  113.486 -28.350 1.00 71.96  ? 98   THR A CA    1 
ATOM   2933  C  C     . THR G  4  98   ? 86.484  113.972 -29.727 1.00 70.82  ? 98   THR A C     1 
ATOM   2934  O  O     . THR G  4  98   ? 86.970  114.990 -30.212 1.00 70.47  ? 98   THR A O     1 
ATOM   2935  C  CB    . THR G  4  98   ? 86.772  114.681 -27.331 1.00 71.24  ? 98   THR A CB    1 
ATOM   2936  O  OG1   . THR G  4  98   ? 86.698  114.167 -25.996 1.00 71.38  ? 98   THR A OG1   1 
ATOM   2937  C  CG2   . THR G  4  98   ? 85.498  115.487 -27.585 1.00 70.85  ? 98   THR A CG2   1 
ATOM   2938  N  N     . LEU G  4  99   ? 85.576  113.237 -30.358 1.00 69.84  ? 99   LEU A N     1 
ATOM   2939  C  CA    . LEU G  4  99   ? 85.063  113.625 -31.660 1.00 69.19  ? 99   LEU A CA    1 
ATOM   2940  C  C     . LEU G  4  99   ? 83.974  114.694 -31.517 1.00 69.04  ? 99   LEU A C     1 
ATOM   2941  O  O     . LEU G  4  99   ? 83.081  114.590 -30.676 1.00 68.86  ? 99   LEU A O     1 
ATOM   2942  C  CB    . LEU G  4  99   ? 84.528  112.381 -32.381 1.00 69.54  ? 99   LEU A CB    1 
ATOM   2943  C  CG    . LEU G  4  99   ? 85.316  111.913 -33.622 1.00 69.53  ? 99   LEU A CG    1 
ATOM   2944  C  CD1   . LEU G  4  99   ? 86.820  111.900 -33.369 1.00 69.05  ? 99   LEU A CD1   1 
ATOM   2945  C  CD2   . LEU G  4  99   ? 84.825  110.523 -33.994 1.00 69.96  ? 99   LEU A CD2   1 
ATOM   2946  N  N     . LEU G  4  100  ? 84.054  115.731 -32.337 1.00 69.07  ? 100  LEU A N     1 
ATOM   2947  C  CA    . LEU G  4  100  ? 83.085  116.801 -32.237 1.00 69.93  ? 100  LEU A CA    1 
ATOM   2948  C  C     . LEU G  4  100  ? 82.242  116.907 -33.479 1.00 70.28  ? 100  LEU A C     1 
ATOM   2949  O  O     . LEU G  4  100  ? 82.723  116.735 -34.598 1.00 69.58  ? 100  LEU A O     1 
ATOM   2950  C  CB    . LEU G  4  100  ? 83.796  118.132 -31.986 1.00 70.81  ? 100  LEU A CB    1 
ATOM   2951  C  CG    . LEU G  4  100  ? 83.310  118.850 -30.714 1.00 71.29  ? 100  LEU A CG    1 
ATOM   2952  C  CD1   . LEU G  4  100  ? 84.269  119.983 -30.380 1.00 70.75  ? 100  LEU A CD1   1 
ATOM   2953  C  CD2   . LEU G  4  100  ? 81.884  119.368 -30.917 1.00 70.78  ? 100  LEU A CD2   1 
ATOM   2954  N  N     . LEU G  4  101  ? 80.967  117.199 -33.261 1.00 70.85  ? 101  LEU A N     1 
ATOM   2955  C  CA    . LEU G  4  101  ? 80.020  117.355 -34.351 1.00 72.01  ? 101  LEU A CA    1 
ATOM   2956  C  C     . LEU G  4  101  ? 78.841  118.234 -33.947 1.00 73.42  ? 101  LEU A C     1 
ATOM   2957  O  O     . LEU G  4  101  ? 78.336  118.172 -32.823 1.00 73.84  ? 101  LEU A O     1 
ATOM   2958  C  CB    . LEU G  4  101  ? 79.514  115.983 -34.820 1.00 69.22  ? 101  LEU A CB    1 
ATOM   2959  C  CG    . LEU G  4  101  ? 78.074  115.498 -34.680 1.00 67.04  ? 101  LEU A CG    1 
ATOM   2960  C  CD1   . LEU G  4  101  ? 77.638  114.788 -35.946 1.00 65.88  ? 101  LEU A CD1   1 
ATOM   2961  C  CD2   . LEU G  4  101  ? 77.986  114.573 -33.511 1.00 66.00  ? 101  LEU A CD2   1 
ATOM   2962  N  N     . LYS G  4  102  ? 78.426  119.061 -34.898 1.00 75.12  ? 102  LYS A N     1 
ATOM   2963  C  CA    . LYS G  4  102  ? 77.295  119.962 -34.737 1.00 76.26  ? 102  LYS A CA    1 
ATOM   2964  C  C     . LYS G  4  102  ? 76.592  120.181 -36.071 1.00 75.78  ? 102  LYS A C     1 
ATOM   2965  O  O     . LYS G  4  102  ? 77.207  120.590 -37.061 1.00 76.65  ? 102  LYS A O     1 
ATOM   2966  C  CB    . LYS G  4  102  ? 77.750  121.322 -34.167 1.00 76.96  ? 102  LYS A CB    1 
ATOM   2967  C  CG    . LYS G  4  102  ? 79.235  121.660 -34.331 1.00 77.84  ? 102  LYS A CG    1 
ATOM   2968  C  CD    . LYS G  4  102  ? 80.071  121.114 -33.174 1.00 77.55  ? 102  LYS A CD    1 
ATOM   2969  C  CE    . LYS G  4  102  ? 80.905  122.207 -32.506 1.00 77.85  ? 102  LYS A CE    1 
ATOM   2970  N  NZ    . LYS G  4  102  ? 80.086  123.291 -31.891 1.00 77.41  ? 102  LYS A NZ    1 
ATOM   2971  N  N     . ALA G  4  103  ? 75.303  119.890 -36.100 1.00 75.63  ? 103  ALA A N     1 
ATOM   2972  C  CA    . ALA G  4  103  ? 74.527  120.072 -37.309 1.00 74.68  ? 103  ALA A CA    1 
ATOM   2973  C  C     . ALA G  4  103  ? 73.213  120.734 -36.984 1.00 74.20  ? 103  ALA A C     1 
ATOM   2974  O  O     . ALA G  4  103  ? 72.675  120.512 -35.904 1.00 74.68  ? 103  ALA A O     1 
ATOM   2975  C  CB    . ALA G  4  103  ? 74.291  118.721 -37.983 1.00 74.24  ? 103  ALA A CB    1 
ATOM   2976  N  N     . GLU G  4  104  ? 72.695  121.548 -37.898 1.00 73.62  ? 104  GLU A N     1 
ATOM   2977  C  CA    . GLU G  4  104  ? 71.435  122.235 -37.643 1.00 72.01  ? 104  GLU A CA    1 
ATOM   2978  C  C     . GLU G  4  104  ? 70.480  122.122 -38.815 1.00 72.15  ? 104  GLU A C     1 
ATOM   2979  O  O     . GLU G  4  104  ? 70.877  121.851 -39.952 1.00 73.04  ? 104  GLU A O     1 
ATOM   2980  C  CB    . GLU G  4  104  ? 71.673  123.717 -37.360 1.00 70.93  ? 104  GLU A CB    1 
ATOM   2981  C  CG    . GLU G  4  104  ? 73.010  124.245 -37.784 1.00 69.85  ? 104  GLU A CG    1 
ATOM   2982  C  CD    . GLU G  4  104  ? 74.060  124.096 -36.704 1.00 69.27  ? 104  GLU A CD    1 
ATOM   2983  O  OE1   . GLU G  4  104  ? 75.165  124.630 -36.908 1.00 70.02  ? 104  GLU A OE1   1 
ATOM   2984  O  OE2   . GLU G  4  104  ? 73.796  123.458 -35.659 1.00 67.67  ? 104  GLU A OE2   1 
ATOM   2985  N  N     . GLY G  4  105  ? 69.203  122.323 -38.511 1.00 71.40  ? 105  GLY A N     1 
ATOM   2986  C  CA    . GLY G  4  105  ? 68.183  122.316 -39.538 1.00 69.66  ? 105  GLY A CA    1 
ATOM   2987  C  C     . GLY G  4  105  ? 67.695  120.958 -40.034 1.00 68.71  ? 105  GLY A C     1 
ATOM   2988  O  O     . GLY G  4  105  ? 67.820  119.949 -39.347 1.00 68.78  ? 105  GLY A O     1 
ATOM   2989  N  N     . PRO G  4  106  ? 67.135  120.922 -41.265 1.00 67.77  ? 106  PRO A N     1 
ATOM   2990  C  CA    . PRO G  4  106  ? 66.554  119.791 -42.010 1.00 66.90  ? 106  PRO A CA    1 
ATOM   2991  C  C     . PRO G  4  106  ? 67.570  118.754 -42.492 1.00 65.46  ? 106  PRO A C     1 
ATOM   2992  O  O     . PRO G  4  106  ? 67.360  118.185 -43.552 1.00 65.88  ? 106  PRO A O     1 
ATOM   2993  C  CB    . PRO G  4  106  ? 65.830  120.467 -43.181 1.00 67.19  ? 106  PRO A CB    1 
ATOM   2994  C  CG    . PRO G  4  106  ? 65.773  121.931 -42.819 1.00 67.98  ? 106  PRO A CG    1 
ATOM   2995  C  CD    . PRO G  4  106  ? 67.046  122.142 -42.092 1.00 68.04  ? 106  PRO A CD    1 
ATOM   2996  N  N     . LYS G  4  107  ? 68.634  118.464 -41.764 1.00 64.42  ? 107  LYS A N     1 
ATOM   2997  C  CA    . LYS G  4  107  ? 69.594  117.491 -42.286 1.00 63.10  ? 107  LYS A CA    1 
ATOM   2998  C  C     . LYS G  4  107  ? 69.623  116.193 -41.460 1.00 63.00  ? 107  LYS A C     1 
ATOM   2999  O  O     . LYS G  4  107  ? 69.295  116.171 -40.273 1.00 63.03  ? 107  LYS A O     1 
ATOM   3000  C  CB    . LYS G  4  107  ? 70.987  118.133 -42.306 1.00 63.44  ? 107  LYS A CB    1 
ATOM   3001  C  CG    . LYS G  4  107  ? 72.167  117.220 -42.655 1.00 63.08  ? 107  LYS A CG    1 
ATOM   3002  C  CD    . LYS G  4  107  ? 73.484  117.998 -42.503 1.00 62.37  ? 107  LYS A CD    1 
ATOM   3003  C  CE    . LYS G  4  107  ? 74.710  117.189 -42.894 1.00 60.90  ? 107  LYS A CE    1 
ATOM   3004  N  NZ    . LYS G  4  107  ? 75.952  117.996 -42.708 1.00 61.66  ? 107  LYS A NZ    1 
ATOM   3005  N  N     . GLU G  4  108  ? 70.008  115.104 -42.115 1.00 61.92  ? 108  GLU A N     1 
ATOM   3006  C  CA    . GLU G  4  108  ? 70.171  113.830 -41.432 1.00 61.59  ? 108  GLU A CA    1 
ATOM   3007  C  C     . GLU G  4  108  ? 71.583  113.739 -40.907 1.00 60.71  ? 108  GLU A C     1 
ATOM   3008  O  O     . GLU G  4  108  ? 72.513  113.969 -41.675 1.00 62.13  ? 108  GLU A O     1 
ATOM   3009  C  CB    . GLU G  4  108  ? 69.911  112.670 -42.394 1.00 62.27  ? 108  GLU A CB    1 
ATOM   3010  C  CG    . GLU G  4  108  ? 68.500  112.641 -42.996 1.00 64.46  ? 108  GLU A CG    1 
ATOM   3011  C  CD    . GLU G  4  108  ? 67.590  111.546 -42.419 1.00 65.88  ? 108  GLU A CD    1 
ATOM   3012  O  OE1   . GLU G  4  108  ? 68.030  110.380 -42.332 1.00 67.08  ? 108  GLU A OE1   1 
ATOM   3013  O  OE2   . GLU G  4  108  ? 66.430  111.849 -42.061 1.00 65.07  ? 108  GLU A OE2   1 
ATOM   3014  N  N     . VAL G  4  109  ? 71.767  113.414 -39.630 1.00 59.40  ? 109  VAL A N     1 
ATOM   3015  C  CA    . VAL G  4  109  ? 73.116  113.393 -39.058 1.00 57.61  ? 109  VAL A CA    1 
ATOM   3016  C  C     . VAL G  4  109  ? 73.767  112.020 -39.159 1.00 55.68  ? 109  VAL A C     1 
ATOM   3017  O  O     . VAL G  4  109  ? 73.350  111.084 -38.480 1.00 56.60  ? 109  VAL A O     1 
ATOM   3018  C  CB    . VAL G  4  109  ? 73.093  113.816 -37.566 1.00 57.99  ? 109  VAL A CB    1 
ATOM   3019  C  CG1   . VAL G  4  109  ? 74.502  114.224 -37.123 1.00 58.90  ? 109  VAL A CG1   1 
ATOM   3020  C  CG2   . VAL G  4  109  ? 72.117  114.957 -37.365 1.00 58.40  ? 109  VAL A CG2   1 
ATOM   3021  N  N     . LYS G  4  110  ? 74.791  111.909 -40.007 1.00 53.59  ? 110  LYS A N     1 
ATOM   3022  C  CA    . LYS G  4  110  ? 75.522  110.660 -40.160 1.00 51.01  ? 110  LYS A CA    1 
ATOM   3023  C  C     . LYS G  4  110  ? 76.887  110.761 -39.494 1.00 50.48  ? 110  LYS A C     1 
ATOM   3024  O  O     . LYS G  4  110  ? 77.270  111.856 -39.095 1.00 50.71  ? 110  LYS A O     1 
ATOM   3025  C  CB    . LYS G  4  110  ? 75.632  110.333 -41.649 1.00 49.92  ? 110  LYS A CB    1 
ATOM   3026  C  CG    . LYS G  4  110  ? 74.277  110.427 -42.348 1.00 47.83  ? 110  LYS A CG    1 
ATOM   3027  C  CD    . LYS G  4  110  ? 73.233  109.559 -41.630 1.00 47.41  ? 110  LYS A CD    1 
ATOM   3028  C  CE    . LYS G  4  110  ? 71.951  110.319 -41.328 1.00 46.76  ? 110  LYS A CE    1 
ATOM   3029  N  NZ    . LYS G  4  110  ? 71.301  109.903 -40.053 1.00 45.35  ? 110  LYS A NZ    1 
ATOM   3030  N  N     . ALA G  4  111  ? 77.610  109.647 -39.368 1.00 49.10  ? 111  ALA A N     1 
ATOM   3031  C  CA    . ALA G  4  111  ? 78.907  109.632 -38.675 1.00 46.73  ? 111  ALA A CA    1 
ATOM   3032  C  C     . ALA G  4  111  ? 79.993  110.355 -39.453 1.00 45.91  ? 111  ALA A C     1 
ATOM   3033  O  O     . ALA G  4  111  ? 81.010  110.748 -38.888 1.00 44.71  ? 111  ALA A O     1 
ATOM   3034  C  CB    . ALA G  4  111  ? 79.330  108.233 -38.426 1.00 46.37  ? 111  ALA A CB    1 
ATOM   3035  N  N     . ARG G  4  112  ? 79.802  110.533 -40.744 1.00 46.05  ? 112  ARG A N     1 
ATOM   3036  C  CA    . ARG G  4  112  ? 80.801  111.250 -41.511 1.00 47.58  ? 112  ARG A CA    1 
ATOM   3037  C  C     . ARG G  4  112  ? 80.768  112.763 -41.197 1.00 48.39  ? 112  ARG A C     1 
ATOM   3038  O  O     . ARG G  4  112  ? 81.724  113.471 -41.519 1.00 50.05  ? 112  ARG A O     1 
ATOM   3039  C  CB    . ARG G  4  112  ? 80.560  111.038 -43.005 1.00 48.15  ? 112  ARG A CB    1 
ATOM   3040  C  CG    . ARG G  4  112  ? 79.406  111.864 -43.557 1.00 50.51  ? 112  ARG A CG    1 
ATOM   3041  C  CD    . ARG G  4  112  ? 79.000  111.451 -44.953 1.00 51.44  ? 112  ARG A CD    1 
ATOM   3042  N  NE    . ARG G  4  112  ? 78.546  110.064 -44.990 1.00 53.65  ? 112  ARG A NE    1 
ATOM   3043  C  CZ    . ARG G  4  112  ? 78.204  109.427 -46.106 1.00 54.75  ? 112  ARG A CZ    1 
ATOM   3044  N  NH1   . ARG G  4  112  ? 78.260  110.060 -47.278 1.00 55.34  ? 112  ARG A NH1   1 
ATOM   3045  N  NH2   . ARG G  4  112  ? 77.815  108.156 -46.056 1.00 54.54  ? 112  ARG A NH2   1 
ATOM   3046  N  N     . ASP G  4  113  ? 79.681  113.249 -40.579 1.00 47.46  ? 113  ASP A N     1 
ATOM   3047  C  CA    . ASP G  4  113  ? 79.501  114.679 -40.243 1.00 46.83  ? 113  ASP A CA    1 
ATOM   3048  C  C     . ASP G  4  113  ? 80.506  115.151 -39.188 1.00 48.13  ? 113  ASP A C     1 
ATOM   3049  O  O     . ASP G  4  113  ? 80.758  116.358 -39.059 1.00 47.36  ? 113  ASP A O     1 
ATOM   3050  C  CB    . ASP G  4  113  ? 78.085  114.935 -39.710 1.00 41.83  ? 113  ASP A CB    1 
ATOM   3051  C  CG    . ASP G  4  113  ? 77.039  114.964 -40.790 1.00 38.11  ? 113  ASP A CG    1 
ATOM   3052  O  OD1   . ASP G  4  113  ? 77.051  114.080 -41.659 1.00 36.49  ? 113  ASP A OD1   1 
ATOM   3053  O  OD2   . ASP G  4  113  ? 76.194  115.872 -40.761 1.00 34.08  ? 113  ASP A OD2   1 
ATOM   3054  N  N     . PHE G  4  114  ? 81.071  114.208 -38.435 1.00 51.40  ? 114  PHE A N     1 
ATOM   3055  C  CA    . PHE G  4  114  ? 82.051  114.542 -37.400 1.00 53.73  ? 114  PHE A CA    1 
ATOM   3056  C  C     . PHE G  4  114  ? 83.259  115.245 -38.004 1.00 56.53  ? 114  PHE A C     1 
ATOM   3057  O  O     . PHE G  4  114  ? 83.793  114.787 -39.019 1.00 56.18  ? 114  PHE A O     1 
ATOM   3058  C  CB    . PHE G  4  114  ? 82.556  113.273 -36.669 1.00 53.06  ? 114  PHE A CB    1 
ATOM   3059  C  CG    . PHE G  4  114  ? 81.686  112.805 -35.499 1.00 50.96  ? 114  PHE A CG    1 
ATOM   3060  C  CD1   . PHE G  4  114  ? 80.896  111.635 -35.612 1.00 49.15  ? 114  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE G  4  114  ? 81.677  113.509 -34.271 1.00 49.30  ? 114  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE G  4  114  ? 80.113  111.176 -34.519 1.00 46.39  ? 114  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE G  4  114  ? 80.904  113.065 -33.173 1.00 46.35  ? 114  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE G  4  114  ? 80.121  111.893 -33.303 1.00 46.30  ? 114  PHE A CZ    1 
ATOM   3065  N  N     . LEU G  4  115  ? 83.680  116.352 -37.399 1.00 60.75  ? 115  LEU A N     1 
ATOM   3066  C  CA    . LEU G  4  115  ? 84.865  117.017 -37.899 1.00 65.10  ? 115  LEU A CA    1 
ATOM   3067  C  C     . LEU G  4  115  ? 86.075  116.071 -37.783 1.00 67.87  ? 115  LEU A C     1 
ATOM   3068  O  O     . LEU G  4  115  ? 86.403  115.599 -36.689 1.00 68.08  ? 115  LEU A O     1 
ATOM   3069  C  CB    . LEU G  4  115  ? 85.113  118.324 -37.119 1.00 65.79  ? 115  LEU A CB    1 
ATOM   3070  C  CG    . LEU G  4  115  ? 84.752  119.695 -37.743 1.00 66.64  ? 115  LEU A CG    1 
ATOM   3071  C  CD1   . LEU G  4  115  ? 85.338  119.772 -39.164 1.00 66.56  ? 115  LEU A CD1   1 
ATOM   3072  C  CD2   . LEU G  4  115  ? 83.240  119.891 -37.767 1.00 65.47  ? 115  LEU A CD2   1 
ATOM   3073  N  N     . PRO G  4  116  ? 86.738  115.764 -38.916 1.00 70.92  ? 116  PRO A N     1 
ATOM   3074  C  CA    . PRO G  4  116  ? 87.905  114.865 -38.980 1.00 72.68  ? 116  PRO A CA    1 
ATOM   3075  C  C     . PRO G  4  116  ? 89.060  115.270 -38.063 1.00 74.38  ? 116  PRO A C     1 
ATOM   3076  O  O     . PRO G  4  116  ? 89.445  116.445 -37.963 1.00 73.90  ? 116  PRO A O     1 
ATOM   3077  C  CB    . PRO G  4  116  ? 88.281  114.894 -40.449 1.00 72.85  ? 116  PRO A CB    1 
ATOM   3078  C  CG    . PRO G  4  116  ? 86.922  114.958 -41.109 1.00 72.90  ? 116  PRO A CG    1 
ATOM   3079  C  CD    . PRO G  4  116  ? 86.237  116.036 -40.282 1.00 72.21  ? 116  PRO A CD    1 
ATOM   3080  N  N     . VAL G  4  117  ? 89.606  114.250 -37.402 1.00 75.68  ? 117  VAL A N     1 
ATOM   3081  C  CA    . VAL G  4  117  ? 90.765  114.408 -36.543 1.00 77.72  ? 117  VAL A CA    1 
ATOM   3082  C  C     . VAL G  4  117  ? 91.966  113.690 -37.160 1.00 78.91  ? 117  VAL A C     1 
ATOM   3083  O  O     . VAL G  4  117  ? 91.861  112.565 -37.674 1.00 78.97  ? 117  VAL A O     1 
ATOM   3084  C  CB    . VAL G  4  117  ? 90.502  113.876 -35.099 1.00 78.29  ? 117  VAL A CB    1 
ATOM   3085  C  CG1   . VAL G  4  117  ? 91.779  113.966 -34.255 1.00 78.98  ? 117  VAL A CG1   1 
ATOM   3086  C  CG2   . VAL G  4  117  ? 89.441  114.737 -34.430 1.00 79.47  ? 117  VAL A CG2   1 
ATOM   3087  N  N     . ALA G  4  118  ? 93.092  114.394 -37.104 1.00 79.32  ? 118  ALA A N     1 
ATOM   3088  C  CA    . ALA G  4  118  ? 94.389  114.025 -37.666 1.00 78.94  ? 118  ALA A CA    1 
ATOM   3089  C  C     . ALA G  4  118  ? 94.656  112.513 -37.657 1.00 77.67  ? 118  ALA A C     1 
ATOM   3090  O  O     . ALA G  4  118  ? 94.625  111.892 -38.723 1.00 78.03  ? 118  ALA A O     1 
ATOM   3091  C  CB    . ALA G  4  118  ? 95.503  114.765 -36.904 1.00 79.31  ? 118  ALA A CB    1 
ATOM   3092  N  N     . ASP G  4  119  ? 94.914  111.930 -36.484 1.00 75.69  ? 119  ASP A N     1 
ATOM   3093  C  CA    . ASP G  4  119  ? 95.300  110.508 -36.383 1.00 75.09  ? 119  ASP A CA    1 
ATOM   3094  C  C     . ASP G  4  119  ? 94.102  109.564 -36.229 1.00 72.35  ? 119  ASP A C     1 
ATOM   3095  O  O     . ASP G  4  119  ? 94.323  108.360 -36.047 1.00 72.01  ? 119  ASP A O     1 
ATOM   3096  C  CB    . ASP G  4  119  ? 96.250  110.286 -35.188 1.00 76.50  ? 119  ASP A CB    1 
ATOM   3097  C  CG    . ASP G  4  119  ? 97.738  110.532 -35.519 1.00 78.00  ? 119  ASP A CG    1 
ATOM   3098  O  OD1   . ASP G  4  119  ? 98.538  110.645 -34.557 1.00 78.87  ? 119  ASP A OD1   1 
ATOM   3099  O  OD2   . ASP G  4  119  ? 98.122  110.608 -36.710 1.00 78.37  ? 119  ASP A OD2   1 
ATOM   3100  N  N     . VAL G  4  120  ? 92.865  110.062 -36.296 1.00 69.68  ? 120  VAL A N     1 
ATOM   3101  C  CA    . VAL G  4  120  ? 91.715  109.163 -36.146 1.00 66.88  ? 120  VAL A CA    1 
ATOM   3102  C  C     . VAL G  4  120  ? 90.938  109.025 -37.446 1.00 65.32  ? 120  VAL A C     1 
ATOM   3103  O  O     . VAL G  4  120  ? 90.887  109.953 -38.254 1.00 65.77  ? 120  VAL A O     1 
ATOM   3104  C  CB    . VAL G  4  120  ? 90.725  109.637 -35.032 1.00 66.64  ? 120  VAL A CB    1 
ATOM   3105  C  CG1   . VAL G  4  120  ? 89.832  110.752 -35.534 1.00 66.00  ? 120  VAL A CG1   1 
ATOM   3106  C  CG2   . VAL G  4  120  ? 89.865  108.445 -34.588 1.00 66.46  ? 120  VAL A CG2   1 
ATOM   3107  N  N     . GLU G  4  121  ? 90.337  107.850 -37.619 1.00 63.57  ? 121  GLU A N     1 
ATOM   3108  C  CA    . GLU G  4  121  ? 89.544  107.511 -38.797 1.00 60.84  ? 121  GLU A CA    1 
ATOM   3109  C  C     . GLU G  4  121  ? 88.184  106.921 -38.384 1.00 59.48  ? 121  GLU A C     1 
ATOM   3110  O  O     . GLU G  4  121  ? 88.073  106.292 -37.319 1.00 59.04  ? 121  GLU A O     1 
ATOM   3111  C  CB    . GLU G  4  121  ? 90.349  106.509 -39.657 1.00 60.26  ? 121  GLU A CB    1 
ATOM   3112  C  CG    . GLU G  4  121  ? 89.594  105.784 -40.783 1.00 59.20  ? 121  GLU A CG    1 
ATOM   3113  C  CD    . GLU G  4  121  ? 90.341  104.547 -41.276 1.00 58.51  ? 121  GLU A CD    1 
ATOM   3114  O  OE1   . GLU G  4  121  ? 91.265  104.102 -40.561 1.00 57.57  ? 121  GLU A OE1   1 
ATOM   3115  O  OE2   . GLU G  4  121  ? 90.002  104.024 -42.364 1.00 56.82  ? 121  GLU A OE2   1 
ATOM   3116  N  N     . ILE G  4  122  ? 87.167  107.127 -39.230 1.00 58.58  ? 122  ILE A N     1 
ATOM   3117  C  CA    . ILE G  4  122  ? 85.805  106.635 -38.983 1.00 57.81  ? 122  ILE A CA    1 
ATOM   3118  C  C     . ILE G  4  122  ? 85.347  105.658 -40.088 1.00 57.47  ? 122  ILE A C     1 
ATOM   3119  O  O     . ILE G  4  122  ? 84.979  106.086 -41.183 1.00 57.10  ? 122  ILE A O     1 
ATOM   3120  C  CB    . ILE G  4  122  ? 84.801  107.812 -38.919 1.00 58.09  ? 122  ILE A CB    1 
ATOM   3121  C  CG1   . ILE G  4  122  ? 85.512  109.093 -38.414 1.00 58.34  ? 122  ILE A CG1   1 
ATOM   3122  C  CG2   . ILE G  4  122  ? 83.669  107.443 -37.968 1.00 59.05  ? 122  ILE A CG2   1 
ATOM   3123  C  CD1   . ILE G  4  122  ? 84.670  110.387 -38.475 1.00 57.03  ? 122  ILE A CD1   1 
ATOM   3124  N  N     . MET G  4  123  ? 85.357  104.356 -39.790 1.00 56.95  ? 123  MET A N     1 
ATOM   3125  C  CA    . MET G  4  123  ? 84.981  103.313 -40.758 1.00 57.24  ? 123  MET A CA    1 
ATOM   3126  C  C     . MET G  4  123  ? 83.476  103.068 -40.797 1.00 58.37  ? 123  MET A C     1 
ATOM   3127  O  O     . MET G  4  123  ? 83.003  102.224 -41.560 1.00 57.66  ? 123  MET A O     1 
ATOM   3128  C  CB    . MET G  4  123  ? 85.693  102.010 -40.423 1.00 55.83  ? 123  MET A CB    1 
ATOM   3129  C  CG    . MET G  4  123  ? 87.120  102.023 -40.872 1.00 55.29  ? 123  MET A CG    1 
ATOM   3130  S  SD    . MET G  4  123  ? 88.017  100.567 -40.397 1.00 55.15  ? 123  MET A SD    1 
ATOM   3131  C  CE    . MET G  4  123  ? 89.473  100.825 -41.350 1.00 54.02  ? 123  MET A CE    1 
ATOM   3132  N  N     . ASN G  4  124  ? 82.739  103.807 -39.977 1.00 58.91  ? 124  ASN A N     1 
ATOM   3133  C  CA    . ASN G  4  124  ? 81.274  103.733 -39.873 1.00 59.99  ? 124  ASN A CA    1 
ATOM   3134  C  C     . ASN G  4  124  ? 80.653  105.108 -40.245 1.00 59.90  ? 124  ASN A C     1 
ATOM   3135  O  O     . ASN G  4  124  ? 80.037  105.756 -39.420 1.00 60.26  ? 124  ASN A O     1 
ATOM   3136  C  CB    . ASN G  4  124  ? 80.949  103.324 -38.418 1.00 61.55  ? 124  ASN A CB    1 
ATOM   3137  C  CG    . ASN G  4  124  ? 79.476  103.041 -38.169 1.00 63.00  ? 124  ASN A CG    1 
ATOM   3138  O  OD1   . ASN G  4  124  ? 78.714  102.735 -39.090 1.00 65.62  ? 124  ASN A OD1   1 
ATOM   3139  N  ND2   . ASN G  4  124  ? 79.071  103.130 -36.905 1.00 61.15  ? 124  ASN A ND2   1 
ATOM   3140  N  N     . PRO G  4  125  ? 80.800  105.547 -41.509 1.00 59.57  ? 125  PRO A N     1 
ATOM   3141  C  CA    . PRO G  4  125  ? 80.329  106.826 -42.053 1.00 59.24  ? 125  PRO A CA    1 
ATOM   3142  C  C     . PRO G  4  125  ? 78.811  106.990 -42.077 1.00 59.02  ? 125  PRO A C     1 
ATOM   3143  O  O     . PRO G  4  125  ? 78.273  107.900 -41.434 1.00 58.39  ? 125  PRO A O     1 
ATOM   3144  C  CB    . PRO G  4  125  ? 80.934  106.862 -43.457 1.00 58.67  ? 125  PRO A CB    1 
ATOM   3145  C  CG    . PRO G  4  125  ? 81.749  105.588 -43.580 1.00 59.51  ? 125  PRO A CG    1 
ATOM   3146  C  CD    . PRO G  4  125  ? 81.105  104.648 -42.631 1.00 59.92  ? 125  PRO A CD    1 
ATOM   3147  N  N     . ASP G  4  126  ? 78.135  106.124 -42.829 1.00 59.34  ? 126  ASP A N     1 
ATOM   3148  C  CA    . ASP G  4  126  ? 76.682  106.219 -43.040 1.00 59.29  ? 126  ASP A CA    1 
ATOM   3149  C  C     . ASP G  4  126  ? 75.854  105.816 -41.809 1.00 58.23  ? 126  ASP A C     1 
ATOM   3150  O  O     . ASP G  4  126  ? 74.621  105.776 -41.907 1.00 57.36  ? 126  ASP A O     1 
ATOM   3151  C  CB    . ASP G  4  126  ? 76.273  105.352 -44.237 1.00 60.64  ? 126  ASP A CB    1 
ATOM   3152  C  CG    . ASP G  4  126  ? 75.016  105.861 -44.924 1.00 61.78  ? 126  ASP A CG    1 
ATOM   3153  O  OD1   . ASP G  4  126  ? 74.770  105.465 -46.091 1.00 61.11  ? 126  ASP A OD1   1 
ATOM   3154  O  OD2   . ASP G  4  126  ? 74.278  106.655 -44.293 1.00 62.21  ? 126  ASP A OD2   1 
ATOM   3155  N  N     . LEU G  4  127  ? 76.479  105.513 -40.674 1.00 56.57  ? 127  LEU A N     1 
ATOM   3156  C  CA    . LEU G  4  127  ? 75.686  105.190 -39.495 1.00 55.78  ? 127  LEU A CA    1 
ATOM   3157  C  C     . LEU G  4  127  ? 74.736  106.339 -39.185 1.00 56.57  ? 127  LEU A C     1 
ATOM   3158  O  O     . LEU G  4  127  ? 75.169  107.490 -39.156 1.00 56.85  ? 127  LEU A O     1 
ATOM   3159  C  CB    . LEU G  4  127  ? 76.608  104.934 -38.292 1.00 54.03  ? 127  LEU A CB    1 
ATOM   3160  C  CG    . LEU G  4  127  ? 76.573  105.791 -37.021 1.00 53.54  ? 127  LEU A CG    1 
ATOM   3161  C  CD1   . LEU G  4  127  ? 75.686  105.141 -35.984 1.00 52.80  ? 127  LEU A CD1   1 
ATOM   3162  C  CD2   . LEU G  4  127  ? 77.966  105.928 -36.463 1.00 53.44  ? 127  LEU A CD2   1 
ATOM   3163  N  N     . HIS G  4  128  ? 73.456  106.035 -38.972 1.00 57.82  ? 128  HIS A N     1 
ATOM   3164  C  CA    . HIS G  4  128  ? 72.453  107.062 -38.679 1.00 58.27  ? 128  HIS A CA    1 
ATOM   3165  C  C     . HIS G  4  128  ? 72.509  107.501 -37.231 1.00 59.62  ? 128  HIS A C     1 
ATOM   3166  O  O     . HIS G  4  128  ? 72.249  106.719 -36.319 1.00 60.01  ? 128  HIS A O     1 
ATOM   3167  C  CB    . HIS G  4  128  ? 71.037  106.546 -38.976 1.00 57.69  ? 128  HIS A CB    1 
ATOM   3168  C  CG    . HIS G  4  128  ? 69.956  107.242 -38.199 1.00 56.85  ? 128  HIS A CG    1 
ATOM   3169  N  ND1   . HIS G  4  128  ? 69.476  108.488 -38.534 1.00 56.19  ? 128  HIS A ND1   1 
ATOM   3170  C  CD2   . HIS G  4  128  ? 69.280  106.868 -37.087 1.00 56.35  ? 128  HIS A CD2   1 
ATOM   3171  C  CE1   . HIS G  4  128  ? 68.552  108.852 -37.664 1.00 55.32  ? 128  HIS A CE1   1 
ATOM   3172  N  NE2   . HIS G  4  128  ? 68.414  107.888 -36.775 1.00 54.95  ? 128  HIS A NE2   1 
ATOM   3173  N  N     . ILE G  4  129  ? 72.839  108.762 -37.018 1.00 61.36  ? 129  ILE A N     1 
ATOM   3174  C  CA    . ILE G  4  129  ? 72.860  109.268 -35.666 1.00 63.14  ? 129  ILE A CA    1 
ATOM   3175  C  C     . ILE G  4  129  ? 71.520  109.898 -35.320 1.00 63.57  ? 129  ILE A C     1 
ATOM   3176  O  O     . ILE G  4  129  ? 70.978  109.640 -34.245 1.00 64.23  ? 129  ILE A O     1 
ATOM   3177  C  CB    . ILE G  4  129  ? 74.014  110.305 -35.473 1.00 63.87  ? 129  ILE A CB    1 
ATOM   3178  C  CG1   . ILE G  4  129  ? 75.366  109.594 -35.712 1.00 65.42  ? 129  ILE A CG1   1 
ATOM   3179  C  CG2   . ILE G  4  129  ? 73.947  110.946 -34.065 1.00 64.09  ? 129  ILE A CG2   1 
ATOM   3180  C  CD1   . ILE G  4  129  ? 75.650  108.326 -34.852 1.00 63.69  ? 129  ILE A CD1   1 
ATOM   3181  N  N     . ALA G  4  130  ? 70.970  110.705 -36.228 1.00 63.26  ? 130  ALA A N     1 
ATOM   3182  C  CA    . ALA G  4  130  ? 69.691  111.351 -35.950 1.00 62.90  ? 130  ALA A CA    1 
ATOM   3183  C  C     . ALA G  4  130  ? 69.068  111.978 -37.191 1.00 62.67  ? 130  ALA A C     1 
ATOM   3184  O  O     . ALA G  4  130  ? 69.703  112.160 -38.231 1.00 63.64  ? 130  ALA A O     1 
ATOM   3185  C  CB    . ALA G  4  130  ? 69.869  112.429 -34.890 1.00 63.06  ? 130  ALA A CB    1 
ATOM   3186  N  N     . THR G  4  131  ? 67.785  112.292 -37.055 1.00 61.76  ? 131  THR A N     1 
ATOM   3187  C  CA    . THR G  4  131  ? 67.032  112.987 -38.090 1.00 60.77  ? 131  THR A CA    1 
ATOM   3188  C  C     . THR G  4  131  ? 66.540  114.320 -37.555 1.00 60.78  ? 131  THR A C     1 
ATOM   3189  O  O     . THR G  4  131  ? 65.701  114.368 -36.653 1.00 61.70  ? 131  THR A O     1 
ATOM   3190  C  CB    . THR G  4  131  ? 65.770  112.180 -38.615 1.00 59.50  ? 131  THR A CB    1 
ATOM   3191  O  OG1   . THR G  4  131  ? 64.893  111.841 -37.537 1.00 59.70  ? 131  THR A OG1   1 
ATOM   3192  C  CG2   . THR G  4  131  ? 66.204  110.910 -39.322 1.00 57.11  ? 131  THR A CG2   1 
ATOM   3193  N  N     . LEU G  4  132  ? 67.075  115.412 -38.083 1.00 60.40  ? 132  LEU A N     1 
ATOM   3194  C  CA    . LEU G  4  132  ? 66.628  116.701 -37.597 1.00 59.75  ? 132  LEU A CA    1 
ATOM   3195  C  C     . LEU G  4  132  ? 65.606  117.311 -38.539 1.00 58.62  ? 132  LEU A C     1 
ATOM   3196  O  O     . LEU G  4  132  ? 65.742  117.245 -39.757 1.00 58.37  ? 132  LEU A O     1 
ATOM   3197  C  CB    . LEU G  4  132  ? 67.842  117.614 -37.378 1.00 60.24  ? 132  LEU A CB    1 
ATOM   3198  C  CG    . LEU G  4  132  ? 68.418  117.288 -35.988 1.00 60.28  ? 132  LEU A CG    1 
ATOM   3199  C  CD1   . LEU G  4  132  ? 69.200  115.981 -36.066 1.00 60.20  ? 132  LEU A CD1   1 
ATOM   3200  C  CD2   . LEU G  4  132  ? 69.313  118.406 -35.501 1.00 59.74  ? 132  LEU A CD2   1 
ATOM   3201  N  N     . GLU G  4  133  ? 64.567  117.885 -37.950 1.00 58.16  ? 133  GLU A N     1 
ATOM   3202  C  CA    . GLU G  4  133  ? 63.463  118.465 -38.701 1.00 58.59  ? 133  GLU A CA    1 
ATOM   3203  C  C     . GLU G  4  133  ? 63.770  119.886 -39.117 1.00 60.01  ? 133  GLU A C     1 
ATOM   3204  O  O     . GLU G  4  133  ? 64.293  120.131 -40.188 1.00 60.91  ? 133  GLU A O     1 
ATOM   3205  C  CB    . GLU G  4  133  ? 62.199  118.443 -37.847 1.00 57.54  ? 133  GLU A CB    1 
ATOM   3206  C  CG    . GLU G  4  133  ? 60.938  118.824 -38.604 1.00 56.26  ? 133  GLU A CG    1 
ATOM   3207  C  CD    . GLU G  4  133  ? 59.963  119.598 -37.743 1.00 55.60  ? 133  GLU A CD    1 
ATOM   3208  O  OE1   . GLU G  4  133  ? 59.703  119.153 -36.608 1.00 56.43  ? 133  GLU A OE1   1 
ATOM   3209  O  OE2   . GLU G  4  133  ? 59.454  120.645 -38.195 1.00 54.20  ? 133  GLU A OE2   1 
ATOM   3210  N  N     . GLU G  4  134  ? 63.412  120.825 -38.259 1.00 61.11  ? 134  GLU A N     1 
ATOM   3211  C  CA    . GLU G  4  134  ? 63.691  122.229 -38.476 1.00 62.20  ? 134  GLU A CA    1 
ATOM   3212  C  C     . GLU G  4  134  ? 64.042  122.865 -37.172 1.00 63.73  ? 134  GLU A C     1 
ATOM   3213  O  O     . GLU G  4  134  ? 63.547  122.414 -36.135 1.00 63.35  ? 134  GLU A O     1 
ATOM   3214  C  CB    . GLU G  4  134  ? 62.494  122.962 -39.087 1.00 62.40  ? 134  GLU A CB    1 
ATOM   3215  C  CG    . GLU G  4  134  ? 62.823  124.441 -39.440 1.00 62.65  ? 134  GLU A CG    1 
ATOM   3216  C  CD    . GLU G  4  134  ? 64.245  124.647 -39.990 1.00 62.95  ? 134  GLU A CD    1 
ATOM   3217  O  OE1   . GLU G  4  134  ? 64.595  124.031 -41.014 1.00 63.87  ? 134  GLU A OE1   1 
ATOM   3218  O  OE2   . GLU G  4  134  ? 65.014  125.432 -39.393 1.00 61.68  ? 134  GLU A OE2   1 
ATOM   3219  N  N     . GLY G  4  135  ? 64.885  123.893 -37.195 1.00 64.89  ? 135  GLY A N     1 
ATOM   3220  C  CA    . GLY G  4  135  ? 65.296  124.479 -35.939 1.00 67.51  ? 135  GLY A CA    1 
ATOM   3221  C  C     . GLY G  4  135  ? 65.870  123.384 -35.048 1.00 69.62  ? 135  GLY A C     1 
ATOM   3222  O  O     . GLY G  4  135  ? 65.832  123.459 -33.813 1.00 70.22  ? 135  GLY A O     1 
ATOM   3223  N  N     . GLY G  4  136  ? 66.390  122.344 -35.702 1.00 70.19  ? 136  GLY A N     1 
ATOM   3224  C  CA    . GLY G  4  136  ? 66.983  121.231 -34.993 1.00 70.83  ? 136  GLY A CA    1 
ATOM   3225  C  C     . GLY G  4  136  ? 68.411  121.551 -34.639 1.00 71.75  ? 136  GLY A C     1 
ATOM   3226  O  O     . GLY G  4  136  ? 69.276  121.533 -35.513 1.00 71.98  ? 136  GLY A O     1 
ATOM   3227  N  N     . ARG G  4  137  ? 68.659  121.857 -33.369 1.00 71.50  ? 137  ARG A N     1 
ATOM   3228  C  CA    . ARG G  4  137  ? 69.999  122.203 -32.917 1.00 71.65  ? 137  ARG A CA    1 
ATOM   3229  C  C     . ARG G  4  137  ? 70.642  121.049 -32.158 1.00 72.86  ? 137  ARG A C     1 
ATOM   3230  O  O     . ARG G  4  137  ? 70.235  120.718 -31.043 1.00 73.24  ? 137  ARG A O     1 
ATOM   3231  C  CB    . ARG G  4  137  ? 69.937  123.447 -32.025 1.00 70.49  ? 137  ARG A CB    1 
ATOM   3232  C  CG    . ARG G  4  137  ? 70.747  124.637 -32.544 1.00 69.73  ? 137  ARG A CG    1 
ATOM   3233  C  CD    . ARG G  4  137  ? 70.435  125.902 -31.752 1.00 69.99  ? 137  ARG A CD    1 
ATOM   3234  N  NE    . ARG G  4  137  ? 71.127  127.094 -32.252 1.00 70.96  ? 137  ARG A NE    1 
ATOM   3235  C  CZ    . ARG G  4  137  ? 70.908  128.333 -31.804 1.00 71.24  ? 137  ARG A CZ    1 
ATOM   3236  N  NH1   . ARG G  4  137  ? 70.011  128.547 -30.842 1.00 72.15  ? 137  ARG A NH1   1 
ATOM   3237  N  NH2   . ARG G  4  137  ? 71.582  129.360 -32.314 1.00 69.24  ? 137  ARG A NH2   1 
ATOM   3238  N  N     . LEU G  4  138  ? 71.650  120.444 -32.779 1.00 73.05  ? 138  LEU A N     1 
ATOM   3239  C  CA    . LEU G  4  138  ? 72.382  119.331 -32.188 1.00 73.96  ? 138  LEU A CA    1 
ATOM   3240  C  C     . LEU G  4  138  ? 73.886  119.592 -32.197 1.00 74.33  ? 138  LEU A C     1 
ATOM   3241  O  O     . LEU G  4  138  ? 74.536  119.574 -33.240 1.00 74.26  ? 138  LEU A O     1 
ATOM   3242  C  CB    . LEU G  4  138  ? 72.083  118.034 -32.950 1.00 73.25  ? 138  LEU A CB    1 
ATOM   3243  C  CG    . LEU G  4  138  ? 73.076  116.885 -32.729 1.00 73.12  ? 138  LEU A CG    1 
ATOM   3244  C  CD1   . LEU G  4  138  ? 72.331  115.586 -32.523 1.00 73.45  ? 138  LEU A CD1   1 
ATOM   3245  C  CD2   . LEU G  4  138  ? 73.999  116.787 -33.918 1.00 72.81  ? 138  LEU A CD2   1 
ATOM   3246  N  N     . ASN G  4  139  ? 74.419  119.835 -31.011 1.00 74.41  ? 139  ASN A N     1 
ATOM   3247  C  CA    . ASN G  4  139  ? 75.836  120.093 -30.816 1.00 75.72  ? 139  ASN A CA    1 
ATOM   3248  C  C     . ASN G  4  139  ? 76.371  119.189 -29.720 1.00 74.96  ? 139  ASN A C     1 
ATOM   3249  O  O     . ASN G  4  139  ? 76.083  119.415 -28.542 1.00 75.80  ? 139  ASN A O     1 
ATOM   3250  C  CB    . ASN G  4  139  ? 76.039  121.570 -30.425 1.00 76.99  ? 139  ASN A CB    1 
ATOM   3251  C  CG    . ASN G  4  139  ? 77.392  122.149 -30.890 1.00 77.67  ? 139  ASN A CG    1 
ATOM   3252  O  OD1   . ASN G  4  139  ? 78.468  121.663 -30.517 1.00 77.52  ? 139  ASN A OD1   1 
ATOM   3253  N  ND2   . ASN G  4  139  ? 77.327  123.203 -31.701 1.00 78.14  ? 139  ASN A ND2   1 
ATOM   3254  N  N     . MET G  4  140  ? 77.140  118.168 -30.080 1.00 74.05  ? 140  MET A N     1 
ATOM   3255  C  CA    . MET G  4  140  ? 77.618  117.261 -29.045 1.00 72.95  ? 140  MET A CA    1 
ATOM   3256  C  C     . MET G  4  140  ? 79.112  116.973 -29.160 1.00 71.45  ? 140  MET A C     1 
ATOM   3257  O  O     . MET G  4  140  ? 79.778  117.304 -30.151 1.00 71.72  ? 140  MET A O     1 
ATOM   3258  C  CB    . MET G  4  140  ? 76.840  115.940 -29.109 1.00 73.90  ? 140  MET A CB    1 
ATOM   3259  C  CG    . MET G  4  140  ? 77.041  115.179 -30.383 1.00 75.13  ? 140  MET A CG    1 
ATOM   3260  S  SD    . MET G  4  140  ? 75.486  114.861 -31.174 1.00 76.92  ? 140  MET A SD    1 
ATOM   3261  C  CE    . MET G  4  140  ? 75.610  113.021 -31.396 1.00 76.52  ? 140  MET A CE    1 
ATOM   3262  N  N     . GLU G  4  141  ? 79.608  116.345 -28.096 1.00 69.06  ? 141  GLU A N     1 
ATOM   3263  C  CA    . GLU G  4  141  ? 80.986  115.906 -27.966 1.00 65.95  ? 141  GLU A CA    1 
ATOM   3264  C  C     . GLU G  4  141  ? 81.025  114.497 -27.440 1.00 64.26  ? 141  GLU A C     1 
ATOM   3265  O  O     . GLU G  4  141  ? 80.686  114.246 -26.282 1.00 64.42  ? 141  GLU A O     1 
ATOM   3266  C  CB    . GLU G  4  141  ? 81.767  116.801 -27.012 1.00 65.30  ? 141  GLU A CB    1 
ATOM   3267  C  CG    . GLU G  4  141  ? 80.934  117.605 -26.057 1.00 63.78  ? 141  GLU A CG    1 
ATOM   3268  C  CD    . GLU G  4  141  ? 81.722  118.012 -24.850 1.00 62.11  ? 141  GLU A CD    1 
ATOM   3269  O  OE1   . GLU G  4  141  ? 81.849  117.165 -23.944 1.00 60.70  ? 141  GLU A OE1   1 
ATOM   3270  O  OE2   . GLU G  4  141  ? 82.209  119.163 -24.815 1.00 60.75  ? 141  GLU A OE2   1 
ATOM   3271  N  N     . VAL G  4  142  ? 81.436  113.575 -28.295 1.00 62.71  ? 142  VAL A N     1 
ATOM   3272  C  CA    . VAL G  4  142  ? 81.471  112.180 -27.910 1.00 61.16  ? 142  VAL A CA    1 
ATOM   3273  C  C     . VAL G  4  142  ? 82.902  111.676 -27.764 1.00 60.21  ? 142  VAL A C     1 
ATOM   3274  O  O     . VAL G  4  142  ? 83.670  111.623 -28.725 1.00 60.27  ? 142  VAL A O     1 
ATOM   3275  C  CB    . VAL G  4  142  ? 80.725  111.310 -28.946 1.00 61.28  ? 142  VAL A CB    1 
ATOM   3276  C  CG1   . VAL G  4  142  ? 80.031  110.193 -28.241 1.00 61.35  ? 142  VAL A CG1   1 
ATOM   3277  C  CG2   . VAL G  4  142  ? 79.698  112.154 -29.720 1.00 62.36  ? 142  VAL A CG2   1 
ATOM   3278  N  N     . ARG G  4  143  ? 83.249  111.308 -26.537 1.00 59.50  ? 143  ARG A N     1 
ATOM   3279  C  CA    . ARG G  4  143  ? 84.571  110.784 -26.215 1.00 57.01  ? 143  ARG A CA    1 
ATOM   3280  C  C     . ARG G  4  143  ? 84.751  109.382 -26.786 1.00 57.30  ? 143  ARG A C     1 
ATOM   3281  O  O     . ARG G  4  143  ? 83.774  108.647 -26.975 1.00 57.55  ? 143  ARG A O     1 
ATOM   3282  C  CB    . ARG G  4  143  ? 84.754  110.786 -24.675 1.00 55.71  ? 143  ARG A CB    1 
ATOM   3283  C  CG    . ARG G  4  143  ? 85.280  109.489 -24.001 1.00 52.64  ? 143  ARG A CG    1 
ATOM   3284  C  CD    . ARG G  4  143  ? 86.737  109.507 -23.441 1.00 50.38  ? 143  ARG A CD    1 
ATOM   3285  N  NE    . ARG G  4  143  ? 86.874  110.003 -22.062 1.00 47.58  ? 143  ARG A NE    1 
ATOM   3286  C  CZ    . ARG G  4  143  ? 87.944  109.806 -21.285 1.00 45.11  ? 143  ARG A CZ    1 
ATOM   3287  N  NH1   . ARG G  4  143  ? 88.976  109.110 -21.738 1.00 42.02  ? 143  ARG A NH1   1 
ATOM   3288  N  NH2   . ARG G  4  143  ? 87.992  110.319 -20.058 1.00 44.20  ? 143  ARG A NH2   1 
ATOM   3289  N  N     . VAL G  4  144  ? 86.001  109.021 -27.070 1.00 57.76  ? 144  VAL A N     1 
ATOM   3290  C  CA    . VAL G  4  144  ? 86.333  107.692 -27.588 1.00 58.04  ? 144  VAL A CA    1 
ATOM   3291  C  C     . VAL G  4  144  ? 87.613  107.176 -26.954 1.00 57.92  ? 144  VAL A C     1 
ATOM   3292  O  O     . VAL G  4  144  ? 88.607  107.902 -26.893 1.00 57.57  ? 144  VAL A O     1 
ATOM   3293  C  CB    . VAL G  4  144  ? 86.535  107.700 -29.106 1.00 58.02  ? 144  VAL A CB    1 
ATOM   3294  C  CG1   . VAL G  4  144  ? 86.800  106.285 -29.576 1.00 57.79  ? 144  VAL A CG1   1 
ATOM   3295  C  CG2   . VAL G  4  144  ? 85.313  108.260 -29.797 1.00 59.05  ? 144  VAL A CG2   1 
ATOM   3296  N  N     . ASP G  4  145  ? 87.599  105.926 -26.497 1.00 58.49  ? 145  ASP A N     1 
ATOM   3297  C  CA    . ASP G  4  145  ? 88.769  105.384 -25.820 1.00 59.41  ? 145  ASP A CA    1 
ATOM   3298  C  C     . ASP G  4  145  ? 89.194  104.031 -26.384 1.00 60.58  ? 145  ASP A C     1 
ATOM   3299  O  O     . ASP G  4  145  ? 88.479  103.371 -27.149 1.00 59.96  ? 145  ASP A O     1 
ATOM   3300  C  CB    . ASP G  4  145  ? 88.473  105.231 -24.325 1.00 58.57  ? 145  ASP A CB    1 
ATOM   3301  C  CG    . ASP G  4  145  ? 89.666  105.577 -23.432 1.00 58.60  ? 145  ASP A CG    1 
ATOM   3302  O  OD1   . ASP G  4  145  ? 90.191  106.710 -23.531 1.00 57.38  ? 145  ASP A OD1   1 
ATOM   3303  O  OD2   . ASP G  4  145  ? 90.072  104.709 -22.620 1.00 57.80  ? 145  ASP A OD2   1 
ATOM   3304  N  N     . ARG G  4  146  ? 90.399  103.661 -25.949 1.00 62.02  ? 146  ARG A N     1 
ATOM   3305  C  CA    . ARG G  4  146  ? 91.101  102.417 -26.245 1.00 63.52  ? 146  ARG A CA    1 
ATOM   3306  C  C     . ARG G  4  146  ? 91.172  101.540 -24.991 1.00 63.85  ? 146  ARG A C     1 
ATOM   3307  O  O     . ARG G  4  146  ? 91.871  101.875 -24.030 1.00 63.82  ? 146  ARG A O     1 
ATOM   3308  C  CB    . ARG G  4  146  ? 92.524  102.735 -26.722 1.00 64.29  ? 146  ARG A CB    1 
ATOM   3309  C  CG    . ARG G  4  146  ? 93.508  101.579 -26.756 1.00 66.32  ? 146  ARG A CG    1 
ATOM   3310  C  CD    . ARG G  4  146  ? 94.885  102.045 -27.252 1.00 66.85  ? 146  ARG A CD    1 
ATOM   3311  N  NE    . ARG G  4  146  ? 95.694  100.946 -27.787 1.00 66.92  ? 146  ARG A NE    1 
ATOM   3312  C  CZ    . ARG G  4  146  ? 96.503  101.053 -28.841 1.00 66.84  ? 146  ARG A CZ    1 
ATOM   3313  N  NH1   . ARG G  4  146  ? 96.612  102.217 -29.476 1.00 65.61  ? 146  ARG A NH1   1 
ATOM   3314  N  NH2   . ARG G  4  146  ? 97.199  99.997  -29.264 1.00 66.12  ? 146  ARG A NH2   1 
ATOM   3315  N  N     . GLY G  4  147  ? 90.445  100.428 -25.000 1.00 64.16  ? 147  GLY A N     1 
ATOM   3316  C  CA    . GLY G  4  147  ? 90.439  99.536  -23.851 1.00 64.04  ? 147  GLY A CA    1 
ATOM   3317  C  C     . GLY G  4  147  ? 90.245  98.087  -24.245 1.00 63.84  ? 147  GLY A C     1 
ATOM   3318  O  O     . GLY G  4  147  ? 90.568  97.706  -25.376 1.00 65.06  ? 147  GLY A O     1 
ATOM   3319  N  N     . VAL G  4  148  ? 89.724  97.271  -23.328 1.00 62.70  ? 148  VAL A N     1 
ATOM   3320  C  CA    . VAL G  4  148  ? 89.504  95.856  -23.619 1.00 61.76  ? 148  VAL A CA    1 
ATOM   3321  C  C     . VAL G  4  148  ? 88.238  95.342  -22.949 1.00 60.99  ? 148  VAL A C     1 
ATOM   3322  O  O     . VAL G  4  148  ? 87.914  95.757  -21.835 1.00 61.58  ? 148  VAL A O     1 
ATOM   3323  C  CB    . VAL G  4  148  ? 90.668  94.957  -23.110 1.00 61.68  ? 148  VAL A CB    1 
ATOM   3324  C  CG1   . VAL G  4  148  ? 90.917  93.862  -24.112 1.00 61.62  ? 148  VAL A CG1   1 
ATOM   3325  C  CG2   . VAL G  4  148  ? 91.916  95.779  -22.846 1.00 61.99  ? 148  VAL A CG2   1 
ATOM   3326  N  N     . GLY G  4  149  ? 87.537  94.439  -23.637 1.00 60.38  ? 149  GLY A N     1 
ATOM   3327  C  CA    . GLY G  4  149  ? 86.331  93.817  -23.098 1.00 58.50  ? 149  GLY A CA    1 
ATOM   3328  C  C     . GLY G  4  149  ? 85.109  94.718  -23.048 1.00 57.25  ? 149  GLY A C     1 
ATOM   3329  O  O     . GLY G  4  149  ? 84.950  95.643  -23.862 1.00 57.17  ? 149  GLY A O     1 
ATOM   3330  N  N     . TYR G  4  150  ? 84.249  94.429  -22.073 1.00 54.12  ? 150  TYR A N     1 
ATOM   3331  C  CA    . TYR G  4  150  ? 83.020  95.167  -21.850 1.00 51.11  ? 150  TYR A CA    1 
ATOM   3332  C  C     . TYR G  4  150  ? 83.098  95.977  -20.539 1.00 51.91  ? 150  TYR A C     1 
ATOM   3333  O  O     . TYR G  4  150  ? 83.420  95.420  -19.488 1.00 51.46  ? 150  TYR A O     1 
ATOM   3334  C  CB    . TYR G  4  150  ? 81.874  94.153  -21.795 1.00 48.39  ? 150  TYR A CB    1 
ATOM   3335  C  CG    . TYR G  4  150  ? 80.495  94.703  -22.004 1.00 45.51  ? 150  TYR A CG    1 
ATOM   3336  C  CD1   . TYR G  4  150  ? 79.916  94.721  -23.286 1.00 43.59  ? 150  TYR A CD1   1 
ATOM   3337  C  CD2   . TYR G  4  150  ? 79.755  95.230  -20.927 1.00 44.66  ? 150  TYR A CD2   1 
ATOM   3338  C  CE1   . TYR G  4  150  ? 78.644  95.250  -23.492 1.00 42.13  ? 150  TYR A CE1   1 
ATOM   3339  C  CE2   . TYR G  4  150  ? 78.471  95.766  -21.122 1.00 44.02  ? 150  TYR A CE2   1 
ATOM   3340  C  CZ    . TYR G  4  150  ? 77.925  95.772  -22.408 1.00 44.09  ? 150  TYR A CZ    1 
ATOM   3341  O  OH    . TYR G  4  150  ? 76.676  96.311  -22.586 1.00 44.67  ? 150  TYR A OH    1 
ATOM   3342  N  N     . VAL G  4  151  ? 82.820  97.280  -20.592 1.00 52.24  ? 151  VAL A N     1 
ATOM   3343  C  CA    . VAL G  4  151  ? 82.831  98.090  -19.377 1.00 53.38  ? 151  VAL A CA    1 
ATOM   3344  C  C     . VAL G  4  151  ? 81.521  98.876  -19.226 1.00 54.48  ? 151  VAL A C     1 
ATOM   3345  O  O     . VAL G  4  151  ? 81.282  99.854  -19.936 1.00 55.64  ? 151  VAL A O     1 
ATOM   3346  C  CB    . VAL G  4  151  ? 84.020  99.094  -19.349 1.00 52.57  ? 151  VAL A CB    1 
ATOM   3347  C  CG1   . VAL G  4  151  ? 84.042  99.821  -17.997 1.00 52.60  ? 151  VAL A CG1   1 
ATOM   3348  C  CG2   . VAL G  4  151  ? 85.336  98.351  -19.536 1.00 51.83  ? 151  VAL A CG2   1 
ATOM   3349  N  N     . PRO G  4  152  ? 80.647  98.439  -18.304 1.00 54.25  ? 152  PRO A N     1 
ATOM   3350  C  CA    . PRO G  4  152  ? 79.385  99.143  -18.100 1.00 54.81  ? 152  PRO A CA    1 
ATOM   3351  C  C     . PRO G  4  152  ? 79.618  100.622 -17.841 1.00 56.34  ? 152  PRO A C     1 
ATOM   3352  O  O     . PRO G  4  152  ? 80.631  100.979 -17.232 1.00 56.40  ? 152  PRO A O     1 
ATOM   3353  C  CB    . PRO G  4  152  ? 78.782  98.408  -16.914 1.00 54.88  ? 152  PRO A CB    1 
ATOM   3354  C  CG    . PRO G  4  152  ? 79.213  97.017  -17.166 1.00 54.61  ? 152  PRO A CG    1 
ATOM   3355  C  CD    . PRO G  4  152  ? 80.661  97.180  -17.539 1.00 54.01  ? 152  PRO A CD    1 
ATOM   3356  N  N     . ALA G  4  153  ? 78.698  101.471 -18.300 1.00 58.19  ? 153  ALA A N     1 
ATOM   3357  C  CA    . ALA G  4  153  ? 78.793  102.929 -18.113 1.00 59.40  ? 153  ALA A CA    1 
ATOM   3358  C  C     . ALA G  4  153  ? 78.895  103.303 -16.623 1.00 59.77  ? 153  ALA A C     1 
ATOM   3359  O  O     . ALA G  4  153  ? 79.398  104.368 -16.251 1.00 58.56  ? 153  ALA A O     1 
ATOM   3360  C  CB    . ALA G  4  153  ? 77.567  103.602 -18.726 1.00 58.12  ? 153  ALA A CB    1 
ATOM   3361  N  N     . GLU G  4  154  ? 78.406  102.395 -15.786 1.00 61.73  ? 154  GLU A N     1 
ATOM   3362  C  CA    . GLU G  4  154  ? 78.388  102.534 -14.333 1.00 63.29  ? 154  GLU A CA    1 
ATOM   3363  C  C     . GLU G  4  154  ? 79.787  102.305 -13.724 1.00 64.68  ? 154  GLU A C     1 
ATOM   3364  O  O     . GLU G  4  154  ? 80.155  102.935 -12.731 1.00 65.01  ? 154  GLU A O     1 
ATOM   3365  C  CB    . GLU G  4  154  ? 77.384  101.514 -13.744 1.00 62.20  ? 154  GLU A CB    1 
ATOM   3366  C  CG    . GLU G  4  154  ? 75.970  101.496 -14.429 1.00 60.01  ? 154  GLU A CG    1 
ATOM   3367  C  CD    . GLU G  4  154  ? 75.945  100.940 -15.878 1.00 59.18  ? 154  GLU A CD    1 
ATOM   3368  O  OE1   . GLU G  4  154  ? 76.206  99.731  -16.066 1.00 58.84  ? 154  GLU A OE1   1 
ATOM   3369  O  OE2   . GLU G  4  154  ? 75.661  101.709 -16.832 1.00 56.72  ? 154  GLU A OE2   1 
ATOM   3370  N  N     . LYS G  4  155  ? 80.560  101.405 -14.331 1.00 65.38  ? 155  LYS A N     1 
ATOM   3371  C  CA    . LYS G  4  155  ? 81.891  101.054 -13.851 1.00 65.18  ? 155  LYS A CA    1 
ATOM   3372  C  C     . LYS G  4  155  ? 82.912  102.189 -14.036 1.00 66.01  ? 155  LYS A C     1 
ATOM   3373  O  O     . LYS G  4  155  ? 83.668  102.463 -13.104 1.00 66.52  ? 155  LYS A O     1 
ATOM   3374  C  CB    . LYS G  4  155  ? 82.399  99.803  -14.568 1.00 64.82  ? 155  LYS A CB    1 
ATOM   3375  C  CG    . LYS G  4  155  ? 82.926  98.785  -13.578 1.00 63.71  ? 155  LYS A CG    1 
ATOM   3376  C  CD    . LYS G  4  155  ? 83.938  97.849  -14.191 1.00 62.63  ? 155  LYS A CD    1 
ATOM   3377  C  CE    . LYS G  4  155  ? 84.664  97.086  -13.101 1.00 61.98  ? 155  LYS A CE    1 
ATOM   3378  N  NZ    . LYS G  4  155  ? 85.728  96.206  -13.649 1.00 62.07  ? 155  LYS A NZ    1 
ATOM   3379  N  N     . HIS G  4  156  ? 82.961  102.849 -15.194 1.00 66.98  ? 156  HIS A N     1 
ATOM   3380  C  CA    . HIS G  4  156  ? 83.955  103.916 -15.393 1.00 67.97  ? 156  HIS A CA    1 
ATOM   3381  C  C     . HIS G  4  156  ? 83.417  105.301 -15.015 1.00 67.62  ? 156  HIS A C     1 
ATOM   3382  O  O     . HIS G  4  156  ? 84.122  106.063 -14.355 1.00 67.78  ? 156  HIS A O     1 
ATOM   3383  C  CB    . HIS G  4  156  ? 84.427  103.944 -16.846 1.00 69.43  ? 156  HIS A CB    1 
ATOM   3384  C  CG    . HIS G  4  156  ? 83.312  103.872 -17.846 1.00 71.76  ? 156  HIS A CG    1 
ATOM   3385  N  ND1   . HIS G  4  156  ? 83.211  102.856 -18.771 1.00 72.40  ? 156  HIS A ND1   1 
ATOM   3386  C  CD2   . HIS G  4  156  ? 82.253  104.689 -18.070 1.00 72.17  ? 156  HIS A CD2   1 
ATOM   3387  C  CE1   . HIS G  4  156  ? 82.139  103.050 -19.519 1.00 72.72  ? 156  HIS A CE1   1 
ATOM   3388  N  NE2   . HIS G  4  156  ? 81.540  104.155 -19.113 1.00 72.58  ? 156  HIS A NE2   1 
ATOM   3389  N  N     . GLY G  4  157  ? 82.195  105.636 -15.418 1.00 68.16  ? 157  GLY A N     1 
ATOM   3390  C  CA    . GLY G  4  157  ? 81.660  106.948 -15.113 1.00 68.26  ? 157  GLY A CA    1 
ATOM   3391  C  C     . GLY G  4  157  ? 82.598  108.052 -15.550 1.00 68.17  ? 157  GLY A C     1 
ATOM   3392  O  O     . GLY G  4  157  ? 83.341  108.605 -14.744 1.00 67.92  ? 157  GLY A O     1 
ATOM   3393  N  N     . ILE G  4  158  ? 82.565  108.375 -16.833 1.00 68.46  ? 158  ILE A N     1 
ATOM   3394  C  CA    . ILE G  4  158  ? 83.416  109.418 -17.394 1.00 69.78  ? 158  ILE A CA    1 
ATOM   3395  C  C     . ILE G  4  158  ? 82.775  110.790 -17.237 1.00 70.94  ? 158  ILE A C     1 
ATOM   3396  O  O     . ILE G  4  158  ? 81.562  110.934 -17.403 1.00 72.07  ? 158  ILE A O     1 
ATOM   3397  C  CB    . ILE G  4  158  ? 83.660  109.138 -18.873 1.00 68.99  ? 158  ILE A CB    1 
ATOM   3398  C  CG1   . ILE G  4  158  ? 84.106  107.684 -19.021 1.00 69.30  ? 158  ILE A CG1   1 
ATOM   3399  C  CG2   . ILE G  4  158  ? 84.638  110.147 -19.447 1.00 69.61  ? 158  ILE A CG2   1 
ATOM   3400  C  CD1   . ILE G  4  158  ? 85.354  107.283 -18.245 1.00 69.47  ? 158  ILE A CD1   1 
ATOM   3401  N  N     . LYS G  4  159  ? 83.583  111.801 -16.934 1.00 70.69  ? 159  LYS A N     1 
ATOM   3402  C  CA    . LYS G  4  159  ? 83.022  113.118 -16.720 1.00 69.88  ? 159  LYS A CA    1 
ATOM   3403  C  C     . LYS G  4  159  ? 83.886  114.232 -17.302 1.00 69.38  ? 159  LYS A C     1 
ATOM   3404  O  O     . LYS G  4  159  ? 84.613  114.921 -16.584 1.00 69.14  ? 159  LYS A O     1 
ATOM   3405  C  CB    . LYS G  4  159  ? 82.789  113.312 -15.212 1.00 70.43  ? 159  LYS A CB    1 
ATOM   3406  C  CG    . LYS G  4  159  ? 81.663  112.394 -14.668 1.00 69.44  ? 159  LYS A CG    1 
ATOM   3407  C  CD    . LYS G  4  159  ? 80.346  112.635 -15.425 1.00 71.05  ? 159  LYS A CD    1 
ATOM   3408  C  CE    . LYS G  4  159  ? 79.382  111.464 -15.313 1.00 72.08  ? 159  LYS A CE    1 
ATOM   3409  N  NZ    . LYS G  4  159  ? 78.123  111.690 -16.103 1.00 73.62  ? 159  LYS A NZ    1 
ATOM   3410  N  N     . ASP G  4  160  ? 83.810  114.404 -18.617 1.00 67.85  ? 160  ASP A N     1 
ATOM   3411  C  CA    . ASP G  4  160  ? 84.507  115.522 -19.227 1.00 67.16  ? 160  ASP A CA    1 
ATOM   3412  C  C     . ASP G  4  160  ? 83.786  116.803 -18.867 1.00 67.26  ? 160  ASP A C     1 
ATOM   3413  O  O     . ASP G  4  160  ? 84.375  117.768 -18.385 1.00 67.89  ? 160  ASP A O     1 
ATOM   3414  C  CB    . ASP G  4  160  ? 84.577  115.296 -20.725 1.00 64.35  ? 160  ASP A CB    1 
ATOM   3415  C  CG    . ASP G  4  160  ? 85.616  114.266 -21.067 1.00 61.74  ? 160  ASP A CG    1 
ATOM   3416  O  OD1   . ASP G  4  160  ? 86.646  114.649 -21.644 1.00 61.52  ? 160  ASP A OD1   1 
ATOM   3417  O  OD2   . ASP G  4  160  ? 85.407  113.078 -20.742 1.00 59.36  ? 160  ASP A OD2   1 
ATOM   3418  N  N     . ARG G  4  161  ? 82.482  116.783 -19.102 1.00 67.20  ? 161  ARG A N     1 
ATOM   3419  C  CA    . ARG G  4  161  ? 81.616  117.856 -18.671 1.00 67.28  ? 161  ARG A CA    1 
ATOM   3420  C  C     . ARG G  4  161  ? 80.678  117.325 -17.595 1.00 66.52  ? 161  ARG A C     1 
ATOM   3421  O  O     . ARG G  4  161  ? 80.296  116.152 -17.642 1.00 66.15  ? 161  ARG A O     1 
ATOM   3422  C  CB    . ARG G  4  161  ? 80.810  118.423 -19.844 1.00 67.96  ? 161  ARG A CB    1 
ATOM   3423  C  CG    . ARG G  4  161  ? 80.162  119.792 -19.563 1.00 68.36  ? 161  ARG A CG    1 
ATOM   3424  C  CD    . ARG G  4  161  ? 81.139  120.814 -18.959 1.00 69.64  ? 161  ARG A CD    1 
ATOM   3425  N  NE    . ARG G  4  161  ? 82.529  120.618 -19.390 1.00 70.19  ? 161  ARG A NE    1 
ATOM   3426  C  CZ    . ARG G  4  161  ? 82.953  120.651 -20.650 1.00 70.17  ? 161  ARG A CZ    1 
ATOM   3427  N  NH1   . ARG G  4  161  ? 82.099  120.875 -21.639 1.00 70.23  ? 161  ARG A NH1   1 
ATOM   3428  N  NH2   . ARG G  4  161  ? 84.237  120.457 -20.920 1.00 70.65  ? 161  ARG A NH2   1 
ATOM   3429  N  N     . ILE G  4  162  ? 80.319  118.162 -16.632 1.00 66.10  ? 162  ILE A N     1 
ATOM   3430  C  CA    . ILE G  4  162  ? 79.475  117.746 -15.509 1.00 66.17  ? 162  ILE A CA    1 
ATOM   3431  C  C     . ILE G  4  162  ? 78.118  117.164 -15.970 1.00 66.71  ? 162  ILE A C     1 
ATOM   3432  O  O     . ILE G  4  162  ? 77.624  116.209 -15.362 1.00 66.69  ? 162  ILE A O     1 
ATOM   3433  C  CB    . ILE G  4  162  ? 79.207  118.951 -14.520 1.00 66.55  ? 162  ILE A CB    1 
ATOM   3434  C  CG1   . ILE G  4  162  ? 78.975  120.243 -15.336 1.00 66.93  ? 162  ILE A CG1   1 
ATOM   3435  C  CG2   . ILE G  4  162  ? 80.366  119.085 -13.513 1.00 65.61  ? 162  ILE A CG2   1 
ATOM   3436  C  CD1   . ILE G  4  162  ? 78.569  121.477 -14.532 1.00 66.68  ? 162  ILE A CD1   1 
ATOM   3437  N  N     . ASN G  4  163  ? 77.512  117.714 -17.024 1.00 65.82  ? 163  ASN A N     1 
ATOM   3438  C  CA    . ASN G  4  163  ? 76.194  117.245 -17.477 1.00 65.16  ? 163  ASN A CA    1 
ATOM   3439  C  C     . ASN G  4  163  ? 76.296  116.130 -18.509 1.00 65.78  ? 163  ASN A C     1 
ATOM   3440  O  O     . ASN G  4  163  ? 75.260  115.649 -18.971 1.00 65.69  ? 163  ASN A O     1 
ATOM   3441  C  CB    . ASN G  4  163  ? 75.389  118.380 -18.112 1.00 63.48  ? 163  ASN A CB    1 
ATOM   3442  C  CG    . ASN G  4  163  ? 74.574  119.155 -17.131 1.00 62.86  ? 163  ASN A CG    1 
ATOM   3443  O  OD1   . ASN G  4  163  ? 73.755  119.984 -17.521 1.00 61.10  ? 163  ASN A OD1   1 
ATOM   3444  N  ND2   . ASN G  4  163  ? 74.786  118.902 -15.850 1.00 63.10  ? 163  ASN A ND2   1 
ATOM   3445  N  N     . ALA G  4  164  ? 77.512  115.727 -18.887 1.00 66.40  ? 164  ALA A N     1 
ATOM   3446  C  CA    . ALA G  4  164  ? 77.696  114.646 -19.867 1.00 66.96  ? 164  ALA A CA    1 
ATOM   3447  C  C     . ALA G  4  164  ? 77.194  113.301 -19.303 1.00 65.97  ? 164  ALA A C     1 
ATOM   3448  O  O     . ALA G  4  164  ? 77.083  113.134 -18.083 1.00 66.54  ? 164  ALA A O     1 
ATOM   3449  C  CB    . ALA G  4  164  ? 79.194  114.535 -20.260 1.00 65.66  ? 164  ALA A CB    1 
ATOM   3450  N  N     . ILE G  4  165  ? 76.883  112.349 -20.180 1.00 64.51  ? 165  ILE A N     1 
ATOM   3451  C  CA    . ILE G  4  165  ? 76.396  111.048 -19.730 1.00 63.33  ? 165  ILE A CA    1 
ATOM   3452  C  C     . ILE G  4  165  ? 77.265  109.903 -20.262 1.00 62.40  ? 165  ILE A C     1 
ATOM   3453  O  O     . ILE G  4  165  ? 77.438  109.746 -21.475 1.00 62.20  ? 165  ILE A O     1 
ATOM   3454  C  CB    . ILE G  4  165  ? 74.934  110.828 -20.165 1.00 63.48  ? 165  ILE A CB    1 
ATOM   3455  C  CG1   . ILE G  4  165  ? 74.782  111.014 -21.680 1.00 64.10  ? 165  ILE A CG1   1 
ATOM   3456  C  CG2   . ILE G  4  165  ? 74.056  111.799 -19.404 1.00 63.98  ? 165  ILE A CG2   1 
ATOM   3457  C  CD1   . ILE G  4  165  ? 73.508  110.399 -22.260 1.00 63.68  ? 165  ILE A CD1   1 
ATOM   3458  N  N     . PRO G  4  166  ? 77.821  109.080 -19.353 1.00 61.01  ? 166  PRO A N     1 
ATOM   3459  C  CA    . PRO G  4  166  ? 78.672  107.963 -19.771 1.00 59.70  ? 166  PRO A CA    1 
ATOM   3460  C  C     . PRO G  4  166  ? 77.913  106.942 -20.606 1.00 58.84  ? 166  PRO A C     1 
ATOM   3461  O  O     . PRO G  4  166  ? 76.690  106.875 -20.557 1.00 58.71  ? 166  PRO A O     1 
ATOM   3462  C  CB    . PRO G  4  166  ? 79.186  107.401 -18.449 1.00 59.79  ? 166  PRO A CB    1 
ATOM   3463  C  CG    . PRO G  4  166  ? 79.202  108.592 -17.558 1.00 59.97  ? 166  PRO A CG    1 
ATOM   3464  C  CD    . PRO G  4  166  ? 77.870  109.223 -17.887 1.00 60.67  ? 166  PRO A CD    1 
ATOM   3465  N  N     . VAL G  4  167  ? 78.653  106.152 -21.380 1.00 58.82  ? 167  VAL A N     1 
ATOM   3466  C  CA    . VAL G  4  167  ? 78.057  105.123 -22.211 1.00 58.74  ? 167  VAL A CA    1 
ATOM   3467  C  C     . VAL G  4  167  ? 78.812  103.816 -22.088 1.00 59.52  ? 167  VAL A C     1 
ATOM   3468  O  O     . VAL G  4  167  ? 80.028  103.796 -21.879 1.00 59.46  ? 167  VAL A O     1 
ATOM   3469  C  CB    . VAL G  4  167  ? 78.036  105.522 -23.679 1.00 57.71  ? 167  VAL A CB    1 
ATOM   3470  C  CG1   . VAL G  4  167  ? 77.238  104.496 -24.476 1.00 56.45  ? 167  VAL A CG1   1 
ATOM   3471  C  CG2   . VAL G  4  167  ? 77.384  106.885 -23.816 1.00 57.97  ? 167  VAL A CG2   1 
ATOM   3472  N  N     . ASP G  4  168  ? 78.061  102.727 -22.223 1.00 61.28  ? 168  ASP A N     1 
ATOM   3473  C  CA    . ASP G  4  168  ? 78.578  101.367 -22.120 1.00 61.17  ? 168  ASP A CA    1 
ATOM   3474  C  C     . ASP G  4  168  ? 79.701  101.133 -23.115 1.00 60.46  ? 168  ASP A C     1 
ATOM   3475  O  O     . ASP G  4  168  ? 79.575  101.422 -24.306 1.00 60.82  ? 168  ASP A O     1 
ATOM   3476  C  CB    . ASP G  4  168  ? 77.442  100.358 -22.353 1.00 62.73  ? 168  ASP A CB    1 
ATOM   3477  C  CG    . ASP G  4  168  ? 76.083  101.036 -22.636 1.00 63.83  ? 168  ASP A CG    1 
ATOM   3478  O  OD1   . ASP G  4  168  ? 75.269  101.190 -21.693 1.00 64.56  ? 168  ASP A OD1   1 
ATOM   3479  O  OD2   . ASP G  4  168  ? 75.829  101.424 -23.796 1.00 63.43  ? 168  ASP A OD2   1 
ATOM   3480  N  N     . ALA G  4  169  ? 80.798  100.596 -22.613 1.00 59.47  ? 169  ALA A N     1 
ATOM   3481  C  CA    . ALA G  4  169  ? 81.955  100.364 -23.438 1.00 59.43  ? 169  ALA A CA    1 
ATOM   3482  C  C     . ALA G  4  169  ? 81.865  99.044  -24.182 1.00 59.68  ? 169  ALA A C     1 
ATOM   3483  O  O     . ALA G  4  169  ? 81.601  98.015  -23.586 1.00 60.86  ? 169  ALA A O     1 
ATOM   3484  C  CB    . ALA G  4  169  ? 83.186  100.381 -22.572 1.00 59.78  ? 169  ALA A CB    1 
ATOM   3485  N  N     . VAL G  4  170  ? 82.085  99.100  -25.489 1.00 59.32  ? 170  VAL A N     1 
ATOM   3486  C  CA    . VAL G  4  170  ? 82.131  97.933  -26.368 1.00 60.66  ? 170  VAL A CA    1 
ATOM   3487  C  C     . VAL G  4  170  ? 83.513  97.866  -27.044 1.00 62.80  ? 170  VAL A C     1 
ATOM   3488  O  O     . VAL G  4  170  ? 83.726  98.495  -28.082 1.00 63.31  ? 170  VAL A O     1 
ATOM   3489  C  CB    . VAL G  4  170  ? 81.020  98.030  -27.437 1.00 60.02  ? 170  VAL A CB    1 
ATOM   3490  C  CG1   . VAL G  4  170  ? 79.709  97.590  -26.854 1.00 60.00  ? 170  VAL A CG1   1 
ATOM   3491  C  CG2   . VAL G  4  170  ? 80.894  99.464  -27.929 1.00 58.88  ? 170  VAL A CG2   1 
ATOM   3492  N  N     . PHE G  4  171  ? 84.442  97.092  -26.474 1.00 64.21  ? 171  PHE A N     1 
ATOM   3493  C  CA    . PHE G  4  171  ? 85.844  97.118  -26.932 1.00 65.42  ? 171  PHE A CA    1 
ATOM   3494  C  C     . PHE G  4  171  ? 86.276  95.976  -27.886 1.00 65.89  ? 171  PHE A C     1 
ATOM   3495  O  O     . PHE G  4  171  ? 87.411  96.053  -28.374 1.00 66.04  ? 171  PHE A O     1 
ATOM   3496  C  CB    . PHE G  4  171  ? 86.775  97.118  -25.711 1.00 66.02  ? 171  PHE A CB    1 
ATOM   3497  C  CG    . PHE G  4  171  ? 86.958  98.476  -25.076 1.00 66.71  ? 171  PHE A CG    1 
ATOM   3498  C  CD1   . PHE G  4  171  ? 87.176  99.628  -25.871 1.00 66.66  ? 171  PHE A CD1   1 
ATOM   3499  C  CD2   . PHE G  4  171  ? 86.941  98.614  -23.676 1.00 66.66  ? 171  PHE A CD2   1 
ATOM   3500  C  CE1   . PHE G  4  171  ? 87.380  100.906 -25.281 1.00 65.98  ? 171  PHE A CE1   1 
ATOM   3501  C  CE2   . PHE G  4  171  ? 87.145  99.888  -23.063 1.00 66.30  ? 171  PHE A CE2   1 
ATOM   3502  C  CZ    . PHE G  4  171  ? 87.364  101.033 -23.874 1.00 66.27  ? 171  PHE A CZ    1 
ATOM   3503  N  N     . SER G  4  172  ? 85.493  94.951  -28.200 1.00 66.28  ? 172  SER A N     1 
ATOM   3504  C  CA    . SER G  4  172  ? 86.099  93.941  -29.074 1.00 67.01  ? 172  SER A CA    1 
ATOM   3505  C  C     . SER G  4  172  ? 85.957  94.296  -30.549 1.00 67.46  ? 172  SER A C     1 
ATOM   3506  O  O     . SER G  4  172  ? 84.849  94.572  -31.023 1.00 67.08  ? 172  SER A O     1 
ATOM   3507  C  CB    . SER G  4  172  ? 85.489  92.558  -28.841 1.00 66.36  ? 172  SER A CB    1 
ATOM   3508  O  OG    . SER G  4  172  ? 86.243  91.557  -29.507 1.00 66.21  ? 172  SER A OG    1 
ATOM   3509  N  N     . PRO G  4  173  ? 87.093  94.315  -31.289 1.00 68.37  ? 173  PRO A N     1 
ATOM   3510  C  CA    . PRO G  4  173  ? 87.035  94.630  -32.726 1.00 68.01  ? 173  PRO A CA    1 
ATOM   3511  C  C     . PRO G  4  173  ? 86.573  93.412  -33.555 1.00 67.71  ? 173  PRO A C     1 
ATOM   3512  O  O     . PRO G  4  173  ? 86.532  93.447  -34.791 1.00 66.68  ? 173  PRO A O     1 
ATOM   3513  C  CB    . PRO G  4  173  ? 88.467  95.076  -33.049 1.00 68.24  ? 173  PRO A CB    1 
ATOM   3514  C  CG    . PRO G  4  173  ? 88.957  95.636  -31.733 1.00 68.41  ? 173  PRO A CG    1 
ATOM   3515  C  CD    . PRO G  4  173  ? 88.456  94.578  -30.774 1.00 68.26  ? 173  PRO A CD    1 
ATOM   3516  N  N     . VAL G  4  174  ? 86.219  92.346  -32.843 1.00 67.60  ? 174  VAL A N     1 
ATOM   3517  C  CA    . VAL G  4  174  ? 85.793  91.081  -33.448 1.00 67.26  ? 174  VAL A CA    1 
ATOM   3518  C  C     . VAL G  4  174  ? 84.335  90.773  -33.125 1.00 66.76  ? 174  VAL A C     1 
ATOM   3519  O  O     . VAL G  4  174  ? 83.969  90.734  -31.946 1.00 67.51  ? 174  VAL A O     1 
ATOM   3520  C  CB    . VAL G  4  174  ? 86.644  89.901  -32.906 1.00 67.06  ? 174  VAL A CB    1 
ATOM   3521  C  CG1   . VAL G  4  174  ? 87.131  89.029  -34.030 1.00 67.87  ? 174  VAL A CG1   1 
ATOM   3522  C  CG2   . VAL G  4  174  ? 87.829  90.453  -32.128 1.00 66.43  ? 174  VAL A CG2   1 
ATOM   3523  N  N     . ARG G  4  175  ? 83.498  90.552  -34.142 1.00 66.28  ? 175  ARG A N     1 
ATOM   3524  C  CA    . ARG G  4  175  ? 82.115  90.214  -33.821 1.00 66.85  ? 175  ARG A CA    1 
ATOM   3525  C  C     . ARG G  4  175  ? 81.934  88.708  -33.691 1.00 67.02  ? 175  ARG A C     1 
ATOM   3526  O  O     . ARG G  4  175  ? 81.271  88.252  -32.758 1.00 66.32  ? 175  ARG A O     1 
ATOM   3527  C  CB    . ARG G  4  175  ? 81.107  90.725  -34.860 1.00 67.14  ? 175  ARG A CB    1 
ATOM   3528  C  CG    . ARG G  4  175  ? 79.698  90.756  -34.245 1.00 70.00  ? 175  ARG A CG    1 
ATOM   3529  C  CD    . ARG G  4  175  ? 78.540  91.159  -35.179 1.00 72.07  ? 175  ARG A CD    1 
ATOM   3530  N  NE    . ARG G  4  175  ? 77.794  90.013  -35.724 1.00 73.41  ? 175  ARG A NE    1 
ATOM   3531  C  CZ    . ARG G  4  175  ? 76.785  89.375  -35.116 1.00 73.56  ? 175  ARG A CZ    1 
ATOM   3532  N  NH1   . ARG G  4  175  ? 76.348  89.750  -33.914 1.00 73.47  ? 175  ARG A NH1   1 
ATOM   3533  N  NH2   . ARG G  4  175  ? 76.203  88.341  -35.714 1.00 73.24  ? 175  ARG A NH2   1 
ATOM   3534  N  N     . ARG G  4  176  ? 82.504  87.921  -34.605 1.00 67.00  ? 176  ARG A N     1 
ATOM   3535  C  CA    . ARG G  4  176  ? 82.344  86.467  -34.483 1.00 67.05  ? 176  ARG A CA    1 
ATOM   3536  C  C     . ARG G  4  176  ? 83.517  85.692  -35.083 1.00 68.87  ? 176  ARG A C     1 
ATOM   3537  O  O     . ARG G  4  176  ? 84.151  86.096  -36.068 1.00 69.74  ? 176  ARG A O     1 
ATOM   3538  C  CB    . ARG G  4  176  ? 81.050  85.975  -35.156 1.00 65.01  ? 176  ARG A CB    1 
ATOM   3539  C  CG    . ARG G  4  176  ? 80.191  87.008  -35.860 1.00 60.51  ? 176  ARG A CG    1 
ATOM   3540  C  CD    . ARG G  4  176  ? 78.725  86.749  -35.535 1.00 55.82  ? 176  ARG A CD    1 
ATOM   3541  N  NE    . ARG G  4  176  ? 77.960  86.242  -36.667 1.00 50.40  ? 176  ARG A NE    1 
ATOM   3542  C  CZ    . ARG G  4  176  ? 78.094  85.027  -37.192 1.00 48.91  ? 176  ARG A CZ    1 
ATOM   3543  N  NH1   . ARG G  4  176  ? 78.969  84.166  -36.693 1.00 46.20  ? 176  ARG A NH1   1 
ATOM   3544  N  NH2   . ARG G  4  176  ? 77.345  84.674  -38.225 1.00 47.01  ? 176  ARG A NH2   1 
ATOM   3545  N  N     . VAL G  4  177  ? 83.768  84.553  -34.445 1.00 68.71  ? 177  VAL A N     1 
ATOM   3546  C  CA    . VAL G  4  177  ? 84.805  83.611  -34.817 1.00 68.96  ? 177  VAL A CA    1 
ATOM   3547  C  C     . VAL G  4  177  ? 84.180  82.264  -35.162 1.00 69.40  ? 177  VAL A C     1 
ATOM   3548  O  O     . VAL G  4  177  ? 83.122  81.927  -34.628 1.00 69.47  ? 177  VAL A O     1 
ATOM   3549  C  CB    . VAL G  4  177  ? 85.802  83.441  -33.640 1.00 68.14  ? 177  VAL A CB    1 
ATOM   3550  C  CG1   . VAL G  4  177  ? 86.772  82.306  -33.901 1.00 68.04  ? 177  VAL A CG1   1 
ATOM   3551  C  CG2   . VAL G  4  177  ? 86.566  84.725  -33.449 1.00 68.19  ? 177  VAL A CG2   1 
ATOM   3552  N  N     . ALA G  4  178  ? 84.816  81.505  -36.048 1.00 69.38  ? 178  ALA A N     1 
ATOM   3553  C  CA    . ALA G  4  178  ? 84.304  80.199  -36.437 1.00 68.98  ? 178  ALA A CA    1 
ATOM   3554  C  C     . ALA G  4  178  ? 85.423  79.315  -36.951 1.00 69.29  ? 178  ALA A C     1 
ATOM   3555  O  O     . ALA G  4  178  ? 86.250  79.771  -37.739 1.00 69.56  ? 178  ALA A O     1 
ATOM   3556  C  CB    . ALA G  4  178  ? 83.232  80.365  -37.518 1.00 68.28  ? 178  ALA A CB    1 
ATOM   3557  N  N     . PHE G  4  179  ? 85.468  78.061  -36.503 1.00 67.86  ? 179  PHE A N     1 
ATOM   3558  C  CA    . PHE G  4  179  ? 86.500  77.151  -36.989 1.00 66.43  ? 179  PHE A CA    1 
ATOM   3559  C  C     . PHE G  4  179  ? 85.926  75.795  -37.344 1.00 66.41  ? 179  PHE A C     1 
ATOM   3560  O  O     . PHE G  4  179  ? 84.967  75.303  -36.738 1.00 66.03  ? 179  PHE A O     1 
ATOM   3561  C  CB    . PHE G  4  179  ? 87.649  76.994  -35.958 1.00 64.71  ? 179  PHE A CB    1 
ATOM   3562  C  CG    . PHE G  4  179  ? 87.386  76.010  -34.829 1.00 63.82  ? 179  PHE A CG    1 
ATOM   3563  C  CD1   . PHE G  4  179  ? 87.481  74.610  -35.033 1.00 63.45  ? 179  PHE A CD1   1 
ATOM   3564  C  CD2   . PHE G  4  179  ? 87.066  76.479  -33.538 1.00 63.66  ? 179  PHE A CD2   1 
ATOM   3565  C  CE1   . PHE G  4  179  ? 87.261  73.694  -33.961 1.00 62.66  ? 179  PHE A CE1   1 
ATOM   3566  C  CE2   . PHE G  4  179  ? 86.841  75.574  -32.446 1.00 61.93  ? 179  PHE A CE2   1 
ATOM   3567  C  CZ    . PHE G  4  179  ? 86.940  74.182  -32.663 1.00 61.37  ? 179  PHE A CZ    1 
ATOM   3568  N  N     . GLN G  4  180  ? 86.545  75.206  -38.351 1.00 66.35  ? 180  GLN A N     1 
ATOM   3569  C  CA    . GLN G  4  180  ? 86.153  73.902  -38.843 1.00 66.90  ? 180  GLN A CA    1 
ATOM   3570  C  C     . GLN G  4  180  ? 87.358  72.976  -38.937 1.00 66.36  ? 180  GLN A C     1 
ATOM   3571  O  O     . GLN G  4  180  ? 88.443  73.389  -39.356 1.00 66.76  ? 180  GLN A O     1 
ATOM   3572  C  CB    . GLN G  4  180  ? 85.501  74.043  -40.217 1.00 66.08  ? 180  GLN A CB    1 
ATOM   3573  C  CG    . GLN G  4  180  ? 84.130  74.677  -40.191 1.00 64.35  ? 180  GLN A CG    1 
ATOM   3574  C  CD    . GLN G  4  180  ? 83.101  73.833  -40.902 1.00 64.04  ? 180  GLN A CD    1 
ATOM   3575  O  OE1   . GLN G  4  180  ? 81.916  74.130  -40.853 1.00 64.39  ? 180  GLN A OE1   1 
ATOM   3576  N  NE2   . GLN G  4  180  ? 83.545  72.774  -41.563 1.00 63.53  ? 180  GLN A NE2   1 
ATOM   3577  N  N     . VAL G  4  181  ? 87.165  71.728  -38.532 1.00 66.65  ? 181  VAL A N     1 
ATOM   3578  C  CA    . VAL G  4  181  ? 88.224  70.738  -38.587 1.00 65.76  ? 181  VAL A CA    1 
ATOM   3579  C  C     . VAL G  4  181  ? 87.833  69.601  -39.519 1.00 66.07  ? 181  VAL A C     1 
ATOM   3580  O  O     . VAL G  4  181  ? 87.246  68.603  -39.093 1.00 66.12  ? 181  VAL A O     1 
ATOM   3581  C  CB    . VAL G  4  181  ? 88.524  70.154  -37.182 1.00 64.96  ? 181  VAL A CB    1 
ATOM   3582  C  CG1   . VAL G  4  181  ? 89.924  69.577  -37.180 1.00 64.37  ? 181  VAL A CG1   1 
ATOM   3583  C  CG2   . VAL G  4  181  ? 88.363  71.229  -36.105 1.00 63.62  ? 181  VAL A CG2   1 
ATOM   3584  N  N     . GLU G  4  182  ? 88.162  69.767  -40.795 1.00 65.68  ? 182  GLU A N     1 
ATOM   3585  C  CA    . GLU G  4  182  ? 87.838  68.793  -41.827 1.00 65.30  ? 182  GLU A CA    1 
ATOM   3586  C  C     . GLU G  4  182  ? 88.994  67.832  -42.062 1.00 67.19  ? 182  GLU A C     1 
ATOM   3587  O  O     . GLU G  4  182  ? 90.159  68.236  -42.047 1.00 67.38  ? 182  GLU A O     1 
ATOM   3588  C  CB    . GLU G  4  182  ? 87.492  69.522  -43.126 1.00 63.57  ? 182  GLU A CB    1 
ATOM   3589  C  CG    . GLU G  4  182  ? 88.027  70.958  -43.237 1.00 60.69  ? 182  GLU A CG    1 
ATOM   3590  C  CD    . GLU G  4  182  ? 87.303  71.960  -42.337 1.00 59.03  ? 182  GLU A CD    1 
ATOM   3591  O  OE1   . GLU G  4  182  ? 87.573  73.172  -42.492 1.00 58.58  ? 182  GLU A OE1   1 
ATOM   3592  O  OE2   . GLU G  4  182  ? 86.479  71.544  -41.486 1.00 55.32  ? 182  GLU A OE2   1 
ATOM   3593  N  N     . ASP G  4  183  ? 88.674  66.557  -42.275 1.00 68.78  ? 183  ASP A N     1 
ATOM   3594  C  CA    . ASP G  4  183  ? 89.712  65.555  -42.506 1.00 70.39  ? 183  ASP A CA    1 
ATOM   3595  C  C     . ASP G  4  183  ? 90.525  65.901  -43.734 1.00 71.30  ? 183  ASP A C     1 
ATOM   3596  O  O     . ASP G  4  183  ? 89.972  66.363  -44.729 1.00 72.53  ? 183  ASP A O     1 
ATOM   3597  C  CB    . ASP G  4  183  ? 89.110  64.172  -42.737 1.00 68.78  ? 183  ASP A CB    1 
ATOM   3598  C  CG    . ASP G  4  183  ? 87.817  63.968  -42.027 1.00 69.06  ? 183  ASP A CG    1 
ATOM   3599  O  OD1   . ASP G  4  183  ? 87.850  63.675  -40.813 1.00 68.35  ? 183  ASP A OD1   1 
ATOM   3600  O  OD2   . ASP G  4  183  ? 86.766  64.104  -42.693 1.00 69.43  ? 183  ASP A OD2   1 
ATOM   3601  N  N     . THR G  4  184  ? 91.832  65.696  -43.663 1.00 73.67  ? 184  THR A N     1 
ATOM   3602  C  CA    . THR G  4  184  ? 92.690  65.935  -44.817 1.00 76.06  ? 184  THR A CA    1 
ATOM   3603  C  C     . THR G  4  184  ? 93.522  64.695  -45.109 1.00 76.76  ? 184  THR A C     1 
ATOM   3604  O  O     . THR G  4  184  ? 93.803  63.914  -44.198 1.00 76.42  ? 184  THR A O     1 
ATOM   3605  C  CB    . THR G  4  184  ? 93.633  67.175  -44.607 1.00 77.06  ? 184  THR A CB    1 
ATOM   3606  O  OG1   . THR G  4  184  ? 94.123  67.622  -45.886 1.00 77.13  ? 184  THR A OG1   1 
ATOM   3607  C  CG2   . THR G  4  184  ? 94.838  66.822  -43.710 1.00 78.13  ? 184  THR A CG2   1 
ATOM   3608  N  N     . ARG G  4  185  ? 93.921  64.505  -46.360 1.00 77.92  ? 185  ARG A N     1 
ATOM   3609  C  CA    . ARG G  4  185  ? 94.644  63.295  -46.695 1.00 78.41  ? 185  ARG A CA    1 
ATOM   3610  C  C     . ARG G  4  185  ? 96.123  63.534  -46.968 1.00 79.27  ? 185  ARG A C     1 
ATOM   3611  O  O     . ARG G  4  185  ? 96.517  64.312  -47.831 1.00 79.20  ? 185  ARG A O     1 
ATOM   3612  C  CB    . ARG G  4  185  ? 93.994  62.618  -47.914 1.00 78.19  ? 185  ARG A CB    1 
ATOM   3613  C  CG    . ARG G  4  185  ? 94.014  63.399  -49.191 1.00 77.91  ? 185  ARG A CG    1 
ATOM   3614  C  CD    . ARG G  4  185  ? 92.902  62.957  -50.112 1.00 77.27  ? 185  ARG A CD    1 
ATOM   3615  N  NE    . ARG G  4  185  ? 93.402  62.657  -51.447 1.00 77.41  ? 185  ARG A NE    1 
ATOM   3616  C  CZ    . ARG G  4  185  ? 94.092  61.564  -51.753 1.00 77.18  ? 185  ARG A CZ    1 
ATOM   3617  N  NH1   . ARG G  4  185  ? 94.360  60.662  -50.817 1.00 77.16  ? 185  ARG A NH1   1 
ATOM   3618  N  NH2   . ARG G  4  185  ? 94.518  61.373  -52.993 1.00 76.43  ? 185  ARG A NH2   1 
ATOM   3619  N  N     . LEU G  4  186  ? 96.926  62.837  -46.182 1.00 80.01  ? 186  LEU A N     1 
ATOM   3620  C  CA    . LEU G  4  186  ? 98.358  62.773  -46.357 1.00 80.74  ? 186  LEU A CA    1 
ATOM   3621  C  C     . LEU G  4  186  ? 98.710  61.361  -46.726 1.00 81.38  ? 186  LEU A C     1 
ATOM   3622  O  O     . LEU G  4  186  ? 98.500  60.478  -45.918 1.00 82.21  ? 186  LEU A O     1 
ATOM   3623  C  CB    . LEU G  4  186  ? 99.099  63.158  -45.069 1.00 79.72  ? 186  LEU A CB    1 
ATOM   3624  C  CG    . LEU G  4  186  ? 100.549 62.704  -44.846 1.00 79.64  ? 186  LEU A CG    1 
ATOM   3625  C  CD1   . LEU G  4  186  ? 101.500 63.463  -45.769 1.00 78.83  ? 186  LEU A CD1   1 
ATOM   3626  C  CD2   . LEU G  4  186  ? 100.916 62.929  -43.381 1.00 78.93  ? 186  LEU A CD2   1 
ATOM   3627  N  N     . GLY G  4  187  ? 99.197  61.159  -47.940 1.00 82.97  ? 187  GLY A N     1 
ATOM   3628  C  CA    . GLY G  4  187  ? 99.555  59.847  -48.462 1.00 85.46  ? 187  GLY A CA    1 
ATOM   3629  C  C     . GLY G  4  187  ? 99.367  58.609  -47.572 1.00 86.98  ? 187  GLY A C     1 
ATOM   3630  O  O     . GLY G  4  187  ? 98.523  57.759  -47.875 1.00 87.53  ? 187  GLY A O     1 
ATOM   3631  N  N     . GLN G  4  188  ? 100.145 58.523  -46.484 1.00 88.48  ? 188  GLN A N     1 
ATOM   3632  C  CA    . GLN G  4  188  ? 100.219 57.375  -45.544 1.00 88.91  ? 188  GLN A CA    1 
ATOM   3633  C  C     . GLN G  4  188  ? 98.952  57.174  -44.658 1.00 88.96  ? 188  GLN A C     1 
ATOM   3634  O  O     . GLN G  4  188  ? 98.269  56.149  -44.801 1.00 89.34  ? 188  GLN A O     1 
ATOM   3635  C  CB    . GLN G  4  188  ? 101.451 57.541  -44.637 1.00 89.68  ? 188  GLN A CB    1 
ATOM   3636  C  CG    . GLN G  4  188  ? 101.592 58.951  -44.017 1.00 89.70  ? 188  GLN A CG    1 
ATOM   3637  C  CD    . GLN G  4  188  ? 102.244 58.958  -42.638 1.00 89.87  ? 188  GLN A CD    1 
ATOM   3638  O  OE1   . GLN G  4  188  ? 101.625 58.569  -41.646 1.00 88.94  ? 188  GLN A OE1   1 
ATOM   3639  N  NE2   . GLN G  4  188  ? 103.498 59.405  -42.573 1.00 90.21  ? 188  GLN A NE2   1 
ATOM   3640  N  N     . ARG G  4  189  ? 98.645  58.098  -43.739 1.00 88.47  ? 189  ARG A N     1 
ATOM   3641  C  CA    . ARG G  4  189  ? 97.492  57.918  -42.826 1.00 87.23  ? 189  ARG A CA    1 
ATOM   3642  C  C     . ARG G  4  189  ? 96.389  58.976  -43.070 1.00 85.99  ? 189  ARG A C     1 
ATOM   3643  O  O     . ARG G  4  189  ? 96.625  60.187  -43.003 1.00 85.51  ? 189  ARG A O     1 
ATOM   3644  C  CB    . ARG G  4  189  ? 97.991  57.971  -41.358 1.00 87.91  ? 189  ARG A CB    1 
ATOM   3645  C  CG    . ARG G  4  189  ? 97.618  56.759  -40.428 1.00 88.49  ? 189  ARG A CG    1 
ATOM   3646  C  CD    . ARG G  4  189  ? 98.244  55.389  -40.801 1.00 89.19  ? 189  ARG A CD    1 
ATOM   3647  N  NE    . ARG G  4  189  ? 97.946  54.310  -39.836 1.00 90.02  ? 189  ARG A NE    1 
ATOM   3648  C  CZ    . ARG G  4  189  ? 96.784  53.655  -39.729 1.00 90.57  ? 189  ARG A CZ    1 
ATOM   3649  N  NH1   . ARG G  4  189  ? 95.760  53.942  -40.525 1.00 91.43  ? 189  ARG A NH1   1 
ATOM   3650  N  NH2   . ARG G  4  189  ? 96.643  52.698  -38.820 1.00 90.66  ? 189  ARG A NH2   1 
ATOM   3651  N  N     . THR G  4  190  ? 95.180  58.479  -43.343 1.00 84.41  ? 190  THR A N     1 
ATOM   3652  C  CA    . THR G  4  190  ? 94.002  59.299  -43.641 1.00 83.74  ? 190  THR A CA    1 
ATOM   3653  C  C     . THR G  4  190  ? 93.531  60.111  -42.423 1.00 83.01  ? 190  THR A C     1 
ATOM   3654  O  O     . THR G  4  190  ? 93.029  61.226  -42.586 1.00 82.96  ? 190  THR A O     1 
ATOM   3655  C  CB    . THR G  4  190  ? 92.818  58.409  -44.132 1.00 84.11  ? 190  THR A CB    1 
ATOM   3656  O  OG1   . THR G  4  190  ? 93.268  57.578  -45.208 1.00 84.58  ? 190  THR A OG1   1 
ATOM   3657  C  CG2   . THR G  4  190  ? 91.657  59.271  -44.648 1.00 83.93  ? 190  THR A CG2   1 
ATOM   3658  N  N     . ASP G  4  191  ? 93.689  59.558  -41.216 1.00 81.91  ? 191  ASP A N     1 
ATOM   3659  C  CA    . ASP G  4  191  ? 93.253  60.219  -39.974 1.00 80.60  ? 191  ASP A CA    1 
ATOM   3660  C  C     . ASP G  4  191  ? 94.055  61.504  -39.680 1.00 79.52  ? 191  ASP A C     1 
ATOM   3661  O  O     . ASP G  4  191  ? 95.083  61.453  -38.991 1.00 79.32  ? 191  ASP A O     1 
ATOM   3662  C  CB    . ASP G  4  191  ? 93.390  59.261  -38.762 1.00 80.63  ? 191  ASP A CB    1 
ATOM   3663  C  CG    . ASP G  4  191  ? 94.227  58.024  -39.052 1.00 80.70  ? 191  ASP A CG    1 
ATOM   3664  O  OD1   . ASP G  4  191  ? 93.624  56.938  -39.253 1.00 80.12  ? 191  ASP A OD1   1 
ATOM   3665  O  OD2   . ASP G  4  191  ? 95.475  58.146  -39.069 1.00 80.32  ? 191  ASP A OD2   1 
ATOM   3666  N  N     . LEU G  4  192  ? 93.591  62.654  -40.180 1.00 76.75  ? 192  LEU A N     1 
ATOM   3667  C  CA    . LEU G  4  192  ? 94.317  63.897  -39.935 1.00 74.37  ? 192  LEU A CA    1 
ATOM   3668  C  C     . LEU G  4  192  ? 93.375  65.097  -39.801 1.00 72.73  ? 192  LEU A C     1 
ATOM   3669  O  O     . LEU G  4  192  ? 92.230  65.065  -40.265 1.00 73.69  ? 192  LEU A O     1 
ATOM   3670  C  CB    . LEU G  4  192  ? 95.332  64.096  -41.068 1.00 73.88  ? 192  LEU A CB    1 
ATOM   3671  C  CG    . LEU G  4  192  ? 96.401  62.967  -41.114 1.00 72.55  ? 192  LEU A CG    1 
ATOM   3672  C  CD1   . LEU G  4  192  ? 97.230  63.063  -42.358 1.00 72.14  ? 192  LEU A CD1   1 
ATOM   3673  C  CD2   . LEU G  4  192  ? 97.299  63.052  -39.887 1.00 72.23  ? 192  LEU A CD2   1 
ATOM   3674  N  N     . ASP G  4  193  ? 93.872  66.155  -39.159 1.00 70.96  ? 193  ASP A N     1 
ATOM   3675  C  CA    . ASP G  4  193  ? 93.073  67.356  -38.928 1.00 68.66  ? 193  ASP A CA    1 
ATOM   3676  C  C     . ASP G  4  193  ? 93.534  68.529  -39.774 1.00 67.14  ? 193  ASP A C     1 
ATOM   3677  O  O     . ASP G  4  193  ? 94.716  68.707  -40.048 1.00 67.33  ? 193  ASP A O     1 
ATOM   3678  C  CB    . ASP G  4  193  ? 93.135  67.745  -37.454 1.00 69.00  ? 193  ASP A CB    1 
ATOM   3679  C  CG    . ASP G  4  193  ? 92.265  66.858  -36.603 1.00 68.95  ? 193  ASP A CG    1 
ATOM   3680  O  OD1   . ASP G  4  193  ? 92.418  65.624  -36.696 1.00 68.51  ? 193  ASP A OD1   1 
ATOM   3681  O  OD2   . ASP G  4  193  ? 91.431  67.379  -35.845 1.00 69.40  ? 193  ASP A OD2   1 
ATOM   3682  N  N     . LYS G  4  194  ? 92.553  69.321  -40.176 1.00 65.93  ? 194  LYS A N     1 
ATOM   3683  C  CA    . LYS G  4  194  ? 92.741  70.523  -40.962 1.00 65.27  ? 194  LYS A CA    1 
ATOM   3684  C  C     . LYS G  4  194  ? 91.929  71.656  -40.358 1.00 65.47  ? 194  LYS A C     1 
ATOM   3685  O  O     . LYS G  4  194  ? 90.704  71.641  -40.440 1.00 66.68  ? 194  LYS A O     1 
ATOM   3686  C  CB    . LYS G  4  194  ? 92.307  70.240  -42.405 1.00 64.54  ? 194  LYS A CB    1 
ATOM   3687  C  CG    . LYS G  4  194  ? 91.856  71.426  -43.224 1.00 65.38  ? 194  LYS A CG    1 
ATOM   3688  C  CD    . LYS G  4  194  ? 92.195  71.226  -44.683 1.00 66.08  ? 194  LYS A CD    1 
ATOM   3689  C  CE    . LYS G  4  194  ? 91.875  72.464  -45.497 1.00 65.58  ? 194  LYS A CE    1 
ATOM   3690  N  NZ    . LYS G  4  194  ? 92.371  72.326  -46.900 1.00 66.98  ? 194  LYS A NZ    1 
ATOM   3691  N  N     . LEU G  4  195  ? 92.588  72.635  -39.741 1.00 64.76  ? 195  LEU A N     1 
ATOM   3692  C  CA    . LEU G  4  195  ? 91.847  73.728  -39.101 1.00 62.87  ? 195  LEU A CA    1 
ATOM   3693  C  C     . LEU G  4  195  ? 91.824  74.987  -39.942 1.00 61.04  ? 195  LEU A C     1 
ATOM   3694  O  O     . LEU G  4  195  ? 92.845  75.489  -40.390 1.00 61.22  ? 195  LEU A O     1 
ATOM   3695  C  CB    . LEU G  4  195  ? 92.438  74.097  -37.731 1.00 64.83  ? 195  LEU A CB    1 
ATOM   3696  C  CG    . LEU G  4  195  ? 91.892  75.424  -37.136 1.00 66.25  ? 195  LEU A CG    1 
ATOM   3697  C  CD1   . LEU G  4  195  ? 90.392  75.299  -36.875 1.00 66.61  ? 195  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU G  4  195  ? 92.627  75.758  -35.846 1.00 66.18  ? 195  LEU A CD2   1 
ATOM   3699  N  N     . THR G  4  196  ? 90.614  75.485  -40.123 1.00 59.62  ? 196  THR A N     1 
ATOM   3700  C  CA    . THR G  4  196  ? 90.359  76.714  -40.838 1.00 58.05  ? 196  THR A CA    1 
ATOM   3701  C  C     . THR G  4  196  ? 89.432  77.589  -40.014 1.00 57.82  ? 196  THR A C     1 
ATOM   3702  O  O     . THR G  4  196  ? 88.274  77.251  -39.831 1.00 59.58  ? 196  THR A O     1 
ATOM   3703  C  CB    . THR G  4  196  ? 89.714  76.431  -42.225 1.00 56.50  ? 196  THR A CB    1 
ATOM   3704  O  OG1   . THR G  4  196  ? 88.382  75.944  -42.056 1.00 53.54  ? 196  THR A OG1   1 
ATOM   3705  C  CG2   . THR G  4  196  ? 90.494  75.360  -42.963 1.00 57.50  ? 196  THR A CG2   1 
ATOM   3706  N  N     . LEU G  4  197  ? 89.935  78.701  -39.494 1.00 57.89  ? 197  LEU A N     1 
ATOM   3707  C  CA    . LEU G  4  197  ? 89.108  79.562  -38.663 1.00 57.18  ? 197  LEU A CA    1 
ATOM   3708  C  C     . LEU G  4  197  ? 88.803  80.870  -39.351 1.00 58.45  ? 197  LEU A C     1 
ATOM   3709  O  O     . LEU G  4  197  ? 89.704  81.584  -39.764 1.00 59.29  ? 197  LEU A O     1 
ATOM   3710  C  CB    . LEU G  4  197  ? 89.808  79.841  -37.328 1.00 55.59  ? 197  LEU A CB    1 
ATOM   3711  C  CG    . LEU G  4  197  ? 91.135  80.639  -37.280 1.00 53.72  ? 197  LEU A CG    1 
ATOM   3712  C  CD1   . LEU G  4  197  ? 91.605  80.727  -35.840 1.00 51.36  ? 197  LEU A CD1   1 
ATOM   3713  C  CD2   . LEU G  4  197  ? 92.219  79.974  -38.113 1.00 51.80  ? 197  LEU A CD2   1 
ATOM   3714  N  N     . ARG G  4  198  ? 87.517  81.173  -39.468 1.00 58.49  ? 198  ARG A N     1 
ATOM   3715  C  CA    . ARG G  4  198  ? 87.039  82.402  -40.095 1.00 60.03  ? 198  ARG A CA    1 
ATOM   3716  C  C     . ARG G  4  198  ? 86.773  83.469  -39.053 1.00 60.62  ? 198  ARG A C     1 
ATOM   3717  O  O     . ARG G  4  198  ? 85.977  83.269  -38.135 1.00 60.72  ? 198  ARG A O     1 
ATOM   3718  C  CB    . ARG G  4  198  ? 85.752  82.135  -40.873 1.00 60.62  ? 198  ARG A CB    1 
ATOM   3719  C  CG    . ARG G  4  198  ? 84.901  81.025  -40.274 1.00 62.99  ? 198  ARG A CG    1 
ATOM   3720  C  CD    . ARG G  4  198  ? 83.579  80.815  -41.017 1.00 65.23  ? 198  ARG A CD    1 
ATOM   3721  N  NE    . ARG G  4  198  ? 83.683  79.955  -42.200 1.00 67.31  ? 198  ARG A NE    1 
ATOM   3722  C  CZ    . ARG G  4  198  ? 82.800  79.956  -43.197 1.00 68.55  ? 198  ARG A CZ    1 
ATOM   3723  N  NH1   . ARG G  4  198  ? 81.750  80.775  -43.158 1.00 69.39  ? 198  ARG A NH1   1 
ATOM   3724  N  NH2   . ARG G  4  198  ? 82.958  79.135  -44.231 1.00 69.07  ? 198  ARG A NH2   1 
ATOM   3725  N  N     . ILE G  4  199  ? 87.435  84.609  -39.203 1.00 59.75  ? 199  ILE A N     1 
ATOM   3726  C  CA    . ILE G  4  199  ? 87.281  85.676  -38.244 1.00 59.58  ? 199  ILE A CA    1 
ATOM   3727  C  C     . ILE G  4  199  ? 86.688  86.931  -38.886 1.00 60.91  ? 199  ILE A C     1 
ATOM   3728  O  O     . ILE G  4  199  ? 87.111  87.378  -39.955 1.00 61.99  ? 199  ILE A O     1 
ATOM   3729  C  CB    . ILE G  4  199  ? 88.644  86.024  -37.616 1.00 56.96  ? 199  ILE A CB    1 
ATOM   3730  C  CG1   . ILE G  4  199  ? 89.321  84.758  -37.080 1.00 54.77  ? 199  ILE A CG1   1 
ATOM   3731  C  CG2   . ILE G  4  199  ? 88.447  86.994  -36.477 1.00 57.82  ? 199  ILE A CG2   1 
ATOM   3732  C  CD1   . ILE G  4  199  ? 90.068  83.973  -38.097 1.00 52.46  ? 199  ILE A CD1   1 
ATOM   3733  N  N     . TRP G  4  200  ? 85.692  87.490  -38.215 1.00 63.14  ? 200  TRP A N     1 
ATOM   3734  C  CA    . TRP G  4  200  ? 85.065  88.717  -38.659 1.00 65.04  ? 200  TRP A CA    1 
ATOM   3735  C  C     . TRP G  4  200  ? 85.473  89.870  -37.752 1.00 67.84  ? 200  TRP A C     1 
ATOM   3736  O  O     . TRP G  4  200  ? 85.500  89.709  -36.535 1.00 67.83  ? 200  TRP A O     1 
ATOM   3737  C  CB    . TRP G  4  200  ? 83.547  88.534  -38.664 1.00 66.41  ? 200  TRP A CB    1 
ATOM   3738  C  CG    . TRP G  4  200  ? 83.026  88.022  -39.994 1.00 67.43  ? 200  TRP A CG    1 
ATOM   3739  C  CD1   . TRP G  4  200  ? 83.008  88.699  -41.187 1.00 67.48  ? 200  TRP A CD1   1 
ATOM   3740  C  CD2   . TRP G  4  200  ? 82.416  86.751  -40.250 1.00 66.62  ? 200  TRP A CD2   1 
ATOM   3741  N  NE1   . TRP G  4  200  ? 82.419  87.935  -42.167 1.00 67.14  ? 200  TRP A NE1   1 
ATOM   3742  C  CE2   . TRP G  4  200  ? 82.042  86.735  -41.629 1.00 66.42  ? 200  TRP A CE2   1 
ATOM   3743  C  CE3   . TRP G  4  200  ? 82.139  85.621  -39.454 1.00 66.34  ? 200  TRP A CE3   1 
ATOM   3744  C  CZ2   . TRP G  4  200  ? 81.398  85.629  -42.237 1.00 65.45  ? 200  TRP A CZ2   1 
ATOM   3745  C  CZ3   . TRP G  4  200  ? 81.493  84.507  -40.058 1.00 67.24  ? 200  TRP A CZ3   1 
ATOM   3746  C  CH2   . TRP G  4  200  ? 81.131  84.528  -41.444 1.00 66.38  ? 200  TRP A CH2   1 
ATOM   3747  N  N     . THR G  4  201  ? 85.804  91.021  -38.334 1.00 69.96  ? 201  THR A N     1 
ATOM   3748  C  CA    . THR G  4  201  ? 86.250  92.199  -37.564 1.00 73.21  ? 201  THR A CA    1 
ATOM   3749  C  C     . THR G  4  201  ? 85.445  93.465  -37.953 1.00 73.76  ? 201  THR A C     1 
ATOM   3750  O  O     . THR G  4  201  ? 85.152  93.670  -39.135 1.00 74.58  ? 201  THR A O     1 
ATOM   3751  C  CB    . THR G  4  201  ? 87.786  92.469  -37.807 1.00 73.34  ? 201  THR A CB    1 
ATOM   3752  O  OG1   . THR G  4  201  ? 88.267  91.611  -38.853 1.00 74.37  ? 201  THR A OG1   1 
ATOM   3753  C  CG2   . THR G  4  201  ? 88.606  92.200  -36.547 1.00 73.09  ? 201  THR A CG2   1 
ATOM   3754  N  N     . ASP G  4  202  ? 85.096  94.307  -36.972 1.00 74.47  ? 202  ASP A N     1 
ATOM   3755  C  CA    . ASP G  4  202  ? 84.308  95.525  -37.232 1.00 73.96  ? 202  ASP A CA    1 
ATOM   3756  C  C     . ASP G  4  202  ? 85.085  96.552  -38.080 1.00 74.01  ? 202  ASP A C     1 
ATOM   3757  O  O     . ASP G  4  202  ? 84.524  97.577  -38.499 1.00 73.50  ? 202  ASP A O     1 
ATOM   3758  C  CB    . ASP G  4  202  ? 83.858  96.160  -35.900 1.00 74.71  ? 202  ASP A CB    1 
ATOM   3759  C  CG    . ASP G  4  202  ? 84.985  96.289  -34.886 1.00 75.14  ? 202  ASP A CG    1 
ATOM   3760  O  OD1   . ASP G  4  202  ? 84.699  96.644  -33.717 1.00 74.31  ? 202  ASP A OD1   1 
ATOM   3761  O  OD2   . ASP G  4  202  ? 86.153  96.042  -35.257 1.00 76.24  ? 202  ASP A OD2   1 
ATOM   3762  N  N     . GLY G  4  203  ? 86.364  96.280  -38.334 1.00 73.80  ? 203  GLY A N     1 
ATOM   3763  C  CA    . GLY G  4  203  ? 87.152  97.184  -39.152 1.00 73.39  ? 203  GLY A CA    1 
ATOM   3764  C  C     . GLY G  4  203  ? 88.304  97.816  -38.406 1.00 72.72  ? 203  GLY A C     1 
ATOM   3765  O  O     . GLY G  4  203  ? 89.347  98.088  -39.003 1.00 73.01  ? 203  GLY A O     1 
ATOM   3766  N  N     . SER G  4  204  ? 88.111  98.058  -37.111 1.00 71.95  ? 204  SER A N     1 
ATOM   3767  C  CA    . SER G  4  204  ? 89.155  98.646  -36.281 1.00 71.92  ? 204  SER A CA    1 
ATOM   3768  C  C     . SER G  4  204  ? 90.485  97.968  -36.571 1.00 71.83  ? 204  SER A C     1 
ATOM   3769  O  O     . SER G  4  204  ? 91.452  98.615  -36.957 1.00 72.10  ? 204  SER A O     1 
ATOM   3770  C  CB    . SER G  4  204  ? 88.781  98.488  -34.802 1.00 71.43  ? 204  SER A CB    1 
ATOM   3771  O  OG    . SER G  4  204  ? 89.523  99.352  -33.967 1.00 70.16  ? 204  SER A OG    1 
ATOM   3772  N  N     . VAL G  4  205  ? 90.509  96.650  -36.396 1.00 71.66  ? 205  VAL A N     1 
ATOM   3773  C  CA    . VAL G  4  205  ? 91.684  95.841  -36.708 1.00 71.66  ? 205  VAL A CA    1 
ATOM   3774  C  C     . VAL G  4  205  ? 91.334  94.816  -37.778 1.00 70.86  ? 205  VAL A C     1 
ATOM   3775  O  O     . VAL G  4  205  ? 90.153  94.647  -38.098 1.00 70.50  ? 205  VAL A O     1 
ATOM   3776  C  CB    . VAL G  4  205  ? 92.232  95.096  -35.453 1.00 72.41  ? 205  VAL A CB    1 
ATOM   3777  C  CG1   . VAL G  4  205  ? 92.603  96.121  -34.374 1.00 72.28  ? 205  VAL A CG1   1 
ATOM   3778  C  CG2   . VAL G  4  205  ? 91.197  94.073  -34.954 1.00 72.75  ? 205  VAL A CG2   1 
ATOM   3779  N  N     . THR G  4  206  ? 92.320  94.129  -38.336 1.00 71.08  ? 206  THR A N     1 
ATOM   3780  C  CA    . THR G  4  206  ? 91.996  93.172  -39.380 1.00 71.63  ? 206  THR A CA    1 
ATOM   3781  C  C     . THR G  4  206  ? 91.958  91.752  -38.832 1.00 71.72  ? 206  THR A C     1 
ATOM   3782  O  O     . THR G  4  206  ? 92.437  91.508  -37.724 1.00 72.86  ? 206  THR A O     1 
ATOM   3783  C  CB    . THR G  4  206  ? 93.022  93.266  -40.549 1.00 72.08  ? 206  THR A CB    1 
ATOM   3784  O  OG1   . THR G  4  206  ? 92.329  93.064  -41.787 1.00 72.69  ? 206  THR A OG1   1 
ATOM   3785  C  CG2   . THR G  4  206  ? 94.115  92.198  -40.431 1.00 72.55  ? 206  THR A CG2   1 
ATOM   3786  N  N     . PRO G  4  207  ? 91.380  90.801  -39.598 1.00 71.18  ? 207  PRO A N     1 
ATOM   3787  C  CA    . PRO G  4  207  ? 91.314  89.412  -39.135 1.00 71.52  ? 207  PRO A CA    1 
ATOM   3788  C  C     . PRO G  4  207  ? 92.707  88.845  -38.818 1.00 71.68  ? 207  PRO A C     1 
ATOM   3789  O  O     . PRO G  4  207  ? 92.896  88.164  -37.813 1.00 71.24  ? 207  PRO A O     1 
ATOM   3790  C  CB    . PRO G  4  207  ? 90.623  88.702  -40.290 1.00 70.91  ? 207  PRO A CB    1 
ATOM   3791  C  CG    . PRO G  4  207  ? 89.697  89.753  -40.821 1.00 69.81  ? 207  PRO A CG    1 
ATOM   3792  C  CD    . PRO G  4  207  ? 90.576  90.966  -40.832 1.00 70.14  ? 207  PRO A CD    1 
ATOM   3793  N  N     . LEU G  4  208  ? 93.675  89.135  -39.686 1.00 72.84  ? 208  LEU A N     1 
ATOM   3794  C  CA    . LEU G  4  208  ? 95.050  88.662  -39.491 1.00 74.57  ? 208  LEU A CA    1 
ATOM   3795  C  C     . LEU G  4  208  ? 95.681  89.284  -38.239 1.00 74.71  ? 208  LEU A C     1 
ATOM   3796  O  O     . LEU G  4  208  ? 96.296  88.569  -37.435 1.00 75.31  ? 208  LEU A O     1 
ATOM   3797  C  CB    . LEU G  4  208  ? 95.933  88.998  -40.717 1.00 75.48  ? 208  LEU A CB    1 
ATOM   3798  C  CG    . LEU G  4  208  ? 97.435  88.621  -40.608 1.00 75.55  ? 208  LEU A CG    1 
ATOM   3799  C  CD1   . LEU G  4  208  ? 97.896  88.000  -41.924 1.00 76.33  ? 208  LEU A CD1   1 
ATOM   3800  C  CD2   . LEU G  4  208  ? 98.287  89.858  -40.253 1.00 74.28  ? 208  LEU A CD2   1 
ATOM   3801  N  N     . GLU G  4  209  ? 95.536  90.604  -38.084 1.00 74.18  ? 209  GLU A N     1 
ATOM   3802  C  CA    . GLU G  4  209  ? 96.087  91.313  -36.926 1.00 73.11  ? 209  GLU A CA    1 
ATOM   3803  C  C     . GLU G  4  209  ? 95.580  90.698  -35.614 1.00 73.07  ? 209  GLU A C     1 
ATOM   3804  O  O     . GLU G  4  209  ? 96.349  90.463  -34.671 1.00 73.34  ? 209  GLU A O     1 
ATOM   3805  C  CB    . GLU G  4  209  ? 95.678  92.791  -36.939 1.00 71.88  ? 209  GLU A CB    1 
ATOM   3806  C  CG    . GLU G  4  209  ? 96.095  93.641  -38.114 1.00 69.87  ? 209  GLU A CG    1 
ATOM   3807  C  CD    . GLU G  4  209  ? 95.708  95.094  -37.899 1.00 68.72  ? 209  GLU A CD    1 
ATOM   3808  O  OE1   . GLU G  4  209  ? 94.569  95.331  -37.457 1.00 68.00  ? 209  GLU A OE1   1 
ATOM   3809  O  OE2   . GLU G  4  209  ? 96.528  95.998  -38.167 1.00 67.78  ? 209  GLU A OE2   1 
ATOM   3810  N  N     . ALA G  4  210  ? 94.271  90.450  -35.577 1.00 72.61  ? 210  ALA A N     1 
ATOM   3811  C  CA    . ALA G  4  210  ? 93.587  89.862  -34.420 1.00 71.78  ? 210  ALA A CA    1 
ATOM   3812  C  C     . ALA G  4  210  ? 94.173  88.493  -34.059 1.00 70.91  ? 210  ALA A C     1 
ATOM   3813  O  O     . ALA G  4  210  ? 94.562  88.260  -32.915 1.00 70.66  ? 210  ALA A O     1 
ATOM   3814  C  CB    . ALA G  4  210  ? 92.099  89.719  -34.726 1.00 72.77  ? 210  ALA A CB    1 
ATOM   3815  N  N     . LEU G  4  211  ? 94.220  87.600  -35.046 1.00 69.15  ? 211  LEU A N     1 
ATOM   3816  C  CA    . LEU G  4  211  ? 94.767  86.248  -34.899 1.00 68.15  ? 211  LEU A CA    1 
ATOM   3817  C  C     . LEU G  4  211  ? 96.177  86.272  -34.287 1.00 67.08  ? 211  LEU A C     1 
ATOM   3818  O  O     . LEU G  4  211  ? 96.465  85.514  -33.357 1.00 66.50  ? 211  LEU A O     1 
ATOM   3819  C  CB    . LEU G  4  211  ? 94.818  85.573  -36.275 1.00 67.72  ? 211  LEU A CB    1 
ATOM   3820  C  CG    . LEU G  4  211  ? 95.686  84.341  -36.526 1.00 67.19  ? 211  LEU A CG    1 
ATOM   3821  C  CD1   . LEU G  4  211  ? 94.898  83.091  -36.171 1.00 66.67  ? 211  LEU A CD1   1 
ATOM   3822  C  CD2   . LEU G  4  211  ? 96.113  84.308  -37.988 1.00 67.41  ? 211  LEU A CD2   1 
ATOM   3823  N  N     . ASN G  4  212  ? 97.046  87.135  -34.821 1.00 66.16  ? 212  ASN A N     1 
ATOM   3824  C  CA    . ASN G  4  212  ? 98.415  87.268  -34.331 1.00 65.44  ? 212  ASN A CA    1 
ATOM   3825  C  C     . ASN G  4  212  ? 98.435  87.705  -32.876 1.00 65.41  ? 212  ASN A C     1 
ATOM   3826  O  O     . ASN G  4  212  ? 99.158  87.123  -32.066 1.00 64.48  ? 212  ASN A O     1 
ATOM   3827  C  CB    . ASN G  4  212  ? 99.189  88.280  -35.186 1.00 65.86  ? 212  ASN A CB    1 
ATOM   3828  C  CG    . ASN G  4  212  ? 99.824  87.650  -36.430 1.00 66.52  ? 212  ASN A CG    1 
ATOM   3829  O  OD1   . ASN G  4  212  ? 99.134  87.135  -37.317 1.00 66.50  ? 212  ASN A OD1   1 
ATOM   3830  N  ND2   . ASN G  4  212  ? 101.147 87.694  -36.494 1.00 65.51  ? 212  ASN A ND2   1 
ATOM   3831  N  N     . GLN G  4  213  ? 97.648  88.727  -32.546 1.00 64.61  ? 213  GLN A N     1 
ATOM   3832  C  CA    . GLN G  4  213  ? 97.569  89.185  -31.171 1.00 64.81  ? 213  GLN A CA    1 
ATOM   3833  C  C     . GLN G  4  213  ? 97.043  88.087  -30.264 1.00 66.12  ? 213  GLN A C     1 
ATOM   3834  O  O     . GLN G  4  213  ? 97.460  87.985  -29.112 1.00 66.14  ? 213  GLN A O     1 
ATOM   3835  C  CB    . GLN G  4  213  ? 96.669  90.388  -31.091 1.00 63.62  ? 213  GLN A CB    1 
ATOM   3836  C  CG    . GLN G  4  213  ? 97.406  91.591  -31.523 1.00 61.96  ? 213  GLN A CG    1 
ATOM   3837  C  CD    . GLN G  4  213  ? 96.504  92.535  -32.213 1.00 61.46  ? 213  GLN A CD    1 
ATOM   3838  O  OE1   . GLN G  4  213  ? 95.495  92.952  -31.651 1.00 60.71  ? 213  GLN A OE1   1 
ATOM   3839  N  NE2   . GLN G  4  213  ? 96.843  92.885  -33.448 1.00 60.38  ? 213  GLN A NE2   1 
ATOM   3840  N  N     . ALA G  4  214  ? 96.135  87.268  -30.804 1.00 67.79  ? 214  ALA A N     1 
ATOM   3841  C  CA    . ALA G  4  214  ? 95.518  86.129  -30.097 1.00 69.23  ? 214  ALA A CA    1 
ATOM   3842  C  C     . ALA G  4  214  ? 96.560  85.052  -29.738 1.00 69.23  ? 214  ALA A C     1 
ATOM   3843  O  O     . ALA G  4  214  ? 96.657  84.633  -28.582 1.00 71.25  ? 214  ALA A O     1 
ATOM   3844  C  CB    . ALA G  4  214  ? 94.423  85.503  -30.971 1.00 68.69  ? 214  ALA A CB    1 
ATOM   3845  N  N     . VAL G  4  215  ? 97.322  84.600  -30.733 1.00 68.61  ? 215  VAL A N     1 
ATOM   3846  C  CA    . VAL G  4  215  ? 98.357  83.600  -30.516 1.00 66.73  ? 215  VAL A CA    1 
ATOM   3847  C  C     . VAL G  4  215  ? 99.396  84.093  -29.523 1.00 66.80  ? 215  VAL A C     1 
ATOM   3848  O  O     . VAL G  4  215  ? 99.946  83.291  -28.771 1.00 67.17  ? 215  VAL A O     1 
ATOM   3849  C  CB    . VAL G  4  215  ? 99.035  83.258  -31.842 1.00 66.81  ? 215  VAL A CB    1 
ATOM   3850  C  CG1   . VAL G  4  215  ? 100.279 82.405  -31.632 1.00 66.69  ? 215  VAL A CG1   1 
ATOM   3851  C  CG2   . VAL G  4  215  ? 98.043  82.544  -32.686 1.00 66.33  ? 215  VAL A CG2   1 
ATOM   3852  N  N     . GLU G  4  216  ? 99.656  85.405  -29.523 1.00 66.50  ? 216  GLU A N     1 
ATOM   3853  C  CA    . GLU G  4  216  ? 100.639 86.031  -28.609 1.00 65.93  ? 216  GLU A CA    1 
ATOM   3854  C  C     . GLU G  4  216  ? 100.162 85.990  -27.144 1.00 64.30  ? 216  GLU A C     1 
ATOM   3855  O  O     . GLU G  4  216  ? 100.933 85.633  -26.249 1.00 64.32  ? 216  GLU A O     1 
ATOM   3856  C  CB    . GLU G  4  216  ? 100.908 87.497  -29.018 1.00 66.21  ? 216  GLU A CB    1 
ATOM   3857  C  CG    . GLU G  4  216  ? 102.364 87.771  -29.422 1.00 65.14  ? 216  GLU A CG    1 
ATOM   3858  C  CD    . GLU G  4  216  ? 103.363 87.347  -28.352 1.00 64.34  ? 216  GLU A CD    1 
ATOM   3859  O  OE1   . GLU G  4  216  ? 104.463 86.868  -28.721 1.00 64.85  ? 216  GLU A OE1   1 
ATOM   3860  O  OE2   . GLU G  4  216  ? 103.048 87.496  -27.149 1.00 61.72  ? 216  GLU A OE2   1 
ATOM   3861  N  N     . ILE G  4  217  ? 98.906  86.360  -26.903 1.00 62.60  ? 217  ILE A N     1 
ATOM   3862  C  CA    . ILE G  4  217  ? 98.337  86.323  -25.565 1.00 60.59  ? 217  ILE A CA    1 
ATOM   3863  C  C     . ILE G  4  217  ? 98.354  84.898  -25.017 1.00 60.17  ? 217  ILE A C     1 
ATOM   3864  O  O     . ILE G  4  217  ? 98.446  84.689  -23.816 1.00 58.29  ? 217  ILE A O     1 
ATOM   3865  C  CB    . ILE G  4  217  ? 96.910  86.849  -25.608 1.00 60.89  ? 217  ILE A CB    1 
ATOM   3866  C  CG1   . ILE G  4  217  ? 96.950  88.278  -26.128 1.00 60.94  ? 217  ILE A CG1   1 
ATOM   3867  C  CG2   . ILE G  4  217  ? 96.264  86.761  -24.239 1.00 60.97  ? 217  ILE A CG2   1 
ATOM   3868  C  CD1   . ILE G  4  217  ? 95.716  88.663  -26.879 1.00 62.09  ? 217  ILE A CD1   1 
ATOM   3869  N  N     . LEU G  4  218  ? 98.256  83.923  -25.922 1.00 60.31  ? 218  LEU A N     1 
ATOM   3870  C  CA    . LEU G  4  218  ? 98.322  82.504  -25.565 1.00 61.60  ? 218  LEU A CA    1 
ATOM   3871  C  C     . LEU G  4  218  ? 99.763  82.117  -25.199 1.00 62.67  ? 218  LEU A C     1 
ATOM   3872  O  O     . LEU G  4  218  ? 100.008 81.481  -24.170 1.00 63.97  ? 218  LEU A O     1 
ATOM   3873  C  CB    . LEU G  4  218  ? 97.878  81.621  -26.739 1.00 61.58  ? 218  LEU A CB    1 
ATOM   3874  C  CG    . LEU G  4  218  ? 96.614  80.756  -26.776 1.00 62.10  ? 218  LEU A CG    1 
ATOM   3875  C  CD1   . LEU G  4  218  ? 95.553  81.448  -27.586 1.00 61.75  ? 218  LEU A CD1   1 
ATOM   3876  C  CD2   . LEU G  4  218  ? 96.938  79.417  -27.432 1.00 61.95  ? 218  LEU A CD2   1 
ATOM   3877  N  N     . ARG G  4  219  ? 100.711 82.500  -26.063 1.00 63.27  ? 219  ARG A N     1 
ATOM   3878  C  CA    . ARG G  4  219  ? 102.142 82.241  -25.830 1.00 62.80  ? 219  ARG A CA    1 
ATOM   3879  C  C     . ARG G  4  219  ? 102.595 82.911  -24.528 1.00 62.16  ? 219  ARG A C     1 
ATOM   3880  O  O     . ARG G  4  219  ? 103.242 82.282  -23.683 1.00 62.51  ? 219  ARG A O     1 
ATOM   3881  C  CB    . ARG G  4  219  ? 103.000 82.787  -27.002 1.00 62.48  ? 219  ARG A CB    1 
ATOM   3882  C  CG    . ARG G  4  219  ? 103.924 81.759  -27.723 1.00 61.69  ? 219  ARG A CG    1 
ATOM   3883  C  CD    . ARG G  4  219  ? 105.412 82.170  -27.704 1.00 60.04  ? 219  ARG A CD    1 
ATOM   3884  N  NE    . ARG G  4  219  ? 106.085 81.891  -28.976 1.00 59.35  ? 219  ARG A NE    1 
ATOM   3885  C  CZ    . ARG G  4  219  ? 107.350 82.213  -29.265 1.00 58.82  ? 219  ARG A CZ    1 
ATOM   3886  N  NH1   . ARG G  4  219  ? 108.119 82.826  -28.376 1.00 57.89  ? 219  ARG A NH1   1 
ATOM   3887  N  NH2   . ARG G  4  219  ? 107.854 81.929  -30.459 1.00 58.50  ? 219  ARG A NH2   1 
ATOM   3888  N  N     . GLU G  4  220  ? 102.239 84.189  -24.380 1.00 61.55  ? 220  GLU A N     1 
ATOM   3889  C  CA    . GLU G  4  220  ? 102.590 84.951  -23.190 1.00 61.54  ? 220  GLU A CA    1 
ATOM   3890  C  C     . GLU G  4  220  ? 102.126 84.236  -21.929 1.00 60.38  ? 220  GLU A C     1 
ATOM   3891  O  O     . GLU G  4  220  ? 102.779 84.334  -20.902 1.00 59.98  ? 220  GLU A O     1 
ATOM   3892  C  CB    . GLU G  4  220  ? 101.969 86.368  -23.224 1.00 63.21  ? 220  GLU A CB    1 
ATOM   3893  C  CG    . GLU G  4  220  ? 103.039 87.492  -22.967 1.00 65.99  ? 220  GLU A CG    1 
ATOM   3894  C  CD    . GLU G  4  220  ? 102.484 88.880  -22.602 1.00 66.81  ? 220  GLU A CD    1 
ATOM   3895  O  OE1   . GLU G  4  220  ? 101.687 89.446  -23.379 1.00 68.26  ? 220  GLU A OE1   1 
ATOM   3896  O  OE2   . GLU G  4  220  ? 102.861 89.409  -21.530 1.00 67.64  ? 220  GLU A OE2   1 
ATOM   3897  N  N     . HIS G  4  221  ? 101.009 83.512  -22.017 1.00 58.08  ? 221  HIS A N     1 
ATOM   3898  C  CA    . HIS G  4  221  ? 100.442 82.797  -20.866 1.00 55.38  ? 221  HIS A CA    1 
ATOM   3899  C  C     . HIS G  4  221  ? 101.060 81.429  -20.690 1.00 53.43  ? 221  HIS A C     1 
ATOM   3900  O  O     . HIS G  4  221  ? 101.007 80.851  -19.614 1.00 52.24  ? 221  HIS A O     1 
ATOM   3901  C  CB    . HIS G  4  221  ? 98.918  82.710  -21.013 1.00 54.57  ? 221  HIS A CB    1 
ATOM   3902  C  CG    . HIS G  4  221  ? 98.230  83.907  -20.428 1.00 54.15  ? 221  HIS A CG    1 
ATOM   3903  N  ND1   . HIS G  4  221  ? 98.308  84.224  -19.086 1.00 53.81  ? 221  HIS A ND1   1 
ATOM   3904  C  CD2   . HIS G  4  221  ? 97.516  84.902  -21.006 1.00 53.84  ? 221  HIS A CD2   1 
ATOM   3905  C  CE1   . HIS G  4  221  ? 97.677  85.363  -18.864 1.00 52.50  ? 221  HIS A CE1   1 
ATOM   3906  N  NE2   . HIS G  4  221  ? 97.188  85.795  -20.012 1.00 53.47  ? 221  HIS A NE2   1 
ATOM   3907  N  N     . LEU G  4  222  ? 101.657 80.927  -21.755 1.00 51.81  ? 222  LEU A N     1 
ATOM   3908  C  CA    . LEU G  4  222  ? 102.328 79.649  -21.725 1.00 50.82  ? 222  LEU A CA    1 
ATOM   3909  C  C     . LEU G  4  222  ? 103.691 79.769  -21.027 1.00 50.43  ? 222  LEU A C     1 
ATOM   3910  O  O     . LEU G  4  222  ? 104.290 78.766  -20.633 1.00 51.00  ? 222  LEU A O     1 
ATOM   3911  C  CB    . LEU G  4  222  ? 102.503 79.175  -23.154 1.00 50.69  ? 222  LEU A CB    1 
ATOM   3912  C  CG    . LEU G  4  222  ? 102.504 77.721  -23.521 1.00 51.22  ? 222  LEU A CG    1 
ATOM   3913  C  CD1   . LEU G  4  222  ? 101.306 76.953  -22.959 1.00 51.17  ? 222  LEU A CD1   1 
ATOM   3914  C  CD2   . LEU G  4  222  ? 102.538 77.712  -25.007 1.00 50.10  ? 222  LEU A CD2   1 
ATOM   3915  N  N     . THR G  4  223  ? 104.171 81.004  -20.879 1.00 50.61  ? 223  THR A N     1 
ATOM   3916  C  CA    . THR G  4  223  ? 105.449 81.267  -20.220 1.00 51.10  ? 223  THR A CA    1 
ATOM   3917  C  C     . THR G  4  223  ? 105.263 81.518  -18.713 1.00 52.16  ? 223  THR A C     1 
ATOM   3918  O  O     . THR G  4  223  ? 106.238 81.490  -17.954 1.00 53.41  ? 223  THR A O     1 
ATOM   3919  C  CB    . THR G  4  223  ? 106.172 82.514  -20.813 1.00 50.35  ? 223  THR A CB    1 
ATOM   3920  O  OG1   . THR G  4  223  ? 107.553 82.458  -20.452 1.00 50.03  ? 223  THR A OG1   1 
ATOM   3921  C  CG2   . THR G  4  223  ? 105.607 83.824  -20.241 1.00 51.09  ? 223  THR A CG2   1 
ATOM   3922  N  N     . TYR G  4  224  ? 104.025 81.765  -18.280 1.00 51.89  ? 224  TYR A N     1 
ATOM   3923  C  CA    . TYR G  4  224  ? 103.765 82.047  -16.869 1.00 50.45  ? 224  TYR A CA    1 
ATOM   3924  C  C     . TYR G  4  224  ? 103.835 80.796  -16.016 1.00 50.13  ? 224  TYR A C     1 
ATOM   3925  O  O     . TYR G  4  224  ? 103.450 80.813  -14.850 1.00 48.95  ? 224  TYR A O     1 
ATOM   3926  C  CB    . TYR G  4  224  ? 102.410 82.758  -16.725 1.00 50.71  ? 224  TYR A CB    1 
ATOM   3927  C  CG    . TYR G  4  224  ? 102.544 84.194  -17.199 1.00 50.64  ? 224  TYR A CG    1 
ATOM   3928  C  CD1   . TYR G  4  224  ? 103.557 85.044  -16.672 1.00 50.27  ? 224  TYR A CD1   1 
ATOM   3929  C  CD2   . TYR G  4  224  ? 101.729 84.695  -18.230 1.00 50.81  ? 224  TYR A CD2   1 
ATOM   3930  C  CE1   . TYR G  4  224  ? 103.758 86.359  -17.175 1.00 50.14  ? 224  TYR A CE1   1 
ATOM   3931  C  CE2   . TYR G  4  224  ? 101.922 86.020  -18.748 1.00 51.14  ? 224  TYR A CE2   1 
ATOM   3932  C  CZ    . TYR G  4  224  ? 102.938 86.836  -18.219 1.00 50.48  ? 224  TYR A CZ    1 
ATOM   3933  O  OH    . TYR G  4  224  ? 103.153 88.089  -18.759 1.00 49.48  ? 224  TYR A OH    1 
ATOM   3934  N  N     . PHE G  4  225  ? 104.340 79.725  -16.620 1.00 50.11  ? 225  PHE A N     1 
ATOM   3935  C  CA    . PHE G  4  225  ? 104.547 78.419  -15.982 1.00 51.17  ? 225  PHE A CA    1 
ATOM   3936  C  C     . PHE G  4  225  ? 106.048 78.197  -15.693 1.00 53.90  ? 225  PHE A C     1 
ATOM   3937  O  O     . PHE G  4  225  ? 106.504 77.052  -15.550 1.00 55.27  ? 225  PHE A O     1 
ATOM   3938  C  CB    . PHE G  4  225  ? 104.106 77.285  -16.910 1.00 46.83  ? 225  PHE A CB    1 
ATOM   3939  C  CG    . PHE G  4  225  ? 102.652 76.947  -16.893 1.00 42.11  ? 225  PHE A CG    1 
ATOM   3940  C  CD1   . PHE G  4  225  ? 102.095 76.341  -18.022 1.00 41.53  ? 225  PHE A CD1   1 
ATOM   3941  C  CD2   . PHE G  4  225  ? 101.837 77.178  -15.782 1.00 41.15  ? 225  PHE A CD2   1 
ATOM   3942  C  CE1   . PHE G  4  225  ? 100.749 75.964  -18.060 1.00 38.68  ? 225  PHE A CE1   1 
ATOM   3943  C  CE2   . PHE G  4  225  ? 100.480 76.806  -15.799 1.00 38.81  ? 225  PHE A CE2   1 
ATOM   3944  C  CZ    . PHE G  4  225  ? 99.937  76.195  -16.947 1.00 38.61  ? 225  PHE A CZ    1 
ATOM   3945  N  N     . SER G  4  226  ? 106.791 79.296  -15.603 1.00 56.63  ? 226  SER A N     1 
ATOM   3946  C  CA    . SER G  4  226  ? 108.251 79.294  -15.433 1.00 58.74  ? 226  SER A CA    1 
ATOM   3947  C  C     . SER G  4  226  ? 108.712 79.019  -13.992 1.00 60.06  ? 226  SER A C     1 
ATOM   3948  O  O     . SER G  4  226  ? 109.382 78.015  -13.743 1.00 59.49  ? 226  SER A O     1 
ATOM   3949  C  CB    . SER G  4  226  ? 108.814 80.656  -15.903 1.00 59.67  ? 226  SER A CB    1 
ATOM   3950  O  OG    . SER G  4  226  ? 110.134 80.922  -15.441 1.00 60.56  ? 226  SER A OG    1 
ATOM   3951  N  N     . ASN G  4  227  ? 108.358 79.910  -13.065 1.00 61.51  ? 227  ASN A N     1 
ATOM   3952  C  CA    . ASN G  4  227  ? 108.842 79.859  -11.676 1.00 62.94  ? 227  ASN A CA    1 
ATOM   3953  C  C     . ASN G  4  227  ? 107.935 79.058  -10.709 1.00 63.88  ? 227  ASN A C     1 
ATOM   3954  O  O     . ASN G  4  227  ? 106.877 79.539  -10.296 1.00 63.47  ? 227  ASN A O     1 
ATOM   3955  C  CB    . ASN G  4  227  ? 109.011 81.299  -11.132 1.00 62.42  ? 227  ASN A CB    1 
ATOM   3956  C  CG    . ASN G  4  227  ? 107.777 82.200  -11.395 1.00 61.13  ? 227  ASN A CG    1 
ATOM   3957  O  OD1   . ASN G  4  227  ? 107.504 82.608  -12.535 1.00 58.56  ? 227  ASN A OD1   1 
ATOM   3958  N  ND2   . ASN G  4  227  ? 107.036 82.506  -10.330 1.00 61.05  ? 227  ASN A ND2   1 
ATOM   3959  N  N     . PRO G  4  228  ? 108.358 77.826  -10.324 1.00 65.77  ? 228  PRO A N     1 
ATOM   3960  C  CA    . PRO G  4  228  ? 107.571 77.011  -9.383  1.00 66.45  ? 228  PRO A CA    1 
ATOM   3961  C  C     . PRO G  4  228  ? 107.602 77.599  -7.946  1.00 66.23  ? 228  PRO A C     1 
ATOM   3962  O  O     . PRO G  4  228  ? 108.413 78.475  -7.635  1.00 65.22  ? 228  PRO A O     1 
ATOM   3963  C  CB    . PRO G  4  228  ? 108.223 75.626  -9.489  1.00 67.23  ? 228  PRO A CB    1 
ATOM   3964  C  CG    . PRO G  4  228  ? 108.635 75.574  -10.942 1.00 67.76  ? 228  PRO A CG    1 
ATOM   3965  C  CD    . PRO G  4  228  ? 109.279 76.953  -11.089 1.00 66.71  ? 228  PRO A CD    1 
ATOM   3966  N  N     . GLN G  4  229  ? 106.712 77.114  -7.085  1.00 66.60  ? 229  GLN A N     1 
ATOM   3967  C  CA    . GLN G  4  229  ? 106.611 77.572  -5.700  1.00 66.53  ? 229  GLN A CA    1 
ATOM   3968  C  C     . GLN G  4  229  ? 105.626 76.699  -4.919  1.00 67.14  ? 229  GLN A C     1 
ATOM   3969  O  O     . GLN G  4  229  ? 105.731 75.462  -5.027  1.00 66.79  ? 229  GLN A O     1 
ATOM   3970  C  CB    . GLN G  4  229  ? 106.143 79.040  -5.645  1.00 67.42  ? 229  GLN A CB    1 
ATOM   3971  C  CG    . GLN G  4  229  ? 106.194 79.668  -4.244  1.00 69.47  ? 229  GLN A CG    1 
ATOM   3972  C  CD    . GLN G  4  229  ? 105.044 80.629  -3.946  1.00 70.19  ? 229  GLN A CD    1 
ATOM   3973  O  OE1   . GLN G  4  229  ? 103.867 80.263  -4.029  1.00 68.62  ? 229  GLN A OE1   1 
ATOM   3974  N  NE2   . GLN G  4  229  ? 105.386 81.865  -3.589  1.00 71.19  ? 229  GLN A NE2   1 
ATOM   3975  N  N     . MET H  4  1    ? 109.380 94.279  -10.162 1.00 95.83  ? 1    MET B N     1 
ATOM   3976  C  CA    . MET H  4  1    ? 108.175 95.073  -10.550 1.00 96.28  ? 1    MET B CA    1 
ATOM   3977  C  C     . MET H  4  1    ? 107.204 95.176  -9.359  1.00 96.51  ? 1    MET B C     1 
ATOM   3978  O  O     . MET H  4  1    ? 107.374 94.444  -8.375  1.00 96.78  ? 1    MET B O     1 
ATOM   3979  C  CB    . MET H  4  1    ? 107.507 94.402  -11.751 1.00 96.17  ? 1    MET B CB    1 
ATOM   3980  C  CG    . MET H  4  1    ? 106.789 95.375  -12.688 1.00 95.69  ? 1    MET B CG    1 
ATOM   3981  S  SD    . MET H  4  1    ? 107.588 95.545  -14.298 1.00 95.70  ? 1    MET B SD    1 
ATOM   3982  C  CE    . MET H  4  1    ? 107.509 97.320  -14.552 1.00 96.09  ? 1    MET B CE    1 
ATOM   3983  N  N     . LEU H  4  2    ? 106.189 96.046  -9.420  1.00 96.80  ? 2    LEU B N     1 
ATOM   3984  C  CA    . LEU H  4  2    ? 105.327 96.192  -8.239  1.00 97.30  ? 2    LEU B CA    1 
ATOM   3985  C  C     . LEU H  4  2    ? 103.806 96.128  -8.540  1.00 98.25  ? 2    LEU B C     1 
ATOM   3986  O  O     . LEU H  4  2    ? 103.090 95.430  -7.809  1.00 98.57  ? 2    LEU B O     1 
ATOM   3987  C  CB    . LEU H  4  2    ? 105.648 97.522  -7.522  1.00 95.95  ? 2    LEU B CB    1 
ATOM   3988  C  CG    . LEU H  4  2    ? 106.389 98.675  -8.233  1.00 95.12  ? 2    LEU B CG    1 
ATOM   3989  C  CD1   . LEU H  4  2    ? 105.496 99.443  -9.208  1.00 93.85  ? 2    LEU B CD1   1 
ATOM   3990  C  CD2   . LEU H  4  2    ? 106.889 99.624  -7.153  1.00 94.63  ? 2    LEU B CD2   1 
ATOM   3991  N  N     . ASP H  4  3    ? 103.302 96.806  -9.579  1.00 99.39  ? 3    ASP B N     1 
ATOM   3992  C  CA    . ASP H  4  3    ? 101.831 96.900  -9.779  1.00 99.11  ? 3    ASP B CA    1 
ATOM   3993  C  C     . ASP H  4  3    ? 101.187 95.710  -10.555 1.00 96.92  ? 3    ASP B C     1 
ATOM   3994  O  O     . ASP H  4  3    ? 100.800 94.714  -9.935  1.00 96.45  ? 3    ASP B O     1 
ATOM   3995  C  CB    . ASP H  4  3    ? 101.483 98.256  -10.448 1.00 102.00 ? 3    ASP B CB    1 
ATOM   3996  C  CG    . ASP H  4  3    ? 100.815 99.252  -9.448  1.00 104.62 ? 3    ASP B CG    1 
ATOM   3997  O  OD1   . ASP H  4  3    ? 101.361 99.443  -8.332  1.00 105.76 ? 3    ASP B OD1   1 
ATOM   3998  O  OD2   . ASP H  4  3    ? 99.751  99.846  -9.768  1.00 105.26 ? 3    ASP B OD2   1 
ATOM   3999  N  N     . SER H  4  4    ? 101.046 95.804  -11.878 1.00 94.59  ? 4    SER B N     1 
ATOM   4000  C  CA    . SER H  4  4    ? 100.337 94.759  -12.634 1.00 91.74  ? 4    SER B CA    1 
ATOM   4001  C  C     . SER H  4  4    ? 101.233 93.570  -12.993 1.00 89.91  ? 4    SER B C     1 
ATOM   4002  O  O     . SER H  4  4    ? 100.713 92.457  -13.153 1.00 89.89  ? 4    SER B O     1 
ATOM   4003  C  CB    . SER H  4  4    ? 99.732  95.348  -13.918 1.00 91.91  ? 4    SER B CB    1 
ATOM   4004  O  OG    . SER H  4  4    ? 98.503  94.705  -14.237 1.00 91.34  ? 4    SER B OG    1 
ATOM   4005  N  N     . LYS H  4  5    ? 102.546 93.776  -13.128 1.00 87.93  ? 5    LYS B N     1 
ATOM   4006  C  CA    . LYS H  4  5    ? 103.456 92.671  -13.472 1.00 83.97  ? 5    LYS B CA    1 
ATOM   4007  C  C     . LYS H  4  5    ? 103.871 91.876  -12.219 1.00 82.09  ? 5    LYS B C     1 
ATOM   4008  O  O     . LYS H  4  5    ? 103.996 90.653  -12.304 1.00 81.91  ? 5    LYS B O     1 
ATOM   4009  C  CB    . LYS H  4  5    ? 104.695 93.208  -14.222 1.00 82.52  ? 5    LYS B CB    1 
ATOM   4010  C  CG    . LYS H  4  5    ? 105.722 92.137  -14.635 1.00 80.70  ? 5    LYS B CG    1 
ATOM   4011  C  CD    . LYS H  4  5    ? 106.544 92.556  -15.861 1.00 78.93  ? 5    LYS B CD    1 
ATOM   4012  C  CE    . LYS H  4  5    ? 105.706 92.542  -17.131 1.00 76.99  ? 5    LYS B CE    1 
ATOM   4013  N  NZ    . LYS H  4  5    ? 106.512 92.762  -18.359 1.00 76.17  ? 5    LYS B NZ    1 
ATOM   4014  N  N     . LEU H  4  6    ? 104.094 92.539  -11.070 1.00 79.20  ? 6    LEU B N     1 
ATOM   4015  C  CA    . LEU H  4  6    ? 104.399 91.773  -9.856  1.00 75.72  ? 6    LEU B CA    1 
ATOM   4016  C  C     . LEU H  4  6    ? 103.208 90.912  -9.515  1.00 72.68  ? 6    LEU B C     1 
ATOM   4017  O  O     . LEU H  4  6    ? 103.349 89.786  -9.045  1.00 73.03  ? 6    LEU B O     1 
ATOM   4018  C  CB    . LEU H  4  6    ? 104.734 92.677  -8.651  1.00 76.23  ? 6    LEU B CB    1 
ATOM   4019  C  CG    . LEU H  4  6    ? 105.304 91.920  -7.426  1.00 77.11  ? 6    LEU B CG    1 
ATOM   4020  C  CD1   . LEU H  4  6    ? 106.592 91.159  -7.808  1.00 77.37  ? 6    LEU B CD1   1 
ATOM   4021  C  CD2   . LEU H  4  6    ? 105.595 92.919  -6.306  1.00 77.63  ? 6    LEU B CD2   1 
ATOM   4022  N  N     . LYS H  4  7    ? 102.022 91.473  -9.758  1.00 69.27  ? 7    LYS B N     1 
ATOM   4023  C  CA    . LYS H  4  7    ? 100.790 90.705  -9.651  1.00 65.27  ? 7    LYS B CA    1 
ATOM   4024  C  C     . LYS H  4  7    ? 100.776 89.707  -10.801 1.00 63.29  ? 7    LYS B C     1 
ATOM   4025  O  O     . LYS H  4  7    ? 100.033 89.833  -11.778 1.00 63.61  ? 7    LYS B O     1 
ATOM   4026  C  CB    . LYS H  4  7    ? 99.550  91.634  -9.750  1.00 64.91  ? 7    LYS B CB    1 
ATOM   4027  C  CG    . LYS H  4  7    ? 98.159  90.975  -9.412  1.00 63.49  ? 7    LYS B CG    1 
ATOM   4028  C  CD    . LYS H  4  7    ? 97.534  90.062  -10.513 1.00 62.64  ? 7    LYS B CD    1 
ATOM   4029  C  CE    . LYS H  4  7    ? 97.005  90.861  -11.715 1.00 61.83  ? 7    LYS B CE    1 
ATOM   4030  N  NZ    . LYS H  4  7    ? 96.476  90.011  -12.814 1.00 59.30  ? 7    LYS B NZ    1 
ATOM   4031  N  N     . ALA H  4  8    ? 101.658 88.725  -10.680 1.00 60.17  ? 8    ALA B N     1 
ATOM   4032  C  CA    . ALA H  4  8    ? 101.860 87.733  -11.713 1.00 56.65  ? 8    ALA B CA    1 
ATOM   4033  C  C     . ALA H  4  8    ? 101.508 86.364  -11.226 1.00 54.69  ? 8    ALA B C     1 
ATOM   4034  O  O     . ALA H  4  8    ? 101.538 86.116  -10.021 1.00 55.70  ? 8    ALA B O     1 
ATOM   4035  C  CB    . ALA H  4  8    ? 103.306 87.755  -12.152 1.00 54.85  ? 8    ALA B CB    1 
ATOM   4036  N  N     . PRO H  4  9    ? 101.182 85.447  -12.161 1.00 52.51  ? 9    PRO B N     1 
ATOM   4037  C  CA    . PRO H  4  9    ? 100.815 84.069  -11.824 1.00 51.06  ? 9    PRO B CA    1 
ATOM   4038  C  C     . PRO H  4  9    ? 101.813 83.425  -10.865 1.00 49.71  ? 9    PRO B C     1 
ATOM   4039  O  O     . PRO H  4  9    ? 102.938 83.084  -11.257 1.00 49.38  ? 9    PRO B O     1 
ATOM   4040  C  CB    . PRO H  4  9    ? 100.775 83.376  -13.177 1.00 50.05  ? 9    PRO B CB    1 
ATOM   4041  C  CG    . PRO H  4  9    ? 100.427 84.444  -14.103 1.00 50.55  ? 9    PRO B CG    1 
ATOM   4042  C  CD    . PRO H  4  9    ? 101.263 85.589  -13.630 1.00 51.39  ? 9    PRO B CD    1 
ATOM   4043  N  N     . VAL H  4  10   ? 101.411 83.268  -9.610  1.00 48.70  ? 10   VAL B N     1 
ATOM   4044  C  CA    . VAL H  4  10   ? 102.286 82.617  -8.670  1.00 46.58  ? 10   VAL B CA    1 
ATOM   4045  C  C     . VAL H  4  10   ? 102.257 81.135  -8.907  1.00 45.69  ? 10   VAL B C     1 
ATOM   4046  O  O     . VAL H  4  10   ? 101.321 80.456  -8.504  1.00 45.41  ? 10   VAL B O     1 
ATOM   4047  C  CB    . VAL H  4  10   ? 101.878 82.904  -7.211  1.00 47.30  ? 10   VAL B CB    1 
ATOM   4048  C  CG1   . VAL H  4  10   ? 102.902 82.268  -6.266  1.00 47.82  ? 10   VAL B CG1   1 
ATOM   4049  C  CG2   . VAL H  4  10   ? 101.846 84.415  -6.972  1.00 47.13  ? 10   VAL B CG2   1 
ATOM   4050  N  N     . PHE H  4  11   ? 103.268 80.628  -9.589  1.00 46.41  ? 11   PHE B N     1 
ATOM   4051  C  CA    . PHE H  4  11   ? 103.270 79.204  -9.851  1.00 49.34  ? 11   PHE B CA    1 
ATOM   4052  C  C     . PHE H  4  11   ? 103.689 78.425  -8.598  1.00 50.14  ? 11   PHE B C     1 
ATOM   4053  O  O     . PHE H  4  11   ? 104.833 78.520  -8.150  1.00 51.64  ? 11   PHE B O     1 
ATOM   4054  C  CB    . PHE H  4  11   ? 104.206 78.870  -11.046 1.00 49.01  ? 11   PHE B CB    1 
ATOM   4055  C  CG    . PHE H  4  11   ? 103.969 77.466  -11.678 1.00 49.26  ? 11   PHE B CG    1 
ATOM   4056  C  CD1   . PHE H  4  11   ? 102.720 77.117  -12.236 1.00 48.99  ? 11   PHE B CD1   1 
ATOM   4057  C  CD2   . PHE H  4  11   ? 105.005 76.489  -11.707 1.00 49.39  ? 11   PHE B CD2   1 
ATOM   4058  C  CE1   . PHE H  4  11   ? 102.501 75.806  -12.816 1.00 49.13  ? 11   PHE B CE1   1 
ATOM   4059  C  CE2   . PHE H  4  11   ? 104.799 75.177  -12.283 1.00 49.09  ? 11   PHE B CE2   1 
ATOM   4060  C  CZ    . PHE H  4  11   ? 103.544 74.847  -12.834 1.00 49.05  ? 11   PHE B CZ    1 
ATOM   4061  N  N     . THR H  4  12   ? 102.741 77.675  -8.031  1.00 50.70  ? 12   THR B N     1 
ATOM   4062  C  CA    . THR H  4  12   ? 102.981 76.852  -6.851  1.00 49.48  ? 12   THR B CA    1 
ATOM   4063  C  C     . THR H  4  12   ? 102.925 75.378  -7.217  1.00 49.98  ? 12   THR B C     1 
ATOM   4064  O  O     . THR H  4  12   ? 102.063 74.966  -7.995  1.00 49.51  ? 12   THR B O     1 
ATOM   4065  C  CB    . THR H  4  12   ? 101.926 77.092  -5.722  1.00 50.17  ? 12   THR B CB    1 
ATOM   4066  O  OG1   . THR H  4  12   ? 100.761 76.297  -5.990  1.00 49.17  ? 12   THR B OG1   1 
ATOM   4067  C  CG2   . THR H  4  12   ? 101.544 78.572  -5.621  1.00 50.62  ? 12   THR B CG2   1 
ATOM   4068  N  N     . VAL H  4  13   ? 103.839 74.593  -6.659  1.00 48.62  ? 13   VAL B N     1 
ATOM   4069  C  CA    . VAL H  4  13   ? 103.895 73.176  -6.956  1.00 48.46  ? 13   VAL B CA    1 
ATOM   4070  C  C     . VAL H  4  13   ? 103.886 72.334  -5.696  1.00 48.53  ? 13   VAL B C     1 
ATOM   4071  O  O     . VAL H  4  13   ? 104.383 72.724  -4.645  1.00 48.29  ? 13   VAL B O     1 
ATOM   4072  C  CB    . VAL H  4  13   ? 105.162 72.835  -7.781  1.00 49.07  ? 13   VAL B CB    1 
ATOM   4073  C  CG1   . VAL H  4  13   ? 105.289 71.301  -7.983  1.00 48.31  ? 13   VAL B CG1   1 
ATOM   4074  C  CG2   . VAL H  4  13   ? 105.059 73.511  -9.154  1.00 49.04  ? 13   VAL B CG2   1 
ATOM   4075  N  N     . ARG H  4  14   ? 103.285 71.166  -5.852  1.00 48.36  ? 14   ARG B N     1 
ATOM   4076  C  CA    . ARG H  4  14   ? 103.162 70.135  -4.838  1.00 49.77  ? 14   ARG B CA    1 
ATOM   4077  C  C     . ARG H  4  14   ? 103.206 68.767  -5.500  1.00 52.16  ? 14   ARG B C     1 
ATOM   4078  O  O     . ARG H  4  14   ? 102.191 68.263  -5.978  1.00 53.97  ? 14   ARG B O     1 
ATOM   4079  C  CB    . ARG H  4  14   ? 101.842 70.282  -4.052  1.00 46.66  ? 14   ARG B CB    1 
ATOM   4080  C  CG    . ARG H  4  14   ? 101.863 71.345  -2.934  1.00 43.82  ? 14   ARG B CG    1 
ATOM   4081  C  CD    . ARG H  4  14   ? 100.517 71.478  -2.214  1.00 39.80  ? 14   ARG B CD    1 
ATOM   4082  N  NE    . ARG H  4  14   ? 99.520  72.086  -3.087  1.00 37.71  ? 14   ARG B NE    1 
ATOM   4083  C  CZ    . ARG H  4  14   ? 99.537  73.360  -3.474  1.00 35.90  ? 14   ARG B CZ    1 
ATOM   4084  N  NH1   . ARG H  4  14   ? 100.489 74.184  -3.072  1.00 35.76  ? 14   ARG B NH1   1 
ATOM   4085  N  NH2   . ARG H  4  14   ? 98.602  73.819  -4.272  1.00 34.49  ? 14   ARG B NH2   1 
ATOM   4086  N  N     . THR H  4  15   ? 104.386 68.168  -5.552  1.00 54.09  ? 15   THR B N     1 
ATOM   4087  C  CA    . THR H  4  15   ? 104.503 66.879  -6.194  1.00 54.92  ? 15   THR B CA    1 
ATOM   4088  C  C     . THR H  4  15   ? 105.121 65.859  -5.271  1.00 56.71  ? 15   THR B C     1 
ATOM   4089  O  O     . THR H  4  15   ? 106.160 66.099  -4.644  1.00 55.64  ? 15   THR B O     1 
ATOM   4090  C  CB    . THR H  4  15   ? 105.344 66.991  -7.514  1.00 54.91  ? 15   THR B CB    1 
ATOM   4091  O  OG1   . THR H  4  15   ? 105.077 65.848  -8.342  1.00 53.65  ? 15   THR B OG1   1 
ATOM   4092  C  CG2   . THR H  4  15   ? 106.854 67.075  -7.226  1.00 54.53  ? 15   THR B CG2   1 
ATOM   4093  N  N     . GLN H  4  16   ? 104.454 64.713  -5.186  1.00 59.85  ? 16   GLN B N     1 
ATOM   4094  C  CA    . GLN H  4  16   ? 104.918 63.584  -4.378  1.00 62.19  ? 16   GLN B CA    1 
ATOM   4095  C  C     . GLN H  4  16   ? 105.215 62.376  -5.280  1.00 62.43  ? 16   GLN B C     1 
ATOM   4096  O  O     . GLN H  4  16   ? 104.331 61.896  -6.009  1.00 62.50  ? 16   GLN B O     1 
ATOM   4097  C  CB    . GLN H  4  16   ? 103.856 63.232  -3.329  1.00 62.56  ? 16   GLN B CB    1 
ATOM   4098  C  CG    . GLN H  4  16   ? 103.171 64.460  -2.668  1.00 63.47  ? 16   GLN B CG    1 
ATOM   4099  C  CD    . GLN H  4  16   ? 104.091 65.431  -1.878  1.00 63.42  ? 16   GLN B CD    1 
ATOM   4100  O  OE1   . GLN H  4  16   ? 104.852 66.209  -2.463  1.00 62.54  ? 16   GLN B OE1   1 
ATOM   4101  N  NE2   . GLN H  4  16   ? 104.011 65.379  -0.548  1.00 61.56  ? 16   GLN B NE2   1 
ATOM   4102  N  N     . GLY H  4  17   ? 106.455 61.895  -5.236  1.00 63.38  ? 17   GLY B N     1 
ATOM   4103  C  CA    . GLY H  4  17   ? 106.831 60.814  -6.125  1.00 64.77  ? 17   GLY B CA    1 
ATOM   4104  C  C     . GLY H  4  17   ? 106.911 61.344  -7.556  1.00 65.68  ? 17   GLY B C     1 
ATOM   4105  O  O     . GLY H  4  17   ? 106.989 62.567  -7.749  1.00 66.39  ? 17   GLY B O     1 
ATOM   4106  N  N     . ARG H  4  18   ? 106.889 60.460  -8.556  1.00 65.68  ? 18   ARG B N     1 
ATOM   4107  C  CA    . ARG H  4  18   ? 106.957 60.873  -9.970  1.00 65.33  ? 18   ARG B CA    1 
ATOM   4108  C  C     . ARG H  4  18   ? 105.630 60.640  -10.662 1.00 67.01  ? 18   ARG B C     1 
ATOM   4109  O  O     . ARG H  4  18   ? 105.509 60.804  -11.883 1.00 66.51  ? 18   ARG B O     1 
ATOM   4110  C  CB    . ARG H  4  18   ? 108.017 60.067  -10.709 1.00 62.96  ? 18   ARG B CB    1 
ATOM   4111  C  CG    . ARG H  4  18   ? 109.305 59.981  -9.969  1.00 60.34  ? 18   ARG B CG    1 
ATOM   4112  C  CD    . ARG H  4  18   ? 109.920 58.663  -10.216 1.00 57.00  ? 18   ARG B CD    1 
ATOM   4113  N  NE    . ARG H  4  18   ? 110.352 58.563  -11.595 1.00 55.02  ? 18   ARG B NE    1 
ATOM   4114  C  CZ    . ARG H  4  18   ? 110.811 57.445  -12.133 1.00 54.41  ? 18   ARG B CZ    1 
ATOM   4115  N  NH1   . ARG H  4  18   ? 110.879 56.350  -11.398 1.00 54.10  ? 18   ARG B NH1   1 
ATOM   4116  N  NH2   . ARG H  4  18   ? 111.212 57.427  -13.393 1.00 52.90  ? 18   ARG B NH2   1 
ATOM   4117  N  N     . GLU H  4  19   ? 104.646 60.261  -9.846  1.00 69.23  ? 19   GLU B N     1 
ATOM   4118  C  CA    . GLU H  4  19   ? 103.297 59.908  -10.286 1.00 71.52  ? 19   GLU B CA    1 
ATOM   4119  C  C     . GLU H  4  19   ? 102.320 61.073  -10.158 1.00 71.49  ? 19   GLU B C     1 
ATOM   4120  O  O     . GLU H  4  19   ? 101.674 61.458  -11.133 1.00 71.23  ? 19   GLU B O     1 
ATOM   4121  C  CB    . GLU H  4  19   ? 102.790 58.709  -9.460  1.00 73.05  ? 19   GLU B CB    1 
ATOM   4122  C  CG    . GLU H  4  19   ? 103.096 57.310  -10.044 1.00 76.57  ? 19   GLU B CG    1 
ATOM   4123  C  CD    . GLU H  4  19   ? 104.552 57.101  -10.541 1.00 78.98  ? 19   GLU B CD    1 
ATOM   4124  O  OE1   . GLU H  4  19   ? 104.759 56.151  -11.327 1.00 80.03  ? 19   GLU B OE1   1 
ATOM   4125  O  OE2   . GLU H  4  19   ? 105.488 57.850  -10.170 1.00 80.63  ? 19   GLU B OE2   1 
ATOM   4126  N  N     . TYR H  4  20   ? 102.199 61.641  -8.967  1.00 71.60  ? 20   TYR B N     1 
ATOM   4127  C  CA    . TYR H  4  20   ? 101.252 62.722  -8.797  1.00 72.14  ? 20   TYR B CA    1 
ATOM   4128  C  C     . TYR H  4  20   ? 101.951 64.072  -8.710  1.00 70.98  ? 20   TYR B C     1 
ATOM   4129  O  O     . TYR H  4  20   ? 103.046 64.189  -8.173  1.00 71.09  ? 20   TYR B O     1 
ATOM   4130  C  CB    . TYR H  4  20   ? 100.411 62.468  -7.541  1.00 73.66  ? 20   TYR B CB    1 
ATOM   4131  C  CG    . TYR H  4  20   ? 99.181  63.348  -7.429  1.00 75.60  ? 20   TYR B CG    1 
ATOM   4132  C  CD1   . TYR H  4  20   ? 98.730  63.792  -6.161  1.00 76.65  ? 20   TYR B CD1   1 
ATOM   4133  C  CD2   . TYR H  4  20   ? 98.472  63.777  -8.580  1.00 75.87  ? 20   TYR B CD2   1 
ATOM   4134  C  CE1   . TYR H  4  20   ? 97.605  64.647  -6.037  1.00 76.31  ? 20   TYR B CE1   1 
ATOM   4135  C  CE2   . TYR H  4  20   ? 97.341  64.640  -8.467  1.00 76.06  ? 20   TYR B CE2   1 
ATOM   4136  C  CZ    . TYR H  4  20   ? 96.926  65.064  -7.193  1.00 76.29  ? 20   TYR B CZ    1 
ATOM   4137  O  OH    . TYR H  4  20   ? 95.861  65.907  -7.065  1.00 76.29  ? 20   TYR B OH    1 
ATOM   4138  N  N     . GLY H  4  21   ? 101.294 65.088  -9.256  1.00 69.86  ? 21   GLY B N     1 
ATOM   4139  C  CA    . GLY H  4  21   ? 101.837 66.431  -9.242  1.00 68.94  ? 21   GLY B CA    1 
ATOM   4140  C  C     . GLY H  4  21   ? 100.763 67.500  -9.407  1.00 68.73  ? 21   GLY B C     1 
ATOM   4141  O  O     . GLY H  4  21   ? 100.192 67.677  -10.487 1.00 69.52  ? 21   GLY B O     1 
ATOM   4142  N  N     . GLU H  4  22   ? 100.462 68.213  -8.330  1.00 67.41  ? 22   GLU B N     1 
ATOM   4143  C  CA    . GLU H  4  22   ? 99.495  69.294  -8.411  1.00 65.71  ? 22   GLU B CA    1 
ATOM   4144  C  C     . GLU H  4  22   ? 100.187 70.589  -8.820  1.00 65.74  ? 22   GLU B C     1 
ATOM   4145  O  O     . GLU H  4  22   ? 101.345 70.795  -8.460  1.00 66.53  ? 22   GLU B O     1 
ATOM   4146  C  CB    . GLU H  4  22   ? 98.808  69.486  -7.063  1.00 65.34  ? 22   GLU B CB    1 
ATOM   4147  C  CG    . GLU H  4  22   ? 97.686  68.484  -6.789  1.00 65.55  ? 22   GLU B CG    1 
ATOM   4148  C  CD    . GLU H  4  22   ? 96.520  69.096  -6.007  1.00 65.23  ? 22   GLU B CD    1 
ATOM   4149  O  OE1   . GLU H  4  22   ? 96.699  69.482  -4.828  1.00 65.54  ? 22   GLU B OE1   1 
ATOM   4150  O  OE2   . GLU H  4  22   ? 95.417  69.194  -6.580  1.00 63.72  ? 22   GLU B OE2   1 
ATOM   4151  N  N     . PHE H  4  23   ? 99.509  71.460  -9.563  1.00 65.01  ? 23   PHE B N     1 
ATOM   4152  C  CA    . PHE H  4  23   ? 100.131 72.705  -10.015 1.00 64.21  ? 23   PHE B CA    1 
ATOM   4153  C  C     . PHE H  4  23   ? 99.138  73.852  -10.009 1.00 62.56  ? 23   PHE B C     1 
ATOM   4154  O  O     . PHE H  4  23   ? 98.241  73.907  -10.840 1.00 62.37  ? 23   PHE B O     1 
ATOM   4155  C  CB    . PHE H  4  23   ? 100.695 72.499  -11.422 1.00 65.60  ? 23   PHE B CB    1 
ATOM   4156  C  CG    . PHE H  4  23   ? 101.538 71.268  -11.540 1.00 67.30  ? 23   PHE B CG    1 
ATOM   4157  C  CD1   . PHE H  4  23   ? 102.768 71.182  -10.849 1.00 68.62  ? 23   PHE B CD1   1 
ATOM   4158  C  CD2   . PHE H  4  23   ? 101.103 70.169  -12.307 1.00 68.01  ? 23   PHE B CD2   1 
ATOM   4159  C  CE1   . PHE H  4  23   ? 103.571 70.007  -10.912 1.00 69.46  ? 23   PHE B CE1   1 
ATOM   4160  C  CE2   . PHE H  4  23   ? 101.892 68.987  -12.385 1.00 69.11  ? 23   PHE B CE2   1 
ATOM   4161  C  CZ    . PHE H  4  23   ? 103.132 68.907  -11.682 1.00 69.20  ? 23   PHE B CZ    1 
ATOM   4162  N  N     . VAL H  4  24   ? 99.311  74.771  -9.065  1.00 60.56  ? 24   VAL B N     1 
ATOM   4163  C  CA    . VAL H  4  24   ? 98.417  75.919  -8.934  1.00 58.66  ? 24   VAL B CA    1 
ATOM   4164  C  C     . VAL H  4  24   ? 99.033  77.164  -9.528  1.00 56.74  ? 24   VAL B C     1 
ATOM   4165  O  O     . VAL H  4  24   ? 100.231 77.350  -9.436  1.00 57.83  ? 24   VAL B O     1 
ATOM   4166  C  CB    . VAL H  4  24   ? 98.089  76.202  -7.454  1.00 59.79  ? 24   VAL B CB    1 
ATOM   4167  C  CG1   . VAL H  4  24   ? 97.179  77.417  -7.350  1.00 60.03  ? 24   VAL B CG1   1 
ATOM   4168  C  CG2   . VAL H  4  24   ? 97.410  74.989  -6.841  1.00 60.88  ? 24   VAL B CG2   1 
ATOM   4169  N  N     . LEU H  4  25   ? 98.208  78.012  -10.128 1.00 54.73  ? 25   LEU B N     1 
ATOM   4170  C  CA    . LEU H  4  25   ? 98.682  79.247  -10.739 1.00 54.20  ? 25   LEU B CA    1 
ATOM   4171  C  C     . LEU H  4  25   ? 97.593  80.314  -10.745 1.00 53.96  ? 25   LEU B C     1 
ATOM   4172  O  O     . LEU H  4  25   ? 96.596  80.179  -11.445 1.00 53.68  ? 25   LEU B O     1 
ATOM   4173  C  CB    . LEU H  4  25   ? 99.146  78.958  -12.170 1.00 53.31  ? 25   LEU B CB    1 
ATOM   4174  C  CG    . LEU H  4  25   ? 99.146  80.062  -13.229 1.00 53.21  ? 25   LEU B CG    1 
ATOM   4175  C  CD1   . LEU H  4  25   ? 100.463 80.116  -13.992 1.00 52.18  ? 25   LEU B CD1   1 
ATOM   4176  C  CD2   . LEU H  4  25   ? 97.995  79.772  -14.168 1.00 54.03  ? 25   LEU B CD2   1 
ATOM   4177  N  N     . GLU H  4  26   ? 97.801  81.375  -9.967  1.00 55.04  ? 26   GLU B N     1 
ATOM   4178  C  CA    . GLU H  4  26   ? 96.841  82.469  -9.855  1.00 55.45  ? 26   GLU B CA    1 
ATOM   4179  C  C     . GLU H  4  26   ? 97.530  83.775  -9.416  1.00 55.84  ? 26   GLU B C     1 
ATOM   4180  O  O     . GLU H  4  26   ? 98.642  83.739  -8.899  1.00 55.48  ? 26   GLU B O     1 
ATOM   4181  C  CB    . GLU H  4  26   ? 95.732  82.075  -8.850  1.00 56.25  ? 26   GLU B CB    1 
ATOM   4182  C  CG    . GLU H  4  26   ? 95.688  82.844  -7.509  1.00 56.70  ? 26   GLU B CG    1 
ATOM   4183  C  CD    . GLU H  4  26   ? 96.744  82.387  -6.529  1.00 56.10  ? 26   GLU B CD    1 
ATOM   4184  O  OE1   . GLU H  4  26   ? 97.926  82.395  -6.902  1.00 55.96  ? 26   GLU B OE1   1 
ATOM   4185  O  OE2   . GLU H  4  26   ? 96.397  82.018  -5.384  1.00 56.52  ? 26   GLU B OE2   1 
ATOM   4186  N  N     . PRO H  4  27   ? 96.876  84.941  -9.619  1.00 56.80  ? 27   PRO B N     1 
ATOM   4187  C  CA    . PRO H  4  27   ? 95.551  85.105  -10.233 1.00 56.88  ? 27   PRO B CA    1 
ATOM   4188  C  C     . PRO H  4  27   ? 95.619  85.124  -11.756 1.00 56.32  ? 27   PRO B C     1 
ATOM   4189  O  O     . PRO H  4  27   ? 96.676  85.316  -12.370 1.00 56.71  ? 27   PRO B O     1 
ATOM   4190  C  CB    . PRO H  4  27   ? 95.029  86.425  -9.645  1.00 57.16  ? 27   PRO B CB    1 
ATOM   4191  C  CG    . PRO H  4  27   ? 95.807  86.576  -8.353  1.00 57.58  ? 27   PRO B CG    1 
ATOM   4192  C  CD    . PRO H  4  27   ? 97.192  86.128  -8.801  1.00 57.87  ? 27   PRO B CD    1 
ATOM   4193  N  N     . LEU H  4  28   ? 94.455  84.907  -12.345 1.00 55.74  ? 28   LEU B N     1 
ATOM   4194  C  CA    . LEU H  4  28   ? 94.274  84.939  -13.774 1.00 55.07  ? 28   LEU B CA    1 
ATOM   4195  C  C     . LEU H  4  28   ? 93.109  85.863  -14.105 1.00 55.56  ? 28   LEU B C     1 
ATOM   4196  O  O     . LEU H  4  28   ? 92.188  85.981  -13.288 1.00 55.68  ? 28   LEU B O     1 
ATOM   4197  C  CB    . LEU H  4  28   ? 93.993  83.520  -14.297 1.00 52.54  ? 28   LEU B CB    1 
ATOM   4198  C  CG    . LEU H  4  28   ? 94.490  82.302  -13.518 1.00 49.16  ? 28   LEU B CG    1 
ATOM   4199  C  CD1   . LEU H  4  28   ? 94.105  81.099  -14.291 1.00 48.11  ? 28   LEU B CD1   1 
ATOM   4200  C  CD2   . LEU H  4  28   ? 95.974  82.324  -13.327 1.00 48.39  ? 28   LEU B CD2   1 
ATOM   4201  N  N     . GLU H  4  29   ? 93.129  86.523  -15.260 1.00 56.20  ? 29   GLU B N     1 
ATOM   4202  C  CA    . GLU H  4  29   ? 92.028  87.416  -15.596 1.00 56.72  ? 29   GLU B CA    1 
ATOM   4203  C  C     . GLU H  4  29   ? 90.709  86.636  -15.756 1.00 56.80  ? 29   GLU B C     1 
ATOM   4204  O  O     . GLU H  4  29   ? 90.481  85.661  -15.043 1.00 56.99  ? 29   GLU B O     1 
ATOM   4205  C  CB    . GLU H  4  29   ? 92.379  88.210  -16.861 1.00 57.97  ? 29   GLU B CB    1 
ATOM   4206  C  CG    . GLU H  4  29   ? 93.721  88.974  -16.738 1.00 58.99  ? 29   GLU B CG    1 
ATOM   4207  C  CD    . GLU H  4  29   ? 93.663  90.422  -17.223 1.00 59.71  ? 29   GLU B CD    1 
ATOM   4208  O  OE1   . GLU H  4  29   ? 93.147  90.645  -18.336 1.00 59.31  ? 29   GLU B OE1   1 
ATOM   4209  O  OE2   . GLU H  4  29   ? 94.138  91.331  -16.496 1.00 60.39  ? 29   GLU B OE2   1 
ATOM   4210  N  N     . ARG H  4  30   ? 89.833  87.030  -16.673 1.00 55.50  ? 30   ARG B N     1 
ATOM   4211  C  CA    . ARG H  4  30   ? 88.552  86.336  -16.769 1.00 54.93  ? 30   ARG B CA    1 
ATOM   4212  C  C     . ARG H  4  30   ? 88.592  85.148  -17.735 1.00 54.98  ? 30   ARG B C     1 
ATOM   4213  O  O     . ARG H  4  30   ? 89.033  85.265  -18.874 1.00 53.33  ? 30   ARG B O     1 
ATOM   4214  C  CB    . ARG H  4  30   ? 87.470  87.308  -17.213 1.00 54.35  ? 30   ARG B CB    1 
ATOM   4215  C  CG    . ARG H  4  30   ? 87.232  88.462  -16.293 1.00 52.91  ? 30   ARG B CG    1 
ATOM   4216  C  CD    . ARG H  4  30   ? 85.918  89.107  -16.656 1.00 52.33  ? 30   ARG B CD    1 
ATOM   4217  N  NE    . ARG H  4  30   ? 84.797  88.191  -16.462 1.00 51.02  ? 30   ARG B NE    1 
ATOM   4218  C  CZ    . ARG H  4  30   ? 84.249  87.429  -17.407 1.00 50.56  ? 30   ARG B CZ    1 
ATOM   4219  N  NH1   . ARG H  4  30   ? 84.704  87.457  -18.653 1.00 48.81  ? 30   ARG B NH1   1 
ATOM   4220  N  NH2   . ARG H  4  30   ? 83.241  86.624  -17.090 1.00 50.75  ? 30   ARG B NH2   1 
ATOM   4221  N  N     . GLY H  4  31   ? 88.113  84.007  -17.234 1.00 55.45  ? 31   GLY B N     1 
ATOM   4222  C  CA    . GLY H  4  31   ? 88.019  82.771  -17.997 1.00 56.56  ? 31   GLY B CA    1 
ATOM   4223  C  C     . GLY H  4  31   ? 89.309  82.296  -18.644 1.00 57.19  ? 31   GLY B C     1 
ATOM   4224  O  O     . GLY H  4  31   ? 89.247  81.707  -19.730 1.00 56.80  ? 31   GLY B O     1 
ATOM   4225  N  N     . PHE H  4  32   ? 90.458  82.526  -18.001 1.00 57.13  ? 32   PHE B N     1 
ATOM   4226  C  CA    . PHE H  4  32   ? 91.729  82.108  -18.583 1.00 57.93  ? 32   PHE B CA    1 
ATOM   4227  C  C     . PHE H  4  32   ? 92.205  80.786  -18.027 1.00 57.68  ? 32   PHE B C     1 
ATOM   4228  O  O     . PHE H  4  32   ? 92.963  80.081  -18.696 1.00 57.62  ? 32   PHE B O     1 
ATOM   4229  C  CB    . PHE H  4  32   ? 92.804  83.160  -18.355 1.00 59.36  ? 32   PHE B CB    1 
ATOM   4230  C  CG    . PHE H  4  32   ? 93.224  83.858  -19.621 1.00 61.13  ? 32   PHE B CG    1 
ATOM   4231  C  CD1   . PHE H  4  32   ? 93.019  85.253  -19.770 1.00 62.53  ? 32   PHE B CD1   1 
ATOM   4232  C  CD2   . PHE H  4  32   ? 93.816  83.129  -20.682 1.00 61.64  ? 32   PHE B CD2   1 
ATOM   4233  C  CE1   . PHE H  4  32   ? 93.398  85.932  -20.967 1.00 62.37  ? 32   PHE B CE1   1 
ATOM   4234  C  CE2   . PHE H  4  32   ? 94.206  83.784  -21.894 1.00 62.74  ? 32   PHE B CE2   1 
ATOM   4235  C  CZ    . PHE H  4  32   ? 93.995  85.197  -22.036 1.00 62.96  ? 32   PHE B CZ    1 
ATOM   4236  N  N     . GLY H  4  33   ? 91.778  80.449  -16.813 1.00 56.70  ? 33   GLY B N     1 
ATOM   4237  C  CA    . GLY H  4  33   ? 92.150  79.171  -16.236 1.00 55.33  ? 33   GLY B CA    1 
ATOM   4238  C  C     . GLY H  4  33   ? 91.684  78.040  -17.127 1.00 55.05  ? 33   GLY B C     1 
ATOM   4239  O  O     . GLY H  4  33   ? 92.369  77.040  -17.294 1.00 53.99  ? 33   GLY B O     1 
ATOM   4240  N  N     . VAL H  4  34   ? 90.505  78.217  -17.712 1.00 55.47  ? 34   VAL B N     1 
ATOM   4241  C  CA    . VAL H  4  34   ? 89.921  77.235  -18.620 1.00 56.65  ? 34   VAL B CA    1 
ATOM   4242  C  C     . VAL H  4  34   ? 90.633  77.255  -19.975 1.00 58.02  ? 34   VAL B C     1 
ATOM   4243  O  O     . VAL H  4  34   ? 90.830  76.216  -20.612 1.00 57.88  ? 34   VAL B O     1 
ATOM   4244  C  CB    . VAL H  4  34   ? 88.422  77.526  -18.882 1.00 55.88  ? 34   VAL B CB    1 
ATOM   4245  C  CG1   . VAL H  4  34   ? 87.771  76.313  -19.555 1.00 55.49  ? 34   VAL B CG1   1 
ATOM   4246  C  CG2   . VAL H  4  34   ? 87.722  77.869  -17.588 1.00 54.80  ? 34   VAL B CG2   1 
ATOM   4247  N  N     . THR H  4  35   ? 91.012  78.460  -20.402 1.00 59.62  ? 35   THR B N     1 
ATOM   4248  C  CA    . THR H  4  35   ? 91.686  78.693  -21.684 1.00 60.73  ? 35   THR B CA    1 
ATOM   4249  C  C     . THR H  4  35   ? 93.088  78.056  -21.714 1.00 60.60  ? 35   THR B C     1 
ATOM   4250  O  O     . THR H  4  35   ? 93.588  77.668  -22.769 1.00 59.66  ? 35   THR B O     1 
ATOM   4251  C  CB    . THR H  4  35   ? 91.792  80.229  -21.960 1.00 61.92  ? 35   THR B CB    1 
ATOM   4252  O  OG1   . THR H  4  35   ? 90.482  80.820  -21.845 1.00 61.35  ? 35   THR B OG1   1 
ATOM   4253  C  CG2   . THR H  4  35   ? 92.331  80.501  -23.372 1.00 62.35  ? 35   THR B CG2   1 
ATOM   4254  N  N     . LEU H  4  36   ? 93.717  77.955  -20.550 1.00 60.71  ? 36   LEU B N     1 
ATOM   4255  C  CA    . LEU H  4  36   ? 95.039  77.353  -20.457 1.00 60.39  ? 36   LEU B CA    1 
ATOM   4256  C  C     . LEU H  4  36   ? 94.945  75.872  -20.094 1.00 60.96  ? 36   LEU B C     1 
ATOM   4257  O  O     . LEU H  4  36   ? 95.579  75.034  -20.723 1.00 61.12  ? 36   LEU B O     1 
ATOM   4258  C  CB    . LEU H  4  36   ? 95.882  78.063  -19.393 1.00 58.37  ? 36   LEU B CB    1 
ATOM   4259  C  CG    . LEU H  4  36   ? 96.239  79.531  -19.561 1.00 56.76  ? 36   LEU B CG    1 
ATOM   4260  C  CD1   . LEU H  4  36   ? 97.034  79.962  -18.351 1.00 56.13  ? 36   LEU B CD1   1 
ATOM   4261  C  CD2   . LEU H  4  36   ? 97.025  79.738  -20.846 1.00 55.92  ? 36   LEU B CD2   1 
ATOM   4262  N  N     . GLY H  4  37   ? 94.144  75.564  -19.075 1.00 61.32  ? 37   GLY B N     1 
ATOM   4263  C  CA    . GLY H  4  37   ? 93.987  74.198  -18.596 1.00 61.69  ? 37   GLY B CA    1 
ATOM   4264  C  C     . GLY H  4  37   ? 93.569  73.165  -19.636 1.00 62.20  ? 37   GLY B C     1 
ATOM   4265  O  O     . GLY H  4  37   ? 94.196  72.101  -19.734 1.00 62.55  ? 37   GLY B O     1 
ATOM   4266  N  N     . ASN H  4  38   ? 92.523  73.454  -20.406 1.00 62.06  ? 38   ASN B N     1 
ATOM   4267  C  CA    . ASN H  4  38   ? 92.028  72.516  -21.411 1.00 60.91  ? 38   ASN B CA    1 
ATOM   4268  C  C     . ASN H  4  38   ? 93.113  72.165  -22.436 1.00 59.95  ? 38   ASN B C     1 
ATOM   4269  O  O     . ASN H  4  38   ? 93.398  70.981  -22.631 1.00 59.46  ? 38   ASN B O     1 
ATOM   4270  C  CB    . ASN H  4  38   ? 90.783  73.132  -22.077 1.00 63.39  ? 38   ASN B CB    1 
ATOM   4271  C  CG    . ASN H  4  38   ? 90.188  72.270  -23.174 1.00 66.14  ? 38   ASN B CG    1 
ATOM   4272  O  OD1   . ASN H  4  38   ? 90.582  71.112  -23.367 1.00 68.09  ? 38   ASN B OD1   1 
ATOM   4273  N  ND2   . ASN H  4  38   ? 89.223  72.838  -23.907 1.00 65.06  ? 38   ASN B ND2   1 
ATOM   4274  N  N     . PRO H  4  39   ? 93.731  73.176  -23.100 1.00 59.60  ? 39   PRO B N     1 
ATOM   4275  C  CA    . PRO H  4  39   ? 94.785  72.881  -24.095 1.00 58.72  ? 39   PRO B CA    1 
ATOM   4276  C  C     . PRO H  4  39   ? 95.933  72.050  -23.504 1.00 56.70  ? 39   PRO B C     1 
ATOM   4277  O  O     . PRO H  4  39   ? 96.353  71.070  -24.117 1.00 56.29  ? 39   PRO B O     1 
ATOM   4278  C  CB    . PRO H  4  39   ? 95.220  74.265  -24.571 1.00 59.49  ? 39   PRO B CB    1 
ATOM   4279  C  CG    . PRO H  4  39   ? 93.931  75.064  -24.441 1.00 60.02  ? 39   PRO B CG    1 
ATOM   4280  C  CD    . PRO H  4  39   ? 93.419  74.623  -23.096 1.00 59.60  ? 39   PRO B CD    1 
ATOM   4281  N  N     . LEU H  4  40   ? 96.441  72.442  -22.333 1.00 54.80  ? 40   LEU B N     1 
ATOM   4282  C  CA    . LEU H  4  40   ? 97.491  71.676  -21.664 1.00 52.65  ? 40   LEU B CA    1 
ATOM   4283  C  C     . LEU H  4  40   ? 97.036  70.248  -21.445 1.00 52.95  ? 40   LEU B C     1 
ATOM   4284  O  O     . LEU H  4  40   ? 97.829  69.349  -21.578 1.00 51.80  ? 40   LEU B O     1 
ATOM   4285  C  CB    . LEU H  4  40   ? 97.853  72.279  -20.308 1.00 49.94  ? 40   LEU B CB    1 
ATOM   4286  C  CG    . LEU H  4  40   ? 98.760  73.493  -20.248 1.00 47.73  ? 40   LEU B CG    1 
ATOM   4287  C  CD1   . LEU H  4  40   ? 98.245  74.340  -19.144 1.00 47.95  ? 40   LEU B CD1   1 
ATOM   4288  C  CD2   . LEU H  4  40   ? 100.196 73.124  -20.042 1.00 45.50  ? 40   LEU B CD2   1 
ATOM   4289  N  N     . ARG H  4  41   ? 95.756  70.047  -21.111 1.00 54.00  ? 41   ARG B N     1 
ATOM   4290  C  CA    . ARG H  4  41   ? 95.205  68.700  -20.931 1.00 55.11  ? 41   ARG B CA    1 
ATOM   4291  C  C     . ARG H  4  41   ? 95.289  67.909  -22.233 1.00 55.85  ? 41   ARG B C     1 
ATOM   4292  O  O     . ARG H  4  41   ? 95.799  66.786  -22.263 1.00 56.93  ? 41   ARG B O     1 
ATOM   4293  C  CB    . ARG H  4  41   ? 93.722  68.748  -20.478 1.00 56.17  ? 41   ARG B CB    1 
ATOM   4294  C  CG    . ARG H  4  41   ? 92.801  67.573  -21.028 1.00 58.36  ? 41   ARG B CG    1 
ATOM   4295  C  CD    . ARG H  4  41   ? 91.882  66.828  -19.987 1.00 59.32  ? 41   ARG B CD    1 
ATOM   4296  N  NE    . ARG H  4  41   ? 90.927  65.868  -20.596 1.00 60.41  ? 41   ARG B NE    1 
ATOM   4297  C  CZ    . ARG H  4  41   ? 90.450  64.752  -20.016 1.00 60.59  ? 41   ARG B CZ    1 
ATOM   4298  N  NH1   . ARG H  4  41   ? 90.831  64.399  -18.792 1.00 60.12  ? 41   ARG B NH1   1 
ATOM   4299  N  NH2   . ARG H  4  41   ? 89.574  63.978  -20.663 1.00 58.90  ? 41   ARG B NH2   1 
ATOM   4300  N  N     . ARG H  4  42   ? 94.781  68.505  -23.308 1.00 56.05  ? 42   ARG B N     1 
ATOM   4301  C  CA    . ARG H  4  42   ? 94.778  67.858  -24.617 1.00 56.75  ? 42   ARG B CA    1 
ATOM   4302  C  C     . ARG H  4  42   ? 96.178  67.456  -25.039 1.00 56.75  ? 42   ARG B C     1 
ATOM   4303  O  O     . ARG H  4  42   ? 96.358  66.450  -25.705 1.00 57.23  ? 42   ARG B O     1 
ATOM   4304  C  CB    . ARG H  4  42   ? 94.168  68.791  -25.670 1.00 56.84  ? 42   ARG B CB    1 
ATOM   4305  C  CG    . ARG H  4  42   ? 92.652  68.876  -25.599 1.00 58.63  ? 42   ARG B CG    1 
ATOM   4306  C  CD    . ARG H  4  42   ? 91.954  68.014  -26.668 1.00 58.93  ? 42   ARG B CD    1 
ATOM   4307  N  NE    . ARG H  4  42   ? 92.721  66.853  -27.149 1.00 58.51  ? 42   ARG B NE    1 
ATOM   4308  C  CZ    . ARG H  4  42   ? 93.064  65.783  -26.429 1.00 57.76  ? 42   ARG B CZ    1 
ATOM   4309  N  NH1   . ARG H  4  42   ? 92.726  65.680  -25.150 1.00 56.79  ? 42   ARG B NH1   1 
ATOM   4310  N  NH2   . ARG H  4  42   ? 93.749  64.799  -27.003 1.00 57.99  ? 42   ARG B NH2   1 
ATOM   4311  N  N     . ILE H  4  43   ? 97.166  68.247  -24.648 1.00 56.50  ? 43   ILE B N     1 
ATOM   4312  C  CA    . ILE H  4  43   ? 98.557  67.973  -24.986 1.00 56.38  ? 43   ILE B CA    1 
ATOM   4313  C  C     . ILE H  4  43   ? 99.116  66.874  -24.110 1.00 55.96  ? 43   ILE B C     1 
ATOM   4314  O  O     . ILE H  4  43   ? 99.707  65.934  -24.603 1.00 56.07  ? 43   ILE B O     1 
ATOM   4315  C  CB    . ILE H  4  43   ? 99.443  69.265  -24.810 1.00 58.02  ? 43   ILE B CB    1 
ATOM   4316  C  CG1   . ILE H  4  43   ? 99.193  70.238  -25.979 1.00 58.39  ? 43   ILE B CG1   1 
ATOM   4317  C  CG2   . ILE H  4  43   ? 100.920 68.905  -24.729 1.00 58.90  ? 43   ILE B CG2   1 
ATOM   4318  C  CD1   . ILE H  4  43   ? 99.522  69.696  -27.366 1.00 58.62  ? 43   ILE B CD1   1 
ATOM   4319  N  N     . LEU H  4  44   ? 98.906  67.022  -22.808 1.00 56.00  ? 44   LEU B N     1 
ATOM   4320  C  CA    . LEU H  4  44   ? 99.403  66.112  -21.777 1.00 56.54  ? 44   LEU B CA    1 
ATOM   4321  C  C     . LEU H  4  44   ? 98.965  64.664  -22.016 1.00 57.77  ? 44   LEU B C     1 
ATOM   4322  O  O     . LEU H  4  44   ? 99.607  63.734  -21.517 1.00 57.57  ? 44   LEU B O     1 
ATOM   4323  C  CB    . LEU H  4  44   ? 98.930  66.600  -20.388 1.00 54.68  ? 44   LEU B CB    1 
ATOM   4324  C  CG    . LEU H  4  44   ? 99.524  67.944  -19.889 1.00 51.66  ? 44   LEU B CG    1 
ATOM   4325  C  CD1   . LEU H  4  44   ? 98.652  68.496  -18.799 1.00 49.93  ? 44   LEU B CD1   1 
ATOM   4326  C  CD2   . LEU H  4  44   ? 100.937 67.780  -19.419 1.00 49.89  ? 44   LEU B CD2   1 
ATOM   4327  N  N     . LEU H  4  45   ? 97.897  64.451  -22.775 1.00 60.77  ? 45   LEU B N     1 
ATOM   4328  C  CA    . LEU H  4  45   ? 97.462  63.076  -23.006 1.00 63.77  ? 45   LEU B CA    1 
ATOM   4329  C  C     . LEU H  4  45   ? 97.974  62.519  -24.339 1.00 65.75  ? 45   LEU B C     1 
ATOM   4330  O  O     . LEU H  4  45   ? 98.459  61.388  -24.399 1.00 66.61  ? 45   LEU B O     1 
ATOM   4331  C  CB    . LEU H  4  45   ? 95.930  62.980  -22.994 1.00 64.14  ? 45   LEU B CB    1 
ATOM   4332  C  CG    . LEU H  4  45   ? 95.316  61.637  -23.443 1.00 64.67  ? 45   LEU B CG    1 
ATOM   4333  C  CD1   . LEU H  4  45   ? 94.094  61.330  -22.599 1.00 66.53  ? 45   LEU B CD1   1 
ATOM   4334  C  CD2   . LEU H  4  45   ? 94.919  61.693  -24.906 1.00 64.15  ? 45   LEU B CD2   1 
ATOM   4335  N  N     . SER H  4  46   ? 97.867  63.301  -25.408 1.00 67.95  ? 46   SER B N     1 
ATOM   4336  C  CA    . SER H  4  46   ? 98.251  62.820  -26.733 1.00 68.57  ? 46   SER B CA    1 
ATOM   4337  C  C     . SER H  4  46   ? 99.692  63.191  -27.095 1.00 69.29  ? 46   SER B C     1 
ATOM   4338  O  O     . SER H  4  46   ? 100.451 62.324  -27.529 1.00 68.09  ? 46   SER B O     1 
ATOM   4339  C  CB    . SER H  4  46   ? 97.270  63.386  -27.793 1.00 70.09  ? 46   SER B CB    1 
ATOM   4340  O  OG    . SER H  4  46   ? 95.904  63.050  -27.524 1.00 69.06  ? 46   SER B OG    1 
ATOM   4341  N  N     . SER H  4  47   ? 100.053 64.462  -26.904 1.00 70.46  ? 47   SER B N     1 
ATOM   4342  C  CA    . SER H  4  47   ? 101.369 64.995  -27.282 1.00 72.83  ? 47   SER B CA    1 
ATOM   4343  C  C     . SER H  4  47   ? 102.526 64.173  -26.729 1.00 73.13  ? 47   SER B C     1 
ATOM   4344  O  O     . SER H  4  47   ? 103.206 63.543  -27.538 1.00 74.55  ? 47   SER B O     1 
ATOM   4345  C  CB    . SER H  4  47   ? 101.529 66.464  -26.843 1.00 73.34  ? 47   SER B CB    1 
ATOM   4346  O  OG    . SER H  4  47   ? 102.392 66.614  -25.723 1.00 72.95  ? 47   SER B OG    1 
ATOM   4347  N  N     . ILE H  4  48   ? 102.768 64.169  -25.408 1.00 73.50  ? 48   ILE B N     1 
ATOM   4348  C  CA    . ILE H  4  48   ? 103.902 63.419  -24.833 1.00 73.01  ? 48   ILE B CA    1 
ATOM   4349  C  C     . ILE H  4  48   ? 103.931 61.969  -25.378 1.00 74.13  ? 48   ILE B C     1 
ATOM   4350  O  O     . ILE H  4  48   ? 103.306 61.053  -24.824 1.00 73.69  ? 48   ILE B O     1 
ATOM   4351  C  CB    . ILE H  4  48   ? 103.847 63.427  -23.257 1.00 71.02  ? 48   ILE B CB    1 
ATOM   4352  C  CG1   . ILE H  4  48   ? 104.164 64.829  -22.727 1.00 68.57  ? 48   ILE B CG1   1 
ATOM   4353  C  CG2   . ILE H  4  48   ? 104.912 62.486  -22.669 1.00 70.55  ? 48   ILE B CG2   1 
ATOM   4354  C  CD1   . ILE H  4  48   ? 103.109 65.859  -22.980 1.00 67.89  ? 48   ILE B CD1   1 
ATOM   4355  N  N     . PRO H  4  49   ? 104.688 61.762  -26.480 1.00 75.14  ? 49   PRO B N     1 
ATOM   4356  C  CA    . PRO H  4  49   ? 104.807 60.467  -27.140 1.00 75.78  ? 49   PRO B CA    1 
ATOM   4357  C  C     . PRO H  4  49   ? 105.232 59.423  -26.175 1.00 76.25  ? 49   PRO B C     1 
ATOM   4358  O  O     . PRO H  4  49   ? 105.676 59.750  -25.074 1.00 75.69  ? 49   PRO B O     1 
ATOM   4359  C  CB    . PRO H  4  49   ? 105.841 60.704  -28.244 1.00 76.42  ? 49   PRO B CB    1 
ATOM   4360  C  CG    . PRO H  4  49   ? 106.221 62.175  -28.129 1.00 76.62  ? 49   PRO B CG    1 
ATOM   4361  C  CD    . PRO H  4  49   ? 105.930 62.519  -26.712 1.00 75.79  ? 49   PRO B CD    1 
ATOM   4362  N  N     . GLY H  4  50   ? 105.111 58.166  -26.565 1.00 76.15  ? 50   GLY B N     1 
ATOM   4363  C  CA    . GLY H  4  50   ? 105.511 57.156  -25.627 1.00 76.45  ? 50   GLY B CA    1 
ATOM   4364  C  C     . GLY H  4  50   ? 105.842 55.833  -26.239 1.00 77.01  ? 50   GLY B C     1 
ATOM   4365  O  O     . GLY H  4  50   ? 106.291 55.720  -27.383 1.00 76.67  ? 50   GLY B O     1 
ATOM   4366  N  N     . THR H  4  51   ? 105.596 54.821  -25.419 1.00 77.07  ? 51   THR B N     1 
ATOM   4367  C  CA    . THR H  4  51   ? 105.886 53.446  -25.754 1.00 77.55  ? 51   THR B CA    1 
ATOM   4368  C  C     . THR H  4  51   ? 104.796 52.493  -25.222 1.00 77.54  ? 51   THR B C     1 
ATOM   4369  O  O     . THR H  4  51   ? 104.334 52.613  -24.086 1.00 77.52  ? 51   THR B O     1 
ATOM   4370  C  CB    . THR H  4  51   ? 107.249 53.053  -25.144 1.00 77.30  ? 51   THR B CB    1 
ATOM   4371  O  OG1   . THR H  4  51   ? 107.142 53.091  -23.713 1.00 77.84  ? 51   THR B OG1   1 
ATOM   4372  C  CG2   . THR H  4  51   ? 108.350 54.031  -25.572 1.00 76.30  ? 51   THR B CG2   1 
ATOM   4373  N  N     . ALA H  4  52   ? 104.403 51.548  -26.067 1.00 77.18  ? 52   ALA B N     1 
ATOM   4374  C  CA    . ALA H  4  52   ? 103.413 50.534  -25.729 1.00 77.53  ? 52   ALA B CA    1 
ATOM   4375  C  C     . ALA H  4  52   ? 103.670 49.262  -26.516 1.00 77.96  ? 52   ALA B C     1 
ATOM   4376  O  O     . ALA H  4  52   ? 104.272 49.321  -27.580 1.00 77.51  ? 52   ALA B O     1 
ATOM   4377  C  CB    . ALA H  4  52   ? 102.048 51.030  -26.047 1.00 77.38  ? 52   ALA B CB    1 
ATOM   4378  N  N     . VAL H  4  53   ? 103.220 48.118  -26.002 1.00 78.96  ? 53   VAL B N     1 
ATOM   4379  C  CA    . VAL H  4  53   ? 103.401 46.835  -26.707 1.00 79.74  ? 53   VAL B CA    1 
ATOM   4380  C  C     . VAL H  4  53   ? 102.491 46.770  -27.936 1.00 79.58  ? 53   VAL B C     1 
ATOM   4381  O  O     . VAL H  4  53   ? 101.263 46.788  -27.809 1.00 80.47  ? 53   VAL B O     1 
ATOM   4382  C  CB    . VAL H  4  53   ? 103.087 45.606  -25.772 1.00 80.46  ? 53   VAL B CB    1 
ATOM   4383  C  CG1   . VAL H  4  53   ? 103.196 44.286  -26.579 1.00 79.36  ? 53   VAL B CG1   1 
ATOM   4384  C  CG2   . VAL H  4  53   ? 104.073 45.575  -24.597 1.00 80.52  ? 53   VAL B CG2   1 
ATOM   4385  N  N     . THR H  4  54   ? 103.088 46.685  -29.121 1.00 78.72  ? 54   THR B N     1 
ATOM   4386  C  CA    . THR H  4  54   ? 102.306 46.710  -30.356 1.00 77.89  ? 54   THR B CA    1 
ATOM   4387  C  C     . THR H  4  54   ? 101.926 45.307  -30.851 1.00 76.51  ? 54   THR B C     1 
ATOM   4388  O  O     . THR H  4  54   ? 100.908 45.163  -31.526 1.00 75.29  ? 54   THR B O     1 
ATOM   4389  C  CB    . THR H  4  54   ? 103.076 47.475  -31.450 1.00 78.54  ? 54   THR B CB    1 
ATOM   4390  O  OG1   . THR H  4  54   ? 103.365 48.804  -30.987 1.00 78.53  ? 54   THR B OG1   1 
ATOM   4391  C  CG2   . THR H  4  54   ? 102.220 47.644  -32.677 1.00 79.04  ? 54   THR B CG2   1 
ATOM   4392  N  N     . SER H  4  55   ? 102.719 44.283  -30.536 1.00 76.57  ? 55   SER B N     1 
ATOM   4393  C  CA    . SER H  4  55   ? 102.384 42.919  -30.959 1.00 75.96  ? 55   SER B CA    1 
ATOM   4394  C  C     . SER H  4  55   ? 103.079 41.880  -30.082 1.00 75.64  ? 55   SER B C     1 
ATOM   4395  O  O     . SER H  4  55   ? 104.033 42.191  -29.367 1.00 75.54  ? 55   SER B O     1 
ATOM   4396  C  CB    . SER H  4  55   ? 102.775 42.698  -32.432 1.00 76.14  ? 55   SER B CB    1 
ATOM   4397  O  OG    . SER H  4  55   ? 104.129 42.323  -32.588 1.00 75.87  ? 55   SER B OG    1 
ATOM   4398  N  N     . VAL H  4  56   ? 102.593 40.645  -30.124 1.00 74.57  ? 56   VAL B N     1 
ATOM   4399  C  CA    . VAL H  4  56   ? 103.190 39.585  -29.321 1.00 74.63  ? 56   VAL B CA    1 
ATOM   4400  C  C     . VAL H  4  56   ? 103.157 38.253  -30.057 1.00 74.04  ? 56   VAL B C     1 
ATOM   4401  O  O     . VAL H  4  56   ? 102.297 38.018  -30.907 1.00 73.68  ? 56   VAL B O     1 
ATOM   4402  C  CB    . VAL H  4  56   ? 102.443 39.413  -27.964 1.00 75.58  ? 56   VAL B CB    1 
ATOM   4403  C  CG1   . VAL H  4  56   ? 103.229 38.459  -27.053 1.00 75.86  ? 56   VAL B CG1   1 
ATOM   4404  C  CG2   . VAL H  4  56   ? 102.284 40.771  -27.273 1.00 75.23  ? 56   VAL B CG2   1 
ATOM   4405  N  N     . TYR H  4  57   ? 104.096 37.377  -29.730 1.00 73.64  ? 57   TYR B N     1 
ATOM   4406  C  CA    . TYR H  4  57   ? 104.099 36.098  -30.386 1.00 74.24  ? 57   TYR B CA    1 
ATOM   4407  C  C     . TYR H  4  57   ? 104.482 34.970  -29.465 1.00 73.22  ? 57   TYR B C     1 
ATOM   4408  O  O     . TYR H  4  57   ? 105.651 34.817  -29.106 1.00 72.73  ? 57   TYR B O     1 
ATOM   4409  C  CB    . TYR H  4  57   ? 105.063 36.064  -31.562 1.00 75.21  ? 57   TYR B CB    1 
ATOM   4410  C  CG    . TYR H  4  57   ? 105.005 34.733  -32.287 1.00 76.94  ? 57   TYR B CG    1 
ATOM   4411  C  CD1   . TYR H  4  57   ? 103.754 34.118  -32.565 1.00 77.90  ? 57   TYR B CD1   1 
ATOM   4412  C  CD2   . TYR H  4  57   ? 106.181 34.088  -32.721 1.00 77.18  ? 57   TYR B CD2   1 
ATOM   4413  C  CE1   . TYR H  4  57   ? 103.671 32.892  -33.260 1.00 78.68  ? 57   TYR B CE1   1 
ATOM   4414  C  CE2   . TYR H  4  57   ? 106.112 32.848  -33.427 1.00 78.87  ? 57   TYR B CE2   1 
ATOM   4415  C  CZ    . TYR H  4  57   ? 104.847 32.266  -33.689 1.00 79.23  ? 57   TYR B CZ    1 
ATOM   4416  O  OH    . TYR H  4  57   ? 104.741 31.084  -34.381 1.00 79.93  ? 57   TYR B OH    1 
ATOM   4417  N  N     . ILE H  4  58   ? 103.485 34.180  -29.079 1.00 73.44  ? 58   ILE B N     1 
ATOM   4418  C  CA    . ILE H  4  58   ? 103.787 32.984  -28.325 1.00 72.50  ? 58   ILE B CA    1 
ATOM   4419  C  C     . ILE H  4  58   ? 104.119 31.890  -29.314 1.00 72.54  ? 58   ILE B C     1 
ATOM   4420  O  O     . ILE H  4  58   ? 103.408 31.733  -30.309 1.00 71.48  ? 58   ILE B O     1 
ATOM   4421  C  CB    . ILE H  4  58   ? 102.601 32.502  -27.435 1.00 72.15  ? 58   ILE B CB    1 
ATOM   4422  C  CG1   . ILE H  4  58   ? 102.168 33.598  -26.449 1.00 72.03  ? 58   ILE B CG1   1 
ATOM   4423  C  CG2   . ILE H  4  58   ? 103.042 31.250  -26.661 1.00 71.52  ? 58   ILE B CG2   1 
ATOM   4424  C  CD1   . ILE H  4  58   ? 103.199 33.982  -25.372 1.00 71.89  ? 58   ILE B CD1   1 
ATOM   4425  N  N     . GLU H  4  59   ? 105.180 31.142  -29.062 1.00 73.00  ? 59   GLU B N     1 
ATOM   4426  C  CA    . GLU H  4  59   ? 105.630 30.169  -30.038 1.00 72.95  ? 59   GLU B CA    1 
ATOM   4427  C  C     . GLU H  4  59   ? 104.583 29.115  -30.377 1.00 72.32  ? 59   GLU B C     1 
ATOM   4428  O  O     . GLU H  4  59   ? 104.307 28.929  -31.559 1.00 71.81  ? 59   GLU B O     1 
ATOM   4429  C  CB    . GLU H  4  59   ? 106.926 29.539  -29.552 1.00 73.99  ? 59   GLU B CB    1 
ATOM   4430  C  CG    . GLU H  4  59   ? 108.068 30.566  -29.567 1.00 74.86  ? 59   GLU B CG    1 
ATOM   4431  C  CD    . GLU H  4  59   ? 108.672 30.847  -30.959 1.00 75.36  ? 59   GLU B CD    1 
ATOM   4432  O  OE1   . GLU H  4  59   ? 109.504 30.043  -31.435 1.00 74.06  ? 59   GLU B OE1   1 
ATOM   4433  O  OE2   . GLU H  4  59   ? 108.317 31.878  -31.578 1.00 75.91  ? 59   GLU B OE2   1 
ATOM   4434  N  N     . ASP H  4  60   ? 103.982 28.434  -29.414 1.00 71.96  ? 60   ASP B N     1 
ATOM   4435  C  CA    . ASP H  4  60   ? 103.022 27.399  -29.796 1.00 72.78  ? 60   ASP B CA    1 
ATOM   4436  C  C     . ASP H  4  60   ? 101.597 27.948  -29.945 1.00 73.62  ? 60   ASP B C     1 
ATOM   4437  O  O     . ASP H  4  60   ? 100.702 27.209  -30.395 1.00 74.30  ? 60   ASP B O     1 
ATOM   4438  C  CB    . ASP H  4  60   ? 103.041 26.280  -28.765 1.00 72.17  ? 60   ASP B CB    1 
ATOM   4439  C  CG    . ASP H  4  60   ? 104.239 26.377  -27.866 1.00 72.23  ? 60   ASP B CG    1 
ATOM   4440  O  OD1   . ASP H  4  60   ? 104.295 27.345  -27.065 1.00 71.72  ? 60   ASP B OD1   1 
ATOM   4441  O  OD2   . ASP H  4  60   ? 105.120 25.496  -27.970 1.00 71.85  ? 60   ASP B OD2   1 
ATOM   4442  N  N     . VAL H  4  61   ? 101.372 29.217  -29.590 1.00 72.63  ? 61   VAL B N     1 
ATOM   4443  C  CA    . VAL H  4  61   ? 100.025 29.788  -29.692 1.00 72.06  ? 61   VAL B CA    1 
ATOM   4444  C  C     . VAL H  4  61   ? 99.757  30.380  -31.090 1.00 72.16  ? 61   VAL B C     1 
ATOM   4445  O  O     . VAL H  4  61   ? 100.622 31.012  -31.706 1.00 71.81  ? 61   VAL B O     1 
ATOM   4446  C  CB    . VAL H  4  61   ? 99.802  30.883  -28.613 1.00 71.41  ? 61   VAL B CB    1 
ATOM   4447  C  CG1   . VAL H  4  61   ? 98.382  31.387  -28.674 1.00 70.88  ? 61   VAL B CG1   1 
ATOM   4448  C  CG2   . VAL H  4  61   ? 100.015 30.311  -27.244 1.00 71.17  ? 61   VAL B CG2   1 
ATOM   4449  N  N     . LEU H  4  62   ? 98.541  30.163  -31.578 1.00 71.31  ? 62   LEU B N     1 
ATOM   4450  C  CA    . LEU H  4  62   ? 98.149  30.648  -32.888 1.00 72.14  ? 62   LEU B CA    1 
ATOM   4451  C  C     . LEU H  4  62   ? 97.168  31.824  -32.789 1.00 72.92  ? 62   LEU B C     1 
ATOM   4452  O  O     . LEU H  4  62   ? 97.350  32.837  -33.469 1.00 72.06  ? 62   LEU B O     1 
ATOM   4453  C  CB    . LEU H  4  62   ? 97.524  29.500  -33.694 1.00 72.79  ? 62   LEU B CB    1 
ATOM   4454  C  CG    . LEU H  4  62   ? 97.037  28.193  -33.045 1.00 72.67  ? 62   LEU B CG    1 
ATOM   4455  C  CD1   . LEU H  4  62   ? 95.941  28.492  -32.033 1.00 71.94  ? 62   LEU B CD1   1 
ATOM   4456  C  CD2   . LEU H  4  62   ? 96.519  27.256  -34.144 1.00 71.47  ? 62   LEU B CD2   1 
ATOM   4457  N  N     . HIS H  4  63   ? 96.133  31.697  -31.954 1.00 73.54  ? 63   HIS B N     1 
ATOM   4458  C  CA    . HIS H  4  63   ? 95.144  32.780  -31.805 1.00 75.19  ? 63   HIS B CA    1 
ATOM   4459  C  C     . HIS H  4  63   ? 95.289  33.494  -30.455 1.00 76.28  ? 63   HIS B C     1 
ATOM   4460  O  O     . HIS H  4  63   ? 96.014  33.033  -29.573 1.00 77.69  ? 63   HIS B O     1 
ATOM   4461  C  CB    . HIS H  4  63   ? 93.687  32.276  -31.866 1.00 74.44  ? 63   HIS B CB    1 
ATOM   4462  C  CG    . HIS H  4  63   ? 93.454  31.083  -32.740 1.00 73.57  ? 63   HIS B CG    1 
ATOM   4463  N  ND1   . HIS H  4  63   ? 94.288  30.730  -33.778 1.00 71.95  ? 63   HIS B ND1   1 
ATOM   4464  C  CD2   . HIS H  4  63   ? 92.445  30.180  -32.741 1.00 72.42  ? 63   HIS B CD2   1 
ATOM   4465  C  CE1   . HIS H  4  63   ? 93.801  29.660  -34.381 1.00 72.55  ? 63   HIS B CE1   1 
ATOM   4466  N  NE2   . HIS H  4  63   ? 92.684  29.307  -33.771 1.00 72.67  ? 63   HIS B NE2   1 
ATOM   4467  N  N     . GLU H  4  64   ? 94.577  34.615  -30.307 1.00 76.48  ? 64   GLU B N     1 
ATOM   4468  C  CA    . GLU H  4  64   ? 94.586  35.408  -29.071 1.00 75.98  ? 64   GLU B CA    1 
ATOM   4469  C  C     . GLU H  4  64   ? 93.746  34.740  -27.960 1.00 76.28  ? 64   GLU B C     1 
ATOM   4470  O  O     . GLU H  4  64   ? 93.960  35.008  -26.775 1.00 76.57  ? 64   GLU B O     1 
ATOM   4471  C  CB    . GLU H  4  64   ? 94.017  36.820  -29.335 1.00 74.07  ? 64   GLU B CB    1 
ATOM   4472  C  CG    . GLU H  4  64   ? 93.759  37.667  -28.062 1.00 70.68  ? 64   GLU B CG    1 
ATOM   4473  C  CD    . GLU H  4  64   ? 92.474  38.477  -28.103 1.00 69.16  ? 64   GLU B CD    1 
ATOM   4474  O  OE1   . GLU H  4  64   ? 91.447  37.927  -28.542 1.00 68.43  ? 64   GLU B OE1   1 
ATOM   4475  O  OE2   . GLU H  4  64   ? 92.488  39.660  -27.685 1.00 68.33  ? 64   GLU B OE2   1 
ATOM   4476  N  N     . PHE H  4  65   ? 92.807  33.871  -28.333 1.00 76.96  ? 65   PHE B N     1 
ATOM   4477  C  CA    . PHE H  4  65   ? 91.901  33.250  -27.358 1.00 76.80  ? 65   PHE B CA    1 
ATOM   4478  C  C     . PHE H  4  65   ? 92.379  31.863  -26.923 1.00 77.14  ? 65   PHE B C     1 
ATOM   4479  O  O     . PHE H  4  65   ? 91.555  31.017  -26.576 1.00 77.19  ? 65   PHE B O     1 
ATOM   4480  C  CB    . PHE H  4  65   ? 90.484  33.089  -27.936 1.00 75.28  ? 65   PHE B CB    1 
ATOM   4481  C  CG    . PHE H  4  65   ? 89.975  34.270  -28.713 1.00 74.14  ? 65   PHE B CG    1 
ATOM   4482  C  CD1   . PHE H  4  65   ? 90.553  34.636  -29.947 1.00 73.64  ? 65   PHE B CD1   1 
ATOM   4483  C  CD2   . PHE H  4  65   ? 88.896  35.021  -28.227 1.00 73.55  ? 65   PHE B CD2   1 
ATOM   4484  C  CE1   . PHE H  4  65   ? 90.056  35.753  -30.695 1.00 73.48  ? 65   PHE B CE1   1 
ATOM   4485  C  CE2   . PHE H  4  65   ? 88.383  36.144  -28.961 1.00 73.17  ? 65   PHE B CE2   1 
ATOM   4486  C  CZ    . PHE H  4  65   ? 88.968  36.506  -30.197 1.00 72.31  ? 65   PHE B CZ    1 
ATOM   4487  N  N     . SER H  4  66   ? 93.684  31.620  -26.931 1.00 77.87  ? 66   SER B N     1 
ATOM   4488  C  CA    . SER H  4  66   ? 94.192  30.315  -26.530 1.00 77.99  ? 66   SER B CA    1 
ATOM   4489  C  C     . SER H  4  66   ? 94.710  30.337  -25.092 1.00 78.21  ? 66   SER B C     1 
ATOM   4490  O  O     . SER H  4  66   ? 94.892  31.398  -24.497 1.00 78.14  ? 66   SER B O     1 
ATOM   4491  C  CB    . SER H  4  66   ? 95.333  29.882  -27.460 1.00 78.66  ? 66   SER B CB    1 
ATOM   4492  O  OG    . SER H  4  66   ? 95.139  30.338  -28.789 1.00 78.72  ? 66   SER B OG    1 
ATOM   4493  N  N     . THR H  4  67   ? 94.938  29.146  -24.548 1.00 79.28  ? 67   THR B N     1 
ATOM   4494  C  CA    . THR H  4  67   ? 95.472  28.964  -23.199 1.00 79.91  ? 67   THR B CA    1 
ATOM   4495  C  C     . THR H  4  67   ? 96.708  28.062  -23.239 1.00 79.27  ? 67   THR B C     1 
ATOM   4496  O  O     . THR H  4  67   ? 96.672  27.012  -23.875 1.00 79.83  ? 67   THR B O     1 
ATOM   4497  C  CB    . THR H  4  67   ? 94.379  28.344  -22.255 1.00 80.12  ? 67   THR B CB    1 
ATOM   4498  O  OG1   . THR H  4  67   ? 94.999  27.738  -21.110 1.00 81.00  ? 67   THR B OG1   1 
ATOM   4499  C  CG2   . THR H  4  67   ? 93.548  27.303  -23.008 1.00 79.92  ? 67   THR B CG2   1 
ATOM   4500  N  N     . ILE H  4  68   ? 97.798  28.461  -22.583 1.00 79.02  ? 68   ILE B N     1 
ATOM   4501  C  CA    . ILE H  4  68   ? 99.026  27.657  -22.605 1.00 79.09  ? 68   ILE B CA    1 
ATOM   4502  C  C     . ILE H  4  68   ? 99.141  26.771  -21.353 1.00 79.05  ? 68   ILE B C     1 
ATOM   4503  O  O     . ILE H  4  68   ? 98.946  27.249  -20.232 1.00 79.39  ? 68   ILE B O     1 
ATOM   4504  C  CB    . ILE H  4  68   ? 100.277 28.578  -22.702 1.00 78.63  ? 68   ILE B CB    1 
ATOM   4505  C  CG1   . ILE H  4  68   ? 100.017 29.670  -23.749 1.00 78.71  ? 68   ILE B CG1   1 
ATOM   4506  C  CG2   . ILE H  4  68   ? 101.522 27.753  -23.088 1.00 78.98  ? 68   ILE B CG2   1 
ATOM   4507  C  CD1   . ILE H  4  68   ? 101.092 30.734  -23.847 1.00 78.71  ? 68   ILE B CD1   1 
ATOM   4508  N  N     . PRO H  4  69   ? 99.458  25.463  -21.530 1.00 78.70  ? 69   PRO B N     1 
ATOM   4509  C  CA    . PRO H  4  69   ? 99.592  24.525  -20.400 1.00 78.93  ? 69   PRO B CA    1 
ATOM   4510  C  C     . PRO H  4  69   ? 100.699 24.945  -19.431 1.00 77.76  ? 69   PRO B C     1 
ATOM   4511  O  O     . PRO H  4  69   ? 101.696 25.547  -19.839 1.00 77.89  ? 69   PRO B O     1 
ATOM   4512  C  CB    . PRO H  4  69   ? 99.879  23.180  -21.077 1.00 78.66  ? 69   PRO B CB    1 
ATOM   4513  C  CG    . PRO H  4  69   ? 99.268  23.325  -22.428 1.00 79.20  ? 69   PRO B CG    1 
ATOM   4514  C  CD    . PRO H  4  69   ? 99.659  24.742  -22.802 1.00 79.05  ? 69   PRO B CD    1 
ATOM   4515  N  N     . GLY H  4  70   ? 100.521 24.622  -18.153 1.00 76.78  ? 70   GLY B N     1 
ATOM   4516  C  CA    . GLY H  4  70   ? 101.519 24.984  -17.163 1.00 75.69  ? 70   GLY B CA    1 
ATOM   4517  C  C     . GLY H  4  70   ? 101.528 26.473  -16.904 1.00 75.53  ? 70   GLY B C     1 
ATOM   4518  O  O     . GLY H  4  70   ? 102.372 26.988  -16.173 1.00 74.92  ? 70   GLY B O     1 
ATOM   4519  N  N     . VAL H  4  71   ? 100.577 27.166  -17.522 1.00 75.61  ? 71   VAL B N     1 
ATOM   4520  C  CA    . VAL H  4  71   ? 100.434 28.609  -17.365 1.00 75.16  ? 71   VAL B CA    1 
ATOM   4521  C  C     . VAL H  4  71   ? 99.014  28.958  -16.948 1.00 73.45  ? 71   VAL B C     1 
ATOM   4522  O  O     . VAL H  4  71   ? 98.074  28.811  -17.723 1.00 72.53  ? 71   VAL B O     1 
ATOM   4523  C  CB    . VAL H  4  71   ? 100.800 29.377  -18.708 1.00 75.53  ? 71   VAL B CB    1 
ATOM   4524  C  CG1   . VAL H  4  71   ? 100.431 30.857  -18.603 1.00 76.49  ? 71   VAL B CG1   1 
ATOM   4525  C  CG2   . VAL H  4  71   ? 102.315 29.274  -18.986 1.00 75.05  ? 71   VAL B CG2   1 
ATOM   4526  N  N     . LYS H  4  72   ? 98.883  29.406  -15.705 1.00 72.69  ? 72   LYS B N     1 
ATOM   4527  C  CA    . LYS H  4  72   ? 97.604  29.801  -15.152 1.00 72.93  ? 72   LYS B CA    1 
ATOM   4528  C  C     . LYS H  4  72   ? 96.880  30.775  -16.084 1.00 73.46  ? 72   LYS B C     1 
ATOM   4529  O  O     . LYS H  4  72   ? 95.776  30.481  -16.563 1.00 74.19  ? 72   LYS B O     1 
ATOM   4530  C  CB    . LYS H  4  72   ? 97.827  30.449  -13.770 1.00 70.10  ? 72   LYS B CB    1 
ATOM   4531  C  CG    . LYS H  4  72   ? 96.581  31.005  -13.052 1.00 67.70  ? 72   LYS B CG    1 
ATOM   4532  C  CD    . LYS H  4  72   ? 96.457  32.547  -13.203 1.00 66.28  ? 72   LYS B CD    1 
ATOM   4533  C  CE    . LYS H  4  72   ? 95.399  33.180  -12.274 1.00 63.67  ? 72   LYS B CE    1 
ATOM   4534  N  NZ    . LYS H  4  72   ? 95.283  34.666  -12.431 1.00 61.48  ? 72   LYS B NZ    1 
ATOM   4535  N  N     . GLU H  4  73   ? 97.519  31.916  -16.350 1.00 75.08  ? 73   GLU B N     1 
ATOM   4536  C  CA    . GLU H  4  73   ? 96.945  32.979  -17.187 1.00 74.97  ? 73   GLU B CA    1 
ATOM   4537  C  C     . GLU H  4  73   ? 96.684  32.514  -18.614 1.00 75.70  ? 73   GLU B C     1 
ATOM   4538  O  O     . GLU H  4  73   ? 97.398  31.675  -19.167 1.00 75.99  ? 73   GLU B O     1 
ATOM   4539  C  CB    . GLU H  4  73   ? 97.871  34.203  -17.268 1.00 74.01  ? 73   GLU B CB    1 
ATOM   4540  C  CG    . GLU H  4  73   ? 99.104  34.150  -16.409 1.00 73.59  ? 73   GLU B CG    1 
ATOM   4541  C  CD    . GLU H  4  73   ? 98.834  34.616  -14.994 1.00 74.21  ? 73   GLU B CD    1 
ATOM   4542  O  OE1   . GLU H  4  73   ? 99.630  34.269  -14.095 1.00 75.48  ? 73   GLU B OE1   1 
ATOM   4543  O  OE2   . GLU H  4  73   ? 97.828  35.333  -14.780 1.00 72.62  ? 73   GLU B OE2   1 
ATOM   4544  N  N     . ASP H  4  74   ? 95.638  33.097  -19.190 1.00 76.47  ? 74   ASP B N     1 
ATOM   4545  C  CA    . ASP H  4  74   ? 95.237  32.861  -20.568 1.00 76.53  ? 74   ASP B CA    1 
ATOM   4546  C  C     . ASP H  4  74   ? 95.920  33.893  -21.476 1.00 76.17  ? 74   ASP B C     1 
ATOM   4547  O  O     . ASP H  4  74   ? 96.254  34.986  -21.005 1.00 76.68  ? 74   ASP B O     1 
ATOM   4548  C  CB    . ASP H  4  74   ? 93.700  32.982  -20.655 1.00 77.34  ? 74   ASP B CB    1 
ATOM   4549  C  CG    . ASP H  4  74   ? 93.115  32.414  -21.930 1.00 77.93  ? 74   ASP B CG    1 
ATOM   4550  O  OD1   . ASP H  4  74   ? 93.281  31.198  -22.171 1.00 78.41  ? 74   ASP B OD1   1 
ATOM   4551  O  OD2   . ASP H  4  74   ? 92.477  33.187  -22.684 1.00 78.94  ? 74   ASP B OD2   1 
ATOM   4552  N  N     . VAL H  4  75   ? 96.142  33.564  -22.746 1.00 74.37  ? 75   VAL B N     1 
ATOM   4553  C  CA    . VAL H  4  75   ? 96.783  34.493  -23.674 1.00 72.29  ? 75   VAL B CA    1 
ATOM   4554  C  C     . VAL H  4  75   ? 96.199  35.910  -23.542 1.00 72.01  ? 75   VAL B C     1 
ATOM   4555  O  O     . VAL H  4  75   ? 96.943  36.888  -23.535 1.00 72.16  ? 75   VAL B O     1 
ATOM   4556  C  CB    . VAL H  4  75   ? 96.626  33.983  -25.138 1.00 70.62  ? 75   VAL B CB    1 
ATOM   4557  C  CG1   . VAL H  4  75   ? 97.178  34.993  -26.117 1.00 68.75  ? 75   VAL B CG1   1 
ATOM   4558  C  CG2   . VAL H  4  75   ? 97.375  32.666  -25.301 1.00 69.20  ? 75   VAL B CG2   1 
ATOM   4559  N  N     . VAL H  4  76   ? 94.877  36.002  -23.415 1.00 71.76  ? 76   VAL B N     1 
ATOM   4560  C  CA    . VAL H  4  76   ? 94.156  37.278  -23.298 1.00 72.33  ? 76   VAL B CA    1 
ATOM   4561  C  C     . VAL H  4  76   ? 94.550  38.047  -22.030 1.00 72.54  ? 76   VAL B C     1 
ATOM   4562  O  O     . VAL H  4  76   ? 94.691  39.270  -22.071 1.00 72.14  ? 76   VAL B O     1 
ATOM   4563  C  CB    . VAL H  4  76   ? 92.622  37.067  -23.238 1.00 72.64  ? 76   VAL B CB    1 
ATOM   4564  C  CG1   . VAL H  4  76   ? 91.916  38.377  -23.533 1.00 72.45  ? 76   VAL B CG1   1 
ATOM   4565  C  CG2   . VAL H  4  76   ? 92.200  35.980  -24.208 1.00 73.68  ? 76   VAL B CG2   1 
ATOM   4566  N  N     . GLU H  4  77   ? 94.706  37.336  -20.911 1.00 72.39  ? 77   GLU B N     1 
ATOM   4567  C  CA    . GLU H  4  77   ? 95.085  37.953  -19.636 1.00 72.65  ? 77   GLU B CA    1 
ATOM   4568  C  C     . GLU H  4  77   ? 96.555  38.393  -19.654 1.00 72.76  ? 77   GLU B C     1 
ATOM   4569  O  O     . GLU H  4  77   ? 96.929  39.374  -19.017 1.00 73.03  ? 77   GLU B O     1 
ATOM   4570  C  CB    . GLU H  4  77   ? 94.841  36.957  -18.489 1.00 72.88  ? 77   GLU B CB    1 
ATOM   4571  C  CG    . GLU H  4  77   ? 94.729  37.576  -17.067 1.00 73.60  ? 77   GLU B CG    1 
ATOM   4572  C  CD    . GLU H  4  77   ? 93.361  37.365  -16.376 1.00 73.88  ? 77   GLU B CD    1 
ATOM   4573  O  OE1   . GLU H  4  77   ? 92.862  36.214  -16.313 1.00 73.70  ? 77   GLU B OE1   1 
ATOM   4574  O  OE2   . GLU H  4  77   ? 92.790  38.367  -15.887 1.00 73.45  ? 77   GLU B OE2   1 
ATOM   4575  N  N     . ILE H  4  78   ? 97.380  37.660  -20.397 1.00 71.57  ? 78   ILE B N     1 
ATOM   4576  C  CA    . ILE H  4  78   ? 98.798  37.956  -20.533 1.00 70.87  ? 78   ILE B CA    1 
ATOM   4577  C  C     . ILE H  4  78   ? 99.017  39.188  -21.398 1.00 71.08  ? 78   ILE B C     1 
ATOM   4578  O  O     . ILE H  4  78   ? 99.669  40.135  -20.958 1.00 70.82  ? 78   ILE B O     1 
ATOM   4579  C  CB    . ILE H  4  78   ? 99.524  36.753  -21.150 1.00 70.16  ? 78   ILE B CB    1 
ATOM   4580  C  CG1   . ILE H  4  78   ? 99.331  35.538  -20.233 1.00 70.06  ? 78   ILE B CG1   1 
ATOM   4581  C  CG2   . ILE H  4  78   ? 101.003 37.042  -21.285 1.00 69.84  ? 78   ILE B CG2   1 
ATOM   4582  C  CD1   . ILE H  4  78   ? 99.682  34.198  -20.840 1.00 69.41  ? 78   ILE B CD1   1 
ATOM   4583  N  N     . ILE H  4  79   ? 98.468  39.168  -22.619 1.00 70.96  ? 79   ILE B N     1 
ATOM   4584  C  CA    . ILE H  4  79   ? 98.576  40.299  -23.559 1.00 71.15  ? 79   ILE B CA    1 
ATOM   4585  C  C     . ILE H  4  79   ? 98.054  41.579  -22.926 1.00 69.55  ? 79   ILE B C     1 
ATOM   4586  O  O     . ILE H  4  79   ? 98.462  42.682  -23.287 1.00 69.03  ? 79   ILE B O     1 
ATOM   4587  C  CB    . ILE H  4  79   ? 97.778  40.046  -24.891 1.00 72.52  ? 79   ILE B CB    1 
ATOM   4588  C  CG1   . ILE H  4  79   ? 96.286  39.827  -24.597 1.00 72.81  ? 79   ILE B CG1   1 
ATOM   4589  C  CG2   . ILE H  4  79   ? 98.397  38.854  -25.632 1.00 72.83  ? 79   ILE B CG2   1 
ATOM   4590  C  CD1   . ILE H  4  79   ? 95.399  41.052  -24.800 1.00 73.52  ? 79   ILE B CD1   1 
ATOM   4591  N  N     . LEU H  4  80   ? 97.140  41.398  -21.979 1.00 68.05  ? 80   LEU B N     1 
ATOM   4592  C  CA    . LEU H  4  80   ? 96.552  42.487  -21.211 1.00 67.39  ? 80   LEU B CA    1 
ATOM   4593  C  C     . LEU H  4  80   ? 97.604  43.071  -20.256 1.00 67.37  ? 80   LEU B C     1 
ATOM   4594  O  O     . LEU H  4  80   ? 97.772  44.287  -20.129 1.00 67.98  ? 80   LEU B O     1 
ATOM   4595  C  CB    . LEU H  4  80   ? 95.357  41.942  -20.406 1.00 65.41  ? 80   LEU B CB    1 
ATOM   4596  C  CG    . LEU H  4  80   ? 94.152  42.775  -19.971 1.00 63.26  ? 80   LEU B CG    1 
ATOM   4597  C  CD1   . LEU H  4  80   ? 93.151  42.761  -21.091 1.00 63.04  ? 80   LEU B CD1   1 
ATOM   4598  C  CD2   . LEU H  4  80   ? 93.525  42.204  -18.720 1.00 61.46  ? 80   LEU B CD2   1 
ATOM   4599  N  N     . ASN H  4  81   ? 98.306  42.154  -19.595 1.00 66.93  ? 81   ASN B N     1 
ATOM   4600  C  CA    . ASN H  4  81   ? 99.368  42.472  -18.653 1.00 65.82  ? 81   ASN B CA    1 
ATOM   4601  C  C     . ASN H  4  81   ? 100.504 43.190  -19.356 1.00 64.85  ? 81   ASN B C     1 
ATOM   4602  O  O     . ASN H  4  81   ? 101.231 43.982  -18.760 1.00 65.15  ? 81   ASN B O     1 
ATOM   4603  C  CB    . ASN H  4  81   ? 99.893  41.175  -18.036 1.00 65.61  ? 81   ASN B CB    1 
ATOM   4604  C  CG    . ASN H  4  81   ? 100.143 41.292  -16.556 1.00 65.89  ? 81   ASN B CG    1 
ATOM   4605  O  OD1   . ASN H  4  81   ? 99.639  40.489  -15.775 1.00 66.64  ? 81   ASN B OD1   1 
ATOM   4606  N  ND2   . ASN H  4  81   ? 100.930 42.286  -16.154 1.00 65.46  ? 81   ASN B ND2   1 
ATOM   4607  N  N     . LEU H  4  82   ? 100.642 42.896  -20.641 1.00 64.64  ? 82   LEU B N     1 
ATOM   4608  C  CA    . LEU H  4  82   ? 101.679 43.489  -21.456 1.00 64.38  ? 82   LEU B CA    1 
ATOM   4609  C  C     . LEU H  4  82   ? 101.391 44.964  -21.727 1.00 64.73  ? 82   LEU B C     1 
ATOM   4610  O  O     . LEU H  4  82   ? 102.310 45.783  -21.763 1.00 64.99  ? 82   LEU B O     1 
ATOM   4611  C  CB    . LEU H  4  82   ? 101.796 42.690  -22.757 1.00 64.03  ? 82   LEU B CB    1 
ATOM   4612  C  CG    . LEU H  4  82   ? 101.972 41.174  -22.513 1.00 64.22  ? 82   LEU B CG    1 
ATOM   4613  C  CD1   . LEU H  4  82   ? 101.973 40.452  -23.799 1.00 63.80  ? 82   LEU B CD1   1 
ATOM   4614  C  CD2   . LEU H  4  82   ? 103.283 40.879  -21.857 1.00 63.32  ? 82   LEU B CD2   1 
ATOM   4615  N  N     . LYS H  4  83   ? 100.118 45.304  -21.915 1.00 65.53  ? 83   LYS B N     1 
ATOM   4616  C  CA    . LYS H  4  83   ? 99.724  46.698  -22.126 1.00 65.78  ? 83   LYS B CA    1 
ATOM   4617  C  C     . LYS H  4  83   ? 100.158 47.552  -20.939 1.00 67.04  ? 83   LYS B C     1 
ATOM   4618  O  O     . LYS H  4  83   ? 100.316 48.767  -21.054 1.00 68.43  ? 83   LYS B O     1 
ATOM   4619  C  CB    . LYS H  4  83   ? 98.196  46.814  -22.274 1.00 63.55  ? 83   LYS B CB    1 
ATOM   4620  C  CG    . LYS H  4  83   ? 97.608  46.082  -23.472 1.00 61.17  ? 83   LYS B CG    1 
ATOM   4621  C  CD    . LYS H  4  83   ? 96.172  45.669  -23.235 1.00 59.16  ? 83   LYS B CD    1 
ATOM   4622  C  CE    . LYS H  4  83   ? 95.647  44.922  -24.456 1.00 58.88  ? 83   LYS B CE    1 
ATOM   4623  N  NZ    . LYS H  4  83   ? 94.256  44.406  -24.320 1.00 57.85  ? 83   LYS B NZ    1 
ATOM   4624  N  N     . GLU H  4  84   ? 100.345 46.883  -19.799 1.00 68.78  ? 84   GLU B N     1 
ATOM   4625  C  CA    . GLU H  4  84   ? 100.744 47.514  -18.536 1.00 68.99  ? 84   GLU B CA    1 
ATOM   4626  C  C     . GLU H  4  84   ? 102.259 47.779  -18.488 1.00 69.82  ? 84   GLU B C     1 
ATOM   4627  O  O     . GLU H  4  84   ? 102.714 48.665  -17.757 1.00 69.53  ? 84   GLU B O     1 
ATOM   4628  C  CB    . GLU H  4  84   ? 100.310 46.617  -17.344 1.00 68.84  ? 84   GLU B CB    1 
ATOM   4629  C  CG    . GLU H  4  84   ? 100.621 47.191  -15.924 1.00 67.37  ? 84   GLU B CG    1 
ATOM   4630  C  CD    . GLU H  4  84   ? 99.794  46.557  -14.793 1.00 67.42  ? 84   GLU B CD    1 
ATOM   4631  O  OE1   . GLU H  4  84   ? 99.716  45.311  -14.738 1.00 67.67  ? 84   GLU B OE1   1 
ATOM   4632  O  OE2   . GLU H  4  84   ? 99.225  47.307  -13.958 1.00 65.82  ? 84   GLU B OE2   1 
ATOM   4633  N  N     . LEU H  4  85   ? 103.033 47.023  -19.268 1.00 69.83  ? 85   LEU B N     1 
ATOM   4634  C  CA    . LEU H  4  85   ? 104.489 47.182  -19.300 1.00 69.79  ? 85   LEU B CA    1 
ATOM   4635  C  C     . LEU H  4  85   ? 104.896 48.543  -19.872 1.00 69.70  ? 85   LEU B C     1 
ATOM   4636  O  O     . LEU H  4  85   ? 104.538 48.895  -20.994 1.00 69.78  ? 85   LEU B O     1 
ATOM   4637  C  CB    . LEU H  4  85   ? 105.130 46.052  -20.135 1.00 70.14  ? 85   LEU B CB    1 
ATOM   4638  C  CG    . LEU H  4  85   ? 105.452 44.710  -19.433 1.00 70.50  ? 85   LEU B CG    1 
ATOM   4639  C  CD1   . LEU H  4  85   ? 104.816 43.555  -20.165 1.00 70.08  ? 85   LEU B CD1   1 
ATOM   4640  C  CD2   . LEU H  4  85   ? 106.947 44.505  -19.378 1.00 70.21  ? 85   LEU B CD2   1 
ATOM   4641  N  N     . VAL H  4  86   ? 105.647 49.308  -19.084 1.00 69.10  ? 86   VAL B N     1 
ATOM   4642  C  CA    . VAL H  4  86   ? 106.126 50.614  -19.524 1.00 69.39  ? 86   VAL B CA    1 
ATOM   4643  C  C     . VAL H  4  86   ? 107.630 50.581  -19.773 1.00 68.01  ? 86   VAL B C     1 
ATOM   4644  O  O     . VAL H  4  86   ? 108.421 50.427  -18.842 1.00 67.59  ? 86   VAL B O     1 
ATOM   4645  C  CB    . VAL H  4  86   ? 105.786 51.755  -18.468 1.00 69.92  ? 86   VAL B CB    1 
ATOM   4646  C  CG1   . VAL H  4  86   ? 106.277 51.365  -17.083 1.00 71.06  ? 86   VAL B CG1   1 
ATOM   4647  C  CG2   . VAL H  4  86   ? 106.418 53.089  -18.910 1.00 69.44  ? 86   VAL B CG2   1 
ATOM   4648  N  N     . VAL H  4  87   ? 108.019 50.708  -21.040 1.00 67.49  ? 87   VAL B N     1 
ATOM   4649  C  CA    . VAL H  4  87   ? 109.434 50.724  -21.402 1.00 66.12  ? 87   VAL B CA    1 
ATOM   4650  C  C     . VAL H  4  87   ? 109.873 52.133  -21.747 1.00 65.49  ? 87   VAL B C     1 
ATOM   4651  O  O     . VAL H  4  87   ? 109.035 52.994  -22.013 1.00 66.14  ? 87   VAL B O     1 
ATOM   4652  C  CB    . VAL H  4  87   ? 109.750 49.806  -22.624 1.00 66.42  ? 87   VAL B CB    1 
ATOM   4653  C  CG1   . VAL H  4  87   ? 109.569 48.342  -22.253 1.00 67.36  ? 87   VAL B CG1   1 
ATOM   4654  C  CG2   . VAL H  4  87   ? 108.871 50.181  -23.769 1.00 66.69  ? 87   VAL B CG2   1 
ATOM   4655  N  N     . ARG H  4  88   ? 111.176 52.373  -21.735 1.00 64.87  ? 88   ARG B N     1 
ATOM   4656  C  CA    . ARG H  4  88   ? 111.698 53.697  -22.034 1.00 64.88  ? 88   ARG B CA    1 
ATOM   4657  C  C     . ARG H  4  88   ? 112.995 53.614  -22.850 1.00 65.33  ? 88   ARG B C     1 
ATOM   4658  O  O     . ARG H  4  88   ? 114.059 53.307  -22.293 1.00 66.10  ? 88   ARG B O     1 
ATOM   4659  C  CB    . ARG H  4  88   ? 111.947 54.451  -20.722 1.00 62.87  ? 88   ARG B CB    1 
ATOM   4660  C  CG    . ARG H  4  88   ? 112.666 55.761  -20.911 1.00 61.70  ? 88   ARG B CG    1 
ATOM   4661  C  CD    . ARG H  4  88   ? 112.880 56.510  -19.617 1.00 60.93  ? 88   ARG B CD    1 
ATOM   4662  N  NE    . ARG H  4  88   ? 113.213 57.900  -19.915 1.00 60.31  ? 88   ARG B NE    1 
ATOM   4663  C  CZ    . ARG H  4  88   ? 113.361 58.865  -19.010 1.00 60.43  ? 88   ARG B CZ    1 
ATOM   4664  N  NH1   . ARG H  4  88   ? 113.215 58.605  -17.717 1.00 58.90  ? 88   ARG B NH1   1 
ATOM   4665  N  NH2   . ARG H  4  88   ? 113.644 60.103  -19.406 1.00 59.91  ? 88   ARG B NH2   1 
ATOM   4666  N  N     . PHE H  4  89   ? 112.911 53.875  -24.163 1.00 65.51  ? 89   PHE B N     1 
ATOM   4667  C  CA    . PHE H  4  89   ? 114.110 53.862  -25.019 1.00 65.77  ? 89   PHE B CA    1 
ATOM   4668  C  C     . PHE H  4  89   ? 114.861 55.198  -24.895 1.00 66.63  ? 89   PHE B C     1 
ATOM   4669  O  O     . PHE H  4  89   ? 114.301 56.170  -24.375 1.00 67.30  ? 89   PHE B O     1 
ATOM   4670  C  CB    . PHE H  4  89   ? 113.763 53.631  -26.513 1.00 63.54  ? 89   PHE B CB    1 
ATOM   4671  C  CG    . PHE H  4  89   ? 112.495 52.815  -26.770 1.00 60.66  ? 89   PHE B CG    1 
ATOM   4672  C  CD1   . PHE H  4  89   ? 112.316 51.528  -26.216 1.00 59.98  ? 89   PHE B CD1   1 
ATOM   4673  C  CD2   . PHE H  4  89   ? 111.487 53.326  -27.614 1.00 58.45  ? 89   PHE B CD2   1 
ATOM   4674  C  CE1   . PHE H  4  89   ? 111.142 50.756  -26.503 1.00 59.19  ? 89   PHE B CE1   1 
ATOM   4675  C  CE2   . PHE H  4  89   ? 110.314 52.569  -27.908 1.00 57.89  ? 89   PHE B CE2   1 
ATOM   4676  C  CZ    . PHE H  4  89   ? 110.146 51.286  -27.353 1.00 57.72  ? 89   PHE B CZ    1 
ATOM   4677  N  N     . LEU H  4  90   ? 116.099 55.270  -25.381 1.00 67.12  ? 90   LEU B N     1 
ATOM   4678  C  CA    . LEU H  4  90   ? 116.902 56.490  -25.205 1.00 67.51  ? 90   LEU B CA    1 
ATOM   4679  C  C     . LEU H  4  90   ? 117.099 57.308  -26.523 1.00 68.95  ? 90   LEU B C     1 
ATOM   4680  O  O     . LEU H  4  90   ? 117.519 58.480  -26.435 1.00 69.80  ? 90   LEU B O     1 
ATOM   4681  C  CB    . LEU H  4  90   ? 118.257 56.077  -24.591 1.00 66.35  ? 90   LEU B CB    1 
ATOM   4682  C  CG    . LEU H  4  90   ? 119.492 56.928  -24.260 1.00 65.29  ? 90   LEU B CG    1 
ATOM   4683  C  CD1   . LEU H  4  90   ? 119.826 56.839  -22.771 1.00 63.68  ? 90   LEU B CD1   1 
ATOM   4684  C  CD2   . LEU H  4  90   ? 120.672 56.417  -25.075 1.00 63.62  ? 90   LEU B CD2   1 
ATOM   4685  N  N     . ASN H  4  91   ? 116.824 56.771  -27.720 1.00 68.87  ? 91   ASN B N     1 
ATOM   4686  C  CA    . ASN H  4  91   ? 117.056 57.617  -28.906 1.00 69.12  ? 91   ASN B CA    1 
ATOM   4687  C  C     . ASN H  4  91   ? 116.214 57.194  -30.136 1.00 70.11  ? 91   ASN B C     1 
ATOM   4688  O  O     . ASN H  4  91   ? 115.815 56.026  -30.257 1.00 70.85  ? 91   ASN B O     1 
ATOM   4689  C  CB    . ASN H  4  91   ? 118.560 57.615  -29.268 1.00 65.58  ? 91   ASN B CB    1 
ATOM   4690  C  CG    . ASN H  4  91   ? 119.221 56.273  -29.076 1.00 63.25  ? 91   ASN B CG    1 
ATOM   4691  O  OD1   . ASN H  4  91   ? 118.622 55.229  -29.311 1.00 61.00  ? 91   ASN B OD1   1 
ATOM   4692  N  ND2   . ASN H  4  91   ? 120.479 56.299  -28.651 1.00 61.73  ? 91   ASN B ND2   1 
ATOM   4693  N  N     . PRO H  4  92   ? 115.937 58.164  -31.065 1.00 71.13  ? 92   PRO B N     1 
ATOM   4694  C  CA    . PRO H  4  92   ? 115.163 57.957  -32.298 1.00 72.48  ? 92   PRO B CA    1 
ATOM   4695  C  C     . PRO H  4  92   ? 115.555 56.661  -33.034 1.00 74.19  ? 92   PRO B C     1 
ATOM   4696  O  O     . PRO H  4  92   ? 114.688 55.994  -33.600 1.00 73.84  ? 92   PRO B O     1 
ATOM   4697  C  CB    . PRO H  4  92   ? 115.449 59.229  -33.104 1.00 71.50  ? 92   PRO B CB    1 
ATOM   4698  C  CG    . PRO H  4  92   ? 115.464 60.263  -32.057 1.00 70.59  ? 92   PRO B CG    1 
ATOM   4699  C  CD    . PRO H  4  92   ? 116.262 59.606  -30.929 1.00 70.84  ? 92   PRO B CD    1 
ATOM   4700  N  N     . SER H  4  93   ? 116.848 56.311  -33.018 1.00 74.99  ? 93   SER B N     1 
ATOM   4701  C  CA    . SER H  4  93   ? 117.342 55.093  -33.676 1.00 75.92  ? 93   SER B CA    1 
ATOM   4702  C  C     . SER H  4  93   ? 116.478 53.872  -33.294 1.00 77.36  ? 93   SER B C     1 
ATOM   4703  O  O     . SER H  4  93   ? 116.390 52.888  -34.041 1.00 78.48  ? 93   SER B O     1 
ATOM   4704  C  CB    . SER H  4  93   ? 118.815 54.837  -33.282 1.00 75.85  ? 93   SER B CB    1 
ATOM   4705  O  OG    . SER H  4  93   ? 119.703 54.912  -34.394 1.00 75.18  ? 93   SER B OG    1 
ATOM   4706  N  N     . LEU H  4  94   ? 115.840 53.948  -32.127 1.00 77.45  ? 94   LEU B N     1 
ATOM   4707  C  CA    . LEU H  4  94   ? 114.965 52.888  -31.654 1.00 77.79  ? 94   LEU B CA    1 
ATOM   4708  C  C     . LEU H  4  94   ? 113.510 53.220  -31.936 1.00 77.85  ? 94   LEU B C     1 
ATOM   4709  O  O     . LEU H  4  94   ? 112.831 53.838  -31.114 1.00 77.57  ? 94   LEU B O     1 
ATOM   4710  C  CB    . LEU H  4  94   ? 115.123 52.685  -30.157 1.00 77.88  ? 94   LEU B CB    1 
ATOM   4711  C  CG    . LEU H  4  94   ? 116.445 52.196  -29.605 1.00 78.30  ? 94   LEU B CG    1 
ATOM   4712  C  CD1   . LEU H  4  94   ? 116.264 52.063  -28.117 1.00 78.80  ? 94   LEU B CD1   1 
ATOM   4713  C  CD2   . LEU H  4  94   ? 116.854 50.867  -30.223 1.00 78.60  ? 94   LEU B CD2   1 
ATOM   4714  N  N     . GLN H  4  95   ? 113.035 52.814  -33.102 1.00 78.56  ? 95   GLN B N     1 
ATOM   4715  C  CA    . GLN H  4  95   ? 111.650 53.048  -33.479 1.00 79.31  ? 95   GLN B CA    1 
ATOM   4716  C  C     . GLN H  4  95   ? 110.787 51.850  -33.108 1.00 78.04  ? 95   GLN B C     1 
ATOM   4717  O  O     . GLN H  4  95   ? 109.685 51.993  -32.580 1.00 77.08  ? 95   GLN B O     1 
ATOM   4718  C  CB    . GLN H  4  95   ? 111.564 53.326  -34.988 1.00 81.24  ? 95   GLN B CB    1 
ATOM   4719  C  CG    . GLN H  4  95   ? 111.718 54.824  -35.383 1.00 83.38  ? 95   GLN B CG    1 
ATOM   4720  C  CD    . GLN H  4  95   ? 113.152 55.281  -35.720 1.00 84.05  ? 95   GLN B CD    1 
ATOM   4721  O  OE1   . GLN H  4  95   ? 113.411 56.483  -35.845 1.00 84.10  ? 95   GLN B OE1   1 
ATOM   4722  N  NE2   . GLN H  4  95   ? 114.074 54.334  -35.867 1.00 83.57  ? 95   GLN B NE2   1 
ATOM   4723  N  N     . THR H  4  96   ? 111.313 50.666  -33.388 1.00 77.90  ? 96   THR B N     1 
ATOM   4724  C  CA    . THR H  4  96   ? 110.640 49.419  -33.068 1.00 78.09  ? 96   THR B CA    1 
ATOM   4725  C  C     . THR H  4  96   ? 111.614 48.416  -32.458 1.00 78.26  ? 96   THR B C     1 
ATOM   4726  O  O     . THR H  4  96   ? 112.482 47.873  -33.136 1.00 78.44  ? 96   THR B O     1 
ATOM   4727  C  CB    . THR H  4  96   ? 109.990 48.777  -34.323 1.00 78.89  ? 96   THR B CB    1 
ATOM   4728  O  OG1   . THR H  4  96   ? 109.604 47.426  -34.021 1.00 78.64  ? 96   THR B OG1   1 
ATOM   4729  C  CG2   . THR H  4  96   ? 110.957 48.776  -35.500 1.00 80.34  ? 96   THR B CG2   1 
ATOM   4730  N  N     . VAL H  4  97   ? 111.464 48.180  -31.161 1.00 78.11  ? 97   VAL B N     1 
ATOM   4731  C  CA    . VAL H  4  97   ? 112.317 47.246  -30.431 1.00 77.72  ? 97   VAL B CA    1 
ATOM   4732  C  C     . VAL H  4  97   ? 111.519 46.000  -29.997 1.00 77.55  ? 97   VAL B C     1 
ATOM   4733  O  O     . VAL H  4  97   ? 110.498 46.120  -29.306 1.00 77.72  ? 97   VAL B O     1 
ATOM   4734  C  CB    . VAL H  4  97   ? 112.936 47.966  -29.168 1.00 76.97  ? 97   VAL B CB    1 
ATOM   4735  C  CG1   . VAL H  4  97   ? 113.744 47.013  -28.336 1.00 76.88  ? 97   VAL B CG1   1 
ATOM   4736  C  CG2   . VAL H  4  97   ? 113.831 49.115  -29.610 1.00 75.15  ? 97   VAL B CG2   1 
ATOM   4737  N  N     . THR H  4  98   ? 111.969 44.813  -30.414 1.00 77.58  ? 98   THR B N     1 
ATOM   4738  C  CA    . THR H  4  98   ? 111.300 43.562  -30.023 1.00 76.98  ? 98   THR B CA    1 
ATOM   4739  C  C     . THR H  4  98   ? 112.002 42.928  -28.811 1.00 76.60  ? 98   THR B C     1 
ATOM   4740  O  O     . THR H  4  98   ? 113.145 42.455  -28.898 1.00 76.85  ? 98   THR B O     1 
ATOM   4741  C  CB    . THR H  4  98   ? 111.253 42.511  -31.219 1.00 77.02  ? 98   THR B CB    1 
ATOM   4742  O  OG1   . THR H  4  98   ? 110.304 42.945  -32.206 1.00 76.76  ? 98   THR B OG1   1 
ATOM   4743  C  CG2   . THR H  4  98   ? 110.795 41.131  -30.741 1.00 76.69  ? 98   THR B CG2   1 
ATOM   4744  N  N     . LEU H  4  99   ? 111.307 42.943  -27.675 1.00 75.33  ? 99   LEU B N     1 
ATOM   4745  C  CA    . LEU H  4  99   ? 111.822 42.371  -26.443 1.00 73.64  ? 99   LEU B CA    1 
ATOM   4746  C  C     . LEU H  4  99   ? 111.600 40.855  -26.431 1.00 73.71  ? 99   LEU B C     1 
ATOM   4747  O  O     . LEU H  4  99   ? 110.504 40.369  -26.730 1.00 73.25  ? 99   LEU B O     1 
ATOM   4748  C  CB    . LEU H  4  99   ? 111.132 43.056  -25.245 1.00 72.04  ? 99   LEU B CB    1 
ATOM   4749  C  CG    . LEU H  4  99   ? 111.583 44.480  -24.838 1.00 70.34  ? 99   LEU B CG    1 
ATOM   4750  C  CD1   . LEU H  4  99   ? 111.411 45.471  -25.973 1.00 69.30  ? 99   LEU B CD1   1 
ATOM   4751  C  CD2   . LEU H  4  99   ? 110.773 44.920  -23.658 1.00 69.40  ? 99   LEU B CD2   1 
ATOM   4752  N  N     . LEU H  4  100  ? 112.647 40.108  -26.097 1.00 74.04  ? 100  LEU B N     1 
ATOM   4753  C  CA    . LEU H  4  100  ? 112.590 38.645  -26.101 1.00 74.10  ? 100  LEU B CA    1 
ATOM   4754  C  C     . LEU H  4  100  ? 112.705 38.061  -24.699 1.00 74.28  ? 100  LEU B C     1 
ATOM   4755  O  O     . LEU H  4  100  ? 113.490 38.522  -23.874 1.00 74.40  ? 100  LEU B O     1 
ATOM   4756  C  CB    . LEU H  4  100  ? 113.727 38.088  -26.953 1.00 73.36  ? 100  LEU B CB    1 
ATOM   4757  C  CG    . LEU H  4  100  ? 113.431 37.522  -28.329 1.00 72.63  ? 100  LEU B CG    1 
ATOM   4758  C  CD1   . LEU H  4  100  ? 114.739 37.270  -29.061 1.00 72.30  ? 100  LEU B CD1   1 
ATOM   4759  C  CD2   . LEU H  4  100  ? 112.627 36.247  -28.172 1.00 72.23  ? 100  LEU B CD2   1 
ATOM   4760  N  N     . LEU H  4  101  ? 111.919 37.026  -24.447 1.00 74.36  ? 101  LEU B N     1 
ATOM   4761  C  CA    . LEU H  4  101  ? 111.935 36.369  -23.160 1.00 75.55  ? 101  LEU B CA    1 
ATOM   4762  C  C     . LEU H  4  101  ? 111.442 34.958  -23.269 1.00 75.82  ? 101  LEU B C     1 
ATOM   4763  O  O     . LEU H  4  101  ? 110.505 34.664  -24.011 1.00 76.45  ? 101  LEU B O     1 
ATOM   4764  C  CB    . LEU H  4  101  ? 111.050 37.113  -22.148 1.00 75.94  ? 101  LEU B CB    1 
ATOM   4765  C  CG    . LEU H  4  101  ? 110.599 36.399  -20.850 1.00 76.28  ? 101  LEU B CG    1 
ATOM   4766  C  CD1   . LEU H  4  101  ? 110.270 37.417  -19.782 1.00 75.82  ? 101  LEU B CD1   1 
ATOM   4767  C  CD2   . LEU H  4  101  ? 109.366 35.547  -21.104 1.00 75.62  ? 101  LEU B CD2   1 
ATOM   4768  N  N     . LYS H  4  102  ? 112.080 34.093  -22.499 1.00 76.75  ? 102  LYS B N     1 
ATOM   4769  C  CA    . LYS H  4  102  ? 111.721 32.695  -22.437 1.00 77.05  ? 102  LYS B CA    1 
ATOM   4770  C  C     . LYS H  4  102  ? 112.045 32.140  -21.082 1.00 77.32  ? 102  LYS B C     1 
ATOM   4771  O  O     . LYS H  4  102  ? 113.176 32.245  -20.622 1.00 76.60  ? 102  LYS B O     1 
ATOM   4772  C  CB    . LYS H  4  102  ? 112.473 31.886  -23.508 1.00 77.84  ? 102  LYS B CB    1 
ATOM   4773  C  CG    . LYS H  4  102  ? 112.029 30.396  -23.608 1.00 78.02  ? 102  LYS B CG    1 
ATOM   4774  C  CD    . LYS H  4  102  ? 112.708 29.659  -24.781 1.00 77.39  ? 102  LYS B CD    1 
ATOM   4775  C  CE    . LYS H  4  102  ? 112.298 28.189  -24.871 1.00 76.50  ? 102  LYS B CE    1 
ATOM   4776  N  NZ    . LYS H  4  102  ? 110.872 27.995  -25.213 1.00 75.87  ? 102  LYS B NZ    1 
ATOM   4777  N  N     . ALA H  4  103  ? 111.049 31.561  -20.437 1.00 78.52  ? 103  ALA B N     1 
ATOM   4778  C  CA    . ALA H  4  103  ? 111.245 30.972  -19.133 1.00 80.36  ? 103  ALA B CA    1 
ATOM   4779  C  C     . ALA H  4  103  ? 110.536 29.649  -19.055 1.00 82.24  ? 103  ALA B C     1 
ATOM   4780  O  O     . ALA H  4  103  ? 109.494 29.470  -19.686 1.00 82.50  ? 103  ALA B O     1 
ATOM   4781  C  CB    . ALA H  4  103  ? 110.727 31.906  -18.066 1.00 81.27  ? 103  ALA B CB    1 
ATOM   4782  N  N     . GLU H  4  104  ? 111.095 28.719  -18.287 1.00 84.58  ? 104  GLU B N     1 
ATOM   4783  C  CA    . GLU H  4  104  ? 110.504 27.391  -18.180 1.00 86.65  ? 104  GLU B CA    1 
ATOM   4784  C  C     . GLU H  4  104  ? 110.418 26.920  -16.735 1.00 86.78  ? 104  GLU B C     1 
ATOM   4785  O  O     . GLU H  4  104  ? 111.130 27.413  -15.857 1.00 87.34  ? 104  GLU B O     1 
ATOM   4786  C  CB    . GLU H  4  104  ? 111.337 26.395  -19.003 1.00 87.89  ? 104  GLU B CB    1 
ATOM   4787  C  CG    . GLU H  4  104  ? 111.361 26.746  -20.509 1.00 90.16  ? 104  GLU B CG    1 
ATOM   4788  C  CD    . GLU H  4  104  ? 112.300 25.875  -21.342 1.00 91.53  ? 104  GLU B CD    1 
ATOM   4789  O  OE1   . GLU H  4  104  ? 112.037 24.653  -21.470 1.00 92.60  ? 104  GLU B OE1   1 
ATOM   4790  O  OE2   . GLU H  4  104  ? 113.302 26.422  -21.871 1.00 91.62  ? 104  GLU B OE2   1 
ATOM   4791  N  N     . GLY H  4  105  ? 109.522 25.963  -16.506 1.00 86.90  ? 105  GLY B N     1 
ATOM   4792  C  CA    . GLY H  4  105  ? 109.369 25.362  -15.192 1.00 86.54  ? 105  GLY B CA    1 
ATOM   4793  C  C     . GLY H  4  105  ? 108.565 26.149  -14.155 1.00 86.04  ? 105  GLY B C     1 
ATOM   4794  O  O     . GLY H  4  105  ? 107.783 27.026  -14.511 1.00 86.57  ? 105  GLY B O     1 
ATOM   4795  N  N     . PRO H  4  106  ? 108.745 25.838  -12.843 1.00 85.27  ? 106  PRO B N     1 
ATOM   4796  C  CA    . PRO H  4  106  ? 108.109 26.419  -11.642 1.00 84.38  ? 106  PRO B CA    1 
ATOM   4797  C  C     . PRO H  4  106  ? 108.529 27.867  -11.337 1.00 83.23  ? 106  PRO B C     1 
ATOM   4798  O  O     . PRO H  4  106  ? 108.743 28.192  -10.174 1.00 83.00  ? 106  PRO B O     1 
ATOM   4799  C  CB    . PRO H  4  106  ? 108.519 25.458  -10.530 1.00 84.81  ? 106  PRO B CB    1 
ATOM   4800  C  CG    . PRO H  4  106  ? 108.601 24.168  -11.228 1.00 85.30  ? 106  PRO B CG    1 
ATOM   4801  C  CD    . PRO H  4  106  ? 109.376 24.555  -12.467 1.00 85.50  ? 106  PRO B CD    1 
ATOM   4802  N  N     . LYS H  4  107  ? 108.630 28.748  -12.323 1.00 81.87  ? 107  LYS B N     1 
ATOM   4803  C  CA    . LYS H  4  107  ? 109.046 30.112  -11.992 1.00 81.03  ? 107  LYS B CA    1 
ATOM   4804  C  C     . LYS H  4  107  ? 107.970 31.140  -12.341 1.00 80.65  ? 107  LYS B C     1 
ATOM   4805  O  O     . LYS H  4  107  ? 107.148 30.916  -13.236 1.00 80.80  ? 107  LYS B O     1 
ATOM   4806  C  CB    . LYS H  4  107  ? 110.340 30.468  -12.742 1.00 80.78  ? 107  LYS B CB    1 
ATOM   4807  C  CG    . LYS H  4  107  ? 110.179 30.657  -14.252 1.00 79.12  ? 107  LYS B CG    1 
ATOM   4808  C  CD    . LYS H  4  107  ? 111.516 30.657  -14.994 1.00 77.61  ? 107  LYS B CD    1 
ATOM   4809  C  CE    . LYS H  4  107  ? 112.412 31.830  -14.630 1.00 75.43  ? 107  LYS B CE    1 
ATOM   4810  N  NZ    . LYS H  4  107  ? 113.492 31.931  -15.635 1.00 73.88  ? 107  LYS B NZ    1 
ATOM   4811  N  N     . GLU H  4  108  ? 107.988 32.262  -11.607 1.00 79.89  ? 108  GLU B N     1 
ATOM   4812  C  CA    . GLU H  4  108  ? 107.099 33.400  -11.868 1.00 78.55  ? 108  GLU B CA    1 
ATOM   4813  C  C     . GLU H  4  108  ? 107.730 34.286  -12.931 1.00 77.17  ? 108  GLU B C     1 
ATOM   4814  O  O     . GLU H  4  108  ? 108.884 34.690  -12.773 1.00 76.75  ? 108  GLU B O     1 
ATOM   4815  C  CB    . GLU H  4  108  ? 106.905 34.337  -10.661 1.00 78.98  ? 108  GLU B CB    1 
ATOM   4816  C  CG    . GLU H  4  108  ? 106.430 33.879  -9.288  1.00 79.10  ? 108  GLU B CG    1 
ATOM   4817  C  CD    . GLU H  4  108  ? 106.570 35.039  -8.253  1.00 79.14  ? 108  GLU B CD    1 
ATOM   4818  O  OE1   . GLU H  4  108  ? 106.137 36.186  -8.545  1.00 77.47  ? 108  GLU B OE1   1 
ATOM   4819  O  OE2   . GLU H  4  108  ? 107.118 34.809  -7.149  1.00 79.65  ? 108  GLU B OE2   1 
ATOM   4820  N  N     . VAL H  4  109  ? 107.007 34.605  -13.994 1.00 76.74  ? 109  VAL B N     1 
ATOM   4821  C  CA    . VAL H  4  109  ? 107.602 35.428  -15.038 1.00 76.10  ? 109  VAL B CA    1 
ATOM   4822  C  C     . VAL H  4  109  ? 107.306 36.915  -14.829 1.00 74.92  ? 109  VAL B C     1 
ATOM   4823  O  O     . VAL H  4  109  ? 106.173 37.369  -15.003 1.00 75.55  ? 109  VAL B O     1 
ATOM   4824  C  CB    . VAL H  4  109  ? 107.091 35.010  -16.451 1.00 77.25  ? 109  VAL B CB    1 
ATOM   4825  C  CG1   . VAL H  4  109  ? 107.942 35.696  -17.542 1.00 77.19  ? 109  VAL B CG1   1 
ATOM   4826  C  CG2   . VAL H  4  109  ? 107.161 33.475  -16.592 1.00 77.33  ? 109  VAL B CG2   1 
ATOM   4827  N  N     . LYS H  4  110  ? 108.342 37.661  -14.451 1.00 73.03  ? 110  LYS B N     1 
ATOM   4828  C  CA    . LYS H  4  110  ? 108.242 39.100  -14.262 1.00 70.35  ? 110  LYS B CA    1 
ATOM   4829  C  C     . LYS H  4  110  ? 108.838 39.827  -15.457 1.00 69.50  ? 110  LYS B C     1 
ATOM   4830  O  O     . LYS H  4  110  ? 109.485 39.205  -16.288 1.00 69.96  ? 110  LYS B O     1 
ATOM   4831  C  CB    . LYS H  4  110  ? 108.963 39.509  -12.978 1.00 67.36  ? 110  LYS B CB    1 
ATOM   4832  C  CG    . LYS H  4  110  ? 110.096 38.569  -12.568 1.00 65.42  ? 110  LYS B CG    1 
ATOM   4833  C  CD    . LYS H  4  110  ? 111.170 39.278  -11.742 1.00 64.19  ? 110  LYS B CD    1 
ATOM   4834  C  CE    . LYS H  4  110  ? 110.693 39.737  -10.368 1.00 62.35  ? 110  LYS B CE    1 
ATOM   4835  N  NZ    . LYS H  4  110  ? 111.685 40.636  -9.707  1.00 60.19  ? 110  LYS B NZ    1 
ATOM   4836  N  N     . ALA H  4  111  ? 108.629 41.133  -15.550 1.00 70.40  ? 111  ALA B N     1 
ATOM   4837  C  CA    . ALA H  4  111  ? 109.129 41.901  -16.688 1.00 70.75  ? 111  ALA B CA    1 
ATOM   4838  C  C     . ALA H  4  111  ? 110.661 42.037  -16.678 1.00 71.86  ? 111  ALA B C     1 
ATOM   4839  O  O     . ALA H  4  111  ? 111.253 42.409  -17.705 1.00 71.86  ? 111  ALA B O     1 
ATOM   4840  C  CB    . ALA H  4  111  ? 108.508 43.259  -16.689 1.00 69.95  ? 111  ALA B CB    1 
ATOM   4841  N  N     . ARG H  4  112  ? 111.314 41.750  -15.552 1.00 71.92  ? 112  ARG B N     1 
ATOM   4842  C  CA    . ARG H  4  112  ? 112.773 41.858  -15.520 1.00 71.13  ? 112  ARG B CA    1 
ATOM   4843  C  C     . ARG H  4  112  ? 113.432 40.671  -16.223 1.00 71.80  ? 112  ARG B C     1 
ATOM   4844  O  O     . ARG H  4  112  ? 114.618 40.743  -16.554 1.00 72.62  ? 112  ARG B O     1 
ATOM   4845  C  CB    . ARG H  4  112  ? 113.289 41.948  -14.068 1.00 70.49  ? 112  ARG B CB    1 
ATOM   4846  C  CG    . ARG H  4  112  ? 113.884 40.658  -13.474 1.00 69.14  ? 112  ARG B CG    1 
ATOM   4847  C  CD    . ARG H  4  112  ? 114.700 40.901  -12.199 1.00 67.92  ? 112  ARG B CD    1 
ATOM   4848  N  NE    . ARG H  4  112  ? 115.840 41.779  -12.436 1.00 66.63  ? 112  ARG B NE    1 
ATOM   4849  C  CZ    . ARG H  4  112  ? 115.826 43.098  -12.261 1.00 66.20  ? 112  ARG B CZ    1 
ATOM   4850  N  NH1   . ARG H  4  112  ? 114.729 43.711  -11.833 1.00 65.69  ? 112  ARG B NH1   1 
ATOM   4851  N  NH2   . ARG H  4  112  ? 116.912 43.810  -12.525 1.00 66.58  ? 112  ARG B NH2   1 
ATOM   4852  N  N     . ASP H  4  113  ? 112.665 39.595  -16.449 1.00 71.26  ? 113  ASP B N     1 
ATOM   4853  C  CA    . ASP H  4  113  ? 113.167 38.361  -17.089 1.00 71.19  ? 113  ASP B CA    1 
ATOM   4854  C  C     . ASP H  4  113  ? 113.485 38.567  -18.579 1.00 71.04  ? 113  ASP B C     1 
ATOM   4855  O  O     . ASP H  4  113  ? 114.146 37.716  -19.200 1.00 71.77  ? 113  ASP B O     1 
ATOM   4856  C  CB    . ASP H  4  113  ? 112.146 37.211  -16.939 1.00 69.56  ? 113  ASP B CB    1 
ATOM   4857  C  CG    . ASP H  4  113  ? 112.663 35.888  -17.504 1.00 68.46  ? 113  ASP B CG    1 
ATOM   4858  O  OD1   . ASP H  4  113  ? 113.815 35.505  -17.197 1.00 67.35  ? 113  ASP B OD1   1 
ATOM   4859  O  OD2   . ASP H  4  113  ? 111.914 35.234  -18.256 1.00 68.34  ? 113  ASP B OD2   1 
ATOM   4860  N  N     . PHE H  4  114  ? 113.028 39.678  -19.154 1.00 69.90  ? 114  PHE B N     1 
ATOM   4861  C  CA    . PHE H  4  114  ? 113.315 39.947  -20.552 1.00 70.11  ? 114  PHE B CA    1 
ATOM   4862  C  C     . PHE H  4  114  ? 114.798 40.191  -20.762 1.00 69.24  ? 114  PHE B C     1 
ATOM   4863  O  O     . PHE H  4  114  ? 115.410 40.941  -19.988 1.00 68.81  ? 114  PHE B O     1 
ATOM   4864  C  CB    . PHE H  4  114  ? 112.506 41.168  -21.045 1.00 70.32  ? 114  PHE B CB    1 
ATOM   4865  C  CG    . PHE H  4  114  ? 111.170 40.788  -21.650 1.00 71.37  ? 114  PHE B CG    1 
ATOM   4866  C  CD1   . PHE H  4  114  ? 110.041 40.555  -20.830 1.00 71.30  ? 114  PHE B CD1   1 
ATOM   4867  C  CD2   . PHE H  4  114  ? 111.052 40.581  -23.045 1.00 71.79  ? 114  PHE B CD2   1 
ATOM   4868  C  CE1   . PHE H  4  114  ? 108.806 40.112  -21.392 1.00 71.63  ? 114  PHE B CE1   1 
ATOM   4869  C  CE2   . PHE H  4  114  ? 109.830 40.139  -23.631 1.00 72.01  ? 114  PHE B CE2   1 
ATOM   4870  C  CZ    . PHE H  4  114  ? 108.704 39.902  -22.797 1.00 72.40  ? 114  PHE B CZ    1 
ATOM   4871  N  N     . LEU H  4  115  ? 115.383 39.552  -21.784 1.00 69.07  ? 115  LEU B N     1 
ATOM   4872  C  CA    . LEU H  4  115  ? 116.797 39.788  -22.066 1.00 68.33  ? 115  LEU B CA    1 
ATOM   4873  C  C     . LEU H  4  115  ? 117.036 41.286  -22.357 1.00 68.33  ? 115  LEU B C     1 
ATOM   4874  O  O     . LEU H  4  115  ? 116.415 41.862  -23.260 1.00 68.85  ? 115  LEU B O     1 
ATOM   4875  C  CB    . LEU H  4  115  ? 117.271 38.903  -23.243 1.00 67.46  ? 115  LEU B CB    1 
ATOM   4876  C  CG    . LEU H  4  115  ? 116.551 38.682  -24.573 1.00 67.25  ? 115  LEU B CG    1 
ATOM   4877  C  CD1   . LEU H  4  115  ? 116.627 39.914  -25.467 1.00 66.66  ? 115  LEU B CD1   1 
ATOM   4878  C  CD2   . LEU H  4  115  ? 117.228 37.508  -25.258 1.00 66.73  ? 115  LEU B CD2   1 
ATOM   4879  N  N     . PRO H  4  116  ? 117.936 41.936  -21.584 1.00 67.26  ? 116  PRO B N     1 
ATOM   4880  C  CA    . PRO H  4  116  ? 118.237 43.368  -21.736 1.00 66.94  ? 116  PRO B CA    1 
ATOM   4881  C  C     . PRO H  4  116  ? 118.713 43.755  -23.141 1.00 65.97  ? 116  PRO B C     1 
ATOM   4882  O  O     . PRO H  4  116  ? 119.533 43.086  -23.757 1.00 67.15  ? 116  PRO B O     1 
ATOM   4883  C  CB    . PRO H  4  116  ? 119.307 43.634  -20.671 1.00 66.64  ? 116  PRO B CB    1 
ATOM   4884  C  CG    . PRO H  4  116  ? 119.284 42.423  -19.780 1.00 66.73  ? 116  PRO B CG    1 
ATOM   4885  C  CD    . PRO H  4  116  ? 118.959 41.310  -20.724 1.00 67.02  ? 116  PRO B CD    1 
ATOM   4886  N  N     . VAL H  4  117  ? 118.175 44.865  -23.629 1.00 65.13  ? 117  VAL B N     1 
ATOM   4887  C  CA    . VAL H  4  117  ? 118.586 45.420  -24.899 1.00 63.36  ? 117  VAL B CA    1 
ATOM   4888  C  C     . VAL H  4  117  ? 119.361 46.723  -24.658 1.00 63.27  ? 117  VAL B C     1 
ATOM   4889  O  O     . VAL H  4  117  ? 118.993 47.530  -23.799 1.00 62.82  ? 117  VAL B O     1 
ATOM   4890  C  CB    . VAL H  4  117  ? 117.359 45.649  -25.813 1.00 63.34  ? 117  VAL B CB    1 
ATOM   4891  C  CG1   . VAL H  4  117  ? 117.807 46.259  -27.137 1.00 63.00  ? 117  VAL B CG1   1 
ATOM   4892  C  CG2   . VAL H  4  117  ? 116.676 44.311  -26.097 1.00 62.27  ? 117  VAL B CG2   1 
ATOM   4893  N  N     . ALA H  4  118  ? 120.439 46.888  -25.414 1.00 63.29  ? 118  ALA B N     1 
ATOM   4894  C  CA    . ALA H  4  118  ? 121.407 47.984  -25.330 1.00 63.41  ? 118  ALA B CA    1 
ATOM   4895  C  C     . ALA H  4  118  ? 120.783 49.365  -25.015 1.00 63.92  ? 118  ALA B C     1 
ATOM   4896  O  O     . ALA H  4  118  ? 121.039 49.916  -23.935 1.00 63.77  ? 118  ALA B O     1 
ATOM   4897  C  CB    . ALA H  4  118  ? 122.180 48.050  -26.628 1.00 63.76  ? 118  ALA B CB    1 
ATOM   4898  N  N     . ASP H  4  119  ? 119.988 49.930  -25.934 1.00 64.59  ? 119  ASP B N     1 
ATOM   4899  C  CA    . ASP H  4  119  ? 119.430 51.293  -25.761 1.00 64.62  ? 119  ASP B CA    1 
ATOM   4900  C  C     . ASP H  4  119  ? 118.029 51.311  -25.107 1.00 64.45  ? 119  ASP B C     1 
ATOM   4901  O  O     . ASP H  4  119  ? 117.453 52.394  -24.943 1.00 64.51  ? 119  ASP B O     1 
ATOM   4902  C  CB    . ASP H  4  119  ? 119.312 52.012  -27.111 1.00 65.01  ? 119  ASP B CB    1 
ATOM   4903  C  CG    . ASP H  4  119  ? 120.613 52.113  -27.851 1.00 66.16  ? 119  ASP B CG    1 
ATOM   4904  O  OD1   . ASP H  4  119  ? 120.954 51.149  -28.571 1.00 66.43  ? 119  ASP B OD1   1 
ATOM   4905  O  OD2   . ASP H  4  119  ? 121.289 53.159  -27.713 1.00 66.63  ? 119  ASP B OD2   1 
ATOM   4906  N  N     . VAL H  4  120  ? 117.477 50.158  -24.736 1.00 64.27  ? 120  VAL B N     1 
ATOM   4907  C  CA    . VAL H  4  120  ? 116.143 50.103  -24.130 1.00 62.74  ? 120  VAL B CA    1 
ATOM   4908  C  C     . VAL H  4  120  ? 116.221 49.779  -22.624 1.00 63.67  ? 120  VAL B C     1 
ATOM   4909  O  O     . VAL H  4  120  ? 117.099 49.028  -22.164 1.00 64.03  ? 120  VAL B O     1 
ATOM   4910  C  CB    . VAL H  4  120  ? 115.259 49.027  -24.854 1.00 61.35  ? 120  VAL B CB    1 
ATOM   4911  C  CG1   . VAL H  4  120  ? 113.877 48.986  -24.271 1.00 60.96  ? 120  VAL B CG1   1 
ATOM   4912  C  CG2   . VAL H  4  120  ? 115.172 49.342  -26.344 1.00 59.63  ? 120  VAL B CG2   1 
ATOM   4913  N  N     . GLU H  4  121  ? 115.286 50.361  -21.872 1.00 64.66  ? 121  GLU B N     1 
ATOM   4914  C  CA    . GLU H  4  121  ? 115.188 50.179  -20.422 1.00 64.70  ? 121  GLU B CA    1 
ATOM   4915  C  C     . GLU H  4  121  ? 113.759 49.772  -20.003 1.00 64.40  ? 121  GLU B C     1 
ATOM   4916  O  O     . GLU H  4  121  ? 112.782 50.170  -20.644 1.00 64.11  ? 121  GLU B O     1 
ATOM   4917  C  CB    . GLU H  4  121  ? 115.595 51.487  -19.723 1.00 63.23  ? 121  GLU B CB    1 
ATOM   4918  C  CG    . GLU H  4  121  ? 115.474 51.475  -18.232 1.00 62.14  ? 121  GLU B CG    1 
ATOM   4919  C  CD    . GLU H  4  121  ? 115.978 52.740  -17.619 1.00 61.83  ? 121  GLU B CD    1 
ATOM   4920  O  OE1   . GLU H  4  121  ? 116.720 53.466  -18.312 1.00 61.13  ? 121  GLU B OE1   1 
ATOM   4921  O  OE2   . GLU H  4  121  ? 115.642 53.004  -16.446 1.00 62.83  ? 121  GLU B OE2   1 
ATOM   4922  N  N     . ILE H  4  122  ? 113.653 48.981  -18.929 1.00 65.12  ? 122  ILE B N     1 
ATOM   4923  C  CA    . ILE H  4  122  ? 112.367 48.511  -18.399 1.00 65.18  ? 122  ILE B CA    1 
ATOM   4924  C  C     . ILE H  4  122  ? 112.102 49.084  -16.981 1.00 65.98  ? 122  ILE B C     1 
ATOM   4925  O  O     . ILE H  4  122  ? 112.684 48.609  -16.005 1.00 66.59  ? 122  ILE B O     1 
ATOM   4926  C  CB    . ILE H  4  122  ? 112.317 46.922  -18.327 1.00 64.89  ? 122  ILE B CB    1 
ATOM   4927  C  CG1   . ILE H  4  122  ? 113.572 46.295  -18.966 1.00 62.91  ? 122  ILE B CG1   1 
ATOM   4928  C  CG2   . ILE H  4  122  ? 111.055 46.417  -19.053 1.00 65.20  ? 122  ILE B CG2   1 
ATOM   4929  C  CD1   . ILE H  4  122  ? 113.626 44.769  -18.935 1.00 60.12  ? 122  ILE B CD1   1 
ATOM   4930  N  N     . MET H  4  123  ? 111.230 50.095  -16.878 1.00 65.35  ? 123  MET B N     1 
ATOM   4931  C  CA    . MET H  4  123  ? 110.889 50.741  -15.600 1.00 65.46  ? 123  MET B CA    1 
ATOM   4932  C  C     . MET H  4  123  ? 109.787 49.983  -14.862 1.00 67.49  ? 123  MET B C     1 
ATOM   4933  O  O     . MET H  4  123  ? 109.400 50.352  -13.749 1.00 67.18  ? 123  MET B O     1 
ATOM   4934  C  CB    . MET H  4  123  ? 110.416 52.168  -15.838 1.00 63.37  ? 123  MET B CB    1 
ATOM   4935  C  CG    . MET H  4  123  ? 111.518 53.216  -15.803 1.00 61.72  ? 123  MET B CG    1 
ATOM   4936  S  SD    . MET H  4  123  ? 112.197 53.443  -14.138 1.00 60.67  ? 123  MET B SD    1 
ATOM   4937  C  CE    . MET H  4  123  ? 110.872 54.192  -13.362 1.00 59.82  ? 123  MET B CE    1 
ATOM   4938  N  N     . ASN H  4  124  ? 109.286 48.924  -15.488 1.00 68.77  ? 124  ASN B N     1 
ATOM   4939  C  CA    . ASN H  4  124  ? 108.239 48.084  -14.910 1.00 71.68  ? 124  ASN B CA    1 
ATOM   4940  C  C     . ASN H  4  124  ? 108.739 46.624  -14.731 1.00 72.22  ? 124  ASN B C     1 
ATOM   4941  O  O     . ASN H  4  124  ? 108.208 45.713  -15.362 1.00 71.94  ? 124  ASN B O     1 
ATOM   4942  C  CB    . ASN H  4  124  ? 107.019 48.120  -15.834 1.00 72.83  ? 124  ASN B CB    1 
ATOM   4943  C  CG    . ASN H  4  124  ? 105.816 47.442  -15.232 1.00 75.02  ? 124  ASN B CG    1 
ATOM   4944  O  OD1   . ASN H  4  124  ? 105.814 47.094  -14.042 1.00 75.26  ? 124  ASN B OD1   1 
ATOM   4945  N  ND2   . ASN H  4  124  ? 104.776 47.252  -16.044 1.00 76.12  ? 124  ASN B ND2   1 
ATOM   4946  N  N     . PRO H  4  125  ? 109.767 46.392  -13.864 1.00 73.26  ? 125  PRO B N     1 
ATOM   4947  C  CA    . PRO H  4  125  ? 110.392 45.084  -13.568 1.00 73.12  ? 125  PRO B CA    1 
ATOM   4948  C  C     . PRO H  4  125  ? 109.451 44.045  -12.930 1.00 72.82  ? 125  PRO B C     1 
ATOM   4949  O  O     . PRO H  4  125  ? 109.203 42.996  -13.537 1.00 74.24  ? 125  PRO B O     1 
ATOM   4950  C  CB    . PRO H  4  125  ? 111.560 45.450  -12.654 1.00 73.76  ? 125  PRO B CB    1 
ATOM   4951  C  CG    . PRO H  4  125  ? 111.967 46.775  -13.168 1.00 74.03  ? 125  PRO B CG    1 
ATOM   4952  C  CD    . PRO H  4  125  ? 110.620 47.456  -13.291 1.00 73.55  ? 125  PRO B CD    1 
ATOM   4953  N  N     . ASP H  4  126  ? 108.945 44.323  -11.724 1.00 71.71  ? 126  ASP B N     1 
ATOM   4954  C  CA    . ASP H  4  126  ? 108.118 43.373  -10.961 1.00 69.90  ? 126  ASP B CA    1 
ATOM   4955  C  C     . ASP H  4  126  ? 106.725 43.149  -11.559 1.00 68.59  ? 126  ASP B C     1 
ATOM   4956  O  O     . ASP H  4  126  ? 105.922 42.454  -10.921 1.00 70.70  ? 126  ASP B O     1 
ATOM   4957  C  CB    . ASP H  4  126  ? 107.990 43.857  -9.525  1.00 69.60  ? 126  ASP B CB    1 
ATOM   4958  C  CG    . ASP H  4  126  ? 109.269 44.452  -9.034  1.00 70.71  ? 126  ASP B CG    1 
ATOM   4959  O  OD1   . ASP H  4  126  ? 110.317 43.813  -9.267  1.00 71.13  ? 126  ASP B OD1   1 
ATOM   4960  O  OD2   . ASP H  4  126  ? 109.238 45.545  -8.429  1.00 71.73  ? 126  ASP B OD2   1 
ATOM   4961  N  N     . LEU H  4  127  ? 106.408 43.706  -12.734 1.00 66.65  ? 127  LEU B N     1 
ATOM   4962  C  CA    . LEU H  4  127  ? 105.092 43.434  -13.329 1.00 62.73  ? 127  LEU B CA    1 
ATOM   4963  C  C     . LEU H  4  127  ? 104.925 41.940  -13.543 1.00 61.67  ? 127  LEU B C     1 
ATOM   4964  O  O     . LEU H  4  127  ? 105.813 41.287  -14.100 1.00 61.50  ? 127  LEU B O     1 
ATOM   4965  C  CB    . LEU H  4  127  ? 104.918 44.138  -14.688 1.00 60.84  ? 127  LEU B CB    1 
ATOM   4966  C  CG    . LEU H  4  127  ? 103.588 43.874  -15.406 1.00 58.08  ? 127  LEU B CG    1 
ATOM   4967  C  CD1   . LEU H  4  127  ? 102.470 44.498  -14.617 1.00 56.11  ? 127  LEU B CD1   1 
ATOM   4968  C  CD2   . LEU H  4  127  ? 103.614 44.451  -16.774 1.00 56.24  ? 127  LEU B CD2   1 
ATOM   4969  N  N     . HIS H  4  128  ? 103.799 41.399  -13.098 1.00 60.50  ? 128  HIS B N     1 
ATOM   4970  C  CA    . HIS H  4  128  ? 103.575 39.975  -13.222 1.00 58.30  ? 128  HIS B CA    1 
ATOM   4971  C  C     . HIS H  4  128  ? 103.077 39.618  -14.598 1.00 57.60  ? 128  HIS B C     1 
ATOM   4972  O  O     . HIS H  4  128  ? 102.001 40.037  -15.001 1.00 57.94  ? 128  HIS B O     1 
ATOM   4973  C  CB    . HIS H  4  128  ? 102.566 39.504  -12.165 1.00 58.28  ? 128  HIS B CB    1 
ATOM   4974  C  CG    . HIS H  4  128  ? 102.798 38.094  -11.708 1.00 56.38  ? 128  HIS B CG    1 
ATOM   4975  N  ND1   . HIS H  4  128  ? 102.527 37.001  -12.502 1.00 56.10  ? 128  HIS B ND1   1 
ATOM   4976  C  CD2   . HIS H  4  128  ? 103.307 37.603  -10.553 1.00 55.70  ? 128  HIS B CD2   1 
ATOM   4977  C  CE1   . HIS H  4  128  ? 102.863 35.901  -11.858 1.00 53.75  ? 128  HIS B CE1   1 
ATOM   4978  N  NE2   . HIS H  4  128  ? 103.339 36.237  -10.674 1.00 55.15  ? 128  HIS B NE2   1 
ATOM   4979  N  N     . ILE H  4  129  ? 103.868 38.846  -15.328 1.00 55.79  ? 129  ILE B N     1 
ATOM   4980  C  CA    . ILE H  4  129  ? 103.450 38.426  -16.648 1.00 54.33  ? 129  ILE B CA    1 
ATOM   4981  C  C     . ILE H  4  129  ? 102.702 37.089  -16.564 1.00 54.20  ? 129  ILE B C     1 
ATOM   4982  O  O     . ILE H  4  129  ? 101.662 36.925  -17.192 1.00 54.10  ? 129  ILE B O     1 
ATOM   4983  C  CB    . ILE H  4  129  ? 104.695 38.325  -17.612 1.00 53.35  ? 129  ILE B CB    1 
ATOM   4984  C  CG1   . ILE H  4  129  ? 105.661 39.508  -17.367 1.00 53.23  ? 129  ILE B CG1   1 
ATOM   4985  C  CG2   . ILE H  4  129  ? 104.258 38.367  -19.072 1.00 51.53  ? 129  ILE B CG2   1 
ATOM   4986  C  CD1   . ILE H  4  129  ? 105.108 40.917  -17.491 1.00 51.96  ? 129  ILE B CD1   1 
ATOM   4987  N  N     . ALA H  4  130  ? 103.212 36.143  -15.777 1.00 55.02  ? 130  ALA B N     1 
ATOM   4988  C  CA    . ALA H  4  130  ? 102.528 34.857  -15.652 1.00 55.99  ? 130  ALA B CA    1 
ATOM   4989  C  C     . ALA H  4  130  ? 103.095 34.013  -14.525 1.00 56.45  ? 130  ALA B C     1 
ATOM   4990  O  O     . ALA H  4  130  ? 104.128 34.319  -13.933 1.00 56.89  ? 130  ALA B O     1 
ATOM   4991  C  CB    . ALA H  4  130  ? 102.628 34.077  -16.964 1.00 56.07  ? 130  ALA B CB    1 
ATOM   4992  N  N     . THR H  4  131  ? 102.370 32.939  -14.245 1.00 57.65  ? 131  THR B N     1 
ATOM   4993  C  CA    . THR H  4  131  ? 102.738 31.960  -13.245 1.00 58.48  ? 131  THR B CA    1 
ATOM   4994  C  C     . THR H  4  131  ? 102.900 30.601  -13.895 1.00 60.24  ? 131  THR B C     1 
ATOM   4995  O  O     . THR H  4  131  ? 101.922 30.016  -14.335 1.00 60.51  ? 131  THR B O     1 
ATOM   4996  C  CB    . THR H  4  131  ? 101.652 31.813  -12.134 1.00 58.23  ? 131  THR B CB    1 
ATOM   4997  O  OG1   . THR H  4  131  ? 100.405 31.448  -12.735 1.00 56.98  ? 131  THR B OG1   1 
ATOM   4998  C  CG2   . THR H  4  131  ? 101.451 33.097  -11.383 1.00 57.19  ? 131  THR B CG2   1 
ATOM   4999  N  N     . LEU H  4  132  ? 104.123 30.099  -13.981 1.00 62.30  ? 132  LEU B N     1 
ATOM   5000  C  CA    . LEU H  4  132  ? 104.318 28.794  -14.588 1.00 65.28  ? 132  LEU B CA    1 
ATOM   5001  C  C     . LEU H  4  132  ? 104.432 27.705  -13.515 1.00 65.52  ? 132  LEU B C     1 
ATOM   5002  O  O     . LEU H  4  132  ? 105.118 27.876  -12.501 1.00 65.97  ? 132  LEU B O     1 
ATOM   5003  C  CB    . LEU H  4  132  ? 105.570 28.819  -15.490 1.00 67.24  ? 132  LEU B CB    1 
ATOM   5004  C  CG    . LEU H  4  132  ? 105.485 29.209  -16.987 1.00 68.73  ? 132  LEU B CG    1 
ATOM   5005  C  CD1   . LEU H  4  132  ? 104.874 30.610  -17.146 1.00 69.60  ? 132  LEU B CD1   1 
ATOM   5006  C  CD2   . LEU H  4  132  ? 106.895 29.163  -17.601 1.00 68.30  ? 132  LEU B CD2   1 
ATOM   5007  N  N     . GLU H  4  133  ? 103.743 26.590  -13.748 1.00 65.16  ? 133  GLU B N     1 
ATOM   5008  C  CA    . GLU H  4  133  ? 103.715 25.477  -12.811 1.00 64.92  ? 133  GLU B CA    1 
ATOM   5009  C  C     . GLU H  4  133  ? 104.900 24.542  -13.013 1.00 65.82  ? 133  GLU B C     1 
ATOM   5010  O  O     . GLU H  4  133  ? 105.944 24.712  -12.405 1.00 65.68  ? 133  GLU B O     1 
ATOM   5011  C  CB    . GLU H  4  133  ? 102.405 24.706  -12.970 1.00 63.17  ? 133  GLU B CB    1 
ATOM   5012  C  CG    . GLU H  4  133  ? 102.080 23.856  -11.745 1.00 61.14  ? 133  GLU B CG    1 
ATOM   5013  C  CD    . GLU H  4  133  ? 101.938 24.672  -10.444 1.00 59.87  ? 133  GLU B CD    1 
ATOM   5014  O  OE1   . GLU H  4  133  ? 102.672 25.667  -10.249 1.00 57.67  ? 133  GLU B OE1   1 
ATOM   5015  O  OE2   . GLU H  4  133  ? 101.090 24.314  -9.598  1.00 58.17  ? 133  GLU B OE2   1 
ATOM   5016  N  N     . GLU H  4  134  ? 104.714 23.541  -13.858 1.00 66.09  ? 134  GLU B N     1 
ATOM   5017  C  CA    . GLU H  4  134  ? 105.758 22.585  -14.205 1.00 66.79  ? 134  GLU B CA    1 
ATOM   5018  C  C     . GLU H  4  134  ? 105.679 22.283  -15.688 1.00 67.71  ? 134  GLU B C     1 
ATOM   5019  O  O     . GLU H  4  134  ? 104.569 22.285  -16.244 1.00 68.87  ? 134  GLU B O     1 
ATOM   5020  C  CB    . GLU H  4  134  ? 105.601 21.279  -13.405 1.00 66.84  ? 134  GLU B CB    1 
ATOM   5021  C  CG    . GLU H  4  134  ? 106.923 20.687  -12.841 1.00 65.18  ? 134  GLU B CG    1 
ATOM   5022  C  CD    . GLU H  4  134  ? 107.828 19.999  -13.871 1.00 64.47  ? 134  GLU B CD    1 
ATOM   5023  O  OE1   . GLU H  4  134  ? 108.987 19.718  -13.518 1.00 65.09  ? 134  GLU B OE1   1 
ATOM   5024  O  OE2   . GLU H  4  134  ? 107.410 19.730  -15.015 1.00 63.26  ? 134  GLU B OE2   1 
ATOM   5025  N  N     . GLY H  4  135  ? 106.817 22.031  -16.336 1.00 67.34  ? 135  GLY B N     1 
ATOM   5026  C  CA    . GLY H  4  135  ? 106.773 21.800  -17.767 1.00 66.12  ? 135  GLY B CA    1 
ATOM   5027  C  C     . GLY H  4  135  ? 106.099 22.981  -18.440 1.00 64.68  ? 135  GLY B C     1 
ATOM   5028  O  O     . GLY H  4  135  ? 105.475 22.869  -19.501 1.00 64.98  ? 135  GLY B O     1 
ATOM   5029  N  N     . GLY H  4  136  ? 106.222 24.128  -17.781 1.00 63.03  ? 136  GLY B N     1 
ATOM   5030  C  CA    . GLY H  4  136  ? 105.639 25.344  -18.292 1.00 62.34  ? 136  GLY B CA    1 
ATOM   5031  C  C     . GLY H  4  136  ? 106.561 25.987  -19.293 1.00 61.75  ? 136  GLY B C     1 
ATOM   5032  O  O     . GLY H  4  136  ? 107.556 26.598  -18.914 1.00 62.15  ? 136  GLY B O     1 
ATOM   5033  N  N     . ARG H  4  137  ? 106.234 25.850  -20.573 1.00 60.82  ? 137  ARG B N     1 
ATOM   5034  C  CA    . ARG H  4  137  ? 107.071 26.402  -21.624 1.00 59.57  ? 137  ARG B CA    1 
ATOM   5035  C  C     . ARG H  4  137  ? 106.485 27.686  -22.191 1.00 59.32  ? 137  ARG B C     1 
ATOM   5036  O  O     . ARG H  4  137  ? 105.458 27.686  -22.857 1.00 58.39  ? 137  ARG B O     1 
ATOM   5037  C  CB    . ARG H  4  137  ? 107.240 25.353  -22.730 1.00 58.74  ? 137  ARG B CB    1 
ATOM   5038  C  CG    . ARG H  4  137  ? 108.297 25.668  -23.775 1.00 57.55  ? 137  ARG B CG    1 
ATOM   5039  C  CD    . ARG H  4  137  ? 107.833 26.668  -24.821 1.00 55.68  ? 137  ARG B CD    1 
ATOM   5040  N  NE    . ARG H  4  137  ? 108.754 26.705  -25.952 1.00 54.23  ? 137  ARG B NE    1 
ATOM   5041  C  CZ    . ARG H  4  137  ? 108.612 27.497  -27.002 1.00 53.21  ? 137  ARG B CZ    1 
ATOM   5042  N  NH1   . ARG H  4  137  ? 107.580 28.320  -27.047 1.00 53.40  ? 137  ARG B NH1   1 
ATOM   5043  N  NH2   . ARG H  4  137  ? 109.490 27.459  -27.994 1.00 50.36  ? 137  ARG B NH2   1 
ATOM   5044  N  N     . LEU H  4  138  ? 107.168 28.784  -21.917 1.00 60.08  ? 138  LEU B N     1 
ATOM   5045  C  CA    . LEU H  4  138  ? 106.753 30.082  -22.401 1.00 61.41  ? 138  LEU B CA    1 
ATOM   5046  C  C     . LEU H  4  138  ? 107.906 30.805  -23.087 1.00 62.46  ? 138  LEU B C     1 
ATOM   5047  O  O     . LEU H  4  138  ? 108.863 31.253  -22.437 1.00 61.61  ? 138  LEU B O     1 
ATOM   5048  C  CB    . LEU H  4  138  ? 106.246 30.946  -21.250 1.00 61.49  ? 138  LEU B CB    1 
ATOM   5049  C  CG    . LEU H  4  138  ? 106.168 32.436  -21.599 1.00 61.34  ? 138  LEU B CG    1 
ATOM   5050  C  CD1   . LEU H  4  138  ? 105.048 32.661  -22.623 1.00 60.52  ? 138  LEU B CD1   1 
ATOM   5051  C  CD2   . LEU H  4  138  ? 105.963 33.240  -20.333 1.00 59.68  ? 138  LEU B CD2   1 
ATOM   5052  N  N     . ASN H  4  139  ? 107.781 30.908  -24.404 1.00 63.79  ? 139  ASN B N     1 
ATOM   5053  C  CA    . ASN H  4  139  ? 108.753 31.571  -25.269 1.00 65.11  ? 139  ASN B CA    1 
ATOM   5054  C  C     . ASN H  4  139  ? 108.050 32.578  -26.163 1.00 64.97  ? 139  ASN B C     1 
ATOM   5055  O  O     . ASN H  4  139  ? 107.354 32.192  -27.104 1.00 65.37  ? 139  ASN B O     1 
ATOM   5056  C  CB    . ASN H  4  139  ? 109.477 30.504  -26.112 1.00 65.37  ? 139  ASN B CB    1 
ATOM   5057  C  CG    . ASN H  4  139  ? 110.438 31.087  -27.153 1.00 65.99  ? 139  ASN B CG    1 
ATOM   5058  O  OD1   . ASN H  4  139  ? 111.052 32.140  -26.955 1.00 66.83  ? 139  ASN B OD1   1 
ATOM   5059  N  ND2   . ASN H  4  139  ? 110.579 30.382  -28.269 1.00 65.44  ? 139  ASN B ND2   1 
ATOM   5060  N  N     . MET H  4  140  ? 108.220 33.864  -25.878 1.00 65.25  ? 140  MET B N     1 
ATOM   5061  C  CA    . MET H  4  140  ? 107.509 34.856  -26.660 1.00 65.75  ? 140  MET B CA    1 
ATOM   5062  C  C     . MET H  4  140  ? 108.407 35.997  -27.104 1.00 66.68  ? 140  MET B C     1 
ATOM   5063  O  O     . MET H  4  140  ? 109.532 36.188  -26.629 1.00 66.70  ? 140  MET B O     1 
ATOM   5064  C  CB    . MET H  4  140  ? 106.333 35.422  -25.832 1.00 64.39  ? 140  MET B CB    1 
ATOM   5065  C  CG    . MET H  4  140  ? 106.722 36.489  -24.750 1.00 62.43  ? 140  MET B CG    1 
ATOM   5066  S  SD    . MET H  4  140  ? 106.336 36.142  -22.983 1.00 59.99  ? 140  MET B SD    1 
ATOM   5067  C  CE    . MET H  4  140  ? 105.115 37.364  -22.600 1.00 58.85  ? 140  MET B CE    1 
ATOM   5068  N  N     . GLU H  4  141  ? 107.852 36.749  -28.043 1.00 68.01  ? 141  GLU B N     1 
ATOM   5069  C  CA    . GLU H  4  141  ? 108.469 37.933  -28.600 1.00 68.73  ? 141  GLU B CA    1 
ATOM   5070  C  C     . GLU H  4  141  ? 107.468 39.066  -28.624 1.00 68.91  ? 141  GLU B C     1 
ATOM   5071  O  O     . GLU H  4  141  ? 106.499 39.030  -29.387 1.00 69.09  ? 141  GLU B O     1 
ATOM   5072  C  CB    . GLU H  4  141  ? 108.966 37.665  -30.020 1.00 70.44  ? 141  GLU B CB    1 
ATOM   5073  C  CG    . GLU H  4  141  ? 109.788 36.386  -30.166 1.00 71.89  ? 141  GLU B CG    1 
ATOM   5074  C  CD    . GLU H  4  141  ? 110.745 36.447  -31.352 1.00 73.55  ? 141  GLU B CD    1 
ATOM   5075  O  OE1   . GLU H  4  141  ? 111.944 36.757  -31.147 1.00 73.91  ? 141  GLU B OE1   1 
ATOM   5076  O  OE2   . GLU H  4  141  ? 110.295 36.191  -32.491 1.00 73.96  ? 141  GLU B OE2   1 
ATOM   5077  N  N     . VAL H  4  142  ? 107.696 40.067  -27.783 1.00 69.25  ? 142  VAL B N     1 
ATOM   5078  C  CA    . VAL H  4  142  ? 106.778 41.191  -27.701 1.00 69.21  ? 142  VAL B CA    1 
ATOM   5079  C  C     . VAL H  4  142  ? 107.383 42.471  -28.306 1.00 69.46  ? 142  VAL B C     1 
ATOM   5080  O  O     . VAL H  4  142  ? 108.379 43.024  -27.826 1.00 69.70  ? 142  VAL B O     1 
ATOM   5081  C  CB    . VAL H  4  142  ? 106.365 41.408  -26.221 1.00 67.93  ? 142  VAL B CB    1 
ATOM   5082  C  CG1   . VAL H  4  142  ? 105.858 40.099  -25.665 1.00 67.73  ? 142  VAL B CG1   1 
ATOM   5083  C  CG2   . VAL H  4  142  ? 107.533 41.880  -25.381 1.00 67.03  ? 142  VAL B CG2   1 
ATOM   5084  N  N     . ARG H  4  143  ? 106.765 42.929  -29.386 1.00 70.16  ? 143  ARG B N     1 
ATOM   5085  C  CA    . ARG H  4  143  ? 107.212 44.137  -30.055 1.00 70.52  ? 143  ARG B CA    1 
ATOM   5086  C  C     . ARG H  4  143  ? 106.878 45.375  -29.223 1.00 71.98  ? 143  ARG B C     1 
ATOM   5087  O  O     . ARG H  4  143  ? 105.945 45.364  -28.414 1.00 72.38  ? 143  ARG B O     1 
ATOM   5088  C  CB    . ARG H  4  143  ? 106.550 44.225  -31.438 1.00 69.71  ? 143  ARG B CB    1 
ATOM   5089  C  CG    . ARG H  4  143  ? 107.268 43.397  -32.498 1.00 67.95  ? 143  ARG B CG    1 
ATOM   5090  C  CD    . ARG H  4  143  ? 106.550 43.420  -33.835 1.00 66.08  ? 143  ARG B CD    1 
ATOM   5091  N  NE    . ARG H  4  143  ? 106.290 44.769  -34.319 1.00 64.41  ? 143  ARG B NE    1 
ATOM   5092  C  CZ    . ARG H  4  143  ? 106.219 45.087  -35.608 1.00 64.40  ? 143  ARG B CZ    1 
ATOM   5093  N  NH1   . ARG H  4  143  ? 106.391 44.149  -36.532 1.00 64.26  ? 143  ARG B NH1   1 
ATOM   5094  N  NH2   . ARG H  4  143  ? 105.964 46.333  -35.979 1.00 64.01  ? 143  ARG B NH2   1 
ATOM   5095  N  N     . VAL H  4  144  ? 107.651 46.437  -29.410 1.00 72.18  ? 144  VAL B N     1 
ATOM   5096  C  CA    . VAL H  4  144  ? 107.425 47.692  -28.705 1.00 73.00  ? 144  VAL B CA    1 
ATOM   5097  C  C     . VAL H  4  144  ? 107.677 48.884  -29.633 1.00 75.72  ? 144  VAL B C     1 
ATOM   5098  O  O     . VAL H  4  144  ? 108.701 48.933  -30.313 1.00 76.95  ? 144  VAL B O     1 
ATOM   5099  C  CB    . VAL H  4  144  ? 108.344 47.804  -27.487 1.00 71.12  ? 144  VAL B CB    1 
ATOM   5100  C  CG1   . VAL H  4  144  ? 107.862 48.898  -26.615 1.00 69.68  ? 144  VAL B CG1   1 
ATOM   5101  C  CG2   . VAL H  4  144  ? 108.358 46.502  -26.705 1.00 69.17  ? 144  VAL B CG2   1 
ATOM   5102  N  N     . ASP H  4  145  ? 106.759 49.845  -29.665 1.00 78.03  ? 145  ASP B N     1 
ATOM   5103  C  CA    . ASP H  4  145  ? 106.908 50.975  -30.584 1.00 81.35  ? 145  ASP B CA    1 
ATOM   5104  C  C     . ASP H  4  145  ? 106.750 52.316  -29.894 1.00 83.34  ? 145  ASP B C     1 
ATOM   5105  O  O     . ASP H  4  145  ? 106.293 52.423  -28.752 1.00 84.09  ? 145  ASP B O     1 
ATOM   5106  C  CB    . ASP H  4  145  ? 105.855 50.920  -31.686 1.00 81.52  ? 145  ASP B CB    1 
ATOM   5107  C  CG    . ASP H  4  145  ? 106.057 49.774  -32.645 1.00 82.52  ? 145  ASP B CG    1 
ATOM   5108  O  OD1   . ASP H  4  145  ? 105.064 49.394  -33.306 1.00 82.50  ? 145  ASP B OD1   1 
ATOM   5109  O  OD2   . ASP H  4  145  ? 107.196 49.262  -32.745 1.00 83.28  ? 145  ASP B OD2   1 
ATOM   5110  N  N     . ARG H  4  146  ? 107.134 53.336  -30.664 1.00 85.11  ? 146  ARG B N     1 
ATOM   5111  C  CA    . ARG H  4  146  ? 107.051 54.743  -30.296 1.00 85.92  ? 146  ARG B CA    1 
ATOM   5112  C  C     . ARG H  4  146  ? 105.978 55.456  -31.135 1.00 87.81  ? 146  ARG B C     1 
ATOM   5113  O  O     . ARG H  4  146  ? 106.105 55.584  -32.363 1.00 88.14  ? 146  ARG B O     1 
ATOM   5114  C  CB    . ARG H  4  146  ? 108.414 55.427  -30.502 1.00 84.77  ? 146  ARG B CB    1 
ATOM   5115  C  CG    . ARG H  4  146  ? 109.171 55.063  -31.774 1.00 82.96  ? 146  ARG B CG    1 
ATOM   5116  C  CD    . ARG H  4  146  ? 110.282 56.074  -32.013 1.00 81.56  ? 146  ARG B CD    1 
ATOM   5117  N  NE    . ARG H  4  146  ? 111.034 56.327  -30.788 1.00 80.66  ? 146  ARG B NE    1 
ATOM   5118  C  CZ    . ARG H  4  146  ? 111.288 57.535  -30.296 1.00 79.96  ? 146  ARG B CZ    1 
ATOM   5119  N  NH1   . ARG H  4  146  ? 110.857 58.621  -30.924 1.00 79.70  ? 146  ARG B NH1   1 
ATOM   5120  N  NH2   . ARG H  4  146  ? 111.972 57.657  -29.169 1.00 79.54  ? 146  ARG B NH2   1 
ATOM   5121  N  N     . GLY H  4  147  ? 104.917 55.906  -30.465 1.00 89.05  ? 147  GLY B N     1 
ATOM   5122  C  CA    . GLY H  4  147  ? 103.830 56.586  -31.155 1.00 90.03  ? 147  GLY B CA    1 
ATOM   5123  C  C     . GLY H  4  147  ? 103.107 57.597  -30.271 1.00 90.12  ? 147  GLY B C     1 
ATOM   5124  O  O     . GLY H  4  147  ? 103.673 58.077  -29.281 1.00 90.18  ? 147  GLY B O     1 
ATOM   5125  N  N     . VAL H  4  148  ? 101.859 57.928  -30.621 1.00 89.24  ? 148  VAL B N     1 
ATOM   5126  C  CA    . VAL H  4  148  ? 101.069 58.895  -29.847 1.00 88.52  ? 148  VAL B CA    1 
ATOM   5127  C  C     . VAL H  4  148  ? 99.590  58.499  -29.770 1.00 87.53  ? 148  VAL B C     1 
ATOM   5128  O  O     . VAL H  4  148  ? 99.022  57.937  -30.704 1.00 87.58  ? 148  VAL B O     1 
ATOM   5129  C  CB    . VAL H  4  148  ? 101.148 60.357  -30.447 1.00 88.68  ? 148  VAL B CB    1 
ATOM   5130  C  CG1   . VAL H  4  148  ? 102.567 60.908  -30.265 1.00 87.98  ? 148  VAL B CG1   1 
ATOM   5131  C  CG2   . VAL H  4  148  ? 100.744 60.372  -31.905 1.00 89.02  ? 148  VAL B CG2   1 
ATOM   5132  N  N     . GLY H  4  149  ? 98.978  58.800  -28.632 1.00 85.66  ? 149  GLY B N     1 
ATOM   5133  C  CA    . GLY H  4  149  ? 97.571  58.510  -28.439 1.00 84.35  ? 149  GLY B CA    1 
ATOM   5134  C  C     . GLY H  4  149  ? 97.261  57.043  -28.262 1.00 84.46  ? 149  GLY B C     1 
ATOM   5135  O  O     . GLY H  4  149  ? 98.099  56.268  -27.804 1.00 84.26  ? 149  GLY B O     1 
ATOM   5136  N  N     . TYR H  4  150  ? 96.036  56.671  -28.626 1.00 84.71  ? 150  TYR B N     1 
ATOM   5137  C  CA    . TYR H  4  150  ? 95.572  55.285  -28.524 1.00 84.61  ? 150  TYR B CA    1 
ATOM   5138  C  C     . TYR H  4  150  ? 95.336  54.686  -29.912 1.00 85.40  ? 150  TYR B C     1 
ATOM   5139  O  O     . TYR H  4  150  ? 94.664  55.298  -30.745 1.00 85.90  ? 150  TYR B O     1 
ATOM   5140  C  CB    . TYR H  4  150  ? 94.256  55.206  -27.723 1.00 86.18  ? 150  TYR B CB    1 
ATOM   5141  C  CG    . TYR H  4  150  ? 93.904  53.805  -27.212 1.00 87.23  ? 150  TYR B CG    1 
ATOM   5142  C  CD1   . TYR H  4  150  ? 94.259  53.395  -25.905 1.00 87.15  ? 150  TYR B CD1   1 
ATOM   5143  C  CD2   . TYR H  4  150  ? 93.230  52.871  -28.040 1.00 87.31  ? 150  TYR B CD2   1 
ATOM   5144  C  CE1   . TYR H  4  150  ? 93.947  52.064  -25.424 1.00 87.55  ? 150  TYR B CE1   1 
ATOM   5145  C  CE2   . TYR H  4  150  ? 92.913  51.542  -27.576 1.00 87.39  ? 150  TYR B CE2   1 
ATOM   5146  C  CZ    . TYR H  4  150  ? 93.275  51.151  -26.273 1.00 87.83  ? 150  TYR B CZ    1 
ATOM   5147  O  OH    . TYR H  4  150  ? 92.965  49.868  -25.844 1.00 88.14  ? 150  TYR B OH    1 
ATOM   5148  N  N     . VAL H  4  151  ? 95.883  53.497  -30.163 1.00 86.05  ? 151  VAL B N     1 
ATOM   5149  C  CA    . VAL H  4  151  ? 95.698  52.844  -31.467 1.00 86.63  ? 151  VAL B CA    1 
ATOM   5150  C  C     . VAL H  4  151  ? 95.152  51.414  -31.306 1.00 85.65  ? 151  VAL B C     1 
ATOM   5151  O  O     . VAL H  4  151  ? 95.896  50.496  -30.939 1.00 85.35  ? 151  VAL B O     1 
ATOM   5152  C  CB    . VAL H  4  151  ? 97.039  52.768  -32.275 1.00 86.76  ? 151  VAL B CB    1 
ATOM   5153  C  CG1   . VAL H  4  151  ? 96.726  52.609  -33.772 1.00 86.09  ? 151  VAL B CG1   1 
ATOM   5154  C  CG2   . VAL H  4  151  ? 97.887  54.023  -32.030 1.00 86.59  ? 151  VAL B CG2   1 
ATOM   5155  N  N     . PRO H  4  152  ? 93.842  51.208  -31.576 1.00 85.42  ? 152  PRO B N     1 
ATOM   5156  C  CA    . PRO H  4  152  ? 93.285  49.859  -31.434 1.00 85.35  ? 152  PRO B CA    1 
ATOM   5157  C  C     . PRO H  4  152  ? 94.109  48.832  -32.190 1.00 86.01  ? 152  PRO B C     1 
ATOM   5158  O  O     . PRO H  4  152  ? 94.676  49.148  -33.237 1.00 85.80  ? 152  PRO B O     1 
ATOM   5159  C  CB    . PRO H  4  152  ? 91.866  50.008  -31.971 1.00 85.11  ? 152  PRO B CB    1 
ATOM   5160  C  CG    . PRO H  4  152  ? 91.518  51.398  -31.595 1.00 85.33  ? 152  PRO B CG    1 
ATOM   5161  C  CD    . PRO H  4  152  ? 92.779  52.161  -31.958 1.00 85.54  ? 152  PRO B CD    1 
ATOM   5162  N  N     . ALA H  4  153  ? 94.183  47.616  -31.652 1.00 86.00  ? 153  ALA B N     1 
ATOM   5163  C  CA    . ALA H  4  153  ? 94.938  46.540  -32.287 1.00 85.98  ? 153  ALA B CA    1 
ATOM   5164  C  C     . ALA H  4  153  ? 94.426  46.278  -33.707 1.00 85.85  ? 153  ALA B C     1 
ATOM   5165  O  O     . ALA H  4  153  ? 95.150  45.741  -34.557 1.00 86.30  ? 153  ALA B O     1 
ATOM   5166  C  CB    . ALA H  4  153  ? 94.826  45.267  -31.450 1.00 85.79  ? 153  ALA B CB    1 
ATOM   5167  N  N     . GLU H  4  154  ? 93.172  46.676  -33.944 1.00 85.67  ? 154  GLU B N     1 
ATOM   5168  C  CA    . GLU H  4  154  ? 92.509  46.519  -35.240 1.00 84.34  ? 154  GLU B CA    1 
ATOM   5169  C  C     . GLU H  4  154  ? 93.033  47.526  -36.265 1.00 83.69  ? 154  GLU B C     1 
ATOM   5170  O  O     . GLU H  4  154  ? 93.136  47.215  -37.451 1.00 84.11  ? 154  GLU B O     1 
ATOM   5171  C  CB    . GLU H  4  154  ? 90.996  46.715  -35.089 1.00 82.97  ? 154  GLU B CB    1 
ATOM   5172  C  CG    . GLU H  4  154  ? 90.223  46.633  -36.423 1.00 82.24  ? 154  GLU B CG    1 
ATOM   5173  C  CD    . GLU H  4  154  ? 88.721  46.838  -36.266 1.00 82.04  ? 154  GLU B CD    1 
ATOM   5174  O  OE1   . GLU H  4  154  ? 87.970  46.507  -37.203 1.00 80.45  ? 154  GLU B OE1   1 
ATOM   5175  O  OE2   . GLU H  4  154  ? 88.285  47.331  -35.208 1.00 82.59  ? 154  GLU B OE2   1 
ATOM   5176  N  N     . LYS H  4  155  ? 93.363  48.726  -35.799 1.00 83.86  ? 155  LYS B N     1 
ATOM   5177  C  CA    . LYS H  4  155  ? 93.844  49.806  -36.663 1.00 83.39  ? 155  LYS B CA    1 
ATOM   5178  C  C     . LYS H  4  155  ? 95.228  49.523  -37.270 1.00 83.45  ? 155  LYS B C     1 
ATOM   5179  O  O     . LYS H  4  155  ? 95.376  49.691  -38.479 1.00 83.75  ? 155  LYS B O     1 
ATOM   5180  C  CB    . LYS H  4  155  ? 93.888  51.122  -35.884 1.00 82.55  ? 155  LYS B CB    1 
ATOM   5181  C  CG    . LYS H  4  155  ? 92.583  51.891  -35.871 1.00 82.59  ? 155  LYS B CG    1 
ATOM   5182  C  CD    . LYS H  4  155  ? 91.456  51.136  -35.181 1.00 82.96  ? 155  LYS B CD    1 
ATOM   5183  C  CE    . LYS H  4  155  ? 90.680  50.230  -36.131 1.00 82.99  ? 155  LYS B CE    1 
ATOM   5184  N  NZ    . LYS H  4  155  ? 89.636  49.481  -35.401 1.00 82.95  ? 155  LYS B NZ    1 
ATOM   5185  N  N     . HIS H  4  156  ? 96.242  49.114  -36.496 1.00 83.21  ? 156  HIS B N     1 
ATOM   5186  C  CA    . HIS H  4  156  ? 97.546  48.895  -37.135 1.00 81.69  ? 156  HIS B CA    1 
ATOM   5187  C  C     . HIS H  4  156  ? 97.741  47.457  -37.589 1.00 81.44  ? 156  HIS B C     1 
ATOM   5188  O  O     . HIS H  4  156  ? 98.281  47.262  -38.674 1.00 81.78  ? 156  HIS B O     1 
ATOM   5189  C  CB    . HIS H  4  156  ? 98.742  49.302  -36.243 1.00 82.97  ? 156  HIS B CB    1 
ATOM   5190  C  CG    . HIS H  4  156  ? 98.674  48.848  -34.825 1.00 84.53  ? 156  HIS B CG    1 
ATOM   5191  N  ND1   . HIS H  4  156  ? 97.952  47.749  -34.410 1.00 86.49  ? 156  HIS B ND1   1 
ATOM   5192  C  CD2   . HIS H  4  156  ? 99.263  49.353  -33.716 1.00 85.37  ? 156  HIS B CD2   1 
ATOM   5193  C  CE1   . HIS H  4  156  ? 98.100  47.598  -33.104 1.00 86.52  ? 156  HIS B CE1   1 
ATOM   5194  N  NE2   . HIS H  4  156  ? 98.891  48.558  -32.660 1.00 86.42  ? 156  HIS B NE2   1 
ATOM   5195  N  N     . GLY H  4  157  ? 97.315  46.464  -36.805 1.00 80.25  ? 157  GLY B N     1 
ATOM   5196  C  CA    . GLY H  4  157  ? 97.497  45.073  -37.207 1.00 78.83  ? 157  GLY B CA    1 
ATOM   5197  C  C     . GLY H  4  157  ? 98.943  44.765  -37.566 1.00 77.89  ? 157  GLY B C     1 
ATOM   5198  O  O     . GLY H  4  157  ? 99.307  44.738  -38.738 1.00 78.68  ? 157  GLY B O     1 
ATOM   5199  N  N     . ILE H  4  158  ? 99.773  44.537  -36.556 1.00 76.80  ? 158  ILE B N     1 
ATOM   5200  C  CA    . ILE H  4  158  ? 101.187 44.252  -36.772 1.00 75.97  ? 158  ILE B CA    1 
ATOM   5201  C  C     . ILE H  4  158  ? 101.413 42.771  -37.072 1.00 75.76  ? 158  ILE B C     1 
ATOM   5202  O  O     . ILE H  4  158  ? 100.733 41.914  -36.518 1.00 76.26  ? 158  ILE B O     1 
ATOM   5203  C  CB    . ILE H  4  158  ? 101.976 44.706  -35.536 1.00 75.83  ? 158  ILE B CB    1 
ATOM   5204  C  CG1   . ILE H  4  158  ? 102.025 46.242  -35.537 1.00 74.76  ? 158  ILE B CG1   1 
ATOM   5205  C  CG2   . ILE H  4  158  ? 103.341 44.047  -35.500 1.00 76.09  ? 158  ILE B CG2   1 
ATOM   5206  C  CD1   . ILE H  4  158  ? 102.748 46.897  -36.707 1.00 74.21  ? 158  ILE B CD1   1 
ATOM   5207  N  N     . LYS H  4  159  ? 102.386 42.476  -37.933 1.00 75.55  ? 159  LYS B N     1 
ATOM   5208  C  CA    . LYS H  4  159  ? 102.612 41.102  -38.367 1.00 75.17  ? 159  LYS B CA    1 
ATOM   5209  C  C     . LYS H  4  159  ? 104.102 40.747  -38.495 1.00 74.36  ? 159  LYS B C     1 
ATOM   5210  O  O     . LYS H  4  159  ? 104.613 40.581  -39.612 1.00 73.27  ? 159  LYS B O     1 
ATOM   5211  C  CB    . LYS H  4  159  ? 101.934 40.892  -39.718 1.00 76.60  ? 159  LYS B CB    1 
ATOM   5212  C  CG    . LYS H  4  159  ? 102.369 41.963  -40.773 1.00 78.88  ? 159  LYS B CG    1 
ATOM   5213  C  CD    . LYS H  4  159  ? 101.699 43.369  -40.589 1.00 79.84  ? 159  LYS B CD    1 
ATOM   5214  C  CE    . LYS H  4  159  ? 102.625 44.583  -40.870 1.00 79.67  ? 159  LYS B CE    1 
ATOM   5215  N  NZ    . LYS H  4  159  ? 103.404 45.071  -39.676 1.00 79.35  ? 159  LYS B NZ    1 
ATOM   5216  N  N     . ASP H  4  160  ? 104.803 40.630  -37.370 1.00 73.61  ? 160  ASP B N     1 
ATOM   5217  C  CA    . ASP H  4  160  ? 106.190 40.176  -37.428 1.00 72.67  ? 160  ASP B CA    1 
ATOM   5218  C  C     . ASP H  4  160  ? 106.208 38.718  -37.860 1.00 72.08  ? 160  ASP B C     1 
ATOM   5219  O  O     . ASP H  4  160  ? 106.864 38.336  -38.831 1.00 73.08  ? 160  ASP B O     1 
ATOM   5220  C  CB    . ASP H  4  160  ? 106.858 40.354  -36.046 1.00 70.94  ? 160  ASP B CB    1 
ATOM   5221  C  CG    . ASP H  4  160  ? 108.107 39.497  -35.863 1.00 70.13  ? 160  ASP B CG    1 
ATOM   5222  O  OD1   . ASP H  4  160  ? 108.901 39.402  -36.811 1.00 69.45  ? 160  ASP B OD1   1 
ATOM   5223  O  OD2   . ASP H  4  160  ? 108.305 38.924  -34.770 1.00 68.89  ? 160  ASP B OD2   1 
ATOM   5224  N  N     . ARG H  4  161  ? 105.449 37.920  -37.116 1.00 71.63  ? 161  ARG B N     1 
ATOM   5225  C  CA    . ARG H  4  161  ? 105.228 36.521  -37.411 1.00 69.94  ? 161  ARG B CA    1 
ATOM   5226  C  C     . ARG H  4  161  ? 103.769 36.333  -37.819 1.00 69.70  ? 161  ARG B C     1 
ATOM   5227  O  O     . ARG H  4  161  ? 102.911 37.042  -37.297 1.00 69.69  ? 161  ARG B O     1 
ATOM   5228  C  CB    . ARG H  4  161  ? 105.551 35.678  -36.179 1.00 70.57  ? 161  ARG B CB    1 
ATOM   5229  C  CG    . ARG H  4  161  ? 106.284 34.406  -36.470 1.00 72.21  ? 161  ARG B CG    1 
ATOM   5230  C  CD    . ARG H  4  161  ? 107.730 34.683  -36.796 1.00 74.14  ? 161  ARG B CD    1 
ATOM   5231  N  NE    . ARG H  4  161  ? 108.599 34.603  -35.625 1.00 76.51  ? 161  ARG B NE    1 
ATOM   5232  C  CZ    . ARG H  4  161  ? 109.920 34.795  -35.654 1.00 77.76  ? 161  ARG B CZ    1 
ATOM   5233  N  NH1   . ARG H  4  161  ? 110.543 35.090  -36.793 1.00 78.43  ? 161  ARG B NH1   1 
ATOM   5234  N  NH2   . ARG H  4  161  ? 110.628 34.681  -34.543 1.00 76.95  ? 161  ARG B NH2   1 
ATOM   5235  N  N     . ILE H  4  162  ? 103.465 35.414  -38.729 1.00 69.98  ? 162  ILE B N     1 
ATOM   5236  C  CA    . ILE H  4  162  ? 102.080 35.289  -39.180 1.00 70.15  ? 162  ILE B CA    1 
ATOM   5237  C  C     . ILE H  4  162  ? 101.119 34.878  -38.057 1.00 71.60  ? 162  ILE B C     1 
ATOM   5238  O  O     . ILE H  4  162  ? 99.954  35.292  -38.094 1.00 72.60  ? 162  ILE B O     1 
ATOM   5239  C  CB    . ILE H  4  162  ? 101.926 34.288  -40.355 1.00 69.33  ? 162  ILE B CB    1 
ATOM   5240  C  CG1   . ILE H  4  162  ? 102.527 32.940  -40.005 1.00 69.87  ? 162  ILE B CG1   1 
ATOM   5241  C  CG2   . ILE H  4  162  ? 102.446 34.953  -41.593 1.00 68.40  ? 162  ILE B CG2   1 
ATOM   5242  C  CD1   . ILE H  4  162  ? 101.504 32.003  -39.378 1.00 69.72  ? 162  ILE B CD1   1 
ATOM   5243  N  N     . ASN H  4  163  ? 101.561 34.091  -37.070 1.00 72.19  ? 163  ASN B N     1 
ATOM   5244  C  CA    . ASN H  4  163  ? 100.646 33.658  -36.000 1.00 73.19  ? 163  ASN B CA    1 
ATOM   5245  C  C     . ASN H  4  163  ? 100.643 34.620  -34.826 1.00 74.19  ? 163  ASN B C     1 
ATOM   5246  O  O     . ASN H  4  163  ? 99.947  34.369  -33.843 1.00 74.27  ? 163  ASN B O     1 
ATOM   5247  C  CB    . ASN H  4  163  ? 100.997 32.273  -35.437 1.00 71.94  ? 163  ASN B CB    1 
ATOM   5248  C  CG    . ASN H  4  163  ? 102.167 31.627  -36.120 1.00 71.99  ? 163  ASN B CG    1 
ATOM   5249  O  OD1   . ASN H  4  163  ? 103.235 32.219  -36.262 1.00 70.82  ? 163  ASN B OD1   1 
ATOM   5250  N  ND2   . ASN H  4  163  ? 101.972 30.384  -36.550 1.00 72.30  ? 163  ASN B ND2   1 
ATOM   5251  N  N     . ALA H  4  164  ? 101.408 35.704  -34.904 1.00 74.56  ? 164  ALA B N     1 
ATOM   5252  C  CA    . ALA H  4  164  ? 101.438 36.676  -33.813 1.00 75.84  ? 164  ALA B CA    1 
ATOM   5253  C  C     . ALA H  4  164  ? 100.101 37.404  -33.703 1.00 76.64  ? 164  ALA B C     1 
ATOM   5254  O  O     . ALA H  4  164  ? 99.312  37.431  -34.654 1.00 75.24  ? 164  ALA B O     1 
ATOM   5255  C  CB    . ALA H  4  164  ? 102.547 37.681  -34.038 1.00 75.19  ? 164  ALA B CB    1 
ATOM   5256  N  N     . ILE H  4  165  ? 99.857  37.997  -32.538 1.00 76.60  ? 165  ILE B N     1 
ATOM   5257  C  CA    . ILE H  4  165  ? 98.606  38.696  -32.283 1.00 76.96  ? 165  ILE B CA    1 
ATOM   5258  C  C     . ILE H  4  165  ? 98.862  40.159  -31.871 1.00 77.87  ? 165  ILE B C     1 
ATOM   5259  O  O     . ILE H  4  165  ? 99.568  40.431  -30.903 1.00 78.24  ? 165  ILE B O     1 
ATOM   5260  C  CB    . ILE H  4  165  ? 97.805  37.942  -31.167 1.00 75.78  ? 165  ILE B CB    1 
ATOM   5261  C  CG1   . ILE H  4  165  ? 97.926  36.419  -31.374 1.00 75.02  ? 165  ILE B CG1   1 
ATOM   5262  C  CG2   . ILE H  4  165  ? 96.349  38.329  -31.222 1.00 76.00  ? 165  ILE B CG2   1 
ATOM   5263  C  CD1   . ILE H  4  165  ? 97.825  35.595  -30.122 1.00 72.36  ? 165  ILE B CD1   1 
ATOM   5264  N  N     . PRO H  4  166  ? 98.289  41.121  -32.612 1.00 79.25  ? 166  PRO B N     1 
ATOM   5265  C  CA    . PRO H  4  166  ? 98.471  42.547  -32.303 1.00 79.42  ? 166  PRO B CA    1 
ATOM   5266  C  C     . PRO H  4  166  ? 97.857  42.919  -30.973 1.00 78.99  ? 166  PRO B C     1 
ATOM   5267  O  O     . PRO H  4  166  ? 96.964  42.234  -30.486 1.00 79.67  ? 166  PRO B O     1 
ATOM   5268  C  CB    . PRO H  4  166  ? 97.796  43.259  -33.470 1.00 80.67  ? 166  PRO B CB    1 
ATOM   5269  C  CG    . PRO H  4  166  ? 97.852  42.231  -34.585 1.00 81.89  ? 166  PRO B CG    1 
ATOM   5270  C  CD    . PRO H  4  166  ? 97.516  40.960  -33.853 1.00 80.65  ? 166  PRO B CD    1 
ATOM   5271  N  N     . VAL H  4  167  ? 98.336  44.012  -30.394 1.00 78.85  ? 167  VAL B N     1 
ATOM   5272  C  CA    . VAL H  4  167  ? 97.817  44.470  -29.113 1.00 78.64  ? 167  VAL B CA    1 
ATOM   5273  C  C     . VAL H  4  167  ? 97.461  45.956  -29.166 1.00 77.83  ? 167  VAL B C     1 
ATOM   5274  O  O     . VAL H  4  167  ? 98.097  46.720  -29.898 1.00 77.72  ? 167  VAL B O     1 
ATOM   5275  C  CB    . VAL H  4  167  ? 98.865  44.247  -27.972 1.00 78.73  ? 167  VAL B CB    1 
ATOM   5276  C  CG1   . VAL H  4  167  ? 98.170  44.185  -26.624 1.00 79.25  ? 167  VAL B CG1   1 
ATOM   5277  C  CG2   . VAL H  4  167  ? 99.656  42.970  -28.227 1.00 78.44  ? 167  VAL B CG2   1 
ATOM   5278  N  N     . ASP H  4  168  ? 96.442  46.350  -28.398 1.00 76.94  ? 168  ASP B N     1 
ATOM   5279  C  CA    . ASP H  4  168  ? 96.025  47.748  -28.327 1.00 76.42  ? 168  ASP B CA    1 
ATOM   5280  C  C     . ASP H  4  168  ? 97.208  48.630  -27.877 1.00 76.13  ? 168  ASP B C     1 
ATOM   5281  O  O     . ASP H  4  168  ? 97.855  48.334  -26.867 1.00 76.47  ? 168  ASP B O     1 
ATOM   5282  C  CB    . ASP H  4  168  ? 94.845  47.907  -27.333 1.00 77.91  ? 168  ASP B CB    1 
ATOM   5283  C  CG    . ASP H  4  168  ? 93.490  47.388  -27.874 1.00 79.03  ? 168  ASP B CG    1 
ATOM   5284  O  OD1   . ASP H  4  168  ? 93.294  47.310  -29.107 1.00 80.86  ? 168  ASP B OD1   1 
ATOM   5285  O  OD2   . ASP H  4  168  ? 92.604  47.069  -27.045 1.00 78.31  ? 168  ASP B OD2   1 
ATOM   5286  N  N     . ALA H  4  169  ? 97.491  49.701  -28.616 1.00 74.77  ? 169  ALA B N     1 
ATOM   5287  C  CA    . ALA H  4  169  ? 98.625  50.590  -28.316 1.00 74.26  ? 169  ALA B CA    1 
ATOM   5288  C  C     . ALA H  4  169  ? 98.263  51.673  -27.294 1.00 74.39  ? 169  ALA B C     1 
ATOM   5289  O  O     . ALA H  4  169  ? 97.317  52.432  -27.495 1.00 75.25  ? 169  ALA B O     1 
ATOM   5290  C  CB    . ALA H  4  169  ? 99.095  51.247  -29.585 1.00 75.11  ? 169  ALA B CB    1 
ATOM   5291  N  N     . VAL H  4  170  ? 99.043  51.729  -26.208 1.00 72.92  ? 170  VAL B N     1 
ATOM   5292  C  CA    . VAL H  4  170  ? 98.921  52.703  -25.101 1.00 71.79  ? 170  VAL B CA    1 
ATOM   5293  C  C     . VAL H  4  170  ? 100.207 53.563  -25.024 1.00 70.57  ? 170  VAL B C     1 
ATOM   5294  O  O     . VAL H  4  170  ? 101.207 53.169  -24.418 1.00 70.59  ? 170  VAL B O     1 
ATOM   5295  C  CB    . VAL H  4  170  ? 98.669  51.921  -23.778 1.00 72.01  ? 170  VAL B CB    1 
ATOM   5296  C  CG1   . VAL H  4  170  ? 97.342  51.205  -23.870 1.00 72.21  ? 170  VAL B CG1   1 
ATOM   5297  C  CG2   . VAL H  4  170  ? 99.764  50.873  -23.544 1.00 71.62  ? 170  VAL B CG2   1 
ATOM   5298  N  N     . PHE H  4  171  ? 100.177 54.755  -25.610 1.00 69.33  ? 171  PHE B N     1 
ATOM   5299  C  CA    . PHE H  4  171  ? 101.441 55.473  -25.786 1.00 69.45  ? 171  PHE B CA    1 
ATOM   5300  C  C     . PHE H  4  171  ? 101.704 56.646  -24.832 1.00 70.65  ? 171  PHE B C     1 
ATOM   5301  O  O     . PHE H  4  171  ? 102.729 57.276  -25.030 1.00 69.30  ? 171  PHE B O     1 
ATOM   5302  C  CB    . PHE H  4  171  ? 101.515 55.975  -27.224 1.00 68.07  ? 171  PHE B CB    1 
ATOM   5303  C  CG    . PHE H  4  171  ? 101.767 54.891  -28.226 1.00 65.92  ? 171  PHE B CG    1 
ATOM   5304  C  CD1   . PHE H  4  171  ? 102.840 53.986  -28.051 1.00 65.05  ? 171  PHE B CD1   1 
ATOM   5305  C  CD2   . PHE H  4  171  ? 100.950 54.776  -29.368 1.00 64.50  ? 171  PHE B CD2   1 
ATOM   5306  C  CE1   . PHE H  4  171  ? 103.109 52.970  -28.994 1.00 63.74  ? 171  PHE B CE1   1 
ATOM   5307  C  CE2   . PHE H  4  171  ? 101.198 53.768  -30.327 1.00 64.07  ? 171  PHE B CE2   1 
ATOM   5308  C  CZ    . PHE H  4  171  ? 102.291 52.858  -30.135 1.00 64.16  ? 171  PHE B CZ    1 
ATOM   5309  N  N     . SER H  4  172  ? 100.912 56.991  -23.826 1.00 72.32  ? 172  SER B N     1 
ATOM   5310  C  CA    . SER H  4  172  ? 101.307 58.183  -23.039 1.00 74.85  ? 172  SER B CA    1 
ATOM   5311  C  C     . SER H  4  172  ? 101.826 57.822  -21.621 1.00 75.89  ? 172  SER B C     1 
ATOM   5312  O  O     . SER H  4  172  ? 101.288 56.927  -20.962 1.00 75.69  ? 172  SER B O     1 
ATOM   5313  C  CB    . SER H  4  172  ? 100.104 59.151  -22.945 1.00 75.53  ? 172  SER B CB    1 
ATOM   5314  O  OG    . SER H  4  172  ? 100.359 60.297  -22.150 1.00 77.10  ? 172  SER B OG    1 
ATOM   5315  N  N     . PRO H  4  173  ? 102.903 58.507  -21.150 1.00 77.11  ? 173  PRO B N     1 
ATOM   5316  C  CA    . PRO H  4  173  ? 103.432 58.236  -19.804 1.00 78.17  ? 173  PRO B CA    1 
ATOM   5317  C  C     . PRO H  4  173  ? 102.538 58.863  -18.710 1.00 79.05  ? 173  PRO B C     1 
ATOM   5318  O  O     . PRO H  4  173  ? 102.724 58.607  -17.517 1.00 80.44  ? 173  PRO B O     1 
ATOM   5319  C  CB    . PRO H  4  173  ? 104.837 58.835  -19.845 1.00 77.67  ? 173  PRO B CB    1 
ATOM   5320  C  CG    . PRO H  4  173  ? 105.224 58.649  -21.256 1.00 77.39  ? 173  PRO B CG    1 
ATOM   5321  C  CD    . PRO H  4  173  ? 103.968 59.111  -21.974 1.00 77.32  ? 173  PRO B CD    1 
ATOM   5322  N  N     . VAL H  4  174  ? 101.578 59.688  -19.136 1.00 79.23  ? 174  VAL B N     1 
ATOM   5323  C  CA    . VAL H  4  174  ? 100.606 60.334  -18.245 1.00 78.51  ? 174  VAL B CA    1 
ATOM   5324  C  C     . VAL H  4  174  ? 99.234  59.607  -18.343 1.00 77.01  ? 174  VAL B C     1 
ATOM   5325  O  O     . VAL H  4  174  ? 98.675  59.513  -19.435 1.00 76.20  ? 174  VAL B O     1 
ATOM   5326  C  CB    . VAL H  4  174  ? 100.480 61.855  -18.637 1.00 79.69  ? 174  VAL B CB    1 
ATOM   5327  C  CG1   . VAL H  4  174  ? 99.482  62.564  -17.722 1.00 81.00  ? 174  VAL B CG1   1 
ATOM   5328  C  CG2   . VAL H  4  174  ? 101.877 62.525  -18.550 1.00 79.23  ? 174  VAL B CG2   1 
ATOM   5329  N  N     . ARG H  4  175  ? 98.699  59.087  -17.230 1.00 75.04  ? 175  ARG B N     1 
ATOM   5330  C  CA    . ARG H  4  175  ? 97.432  58.345  -17.272 1.00 73.39  ? 175  ARG B CA    1 
ATOM   5331  C  C     . ARG H  4  175  ? 96.223  59.284  -17.254 1.00 73.16  ? 175  ARG B C     1 
ATOM   5332  O  O     . ARG H  4  175  ? 95.278  59.099  -18.029 1.00 73.56  ? 175  ARG B O     1 
ATOM   5333  C  CB    . ARG H  4  175  ? 97.344  57.354  -16.087 1.00 71.54  ? 175  ARG B CB    1 
ATOM   5334  C  CG    . ARG H  4  175  ? 98.669  56.664  -15.712 1.00 69.05  ? 175  ARG B CG    1 
ATOM   5335  C  CD    . ARG H  4  175  ? 99.444  56.153  -16.931 1.00 67.36  ? 175  ARG B CD    1 
ATOM   5336  N  NE    . ARG H  4  175  ? 99.363  54.708  -17.126 1.00 64.92  ? 175  ARG B NE    1 
ATOM   5337  C  CZ    . ARG H  4  175  ? 99.674  54.092  -18.262 1.00 63.33  ? 175  ARG B CZ    1 
ATOM   5338  N  NH1   . ARG H  4  175  ? 100.082 54.793  -19.313 1.00 62.86  ? 175  ARG B NH1   1 
ATOM   5339  N  NH2   . ARG H  4  175  ? 99.582  52.773  -18.346 1.00 61.92  ? 175  ARG B NH2   1 
ATOM   5340  N  N     . ARG H  4  176  ? 96.238  60.297  -16.395 1.00 72.50  ? 176  ARG B N     1 
ATOM   5341  C  CA    . ARG H  4  176  ? 95.090  61.188  -16.339 1.00 72.09  ? 176  ARG B CA    1 
ATOM   5342  C  C     . ARG H  4  176  ? 95.476  62.583  -15.909 1.00 72.51  ? 176  ARG B C     1 
ATOM   5343  O  O     . ARG H  4  176  ? 96.376  62.777  -15.104 1.00 73.24  ? 176  ARG B O     1 
ATOM   5344  C  CB    . ARG H  4  176  ? 94.028  60.633  -15.368 1.00 70.89  ? 176  ARG B CB    1 
ATOM   5345  C  CG    . ARG H  4  176  ? 94.620  59.805  -14.202 1.00 69.50  ? 176  ARG B CG    1 
ATOM   5346  C  CD    . ARG H  4  176  ? 93.596  59.267  -13.163 1.00 67.60  ? 176  ARG B CD    1 
ATOM   5347  N  NE    . ARG H  4  176  ? 93.971  57.921  -12.687 1.00 66.55  ? 176  ARG B NE    1 
ATOM   5348  C  CZ    . ARG H  4  176  ? 93.457  57.289  -11.628 1.00 65.92  ? 176  ARG B CZ    1 
ATOM   5349  N  NH1   . ARG H  4  176  ? 92.520  57.856  -10.881 1.00 66.28  ? 176  ARG B NH1   1 
ATOM   5350  N  NH2   . ARG H  4  176  ? 93.885  56.073  -11.313 1.00 64.94  ? 176  ARG B NH2   1 
ATOM   5351  N  N     . VAL H  4  177  ? 94.763  63.545  -16.475 1.00 72.95  ? 177  VAL B N     1 
ATOM   5352  C  CA    . VAL H  4  177  ? 94.924  64.952  -16.168 1.00 74.08  ? 177  VAL B CA    1 
ATOM   5353  C  C     . VAL H  4  177  ? 93.621  65.519  -15.628 1.00 75.47  ? 177  VAL B C     1 
ATOM   5354  O  O     . VAL H  4  177  ? 92.542  65.005  -15.952 1.00 76.69  ? 177  VAL B O     1 
ATOM   5355  C  CB    . VAL H  4  177  ? 95.316  65.730  -17.411 1.00 73.67  ? 177  VAL B CB    1 
ATOM   5356  C  CG1   . VAL H  4  177  ? 96.748  65.409  -17.777 1.00 74.66  ? 177  VAL B CG1   1 
ATOM   5357  C  CG2   . VAL H  4  177  ? 94.428  65.345  -18.547 1.00 74.08  ? 177  VAL B CG2   1 
ATOM   5358  N  N     . ALA H  4  178  ? 93.703  66.562  -14.807 1.00 75.62  ? 178  ALA B N     1 
ATOM   5359  C  CA    . ALA H  4  178  ? 92.501  67.171  -14.233 1.00 74.97  ? 178  ALA B CA    1 
ATOM   5360  C  C     . ALA H  4  178  ? 92.760  68.607  -13.834 1.00 74.62  ? 178  ALA B C     1 
ATOM   5361  O  O     . ALA H  4  178  ? 93.782  68.907  -13.226 1.00 74.23  ? 178  ALA B O     1 
ATOM   5362  C  CB    . ALA H  4  178  ? 92.042  66.374  -13.010 1.00 76.78  ? 178  ALA B CB    1 
ATOM   5363  N  N     . PHE H  4  179  ? 91.840  69.499  -14.177 1.00 73.20  ? 179  PHE B N     1 
ATOM   5364  C  CA    . PHE H  4  179  ? 92.027  70.893  -13.818 1.00 72.05  ? 179  PHE B CA    1 
ATOM   5365  C  C     . PHE H  4  179  ? 90.761  71.482  -13.220 1.00 70.42  ? 179  PHE B C     1 
ATOM   5366  O  O     . PHE H  4  179  ? 89.640  71.114  -13.592 1.00 70.92  ? 179  PHE B O     1 
ATOM   5367  C  CB    . PHE H  4  179  ? 92.469  71.714  -15.054 1.00 72.94  ? 179  PHE B CB    1 
ATOM   5368  C  CG    . PHE H  4  179  ? 91.322  72.276  -15.884 1.00 73.54  ? 179  PHE B CG    1 
ATOM   5369  C  CD1   . PHE H  4  179  ? 90.646  73.463  -15.493 1.00 73.06  ? 179  PHE B CD1   1 
ATOM   5370  C  CD2   . PHE H  4  179  ? 90.911  71.623  -17.062 1.00 74.69  ? 179  PHE B CD2   1 
ATOM   5371  C  CE1   . PHE H  4  179  ? 89.578  73.989  -16.258 1.00 73.10  ? 179  PHE B CE1   1 
ATOM   5372  C  CE2   . PHE H  4  179  ? 89.830  72.143  -17.850 1.00 75.22  ? 179  PHE B CE2   1 
ATOM   5373  C  CZ    . PHE H  4  179  ? 89.167  73.332  -17.439 1.00 74.28  ? 179  PHE B CZ    1 
ATOM   5374  N  N     . GLN H  4  180  ? 90.964  72.412  -12.291 1.00 68.55  ? 180  GLN B N     1 
ATOM   5375  C  CA    . GLN H  4  180  ? 89.870  73.112  -11.636 1.00 65.60  ? 180  GLN B CA    1 
ATOM   5376  C  C     . GLN H  4  180  ? 90.094  74.615  -11.679 1.00 62.73  ? 180  GLN B C     1 
ATOM   5377  O  O     . GLN H  4  180  ? 91.210  75.087  -11.502 1.00 62.46  ? 180  GLN B O     1 
ATOM   5378  C  CB    . GLN H  4  180  ? 89.742  72.666  -10.169 1.00 66.37  ? 180  GLN B CB    1 
ATOM   5379  C  CG    . GLN H  4  180  ? 89.094  71.279  -9.921  1.00 66.57  ? 180  GLN B CG    1 
ATOM   5380  C  CD    . GLN H  4  180  ? 88.938  70.935  -8.424  1.00 66.68  ? 180  GLN B CD    1 
ATOM   5381  O  OE1   . GLN H  4  180  ? 88.857  69.755  -8.049  1.00 65.80  ? 180  GLN B OE1   1 
ATOM   5382  N  NE2   . GLN H  4  180  ? 88.891  71.970  -7.572  1.00 66.30  ? 180  GLN B NE2   1 
ATOM   5383  N  N     . VAL H  4  181  ? 89.031  75.362  -11.929 1.00 59.73  ? 181  VAL B N     1 
ATOM   5384  C  CA    . VAL H  4  181  ? 89.119  76.808  -11.950 1.00 58.11  ? 181  VAL B CA    1 
ATOM   5385  C  C     . VAL H  4  181  ? 88.247  77.394  -10.880 1.00 56.33  ? 181  VAL B C     1 
ATOM   5386  O  O     . VAL H  4  181  ? 87.073  77.669  -11.096 1.00 55.80  ? 181  VAL B O     1 
ATOM   5387  C  CB    . VAL H  4  181  ? 88.679  77.379  -13.298 1.00 59.53  ? 181  VAL B CB    1 
ATOM   5388  C  CG1   . VAL H  4  181  ? 88.688  78.904  -13.257 1.00 60.31  ? 181  VAL B CG1   1 
ATOM   5389  C  CG2   . VAL H  4  181  ? 89.613  76.878  -14.375 1.00 61.92  ? 181  VAL B CG2   1 
ATOM   5390  N  N     . GLU H  4  182  ? 88.831  77.573  -9.713  1.00 54.36  ? 182  GLU B N     1 
ATOM   5391  C  CA    . GLU H  4  182  ? 88.097  78.107  -8.590  1.00 53.81  ? 182  GLU B CA    1 
ATOM   5392  C  C     . GLU H  4  182  ? 88.284  79.618  -8.494  1.00 54.14  ? 182  GLU B C     1 
ATOM   5393  O  O     . GLU H  4  182  ? 89.352  80.142  -8.831  1.00 54.47  ? 182  GLU B O     1 
ATOM   5394  C  CB    . GLU H  4  182  ? 88.568  77.429  -7.283  1.00 52.31  ? 182  GLU B CB    1 
ATOM   5395  C  CG    . GLU H  4  182  ? 88.983  75.932  -7.388  1.00 46.82  ? 182  GLU B CG    1 
ATOM   5396  C  CD    . GLU H  4  182  ? 90.466  75.727  -7.727  1.00 42.33  ? 182  GLU B CD    1 
ATOM   5397  O  OE1   . GLU H  4  182  ? 90.922  76.263  -8.759  1.00 38.86  ? 182  GLU B OE1   1 
ATOM   5398  O  OE2   . GLU H  4  182  ? 91.163  75.027  -6.957  1.00 37.79  ? 182  GLU B OE2   1 
ATOM   5399  N  N     . ASP H  4  183  ? 87.257  80.324  -8.044  1.00 54.72  ? 183  ASP B N     1 
ATOM   5400  C  CA    . ASP H  4  183  ? 87.395  81.757  -7.924  1.00 55.96  ? 183  ASP B CA    1 
ATOM   5401  C  C     . ASP H  4  183  ? 88.368  82.133  -6.835  1.00 57.13  ? 183  ASP B C     1 
ATOM   5402  O  O     . ASP H  4  183  ? 88.417  81.497  -5.793  1.00 57.91  ? 183  ASP B O     1 
ATOM   5403  C  CB    . ASP H  4  183  ? 86.041  82.381  -7.670  1.00 55.13  ? 183  ASP B CB    1 
ATOM   5404  C  CG    . ASP H  4  183  ? 85.269  82.483  -8.943  1.00 55.38  ? 183  ASP B CG    1 
ATOM   5405  O  OD1   . ASP H  4  183  ? 84.561  83.496  -9.148  1.00 56.78  ? 183  ASP B OD1   1 
ATOM   5406  O  OD2   . ASP H  4  183  ? 85.395  81.521  -9.744  1.00 53.43  ? 183  ASP B OD2   1 
ATOM   5407  N  N     . THR H  4  184  ? 89.158  83.169  -7.105  1.00 57.62  ? 184  THR B N     1 
ATOM   5408  C  CA    . THR H  4  184  ? 90.137  83.687  -6.160  1.00 58.78  ? 184  THR B CA    1 
ATOM   5409  C  C     . THR H  4  184  ? 89.892  85.181  -5.918  1.00 60.47  ? 184  THR B C     1 
ATOM   5410  O  O     . THR H  4  184  ? 89.418  85.888  -6.814  1.00 60.89  ? 184  THR B O     1 
ATOM   5411  C  CB    . THR H  4  184  ? 91.608  83.416  -6.688  1.00 58.11  ? 184  THR B CB    1 
ATOM   5412  O  OG1   . THR H  4  184  ? 92.570  83.812  -5.702  1.00 57.21  ? 184  THR B OG1   1 
ATOM   5413  C  CG2   . THR H  4  184  ? 91.878  84.180  -7.970  1.00 57.47  ? 184  THR B CG2   1 
ATOM   5414  N  N     . ARG H  4  185  ? 90.198  85.664  -4.717  1.00 60.77  ? 185  ARG B N     1 
ATOM   5415  C  CA    . ARG H  4  185  ? 89.923  87.059  -4.397  1.00 61.10  ? 185  ARG B CA    1 
ATOM   5416  C  C     . ARG H  4  185  ? 91.178  87.920  -4.387  1.00 62.94  ? 185  ARG B C     1 
ATOM   5417  O  O     . ARG H  4  185  ? 92.137  87.681  -3.644  1.00 64.33  ? 185  ARG B O     1 
ATOM   5418  C  CB    . ARG H  4  185  ? 89.231  87.163  -3.022  1.00 58.01  ? 185  ARG B CB    1 
ATOM   5419  C  CG    . ARG H  4  185  ? 89.089  88.586  -2.449  1.00 55.34  ? 185  ARG B CG    1 
ATOM   5420  C  CD    . ARG H  4  185  ? 89.044  88.603  -0.908  1.00 52.70  ? 185  ARG B CD    1 
ATOM   5421  N  NE    . ARG H  4  185  ? 89.071  89.955  -0.351  1.00 49.49  ? 185  ARG B NE    1 
ATOM   5422  C  CZ    . ARG H  4  185  ? 88.016  90.761  -0.279  1.00 48.95  ? 185  ARG B CZ    1 
ATOM   5423  N  NH1   . ARG H  4  185  ? 86.827  90.367  -0.718  1.00 47.87  ? 185  ARG B NH1   1 
ATOM   5424  N  NH2   . ARG H  4  185  ? 88.149  91.971  0.229   1.00 47.99  ? 185  ARG B NH2   1 
ATOM   5425  N  N     . LEU H  4  186  ? 91.148  88.928  -5.246  1.00 64.77  ? 186  LEU B N     1 
ATOM   5426  C  CA    . LEU H  4  186  ? 92.171  89.941  -5.265  1.00 66.82  ? 186  LEU B CA    1 
ATOM   5427  C  C     . LEU H  4  186  ? 91.537  91.265  -4.911  1.00 68.36  ? 186  LEU B C     1 
ATOM   5428  O  O     . LEU H  4  186  ? 90.679  91.752  -5.638  1.00 68.36  ? 186  LEU B O     1 
ATOM   5429  C  CB    . LEU H  4  186  ? 92.848  90.057  -6.629  1.00 66.20  ? 186  LEU B CB    1 
ATOM   5430  C  CG    . LEU H  4  186  ? 94.105  90.937  -6.461  1.00 66.12  ? 186  LEU B CG    1 
ATOM   5431  C  CD1   . LEU H  4  186  ? 95.312  90.340  -7.188  1.00 66.36  ? 186  LEU B CD1   1 
ATOM   5432  C  CD2   . LEU H  4  186  ? 93.770  92.330  -6.959  1.00 65.22  ? 186  LEU B CD2   1 
ATOM   5433  N  N     . GLY H  4  187  ? 91.955  91.799  -3.775  1.00 70.03  ? 187  GLY B N     1 
ATOM   5434  C  CA    . GLY H  4  187  ? 91.456  93.046  -3.224  1.00 72.18  ? 187  GLY B CA    1 
ATOM   5435  C  C     . GLY H  4  187  ? 90.296  93.737  -3.932  1.00 73.80  ? 187  GLY B C     1 
ATOM   5436  O  O     . GLY H  4  187  ? 89.174  93.767  -3.420  1.00 74.70  ? 187  GLY B O     1 
ATOM   5437  N  N     . GLN H  4  188  ? 90.574  94.276  -5.117  1.00 74.69  ? 188  GLN B N     1 
ATOM   5438  C  CA    . GLN H  4  188  ? 89.630  95.095  -5.876  1.00 75.71  ? 188  GLN B CA    1 
ATOM   5439  C  C     . GLN H  4  188  ? 88.498  94.301  -6.558  1.00 75.24  ? 188  GLN B C     1 
ATOM   5440  O  O     . GLN H  4  188  ? 87.329  94.565  -6.236  1.00 75.52  ? 188  GLN B O     1 
ATOM   5441  C  CB    . GLN H  4  188  ? 90.436  95.936  -6.874  1.00 76.57  ? 188  GLN B CB    1 
ATOM   5442  C  CG    . GLN H  4  188  ? 91.490  96.776  -6.065  1.00 79.15  ? 188  GLN B CG    1 
ATOM   5443  C  CD    . GLN H  4  188  ? 91.617  98.271  -6.422  1.00 80.62  ? 188  GLN B CD    1 
ATOM   5444  O  OE1   . GLN H  4  188  ? 90.681  98.906  -6.919  1.00 81.89  ? 188  GLN B OE1   1 
ATOM   5445  N  NE2   . GLN H  4  188  ? 92.795  98.836  -6.145  1.00 80.08  ? 188  GLN B NE2   1 
ATOM   5446  N  N     . ARG H  4  189  ? 88.791  93.362  -7.467  1.00 74.59  ? 189  ARG B N     1 
ATOM   5447  C  CA    . ARG H  4  189  ? 87.715  92.634  -8.191  1.00 72.81  ? 189  ARG B CA    1 
ATOM   5448  C  C     . ARG H  4  189  ? 87.671  91.137  -7.843  1.00 72.05  ? 189  ARG B C     1 
ATOM   5449  O  O     . ARG H  4  189  ? 88.630  90.405  -8.015  1.00 71.10  ? 189  ARG B O     1 
ATOM   5450  C  CB    . ARG H  4  189  ? 87.897  92.804  -9.713  1.00 72.30  ? 189  ARG B CB    1 
ATOM   5451  C  CG    . ARG H  4  189  ? 89.330  92.493  -10.218 1.00 69.89  ? 189  ARG B CG    1 
ATOM   5452  C  CD    . ARG H  4  189  ? 89.592  93.118  -11.592 1.00 68.28  ? 189  ARG B CD    1 
ATOM   5453  N  NE    . ARG H  4  189  ? 89.636  92.147  -12.690 1.00 68.26  ? 189  ARG B NE    1 
ATOM   5454  C  CZ    . ARG H  4  189  ? 88.990  92.264  -13.856 1.00 66.67  ? 189  ARG B CZ    1 
ATOM   5455  N  NH1   . ARG H  4  189  ? 88.226  93.318  -14.100 1.00 64.83  ? 189  ARG B NH1   1 
ATOM   5456  N  NH2   . ARG H  4  189  ? 89.114  91.319  -14.788 1.00 65.24  ? 189  ARG B NH2   1 
ATOM   5457  N  N     . THR H  4  190  ? 86.514  90.704  -7.366  1.00 70.89  ? 190  THR B N     1 
ATOM   5458  C  CA    . THR H  4  190  ? 86.284  89.329  -6.960  1.00 70.28  ? 190  THR B CA    1 
ATOM   5459  C  C     . THR H  4  190  ? 86.327  88.356  -8.156  1.00 68.46  ? 190  THR B C     1 
ATOM   5460  O  O     . THR H  4  190  ? 86.823  87.235  -8.017  1.00 68.74  ? 190  THR B O     1 
ATOM   5461  C  CB    . THR H  4  190  ? 84.903  89.216  -6.255  1.00 71.42  ? 190  THR B CB    1 
ATOM   5462  O  OG1   . THR H  4  190  ? 84.853  90.146  -5.164  1.00 71.60  ? 190  THR B OG1   1 
ATOM   5463  C  CG2   . THR H  4  190  ? 84.668  87.788  -5.723  1.00 72.84  ? 190  THR B CG2   1 
ATOM   5464  N  N     . ASP H  4  191  ? 85.811  88.781  -9.314  1.00 65.82  ? 191  ASP B N     1 
ATOM   5465  C  CA    . ASP H  4  191  ? 85.731  87.948  -10.529 1.00 61.82  ? 191  ASP B CA    1 
ATOM   5466  C  C     . ASP H  4  191  ? 87.116  87.555  -11.048 1.00 60.50  ? 191  ASP B C     1 
ATOM   5467  O  O     . ASP H  4  191  ? 87.695  88.266  -11.856 1.00 59.64  ? 191  ASP B O     1 
ATOM   5468  C  CB    . ASP H  4  191  ? 84.972  88.717  -11.613 1.00 60.22  ? 191  ASP B CB    1 
ATOM   5469  C  CG    . ASP H  4  191  ? 85.418  90.160  -11.715 1.00 59.22  ? 191  ASP B CG    1 
ATOM   5470  O  OD1   . ASP H  4  191  ? 85.045  90.979  -10.844 1.00 58.19  ? 191  ASP B OD1   1 
ATOM   5471  O  OD2   . ASP H  4  191  ? 86.149  90.474  -12.670 1.00 58.14  ? 191  ASP B OD2   1 
ATOM   5472  N  N     . LEU H  4  192  ? 87.642  86.417  -10.600 1.00 58.80  ? 192  LEU B N     1 
ATOM   5473  C  CA    . LEU H  4  192  ? 88.965  85.993  -11.038 1.00 56.71  ? 192  LEU B CA    1 
ATOM   5474  C  C     . LEU H  4  192  ? 89.069  84.479  -11.144 1.00 55.55  ? 192  LEU B C     1 
ATOM   5475  O  O     . LEU H  4  192  ? 88.285  83.742  -10.560 1.00 57.32  ? 192  LEU B O     1 
ATOM   5476  C  CB    . LEU H  4  192  ? 90.004  86.506  -10.063 1.00 55.94  ? 192  LEU B CB    1 
ATOM   5477  C  CG    . LEU H  4  192  ? 90.159  88.020  -10.109 1.00 56.53  ? 192  LEU B CG    1 
ATOM   5478  C  CD1   . LEU H  4  192  ? 90.689  88.481  -8.780  1.00 57.76  ? 192  LEU B CD1   1 
ATOM   5479  C  CD2   . LEU H  4  192  ? 91.067  88.414  -11.265 1.00 54.95  ? 192  LEU B CD2   1 
ATOM   5480  N  N     . ASP H  4  193  ? 90.060  84.020  -11.899 1.00 54.84  ? 193  ASP B N     1 
ATOM   5481  C  CA    . ASP H  4  193  ? 90.273  82.596  -12.097 1.00 52.45  ? 193  ASP B CA    1 
ATOM   5482  C  C     . ASP H  4  193  ? 91.547  82.111  -11.426 1.00 49.79  ? 193  ASP B C     1 
ATOM   5483  O  O     . ASP H  4  193  ? 92.550  82.820  -11.331 1.00 48.73  ? 193  ASP B O     1 
ATOM   5484  C  CB    . ASP H  4  193  ? 90.341  82.274  -13.593 1.00 53.67  ? 193  ASP B CB    1 
ATOM   5485  C  CG    . ASP H  4  193  ? 88.964  82.106  -14.206 1.00 54.78  ? 193  ASP B CG    1 
ATOM   5486  O  OD1   . ASP H  4  193  ? 87.951  82.280  -13.489 1.00 54.94  ? 193  ASP B OD1   1 
ATOM   5487  O  OD2   . ASP H  4  193  ? 88.893  81.795  -15.410 1.00 56.32  ? 193  ASP B OD2   1 
ATOM   5488  N  N     . LYS H  4  194  ? 91.468  80.878  -10.951 1.00 48.19  ? 194  LYS B N     1 
ATOM   5489  C  CA    . LYS H  4  194  ? 92.584  80.186  -10.341 1.00 45.85  ? 194  LYS B CA    1 
ATOM   5490  C  C     . LYS H  4  194  ? 92.681  78.782  -10.905 1.00 46.46  ? 194  LYS B C     1 
ATOM   5491  O  O     . LYS H  4  194  ? 91.818  77.956  -10.648 1.00 46.71  ? 194  LYS B O     1 
ATOM   5492  C  CB    . LYS H  4  194  ? 92.410  80.108  -8.831  1.00 44.96  ? 194  LYS B CB    1 
ATOM   5493  C  CG    . LYS H  4  194  ? 93.577  79.395  -8.122  1.00 43.65  ? 194  LYS B CG    1 
ATOM   5494  C  CD    . LYS H  4  194  ? 93.308  79.253  -6.634  1.00 41.21  ? 194  LYS B CD    1 
ATOM   5495  C  CE    . LYS H  4  194  ? 94.517  78.777  -5.889  1.00 39.08  ? 194  LYS B CE    1 
ATOM   5496  N  NZ    . LYS H  4  194  ? 94.198  78.609  -4.449  1.00 40.27  ? 194  LYS B NZ    1 
ATOM   5497  N  N     . LEU H  4  195  ? 93.717  78.505  -11.677 1.00 47.67  ? 195  LEU B N     1 
ATOM   5498  C  CA    . LEU H  4  195  ? 93.829  77.201  -12.285 1.00 49.99  ? 195  LEU B CA    1 
ATOM   5499  C  C     . LEU H  4  195  ? 94.834  76.325  -11.580 1.00 52.06  ? 195  LEU B C     1 
ATOM   5500  O  O     . LEU H  4  195  ? 95.983  76.703  -11.362 1.00 54.71  ? 195  LEU B O     1 
ATOM   5501  C  CB    . LEU H  4  195  ? 94.247  77.319  -13.744 1.00 50.18  ? 195  LEU B CB    1 
ATOM   5502  C  CG    . LEU H  4  195  ? 94.771  75.988  -14.275 1.00 51.07  ? 195  LEU B CG    1 
ATOM   5503  C  CD1   . LEU H  4  195  ? 93.803  75.476  -15.302 1.00 51.39  ? 195  LEU B CD1   1 
ATOM   5504  C  CD2   . LEU H  4  195  ? 96.189  76.152  -14.810 1.00 50.86  ? 195  LEU B CD2   1 
ATOM   5505  N  N     . THR H  4  196  ? 94.368  75.128  -11.253 1.00 53.70  ? 196  THR B N     1 
ATOM   5506  C  CA    . THR H  4  196  ? 95.175  74.087  -10.637 1.00 54.29  ? 196  THR B CA    1 
ATOM   5507  C  C     . THR H  4  196  ? 94.952  72.766  -11.370 1.00 55.28  ? 196  THR B C     1 
ATOM   5508  O  O     . THR H  4  196  ? 93.849  72.216  -11.343 1.00 55.52  ? 196  THR B O     1 
ATOM   5509  C  CB    . THR H  4  196  ? 94.837  73.905  -9.109  1.00 54.23  ? 196  THR B CB    1 
ATOM   5510  O  OG1   . THR H  4  196  ? 94.013  72.749  -8.912  1.00 53.17  ? 196  THR B OG1   1 
ATOM   5511  C  CG2   . THR H  4  196  ? 94.144  75.154  -8.561  1.00 55.31  ? 196  THR B CG2   1 
ATOM   5512  N  N     . LEU H  4  197  ? 95.981  72.263  -12.047 1.00 55.03  ? 197  LEU B N     1 
ATOM   5513  C  CA    . LEU H  4  197  ? 95.828  71.014  -12.785 1.00 54.91  ? 197  LEU B CA    1 
ATOM   5514  C  C     . LEU H  4  197  ? 96.666  69.891  -12.175 1.00 54.92  ? 197  LEU B C     1 
ATOM   5515  O  O     . LEU H  4  197  ? 97.880  70.009  -11.976 1.00 55.66  ? 197  LEU B O     1 
ATOM   5516  C  CB    . LEU H  4  197  ? 96.208  71.219  -14.257 1.00 53.86  ? 197  LEU B CB    1 
ATOM   5517  C  CG    . LEU H  4  197  ? 97.421  70.507  -14.878 1.00 53.20  ? 197  LEU B CG    1 
ATOM   5518  C  CD1   . LEU H  4  197  ? 97.186  70.407  -16.359 1.00 52.94  ? 197  LEU B CD1   1 
ATOM   5519  C  CD2   . LEU H  4  197  ? 98.720  71.248  -14.581 1.00 52.04  ? 197  LEU B CD2   1 
ATOM   5520  N  N     . ARG H  4  198  ? 95.987  68.792  -11.885 1.00 53.95  ? 198  ARG B N     1 
ATOM   5521  C  CA    . ARG H  4  198  ? 96.605  67.619  -11.298 1.00 52.71  ? 198  ARG B CA    1 
ATOM   5522  C  C     . ARG H  4  198  ? 96.943  66.622  -12.354 1.00 52.55  ? 198  ARG B C     1 
ATOM   5523  O  O     . ARG H  4  198  ? 96.079  66.166  -13.095 1.00 52.01  ? 198  ARG B O     1 
ATOM   5524  C  CB    . ARG H  4  198  ? 95.657  66.988  -10.301 1.00 52.08  ? 198  ARG B CB    1 
ATOM   5525  C  CG    . ARG H  4  198  ? 95.063  68.015  -9.387  1.00 51.99  ? 198  ARG B CG    1 
ATOM   5526  C  CD    . ARG H  4  198  ? 93.974  67.452  -8.545  1.00 51.65  ? 198  ARG B CD    1 
ATOM   5527  N  NE    . ARG H  4  198  ? 93.107  66.570  -9.307  1.00 52.32  ? 198  ARG B NE    1 
ATOM   5528  C  CZ    . ARG H  4  198  ? 91.968  66.077  -8.840  1.00 52.80  ? 198  ARG B CZ    1 
ATOM   5529  N  NH1   . ARG H  4  198  ? 91.569  66.393  -7.611  1.00 52.41  ? 198  ARG B NH1   1 
ATOM   5530  N  NH2   . ARG H  4  198  ? 91.232  65.267  -9.597  1.00 52.64  ? 198  ARG B NH2   1 
ATOM   5531  N  N     . ILE H  4  199  ? 98.211  66.273  -12.422 1.00 53.42  ? 199  ILE B N     1 
ATOM   5532  C  CA    . ILE H  4  199  ? 98.642  65.337  -13.430 1.00 55.51  ? 199  ILE B CA    1 
ATOM   5533  C  C     . ILE H  4  199  ? 99.197  64.063  -12.808 1.00 56.93  ? 199  ILE B C     1 
ATOM   5534  O  O     . ILE H  4  199  ? 99.960  64.093  -11.839 1.00 57.33  ? 199  ILE B O     1 
ATOM   5535  C  CB    . ILE H  4  199  ? 99.715  65.992  -14.338 1.00 56.01  ? 199  ILE B CB    1 
ATOM   5536  C  CG1   . ILE H  4  199  ? 99.368  67.481  -14.556 1.00 56.33  ? 199  ILE B CG1   1 
ATOM   5537  C  CG2   . ILE H  4  199  ? 99.765  65.259  -15.676 1.00 55.99  ? 199  ILE B CG2   1 
ATOM   5538  C  CD1   . ILE H  4  199  ? 100.416 68.292  -15.301 1.00 57.00  ? 199  ILE B CD1   1 
ATOM   5539  N  N     . TRP H  4  200  ? 98.787  62.936  -13.376 1.00 59.45  ? 200  TRP B N     1 
ATOM   5540  C  CA    . TRP H  4  200  ? 99.256  61.624  -12.962 1.00 61.74  ? 200  TRP B CA    1 
ATOM   5541  C  C     . TRP H  4  200  ? 100.165 61.039  -14.029 1.00 62.28  ? 200  TRP B C     1 
ATOM   5542  O  O     . TRP H  4  200  ? 99.839  61.106  -15.209 1.00 61.38  ? 200  TRP B O     1 
ATOM   5543  C  CB    . TRP H  4  200  ? 98.070  60.691  -12.725 1.00 63.03  ? 200  TRP B CB    1 
ATOM   5544  C  CG    . TRP H  4  200  ? 97.366  60.977  -11.444 1.00 65.12  ? 200  TRP B CG    1 
ATOM   5545  C  CD1   . TRP H  4  200  ? 97.766  60.623  -10.180 1.00 65.32  ? 200  TRP B CD1   1 
ATOM   5546  C  CD2   . TRP H  4  200  ? 96.133  61.683  -11.293 1.00 65.59  ? 200  TRP B CD2   1 
ATOM   5547  N  NE1   . TRP H  4  200  ? 96.854  61.063  -9.252  1.00 66.09  ? 200  TRP B NE1   1 
ATOM   5548  C  CE2   . TRP H  4  200  ? 95.840  61.717  -9.903  1.00 66.00  ? 200  TRP B CE2   1 
ATOM   5549  C  CE3   . TRP H  4  200  ? 95.234  62.294  -12.200 1.00 64.88  ? 200  TRP B CE3   1 
ATOM   5550  C  CZ2   . TRP H  4  200  ? 94.674  62.344  -9.390  1.00 66.06  ? 200  TRP B CZ2   1 
ATOM   5551  C  CZ3   . TRP H  4  200  ? 94.072  62.919  -11.699 1.00 65.51  ? 200  TRP B CZ3   1 
ATOM   5552  C  CH2   . TRP H  4  200  ? 93.805  62.936  -10.300 1.00 66.22  ? 200  TRP B CH2   1 
ATOM   5553  N  N     . THR H  4  201  ? 101.305 60.481  -13.620 1.00 64.25  ? 201  THR B N     1 
ATOM   5554  C  CA    . THR H  4  201  ? 102.274 59.898  -14.565 1.00 65.66  ? 201  THR B CA    1 
ATOM   5555  C  C     . THR H  4  201  ? 102.672 58.455  -14.147 1.00 67.98  ? 201  THR B C     1 
ATOM   5556  O  O     . THR H  4  201  ? 102.849 58.177  -12.959 1.00 69.99  ? 201  THR B O     1 
ATOM   5557  C  CB    . THR H  4  201  ? 103.552 60.792  -14.650 1.00 63.82  ? 201  THR B CB    1 
ATOM   5558  O  OG1   . THR H  4  201  ? 103.209 62.164  -14.443 1.00 62.06  ? 201  THR B OG1   1 
ATOM   5559  C  CG2   . THR H  4  201  ? 104.161 60.714  -16.035 1.00 61.77  ? 201  THR B CG2   1 
ATOM   5560  N  N     . ASP H  4  202  ? 102.815 57.542  -15.113 1.00 69.49  ? 202  ASP B N     1 
ATOM   5561  C  CA    . ASP H  4  202  ? 103.146 56.145  -14.798 1.00 70.60  ? 202  ASP B CA    1 
ATOM   5562  C  C     . ASP H  4  202  ? 104.546 55.996  -14.176 1.00 71.21  ? 202  ASP B C     1 
ATOM   5563  O  O     . ASP H  4  202  ? 104.929 54.898  -13.767 1.00 71.11  ? 202  ASP B O     1 
ATOM   5564  C  CB    . ASP H  4  202  ? 103.028 55.259  -16.059 1.00 71.27  ? 202  ASP B CB    1 
ATOM   5565  C  CG    . ASP H  4  202  ? 103.744 55.824  -17.269 1.00 71.72  ? 202  ASP B CG    1 
ATOM   5566  O  OD1   . ASP H  4  202  ? 104.747 56.545  -17.098 1.00 72.81  ? 202  ASP B OD1   1 
ATOM   5567  O  OD2   . ASP H  4  202  ? 103.302 55.529  -18.403 1.00 72.19  ? 202  ASP B OD2   1 
ATOM   5568  N  N     . GLY H  4  203  ? 105.305 57.084  -14.094 1.00 71.41  ? 203  GLY B N     1 
ATOM   5569  C  CA    . GLY H  4  203  ? 106.627 56.998  -13.506 1.00 72.45  ? 203  GLY B CA    1 
ATOM   5570  C  C     . GLY H  4  203  ? 107.726 57.292  -14.500 1.00 73.66  ? 203  GLY B C     1 
ATOM   5571  O  O     . GLY H  4  203  ? 108.744 57.858  -14.108 1.00 74.12  ? 203  GLY B O     1 
ATOM   5572  N  N     . SER H  4  204  ? 107.532 56.903  -15.766 1.00 73.17  ? 204  SER B N     1 
ATOM   5573  C  CA    . SER H  4  204  ? 108.521 57.166  -16.819 1.00 74.34  ? 204  SER B CA    1 
ATOM   5574  C  C     . SER H  4  204  ? 109.036 58.600  -16.706 1.00 74.69  ? 204  SER B C     1 
ATOM   5575  O  O     . SER H  4  204  ? 110.234 58.825  -16.539 1.00 74.58  ? 204  SER B O     1 
ATOM   5576  C  CB    . SER H  4  204  ? 107.902 56.937  -18.215 1.00 73.02  ? 204  SER B CB    1 
ATOM   5577  O  OG    . SER H  4  204  ? 108.053 55.594  -18.666 1.00 71.63  ? 204  SER B OG    1 
ATOM   5578  N  N     . VAL H  4  205  ? 108.117 59.560  -16.789 1.00 75.07  ? 205  VAL B N     1 
ATOM   5579  C  CA    . VAL H  4  205  ? 108.434 60.979  -16.620 1.00 75.89  ? 205  VAL B CA    1 
ATOM   5580  C  C     . VAL H  4  205  ? 107.709 61.531  -15.379 1.00 76.46  ? 205  VAL B C     1 
ATOM   5581  O  O     . VAL H  4  205  ? 106.865 60.827  -14.807 1.00 77.15  ? 205  VAL B O     1 
ATOM   5582  C  CB    . VAL H  4  205  ? 108.024 61.815  -17.897 1.00 75.88  ? 205  VAL B CB    1 
ATOM   5583  C  CG1   . VAL H  4  205  ? 108.843 61.367  -19.095 1.00 76.24  ? 205  VAL B CG1   1 
ATOM   5584  C  CG2   . VAL H  4  205  ? 106.543 61.627  -18.220 1.00 76.27  ? 205  VAL B CG2   1 
ATOM   5585  N  N     . THR H  4  206  ? 108.020 62.750  -14.944 1.00 76.19  ? 206  THR B N     1 
ATOM   5586  C  CA    . THR H  4  206  ? 107.352 63.305  -13.763 1.00 76.46  ? 206  THR B CA    1 
ATOM   5587  C  C     . THR H  4  206  ? 106.229 64.240  -14.173 1.00 77.00  ? 206  THR B C     1 
ATOM   5588  O  O     . THR H  4  206  ? 106.170 64.643  -15.334 1.00 77.86  ? 206  THR B O     1 
ATOM   5589  C  CB    . THR H  4  206  ? 108.366 64.088  -12.841 1.00 75.43  ? 206  THR B CB    1 
ATOM   5590  O  OG1   . THR H  4  206  ? 107.962 63.977  -11.477 1.00 76.46  ? 206  THR B OG1   1 
ATOM   5591  C  CG2   . THR H  4  206  ? 108.382 65.569  -13.149 1.00 74.58  ? 206  THR B CG2   1 
ATOM   5592  N  N     . PRO H  4  207  ? 105.322 64.599  -13.233 1.00 78.38  ? 207  PRO B N     1 
ATOM   5593  C  CA    . PRO H  4  207  ? 104.216 65.511  -13.567 1.00 78.89  ? 207  PRO B CA    1 
ATOM   5594  C  C     . PRO H  4  207  ? 104.724 66.873  -14.067 1.00 78.81  ? 207  PRO B C     1 
ATOM   5595  O  O     . PRO H  4  207  ? 104.179 67.437  -15.023 1.00 78.63  ? 207  PRO B O     1 
ATOM   5596  C  CB    . PRO H  4  207  ? 103.440 65.619  -12.261 1.00 78.98  ? 207  PRO B CB    1 
ATOM   5597  C  CG    . PRO H  4  207  ? 103.676 64.314  -11.606 1.00 79.57  ? 207  PRO B CG    1 
ATOM   5598  C  CD    . PRO H  4  207  ? 105.141 64.073  -11.864 1.00 79.06  ? 207  PRO B CD    1 
ATOM   5599  N  N     . LEU H  4  208  ? 105.764 67.386  -13.404 1.00 77.90  ? 208  LEU B N     1 
ATOM   5600  C  CA    . LEU H  4  208  ? 106.388 68.671  -13.753 1.00 76.98  ? 208  LEU B CA    1 
ATOM   5601  C  C     . LEU H  4  208  ? 107.047 68.613  -15.140 1.00 76.54  ? 208  LEU B C     1 
ATOM   5602  O  O     . LEU H  4  208  ? 106.864 69.519  -15.955 1.00 76.67  ? 208  LEU B O     1 
ATOM   5603  C  CB    . LEU H  4  208  ? 107.443 69.052  -12.696 1.00 75.57  ? 208  LEU B CB    1 
ATOM   5604  C  CG    . LEU H  4  208  ? 108.202 70.390  -12.798 1.00 74.31  ? 208  LEU B CG    1 
ATOM   5605  C  CD1   . LEU H  4  208  ? 107.228 71.543  -12.962 1.00 73.44  ? 208  LEU B CD1   1 
ATOM   5606  C  CD2   . LEU H  4  208  ? 109.053 70.579  -11.543 1.00 73.69  ? 208  LEU B CD2   1 
ATOM   5607  N  N     . GLU H  4  209  ? 107.811 67.552  -15.397 1.00 75.20  ? 209  GLU B N     1 
ATOM   5608  C  CA    . GLU H  4  209  ? 108.479 67.363  -16.679 1.00 74.80  ? 209  GLU B CA    1 
ATOM   5609  C  C     . GLU H  4  209  ? 107.464 67.320  -17.828 1.00 73.85  ? 209  GLU B C     1 
ATOM   5610  O  O     . GLU H  4  209  ? 107.662 67.960  -18.872 1.00 74.14  ? 209  GLU B O     1 
ATOM   5611  C  CB    . GLU H  4  209  ? 109.317 66.075  -16.605 1.00 75.53  ? 209  GLU B CB    1 
ATOM   5612  C  CG    . GLU H  4  209  ? 110.590 66.313  -15.734 1.00 76.22  ? 209  GLU B CG    1 
ATOM   5613  C  CD    . GLU H  4  209  ? 110.966 65.163  -14.795 1.00 76.10  ? 209  GLU B CD    1 
ATOM   5614  O  OE1   . GLU H  4  209  ? 111.849 65.355  -13.920 1.00 75.87  ? 209  GLU B OE1   1 
ATOM   5615  O  OE2   . GLU H  4  209  ? 110.380 64.071  -14.932 1.00 76.09  ? 209  GLU B OE2   1 
ATOM   5616  N  N     . ALA H  4  210  ? 106.378 66.577  -17.619 1.00 71.51  ? 210  ALA B N     1 
ATOM   5617  C  CA    . ALA H  4  210  ? 105.300 66.462  -18.595 1.00 70.02  ? 210  ALA B CA    1 
ATOM   5618  C  C     . ALA H  4  210  ? 104.704 67.839  -18.924 1.00 69.13  ? 210  ALA B C     1 
ATOM   5619  O  O     . ALA H  4  210  ? 104.593 68.200  -20.094 1.00 69.55  ? 210  ALA B O     1 
ATOM   5620  C  CB    . ALA H  4  210  ? 104.199 65.538  -18.053 1.00 70.78  ? 210  ALA B CB    1 
ATOM   5621  N  N     . LEU H  4  211  ? 104.328 68.600  -17.888 1.00 67.14  ? 211  LEU B N     1 
ATOM   5622  C  CA    . LEU H  4  211  ? 103.734 69.943  -18.043 1.00 64.12  ? 211  LEU B CA    1 
ATOM   5623  C  C     . LEU H  4  211  ? 104.638 70.876  -18.865 1.00 63.11  ? 211  LEU B C     1 
ATOM   5624  O  O     . LEU H  4  211  ? 104.160 71.600  -19.740 1.00 62.25  ? 211  LEU B O     1 
ATOM   5625  C  CB    . LEU H  4  211  ? 103.484 70.587  -16.671 1.00 62.80  ? 211  LEU B CB    1 
ATOM   5626  C  CG    . LEU H  4  211  ? 102.853 71.976  -16.749 1.00 60.36  ? 211  LEU B CG    1 
ATOM   5627  C  CD1   . LEU H  4  211  ? 101.419 71.849  -17.201 1.00 59.50  ? 211  LEU B CD1   1 
ATOM   5628  C  CD2   . LEU H  4  211  ? 102.923 72.647  -15.400 1.00 60.12  ? 211  LEU B CD2   1 
ATOM   5629  N  N     . ASN H  4  212  ? 105.935 70.861  -18.574 1.00 60.96  ? 212  ASN B N     1 
ATOM   5630  C  CA    . ASN H  4  212  ? 106.867 71.692  -19.300 1.00 60.54  ? 212  ASN B CA    1 
ATOM   5631  C  C     . ASN H  4  212  ? 106.930 71.292  -20.756 1.00 60.99  ? 212  ASN B C     1 
ATOM   5632  O  O     . ASN H  4  212  ? 106.899 72.148  -21.631 1.00 62.00  ? 212  ASN B O     1 
ATOM   5633  C  CB    . ASN H  4  212  ? 108.243 71.597  -18.669 1.00 59.25  ? 212  ASN B CB    1 
ATOM   5634  C  CG    . ASN H  4  212  ? 108.436 72.627  -17.583 1.00 58.19  ? 212  ASN B CG    1 
ATOM   5635  O  OD1   . ASN H  4  212  ? 107.667 72.680  -16.630 1.00 58.00  ? 212  ASN B OD1   1 
ATOM   5636  N  ND2   . ASN H  4  212  ? 109.464 73.454  -17.721 1.00 57.14  ? 212  ASN B ND2   1 
ATOM   5637  N  N     . GLN H  4  213  ? 107.024 69.994  -21.022 1.00 61.17  ? 213  GLN B N     1 
ATOM   5638  C  CA    . GLN H  4  213  ? 107.035 69.504  -22.401 1.00 61.37  ? 213  GLN B CA    1 
ATOM   5639  C  C     . GLN H  4  213  ? 105.757 69.926  -23.124 1.00 61.87  ? 213  GLN B C     1 
ATOM   5640  O  O     . GLN H  4  213  ? 105.783 70.249  -24.299 1.00 61.36  ? 213  GLN B O     1 
ATOM   5641  C  CB    . GLN H  4  213  ? 107.110 67.981  -22.424 1.00 62.24  ? 213  GLN B CB    1 
ATOM   5642  C  CG    . GLN H  4  213  ? 108.341 67.379  -23.056 1.00 62.59  ? 213  GLN B CG    1 
ATOM   5643  C  CD    . GLN H  4  213  ? 109.416 67.064  -22.035 1.00 62.94  ? 213  GLN B CD    1 
ATOM   5644  O  OE1   . GLN H  4  213  ? 109.125 66.553  -20.947 1.00 61.24  ? 213  GLN B OE1   1 
ATOM   5645  N  NE2   . GLN H  4  213  ? 110.670 67.362  -22.381 1.00 62.84  ? 213  GLN B NE2   1 
ATOM   5646  N  N     . ALA H  4  214  ? 104.645 69.911  -22.382 1.00 62.12  ? 214  ALA B N     1 
ATOM   5647  C  CA    . ALA H  4  214  ? 103.310 70.272  -22.870 1.00 63.03  ? 214  ALA B CA    1 
ATOM   5648  C  C     . ALA H  4  214  ? 103.243 71.739  -23.294 1.00 63.95  ? 214  ALA B C     1 
ATOM   5649  O  O     . ALA H  4  214  ? 102.813 72.045  -24.415 1.00 64.06  ? 214  ALA B O     1 
ATOM   5650  C  CB    . ALA H  4  214  ? 102.269 70.011  -21.778 1.00 62.00  ? 214  ALA B CB    1 
ATOM   5651  N  N     . VAL H  4  215  ? 103.660 72.637  -22.393 1.00 65.21  ? 215  VAL B N     1 
ATOM   5652  C  CA    . VAL H  4  215  ? 103.673 74.079  -22.660 1.00 65.12  ? 215  VAL B CA    1 
ATOM   5653  C  C     . VAL H  4  215  ? 104.574 74.407  -23.866 1.00 65.90  ? 215  VAL B C     1 
ATOM   5654  O  O     . VAL H  4  215  ? 104.295 75.342  -24.620 1.00 66.08  ? 215  VAL B O     1 
ATOM   5655  C  CB    . VAL H  4  215  ? 104.186 74.870  -21.419 1.00 63.78  ? 215  VAL B CB    1 
ATOM   5656  C  CG1   . VAL H  4  215  ? 103.559 74.328  -20.154 1.00 62.65  ? 215  VAL B CG1   1 
ATOM   5657  C  CG2   . VAL H  4  215  ? 105.685 74.741  -21.305 1.00 63.25  ? 215  VAL B CG2   1 
ATOM   5658  N  N     . GLU H  4  216  ? 105.651 73.626  -24.024 1.00 66.79  ? 216  GLU B N     1 
ATOM   5659  C  CA    . GLU H  4  216  ? 106.599 73.777  -25.128 1.00 66.90  ? 216  GLU B CA    1 
ATOM   5660  C  C     . GLU H  4  216  ? 105.938 73.428  -26.457 1.00 69.24  ? 216  GLU B C     1 
ATOM   5661  O  O     . GLU H  4  216  ? 106.008 74.207  -27.405 1.00 69.52  ? 216  GLU B O     1 
ATOM   5662  C  CB    . GLU H  4  216  ? 107.825 72.871  -24.891 1.00 65.81  ? 216  GLU B CB    1 
ATOM   5663  C  CG    . GLU H  4  216  ? 108.600 72.404  -26.147 1.00 63.42  ? 216  GLU B CG    1 
ATOM   5664  C  CD    . GLU H  4  216  ? 109.978 73.051  -26.304 1.00 62.12  ? 216  GLU B CD    1 
ATOM   5665  O  OE1   . GLU H  4  216  ? 110.923 72.677  -25.577 1.00 59.89  ? 216  GLU B OE1   1 
ATOM   5666  O  OE2   . GLU H  4  216  ? 110.115 73.939  -27.163 1.00 61.56  ? 216  GLU B OE2   1 
ATOM   5667  N  N     . ILE H  4  217  ? 105.301 72.257  -26.513 1.00 70.49  ? 217  ILE B N     1 
ATOM   5668  C  CA    . ILE H  4  217  ? 104.597 71.807  -27.716 1.00 72.59  ? 217  ILE B CA    1 
ATOM   5669  C  C     . ILE H  4  217  ? 103.546 72.841  -28.149 1.00 73.80  ? 217  ILE B C     1 
ATOM   5670  O  O     . ILE H  4  217  ? 103.268 72.984  -29.351 1.00 74.72  ? 217  ILE B O     1 
ATOM   5671  C  CB    . ILE H  4  217  ? 103.917 70.391  -27.464 1.00 71.69  ? 217  ILE B CB    1 
ATOM   5672  C  CG1   . ILE H  4  217  ? 104.919 69.245  -27.706 1.00 71.10  ? 217  ILE B CG1   1 
ATOM   5673  C  CG2   . ILE H  4  217  ? 102.755 70.164  -28.430 1.00 72.21  ? 217  ILE B CG2   1 
ATOM   5674  C  CD1   . ILE H  4  217  ? 106.232 69.304  -26.950 1.00 69.04  ? 217  ILE B CD1   1 
ATOM   5675  N  N     . LEU H  4  218  ? 102.966 73.553  -27.178 1.00 75.27  ? 218  LEU B N     1 
ATOM   5676  C  CA    . LEU H  4  218  ? 101.987 74.590  -27.505 1.00 76.82  ? 218  LEU B CA    1 
ATOM   5677  C  C     . LEU H  4  218  ? 102.680 75.849  -28.027 1.00 76.95  ? 218  LEU B C     1 
ATOM   5678  O  O     . LEU H  4  218  ? 102.225 76.440  -29.012 1.00 77.33  ? 218  LEU B O     1 
ATOM   5679  C  CB    . LEU H  4  218  ? 101.122 74.990  -26.298 1.00 77.19  ? 218  LEU B CB    1 
ATOM   5680  C  CG    . LEU H  4  218  ? 100.069 76.011  -26.824 1.00 77.65  ? 218  LEU B CG    1 
ATOM   5681  C  CD1   . LEU H  4  218  ? 99.047  75.273  -27.725 1.00 77.38  ? 218  LEU B CD1   1 
ATOM   5682  C  CD2   . LEU H  4  218  ? 99.366  76.719  -25.672 1.00 77.13  ? 218  LEU B CD2   1 
ATOM   5683  N  N     . ARG H  4  219  ? 103.768 76.255  -27.367 1.00 76.59  ? 219  ARG B N     1 
ATOM   5684  C  CA    . ARG H  4  219  ? 104.528 77.425  -27.797 1.00 75.91  ? 219  ARG B CA    1 
ATOM   5685  C  C     . ARG H  4  219  ? 105.074 77.215  -29.201 1.00 75.42  ? 219  ARG B C     1 
ATOM   5686  O  O     . ARG H  4  219  ? 104.945 78.089  -30.058 1.00 76.66  ? 219  ARG B O     1 
ATOM   5687  C  CB    . ARG H  4  219  ? 105.688 77.690  -26.840 1.00 76.05  ? 219  ARG B CB    1 
ATOM   5688  C  CG    . ARG H  4  219  ? 106.493 78.941  -27.177 1.00 76.33  ? 219  ARG B CG    1 
ATOM   5689  C  CD    . ARG H  4  219  ? 107.634 79.158  -26.201 1.00 76.53  ? 219  ARG B CD    1 
ATOM   5690  N  NE    . ARG H  4  219  ? 108.584 78.040  -26.158 1.00 76.58  ? 219  ARG B NE    1 
ATOM   5691  C  CZ    . ARG H  4  219  ? 108.468 76.954  -25.387 1.00 76.93  ? 219  ARG B CZ    1 
ATOM   5692  N  NH1   . ARG H  4  219  ? 107.438 76.797  -24.568 1.00 76.77  ? 219  ARG B NH1   1 
ATOM   5693  N  NH2   . ARG H  4  219  ? 109.396 76.008  -25.428 1.00 77.07  ? 219  ARG B NH2   1 
ATOM   5694  N  N     . GLU H  4  220  ? 105.678 76.047  -29.424 1.00 72.98  ? 220  GLU B N     1 
ATOM   5695  C  CA    . GLU H  4  220  ? 106.233 75.660  -30.730 1.00 70.26  ? 220  GLU B CA    1 
ATOM   5696  C  C     . GLU H  4  220  ? 105.176 75.764  -31.837 1.00 68.28  ? 220  GLU B C     1 
ATOM   5697  O  O     . GLU H  4  220  ? 105.505 76.072  -32.980 1.00 67.75  ? 220  GLU B O     1 
ATOM   5698  C  CB    . GLU H  4  220  ? 106.735 74.221  -30.674 1.00 71.05  ? 220  GLU B CB    1 
ATOM   5699  C  CG    . GLU H  4  220  ? 108.234 74.050  -30.753 1.00 71.45  ? 220  GLU B CG    1 
ATOM   5700  C  CD    . GLU H  4  220  ? 108.689 72.777  -30.051 1.00 72.21  ? 220  GLU B CD    1 
ATOM   5701  O  OE1   . GLU H  4  220  ? 107.977 71.740  -30.123 1.00 71.43  ? 220  GLU B OE1   1 
ATOM   5702  O  OE2   . GLU H  4  220  ? 109.769 72.822  -29.427 1.00 72.40  ? 220  GLU B OE2   1 
ATOM   5703  N  N     . HIS H  4  221  ? 103.918 75.498  -31.478 1.00 66.45  ? 221  HIS B N     1 
ATOM   5704  C  CA    . HIS H  4  221  ? 102.763 75.543  -32.390 1.00 64.68  ? 221  HIS B CA    1 
ATOM   5705  C  C     . HIS H  4  221  ? 102.289 76.992  -32.612 1.00 64.40  ? 221  HIS B C     1 
ATOM   5706  O  O     . HIS H  4  221  ? 101.708 77.312  -33.660 1.00 65.31  ? 221  HIS B O     1 
ATOM   5707  C  CB    . HIS H  4  221  ? 101.595 74.738  -31.795 1.00 62.15  ? 221  HIS B CB    1 
ATOM   5708  C  CG    . HIS H  4  221  ? 101.146 73.560  -32.598 1.00 59.51  ? 221  HIS B CG    1 
ATOM   5709  N  ND1   . HIS H  4  221  ? 101.870 72.394  -32.687 1.00 58.45  ? 221  HIS B ND1   1 
ATOM   5710  C  CD2   . HIS H  4  221  ? 100.027 73.362  -33.327 1.00 57.72  ? 221  HIS B CD2   1 
ATOM   5711  C  CE1   . HIS H  4  221  ? 101.215 71.526  -33.436 1.00 57.66  ? 221  HIS B CE1   1 
ATOM   5712  N  NE2   . HIS H  4  221  ? 100.092 72.089  -33.836 1.00 57.41  ? 221  HIS B NE2   1 
ATOM   5713  N  N     . LEU H  4  222  ? 102.532 77.853  -31.620 1.00 64.27  ? 222  LEU B N     1 
ATOM   5714  C  CA    . LEU H  4  222  ? 102.133 79.260  -31.674 1.00 63.42  ? 222  LEU B CA    1 
ATOM   5715  C  C     . LEU H  4  222  ? 103.060 80.074  -32.582 1.00 65.26  ? 222  LEU B C     1 
ATOM   5716  O  O     . LEU H  4  222  ? 102.728 81.191  -32.984 1.00 65.08  ? 222  LEU B O     1 
ATOM   5717  C  CB    . LEU H  4  222  ? 102.117 79.830  -30.247 1.00 59.97  ? 222  LEU B CB    1 
ATOM   5718  C  CG    . LEU H  4  222  ? 101.167 79.042  -29.322 1.00 57.43  ? 222  LEU B CG    1 
ATOM   5719  C  CD1   . LEU H  4  222  ? 101.322 79.528  -27.905 1.00 56.19  ? 222  LEU B CD1   1 
ATOM   5720  C  CD2   . LEU H  4  222  ? 99.728  79.172  -29.782 1.00 55.15  ? 222  LEU B CD2   1 
ATOM   5721  N  N     . THR H  4  223  ? 104.218 79.499  -32.907 1.00 66.96  ? 223  THR B N     1 
ATOM   5722  C  CA    . THR H  4  223  ? 105.209 80.133  -33.786 1.00 68.41  ? 223  THR B CA    1 
ATOM   5723  C  C     . THR H  4  223  ? 104.977 79.739  -35.260 1.00 69.72  ? 223  THR B C     1 
ATOM   5724  O  O     . THR H  4  223  ? 105.471 80.400  -36.170 1.00 69.51  ? 223  THR B O     1 
ATOM   5725  C  CB    . THR H  4  223  ? 106.673 79.724  -33.387 1.00 68.22  ? 223  THR B CB    1 
ATOM   5726  O  OG1   . THR H  4  223  ? 106.893 79.978  -31.992 1.00 66.75  ? 223  THR B OG1   1 
ATOM   5727  C  CG2   . THR H  4  223  ? 107.691 80.528  -34.189 1.00 69.57  ? 223  THR B CG2   1 
ATOM   5728  N  N     . TYR H  4  224  ? 104.222 78.664  -35.487 1.00 70.58  ? 224  TYR B N     1 
ATOM   5729  C  CA    . TYR H  4  224  ? 103.923 78.179  -36.844 1.00 72.59  ? 224  TYR B CA    1 
ATOM   5730  C  C     . TYR H  4  224  ? 102.993 79.143  -37.596 1.00 72.49  ? 224  TYR B C     1 
ATOM   5731  O  O     . TYR H  4  224  ? 102.508 78.825  -38.691 1.00 72.49  ? 224  TYR B O     1 
ATOM   5732  C  CB    . TYR H  4  224  ? 103.249 76.804  -36.779 1.00 73.87  ? 224  TYR B CB    1 
ATOM   5733  C  CG    . TYR H  4  224  ? 104.151 75.619  -37.002 1.00 76.44  ? 224  TYR B CG    1 
ATOM   5734  C  CD1   . TYR H  4  224  ? 104.600 75.273  -38.300 1.00 77.14  ? 224  TYR B CD1   1 
ATOM   5735  C  CD2   . TYR H  4  224  ? 104.560 74.820  -35.915 1.00 77.93  ? 224  TYR B CD2   1 
ATOM   5736  C  CE1   . TYR H  4  224  ? 105.451 74.134  -38.503 1.00 78.91  ? 224  TYR B CE1   1 
ATOM   5737  C  CE2   . TYR H  4  224  ? 105.407 73.674  -36.101 1.00 79.22  ? 224  TYR B CE2   1 
ATOM   5738  C  CZ    . TYR H  4  224  ? 105.847 73.340  -37.392 1.00 79.54  ? 224  TYR B CZ    1 
ATOM   5739  O  OH    . TYR H  4  224  ? 106.659 72.229  -37.545 1.00 79.66  ? 224  TYR B OH    1 
ATOM   5740  N  N     . PHE H  4  225  ? 102.750 80.307  -37.000 1.00 71.18  ? 225  PHE B N     1 
ATOM   5741  C  CA    . PHE H  4  225  ? 101.876 81.327  -37.571 1.00 71.27  ? 225  PHE B CA    1 
ATOM   5742  C  C     . PHE H  4  225  ? 102.677 82.517  -38.039 1.00 73.19  ? 225  PHE B C     1 
ATOM   5743  O  O     . PHE H  4  225  ? 102.175 83.635  -38.111 1.00 73.20  ? 225  PHE B O     1 
ATOM   5744  C  CB    . PHE H  4  225  ? 100.865 81.727  -36.503 1.00 67.68  ? 225  PHE B CB    1 
ATOM   5745  C  CG    . PHE H  4  225  ? 100.214 80.543  -35.857 1.00 64.13  ? 225  PHE B CG    1 
ATOM   5746  C  CD1   . PHE H  4  225  ? 99.924  80.554  -34.496 1.00 62.89  ? 225  PHE B CD1   1 
ATOM   5747  C  CD2   . PHE H  4  225  ? 99.914  79.381  -36.610 1.00 62.01  ? 225  PHE B CD2   1 
ATOM   5748  C  CE1   . PHE H  4  225  ? 99.344  79.420  -33.876 1.00 62.98  ? 225  PHE B CE1   1 
ATOM   5749  C  CE2   . PHE H  4  225  ? 99.343  78.249  -36.018 1.00 60.31  ? 225  PHE B CE2   1 
ATOM   5750  C  CZ    . PHE H  4  225  ? 99.054  78.260  -34.648 1.00 61.59  ? 225  PHE B CZ    1 
ATOM   5751  N  N     . SER H  4  226  ? 103.935 82.236  -38.377 1.00 75.68  ? 226  SER B N     1 
ATOM   5752  C  CA    . SER H  4  226  ? 104.911 83.250  -38.784 1.00 78.68  ? 226  SER B CA    1 
ATOM   5753  C  C     . SER H  4  226  ? 104.806 83.656  -40.277 1.00 79.69  ? 226  SER B C     1 
ATOM   5754  O  O     . SER H  4  226  ? 104.554 84.831  -40.577 1.00 80.57  ? 226  SER B O     1 
ATOM   5755  C  CB    . SER H  4  226  ? 106.336 82.744  -38.508 1.00 79.43  ? 226  SER B CB    1 
ATOM   5756  O  OG    . SER H  4  226  ? 106.732 81.777  -39.461 1.00 80.84  ? 226  SER B OG    1 
ATOM   5757  N  N     . ASN H  4  227  ? 104.991 82.716  -41.203 1.00 79.83  ? 227  ASN B N     1 
ATOM   5758  C  CA    . ASN H  4  227  ? 105.030 83.066  -42.623 1.00 80.83  ? 227  ASN B CA    1 
ATOM   5759  C  C     . ASN H  4  227  ? 103.667 82.971  -43.316 1.00 81.06  ? 227  ASN B C     1 
ATOM   5760  O  O     . ASN H  4  227  ? 103.139 81.875  -43.514 1.00 80.76  ? 227  ASN B O     1 
ATOM   5761  C  CB    . ASN H  4  227  ? 106.042 82.169  -43.330 1.00 81.39  ? 227  ASN B CB    1 
ATOM   5762  C  CG    . ASN H  4  227  ? 107.439 82.400  -42.830 1.00 82.36  ? 227  ASN B CG    1 
ATOM   5763  O  OD1   . ASN H  4  227  ? 107.909 83.539  -42.800 1.00 82.95  ? 227  ASN B OD1   1 
ATOM   5764  N  ND2   . ASN H  4  227  ? 108.119 81.326  -42.428 1.00 82.52  ? 227  ASN B ND2   1 
ATOM   5765  N  N     . PRO H  4  228  ? 103.087 84.135  -43.712 1.00 81.81  ? 228  PRO B N     1 
ATOM   5766  C  CA    . PRO H  4  228  ? 101.787 84.148  -44.402 1.00 81.68  ? 228  PRO B CA    1 
ATOM   5767  C  C     . PRO H  4  228  ? 101.932 83.669  -45.856 1.00 81.48  ? 228  PRO B C     1 
ATOM   5768  O  O     . PRO H  4  228  ? 103.054 83.613  -46.366 1.00 81.48  ? 228  PRO B O     1 
ATOM   5769  C  CB    . PRO H  4  228  ? 101.333 85.613  -44.315 1.00 81.94  ? 228  PRO B CB    1 
ATOM   5770  C  CG    . PRO H  4  228  ? 102.287 86.274  -43.320 1.00 82.10  ? 228  PRO B CG    1 
ATOM   5771  C  CD    . PRO H  4  228  ? 103.570 85.518  -43.514 1.00 82.18  ? 228  PRO B CD    1 
ATOM   5772  N  N     . GLN H  4  229  ? 100.827 83.332  -46.525 1.00 81.39  ? 229  GLN B N     1 
ATOM   5773  C  CA    . GLN H  4  229  ? 100.917 82.870  -47.917 1.00 80.91  ? 229  GLN B CA    1 
ATOM   5774  C  C     . GLN H  4  229  ? 99.553  82.898  -48.615 1.00 80.95  ? 229  GLN B C     1 
ATOM   5775  O  O     . GLN H  4  229  ? 98.635  83.596  -48.126 1.00 81.16  ? 229  GLN B O     1 
ATOM   5776  C  CB    . GLN H  4  229  ? 101.512 81.446  -47.961 1.00 80.36  ? 229  GLN B CB    1 
ATOM   5777  C  CG    . GLN H  4  229  ? 102.227 81.056  -49.270 1.00 78.19  ? 229  GLN B CG    1 
ATOM   5778  C  CD    . GLN H  4  229  ? 103.539 80.306  -49.035 1.00 77.83  ? 229  GLN B CD    1 
ATOM   5779  O  OE1   . GLN H  4  229  ? 104.052 79.628  -49.924 1.00 77.92  ? 229  GLN B OE1   1 
ATOM   5780  N  NE2   . GLN H  4  229  ? 104.086 80.431  -47.829 1.00 77.48  ? 229  GLN B NE2   1 
ATOM   5781  N  N     . MET I  5  1    ? 61.110  91.413  -43.146 1.00 44.22  ? 1    MET C N     1 
ATOM   5782  C  CA    . MET I  5  1    ? 60.553  90.137  -42.619 1.00 42.34  ? 1    MET C CA    1 
ATOM   5783  C  C     . MET I  5  1    ? 59.159  89.870  -43.171 1.00 42.61  ? 1    MET C C     1 
ATOM   5784  O  O     . MET I  5  1    ? 58.390  90.792  -43.412 1.00 41.95  ? 1    MET C O     1 
ATOM   5785  C  CB    . MET I  5  1    ? 60.543  90.191  -41.090 1.00 40.14  ? 1    MET C CB    1 
ATOM   5786  C  CG    . MET I  5  1    ? 61.957  90.073  -40.468 1.00 38.90  ? 1    MET C CG    1 
ATOM   5787  S  SD    . MET I  5  1    ? 62.912  91.603  -40.145 1.00 38.37  ? 1    MET C SD    1 
ATOM   5788  C  CE    . MET I  5  1    ? 63.622  91.265  -38.527 1.00 33.78  ? 1    MET C CE    1 
ATOM   5789  N  N     . GLU I  5  2    ? 58.848  88.593  -43.372 1.00 44.08  ? 2    GLU C N     1 
ATOM   5790  C  CA    . GLU I  5  2    ? 57.558  88.184  -43.936 1.00 44.84  ? 2    GLU C CA    1 
ATOM   5791  C  C     . GLU I  5  2    ? 56.653  87.541  -42.879 1.00 46.38  ? 2    GLU C C     1 
ATOM   5792  O  O     . GLU I  5  2    ? 57.144  87.047  -41.870 1.00 47.61  ? 2    GLU C O     1 
ATOM   5793  C  CB    . GLU I  5  2    ? 57.777  87.186  -45.080 1.00 44.23  ? 2    GLU C CB    1 
ATOM   5794  C  CG    . GLU I  5  2    ? 59.238  86.947  -45.511 1.00 42.34  ? 2    GLU C CG    1 
ATOM   5795  C  CD    . GLU I  5  2    ? 59.349  86.320  -46.915 1.00 41.25  ? 2    GLU C CD    1 
ATOM   5796  O  OE1   . GLU I  5  2    ? 58.959  85.151  -47.115 1.00 39.58  ? 2    GLU C OE1   1 
ATOM   5797  O  OE2   . GLU I  5  2    ? 59.829  87.009  -47.834 1.00 41.32  ? 2    GLU C OE2   1 
ATOM   5798  N  N     . ILE I  5  3    ? 55.337  87.534  -43.126 1.00 48.64  ? 3    ILE C N     1 
ATOM   5799  C  CA    . ILE I  5  3    ? 54.352  86.986  -42.175 1.00 48.99  ? 3    ILE C CA    1 
ATOM   5800  C  C     . ILE I  5  3    ? 53.388  85.979  -42.852 1.00 50.09  ? 3    ILE C C     1 
ATOM   5801  O  O     . ILE I  5  3    ? 52.614  86.351  -43.738 1.00 50.63  ? 3    ILE C O     1 
ATOM   5802  C  CB    . ILE I  5  3    ? 53.492  88.138  -41.548 1.00 48.14  ? 3    ILE C CB    1 
ATOM   5803  C  CG1   . ILE I  5  3    ? 54.335  89.421  -41.373 1.00 48.06  ? 3    ILE C CG1   1 
ATOM   5804  C  CG2   . ILE I  5  3    ? 52.933  87.698  -40.237 1.00 47.76  ? 3    ILE C CG2   1 
ATOM   5805  C  CD1   . ILE I  5  3    ? 55.518  89.340  -40.400 1.00 46.55  ? 3    ILE C CD1   1 
ATOM   5806  N  N     . LYS I  5  4    ? 53.434  84.715  -42.422 1.00 52.04  ? 4    LYS C N     1 
ATOM   5807  C  CA    . LYS I  5  4    ? 52.560  83.655  -42.949 1.00 53.60  ? 4    LYS C CA    1 
ATOM   5808  C  C     . LYS I  5  4    ? 51.621  83.112  -41.855 1.00 55.72  ? 4    LYS C C     1 
ATOM   5809  O  O     . LYS I  5  4    ? 52.080  82.497  -40.887 1.00 54.68  ? 4    LYS C O     1 
ATOM   5810  C  CB    . LYS I  5  4    ? 53.407  82.489  -43.517 1.00 52.41  ? 4    LYS C CB    1 
ATOM   5811  C  CG    . LYS I  5  4    ? 52.607  81.240  -43.976 1.00 50.69  ? 4    LYS C CG    1 
ATOM   5812  C  CD    . LYS I  5  4    ? 53.507  80.105  -44.525 1.00 45.82  ? 4    LYS C CD    1 
ATOM   5813  C  CE    . LYS I  5  4    ? 52.697  78.936  -45.087 1.00 41.95  ? 4    LYS C CE    1 
ATOM   5814  N  NZ    . LYS I  5  4    ? 53.577  77.887  -45.660 1.00 39.50  ? 4    LYS C NZ    1 
ATOM   5815  N  N     . ARG I  5  5    ? 50.316  83.347  -42.025 1.00 58.92  ? 5    ARG C N     1 
ATOM   5816  C  CA    . ARG I  5  5    ? 49.279  82.881  -41.090 1.00 62.07  ? 5    ARG C CA    1 
ATOM   5817  C  C     . ARG I  5  5    ? 48.591  81.594  -41.610 1.00 63.50  ? 5    ARG C C     1 
ATOM   5818  O  O     . ARG I  5  5    ? 47.945  81.577  -42.657 1.00 63.72  ? 5    ARG C O     1 
ATOM   5819  C  CB    . ARG I  5  5    ? 48.263  83.999  -40.865 1.00 63.02  ? 5    ARG C CB    1 
ATOM   5820  C  CG    . ARG I  5  5    ? 47.745  84.711  -42.091 1.00 65.05  ? 5    ARG C CG    1 
ATOM   5821  C  CD    . ARG I  5  5    ? 46.560  85.573  -41.668 1.00 68.78  ? 5    ARG C CD    1 
ATOM   5822  N  NE    . ARG I  5  5    ? 45.685  84.817  -40.763 1.00 71.66  ? 5    ARG C NE    1 
ATOM   5823  C  CZ    . ARG I  5  5    ? 44.566  85.275  -40.204 1.00 72.21  ? 5    ARG C CZ    1 
ATOM   5824  N  NH1   . ARG I  5  5    ? 44.145  86.514  -40.440 1.00 72.20  ? 5    ARG C NH1   1 
ATOM   5825  N  NH2   . ARG I  5  5    ? 43.867  84.477  -39.402 1.00 72.30  ? 5    ARG C NH2   1 
ATOM   5826  N  N     . PHE I  5  6    ? 48.724  80.531  -40.824 1.00 64.78  ? 6    PHE C N     1 
ATOM   5827  C  CA    . PHE I  5  6    ? 48.322  79.163  -41.183 1.00 66.57  ? 6    PHE C CA    1 
ATOM   5828  C  C     . PHE I  5  6    ? 46.795  78.849  -41.031 1.00 67.70  ? 6    PHE C C     1 
ATOM   5829  O  O     . PHE I  5  6    ? 46.160  78.510  -42.029 1.00 68.21  ? 6    PHE C O     1 
ATOM   5830  C  CB    . PHE I  5  6    ? 49.154  78.180  -40.333 1.00 67.08  ? 6    PHE C CB    1 
ATOM   5831  C  CG    . PHE I  5  6    ? 50.630  78.550  -40.212 1.00 68.19  ? 6    PHE C CG    1 
ATOM   5832  C  CD1   . PHE I  5  6    ? 51.048  79.624  -39.388 1.00 68.63  ? 6    PHE C CD1   1 
ATOM   5833  C  CD2   . PHE I  5  6    ? 51.611  77.821  -40.910 1.00 67.88  ? 6    PHE C CD2   1 
ATOM   5834  C  CE1   . PHE I  5  6    ? 52.427  79.969  -39.256 1.00 69.37  ? 6    PHE C CE1   1 
ATOM   5835  C  CE2   . PHE I  5  6    ? 52.998  78.152  -40.788 1.00 68.66  ? 6    PHE C CE2   1 
ATOM   5836  C  CZ    . PHE I  5  6    ? 53.405  79.231  -39.958 1.00 68.82  ? 6    PHE C CZ    1 
ATOM   5837  N  N     . GLY I  5  7    ? 46.221  78.927  -39.826 1.00 67.78  ? 7    GLY C N     1 
ATOM   5838  C  CA    . GLY I  5  7    ? 44.819  78.546  -39.589 1.00 66.98  ? 7    GLY C CA    1 
ATOM   5839  C  C     . GLY I  5  7    ? 43.749  79.249  -40.396 1.00 66.09  ? 7    GLY C C     1 
ATOM   5840  O  O     . GLY I  5  7    ? 43.675  80.478  -40.360 1.00 66.16  ? 7    GLY C O     1 
ATOM   5841  N  N     . ARG I  5  8    ? 42.910  78.478  -41.105 1.00 65.44  ? 8    ARG C N     1 
ATOM   5842  C  CA    . ARG I  5  8    ? 41.869  79.080  -41.940 1.00 64.63  ? 8    ARG C CA    1 
ATOM   5843  C  C     . ARG I  5  8    ? 40.431  78.656  -41.558 1.00 64.43  ? 8    ARG C C     1 
ATOM   5844  O  O     . ARG I  5  8    ? 39.888  77.626  -42.000 1.00 64.73  ? 8    ARG C O     1 
ATOM   5845  C  CB    . ARG I  5  8    ? 42.084  78.748  -43.420 1.00 63.30  ? 8    ARG C CB    1 
ATOM   5846  C  CG    . ARG I  5  8    ? 43.371  79.292  -44.124 1.00 61.96  ? 8    ARG C CG    1 
ATOM   5847  C  CD    . ARG I  5  8    ? 44.281  80.253  -43.321 1.00 59.73  ? 8    ARG C CD    1 
ATOM   5848  N  NE    . ARG I  5  8    ? 43.893  81.660  -43.317 1.00 57.69  ? 8    ARG C NE    1 
ATOM   5849  C  CZ    . ARG I  5  8    ? 44.405  82.573  -42.496 1.00 56.27  ? 8    ARG C CZ    1 
ATOM   5850  N  NH1   . ARG I  5  8    ? 45.328  82.240  -41.596 1.00 53.76  ? 8    ARG C NH1   1 
ATOM   5851  N  NH2   . ARG I  5  8    ? 43.986  83.825  -42.584 1.00 55.63  ? 8    ARG C NH2   1 
ATOM   5852  N  N     . ILE I  5  9    ? 39.857  79.519  -40.729 1.00 64.53  ? 9    ILE C N     1 
ATOM   5853  C  CA    . ILE I  5  9    ? 38.467  79.543  -40.291 1.00 63.60  ? 9    ILE C CA    1 
ATOM   5854  C  C     . ILE I  5  9    ? 37.971  80.950  -40.509 1.00 62.13  ? 9    ILE C C     1 
ATOM   5855  O  O     . ILE I  5  9    ? 38.571  81.881  -39.957 1.00 62.03  ? 9    ILE C O     1 
ATOM   5856  C  CB    . ILE I  5  9    ? 38.262  79.187  -38.765 1.00 65.23  ? 9    ILE C CB    1 
ATOM   5857  C  CG1   . ILE I  5  9    ? 39.612  78.981  -38.048 1.00 65.13  ? 9    ILE C CG1   1 
ATOM   5858  C  CG2   . ILE I  5  9    ? 37.363  77.958  -38.661 1.00 65.75  ? 9    ILE C CG2   1 
ATOM   5859  C  CD1   . ILE I  5  9    ? 40.470  80.238  -37.865 1.00 65.59  ? 9    ILE C CD1   1 
ATOM   5860  N  N     . ARG I  5  10   ? 36.926  81.148  -41.297 1.00 58.83  ? 10   ARG C N     1 
ATOM   5861  C  CA    . ARG I  5  10   ? 36.608  82.521  -41.586 1.00 57.20  ? 10   ARG C CA    1 
ATOM   5862  C  C     . ARG I  5  10   ? 36.116  83.291  -40.391 1.00 57.65  ? 10   ARG C C     1 
ATOM   5863  O  O     . ARG I  5  10   ? 34.969  83.180  -39.943 1.00 57.06  ? 10   ARG C O     1 
ATOM   5864  C  CB    . ARG I  5  10   ? 35.620  82.647  -42.746 1.00 54.36  ? 10   ARG C CB    1 
ATOM   5865  C  CG    . ARG I  5  10   ? 36.357  83.224  -43.987 1.00 49.98  ? 10   ARG C CG    1 
ATOM   5866  C  CD    . ARG I  5  10   ? 37.320  84.418  -43.629 1.00 46.35  ? 10   ARG C CD    1 
ATOM   5867  N  NE    . ARG I  5  10   ? 38.745  84.196  -43.946 1.00 40.45  ? 10   ARG C NE    1 
ATOM   5868  C  CZ    . ARG I  5  10   ? 39.702  83.814  -43.092 1.00 37.33  ? 10   ARG C CZ    1 
ATOM   5869  N  NH1   . ARG I  5  10   ? 39.462  83.582  -41.811 1.00 33.47  ? 10   ARG C NH1   1 
ATOM   5870  N  NH2   . ARG I  5  10   ? 40.932  83.667  -43.537 1.00 36.29  ? 10   ARG C NH2   1 
ATOM   5871  N  N     . GLU I  5  11   ? 37.049  84.087  -39.878 1.00 56.70  ? 11   GLU C N     1 
ATOM   5872  C  CA    . GLU I  5  11   ? 36.745  84.991  -38.808 1.00 57.36  ? 11   GLU C CA    1 
ATOM   5873  C  C     . GLU I  5  11   ? 35.680  85.956  -39.300 1.00 55.73  ? 11   GLU C C     1 
ATOM   5874  O  O     . GLU I  5  11   ? 35.993  86.930  -39.970 1.00 56.77  ? 11   GLU C O     1 
ATOM   5875  C  CB    . GLU I  5  11   ? 38.055  85.696  -38.399 1.00 58.36  ? 11   GLU C CB    1 
ATOM   5876  C  CG    . GLU I  5  11   ? 39.016  84.743  -37.624 1.00 58.16  ? 11   GLU C CG    1 
ATOM   5877  C  CD    . GLU I  5  11   ? 40.499  85.031  -37.808 1.00 58.39  ? 11   GLU C CD    1 
ATOM   5878  O  OE1   . GLU I  5  11   ? 40.894  86.214  -37.773 1.00 57.65  ? 11   GLU C OE1   1 
ATOM   5879  O  OE2   . GLU I  5  11   ? 41.268  84.058  -37.980 1.00 58.47  ? 11   GLU C OE2   1 
ATOM   5880  N  N     . VAL I  5  12   ? 34.425  85.647  -38.982 1.00 53.06  ? 12   VAL C N     1 
ATOM   5881  C  CA    . VAL I  5  12   ? 33.268  86.392  -39.468 1.00 52.13  ? 12   VAL C CA    1 
ATOM   5882  C  C     . VAL I  5  12   ? 33.179  87.834  -38.924 1.00 52.39  ? 12   VAL C C     1 
ATOM   5883  O  O     . VAL I  5  12   ? 32.769  88.722  -39.675 1.00 52.29  ? 12   VAL C O     1 
ATOM   5884  C  CB    . VAL I  5  12   ? 31.963  85.630  -39.137 1.00 51.85  ? 12   VAL C CB    1 
ATOM   5885  C  CG1   . VAL I  5  12   ? 31.795  85.480  -37.635 1.00 51.56  ? 12   VAL C CG1   1 
ATOM   5886  C  CG2   . VAL I  5  12   ? 30.794  86.371  -39.700 1.00 51.09  ? 12   VAL C CG2   1 
ATOM   5887  N  N     . ILE I  5  13   ? 33.526  88.094  -37.665 1.00 51.97  ? 13   ILE C N     1 
ATOM   5888  C  CA    . ILE I  5  13   ? 33.422  89.466  -37.158 1.00 51.29  ? 13   ILE C CA    1 
ATOM   5889  C  C     . ILE I  5  13   ? 34.622  89.841  -36.333 1.00 49.76  ? 13   ILE C C     1 
ATOM   5890  O  O     . ILE I  5  13   ? 35.273  88.978  -35.765 1.00 49.92  ? 13   ILE C O     1 
ATOM   5891  C  CB    . ILE I  5  13   ? 32.162  89.693  -36.264 1.00 51.35  ? 13   ILE C CB    1 
ATOM   5892  C  CG1   . ILE I  5  13   ? 31.406  88.370  -36.045 1.00 52.11  ? 13   ILE C CG1   1 
ATOM   5893  C  CG2   . ILE I  5  13   ? 31.281  90.759  -36.908 1.00 52.19  ? 13   ILE C CG2   1 
ATOM   5894  C  CD1   . ILE I  5  13   ? 30.136  88.472  -35.183 1.00 51.22  ? 13   ILE C CD1   1 
ATOM   5895  N  N     . PRO I  5  14   ? 34.932  91.145  -36.256 1.00 49.83  ? 14   PRO C N     1 
ATOM   5896  C  CA    . PRO I  5  14   ? 36.090  91.563  -35.461 1.00 50.34  ? 14   PRO C CA    1 
ATOM   5897  C  C     . PRO I  5  14   ? 35.813  91.475  -33.944 1.00 48.85  ? 14   PRO C C     1 
ATOM   5898  O  O     . PRO I  5  14   ? 34.645  91.442  -33.514 1.00 48.19  ? 14   PRO C O     1 
ATOM   5899  C  CB    . PRO I  5  14   ? 36.359  93.003  -35.933 1.00 50.46  ? 14   PRO C CB    1 
ATOM   5900  C  CG    . PRO I  5  14   ? 35.542  93.153  -37.219 1.00 50.49  ? 14   PRO C CG    1 
ATOM   5901  C  CD    . PRO I  5  14   ? 34.340  92.300  -36.953 1.00 50.51  ? 14   PRO C CD    1 
ATOM   5902  N  N     . LEU I  5  15   ? 36.886  91.427  -33.145 1.00 46.79  ? 15   LEU C N     1 
ATOM   5903  C  CA    . LEU I  5  15   ? 36.745  91.396  -31.699 1.00 45.17  ? 15   LEU C CA    1 
ATOM   5904  C  C     . LEU I  5  15   ? 36.198  92.726  -31.211 1.00 44.26  ? 15   LEU C C     1 
ATOM   5905  O  O     . LEU I  5  15   ? 36.729  93.771  -31.576 1.00 44.62  ? 15   LEU C O     1 
ATOM   5906  C  CB    . LEU I  5  15   ? 38.093  91.117  -31.043 1.00 43.18  ? 15   LEU C CB    1 
ATOM   5907  C  CG    . LEU I  5  15   ? 38.596  89.691  -31.238 1.00 42.38  ? 15   LEU C CG    1 
ATOM   5908  C  CD1   . LEU I  5  15   ? 39.217  89.533  -32.617 1.00 41.90  ? 15   LEU C CD1   1 
ATOM   5909  C  CD2   . LEU I  5  15   ? 39.603  89.388  -30.153 1.00 42.53  ? 15   LEU C CD2   1 
ATOM   5910  N  N     . PRO I  5  16   ? 35.131  92.713  -30.391 1.00 43.00  ? 16   PRO C N     1 
ATOM   5911  C  CA    . PRO I  5  16   ? 34.518  93.944  -29.873 1.00 43.28  ? 16   PRO C CA    1 
ATOM   5912  C  C     . PRO I  5  16   ? 35.507  94.852  -29.165 1.00 43.05  ? 16   PRO C C     1 
ATOM   5913  O  O     . PRO I  5  16   ? 36.598  94.406  -28.771 1.00 42.87  ? 16   PRO C O     1 
ATOM   5914  C  CB    . PRO I  5  16   ? 33.445  93.436  -28.925 1.00 42.21  ? 16   PRO C CB    1 
ATOM   5915  C  CG    . PRO I  5  16   ? 33.038  92.200  -29.558 1.00 43.73  ? 16   PRO C CG    1 
ATOM   5916  C  CD    . PRO I  5  16   ? 34.338  91.551  -29.968 1.00 42.81  ? 16   PRO C CD    1 
ATOM   5917  N  N     . PRO I  5  17   ? 35.146  96.159  -29.027 1.00 42.15  ? 17   PRO C N     1 
ATOM   5918  C  CA    . PRO I  5  17   ? 36.086  97.016  -28.301 1.00 41.65  ? 17   PRO C CA    1 
ATOM   5919  C  C     . PRO I  5  17   ? 36.335  96.428  -26.894 1.00 40.26  ? 17   PRO C C     1 
ATOM   5920  O  O     . PRO I  5  17   ? 35.438  96.387  -26.065 1.00 40.38  ? 17   PRO C O     1 
ATOM   5921  C  CB    . PRO I  5  17   ? 35.373  98.368  -28.306 1.00 40.21  ? 17   PRO C CB    1 
ATOM   5922  C  CG    . PRO I  5  17   ? 34.737  98.382  -29.660 1.00 38.54  ? 17   PRO C CG    1 
ATOM   5923  C  CD    . PRO I  5  17   ? 34.154  96.984  -29.754 1.00 40.82  ? 17   PRO C CD    1 
ATOM   5924  N  N     . LEU I  5  18   ? 37.538  95.936  -26.638 1.00 38.86  ? 18   LEU C N     1 
ATOM   5925  C  CA    . LEU I  5  18   ? 37.832  95.333  -25.342 1.00 37.33  ? 18   LEU C CA    1 
ATOM   5926  C  C     . LEU I  5  18   ? 37.322  96.205  -24.211 1.00 37.98  ? 18   LEU C C     1 
ATOM   5927  O  O     . LEU I  5  18   ? 36.891  95.730  -23.161 1.00 37.17  ? 18   LEU C O     1 
ATOM   5928  C  CB    . LEU I  5  18   ? 39.343  95.121  -25.203 1.00 36.08  ? 18   LEU C CB    1 
ATOM   5929  C  CG    . LEU I  5  18   ? 39.977  94.141  -26.190 1.00 33.56  ? 18   LEU C CG    1 
ATOM   5930  C  CD1   . LEU I  5  18   ? 40.194  94.763  -27.536 1.00 32.90  ? 18   LEU C CD1   1 
ATOM   5931  C  CD2   . LEU I  5  18   ? 41.284  93.731  -25.648 1.00 33.18  ? 18   LEU C CD2   1 
ATOM   5932  N  N     . THR I  5  19   ? 37.363  97.499  -24.477 1.00 39.99  ? 19   THR C N     1 
ATOM   5933  C  CA    . THR I  5  19   ? 36.948  98.518  -23.541 1.00 42.51  ? 19   THR C CA    1 
ATOM   5934  C  C     . THR I  5  19   ? 35.440  98.804  -23.638 1.00 42.89  ? 19   THR C C     1 
ATOM   5935  O  O     . THR I  5  19   ? 34.900  99.483  -22.765 1.00 43.63  ? 19   THR C O     1 
ATOM   5936  C  CB    . THR I  5  19   ? 37.729  99.833  -23.811 1.00 42.59  ? 19   THR C CB    1 
ATOM   5937  O  OG1   . THR I  5  19   ? 37.372  100.335 -25.105 1.00 44.21  ? 19   THR C OG1   1 
ATOM   5938  C  CG2   . THR I  5  19   ? 39.262  99.591  -23.791 1.00 44.05  ? 19   THR C CG2   1 
ATOM   5939  N  N     . GLU I  5  20   ? 34.779  98.286  -24.677 1.00 44.08  ? 20   GLU C N     1 
ATOM   5940  C  CA    . GLU I  5  20   ? 33.336  98.485  -24.960 1.00 45.21  ? 20   GLU C CA    1 
ATOM   5941  C  C     . GLU I  5  20   ? 32.440  98.333  -23.710 1.00 45.48  ? 20   GLU C C     1 
ATOM   5942  O  O     . GLU I  5  20   ? 31.539  99.138  -23.522 1.00 45.58  ? 20   GLU C O     1 
ATOM   5943  C  CB    . GLU I  5  20   ? 32.871  97.500  -26.040 1.00 44.95  ? 20   GLU C CB    1 
ATOM   5944  C  CG    . GLU I  5  20   ? 31.370  97.302  -26.173 1.00 44.45  ? 20   GLU C CG    1 
ATOM   5945  C  CD    . GLU I  5  20   ? 31.039  96.028  -26.914 1.00 45.20  ? 20   GLU C CD    1 
ATOM   5946  O  OE1   . GLU I  5  20   ? 31.394  95.932  -28.109 1.00 45.77  ? 20   GLU C OE1   1 
ATOM   5947  O  OE2   . GLU I  5  20   ? 30.430  95.126  -26.298 1.00 43.25  ? 20   GLU C OE2   1 
ATOM   5948  N  N     . ILE I  5  21   ? 32.654  97.330  -22.864 1.00 46.40  ? 21   ILE C N     1 
ATOM   5949  C  CA    . ILE I  5  21   ? 31.803  97.158  -21.672 1.00 47.68  ? 21   ILE C CA    1 
ATOM   5950  C  C     . ILE I  5  21   ? 31.940  98.336  -20.681 1.00 48.04  ? 21   ILE C C     1 
ATOM   5951  O  O     . ILE I  5  21   ? 30.943  98.746  -20.090 1.00 50.13  ? 21   ILE C O     1 
ATOM   5952  C  CB    . ILE I  5  21   ? 32.122  95.832  -20.894 1.00 48.41  ? 21   ILE C CB    1 
ATOM   5953  C  CG1   . ILE I  5  21   ? 31.578  94.616  -21.670 1.00 49.66  ? 21   ILE C CG1   1 
ATOM   5954  C  CG2   . ILE I  5  21   ? 31.430  95.845  -19.507 1.00 47.78  ? 21   ILE C CG2   1 
ATOM   5955  C  CD1   . ILE I  5  21   ? 32.293  94.312  -23.004 1.00 50.42  ? 21   ILE C CD1   1 
ATOM   5956  N  N     . GLN I  5  22   ? 33.140  98.880  -20.488 1.00 47.57  ? 22   GLN C N     1 
ATOM   5957  C  CA    . GLN I  5  22   ? 33.310  99.991  -19.549 1.00 45.08  ? 22   GLN C CA    1 
ATOM   5958  C  C     . GLN I  5  22   ? 32.901  101.314 -20.176 1.00 45.44  ? 22   GLN C C     1 
ATOM   5959  O  O     . GLN I  5  22   ? 32.214  102.124 -19.554 1.00 46.80  ? 22   GLN C O     1 
ATOM   5960  C  CB    . GLN I  5  22   ? 34.765  100.038 -19.085 1.00 41.57  ? 22   GLN C CB    1 
ATOM   5961  C  CG    . GLN I  5  22   ? 35.262  98.624  -18.833 1.00 34.18  ? 22   GLN C CG    1 
ATOM   5962  C  CD    . GLN I  5  22   ? 36.447  98.533  -17.943 1.00 30.56  ? 22   GLN C CD    1 
ATOM   5963  O  OE1   . GLN I  5  22   ? 36.745  97.461  -17.443 1.00 26.81  ? 22   GLN C OE1   1 
ATOM   5964  N  NE2   . GLN I  5  22   ? 37.135  99.642  -17.733 1.00 27.84  ? 22   GLN C NE2   1 
ATOM   5965  N  N     . VAL I  5  23   ? 33.316  101.532 -21.412 1.00 45.46  ? 23   VAL C N     1 
ATOM   5966  C  CA    . VAL I  5  23   ? 33.003  102.773 -22.090 1.00 45.77  ? 23   VAL C CA    1 
ATOM   5967  C  C     . VAL I  5  23   ? 31.507  102.976 -22.221 1.00 46.17  ? 23   VAL C C     1 
ATOM   5968  O  O     . VAL I  5  23   ? 30.941  103.927 -21.670 1.00 45.17  ? 23   VAL C O     1 
ATOM   5969  C  CB    . VAL I  5  23   ? 33.608  102.803 -23.502 1.00 46.18  ? 23   VAL C CB    1 
ATOM   5970  C  CG1   . VAL I  5  23   ? 33.513  104.200 -24.054 1.00 47.83  ? 23   VAL C CG1   1 
ATOM   5971  C  CG2   . VAL I  5  23   ? 35.061  102.351 -23.462 1.00 46.25  ? 23   VAL C CG2   1 
ATOM   5972  N  N     . GLU I  5  24   ? 30.881  102.064 -22.958 1.00 48.04  ? 24   GLU C N     1 
ATOM   5973  C  CA    . GLU I  5  24   ? 29.456  102.135 -23.263 1.00 49.68  ? 24   GLU C CA    1 
ATOM   5974  C  C     . GLU I  5  24   ? 28.597  102.129 -21.996 1.00 50.58  ? 24   GLU C C     1 
ATOM   5975  O  O     . GLU I  5  24   ? 27.629  102.893 -21.899 1.00 50.62  ? 24   GLU C O     1 
ATOM   5976  C  CB    . GLU I  5  24   ? 29.058  100.966 -24.185 1.00 49.71  ? 24   GLU C CB    1 
ATOM   5977  C  CG    . GLU I  5  24   ? 30.059  100.629 -25.346 1.00 49.15  ? 24   GLU C CG    1 
ATOM   5978  C  CD    . GLU I  5  24   ? 30.180  101.668 -26.477 1.00 49.89  ? 24   GLU C CD    1 
ATOM   5979  O  OE1   . GLU I  5  24   ? 29.171  101.970 -27.157 1.00 49.69  ? 24   GLU C OE1   1 
ATOM   5980  O  OE2   . GLU I  5  24   ? 31.302  102.175 -26.695 1.00 48.43  ? 24   GLU C OE2   1 
ATOM   5981  N  N     . SER I  5  25   ? 28.936  101.276 -21.033 1.00 51.13  ? 25   SER C N     1 
ATOM   5982  C  CA    . SER I  5  25   ? 28.166  101.221 -19.796 1.00 51.39  ? 25   SER C CA    1 
ATOM   5983  C  C     . SER I  5  25   ? 28.074  102.594 -19.157 1.00 51.94  ? 25   SER C C     1 
ATOM   5984  O  O     . SER I  5  25   ? 26.991  103.056 -18.787 1.00 51.87  ? 25   SER C O     1 
ATOM   5985  C  CB    . SER I  5  25   ? 28.810  100.263 -18.804 1.00 51.61  ? 25   SER C CB    1 
ATOM   5986  O  OG    . SER I  5  25   ? 30.119  100.687 -18.475 1.00 52.26  ? 25   SER C OG    1 
ATOM   5987  N  N     . TYR I  5  26   ? 29.223  103.247 -19.039 1.00 51.79  ? 26   TYR C N     1 
ATOM   5988  C  CA    . TYR I  5  26   ? 29.251  104.557 -18.450 1.00 52.40  ? 26   TYR C CA    1 
ATOM   5989  C  C     . TYR I  5  26   ? 28.590  105.573 -19.373 1.00 54.41  ? 26   TYR C C     1 
ATOM   5990  O  O     . TYR I  5  26   ? 28.125  106.624 -18.934 1.00 54.44  ? 26   TYR C O     1 
ATOM   5991  C  CB    . TYR I  5  26   ? 30.699  104.927 -18.124 1.00 49.50  ? 26   TYR C CB    1 
ATOM   5992  C  CG    . TYR I  5  26   ? 30.828  105.875 -16.945 1.00 47.24  ? 26   TYR C CG    1 
ATOM   5993  C  CD1   . TYR I  5  26   ? 29.770  106.047 -16.025 1.00 46.70  ? 26   TYR C CD1   1 
ATOM   5994  C  CD2   . TYR I  5  26   ? 31.999  106.643 -16.764 1.00 46.40  ? 26   TYR C CD2   1 
ATOM   5995  C  CE1   . TYR I  5  26   ? 29.873  106.973 -14.952 1.00 47.34  ? 26   TYR C CE1   1 
ATOM   5996  C  CE2   . TYR I  5  26   ? 32.116  107.570 -15.695 1.00 45.24  ? 26   TYR C CE2   1 
ATOM   5997  C  CZ    . TYR I  5  26   ? 31.048  107.729 -14.800 1.00 46.02  ? 26   TYR C CZ    1 
ATOM   5998  O  OH    . TYR I  5  26   ? 31.132  108.632 -13.775 1.00 45.53  ? 26   TYR C OH    1 
ATOM   5999  N  N     . ARG I  5  27   ? 28.538  105.258 -20.662 1.00 56.20  ? 27   ARG C N     1 
ATOM   6000  C  CA    . ARG I  5  27   ? 27.838  106.141 -21.570 1.00 58.69  ? 27   ARG C CA    1 
ATOM   6001  C  C     . ARG I  5  27   ? 26.340  106.146 -21.241 1.00 59.98  ? 27   ARG C C     1 
ATOM   6002  O  O     . ARG I  5  27   ? 25.778  107.179 -20.854 1.00 59.85  ? 27   ARG C O     1 
ATOM   6003  C  CB    . ARG I  5  27   ? 28.050  105.695 -23.026 1.00 60.39  ? 27   ARG C CB    1 
ATOM   6004  C  CG    . ARG I  5  27   ? 26.975  106.207 -23.974 1.00 61.97  ? 27   ARG C CG    1 
ATOM   6005  C  CD    . ARG I  5  27   ? 27.477  106.562 -25.372 1.00 63.64  ? 27   ARG C CD    1 
ATOM   6006  N  NE    . ARG I  5  27   ? 26.442  107.280 -26.125 1.00 64.11  ? 27   ARG C NE    1 
ATOM   6007  C  CZ    . ARG I  5  27   ? 26.624  107.877 -27.298 1.00 63.39  ? 27   ARG C CZ    1 
ATOM   6008  N  NH1   . ARG I  5  27   ? 27.813  107.857 -27.888 1.00 63.77  ? 27   ARG C NH1   1 
ATOM   6009  N  NH2   . ARG I  5  27   ? 25.611  108.499 -27.877 1.00 62.77  ? 27   ARG C NH2   1 
ATOM   6010  N  N     . ARG I  5  28   ? 25.704  104.983 -21.391 1.00 60.06  ? 28   ARG C N     1 
ATOM   6011  C  CA    . ARG I  5  28   ? 24.286  104.862 -21.091 1.00 61.20  ? 28   ARG C CA    1 
ATOM   6012  C  C     . ARG I  5  28   ? 24.012  105.250 -19.631 1.00 62.14  ? 28   ARG C C     1 
ATOM   6013  O  O     . ARG I  5  28   ? 22.942  105.775 -19.308 1.00 62.40  ? 28   ARG C O     1 
ATOM   6014  C  CB    . ARG I  5  28   ? 23.816  103.423 -21.368 1.00 59.90  ? 28   ARG C CB    1 
ATOM   6015  C  CG    . ARG I  5  28   ? 24.315  102.849 -22.696 1.00 59.91  ? 28   ARG C CG    1 
ATOM   6016  C  CD    . ARG I  5  28   ? 23.511  101.634 -23.153 1.00 60.15  ? 28   ARG C CD    1 
ATOM   6017  N  NE    . ARG I  5  28   ? 24.245  100.757 -24.077 1.00 61.52  ? 28   ARG C NE    1 
ATOM   6018  C  CZ    . ARG I  5  28   ? 23.674  99.842  -24.869 1.00 62.46  ? 28   ARG C CZ    1 
ATOM   6019  N  NH1   . ARG I  5  28   ? 22.361  99.678  -24.870 1.00 62.54  ? 28   ARG C NH1   1 
ATOM   6020  N  NH2   . ARG I  5  28   ? 24.411  99.076  -25.663 1.00 63.36  ? 28   ARG C NH2   1 
ATOM   6021  N  N     . ALA I  5  29   ? 24.991  104.993 -18.758 1.00 62.37  ? 29   ALA C N     1 
ATOM   6022  C  CA    . ALA I  5  29   ? 24.891  105.341 -17.338 1.00 63.04  ? 29   ALA C CA    1 
ATOM   6023  C  C     . ALA I  5  29   ? 24.586  106.819 -17.177 1.00 63.91  ? 29   ALA C C     1 
ATOM   6024  O  O     . ALA I  5  29   ? 23.574  107.197 -16.594 1.00 63.39  ? 29   ALA C O     1 
ATOM   6025  C  CB    . ALA I  5  29   ? 26.188  105.011 -16.637 1.00 62.92  ? 29   ALA C CB    1 
ATOM   6026  N  N     . LEU I  5  30   ? 25.489  107.642 -17.702 1.00 64.07  ? 30   LEU C N     1 
ATOM   6027  C  CA    . LEU I  5  30   ? 25.334  109.092 -17.724 1.00 65.40  ? 30   LEU C CA    1 
ATOM   6028  C  C     . LEU I  5  30   ? 25.148  109.581 -19.174 1.00 65.48  ? 30   LEU C C     1 
ATOM   6029  O  O     . LEU I  5  30   ? 26.097  109.796 -19.921 1.00 66.24  ? 30   LEU C O     1 
ATOM   6030  C  CB    . LEU I  5  30   ? 26.557  109.769 -17.050 1.00 65.05  ? 30   LEU C CB    1 
ATOM   6031  C  CG    . LEU I  5  30   ? 28.032  109.302 -17.082 1.00 64.97  ? 30   LEU C CG    1 
ATOM   6032  C  CD1   . LEU I  5  30   ? 28.650  109.483 -18.459 1.00 65.13  ? 30   LEU C CD1   1 
ATOM   6033  C  CD2   . LEU I  5  30   ? 28.824  110.136 -16.083 1.00 63.71  ? 30   LEU C CD2   1 
ATOM   6034  N  N     . GLN I  5  31   ? 23.887  109.740 -19.552 1.00 65.19  ? 31   GLN C N     1 
ATOM   6035  C  CA    . GLN I  5  31   ? 23.462  110.123 -20.899 1.00 65.66  ? 31   GLN C CA    1 
ATOM   6036  C  C     . GLN I  5  31   ? 23.784  111.599 -21.211 1.00 65.43  ? 31   GLN C C     1 
ATOM   6037  O  O     . GLN I  5  31   ? 23.390  112.121 -22.247 1.00 65.51  ? 31   GLN C O     1 
ATOM   6038  C  CB    . GLN I  5  31   ? 21.952  109.827 -20.974 1.00 66.02  ? 31   GLN C CB    1 
ATOM   6039  C  CG    . GLN I  5  31   ? 21.161  110.263 -22.205 1.00 67.24  ? 31   GLN C CG    1 
ATOM   6040  C  CD    . GLN I  5  31   ? 19.765  110.806 -21.851 1.00 68.55  ? 31   GLN C CD    1 
ATOM   6041  O  OE1   . GLN I  5  31   ? 19.187  110.460 -20.824 1.00 69.48  ? 31   GLN C OE1   1 
ATOM   6042  N  NE2   . GLN I  5  31   ? 19.226  111.657 -22.713 1.00 68.63  ? 31   GLN C NE2   1 
ATOM   6043  N  N     . ALA I  5  32   ? 24.526  112.250 -20.328 1.00 64.67  ? 32   ALA C N     1 
ATOM   6044  C  CA    . ALA I  5  32   ? 24.869  113.681 -20.412 1.00 64.24  ? 32   ALA C CA    1 
ATOM   6045  C  C     . ALA I  5  32   ? 25.336  114.153 -21.816 1.00 63.48  ? 32   ALA C C     1 
ATOM   6046  O  O     . ALA I  5  32   ? 25.116  115.319 -22.143 1.00 62.50  ? 32   ALA C O     1 
ATOM   6047  C  CB    . ALA I  5  32   ? 25.939  113.996 -19.392 1.00 66.22  ? 32   ALA C CB    1 
ATOM   6048  N  N     . ASP I  5  33   ? 25.967  113.326 -22.640 1.00 63.13  ? 33   ASP C N     1 
ATOM   6049  C  CA    . ASP I  5  33   ? 26.436  113.837 -23.939 1.00 63.20  ? 33   ASP C CA    1 
ATOM   6050  C  C     . ASP I  5  33   ? 25.273  114.306 -24.842 1.00 62.55  ? 33   ASP C C     1 
ATOM   6051  O  O     . ASP I  5  33   ? 25.445  115.209 -25.674 1.00 63.28  ? 33   ASP C O     1 
ATOM   6052  C  CB    . ASP I  5  33   ? 27.265  112.768 -24.682 1.00 63.21  ? 33   ASP C CB    1 
ATOM   6053  C  CG    . ASP I  5  33   ? 28.609  112.492 -24.016 1.00 63.12  ? 33   ASP C CG    1 
ATOM   6054  O  OD1   . ASP I  5  33   ? 29.372  113.468 -23.824 1.00 62.70  ? 33   ASP C OD1   1 
ATOM   6055  O  OD2   . ASP I  5  33   ? 28.899  111.309 -23.691 1.00 62.09  ? 33   ASP C OD2   1 
ATOM   6056  N  N     . VAL I  5  34   ? 24.097  113.709 -24.693 1.00 62.74  ? 34   VAL C N     1 
ATOM   6057  C  CA    . VAL I  5  34   ? 22.967  114.126 -25.506 1.00 62.59  ? 34   VAL C CA    1 
ATOM   6058  C  C     . VAL I  5  34   ? 21.916  114.817 -24.661 1.00 63.53  ? 34   VAL C C     1 
ATOM   6059  O  O     . VAL I  5  34   ? 21.729  114.464 -23.496 1.00 64.03  ? 34   VAL C O     1 
ATOM   6060  C  CB    . VAL I  5  34   ? 22.338  112.949 -26.221 1.00 60.46  ? 34   VAL C CB    1 
ATOM   6061  C  CG1   . VAL I  5  34   ? 22.873  112.900 -27.635 1.00 59.89  ? 34   VAL C CG1   1 
ATOM   6062  C  CG2   . VAL I  5  34   ? 22.656  111.669 -25.493 1.00 61.15  ? 34   VAL C CG2   1 
ATOM   6063  N  N     . PRO I  5  35   ? 21.220  115.824 -25.233 1.00 64.23  ? 35   PRO C N     1 
ATOM   6064  C  CA    . PRO I  5  35   ? 20.188  116.570 -24.504 1.00 67.05  ? 35   PRO C CA    1 
ATOM   6065  C  C     . PRO I  5  35   ? 19.179  115.648 -23.791 1.00 67.77  ? 35   PRO C C     1 
ATOM   6066  O  O     . PRO I  5  35   ? 19.027  114.483 -24.152 1.00 67.15  ? 35   PRO C O     1 
ATOM   6067  C  CB    . PRO I  5  35   ? 19.578  117.441 -25.592 1.00 65.55  ? 35   PRO C CB    1 
ATOM   6068  C  CG    . PRO I  5  35   ? 20.787  117.743 -26.466 1.00 64.26  ? 35   PRO C CG    1 
ATOM   6069  C  CD    . PRO I  5  35   ? 21.386  116.373 -26.594 1.00 64.69  ? 35   PRO C CD    1 
ATOM   6070  N  N     . PRO I  5  36   ? 18.484  116.161 -22.755 1.00 68.56  ? 36   PRO C N     1 
ATOM   6071  C  CA    . PRO I  5  36   ? 17.505  115.336 -22.034 1.00 71.13  ? 36   PRO C CA    1 
ATOM   6072  C  C     . PRO I  5  36   ? 16.398  114.843 -22.954 1.00 71.41  ? 36   PRO C C     1 
ATOM   6073  O  O     . PRO I  5  36   ? 15.631  113.942 -22.606 1.00 71.36  ? 36   PRO C O     1 
ATOM   6074  C  CB    . PRO I  5  36   ? 17.010  116.267 -20.930 1.00 70.60  ? 36   PRO C CB    1 
ATOM   6075  C  CG    . PRO I  5  36   ? 18.211  117.126 -20.669 1.00 70.09  ? 36   PRO C CG    1 
ATOM   6076  C  CD    . PRO I  5  36   ? 18.672  117.454 -22.068 1.00 69.75  ? 36   PRO C CD    1 
ATOM   6077  N  N     . GLU I  5  37   ? 16.328  115.463 -24.128 1.00 73.01  ? 37   GLU C N     1 
ATOM   6078  C  CA    . GLU I  5  37   ? 15.363  115.097 -25.145 1.00 74.70  ? 37   GLU C CA    1 
ATOM   6079  C  C     . GLU I  5  37   ? 15.588  113.660 -25.590 1.00 76.46  ? 37   GLU C C     1 
ATOM   6080  O  O     . GLU I  5  37   ? 14.638  112.889 -25.687 1.00 76.93  ? 37   GLU C O     1 
ATOM   6081  C  CB    . GLU I  5  37   ? 15.488  116.067 -26.328 1.00 73.06  ? 37   GLU C CB    1 
ATOM   6082  C  CG    . GLU I  5  37   ? 15.011  117.498 -25.985 1.00 70.48  ? 37   GLU C CG    1 
ATOM   6083  C  CD    . GLU I  5  37   ? 15.594  118.607 -26.876 1.00 68.34  ? 37   GLU C CD    1 
ATOM   6084  O  OE1   . GLU I  5  37   ? 15.145  119.764 -26.740 1.00 66.33  ? 37   GLU C OE1   1 
ATOM   6085  O  OE2   . GLU I  5  37   ? 16.493  118.337 -27.701 1.00 66.81  ? 37   GLU C OE2   1 
ATOM   6086  N  N     . LYS I  5  38   ? 16.851  113.303 -25.847 1.00 79.88  ? 38   LYS C N     1 
ATOM   6087  C  CA    . LYS I  5  38   ? 17.205  111.935 -26.245 1.00 82.49  ? 38   LYS C CA    1 
ATOM   6088  C  C     . LYS I  5  38   ? 16.677  110.920 -25.197 1.00 83.92  ? 38   LYS C C     1 
ATOM   6089  O  O     . LYS I  5  38   ? 16.934  111.021 -23.991 1.00 85.03  ? 38   LYS C O     1 
ATOM   6090  C  CB    . LYS I  5  38   ? 18.745  111.840 -26.446 1.00 82.97  ? 38   LYS C CB    1 
ATOM   6091  C  CG    . LYS I  5  38   ? 19.310  112.830 -27.519 1.00 82.97  ? 38   LYS C CG    1 
ATOM   6092  C  CD    . LYS I  5  38   ? 19.751  112.188 -28.862 1.00 82.74  ? 38   LYS C CD    1 
ATOM   6093  C  CE    . LYS I  5  38   ? 18.632  111.466 -29.593 1.00 82.68  ? 38   LYS C CE    1 
ATOM   6094  N  NZ    . LYS I  5  38   ? 18.661  109.996 -29.341 1.00 82.19  ? 38   LYS C NZ    1 
ATOM   6095  N  N     . ARG I  5  39   ? 15.925  109.959 -25.732 1.00 85.54  ? 39   ARG C N     1 
ATOM   6096  C  CA    . ARG I  5  39   ? 15.119  108.896 -25.095 1.00 85.68  ? 39   ARG C CA    1 
ATOM   6097  C  C     . ARG I  5  39   ? 15.882  107.959 -24.109 1.00 86.26  ? 39   ARG C C     1 
ATOM   6098  O  O     . ARG I  5  39   ? 15.291  107.645 -23.076 1.00 86.17  ? 39   ARG C O     1 
ATOM   6099  C  CB    . ARG I  5  39   ? 14.449  108.088 -26.216 1.00 86.03  ? 39   ARG C CB    1 
ATOM   6100  C  CG    . ARG I  5  39   ? 13.936  108.969 -27.405 1.00 85.08  ? 39   ARG C CG    1 
ATOM   6101  C  CD    . ARG I  5  39   ? 15.048  109.423 -28.388 1.00 83.86  ? 39   ARG C CD    1 
ATOM   6102  N  NE    . ARG I  5  39   ? 14.572  110.280 -29.481 1.00 82.31  ? 39   ARG C NE    1 
ATOM   6103  C  CZ    . ARG I  5  39   ? 14.079  111.510 -29.345 1.00 81.68  ? 39   ARG C CZ    1 
ATOM   6104  N  NH1   . ARG I  5  39   ? 13.975  112.065 -28.149 1.00 81.06  ? 39   ARG C NH1   1 
ATOM   6105  N  NH2   . ARG I  5  39   ? 13.687  112.186 -30.420 1.00 80.31  ? 39   ARG C NH2   1 
ATOM   6106  N  N     . GLU I  5  40   ? 17.110  107.488 -24.369 1.00 86.72  ? 40   GLU C N     1 
ATOM   6107  C  CA    . GLU I  5  40   ? 17.797  106.585 -23.398 1.00 86.47  ? 40   GLU C CA    1 
ATOM   6108  C  C     . GLU I  5  40   ? 17.834  107.211 -21.986 1.00 85.57  ? 40   GLU C C     1 
ATOM   6109  O  O     . GLU I  5  40   ? 18.738  107.991 -21.656 1.00 85.31  ? 40   GLU C O     1 
ATOM   6110  C  CB    . GLU I  5  40   ? 19.238  106.279 -23.867 1.00 86.89  ? 40   GLU C CB    1 
ATOM   6111  C  CG    . GLU I  5  40   ? 19.463  104.866 -24.458 1.00 85.77  ? 40   GLU C CG    1 
ATOM   6112  C  CD    . GLU I  5  40   ? 19.748  103.800 -23.399 1.00 85.56  ? 40   GLU C CD    1 
ATOM   6113  O  OE1   . GLU I  5  40   ? 18.818  103.409 -22.658 1.00 83.68  ? 40   GLU C OE1   1 
ATOM   6114  O  OE2   . GLU I  5  40   ? 20.916  103.357 -23.315 1.00 85.53  ? 40   GLU C OE2   1 
ATOM   6115  N  N     . ASN I  5  41   ? 16.850  106.841 -21.157 1.00 84.52  ? 41   ASN C N     1 
ATOM   6116  C  CA    . ASN I  5  41   ? 16.688  107.435 -19.826 1.00 82.69  ? 41   ASN C CA    1 
ATOM   6117  C  C     . ASN I  5  41   ? 17.105  106.499 -18.691 1.00 81.46  ? 41   ASN C C     1 
ATOM   6118  O  O     . ASN I  5  41   ? 16.648  106.671 -17.566 1.00 81.14  ? 41   ASN C O     1 
ATOM   6119  C  CB    . ASN I  5  41   ? 15.216  107.897 -19.650 1.00 82.34  ? 41   ASN C CB    1 
ATOM   6120  C  CG    . ASN I  5  41   ? 14.328  106.885 -18.920 1.00 82.06  ? 41   ASN C CG    1 
ATOM   6121  O  OD1   . ASN I  5  41   ? 13.507  107.275 -18.094 1.00 81.90  ? 41   ASN C OD1   1 
ATOM   6122  N  ND2   . ASN I  5  41   ? 14.484  105.596 -19.221 1.00 81.58  ? 41   ASN C ND2   1 
ATOM   6123  N  N     . VAL I  5  42   ? 17.961  105.521 -18.957 1.00 80.63  ? 42   VAL C N     1 
ATOM   6124  C  CA    . VAL I  5  42   ? 18.416  104.634 -17.885 1.00 79.91  ? 42   VAL C CA    1 
ATOM   6125  C  C     . VAL I  5  42   ? 19.493  105.321 -17.050 1.00 78.95  ? 42   VAL C C     1 
ATOM   6126  O  O     . VAL I  5  42   ? 19.869  106.452 -17.359 1.00 79.46  ? 42   VAL C O     1 
ATOM   6127  C  CB    . VAL I  5  42   ? 18.991  103.329 -18.455 1.00 80.30  ? 42   VAL C CB    1 
ATOM   6128  C  CG1   . VAL I  5  42   ? 17.863  102.375 -18.807 1.00 80.53  ? 42   VAL C CG1   1 
ATOM   6129  C  CG2   . VAL I  5  42   ? 19.805  103.637 -19.707 1.00 80.74  ? 42   VAL C CG2   1 
ATOM   6130  N  N     . GLY I  5  43   ? 19.979  104.659 -16.000 1.00 77.62  ? 43   GLY C N     1 
ATOM   6131  C  CA    . GLY I  5  43   ? 21.026  105.246 -15.163 1.00 76.16  ? 43   GLY C CA    1 
ATOM   6132  C  C     . GLY I  5  43   ? 20.661  106.585 -14.509 1.00 74.66  ? 43   GLY C C     1 
ATOM   6133  O  O     . GLY I  5  43   ? 19.578  106.708 -13.946 1.00 74.72  ? 43   GLY C O     1 
ATOM   6134  N  N     . ILE I  5  44   ? 21.568  107.572 -14.586 1.00 72.85  ? 44   ILE C N     1 
ATOM   6135  C  CA    . ILE I  5  44   ? 21.388  108.918 -14.006 1.00 70.30  ? 44   ILE C CA    1 
ATOM   6136  C  C     . ILE I  5  44   ? 19.934  109.350 -14.026 1.00 69.97  ? 44   ILE C C     1 
ATOM   6137  O  O     . ILE I  5  44   ? 19.274  109.366 -12.988 1.00 68.90  ? 44   ILE C O     1 
ATOM   6138  C  CB    . ILE I  5  44   ? 22.211  110.042 -14.778 1.00 69.90  ? 44   ILE C CB    1 
ATOM   6139  C  CG1   . ILE I  5  44   ? 23.698  109.990 -14.397 1.00 70.24  ? 44   ILE C CG1   1 
ATOM   6140  C  CG2   . ILE I  5  44   ? 21.689  111.448 -14.401 1.00 68.58  ? 44   ILE C CG2   1 
ATOM   6141  C  CD1   . ILE I  5  44   ? 24.535  111.243 -14.801 1.00 67.84  ? 44   ILE C CD1   1 
ATOM   6142  N  N     . GLN I  5  45   ? 19.457  109.696 -15.221 1.00 70.13  ? 45   GLN C N     1 
ATOM   6143  C  CA    . GLN I  5  45   ? 18.089  110.184 -15.439 1.00 70.90  ? 45   GLN C CA    1 
ATOM   6144  C  C     . GLN I  5  45   ? 17.045  109.261 -14.814 1.00 71.65  ? 45   GLN C C     1 
ATOM   6145  O  O     . GLN I  5  45   ? 16.087  109.746 -14.215 1.00 70.73  ? 45   GLN C O     1 
ATOM   6146  C  CB    . GLN I  5  45   ? 17.801  110.337 -16.950 1.00 69.64  ? 45   GLN C CB    1 
ATOM   6147  C  CG    . GLN I  5  45   ? 16.485  111.067 -17.251 1.00 67.01  ? 45   GLN C CG    1 
ATOM   6148  C  CD    . GLN I  5  45   ? 16.319  111.592 -18.686 1.00 66.17  ? 45   GLN C CD    1 
ATOM   6149  O  OE1   . GLN I  5  45   ? 16.351  110.839 -19.656 1.00 64.68  ? 45   GLN C OE1   1 
ATOM   6150  N  NE2   . GLN I  5  45   ? 16.131  112.902 -18.810 1.00 65.04  ? 45   GLN C NE2   1 
ATOM   6151  N  N     . ALA I  5  46   ? 17.224  107.945 -14.960 1.00 73.12  ? 46   ALA C N     1 
ATOM   6152  C  CA    . ALA I  5  46   ? 16.288  106.950 -14.403 1.00 75.43  ? 46   ALA C CA    1 
ATOM   6153  C  C     . ALA I  5  46   ? 16.219  107.046 -12.880 1.00 76.94  ? 46   ALA C C     1 
ATOM   6154  O  O     . ALA I  5  46   ? 15.132  107.164 -12.306 1.00 76.43  ? 46   ALA C O     1 
ATOM   6155  C  CB    . ALA I  5  46   ? 16.715  105.528 -14.801 1.00 75.45  ? 46   ALA C CB    1 
ATOM   6156  N  N     . ALA I  5  47   ? 17.389  106.985 -12.239 1.00 77.46  ? 47   ALA C N     1 
ATOM   6157  C  CA    . ALA I  5  47   ? 17.506  107.096 -10.784 1.00 78.41  ? 47   ALA C CA    1 
ATOM   6158  C  C     . ALA I  5  47   ? 16.936  108.429 -10.295 1.00 78.22  ? 47   ALA C C     1 
ATOM   6159  O  O     . ALA I  5  47   ? 16.430  108.520 -9.174  1.00 79.82  ? 47   ALA C O     1 
ATOM   6160  C  CB    . ALA I  5  47   ? 18.980  106.976 -10.359 1.00 78.18  ? 47   ALA C CB    1 
ATOM   6161  N  N     . PHE I  5  48   ? 17.022  109.455 -11.141 1.00 76.79  ? 48   PHE C N     1 
ATOM   6162  C  CA    . PHE I  5  48   ? 16.498  110.781 -10.808 1.00 75.13  ? 48   PHE C CA    1 
ATOM   6163  C  C     . PHE I  5  48   ? 14.972  110.772 -10.704 1.00 74.14  ? 48   PHE C C     1 
ATOM   6164  O  O     . PHE I  5  48   ? 14.421  111.148 -9.676  1.00 73.67  ? 48   PHE C O     1 
ATOM   6165  C  CB    . PHE I  5  48   ? 16.916  111.810 -11.858 1.00 73.68  ? 48   PHE C CB    1 
ATOM   6166  C  CG    . PHE I  5  48   ? 17.892  112.812 -11.348 1.00 71.93  ? 48   PHE C CG    1 
ATOM   6167  C  CD1   . PHE I  5  48   ? 17.664  113.469 -10.129 1.00 70.72  ? 48   PHE C CD1   1 
ATOM   6168  C  CD2   . PHE I  5  48   ? 19.058  113.096 -12.068 1.00 71.54  ? 48   PHE C CD2   1 
ATOM   6169  C  CE1   . PHE I  5  48   ? 18.594  114.406 -9.621  1.00 70.60  ? 48   PHE C CE1   1 
ATOM   6170  C  CE2   . PHE I  5  48   ? 20.008  114.035 -11.578 1.00 71.49  ? 48   PHE C CE2   1 
ATOM   6171  C  CZ    . PHE I  5  48   ? 19.772  114.692 -10.346 1.00 70.41  ? 48   PHE C CZ    1 
ATOM   6172  N  N     . ARG I  5  49   ? 14.297  110.352 -11.771 1.00 73.84  ? 49   ARG C N     1 
ATOM   6173  C  CA    . ARG I  5  49   ? 12.842  110.277 -11.764 1.00 73.58  ? 49   ARG C CA    1 
ATOM   6174  C  C     . ARG I  5  49   ? 12.357  109.237 -10.762 1.00 73.32  ? 49   ARG C C     1 
ATOM   6175  O  O     . ARG I  5  49   ? 11.236  109.329 -10.259 1.00 74.26  ? 49   ARG C O     1 
ATOM   6176  C  CB    . ARG I  5  49   ? 12.323  109.909 -13.150 1.00 72.90  ? 49   ARG C CB    1 
ATOM   6177  C  CG    . ARG I  5  49   ? 13.024  108.704 -13.753 1.00 72.32  ? 49   ARG C CG    1 
ATOM   6178  C  CD    . ARG I  5  49   ? 13.246  108.922 -15.231 1.00 71.37  ? 49   ARG C CD    1 
ATOM   6179  N  NE    . ARG I  5  49   ? 13.515  110.327 -15.501 1.00 70.32  ? 49   ARG C NE    1 
ATOM   6180  C  CZ    . ARG I  5  49   ? 13.496  110.868 -16.710 1.00 70.41  ? 49   ARG C CZ    1 
ATOM   6181  N  NH1   . ARG I  5  49   ? 13.230  110.117 -17.763 1.00 70.52  ? 49   ARG C NH1   1 
ATOM   6182  N  NH2   . ARG I  5  49   ? 13.738  112.161 -16.870 1.00 70.63  ? 49   ARG C NH2   1 
ATOM   6183  N  N     . GLU I  5  50   ? 13.204  108.246 -10.482 1.00 71.43  ? 50   GLU C N     1 
ATOM   6184  C  CA    . GLU I  5  50   ? 12.877  107.201 -9.511  1.00 68.89  ? 50   GLU C CA    1 
ATOM   6185  C  C     . GLU I  5  50   ? 12.585  107.815 -8.119  1.00 67.98  ? 50   GLU C C     1 
ATOM   6186  O  O     . GLU I  5  50   ? 11.661  107.379 -7.415  1.00 67.25  ? 50   GLU C O     1 
ATOM   6187  C  CB    . GLU I  5  50   ? 14.054  106.198 -9.430  1.00 68.76  ? 50   GLU C CB    1 
ATOM   6188  C  CG    . GLU I  5  50   ? 13.931  105.109 -8.359  1.00 68.61  ? 50   GLU C CG    1 
ATOM   6189  C  CD    . GLU I  5  50   ? 15.067  105.163 -7.341  1.00 67.95  ? 50   GLU C CD    1 
ATOM   6190  O  OE1   . GLU I  5  50   ? 14.910  104.620 -6.219  1.00 67.48  ? 50   GLU C OE1   1 
ATOM   6191  O  OE2   . GLU I  5  50   ? 16.121  105.751 -7.666  1.00 67.53  ? 50   GLU C OE2   1 
ATOM   6192  N  N     . THR I  5  51   ? 13.364  108.838 -7.742  1.00 65.38  ? 51   THR C N     1 
ATOM   6193  C  CA    . THR I  5  51   ? 13.223  109.480 -6.432  1.00 61.98  ? 51   THR C CA    1 
ATOM   6194  C  C     . THR I  5  51   ? 13.014  110.984 -6.544  1.00 59.99  ? 51   THR C C     1 
ATOM   6195  O  O     . THR I  5  51   ? 13.106  111.671 -5.531  1.00 60.16  ? 51   THR C O     1 
ATOM   6196  C  CB    . THR I  5  51   ? 14.478  109.309 -5.523  1.00 61.62  ? 51   THR C CB    1 
ATOM   6197  O  OG1   . THR I  5  51   ? 15.246  110.517 -5.562  1.00 59.43  ? 51   THR C OG1   1 
ATOM   6198  C  CG2   . THR I  5  51   ? 15.341  108.145 -5.968  1.00 61.11  ? 51   THR C CG2   1 
ATOM   6199  N  N     . PHE I  5  52   ? 12.737  111.527 -7.719  1.00 57.64  ? 52   PHE C N     1 
ATOM   6200  C  CA    . PHE I  5  52   ? 12.575  112.966 -7.746  1.00 56.97  ? 52   PHE C CA    1 
ATOM   6201  C  C     . PHE I  5  52   ? 11.178  113.385 -7.337  1.00 56.21  ? 52   PHE C C     1 
ATOM   6202  O  O     . PHE I  5  52   ? 11.049  114.227 -6.451  1.00 55.41  ? 52   PHE C O     1 
ATOM   6203  C  CB    . PHE I  5  52   ? 12.886  113.536 -9.118  1.00 57.19  ? 52   PHE C CB    1 
ATOM   6204  C  CG    . PHE I  5  52   ? 13.458  114.932 -9.067  1.00 57.58  ? 52   PHE C CG    1 
ATOM   6205  C  CD1   . PHE I  5  52   ? 12.667  116.019 -8.628  1.00 57.66  ? 52   PHE C CD1   1 
ATOM   6206  C  CD2   . PHE I  5  52   ? 14.787  115.182 -9.472  1.00 57.59  ? 52   PHE C CD2   1 
ATOM   6207  C  CE1   . PHE I  5  52   ? 13.194  117.346 -8.593  1.00 56.16  ? 52   PHE C CE1   1 
ATOM   6208  C  CE2   . PHE I  5  52   ? 15.326  116.504 -9.444  1.00 56.74  ? 52   PHE C CE2   1 
ATOM   6209  C  CZ    . PHE I  5  52   ? 14.522  117.585 -9.004  1.00 56.33  ? 52   PHE C CZ    1 
ATOM   6210  N  N     . PRO I  5  53   ? 10.115  112.823 -7.960  1.00 55.90  ? 53   PRO C N     1 
ATOM   6211  C  CA    . PRO I  5  53   ? 8.778   113.256 -7.534  1.00 56.37  ? 53   PRO C CA    1 
ATOM   6212  C  C     . PRO I  5  53   ? 8.534   112.950 -6.049  1.00 57.52  ? 53   PRO C C     1 
ATOM   6213  O  O     . PRO I  5  53   ? 7.992   111.897 -5.709  1.00 59.87  ? 53   PRO C O     1 
ATOM   6214  C  CB    . PRO I  5  53   ? 7.830   112.486 -8.461  1.00 55.59  ? 53   PRO C CB    1 
ATOM   6215  C  CG    . PRO I  5  53   ? 8.691   112.036 -9.585  1.00 55.22  ? 53   PRO C CG    1 
ATOM   6216  C  CD    . PRO I  5  53   ? 10.007  111.735 -8.942  1.00 55.24  ? 53   PRO C CD    1 
ATOM   6217  N  N     . ILE I  5  54   ? 8.935   113.857 -5.163  1.00 57.24  ? 54   ILE C N     1 
ATOM   6218  C  CA    . ILE I  5  54   ? 8.739   113.621 -3.749  1.00 56.18  ? 54   ILE C CA    1 
ATOM   6219  C  C     . ILE I  5  54   ? 7.336   114.025 -3.317  1.00 55.70  ? 54   ILE C C     1 
ATOM   6220  O  O     . ILE I  5  54   ? 6.972   115.207 -3.303  1.00 57.12  ? 54   ILE C O     1 
ATOM   6221  C  CB    . ILE I  5  54   ? 9.823   114.378 -2.911  1.00 56.52  ? 54   ILE C CB    1 
ATOM   6222  C  CG1   . ILE I  5  54   ? 9.595   114.098 -1.426  1.00 56.78  ? 54   ILE C CG1   1 
ATOM   6223  C  CG2   . ILE I  5  54   ? 9.837   115.857 -3.259  1.00 57.15  ? 54   ILE C CG2   1 
ATOM   6224  C  CD1   . ILE I  5  54   ? 10.736  114.548 -0.532  1.00 56.56  ? 54   ILE C CD1   1 
ATOM   6225  N  N     . GLU I  5  55   ? 6.537   113.023 -2.976  1.00 55.49  ? 55   GLU C N     1 
ATOM   6226  C  CA    . GLU I  5  55   ? 5.183   113.276 -2.529  1.00 54.68  ? 55   GLU C CA    1 
ATOM   6227  C  C     . GLU I  5  55   ? 5.079   113.142 -1.017  1.00 56.92  ? 55   GLU C C     1 
ATOM   6228  O  O     . GLU I  5  55   ? 5.228   112.061 -0.446  1.00 56.64  ? 55   GLU C O     1 
ATOM   6229  C  CB    . GLU I  5  55   ? 4.198   112.310 -3.229  1.00 50.35  ? 55   GLU C CB    1 
ATOM   6230  C  CG    . GLU I  5  55   ? 2.735   112.285 -2.702  1.00 42.45  ? 55   GLU C CG    1 
ATOM   6231  C  CD    . GLU I  5  55   ? 1.775   113.213 -3.432  1.00 37.86  ? 55   GLU C CD    1 
ATOM   6232  O  OE1   . GLU I  5  55   ? 0.617   112.801 -3.623  1.00 33.61  ? 55   GLU C OE1   1 
ATOM   6233  O  OE2   . GLU I  5  55   ? 2.161   114.336 -3.805  1.00 34.29  ? 55   GLU C OE2   1 
ATOM   6234  N  N     . GLU I  5  56   ? 4.845   114.288 -0.393  1.00 59.97  ? 56   GLU C N     1 
ATOM   6235  C  CA    . GLU I  5  56   ? 4.631   114.434 1.029   1.00 63.24  ? 56   GLU C CA    1 
ATOM   6236  C  C     . GLU I  5  56   ? 3.313   115.175 1.262   1.00 66.41  ? 56   GLU C C     1 
ATOM   6237  O  O     . GLU I  5  56   ? 3.259   116.394 1.059   1.00 66.63  ? 56   GLU C O     1 
ATOM   6238  C  CB    . GLU I  5  56   ? 5.792   115.213 1.640   1.00 62.96  ? 56   GLU C CB    1 
ATOM   6239  C  CG    . GLU I  5  56   ? 5.703   115.313 3.138   1.00 63.28  ? 56   GLU C CG    1 
ATOM   6240  C  CD    . GLU I  5  56   ? 5.092   114.064 3.748   1.00 64.14  ? 56   GLU C CD    1 
ATOM   6241  O  OE1   . GLU I  5  56   ? 3.846   113.941 3.757   1.00 63.62  ? 56   GLU C OE1   1 
ATOM   6242  O  OE2   . GLU I  5  56   ? 5.859   113.196 4.211   1.00 65.42  ? 56   GLU C OE2   1 
ATOM   6243  N  N     . GLU I  5  57   ? 2.264   114.458 1.689   1.00 68.93  ? 57   GLU C N     1 
ATOM   6244  C  CA    . GLU I  5  57   ? 0.935   115.077 1.771   1.00 71.58  ? 57   GLU C CA    1 
ATOM   6245  C  C     . GLU I  5  57   ? 0.505   115.479 3.187   1.00 75.37  ? 57   GLU C C     1 
ATOM   6246  O  O     . GLU I  5  57   ? 0.626   116.657 3.535   1.00 76.77  ? 57   GLU C O     1 
ATOM   6247  C  CB    . GLU I  5  57   ? -0.136  114.147 1.152   1.00 68.69  ? 57   GLU C CB    1 
ATOM   6248  C  CG    . GLU I  5  57   ? -1.634  114.594 1.339   1.00 64.60  ? 57   GLU C CG    1 
ATOM   6249  C  CD    . GLU I  5  57   ? -2.169  115.591 0.290   1.00 61.87  ? 57   GLU C CD    1 
ATOM   6250  O  OE1   . GLU I  5  57   ? -2.330  115.196 -0.881  1.00 60.06  ? 57   GLU C OE1   1 
ATOM   6251  O  OE2   . GLU I  5  57   ? -2.433  116.768 0.633   1.00 59.13  ? 57   GLU C OE2   1 
ATOM   6252  N  N     . ASP I  5  58   ? 0.006   114.566 4.023   1.00 78.78  ? 58   ASP C N     1 
ATOM   6253  C  CA    . ASP I  5  58   ? -0.537  115.120 5.261   1.00 81.98  ? 58   ASP C CA    1 
ATOM   6254  C  C     . ASP I  5  58   ? -0.078  114.431 6.547   1.00 83.99  ? 58   ASP C C     1 
ATOM   6255  O  O     . ASP I  5  58   ? -0.140  113.212 6.777   1.00 84.35  ? 58   ASP C O     1 
ATOM   6256  C  CB    . ASP I  5  58   ? -2.069  115.166 5.157   1.00 82.56  ? 58   ASP C CB    1 
ATOM   6257  C  CG    . ASP I  5  58   ? -2.546  116.350 4.301   1.00 83.86  ? 58   ASP C CG    1 
ATOM   6258  O  OD1   . ASP I  5  58   ? -2.118  117.486 4.606   1.00 83.52  ? 58   ASP C OD1   1 
ATOM   6259  O  OD2   . ASP I  5  58   ? -3.329  116.164 3.336   1.00 84.80  ? 58   ASP C OD2   1 
ATOM   6260  N  N     . LYS I  5  59   ? 0.356   115.392 7.359   1.00 85.48  ? 59   LYS C N     1 
ATOM   6261  C  CA    . LYS I  5  59   ? 0.890   115.461 8.717   1.00 87.03  ? 59   LYS C CA    1 
ATOM   6262  C  C     . LYS I  5  59   ? 1.222   116.935 8.993   1.00 87.57  ? 59   LYS C C     1 
ATOM   6263  O  O     . LYS I  5  59   ? 2.382   117.379 8.912   1.00 88.20  ? 59   LYS C O     1 
ATOM   6264  C  CB    . LYS I  5  59   ? 2.154   114.577 8.882   1.00 86.17  ? 59   LYS C CB    1 
ATOM   6265  C  CG    . LYS I  5  59   ? 1.855   113.152 9.417   1.00 84.75  ? 59   LYS C CG    1 
ATOM   6266  C  CD    . LYS I  5  59   ? 3.081   112.241 9.399   1.00 83.78  ? 59   LYS C CD    1 
ATOM   6267  C  CE    . LYS I  5  59   ? 2.681   110.770 9.522   1.00 82.54  ? 59   LYS C CE    1 
ATOM   6268  N  NZ    . LYS I  5  59   ? 3.747   109.852 9.022   1.00 81.49  ? 59   LYS C NZ    1 
ATOM   6269  N  N     . GLY I  5  60   ? 0.149   117.680 9.281   1.00 87.30  ? 60   GLY C N     1 
ATOM   6270  C  CA    . GLY I  5  60   ? 0.218   119.119 9.442   1.00 87.02  ? 60   GLY C CA    1 
ATOM   6271  C  C     . GLY I  5  60   ? -0.187  119.705 8.100   1.00 86.89  ? 60   GLY C C     1 
ATOM   6272  O  O     . GLY I  5  60   ? -1.346  119.571 7.704   1.00 86.80  ? 60   GLY C O     1 
ATOM   6273  N  N     . LYS I  5  61   ? 0.753   120.329 7.390   1.00 86.31  ? 61   LYS C N     1 
ATOM   6274  C  CA    . LYS I  5  61   ? 0.485   120.873 6.049   1.00 84.88  ? 61   LYS C CA    1 
ATOM   6275  C  C     . LYS I  5  61   ? 1.466   120.290 5.015   1.00 84.33  ? 61   LYS C C     1 
ATOM   6276  O  O     . LYS I  5  61   ? 2.686   120.243 5.247   1.00 84.09  ? 61   LYS C O     1 
ATOM   6277  C  CB    . LYS I  5  61   ? 0.604   122.410 6.045   1.00 83.85  ? 61   LYS C CB    1 
ATOM   6278  C  CG    . LYS I  5  61   ? 0.711   123.042 4.656   1.00 81.44  ? 61   LYS C CG    1 
ATOM   6279  C  CD    . LYS I  5  61   ? 1.460   124.351 4.726   1.00 79.04  ? 61   LYS C CD    1 
ATOM   6280  C  CE    . LYS I  5  61   ? 2.262   124.594 3.467   1.00 77.88  ? 61   LYS C CE    1 
ATOM   6281  N  NZ    . LYS I  5  61   ? 3.056   125.838 3.600   1.00 76.76  ? 61   LYS C NZ    1 
ATOM   6282  N  N     . GLY I  5  62   ? 0.925   119.853 3.880   1.00 83.48  ? 62   GLY C N     1 
ATOM   6283  C  CA    . GLY I  5  62   ? 1.765   119.287 2.847   1.00 82.01  ? 62   GLY C CA    1 
ATOM   6284  C  C     . GLY I  5  62   ? 1.288   119.598 1.442   1.00 81.21  ? 62   GLY C C     1 
ATOM   6285  O  O     . GLY I  5  62   ? 0.884   120.727 1.139   1.00 81.35  ? 62   GLY C O     1 
ATOM   6286  N  N     . GLY I  5  63   ? 1.329   118.580 0.587   1.00 80.25  ? 63   GLY C N     1 
ATOM   6287  C  CA    . GLY I  5  63   ? 0.952   118.755 -0.801  1.00 78.86  ? 63   GLY C CA    1 
ATOM   6288  C  C     . GLY I  5  63   ? 2.180   119.157 -1.588  1.00 77.87  ? 63   GLY C C     1 
ATOM   6289  O  O     . GLY I  5  63   ? 2.108   119.867 -2.599  1.00 78.23  ? 63   GLY C O     1 
ATOM   6290  N  N     . LEU I  5  64   ? 3.318   118.680 -1.082  1.00 76.65  ? 64   LEU C N     1 
ATOM   6291  C  CA    . LEU I  5  64   ? 4.651   118.934 -1.631  1.00 75.14  ? 64   LEU C CA    1 
ATOM   6292  C  C     . LEU I  5  64   ? 4.856   118.241 -2.962  1.00 73.80  ? 64   LEU C C     1 
ATOM   6293  O  O     . LEU I  5  64   ? 4.606   117.043 -3.116  1.00 73.92  ? 64   LEU C O     1 
ATOM   6294  C  CB    . LEU I  5  64   ? 5.729   118.452 -0.646  1.00 74.81  ? 64   LEU C CB    1 
ATOM   6295  C  CG    . LEU I  5  64   ? 7.079   117.884 -1.125  1.00 74.43  ? 64   LEU C CG    1 
ATOM   6296  C  CD1   . LEU I  5  64   ? 7.882   118.890 -1.912  1.00 73.32  ? 64   LEU C CD1   1 
ATOM   6297  C  CD2   . LEU I  5  64   ? 7.851   117.465 0.091   1.00 73.82  ? 64   LEU C CD2   1 
ATOM   6298  N  N     . VAL I  5  65   ? 5.330   119.013 -3.930  1.00 71.97  ? 65   VAL C N     1 
ATOM   6299  C  CA    . VAL I  5  65   ? 5.578   118.449 -5.228  1.00 69.72  ? 65   VAL C CA    1 
ATOM   6300  C  C     . VAL I  5  65   ? 6.810   119.057 -5.869  1.00 69.10  ? 65   VAL C C     1 
ATOM   6301  O  O     . VAL I  5  65   ? 6.760   120.117 -6.473  1.00 68.27  ? 65   VAL C O     1 
ATOM   6302  C  CB    . VAL I  5  65   ? 4.373   118.641 -6.176  1.00 69.16  ? 65   VAL C CB    1 
ATOM   6303  C  CG1   . VAL I  5  65   ? 4.005   117.299 -6.755  1.00 69.24  ? 65   VAL C CG1   1 
ATOM   6304  C  CG2   . VAL I  5  65   ? 3.165   119.209 -5.436  1.00 68.57  ? 65   VAL C CG2   1 
ATOM   6305  N  N     . LEU I  5  66   ? 7.927   118.365 -5.709  1.00 67.80  ? 66   LEU C N     1 
ATOM   6306  C  CA    . LEU I  5  66   ? 9.190   118.745 -6.318  1.00 66.62  ? 66   LEU C CA    1 
ATOM   6307  C  C     . LEU I  5  66   ? 9.446   117.859 -7.529  1.00 65.79  ? 66   LEU C C     1 
ATOM   6308  O  O     . LEU I  5  66   ? 9.475   116.645 -7.389  1.00 65.33  ? 66   LEU C O     1 
ATOM   6309  C  CB    . LEU I  5  66   ? 10.308  118.580 -5.288  1.00 66.31  ? 66   LEU C CB    1 
ATOM   6310  C  CG    . LEU I  5  66   ? 11.736  118.324 -5.744  1.00 66.00  ? 66   LEU C CG    1 
ATOM   6311  C  CD1   . LEU I  5  66   ? 12.380  119.637 -6.151  1.00 66.48  ? 66   LEU C CD1   1 
ATOM   6312  C  CD2   . LEU I  5  66   ? 12.505  117.658 -4.618  1.00 65.35  ? 66   LEU C CD2   1 
ATOM   6313  N  N     . ASP I  5  67   ? 9.624   118.424 -8.714  1.00 65.10  ? 67   ASP C N     1 
ATOM   6314  C  CA    . ASP I  5  67   ? 9.806   117.541 -9.854  1.00 65.84  ? 67   ASP C CA    1 
ATOM   6315  C  C     . ASP I  5  67   ? 10.984  117.944 -10.742 1.00 66.82  ? 67   ASP C C     1 
ATOM   6316  O  O     . ASP I  5  67   ? 11.369  119.111 -10.843 1.00 68.36  ? 67   ASP C O     1 
ATOM   6317  C  CB    . ASP I  5  67   ? 8.498   117.470 -10.651 1.00 64.39  ? 67   ASP C CB    1 
ATOM   6318  C  CG    . ASP I  5  67   ? 7.553   116.361 -10.136 1.00 62.67  ? 67   ASP C CG    1 
ATOM   6319  O  OD1   . ASP I  5  67   ? 7.913   115.659 -9.164  1.00 60.27  ? 67   ASP C OD1   1 
ATOM   6320  O  OD2   . ASP I  5  67   ? 6.454   116.180 -10.703 1.00 62.03  ? 67   ASP C OD2   1 
ATOM   6321  N  N     . PHE I  5  68   ? 11.536  116.907 -11.375 1.00 68.48  ? 68   PHE C N     1 
ATOM   6322  C  CA    . PHE I  5  68   ? 12.711  116.943 -12.253 1.00 69.10  ? 68   PHE C CA    1 
ATOM   6323  C  C     . PHE I  5  68   ? 12.373  117.404 -13.658 1.00 69.29  ? 68   PHE C C     1 
ATOM   6324  O  O     . PHE I  5  68   ? 11.407  116.939 -14.286 1.00 71.03  ? 68   PHE C O     1 
ATOM   6325  C  CB    . PHE I  5  68   ? 13.333  115.549 -12.361 1.00 69.36  ? 68   PHE C CB    1 
ATOM   6326  C  CG    . PHE I  5  68   ? 14.451  115.445 -13.370 1.00 69.38  ? 68   PHE C CG    1 
ATOM   6327  C  CD1   . PHE I  5  68   ? 15.728  115.973 -13.095 1.00 69.71  ? 68   PHE C CD1   1 
ATOM   6328  C  CD2   . PHE I  5  68   ? 14.229  114.817 -14.615 1.00 69.36  ? 68   PHE C CD2   1 
ATOM   6329  C  CE1   . PHE I  5  68   ? 16.785  115.870 -14.067 1.00 70.08  ? 68   PHE C CE1   1 
ATOM   6330  C  CE2   . PHE I  5  68   ? 15.268  114.708 -15.588 1.00 68.19  ? 68   PHE C CE2   1 
ATOM   6331  C  CZ    . PHE I  5  68   ? 16.539  115.234 -15.313 1.00 68.12  ? 68   PHE C CZ    1 
ATOM   6332  N  N     . LEU I  5  69   ? 13.217  118.309 -14.146 1.00 68.80  ? 69   LEU C N     1 
ATOM   6333  C  CA    . LEU I  5  69   ? 13.100  118.831 -15.496 1.00 67.03  ? 69   LEU C CA    1 
ATOM   6334  C  C     . LEU I  5  69   ? 14.164  118.195 -16.409 1.00 64.78  ? 69   LEU C C     1 
ATOM   6335  O  O     . LEU I  5  69   ? 13.872  117.265 -17.175 1.00 64.70  ? 69   LEU C O     1 
ATOM   6336  C  CB    . LEU I  5  69   ? 13.231  120.387 -15.488 1.00 67.73  ? 69   LEU C CB    1 
ATOM   6337  C  CG    . LEU I  5  69   ? 12.142  121.276 -14.819 1.00 67.53  ? 69   LEU C CG    1 
ATOM   6338  C  CD1   . LEU I  5  69   ? 12.490  121.512 -13.346 1.00 66.49  ? 69   LEU C CD1   1 
ATOM   6339  C  CD2   . LEU I  5  69   ? 12.024  122.618 -15.543 1.00 65.70  ? 69   LEU C CD2   1 
ATOM   6340  N  N     . GLU I  5  70   ? 15.392  118.686 -16.326 1.00 62.05  ? 70   GLU C N     1 
ATOM   6341  C  CA    . GLU I  5  70   ? 16.453  118.141 -17.144 1.00 59.12  ? 70   GLU C CA    1 
ATOM   6342  C  C     . GLU I  5  70   ? 17.756  118.127 -16.376 1.00 57.87  ? 70   GLU C C     1 
ATOM   6343  O  O     . GLU I  5  70   ? 18.067  119.071 -15.649 1.00 57.48  ? 70   GLU C O     1 
ATOM   6344  C  CB    . GLU I  5  70   ? 16.595  118.977 -18.429 1.00 58.31  ? 70   GLU C CB    1 
ATOM   6345  C  CG    . GLU I  5  70   ? 15.238  119.399 -19.116 1.00 56.24  ? 70   GLU C CG    1 
ATOM   6346  C  CD    . GLU I  5  70   ? 15.015  118.852 -20.547 1.00 55.26  ? 70   GLU C CD    1 
ATOM   6347  O  OE1   . GLU I  5  70   ? 15.834  119.141 -21.445 1.00 54.75  ? 70   GLU C OE1   1 
ATOM   6348  O  OE2   . GLU I  5  70   ? 14.015  118.136 -20.778 1.00 52.96  ? 70   GLU C OE2   1 
ATOM   6349  N  N     . TYR I  5  71   ? 18.507  117.046 -16.519 1.00 57.33  ? 71   TYR C N     1 
ATOM   6350  C  CA    . TYR I  5  71   ? 19.781  116.954 -15.851 1.00 56.46  ? 71   TYR C CA    1 
ATOM   6351  C  C     . TYR I  5  71   ? 20.887  117.329 -16.806 1.00 55.49  ? 71   TYR C C     1 
ATOM   6352  O  O     . TYR I  5  71   ? 20.991  116.780 -17.904 1.00 54.22  ? 71   TYR C O     1 
ATOM   6353  C  CB    . TYR I  5  71   ? 19.988  115.541 -15.310 1.00 58.75  ? 71   TYR C CB    1 
ATOM   6354  C  CG    . TYR I  5  71   ? 20.220  114.543 -16.378 1.00 61.46  ? 71   TYR C CG    1 
ATOM   6355  C  CD1   . TYR I  5  71   ? 21.533  114.167 -16.730 1.00 63.22  ? 71   TYR C CD1   1 
ATOM   6356  C  CD2   . TYR I  5  71   ? 19.146  114.006 -17.097 1.00 63.43  ? 71   TYR C CD2   1 
ATOM   6357  C  CE1   . TYR I  5  71   ? 21.773  113.280 -17.783 1.00 64.97  ? 71   TYR C CE1   1 
ATOM   6358  C  CE2   . TYR I  5  71   ? 19.367  113.116 -18.158 1.00 65.03  ? 71   TYR C CE2   1 
ATOM   6359  C  CZ    . TYR I  5  71   ? 20.687  112.766 -18.488 1.00 65.89  ? 71   TYR C CZ    1 
ATOM   6360  O  OH    . TYR I  5  71   ? 20.923  111.921 -19.518 1.00 66.80  ? 71   TYR C OH    1 
ATOM   6361  N  N     . ARG I  5  72   ? 21.699  118.292 -16.402 1.00 54.93  ? 72   ARG C N     1 
ATOM   6362  C  CA    . ARG I  5  72   ? 22.791  118.726 -17.249 1.00 54.45  ? 72   ARG C CA    1 
ATOM   6363  C  C     . ARG I  5  72   ? 24.030  119.008 -16.442 1.00 54.69  ? 72   ARG C C     1 
ATOM   6364  O  O     . ARG I  5  72   ? 24.007  119.750 -15.457 1.00 55.04  ? 72   ARG C O     1 
ATOM   6365  C  CB    . ARG I  5  72   ? 22.405  119.979 -18.058 1.00 53.32  ? 72   ARG C CB    1 
ATOM   6366  C  CG    . ARG I  5  72   ? 21.534  120.994 -17.347 1.00 50.69  ? 72   ARG C CG    1 
ATOM   6367  C  CD    . ARG I  5  72   ? 21.866  122.398 -17.802 1.00 47.97  ? 72   ARG C CD    1 
ATOM   6368  N  NE    . ARG I  5  72   ? 21.835  122.563 -19.249 1.00 45.88  ? 72   ARG C NE    1 
ATOM   6369  C  CZ    . ARG I  5  72   ? 22.244  123.667 -19.865 1.00 45.03  ? 72   ARG C CZ    1 
ATOM   6370  N  NH1   . ARG I  5  72   ? 22.714  124.690 -19.154 1.00 43.52  ? 72   ARG C NH1   1 
ATOM   6371  N  NH2   . ARG I  5  72   ? 22.182  123.756 -21.186 1.00 44.20  ? 72   ARG C NH2   1 
ATOM   6372  N  N     . LEU I  5  73   ? 25.105  118.381 -16.902 1.00 54.03  ? 73   LEU C N     1 
ATOM   6373  C  CA    . LEU I  5  73   ? 26.446  118.449 -16.334 1.00 53.96  ? 73   LEU C CA    1 
ATOM   6374  C  C     . LEU I  5  73   ? 27.452  118.776 -17.430 1.00 53.91  ? 73   LEU C C     1 
ATOM   6375  O  O     . LEU I  5  73   ? 27.333  118.209 -18.522 1.00 54.08  ? 73   LEU C O     1 
ATOM   6376  C  CB    . LEU I  5  73   ? 26.776  117.089 -15.698 1.00 52.28  ? 73   LEU C CB    1 
ATOM   6377  C  CG    . LEU I  5  73   ? 26.370  115.810 -16.476 1.00 51.25  ? 73   LEU C CG    1 
ATOM   6378  C  CD1   . LEU I  5  73   ? 27.149  114.671 -15.916 1.00 51.22  ? 73   LEU C CD1   1 
ATOM   6379  C  CD2   . LEU I  5  73   ? 24.880  115.500 -16.373 1.00 49.38  ? 73   LEU C CD2   1 
ATOM   6380  N  N     . GLY I  5  74   ? 28.433  119.653 -17.204 1.00 53.67  ? 74   GLY C N     1 
ATOM   6381  C  CA    . GLY I  5  74   ? 29.281  119.912 -18.352 1.00 54.65  ? 74   GLY C CA    1 
ATOM   6382  C  C     . GLY I  5  74   ? 30.649  120.550 -18.200 1.00 55.09  ? 74   GLY C C     1 
ATOM   6383  O  O     . GLY I  5  74   ? 31.498  120.221 -19.010 1.00 54.67  ? 74   GLY C O     1 
ATOM   6384  N  N     . GLU I  5  75   ? 30.928  121.426 -17.247 1.00 56.19  ? 75   GLU C N     1 
ATOM   6385  C  CA    . GLU I  5  75   ? 32.270  122.004 -17.285 1.00 56.61  ? 75   GLU C CA    1 
ATOM   6386  C  C     . GLU I  5  75   ? 33.162  121.510 -16.175 1.00 57.06  ? 75   GLU C C     1 
ATOM   6387  O  O     . GLU I  5  75   ? 33.031  121.900 -15.018 1.00 55.88  ? 75   GLU C O     1 
ATOM   6388  C  CB    . GLU I  5  75   ? 32.199  123.537 -17.299 1.00 57.28  ? 75   GLU C CB    1 
ATOM   6389  C  CG    . GLU I  5  75   ? 31.901  124.033 -18.719 1.00 55.19  ? 75   GLU C CG    1 
ATOM   6390  C  CD    . GLU I  5  75   ? 32.560  123.142 -19.776 1.00 53.86  ? 75   GLU C CD    1 
ATOM   6391  O  OE1   . GLU I  5  75   ? 33.807  123.051 -19.780 1.00 53.39  ? 75   GLU C OE1   1 
ATOM   6392  O  OE2   . GLU I  5  75   ? 31.836  122.529 -20.585 1.00 51.19  ? 75   GLU C OE2   1 
ATOM   6393  N  N     . PRO I  5  76   ? 34.119  120.643 -16.548 1.00 58.76  ? 76   PRO C N     1 
ATOM   6394  C  CA    . PRO I  5  76   ? 35.075  120.048 -15.621 1.00 59.32  ? 76   PRO C CA    1 
ATOM   6395  C  C     . PRO I  5  76   ? 35.828  121.103 -14.837 1.00 59.39  ? 76   PRO C C     1 
ATOM   6396  O  O     . PRO I  5  76   ? 36.262  122.116 -15.388 1.00 59.78  ? 76   PRO C O     1 
ATOM   6397  C  CB    . PRO I  5  76   ? 36.000  119.221 -16.518 1.00 59.94  ? 76   PRO C CB    1 
ATOM   6398  C  CG    . PRO I  5  76   ? 35.244  119.092 -17.832 1.00 60.32  ? 76   PRO C CG    1 
ATOM   6399  C  CD    . PRO I  5  76   ? 34.570  120.423 -17.936 1.00 59.07  ? 76   PRO C CD    1 
ATOM   6400  N  N     . PRO I  5  77   ? 35.998  120.873 -13.535 1.00 59.65  ? 77   PRO C N     1 
ATOM   6401  C  CA    . PRO I  5  77   ? 36.714  121.840 -12.712 1.00 58.46  ? 77   PRO C CA    1 
ATOM   6402  C  C     . PRO I  5  77   ? 38.120  122.055 -13.235 1.00 57.06  ? 77   PRO C C     1 
ATOM   6403  O  O     . PRO I  5  77   ? 38.513  123.170 -13.543 1.00 56.29  ? 77   PRO C O     1 
ATOM   6404  C  CB    . PRO I  5  77   ? 36.685  121.209 -11.320 1.00 60.97  ? 77   PRO C CB    1 
ATOM   6405  C  CG    . PRO I  5  77   ? 35.664  120.043 -11.434 1.00 61.15  ? 77   PRO C CG    1 
ATOM   6406  C  CD    . PRO I  5  77   ? 35.852  119.594 -12.828 1.00 59.78  ? 77   PRO C CD    1 
ATOM   6407  N  N     . PHE I  5  78   ? 38.857  120.953 -13.334 1.00 55.55  ? 78   PHE C N     1 
ATOM   6408  C  CA    . PHE I  5  78   ? 40.224  120.961 -13.825 1.00 54.73  ? 78   PHE C CA    1 
ATOM   6409  C  C     . PHE I  5  78   ? 40.434  119.876 -14.874 1.00 54.09  ? 78   PHE C C     1 
ATOM   6410  O  O     . PHE I  5  78   ? 39.491  119.155 -15.202 1.00 53.87  ? 78   PHE C O     1 
ATOM   6411  C  CB    . PHE I  5  78   ? 41.176  120.749 -12.670 1.00 55.10  ? 78   PHE C CB    1 
ATOM   6412  C  CG    . PHE I  5  78   ? 40.936  121.674 -11.541 1.00 56.37  ? 78   PHE C CG    1 
ATOM   6413  C  CD1   . PHE I  5  78   ? 39.956  121.378 -10.580 1.00 56.05  ? 78   PHE C CD1   1 
ATOM   6414  C  CD2   . PHE I  5  78   ? 41.687  122.854 -11.416 1.00 56.12  ? 78   PHE C CD2   1 
ATOM   6415  C  CE1   . PHE I  5  78   ? 39.723  122.255 -9.488  1.00 57.21  ? 78   PHE C CE1   1 
ATOM   6416  C  CE2   . PHE I  5  78   ? 41.472  123.745 -10.332 1.00 57.15  ? 78   PHE C CE2   1 
ATOM   6417  C  CZ    . PHE I  5  78   ? 40.485  123.445 -9.361  1.00 56.68  ? 78   PHE C CZ    1 
ATOM   6418  N  N     . PRO I  5  79   ? 41.662  119.755 -15.429 1.00 53.98  ? 79   PRO C N     1 
ATOM   6419  C  CA    . PRO I  5  79   ? 41.908  118.717 -16.443 1.00 53.71  ? 79   PRO C CA    1 
ATOM   6420  C  C     . PRO I  5  79   ? 42.691  117.535 -15.887 1.00 53.42  ? 79   PRO C C     1 
ATOM   6421  O  O     . PRO I  5  79   ? 43.312  117.626 -14.820 1.00 54.11  ? 79   PRO C O     1 
ATOM   6422  C  CB    . PRO I  5  79   ? 42.655  119.459 -17.526 1.00 53.21  ? 79   PRO C CB    1 
ATOM   6423  C  CG    . PRO I  5  79   ? 43.536  120.320 -16.725 1.00 54.40  ? 79   PRO C CG    1 
ATOM   6424  C  CD    . PRO I  5  79   ? 42.631  120.852 -15.607 1.00 53.68  ? 79   PRO C CD    1 
ATOM   6425  N  N     . GLN I  5  80   ? 42.647  116.442 -16.648 1.00 53.27  ? 80   GLN C N     1 
ATOM   6426  C  CA    . GLN I  5  80   ? 43.265  115.150 -16.334 1.00 52.90  ? 80   GLN C CA    1 
ATOM   6427  C  C     . GLN I  5  80   ? 44.627  115.301 -15.657 1.00 54.07  ? 80   GLN C C     1 
ATOM   6428  O  O     . GLN I  5  80   ? 44.740  115.087 -14.443 1.00 53.99  ? 80   GLN C O     1 
ATOM   6429  C  CB    . GLN I  5  80   ? 43.441  114.313 -17.612 1.00 52.64  ? 80   GLN C CB    1 
ATOM   6430  C  CG    . GLN I  5  80   ? 42.227  114.301 -18.559 1.00 50.76  ? 80   GLN C CG    1 
ATOM   6431  C  CD    . GLN I  5  80   ? 41.727  112.900 -18.956 1.00 49.26  ? 80   GLN C CD    1 
ATOM   6432  O  OE1   . GLN I  5  80   ? 40.858  112.757 -19.826 1.00 46.69  ? 80   GLN C OE1   1 
ATOM   6433  N  NE2   . GLN I  5  80   ? 42.272  111.873 -18.322 1.00 47.40  ? 80   GLN C NE2   1 
ATOM   6434  N  N     . ASP I  5  81   ? 45.654  115.651 -16.437 1.00 54.61  ? 81   ASP C N     1 
ATOM   6435  C  CA    . ASP I  5  81   ? 47.009  115.790 -15.902 1.00 55.11  ? 81   ASP C CA    1 
ATOM   6436  C  C     . ASP I  5  81   ? 47.032  116.705 -14.676 1.00 56.49  ? 81   ASP C C     1 
ATOM   6437  O  O     . ASP I  5  81   ? 47.751  116.415 -13.717 1.00 57.48  ? 81   ASP C O     1 
ATOM   6438  C  CB    . ASP I  5  81   ? 47.963  116.324 -16.985 1.00 54.53  ? 81   ASP C CB    1 
ATOM   6439  C  CG    . ASP I  5  81   ? 48.056  115.391 -18.206 1.00 54.45  ? 81   ASP C CG    1 
ATOM   6440  O  OD1   . ASP I  5  81   ? 48.012  114.156 -18.017 1.00 52.82  ? 81   ASP C OD1   1 
ATOM   6441  O  OD2   . ASP I  5  81   ? 48.181  115.885 -19.353 1.00 54.61  ? 81   ASP C OD2   1 
ATOM   6442  N  N     . GLU I  5  82   ? 46.252  117.792 -14.698 1.00 55.77  ? 82   GLU C N     1 
ATOM   6443  C  CA    . GLU I  5  82   ? 46.195  118.697 -13.558 1.00 54.74  ? 82   GLU C CA    1 
ATOM   6444  C  C     . GLU I  5  82   ? 45.724  117.966 -12.326 1.00 55.57  ? 82   GLU C C     1 
ATOM   6445  O  O     . GLU I  5  82   ? 46.111  118.309 -11.220 1.00 57.00  ? 82   GLU C O     1 
ATOM   6446  C  CB    . GLU I  5  82   ? 45.236  119.849 -13.806 1.00 52.14  ? 82   GLU C CB    1 
ATOM   6447  C  CG    . GLU I  5  82   ? 45.740  121.163 -13.220 1.00 49.84  ? 82   GLU C CG    1 
ATOM   6448  C  CD    . GLU I  5  82   ? 44.702  121.946 -12.421 1.00 47.99  ? 82   GLU C CD    1 
ATOM   6449  O  OE1   . GLU I  5  82   ? 44.267  121.462 -11.357 1.00 45.18  ? 82   GLU C OE1   1 
ATOM   6450  O  OE2   . GLU I  5  82   ? 44.331  123.055 -12.859 1.00 46.72  ? 82   GLU C OE2   1 
ATOM   6451  N  N     . CYS I  5  83   ? 44.891  116.950 -12.524 1.00 56.48  ? 83   CYS C N     1 
ATOM   6452  C  CA    . CYS I  5  83   ? 44.360  116.177 -11.414 1.00 57.89  ? 83   CYS C CA    1 
ATOM   6453  C  C     . CYS I  5  83   ? 45.336  115.099 -10.939 1.00 59.06  ? 83   CYS C C     1 
ATOM   6454  O  O     . CYS I  5  83   ? 45.125  114.492 -9.887  1.00 60.02  ? 83   CYS C O     1 
ATOM   6455  C  CB    . CYS I  5  83   ? 43.028  115.570 -11.828 1.00 58.45  ? 83   CYS C CB    1 
ATOM   6456  S  SG    . CYS I  5  83   ? 41.767  116.877 -11.940 1.00 60.40  ? 83   CYS C SG    1 
ATOM   6457  N  N     . ARG I  5  84   ? 46.400  114.861 -11.702 1.00 60.45  ? 84   ARG C N     1 
ATOM   6458  C  CA    . ARG I  5  84   ? 47.414  113.881 -11.311 1.00 60.95  ? 84   ARG C CA    1 
ATOM   6459  C  C     . ARG I  5  84   ? 48.632  114.584 -10.714 1.00 61.31  ? 84   ARG C C     1 
ATOM   6460  O  O     . ARG I  5  84   ? 49.294  114.075 -9.804  1.00 62.76  ? 84   ARG C O     1 
ATOM   6461  C  CB    . ARG I  5  84   ? 47.845  113.047 -12.520 1.00 61.30  ? 84   ARG C CB    1 
ATOM   6462  C  CG    . ARG I  5  84   ? 46.702  112.722 -13.497 1.00 62.82  ? 84   ARG C CG    1 
ATOM   6463  C  CD    . ARG I  5  84   ? 47.061  111.624 -14.521 1.00 62.58  ? 84   ARG C CD    1 
ATOM   6464  N  NE    . ARG I  5  84   ? 46.680  111.996 -15.886 1.00 63.05  ? 84   ARG C NE    1 
ATOM   6465  C  CZ    . ARG I  5  84   ? 46.676  111.168 -16.927 1.00 62.12  ? 84   ARG C CZ    1 
ATOM   6466  N  NH1   . ARG I  5  84   ? 47.024  109.903 -16.771 1.00 62.16  ? 84   ARG C NH1   1 
ATOM   6467  N  NH2   . ARG I  5  84   ? 46.334  111.607 -18.130 1.00 61.48  ? 84   ARG C NH2   1 
ATOM   6468  N  N     . GLU I  5  85   ? 48.931  115.760 -11.249 1.00 61.36  ? 85   GLU C N     1 
ATOM   6469  C  CA    . GLU I  5  85   ? 50.006  116.577 -10.721 1.00 61.32  ? 85   GLU C CA    1 
ATOM   6470  C  C     . GLU I  5  85   ? 49.645  116.990 -9.314  1.00 63.19  ? 85   GLU C C     1 
ATOM   6471  O  O     . GLU I  5  85   ? 50.361  116.701 -8.347  1.00 63.59  ? 85   GLU C O     1 
ATOM   6472  C  CB    . GLU I  5  85   ? 50.165  117.789 -11.611 1.00 59.18  ? 85   GLU C CB    1 
ATOM   6473  C  CG    . GLU I  5  85   ? 51.406  118.534 -11.445 1.00 56.73  ? 85   GLU C CG    1 
ATOM   6474  C  CD    . GLU I  5  85   ? 51.613  119.439 -12.613 1.00 55.97  ? 85   GLU C CD    1 
ATOM   6475  O  OE1   . GLU I  5  85   ? 50.748  120.300 -12.878 1.00 54.91  ? 85   GLU C OE1   1 
ATOM   6476  O  OE2   . GLU I  5  85   ? 52.646  119.283 -13.274 1.00 57.00  ? 85   GLU C OE2   1 
ATOM   6477  N  N     . LYS I  5  86   ? 48.499  117.672 -9.236  1.00 65.08  ? 86   LYS C N     1 
ATOM   6478  C  CA    . LYS I  5  86   ? 47.869  118.060 -7.973  1.00 66.10  ? 86   LYS C CA    1 
ATOM   6479  C  C     . LYS I  5  86   ? 46.972  116.925 -7.516  1.00 65.90  ? 86   LYS C C     1 
ATOM   6480  O  O     . LYS I  5  86   ? 46.307  116.309 -8.361  1.00 66.65  ? 86   LYS C O     1 
ATOM   6481  C  CB    . LYS I  5  86   ? 46.993  119.309 -8.146  1.00 66.29  ? 86   LYS C CB    1 
ATOM   6482  C  CG    . LYS I  5  86   ? 47.598  120.397 -9.034  1.00 68.39  ? 86   LYS C CG    1 
ATOM   6483  C  CD    . LYS I  5  86   ? 46.802  121.698 -8.930  1.00 70.31  ? 86   LYS C CD    1 
ATOM   6484  C  CE    . LYS I  5  86   ? 47.478  122.807 -9.749  1.00 70.43  ? 86   LYS C CE    1 
ATOM   6485  N  NZ    . LYS I  5  86   ? 47.004  124.190 -9.431  1.00 70.22  ? 86   LYS C NZ    1 
ATOM   6486  N  N     . ASP I  5  87   ? 46.930  116.604 -6.233  1.00 65.60  ? 87   ASP C N     1 
ATOM   6487  C  CA    . ASP I  5  87   ? 46.054  115.512 -5.880  1.00 63.75  ? 87   ASP C CA    1 
ATOM   6488  C  C     . ASP I  5  87   ? 44.620  115.920 -6.052  1.00 62.70  ? 87   ASP C C     1 
ATOM   6489  O  O     . ASP I  5  87   ? 44.028  116.528 -5.181  1.00 62.51  ? 87   ASP C O     1 
ATOM   6490  C  CB    . ASP I  5  87   ? 46.344  115.051 -4.459  1.00 64.97  ? 87   ASP C CB    1 
ATOM   6491  C  CG    . ASP I  5  87   ? 47.627  114.242 -4.381  1.00 65.80  ? 87   ASP C CG    1 
ATOM   6492  O  OD1   . ASP I  5  87   ? 47.921  113.516 -5.359  1.00 65.13  ? 87   ASP C OD1   1 
ATOM   6493  O  OD2   . ASP I  5  87   ? 48.334  114.327 -3.354  1.00 67.34  ? 87   ASP C OD2   1 
ATOM   6494  N  N     . LEU I  5  88   ? 44.074  115.587 -7.213  1.00 61.85  ? 88   LEU C N     1 
ATOM   6495  C  CA    . LEU I  5  88   ? 42.716  115.955 -7.533  1.00 60.93  ? 88   LEU C CA    1 
ATOM   6496  C  C     . LEU I  5  88   ? 41.929  114.788 -8.044  1.00 61.40  ? 88   LEU C C     1 
ATOM   6497  O  O     . LEU I  5  88   ? 42.460  113.746 -8.462  1.00 60.94  ? 88   LEU C O     1 
ATOM   6498  C  CB    . LEU I  5  88   ? 42.675  117.044 -8.604  1.00 59.32  ? 88   LEU C CB    1 
ATOM   6499  C  CG    . LEU I  5  88   ? 42.341  118.482 -8.231  1.00 58.37  ? 88   LEU C CG    1 
ATOM   6500  C  CD1   . LEU I  5  88   ? 41.035  118.562 -7.525  1.00 56.86  ? 88   LEU C CD1   1 
ATOM   6501  C  CD2   . LEU I  5  88   ? 43.404  118.999 -7.347  1.00 57.68  ? 88   LEU C CD2   1 
ATOM   6502  N  N     . THR I  5  89   ? 40.629  115.012 -8.005  1.00 61.67  ? 89   THR C N     1 
ATOM   6503  C  CA    . THR I  5  89   ? 39.656  114.055 -8.465  1.00 61.84  ? 89   THR C CA    1 
ATOM   6504  C  C     . THR I  5  89   ? 38.892  114.602 -9.671  1.00 60.17  ? 89   THR C C     1 
ATOM   6505  O  O     . THR I  5  89   ? 38.093  115.536 -9.560  1.00 60.47  ? 89   THR C O     1 
ATOM   6506  C  CB    . THR I  5  89   ? 38.700  113.694 -7.311  1.00 62.89  ? 89   THR C CB    1 
ATOM   6507  O  OG1   . THR I  5  89   ? 37.578  112.978 -7.843  1.00 63.97  ? 89   THR C OG1   1 
ATOM   6508  C  CG2   . THR I  5  89   ? 38.267  114.950 -6.553  1.00 64.32  ? 89   THR C CG2   1 
ATOM   6509  N  N     . TYR I  5  90   ? 39.181  114.012 -10.828 1.00 58.20  ? 90   TYR C N     1 
ATOM   6510  C  CA    . TYR I  5  90   ? 38.585  114.376 -12.108 1.00 55.62  ? 90   TYR C CA    1 
ATOM   6511  C  C     . TYR I  5  90   ? 37.096  114.048 -12.115 1.00 56.94  ? 90   TYR C C     1 
ATOM   6512  O  O     . TYR I  5  90   ? 36.720  112.902 -12.362 1.00 57.02  ? 90   TYR C O     1 
ATOM   6513  C  CB    . TYR I  5  90   ? 39.327  113.599 -13.195 1.00 52.46  ? 90   TYR C CB    1 
ATOM   6514  C  CG    . TYR I  5  90   ? 39.167  114.075 -14.614 1.00 49.09  ? 90   TYR C CG    1 
ATOM   6515  C  CD1   . TYR I  5  90   ? 38.288  113.420 -15.504 1.00 47.54  ? 90   TYR C CD1   1 
ATOM   6516  C  CD2   . TYR I  5  90   ? 39.904  115.176 -15.091 1.00 46.90  ? 90   TYR C CD2   1 
ATOM   6517  C  CE1   . TYR I  5  90   ? 38.153  113.854 -16.849 1.00 45.24  ? 90   TYR C CE1   1 
ATOM   6518  C  CE2   . TYR I  5  90   ? 39.775  115.621 -16.436 1.00 44.35  ? 90   TYR C CE2   1 
ATOM   6519  C  CZ    . TYR I  5  90   ? 38.900  114.955 -17.299 1.00 43.81  ? 90   TYR C CZ    1 
ATOM   6520  O  OH    . TYR I  5  90   ? 38.770  115.376 -18.596 1.00 43.31  ? 90   TYR C OH    1 
ATOM   6521  N  N     . GLN I  5  91   ? 36.261  115.054 -11.837 1.00 56.50  ? 91   GLN C N     1 
ATOM   6522  C  CA    . GLN I  5  91   ? 34.804  114.889 -11.766 1.00 57.55  ? 91   GLN C CA    1 
ATOM   6523  C  C     . GLN I  5  91   ? 34.083  116.057 -12.415 1.00 56.61  ? 91   GLN C C     1 
ATOM   6524  O  O     . GLN I  5  91   ? 34.453  117.205 -12.207 1.00 56.80  ? 91   GLN C O     1 
ATOM   6525  C  CB    . GLN I  5  91   ? 34.317  114.839 -10.317 1.00 59.17  ? 91   GLN C CB    1 
ATOM   6526  C  CG    . GLN I  5  91   ? 35.363  114.474 -9.249  1.00 60.58  ? 91   GLN C CG    1 
ATOM   6527  C  CD    . GLN I  5  91   ? 35.484  115.512 -8.101  1.00 61.11  ? 91   GLN C CD    1 
ATOM   6528  O  OE1   . GLN I  5  91   ? 36.006  116.621 -8.288  1.00 59.90  ? 91   GLN C OE1   1 
ATOM   6529  N  NE2   . GLN I  5  91   ? 35.000  115.141 -6.912  1.00 61.22  ? 91   GLN C NE2   1 
ATOM   6530  N  N     . ALA I  5  92   ? 33.048  115.773 -13.190 1.00 54.54  ? 92   ALA C N     1 
ATOM   6531  C  CA    . ALA I  5  92   ? 32.285  116.850 -13.801 1.00 54.21  ? 92   ALA C CA    1 
ATOM   6532  C  C     . ALA I  5  92   ? 31.219  117.364 -12.828 1.00 54.02  ? 92   ALA C C     1 
ATOM   6533  O  O     . ALA I  5  92   ? 30.800  116.638 -11.924 1.00 54.78  ? 92   ALA C O     1 
ATOM   6534  C  CB    . ALA I  5  92   ? 31.633  116.360 -15.081 1.00 54.84  ? 92   ALA C CB    1 
ATOM   6535  N  N     . PRO I  5  93   ? 30.773  118.620 -12.986 1.00 53.79  ? 93   PRO C N     1 
ATOM   6536  C  CA    . PRO I  5  93   ? 29.751  119.186 -12.095 1.00 53.36  ? 93   PRO C CA    1 
ATOM   6537  C  C     . PRO I  5  93   ? 28.352  118.928 -12.615 1.00 52.21  ? 93   PRO C C     1 
ATOM   6538  O  O     . PRO I  5  93   ? 28.098  119.120 -13.796 1.00 52.55  ? 93   PRO C O     1 
ATOM   6539  C  CB    . PRO I  5  93   ? 30.076  120.682 -12.060 1.00 53.32  ? 93   PRO C CB    1 
ATOM   6540  C  CG    . PRO I  5  93   ? 31.397  120.811 -12.761 1.00 54.88  ? 93   PRO C CG    1 
ATOM   6541  C  CD    . PRO I  5  93   ? 31.401  119.694 -13.762 1.00 54.61  ? 93   PRO C CD    1 
ATOM   6542  N  N     . LEU I  5  94   ? 27.450  118.500 -11.739 1.00 51.52  ? 94   LEU C N     1 
ATOM   6543  C  CA    . LEU I  5  94   ? 26.081  118.241 -12.146 1.00 51.06  ? 94   LEU C CA    1 
ATOM   6544  C  C     . LEU I  5  94   ? 25.105  119.032 -11.318 1.00 52.78  ? 94   LEU C C     1 
ATOM   6545  O  O     . LEU I  5  94   ? 25.187  119.069 -10.093 1.00 52.91  ? 94   LEU C O     1 
ATOM   6546  C  CB    . LEU I  5  94   ? 25.715  116.755 -12.012 1.00 48.57  ? 94   LEU C CB    1 
ATOM   6547  C  CG    . LEU I  5  94   ? 24.213  116.423 -11.874 1.00 46.40  ? 94   LEU C CG    1 
ATOM   6548  C  CD1   . LEU I  5  94   ? 23.581  116.246 -13.249 1.00 44.30  ? 94   LEU C CD1   1 
ATOM   6549  C  CD2   . LEU I  5  94   ? 24.057  115.168 -11.032 1.00 45.11  ? 94   LEU C CD2   1 
ATOM   6550  N  N     . TYR I  5  95   ? 24.183  119.660 -12.037 1.00 53.57  ? 95   TYR C N     1 
ATOM   6551  C  CA    . TYR I  5  95   ? 23.090  120.424 -11.485 1.00 54.34  ? 95   TYR C CA    1 
ATOM   6552  C  C     . TYR I  5  95   ? 21.922  120.409 -12.437 1.00 54.82  ? 95   TYR C C     1 
ATOM   6553  O  O     . TYR I  5  95   ? 21.973  121.008 -13.496 1.00 54.26  ? 95   TYR C O     1 
ATOM   6554  C  CB    . TYR I  5  95   ? 23.495  121.887 -11.177 1.00 55.14  ? 95   TYR C CB    1 
ATOM   6555  C  CG    . TYR I  5  95   ? 24.477  122.604 -12.106 1.00 56.58  ? 95   TYR C CG    1 
ATOM   6556  C  CD1   . TYR I  5  95   ? 24.067  123.717 -12.872 1.00 56.38  ? 95   TYR C CD1   1 
ATOM   6557  C  CD2   . TYR I  5  95   ? 25.832  122.214 -12.184 1.00 58.28  ? 95   TYR C CD2   1 
ATOM   6558  C  CE1   . TYR I  5  95   ? 24.979  124.440 -13.696 1.00 57.43  ? 95   TYR C CE1   1 
ATOM   6559  C  CE2   . TYR I  5  95   ? 26.770  122.931 -13.013 1.00 59.10  ? 95   TYR C CE2   1 
ATOM   6560  C  CZ    . TYR I  5  95   ? 26.331  124.044 -13.763 1.00 58.03  ? 95   TYR C CZ    1 
ATOM   6561  O  OH    . TYR I  5  95   ? 27.235  124.751 -14.544 1.00 56.68  ? 95   TYR C OH    1 
ATOM   6562  N  N     . ALA I  5  96   ? 20.874  119.688 -12.070 1.00 56.25  ? 96   ALA C N     1 
ATOM   6563  C  CA    . ALA I  5  96   ? 19.685  119.617 -12.907 1.00 58.10  ? 96   ALA C CA    1 
ATOM   6564  C  C     . ALA I  5  96   ? 18.663  120.680 -12.491 1.00 60.04  ? 96   ALA C C     1 
ATOM   6565  O  O     . ALA I  5  96   ? 18.785  121.302 -11.429 1.00 61.13  ? 96   ALA C O     1 
ATOM   6566  C  CB    . ALA I  5  96   ? 19.067  118.224 -12.805 1.00 57.15  ? 96   ALA C CB    1 
ATOM   6567  N  N     . ARG I  5  97   ? 17.653  120.896 -13.319 1.00 61.44  ? 97   ARG C N     1 
ATOM   6568  C  CA    . ARG I  5  97   ? 16.640  121.887 -12.992 1.00 62.61  ? 97   ARG C CA    1 
ATOM   6569  C  C     . ARG I  5  97   ? 15.627  121.326 -11.996 1.00 63.43  ? 97   ARG C C     1 
ATOM   6570  O  O     . ARG I  5  97   ? 15.290  120.139 -12.054 1.00 64.05  ? 97   ARG C O     1 
ATOM   6571  C  CB    . ARG I  5  97   ? 15.938  122.329 -14.274 1.00 62.51  ? 97   ARG C CB    1 
ATOM   6572  C  CG    . ARG I  5  97   ? 16.883  122.843 -15.343 1.00 61.91  ? 97   ARG C CG    1 
ATOM   6573  C  CD    . ARG I  5  97   ? 16.148  123.558 -16.454 1.00 59.38  ? 97   ARG C CD    1 
ATOM   6574  N  NE    . ARG I  5  97   ? 17.065  123.905 -17.533 1.00 57.38  ? 97   ARG C NE    1 
ATOM   6575  C  CZ    . ARG I  5  97   ? 16.712  124.536 -18.645 1.00 55.75  ? 97   ARG C CZ    1 
ATOM   6576  N  NH1   . ARG I  5  97   ? 15.454  124.900 -18.834 1.00 54.40  ? 97   ARG C NH1   1 
ATOM   6577  N  NH2   . ARG I  5  97   ? 17.619  124.797 -19.571 1.00 55.21  ? 97   ARG C NH2   1 
ATOM   6578  N  N     . LEU I  5  98   ? 15.139  122.175 -11.090 1.00 64.00  ? 98   LEU C N     1 
ATOM   6579  C  CA    . LEU I  5  98   ? 14.190  121.730 -10.072 1.00 64.62  ? 98   LEU C CA    1 
ATOM   6580  C  C     . LEU I  5  98   ? 13.155  122.789 -9.764  1.00 65.21  ? 98   LEU C C     1 
ATOM   6581  O  O     . LEU I  5  98   ? 13.493  123.955 -9.619  1.00 63.72  ? 98   LEU C O     1 
ATOM   6582  C  CB    . LEU I  5  98   ? 14.903  121.405 -8.758  1.00 64.37  ? 98   LEU C CB    1 
ATOM   6583  C  CG    . LEU I  5  98   ? 16.426  121.221 -8.654  1.00 64.78  ? 98   LEU C CG    1 
ATOM   6584  C  CD1   . LEU I  5  98   ? 17.201  122.479 -8.996  1.00 64.57  ? 98   LEU C CD1   1 
ATOM   6585  C  CD2   . LEU I  5  98   ? 16.727  120.852 -7.224  1.00 64.87  ? 98   LEU C CD2   1 
ATOM   6586  N  N     . GLN I  5  99   ? 11.896  122.367 -9.653  1.00 67.37  ? 99   GLN C N     1 
ATOM   6587  C  CA    . GLN I  5  99   ? 10.819  123.279 -9.282  1.00 71.07  ? 99   GLN C CA    1 
ATOM   6588  C  C     . GLN I  5  99   ? 9.838   122.624 -8.306  1.00 72.56  ? 99   GLN C C     1 
ATOM   6589  O  O     . GLN I  5  99   ? 9.242   121.582 -8.589  1.00 71.73  ? 99   GLN C O     1 
ATOM   6590  C  CB    . GLN I  5  99   ? 10.057  123.780 -10.514 1.00 72.25  ? 99   GLN C CB    1 
ATOM   6591  C  CG    . GLN I  5  99   ? 9.090   122.854 -11.180 1.00 73.85  ? 99   GLN C CG    1 
ATOM   6592  C  CD    . GLN I  5  99   ? 8.355   123.572 -12.290 1.00 75.38  ? 99   GLN C CD    1 
ATOM   6593  O  OE1   . GLN I  5  99   ? 8.982   124.069 -13.226 1.00 75.82  ? 99   GLN C OE1   1 
ATOM   6594  N  NE2   . GLN I  5  99   ? 7.025   123.639 -12.192 1.00 75.66  ? 99   GLN C NE2   1 
ATOM   6595  N  N     . LEU I  5  100  ? 9.691   123.271 -7.150  1.00 75.48  ? 100  LEU C N     1 
ATOM   6596  C  CA    . LEU I  5  100  ? 8.821   122.827 -6.065  1.00 78.35  ? 100  LEU C CA    1 
ATOM   6597  C  C     . LEU I  5  100  ? 7.458   123.536 -6.117  1.00 79.81  ? 100  LEU C C     1 
ATOM   6598  O  O     . LEU I  5  100  ? 7.369   124.767 -6.234  1.00 78.91  ? 100  LEU C O     1 
ATOM   6599  C  CB    . LEU I  5  100  ? 9.543   123.080 -4.725  1.00 79.09  ? 100  LEU C CB    1 
ATOM   6600  C  CG    . LEU I  5  100  ? 8.854   123.025 -3.360  1.00 80.53  ? 100  LEU C CG    1 
ATOM   6601  C  CD1   . LEU I  5  100  ? 7.985   121.790 -3.269  1.00 80.63  ? 100  LEU C CD1   1 
ATOM   6602  C  CD2   . LEU I  5  100  ? 9.916   123.048 -2.267  1.00 79.69  ? 100  LEU C CD2   1 
ATOM   6603  N  N     . ILE I  5  101  ? 6.408   122.720 -6.023  1.00 80.84  ? 101  ILE C N     1 
ATOM   6604  C  CA    . ILE I  5  101  ? 5.010   123.155 -6.090  1.00 82.98  ? 101  ILE C CA    1 
ATOM   6605  C  C     . ILE I  5  101  ? 4.446   123.455 -4.696  1.00 82.64  ? 101  ILE C C     1 
ATOM   6606  O  O     . ILE I  5  101  ? 5.020   123.065 -3.668  1.00 82.16  ? 101  ILE C O     1 
ATOM   6607  C  CB    . ILE I  5  101  ? 4.138   122.040 -6.792  1.00 84.26  ? 101  ILE C CB    1 
ATOM   6608  C  CG1   . ILE I  5  101  ? 4.744   121.710 -8.166  1.00 85.64  ? 101  ILE C CG1   1 
ATOM   6609  C  CG2   . ILE I  5  101  ? 2.666   122.491 -6.942  1.00 84.99  ? 101  ILE C CG2   1 
ATOM   6610  C  CD1   . ILE I  5  101  ? 4.805   122.881 -9.164  1.00 86.68  ? 101  ILE C CD1   1 
ATOM   6611  N  N     . HIS I  5  102  ? 3.312   124.155 -4.686  1.00 81.78  ? 102  HIS C N     1 
ATOM   6612  C  CA    . HIS I  5  102  ? 2.630   124.529 -3.460  1.00 80.84  ? 102  HIS C CA    1 
ATOM   6613  C  C     . HIS I  5  102  ? 1.124   124.242 -3.539  1.00 78.68  ? 102  HIS C C     1 
ATOM   6614  O  O     . HIS I  5  102  ? 0.530   124.199 -4.626  1.00 78.15  ? 102  HIS C O     1 
ATOM   6615  C  CB    . HIS I  5  102  ? 2.897   126.020 -3.201  1.00 81.93  ? 102  HIS C CB    1 
ATOM   6616  C  CG    . HIS I  5  102  ? 4.342   126.317 -2.889  1.00 82.68  ? 102  HIS C CG    1 
ATOM   6617  N  ND1   . HIS I  5  102  ? 4.824   126.408 -1.599  1.00 84.03  ? 102  HIS C ND1   1 
ATOM   6618  C  CD2   . HIS I  5  102  ? 5.414   126.506 -3.700  1.00 82.90  ? 102  HIS C CD2   1 
ATOM   6619  C  CE1   . HIS I  5  102  ? 6.126   126.640 -1.630  1.00 83.19  ? 102  HIS C CE1   1 
ATOM   6620  N  NE2   . HIS I  5  102  ? 6.509   126.703 -2.893  1.00 82.27  ? 102  HIS C NE2   1 
ATOM   6621  N  N     . LYS I  5  103  ? 0.515   124.017 -2.379  1.00 76.04  ? 103  LYS C N     1 
ATOM   6622  C  CA    . LYS I  5  103  ? -0.917  123.841 -2.368  1.00 73.92  ? 103  LYS C CA    1 
ATOM   6623  C  C     . LYS I  5  103  ? -1.592  125.199 -2.442  1.00 74.20  ? 103  LYS C C     1 
ATOM   6624  O  O     . LYS I  5  103  ? -2.793  125.313 -2.667  1.00 74.89  ? 103  LYS C O     1 
ATOM   6625  C  CB    . LYS I  5  103  ? -1.367  123.088 -1.116  1.00 70.77  ? 103  LYS C CB    1 
ATOM   6626  C  CG    . LYS I  5  103  ? -1.966  121.728 -1.461  1.00 66.55  ? 103  LYS C CG    1 
ATOM   6627  C  CD    . LYS I  5  103  ? -2.693  121.090 -0.303  1.00 62.82  ? 103  LYS C CD    1 
ATOM   6628  C  CE    . LYS I  5  103  ? -3.205  119.719 -0.696  1.00 60.83  ? 103  LYS C CE    1 
ATOM   6629  N  NZ    . LYS I  5  103  ? -3.860  119.020 0.433   1.00 59.26  ? 103  LYS C NZ    1 
ATOM   6630  N  N     . ASP I  5  104  ? -0.779  126.235 -2.238  1.00 74.48  ? 104  ASP C N     1 
ATOM   6631  C  CA    . ASP I  5  104  ? -1.214  127.623 -2.367  1.00 74.56  ? 104  ASP C CA    1 
ATOM   6632  C  C     . ASP I  5  104  ? -0.652  128.202 -3.664  1.00 74.46  ? 104  ASP C C     1 
ATOM   6633  O  O     . ASP I  5  104  ? 0.314   127.635 -4.199  1.00 74.80  ? 104  ASP C O     1 
ATOM   6634  C  CB    . ASP I  5  104  ? -0.751  128.466 -1.144  1.00 75.24  ? 104  ASP C CB    1 
ATOM   6635  C  CG    . ASP I  5  104  ? 0.770   128.327 -0.837  1.00 76.03  ? 104  ASP C CG    1 
ATOM   6636  O  OD1   . ASP I  5  104  ? 1.110   128.072 0.343   1.00 76.22  ? 104  ASP C OD1   1 
ATOM   6637  O  OD2   . ASP I  5  104  ? 1.622   128.476 -1.753  1.00 74.00  ? 104  ASP C OD2   1 
ATOM   6638  N  N     . THR I  5  105  ? -1.221  129.294 -4.183  1.00 73.04  ? 105  THR C N     1 
ATOM   6639  C  CA    . THR I  5  105  ? -0.743  129.876 -5.454  1.00 71.67  ? 105  THR C CA    1 
ATOM   6640  C  C     . THR I  5  105  ? 0.742   130.261 -5.407  1.00 70.41  ? 105  THR C C     1 
ATOM   6641  O  O     . THR I  5  105  ? 1.140   131.275 -4.820  1.00 71.08  ? 105  THR C O     1 
ATOM   6642  C  CB    . THR I  5  105  ? -1.522  131.147 -5.864  1.00 71.50  ? 105  THR C CB    1 
ATOM   6643  O  OG1   . THR I  5  105  ? -0.663  131.991 -6.655  1.00 70.41  ? 105  THR C OG1   1 
ATOM   6644  C  CG2   . THR I  5  105  ? -1.987  131.921 -4.643  1.00 71.61  ? 105  THR C CG2   1 
ATOM   6645  N  N     . GLY I  5  106  ? 1.549   129.437 -6.060  1.00 68.00  ? 106  GLY C N     1 
ATOM   6646  C  CA    . GLY I  5  106  ? 2.968   129.678 -6.113  1.00 64.59  ? 106  GLY C CA    1 
ATOM   6647  C  C     . GLY I  5  106  ? 3.720   128.400 -6.346  1.00 62.11  ? 106  GLY C C     1 
ATOM   6648  O  O     . GLY I  5  106  ? 3.429   127.386 -5.724  1.00 61.10  ? 106  GLY C O     1 
ATOM   6649  N  N     . LEU I  5  107  ? 4.668   128.470 -7.270  1.00 60.24  ? 107  LEU C N     1 
ATOM   6650  C  CA    . LEU I  5  107  ? 5.554   127.379 -7.642  1.00 58.75  ? 107  LEU C CA    1 
ATOM   6651  C  C     . LEU I  5  107  ? 6.936   127.941 -7.925  1.00 58.04  ? 107  LEU C C     1 
ATOM   6652  O  O     . LEU I  5  107  ? 7.180   128.465 -9.005  1.00 58.15  ? 107  LEU C O     1 
ATOM   6653  C  CB    . LEU I  5  107  ? 5.019   126.644 -8.894  1.00 57.90  ? 107  LEU C CB    1 
ATOM   6654  C  CG    . LEU I  5  107  ? 3.503   126.581 -9.211  1.00 57.50  ? 107  LEU C CG    1 
ATOM   6655  C  CD1   . LEU I  5  107  ? 3.324   125.793 -10.489 1.00 57.46  ? 107  LEU C CD1   1 
ATOM   6656  C  CD2   . LEU I  5  107  ? 2.704   125.915 -8.111  1.00 56.75  ? 107  LEU C CD2   1 
ATOM   6657  N  N     . ILE I  5  108  ? 7.835   127.857 -6.953  1.00 57.39  ? 108  ILE C N     1 
ATOM   6658  C  CA    . ILE I  5  108  ? 9.161   128.436 -7.136  1.00 56.80  ? 108  ILE C CA    1 
ATOM   6659  C  C     . ILE I  5  108  ? 10.138  127.447 -7.735  1.00 56.31  ? 108  ILE C C     1 
ATOM   6660  O  O     . ILE I  5  108  ? 10.290  126.328 -7.257  1.00 55.79  ? 108  ILE C O     1 
ATOM   6661  C  CB    . ILE I  5  108  ? 9.731   128.965 -5.792  1.00 56.14  ? 108  ILE C CB    1 
ATOM   6662  C  CG1   . ILE I  5  108  ? 8.956   130.220 -5.366  1.00 56.01  ? 108  ILE C CG1   1 
ATOM   6663  C  CG2   . ILE I  5  108  ? 11.218  129.278 -5.942  1.00 56.82  ? 108  ILE C CG2   1 
ATOM   6664  C  CD1   . ILE I  5  108  ? 9.507   130.938 -4.139  1.00 55.72  ? 108  ILE C CD1   1 
ATOM   6665  N  N     . LYS I  5  109  ? 10.808  127.903 -8.788  1.00 56.35  ? 109  LYS C N     1 
ATOM   6666  C  CA    . LYS I  5  109  ? 11.788  127.103 -9.483  1.00 56.99  ? 109  LYS C CA    1 
ATOM   6667  C  C     . LYS I  5  109  ? 13.192  127.639 -9.291  1.00 57.51  ? 109  LYS C C     1 
ATOM   6668  O  O     . LYS I  5  109  ? 13.588  128.626 -9.921  1.00 56.97  ? 109  LYS C O     1 
ATOM   6669  C  CB    . LYS I  5  109  ? 11.496  127.058 -10.986 1.00 57.75  ? 109  LYS C CB    1 
ATOM   6670  C  CG    . LYS I  5  109  ? 12.647  126.533 -11.861 1.00 58.15  ? 109  LYS C CG    1 
ATOM   6671  C  CD    . LYS I  5  109  ? 12.581  125.045 -12.173 1.00 57.44  ? 109  LYS C CD    1 
ATOM   6672  C  CE    . LYS I  5  109  ? 13.607  124.674 -13.217 1.00 57.26  ? 109  LYS C CE    1 
ATOM   6673  N  NZ    . LYS I  5  109  ? 13.421  125.442 -14.490 1.00 56.22  ? 109  LYS C NZ    1 
ATOM   6674  N  N     . GLU I  5  110  ? 13.932  126.986 -8.403  1.00 58.32  ? 110  GLU C N     1 
ATOM   6675  C  CA    . GLU I  5  110  ? 15.336  127.295 -8.236  1.00 58.54  ? 110  GLU C CA    1 
ATOM   6676  C  C     . GLU I  5  110  ? 16.135  126.355 -9.132  1.00 58.20  ? 110  GLU C C     1 
ATOM   6677  O  O     . GLU I  5  110  ? 16.483  125.235 -8.763  1.00 57.65  ? 110  GLU C O     1 
ATOM   6678  C  CB    . GLU I  5  110  ? 15.758  127.127 -6.776  1.00 59.27  ? 110  GLU C CB    1 
ATOM   6679  C  CG    . GLU I  5  110  ? 16.936  127.997 -6.342  1.00 61.60  ? 110  GLU C CG    1 
ATOM   6680  C  CD    . GLU I  5  110  ? 18.193  127.773 -7.166  1.00 63.13  ? 110  GLU C CD    1 
ATOM   6681  O  OE1   . GLU I  5  110  ? 18.548  126.594 -7.370  1.00 64.53  ? 110  GLU C OE1   1 
ATOM   6682  O  OE2   . GLU I  5  110  ? 18.823  128.770 -7.601  1.00 62.61  ? 110  GLU C OE2   1 
ATOM   6683  N  N     . ASP I  5  111  ? 16.363  126.866 -10.330 1.00 58.04  ? 111  ASP C N     1 
ATOM   6684  C  CA    . ASP I  5  111  ? 17.005  126.248 -11.476 1.00 57.60  ? 111  ASP C CA    1 
ATOM   6685  C  C     . ASP I  5  111  ? 18.171  125.307 -11.132 1.00 57.67  ? 111  ASP C C     1 
ATOM   6686  O  O     . ASP I  5  111  ? 18.029  124.109 -11.370 1.00 56.43  ? 111  ASP C O     1 
ATOM   6687  C  CB    . ASP I  5  111  ? 17.432  127.368 -12.431 1.00 58.94  ? 111  ASP C CB    1 
ATOM   6688  C  CG    . ASP I  5  111  ? 16.226  128.176 -12.936 1.00 59.87  ? 111  ASP C CG    1 
ATOM   6689  O  OD1   . ASP I  5  111  ? 15.125  127.590 -13.011 1.00 59.93  ? 111  ASP C OD1   1 
ATOM   6690  O  OD2   . ASP I  5  111  ? 16.366  129.379 -13.259 1.00 59.72  ? 111  ASP C OD2   1 
ATOM   6691  N  N     . GLU I  5  112  ? 19.300  125.782 -10.595 1.00 58.63  ? 112  GLU C N     1 
ATOM   6692  C  CA    . GLU I  5  112  ? 20.437  124.858 -10.399 1.00 59.88  ? 112  GLU C CA    1 
ATOM   6693  C  C     . GLU I  5  112  ? 20.903  124.760 -8.963  1.00 61.14  ? 112  GLU C C     1 
ATOM   6694  O  O     . GLU I  5  112  ? 20.854  125.702 -8.180  1.00 62.59  ? 112  GLU C O     1 
ATOM   6695  C  CB    . GLU I  5  112  ? 21.632  125.284 -11.252 1.00 58.06  ? 112  GLU C CB    1 
ATOM   6696  C  CG    . GLU I  5  112  ? 21.296  125.478 -12.733 1.00 57.18  ? 112  GLU C CG    1 
ATOM   6697  C  CD    . GLU I  5  112  ? 21.010  124.185 -13.482 1.00 55.72  ? 112  GLU C CD    1 
ATOM   6698  O  OE1   . GLU I  5  112  ? 20.634  123.182 -12.850 1.00 56.00  ? 112  GLU C OE1   1 
ATOM   6699  O  OE2   . GLU I  5  112  ? 21.155  124.177 -14.719 1.00 53.74  ? 112  GLU C OE2   1 
ATOM   6700  N  N     . VAL I  5  113  ? 21.376  123.563 -8.653  1.00 63.09  ? 113  VAL C N     1 
ATOM   6701  C  CA    . VAL I  5  113  ? 21.941  123.220 -7.360  1.00 65.37  ? 113  VAL C CA    1 
ATOM   6702  C  C     . VAL I  5  113  ? 23.071  122.228 -7.551  1.00 67.03  ? 113  VAL C C     1 
ATOM   6703  O  O     . VAL I  5  113  ? 22.803  121.044 -7.752  1.00 66.93  ? 113  VAL C O     1 
ATOM   6704  C  CB    . VAL I  5  113  ? 20.907  122.564 -6.430  1.00 65.41  ? 113  VAL C CB    1 
ATOM   6705  C  CG1   . VAL I  5  113  ? 21.459  122.521 -5.015  1.00 64.90  ? 113  VAL C CG1   1 
ATOM   6706  C  CG2   . VAL I  5  113  ? 19.600  123.320 -6.483  1.00 66.04  ? 113  VAL C CG2   1 
ATOM   6707  N  N     . PHE I  5  114  ? 24.324  122.692 -7.506  1.00 69.45  ? 114  PHE C N     1 
ATOM   6708  C  CA    . PHE I  5  114  ? 25.417  121.762 -7.736  1.00 71.22  ? 114  PHE C CA    1 
ATOM   6709  C  C     . PHE I  5  114  ? 25.688  120.889 -6.530  1.00 71.42  ? 114  PHE C C     1 
ATOM   6710  O  O     . PHE I  5  114  ? 26.437  121.203 -5.596  1.00 71.28  ? 114  PHE C O     1 
ATOM   6711  C  CB    . PHE I  5  114  ? 26.733  122.460 -8.210  1.00 71.42  ? 114  PHE C CB    1 
ATOM   6712  C  CG    . PHE I  5  114  ? 26.964  123.890 -7.714  1.00 71.61  ? 114  PHE C CG    1 
ATOM   6713  C  CD1   . PHE I  5  114  ? 27.586  124.831 -8.579  1.00 70.83  ? 114  PHE C CD1   1 
ATOM   6714  C  CD2   . PHE I  5  114  ? 26.628  124.296 -6.403  1.00 70.83  ? 114  PHE C CD2   1 
ATOM   6715  C  CE1   . PHE I  5  114  ? 27.874  126.162 -8.144  1.00 69.37  ? 114  PHE C CE1   1 
ATOM   6716  C  CE2   . PHE I  5  114  ? 26.909  125.622 -5.950  1.00 69.90  ? 114  PHE C CE2   1 
ATOM   6717  C  CZ    . PHE I  5  114  ? 27.536  126.554 -6.828  1.00 69.68  ? 114  PHE C CZ    1 
ATOM   6718  N  N     . LEU I  5  115  ? 25.015  119.757 -6.613  1.00 72.13  ? 115  LEU C N     1 
ATOM   6719  C  CA    . LEU I  5  115  ? 25.091  118.693 -5.658  1.00 73.43  ? 115  LEU C CA    1 
ATOM   6720  C  C     . LEU I  5  115  ? 25.771  117.495 -6.283  1.00 73.75  ? 115  LEU C C     1 
ATOM   6721  O  O     . LEU I  5  115  ? 25.280  116.924 -7.265  1.00 74.39  ? 115  LEU C O     1 
ATOM   6722  C  CB    . LEU I  5  115  ? 23.682  118.328 -5.194  1.00 74.13  ? 115  LEU C CB    1 
ATOM   6723  C  CG    . LEU I  5  115  ? 22.585  118.489 -6.244  1.00 75.19  ? 115  LEU C CG    1 
ATOM   6724  C  CD1   . LEU I  5  115  ? 22.275  117.164 -6.898  1.00 75.60  ? 115  LEU C CD1   1 
ATOM   6725  C  CD2   . LEU I  5  115  ? 21.358  119.039 -5.580  1.00 75.52  ? 115  LEU C CD2   1 
ATOM   6726  N  N     . GLY I  5  116  ? 26.918  117.136 -5.731  1.00 73.00  ? 116  GLY C N     1 
ATOM   6727  C  CA    . GLY I  5  116  ? 27.620  115.999 -6.255  1.00 72.14  ? 116  GLY C CA    1 
ATOM   6728  C  C     . GLY I  5  116  ? 28.495  116.283 -7.451  1.00 71.33  ? 116  GLY C C     1 
ATOM   6729  O  O     . GLY I  5  116  ? 28.103  116.839 -8.474  1.00 71.15  ? 116  GLY C O     1 
ATOM   6730  N  N     . HIS I  5  117  ? 29.734  115.885 -7.268  1.00 71.40  ? 117  HIS C N     1 
ATOM   6731  C  CA    . HIS I  5  117  ? 30.750  115.938 -8.293  1.00 70.77  ? 117  HIS C CA    1 
ATOM   6732  C  C     . HIS I  5  117  ? 31.038  114.509 -8.755  1.00 70.25  ? 117  HIS C C     1 
ATOM   6733  O  O     . HIS I  5  117  ? 31.738  113.785 -8.042  1.00 71.04  ? 117  HIS C O     1 
ATOM   6734  C  CB    . HIS I  5  117  ? 32.025  116.565 -7.717  1.00 71.17  ? 117  HIS C CB    1 
ATOM   6735  C  CG    . HIS I  5  117  ? 31.863  117.982 -7.255  1.00 71.09  ? 117  HIS C CG    1 
ATOM   6736  N  ND1   . HIS I  5  117  ? 30.705  118.455 -6.676  1.00 70.93  ? 117  HIS C ND1   1 
ATOM   6737  C  CD2   . HIS I  5  117  ? 32.735  119.018 -7.252  1.00 70.72  ? 117  HIS C CD2   1 
ATOM   6738  C  CE1   . HIS I  5  117  ? 30.871  119.721 -6.335  1.00 71.21  ? 117  HIS C CE1   1 
ATOM   6739  N  NE2   . HIS I  5  117  ? 32.094  120.087 -6.674  1.00 70.91  ? 117  HIS C NE2   1 
ATOM   6740  N  N     . ILE I  5  118  ? 30.510  114.075 -9.903  1.00 68.63  ? 118  ILE C N     1 
ATOM   6741  C  CA    . ILE I  5  118  ? 30.748  112.684 -10.272 1.00 66.90  ? 118  ILE C CA    1 
ATOM   6742  C  C     . ILE I  5  118  ? 31.925  112.534 -11.226 1.00 65.75  ? 118  ILE C C     1 
ATOM   6743  O  O     . ILE I  5  118  ? 32.115  113.325 -12.144 1.00 64.84  ? 118  ILE C O     1 
ATOM   6744  C  CB    . ILE I  5  118  ? 29.460  112.014 -10.869 1.00 66.40  ? 118  ILE C CB    1 
ATOM   6745  C  CG1   . ILE I  5  118  ? 29.211  112.465 -12.299 1.00 66.69  ? 118  ILE C CG1   1 
ATOM   6746  C  CG2   . ILE I  5  118  ? 28.260  112.342 -9.960  1.00 64.60  ? 118  ILE C CG2   1 
ATOM   6747  C  CD1   . ILE I  5  118  ? 28.193  111.587 -13.000 1.00 68.59  ? 118  ILE C CD1   1 
ATOM   6748  N  N     . PRO I  5  119  ? 32.746  111.497 -10.999 1.00 65.42  ? 119  PRO C N     1 
ATOM   6749  C  CA    . PRO I  5  119  ? 33.921  111.219 -11.820 1.00 65.05  ? 119  PRO C CA    1 
ATOM   6750  C  C     . PRO I  5  119  ? 33.568  110.999 -13.273 1.00 65.33  ? 119  PRO C C     1 
ATOM   6751  O  O     . PRO I  5  119  ? 32.434  110.680 -13.626 1.00 63.95  ? 119  PRO C O     1 
ATOM   6752  C  CB    . PRO I  5  119  ? 34.532  109.987 -11.164 1.00 65.32  ? 119  PRO C CB    1 
ATOM   6753  C  CG    . PRO I  5  119  ? 34.116  110.127 -9.752  1.00 65.67  ? 119  PRO C CG    1 
ATOM   6754  C  CD    . PRO I  5  119  ? 32.680  110.537 -9.882  1.00 66.05  ? 119  PRO C CD    1 
ATOM   6755  N  N     . LEU I  5  120  ? 34.581  111.180 -14.108 1.00 65.56  ? 120  LEU C N     1 
ATOM   6756  C  CA    . LEU I  5  120  ? 34.469  110.997 -15.538 1.00 65.13  ? 120  LEU C CA    1 
ATOM   6757  C  C     . LEU I  5  120  ? 35.362  109.870 -15.983 1.00 64.95  ? 120  LEU C C     1 
ATOM   6758  O  O     . LEU I  5  120  ? 36.284  109.474 -15.260 1.00 65.61  ? 120  LEU C O     1 
ATOM   6759  C  CB    . LEU I  5  120  ? 34.870  112.281 -16.279 1.00 63.87  ? 120  LEU C CB    1 
ATOM   6760  C  CG    . LEU I  5  120  ? 33.880  113.442 -16.203 1.00 62.37  ? 120  LEU C CG    1 
ATOM   6761  C  CD1   . LEU I  5  120  ? 34.618  114.762 -16.383 1.00 61.88  ? 120  LEU C CD1   1 
ATOM   6762  C  CD2   . LEU I  5  120  ? 32.802  113.243 -17.257 1.00 61.38  ? 120  LEU C CD2   1 
ATOM   6763  N  N     . MET I  5  121  ? 35.086  109.346 -17.167 1.00 64.73  ? 121  MET C N     1 
ATOM   6764  C  CA    . MET I  5  121  ? 35.886  108.262 -17.680 1.00 64.10  ? 121  MET C CA    1 
ATOM   6765  C  C     . MET I  5  121  ? 36.879  108.768 -18.694 1.00 64.65  ? 121  MET C C     1 
ATOM   6766  O  O     . MET I  5  121  ? 36.557  109.644 -19.494 1.00 65.02  ? 121  MET C O     1 
ATOM   6767  C  CB    . MET I  5  121  ? 34.998  107.205 -18.331 1.00 61.82  ? 121  MET C CB    1 
ATOM   6768  C  CG    . MET I  5  121  ? 35.772  105.925 -18.654 1.00 58.38  ? 121  MET C CG    1 
ATOM   6769  S  SD    . MET I  5  121  ? 35.136  104.411 -17.923 1.00 57.19  ? 121  MET C SD    1 
ATOM   6770  C  CE    . MET I  5  121  ? 35.070  103.400 -19.266 1.00 52.42  ? 121  MET C CE    1 
ATOM   6771  N  N     . THR I  5  122  ? 38.090  108.229 -18.648 1.00 64.61  ? 122  THR C N     1 
ATOM   6772  C  CA    . THR I  5  122  ? 39.099  108.612 -19.615 1.00 64.58  ? 122  THR C CA    1 
ATOM   6773  C  C     . THR I  5  122  ? 38.810  107.943 -20.960 1.00 65.44  ? 122  THR C C     1 
ATOM   6774  O  O     . THR I  5  122  ? 38.079  106.950 -21.006 1.00 65.52  ? 122  THR C O     1 
ATOM   6775  C  CB    . THR I  5  122  ? 40.492  108.215 -19.122 1.00 64.25  ? 122  THR C CB    1 
ATOM   6776  O  OG1   . THR I  5  122  ? 40.606  108.530 -17.730 1.00 63.47  ? 122  THR C OG1   1 
ATOM   6777  C  CG2   . THR I  5  122  ? 41.564  108.993 -19.875 1.00 64.41  ? 122  THR C CG2   1 
ATOM   6778  N  N     . GLU I  5  123  ? 39.369  108.472 -22.044 1.00 65.21  ? 123  GLU C N     1 
ATOM   6779  C  CA    . GLU I  5  123  ? 39.104  107.948 -23.393 1.00 66.00  ? 123  GLU C CA    1 
ATOM   6780  C  C     . GLU I  5  123  ? 39.417  106.448 -23.513 1.00 65.75  ? 123  GLU C C     1 
ATOM   6781  O  O     . GLU I  5  123  ? 38.845  105.744 -24.353 1.00 66.17  ? 123  GLU C O     1 
ATOM   6782  C  CB    . GLU I  5  123  ? 39.917  108.731 -24.451 1.00 66.05  ? 123  GLU C CB    1 
ATOM   6783  C  CG    . GLU I  5  123  ? 41.004  109.693 -23.944 1.00 66.13  ? 123  GLU C CG    1 
ATOM   6784  C  CD    . GLU I  5  123  ? 41.381  110.741 -24.990 1.00 66.43  ? 123  GLU C CD    1 
ATOM   6785  O  OE1   . GLU I  5  123  ? 42.399  111.437 -24.794 1.00 66.37  ? 123  GLU C OE1   1 
ATOM   6786  O  OE2   . GLU I  5  123  ? 40.659  110.870 -26.004 1.00 66.42  ? 123  GLU C OE2   1 
ATOM   6787  N  N     . ASP I  5  124  ? 40.311  105.964 -22.666 1.00 64.37  ? 124  ASP C N     1 
ATOM   6788  C  CA    . ASP I  5  124  ? 40.745  104.574 -22.702 1.00 64.00  ? 124  ASP C CA    1 
ATOM   6789  C  C     . ASP I  5  124  ? 39.768  103.639 -21.962 1.00 62.40  ? 124  ASP C C     1 
ATOM   6790  O  O     . ASP I  5  124  ? 39.474  102.549 -22.458 1.00 62.22  ? 124  ASP C O     1 
ATOM   6791  C  CB    . ASP I  5  124  ? 42.142  104.511 -22.097 1.00 65.61  ? 124  ASP C CB    1 
ATOM   6792  C  CG    . ASP I  5  124  ? 42.975  105.770 -22.418 1.00 67.07  ? 124  ASP C CG    1 
ATOM   6793  O  OD1   . ASP I  5  124  ? 42.537  106.902 -22.103 1.00 67.66  ? 124  ASP C OD1   1 
ATOM   6794  O  OD2   . ASP I  5  124  ? 44.078  105.637 -22.987 1.00 67.99  ? 124  ASP C OD2   1 
ATOM   6795  N  N     . GLY I  5  125  ? 39.279  104.054 -20.788 1.00 60.66  ? 125  GLY C N     1 
ATOM   6796  C  CA    . GLY I  5  125  ? 38.334  103.237 -20.034 1.00 58.45  ? 125  GLY C CA    1 
ATOM   6797  C  C     . GLY I  5  125  ? 38.542  103.276 -18.531 1.00 56.47  ? 125  GLY C C     1 
ATOM   6798  O  O     . GLY I  5  125  ? 37.798  102.654 -17.774 1.00 56.69  ? 125  GLY C O     1 
ATOM   6799  N  N     . SER I  5  126  ? 39.554  104.009 -18.097 1.00 54.03  ? 126  SER C N     1 
ATOM   6800  C  CA    . SER I  5  126  ? 39.882  104.105 -16.688 1.00 52.86  ? 126  SER C CA    1 
ATOM   6801  C  C     . SER I  5  126  ? 39.518  105.468 -16.135 1.00 53.32  ? 126  SER C C     1 
ATOM   6802  O  O     . SER I  5  126  ? 39.212  106.378 -16.897 1.00 53.22  ? 126  SER C O     1 
ATOM   6803  C  CB    . SER I  5  126  ? 41.388  103.853 -16.494 1.00 52.65  ? 126  SER C CB    1 
ATOM   6804  O  OG    . SER I  5  126  ? 42.214  104.878 -17.054 1.00 49.99  ? 126  SER C OG    1 
ATOM   6805  N  N     . PHE I  5  127  ? 39.547  105.606 -14.809 1.00 54.01  ? 127  PHE C N     1 
ATOM   6806  C  CA    . PHE I  5  127  ? 39.262  106.899 -14.163 1.00 54.90  ? 127  PHE C CA    1 
ATOM   6807  C  C     . PHE I  5  127  ? 40.517  107.483 -13.507 1.00 56.27  ? 127  PHE C C     1 
ATOM   6808  O  O     . PHE I  5  127  ? 41.630  106.967 -13.590 1.00 57.13  ? 127  PHE C O     1 
ATOM   6809  C  CB    . PHE I  5  127  ? 38.274  106.843 -12.987 1.00 53.33  ? 127  PHE C CB    1 
ATOM   6810  C  CG    . PHE I  5  127  ? 37.168  105.875 -13.123 1.00 52.63  ? 127  PHE C CG    1 
ATOM   6811  C  CD1   . PHE I  5  127  ? 37.383  104.494 -12.926 1.00 51.48  ? 127  PHE C CD1   1 
ATOM   6812  C  CD2   . PHE I  5  127  ? 35.877  106.338 -13.417 1.00 51.07  ? 127  PHE C CD2   1 
ATOM   6813  C  CE1   . PHE I  5  127  ? 36.306  103.575 -13.023 1.00 51.54  ? 127  PHE C CE1   1 
ATOM   6814  C  CE2   . PHE I  5  127  ? 34.787  105.450 -13.519 1.00 50.87  ? 127  PHE C CE2   1 
ATOM   6815  C  CZ    . PHE I  5  127  ? 34.997  104.061 -13.322 1.00 51.52  ? 127  PHE C CZ    1 
ATOM   6816  N  N     . ILE I  5  128  ? 40.272  108.596 -12.837 1.00 57.20  ? 128  ILE C N     1 
ATOM   6817  C  CA    . ILE I  5  128  ? 41.238  109.301 -12.017 1.00 58.80  ? 128  ILE C CA    1 
ATOM   6818  C  C     . ILE I  5  128  ? 40.545  109.759 -10.770 1.00 59.84  ? 128  ILE C C     1 
ATOM   6819  O  O     . ILE I  5  128  ? 39.887  110.805 -10.759 1.00 60.31  ? 128  ILE C O     1 
ATOM   6820  C  CB    . ILE I  5  128  ? 41.851  110.592 -12.687 1.00 58.57  ? 128  ILE C CB    1 
ATOM   6821  C  CG1   . ILE I  5  128  ? 42.916  110.214 -13.728 1.00 59.15  ? 128  ILE C CG1   1 
ATOM   6822  C  CG2   . ILE I  5  128  ? 42.538  111.486 -11.604 1.00 58.47  ? 128  ILE C CG2   1 
ATOM   6823  C  CD1   . ILE I  5  128  ? 43.569  111.432 -14.434 1.00 57.21  ? 128  ILE C CD1   1 
ATOM   6824  N  N     . ILE I  5  129  ? 40.659  108.960 -9.726  1.00 60.07  ? 129  ILE C N     1 
ATOM   6825  C  CA    . ILE I  5  129  ? 40.016  109.325 -8.490  1.00 60.32  ? 129  ILE C CA    1 
ATOM   6826  C  C     . ILE I  5  129  ? 40.863  110.318 -7.744  1.00 58.56  ? 129  ILE C C     1 
ATOM   6827  O  O     . ILE I  5  129  ? 40.532  111.481 -7.657  1.00 57.28  ? 129  ILE C O     1 
ATOM   6828  C  CB    . ILE I  5  129  ? 39.741  108.045 -7.637  1.00 62.36  ? 129  ILE C CB    1 
ATOM   6829  C  CG1   . ILE I  5  129  ? 38.486  107.336 -8.157  1.00 64.36  ? 129  ILE C CG1   1 
ATOM   6830  C  CG2   . ILE I  5  129  ? 39.477  108.406 -6.181  1.00 63.20  ? 129  ILE C CG2   1 
ATOM   6831  C  CD1   . ILE I  5  129  ? 38.535  106.930 -9.626  1.00 67.41  ? 129  ILE C CD1   1 
ATOM   6832  N  N     . ASN I  5  130  ? 41.974  109.861 -7.214  1.00 56.82  ? 130  ASN C N     1 
ATOM   6833  C  CA    . ASN I  5  130  ? 42.834  110.769 -6.509  1.00 55.79  ? 130  ASN C CA    1 
ATOM   6834  C  C     . ASN I  5  130  ? 44.270  110.487 -6.841  1.00 53.47  ? 130  ASN C C     1 
ATOM   6835  O  O     . ASN I  5  130  ? 44.863  109.567 -6.314  1.00 53.62  ? 130  ASN C O     1 
ATOM   6836  C  CB    . ASN I  5  130  ? 42.552  110.660 -4.995  1.00 57.73  ? 130  ASN C CB    1 
ATOM   6837  C  CG    . ASN I  5  130  ? 41.323  111.494 -4.559  1.00 59.49  ? 130  ASN C CG    1 
ATOM   6838  O  OD1   . ASN I  5  130  ? 40.647  111.182 -3.571  1.00 59.30  ? 130  ASN C OD1   1 
ATOM   6839  N  ND2   . ASN I  5  130  ? 41.049  112.565 -5.299  1.00 60.61  ? 130  ASN C ND2   1 
ATOM   6840  N  N     . GLY I  5  131  ? 44.819  111.281 -7.749  1.00 51.04  ? 131  GLY C N     1 
ATOM   6841  C  CA    . GLY I  5  131  ? 46.200  111.105 -8.142  1.00 49.78  ? 131  GLY C CA    1 
ATOM   6842  C  C     . GLY I  5  131  ? 46.448  109.852 -8.957  1.00 49.76  ? 131  GLY C C     1 
ATOM   6843  O  O     . GLY I  5  131  ? 47.278  109.870 -9.860  1.00 48.73  ? 131  GLY C O     1 
ATOM   6844  N  N     . ALA I  5  132  ? 45.741  108.765 -8.656  1.00 50.26  ? 132  ALA C N     1 
ATOM   6845  C  CA    . ALA I  5  132  ? 45.947  107.508 -9.378  1.00 50.98  ? 132  ALA C CA    1 
ATOM   6846  C  C     . ALA I  5  132  ? 44.712  107.079 -10.159 1.00 51.00  ? 132  ALA C C     1 
ATOM   6847  O  O     . ALA I  5  132  ? 43.554  107.258 -9.731  1.00 51.69  ? 132  ALA C O     1 
ATOM   6848  C  CB    . ALA I  5  132  ? 46.324  106.403 -8.421  1.00 51.81  ? 132  ALA C CB    1 
ATOM   6849  N  N     . ASP I  5  133  ? 45.006  106.503 -11.323 1.00 49.73  ? 133  ASP C N     1 
ATOM   6850  C  CA    . ASP I  5  133  ? 44.002  105.979 -12.224 1.00 47.17  ? 133  ASP C CA    1 
ATOM   6851  C  C     . ASP I  5  133  ? 43.350  104.765 -11.606 1.00 44.61  ? 133  ASP C C     1 
ATOM   6852  O  O     . ASP I  5  133  ? 44.055  103.877 -11.098 1.00 44.85  ? 133  ASP C O     1 
ATOM   6853  C  CB    . ASP I  5  133  ? 44.635  105.561 -13.559 1.00 48.63  ? 133  ASP C CB    1 
ATOM   6854  C  CG    . ASP I  5  133  ? 45.760  106.485 -14.003 1.00 50.13  ? 133  ASP C CG    1 
ATOM   6855  O  OD1   . ASP I  5  133  ? 46.598  106.018 -14.799 1.00 50.25  ? 133  ASP C OD1   1 
ATOM   6856  O  OD2   . ASP I  5  133  ? 45.821  107.663 -13.572 1.00 52.01  ? 133  ASP C OD2   1 
ATOM   6857  N  N     . ARG I  5  134  ? 42.025  104.710 -11.630 1.00 41.77  ? 134  ARG C N     1 
ATOM   6858  C  CA    . ARG I  5  134  ? 41.350  103.565 -11.049 1.00 38.53  ? 134  ARG C CA    1 
ATOM   6859  C  C     . ARG I  5  134  ? 40.464  102.877 -12.048 1.00 35.03  ? 134  ARG C C     1 
ATOM   6860  O  O     . ARG I  5  134  ? 40.182  103.407 -13.128 1.00 35.70  ? 134  ARG C O     1 
ATOM   6861  C  CB    . ARG I  5  134  ? 40.518  103.978 -9.852  1.00 40.51  ? 134  ARG C CB    1 
ATOM   6862  C  CG    . ARG I  5  134  ? 41.242  103.858 -8.538  1.00 42.79  ? 134  ARG C CG    1 
ATOM   6863  C  CD    . ARG I  5  134  ? 40.526  104.673 -7.459  1.00 44.70  ? 134  ARG C CD    1 
ATOM   6864  N  NE    . ARG I  5  134  ? 39.646  103.886 -6.600  1.00 44.49  ? 134  ARG C NE    1 
ATOM   6865  C  CZ    . ARG I  5  134  ? 39.777  103.815 -5.277  1.00 44.92  ? 134  ARG C CZ    1 
ATOM   6866  N  NH1   . ARG I  5  134  ? 40.747  104.481 -4.660  1.00 44.42  ? 134  ARG C NH1   1 
ATOM   6867  N  NH2   . ARG I  5  134  ? 38.940  103.076 -4.568  1.00 45.11  ? 134  ARG C NH2   1 
ATOM   6868  N  N     . VAL I  5  135  ? 40.020  101.689 -11.653 1.00 30.69  ? 135  VAL C N     1 
ATOM   6869  C  CA    . VAL I  5  135  ? 39.221  100.842 -12.505 1.00 27.00  ? 135  VAL C CA    1 
ATOM   6870  C  C     . VAL I  5  135  ? 38.001  100.289 -11.773 1.00 26.43  ? 135  VAL C C     1 
ATOM   6871  O  O     . VAL I  5  135  ? 38.123  99.828  -10.636 1.00 27.15  ? 135  VAL C O     1 
ATOM   6872  C  CB    . VAL I  5  135  ? 40.091  99.646  -13.008 1.00 26.63  ? 135  VAL C CB    1 
ATOM   6873  C  CG1   . VAL I  5  135  ? 41.427  100.141 -13.530 1.00 27.89  ? 135  VAL C CG1   1 
ATOM   6874  C  CG2   . VAL I  5  135  ? 40.405  98.684  -11.848 1.00 25.62  ? 135  VAL C CG2   1 
ATOM   6875  N  N     . ILE I  5  136  ? 36.830  100.331 -12.411 1.00 25.73  ? 136  ILE C N     1 
ATOM   6876  C  CA    . ILE I  5  136  ? 35.634  99.732  -11.812 1.00 24.94  ? 136  ILE C CA    1 
ATOM   6877  C  C     . ILE I  5  136  ? 35.375  98.365  -12.411 1.00 25.34  ? 136  ILE C C     1 
ATOM   6878  O  O     . ILE I  5  136  ? 34.890  98.263  -13.525 1.00 26.83  ? 136  ILE C O     1 
ATOM   6879  C  CB    . ILE I  5  136  ? 34.378  100.579 -12.027 1.00 24.02  ? 136  ILE C CB    1 
ATOM   6880  C  CG1   . ILE I  5  136  ? 34.367  101.734 -11.035 1.00 28.18  ? 136  ILE C CG1   1 
ATOM   6881  C  CG2   . ILE I  5  136  ? 33.137  99.765  -11.737 1.00 23.40  ? 136  ILE C CG2   1 
ATOM   6882  C  CD1   . ILE I  5  136  ? 34.320  101.334 -9.536  1.00 33.04  ? 136  ILE C CD1   1 
ATOM   6883  N  N     . VAL I  5  137  ? 35.688  97.315  -11.671 1.00 27.00  ? 137  VAL C N     1 
ATOM   6884  C  CA    . VAL I  5  137  ? 35.528  95.978  -12.202 1.00 28.19  ? 137  VAL C CA    1 
ATOM   6885  C  C     . VAL I  5  137  ? 34.093  95.505  -12.096 1.00 30.18  ? 137  VAL C C     1 
ATOM   6886  O  O     . VAL I  5  137  ? 33.420  95.711  -11.094 1.00 29.18  ? 137  VAL C O     1 
ATOM   6887  C  CB    . VAL I  5  137  ? 36.497  94.986  -11.475 1.00 28.80  ? 137  VAL C CB    1 
ATOM   6888  C  CG1   . VAL I  5  137  ? 37.939  95.472  -11.631 1.00 29.22  ? 137  VAL C CG1   1 
ATOM   6889  C  CG2   . VAL I  5  137  ? 36.175  94.898  -10.021 1.00 29.28  ? 137  VAL C CG2   1 
ATOM   6890  N  N     . SER I  5  138  ? 33.623  94.862  -13.154 1.00 32.92  ? 138  SER C N     1 
ATOM   6891  C  CA    . SER I  5  138  ? 32.259  94.357  -13.167 1.00 37.37  ? 138  SER C CA    1 
ATOM   6892  C  C     . SER I  5  138  ? 32.067  93.251  -12.125 1.00 38.47  ? 138  SER C C     1 
ATOM   6893  O  O     . SER I  5  138  ? 33.015  92.880  -11.426 1.00 38.19  ? 138  SER C O     1 
ATOM   6894  C  CB    . SER I  5  138  ? 31.912  93.828  -14.556 1.00 38.60  ? 138  SER C CB    1 
ATOM   6895  O  OG    . SER I  5  138  ? 30.504  93.744  -14.705 1.00 42.00  ? 138  SER C OG    1 
ATOM   6896  N  N     . GLN I  5  139  ? 30.852  92.717  -12.021 1.00 39.79  ? 139  GLN C N     1 
ATOM   6897  C  CA    . GLN I  5  139  ? 30.593  91.693  -11.020 1.00 42.56  ? 139  GLN C CA    1 
ATOM   6898  C  C     . GLN I  5  139  ? 29.474  90.730  -11.460 1.00 45.22  ? 139  GLN C C     1 
ATOM   6899  O  O     . GLN I  5  139  ? 28.803  91.018  -12.431 1.00 47.00  ? 139  GLN C O     1 
ATOM   6900  C  CB    . GLN I  5  139  ? 30.263  92.420  -9.723  1.00 40.73  ? 139  GLN C CB    1 
ATOM   6901  C  CG    . GLN I  5  139  ? 28.857  92.454  -9.301  1.00 41.56  ? 139  GLN C CG    1 
ATOM   6902  C  CD    . GLN I  5  139  ? 28.791  92.653  -7.833  1.00 42.84  ? 139  GLN C CD    1 
ATOM   6903  O  OE1   . GLN I  5  139  ? 29.480  91.955  -7.088  1.00 44.30  ? 139  GLN C OE1   1 
ATOM   6904  N  NE2   . GLN I  5  139  ? 27.970  93.601  -7.386  1.00 42.67  ? 139  GLN C NE2   1 
ATOM   6905  N  N     . ILE I  5  140  ? 29.275  89.600  -10.766 1.00 46.87  ? 140  ILE C N     1 
ATOM   6906  C  CA    . ILE I  5  140  ? 28.224  88.641  -11.144 1.00 48.48  ? 140  ILE C CA    1 
ATOM   6907  C  C     . ILE I  5  140  ? 27.315  88.299  -9.982  1.00 49.92  ? 140  ILE C C     1 
ATOM   6908  O  O     . ILE I  5  140  ? 27.677  88.468  -8.822  1.00 48.68  ? 140  ILE C O     1 
ATOM   6909  C  CB    . ILE I  5  140  ? 28.795  87.311  -11.659 1.00 50.05  ? 140  ILE C CB    1 
ATOM   6910  C  CG1   . ILE I  5  140  ? 29.926  86.817  -10.732 1.00 52.03  ? 140  ILE C CG1   1 
ATOM   6911  C  CG2   . ILE I  5  140  ? 29.229  87.494  -13.094 1.00 50.74  ? 140  ILE C CG2   1 
ATOM   6912  C  CD1   . ILE I  5  140  ? 29.468  85.991  -9.498  1.00 51.22  ? 140  ILE C CD1   1 
ATOM   6913  N  N     . HIS I  5  141  ? 26.133  87.785  -10.309 1.00 52.31  ? 141  HIS C N     1 
ATOM   6914  C  CA    . HIS I  5  141  ? 25.159  87.427  -9.284  1.00 55.59  ? 141  HIS C CA    1 
ATOM   6915  C  C     . HIS I  5  141  ? 23.911  86.807  -9.882  1.00 56.10  ? 141  HIS C C     1 
ATOM   6916  O  O     . HIS I  5  141  ? 23.742  86.776  -11.089 1.00 57.25  ? 141  HIS C O     1 
ATOM   6917  C  CB    . HIS I  5  141  ? 24.728  88.675  -8.518  1.00 55.58  ? 141  HIS C CB    1 
ATOM   6918  C  CG    . HIS I  5  141  ? 24.046  89.711  -9.375  1.00 56.19  ? 141  HIS C CG    1 
ATOM   6919  N  ND1   . HIS I  5  141  ? 24.278  91.062  -9.236  1.00 56.83  ? 141  HIS C ND1   1 
ATOM   6920  C  CD2   . HIS I  5  141  ? 23.135  89.591  -10.376 1.00 56.39  ? 141  HIS C CD2   1 
ATOM   6921  C  CE1   . HIS I  5  141  ? 23.541  91.722  -10.114 1.00 57.15  ? 141  HIS C CE1   1 
ATOM   6922  N  NE2   . HIS I  5  141  ? 22.840  90.853  -10.817 1.00 57.47  ? 141  HIS C NE2   1 
ATOM   6923  N  N     . ARG I  5  142  ? 23.015  86.342  -9.026  1.00 56.82  ? 142  ARG C N     1 
ATOM   6924  C  CA    . ARG I  5  142  ? 21.748  85.828  -9.514  1.00 58.15  ? 142  ARG C CA    1 
ATOM   6925  C  C     . ARG I  5  142  ? 20.850  87.003  -10.023 1.00 58.61  ? 142  ARG C C     1 
ATOM   6926  O  O     . ARG I  5  142  ? 20.751  88.050  -9.362  1.00 58.92  ? 142  ARG C O     1 
ATOM   6927  C  CB    . ARG I  5  142  ? 21.014  85.078  -8.378  1.00 59.30  ? 142  ARG C CB    1 
ATOM   6928  C  CG    . ARG I  5  142  ? 21.881  84.305  -7.375  1.00 61.24  ? 142  ARG C CG    1 
ATOM   6929  C  CD    . ARG I  5  142  ? 22.613  83.119  -7.995  1.00 64.11  ? 142  ARG C CD    1 
ATOM   6930  N  NE    . ARG I  5  142  ? 22.052  81.808  -7.640  1.00 65.86  ? 142  ARG C NE    1 
ATOM   6931  C  CZ    . ARG I  5  142  ? 20.843  81.366  -7.986  1.00 66.42  ? 142  ARG C CZ    1 
ATOM   6932  N  NH1   . ARG I  5  142  ? 20.026  82.126  -8.700  1.00 67.17  ? 142  ARG C NH1   1 
ATOM   6933  N  NH2   . ARG I  5  142  ? 20.456  80.147  -7.630  1.00 66.81  ? 142  ARG C NH2   1 
ATOM   6934  N  N     . SER I  5  143  ? 20.214  86.862  -11.186 1.00 58.18  ? 143  SER C N     1 
ATOM   6935  C  CA    . SER I  5  143  ? 19.303  87.902  -11.665 1.00 57.77  ? 143  SER C CA    1 
ATOM   6936  C  C     . SER I  5  143  ? 17.924  87.774  -10.932 1.00 58.90  ? 143  SER C C     1 
ATOM   6937  O  O     . SER I  5  143  ? 17.756  86.822  -10.177 1.00 59.40  ? 143  SER C O     1 
ATOM   6938  C  CB    . SER I  5  143  ? 19.188  87.745  -13.170 1.00 58.81  ? 143  SER C CB    1 
ATOM   6939  O  OG    . SER I  5  143  ? 18.897  86.397  -13.489 1.00 58.70  ? 143  SER C OG    1 
ATOM   6940  N  N     . PRO I  5  144  ? 16.931  88.691  -11.137 1.00 59.35  ? 144  PRO C N     1 
ATOM   6941  C  CA    . PRO I  5  144  ? 15.584  88.696  -10.469 1.00 60.89  ? 144  PRO C CA    1 
ATOM   6942  C  C     . PRO I  5  144  ? 14.417  87.902  -11.189 1.00 62.41  ? 144  PRO C C     1 
ATOM   6943  O  O     . PRO I  5  144  ? 13.903  88.339  -12.219 1.00 62.81  ? 144  PRO C O     1 
ATOM   6944  C  CB    . PRO I  5  144  ? 15.266  90.190  -10.356 1.00 59.63  ? 144  PRO C CB    1 
ATOM   6945  C  CG    . PRO I  5  144  ? 16.593  90.831  -10.485 1.00 58.24  ? 144  PRO C CG    1 
ATOM   6946  C  CD    . PRO I  5  144  ? 17.244  90.060  -11.579 1.00 57.74  ? 144  PRO C CD    1 
ATOM   6947  N  N     . GLY I  5  145  ? 13.973  86.781  -10.592 1.00 64.58  ? 145  GLY C N     1 
ATOM   6948  C  CA    . GLY I  5  145  ? 12.864  85.962  -11.111 1.00 66.92  ? 145  GLY C CA    1 
ATOM   6949  C  C     . GLY I  5  145  ? 12.321  84.978  -10.061 1.00 68.85  ? 145  GLY C C     1 
ATOM   6950  O  O     . GLY I  5  145  ? 12.411  85.251  -8.867  1.00 69.14  ? 145  GLY C O     1 
ATOM   6951  N  N     . VAL I  5  146  ? 11.744  83.849  -10.477 1.00 70.26  ? 146  VAL C N     1 
ATOM   6952  C  CA    . VAL I  5  146  ? 11.262  82.840  -9.512  1.00 72.17  ? 146  VAL C CA    1 
ATOM   6953  C  C     . VAL I  5  146  ? 11.660  81.425  -9.965  1.00 74.96  ? 146  VAL C C     1 
ATOM   6954  O  O     . VAL I  5  146  ? 11.415  81.019  -11.102 1.00 75.57  ? 146  VAL C O     1 
ATOM   6955  C  CB    . VAL I  5  146  ? 9.705   82.890  -9.303  1.00 70.71  ? 146  VAL C CB    1 
ATOM   6956  C  CG1   . VAL I  5  146  ? 9.347   82.090  -8.091  1.00 69.73  ? 146  VAL C CG1   1 
ATOM   6957  C  CG2   . VAL I  5  146  ? 9.228   84.319  -9.113  1.00 69.47  ? 146  VAL C CG2   1 
ATOM   6958  N  N     . TYR I  5  147  ? 12.299  80.675  -9.075  1.00 76.89  ? 147  TYR C N     1 
ATOM   6959  C  CA    . TYR I  5  147  ? 12.770  79.344  -9.426  1.00 79.47  ? 147  TYR C CA    1 
ATOM   6960  C  C     . TYR I  5  147  ? 12.478  78.353  -8.320  1.00 80.94  ? 147  TYR C C     1 
ATOM   6961  O  O     . TYR I  5  147  ? 12.171  78.714  -7.197  1.00 81.59  ? 147  TYR C O     1 
ATOM   6962  C  CB    . TYR I  5  147  ? 14.270  79.374  -9.721  1.00 79.83  ? 147  TYR C CB    1 
ATOM   6963  C  CG    . TYR I  5  147  ? 14.824  80.756  -9.936  1.00 81.16  ? 147  TYR C CG    1 
ATOM   6964  C  CD1   . TYR I  5  147  ? 15.572  81.392  -8.923  1.00 81.98  ? 147  TYR C CD1   1 
ATOM   6965  C  CD2   . TYR I  5  147  ? 14.589  81.455  -11.136 1.00 81.39  ? 147  TYR C CD2   1 
ATOM   6966  C  CE1   . TYR I  5  147  ? 16.080  82.706  -9.101  1.00 82.67  ? 147  TYR C CE1   1 
ATOM   6967  C  CE2   . TYR I  5  147  ? 15.091  82.772  -11.328 1.00 82.17  ? 147  TYR C CE2   1 
ATOM   6968  C  CZ    . TYR I  5  147  ? 15.834  83.384  -10.304 1.00 82.64  ? 147  TYR C CZ    1 
ATOM   6969  O  OH    . TYR I  5  147  ? 16.333  84.650  -10.484 1.00 82.64  ? 147  TYR C OH    1 
ATOM   6970  N  N     . PHE I  5  148  ? 12.610  77.086  -8.668  1.00 82.67  ? 148  PHE C N     1 
ATOM   6971  C  CA    . PHE I  5  148  ? 12.239  75.936  -7.834  1.00 84.40  ? 148  PHE C CA    1 
ATOM   6972  C  C     . PHE I  5  148  ? 13.385  74.953  -7.759  1.00 86.12  ? 148  PHE C C     1 
ATOM   6973  O  O     . PHE I  5  148  ? 13.661  74.199  -8.697  1.00 86.47  ? 148  PHE C O     1 
ATOM   6974  C  CB    . PHE I  5  148  ? 10.985  75.387  -8.509  1.00 83.01  ? 148  PHE C CB    1 
ATOM   6975  C  CG    . PHE I  5  148  ? 10.643  76.216  -9.730  1.00 80.92  ? 148  PHE C CG    1 
ATOM   6976  C  CD1   . PHE I  5  148  ? 11.337  76.011  -10.956 1.00 79.95  ? 148  PHE C CD1   1 
ATOM   6977  C  CD2   . PHE I  5  148  ? 9.797   77.330  -9.618  1.00 79.33  ? 148  PHE C CD2   1 
ATOM   6978  C  CE1   . PHE I  5  148  ? 11.210  76.905  -12.036 1.00 78.47  ? 148  PHE C CE1   1 
ATOM   6979  C  CE2   . PHE I  5  148  ? 9.663   78.226  -10.685 1.00 78.46  ? 148  PHE C CE2   1 
ATOM   6980  C  CZ    . PHE I  5  148  ? 10.374  78.018  -11.898 1.00 78.31  ? 148  PHE C CZ    1 
ATOM   6981  N  N     . THR I  5  149  ? 14.063  74.991  -6.625  1.00 87.77  ? 149  THR C N     1 
ATOM   6982  C  CA    . THR I  5  149  ? 15.230  74.169  -6.408  1.00 89.44  ? 149  THR C CA    1 
ATOM   6983  C  C     . THR I  5  149  ? 14.945  73.066  -5.370  1.00 91.71  ? 149  THR C C     1 
ATOM   6984  O  O     . THR I  5  149  ? 14.077  73.242  -4.514  1.00 92.64  ? 149  THR C O     1 
ATOM   6985  C  CB    . THR I  5  149  ? 16.404  75.125  -5.991  1.00 88.80  ? 149  THR C CB    1 
ATOM   6986  O  OG1   . THR I  5  149  ? 17.587  74.368  -5.708  1.00 88.39  ? 149  THR C OG1   1 
ATOM   6987  C  CG2   . THR I  5  149  ? 16.019  75.948  -4.771  1.00 88.15  ? 149  THR C CG2   1 
ATOM   6988  N  N     . PRO I  5  150  ? 15.654  71.906  -5.444  1.00 93.55  ? 150  PRO C N     1 
ATOM   6989  C  CA    . PRO I  5  150  ? 15.507  70.747  -4.532  1.00 94.15  ? 150  PRO C CA    1 
ATOM   6990  C  C     . PRO I  5  150  ? 15.686  71.113  -3.051  1.00 93.94  ? 150  PRO C C     1 
ATOM   6991  O  O     . PRO I  5  150  ? 16.471  72.004  -2.708  1.00 94.27  ? 150  PRO C O     1 
ATOM   6992  C  CB    . PRO I  5  150  ? 16.562  69.760  -5.032  1.00 94.49  ? 150  PRO C CB    1 
ATOM   6993  C  CG    . PRO I  5  150  ? 16.578  70.011  -6.501  1.00 94.83  ? 150  PRO C CG    1 
ATOM   6994  C  CD    . PRO I  5  150  ? 16.517  71.538  -6.589  1.00 94.38  ? 150  PRO C CD    1 
ATOM   6995  N  N     . ASP I  5  151  ? 14.950  70.396  -2.194  1.00 93.37  ? 151  ASP C N     1 
ATOM   6996  C  CA    . ASP I  5  151  ? 14.967  70.601  -0.743  1.00 92.23  ? 151  ASP C CA    1 
ATOM   6997  C  C     . ASP I  5  151  ? 16.367  70.364  -0.162  1.00 92.12  ? 151  ASP C C     1 
ATOM   6998  O  O     . ASP I  5  151  ? 17.068  69.455  -0.609  1.00 92.22  ? 151  ASP C O     1 
ATOM   6999  C  CB    . ASP I  5  151  ? 13.969  69.654  -0.082  1.00 91.31  ? 151  ASP C CB    1 
ATOM   7000  C  CG    . ASP I  5  151  ? 13.082  70.356  0.928   1.00 90.47  ? 151  ASP C CG    1 
ATOM   7001  O  OD1   . ASP I  5  151  ? 13.600  70.711  2.000   1.00 91.51  ? 151  ASP C OD1   1 
ATOM   7002  O  OD2   . ASP I  5  151  ? 11.879  70.561  0.664   1.00 88.71  ? 151  ASP C OD2   1 
ATOM   7003  N  N     . PRO I  5  152  ? 16.787  71.176  0.842   1.00 91.73  ? 152  PRO C N     1 
ATOM   7004  C  CA    . PRO I  5  152  ? 18.101  71.098  1.513   1.00 91.00  ? 152  PRO C CA    1 
ATOM   7005  C  C     . PRO I  5  152  ? 18.528  69.655  1.922   1.00 89.55  ? 152  PRO C C     1 
ATOM   7006  O  O     . PRO I  5  152  ? 19.227  68.982  1.149   1.00 89.36  ? 152  PRO C O     1 
ATOM   7007  C  CB    . PRO I  5  152  ? 17.934  72.057  2.688   1.00 91.96  ? 152  PRO C CB    1 
ATOM   7008  C  CG    . PRO I  5  152  ? 17.142  73.172  2.044   1.00 92.06  ? 152  PRO C CG    1 
ATOM   7009  C  CD    . PRO I  5  152  ? 16.067  72.392  1.291   1.00 91.61  ? 152  PRO C CD    1 
ATOM   7010  N  N     . ALA I  5  153  ? 18.129  69.192  3.116   1.00 87.67  ? 153  ALA C N     1 
ATOM   7011  C  CA    . ALA I  5  153  ? 18.529  67.866  3.630   1.00 85.75  ? 153  ALA C CA    1 
ATOM   7012  C  C     . ALA I  5  153  ? 17.561  66.750  3.205   1.00 84.57  ? 153  ALA C C     1 
ATOM   7013  O  O     . ALA I  5  153  ? 17.995  65.767  2.605   1.00 84.68  ? 153  ALA C O     1 
ATOM   7014  C  CB    . ALA I  5  153  ? 18.631  67.909  5.157   1.00 85.21  ? 153  ALA C CB    1 
ATOM   7015  N  N     . ARG I  5  154  ? 16.271  66.885  3.516   1.00 83.56  ? 154  ARG C N     1 
ATOM   7016  C  CA    . ARG I  5  154  ? 15.269  65.863  3.156   1.00 82.22  ? 154  ARG C CA    1 
ATOM   7017  C  C     . ARG I  5  154  ? 15.344  65.495  1.653   1.00 81.24  ? 154  ARG C C     1 
ATOM   7018  O  O     . ARG I  5  154  ? 15.260  66.380  0.799   1.00 81.89  ? 154  ARG C O     1 
ATOM   7019  C  CB    . ARG I  5  154  ? 13.840  66.372  3.505   1.00 82.26  ? 154  ARG C CB    1 
ATOM   7020  C  CG    . ARG I  5  154  ? 13.353  67.682  2.830   1.00 79.91  ? 154  ARG C CG    1 
ATOM   7021  C  CD    . ARG I  5  154  ? 11.821  67.893  2.986   1.00 77.99  ? 154  ARG C CD    1 
ATOM   7022  N  NE    . ARG I  5  154  ? 11.038  66.975  2.146   1.00 76.57  ? 154  ARG C NE    1 
ATOM   7023  C  CZ    . ARG I  5  154  ? 9.715   66.808  2.208   1.00 75.19  ? 154  ARG C CZ    1 
ATOM   7024  N  NH1   . ARG I  5  154  ? 8.988   67.495  3.074   1.00 74.40  ? 154  ARG C NH1   1 
ATOM   7025  N  NH2   . ARG I  5  154  ? 9.113   65.945  1.400   1.00 74.56  ? 154  ARG C NH2   1 
ATOM   7026  N  N     . PRO I  5  155  ? 15.507  64.191  1.310   1.00 80.13  ? 155  PRO C N     1 
ATOM   7027  C  CA    . PRO I  5  155  ? 15.587  63.798  -0.113  1.00 79.34  ? 155  PRO C CA    1 
ATOM   7028  C  C     . PRO I  5  155  ? 14.244  63.954  -0.827  1.00 79.03  ? 155  PRO C C     1 
ATOM   7029  O  O     . PRO I  5  155  ? 14.172  63.950  -2.056  1.00 78.85  ? 155  PRO C O     1 
ATOM   7030  C  CB    . PRO I  5  155  ? 16.042  62.338  -0.071  1.00 78.64  ? 155  PRO C CB    1 
ATOM   7031  C  CG    . PRO I  5  155  ? 16.600  62.154  1.313   1.00 79.11  ? 155  PRO C CG    1 
ATOM   7032  C  CD    . PRO I  5  155  ? 15.716  63.014  2.173   1.00 79.78  ? 155  PRO C CD    1 
ATOM   7033  N  N     . GLY I  5  156  ? 13.200  64.096  -0.018  1.00 79.05  ? 156  GLY C N     1 
ATOM   7034  C  CA    . GLY I  5  156  ? 11.817  64.207  -0.461  1.00 78.47  ? 156  GLY C CA    1 
ATOM   7035  C  C     . GLY I  5  156  ? 11.470  65.118  -1.634  1.00 77.85  ? 156  GLY C C     1 
ATOM   7036  O  O     . GLY I  5  156  ? 11.732  64.802  -2.796  1.00 78.29  ? 156  GLY C O     1 
ATOM   7037  N  N     . ARG I  5  157  ? 10.870  66.259  -1.304  1.00 77.00  ? 157  ARG C N     1 
ATOM   7038  C  CA    . ARG I  5  157  ? 10.325  67.202  -2.280  1.00 76.93  ? 157  ARG C CA    1 
ATOM   7039  C  C     . ARG I  5  157  ? 11.039  68.558  -2.250  1.00 77.02  ? 157  ARG C C     1 
ATOM   7040  O  O     . ARG I  5  157  ? 11.537  68.956  -1.215  1.00 76.96  ? 157  ARG C O     1 
ATOM   7041  C  CB    . ARG I  5  157  ? 8.842   67.296  -1.936  1.00 76.72  ? 157  ARG C CB    1 
ATOM   7042  C  CG    . ARG I  5  157  ? 7.980   68.396  -2.492  1.00 76.60  ? 157  ARG C CG    1 
ATOM   7043  C  CD    . ARG I  5  157  ? 6.528   67.882  -2.564  1.00 76.08  ? 157  ARG C CD    1 
ATOM   7044  N  NE    . ARG I  5  157  ? 6.465   66.611  -3.306  1.00 76.82  ? 157  ARG C NE    1 
ATOM   7045  C  CZ    . ARG I  5  157  ? 5.465   65.729  -3.254  1.00 76.66  ? 157  ARG C CZ    1 
ATOM   7046  N  NH1   . ARG I  5  157  ? 4.408   65.962  -2.486  1.00 76.92  ? 157  ARG C NH1   1 
ATOM   7047  N  NH2   . ARG I  5  157  ? 5.519   64.607  -3.972  1.00 75.36  ? 157  ARG C NH2   1 
ATOM   7048  N  N     . TYR I  5  158  ? 11.054  69.254  -3.400  1.00 76.83  ? 158  TYR C N     1 
ATOM   7049  C  CA    . TYR I  5  158  ? 11.716  70.565  -3.594  1.00 76.62  ? 158  TYR C CA    1 
ATOM   7050  C  C     . TYR I  5  158  ? 10.802  71.743  -3.172  1.00 77.09  ? 158  TYR C C     1 
ATOM   7051  O  O     . TYR I  5  158  ? 9.588   71.586  -3.036  1.00 76.74  ? 158  TYR C O     1 
ATOM   7052  C  CB    . TYR I  5  158  ? 12.139  70.756  -5.080  1.00 76.45  ? 158  TYR C CB    1 
ATOM   7053  C  CG    . TYR I  5  158  ? 12.241  69.484  -5.963  1.00 77.08  ? 158  TYR C CG    1 
ATOM   7054  C  CD1   . TYR I  5  158  ? 11.079  68.821  -6.421  1.00 76.88  ? 158  TYR C CD1   1 
ATOM   7055  C  CD2   . TYR I  5  158  ? 13.497  68.963  -6.379  1.00 75.45  ? 158  TYR C CD2   1 
ATOM   7056  C  CE1   . TYR I  5  158  ? 11.155  67.677  -7.277  1.00 75.44  ? 158  TYR C CE1   1 
ATOM   7057  C  CE2   . TYR I  5  158  ? 13.587  67.812  -7.239  1.00 75.14  ? 158  TYR C CE2   1 
ATOM   7058  C  CZ    . TYR I  5  158  ? 12.401  67.183  -7.680  1.00 75.09  ? 158  TYR C CZ    1 
ATOM   7059  O  OH    . TYR I  5  158  ? 12.430  66.089  -8.517  1.00 73.88  ? 158  TYR C OH    1 
ATOM   7060  N  N     . ILE I  5  159  ? 11.412  72.918  -2.974  1.00 77.36  ? 159  ILE C N     1 
ATOM   7061  C  CA    . ILE I  5  159  ? 10.723  74.147  -2.532  1.00 77.95  ? 159  ILE C CA    1 
ATOM   7062  C  C     . ILE I  5  159  ? 10.902  75.306  -3.555  1.00 77.47  ? 159  ILE C C     1 
ATOM   7063  O  O     . ILE I  5  159  ? 11.873  75.348  -4.315  1.00 77.05  ? 159  ILE C O     1 
ATOM   7064  C  CB    . ILE I  5  159  ? 11.250  74.592  -1.095  1.00 78.50  ? 159  ILE C CB    1 
ATOM   7065  C  CG1   . ILE I  5  159  ? 12.744  74.951  -1.145  1.00 78.07  ? 159  ILE C CG1   1 
ATOM   7066  C  CG2   . ILE I  5  159  ? 11.070  73.439  -0.102  1.00 78.64  ? 159  ILE C CG2   1 
ATOM   7067  C  CD1   . ILE I  5  159  ? 13.315  75.544  0.134   1.00 76.87  ? 159  ILE C CD1   1 
ATOM   7068  N  N     . ALA I  5  160  ? 9.948   76.238  -3.567  1.00 77.60  ? 160  ALA C N     1 
ATOM   7069  C  CA    . ALA I  5  160  ? 9.961   77.380  -4.490  1.00 77.92  ? 160  ALA C CA    1 
ATOM   7070  C  C     . ALA I  5  160  ? 10.657  78.613  -3.872  1.00 78.46  ? 160  ALA C C     1 
ATOM   7071  O  O     . ALA I  5  160  ? 10.750  78.733  -2.647  1.00 79.43  ? 160  ALA C O     1 
ATOM   7072  C  CB    . ALA I  5  160  ? 8.524   77.728  -4.874  1.00 77.40  ? 160  ALA C CB    1 
ATOM   7073  N  N     . SER I  5  161  ? 11.141  79.521  -4.730  1.00 78.65  ? 161  SER C N     1 
ATOM   7074  C  CA    . SER I  5  161  ? 11.839  80.754  -4.306  1.00 77.55  ? 161  SER C CA    1 
ATOM   7075  C  C     . SER I  5  161  ? 11.516  81.925  -5.255  1.00 78.39  ? 161  SER C C     1 
ATOM   7076  O  O     . SER I  5  161  ? 11.802  81.844  -6.450  1.00 78.62  ? 161  SER C O     1 
ATOM   7077  C  CB    . SER I  5  161  ? 13.376  80.528  -4.302  1.00 77.26  ? 161  SER C CB    1 
ATOM   7078  O  OG    . SER I  5  161  ? 14.055  81.131  -3.204  1.00 75.25  ? 161  SER C OG    1 
ATOM   7079  N  N     . ILE I  5  162  ? 10.913  82.992  -4.722  1.00 77.77  ? 162  ILE C N     1 
ATOM   7080  C  CA    . ILE I  5  162  ? 10.615  84.216  -5.480  1.00 77.07  ? 162  ILE C CA    1 
ATOM   7081  C  C     . ILE I  5  162  ? 11.680  85.274  -5.157  1.00 77.20  ? 162  ILE C C     1 
ATOM   7082  O  O     . ILE I  5  162  ? 11.762  85.711  -3.998  1.00 78.04  ? 162  ILE C O     1 
ATOM   7083  C  CB    . ILE I  5  162  ? 9.204   84.761  -5.107  1.00 76.67  ? 162  ILE C CB    1 
ATOM   7084  C  CG1   . ILE I  5  162  ? 8.196   83.606  -5.092  1.00 75.91  ? 162  ILE C CG1   1 
ATOM   7085  C  CG2   . ILE I  5  162  ? 8.762   85.813  -6.123  1.00 76.93  ? 162  ILE C CG2   1 
ATOM   7086  C  CD1   . ILE I  5  162  ? 6.857   83.945  -4.450  1.00 75.17  ? 162  ILE C CD1   1 
ATOM   7087  N  N     . ILE I  5  163  ? 12.497  85.683  -6.139  1.00 75.68  ? 163  ILE C N     1 
ATOM   7088  C  CA    . ILE I  5  163  ? 13.594  86.614  -5.824  1.00 73.41  ? 163  ILE C CA    1 
ATOM   7089  C  C     . ILE I  5  163  ? 13.386  88.038  -6.431  1.00 71.94  ? 163  ILE C C     1 
ATOM   7090  O  O     . ILE I  5  163  ? 13.449  88.255  -7.641  1.00 71.56  ? 163  ILE C O     1 
ATOM   7091  C  CB    . ILE I  5  163  ? 15.019  85.946  -6.235  1.00 73.13  ? 163  ILE C CB    1 
ATOM   7092  C  CG1   . ILE I  5  163  ? 15.545  86.444  -7.582  1.00 72.49  ? 163  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE I  5  163  ? 14.873  84.418  -6.254  1.00 72.46  ? 163  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE I  5  163  ? 16.550  87.581  -7.454  1.00 71.56  ? 163  ILE C CD1   1 
ATOM   7095  N  N     . PRO I  5  164  ? 13.097  89.028  -5.556  1.00 70.38  ? 164  PRO C N     1 
ATOM   7096  C  CA    . PRO I  5  164  ? 12.892  90.426  -5.952  1.00 68.18  ? 164  PRO C CA    1 
ATOM   7097  C  C     . PRO I  5  164  ? 14.035  91.340  -5.482  1.00 66.69  ? 164  PRO C C     1 
ATOM   7098  O  O     . PRO I  5  164  ? 14.226  91.521  -4.277  1.00 66.98  ? 164  PRO C O     1 
ATOM   7099  C  CB    . PRO I  5  164  ? 11.554  90.800  -5.292  1.00 69.42  ? 164  PRO C CB    1 
ATOM   7100  C  CG    . PRO I  5  164  ? 10.950  89.479  -4.863  1.00 69.68  ? 164  PRO C CG    1 
ATOM   7101  C  CD    . PRO I  5  164  ? 12.181  88.734  -4.438  1.00 70.50  ? 164  PRO C CD    1 
ATOM   7102  N  N     . LEU I  5  165  ? 14.792  91.905  -6.421  1.00 64.47  ? 165  LEU C N     1 
ATOM   7103  C  CA    . LEU I  5  165  ? 15.861  92.859  -6.090  1.00 62.52  ? 165  LEU C CA    1 
ATOM   7104  C  C     . LEU I  5  165  ? 15.402  94.257  -6.480  1.00 61.23  ? 165  LEU C C     1 
ATOM   7105  O  O     . LEU I  5  165  ? 14.659  94.356  -7.450  1.00 61.03  ? 165  LEU C O     1 
ATOM   7106  C  CB    . LEU I  5  165  ? 17.149  92.473  -6.857  1.00 60.70  ? 165  LEU C CB    1 
ATOM   7107  C  CG    . LEU I  5  165  ? 18.522  93.095  -6.576  1.00 59.34  ? 165  LEU C CG    1 
ATOM   7108  C  CD1   . LEU I  5  165  ? 19.152  92.453  -5.362  1.00 58.65  ? 165  LEU C CD1   1 
ATOM   7109  C  CD2   . LEU I  5  165  ? 19.431  92.863  -7.759  1.00 58.44  ? 165  LEU C CD2   1 
ATOM   7110  N  N     . PRO I  5  166  ? 15.793  95.346  -5.770  1.00 60.84  ? 166  PRO C N     1 
ATOM   7111  C  CA    . PRO I  5  166  ? 16.604  95.782  -4.624  1.00 61.67  ? 166  PRO C CA    1 
ATOM   7112  C  C     . PRO I  5  166  ? 16.531  94.862  -3.424  1.00 63.15  ? 166  PRO C C     1 
ATOM   7113  O  O     . PRO I  5  166  ? 15.619  94.055  -3.289  1.00 62.33  ? 166  PRO C O     1 
ATOM   7114  C  CB    . PRO I  5  166  ? 16.053  97.158  -4.309  1.00 60.93  ? 166  PRO C CB    1 
ATOM   7115  C  CG    . PRO I  5  166  ? 15.770  97.673  -5.610  1.00 60.80  ? 166  PRO C CG    1 
ATOM   7116  C  CD    . PRO I  5  166  ? 15.071  96.529  -6.284  1.00 60.73  ? 166  PRO C CD    1 
ATOM   7117  N  N     . LYS I  5  167  ? 17.534  95.036  -2.555  1.00 65.27  ? 167  LYS C N     1 
ATOM   7118  C  CA    . LYS I  5  167  ? 17.673  94.312  -1.285  1.00 67.74  ? 167  LYS C CA    1 
ATOM   7119  C  C     . LYS I  5  167  ? 16.384  94.421  -0.488  1.00 69.55  ? 167  LYS C C     1 
ATOM   7120  O  O     . LYS I  5  167  ? 15.737  93.400  -0.186  1.00 70.21  ? 167  LYS C O     1 
ATOM   7121  C  CB    . LYS I  5  167  ? 18.853  94.898  -0.472  1.00 66.69  ? 167  LYS C CB    1 
ATOM   7122  C  CG    . LYS I  5  167  ? 19.048  94.350  0.980   1.00 64.74  ? 167  LYS C CG    1 
ATOM   7123  C  CD    . LYS I  5  167  ? 20.289  94.990  1.627   1.00 62.00  ? 167  LYS C CD    1 
ATOM   7124  C  CE    . LYS I  5  167  ? 20.669  94.374  2.969   1.00 59.88  ? 167  LYS C CE    1 
ATOM   7125  N  NZ    . LYS I  5  167  ? 22.088  94.691  3.348   1.00 57.67  ? 167  LYS C NZ    1 
ATOM   7126  N  N     . ARG I  5  168  ? 16.020  95.659  -0.134  1.00 70.67  ? 168  ARG C N     1 
ATOM   7127  C  CA    . ARG I  5  168  ? 14.748  95.844  0.516   1.00 71.59  ? 168  ARG C CA    1 
ATOM   7128  C  C     . ARG I  5  168  ? 13.672  95.414  -0.445  1.00 71.92  ? 168  ARG C C     1 
ATOM   7129  O  O     . ARG I  5  168  ? 13.587  95.908  -1.575  1.00 72.07  ? 168  ARG C O     1 
ATOM   7130  C  CB    . ARG I  5  168  ? 14.552  97.307  0.940   1.00 72.01  ? 168  ARG C CB    1 
ATOM   7131  C  CG    . ARG I  5  168  ? 15.388  97.714  2.174   1.00 72.35  ? 168  ARG C CG    1 
ATOM   7132  C  CD    . ARG I  5  168  ? 14.767  97.264  3.526   1.00 72.51  ? 168  ARG C CD    1 
ATOM   7133  N  NE    . ARG I  5  168  ? 15.678  97.418  4.670   1.00 70.98  ? 168  ARG C NE    1 
ATOM   7134  C  CZ    . ARG I  5  168  ? 16.250  98.561  5.043   1.00 70.52  ? 168  ARG C CZ    1 
ATOM   7135  N  NH1   . ARG I  5  168  ? 16.023  99.686  4.375   1.00 70.02  ? 168  ARG C NH1   1 
ATOM   7136  N  NH2   . ARG I  5  168  ? 17.059  98.580  6.093   1.00 69.97  ? 168  ARG C NH2   1 
ATOM   7137  N  N     . GLY I  5  169  ? 12.884  94.463  0.014   1.00 72.31  ? 169  GLY C N     1 
ATOM   7138  C  CA    . GLY I  5  169  ? 11.880  93.845  -0.808  1.00 74.17  ? 169  GLY C CA    1 
ATOM   7139  C  C     . GLY I  5  169  ? 11.969  92.365  -0.541  1.00 75.68  ? 169  GLY C C     1 
ATOM   7140  O  O     . GLY I  5  169  ? 12.973  91.748  -0.912  1.00 75.92  ? 169  GLY C O     1 
ATOM   7141  N  N     . PRO I  5  170  ? 10.947  91.770  0.108   1.00 76.30  ? 170  PRO C N     1 
ATOM   7142  C  CA    . PRO I  5  170  ? 10.813  90.370  0.500   1.00 77.04  ? 170  PRO C CA    1 
ATOM   7143  C  C     . PRO I  5  170  ? 11.495  89.382  -0.438  1.00 78.32  ? 170  PRO C C     1 
ATOM   7144  O  O     . PRO I  5  170  ? 11.816  89.646  -1.595  1.00 78.48  ? 170  PRO C O     1 
ATOM   7145  C  CB    . PRO I  5  170  ? 9.308   90.189  0.596   1.00 76.31  ? 170  PRO C CB    1 
ATOM   7146  C  CG    . PRO I  5  170  ? 8.892   91.454  1.198   1.00 75.32  ? 170  PRO C CG    1 
ATOM   7147  C  CD    . PRO I  5  170  ? 9.652   92.444  0.341   1.00 76.08  ? 170  PRO C CD    1 
ATOM   7148  N  N     . TRP I  5  171  ? 11.696  88.218  0.157   1.00 79.58  ? 171  TRP C N     1 
ATOM   7149  C  CA    . TRP I  5  171  ? 12.285  87.034  -0.430  1.00 80.59  ? 171  TRP C CA    1 
ATOM   7150  C  C     . TRP I  5  171  ? 11.450  85.835  -0.045  1.00 81.03  ? 171  TRP C C     1 
ATOM   7151  O  O     . TRP I  5  171  ? 11.643  85.285  1.038   1.00 81.66  ? 171  TRP C O     1 
ATOM   7152  C  CB    . TRP I  5  171  ? 13.696  86.856  0.104   1.00 80.41  ? 171  TRP C CB    1 
ATOM   7153  C  CG    . TRP I  5  171  ? 14.694  86.546  -0.945  1.00 80.79  ? 171  TRP C CG    1 
ATOM   7154  C  CD1   . TRP I  5  171  ? 14.658  85.515  -1.846  1.00 80.35  ? 171  TRP C CD1   1 
ATOM   7155  C  CD2   . TRP I  5  171  ? 15.909  87.263  -1.195  1.00 81.00  ? 171  TRP C CD2   1 
ATOM   7156  N  NE1   . TRP I  5  171  ? 15.780  85.543  -2.644  1.00 80.76  ? 171  TRP C NE1   1 
ATOM   7157  C  CE2   . TRP I  5  171  ? 16.568  86.604  -2.270  1.00 80.96  ? 171  TRP C CE2   1 
ATOM   7158  C  CE3   . TRP I  5  171  ? 16.514  88.408  -0.610  1.00 80.92  ? 171  TRP C CE3   1 
ATOM   7159  C  CZ2   . TRP I  5  171  ? 17.816  87.049  -2.782  1.00 80.88  ? 171  TRP C CZ2   1 
ATOM   7160  C  CZ3   . TRP I  5  171  ? 17.761  88.861  -1.116  1.00 79.92  ? 171  TRP C CZ3   1 
ATOM   7161  C  CH2   . TRP I  5  171  ? 18.395  88.173  -2.196  1.00 81.07  ? 171  TRP C CH2   1 
ATOM   7162  N  N     . ILE I  5  172  ? 10.529  85.440  -0.921  1.00 81.78  ? 172  ILE C N     1 
ATOM   7163  C  CA    . ILE I  5  172  ? 9.561   84.371  -0.634  1.00 82.10  ? 172  ILE C CA    1 
ATOM   7164  C  C     . ILE I  5  172  ? 10.119  82.958  -0.915  1.00 82.11  ? 172  ILE C C     1 
ATOM   7165  O  O     . ILE I  5  172  ? 10.967  82.769  -1.794  1.00 83.00  ? 172  ILE C O     1 
ATOM   7166  C  CB    . ILE I  5  172  ? 8.259   84.577  -1.484  1.00 82.71  ? 172  ILE C CB    1 
ATOM   7167  C  CG1   . ILE I  5  172  ? 7.737   86.021  -1.340  1.00 83.53  ? 172  ILE C CG1   1 
ATOM   7168  C  CG2   . ILE I  5  172  ? 7.176   83.602  -1.023  1.00 82.92  ? 172  ILE C CG2   1 
ATOM   7169  C  CD1   . ILE I  5  172  ? 8.346   87.056  -2.315  1.00 82.89  ? 172  ILE C CD1   1 
ATOM   7170  N  N     . ASP I  5  173  ? 9.612   81.985  -0.139  1.00 81.11  ? 173  ASP C N     1 
ATOM   7171  C  CA    . ASP I  5  173  ? 9.929   80.546  -0.240  1.00 80.13  ? 173  ASP C CA    1 
ATOM   7172  C  C     . ASP I  5  173  ? 8.648   79.699  0.015   1.00 80.04  ? 173  ASP C C     1 
ATOM   7173  O  O     . ASP I  5  173  ? 7.932   79.969  0.973   1.00 80.47  ? 173  ASP C O     1 
ATOM   7174  C  CB    . ASP I  5  173  ? 11.011  80.107  0.793   1.00 79.06  ? 173  ASP C CB    1 
ATOM   7175  C  CG    . ASP I  5  173  ? 12.222  81.068  0.886   1.00 77.43  ? 173  ASP C CG    1 
ATOM   7176  O  OD1   . ASP I  5  173  ? 12.201  81.961  1.765   1.00 77.65  ? 173  ASP C OD1   1 
ATOM   7177  O  OD2   . ASP I  5  173  ? 13.192  80.932  0.097   1.00 75.29  ? 173  ASP C OD2   1 
ATOM   7178  N  N     . LEU I  5  174  ? 8.353   78.699  -0.822  1.00 79.20  ? 174  LEU C N     1 
ATOM   7179  C  CA    . LEU I  5  174  ? 7.148   77.865  -0.641  1.00 78.13  ? 174  LEU C CA    1 
ATOM   7180  C  C     . LEU I  5  174  ? 7.518   76.376  -0.399  1.00 78.71  ? 174  LEU C C     1 
ATOM   7181  O  O     . LEU I  5  174  ? 7.941   75.682  -1.326  1.00 80.18  ? 174  LEU C O     1 
ATOM   7182  C  CB    . LEU I  5  174  ? 6.231   78.007  -1.883  1.00 75.23  ? 174  LEU C CB    1 
ATOM   7183  C  CG    . LEU I  5  174  ? 5.812   79.459  -2.194  1.00 73.27  ? 174  LEU C CG    1 
ATOM   7184  C  CD1   . LEU I  5  174  ? 6.702   80.027  -3.278  1.00 72.57  ? 174  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU I  5  174  ? 4.377   79.514  -2.640  1.00 71.08  ? 174  LEU C CD2   1 
ATOM   7186  N  N     . GLU I  5  175  ? 7.351   75.900  0.846   1.00 78.65  ? 175  GLU C N     1 
ATOM   7187  C  CA    . GLU I  5  175  ? 7.678   74.516  1.235   1.00 77.36  ? 175  GLU C CA    1 
ATOM   7188  C  C     . GLU I  5  175  ? 6.505   73.828  1.964   1.00 77.66  ? 175  GLU C C     1 
ATOM   7189  O  O     . GLU I  5  175  ? 5.912   74.411  2.875   1.00 77.40  ? 175  GLU C O     1 
ATOM   7190  C  CB    . GLU I  5  175  ? 8.915   74.510  2.153   1.00 76.10  ? 175  GLU C CB    1 
ATOM   7191  C  CG    . GLU I  5  175  ? 8.993   73.273  3.077   1.00 72.89  ? 175  GLU C CG    1 
ATOM   7192  C  CD    . GLU I  5  175  ? 10.308  73.117  3.801   1.00 70.71  ? 175  GLU C CD    1 
ATOM   7193  O  OE1   . GLU I  5  175  ? 10.746  74.051  4.511   1.00 68.45  ? 175  GLU C OE1   1 
ATOM   7194  O  OE2   . GLU I  5  175  ? 10.899  72.031  3.650   1.00 69.62  ? 175  GLU C OE2   1 
ATOM   7195  N  N     . VAL I  5  176  ? 6.191   72.588  1.574   1.00 77.90  ? 176  VAL C N     1 
ATOM   7196  C  CA    . VAL I  5  176  ? 5.093   71.845  2.207   1.00 78.25  ? 176  VAL C CA    1 
ATOM   7197  C  C     . VAL I  5  176  ? 5.605   70.683  3.074   1.00 79.27  ? 176  VAL C C     1 
ATOM   7198  O  O     . VAL I  5  176  ? 6.274   69.772  2.584   1.00 78.60  ? 176  VAL C O     1 
ATOM   7199  C  CB    . VAL I  5  176  ? 4.101   71.234  1.157   1.00 77.19  ? 176  VAL C CB    1 
ATOM   7200  C  CG1   . VAL I  5  176  ? 3.248   72.331  0.525   1.00 75.11  ? 176  VAL C CG1   1 
ATOM   7201  C  CG2   . VAL I  5  176  ? 4.882   70.478  0.094   1.00 76.99  ? 176  VAL C CG2   1 
ATOM   7202  N  N     . GLU I  5  177  ? 5.279   70.735  4.368   1.00 81.34  ? 177  GLU C N     1 
ATOM   7203  C  CA    . GLU I  5  177  ? 5.609   69.672  5.331   1.00 83.22  ? 177  GLU C CA    1 
ATOM   7204  C  C     . GLU I  5  177  ? 4.293   69.101  5.978   1.00 85.21  ? 177  GLU C C     1 
ATOM   7205  O  O     . GLU I  5  177  ? 4.049   69.303  7.167   1.00 85.70  ? 177  GLU C O     1 
ATOM   7206  C  CB    . GLU I  5  177  ? 6.567   70.219  6.411   1.00 81.45  ? 177  GLU C CB    1 
ATOM   7207  C  CG    . GLU I  5  177  ? 7.903   69.456  6.463   1.00 78.57  ? 177  GLU C CG    1 
ATOM   7208  C  CD    . GLU I  5  177  ? 7.752   67.987  6.865   1.00 76.22  ? 177  GLU C CD    1 
ATOM   7209  O  OE1   . GLU I  5  177  ? 7.962   67.670  8.056   1.00 74.42  ? 177  GLU C OE1   1 
ATOM   7210  O  OE2   . GLU I  5  177  ? 7.421   67.153  5.992   1.00 74.88  ? 177  GLU C OE2   1 
ATOM   7211  N  N     . PRO I  5  178  ? 3.446   68.380  5.176   1.00 87.03  ? 178  PRO C N     1 
ATOM   7212  C  CA    . PRO I  5  178  ? 2.140   67.680  5.261   1.00 88.35  ? 178  PRO C CA    1 
ATOM   7213  C  C     . PRO I  5  178  ? 1.699   67.116  6.650   1.00 89.83  ? 178  PRO C C     1 
ATOM   7214  O  O     . PRO I  5  178  ? 0.495   66.838  6.732   1.00 89.79  ? 178  PRO C O     1 
ATOM   7215  C  CB    . PRO I  5  178  ? 2.259   66.602  4.197   1.00 88.53  ? 178  PRO C CB    1 
ATOM   7216  C  CG    . PRO I  5  178  ? 2.908   67.333  3.128   1.00 88.43  ? 178  PRO C CG    1 
ATOM   7217  C  CD    . PRO I  5  178  ? 4.055   67.972  3.882   1.00 87.79  ? 178  PRO C CD    1 
ATOM   7218  N  N     . ASN I  5  179  ? 2.502   66.911  7.709   1.00 91.13  ? 179  ASN C N     1 
ATOM   7219  C  CA    . ASN I  5  179  ? 1.849   66.357  8.937   1.00 92.46  ? 179  ASN C CA    1 
ATOM   7220  C  C     . ASN I  5  179  ? 0.804   67.334  9.503   1.00 91.79  ? 179  ASN C C     1 
ATOM   7221  O  O     . ASN I  5  179  ? -0.048  66.968  10.334  1.00 91.54  ? 179  ASN C O     1 
ATOM   7222  C  CB    . ASN I  5  179  ? 2.842   66.017  10.076  1.00 94.22  ? 179  ASN C CB    1 
ATOM   7223  C  CG    . ASN I  5  179  ? 2.144   65.276  11.252  1.00 95.69  ? 179  ASN C CG    1 
ATOM   7224  O  OD1   . ASN I  5  179  ? 1.432   65.892  12.061  1.00 95.73  ? 179  ASN C OD1   1 
ATOM   7225  N  ND2   . ASN I  5  179  ? 2.342   63.951  11.331  1.00 95.84  ? 179  ASN C ND2   1 
ATOM   7226  N  N     . GLY I  5  180  ? 0.876   68.579  9.033   1.00 91.49  ? 180  GLY C N     1 
ATOM   7227  C  CA    . GLY I  5  180  ? -0.070  69.594  9.452   1.00 90.69  ? 180  GLY C CA    1 
ATOM   7228  C  C     . GLY I  5  180  ? 0.301   71.023  9.061   1.00 89.85  ? 180  GLY C C     1 
ATOM   7229  O  O     . GLY I  5  180  ? -0.432  71.939  9.436   1.00 90.67  ? 180  GLY C O     1 
ATOM   7230  N  N     . VAL I  5  181  ? 1.391   71.258  8.323   1.00 88.12  ? 181  VAL C N     1 
ATOM   7231  C  CA    . VAL I  5  181  ? 1.746   72.646  8.006   1.00 85.85  ? 181  VAL C CA    1 
ATOM   7232  C  C     . VAL I  5  181  ? 2.362   72.794  6.615   1.00 85.46  ? 181  VAL C C     1 
ATOM   7233  O  O     . VAL I  5  181  ? 2.900   71.852  6.032   1.00 85.28  ? 181  VAL C O     1 
ATOM   7234  C  CB    . VAL I  5  181  ? 2.792   73.242  9.003   1.00 84.95  ? 181  VAL C CB    1 
ATOM   7235  C  CG1   . VAL I  5  181  ? 2.708   74.756  8.968   1.00 84.29  ? 181  VAL C CG1   1 
ATOM   7236  C  CG2   . VAL I  5  181  ? 2.568   72.726  10.410  1.00 83.90  ? 181  VAL C CG2   1 
ATOM   7237  N  N     . VAL I  5  182  ? 2.250   74.028  6.120   1.00 84.85  ? 182  VAL C N     1 
ATOM   7238  C  CA    . VAL I  5  182  ? 2.821   74.517  4.862   1.00 83.72  ? 182  VAL C CA    1 
ATOM   7239  C  C     . VAL I  5  182  ? 3.619   75.764  5.153   1.00 82.92  ? 182  VAL C C     1 
ATOM   7240  O  O     . VAL I  5  182  ? 3.295   76.450  6.123   1.00 82.57  ? 182  VAL C O     1 
ATOM   7241  C  CB    . VAL I  5  182  ? 1.735   74.831  3.843   1.00 83.26  ? 182  VAL C CB    1 
ATOM   7242  C  CG1   . VAL I  5  182  ? 2.278   74.804  2.442   1.00 82.72  ? 182  VAL C CG1   1 
ATOM   7243  C  CG2   . VAL I  5  182  ? 0.742   73.781  3.917   1.00 83.55  ? 182  VAL C CG2   1 
ATOM   7244  N  N     . SER I  5  183  ? 4.635   76.092  4.363   1.00 82.10  ? 183  SER C N     1 
ATOM   7245  C  CA    . SER I  5  183  ? 5.468   77.210  4.779   1.00 81.33  ? 183  SER C CA    1 
ATOM   7246  C  C     . SER I  5  183  ? 5.808   78.179  3.650   1.00 81.67  ? 183  SER C C     1 
ATOM   7247  O  O     . SER I  5  183  ? 6.438   77.791  2.674   1.00 82.48  ? 183  SER C O     1 
ATOM   7248  C  CB    . SER I  5  183  ? 6.747   76.633  5.394   1.00 80.31  ? 183  SER C CB    1 
ATOM   7249  O  OG    . SER I  5  183  ? 7.890   77.377  5.045   1.00 79.70  ? 183  SER C OG    1 
ATOM   7250  N  N     . MET I  5  184  ? 5.374   79.438  3.813   1.00 81.99  ? 184  MET C N     1 
ATOM   7251  C  CA    . MET I  5  184  ? 5.688   80.574  2.912   1.00 82.03  ? 184  MET C CA    1 
ATOM   7252  C  C     . MET I  5  184  ? 6.386   81.686  3.719   1.00 82.99  ? 184  MET C C     1 
ATOM   7253  O  O     . MET I  5  184  ? 5.758   82.342  4.556   1.00 82.79  ? 184  MET C O     1 
ATOM   7254  C  CB    . MET I  5  184  ? 4.420   81.144  2.272   1.00 80.74  ? 184  MET C CB    1 
ATOM   7255  C  CG    . MET I  5  184  ? 4.672   82.035  1.072   1.00 79.23  ? 184  MET C CG    1 
ATOM   7256  S  SD    . MET I  5  184  ? 3.785   83.572  1.220   1.00 79.64  ? 184  MET C SD    1 
ATOM   7257  C  CE    . MET I  5  184  ? 5.126   84.735  1.302   1.00 78.77  ? 184  MET C CE    1 
ATOM   7258  N  N     . LYS I  5  185  ? 7.678   81.898  3.466   1.00 84.32  ? 185  LYS C N     1 
ATOM   7259  C  CA    . LYS I  5  185  ? 8.466   82.827  4.280   1.00 85.45  ? 185  LYS C CA    1 
ATOM   7260  C  C     . LYS I  5  185  ? 8.840   84.105  3.533   1.00 86.32  ? 185  LYS C C     1 
ATOM   7261  O  O     . LYS I  5  185  ? 9.524   84.047  2.515   1.00 87.58  ? 185  LYS C O     1 
ATOM   7262  C  CB    . LYS I  5  185  ? 9.767   82.123  4.768   1.00 84.01  ? 185  LYS C CB    1 
ATOM   7263  C  CG    . LYS I  5  185  ? 9.697   80.573  4.866   1.00 82.95  ? 185  LYS C CG    1 
ATOM   7264  C  CD    . LYS I  5  185  ? 10.859  79.919  5.650   1.00 82.26  ? 185  LYS C CD    1 
ATOM   7265  C  CE    . LYS I  5  185  ? 10.986  78.413  5.330   1.00 81.19  ? 185  LYS C CE    1 
ATOM   7266  N  NZ    . LYS I  5  185  ? 11.962  77.670  6.190   1.00 79.16  ? 185  LYS C NZ    1 
ATOM   7267  N  N     . VAL I  5  186  ? 8.384   85.253  4.052   1.00 87.24  ? 186  VAL C N     1 
ATOM   7268  C  CA    . VAL I  5  186  ? 8.768   86.558  3.502   1.00 86.37  ? 186  VAL C CA    1 
ATOM   7269  C  C     . VAL I  5  186  ? 10.136  86.981  4.083   1.00 86.87  ? 186  VAL C C     1 
ATOM   7270  O  O     . VAL I  5  186  ? 11.151  86.895  3.381   1.00 88.28  ? 186  VAL C O     1 
ATOM   7271  C  CB    . VAL I  5  186  ? 7.681   87.652  3.795   1.00 85.92  ? 186  VAL C CB    1 
ATOM   7272  C  CG1   . VAL I  5  186  ? 6.479   87.389  2.922   1.00 84.71  ? 186  VAL C CG1   1 
ATOM   7273  C  CG2   . VAL I  5  186  ? 7.250   87.635  5.253   1.00 85.87  ? 186  VAL C CG2   1 
ATOM   7274  N  N     . ASN I  5  187  ? 10.191  87.423  5.344   1.00 86.28  ? 187  ASN C N     1 
ATOM   7275  C  CA    . ASN I  5  187  ? 11.486  87.732  5.967   1.00 85.52  ? 187  ASN C CA    1 
ATOM   7276  C  C     . ASN I  5  187  ? 12.058  86.491  6.657   1.00 85.10  ? 187  ASN C C     1 
ATOM   7277  O  O     . ASN I  5  187  ? 13.268  86.242  6.590   1.00 85.53  ? 187  ASN C O     1 
ATOM   7278  C  CB    . ASN I  5  187  ? 11.367  88.862  7.006   1.00 83.74  ? 187  ASN C CB    1 
ATOM   7279  C  CG    . ASN I  5  187  ? 12.281  88.652  8.231   1.00 82.45  ? 187  ASN C CG    1 
ATOM   7280  O  OD1   . ASN I  5  187  ? 11.803  88.478  9.352   1.00 81.34  ? 187  ASN C OD1   1 
ATOM   7281  N  ND2   . ASN I  5  187  ? 13.592  88.668  8.012   1.00 82.50  ? 187  ASN C ND2   1 
ATOM   7282  N  N     . LYS I  5  188  ? 11.187  85.717  7.317   1.00 85.44  ? 188  LYS C N     1 
ATOM   7283  C  CA    . LYS I  5  188  ? 11.631  84.497  8.000   1.00 84.15  ? 188  LYS C CA    1 
ATOM   7284  C  C     . LYS I  5  188  ? 10.458  83.590  8.418   1.00 83.96  ? 188  LYS C C     1 
ATOM   7285  O  O     . LYS I  5  188  ? 10.228  82.570  7.760   1.00 84.09  ? 188  LYS C O     1 
ATOM   7286  C  CB    . LYS I  5  188  ? 12.469  84.844  9.243   1.00 83.78  ? 188  LYS C CB    1 
ATOM   7287  C  CG    . LYS I  5  188  ? 13.948  84.425  9.172   1.00 82.01  ? 188  LYS C CG    1 
ATOM   7288  C  CD    . LYS I  5  188  ? 14.751  84.990  10.346  1.00 80.70  ? 188  LYS C CD    1 
ATOM   7289  C  CE    . LYS I  5  188  ? 14.915  86.520  10.269  1.00 79.31  ? 188  LYS C CE    1 
ATOM   7290  N  NZ    . LYS I  5  188  ? 15.640  86.991  9.051   1.00 77.41  ? 188  LYS C NZ    1 
ATOM   7291  N  N     . ARG I  5  189  ? 9.724   83.941  9.482   1.00 83.16  ? 189  ARG C N     1 
ATOM   7292  C  CA    . ARG I  5  189  ? 8.664   83.054  9.981   1.00 81.88  ? 189  ARG C CA    1 
ATOM   7293  C  C     . ARG I  5  189  ? 7.550   82.838  8.979   1.00 81.90  ? 189  ARG C C     1 
ATOM   7294  O  O     . ARG I  5  189  ? 6.960   83.761  8.384   1.00 81.38  ? 189  ARG C O     1 
ATOM   7295  C  CB    . ARG I  5  189  ? 8.053   83.553  11.301  1.00 81.48  ? 189  ARG C CB    1 
ATOM   7296  C  CG    . ARG I  5  189  ? 6.968   82.610  11.927  1.00 80.45  ? 189  ARG C CG    1 
ATOM   7297  C  CD    . ARG I  5  189  ? 7.355   81.125  11.927  1.00 79.57  ? 189  ARG C CD    1 
ATOM   7298  N  NE    . ARG I  5  189  ? 8.729   80.946  12.372  1.00 80.84  ? 189  ARG C NE    1 
ATOM   7299  C  CZ    . ARG I  5  189  ? 9.458   79.853  12.163  1.00 81.61  ? 189  ARG C CZ    1 
ATOM   7300  N  NH1   . ARG I  5  189  ? 8.940   78.820  11.506  1.00 81.43  ? 189  ARG C NH1   1 
ATOM   7301  N  NH2   . ARG I  5  189  ? 10.711  79.801  12.610  1.00 82.12  ? 189  ARG C NH2   1 
ATOM   7302  N  N     . LYS I  5  190  ? 7.287   81.542  8.844   1.00 81.89  ? 190  LYS C N     1 
ATOM   7303  C  CA    . LYS I  5  190  ? 6.294   80.976  7.964   1.00 81.48  ? 190  LYS C CA    1 
ATOM   7304  C  C     . LYS I  5  190  ? 4.903   81.228  8.466   1.00 81.17  ? 190  LYS C C     1 
ATOM   7305  O  O     . LYS I  5  190  ? 4.607   81.225  9.663   1.00 82.05  ? 190  LYS C O     1 
ATOM   7306  C  CB    . LYS I  5  190  ? 6.432   79.446  7.847   1.00 80.18  ? 190  LYS C CB    1 
ATOM   7307  C  CG    . LYS I  5  190  ? 7.844   78.907  7.726   1.00 78.30  ? 190  LYS C CG    1 
ATOM   7308  C  CD    . LYS I  5  190  ? 8.040   77.721  8.636   1.00 75.97  ? 190  LYS C CD    1 
ATOM   7309  C  CE    . LYS I  5  190  ? 9.395   77.113  8.401   1.00 75.18  ? 190  LYS C CE    1 
ATOM   7310  N  NZ    . LYS I  5  190  ? 9.453   76.459  7.072   1.00 73.05  ? 190  LYS C NZ    1 
ATOM   7311  N  N     . PHE I  5  191  ? 4.067   81.439  7.476   1.00 79.88  ? 191  PHE C N     1 
ATOM   7312  C  CA    . PHE I  5  191  ? 2.646   81.560  7.587   1.00 78.34  ? 191  PHE C CA    1 
ATOM   7313  C  C     . PHE I  5  191  ? 2.050   80.783  6.437   1.00 77.26  ? 191  PHE C C     1 
ATOM   7314  O  O     . PHE I  5  191  ? 2.709   79.825  5.990   1.00 77.51  ? 191  PHE C O     1 
ATOM   7315  C  CB    . PHE I  5  191  ? 2.217   83.051  7.589   1.00 77.46  ? 191  PHE C CB    1 
ATOM   7316  C  CG    . PHE I  5  191  ? 2.745   83.864  6.443   1.00 76.26  ? 191  PHE C CG    1 
ATOM   7317  C  CD1   . PHE I  5  191  ? 4.116   84.166  6.333   1.00 75.93  ? 191  PHE C CD1   1 
ATOM   7318  C  CD2   . PHE I  5  191  ? 1.860   84.349  5.461   1.00 76.51  ? 191  PHE C CD2   1 
ATOM   7319  C  CE1   . PHE I  5  191  ? 4.607   84.950  5.248   1.00 75.97  ? 191  PHE C CE1   1 
ATOM   7320  C  CE2   . PHE I  5  191  ? 2.329   85.133  4.369   1.00 76.15  ? 191  PHE C CE2   1 
ATOM   7321  C  CZ    . PHE I  5  191  ? 3.705   85.434  4.262   1.00 75.61  ? 191  PHE C CZ    1 
ATOM   7322  N  N     . PRO I  5  192  ? 0.851   81.109  5.956   1.00 76.05  ? 192  PRO C N     1 
ATOM   7323  C  CA    . PRO I  5  192  ? 0.723   80.123  4.885   1.00 74.67  ? 192  PRO C CA    1 
ATOM   7324  C  C     . PRO I  5  192  ? 1.116   80.690  3.542   1.00 72.73  ? 192  PRO C C     1 
ATOM   7325  O  O     . PRO I  5  192  ? 1.436   81.870  3.389   1.00 73.04  ? 192  PRO C O     1 
ATOM   7326  C  CB    . PRO I  5  192  ? -0.737  79.691  4.965   1.00 75.28  ? 192  PRO C CB    1 
ATOM   7327  C  CG    . PRO I  5  192  ? -1.071  79.893  6.409   1.00 76.10  ? 192  PRO C CG    1 
ATOM   7328  C  CD    . PRO I  5  192  ? -0.432  81.240  6.665   1.00 76.45  ? 192  PRO C CD    1 
ATOM   7329  N  N     . LEU I  5  193  ? 1.116   79.802  2.571   1.00 71.08  ? 193  LEU C N     1 
ATOM   7330  C  CA    . LEU I  5  193  ? 1.335   80.194  1.211   1.00 69.24  ? 193  LEU C CA    1 
ATOM   7331  C  C     . LEU I  5  193  ? 0.016   80.618  0.650   1.00 69.18  ? 193  LEU C C     1 
ATOM   7332  O  O     . LEU I  5  193  ? -0.089  81.252  -0.380  1.00 70.01  ? 193  LEU C O     1 
ATOM   7333  C  CB    . LEU I  5  193  ? 1.834   79.026  0.382   1.00 67.53  ? 193  LEU C CB    1 
ATOM   7334  C  CG    . LEU I  5  193  ? 3.027   78.179  0.775   1.00 66.56  ? 193  LEU C CG    1 
ATOM   7335  C  CD1   . LEU I  5  193  ? 3.056   77.835  2.240   1.00 65.18  ? 193  LEU C CD1   1 
ATOM   7336  C  CD2   . LEU I  5  193  ? 2.931   76.944  -0.063  1.00 65.84  ? 193  LEU C CD2   1 
ATOM   7337  N  N     . VAL I  5  194  ? -0.999  80.218  1.409   1.00 69.00  ? 194  VAL C N     1 
ATOM   7338  C  CA    . VAL I  5  194  ? -2.390  80.454  1.101   1.00 68.35  ? 194  VAL C CA    1 
ATOM   7339  C  C     . VAL I  5  194  ? -2.909  81.706  1.780   1.00 68.88  ? 194  VAL C C     1 
ATOM   7340  O  O     . VAL I  5  194  ? -3.803  82.344  1.226   1.00 69.54  ? 194  VAL C O     1 
ATOM   7341  C  CB    . VAL I  5  194  ? -3.268  79.301  1.547   1.00 67.62  ? 194  VAL C CB    1 
ATOM   7342  C  CG1   . VAL I  5  194  ? -4.216  78.955  0.428   1.00 67.44  ? 194  VAL C CG1   1 
ATOM   7343  C  CG2   . VAL I  5  194  ? -2.433  78.114  1.914   1.00 67.86  ? 194  VAL C CG2   1 
ATOM   7344  N  N     . LEU I  5  195  ? -2.383  82.060  2.962   1.00 70.12  ? 195  LEU C N     1 
ATOM   7345  C  CA    . LEU I  5  195  ? -2.822  83.294  3.656   1.00 70.39  ? 195  LEU C CA    1 
ATOM   7346  C  C     . LEU I  5  195  ? -2.614  84.502  2.760   1.00 71.05  ? 195  LEU C C     1 
ATOM   7347  O  O     . LEU I  5  195  ? -3.305  85.514  2.870   1.00 70.47  ? 195  LEU C O     1 
ATOM   7348  C  CB    . LEU I  5  195  ? -2.042  83.523  4.975   1.00 69.46  ? 195  LEU C CB    1 
ATOM   7349  C  CG    . LEU I  5  195  ? -2.436  84.604  6.013   1.00 68.36  ? 195  LEU C CG    1 
ATOM   7350  C  CD1   . LEU I  5  195  ? -3.787  84.283  6.650   1.00 67.89  ? 195  LEU C CD1   1 
ATOM   7351  C  CD2   . LEU I  5  195  ? -1.372  84.671  7.094   1.00 66.56  ? 195  LEU C CD2   1 
ATOM   7352  N  N     . LEU I  5  196  ? -1.637  84.367  1.871   1.00 72.17  ? 196  LEU C N     1 
ATOM   7353  C  CA    . LEU I  5  196  ? -1.324  85.395  0.901   1.00 74.33  ? 196  LEU C CA    1 
ATOM   7354  C  C     . LEU I  5  196  ? -2.238  85.271  -0.343  1.00 75.55  ? 196  LEU C C     1 
ATOM   7355  O  O     . LEU I  5  196  ? -2.771  86.279  -0.826  1.00 76.88  ? 196  LEU C O     1 
ATOM   7356  C  CB    . LEU I  5  196  ? 0.161   85.289  0.516   1.00 74.18  ? 196  LEU C CB    1 
ATOM   7357  C  CG    . LEU I  5  196  ? 0.866   86.649  0.624   1.00 74.82  ? 196  LEU C CG    1 
ATOM   7358  C  CD1   . LEU I  5  196  ? 2.276   86.464  1.119   1.00 74.48  ? 196  LEU C CD1   1 
ATOM   7359  C  CD2   . LEU I  5  196  ? 0.832   87.348  -0.736  1.00 74.79  ? 196  LEU C CD2   1 
ATOM   7360  N  N     . LEU I  5  197  ? -2.423  84.044  -0.854  1.00 75.65  ? 197  LEU C N     1 
ATOM   7361  C  CA    . LEU I  5  197  ? -3.304  83.800  -2.005  1.00 75.19  ? 197  LEU C CA    1 
ATOM   7362  C  C     . LEU I  5  197  ? -4.715  84.312  -1.729  1.00 75.93  ? 197  LEU C C     1 
ATOM   7363  O  O     . LEU I  5  197  ? -5.351  84.916  -2.592  1.00 76.17  ? 197  LEU C O     1 
ATOM   7364  C  CB    . LEU I  5  197  ? -3.403  82.304  -2.310  1.00 74.07  ? 197  LEU C CB    1 
ATOM   7365  C  CG    . LEU I  5  197  ? -2.141  81.578  -2.737  1.00 73.55  ? 197  LEU C CG    1 
ATOM   7366  C  CD1   . LEU I  5  197  ? -2.335  80.115  -2.488  1.00 73.24  ? 197  LEU C CD1   1 
ATOM   7367  C  CD2   . LEU I  5  197  ? -1.846  81.858  -4.188  1.00 73.18  ? 197  LEU C CD2   1 
ATOM   7368  N  N     . ARG I  5  198  ? -5.190  84.064  -0.509  1.00 75.65  ? 198  ARG C N     1 
ATOM   7369  C  CA    . ARG I  5  198  ? -6.528  84.472  -0.090  1.00 76.57  ? 198  ARG C CA    1 
ATOM   7370  C  C     . ARG I  5  198  ? -6.673  86.007  -0.042  1.00 75.85  ? 198  ARG C C     1 
ATOM   7371  O  O     . ARG I  5  198  ? -7.755  86.531  -0.325  1.00 76.23  ? 198  ARG C O     1 
ATOM   7372  C  CB    . ARG I  5  198  ? -6.845  83.851  1.284   1.00 77.14  ? 198  ARG C CB    1 
ATOM   7373  C  CG    . ARG I  5  198  ? -6.853  82.310  1.257   1.00 78.49  ? 198  ARG C CG    1 
ATOM   7374  C  CD    . ARG I  5  198  ? -8.249  81.667  1.490   1.00 80.32  ? 198  ARG C CD    1 
ATOM   7375  N  NE    . ARG I  5  198  ? -9.391  82.369  0.879   1.00 81.92  ? 198  ARG C NE    1 
ATOM   7376  C  CZ    . ARG I  5  198  ? -10.592 81.826  0.632   1.00 82.79  ? 198  ARG C CZ    1 
ATOM   7377  N  NH1   . ARG I  5  198  ? -10.845 80.550  0.928   1.00 82.36  ? 198  ARG C NH1   1 
ATOM   7378  N  NH2   . ARG I  5  198  ? -11.559 82.568  0.094   1.00 82.84  ? 198  ARG C NH2   1 
ATOM   7379  N  N     . VAL I  5  199  ? -5.600  86.724  0.307   1.00 75.14  ? 199  VAL C N     1 
ATOM   7380  C  CA    . VAL I  5  199  ? -5.641  88.200  0.367   1.00 74.28  ? 199  VAL C CA    1 
ATOM   7381  C  C     . VAL I  5  199  ? -5.853  88.792  -1.023  1.00 74.10  ? 199  VAL C C     1 
ATOM   7382  O  O     . VAL I  5  199  ? -6.636  89.725  -1.209  1.00 74.73  ? 199  VAL C O     1 
ATOM   7383  C  CB    . VAL I  5  199  ? -4.307  88.825  0.961   1.00 73.32  ? 199  VAL C CB    1 
ATOM   7384  C  CG1   . VAL I  5  199  ? -4.291  90.356  0.763   1.00 71.14  ? 199  VAL C CG1   1 
ATOM   7385  C  CG2   . VAL I  5  199  ? -4.207  88.544  2.452   1.00 72.79  ? 199  VAL C CG2   1 
ATOM   7386  N  N     . LEU I  5  200  ? -5.149  88.227  -1.991  1.00 72.97  ? 200  LEU C N     1 
ATOM   7387  C  CA    . LEU I  5  200  ? -5.210  88.688  -3.360  1.00 72.96  ? 200  LEU C CA    1 
ATOM   7388  C  C     . LEU I  5  200  ? -6.535  88.301  -4.018  1.00 73.52  ? 200  LEU C C     1 
ATOM   7389  O  O     . LEU I  5  200  ? -7.015  89.007  -4.908  1.00 73.55  ? 200  LEU C O     1 
ATOM   7390  C  CB    . LEU I  5  200  ? -4.012  88.104  -4.103  1.00 73.21  ? 200  LEU C CB    1 
ATOM   7391  C  CG    . LEU I  5  200  ? -2.717  88.396  -3.315  1.00 72.83  ? 200  LEU C CG    1 
ATOM   7392  C  CD1   . LEU I  5  200  ? -1.709  87.277  -3.487  1.00 73.12  ? 200  LEU C CD1   1 
ATOM   7393  C  CD2   . LEU I  5  200  ? -2.146  89.716  -3.783  1.00 73.79  ? 200  LEU C CD2   1 
ATOM   7394  N  N     . GLY I  5  201  ? -7.125  87.190  -3.580  1.00 74.51  ? 201  GLY C N     1 
ATOM   7395  C  CA    . GLY I  5  201  ? -8.400  86.778  -4.145  1.00 75.83  ? 201  GLY C CA    1 
ATOM   7396  C  C     . GLY I  5  201  ? -8.543  85.294  -4.471  1.00 76.95  ? 201  GLY C C     1 
ATOM   7397  O  O     . GLY I  5  201  ? -9.589  84.922  -4.985  1.00 76.93  ? 201  GLY C O     1 
ATOM   7398  N  N     . TYR I  5  202  ? -7.545  84.448  -4.188  1.00 78.41  ? 202  TYR C N     1 
ATOM   7399  C  CA    . TYR I  5  202  ? -7.638  82.999  -4.497  1.00 79.69  ? 202  TYR C CA    1 
ATOM   7400  C  C     . TYR I  5  202  ? -8.203  82.194  -3.325  1.00 79.09  ? 202  TYR C C     1 
ATOM   7401  O  O     . TYR I  5  202  ? -7.522  81.995  -2.311  1.00 78.48  ? 202  TYR C O     1 
ATOM   7402  C  CB    . TYR I  5  202  ? -6.259  82.429  -4.871  1.00 80.83  ? 202  TYR C CB    1 
ATOM   7403  C  CG    . TYR I  5  202  ? -5.552  83.313  -5.837  1.00 82.24  ? 202  TYR C CG    1 
ATOM   7404  C  CD1   . TYR I  5  202  ? -6.221  83.800  -6.980  1.00 82.48  ? 202  TYR C CD1   1 
ATOM   7405  C  CD2   . TYR I  5  202  ? -4.229  83.729  -5.601  1.00 82.95  ? 202  TYR C CD2   1 
ATOM   7406  C  CE1   . TYR I  5  202  ? -5.590  84.693  -7.869  1.00 83.65  ? 202  TYR C CE1   1 
ATOM   7407  C  CE2   . TYR I  5  202  ? -3.580  84.628  -6.486  1.00 82.74  ? 202  TYR C CE2   1 
ATOM   7408  C  CZ    . TYR I  5  202  ? -4.271  85.102  -7.615  1.00 83.46  ? 202  TYR C CZ    1 
ATOM   7409  O  OH    . TYR I  5  202  ? -3.662  85.976  -8.478  1.00 84.27  ? 202  TYR C OH    1 
ATOM   7410  N  N     . ASP I  5  203  ? -9.451  81.736  -3.496  1.00 78.76  ? 203  ASP C N     1 
ATOM   7411  C  CA    . ASP I  5  203  ? -10.189 80.931  -2.505  1.00 78.26  ? 203  ASP C CA    1 
ATOM   7412  C  C     . ASP I  5  203  ? -9.683  79.469  -2.501  1.00 77.43  ? 203  ASP C C     1 
ATOM   7413  O  O     . ASP I  5  203  ? -9.131  79.007  -3.497  1.00 78.22  ? 203  ASP C O     1 
ATOM   7414  C  CB    . ASP I  5  203  ? -11.713 80.898  -2.808  1.00 79.32  ? 203  ASP C CB    1 
ATOM   7415  C  CG    . ASP I  5  203  ? -12.410 82.265  -2.740  1.00 80.67  ? 203  ASP C CG    1 
ATOM   7416  O  OD1   . ASP I  5  203  ? -13.657 82.285  -2.880  1.00 80.82  ? 203  ASP C OD1   1 
ATOM   7417  O  OD2   . ASP I  5  203  ? -11.746 83.302  -2.548  1.00 81.84  ? 203  ASP C OD2   1 
ATOM   7418  N  N     . GLN I  5  204  ? -9.890  78.751  -1.394  1.00 75.56  ? 204  GLN C N     1 
ATOM   7419  C  CA    . GLN I  5  204  ? -9.429  77.368  -1.241  1.00 73.01  ? 204  GLN C CA    1 
ATOM   7420  C  C     . GLN I  5  204  ? -10.024 76.435  -2.281  1.00 72.09  ? 204  GLN C C     1 
ATOM   7421  O  O     . GLN I  5  204  ? -9.321  75.570  -2.805  1.00 72.61  ? 204  GLN C O     1 
ATOM   7422  C  CB    . GLN I  5  204  ? -9.766  76.876  0.157   1.00 72.04  ? 204  GLN C CB    1 
ATOM   7423  C  CG    . GLN I  5  204  ? -9.019  77.679  1.181   1.00 71.70  ? 204  GLN C CG    1 
ATOM   7424  C  CD    . GLN I  5  204  ? -7.555  77.867  0.798   1.00 71.57  ? 204  GLN C CD    1 
ATOM   7425  O  OE1   . GLN I  5  204  ? -6.755  76.956  0.923   1.00 70.97  ? 204  GLN C OE1   1 
ATOM   7426  N  NE2   . GLN I  5  204  ? -7.212  79.053  0.320   1.00 71.09  ? 204  GLN C NE2   1 
ATOM   7427  N  N     . GLU I  5  205  ? -11.309 76.600  -2.586  1.00 71.22  ? 205  GLU C N     1 
ATOM   7428  C  CA    . GLU I  5  205  ? -11.982 75.753  -3.586  1.00 69.66  ? 205  GLU C CA    1 
ATOM   7429  C  C     . GLU I  5  205  ? -11.344 75.888  -5.006  1.00 70.42  ? 205  GLU C C     1 
ATOM   7430  O  O     . GLU I  5  205  ? -10.682 74.951  -5.473  1.00 69.69  ? 205  GLU C O     1 
ATOM   7431  C  CB    . GLU I  5  205  ? -13.498 76.094  -3.648  1.00 66.55  ? 205  GLU C CB    1 
ATOM   7432  C  CG    . GLU I  5  205  ? -13.928 77.586  -3.370  1.00 60.86  ? 205  GLU C CG    1 
ATOM   7433  C  CD    . GLU I  5  205  ? -14.054 78.486  -4.612  1.00 56.71  ? 205  GLU C CD    1 
ATOM   7434  O  OE1   . GLU I  5  205  ? -14.454 78.001  -5.693  1.00 54.04  ? 205  GLU C OE1   1 
ATOM   7435  O  OE2   . GLU I  5  205  ? -13.759 79.693  -4.493  1.00 53.45  ? 205  GLU C OE2   1 
ATOM   7436  N  N     . THR I  5  206  ? -11.538 77.034  -5.675  1.00 70.52  ? 206  THR C N     1 
ATOM   7437  C  CA    . THR I  5  206  ? -11.017 77.280  -7.039  1.00 69.62  ? 206  THR C CA    1 
ATOM   7438  C  C     . THR I  5  206  ? -9.490  77.015  -7.136  1.00 70.28  ? 206  THR C C     1 
ATOM   7439  O  O     . THR I  5  206  ? -9.051  76.315  -8.052  1.00 70.26  ? 206  THR C O     1 
ATOM   7440  C  CB    . THR I  5  206  ? -11.381 78.771  -7.514  1.00 68.14  ? 206  THR C CB    1 
ATOM   7441  O  OG1   . THR I  5  206  ? -11.119 78.907  -8.914  1.00 65.90  ? 206  THR C OG1   1 
ATOM   7442  C  CG2   . THR I  5  206  ? -10.582 79.821  -6.780  1.00 67.56  ? 206  THR C CG2   1 
ATOM   7443  N  N     . LEU I  5  207  ? -8.708  77.558  -6.195  1.00 71.51  ? 207  LEU C N     1 
ATOM   7444  C  CA    . LEU I  5  207  ? -7.232  77.431  -6.129  1.00 73.50  ? 207  LEU C CA    1 
ATOM   7445  C  C     . LEU I  5  207  ? -6.784  75.954  -6.147  1.00 75.26  ? 207  LEU C C     1 
ATOM   7446  O  O     . LEU I  5  207  ? -6.005  75.534  -7.012  1.00 75.61  ? 207  LEU C O     1 
ATOM   7447  C  CB    . LEU I  5  207  ? -6.727  78.118  -4.838  1.00 71.81  ? 207  LEU C CB    1 
ATOM   7448  C  CG    . LEU I  5  207  ? -5.344  78.698  -4.503  1.00 70.38  ? 207  LEU C CG    1 
ATOM   7449  C  CD1   . LEU I  5  207  ? -5.510  79.546  -3.246  1.00 69.77  ? 207  LEU C CD1   1 
ATOM   7450  C  CD2   . LEU I  5  207  ? -4.306  77.605  -4.281  1.00 69.56  ? 207  LEU C CD2   1 
ATOM   7451  N  N     . ALA I  5  208  ? -7.287  75.186  -5.182  1.00 77.13  ? 208  ALA C N     1 
ATOM   7452  C  CA    . ALA I  5  208  ? -6.961  73.772  -5.010  1.00 79.03  ? 208  ALA C CA    1 
ATOM   7453  C  C     . ALA I  5  208  ? -7.293  72.936  -6.257  1.00 80.12  ? 208  ALA C C     1 
ATOM   7454  O  O     . ALA I  5  208  ? -6.461  72.145  -6.697  1.00 81.42  ? 208  ALA C O     1 
ATOM   7455  C  CB    . ALA I  5  208  ? -7.718  73.219  -3.804  1.00 77.94  ? 208  ALA C CB    1 
ATOM   7456  N  N     . ARG I  5  209  ? -8.490  73.110  -6.823  1.00 80.70  ? 209  ARG C N     1 
ATOM   7457  C  CA    . ARG I  5  209  ? -8.949  72.318  -7.977  1.00 80.70  ? 209  ARG C CA    1 
ATOM   7458  C  C     . ARG I  5  209  ? -8.205  72.655  -9.273  1.00 81.27  ? 209  ARG C C     1 
ATOM   7459  O  O     . ARG I  5  209  ? -8.029  71.772  -10.115 1.00 80.89  ? 209  ARG C O     1 
ATOM   7460  C  CB    . ARG I  5  209  ? -10.460 72.513  -8.186  1.00 81.37  ? 209  ARG C CB    1 
ATOM   7461  C  CG    . ARG I  5  209  ? -11.306 71.570  -7.318  1.00 81.51  ? 209  ARG C CG    1 
ATOM   7462  C  CD    . ARG I  5  209  ? -12.086 72.291  -6.223  1.00 81.43  ? 209  ARG C CD    1 
ATOM   7463  N  NE    . ARG I  5  209  ? -12.081 71.540  -4.968  1.00 80.76  ? 209  ARG C NE    1 
ATOM   7464  C  CZ    . ARG I  5  209  ? -12.900 71.772  -3.948  1.00 80.62  ? 209  ARG C CZ    1 
ATOM   7465  N  NH1   . ARG I  5  209  ? -13.814 72.738  -4.028  1.00 80.52  ? 209  ARG C NH1   1 
ATOM   7466  N  NH2   . ARG I  5  209  ? -12.791 71.041  -2.848  1.00 79.82  ? 209  ARG C NH2   1 
ATOM   7467  N  N     . GLU I  5  210  ? -7.768  73.897  -9.454  1.00 81.84  ? 210  GLU C N     1 
ATOM   7468  C  CA    . GLU I  5  210  ? -7.075  74.246  -10.694 1.00 82.96  ? 210  GLU C CA    1 
ATOM   7469  C  C     . GLU I  5  210  ? -5.566  74.001  -10.598 1.00 82.99  ? 210  GLU C C     1 
ATOM   7470  O  O     . GLU I  5  210  ? -4.967  73.505  -11.552 1.00 82.92  ? 210  GLU C O     1 
ATOM   7471  C  CB    . GLU I  5  210  ? -7.341  75.715  -11.067 1.00 84.17  ? 210  GLU C CB    1 
ATOM   7472  C  CG    . GLU I  5  210  ? -8.744  75.973  -11.670 1.00 85.23  ? 210  GLU C CG    1 
ATOM   7473  C  CD    . GLU I  5  210  ? -8.735  76.915  -12.881 1.00 84.73  ? 210  GLU C CD    1 
ATOM   7474  O  OE1   . GLU I  5  210  ? -8.088  76.575  -13.895 1.00 83.11  ? 210  GLU C OE1   1 
ATOM   7475  O  OE2   . GLU I  5  210  ? -9.380  77.991  -12.817 1.00 84.93  ? 210  GLU C OE2   1 
ATOM   7476  N  N     . LEU I  5  211  ? -4.951  74.343  -9.467  1.00 83.79  ? 211  LEU C N     1 
ATOM   7477  C  CA    . LEU I  5  211  ? -3.506  74.144  -9.279  1.00 84.34  ? 211  LEU C CA    1 
ATOM   7478  C  C     . LEU I  5  211  ? -3.192  72.709  -8.892  1.00 84.32  ? 211  LEU C C     1 
ATOM   7479  O  O     . LEU I  5  211  ? -2.082  72.216  -9.127  1.00 83.66  ? 211  LEU C O     1 
ATOM   7480  C  CB    . LEU I  5  211  ? -2.971  75.070  -8.174  1.00 84.95  ? 211  LEU C CB    1 
ATOM   7481  C  CG    . LEU I  5  211  ? -1.640  74.706  -7.489  1.00 85.18  ? 211  LEU C CG    1 
ATOM   7482  C  CD1   . LEU I  5  211  ? -0.518  74.710  -8.518  1.00 84.67  ? 211  LEU C CD1   1 
ATOM   7483  C  CD2   . LEU I  5  211  ? -1.365  75.692  -6.347  1.00 85.52  ? 211  LEU C CD2   1 
ATOM   7484  N  N     . GLY I  5  212  ? -4.186  72.053  -8.299  1.00 84.61  ? 212  GLY C N     1 
ATOM   7485  C  CA    . GLY I  5  212  ? -4.005  70.696  -7.827  1.00 85.75  ? 212  GLY C CA    1 
ATOM   7486  C  C     . GLY I  5  212  ? -4.800  69.629  -8.548  1.00 86.11  ? 212  GLY C C     1 
ATOM   7487  O  O     . GLY I  5  212  ? -4.871  68.513  -8.037  1.00 86.29  ? 212  GLY C O     1 
ATOM   7488  N  N     . ALA I  5  213  ? -5.409  69.924  -9.694  1.00 86.34  ? 213  ALA C N     1 
ATOM   7489  C  CA    . ALA I  5  213  ? -6.087  68.855  -10.403 1.00 87.07  ? 213  ALA C CA    1 
ATOM   7490  C  C     . ALA I  5  213  ? -5.077  67.756  -10.743 1.00 87.39  ? 213  ALA C C     1 
ATOM   7491  O  O     . ALA I  5  213  ? -5.375  66.555  -10.667 1.00 87.90  ? 213  ALA C O     1 
ATOM   7492  C  CB    . ALA I  5  213  ? -6.727  69.394  -11.684 1.00 85.65  ? 213  ALA C CB    1 
ATOM   7493  N  N     . TYR I  5  214  ? -3.862  68.201  -11.082 1.00 87.86  ? 214  TYR C N     1 
ATOM   7494  C  CA    . TYR I  5  214  ? -2.755  67.316  -11.448 1.00 87.65  ? 214  TYR C CA    1 
ATOM   7495  C  C     . TYR I  5  214  ? -1.967  66.818  -10.219 1.00 87.55  ? 214  TYR C C     1 
ATOM   7496  O  O     . TYR I  5  214  ? -1.360  65.743  -10.295 1.00 87.52  ? 214  TYR C O     1 
ATOM   7497  C  CB    . TYR I  5  214  ? -1.806  68.033  -12.443 1.00 88.41  ? 214  TYR C CB    1 
ATOM   7498  C  CG    . TYR I  5  214  ? -0.760  69.027  -11.928 1.00 89.29  ? 214  TYR C CG    1 
ATOM   7499  C  CD1   . TYR I  5  214  ? 0.508   68.593  -11.446 1.00 88.87  ? 214  TYR C CD1   1 
ATOM   7500  C  CD2   . TYR I  5  214  ? -1.015  70.422  -11.971 1.00 90.02  ? 214  TYR C CD2   1 
ATOM   7501  C  CE1   . TYR I  5  214  ? 1.495   69.543  -11.024 1.00 88.54  ? 214  TYR C CE1   1 
ATOM   7502  C  CE2   . TYR I  5  214  ? -0.034  71.372  -11.552 1.00 89.34  ? 214  TYR C CE2   1 
ATOM   7503  C  CZ    . TYR I  5  214  ? 1.201   70.920  -11.088 1.00 88.63  ? 214  TYR C CZ    1 
ATOM   7504  O  OH    . TYR I  5  214  ? 2.106   71.856  -10.709 1.00 88.41  ? 214  TYR C OH    1 
ATOM   7505  N  N     . GLY I  5  215  ? -1.978  67.567  -9.107  1.00 87.23  ? 215  GLY C N     1 
ATOM   7506  C  CA    . GLY I  5  215  ? -1.227  67.165  -7.908  1.00 87.07  ? 215  GLY C CA    1 
ATOM   7507  C  C     . GLY I  5  215  ? -2.033  66.995  -6.600  1.00 86.47  ? 215  GLY C C     1 
ATOM   7508  O  O     . GLY I  5  215  ? -3.245  67.241  -6.537  1.00 86.78  ? 215  GLY C O     1 
ATOM   7509  N  N     . GLU I  5  216  ? -1.333  66.575  -5.538  1.00 84.99  ? 216  GLU C N     1 
ATOM   7510  C  CA    . GLU I  5  216  ? -1.935  66.319  -4.218  1.00 82.70  ? 216  GLU C CA    1 
ATOM   7511  C  C     . GLU I  5  216  ? -1.449  67.327  -3.146  1.00 81.51  ? 216  GLU C C     1 
ATOM   7512  O  O     . GLU I  5  216  ? -2.052  67.424  -2.068  1.00 81.67  ? 216  GLU C O     1 
ATOM   7513  C  CB    . GLU I  5  216  ? -1.594  64.875  -3.789  1.00 82.10  ? 216  GLU C CB    1 
ATOM   7514  C  CG    . GLU I  5  216  ? -1.942  64.487  -2.359  1.00 81.71  ? 216  GLU C CG    1 
ATOM   7515  C  CD    . GLU I  5  216  ? -0.706  64.340  -1.481  1.00 81.59  ? 216  GLU C CD    1 
ATOM   7516  O  OE1   . GLU I  5  216  ? 0.166   63.510  -1.823  1.00 81.54  ? 216  GLU C OE1   1 
ATOM   7517  O  OE2   . GLU I  5  216  ? -0.606  65.050  -0.456  1.00 80.67  ? 216  GLU C OE2   1 
ATOM   7518  N  N     . LEU I  5  217  ? -0.386  68.080  -3.429  1.00 79.80  ? 217  LEU C N     1 
ATOM   7519  C  CA    . LEU I  5  217  ? 0.168   69.033  -2.457  1.00 77.65  ? 217  LEU C CA    1 
ATOM   7520  C  C     . LEU I  5  217  ? -0.876  70.095  -2.034  1.00 76.39  ? 217  LEU C C     1 
ATOM   7521  O  O     . LEU I  5  217  ? -0.700  70.785  -1.026  1.00 76.39  ? 217  LEU C O     1 
ATOM   7522  C  CB    . LEU I  5  217  ? 1.407   69.732  -3.052  1.00 77.65  ? 217  LEU C CB    1 
ATOM   7523  C  CG    . LEU I  5  217  ? 2.333   69.114  -4.118  1.00 76.95  ? 217  LEU C CG    1 
ATOM   7524  C  CD1   . LEU I  5  217  ? 3.720   69.741  -3.938  1.00 76.96  ? 217  LEU C CD1   1 
ATOM   7525  C  CD2   . LEU I  5  217  ? 2.448   67.611  -3.990  1.00 76.42  ? 217  LEU C CD2   1 
ATOM   7526  N  N     . VAL I  5  218  ? -1.951  70.203  -2.816  1.00 74.37  ? 218  VAL C N     1 
ATOM   7527  C  CA    . VAL I  5  218  ? -3.068  71.140  -2.617  1.00 72.24  ? 218  VAL C CA    1 
ATOM   7528  C  C     . VAL I  5  218  ? -3.730  70.978  -1.225  1.00 71.07  ? 218  VAL C C     1 
ATOM   7529  O  O     . VAL I  5  218  ? -4.471  71.868  -0.783  1.00 70.67  ? 218  VAL C O     1 
ATOM   7530  C  CB    . VAL I  5  218  ? -4.115  70.922  -3.788  1.00 72.28  ? 218  VAL C CB    1 
ATOM   7531  C  CG1   . VAL I  5  218  ? -5.541  70.785  -3.276  1.00 71.78  ? 218  VAL C CG1   1 
ATOM   7532  C  CG2   . VAL I  5  218  ? -4.016  72.080  -4.747  1.00 72.14  ? 218  VAL C CG2   1 
ATOM   7533  N  N     . GLN I  5  219  ? -3.463  69.861  -0.547  1.00 69.29  ? 219  GLN C N     1 
ATOM   7534  C  CA    . GLN I  5  219  ? -4.044  69.568  0.770   1.00 67.76  ? 219  GLN C CA    1 
ATOM   7535  C  C     . GLN I  5  219  ? -3.361  70.357  1.890   1.00 66.66  ? 219  GLN C C     1 
ATOM   7536  O  O     . GLN I  5  219  ? -3.912  70.471  2.979   1.00 66.22  ? 219  GLN C O     1 
ATOM   7537  C  CB    . GLN I  5  219  ? -3.958  68.062  1.050   1.00 67.09  ? 219  GLN C CB    1 
ATOM   7538  C  CG    . GLN I  5  219  ? -5.138  67.262  0.454   1.00 66.81  ? 219  GLN C CG    1 
ATOM   7539  C  CD    . GLN I  5  219  ? -4.732  65.997  -0.317  1.00 67.30  ? 219  GLN C CD    1 
ATOM   7540  O  OE1   . GLN I  5  219  ? -4.058  65.104  0.212   1.00 67.14  ? 219  GLN C OE1   1 
ATOM   7541  N  NE2   . GLN I  5  219  ? -5.153  65.920  -1.579  1.00 67.36  ? 219  GLN C NE2   1 
ATOM   7542  N  N     . GLY I  5  220  ? -2.171  70.893  1.630   1.00 66.71  ? 220  GLY C N     1 
ATOM   7543  C  CA    . GLY I  5  220  ? -1.491  71.700  2.627   1.00 66.54  ? 220  GLY C CA    1 
ATOM   7544  C  C     . GLY I  5  220  ? -1.961  73.143  2.533   1.00 67.28  ? 220  GLY C C     1 
ATOM   7545  O  O     . GLY I  5  220  ? -1.886  73.911  3.490   1.00 67.81  ? 220  GLY C O     1 
ATOM   7546  N  N     . LEU I  5  221  ? -2.468  73.509  1.358   1.00 67.49  ? 221  LEU C N     1 
ATOM   7547  C  CA    . LEU I  5  221  ? -2.959  74.861  1.109   1.00 66.60  ? 221  LEU C CA    1 
ATOM   7548  C  C     . LEU I  5  221  ? -4.342  75.102  1.758   1.00 68.77  ? 221  LEU C C     1 
ATOM   7549  O  O     . LEU I  5  221  ? -4.556  76.172  2.321   1.00 68.66  ? 221  LEU C O     1 
ATOM   7550  C  CB    . LEU I  5  221  ? -3.024  75.110  -0.404  1.00 64.68  ? 221  LEU C CB    1 
ATOM   7551  C  CG    . LEU I  5  221  ? -4.252  74.798  -1.253  1.00 62.80  ? 221  LEU C CG    1 
ATOM   7552  C  CD1   . LEU I  5  221  ? -5.183  75.969  -1.242  1.00 61.96  ? 221  LEU C CD1   1 
ATOM   7553  C  CD2   . LEU I  5  221  ? -3.827  74.547  -2.672  1.00 62.26  ? 221  LEU C CD2   1 
ATOM   7554  N  N     . MET I  5  222  ? -5.267  74.131  1.693   1.00 71.19  ? 222  MET C N     1 
ATOM   7555  C  CA    . MET I  5  222  ? -6.631  74.264  2.284   1.00 72.80  ? 222  MET C CA    1 
ATOM   7556  C  C     . MET I  5  222  ? -6.637  73.973  3.813   1.00 74.07  ? 222  MET C C     1 
ATOM   7557  O  O     . MET I  5  222  ? -7.672  74.091  4.470   1.00 75.90  ? 222  MET C O     1 
ATOM   7558  C  CB    . MET I  5  222  ? -7.618  73.288  1.613   1.00 70.96  ? 222  MET C CB    1 
ATOM   7559  C  CG    . MET I  5  222  ? -7.621  73.300  0.117   1.00 70.70  ? 222  MET C CG    1 
ATOM   7560  S  SD    . MET I  5  222  ? -8.505  71.874  -0.442  1.00 71.70  ? 222  MET C SD    1 
ATOM   7561  C  CE    . MET I  5  222  ? -7.304  70.609  -0.075  1.00 72.17  ? 222  MET C CE    1 
ATOM   7562  N  N     . ASP I  5  223  ? -5.477  73.604  4.348   1.00 75.49  ? 223  ASP C N     1 
ATOM   7563  C  CA    . ASP I  5  223  ? -5.234  73.226  5.750   1.00 76.94  ? 223  ASP C CA    1 
ATOM   7564  C  C     . ASP I  5  223  ? -5.931  74.156  6.758   1.00 77.39  ? 223  ASP C C     1 
ATOM   7565  O  O     . ASP I  5  223  ? -6.977  73.802  7.307   1.00 77.59  ? 223  ASP C O     1 
ATOM   7566  C  CB    . ASP I  5  223  ? -3.711  73.209  5.980   1.00 75.95  ? 223  ASP C CB    1 
ATOM   7567  C  CG    . ASP I  5  223  ? -3.310  72.691  7.361   1.00 75.30  ? 223  ASP C CG    1 
ATOM   7568  O  OD1   . ASP I  5  223  ? -4.057  71.885  7.969   1.00 74.75  ? 223  ASP C OD1   1 
ATOM   7569  O  OD2   . ASP I  5  223  ? -2.221  73.100  7.828   1.00 74.68  ? 223  ASP C OD2   1 
ATOM   7570  N  N     . GLU I  5  224  ? -5.341  75.327  7.001   1.00 79.41  ? 224  GLU C N     1 
ATOM   7571  C  CA    . GLU I  5  224  ? -5.864  76.291  7.974   1.00 80.86  ? 224  GLU C CA    1 
ATOM   7572  C  C     . GLU I  5  224  ? -7.123  76.995  7.441   1.00 82.36  ? 224  GLU C C     1 
ATOM   7573  O  O     . GLU I  5  224  ? -7.076  78.175  7.082   1.00 82.51  ? 224  GLU C O     1 
ATOM   7574  C  CB    . GLU I  5  224  ? -4.778  77.342  8.315   1.00 80.83  ? 224  GLU C CB    1 
ATOM   7575  C  CG    . GLU I  5  224  ? -3.328  76.817  8.470   1.00 80.90  ? 224  GLU C CG    1 
ATOM   7576  C  CD    . GLU I  5  224  ? -2.903  76.489  9.917   1.00 81.15  ? 224  GLU C CD    1 
ATOM   7577  O  OE1   . GLU I  5  224  ? -1.792  75.930  10.097  1.00 81.32  ? 224  GLU C OE1   1 
ATOM   7578  O  OE2   . GLU I  5  224  ? -3.659  76.784  10.871  1.00 80.23  ? 224  GLU C OE2   1 
ATOM   7579  N  N     . SER I  5  225  ? -8.239  76.261  7.400   1.00 82.80  ? 225  SER C N     1 
ATOM   7580  C  CA    . SER I  5  225  ? -9.527  76.770  6.902   1.00 83.37  ? 225  SER C CA    1 
ATOM   7581  C  C     . SER I  5  225  ? -10.018 77.972  7.717   1.00 85.12  ? 225  SER C C     1 
ATOM   7582  O  O     . SER I  5  225  ? -10.624 78.886  7.153   1.00 85.26  ? 225  SER C O     1 
ATOM   7583  C  CB    . SER I  5  225  ? -10.600 75.665  6.954   1.00 83.17  ? 225  SER C CB    1 
ATOM   7584  O  OG    . SER I  5  225  ? -11.249 75.492  5.705   1.00 81.84  ? 225  SER C OG    1 
ATOM   7585  N  N     . VAL I  5  226  ? -9.752  77.965  9.026   1.00 85.43  ? 226  VAL C N     1 
ATOM   7586  C  CA    . VAL I  5  226  ? -10.178 79.026  9.953   1.00 86.59  ? 226  VAL C CA    1 
ATOM   7587  C  C     . VAL I  5  226  ? -9.774  80.451  9.457   1.00 86.09  ? 226  VAL C C     1 
ATOM   7588  O  O     . VAL I  5  226  ? -10.577 81.390  9.579   1.00 86.97  ? 226  VAL C O     1 
ATOM   7589  C  CB    . VAL I  5  226  ? -9.608  78.720  11.416  1.00 86.19  ? 226  VAL C CB    1 
ATOM   7590  C  CG1   . VAL I  5  226  ? -8.147  78.296  11.330  1.00 86.45  ? 226  VAL C CG1   1 
ATOM   7591  C  CG2   . VAL I  5  226  ? -9.756  79.932  12.330  1.00 86.74  ? 226  VAL C CG2   1 
ATOM   7592  N  N     . PHE I  5  227  ? -8.572  80.634  8.898   1.00 85.34  ? 227  PHE C N     1 
ATOM   7593  C  CA    . PHE I  5  227  ? -8.158  81.972  8.424   1.00 84.12  ? 227  PHE C CA    1 
ATOM   7594  C  C     . PHE I  5  227  ? -8.608  82.223  6.975   1.00 85.02  ? 227  PHE C C     1 
ATOM   7595  O  O     . PHE I  5  227  ? -8.815  83.366  6.550   1.00 84.46  ? 227  PHE C O     1 
ATOM   7596  C  CB    . PHE I  5  227  ? -6.620  82.135  8.491   1.00 81.48  ? 227  PHE C CB    1 
ATOM   7597  C  CG    . PHE I  5  227  ? -6.017  81.753  9.818   1.00 78.00  ? 227  PHE C CG    1 
ATOM   7598  C  CD1   . PHE I  5  227  ? -5.713  80.409  10.103  1.00 76.21  ? 227  PHE C CD1   1 
ATOM   7599  C  CD2   . PHE I  5  227  ? -5.763  82.729  10.796  1.00 76.11  ? 227  PHE C CD2   1 
ATOM   7600  C  CE1   . PHE I  5  227  ? -5.164  80.034  11.349  1.00 74.94  ? 227  PHE C CE1   1 
ATOM   7601  C  CE2   . PHE I  5  227  ? -5.211  82.368  12.055  1.00 75.40  ? 227  PHE C CE2   1 
ATOM   7602  C  CZ    . PHE I  5  227  ? -4.911  81.015  12.328  1.00 75.07  ? 227  PHE C CZ    1 
ATOM   7603  N  N     . ALA I  5  228  ? -8.764  81.131  6.238   1.00 85.93  ? 228  ALA C N     1 
ATOM   7604  C  CA    . ALA I  5  228  ? -9.128  81.160  4.828   1.00 87.04  ? 228  ALA C CA    1 
ATOM   7605  C  C     . ALA I  5  228  ? -10.613 81.536  4.595   1.00 88.03  ? 228  ALA C C     1 
ATOM   7606  O  O     . ALA I  5  228  ? -11.000 81.763  3.447   1.00 88.90  ? 228  ALA C O     1 
ATOM   7607  C  CB    . ALA I  5  228  ? -8.824  79.790  4.210   1.00 86.73  ? 228  ALA C CB    1 
ATOM   7608  N  N     . MET I  5  229  ? -11.447 81.610  5.634   1.00 87.09  ? 229  MET C N     1 
ATOM   7609  C  CA    . MET I  5  229  ? -12.865 81.948  5.425   1.00 86.02  ? 229  MET C CA    1 
ATOM   7610  C  C     . MET I  5  229  ? -13.091 83.474  5.422   1.00 84.68  ? 229  MET C C     1 
ATOM   7611  O  O     . MET I  5  229  ? -14.213 83.925  5.216   1.00 84.68  ? 229  MET C O     1 
ATOM   7612  C  CB    . MET I  5  229  ? -13.743 81.297  6.518   1.00 85.22  ? 229  MET C CB    1 
ATOM   7613  C  CG    . MET I  5  229  ? -13.631 79.776  6.637   1.00 85.25  ? 229  MET C CG    1 
ATOM   7614  S  SD    . MET I  5  229  ? -14.937 78.775  5.862   1.00 86.22  ? 229  MET C SD    1 
ATOM   7615  C  CE    . MET I  5  229  ? -15.635 77.876  7.302   1.00 85.29  ? 229  MET C CE    1 
ATOM   7616  N  N     . ARG I  5  230  ? -12.040 84.263  5.647   1.00 83.00  ? 230  ARG C N     1 
ATOM   7617  C  CA    . ARG I  5  230  ? -12.160 85.723  5.653   1.00 82.07  ? 230  ARG C CA    1 
ATOM   7618  C  C     . ARG I  5  230  ? -11.108 86.364  4.738   1.00 83.21  ? 230  ARG C C     1 
ATOM   7619  O  O     . ARG I  5  230  ? -9.920  86.308  5.051   1.00 83.56  ? 230  ARG C O     1 
ATOM   7620  C  CB    . ARG I  5  230  ? -11.991 86.265  7.069   1.00 80.12  ? 230  ARG C CB    1 
ATOM   7621  C  CG    . ARG I  5  230  ? -12.969 85.704  8.058   1.00 78.84  ? 230  ARG C CG    1 
ATOM   7622  C  CD    . ARG I  5  230  ? -13.013 86.526  9.338   1.00 76.60  ? 230  ARG C CD    1 
ATOM   7623  N  NE    . ARG I  5  230  ? -13.915 85.959  10.348  1.00 74.86  ? 230  ARG C NE    1 
ATOM   7624  C  CZ    . ARG I  5  230  ? -15.207 85.678  10.167  1.00 73.47  ? 230  ARG C CZ    1 
ATOM   7625  N  NH1   . ARG I  5  230  ? -15.797 85.897  9.002   1.00 72.69  ? 230  ARG C NH1   1 
ATOM   7626  N  NH2   . ARG I  5  230  ? -15.918 85.173  11.164  1.00 72.36  ? 230  ARG C NH2   1 
ATOM   7627  N  N     . PRO I  5  231  ? -11.540 86.989  3.605   1.00 84.11  ? 231  PRO C N     1 
ATOM   7628  C  CA    . PRO I  5  231  ? -10.763 87.673  2.541   1.00 84.12  ? 231  PRO C CA    1 
ATOM   7629  C  C     . PRO I  5  231  ? -9.920  88.876  3.033   1.00 83.81  ? 231  PRO C C     1 
ATOM   7630  O  O     . PRO I  5  231  ? -8.843  88.702  3.598   1.00 84.72  ? 231  PRO C O     1 
ATOM   7631  C  CB    . PRO I  5  231  ? -11.833 88.090  1.529   1.00 84.51  ? 231  PRO C CB    1 
ATOM   7632  C  CG    . PRO I  5  231  ? -12.926 87.112  1.752   1.00 84.88  ? 231  PRO C CG    1 
ATOM   7633  C  CD    . PRO I  5  231  ? -12.976 87.031  3.251   1.00 84.35  ? 231  PRO C CD    1 
ATOM   7634  N  N     . GLU I  5  232  ? -10.429 90.087  2.777   1.00 82.38  ? 232  GLU C N     1 
ATOM   7635  C  CA    . GLU I  5  232  ? -9.788  91.372  3.108   1.00 80.03  ? 232  GLU C CA    1 
ATOM   7636  C  C     . GLU I  5  232  ? -9.230  91.404  4.531   1.00 79.34  ? 232  GLU C C     1 
ATOM   7637  O  O     . GLU I  5  232  ? -8.329  92.199  4.825   1.00 79.60  ? 232  GLU C O     1 
ATOM   7638  C  CB    . GLU I  5  232  ? -10.795 92.507  2.937   1.00 77.22  ? 232  GLU C CB    1 
ATOM   7639  C  CG    . GLU I  5  232  ? -11.248 92.713  1.517   1.00 73.53  ? 232  GLU C CG    1 
ATOM   7640  C  CD    . GLU I  5  232  ? -11.810 94.089  1.300   1.00 71.75  ? 232  GLU C CD    1 
ATOM   7641  O  OE1   . GLU I  5  232  ? -11.157 95.063  1.727   1.00 70.94  ? 232  GLU C OE1   1 
ATOM   7642  O  OE2   . GLU I  5  232  ? -12.896 94.196  0.701   1.00 69.66  ? 232  GLU C OE2   1 
ATOM   7643  N  N     . GLU I  5  233  ? -9.766  90.557  5.404   1.00 78.59  ? 233  GLU C N     1 
ATOM   7644  C  CA    . GLU I  5  233  ? -9.311  90.470  6.791   1.00 77.64  ? 233  GLU C CA    1 
ATOM   7645  C  C     . GLU I  5  233  ? -7.917  89.798  6.876   1.00 76.10  ? 233  GLU C C     1 
ATOM   7646  O  O     . GLU I  5  233  ? -7.105  90.135  7.742   1.00 77.03  ? 233  GLU C O     1 
ATOM   7647  C  CB    . GLU I  5  233  ? -10.348 89.676  7.617   1.00 78.69  ? 233  GLU C CB    1 
ATOM   7648  C  CG    . GLU I  5  233  ? -10.815 90.354  8.917   1.00 79.77  ? 233  GLU C CG    1 
ATOM   7649  C  CD    . GLU I  5  233  ? -9.900  90.094  10.110  1.00 79.96  ? 233  GLU C CD    1 
ATOM   7650  O  OE1   . GLU I  5  233  ? -9.943  88.958  10.634  1.00 79.49  ? 233  GLU C OE1   1 
ATOM   7651  O  OE2   . GLU I  5  233  ? -9.149  91.018  10.515  1.00 79.45  ? 233  GLU C OE2   1 
ATOM   7652  N  N     . ALA I  5  234  ? -7.646  88.855  5.977   1.00 72.64  ? 234  ALA C N     1 
ATOM   7653  C  CA    . ALA I  5  234  ? -6.357  88.169  5.943   1.00 69.72  ? 234  ALA C CA    1 
ATOM   7654  C  C     . ALA I  5  234  ? -5.243  89.134  5.543   1.00 67.39  ? 234  ALA C C     1 
ATOM   7655  O  O     . ALA I  5  234  ? -4.058  88.847  5.714   1.00 66.34  ? 234  ALA C O     1 
ATOM   7656  C  CB    . ALA I  5  234  ? -6.425  87.004  4.961   1.00 70.92  ? 234  ALA C CB    1 
ATOM   7657  N  N     . LEU I  5  235  ? -5.657  90.272  4.995   1.00 65.89  ? 235  LEU C N     1 
ATOM   7658  C  CA    . LEU I  5  235  ? -4.758  91.340  4.599   1.00 65.26  ? 235  LEU C CA    1 
ATOM   7659  C  C     . LEU I  5  235  ? -4.208  92.018  5.836   1.00 65.52  ? 235  LEU C C     1 
ATOM   7660  O  O     . LEU I  5  235  ? -3.023  92.345  5.931   1.00 66.46  ? 235  LEU C O     1 
ATOM   7661  C  CB    . LEU I  5  235  ? -5.529  92.341  3.723   1.00 62.92  ? 235  LEU C CB    1 
ATOM   7662  C  CG    . LEU I  5  235  ? -5.104  93.786  3.470   1.00 61.54  ? 235  LEU C CG    1 
ATOM   7663  C  CD1   . LEU I  5  235  ? -5.885  94.338  2.300   1.00 60.09  ? 235  LEU C CD1   1 
ATOM   7664  C  CD2   . LEU I  5  235  ? -5.359  94.618  4.690   1.00 59.96  ? 235  LEU C CD2   1 
ATOM   7665  N  N     . ILE I  5  236  ? -5.114  92.216  6.786   1.00 65.36  ? 236  ILE C N     1 
ATOM   7666  C  CA    . ILE I  5  236  ? -4.786  92.812  8.066   1.00 65.17  ? 236  ILE C CA    1 
ATOM   7667  C  C     . ILE I  5  236  ? -4.120  91.780  8.996   1.00 64.20  ? 236  ILE C C     1 
ATOM   7668  O  O     . ILE I  5  236  ? -3.294  92.145  9.830   1.00 64.21  ? 236  ILE C O     1 
ATOM   7669  C  CB    . ILE I  5  236  ? -6.073  93.378  8.761   1.00 66.18  ? 236  ILE C CB    1 
ATOM   7670  C  CG1   . ILE I  5  236  ? -6.704  94.496  7.914   1.00 66.68  ? 236  ILE C CG1   1 
ATOM   7671  C  CG2   . ILE I  5  236  ? -5.707  94.007  10.109  1.00 65.87  ? 236  ILE C CG2   1 
ATOM   7672  C  CD1   . ILE I  5  236  ? -7.749  94.056  6.943   1.00 66.81  ? 236  ILE C CD1   1 
ATOM   7673  N  N     . ARG I  5  237  ? -4.487  90.502  8.833   1.00 64.81  ? 237  ARG C N     1 
ATOM   7674  C  CA    . ARG I  5  237  ? -3.967  89.378  9.638   1.00 63.76  ? 237  ARG C CA    1 
ATOM   7675  C  C     . ARG I  5  237  ? -2.506  89.105  9.325   1.00 63.82  ? 237  ARG C C     1 
ATOM   7676  O  O     . ARG I  5  237  ? -1.725  88.718  10.206  1.00 62.92  ? 237  ARG C O     1 
ATOM   7677  C  CB    . ARG I  5  237  ? -4.778  88.110  9.371   1.00 64.39  ? 237  ARG C CB    1 
ATOM   7678  C  CG    . ARG I  5  237  ? -4.682  87.094  10.510  1.00 64.66  ? 237  ARG C CG    1 
ATOM   7679  C  CD    . ARG I  5  237  ? -6.075  86.562  10.903  1.00 63.80  ? 237  ARG C CD    1 
ATOM   7680  N  NE    . ARG I  5  237  ? -6.468  86.882  12.281  1.00 61.81  ? 237  ARG C NE    1 
ATOM   7681  C  CZ    . ARG I  5  237  ? -6.808  88.090  12.725  1.00 60.49  ? 237  ARG C CZ    1 
ATOM   7682  N  NH1   . ARG I  5  237  ? -6.819  89.141  11.918  1.00 59.53  ? 237  ARG C NH1   1 
ATOM   7683  N  NH2   . ARG I  5  237  ? -7.142  88.248  13.993  1.00 60.15  ? 237  ARG C NH2   1 
ATOM   7684  N  N     . LEU I  5  238  ? -2.159  89.291  8.053   1.00 64.34  ? 238  LEU C N     1 
ATOM   7685  C  CA    . LEU I  5  238  ? -0.788  89.157  7.609   1.00 64.65  ? 238  LEU C CA    1 
ATOM   7686  C  C     . LEU I  5  238  ? 0.037   90.276  8.182   1.00 65.30  ? 238  LEU C C     1 
ATOM   7687  O  O     . LEU I  5  238  ? 1.126   90.028  8.675   1.00 65.31  ? 238  LEU C O     1 
ATOM   7688  C  CB    . LEU I  5  238  ? -0.695  89.214  6.090   1.00 64.55  ? 238  LEU C CB    1 
ATOM   7689  C  CG    . LEU I  5  238  ? -0.418  87.907  5.361   1.00 65.41  ? 238  LEU C CG    1 
ATOM   7690  C  CD1   . LEU I  5  238  ? -1.659  87.470  4.617   1.00 64.90  ? 238  LEU C CD1   1 
ATOM   7691  C  CD2   . LEU I  5  238  ? 0.734   88.112  4.386   1.00 65.29  ? 238  LEU C CD2   1 
ATOM   7692  N  N     . PHE I  5  239  ? -0.501  91.507  8.109   1.00 66.41  ? 239  PHE C N     1 
ATOM   7693  C  CA    . PHE I  5  239  ? 0.140   92.717  8.678   1.00 67.97  ? 239  PHE C CA    1 
ATOM   7694  C  C     . PHE I  5  239  ? 0.495   92.485  10.133  1.00 70.64  ? 239  PHE C C     1 
ATOM   7695  O  O     . PHE I  5  239  ? 1.520   92.968  10.617  1.00 70.94  ? 239  PHE C O     1 
ATOM   7696  C  CB    . PHE I  5  239  ? -0.784  93.956  8.658   1.00 64.41  ? 239  PHE C CB    1 
ATOM   7697  C  CG    . PHE I  5  239  ? -0.959  94.606  7.314   1.00 60.60  ? 239  PHE C CG    1 
ATOM   7698  C  CD1   . PHE I  5  239  ? -0.100  94.318  6.232   1.00 59.05  ? 239  PHE C CD1   1 
ATOM   7699  C  CD2   . PHE I  5  239  ? -2.004  95.531  7.127   1.00 57.62  ? 239  PHE C CD2   1 
ATOM   7700  C  CE1   . PHE I  5  239  ? -0.285  94.943  4.981   1.00 57.22  ? 239  PHE C CE1   1 
ATOM   7701  C  CE2   . PHE I  5  239  ? -2.202  96.163  5.881   1.00 56.18  ? 239  PHE C CE2   1 
ATOM   7702  C  CZ    . PHE I  5  239  ? -1.342  95.870  4.808   1.00 56.36  ? 239  PHE C CZ    1 
ATOM   7703  N  N     . THR I  5  240  ? -0.398  91.749  10.808  1.00 73.73  ? 240  THR C N     1 
ATOM   7704  C  CA    . THR I  5  240  ? -0.269  91.346  12.210  1.00 76.08  ? 240  THR C CA    1 
ATOM   7705  C  C     . THR I  5  240  ? 0.903   90.385  12.377  1.00 77.59  ? 240  THR C C     1 
ATOM   7706  O  O     . THR I  5  240  ? 1.650   90.475  13.360  1.00 78.95  ? 240  THR C O     1 
ATOM   7707  C  CB    . THR I  5  240  ? -1.585  90.638  12.720  1.00 76.17  ? 240  THR C CB    1 
ATOM   7708  O  OG1   . THR I  5  240  ? -2.647  91.601  12.812  1.00 76.40  ? 240  THR C OG1   1 
ATOM   7709  C  CG2   . THR I  5  240  ? -1.374  89.986  14.086  1.00 75.58  ? 240  THR C CG2   1 
ATOM   7710  N  N     . LEU I  5  241  ? 1.049   89.475  11.403  1.00 78.63  ? 241  LEU C N     1 
ATOM   7711  C  CA    . LEU I  5  241  ? 2.132   88.487  11.388  1.00 78.91  ? 241  LEU C CA    1 
ATOM   7712  C  C     . LEU I  5  241  ? 3.522   89.173  11.342  1.00 79.42  ? 241  LEU C C     1 
ATOM   7713  O  O     . LEU I  5  241  ? 4.466   88.685  11.971  1.00 79.85  ? 241  LEU C O     1 
ATOM   7714  C  CB    . LEU I  5  241  ? 1.937   87.539  10.201  1.00 77.47  ? 241  LEU C CB    1 
ATOM   7715  C  CG    . LEU I  5  241  ? 1.787   86.102  10.699  1.00 76.64  ? 241  LEU C CG    1 
ATOM   7716  C  CD1   . LEU I  5  241  ? 0.993   85.285  9.707   1.00 76.50  ? 241  LEU C CD1   1 
ATOM   7717  C  CD2   . LEU I  5  241  ? 3.172   85.521  10.947  1.00 76.31  ? 241  LEU C CD2   1 
ATOM   7718  N  N     . LEU I  5  242  ? 3.661   90.282  10.601  1.00 79.82  ? 242  LEU C N     1 
ATOM   7719  C  CA    . LEU I  5  242  ? 4.917   91.046  10.644  1.00 80.61  ? 242  LEU C CA    1 
ATOM   7720  C  C     . LEU I  5  242  ? 5.145   91.499  12.085  1.00 80.24  ? 242  LEU C C     1 
ATOM   7721  O  O     . LEU I  5  242  ? 4.184   91.426  12.859  1.00 79.95  ? 242  LEU C O     1 
ATOM   7722  C  CB    . LEU I  5  242  ? 4.836   92.274  9.717   1.00 81.20  ? 242  LEU C CB    1 
ATOM   7723  C  CG    . LEU I  5  242  ? 4.871   92.055  8.199   1.00 82.77  ? 242  LEU C CG    1 
ATOM   7724  C  CD1   . LEU I  5  242  ? 4.367   93.334  7.526   1.00 82.95  ? 242  LEU C CD1   1 
ATOM   7725  C  CD2   . LEU I  5  242  ? 6.299   91.673  7.729   1.00 83.11  ? 242  LEU C CD2   1 
ATOM   7726  N  N     . ARG I  5  243  ? 6.314   91.972  12.515  1.00 80.28  ? 243  ARG C N     1 
ATOM   7727  C  CA    . ARG I  5  243  ? 6.315   92.238  13.953  1.00 80.01  ? 243  ARG C CA    1 
ATOM   7728  C  C     . ARG I  5  243  ? 7.158   93.462  14.398  1.00 80.86  ? 243  ARG C C     1 
ATOM   7729  O  O     . ARG I  5  243  ? 8.388   93.450  14.365  1.00 80.69  ? 243  ARG C O     1 
ATOM   7730  C  CB    . ARG I  5  243  ? 6.771   90.981  14.719  1.00 79.45  ? 243  ARG C CB    1 
ATOM   7731  C  CG    . ARG I  5  243  ? 7.740   90.059  13.954  1.00 78.38  ? 243  ARG C CG    1 
ATOM   7732  C  CD    . ARG I  5  243  ? 8.276   88.903  14.812  1.00 77.05  ? 243  ARG C CD    1 
ATOM   7733  N  NE    . ARG I  5  243  ? 9.343   89.330  15.721  1.00 76.19  ? 243  ARG C NE    1 
ATOM   7734  C  CZ    . ARG I  5  243  ? 10.578  89.664  15.351  1.00 74.16  ? 243  ARG C CZ    1 
ATOM   7735  N  NH1   . ARG I  5  243  ? 10.935  89.621  14.077  1.00 72.84  ? 243  ARG C NH1   1 
ATOM   7736  N  NH2   . ARG I  5  243  ? 11.460  90.051  16.259  1.00 72.85  ? 243  ARG C NH2   1 
ATOM   7737  N  N     . PRO I  5  244  ? 6.463   94.551  14.800  1.00 80.94  ? 244  PRO C N     1 
ATOM   7738  C  CA    . PRO I  5  244  ? 6.834   95.860  15.337  1.00 80.77  ? 244  PRO C CA    1 
ATOM   7739  C  C     . PRO I  5  244  ? 5.825   96.289  16.397  1.00 80.32  ? 244  PRO C C     1 
ATOM   7740  O  O     . PRO I  5  244  ? 6.173   96.830  17.448  1.00 79.70  ? 244  PRO C O     1 
ATOM   7741  C  CB    . PRO I  5  244  ? 6.800   96.803  14.131  1.00 80.23  ? 244  PRO C CB    1 
ATOM   7742  C  CG    . PRO I  5  244  ? 6.461   95.952  12.970  1.00 80.76  ? 244  PRO C CG    1 
ATOM   7743  C  CD    . PRO I  5  244  ? 5.638   94.865  13.614  1.00 81.45  ? 244  PRO C CD    1 
ATOM   7744  N  N     . GLY I  5  245  ? 4.563   95.990  16.069  1.00 81.34  ? 245  GLY C N     1 
ATOM   7745  C  CA    . GLY I  5  245  ? 3.395   96.365  16.846  1.00 82.38  ? 245  GLY C CA    1 
ATOM   7746  C  C     . GLY I  5  245  ? 2.787   97.572  16.155  1.00 82.15  ? 245  GLY C C     1 
ATOM   7747  O  O     . GLY I  5  245  ? 2.729   98.672  16.713  1.00 82.40  ? 245  GLY C O     1 
ATOM   7748  N  N     . ASP I  5  246  ? 2.339   97.356  14.922  1.00 82.17  ? 246  ASP C N     1 
ATOM   7749  C  CA    . ASP I  5  246  ? 1.838   98.445  14.095  1.00 82.86  ? 246  ASP C CA    1 
ATOM   7750  C  C     . ASP I  5  246  ? 0.303   98.484  14.035  1.00 83.44  ? 246  ASP C C     1 
ATOM   7751  O  O     . ASP I  5  246  ? -0.379  97.511  14.393  1.00 83.21  ? 246  ASP C O     1 
ATOM   7752  C  CB    . ASP I  5  246  ? 2.442   98.320  12.669  1.00 82.58  ? 246  ASP C CB    1 
ATOM   7753  C  CG    . ASP I  5  246  ? 3.806   99.072  12.507  1.00 82.24  ? 246  ASP C CG    1 
ATOM   7754  O  OD1   . ASP I  5  246  ? 3.888   100.270 12.865  1.00 80.65  ? 246  ASP C OD1   1 
ATOM   7755  O  OD2   . ASP I  5  246  ? 4.793   98.466  12.015  1.00 81.53  ? 246  ASP C OD2   1 
ATOM   7756  N  N     . PRO I  5  247  ? -0.257  99.638  13.580  1.00 83.57  ? 247  PRO C N     1 
ATOM   7757  C  CA    . PRO I  5  247  ? -1.710  99.828  13.459  1.00 85.63  ? 247  PRO C CA    1 
ATOM   7758  C  C     . PRO I  5  247  ? -2.359  98.774  12.546  1.00 84.69  ? 247  PRO C C     1 
ATOM   7759  O  O     . PRO I  5  247  ? -1.883  98.535  11.428  1.00 84.79  ? 247  PRO C O     1 
ATOM   7760  C  CB    . PRO I  5  247  ? -1.830  101.254 12.911  1.00 84.39  ? 247  PRO C CB    1 
ATOM   7761  C  CG    . PRO I  5  247  ? -0.662  101.943 13.531  1.00 84.81  ? 247  PRO C CG    1 
ATOM   7762  C  CD    . PRO I  5  247  ? 0.440   100.925 13.340  1.00 84.56  ? 247  PRO C CD    1 
ATOM   7763  N  N     . PRO I  5  248  ? -3.443  98.116  13.016  1.00 83.22  ? 248  PRO C N     1 
ATOM   7764  C  CA    . PRO I  5  248  ? -4.090  97.116  12.162  1.00 84.39  ? 248  PRO C CA    1 
ATOM   7765  C  C     . PRO I  5  248  ? -4.610  97.737  10.867  1.00 84.28  ? 248  PRO C C     1 
ATOM   7766  O  O     . PRO I  5  248  ? -4.666  97.079  9.823   1.00 84.85  ? 248  PRO C O     1 
ATOM   7767  C  CB    . PRO I  5  248  ? -5.201  96.573  13.044  1.00 83.13  ? 248  PRO C CB    1 
ATOM   7768  C  CG    . PRO I  5  248  ? -4.590  96.629  14.393  1.00 83.47  ? 248  PRO C CG    1 
ATOM   7769  C  CD    . PRO I  5  248  ? -3.932  97.991  14.402  1.00 83.95  ? 248  PRO C CD    1 
ATOM   7770  N  N     . LYS I  5  249  ? -4.978  99.015  10.955  1.00 84.47  ? 249  LYS C N     1 
ATOM   7771  C  CA    . LYS I  5  249  ? -5.514  99.760  9.820   1.00 84.62  ? 249  LYS C CA    1 
ATOM   7772  C  C     . LYS I  5  249  ? -4.412  100.523 9.038   1.00 84.71  ? 249  LYS C C     1 
ATOM   7773  O  O     . LYS I  5  249  ? -3.699  101.409 9.553   1.00 85.63  ? 249  LYS C O     1 
ATOM   7774  C  CB    . LYS I  5  249  ? -6.600  100.727 10.318  1.00 83.91  ? 249  LYS C CB    1 
ATOM   7775  C  CG    . LYS I  5  249  ? -7.902  100.011 10.726  1.00 82.53  ? 249  LYS C CG    1 
ATOM   7776  C  CD    . LYS I  5  249  ? -8.858  100.895 11.519  1.00 81.94  ? 249  LYS C CD    1 
ATOM   7777  C  CE    . LYS I  5  249  ? -9.424  102.035 10.697  1.00 81.41  ? 249  LYS C CE    1 
ATOM   7778  N  NZ    . LYS I  5  249  ? -8.417  103.101 10.410  1.00 81.24  ? 249  LYS C NZ    1 
ATOM   7779  N  N     . ARG I  5  250  ? -4.320  100.121 7.770   1.00 84.02  ? 250  ARG C N     1 
ATOM   7780  C  CA    . ARG I  5  250  ? -3.442  100.621 6.702   1.00 82.41  ? 250  ARG C CA    1 
ATOM   7781  C  C     . ARG I  5  250  ? -3.931  100.048 5.364   1.00 81.64  ? 250  ARG C C     1 
ATOM   7782  O  O     . ARG I  5  250  ? -3.382  99.078  4.837   1.00 81.46  ? 250  ARG C O     1 
ATOM   7783  C  CB    . ARG I  5  250  ? -1.974  100.211 6.966   1.00 82.13  ? 250  ARG C CB    1 
ATOM   7784  C  CG    . ARG I  5  250  ? -0.942  101.316 6.699   1.00 82.13  ? 250  ARG C CG    1 
ATOM   7785  C  CD    . ARG I  5  250  ? 0.503   100.945 7.099   1.00 81.81  ? 250  ARG C CD    1 
ATOM   7786  N  NE    . ARG I  5  250  ? 1.457   102.053 6.924   1.00 82.25  ? 250  ARG C NE    1 
ATOM   7787  C  CZ    . ARG I  5  250  ? 1.456   103.189 7.628   1.00 82.55  ? 250  ARG C CZ    1 
ATOM   7788  N  NH1   . ARG I  5  250  ? 0.552   103.395 8.578   1.00 83.59  ? 250  ARG C NH1   1 
ATOM   7789  N  NH2   . ARG I  5  250  ? 2.361   104.133 7.383   1.00 81.90  ? 250  ARG C NH2   1 
ATOM   7790  N  N     . ASP I  5  251  ? -5.004  100.675 4.871   1.00 81.54  ? 251  ASP C N     1 
ATOM   7791  C  CA    . ASP I  5  251  ? -5.761  100.332 3.657   1.00 80.06  ? 251  ASP C CA    1 
ATOM   7792  C  C     . ASP I  5  251  ? -4.987  99.430  2.695   1.00 79.83  ? 251  ASP C C     1 
ATOM   7793  O  O     . ASP I  5  251  ? -5.222  98.226  2.660   1.00 79.22  ? 251  ASP C O     1 
ATOM   7794  C  CB    . ASP I  5  251  ? -6.207  101.609 2.934   1.00 79.24  ? 251  ASP C CB    1 
ATOM   7795  C  CG    . ASP I  5  251  ? -7.518  102.142 3.446   1.00 78.31  ? 251  ASP C CG    1 
ATOM   7796  O  OD1   . ASP I  5  251  ? -8.407  101.333 3.779   1.00 78.85  ? 251  ASP C OD1   1 
ATOM   7797  O  OD2   . ASP I  5  251  ? -7.662  103.371 3.508   1.00 77.20  ? 251  ASP C OD2   1 
ATOM   7798  N  N     . LYS I  5  252  ? -4.077  99.997  1.911   1.00 80.19  ? 252  LYS C N     1 
ATOM   7799  C  CA    . LYS I  5  252  ? -3.327  99.197  0.951   1.00 80.75  ? 252  LYS C CA    1 
ATOM   7800  C  C     . LYS I  5  252  ? -1.883  99.646  0.885   1.00 81.49  ? 252  LYS C C     1 
ATOM   7801  O  O     . LYS I  5  252  ? -1.256  99.497  -0.156  1.00 81.72  ? 252  LYS C O     1 
ATOM   7802  C  CB    . LYS I  5  252  ? -3.946  99.329  -0.450  1.00 79.91  ? 252  LYS C CB    1 
ATOM   7803  C  CG    . LYS I  5  252  ? -5.403  99.783  -0.510  1.00 79.46  ? 252  LYS C CG    1 
ATOM   7804  C  CD    . LYS I  5  252  ? -5.527  101.308 -0.370  1.00 79.73  ? 252  LYS C CD    1 
ATOM   7805  C  CE    . LYS I  5  252  ? -6.981  101.787 -0.421  1.00 79.22  ? 252  LYS C CE    1 
ATOM   7806  N  NZ    . LYS I  5  252  ? -7.569  101.660 -1.777  1.00 78.78  ? 252  LYS C NZ    1 
ATOM   7807  N  N     . ALA I  5  253  ? -1.369  100.162 2.004   1.00 82.90  ? 253  ALA C N     1 
ATOM   7808  C  CA    . ALA I  5  253  ? -0.022  100.765 2.131   1.00 84.34  ? 253  ALA C CA    1 
ATOM   7809  C  C     . ALA I  5  253  ? 1.149   99.777  1.909   1.00 85.09  ? 253  ALA C C     1 
ATOM   7810  O  O     . ALA I  5  253  ? 1.855   99.908  0.897   1.00 84.91  ? 253  ALA C O     1 
ATOM   7811  C  CB    . ALA I  5  253  ? 0.117   101.414 3.495   1.00 84.85  ? 253  ALA C CB    1 
ATOM   7812  N  N     . VAL I  5  254  ? 1.394   98.828  2.822   1.00 84.19  ? 254  VAL C N     1 
ATOM   7813  C  CA    . VAL I  5  254  ? 2.543   97.929  2.633   1.00 84.29  ? 254  VAL C CA    1 
ATOM   7814  C  C     . VAL I  5  254  ? 2.301   96.917  1.485   1.00 84.39  ? 254  VAL C C     1 
ATOM   7815  O  O     . VAL I  5  254  ? 3.264   96.373  0.929   1.00 84.90  ? 254  VAL C O     1 
ATOM   7816  C  CB    . VAL I  5  254  ? 2.921   97.168  3.972   1.00 83.36  ? 254  VAL C CB    1 
ATOM   7817  C  CG1   . VAL I  5  254  ? 4.442   97.212  4.167   1.00 81.35  ? 254  VAL C CG1   1 
ATOM   7818  C  CG2   . VAL I  5  254  ? 2.266   97.836  5.190   1.00 82.49  ? 254  VAL C CG2   1 
ATOM   7819  N  N     . ALA I  5  255  ? 1.042   96.674  1.113   1.00 83.27  ? 255  ALA C N     1 
ATOM   7820  C  CA    . ALA I  5  255  ? 0.745   95.756  0.002   1.00 81.55  ? 255  ALA C CA    1 
ATOM   7821  C  C     . ALA I  5  255  ? 1.192   96.359  -1.331  1.00 79.84  ? 255  ALA C C     1 
ATOM   7822  O  O     . ALA I  5  255  ? 1.352   95.658  -2.339  1.00 79.76  ? 255  ALA C O     1 
ATOM   7823  C  CB    . ALA I  5  255  ? -0.742  95.453  -0.038  1.00 82.59  ? 255  ALA C CB    1 
ATOM   7824  N  N     . TYR I  5  256  ? 1.389   97.677  -1.308  1.00 77.38  ? 256  TYR C N     1 
ATOM   7825  C  CA    . TYR I  5  256  ? 1.867   98.438  -2.463  1.00 74.96  ? 256  TYR C CA    1 
ATOM   7826  C  C     . TYR I  5  256  ? 3.363   98.184  -2.713  1.00 74.09  ? 256  TYR C C     1 
ATOM   7827  O  O     . TYR I  5  256  ? 3.762   97.928  -3.839  1.00 74.63  ? 256  TYR C O     1 
ATOM   7828  C  CB    . TYR I  5  256  ? 1.734   99.958  -2.261  1.00 73.48  ? 256  TYR C CB    1 
ATOM   7829  C  CG    . TYR I  5  256  ? 0.361   100.585 -2.358  1.00 71.68  ? 256  TYR C CG    1 
ATOM   7830  C  CD1   . TYR I  5  256  ? -0.618  100.112 -3.265  1.00 70.84  ? 256  TYR C CD1   1 
ATOM   7831  C  CD2   . TYR I  5  256  ? 0.042   101.695 -1.548  1.00 71.37  ? 256  TYR C CD2   1 
ATOM   7832  C  CE1   . TYR I  5  256  ? -1.899  100.745 -3.360  1.00 69.63  ? 256  TYR C CE1   1 
ATOM   7833  C  CE2   . TYR I  5  256  ? -1.232  102.334 -1.631  1.00 71.06  ? 256  TYR C CE2   1 
ATOM   7834  C  CZ    . TYR I  5  256  ? -2.189  101.854 -2.536  1.00 70.09  ? 256  TYR C CZ    1 
ATOM   7835  O  OH    . TYR I  5  256  ? -3.401  102.497 -2.608  1.00 69.93  ? 256  TYR C OH    1 
ATOM   7836  N  N     . VAL I  5  257  ? 4.176   98.272  -1.655  1.00 73.00  ? 257  VAL C N     1 
ATOM   7837  C  CA    . VAL I  5  257  ? 5.633   98.108  -1.732  1.00 71.37  ? 257  VAL C CA    1 
ATOM   7838  C  C     . VAL I  5  257  ? 6.029   96.772  -2.359  1.00 71.59  ? 257  VAL C C     1 
ATOM   7839  O  O     . VAL I  5  257  ? 7.010   96.701  -3.084  1.00 71.41  ? 257  VAL C O     1 
ATOM   7840  C  CB    . VAL I  5  257  ? 6.268   98.200  -0.336  1.00 70.23  ? 257  VAL C CB    1 
ATOM   7841  C  CG1   . VAL I  5  257  ? 7.748   98.382  -0.456  1.00 69.80  ? 257  VAL C CG1   1 
ATOM   7842  C  CG2   . VAL I  5  257  ? 5.697   99.365  0.399   1.00 70.40  ? 257  VAL C CG2   1 
ATOM   7843  N  N     . TYR I  5  258  ? 5.292   95.706  -2.077  1.00 72.24  ? 258  TYR C N     1 
ATOM   7844  C  CA    . TYR I  5  258  ? 5.611   94.408  -2.665  1.00 72.12  ? 258  TYR C CA    1 
ATOM   7845  C  C     . TYR I  5  258  ? 4.685   94.149  -3.802  1.00 72.10  ? 258  TYR C C     1 
ATOM   7846  O  O     . TYR I  5  258  ? 4.427   93.032  -4.229  1.00 72.80  ? 258  TYR C O     1 
ATOM   7847  C  CB    . TYR I  5  258  ? 5.521   93.348  -1.568  1.00 73.18  ? 258  TYR C CB    1 
ATOM   7848  C  CG    . TYR I  5  258  ? 6.226   93.842  -0.311  1.00 74.62  ? 258  TYR C CG    1 
ATOM   7849  C  CD1   . TYR I  5  258  ? 5.748   93.510  0.974   1.00 75.41  ? 258  TYR C CD1   1 
ATOM   7850  C  CD2   . TYR I  5  258  ? 7.350   94.713  -0.397  1.00 75.61  ? 258  TYR C CD2   1 
ATOM   7851  C  CE1   . TYR I  5  258  ? 6.374   94.047  2.151   1.00 76.28  ? 258  TYR C CE1   1 
ATOM   7852  C  CE2   . TYR I  5  258  ? 7.964   95.247  0.753   1.00 76.54  ? 258  TYR C CE2   1 
ATOM   7853  C  CZ    . TYR I  5  258  ? 7.481   94.917  2.016   1.00 76.83  ? 258  TYR C CZ    1 
ATOM   7854  O  OH    . TYR I  5  258  ? 8.107   95.476  3.109   1.00 76.28  ? 258  TYR C OH    1 
ATOM   7855  N  N     . GLY I  5  259  ? 4.203   95.290  -4.274  1.00 71.95  ? 259  GLY C N     1 
ATOM   7856  C  CA    . GLY I  5  259  ? 3.281   95.381  -5.376  1.00 71.33  ? 259  GLY C CA    1 
ATOM   7857  C  C     . GLY I  5  259  ? 3.866   96.051  -6.622  1.00 70.71  ? 259  GLY C C     1 
ATOM   7858  O  O     . GLY I  5  259  ? 4.426   95.348  -7.460  1.00 71.90  ? 259  GLY C O     1 
ATOM   7859  N  N     . LEU I  5  260  ? 3.816   97.384  -6.755  1.00 68.72  ? 260  LEU C N     1 
ATOM   7860  C  CA    . LEU I  5  260  ? 4.190   97.957  -8.059  1.00 65.87  ? 260  LEU C CA    1 
ATOM   7861  C  C     . LEU I  5  260  ? 5.516   98.776  -8.141  1.00 63.80  ? 260  LEU C C     1 
ATOM   7862  O  O     . LEU I  5  260  ? 6.241   98.553  -9.114  1.00 62.93  ? 260  LEU C O     1 
ATOM   7863  C  CB    . LEU I  5  260  ? 3.021   98.829  -8.561  1.00 65.06  ? 260  LEU C CB    1 
ATOM   7864  C  CG    . LEU I  5  260  ? 3.091   100.334 -8.851  1.00 63.50  ? 260  LEU C CG    1 
ATOM   7865  C  CD1   . LEU I  5  260  ? 4.080   100.709 -9.965  1.00 62.50  ? 260  LEU C CD1   1 
ATOM   7866  C  CD2   . LEU I  5  260  ? 1.706   100.729 -9.269  1.00 62.46  ? 260  LEU C CD2   1 
ATOM   7867  N  N     . ILE I  5  261  ? 5.888   99.669  -7.223  1.00 61.68  ? 261  ILE C N     1 
ATOM   7868  C  CA    . ILE I  5  261  ? 6.999   100.579 -7.600  1.00 59.31  ? 261  ILE C CA    1 
ATOM   7869  C  C     . ILE I  5  261  ? 8.433   100.190 -7.131  1.00 58.71  ? 261  ILE C C     1 
ATOM   7870  O  O     . ILE I  5  261  ? 9.261   99.863  -7.977  1.00 58.59  ? 261  ILE C O     1 
ATOM   7871  C  CB    . ILE I  5  261  ? 6.741   102.050 -7.110  1.00 58.16  ? 261  ILE C CB    1 
ATOM   7872  C  CG1   . ILE I  5  261  ? 5.287   102.469 -7.315  1.00 56.98  ? 261  ILE C CG1   1 
ATOM   7873  C  CG2   . ILE I  5  261  ? 7.506   103.007 -7.956  1.00 54.88  ? 261  ILE C CG2   1 
ATOM   7874  C  CD1   . ILE I  5  261  ? 4.423   102.266 -6.095  1.00 56.00  ? 261  ILE C CD1   1 
ATOM   7875  N  N     . ALA I  5  262  ? 8.733   100.237 -5.830  1.00 58.28  ? 262  ALA C N     1 
ATOM   7876  C  CA    . ALA I  5  262  ? 10.122  100.142 -5.294  1.00 57.07  ? 262  ALA C CA    1 
ATOM   7877  C  C     . ALA I  5  262  ? 10.793  98.736  -5.336  1.00 56.45  ? 262  ALA C C     1 
ATOM   7878  O  O     . ALA I  5  262  ? 11.431  98.404  -6.319  1.00 55.59  ? 262  ALA C O     1 
ATOM   7879  C  CB    . ALA I  5  262  ? 10.140  100.687 -3.868  1.00 56.64  ? 262  ALA C CB    1 
ATOM   7880  N  N     . ASP I  5  263  ? 10.697  97.957  -4.252  1.00 56.28  ? 263  ASP C N     1 
ATOM   7881  C  CA    . ASP I  5  263  ? 11.361  96.639  -4.096  1.00 55.52  ? 263  ASP C CA    1 
ATOM   7882  C  C     . ASP I  5  263  ? 11.326  95.822  -5.357  1.00 56.32  ? 263  ASP C C     1 
ATOM   7883  O  O     . ASP I  5  263  ? 12.392  95.410  -5.819  1.00 55.76  ? 263  ASP C O     1 
ATOM   7884  C  CB    . ASP I  5  263  ? 10.722  95.881  -2.954  1.00 53.94  ? 263  ASP C CB    1 
ATOM   7885  C  CG    . ASP I  5  263  ? 10.742  96.672  -1.691  1.00 53.57  ? 263  ASP C CG    1 
ATOM   7886  O  OD1   . ASP I  5  263  ? 10.128  96.231  -0.712  1.00 51.96  ? 263  ASP C OD1   1 
ATOM   7887  O  OD2   . ASP I  5  263  ? 11.384  97.745  -1.681  1.00 54.29  ? 263  ASP C OD2   1 
ATOM   7888  N  N     . PRO I  5  264  ? 10.126  95.541  -5.929  1.00 57.40  ? 264  PRO C N     1 
ATOM   7889  C  CA    . PRO I  5  264  ? 10.182  94.776  -7.172  1.00 58.41  ? 264  PRO C CA    1 
ATOM   7890  C  C     . PRO I  5  264  ? 10.978  95.575  -8.227  1.00 59.76  ? 264  PRO C C     1 
ATOM   7891  O  O     . PRO I  5  264  ? 11.575  96.571  -7.820  1.00 60.05  ? 264  PRO C O     1 
ATOM   7892  C  CB    . PRO I  5  264  ? 8.716   94.552  -7.470  1.00 56.53  ? 264  PRO C CB    1 
ATOM   7893  C  CG    . PRO I  5  264  ? 8.135   94.374  -6.129  1.00 56.53  ? 264  PRO C CG    1 
ATOM   7894  C  CD    . PRO I  5  264  ? 8.742   95.542  -5.413  1.00 57.21  ? 264  PRO C CD    1 
ATOM   7895  N  N     . ARG I  5  265  ? 11.038  95.277  -9.525  1.00 61.07  ? 265  ARG C N     1 
ATOM   7896  C  CA    . ARG I  5  265  ? 11.991  96.150  -10.215 1.00 62.29  ? 265  ARG C CA    1 
ATOM   7897  C  C     . ARG I  5  265  ? 11.441  96.895  -11.429 1.00 63.24  ? 265  ARG C C     1 
ATOM   7898  O  O     . ARG I  5  265  ? 10.546  96.463  -12.161 1.00 62.93  ? 265  ARG C O     1 
ATOM   7899  C  CB    . ARG I  5  265  ? 13.233  95.352  -10.597 1.00 62.90  ? 265  ARG C CB    1 
ATOM   7900  C  CG    . ARG I  5  265  ? 14.483  96.181  -10.466 1.00 64.86  ? 265  ARG C CG    1 
ATOM   7901  C  CD    . ARG I  5  265  ? 15.472  95.882  -11.538 1.00 66.12  ? 265  ARG C CD    1 
ATOM   7902  N  NE    . ARG I  5  265  ? 16.197  94.640  -11.312 1.00 68.97  ? 265  ARG C NE    1 
ATOM   7903  C  CZ    . ARG I  5  265  ? 16.996  94.082  -12.218 1.00 69.98  ? 265  ARG C CZ    1 
ATOM   7904  N  NH1   . ARG I  5  265  ? 17.150  94.653  -13.404 1.00 70.04  ? 265  ARG C NH1   1 
ATOM   7905  N  NH2   . ARG I  5  265  ? 17.651  92.968  -11.947 1.00 71.09  ? 265  ARG C NH2   1 
ATOM   7906  N  N     . ARG I  5  266  ? 12.054  98.071  -11.584 1.00 63.75  ? 266  ARG C N     1 
ATOM   7907  C  CA    . ARG I  5  266  ? 11.823  98.985  -12.675 1.00 65.26  ? 266  ARG C CA    1 
ATOM   7908  C  C     . ARG I  5  266  ? 12.685  98.584  -13.868 1.00 66.41  ? 266  ARG C C     1 
ATOM   7909  O  O     . ARG I  5  266  ? 12.918  99.372  -14.790 1.00 67.02  ? 266  ARG C O     1 
ATOM   7910  C  CB    . ARG I  5  266  ? 12.144  100.436 -12.250 1.00 64.43  ? 266  ARG C CB    1 
ATOM   7911  C  CG    . ARG I  5  266  ? 10.937  101.401 -12.339 1.00 63.05  ? 266  ARG C CG    1 
ATOM   7912  C  CD    . ARG I  5  266  ? 11.132  102.532 -13.378 1.00 61.20  ? 266  ARG C CD    1 
ATOM   7913  N  NE    . ARG I  5  266  ? 9.868   103.186 -13.725 1.00 59.93  ? 266  ARG C NE    1 
ATOM   7914  C  CZ    . ARG I  5  266  ? 9.745   104.193 -14.586 1.00 60.37  ? 266  ARG C CZ    1 
ATOM   7915  N  NH1   . ARG I  5  266  ? 10.812  104.680 -15.201 1.00 61.38  ? 266  ARG C NH1   1 
ATOM   7916  N  NH2   . ARG I  5  266  ? 8.551   104.716 -14.837 1.00 60.80  ? 266  ARG C NH2   1 
ATOM   7917  N  N     . TYR I  5  267  ? 13.192  97.350  -13.829 1.00 67.47  ? 267  TYR C N     1 
ATOM   7918  C  CA    . TYR I  5  267  ? 13.916  96.856  -14.981 1.00 68.58  ? 267  TYR C CA    1 
ATOM   7919  C  C     . TYR I  5  267  ? 12.972  96.799  -16.151 1.00 69.87  ? 267  TYR C C     1 
ATOM   7920  O  O     . TYR I  5  267  ? 11.897  96.221  -16.013 1.00 70.57  ? 267  TYR C O     1 
ATOM   7921  C  CB    . TYR I  5  267  ? 14.508  95.466  -14.717 1.00 67.20  ? 267  TYR C CB    1 
ATOM   7922  C  CG    . TYR I  5  267  ? 13.672  94.429  -13.964 1.00 66.66  ? 267  TYR C CG    1 
ATOM   7923  C  CD1   . TYR I  5  267  ? 14.280  93.238  -13.510 1.00 66.83  ? 267  TYR C CD1   1 
ATOM   7924  C  CD2   . TYR I  5  267  ? 12.307  94.628  -13.653 1.00 65.51  ? 267  TYR C CD2   1 
ATOM   7925  C  CE1   . TYR I  5  267  ? 13.557  92.275  -12.757 1.00 66.06  ? 267  TYR C CE1   1 
ATOM   7926  C  CE2   . TYR I  5  267  ? 11.569  93.668  -12.901 1.00 65.27  ? 267  TYR C CE2   1 
ATOM   7927  C  CZ    . TYR I  5  267  ? 12.209  92.504  -12.459 1.00 65.30  ? 267  TYR C CZ    1 
ATOM   7928  O  OH    . TYR I  5  267  ? 11.525  91.583  -11.712 1.00 64.92  ? 267  TYR C OH    1 
ATOM   7929  N  N     . ASP I  5  268  ? 13.360  97.413  -17.272 1.00 71.27  ? 268  ASP C N     1 
ATOM   7930  C  CA    . ASP I  5  268  ? 12.527  97.553  -18.487 1.00 71.32  ? 268  ASP C CA    1 
ATOM   7931  C  C     . ASP I  5  268  ? 11.362  96.525  -18.528 1.00 71.17  ? 268  ASP C C     1 
ATOM   7932  O  O     . ASP I  5  268  ? 11.556  95.314  -18.377 1.00 70.66  ? 268  ASP C O     1 
ATOM   7933  C  CB    . ASP I  5  268  ? 13.412  97.456  -19.767 1.00 72.04  ? 268  ASP C CB    1 
ATOM   7934  C  CG    . ASP I  5  268  ? 13.687  98.849  -20.440 1.00 72.46  ? 268  ASP C CG    1 
ATOM   7935  O  OD1   . ASP I  5  268  ? 12.723  99.588  -20.742 1.00 72.83  ? 268  ASP C OD1   1 
ATOM   7936  O  OD2   . ASP I  5  268  ? 14.865  99.211  -20.683 1.00 72.21  ? 268  ASP C OD2   1 
ATOM   7937  N  N     . LEU I  5  269  ? 10.147  97.057  -18.710 1.00 71.63  ? 269  LEU C N     1 
ATOM   7938  C  CA    . LEU I  5  269  ? 8.912   96.272  -18.774 1.00 71.45  ? 269  LEU C CA    1 
ATOM   7939  C  C     . LEU I  5  269  ? 8.887   95.407  -20.004 1.00 71.80  ? 269  LEU C C     1 
ATOM   7940  O  O     . LEU I  5  269  ? 8.788   95.928  -21.126 1.00 72.31  ? 269  LEU C O     1 
ATOM   7941  C  CB    . LEU I  5  269  ? 7.670   97.188  -18.804 1.00 69.65  ? 269  LEU C CB    1 
ATOM   7942  C  CG    . LEU I  5  269  ? 6.270   96.546  -18.809 1.00 68.31  ? 269  LEU C CG    1 
ATOM   7943  C  CD1   . LEU I  5  269  ? 5.262   97.532  -18.280 1.00 68.92  ? 269  LEU C CD1   1 
ATOM   7944  C  CD2   . LEU I  5  269  ? 5.878   96.141  -20.196 1.00 67.05  ? 269  LEU C CD2   1 
ATOM   7945  N  N     . GLY I  5  270  ? 8.976   94.091  -19.799 1.00 72.61  ? 270  GLY C N     1 
ATOM   7946  C  CA    . GLY I  5  270  ? 8.932   93.194  -20.935 1.00 72.78  ? 270  GLY C CA    1 
ATOM   7947  C  C     . GLY I  5  270  ? 10.010  92.122  -21.007 1.00 72.81  ? 270  GLY C C     1 
ATOM   7948  O  O     . GLY I  5  270  ? 9.658   90.958  -20.942 1.00 72.35  ? 270  GLY C O     1 
ATOM   7949  N  N     . GLU I  5  271  ? 11.296  92.472  -21.144 1.00 74.10  ? 271  GLU C N     1 
ATOM   7950  C  CA    . GLU I  5  271  ? 12.359  91.446  -21.296 1.00 73.63  ? 271  GLU C CA    1 
ATOM   7951  C  C     . GLU I  5  271  ? 13.324  91.377  -20.080 1.00 73.23  ? 271  GLU C C     1 
ATOM   7952  O  O     . GLU I  5  271  ? 14.084  90.401  -19.967 1.00 73.91  ? 271  GLU C O     1 
ATOM   7953  C  CB    . GLU I  5  271  ? 13.182  91.704  -22.587 1.00 75.19  ? 271  GLU C CB    1 
ATOM   7954  C  CG    . GLU I  5  271  ? 12.458  91.406  -23.951 1.00 75.13  ? 271  GLU C CG    1 
ATOM   7955  C  CD    . GLU I  5  271  ? 12.886  90.085  -24.617 1.00 73.89  ? 271  GLU C CD    1 
ATOM   7956  O  OE1   . GLU I  5  271  ? 12.494  89.001  -24.127 1.00 72.48  ? 271  GLU C OE1   1 
ATOM   7957  O  OE2   . GLU I  5  271  ? 13.618  90.139  -25.633 1.00 72.81  ? 271  GLU C OE2   1 
ATOM   7958  N  N     . ALA I  5  272  ? 13.319  92.367  -19.189 1.00 72.44  ? 272  ALA C N     1 
ATOM   7959  C  CA    . ALA I  5  272  ? 14.201  92.314  -18.023 1.00 71.55  ? 272  ALA C CA    1 
ATOM   7960  C  C     . ALA I  5  272  ? 13.939  91.055  -17.206 1.00 70.83  ? 272  ALA C C     1 
ATOM   7961  O  O     . ALA I  5  272  ? 14.762  90.137  -17.188 1.00 71.43  ? 272  ALA C O     1 
ATOM   7962  C  CB    . ALA I  5  272  ? 13.982  93.514  -17.175 1.00 70.30  ? 272  ALA C CB    1 
ATOM   7963  N  N     . GLY I  5  273  ? 12.779  91.021  -16.546 1.00 71.30  ? 273  GLY C N     1 
ATOM   7964  C  CA    . GLY I  5  273  ? 12.396  89.875  -15.732 1.00 71.04  ? 273  GLY C CA    1 
ATOM   7965  C  C     . GLY I  5  273  ? 11.417  88.909  -16.398 1.00 70.53  ? 273  GLY C C     1 
ATOM   7966  O  O     . GLY I  5  273  ? 11.565  87.702  -16.239 1.00 69.87  ? 273  GLY C O     1 
ATOM   7967  N  N     . ARG I  5  274  ? 10.432  89.428  -17.137 1.00 71.30  ? 274  ARG C N     1 
ATOM   7968  C  CA    . ARG I  5  274  ? 9.392   88.625  -17.828 1.00 72.30  ? 274  ARG C CA    1 
ATOM   7969  C  C     . ARG I  5  274  ? 10.001  87.512  -18.683 1.00 72.94  ? 274  ARG C C     1 
ATOM   7970  O  O     . ARG I  5  274  ? 9.324   86.547  -19.062 1.00 72.32  ? 274  ARG C O     1 
ATOM   7971  C  CB    . ARG I  5  274  ? 8.524   89.539  -18.720 1.00 72.15  ? 274  ARG C CB    1 
ATOM   7972  C  CG    . ARG I  5  274  ? 7.439   88.845  -19.608 1.00 71.25  ? 274  ARG C CG    1 
ATOM   7973  C  CD    . ARG I  5  274  ? 7.940   88.523  -21.032 1.00 70.09  ? 274  ARG C CD    1 
ATOM   7974  N  NE    . ARG I  5  274  ? 6.889   88.165  -21.989 1.00 67.56  ? 274  ARG C NE    1 
ATOM   7975  C  CZ    . ARG I  5  274  ? 5.940   88.994  -22.415 1.00 67.41  ? 274  ARG C CZ    1 
ATOM   7976  N  NH1   . ARG I  5  274  ? 5.890   90.241  -21.968 1.00 68.57  ? 274  ARG C NH1   1 
ATOM   7977  N  NH2   . ARG I  5  274  ? 5.040   88.583  -23.296 1.00 65.99  ? 274  ARG C NH2   1 
ATOM   7978  N  N     . TYR I  5  275  ? 11.277  87.654  -18.996 1.00 74.37  ? 275  TYR C N     1 
ATOM   7979  C  CA    . TYR I  5  275  ? 11.977  86.659  -19.781 1.00 75.48  ? 275  TYR C CA    1 
ATOM   7980  C  C     . TYR I  5  275  ? 12.158  85.388  -18.966 1.00 76.13  ? 275  TYR C C     1 
ATOM   7981  O  O     . TYR I  5  275  ? 11.797  84.288  -19.401 1.00 76.21  ? 275  TYR C O     1 
ATOM   7982  C  CB    . TYR I  5  275  ? 13.288  87.313  -20.228 1.00 74.55  ? 275  TYR C CB    1 
ATOM   7983  C  CG    . TYR I  5  275  ? 14.531  86.500  -20.277 1.00 74.00  ? 275  TYR C CG    1 
ATOM   7984  C  CD1   . TYR I  5  275  ? 14.854  85.711  -21.403 1.00 73.59  ? 275  TYR C CD1   1 
ATOM   7985  C  CD2   . TYR I  5  275  ? 15.439  86.563  -19.208 1.00 74.13  ? 275  TYR C CD2   1 
ATOM   7986  C  CE1   . TYR I  5  275  ? 16.085  84.996  -21.462 1.00 73.87  ? 275  TYR C CE1   1 
ATOM   7987  C  CE2   . TYR I  5  275  ? 16.657  85.866  -19.245 1.00 74.13  ? 275  TYR C CE2   1 
ATOM   7988  C  CZ    . TYR I  5  275  ? 16.977  85.091  -20.367 1.00 74.03  ? 275  TYR C CZ    1 
ATOM   7989  O  OH    . TYR I  5  275  ? 18.190  84.463  -20.366 1.00 73.86  ? 275  TYR C OH    1 
ATOM   7990  N  N     . LYS I  5  276  ? 12.698  85.566  -17.767 1.00 77.08  ? 276  LYS C N     1 
ATOM   7991  C  CA    . LYS I  5  276  ? 12.898  84.466  -16.838 1.00 77.88  ? 276  LYS C CA    1 
ATOM   7992  C  C     . LYS I  5  276  ? 11.572  83.851  -16.448 1.00 78.34  ? 276  LYS C C     1 
ATOM   7993  O  O     . LYS I  5  276  ? 11.516  82.766  -15.881 1.00 77.45  ? 276  LYS C O     1 
ATOM   7994  C  CB    . LYS I  5  276  ? 13.595  84.958  -15.575 1.00 78.86  ? 276  LYS C CB    1 
ATOM   7995  C  CG    . LYS I  5  276  ? 15.116  84.888  -15.665 1.00 79.40  ? 276  LYS C CG    1 
ATOM   7996  C  CD    . LYS I  5  276  ? 15.786  85.435  -14.423 1.00 80.26  ? 276  LYS C CD    1 
ATOM   7997  C  CE    . LYS I  5  276  ? 15.410  86.881  -14.239 1.00 81.14  ? 276  LYS C CE    1 
ATOM   7998  N  NZ    . LYS I  5  276  ? 16.369  87.599  -13.408 1.00 81.94  ? 276  LYS C NZ    1 
ATOM   7999  N  N     . ALA I  5  277  ? 10.497  84.564  -16.754 1.00 79.73  ? 277  ALA C N     1 
ATOM   8000  C  CA    . ALA I  5  277  ? 9.165   84.093  -16.423 1.00 81.40  ? 277  ALA C CA    1 
ATOM   8001  C  C     . ALA I  5  277  ? 8.616   83.174  -17.512 1.00 81.82  ? 277  ALA C C     1 
ATOM   8002  O  O     . ALA I  5  277  ? 8.710   81.959  -17.383 1.00 82.20  ? 277  ALA C O     1 
ATOM   8003  C  CB    . ALA I  5  277  ? 8.213   85.297  -16.205 1.00 81.59  ? 277  ALA C CB    1 
ATOM   8004  N  N     . GLU I  5  278  ? 8.065   83.768  -18.574 1.00 81.73  ? 278  GLU C N     1 
ATOM   8005  C  CA    . GLU I  5  278  ? 7.429   83.066  -19.695 1.00 81.69  ? 278  GLU C CA    1 
ATOM   8006  C  C     . GLU I  5  278  ? 8.101   81.719  -20.022 1.00 82.89  ? 278  GLU C C     1 
ATOM   8007  O  O     . GLU I  5  278  ? 7.399   80.706  -20.160 1.00 82.76  ? 278  GLU C O     1 
ATOM   8008  C  CB    . GLU I  5  278  ? 7.452   83.952  -20.933 1.00 79.97  ? 278  GLU C CB    1 
ATOM   8009  C  CG    . GLU I  5  278  ? 6.120   84.121  -21.623 1.00 77.87  ? 278  GLU C CG    1 
ATOM   8010  C  CD    . GLU I  5  278  ? 5.392   85.378  -21.200 1.00 75.98  ? 278  GLU C CD    1 
ATOM   8011  O  OE1   . GLU I  5  278  ? 4.291   85.619  -21.734 1.00 74.68  ? 278  GLU C OE1   1 
ATOM   8012  O  OE2   . GLU I  5  278  ? 5.910   86.123  -20.341 1.00 74.06  ? 278  GLU C OE2   1 
ATOM   8013  N  N     . GLU I  5  279  ? 9.432   81.695  -20.145 1.00 83.98  ? 279  GLU C N     1 
ATOM   8014  C  CA    . GLU I  5  279  ? 10.155  80.451  -20.489 1.00 84.58  ? 279  GLU C CA    1 
ATOM   8015  C  C     . GLU I  5  279  ? 10.270  79.479  -19.281 1.00 85.85  ? 279  GLU C C     1 
ATOM   8016  O  O     . GLU I  5  279  ? 9.856   78.308  -19.372 1.00 85.72  ? 279  GLU C O     1 
ATOM   8017  C  CB    . GLU I  5  279  ? 11.574  80.802  -21.063 1.00 82.93  ? 279  GLU C CB    1 
ATOM   8018  C  CG    . GLU I  5  279  ? 12.878  80.451  -20.232 1.00 79.41  ? 279  GLU C CG    1 
ATOM   8019  C  CD    . GLU I  5  279  ? 13.357  78.975  -20.305 1.00 77.33  ? 279  GLU C CD    1 
ATOM   8020  O  OE1   . GLU I  5  279  ? 13.808  78.519  -21.374 1.00 75.93  ? 279  GLU C OE1   1 
ATOM   8021  O  OE2   . GLU I  5  279  ? 13.290  78.262  -19.282 1.00 75.63  ? 279  GLU C OE2   1 
ATOM   8022  N  N     . LYS I  5  280  ? 10.809  79.965  -18.161 1.00 87.39  ? 280  LYS C N     1 
ATOM   8023  C  CA    . LYS I  5  280  ? 11.050  79.137  -16.973 1.00 88.10  ? 280  LYS C CA    1 
ATOM   8024  C  C     . LYS I  5  280  ? 9.745   78.758  -16.229 1.00 88.36  ? 280  LYS C C     1 
ATOM   8025  O  O     . LYS I  5  280  ? 9.519   77.565  -16.027 1.00 88.00  ? 280  LYS C O     1 
ATOM   8026  C  CB    . LYS I  5  280  ? 12.050  79.875  -16.046 1.00 88.39  ? 280  LYS C CB    1 
ATOM   8027  C  CG    . LYS I  5  280  ? 13.358  80.323  -16.797 1.00 88.53  ? 280  LYS C CG    1 
ATOM   8028  C  CD    . LYS I  5  280  ? 14.383  81.135  -15.962 1.00 87.38  ? 280  LYS C CD    1 
ATOM   8029  C  CE    . LYS I  5  280  ? 15.548  81.648  -16.840 1.00 85.77  ? 280  LYS C CE    1 
ATOM   8030  N  NZ    . LYS I  5  280  ? 16.669  82.271  -16.073 1.00 84.19  ? 280  LYS C NZ    1 
ATOM   8031  N  N     . LEU I  5  281  ? 8.896   79.721  -15.830 1.00 89.49  ? 281  LEU C N     1 
ATOM   8032  C  CA    . LEU I  5  281  ? 7.638   79.404  -15.092 1.00 90.47  ? 281  LEU C CA    1 
ATOM   8033  C  C     . LEU I  5  281  ? 6.542   80.492  -15.289 1.00 91.76  ? 281  LEU C C     1 
ATOM   8034  O  O     . LEU I  5  281  ? 6.859   81.655  -15.533 1.00 92.86  ? 281  LEU C O     1 
ATOM   8035  C  CB    . LEU I  5  281  ? 7.901   79.306  -13.587 1.00 89.36  ? 281  LEU C CB    1 
ATOM   8036  C  CG    . LEU I  5  281  ? 8.012   80.687  -12.910 1.00 88.99  ? 281  LEU C CG    1 
ATOM   8037  C  CD1   . LEU I  5  281  ? 7.690   80.635  -11.429 1.00 88.55  ? 281  LEU C CD1   1 
ATOM   8038  C  CD2   . LEU I  5  281  ? 9.397   81.208  -13.180 1.00 89.53  ? 281  LEU C CD2   1 
ATOM   8039  N  N     . GLY I  5  282  ? 5.264   80.113  -15.153 1.00 92.79  ? 282  GLY C N     1 
ATOM   8040  C  CA    . GLY I  5  282  ? 4.165   81.070  -15.283 1.00 93.69  ? 282  GLY C CA    1 
ATOM   8041  C  C     . GLY I  5  282  ? 4.089   81.723  -16.654 1.00 94.49  ? 282  GLY C C     1 
ATOM   8042  O  O     . GLY I  5  282  ? 5.101   81.847  -17.337 1.00 94.96  ? 282  GLY C O     1 
ATOM   8043  N  N     . ILE I  5  283  ? 2.908   82.166  -17.074 1.00 95.46  ? 283  ILE C N     1 
ATOM   8044  C  CA    . ILE I  5  283  ? 2.817   82.744  -18.416 1.00 96.50  ? 283  ILE C CA    1 
ATOM   8045  C  C     . ILE I  5  283  ? 2.802   84.285  -18.410 1.00 96.82  ? 283  ILE C C     1 
ATOM   8046  O  O     . ILE I  5  283  ? 3.535   84.888  -19.204 1.00 97.18  ? 283  ILE C O     1 
ATOM   8047  C  CB    . ILE I  5  283  ? 1.534   82.302  -19.207 1.00 96.53  ? 283  ILE C CB    1 
ATOM   8048  C  CG1   . ILE I  5  283  ? 1.163   80.839  -18.925 1.00 96.64  ? 283  ILE C CG1   1 
ATOM   8049  C  CG2   . ILE I  5  283  ? 1.814   82.454  -20.722 1.00 96.27  ? 283  ILE C CG2   1 
ATOM   8050  C  CD1   . ILE I  5  283  ? -0.248  80.474  -19.415 1.00 95.05  ? 283  ILE C CD1   1 
ATOM   8051  N  N     . ARG I  5  284  ? 2.011   84.944  -17.552 1.00 96.86  ? 284  ARG C N     1 
ATOM   8052  C  CA    . ARG I  5  284  ? 1.943   86.409  -17.687 1.00 95.72  ? 284  ARG C CA    1 
ATOM   8053  C  C     . ARG I  5  284  ? 2.335   87.176  -16.417 1.00 95.13  ? 284  ARG C C     1 
ATOM   8054  O  O     . ARG I  5  284  ? 2.375   86.666  -15.288 1.00 95.19  ? 284  ARG C O     1 
ATOM   8055  C  CB    . ARG I  5  284  ? 0.525   86.822  -18.122 1.00 94.66  ? 284  ARG C CB    1 
ATOM   8056  C  CG    . ARG I  5  284  ? 0.357   88.287  -18.536 1.00 93.31  ? 284  ARG C CG    1 
ATOM   8057  C  CD    . ARG I  5  284  ? 0.067   88.477  -20.027 1.00 92.29  ? 284  ARG C CD    1 
ATOM   8058  N  NE    . ARG I  5  284  ? 1.235   88.864  -20.823 1.00 91.40  ? 284  ARG C NE    1 
ATOM   8059  C  CZ    . ARG I  5  284  ? 1.160   89.369  -22.053 1.00 91.21  ? 284  ARG C CZ    1 
ATOM   8060  N  NH1   . ARG I  5  284  ? -0.021  89.551  -22.626 1.00 90.85  ? 284  ARG C NH1   1 
ATOM   8061  N  NH2   . ARG I  5  284  ? 2.263   89.693  -22.716 1.00 91.02  ? 284  ARG C NH2   1 
ATOM   8062  N  N     . LEU I  5  285  ? 2.621   88.449  -16.704 1.00 95.06  ? 285  LEU C N     1 
ATOM   8063  C  CA    . LEU I  5  285  ? 2.993   89.507  -15.781 1.00 93.88  ? 285  LEU C CA    1 
ATOM   8064  C  C     . LEU I  5  285  ? 2.224   90.799  -16.121 1.00 93.59  ? 285  LEU C C     1 
ATOM   8065  O  O     . LEU I  5  285  ? 2.429   91.392  -17.186 1.00 93.61  ? 285  LEU C O     1 
ATOM   8066  C  CB    . LEU I  5  285  ? 4.521   89.783  -15.862 1.00 93.68  ? 285  LEU C CB    1 
ATOM   8067  C  CG    . LEU I  5  285  ? 5.185   90.901  -16.721 1.00 92.92  ? 285  LEU C CG    1 
ATOM   8068  C  CD1   . LEU I  5  285  ? 6.656   90.960  -16.401 1.00 92.36  ? 285  LEU C CD1   1 
ATOM   8069  C  CD2   . LEU I  5  285  ? 5.001   90.656  -18.211 1.00 92.40  ? 285  LEU C CD2   1 
ATOM   8070  N  N     . SER I  5  286  ? 1.313   91.226  -15.253 1.00 93.88  ? 286  SER C N     1 
ATOM   8071  C  CA    . SER I  5  286  ? 0.626   92.487  -15.507 1.00 93.43  ? 286  SER C CA    1 
ATOM   8072  C  C     . SER I  5  286  ? 1.282   93.591  -14.678 1.00 93.76  ? 286  SER C C     1 
ATOM   8073  O  O     . SER I  5  286  ? 1.138   93.632  -13.447 1.00 94.19  ? 286  SER C O     1 
ATOM   8074  C  CB    . SER I  5  286  ? -0.868  92.365  -15.171 1.00 92.34  ? 286  SER C CB    1 
ATOM   8075  O  OG    . SER I  5  286  ? -1.674  92.974  -16.170 1.00 90.61  ? 286  SER C OG    1 
ATOM   8076  N  N     . GLY I  5  287  ? 2.012   94.469  -15.372 1.00 94.49  ? 287  GLY C N     1 
ATOM   8077  C  CA    . GLY I  5  287  ? 2.787   95.518  -14.725 1.00 93.89  ? 287  GLY C CA    1 
ATOM   8078  C  C     . GLY I  5  287  ? 4.145   94.930  -14.386 1.00 93.10  ? 287  GLY C C     1 
ATOM   8079  O  O     . GLY I  5  287  ? 4.147   93.875  -13.750 1.00 93.85  ? 287  GLY C O     1 
ATOM   8080  N  N     . ARG I  5  288  ? 5.253   95.564  -14.800 1.00 91.26  ? 288  ARG C N     1 
ATOM   8081  C  CA    . ARG I  5  288  ? 6.635   95.078  -14.572 1.00 89.37  ? 288  ARG C CA    1 
ATOM   8082  C  C     . ARG I  5  288  ? 6.675   93.865  -13.651 1.00 88.88  ? 288  ARG C C     1 
ATOM   8083  O  O     . ARG I  5  288  ? 6.643   92.735  -14.116 1.00 89.24  ? 288  ARG C O     1 
ATOM   8084  C  CB    . ARG I  5  288  ? 7.491   96.179  -13.982 1.00 87.27  ? 288  ARG C CB    1 
ATOM   8085  C  CG    . ARG I  5  288  ? 8.131   97.026  -15.036 1.00 85.54  ? 288  ARG C CG    1 
ATOM   8086  C  CD    . ARG I  5  288  ? 9.125   97.979  -14.436 1.00 84.30  ? 288  ARG C CD    1 
ATOM   8087  N  NE    . ARG I  5  288  ? 8.481   99.103  -13.768 1.00 83.99  ? 288  ARG C NE    1 
ATOM   8088  C  CZ    . ARG I  5  288  ? 7.950   99.073  -12.547 1.00 84.03  ? 288  ARG C CZ    1 
ATOM   8089  N  NH1   . ARG I  5  288  ? 7.979   97.971  -11.815 1.00 83.69  ? 288  ARG C NH1   1 
ATOM   8090  N  NH2   . ARG I  5  288  ? 7.378   100.159 -12.046 1.00 84.68  ? 288  ARG C NH2   1 
ATOM   8091  N  N     . THR I  5  289  ? 6.747   94.101  -12.349 1.00 88.17  ? 289  THR C N     1 
ATOM   8092  C  CA    . THR I  5  289  ? 6.713   93.023  -11.364 1.00 86.95  ? 289  THR C CA    1 
ATOM   8093  C  C     . THR I  5  289  ? 5.285   92.883  -10.811 1.00 85.57  ? 289  THR C C     1 
ATOM   8094  O  O     . THR I  5  289  ? 4.459   93.705  -11.180 1.00 85.19  ? 289  THR C O     1 
ATOM   8095  C  CB    . THR I  5  289  ? 7.672   93.352  -10.245 1.00 88.17  ? 289  THR C CB    1 
ATOM   8096  O  OG1   . THR I  5  289  ? 7.611   94.767  -10.008 1.00 89.07  ? 289  THR C OG1   1 
ATOM   8097  C  CG2   . THR I  5  289  ? 9.088   92.936  -10.604 1.00 89.21  ? 289  THR C CG2   1 
ATOM   8098  N  N     . LEU I  5  290  ? 4.974   91.888  -9.972  1.00 83.73  ? 290  LEU C N     1 
ATOM   8099  C  CA    . LEU I  5  290  ? 3.602   91.733  -9.416  1.00 82.21  ? 290  LEU C CA    1 
ATOM   8100  C  C     . LEU I  5  290  ? 3.059   93.086  -8.922  1.00 80.69  ? 290  LEU C C     1 
ATOM   8101  O  O     . LEU I  5  290  ? 3.125   93.385  -7.738  1.00 80.92  ? 290  LEU C O     1 
ATOM   8102  C  CB    . LEU I  5  290  ? 3.625   90.710  -8.257  1.00 81.27  ? 290  LEU C CB    1 
ATOM   8103  C  CG    . LEU I  5  290  ? 4.639   90.726  -7.080  1.00 80.51  ? 290  LEU C CG    1 
ATOM   8104  C  CD1   . LEU I  5  290  ? 4.169   89.715  -6.049  1.00 79.71  ? 290  LEU C CD1   1 
ATOM   8105  C  CD2   . LEU I  5  290  ? 6.066   90.381  -7.527  1.00 79.24  ? 290  LEU C CD2   1 
ATOM   8106  N  N     . ALA I  5  291  ? 2.479   93.875  -9.826  1.00 79.47  ? 291  ALA C N     1 
ATOM   8107  C  CA    . ALA I  5  291  ? 2.128   95.257  -9.507  1.00 78.84  ? 291  ALA C CA    1 
ATOM   8108  C  C     . ALA I  5  291  ? 0.669   95.612  -9.791  1.00 78.57  ? 291  ALA C C     1 
ATOM   8109  O  O     . ALA I  5  291  ? 0.085   95.156  -10.768 1.00 78.38  ? 291  ALA C O     1 
ATOM   8110  C  CB    . ALA I  5  291  ? 3.019   96.142  -10.330 1.00 78.19  ? 291  ALA C CB    1 
ATOM   8111  N  N     . ARG I  5  292  ? 0.110   96.456  -8.919  1.00 77.76  ? 292  ARG C N     1 
ATOM   8112  C  CA    . ARG I  5  292  ? -1.243  97.016  -9.074  1.00 78.28  ? 292  ARG C CA    1 
ATOM   8113  C  C     . ARG I  5  292  ? -1.623  97.918  -7.893  1.00 80.13  ? 292  ARG C C     1 
ATOM   8114  O  O     . ARG I  5  292  ? -1.280  97.642  -6.741  1.00 81.18  ? 292  ARG C O     1 
ATOM   8115  C  CB    . ARG I  5  292  ? -2.345  95.934  -9.222  1.00 76.03  ? 292  ARG C CB    1 
ATOM   8116  C  CG    . ARG I  5  292  ? -3.772  96.572  -9.517  1.00 72.91  ? 292  ARG C CG    1 
ATOM   8117  C  CD    . ARG I  5  292  ? -4.660  95.807  -10.551 1.00 69.83  ? 292  ARG C CD    1 
ATOM   8118  N  NE    . ARG I  5  292  ? -5.412  96.676  -11.480 1.00 65.42  ? 292  ARG C NE    1 
ATOM   8119  C  CZ    . ARG I  5  292  ? -6.175  96.245  -12.491 1.00 62.52  ? 292  ARG C CZ    1 
ATOM   8120  N  NH1   . ARG I  5  292  ? -6.316  94.949  -12.737 1.00 60.09  ? 292  ARG C NH1   1 
ATOM   8121  N  NH2   . ARG I  5  292  ? -6.799  97.116  -13.271 1.00 60.58  ? 292  ARG C NH2   1 
ATOM   8122  N  N     . PHE I  5  293  ? -2.334  99.004  -8.206  1.00 80.51  ? 293  PHE C N     1 
ATOM   8123  C  CA    . PHE I  5  293  ? -2.825  99.952  -7.211  1.00 80.66  ? 293  PHE C CA    1 
ATOM   8124  C  C     . PHE I  5  293  ? -4.018  100.760 -7.772  1.00 80.64  ? 293  PHE C C     1 
ATOM   8125  O  O     . PHE I  5  293  ? -4.223  101.924 -7.419  1.00 81.00  ? 293  PHE C O     1 
ATOM   8126  C  CB    . PHE I  5  293  ? -1.643  100.859 -6.761  1.00 79.70  ? 293  PHE C CB    1 
ATOM   8127  C  CG    . PHE I  5  293  ? -1.384  102.061 -7.632  1.00 79.07  ? 293  PHE C CG    1 
ATOM   8128  C  CD1   . PHE I  5  293  ? -1.338  101.955 -9.038  1.00 78.98  ? 293  PHE C CD1   1 
ATOM   8129  C  CD2   . PHE I  5  293  ? -1.178  103.327 -7.029  1.00 78.75  ? 293  PHE C CD2   1 
ATOM   8130  C  CE1   . PHE I  5  293  ? -1.090  103.099 -9.837  1.00 79.36  ? 293  PHE C CE1   1 
ATOM   8131  C  CE2   . PHE I  5  293  ? -0.928  104.484 -7.808  1.00 78.03  ? 293  PHE C CE2   1 
ATOM   8132  C  CZ    . PHE I  5  293  ? -0.884  104.374 -9.212  1.00 78.89  ? 293  PHE C CZ    1 
ATOM   8133  N  N     . GLU I  5  294  ? -4.814  100.119 -8.633  1.00 80.75  ? 294  GLU C N     1 
ATOM   8134  C  CA    . GLU I  5  294  ? -5.952  100.781 -9.290  1.00 81.34  ? 294  GLU C CA    1 
ATOM   8135  C  C     . GLU I  5  294  ? -7.252  100.640 -8.494  1.00 81.95  ? 294  GLU C C     1 
ATOM   8136  O  O     . GLU I  5  294  ? -8.028  101.597 -8.410  1.00 81.77  ? 294  GLU C O     1 
ATOM   8137  C  CB    . GLU I  5  294  ? -6.164  100.205 -10.707 1.00 81.67  ? 294  GLU C CB    1 
ATOM   8138  C  CG    . GLU I  5  294  ? -7.163  100.981 -11.619 1.00 81.04  ? 294  GLU C CG    1 
ATOM   8139  C  CD    . GLU I  5  294  ? -8.624  100.525 -11.481 1.00 80.85  ? 294  GLU C CD    1 
ATOM   8140  O  OE1   . GLU I  5  294  ? -9.309  100.957 -10.530 1.00 80.33  ? 294  GLU C OE1   1 
ATOM   8141  O  OE2   . GLU I  5  294  ? -9.089  99.728  -12.330 1.00 80.62  ? 294  GLU C OE2   1 
ATOM   8142  N  N     . ASP I  5  295  ? -7.504  99.475  -7.904  1.00 82.69  ? 295  ASP C N     1 
ATOM   8143  C  CA    . ASP I  5  295  ? -8.769  99.277  -7.188  1.00 83.57  ? 295  ASP C CA    1 
ATOM   8144  C  C     . ASP I  5  295  ? -8.565  99.000  -5.699  1.00 84.13  ? 295  ASP C C     1 
ATOM   8145  O  O     . ASP I  5  295  ? -9.554  98.913  -4.954  1.00 84.07  ? 295  ASP C O     1 
ATOM   8146  C  CB    . ASP I  5  295  ? -9.538  98.104  -7.810  1.00 83.95  ? 295  ASP C CB    1 
ATOM   8147  C  CG    . ASP I  5  295  ? -10.791 98.547  -8.551  1.00 84.33  ? 295  ASP C CG    1 
ATOM   8148  O  OD1   . ASP I  5  295  ? -11.444 97.676  -9.178  1.00 84.61  ? 295  ASP C OD1   1 
ATOM   8149  O  OD2   . ASP I  5  295  ? -11.123 99.754  -8.504  1.00 83.80  ? 295  ASP C OD2   1 
ATOM   8150  N  N     . GLY I  5  296  ? -7.315  98.868  -5.255  1.00 84.49  ? 296  GLY C N     1 
ATOM   8151  C  CA    . GLY I  5  296  ? -7.071  98.551  -3.854  1.00 84.12  ? 296  GLY C CA    1 
ATOM   8152  C  C     . GLY I  5  296  ? -6.945  97.049  -3.703  1.00 83.24  ? 296  GLY C C     1 
ATOM   8153  O  O     . GLY I  5  296  ? -6.320  96.531  -2.771  1.00 83.49  ? 296  GLY C O     1 
ATOM   8154  N  N     . GLU I  5  297  ? -7.590  96.370  -4.653  1.00 82.05  ? 297  GLU C N     1 
ATOM   8155  C  CA    . GLU I  5  297  ? -7.544  94.923  -4.807  1.00 80.15  ? 297  GLU C CA    1 
ATOM   8156  C  C     . GLU I  5  297  ? -6.397  94.577  -5.743  1.00 80.95  ? 297  GLU C C     1 
ATOM   8157  O  O     . GLU I  5  297  ? -6.393  94.983  -6.914  1.00 81.21  ? 297  GLU C O     1 
ATOM   8158  C  CB    . GLU I  5  297  ? -8.872  94.402  -5.382  1.00 77.47  ? 297  GLU C CB    1 
ATOM   8159  C  CG    . GLU I  5  297  ? -9.770  93.724  -4.369  1.00 72.48  ? 297  GLU C CG    1 
ATOM   8160  C  CD    . GLU I  5  297  ? -9.388  92.284  -4.102  1.00 69.40  ? 297  GLU C CD    1 
ATOM   8161  O  OE1   . GLU I  5  297  ? -10.085 91.658  -3.291  1.00 66.95  ? 297  GLU C OE1   1 
ATOM   8162  O  OE2   . GLU I  5  297  ? -8.411  91.777  -4.694  1.00 67.57  ? 297  GLU C OE2   1 
ATOM   8163  N  N     . PHE I  5  298  ? -5.423  93.841  -5.219  1.00 81.32  ? 298  PHE C N     1 
ATOM   8164  C  CA    . PHE I  5  298  ? -4.208  93.542  -5.961  1.00 80.66  ? 298  PHE C CA    1 
ATOM   8165  C  C     . PHE I  5  298  ? -4.339  92.282  -6.827  1.00 79.89  ? 298  PHE C C     1 
ATOM   8166  O  O     . PHE I  5  298  ? -5.189  91.406  -6.599  1.00 79.66  ? 298  PHE C O     1 
ATOM   8167  C  CB    . PHE I  5  298  ? -3.033  93.413  -4.956  1.00 81.08  ? 298  PHE C CB    1 
ATOM   8168  C  CG    . PHE I  5  298  ? -3.113  94.389  -3.782  1.00 81.67  ? 298  PHE C CG    1 
ATOM   8169  C  CD1   . PHE I  5  298  ? -3.734  94.005  -2.566  1.00 81.88  ? 298  PHE C CD1   1 
ATOM   8170  C  CD2   . PHE I  5  298  ? -2.620  95.714  -3.909  1.00 81.95  ? 298  PHE C CD2   1 
ATOM   8171  C  CE1   . PHE I  5  298  ? -3.875  94.934  -1.483  1.00 81.93  ? 298  PHE C CE1   1 
ATOM   8172  C  CE2   . PHE I  5  298  ? -2.751  96.659  -2.837  1.00 81.76  ? 298  PHE C CE2   1 
ATOM   8173  C  CZ    . PHE I  5  298  ? -3.381  96.265  -1.628  1.00 81.82  ? 298  PHE C CZ    1 
ATOM   8174  N  N     . LYS I  5  299  ? -3.466  92.248  -7.838  1.00 79.13  ? 299  LYS C N     1 
ATOM   8175  C  CA    . LYS I  5  299  ? -3.328  91.156  -8.793  1.00 78.08  ? 299  LYS C CA    1 
ATOM   8176  C  C     . LYS I  5  299  ? -1.894  90.608  -8.772  1.00 78.07  ? 299  LYS C C     1 
ATOM   8177  O  O     . LYS I  5  299  ? -0.913  91.362  -8.871  1.00 77.44  ? 299  LYS C O     1 
ATOM   8178  C  CB    . LYS I  5  299  ? -3.687  91.638  -10.212 1.00 76.56  ? 299  LYS C CB    1 
ATOM   8179  C  CG    . LYS I  5  299  ? -2.759  92.697  -10.820 1.00 73.78  ? 299  LYS C CG    1 
ATOM   8180  C  CD    . LYS I  5  299  ? -3.235  93.050  -12.217 1.00 71.07  ? 299  LYS C CD    1 
ATOM   8181  C  CE    . LYS I  5  299  ? -2.559  94.282  -12.746 1.00 69.05  ? 299  LYS C CE    1 
ATOM   8182  N  NZ    . LYS I  5  299  ? -3.341  94.807  -13.891 1.00 69.06  ? 299  LYS C NZ    1 
ATOM   8183  N  N     . ASP I  5  300  ? -1.784  89.292  -8.630  1.00 78.20  ? 300  ASP C N     1 
ATOM   8184  C  CA    . ASP I  5  300  ? -0.490  88.623  -8.561  1.00 77.93  ? 300  ASP C CA    1 
ATOM   8185  C  C     . ASP I  5  300  ? -0.414  87.442  -9.540  1.00 77.94  ? 300  ASP C C     1 
ATOM   8186  O  O     . ASP I  5  300  ? -0.785  86.326  -9.201  1.00 77.67  ? 300  ASP C O     1 
ATOM   8187  C  CB    . ASP I  5  300  ? -0.252  88.125  -7.132  1.00 78.83  ? 300  ASP C CB    1 
ATOM   8188  C  CG    . ASP I  5  300  ? -1.286  87.100  -6.688  1.00 79.43  ? 300  ASP C CG    1 
ATOM   8189  O  OD1   . ASP I  5  300  ? -2.495  87.422  -6.686  1.00 80.14  ? 300  ASP C OD1   1 
ATOM   8190  O  OD2   . ASP I  5  300  ? -0.888  85.969  -6.343  1.00 79.72  ? 300  ASP C OD2   1 
ATOM   8191  N  N     . GLU I  5  301  ? 0.071   87.683  -10.753 1.00 77.52  ? 301  GLU C N     1 
ATOM   8192  C  CA    . GLU I  5  301  ? 0.187   86.606  -11.725 1.00 76.56  ? 301  GLU C CA    1 
ATOM   8193  C  C     . GLU I  5  301  ? 1.495   85.856  -11.540 1.00 77.92  ? 301  GLU C C     1 
ATOM   8194  O  O     . GLU I  5  301  ? 1.818   84.962  -12.318 1.00 77.40  ? 301  GLU C O     1 
ATOM   8195  C  CB    . GLU I  5  301  ? 0.124   87.174  -13.131 1.00 73.80  ? 301  GLU C CB    1 
ATOM   8196  C  CG    . GLU I  5  301  ? -0.582  88.500  -13.197 1.00 68.32  ? 301  GLU C CG    1 
ATOM   8197  C  CD    . GLU I  5  301  ? -1.310  88.675  -14.483 1.00 66.40  ? 301  GLU C CD    1 
ATOM   8198  O  OE1   . GLU I  5  301  ? -0.688  88.530  -15.549 1.00 65.68  ? 301  GLU C OE1   1 
ATOM   8199  O  OE2   . GLU I  5  301  ? -2.512  88.958  -14.428 1.00 65.03  ? 301  GLU C OE2   1 
ATOM   8200  N  N     . VAL I  5  302  ? 2.232   86.227  -10.493 1.00 80.11  ? 302  VAL C N     1 
ATOM   8201  C  CA    . VAL I  5  302  ? 3.530   85.622  -10.197 1.00 83.31  ? 302  VAL C CA    1 
ATOM   8202  C  C     . VAL I  5  302  ? 3.497   84.719  -8.938  1.00 84.80  ? 302  VAL C C     1 
ATOM   8203  O  O     . VAL I  5  302  ? 4.199   83.707  -8.930  1.00 84.57  ? 302  VAL C O     1 
ATOM   8204  C  CB    . VAL I  5  302  ? 4.644   86.732  -10.001 1.00 84.03  ? 302  VAL C CB    1 
ATOM   8205  C  CG1   . VAL I  5  302  ? 4.366   87.543  -8.747  1.00 84.83  ? 302  VAL C CG1   1 
ATOM   8206  C  CG2   . VAL I  5  302  ? 6.037   86.083  -9.913  1.00 84.71  ? 302  VAL C CG2   1 
ATOM   8207  N  N     . PHE I  5  303  ? 2.705   85.049  -7.902  1.00 86.85  ? 303  PHE C N     1 
ATOM   8208  C  CA    . PHE I  5  303  ? 2.706   84.255  -6.642  1.00 87.69  ? 303  PHE C CA    1 
ATOM   8209  C  C     . PHE I  5  303  ? 2.081   82.856  -6.809  1.00 87.88  ? 303  PHE C C     1 
ATOM   8210  O  O     . PHE I  5  303  ? 2.511   81.931  -6.117  1.00 88.96  ? 303  PHE C O     1 
ATOM   8211  C  CB    . PHE I  5  303  ? 1.979   84.991  -5.481  1.00 88.30  ? 303  PHE C CB    1 
ATOM   8212  C  CG    . PHE I  5  303  ? 2.114   84.289  -4.120  1.00 88.07  ? 303  PHE C CG    1 
ATOM   8213  C  CD1   . PHE I  5  303  ? 3.387   84.136  -3.502  1.00 87.70  ? 303  PHE C CD1   1 
ATOM   8214  C  CD2   . PHE I  5  303  ? 0.975   83.773  -3.465  1.00 86.59  ? 303  PHE C CD2   1 
ATOM   8215  C  CE1   . PHE I  5  303  ? 3.518   83.474  -2.242  1.00 87.03  ? 303  PHE C CE1   1 
ATOM   8216  C  CE2   . PHE I  5  303  ? 1.091   83.114  -2.216  1.00 85.87  ? 303  PHE C CE2   1 
ATOM   8217  C  CZ    . PHE I  5  303  ? 2.358   82.962  -1.603  1.00 86.43  ? 303  PHE C CZ    1 
ATOM   8218  N  N     . LEU I  5  304  ? 1.084   82.667  -7.675  1.00 88.10  ? 304  LEU C N     1 
ATOM   8219  C  CA    . LEU I  5  304  ? 0.549   81.310  -7.824  1.00 88.30  ? 304  LEU C CA    1 
ATOM   8220  C  C     . LEU I  5  304  ? 1.406   80.480  -8.787  1.00 89.31  ? 304  LEU C C     1 
ATOM   8221  O  O     . LEU I  5  304  ? 1.552   79.271  -8.570  1.00 90.24  ? 304  LEU C O     1 
ATOM   8222  C  CB    . LEU I  5  304  ? -0.919  81.301  -8.316  1.00 86.81  ? 304  LEU C CB    1 
ATOM   8223  C  CG    . LEU I  5  304  ? -1.688  79.983  -8.533  1.00 85.32  ? 304  LEU C CG    1 
ATOM   8224  C  CD1   . LEU I  5  304  ? -3.183  80.247  -8.515  1.00 84.56  ? 304  LEU C CD1   1 
ATOM   8225  C  CD2   . LEU I  5  304  ? -1.315  79.331  -9.856  1.00 84.30  ? 304  LEU C CD2   1 
ATOM   8226  N  N     . PRO I  5  305  ? 1.975   81.091  -9.861  1.00 89.61  ? 305  PRO C N     1 
ATOM   8227  C  CA    . PRO I  5  305  ? 2.805   80.286  -10.771 1.00 89.49  ? 305  PRO C CA    1 
ATOM   8228  C  C     . PRO I  5  305  ? 4.084   79.713  -10.090 1.00 89.20  ? 305  PRO C C     1 
ATOM   8229  O  O     . PRO I  5  305  ? 4.543   78.656  -10.515 1.00 89.29  ? 305  PRO C O     1 
ATOM   8230  C  CB    . PRO I  5  305  ? 3.103   81.250  -11.917 1.00 89.93  ? 305  PRO C CB    1 
ATOM   8231  C  CG    . PRO I  5  305  ? 1.878   82.044  -12.001 1.00 89.57  ? 305  PRO C CG    1 
ATOM   8232  C  CD    . PRO I  5  305  ? 1.544   82.329  -10.550 1.00 89.91  ? 305  PRO C CD    1 
ATOM   8233  N  N     . THR I  5  306  ? 4.659   80.375  -9.070  1.00 88.16  ? 306  THR C N     1 
ATOM   8234  C  CA    . THR I  5  306  ? 5.873   79.849  -8.380  1.00 87.39  ? 306  THR C CA    1 
ATOM   8235  C  C     . THR I  5  306  ? 5.582   78.541  -7.645  1.00 87.41  ? 306  THR C C     1 
ATOM   8236  O  O     . THR I  5  306  ? 6.381   77.600  -7.710  1.00 87.98  ? 306  THR C O     1 
ATOM   8237  C  CB    . THR I  5  306  ? 6.468   80.819  -7.299  1.00 86.84  ? 306  THR C CB    1 
ATOM   8238  O  OG1   . THR I  5  306  ? 7.434   80.121  -6.496  1.00 84.91  ? 306  THR C OG1   1 
ATOM   8239  C  CG2   . THR I  5  306  ? 5.399   81.334  -6.372  1.00 86.64  ? 306  THR C CG2   1 
ATOM   8240  N  N     . LEU I  5  307  ? 4.452   78.493  -6.932  1.00 87.17  ? 307  LEU C N     1 
ATOM   8241  C  CA    . LEU I  5  307  ? 4.028   77.284  -6.223  1.00 86.29  ? 307  LEU C CA    1 
ATOM   8242  C  C     . LEU I  5  307  ? 3.397   76.290  -7.202  1.00 85.15  ? 307  LEU C C     1 
ATOM   8243  O  O     . LEU I  5  307  ? 3.360   75.094  -6.945  1.00 84.74  ? 307  LEU C O     1 
ATOM   8244  C  CB    . LEU I  5  307  ? 3.022   77.632  -5.111  1.00 86.34  ? 307  LEU C CB    1 
ATOM   8245  C  CG    . LEU I  5  307  ? 2.603   76.537  -4.114  1.00 86.00  ? 307  LEU C CG    1 
ATOM   8246  C  CD1   . LEU I  5  307  ? 3.805   76.025  -3.322  1.00 85.31  ? 307  LEU C CD1   1 
ATOM   8247  C  CD2   . LEU I  5  307  ? 1.567   77.106  -3.167  1.00 85.57  ? 307  LEU C CD2   1 
ATOM   8248  N  N     . ARG I  5  308  ? 2.898   76.806  -8.328  1.00 83.61  ? 308  ARG C N     1 
ATOM   8249  C  CA    . ARG I  5  308  ? 2.330   75.976  -9.385  1.00 82.45  ? 308  ARG C CA    1 
ATOM   8250  C  C     . ARG I  5  308  ? 3.417   75.137  -10.039 1.00 84.07  ? 308  ARG C C     1 
ATOM   8251  O  O     . ARG I  5  308  ? 3.166   74.021  -10.464 1.00 83.87  ? 308  ARG C O     1 
ATOM   8252  C  CB    . ARG I  5  308  ? 1.640   76.850  -10.443 1.00 79.33  ? 308  ARG C CB    1 
ATOM   8253  C  CG    . ARG I  5  308  ? 1.814   76.344  -11.863 1.00 75.17  ? 308  ARG C CG    1 
ATOM   8254  C  CD    . ARG I  5  308  ? 0.643   76.597  -12.745 1.00 72.43  ? 308  ARG C CD    1 
ATOM   8255  N  NE    . ARG I  5  308  ? 0.057   77.915  -12.545 1.00 68.61  ? 308  ARG C NE    1 
ATOM   8256  C  CZ    . ARG I  5  308  ? 0.589   79.061  -12.944 1.00 66.56  ? 308  ARG C CZ    1 
ATOM   8257  N  NH1   . ARG I  5  308  ? 1.751   79.100  -13.579 1.00 63.33  ? 308  ARG C NH1   1 
ATOM   8258  N  NH2   . ARG I  5  308  ? -0.077  80.174  -12.705 1.00 65.67  ? 308  ARG C NH2   1 
ATOM   8259  N  N     . TYR I  5  309  ? 4.623   75.697  -10.136 1.00 86.68  ? 309  TYR C N     1 
ATOM   8260  C  CA    . TYR I  5  309  ? 5.760   74.948  -10.670 1.00 88.41  ? 309  TYR C CA    1 
ATOM   8261  C  C     . TYR I  5  309  ? 6.485   74.221  -9.529  1.00 87.99  ? 309  TYR C C     1 
ATOM   8262  O  O     . TYR I  5  309  ? 7.339   73.368  -9.775  1.00 88.33  ? 309  TYR C O     1 
ATOM   8263  C  CB    . TYR I  5  309  ? 6.748   75.872  -11.431 1.00 91.70  ? 309  TYR C CB    1 
ATOM   8264  C  CG    . TYR I  5  309  ? 7.234   75.350  -12.820 1.00 94.09  ? 309  TYR C CG    1 
ATOM   8265  C  CD1   . TYR I  5  309  ? 6.310   75.029  -13.849 1.00 94.95  ? 309  TYR C CD1   1 
ATOM   8266  C  CD2   . TYR I  5  309  ? 8.618   75.240  -13.128 1.00 94.99  ? 309  TYR C CD2   1 
ATOM   8267  C  CE1   . TYR I  5  309  ? 6.762   74.615  -15.161 1.00 95.64  ? 309  TYR C CE1   1 
ATOM   8268  C  CE2   . TYR I  5  309  ? 9.085   74.832  -14.438 1.00 95.27  ? 309  TYR C CE2   1 
ATOM   8269  C  CZ    . TYR I  5  309  ? 8.146   74.524  -15.446 1.00 95.60  ? 309  TYR C CZ    1 
ATOM   8270  O  OH    . TYR I  5  309  ? 8.583   74.152  -16.716 1.00 95.66  ? 309  TYR C OH    1 
ATOM   8271  N  N     . LEU I  5  310  ? 6.152   74.576  -8.279  1.00 87.43  ? 310  LEU C N     1 
ATOM   8272  C  CA    . LEU I  5  310  ? 6.678   73.820  -7.145  1.00 86.67  ? 310  LEU C CA    1 
ATOM   8273  C  C     . LEU I  5  310  ? 5.929   72.506  -7.065  1.00 87.02  ? 310  LEU C C     1 
ATOM   8274  O  O     . LEU I  5  310  ? 6.501   71.452  -6.844  1.00 87.95  ? 310  LEU C O     1 
ATOM   8275  C  CB    . LEU I  5  310  ? 6.491   74.534  -5.798  1.00 84.05  ? 310  LEU C CB    1 
ATOM   8276  C  CG    . LEU I  5  310  ? 7.039   73.633  -4.695  1.00 81.35  ? 310  LEU C CG    1 
ATOM   8277  C  CD1   . LEU I  5  310  ? 8.531   73.571  -4.849  1.00 79.94  ? 310  LEU C CD1   1 
ATOM   8278  C  CD2   . LEU I  5  310  ? 6.657   74.129  -3.354  1.00 80.44  ? 310  LEU C CD2   1 
ATOM   8279  N  N     . PHE I  5  311  ? 4.614   72.611  -7.260  1.00 86.42  ? 311  PHE C N     1 
ATOM   8280  C  CA    . PHE I  5  311  ? 3.713   71.457  -7.319  1.00 84.69  ? 311  PHE C CA    1 
ATOM   8281  C  C     . PHE I  5  311  ? 4.042   70.607  -8.562  1.00 82.28  ? 311  PHE C C     1 
ATOM   8282  O  O     . PHE I  5  311  ? 3.902   69.383  -8.559  1.00 81.37  ? 311  PHE C O     1 
ATOM   8283  C  CB    . PHE I  5  311  ? 2.224   71.910  -7.431  1.00 86.55  ? 311  PHE C CB    1 
ATOM   8284  C  CG    . PHE I  5  311  ? 1.539   72.309  -6.113  1.00 87.71  ? 311  PHE C CG    1 
ATOM   8285  C  CD1   . PHE I  5  311  ? 0.148   72.090  -5.964  1.00 87.46  ? 311  PHE C CD1   1 
ATOM   8286  C  CD2   . PHE I  5  311  ? 2.247   72.911  -5.035  1.00 87.96  ? 311  PHE C CD2   1 
ATOM   8287  C  CE1   . PHE I  5  311  ? -0.544  72.464  -4.764  1.00 87.45  ? 311  PHE C CE1   1 
ATOM   8288  C  CE2   . PHE I  5  311  ? 1.568   73.296  -3.814  1.00 87.73  ? 311  PHE C CE2   1 
ATOM   8289  C  CZ    . PHE I  5  311  ? 0.169   73.067  -3.688  1.00 87.82  ? 311  PHE C CZ    1 
ATOM   8290  N  N     . ALA I  5  312  ? 4.482   71.299  -9.618  1.00 78.87  ? 312  ALA C N     1 
ATOM   8291  C  CA    . ALA I  5  312  ? 4.830   70.698  -10.897 1.00 77.10  ? 312  ALA C CA    1 
ATOM   8292  C  C     . ALA I  5  312  ? 6.235   70.105  -10.872 1.00 76.68  ? 312  ALA C C     1 
ATOM   8293  O  O     . ALA I  5  312  ? 6.464   69.064  -11.478 1.00 76.64  ? 312  ALA C O     1 
ATOM   8294  C  CB    . ALA I  5  312  ? 4.725   71.745  -12.011 1.00 76.00  ? 312  ALA C CB    1 
ATOM   8295  N  N     . LEU I  5  313  ? 7.178   70.752  -10.185 1.00 76.47  ? 313  LEU C N     1 
ATOM   8296  C  CA    . LEU I  5  313  ? 8.565   70.248  -10.103 1.00 76.62  ? 313  LEU C CA    1 
ATOM   8297  C  C     . LEU I  5  313  ? 8.658   69.028  -9.242  1.00 77.11  ? 313  LEU C C     1 
ATOM   8298  O  O     . LEU I  5  313  ? 9.457   68.127  -9.489  1.00 75.71  ? 313  LEU C O     1 
ATOM   8299  C  CB    . LEU I  5  313  ? 9.515   71.270  -9.484  1.00 76.51  ? 313  LEU C CB    1 
ATOM   8300  C  CG    . LEU I  5  313  ? 10.928  70.851  -8.997  1.00 77.03  ? 313  LEU C CG    1 
ATOM   8301  C  CD1   . LEU I  5  313  ? 11.695  70.047  -10.043 1.00 75.82  ? 313  LEU C CD1   1 
ATOM   8302  C  CD2   . LEU I  5  313  ? 11.663  72.112  -8.640  1.00 75.74  ? 313  LEU C CD2   1 
ATOM   8303  N  N     . THR I  5  314  ? 7.823   69.032  -8.219  1.00 78.10  ? 314  THR C N     1 
ATOM   8304  C  CA    . THR I  5  314  ? 7.788   67.991  -7.213  1.00 80.28  ? 314  THR C CA    1 
ATOM   8305  C  C     . THR I  5  314  ? 6.928   66.778  -7.635  1.00 81.85  ? 314  THR C C     1 
ATOM   8306  O  O     . THR I  5  314  ? 7.010   65.728  -6.976  1.00 82.69  ? 314  THR C O     1 
ATOM   8307  C  CB    . THR I  5  314  ? 7.239   68.574  -5.868  1.00 79.43  ? 314  THR C CB    1 
ATOM   8308  O  OG1   . THR I  5  314  ? 5.906   69.076  -6.046  1.00 77.54  ? 314  THR C OG1   1 
ATOM   8309  C  CG2   . THR I  5  314  ? 8.114   69.720  -5.395  1.00 79.26  ? 314  THR C CG2   1 
ATOM   8310  N  N     . ALA I  5  315  ? 6.133   66.879  -8.706  1.00 83.08  ? 315  ALA C N     1 
ATOM   8311  C  CA    . ALA I  5  315  ? 5.241   65.756  -9.064  1.00 82.85  ? 315  ALA C CA    1 
ATOM   8312  C  C     . ALA I  5  315  ? 5.708   64.967  -10.307 1.00 82.24  ? 315  ALA C C     1 
ATOM   8313  O  O     . ALA I  5  315  ? 5.670   63.732  -10.277 1.00 81.58  ? 315  ALA C O     1 
ATOM   8314  C  CB    . ALA I  5  315  ? 3.808   66.279  -9.277  1.00 83.93  ? 315  ALA C CB    1 
ATOM   8315  N  N     . GLY I  5  316  ? 6.132   65.628  -11.387 1.00 81.39  ? 316  GLY C N     1 
ATOM   8316  C  CA    . GLY I  5  316  ? 6.533   64.852  -12.554 1.00 80.31  ? 316  GLY C CA    1 
ATOM   8317  C  C     . GLY I  5  316  ? 7.345   65.591  -13.608 1.00 79.91  ? 316  GLY C C     1 
ATOM   8318  O  O     . GLY I  5  316  ? 8.269   66.350  -13.275 1.00 79.59  ? 316  GLY C O     1 
ATOM   8319  N  N     . VAL I  5  317  ? 6.997   65.370  -14.885 1.00 78.76  ? 317  VAL C N     1 
ATOM   8320  C  CA    . VAL I  5  317  ? 7.741   65.982  -15.988 1.00 77.19  ? 317  VAL C CA    1 
ATOM   8321  C  C     . VAL I  5  317  ? 6.919   67.017  -16.786 1.00 76.37  ? 317  VAL C C     1 
ATOM   8322  O  O     . VAL I  5  317  ? 6.619   66.789  -17.962 1.00 74.81  ? 317  VAL C O     1 
ATOM   8323  C  CB    . VAL I  5  317  ? 8.273   64.906  -17.006 1.00 77.29  ? 317  VAL C CB    1 
ATOM   8324  C  CG1   . VAL I  5  317  ? 9.237   65.550  -18.002 1.00 76.87  ? 317  VAL C CG1   1 
ATOM   8325  C  CG2   . VAL I  5  317  ? 8.987   63.800  -16.276 1.00 76.40  ? 317  VAL C CG2   1 
ATOM   8326  N  N     . PRO I  5  318  ? 6.507   68.148  -16.165 1.00 76.88  ? 318  PRO C N     1 
ATOM   8327  C  CA    . PRO I  5  318  ? 5.795   69.052  -17.083 1.00 76.59  ? 318  PRO C CA    1 
ATOM   8328  C  C     . PRO I  5  318  ? 6.793   69.507  -18.159 1.00 75.49  ? 318  PRO C C     1 
ATOM   8329  O  O     . PRO I  5  318  ? 6.487   69.856  -19.295 1.00 74.90  ? 318  PRO C O     1 
ATOM   8330  C  CB    . PRO I  5  318  ? 5.331   70.201  -16.172 1.00 77.42  ? 318  PRO C CB    1 
ATOM   8331  C  CG    . PRO I  5  318  ? 5.218   69.566  -14.807 1.00 77.73  ? 318  PRO C CG    1 
ATOM   8332  C  CD    . PRO I  5  318  ? 6.380   68.581  -14.759 1.00 77.35  ? 318  PRO C CD    1 
ATOM   8333  N  N     . GLY I  5  319  ? 8.022   69.419  -17.650 1.00 75.23  ? 319  GLY C N     1 
ATOM   8334  C  CA    . GLY I  5  319  ? 9.324   69.695  -18.228 1.00 75.06  ? 319  GLY C CA    1 
ATOM   8335  C  C     . GLY I  5  319  ? 10.308  69.360  -17.100 1.00 75.59  ? 319  GLY C C     1 
ATOM   8336  O  O     . GLY I  5  319  ? 9.807   69.086  -16.011 1.00 76.34  ? 319  GLY C O     1 
ATOM   8337  N  N     . HIS I  5  320  ? 11.635  69.346  -17.267 1.00 75.03  ? 320  HIS C N     1 
ATOM   8338  C  CA    . HIS I  5  320  ? 12.511  69.036  -16.107 1.00 74.33  ? 320  HIS C CA    1 
ATOM   8339  C  C     . HIS I  5  320  ? 13.018  70.310  -15.457 1.00 73.56  ? 320  HIS C C     1 
ATOM   8340  O  O     . HIS I  5  320  ? 13.952  70.951  -15.944 1.00 73.02  ? 320  HIS C O     1 
ATOM   8341  C  CB    . HIS I  5  320  ? 13.669  68.142  -16.548 1.00 75.04  ? 320  HIS C CB    1 
ATOM   8342  C  CG    . HIS I  5  320  ? 13.214  66.773  -16.947 1.00 76.04  ? 320  HIS C CG    1 
ATOM   8343  N  ND1   . HIS I  5  320  ? 12.496  65.957  -16.098 1.00 76.10  ? 320  HIS C ND1   1 
ATOM   8344  C  CD2   . HIS I  5  320  ? 13.332  66.090  -18.110 1.00 76.57  ? 320  HIS C CD2   1 
ATOM   8345  C  CE1   . HIS I  5  320  ? 12.190  64.833  -16.721 1.00 76.07  ? 320  HIS C CE1   1 
ATOM   8346  N  NE2   . HIS I  5  320  ? 12.685  64.887  -17.944 1.00 76.64  ? 320  HIS C NE2   1 
ATOM   8347  N  N     . GLU I  5  321  ? 12.382  70.648  -14.333 1.00 73.57  ? 321  GLU C N     1 
ATOM   8348  C  CA    . GLU I  5  321  ? 12.608  71.917  -13.635 1.00 73.17  ? 321  GLU C CA    1 
ATOM   8349  C  C     . GLU I  5  321  ? 13.727  71.870  -12.596 1.00 71.88  ? 321  GLU C C     1 
ATOM   8350  O  O     . GLU I  5  321  ? 13.499  71.994  -11.384 1.00 72.06  ? 321  GLU C O     1 
ATOM   8351  C  CB    . GLU I  5  321  ? 11.297  72.402  -12.976 1.00 74.14  ? 321  GLU C CB    1 
ATOM   8352  C  CG    . GLU I  5  321  ? 10.273  71.299  -12.675 1.00 73.79  ? 321  GLU C CG    1 
ATOM   8353  C  CD    . GLU I  5  321  ? 9.165   71.128  -13.719 1.00 73.74  ? 321  GLU C CD    1 
ATOM   8354  O  OE1   . GLU I  5  321  ? 8.202   70.401  -13.408 1.00 73.00  ? 321  GLU C OE1   1 
ATOM   8355  O  OE2   . GLU I  5  321  ? 9.239   71.699  -14.833 1.00 74.02  ? 321  GLU C OE2   1 
ATOM   8356  N  N     . VAL I  5  322  ? 14.940  71.698  -13.100 1.00 71.28  ? 322  VAL C N     1 
ATOM   8357  C  CA    . VAL I  5  322  ? 16.145  71.771  -12.299 1.00 69.84  ? 322  VAL C CA    1 
ATOM   8358  C  C     . VAL I  5  322  ? 17.063  72.795  -12.924 1.00 69.20  ? 322  VAL C C     1 
ATOM   8359  O  O     . VAL I  5  322  ? 17.588  72.580  -14.018 1.00 69.67  ? 322  VAL C O     1 
ATOM   8360  C  CB    . VAL I  5  322  ? 16.881  70.391  -12.191 1.00 69.10  ? 322  VAL C CB    1 
ATOM   8361  C  CG1   . VAL I  5  322  ? 15.999  69.401  -11.448 1.00 68.93  ? 322  VAL C CG1   1 
ATOM   8362  C  CG2   . VAL I  5  322  ? 17.204  69.832  -13.565 1.00 68.23  ? 322  VAL C CG2   1 
ATOM   8363  N  N     . ASP I  5  323  ? 17.245  73.925  -12.253 1.00 68.03  ? 323  ASP C N     1 
ATOM   8364  C  CA    . ASP I  5  323  ? 18.023  75.002  -12.851 1.00 66.13  ? 323  ASP C CA    1 
ATOM   8365  C  C     . ASP I  5  323  ? 19.486  74.984  -12.431 1.00 64.99  ? 323  ASP C C     1 
ATOM   8366  O  O     . ASP I  5  323  ? 19.826  75.070  -11.239 1.00 65.41  ? 323  ASP C O     1 
ATOM   8367  C  CB    . ASP I  5  323  ? 17.382  76.356  -12.497 1.00 66.30  ? 323  ASP C CB    1 
ATOM   8368  C  CG    . ASP I  5  323  ? 16.162  76.683  -13.372 1.00 65.88  ? 323  ASP C CG    1 
ATOM   8369  O  OD1   . ASP I  5  323  ? 16.333  77.466  -14.331 1.00 66.12  ? 323  ASP C OD1   1 
ATOM   8370  O  OD2   . ASP I  5  323  ? 15.043  76.169  -13.118 1.00 64.90  ? 323  ASP C OD2   1 
ATOM   8371  N  N     . ASP I  5  324  ? 20.342  74.863  -13.448 1.00 62.23  ? 324  ASP C N     1 
ATOM   8372  C  CA    . ASP I  5  324  ? 21.782  74.927  -13.269 1.00 58.90  ? 324  ASP C CA    1 
ATOM   8373  C  C     . ASP I  5  324  ? 22.193  76.392  -13.142 1.00 57.07  ? 324  ASP C C     1 
ATOM   8374  O  O     . ASP I  5  324  ? 22.427  77.050  -14.146 1.00 56.63  ? 324  ASP C O     1 
ATOM   8375  C  CB    . ASP I  5  324  ? 22.485  74.263  -14.476 1.00 58.08  ? 324  ASP C CB    1 
ATOM   8376  C  CG    . ASP I  5  324  ? 22.000  72.809  -14.731 1.00 58.56  ? 324  ASP C CG    1 
ATOM   8377  O  OD1   . ASP I  5  324  ? 22.157  71.964  -13.827 1.00 57.33  ? 324  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP I  5  324  ? 21.462  72.501  -15.826 1.00 57.04  ? 324  ASP C OD2   1 
ATOM   8379  N  N     . ILE I  5  325  ? 22.228  76.882  -11.898 1.00 57.02  ? 325  ILE C N     1 
ATOM   8380  C  CA    . ILE I  5  325  ? 22.562  78.270  -11.521 1.00 56.04  ? 325  ILE C CA    1 
ATOM   8381  C  C     . ILE I  5  325  ? 23.536  78.892  -12.505 1.00 56.75  ? 325  ILE C C     1 
ATOM   8382  O  O     . ILE I  5  325  ? 23.249  79.839  -13.239 1.00 55.20  ? 325  ILE C O     1 
ATOM   8383  C  CB    . ILE I  5  325  ? 23.230  78.323  -10.067 1.00 54.44  ? 325  ILE C CB    1 
ATOM   8384  C  CG1   . ILE I  5  325  ? 22.208  77.921  -9.000  1.00 53.00  ? 325  ILE C CG1   1 
ATOM   8385  C  CG2   . ILE I  5  325  ? 23.808  79.716  -9.778  1.00 53.10  ? 325  ILE C CG2   1 
ATOM   8386  C  CD1   . ILE I  5  325  ? 22.782  77.847  -7.598  1.00 52.67  ? 325  ILE C CD1   1 
ATOM   8387  N  N     . ASP I  5  326  ? 24.706  78.289  -12.478 1.00 59.32  ? 326  ASP C N     1 
ATOM   8388  C  CA    . ASP I  5  326  ? 25.856  78.680  -13.226 1.00 60.67  ? 326  ASP C CA    1 
ATOM   8389  C  C     . ASP I  5  326  ? 25.549  78.836  -14.721 1.00 61.64  ? 326  ASP C C     1 
ATOM   8390  O  O     . ASP I  5  326  ? 26.317  79.508  -15.414 1.00 61.42  ? 326  ASP C O     1 
ATOM   8391  C  CB    . ASP I  5  326  ? 26.925  77.649  -12.886 1.00 60.83  ? 326  ASP C CB    1 
ATOM   8392  C  CG    . ASP I  5  326  ? 26.897  77.231  -11.411 1.00 61.06  ? 326  ASP C CG    1 
ATOM   8393  O  OD1   . ASP I  5  326  ? 27.076  78.110  -10.533 1.00 61.93  ? 326  ASP C OD1   1 
ATOM   8394  O  OD2   . ASP I  5  326  ? 26.694  76.027  -11.132 1.00 59.34  ? 326  ASP C OD2   1 
ATOM   8395  N  N     . HIS I  5  327  ? 24.477  78.234  -15.247 1.00 63.34  ? 327  HIS C N     1 
ATOM   8396  C  CA    . HIS I  5  327  ? 24.171  78.534  -16.646 1.00 64.68  ? 327  HIS C CA    1 
ATOM   8397  C  C     . HIS I  5  327  ? 24.082  80.050  -16.786 1.00 64.66  ? 327  HIS C C     1 
ATOM   8398  O  O     . HIS I  5  327  ? 23.347  80.689  -16.046 1.00 65.76  ? 327  HIS C O     1 
ATOM   8399  C  CB    . HIS I  5  327  ? 22.864  77.823  -17.096 1.00 65.74  ? 327  HIS C CB    1 
ATOM   8400  C  CG    . HIS I  5  327  ? 23.100  76.662  -18.026 1.00 66.05  ? 327  HIS C CG    1 
ATOM   8401  N  ND1   . HIS I  5  327  ? 23.012  76.773  -19.398 1.00 65.79  ? 327  HIS C ND1   1 
ATOM   8402  C  CD2   . HIS I  5  327  ? 23.432  75.369  -17.777 1.00 66.01  ? 327  HIS C CD2   1 
ATOM   8403  C  CE1   . HIS I  5  327  ? 23.280  75.601  -19.951 1.00 66.32  ? 327  HIS C CE1   1 
ATOM   8404  N  NE2   . HIS I  5  327  ? 23.539  74.732  -18.990 1.00 66.05  ? 327  HIS C NE2   1 
ATOM   8405  N  N     . LEU I  5  328  ? 24.840  80.648  -17.686 1.00 64.63  ? 328  LEU C N     1 
ATOM   8406  C  CA    . LEU I  5  328  ? 24.858  82.084  -17.715 1.00 64.38  ? 328  LEU C CA    1 
ATOM   8407  C  C     . LEU I  5  328  ? 23.525  82.676  -18.068 1.00 65.22  ? 328  LEU C C     1 
ATOM   8408  O  O     . LEU I  5  328  ? 23.405  83.897  -18.102 1.00 67.03  ? 328  LEU C O     1 
ATOM   8409  C  CB    . LEU I  5  328  ? 25.915  82.591  -18.674 1.00 63.55  ? 328  LEU C CB    1 
ATOM   8410  C  CG    . LEU I  5  328  ? 26.588  83.719  -17.900 1.00 63.13  ? 328  LEU C CG    1 
ATOM   8411  C  CD1   . LEU I  5  328  ? 27.450  83.104  -16.802 1.00 63.09  ? 328  LEU C CD1   1 
ATOM   8412  C  CD2   . LEU I  5  328  ? 27.413  84.585  -18.823 1.00 62.66  ? 328  LEU C CD2   1 
ATOM   8413  N  N     . GLY I  5  329  ? 22.523  81.844  -18.340 1.00 65.21  ? 329  GLY C N     1 
ATOM   8414  C  CA    . GLY I  5  329  ? 21.212  82.378  -18.651 1.00 63.99  ? 329  GLY C CA    1 
ATOM   8415  C  C     . GLY I  5  329  ? 20.501  82.731  -17.372 1.00 63.66  ? 329  GLY C C     1 
ATOM   8416  O  O     . GLY I  5  329  ? 19.323  83.092  -17.370 1.00 63.39  ? 329  GLY C O     1 
ATOM   8417  N  N     . ASN I  5  330  ? 21.261  82.627  -16.279 1.00 63.96  ? 330  ASN C N     1 
ATOM   8418  C  CA    . ASN I  5  330  ? 20.753  82.879  -14.935 1.00 63.88  ? 330  ASN C CA    1 
ATOM   8419  C  C     . ASN I  5  330  ? 21.622  83.901  -14.143 1.00 63.05  ? 330  ASN C C     1 
ATOM   8420  O  O     . ASN I  5  330  ? 21.081  84.932  -13.736 1.00 63.04  ? 330  ASN C O     1 
ATOM   8421  C  CB    . ASN I  5  330  ? 20.654  81.543  -14.171 1.00 65.28  ? 330  ASN C CB    1 
ATOM   8422  C  CG    . ASN I  5  330  ? 19.480  81.521  -13.166 1.00 66.11  ? 330  ASN C CG    1 
ATOM   8423  O  OD1   . ASN I  5  330  ? 18.866  80.479  -12.946 1.00 65.99  ? 330  ASN C OD1   1 
ATOM   8424  N  ND2   . ASN I  5  330  ? 19.176  82.675  -12.557 1.00 65.00  ? 330  ASN C ND2   1 
ATOM   8425  N  N     . ARG I  5  331  ? 22.922  83.658  -13.904 1.00 62.62  ? 331  ARG C N     1 
ATOM   8426  C  CA    . ARG I  5  331  ? 23.720  84.645  -13.135 1.00 62.00  ? 331  ARG C CA    1 
ATOM   8427  C  C     . ARG I  5  331  ? 24.138  85.835  -14.019 1.00 61.64  ? 331  ARG C C     1 
ATOM   8428  O  O     . ARG I  5  331  ? 24.771  85.651  -15.055 1.00 62.53  ? 331  ARG C O     1 
ATOM   8429  C  CB    . ARG I  5  331  ? 24.967  83.978  -12.489 1.00 61.03  ? 331  ARG C CB    1 
ATOM   8430  C  CG    . ARG I  5  331  ? 24.892  83.898  -10.941 1.00 60.20  ? 331  ARG C CG    1 
ATOM   8431  C  CD    . ARG I  5  331  ? 26.114  83.249  -10.304 1.00 60.15  ? 331  ARG C CD    1 
ATOM   8432  N  NE    . ARG I  5  331  ? 27.358  83.775  -10.861 1.00 59.99  ? 331  ARG C NE    1 
ATOM   8433  C  CZ    . ARG I  5  331  ? 28.472  83.059  -10.989 1.00 60.06  ? 331  ARG C CZ    1 
ATOM   8434  N  NH1   . ARG I  5  331  ? 28.494  81.796  -10.591 1.00 60.01  ? 331  ARG C NH1   1 
ATOM   8435  N  NH2   . ARG I  5  331  ? 29.560  83.594  -11.526 1.00 58.81  ? 331  ARG C NH2   1 
ATOM   8436  N  N     . ARG I  5  332  ? 23.766  87.046  -13.583 1.00 60.79  ? 332  ARG C N     1 
ATOM   8437  C  CA    . ARG I  5  332  ? 23.970  88.322  -14.295 1.00 59.36  ? 332  ARG C CA    1 
ATOM   8438  C  C     . ARG I  5  332  ? 25.272  89.040  -13.877 1.00 57.59  ? 332  ARG C C     1 
ATOM   8439  O  O     . ARG I  5  332  ? 25.761  88.871  -12.758 1.00 58.21  ? 332  ARG C O     1 
ATOM   8440  C  CB    . ARG I  5  332  ? 22.773  89.234  -14.016 1.00 60.99  ? 332  ARG C CB    1 
ATOM   8441  C  CG    . ARG I  5  332  ? 22.696  90.454  -14.912 1.00 61.70  ? 332  ARG C CG    1 
ATOM   8442  C  CD    . ARG I  5  332  ? 21.866  91.550  -14.271 1.00 61.37  ? 332  ARG C CD    1 
ATOM   8443  N  NE    . ARG I  5  332  ? 21.939  92.798  -15.027 1.00 60.80  ? 332  ARG C NE    1 
ATOM   8444  C  CZ    . ARG I  5  332  ? 21.708  94.001  -14.506 1.00 60.51  ? 332  ARG C CZ    1 
ATOM   8445  N  NH1   . ARG I  5  332  ? 21.390  94.118  -13.226 1.00 60.04  ? 332  ARG C NH1   1 
ATOM   8446  N  NH2   . ARG I  5  332  ? 21.790  95.091  -15.257 1.00 60.07  ? 332  ARG C NH2   1 
ATOM   8447  N  N     . ILE I  5  333  ? 25.797  89.860  -14.798 1.00 54.29  ? 333  ILE C N     1 
ATOM   8448  C  CA    . ILE I  5  333  ? 27.047  90.616  -14.617 1.00 51.06  ? 333  ILE C CA    1 
ATOM   8449  C  C     . ILE I  5  333  ? 26.795  92.137  -14.487 1.00 49.89  ? 333  ILE C C     1 
ATOM   8450  O  O     . ILE I  5  333  ? 26.301  92.773  -15.419 1.00 49.84  ? 333  ILE C O     1 
ATOM   8451  C  CB    . ILE I  5  333  ? 28.000  90.409  -15.805 1.00 50.31  ? 333  ILE C CB    1 
ATOM   8452  C  CG1   . ILE I  5  333  ? 28.385  88.940  -15.942 1.00 49.73  ? 333  ILE C CG1   1 
ATOM   8453  C  CG2   . ILE I  5  333  ? 29.246  91.191  -15.590 1.00 50.71  ? 333  ILE C CG2   1 
ATOM   8454  C  CD1   . ILE I  5  333  ? 27.377  88.106  -16.636 1.00 50.02  ? 333  ILE C CD1   1 
ATOM   8455  N  N     . ARG I  5  334  ? 27.184  92.704  -13.339 1.00 49.11  ? 334  ARG C N     1 
ATOM   8456  C  CA    . ARG I  5  334  ? 26.973  94.121  -13.005 1.00 48.47  ? 334  ARG C CA    1 
ATOM   8457  C  C     . ARG I  5  334  ? 28.046  95.040  -13.577 1.00 47.81  ? 334  ARG C C     1 
ATOM   8458  O  O     . ARG I  5  334  ? 29.163  95.140  -13.063 1.00 47.39  ? 334  ARG C O     1 
ATOM   8459  C  CB    . ARG I  5  334  ? 26.941  94.325  -11.490 1.00 48.27  ? 334  ARG C CB    1 
ATOM   8460  C  CG    . ARG I  5  334  ? 25.611  94.022  -10.824 1.00 46.53  ? 334  ARG C CG    1 
ATOM   8461  C  CD    . ARG I  5  334  ? 25.723  94.049  -9.305  1.00 44.94  ? 334  ARG C CD    1 
ATOM   8462  N  NE    . ARG I  5  334  ? 24.671  94.831  -8.666  1.00 44.16  ? 334  ARG C NE    1 
ATOM   8463  C  CZ    . ARG I  5  334  ? 24.895  95.882  -7.879  1.00 44.56  ? 334  ARG C CZ    1 
ATOM   8464  N  NH1   . ARG I  5  334  ? 26.138  96.274  -7.632  1.00 44.33  ? 334  ARG C NH1   1 
ATOM   8465  N  NH2   . ARG I  5  334  ? 23.880  96.546  -7.338  1.00 43.00  ? 334  ARG C NH2   1 
ATOM   8466  N  N     . THR I  5  335  ? 27.668  95.736  -14.637 1.00 47.22  ? 335  THR C N     1 
ATOM   8467  C  CA    . THR I  5  335  ? 28.547  96.684  -15.275 1.00 47.39  ? 335  THR C CA    1 
ATOM   8468  C  C     . THR I  5  335  ? 28.825  97.852  -14.346 1.00 46.90  ? 335  THR C C     1 
ATOM   8469  O  O     . THR I  5  335  ? 28.076  98.081  -13.408 1.00 45.52  ? 335  THR C O     1 
ATOM   8470  C  CB    . THR I  5  335  ? 27.901  97.208  -16.583 1.00 48.55  ? 335  THR C CB    1 
ATOM   8471  O  OG1   . THR I  5  335  ? 26.575  97.679  -16.298 1.00 48.44  ? 335  THR C OG1   1 
ATOM   8472  C  CG2   . THR I  5  335  ? 27.814  96.101  -17.635 1.00 50.21  ? 335  THR C CG2   1 
ATOM   8473  N  N     . VAL I  5  336  ? 29.906  98.572  -14.608 1.00 47.05  ? 336  VAL C N     1 
ATOM   8474  C  CA    . VAL I  5  336  ? 30.271  99.757  -13.832 1.00 49.18  ? 336  VAL C CA    1 
ATOM   8475  C  C     . VAL I  5  336  ? 29.038  100.613 -13.521 1.00 50.43  ? 336  VAL C C     1 
ATOM   8476  O  O     . VAL I  5  336  ? 28.667  100.782 -12.365 1.00 51.21  ? 336  VAL C O     1 
ATOM   8477  C  CB    . VAL I  5  336  ? 31.261  100.674 -14.612 1.00 48.95  ? 336  VAL C CB    1 
ATOM   8478  C  CG1   . VAL I  5  336  ? 31.545  101.948 -13.810 1.00 46.88  ? 336  VAL C CG1   1 
ATOM   8479  C  CG2   . VAL I  5  336  ? 32.530  99.928  -14.919 1.00 49.41  ? 336  VAL C CG2   1 
ATOM   8480  N  N     . GLY I  5  337  ? 28.434  101.142 -14.587 1.00 51.30  ? 337  GLY C N     1 
ATOM   8481  C  CA    . GLY I  5  337  ? 27.261  101.995 -14.509 1.00 51.71  ? 337  GLY C CA    1 
ATOM   8482  C  C     . GLY I  5  337  ? 26.332  101.611 -13.391 1.00 52.99  ? 337  GLY C C     1 
ATOM   8483  O  O     . GLY I  5  337  ? 26.158  102.353 -12.428 1.00 52.26  ? 337  GLY C O     1 
ATOM   8484  N  N     . GLU I  5  338  ? 25.748  100.433 -13.537 1.00 54.36  ? 338  GLU C N     1 
ATOM   8485  C  CA    . GLU I  5  338  ? 24.843  99.881  -12.552 1.00 56.42  ? 338  GLU C CA    1 
ATOM   8486  C  C     . GLU I  5  338  ? 25.403  100.070 -11.136 1.00 56.84  ? 338  GLU C C     1 
ATOM   8487  O  O     . GLU I  5  338  ? 24.710  100.505 -10.215 1.00 56.71  ? 338  GLU C O     1 
ATOM   8488  C  CB    . GLU I  5  338  ? 24.641  98.393  -12.879 1.00 58.09  ? 338  GLU C CB    1 
ATOM   8489  C  CG    . GLU I  5  338  ? 23.667  97.637  -11.996 1.00 61.08  ? 338  GLU C CG    1 
ATOM   8490  C  CD    . GLU I  5  338  ? 23.633  96.148  -12.300 1.00 62.90  ? 338  GLU C CD    1 
ATOM   8491  O  OE1   . GLU I  5  338  ? 22.910  95.418  -11.588 1.00 63.97  ? 338  GLU C OE1   1 
ATOM   8492  O  OE2   . GLU I  5  338  ? 24.324  95.705  -13.243 1.00 63.14  ? 338  GLU C OE2   1 
ATOM   8493  N  N     . LEU I  5  339  ? 26.679  99.754  -10.975 1.00 57.03  ? 339  LEU C N     1 
ATOM   8494  C  CA    . LEU I  5  339  ? 27.319  99.874  -9.676  1.00 58.54  ? 339  LEU C CA    1 
ATOM   8495  C  C     . LEU I  5  339  ? 27.421  101.329 -9.229  1.00 57.23  ? 339  LEU C C     1 
ATOM   8496  O  O     . LEU I  5  339  ? 27.420  101.615 -8.034  1.00 56.90  ? 339  LEU C O     1 
ATOM   8497  C  CB    . LEU I  5  339  ? 28.703  99.217  -9.719  1.00 60.68  ? 339  LEU C CB    1 
ATOM   8498  C  CG    . LEU I  5  339  ? 28.707  97.793  -9.139  1.00 63.14  ? 339  LEU C CG    1 
ATOM   8499  C  CD1   . LEU I  5  339  ? 29.904  97.019  -9.687  1.00 64.44  ? 339  LEU C CD1   1 
ATOM   8500  C  CD2   . LEU I  5  339  ? 28.725  97.866  -7.608  1.00 63.41  ? 339  LEU C CD2   1 
ATOM   8501  N  N     . MET I  5  340  ? 27.515  102.258 -10.167 1.00 55.05  ? 340  MET C N     1 
ATOM   8502  C  CA    . MET I  5  340  ? 27.563  103.626 -9.734  1.00 54.67  ? 340  MET C CA    1 
ATOM   8503  C  C     . MET I  5  340  ? 26.169  104.152 -9.543  1.00 54.46  ? 340  MET C C     1 
ATOM   8504  O  O     . MET I  5  340  ? 25.901  104.925 -8.635  1.00 53.48  ? 340  MET C O     1 
ATOM   8505  C  CB    . MET I  5  340  ? 28.316  104.481 -10.746 1.00 55.69  ? 340  MET C CB    1 
ATOM   8506  C  CG    . MET I  5  340  ? 28.467  105.951 -10.326 1.00 56.61  ? 340  MET C CG    1 
ATOM   8507  S  SD    . MET I  5  340  ? 27.043  106.968 -10.764 1.00 59.91  ? 340  MET C SD    1 
ATOM   8508  C  CE    . MET I  5  340  ? 27.793  108.173 -11.870 1.00 58.01  ? 340  MET C CE    1 
ATOM   8509  N  N     . THR I  5  341  ? 25.264  103.708 -10.400 1.00 54.31  ? 341  THR C N     1 
ATOM   8510  C  CA    . THR I  5  341  ? 23.902  104.179 -10.287 1.00 55.29  ? 341  THR C CA    1 
ATOM   8511  C  C     . THR I  5  341  ? 23.297  103.750 -8.981  1.00 55.13  ? 341  THR C C     1 
ATOM   8512  O  O     . THR I  5  341  ? 22.524  104.496 -8.394  1.00 55.75  ? 341  THR C O     1 
ATOM   8513  C  CB    . THR I  5  341  ? 22.983  103.674 -11.449 1.00 56.76  ? 341  THR C CB    1 
ATOM   8514  O  OG1   . THR I  5  341  ? 21.775  104.452 -11.448 1.00 56.53  ? 341  THR C OG1   1 
ATOM   8515  C  CG2   . THR I  5  341  ? 22.612  102.207 -11.299 1.00 57.82  ? 341  THR C CG2   1 
ATOM   8516  N  N     . ASP I  5  342  ? 23.652  102.555 -8.516  1.00 54.70  ? 342  ASP C N     1 
ATOM   8517  C  CA    . ASP I  5  342  ? 23.096  102.097 -7.268  1.00 55.88  ? 342  ASP C CA    1 
ATOM   8518  C  C     . ASP I  5  342  ? 23.500  103.011 -6.138  1.00 56.12  ? 342  ASP C C     1 
ATOM   8519  O  O     . ASP I  5  342  ? 22.647  103.451 -5.364  1.00 57.29  ? 342  ASP C O     1 
ATOM   8520  C  CB    . ASP I  5  342  ? 23.554  100.692 -6.932  1.00 56.38  ? 342  ASP C CB    1 
ATOM   8521  C  CG    . ASP I  5  342  ? 22.600  99.997  -5.986  1.00 57.46  ? 342  ASP C CG    1 
ATOM   8522  O  OD1   . ASP I  5  342  ? 22.152  100.649 -5.010  1.00 57.44  ? 342  ASP C OD1   1 
ATOM   8523  O  OD2   . ASP I  5  342  ? 22.301  98.802  -6.223  1.00 58.89  ? 342  ASP C OD2   1 
ATOM   8524  N  N     . GLN I  5  343  ? 24.801  103.299 -6.030  1.00 54.85  ? 343  GLN C N     1 
ATOM   8525  C  CA    . GLN I  5  343  ? 25.254  104.191 -4.978  1.00 52.18  ? 343  GLN C CA    1 
ATOM   8526  C  C     . GLN I  5  343  ? 24.694  105.568 -5.178  1.00 51.55  ? 343  GLN C C     1 
ATOM   8527  O  O     . GLN I  5  343  ? 24.446  106.287 -4.221  1.00 51.40  ? 343  GLN C O     1 
ATOM   8528  C  CB    . GLN I  5  343  ? 26.764  104.297 -4.931  1.00 51.69  ? 343  GLN C CB    1 
ATOM   8529  C  CG    . GLN I  5  343  ? 27.247  105.227 -3.820  1.00 51.37  ? 343  GLN C CG    1 
ATOM   8530  C  CD    . GLN I  5  343  ? 26.807  104.808 -2.411  1.00 51.79  ? 343  GLN C CD    1 
ATOM   8531  O  OE1   . GLN I  5  343  ? 27.203  105.423 -1.429  1.00 52.42  ? 343  GLN C OE1   1 
ATOM   8532  N  NE2   . GLN I  5  343  ? 25.991  103.763 -2.312  1.00 51.19  ? 343  GLN C NE2   1 
ATOM   8533  N  N     . PHE I  5  344  ? 24.498  105.944 -6.435  1.00 49.59  ? 344  PHE C N     1 
ATOM   8534  C  CA    . PHE I  5  344  ? 23.915  107.234 -6.694  1.00 48.27  ? 344  PHE C CA    1 
ATOM   8535  C  C     . PHE I  5  344  ? 22.491  107.288 -6.150  1.00 49.12  ? 344  PHE C C     1 
ATOM   8536  O  O     . PHE I  5  344  ? 22.089  108.312 -5.600  1.00 50.65  ? 344  PHE C O     1 
ATOM   8537  C  CB    . PHE I  5  344  ? 23.905  107.537 -8.193  1.00 45.93  ? 344  PHE C CB    1 
ATOM   8538  C  CG    . PHE I  5  344  ? 23.406  108.928 -8.522  1.00 43.09  ? 344  PHE C CG    1 
ATOM   8539  C  CD1   . PHE I  5  344  ? 22.020  109.179 -8.676  1.00 41.79  ? 344  PHE C CD1   1 
ATOM   8540  C  CD2   . PHE I  5  344  ? 24.317  110.003 -8.657  1.00 41.71  ? 344  PHE C CD2   1 
ATOM   8541  C  CE1   . PHE I  5  344  ? 21.541  110.484 -8.960  1.00 40.50  ? 344  PHE C CE1   1 
ATOM   8542  C  CE2   . PHE I  5  344  ? 23.862  111.332 -8.943  1.00 39.88  ? 344  PHE C CE2   1 
ATOM   8543  C  CZ    . PHE I  5  344  ? 22.469  111.572 -9.095  1.00 39.54  ? 344  PHE C CZ    1 
ATOM   8544  N  N     . ARG I  5  345  ? 21.736  106.188 -6.289  1.00 48.89  ? 345  ARG C N     1 
ATOM   8545  C  CA    . ARG I  5  345  ? 20.350  106.137 -5.794  1.00 48.40  ? 345  ARG C CA    1 
ATOM   8546  C  C     . ARG I  5  345  ? 20.310  105.950 -4.290  1.00 47.22  ? 345  ARG C C     1 
ATOM   8547  O  O     . ARG I  5  345  ? 19.318  106.330 -3.664  1.00 47.85  ? 345  ARG C O     1 
ATOM   8548  C  CB    . ARG I  5  345  ? 19.542  105.017 -6.493  1.00 49.33  ? 345  ARG C CB    1 
ATOM   8549  C  CG    . ARG I  5  345  ? 19.581  103.592 -5.902  1.00 50.39  ? 345  ARG C CG    1 
ATOM   8550  C  CD    . ARG I  5  345  ? 19.809  102.479 -6.982  1.00 50.11  ? 345  ARG C CD    1 
ATOM   8551  N  NE    . ARG I  5  345  ? 18.814  102.345 -8.066  1.00 48.43  ? 345  ARG C NE    1 
ATOM   8552  C  CZ    . ARG I  5  345  ? 19.020  102.694 -9.343  1.00 48.36  ? 345  ARG C CZ    1 
ATOM   8553  N  NH1   . ARG I  5  345  ? 20.178  103.216 -9.722  1.00 47.42  ? 345  ARG C NH1   1 
ATOM   8554  N  NH2   . ARG I  5  345  ? 18.075  102.506 -10.258 1.00 46.98  ? 345  ARG C NH2   1 
ATOM   8555  N  N     . VAL I  5  346  ? 21.373  105.355 -3.725  1.00 45.49  ? 346  VAL C N     1 
ATOM   8556  C  CA    . VAL I  5  346  ? 21.510  105.216 -2.270  1.00 43.11  ? 346  VAL C CA    1 
ATOM   8557  C  C     . VAL I  5  346  ? 21.751  106.611 -1.647  1.00 43.43  ? 346  VAL C C     1 
ATOM   8558  O  O     . VAL I  5  346  ? 21.309  106.898 -0.534  1.00 43.68  ? 346  VAL C O     1 
ATOM   8559  C  CB    . VAL I  5  346  ? 22.712  104.249 -1.894  1.00 41.71  ? 346  VAL C CB    1 
ATOM   8560  C  CG1   . VAL I  5  346  ? 22.870  104.135 -0.389  1.00 40.02  ? 346  VAL C CG1   1 
ATOM   8561  C  CG2   . VAL I  5  346  ? 22.460  102.871 -2.455  1.00 38.75  ? 346  VAL C CG2   1 
ATOM   8562  N  N     . GLY I  5  347  ? 22.446  107.468 -2.404  1.00 43.03  ? 347  GLY C N     1 
ATOM   8563  C  CA    . GLY I  5  347  ? 22.723  108.831 -1.989  1.00 43.25  ? 347  GLY C CA    1 
ATOM   8564  C  C     . GLY I  5  347  ? 21.481  109.683 -2.138  1.00 44.45  ? 347  GLY C C     1 
ATOM   8565  O  O     . GLY I  5  347  ? 21.230  110.571 -1.327  1.00 45.35  ? 347  GLY C O     1 
ATOM   8566  N  N     . LEU I  5  348  ? 20.700  109.400 -3.180  1.00 46.22  ? 348  LEU C N     1 
ATOM   8567  C  CA    . LEU I  5  348  ? 19.455  110.118 -3.443  1.00 48.07  ? 348  LEU C CA    1 
ATOM   8568  C  C     . LEU I  5  348  ? 18.451  109.892 -2.326  1.00 49.90  ? 348  LEU C C     1 
ATOM   8569  O  O     . LEU I  5  348  ? 17.728  110.808 -1.946  1.00 52.09  ? 348  LEU C O     1 
ATOM   8570  C  CB    . LEU I  5  348  ? 18.831  109.659 -4.770  1.00 48.51  ? 348  LEU C CB    1 
ATOM   8571  C  CG    . LEU I  5  348  ? 18.035  110.723 -5.555  1.00 48.85  ? 348  LEU C CG    1 
ATOM   8572  C  CD1   . LEU I  5  348  ? 18.842  111.996 -5.655  1.00 50.81  ? 348  LEU C CD1   1 
ATOM   8573  C  CD2   . LEU I  5  348  ? 17.733  110.238 -6.970  1.00 48.53  ? 348  LEU C CD2   1 
ATOM   8574  N  N     . ALA I  5  349  ? 18.402  108.668 -1.806  1.00 51.97  ? 349  ALA C N     1 
ATOM   8575  C  CA    . ALA I  5  349  ? 17.503  108.328 -0.701  1.00 52.25  ? 349  ALA C CA    1 
ATOM   8576  C  C     . ALA I  5  349  ? 17.903  109.080 0.565   1.00 52.37  ? 349  ALA C C     1 
ATOM   8577  O  O     . ALA I  5  349  ? 17.049  109.584 1.287   1.00 51.14  ? 349  ALA C O     1 
ATOM   8578  C  CB    . ALA I  5  349  ? 17.543  106.812 -0.439  1.00 52.78  ? 349  ALA C CB    1 
ATOM   8579  N  N     . ARG I  5  350  ? 19.216  109.136 0.808   1.00 53.62  ? 350  ARG C N     1 
ATOM   8580  C  CA    . ARG I  5  350  ? 19.820  109.822 1.956   1.00 54.38  ? 350  ARG C CA    1 
ATOM   8581  C  C     . ARG I  5  350  ? 19.527  111.327 1.917   1.00 55.16  ? 350  ARG C C     1 
ATOM   8582  O  O     . ARG I  5  350  ? 19.407  111.981 2.952   1.00 53.91  ? 350  ARG C O     1 
ATOM   8583  C  CB    . ARG I  5  350  ? 21.343  109.605 1.959   1.00 53.64  ? 350  ARG C CB    1 
ATOM   8584  C  CG    . ARG I  5  350  ? 21.809  108.190 2.259   1.00 52.82  ? 350  ARG C CG    1 
ATOM   8585  C  CD    . ARG I  5  350  ? 21.462  107.771 3.673   1.00 52.08  ? 350  ARG C CD    1 
ATOM   8586  N  NE    . ARG I  5  350  ? 22.461  106.861 4.221   1.00 51.68  ? 350  ARG C NE    1 
ATOM   8587  C  CZ    . ARG I  5  350  ? 23.726  107.198 4.458   1.00 53.02  ? 350  ARG C CZ    1 
ATOM   8588  N  NH1   . ARG I  5  350  ? 24.162  108.429 4.199   1.00 53.58  ? 350  ARG C NH1   1 
ATOM   8589  N  NH2   . ARG I  5  350  ? 24.563  106.301 4.961   1.00 53.76  ? 350  ARG C NH2   1 
ATOM   8590  N  N     . LEU I  5  351  ? 19.422  111.864 0.706   1.00 57.81  ? 351  LEU C N     1 
ATOM   8591  C  CA    . LEU I  5  351  ? 19.110  113.280 0.492   1.00 59.96  ? 351  LEU C CA    1 
ATOM   8592  C  C     . LEU I  5  351  ? 17.604  113.537 0.690   1.00 61.99  ? 351  LEU C C     1 
ATOM   8593  O  O     . LEU I  5  351  ? 17.184  114.480 1.377   1.00 62.01  ? 351  LEU C O     1 
ATOM   8594  C  CB    . LEU I  5  351  ? 19.544  113.672 -0.935  1.00 59.03  ? 351  LEU C CB    1 
ATOM   8595  C  CG    . LEU I  5  351  ? 19.837  115.123 -1.341  1.00 57.94  ? 351  LEU C CG    1 
ATOM   8596  C  CD1   . LEU I  5  351  ? 20.051  115.990 -0.130  1.00 58.27  ? 351  LEU C CD1   1 
ATOM   8597  C  CD2   . LEU I  5  351  ? 21.072  115.136 -2.222  1.00 56.58  ? 351  LEU C CD2   1 
ATOM   8598  N  N     . ALA I  5  352  ? 16.806  112.666 0.078   1.00 63.77  ? 352  ALA C N     1 
ATOM   8599  C  CA    . ALA I  5  352  ? 15.354  112.713 0.167   1.00 65.05  ? 352  ALA C CA    1 
ATOM   8600  C  C     . ALA I  5  352  ? 14.893  112.493 1.606   1.00 65.65  ? 352  ALA C C     1 
ATOM   8601  O  O     . ALA I  5  352  ? 13.783  112.881 1.985   1.00 66.07  ? 352  ALA C O     1 
ATOM   8602  C  CB    . ALA I  5  352  ? 14.738  111.645 -0.752  1.00 66.69  ? 352  ALA C CB    1 
ATOM   8603  N  N     . ARG I  5  353  ? 15.760  111.856 2.391   1.00 66.14  ? 353  ARG C N     1 
ATOM   8604  C  CA    . ARG I  5  353  ? 15.503  111.586 3.808   1.00 66.00  ? 353  ARG C CA    1 
ATOM   8605  C  C     . ARG I  5  353  ? 15.449  112.888 4.591   1.00 65.58  ? 353  ARG C C     1 
ATOM   8606  O  O     . ARG I  5  353  ? 14.463  113.186 5.280   1.00 65.69  ? 353  ARG C O     1 
ATOM   8607  C  CB    . ARG I  5  353  ? 16.624  110.699 4.406   1.00 66.07  ? 353  ARG C CB    1 
ATOM   8608  C  CG    . ARG I  5  353  ? 16.503  110.394 5.924   1.00 64.65  ? 353  ARG C CG    1 
ATOM   8609  C  CD    . ARG I  5  353  ? 17.855  110.169 6.646   1.00 64.40  ? 353  ARG C CD    1 
ATOM   8610  N  NE    . ARG I  5  353  ? 18.655  109.043 6.148   1.00 65.04  ? 353  ARG C NE    1 
ATOM   8611  C  CZ    . ARG I  5  353  ? 19.404  108.249 6.918   1.00 65.03  ? 353  ARG C CZ    1 
ATOM   8612  N  NH1   . ARG I  5  353  ? 19.458  108.442 8.226   1.00 65.20  ? 353  ARG C NH1   1 
ATOM   8613  N  NH2   . ARG I  5  353  ? 20.104  107.260 6.382   1.00 64.28  ? 353  ARG C NH2   1 
ATOM   8614  N  N     . GLY I  5  354  ? 16.538  113.648 4.452   1.00 65.97  ? 354  GLY C N     1 
ATOM   8615  C  CA    . GLY I  5  354  ? 16.705  114.920 5.126   1.00 64.84  ? 354  GLY C CA    1 
ATOM   8616  C  C     . GLY I  5  354  ? 15.841  116.017 4.554   1.00 63.63  ? 354  GLY C C     1 
ATOM   8617  O  O     . GLY I  5  354  ? 15.450  116.907 5.296   1.00 64.11  ? 354  GLY C O     1 
ATOM   8618  N  N     . VAL I  5  355  ? 15.536  115.962 3.261   1.00 61.98  ? 355  VAL C N     1 
ATOM   8619  C  CA    . VAL I  5  355  ? 14.697  116.985 2.658   1.00 60.85  ? 355  VAL C CA    1 
ATOM   8620  C  C     . VAL I  5  355  ? 13.263  116.948 3.227   1.00 61.12  ? 355  VAL C C     1 
ATOM   8621  O  O     . VAL I  5  355  ? 12.652  118.001 3.448   1.00 60.98  ? 355  VAL C O     1 
ATOM   8622  C  CB    . VAL I  5  355  ? 14.637  116.819 1.121   1.00 60.54  ? 355  VAL C CB    1 
ATOM   8623  C  CG1   . VAL I  5  355  ? 13.953  115.544 0.760   1.00 60.30  ? 355  VAL C CG1   1 
ATOM   8624  C  CG2   . VAL I  5  355  ? 13.877  117.965 0.509   1.00 60.44  ? 355  VAL C CG2   1 
ATOM   8625  N  N     . ARG I  5  356  ? 12.736  115.742 3.458   1.00 59.93  ? 356  ARG C N     1 
ATOM   8626  C  CA    . ARG I  5  356  ? 11.382  115.543 3.997   1.00 58.40  ? 356  ARG C CA    1 
ATOM   8627  C  C     . ARG I  5  356  ? 11.222  116.215 5.356   1.00 58.67  ? 356  ARG C C     1 
ATOM   8628  O  O     . ARG I  5  356  ? 10.140  116.707 5.695   1.00 58.19  ? 356  ARG C O     1 
ATOM   8629  C  CB    . ARG I  5  356  ? 11.086  114.041 4.142   1.00 56.08  ? 356  ARG C CB    1 
ATOM   8630  C  CG    . ARG I  5  356  ? 9.615   113.617 3.973   1.00 52.33  ? 356  ARG C CG    1 
ATOM   8631  C  CD    . ARG I  5  356  ? 9.408   112.118 4.335   1.00 47.33  ? 356  ARG C CD    1 
ATOM   8632  N  NE    . ARG I  5  356  ? 8.245   111.483 3.694   1.00 42.63  ? 356  ARG C NE    1 
ATOM   8633  C  CZ    . ARG I  5  356  ? 8.229   111.010 2.450   1.00 39.74  ? 356  ARG C CZ    1 
ATOM   8634  N  NH1   . ARG I  5  356  ? 9.307   111.086 1.688   1.00 38.15  ? 356  ARG C NH1   1 
ATOM   8635  N  NH2   . ARG I  5  356  ? 7.127   110.463 1.968   1.00 37.38  ? 356  ARG C NH2   1 
ATOM   8636  N  N     . GLU I  5  357  ? 12.317  116.218 6.122   1.00 58.17  ? 357  GLU C N     1 
ATOM   8637  C  CA    . GLU I  5  357  ? 12.368  116.819 7.448   1.00 57.01  ? 357  GLU C CA    1 
ATOM   8638  C  C     . GLU I  5  357  ? 12.278  118.326 7.359   1.00 56.82  ? 357  GLU C C     1 
ATOM   8639  O  O     . GLU I  5  357  ? 11.802  118.977 8.278   1.00 56.07  ? 357  GLU C O     1 
ATOM   8640  C  CB    . GLU I  5  357  ? 13.684  116.447 8.163   1.00 55.60  ? 357  GLU C CB    1 
ATOM   8641  C  CG    . GLU I  5  357  ? 14.021  114.935 8.230   1.00 54.34  ? 357  GLU C CG    1 
ATOM   8642  C  CD    . GLU I  5  357  ? 14.956  114.558 9.391   1.00 52.72  ? 357  GLU C CD    1 
ATOM   8643  O  OE1   . GLU I  5  357  ? 15.958  115.258 9.610   1.00 52.20  ? 357  GLU C OE1   1 
ATOM   8644  O  OE2   . GLU I  5  357  ? 14.689  113.555 10.087  1.00 51.99  ? 357  GLU C OE2   1 
ATOM   8645  N  N     . ARG I  5  358  ? 12.733  118.858 6.225   1.00 58.27  ? 358  ARG C N     1 
ATOM   8646  C  CA    . ARG I  5  358  ? 12.779  120.297 5.965   1.00 59.46  ? 358  ARG C CA    1 
ATOM   8647  C  C     . ARG I  5  358  ? 11.493  120.812 5.336   1.00 60.38  ? 358  ARG C C     1 
ATOM   8648  O  O     . ARG I  5  358  ? 11.306  122.019 5.196   1.00 59.49  ? 358  ARG C O     1 
ATOM   8649  C  CB    . ARG I  5  358  ? 13.973  120.588 5.074   1.00 59.52  ? 358  ARG C CB    1 
ATOM   8650  C  CG    . ARG I  5  358  ? 15.264  119.975 5.651   1.00 60.26  ? 358  ARG C CG    1 
ATOM   8651  C  CD    . ARG I  5  358  ? 16.236  119.488 4.594   1.00 59.29  ? 358  ARG C CD    1 
ATOM   8652  N  NE    . ARG I  5  358  ? 17.101  120.540 4.095   1.00 60.37  ? 358  ARG C NE    1 
ATOM   8653  C  CZ    . ARG I  5  358  ? 17.976  120.373 3.117   1.00 60.62  ? 358  ARG C CZ    1 
ATOM   8654  N  NH1   . ARG I  5  358  ? 18.100  119.186 2.535   1.00 61.32  ? 358  ARG C NH1   1 
ATOM   8655  N  NH2   . ARG I  5  358  ? 18.722  121.395 2.729   1.00 60.84  ? 358  ARG C NH2   1 
ATOM   8656  N  N     . MET I  5  359  ? 10.611  119.908 4.942   1.00 62.47  ? 359  MET C N     1 
ATOM   8657  C  CA    . MET I  5  359  ? 9.321   120.337 4.423   1.00 65.09  ? 359  MET C CA    1 
ATOM   8658  C  C     . MET I  5  359  ? 8.482   120.939 5.566   1.00 65.34  ? 359  MET C C     1 
ATOM   8659  O  O     . MET I  5  359  ? 7.589   121.767 5.354   1.00 66.09  ? 359  MET C O     1 
ATOM   8660  C  CB    . MET I  5  359  ? 8.596   119.131 3.798   1.00 67.07  ? 359  MET C CB    1 
ATOM   8661  C  CG    . MET I  5  359  ? 7.298   119.435 3.042   1.00 69.31  ? 359  MET C CG    1 
ATOM   8662  S  SD    . MET I  5  359  ? 5.772   119.462 4.049   1.00 72.30  ? 359  MET C SD    1 
ATOM   8663  C  CE    . MET I  5  359  ? 5.174   121.190 3.785   1.00 71.56  ? 359  MET C CE    1 
ATOM   8664  N  N     . LEU I  5  360  ? 8.825   120.501 6.785   1.00 64.08  ? 360  LEU C N     1 
ATOM   8665  C  CA    . LEU I  5  360  ? 8.193   120.909 8.052   1.00 61.85  ? 360  LEU C CA    1 
ATOM   8666  C  C     . LEU I  5  360  ? 9.001   122.030 8.754   1.00 61.45  ? 360  LEU C C     1 
ATOM   8667  O  O     . LEU I  5  360  ? 8.455   122.806 9.548   1.00 60.45  ? 360  LEU C O     1 
ATOM   8668  C  CB    . LEU I  5  360  ? 8.086   119.687 8.994   1.00 58.48  ? 360  LEU C CB    1 
ATOM   8669  C  CG    . LEU I  5  360  ? 8.568   118.302 8.523   1.00 54.96  ? 360  LEU C CG    1 
ATOM   8670  C  CD1   . LEU I  5  360  ? 8.736   117.398 9.711   1.00 52.78  ? 360  LEU C CD1   1 
ATOM   8671  C  CD2   . LEU I  5  360  ? 7.591   117.709 7.553   1.00 52.20  ? 360  LEU C CD2   1 
ATOM   8672  N  N     . MET I  5  361  ? 10.296  122.103 8.454   1.00 60.65  ? 361  MET C N     1 
ATOM   8673  C  CA    . MET I  5  361  ? 11.175  123.096 9.064   1.00 60.99  ? 361  MET C CA    1 
ATOM   8674  C  C     . MET I  5  361  ? 10.947  124.484 8.469   1.00 63.70  ? 361  MET C C     1 
ATOM   8675  O  O     . MET I  5  361  ? 10.858  125.471 9.208   1.00 64.90  ? 361  MET C O     1 
ATOM   8676  C  CB    . MET I  5  361  ? 12.661  122.696 8.888   1.00 56.05  ? 361  MET C CB    1 
ATOM   8677  C  CG    . MET I  5  361  ? 13.354  123.115 7.590   1.00 49.84  ? 361  MET C CG    1 
ATOM   8678  S  SD    . MET I  5  361  ? 15.106  122.818 7.593   1.00 42.57  ? 361  MET C SD    1 
ATOM   8679  C  CE    . MET I  5  361  ? 15.768  124.424 7.608   1.00 43.39  ? 361  MET C CE    1 
ATOM   8680  N  N     . GLY I  5  362  ? 10.851  124.552 7.139   1.00 65.62  ? 362  GLY C N     1 
ATOM   8681  C  CA    . GLY I  5  362  ? 10.665  125.823 6.452   1.00 67.67  ? 362  GLY C CA    1 
ATOM   8682  C  C     . GLY I  5  362  ? 9.426   126.565 6.891   1.00 68.67  ? 362  GLY C C     1 
ATOM   8683  O  O     . GLY I  5  362  ? 8.319   126.032 6.791   1.00 67.10  ? 362  GLY C O     1 
ATOM   8684  N  N     . SER I  5  363  ? 9.620   127.788 7.384   1.00 70.47  ? 363  SER C N     1 
ATOM   8685  C  CA    . SER I  5  363  ? 8.514   128.614 7.836   1.00 72.92  ? 363  SER C CA    1 
ATOM   8686  C  C     . SER I  5  363  ? 7.406   128.670 6.780   1.00 74.08  ? 363  SER C C     1 
ATOM   8687  O  O     . SER I  5  363  ? 6.434   127.914 6.871   1.00 74.50  ? 363  SER C O     1 
ATOM   8688  C  CB    . SER I  5  363  ? 9.026   130.026 8.164   1.00 74.37  ? 363  SER C CB    1 
ATOM   8689  O  OG    . SER I  5  363  ? 10.201  130.346 7.426   1.00 76.66  ? 363  SER C OG    1 
ATOM   8690  N  N     . GLU I  5  364  ? 7.546   129.543 5.779   1.00 74.22  ? 364  GLU C N     1 
ATOM   8691  C  CA    . GLU I  5  364  ? 6.537   129.645 4.726   1.00 74.66  ? 364  GLU C CA    1 
ATOM   8692  C  C     . GLU I  5  364  ? 7.057   129.121 3.377   1.00 75.00  ? 364  GLU C C     1 
ATOM   8693  O  O     . GLU I  5  364  ? 8.018   128.355 3.311   1.00 75.88  ? 364  GLU C O     1 
ATOM   8694  C  CB    . GLU I  5  364  ? 6.060   131.093 4.581   1.00 73.11  ? 364  GLU C CB    1 
ATOM   8695  C  CG    . GLU I  5  364  ? 5.097   131.531 5.659   1.00 72.88  ? 364  GLU C CG    1 
ATOM   8696  C  CD    . GLU I  5  364  ? 3.960   130.545 5.869   1.00 73.12  ? 364  GLU C CD    1 
ATOM   8697  O  OE1   . GLU I  5  364  ? 3.442   130.003 4.867   1.00 72.67  ? 364  GLU C OE1   1 
ATOM   8698  O  OE2   . GLU I  5  364  ? 3.583   130.312 7.040   1.00 73.67  ? 364  GLU C OE2   1 
ATOM   8699  N  N     . ASP I  5  365  ? 6.396   129.560 2.312   1.00 74.61  ? 365  ASP C N     1 
ATOM   8700  C  CA    . ASP I  5  365  ? 6.622   129.157 0.922   1.00 74.56  ? 365  ASP C CA    1 
ATOM   8701  C  C     . ASP I  5  365  ? 8.117   129.243 0.447   1.00 75.18  ? 365  ASP C C     1 
ATOM   8702  O  O     . ASP I  5  365  ? 8.543   128.332 -0.263  1.00 75.09  ? 365  ASP C O     1 
ATOM   8703  C  CB    . ASP I  5  365  ? 5.677   130.005 0.051   1.00 72.99  ? 365  ASP C CB    1 
ATOM   8704  C  CG    . ASP I  5  365  ? 6.259   130.353 -1.296  1.00 72.67  ? 365  ASP C CG    1 
ATOM   8705  O  OD1   . ASP I  5  365  ? 7.162   131.208 -1.363  1.00 73.27  ? 365  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP I  5  365  ? 5.818   129.775 -2.299  1.00 72.55  ? 365  ASP C OD2   1 
ATOM   8707  N  N     . SER I  5  366  ? 8.914   130.266 0.789   1.00 75.82  ? 366  SER C N     1 
ATOM   8708  C  CA    . SER I  5  366  ? 10.312  130.327 0.282   1.00 75.54  ? 366  SER C CA    1 
ATOM   8709  C  C     . SER I  5  366  ? 11.204  129.253 0.926   1.00 75.78  ? 366  SER C C     1 
ATOM   8710  O  O     . SER I  5  366  ? 11.911  129.495 1.911   1.00 75.33  ? 366  SER C O     1 
ATOM   8711  C  CB    . SER I  5  366  ? 10.914  131.724 0.516   1.00 75.55  ? 366  SER C CB    1 
ATOM   8712  O  OG    . SER I  5  366  ? 10.740  132.543 -0.637  1.00 75.31  ? 366  SER C OG    1 
ATOM   8713  N  N     . LEU I  5  367  ? 11.170  128.061 0.334   1.00 75.44  ? 367  LEU C N     1 
ATOM   8714  C  CA    . LEU I  5  367  ? 11.907  126.919 0.846   1.00 74.53  ? 367  LEU C CA    1 
ATOM   8715  C  C     . LEU I  5  367  ? 12.446  126.028 -0.282  1.00 74.58  ? 367  LEU C C     1 
ATOM   8716  O  O     . LEU I  5  367  ? 12.816  124.881 -0.036  1.00 75.28  ? 367  LEU C O     1 
ATOM   8717  C  CB    . LEU I  5  367  ? 10.975  126.102 1.757   1.00 73.10  ? 367  LEU C CB    1 
ATOM   8718  C  CG    . LEU I  5  367  ? 9.454   126.055 1.480   1.00 72.27  ? 367  LEU C CG    1 
ATOM   8719  C  CD1   . LEU I  5  367  ? 9.185   125.438 0.130   1.00 72.17  ? 367  LEU C CD1   1 
ATOM   8720  C  CD2   . LEU I  5  367  ? 8.752   125.235 2.550   1.00 71.79  ? 367  LEU C CD2   1 
ATOM   8721  N  N     . THR I  5  368  ? 12.510  126.544 -1.504  1.00 74.12  ? 368  THR C N     1 
ATOM   8722  C  CA    . THR I  5  368  ? 12.950  125.747 -2.652  1.00 73.53  ? 368  THR C CA    1 
ATOM   8723  C  C     . THR I  5  368  ? 14.466  125.416 -2.611  1.00 73.11  ? 368  THR C C     1 
ATOM   8724  O  O     . THR I  5  368  ? 14.847  124.246 -2.511  1.00 72.99  ? 368  THR C O     1 
ATOM   8725  C  CB    . THR I  5  368  ? 12.625  126.501 -3.969  1.00 72.94  ? 368  THR C CB    1 
ATOM   8726  O  OG1   . THR I  5  368  ? 11.427  127.258 -3.781  1.00 72.35  ? 368  THR C OG1   1 
ATOM   8727  C  CG2   . THR I  5  368  ? 12.466  125.547 -5.127  1.00 73.54  ? 368  THR C CG2   1 
ATOM   8728  N  N     . PRO I  5  369  ? 15.335  126.438 -2.671  1.00 72.70  ? 369  PRO C N     1 
ATOM   8729  C  CA    . PRO I  5  369  ? 16.787  126.240 -2.670  1.00 72.97  ? 369  PRO C CA    1 
ATOM   8730  C  C     . PRO I  5  369  ? 17.309  125.375 -1.511  1.00 74.10  ? 369  PRO C C     1 
ATOM   8731  O  O     . PRO I  5  369  ? 17.153  124.150 -1.480  1.00 73.60  ? 369  PRO C O     1 
ATOM   8732  C  CB    . PRO I  5  369  ? 17.317  127.661 -2.634  1.00 72.78  ? 369  PRO C CB    1 
ATOM   8733  C  CG    . PRO I  5  369  ? 16.309  128.345 -1.761  1.00 72.34  ? 369  PRO C CG    1 
ATOM   8734  C  CD    . PRO I  5  369  ? 15.034  127.856 -2.363  1.00 72.37  ? 369  PRO C CD    1 
ATOM   8735  N  N     . ALA I  5  370  ? 17.953  126.067 -0.573  1.00 74.57  ? 370  ALA C N     1 
ATOM   8736  C  CA    . ALA I  5  370  ? 18.629  125.499 0.587   1.00 74.64  ? 370  ALA C CA    1 
ATOM   8737  C  C     . ALA I  5  370  ? 17.671  124.828 1.557   1.00 74.03  ? 370  ALA C C     1 
ATOM   8738  O  O     . ALA I  5  370  ? 18.093  123.941 2.305   1.00 74.32  ? 370  ALA C O     1 
ATOM   8739  C  CB    . ALA I  5  370  ? 19.419  126.600 1.313   1.00 74.90  ? 370  ALA C CB    1 
ATOM   8740  N  N     . LYS I  5  371  ? 16.404  125.215 1.578   1.00 71.90  ? 371  LYS C N     1 
ATOM   8741  C  CA    . LYS I  5  371  ? 15.521  124.577 2.540   1.00 71.71  ? 371  LYS C CA    1 
ATOM   8742  C  C     . LYS I  5  371  ? 15.294  123.110 2.194   1.00 71.35  ? 371  LYS C C     1 
ATOM   8743  O  O     . LYS I  5  371  ? 15.084  122.315 3.094   1.00 72.53  ? 371  LYS C O     1 
ATOM   8744  C  CB    . LYS I  5  371  ? 14.175  125.306 2.617   1.00 70.16  ? 371  LYS C CB    1 
ATOM   8745  C  CG    . LYS I  5  371  ? 13.355  125.045 3.894   1.00 68.55  ? 371  LYS C CG    1 
ATOM   8746  C  CD    . LYS I  5  371  ? 13.894  125.753 5.157   1.00 66.79  ? 371  LYS C CD    1 
ATOM   8747  C  CE    . LYS I  5  371  ? 13.443  127.206 5.278   1.00 65.28  ? 371  LYS C CE    1 
ATOM   8748  N  NZ    . LYS I  5  371  ? 13.402  127.651 6.703   1.00 62.81  ? 371  LYS C NZ    1 
ATOM   8749  N  N     . LEU I  5  372  ? 15.347  122.730 0.917   1.00 70.61  ? 372  LEU C N     1 
ATOM   8750  C  CA    . LEU I  5  372  ? 15.113  121.323 0.572   1.00 68.83  ? 372  LEU C CA    1 
ATOM   8751  C  C     . LEU I  5  372  ? 16.413  120.578 0.230   1.00 69.64  ? 372  LEU C C     1 
ATOM   8752  O  O     . LEU I  5  372  ? 16.469  119.362 0.408   1.00 70.70  ? 372  LEU C O     1 
ATOM   8753  C  CB    . LEU I  5  372  ? 14.138  121.211 -0.615  1.00 65.80  ? 372  LEU C CB    1 
ATOM   8754  C  CG    . LEU I  5  372  ? 12.669  120.871 -0.318  1.00 63.20  ? 372  LEU C CG    1 
ATOM   8755  C  CD1   . LEU I  5  372  ? 11.955  121.982 0.410   1.00 60.97  ? 372  LEU C CD1   1 
ATOM   8756  C  CD2   . LEU I  5  372  ? 11.999  120.589 -1.624  1.00 63.00  ? 372  LEU C CD2   1 
ATOM   8757  N  N     . VAL I  5  373  ? 17.462  121.263 -0.223  1.00 69.71  ? 373  VAL C N     1 
ATOM   8758  C  CA    . VAL I  5  373  ? 18.645  120.515 -0.662  1.00 69.89  ? 373  VAL C CA    1 
ATOM   8759  C  C     . VAL I  5  373  ? 19.896  120.756 0.195   1.00 69.64  ? 373  VAL C C     1 
ATOM   8760  O  O     . VAL I  5  373  ? 20.226  121.891 0.553   1.00 69.64  ? 373  VAL C O     1 
ATOM   8761  C  CB    . VAL I  5  373  ? 18.988  120.871 -2.110  1.00 70.33  ? 373  VAL C CB    1 
ATOM   8762  C  CG1   . VAL I  5  373  ? 20.103  119.976 -2.610  1.00 71.37  ? 373  VAL C CG1   1 
ATOM   8763  C  CG2   . VAL I  5  373  ? 17.751  120.729 -2.972  1.00 70.18  ? 373  VAL C CG2   1 
ATOM   8764  N  N     . ASN I  5  374  ? 20.578  119.630 0.480   1.00 70.20  ? 374  ASN C N     1 
ATOM   8765  C  CA    . ASN I  5  374  ? 21.857  119.524 1.206   1.00 70.28  ? 374  ASN C CA    1 
ATOM   8766  C  C     . ASN I  5  374  ? 22.785  118.526 0.487   1.00 70.25  ? 374  ASN C C     1 
ATOM   8767  O  O     . ASN I  5  374  ? 22.506  117.344 0.420   1.00 70.41  ? 374  ASN C O     1 
ATOM   8768  C  CB    . ASN I  5  374  ? 21.635  119.089 2.688   1.00 68.93  ? 374  ASN C CB    1 
ATOM   8769  C  CG    . ASN I  5  374  ? 21.112  117.633 2.851   1.00 67.50  ? 374  ASN C CG    1 
ATOM   8770  O  OD1   . ASN I  5  374  ? 19.977  117.298 2.510   1.00 64.52  ? 374  ASN C OD1   1 
ATOM   8771  N  ND2   . ASN I  5  374  ? 21.961  116.780 3.394   1.00 68.00  ? 374  ASN C ND2   1 
ATOM   8772  N  N     . SER I  5  375  ? 23.888  119.020 -0.059  1.00 71.72  ? 375  SER C N     1 
ATOM   8773  C  CA    . SER I  5  375  ? 24.818  118.200 -0.851  1.00 73.03  ? 375  SER C CA    1 
ATOM   8774  C  C     . SER I  5  375  ? 25.621  117.230 0.003   1.00 74.04  ? 375  SER C C     1 
ATOM   8775  O  O     . SER I  5  375  ? 26.336  116.388 -0.542  1.00 73.48  ? 375  SER C O     1 
ATOM   8776  C  CB    . SER I  5  375  ? 25.800  119.102 -1.601  1.00 74.37  ? 375  SER C CB    1 
ATOM   8777  O  OG    . SER I  5  375  ? 25.126  120.150 -2.277  1.00 76.20  ? 375  SER C OG    1 
ATOM   8778  N  N     . ARG I  5  376  ? 25.507  117.341 1.319   1.00 75.09  ? 376  ARG C N     1 
ATOM   8779  C  CA    . ARG I  5  376  ? 26.283  116.504 2.228   1.00 76.19  ? 376  ARG C CA    1 
ATOM   8780  C  C     . ARG I  5  376  ? 26.170  114.990 1.897   1.00 76.83  ? 376  ARG C C     1 
ATOM   8781  O  O     . ARG I  5  376  ? 27.203  114.362 1.641   1.00 77.77  ? 376  ARG C O     1 
ATOM   8782  C  CB    . ARG I  5  376  ? 25.851  116.752 3.691   1.00 76.34  ? 376  ARG C CB    1 
ATOM   8783  C  CG    . ARG I  5  376  ? 26.918  116.413 4.740   1.00 77.69  ? 376  ARG C CG    1 
ATOM   8784  C  CD    . ARG I  5  376  ? 28.078  117.410 4.738   1.00 79.97  ? 376  ARG C CD    1 
ATOM   8785  N  NE    . ARG I  5  376  ? 27.640  118.740 5.164   1.00 82.54  ? 376  ARG C NE    1 
ATOM   8786  C  CZ    . ARG I  5  376  ? 28.435  119.806 5.279   1.00 84.43  ? 376  ARG C CZ    1 
ATOM   8787  N  NH1   . ARG I  5  376  ? 29.734  119.713 5.004   1.00 85.08  ? 376  ARG C NH1   1 
ATOM   8788  N  NH2   . ARG I  5  376  ? 27.930  120.973 5.675   1.00 85.57  ? 376  ARG C NH2   1 
ATOM   8789  N  N     . PRO I  5  377  ? 24.942  114.391 1.868   1.00 76.71  ? 377  PRO C N     1 
ATOM   8790  C  CA    . PRO I  5  377  ? 24.713  112.950 1.599   1.00 76.20  ? 377  PRO C CA    1 
ATOM   8791  C  C     . PRO I  5  377  ? 25.306  112.464 0.280   1.00 74.87  ? 377  PRO C C     1 
ATOM   8792  O  O     . PRO I  5  377  ? 26.111  111.528 0.240   1.00 74.68  ? 377  PRO C O     1 
ATOM   8793  C  CB    . PRO I  5  377  ? 23.191  112.798 1.616   1.00 75.85  ? 377  PRO C CB    1 
ATOM   8794  C  CG    . PRO I  5  377  ? 22.685  114.082 2.171   1.00 75.89  ? 377  PRO C CG    1 
ATOM   8795  C  CD    . PRO I  5  377  ? 23.665  115.099 1.705   1.00 76.06  ? 377  PRO C CD    1 
ATOM   8796  N  N     . LEU I  5  378  ? 24.878  113.093 -0.799  1.00 73.30  ? 378  LEU C N     1 
ATOM   8797  C  CA    . LEU I  5  378  ? 25.321  112.711 -2.112  1.00 71.51  ? 378  LEU C CA    1 
ATOM   8798  C  C     . LEU I  5  378  ? 26.841  112.627 -2.201  1.00 70.96  ? 378  LEU C C     1 
ATOM   8799  O  O     . LEU I  5  378  ? 27.378  111.609 -2.629  1.00 69.99  ? 378  LEU C O     1 
ATOM   8800  C  CB    . LEU I  5  378  ? 24.796  113.716 -3.109  1.00 70.59  ? 378  LEU C CB    1 
ATOM   8801  C  CG    . LEU I  5  378  ? 25.042  113.270 -4.530  1.00 70.52  ? 378  LEU C CG    1 
ATOM   8802  C  CD1   . LEU I  5  378  ? 24.344  111.938 -4.788  1.00 71.12  ? 378  LEU C CD1   1 
ATOM   8803  C  CD2   . LEU I  5  378  ? 24.526  114.330 -5.444  1.00 70.84  ? 378  LEU C CD2   1 
ATOM   8804  N  N     . GLU I  5  379  ? 27.522  113.695 -1.792  1.00 71.39  ? 379  GLU C N     1 
ATOM   8805  C  CA    . GLU I  5  379  ? 28.986  113.776 -1.845  1.00 71.42  ? 379  GLU C CA    1 
ATOM   8806  C  C     . GLU I  5  379  ? 29.644  112.569 -1.194  1.00 72.22  ? 379  GLU C C     1 
ATOM   8807  O  O     . GLU I  5  379  ? 30.357  111.813 -1.855  1.00 71.57  ? 379  GLU C O     1 
ATOM   8808  C  CB    . GLU I  5  379  ? 29.468  115.055 -1.140  1.00 71.41  ? 379  GLU C CB    1 
ATOM   8809  C  CG    . GLU I  5  379  ? 30.992  115.184 -0.949  1.00 70.04  ? 379  GLU C CG    1 
ATOM   8810  C  CD    . GLU I  5  379  ? 31.689  115.957 -2.059  1.00 69.32  ? 379  GLU C CD    1 
ATOM   8811  O  OE1   . GLU I  5  379  ? 31.659  115.493 -3.213  1.00 70.37  ? 379  GLU C OE1   1 
ATOM   8812  O  OE2   . GLU I  5  379  ? 32.268  117.029 -1.777  1.00 66.63  ? 379  GLU C OE2   1 
ATOM   8813  N  N     . ALA I  5  380  ? 29.402  112.405 0.102   1.00 74.27  ? 380  ALA C N     1 
ATOM   8814  C  CA    . ALA I  5  380  ? 29.985  111.304 0.866   1.00 76.40  ? 380  ALA C CA    1 
ATOM   8815  C  C     . ALA I  5  380  ? 29.627  109.942 0.255   1.00 77.29  ? 380  ALA C C     1 
ATOM   8816  O  O     . ALA I  5  380  ? 30.475  109.042 0.213   1.00 77.73  ? 380  ALA C O     1 
ATOM   8817  C  CB    . ALA I  5  380  ? 29.506  111.365 2.330   1.00 76.58  ? 380  ALA C CB    1 
ATOM   8818  N  N     . ALA I  5  381  ? 28.379  109.802 -0.213  1.00 77.77  ? 381  ALA C N     1 
ATOM   8819  C  CA    . ALA I  5  381  ? 27.872  108.552 -0.802  1.00 76.67  ? 381  ALA C CA    1 
ATOM   8820  C  C     . ALA I  5  381  ? 28.712  108.125 -2.000  1.00 75.69  ? 381  ALA C C     1 
ATOM   8821  O  O     . ALA I  5  381  ? 29.397  107.093 -1.984  1.00 75.80  ? 381  ALA C O     1 
ATOM   8822  C  CB    . ALA I  5  381  ? 26.405  108.741 -1.227  1.00 75.93  ? 381  ALA C CB    1 
ATOM   8823  N  N     . ILE I  5  382  ? 28.647  108.930 -3.045  1.00 73.03  ? 382  ILE C N     1 
ATOM   8824  C  CA    . ILE I  5  382  ? 29.420  108.649 -4.228  1.00 70.99  ? 382  ILE C CA    1 
ATOM   8825  C  C     . ILE I  5  382  ? 30.892  108.554 -3.889  1.00 68.59  ? 382  ILE C C     1 
ATOM   8826  O  O     . ILE I  5  382  ? 31.523  107.551 -4.192  1.00 68.13  ? 382  ILE C O     1 
ATOM   8827  C  CB    . ILE I  5  382  ? 29.218  109.748 -5.296  1.00 72.01  ? 382  ILE C CB    1 
ATOM   8828  C  CG1   . ILE I  5  382  ? 27.772  109.698 -5.814  1.00 73.64  ? 382  ILE C CG1   1 
ATOM   8829  C  CG2   . ILE I  5  382  ? 30.198  109.537 -6.471  1.00 71.45  ? 382  ILE C CG2   1 
ATOM   8830  C  CD1   . ILE I  5  382  ? 27.428  110.754 -6.885  1.00 75.41  ? 382  ILE C CD1   1 
ATOM   8831  N  N     . ARG I  5  383  ? 31.430  109.593 -3.256  1.00 66.07  ? 383  ARG C N     1 
ATOM   8832  C  CA    . ARG I  5  383  ? 32.846  109.605 -2.909  1.00 64.38  ? 383  ARG C CA    1 
ATOM   8833  C  C     . ARG I  5  383  ? 33.277  108.279 -2.268  1.00 64.15  ? 383  ARG C C     1 
ATOM   8834  O  O     . ARG I  5  383  ? 34.296  107.700 -2.658  1.00 63.70  ? 383  ARG C O     1 
ATOM   8835  C  CB    . ARG I  5  383  ? 33.162  110.771 -1.951  1.00 63.22  ? 383  ARG C CB    1 
ATOM   8836  C  CG    . ARG I  5  383  ? 34.620  110.774 -1.396  1.00 60.73  ? 383  ARG C CG    1 
ATOM   8837  C  CD    . ARG I  5  383  ? 35.675  111.442 -2.300  1.00 57.95  ? 383  ARG C CD    1 
ATOM   8838  N  NE    . ARG I  5  383  ? 35.737  112.902 -2.126  1.00 56.12  ? 383  ARG C NE    1 
ATOM   8839  C  CZ    . ARG I  5  383  ? 36.859  113.627 -2.192  1.00 54.26  ? 383  ARG C CZ    1 
ATOM   8840  N  NH1   . ARG I  5  383  ? 38.023  113.031 -2.423  1.00 52.38  ? 383  ARG C NH1   1 
ATOM   8841  N  NH2   . ARG I  5  383  ? 36.827  114.949 -2.029  1.00 52.32  ? 383  ARG C NH2   1 
ATOM   8842  N  N     . GLU I  5  384  ? 32.493  107.798 -1.306  1.00 63.38  ? 384  GLU C N     1 
ATOM   8843  C  CA    . GLU I  5  384  ? 32.815  106.566 -0.590  1.00 63.06  ? 384  GLU C CA    1 
ATOM   8844  C  C     . GLU I  5  384  ? 32.899  105.382 -1.524  1.00 61.44  ? 384  GLU C C     1 
ATOM   8845  O  O     . GLU I  5  384  ? 33.693  104.474 -1.306  1.00 60.57  ? 384  GLU C O     1 
ATOM   8846  C  CB    . GLU I  5  384  ? 31.763  106.268 0.480   1.00 64.33  ? 384  GLU C CB    1 
ATOM   8847  C  CG    . GLU I  5  384  ? 31.891  104.859 1.107   1.00 66.63  ? 384  GLU C CG    1 
ATOM   8848  C  CD    . GLU I  5  384  ? 32.819  104.810 2.318   1.00 68.53  ? 384  GLU C CD    1 
ATOM   8849  O  OE1   . GLU I  5  384  ? 33.371  103.722 2.622   1.00 68.53  ? 384  GLU C OE1   1 
ATOM   8850  O  OE2   . GLU I  5  384  ? 32.989  105.859 2.975   1.00 70.24  ? 384  GLU C OE2   1 
ATOM   8851  N  N     . PHE I  5  385  ? 32.086  105.373 -2.560  1.00 60.23  ? 385  PHE C N     1 
ATOM   8852  C  CA    . PHE I  5  385  ? 32.131  104.239 -3.450  1.00 61.30  ? 385  PHE C CA    1 
ATOM   8853  C  C     . PHE I  5  385  ? 33.402  104.229 -4.288  1.00 62.50  ? 385  PHE C C     1 
ATOM   8854  O  O     . PHE I  5  385  ? 34.023  103.192 -4.457  1.00 63.00  ? 385  PHE C O     1 
ATOM   8855  C  CB    . PHE I  5  385  ? 30.924  104.247 -4.376  1.00 61.88  ? 385  PHE C CB    1 
ATOM   8856  C  CG    . PHE I  5  385  ? 29.904  103.169 -4.075  1.00 62.52  ? 385  PHE C CG    1 
ATOM   8857  C  CD1   . PHE I  5  385  ? 29.439  102.952 -2.763  1.00 62.85  ? 385  PHE C CD1   1 
ATOM   8858  C  CD2   . PHE I  5  385  ? 29.359  102.394 -5.120  1.00 62.33  ? 385  PHE C CD2   1 
ATOM   8859  C  CE1   . PHE I  5  385  ? 28.422  101.965 -2.497  1.00 63.26  ? 385  PHE C CE1   1 
ATOM   8860  C  CE2   . PHE I  5  385  ? 28.344  101.405 -4.869  1.00 62.44  ? 385  PHE C CE2   1 
ATOM   8861  C  CZ    . PHE I  5  385  ? 27.877  101.195 -3.557  1.00 61.83  ? 385  PHE C CZ    1 
ATOM   8862  N  N     . PHE I  5  386  ? 33.810  105.375 -4.810  1.00 62.36  ? 386  PHE C N     1 
ATOM   8863  C  CA    . PHE I  5  386  ? 34.973  105.385 -5.691  1.00 61.75  ? 386  PHE C CA    1 
ATOM   8864  C  C     . PHE I  5  386  ? 36.287  105.379 -4.933  1.00 61.49  ? 386  PHE C C     1 
ATOM   8865  O  O     . PHE I  5  386  ? 37.315  105.060 -5.536  1.00 62.04  ? 386  PHE C O     1 
ATOM   8866  C  CB    . PHE I  5  386  ? 34.895  106.591 -6.632  1.00 61.80  ? 386  PHE C CB    1 
ATOM   8867  C  CG    . PHE I  5  386  ? 34.010  106.355 -7.842  1.00 62.09  ? 386  PHE C CG    1 
ATOM   8868  C  CD1   . PHE I  5  386  ? 32.786  105.650 -7.719  1.00 62.37  ? 386  PHE C CD1   1 
ATOM   8869  C  CD2   . PHE I  5  386  ? 34.391  106.832 -9.110  1.00 62.39  ? 386  PHE C CD2   1 
ATOM   8870  C  CE1   . PHE I  5  386  ? 31.947  105.420 -8.852  1.00 62.13  ? 386  PHE C CE1   1 
ATOM   8871  C  CE2   . PHE I  5  386  ? 33.560  106.611 -10.263 1.00 62.32  ? 386  PHE C CE2   1 
ATOM   8872  C  CZ    . PHE I  5  386  ? 32.338  105.903 -10.128 1.00 61.79  ? 386  PHE C CZ    1 
ATOM   8873  N  N     . SER I  5  387  ? 36.283  105.712 -3.641  1.00 61.50  ? 387  SER C N     1 
ATOM   8874  C  CA    . SER I  5  387  ? 37.546  105.722 -2.898  1.00 61.23  ? 387  SER C CA    1 
ATOM   8875  C  C     . SER I  5  387  ? 37.647  104.555 -1.892  1.00 61.04  ? 387  SER C C     1 
ATOM   8876  O  O     . SER I  5  387  ? 38.761  104.085 -1.604  1.00 62.42  ? 387  SER C O     1 
ATOM   8877  C  CB    . SER I  5  387  ? 37.749  107.062 -2.130  1.00 60.04  ? 387  SER C CB    1 
ATOM   8878  O  OG    . SER I  5  387  ? 36.740  108.038 -2.361  1.00 57.12  ? 387  SER C OG    1 
ATOM   8879  N  N     . ARG I  5  388  ? 36.531  104.064 -1.357  1.00 60.56  ? 388  ARG C N     1 
ATOM   8880  C  CA    . ARG I  5  388  ? 36.674  103.006 -0.360  1.00 58.80  ? 388  ARG C CA    1 
ATOM   8881  C  C     . ARG I  5  388  ? 35.935  101.725 -0.740  1.00 59.33  ? 388  ARG C C     1 
ATOM   8882  O  O     . ARG I  5  388  ? 36.100  100.725 -0.026  1.00 58.47  ? 388  ARG C O     1 
ATOM   8883  C  CB    . ARG I  5  388  ? 36.204  103.508 1.025   1.00 57.14  ? 388  ARG C CB    1 
ATOM   8884  C  CG    . ARG I  5  388  ? 37.302  104.212 1.897   1.00 53.41  ? 388  ARG C CG    1 
ATOM   8885  C  CD    . ARG I  5  388  ? 37.272  105.758 1.801   1.00 49.87  ? 388  ARG C CD    1 
ATOM   8886  N  NE    . ARG I  5  388  ? 36.337  106.414 2.724   1.00 44.21  ? 388  ARG C NE    1 
ATOM   8887  C  CZ    . ARG I  5  388  ? 36.155  107.729 2.803   1.00 41.92  ? 388  ARG C CZ    1 
ATOM   8888  N  NH1   . ARG I  5  388  ? 36.833  108.554 2.025   1.00 39.00  ? 388  ARG C NH1   1 
ATOM   8889  N  NH2   . ARG I  5  388  ? 35.296  108.224 3.675   1.00 41.37  ? 388  ARG C NH2   1 
ATOM   8890  N  N     . SER I  5  389  ? 35.135  101.713 -1.815  1.00 59.14  ? 389  SER C N     1 
ATOM   8891  C  CA    . SER I  5  389  ? 34.488  100.440 -2.171  1.00 59.34  ? 389  SER C CA    1 
ATOM   8892  C  C     . SER I  5  389  ? 35.559  99.359  -2.392  1.00 59.32  ? 389  SER C C     1 
ATOM   8893  O  O     . SER I  5  389  ? 36.605  99.635  -2.982  1.00 59.84  ? 389  SER C O     1 
ATOM   8894  C  CB    . SER I  5  389  ? 33.618  100.582 -3.435  1.00 59.06  ? 389  SER C CB    1 
ATOM   8895  O  OG    . SER I  5  389  ? 32.406  101.264 -3.156  1.00 59.36  ? 389  SER C OG    1 
ATOM   8896  N  N     . GLN I  5  390  ? 35.302  98.144  -1.914  1.00 58.83  ? 390  GLN C N     1 
ATOM   8897  C  CA    . GLN I  5  390  ? 36.275  97.035  -1.967  1.00 57.98  ? 390  GLN C CA    1 
ATOM   8898  C  C     . GLN I  5  390  ? 36.628  96.613  -3.416  1.00 57.64  ? 390  GLN C C     1 
ATOM   8899  O  O     . GLN I  5  390  ? 37.456  95.711  -3.617  1.00 57.38  ? 390  GLN C O     1 
ATOM   8900  C  CB    . GLN I  5  390  ? 35.698  95.812  -1.213  1.00 57.77  ? 390  GLN C CB    1 
ATOM   8901  C  CG    . GLN I  5  390  ? 34.790  96.120  0.003   1.00 53.82  ? 390  GLN C CG    1 
ATOM   8902  C  CD    . GLN I  5  390  ? 34.862  95.067  1.107   1.00 50.85  ? 390  GLN C CD    1 
ATOM   8903  O  OE1   . GLN I  5  390  ? 34.074  95.088  2.044   1.00 49.17  ? 390  GLN C OE1   1 
ATOM   8904  N  NE2   . GLN I  5  390  ? 35.817  94.153  0.999   1.00 50.42  ? 390  GLN C NE2   1 
ATOM   8905  N  N     . LEU I  5  391  ? 36.031  97.281  -4.403  1.00 57.24  ? 391  LEU C N     1 
ATOM   8906  C  CA    . LEU I  5  391  ? 36.145  96.909  -5.819  1.00 57.20  ? 391  LEU C CA    1 
ATOM   8907  C  C     . LEU I  5  391  ? 37.152  97.759  -6.624  1.00 56.87  ? 391  LEU C C     1 
ATOM   8908  O  O     . LEU I  5  391  ? 37.653  97.263  -7.629  1.00 57.45  ? 391  LEU C O     1 
ATOM   8909  C  CB    . LEU I  5  391  ? 34.753  97.010  -6.421  1.00 56.81  ? 391  LEU C CB    1 
ATOM   8910  C  CG    . LEU I  5  391  ? 34.403  96.818  -7.886  1.00 57.45  ? 391  LEU C CG    1 
ATOM   8911  C  CD1   . LEU I  5  391  ? 32.891  96.677  -7.978  1.00 57.53  ? 391  LEU C CD1   1 
ATOM   8912  C  CD2   . LEU I  5  391  ? 34.884  97.995  -8.724  1.00 58.94  ? 391  LEU C CD2   1 
ATOM   8913  N  N     . SER I  5  392  ? 37.458  98.998  -6.248  1.00 56.82  ? 392  SER C N     1 
ATOM   8914  C  CA    . SER I  5  392  ? 38.410  99.792  -7.054  1.00 56.62  ? 392  SER C CA    1 
ATOM   8915  C  C     . SER I  5  392  ? 39.873  99.583  -6.603  1.00 56.35  ? 392  SER C C     1 
ATOM   8916  O  O     . SER I  5  392  ? 40.221  99.708  -5.426  1.00 55.43  ? 392  SER C O     1 
ATOM   8917  C  CB    . SER I  5  392  ? 38.037  101.281 -6.986  1.00 57.61  ? 392  SER C CB    1 
ATOM   8918  O  OG    . SER I  5  392  ? 36.772  101.523 -7.600  1.00 57.46  ? 392  SER C OG    1 
ATOM   8919  N  N     . GLN I  5  393  ? 40.726  99.274  -7.576  1.00 56.92  ? 393  GLN C N     1 
ATOM   8920  C  CA    . GLN I  5  393  ? 42.130  98.993  -7.311  1.00 57.47  ? 393  GLN C CA    1 
ATOM   8921  C  C     . GLN I  5  393  ? 43.061  99.736  -8.288  1.00 59.17  ? 393  GLN C C     1 
ATOM   8922  O  O     . GLN I  5  393  ? 42.619  100.492 -9.158  1.00 59.69  ? 393  GLN C O     1 
ATOM   8923  C  CB    . GLN I  5  393  ? 42.354  97.473  -7.418  1.00 55.43  ? 393  GLN C CB    1 
ATOM   8924  C  CG    . GLN I  5  393  ? 41.550  96.660  -6.412  1.00 50.94  ? 393  GLN C CG    1 
ATOM   8925  C  CD    . GLN I  5  393  ? 40.605  95.636  -7.026  1.00 48.24  ? 393  GLN C CD    1 
ATOM   8926  O  OE1   . GLN I  5  393  ? 39.988  94.853  -6.311  1.00 44.80  ? 393  GLN C OE1   1 
ATOM   8927  N  NE2   . GLN I  5  393  ? 40.483  95.645  -8.348  1.00 47.51  ? 393  GLN C NE2   1 
ATOM   8928  N  N     . PHE I  5  394  ? 44.362  99.507  -8.116  1.00 60.43  ? 394  PHE C N     1 
ATOM   8929  C  CA    . PHE I  5  394  ? 45.379  100.091 -8.965  1.00 61.10  ? 394  PHE C CA    1 
ATOM   8930  C  C     . PHE I  5  394  ? 45.338  99.493  -10.356 1.00 62.02  ? 394  PHE C C     1 
ATOM   8931  O  O     . PHE I  5  394  ? 45.403  98.272  -10.498 1.00 62.58  ? 394  PHE C O     1 
ATOM   8932  C  CB    . PHE I  5  394  ? 46.748  99.844  -8.373  1.00 60.61  ? 394  PHE C CB    1 
ATOM   8933  C  CG    . PHE I  5  394  ? 47.501  101.091 -8.128  1.00 61.24  ? 394  PHE C CG    1 
ATOM   8934  C  CD1   . PHE I  5  394  ? 48.895  101.116 -8.288  1.00 62.62  ? 394  PHE C CD1   1 
ATOM   8935  C  CD2   . PHE I  5  394  ? 46.834  102.269 -7.748  1.00 61.55  ? 394  PHE C CD2   1 
ATOM   8936  C  CE1   . PHE I  5  394  ? 49.636  102.302 -8.083  1.00 62.95  ? 394  PHE C CE1   1 
ATOM   8937  C  CE2   . PHE I  5  394  ? 47.549  103.465 -7.536  1.00 62.84  ? 394  PHE C CE2   1 
ATOM   8938  C  CZ    . PHE I  5  394  ? 48.964  103.488 -7.703  1.00 63.15  ? 394  PHE C CZ    1 
ATOM   8939  N  N     . LYS I  5  395  ? 45.221  100.333 -11.382 1.00 62.00  ? 395  LYS C N     1 
ATOM   8940  C  CA    . LYS I  5  395  ? 45.201  99.816  -12.751 1.00 61.32  ? 395  LYS C CA    1 
ATOM   8941  C  C     . LYS I  5  395  ? 46.486  99.017  -13.035 1.00 61.01  ? 395  LYS C C     1 
ATOM   8942  O  O     . LYS I  5  395  ? 47.589  99.551  -12.903 1.00 62.34  ? 395  LYS C O     1 
ATOM   8943  C  CB    . LYS I  5  395  ? 45.075  100.993 -13.719 1.00 60.17  ? 395  LYS C CB    1 
ATOM   8944  C  CG    . LYS I  5  395  ? 44.855  100.649 -15.180 1.00 58.68  ? 395  LYS C CG    1 
ATOM   8945  C  CD    . LYS I  5  395  ? 44.724  101.958 -15.974 1.00 58.33  ? 395  LYS C CD    1 
ATOM   8946  C  CE    . LYS I  5  395  ? 44.209  101.754 -17.391 1.00 58.04  ? 395  LYS C CE    1 
ATOM   8947  N  NZ    . LYS I  5  395  ? 43.975  103.074 -18.020 1.00 57.36  ? 395  LYS C NZ    1 
ATOM   8948  N  N     . ASP I  5  396  ? 46.360  97.746  -13.403 1.00 59.83  ? 396  ASP C N     1 
ATOM   8949  C  CA    . ASP I  5  396  ? 47.549  96.932  -13.670 1.00 58.55  ? 396  ASP C CA    1 
ATOM   8950  C  C     . ASP I  5  396  ? 48.129  97.269  -15.035 1.00 57.17  ? 396  ASP C C     1 
ATOM   8951  O  O     . ASP I  5  396  ? 47.797  96.621  -16.009 1.00 56.86  ? 396  ASP C O     1 
ATOM   8952  C  CB    . ASP I  5  396  ? 47.155  95.438  -13.593 1.00 60.11  ? 396  ASP C CB    1 
ATOM   8953  C  CG    . ASP I  5  396  ? 48.363  94.471  -13.420 1.00 61.17  ? 396  ASP C CG    1 
ATOM   8954  O  OD1   . ASP I  5  396  ? 48.138  93.312  -12.985 1.00 59.45  ? 396  ASP C OD1   1 
ATOM   8955  O  OD2   . ASP I  5  396  ? 49.520  94.847  -13.713 1.00 61.65  ? 396  ASP C OD2   1 
ATOM   8956  N  N     . GLU I  5  397  ? 48.996  98.275  -15.120 1.00 55.35  ? 397  GLU C N     1 
ATOM   8957  C  CA    . GLU I  5  397  ? 49.525  98.643  -16.430 1.00 53.72  ? 397  GLU C CA    1 
ATOM   8958  C  C     . GLU I  5  397  ? 50.989  98.271  -16.594 1.00 52.88  ? 397  GLU C C     1 
ATOM   8959  O  O     . GLU I  5  397  ? 51.830  99.109  -16.890 1.00 53.00  ? 397  GLU C O     1 
ATOM   8960  C  CB    . GLU I  5  397  ? 49.363  100.143 -16.698 1.00 53.79  ? 397  GLU C CB    1 
ATOM   8961  C  CG    . GLU I  5  397  ? 48.656  100.895 -15.613 1.00 55.58  ? 397  GLU C CG    1 
ATOM   8962  C  CD    . GLU I  5  397  ? 49.612  101.588 -14.668 1.00 55.37  ? 397  GLU C CD    1 
ATOM   8963  O  OE1   . GLU I  5  397  ? 50.121  102.654 -15.051 1.00 54.47  ? 397  GLU C OE1   1 
ATOM   8964  O  OE2   . GLU I  5  397  ? 49.857  101.075 -13.553 1.00 55.91  ? 397  GLU C OE2   1 
ATOM   8965  N  N     . THR I  5  398  ? 51.305  97.006  -16.392 1.00 52.11  ? 398  THR C N     1 
ATOM   8966  C  CA    . THR I  5  398  ? 52.654  96.528  -16.647 1.00 50.61  ? 398  THR C CA    1 
ATOM   8967  C  C     . THR I  5  398  ? 53.003  96.815  -18.099 1.00 49.14  ? 398  THR C C     1 
ATOM   8968  O  O     . THR I  5  398  ? 54.087  97.259  -18.459 1.00 49.25  ? 398  THR C O     1 
ATOM   8969  C  CB    . THR I  5  398  ? 52.672  95.046  -16.343 1.00 51.08  ? 398  THR C CB    1 
ATOM   8970  O  OG1   . THR I  5  398  ? 51.443  94.719  -15.697 1.00 51.53  ? 398  THR C OG1   1 
ATOM   8971  C  CG2   . THR I  5  398  ? 53.815  94.694  -15.389 1.00 50.91  ? 398  THR C CG2   1 
ATOM   8972  N  N     . ASN I  5  399  ? 51.980  96.540  -18.894 1.00 47.22  ? 399  ASN C N     1 
ATOM   8973  C  CA    . ASN I  5  399  ? 51.840  96.757  -20.322 1.00 44.27  ? 399  ASN C CA    1 
ATOM   8974  C  C     . ASN I  5  399  ? 50.364  96.972  -20.604 1.00 42.47  ? 399  ASN C C     1 
ATOM   8975  O  O     . ASN I  5  399  ? 49.562  96.285  -19.988 1.00 42.28  ? 399  ASN C O     1 
ATOM   8976  C  CB    . ASN I  5  399  ? 52.399  95.553  -21.118 1.00 44.28  ? 399  ASN C CB    1 
ATOM   8977  C  CG    . ASN I  5  399  ? 51.827  94.198  -20.669 1.00 44.86  ? 399  ASN C CG    1 
ATOM   8978  O  OD1   . ASN I  5  399  ? 51.135  93.524  -21.429 1.00 44.70  ? 399  ASN C OD1   1 
ATOM   8979  N  ND2   . ASN I  5  399  ? 52.124  93.799  -19.437 1.00 43.88  ? 399  ASN C ND2   1 
ATOM   8980  N  N     . PRO I  5  400  ? 49.976  97.912  -21.492 1.00 41.09  ? 400  PRO C N     1 
ATOM   8981  C  CA    . PRO I  5  400  ? 48.538  98.132  -21.743 1.00 39.58  ? 400  PRO C CA    1 
ATOM   8982  C  C     . PRO I  5  400  ? 47.690  96.833  -21.664 1.00 37.92  ? 400  PRO C C     1 
ATOM   8983  O  O     . PRO I  5  400  ? 46.623  96.847  -21.057 1.00 38.68  ? 400  PRO C O     1 
ATOM   8984  C  CB    . PRO I  5  400  ? 48.534  98.813  -23.103 1.00 39.60  ? 400  PRO C CB    1 
ATOM   8985  C  CG    . PRO I  5  400  ? 49.787  99.638  -23.055 1.00 39.45  ? 400  PRO C CG    1 
ATOM   8986  C  CD    . PRO I  5  400  ? 50.793  98.669  -22.464 1.00 40.39  ? 400  PRO C CD    1 
ATOM   8987  N  N     . LEU I  5  401  ? 48.153  95.729  -22.250 1.00 36.46  ? 401  LEU C N     1 
ATOM   8988  C  CA    . LEU I  5  401  ? 47.420  94.462  -22.172 1.00 36.03  ? 401  LEU C CA    1 
ATOM   8989  C  C     . LEU I  5  401  ? 47.011  94.166  -20.749 1.00 37.23  ? 401  LEU C C     1 
ATOM   8990  O  O     . LEU I  5  401  ? 45.865  93.840  -20.480 1.00 36.81  ? 401  LEU C O     1 
ATOM   8991  C  CB    . LEU I  5  401  ? 48.266  93.274  -22.658 1.00 35.34  ? 401  LEU C CB    1 
ATOM   8992  C  CG    . LEU I  5  401  ? 48.089  91.880  -21.987 1.00 33.86  ? 401  LEU C CG    1 
ATOM   8993  C  CD1   . LEU I  5  401  ? 46.707  91.289  -22.199 1.00 32.63  ? 401  LEU C CD1   1 
ATOM   8994  C  CD2   . LEU I  5  401  ? 49.103  90.964  -22.572 1.00 34.14  ? 401  LEU C CD2   1 
ATOM   8995  N  N     . SER I  5  402  ? 47.975  94.264  -19.842 1.00 39.17  ? 402  SER C N     1 
ATOM   8996  C  CA    . SER I  5  402  ? 47.731  94.010  -18.431 1.00 40.98  ? 402  SER C CA    1 
ATOM   8997  C  C     . SER I  5  402  ? 46.477  94.744  -17.953 1.00 41.78  ? 402  SER C C     1 
ATOM   8998  O  O     . SER I  5  402  ? 45.561  94.113  -17.408 1.00 41.89  ? 402  SER C O     1 
ATOM   8999  C  CB    . SER I  5  402  ? 48.943  94.460  -17.590 1.00 40.65  ? 402  SER C CB    1 
ATOM   9000  O  OG    . SER I  5  402  ? 50.118  93.744  -17.905 1.00 40.23  ? 402  SER C OG    1 
ATOM   9001  N  N     . SER I  5  403  ? 46.440  96.065  -18.179 1.00 43.06  ? 403  SER C N     1 
ATOM   9002  C  CA    . SER I  5  403  ? 45.327  96.935  -17.760 1.00 43.45  ? 403  SER C CA    1 
ATOM   9003  C  C     . SER I  5  403  ? 44.003  96.513  -18.405 1.00 43.73  ? 403  SER C C     1 
ATOM   9004  O  O     . SER I  5  403  ? 42.971  96.390  -17.737 1.00 43.12  ? 403  SER C O     1 
ATOM   9005  C  CB    . SER I  5  403  ? 45.639  98.403  -18.113 1.00 41.93  ? 403  SER C CB    1 
ATOM   9006  O  OG    . SER I  5  403  ? 45.717  98.626  -19.502 1.00 39.40  ? 403  SER C OG    1 
ATOM   9007  N  N     . LEU I  5  404  ? 44.034  96.290  -19.707 1.00 45.37  ? 404  LEU C N     1 
ATOM   9008  C  CA    . LEU I  5  404  ? 42.842  95.863  -20.418 1.00 45.15  ? 404  LEU C CA    1 
ATOM   9009  C  C     . LEU I  5  404  ? 42.221  94.611  -19.747 1.00 45.92  ? 404  LEU C C     1 
ATOM   9010  O  O     . LEU I  5  404  ? 41.009  94.556  -19.552 1.00 46.55  ? 404  LEU C O     1 
ATOM   9011  C  CB    . LEU I  5  404  ? 43.234  95.602  -21.892 1.00 42.78  ? 404  LEU C CB    1 
ATOM   9012  C  CG    . LEU I  5  404  ? 42.318  95.791  -23.124 1.00 41.01  ? 404  LEU C CG    1 
ATOM   9013  C  CD1   . LEU I  5  404  ? 41.297  96.885  -22.932 1.00 39.66  ? 404  LEU C CD1   1 
ATOM   9014  C  CD2   . LEU I  5  404  ? 43.216  96.104  -24.309 1.00 38.92  ? 404  LEU C CD2   1 
ATOM   9015  N  N     . ARG I  5  405  ? 43.055  93.630  -19.379 1.00 46.08  ? 405  AR