data_2O6C
# 
_entry.id   2O6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2O6C         pdb_00002o6c 10.2210/pdb2o6c/pdb 
RCSB  RCSB040742   ?            ?                   
WWPDB D_1000040742 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6D . unspecified 
PDB 2O6E . unspecified 
PDB 2O6F . unspecified 
# 
_pdbx_database_status.entry_id                        2O6C 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Machius, M.'     1 
'Brautigam, C.A.' 2 
'Deka, R.K.'      3 
'Tomchick, D.R.'  4 
'Lumpkins, S.B.'  5 
'Norgard, M.V.'   6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                5944 
_citation.page_last                 5958 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17192261 
_citation.pdbx_database_id_DOI      10.1074/jbc.M610215200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Deka, R.K.'      1 ? 
primary 'Brautigam, C.A.' 2 ? 
primary 'Tomson, F.L.'    3 ? 
primary 'Lumpkins, S.B.'  4 ? 
primary 'Tomchick, D.R.'  5 ? 
primary 'Machius, M.'     6 ? 
primary 'Norgard, M.V.'   7 ? 
# 
_cell.length_a           34.410 
_cell.length_b           66.020 
_cell.length_c           150.992 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2O6C 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2O6C 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '34 kDa membrane antigen' 20724.820 2   ? 'V16G, F17A, S18M, A19G, C20S' ? ? 
2 non-polymer syn 'CHLORIDE ION'            35.453    4   ? ?                              ? ? 
3 non-polymer syn 1,2-ETHANEDIOL            62.068    2   ? ?                              ? ? 
4 non-polymer syn 'SULFATE ION'             96.063    2   ? ?                              ? ? 
5 water       nat water                     18.015    221 ? ?                              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pathogen-specific membrane antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GA(MSE)GSGGGGEHQHGEE(MSE)(MSE)AAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVE(MSE)HPAPGA
QPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKV(MSE)FAP(MSE)NAGDGPHYGANVKFE
EGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MSE n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   GLY n 
1 8   GLY n 
1 9   GLY n 
1 10  GLU n 
1 11  HIS n 
1 12  GLN n 
1 13  HIS n 
1 14  GLY n 
1 15  GLU n 
1 16  GLU n 
1 17  MSE n 
1 18  MSE n 
1 19  ALA n 
1 20  ALA n 
1 21  VAL n 
1 22  PRO n 
1 23  ALA n 
1 24  PRO n 
1 25  ASP n 
1 26  ALA n 
1 27  GLU n 
1 28  GLY n 
1 29  ALA n 
1 30  ALA n 
1 31  GLY n 
1 32  PHE n 
1 33  ASP n 
1 34  GLU n 
1 35  PHE n 
1 36  PRO n 
1 37  ILE n 
1 38  GLY n 
1 39  GLU n 
1 40  ASP n 
1 41  ARG n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  PRO n 
1 46  LEU n 
1 47  HIS n 
1 48  VAL n 
1 49  GLY n 
1 50  GLY n 
1 51  VAL n 
1 52  TYR n 
1 53  PHE n 
1 54  GLN n 
1 55  PRO n 
1 56  VAL n 
1 57  GLU n 
1 58  MSE n 
1 59  HIS n 
1 60  PRO n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  GLN n 
1 66  PRO n 
1 67  SER n 
1 68  LYS n 
1 69  GLU n 
1 70  GLU n 
1 71  ALA n 
1 72  ASP n 
1 73  CYS n 
1 74  HIS n 
1 75  ILE n 
1 76  GLU n 
1 77  ALA n 
1 78  ASP n 
1 79  ILE n 
1 80  HIS n 
1 81  ALA n 
1 82  ASN n 
1 83  GLU n 
1 84  ALA n 
1 85  GLY n 
1 86  LYS n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  TYR n 
1 91  GLY n 
1 92  VAL n 
1 93  GLY n 
1 94  ASP n 
1 95  PHE n 
1 96  VAL n 
1 97  PRO n 
1 98  TYR n 
1 99  LEU n 
1 100 ARG n 
1 101 VAL n 
1 102 VAL n 
1 103 ALA n 
1 104 PHE n 
1 105 LEU n 
1 106 GLN n 
1 107 LYS n 
1 108 HIS n 
1 109 GLY n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 GLN n 
1 115 LYS n 
1 116 VAL n 
1 117 MSE n 
1 118 PHE n 
1 119 ALA n 
1 120 PRO n 
1 121 MSE n 
1 122 ASN n 
1 123 ALA n 
1 124 GLY n 
1 125 ASP n 
1 126 GLY n 
1 127 PRO n 
1 128 HIS n 
1 129 TYR n 
1 130 GLY n 
1 131 ALA n 
1 132 ASN n 
1 133 VAL n 
1 134 LYS n 
1 135 PHE n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
1 141 THR n 
1 142 TYR n 
1 143 LYS n 
1 144 VAL n 
1 145 ARG n 
1 146 PHE n 
1 147 GLU n 
1 148 ILE n 
1 149 ALA n 
1 150 ALA n 
1 151 PRO n 
1 152 SER n 
1 153 HIS n 
1 154 ASP n 
1 155 GLU n 
1 156 TYR n 
1 157 SER n 
1 158 LEU n 
1 159 HIS n 
1 160 ILE n 
1 161 ASP n 
1 162 GLU n 
1 163 GLN n 
1 164 THR n 
1 165 GLY n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 ARG n 
1 170 PHE n 
1 171 TRP n 
1 172 SER n 
1 173 GLU n 
1 174 PRO n 
1 175 LEU n 
1 176 VAL n 
1 177 ALA n 
1 178 GLU n 
1 179 TRP n 
1 180 ASP n 
1 181 ASP n 
1 182 PHE n 
1 183 GLU n 
1 184 TRP n 
1 185 LYS n 
1 186 GLY n 
1 187 PRO n 
1 188 GLN n 
1 189 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Treponema 
_entity_src_gen.pdbx_gene_src_gene                 tpd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Treponema pallidum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     160 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XL1-Blue 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pProExHTa 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TA34_TREPA 
_struct_ref.pdbx_db_accession          P19478 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VFSACGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O6C A 1 ? 189 ? P19478 16 ? 204 ? -3 185 
2 1 2O6C B 1 ? 189 ? P19478 16 ? 204 ? -3 185 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O6C GLY A 1   ? UNP P19478 VAL 16  'engineered mutation' -3  1  
1 2O6C ALA A 2   ? UNP P19478 PHE 17  'engineered mutation' -2  2  
1 2O6C MSE A 3   ? UNP P19478 SER 18  'engineered mutation' -1  3  
1 2O6C GLY A 4   ? UNP P19478 ALA 19  'engineered mutation' 0   4  
1 2O6C SER A 5   ? UNP P19478 CYS 20  'engineered mutation' 1   5  
1 2O6C MSE A 17  ? UNP P19478 MET 32  'modified residue'    13  6  
1 2O6C MSE A 18  ? UNP P19478 MET 33  'modified residue'    14  7  
1 2O6C MSE A 58  ? UNP P19478 MET 73  'modified residue'    54  8  
1 2O6C MSE A 117 ? UNP P19478 MET 132 'modified residue'    113 9  
1 2O6C MSE A 121 ? UNP P19478 MET 136 'modified residue'    117 10 
2 2O6C GLY B 1   ? UNP P19478 VAL 16  'engineered mutation' -3  11 
2 2O6C ALA B 2   ? UNP P19478 PHE 17  'engineered mutation' -2  12 
2 2O6C MSE B 3   ? UNP P19478 SER 18  'engineered mutation' -1  13 
2 2O6C GLY B 4   ? UNP P19478 ALA 19  'engineered mutation' 0   14 
2 2O6C SER B 5   ? UNP P19478 CYS 20  'engineered mutation' 1   15 
2 2O6C MSE B 17  ? UNP P19478 MET 32  'modified residue'    13  16 
2 2O6C MSE B 18  ? UNP P19478 MET 33  'modified residue'    14  17 
2 2O6C MSE B 58  ? UNP P19478 MET 73  'modified residue'    54  18 
2 2O6C MSE B 117 ? UNP P19478 MET 132 'modified residue'    113 19 
2 2O6C MSE B 121 ? UNP P19478 MET 136 'modified residue'    117 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL   'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE        ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ?                 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'    ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE        ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O6C 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   40.51 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '2.4 M Ammonium sulfate, 0.1 M Bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2004-02-22 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double-crystal Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97943 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97943 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
# 
_reflns.entry_id                     2O6C 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             23.53 
_reflns.number_all                   38808 
_reflns.number_obs                   38808 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.076 
_reflns.pdbx_netI_over_sigmaI        39.8 
_reflns.B_iso_Wilson_estimate        23.9 
_reflns.pdbx_redundancy              14.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   93.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_Rsym_value        0.782 
_reflns_shell.pdbx_redundancy        7.9 
_reflns_shell.number_unique_all      3284 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O6C 
_refine.ls_d_res_high                            1.700 
_refine.ls_d_res_low                             23.530 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.490 
_refine.ls_number_reflns_obs                     38740 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.187 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.215 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  3863 
_refine.B_iso_mean                               26.414 
_refine.aniso_B[1][1]                            1.090 
_refine.aniso_B[2][2]                            -1.070 
_refine.aniso_B[3][3]                            -0.010 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.947 
_refine.pdbx_overall_ESU_R                       0.111 
_refine.pdbx_overall_ESU_R_Free                  0.107 
_refine.overall_SU_ML                            0.069 
_refine.overall_SU_B                             4.089 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2O6C 
_refine_analyze.Luzzati_coordinate_error_obs    .233 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2485 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             221 
_refine_hist.number_atoms_total               2728 
_refine_hist.d_res_high                       1.700 
_refine_hist.d_res_low                        23.530 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2632 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3583 2.011  1.934  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   323  5.091  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   139  33.928 24.820 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   381  14.500 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   8    20.402 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           342  0.139  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2445 0.014  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1110 0.189  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1717 0.319  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    183  0.138  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   31   0.167  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 8    0.134  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1622 1.302  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2555 1.788  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1153 2.791  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1028 4.416  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.7 
_refine_ls_shell.d_res_low                        1.743 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               93.670 
_refine_ls_shell.number_reflns_R_work             2344 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.305 
_refine_ls_shell.R_factor_R_free                  0.337 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             275 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2619 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O6C 
_struct.title                     'Structure of selenomethionyl rTp34 from Treponema pallidum' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O6C 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN, PROTEIN BINDING' 
_struct_keywords.text            'Ig-fold, syphilis, metal-ion binding, dimer, MEMBRANE PROTEIN, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 2 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 83  ? GLY A 89  ? GLU A 79  GLY A 85  5 ? 7 
HELX_P HELX_P2 2 SER A 152 ? TYR A 156 ? SER A 148 TYR A 152 5 ? 5 
HELX_P HELX_P3 3 GLU B 83  ? GLY B 89  ? GLU B 79  GLY B 85  5 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A GLU 57  C ? ? ? 1_555 A MSE 58  N ? ? A GLU 53  A MSE 54  1_555 ? ? ? ? ? ? ? 1.330 ? ? 
covale2  covale both ? A MSE 58  C ? ? ? 1_555 A HIS 59  N ? ? A MSE 54  A HIS 55  1_555 ? ? ? ? ? ? ? 1.331 ? ? 
covale3  covale both ? A VAL 116 C ? ? ? 1_555 A MSE 117 N ? ? A VAL 112 A MSE 113 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale4  covale both ? A MSE 117 C ? ? ? 1_555 A PHE 118 N ? ? A MSE 113 A PHE 114 1_555 ? ? ? ? ? ? ? 1.327 ? ? 
covale5  covale both ? A PRO 120 C ? ? ? 1_555 A MSE 121 N ? ? A PRO 116 A MSE 117 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale6  covale both ? A MSE 121 C ? ? ? 1_555 A ASN 122 N ? ? A MSE 117 A ASN 118 1_555 ? ? ? ? ? ? ? 1.329 ? ? 
covale7  covale both ? B GLU 57  C ? ? ? 1_555 B MSE 58  N ? ? B GLU 53  B MSE 54  1_555 ? ? ? ? ? ? ? 1.326 ? ? 
covale8  covale both ? B MSE 58  C ? ? ? 1_555 B HIS 59  N ? ? B MSE 54  B HIS 55  1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale9  covale both ? B VAL 116 C ? ? ? 1_555 B MSE 117 N ? ? B VAL 112 B MSE 113 1_555 ? ? ? ? ? ? ? 1.321 ? ? 
covale10 covale both ? B MSE 117 C ? ? ? 1_555 B PHE 118 N B ? B MSE 113 B PHE 114 1_555 ? ? ? ? ? ? ? 1.324 ? ? 
covale11 covale both ? B MSE 117 C ? ? ? 1_555 B PHE 118 N A ? B MSE 113 B PHE 114 1_555 ? ? ? ? ? ? ? 1.328 ? ? 
covale12 covale both ? B PRO 120 C ? ? ? 1_555 B MSE 121 N ? ? B PRO 116 B MSE 117 1_555 ? ? ? ? ? ? ? 1.333 ? ? 
covale13 covale both ? B MSE 121 C ? ? ? 1_555 B ASN 122 N ? ? B MSE 117 B ASN 118 1_555 ? ? ? ? ? ? ? 1.337 ? ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 59 A . ? HIS 55 A PRO 60 A ? PRO 56 A 1 -12.99 
2 HIS 59 B . ? HIS 55 B PRO 60 B ? PRO 56 B 1 -11.76 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 7 ? 
C ? 4 ? 
D ? 3 ? 
E ? 7 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
A 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
A 3 ARG A 41  ? VAL A 43  ? ARG A 37  VAL A 39  
B 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
B 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
B 3 CYS A 73  ? ALA A 81  ? CYS A 69  ALA A 77  
B 4 GLY A 126 ? VAL A 133 ? GLY A 122 VAL A 129 
B 5 ALA A 119 ? ALA A 123 ? ALA A 115 ALA A 119 
B 6 SER B 157 ? HIS B 159 ? SER B 153 HIS B 155 
B 7 MSE A 58  ? HIS A 59  ? MSE A 54  HIS A 55  
C 1 GLN A 114 ? MSE A 117 ? GLN A 110 MSE A 113 
C 2 ARG A 100 ? LYS A 107 ? ARG A 96  LYS A 103 
C 3 GLY A 140 ? ALA A 149 ? GLY A 136 ALA A 145 
C 4 LEU A 175 ? TRP A 184 ? LEU A 171 TRP A 180 
D 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
D 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
D 3 ARG B 41  ? VAL B 43  ? ARG B 37  VAL B 39  
E 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
E 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
E 3 CYS B 73  ? ALA B 81  ? CYS B 69  ALA B 77  
E 4 GLY B 126 ? VAL B 133 ? GLY B 122 VAL B 129 
E 5 ALA B 119 ? ALA B 123 ? ALA B 115 ALA B 119 
E 6 SER A 157 ? HIS A 159 ? SER A 153 HIS A 155 
E 7 MSE B 58  ? HIS B 59  ? MSE B 54  HIS B 55  
F 1 GLN B 114 ? MSE B 117 ? GLN B 110 MSE B 113 
F 2 ARG B 100 ? LYS B 107 ? ARG B 96  LYS B 103 
F 3 GLY B 140 ? ALA B 149 ? GLY B 136 ALA B 145 
F 4 LEU B 175 ? TRP B 184 ? LEU B 171 TRP B 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
A 2 3 O VAL A 48  ? O VAL A 44  N ARG A 41  ? N ARG A 37  
B 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
B 2 3 N HIS A 47  ? N HIS A 43  O HIS A 80  ? O HIS A 76  
B 3 4 N ALA A 77  ? N ALA A 73  O TYR A 129 ? O TYR A 125 
B 4 5 O GLY A 130 ? O GLY A 126 N ALA A 119 ? N ALA A 115 
B 5 6 N ASN A 122 ? N ASN A 118 O HIS B 159 ? O HIS B 155 
B 6 7 O LEU B 158 ? O LEU B 154 N HIS A 59  ? N HIS A 55  
C 1 2 O VAL A 116 ? O VAL A 112 N ALA A 103 ? N ALA A 99  
C 2 3 N ARG A 100 ? N ARG A 96  O ALA A 149 ? O ALA A 145 
C 3 4 N PHE A 146 ? N PHE A 142 O ALA A 177 ? O ALA A 173 
D 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
D 2 3 O VAL B 48  ? O VAL B 44  N ARG B 41  ? N ARG B 37  
E 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
E 2 3 N HIS B 47  ? N HIS B 43  O HIS B 80  ? O HIS B 76  
E 3 4 N CYS B 73  ? N CYS B 69  O VAL B 133 ? O VAL B 129 
E 4 5 O GLY B 130 ? O GLY B 126 N ALA B 119 ? N ALA B 115 
E 5 6 O ASN B 122 ? O ASN B 118 N HIS A 159 ? N HIS A 155 
E 6 7 N LEU A 158 ? N LEU A 154 O HIS B 59  ? O HIS B 55  
F 1 2 O VAL B 116 ? O VAL B 112 N ALA B 103 ? N ALA B 99  
F 2 3 N VAL B 102 ? N VAL B 98  O GLU B 147 ? O GLU B 143 
F 3 4 N TYR B 142 ? N TYR B 138 O PHE B 182 ? O PHE B 178 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B SO4 501 ? 7 'BINDING SITE FOR RESIDUE SO4 B 501' 
AC2 Software B SO4 502 ? 5 'BINDING SITE FOR RESIDUE SO4 B 502' 
AC3 Software A CL  301 ? 1 'BINDING SITE FOR RESIDUE CL A 301'  
AC4 Software A CL  302 ? 1 'BINDING SITE FOR RESIDUE CL A 302'  
AC5 Software A CL  304 ? 1 'BINDING SITE FOR RESIDUE CL A 304'  
AC6 Software A EDO 401 ? 8 'BINDING SITE FOR RESIDUE EDO A 401' 
AC7 Software A EDO 403 ? 6 'BINDING SITE FOR RESIDUE EDO A 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 ARG A 169 ? ARG A 165 . ? 3_545 ? 
2  AC1 7 TRP A 171 ? TRP A 167 . ? 3_545 ? 
3  AC1 7 SER A 172 ? SER A 168 . ? 3_545 ? 
4  AC1 7 GLU A 173 ? GLU A 169 . ? 3_545 ? 
5  AC1 7 HOH K .   ? HOH A 450 . ? 3_545 ? 
6  AC1 7 HOH L .   ? HOH B 514 . ? 1_555 ? 
7  AC1 7 HOH L .   ? HOH B 552 . ? 1_555 ? 
8  AC2 5 GLY B 38  ? GLY B 34  . ? 1_555 ? 
9  AC2 5 GLU B 39  ? GLU B 35  . ? 1_555 ? 
10 AC2 5 ARG B 41  ? ARG B 37  . ? 1_555 ? 
11 AC2 5 TRP B 179 ? TRP B 175 . ? 1_555 ? 
12 AC2 5 HOH L .   ? HOH B 580 . ? 1_555 ? 
13 AC3 1 HIS A 153 ? HIS A 149 . ? 1_555 ? 
14 AC4 1 ARG A 145 ? ARG A 141 . ? 1_555 ? 
15 AC5 1 HOH K .   ? HOH A 514 . ? 1_555 ? 
16 AC6 8 PHE A 35  ? PHE A 31  . ? 1_555 ? 
17 AC6 8 PRO A 36  ? PRO A 32  . ? 1_555 ? 
18 AC6 8 TYR A 52  ? TYR A 48  . ? 1_555 ? 
19 AC6 8 ASP A 72  ? ASP A 68  . ? 4_466 ? 
20 AC6 8 LYS A 134 ? LYS A 130 . ? 4_466 ? 
21 AC6 8 LYS A 185 ? LYS A 181 . ? 1_555 ? 
22 AC6 8 GLN A 188 ? GLN A 184 . ? 1_555 ? 
23 AC6 8 HOH K .   ? HOH A 408 . ? 4_466 ? 
24 AC7 6 ARG A 41  ? ARG A 37  . ? 1_555 ? 
25 AC7 6 TRP A 179 ? TRP A 175 . ? 1_555 ? 
26 AC7 6 ASP A 180 ? ASP A 176 . ? 1_555 ? 
27 AC7 6 HOH K .   ? HOH A 425 . ? 4_466 ? 
28 AC7 6 HOH K .   ? HOH A 506 . ? 1_555 ? 
29 AC7 6 HOH K .   ? HOH A 533 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2O6C 
_atom_sites.fract_transf_matrix[1][1]   0.029061 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015147 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006623 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 32  ? 8.451   35.017 79.155 1.00 35.63 ? 28  PHE A N   1 
ATOM   2    C  CA  . PHE A 1 32  ? 9.481   36.087 79.218 1.00 34.94 ? 28  PHE A CA  1 
ATOM   3    C  C   . PHE A 1 32  ? 8.888   37.436 78.790 1.00 33.43 ? 28  PHE A C   1 
ATOM   4    O  O   . PHE A 1 32  ? 7.936   37.489 77.970 1.00 34.95 ? 28  PHE A O   1 
ATOM   5    C  CB  . PHE A 1 32  ? 10.710  35.727 78.366 1.00 35.09 ? 28  PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 32  ? 10.386  35.444 76.909 1.00 36.75 ? 28  PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 32  ? 9.853   34.201 76.515 1.00 36.01 ? 28  PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 32  ? 10.642  36.419 75.926 1.00 37.02 ? 28  PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 32  ? 9.568   33.931 75.160 1.00 36.83 ? 28  PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 32  ? 10.361  36.170 74.579 1.00 36.74 ? 28  PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 32  ? 9.827   34.919 74.185 1.00 37.61 ? 28  PHE A CZ  1 
ATOM   12   N  N   . ASP A 1 33  ? 9.457   38.497 79.352 1.00 32.15 ? 29  ASP A N   1 
ATOM   13   C  CA  . ASP A 1 33  ? 9.007   39.881 79.123 1.00 29.00 ? 29  ASP A CA  1 
ATOM   14   C  C   . ASP A 1 33  ? 9.339   40.404 77.757 1.00 27.19 ? 29  ASP A C   1 
ATOM   15   O  O   . ASP A 1 33  ? 10.511  40.461 77.400 1.00 28.43 ? 29  ASP A O   1 
ATOM   16   C  CB  . ASP A 1 33  ? 9.667   40.855 80.114 1.00 28.76 ? 29  ASP A CB  1 
ATOM   17   C  CG  . ASP A 1 33  ? 9.374   40.540 81.583 1.00 29.45 ? 29  ASP A CG  1 
ATOM   18   O  OD1 . ASP A 1 33  ? 8.553   39.644 81.897 1.00 28.72 ? 29  ASP A OD1 1 
ATOM   19   O  OD2 . ASP A 1 33  ? 9.964   41.260 82.411 1.00 32.87 ? 29  ASP A OD2 1 
ATOM   20   N  N   . GLU A 1 34  ? 8.322   40.838 77.022 1.00 23.06 ? 30  GLU A N   1 
ATOM   21   C  CA  . GLU A 1 34  ? 8.532   41.456 75.724 1.00 21.68 ? 30  GLU A CA  1 
ATOM   22   C  C   . GLU A 1 34  ? 8.046   42.907 75.780 1.00 19.75 ? 30  GLU A C   1 
ATOM   23   O  O   . GLU A 1 34  ? 6.989   43.184 76.390 1.00 19.01 ? 30  GLU A O   1 
ATOM   24   C  CB  . GLU A 1 34  ? 7.884   40.673 74.582 1.00 22.96 ? 30  GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 34  ? 6.474   40.304 74.662 1.00 30.29 ? 30  GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 34  ? 6.081   39.463 73.442 1.00 34.71 ? 30  GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 34  ? 6.970   38.824 72.820 1.00 36.83 ? 30  GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 34  ? 4.887   39.469 73.105 1.00 38.26 ? 30  GLU A OE2 1 
ATOM   29   N  N   . PHE A 1 35  ? 8.776   43.794 75.112 1.00 17.60 ? 31  PHE A N   1 
ATOM   30   C  CA  . PHE A 1 35  ? 8.464   45.224 75.087 1.00 16.36 ? 31  PHE A CA  1 
ATOM   31   C  C   . PHE A 1 35  ? 8.127   45.652 73.686 1.00 17.42 ? 31  PHE A C   1 
ATOM   32   O  O   . PHE A 1 35  ? 8.750   45.174 72.730 1.00 17.73 ? 31  PHE A O   1 
ATOM   33   C  CB  . PHE A 1 35  ? 9.701   45.980 75.605 1.00 17.40 ? 31  PHE A CB  1 
ATOM   34   C  CG  . PHE A 1 35  ? 10.020  45.619 77.030 1.00 15.57 ? 31  PHE A CG  1 
ATOM   35   C  CD1 . PHE A 1 35  ? 9.357   46.235 78.075 1.00 16.01 ? 31  PHE A CD1 1 
ATOM   36   C  CD2 . PHE A 1 35  ? 10.880  44.555 77.312 1.00 17.55 ? 31  PHE A CD2 1 
ATOM   37   C  CE1 . PHE A 1 35  ? 9.611   45.824 79.429 1.00 18.70 ? 31  PHE A CE1 1 
ATOM   38   C  CE2 . PHE A 1 35  ? 11.158  44.139 78.658 1.00 15.09 ? 31  PHE A CE2 1 
ATOM   39   C  CZ  . PHE A 1 35  ? 10.502  44.792 79.696 1.00 17.30 ? 31  PHE A CZ  1 
ATOM   40   N  N   . PRO A 1 36  ? 7.139   46.515 73.519 1.00 16.97 ? 32  PRO A N   1 
ATOM   41   C  CA  . PRO A 1 36  ? 6.779   46.862 72.140 1.00 16.84 ? 32  PRO A CA  1 
ATOM   42   C  C   . PRO A 1 36  ? 7.693   47.865 71.449 1.00 17.49 ? 32  PRO A C   1 
ATOM   43   O  O   . PRO A 1 36  ? 8.264   48.730 72.097 1.00 18.57 ? 32  PRO A O   1 
ATOM   44   C  CB  . PRO A 1 36  ? 5.398   47.517 72.279 1.00 17.58 ? 32  PRO A CB  1 
ATOM   45   C  CG  . PRO A 1 36  ? 5.478   48.181 73.664 1.00 15.39 ? 32  PRO A CG  1 
ATOM   46   C  CD  . PRO A 1 36  ? 6.275   47.168 74.521 1.00 17.20 ? 32  PRO A CD  1 
ATOM   47   N  N   . ILE A 1 37  ? 7.823   47.723 70.124 1.00 18.22 ? 33  ILE A N   1 
ATOM   48   C  CA  . ILE A 1 37  ? 8.598   48.669 69.328 1.00 19.01 ? 33  ILE A CA  1 
ATOM   49   C  C   . ILE A 1 37  ? 7.654   49.821 68.940 1.00 19.15 ? 33  ILE A C   1 
ATOM   50   O  O   . ILE A 1 37  ? 8.015   51.004 68.912 1.00 19.49 ? 33  ILE A O   1 
ATOM   51   C  CB  . ILE A 1 37  ? 9.184   48.010 68.040 1.00 18.69 ? 33  ILE A CB  1 
ATOM   52   C  CG1 . ILE A 1 37  ? 10.289  47.045 68.478 1.00 22.92 ? 33  ILE A CG1 1 
ATOM   53   C  CG2 . ILE A 1 37  ? 9.769   49.148 67.147 1.00 19.87 ? 33  ILE A CG2 1 
ATOM   54   C  CD1 . ILE A 1 37  ? 10.997  46.388 67.350 1.00 24.03 ? 33  ILE A CD1 1 
ATOM   55   N  N   . GLY A 1 38  ? 6.396   49.475 68.699 1.00 18.34 ? 34  GLY A N   1 
ATOM   56   C  CA  . GLY A 1 38  ? 5.384   50.433 68.303 1.00 18.31 ? 34  GLY A CA  1 
ATOM   57   C  C   . GLY A 1 38  ? 4.115   49.676 67.976 1.00 17.95 ? 34  GLY A C   1 
ATOM   58   O  O   . GLY A 1 38  ? 4.040   48.453 68.184 1.00 17.32 ? 34  GLY A O   1 
ATOM   59   N  N   . GLU A 1 39  ? 3.129   50.396 67.442 1.00 16.96 ? 35  GLU A N   1 
ATOM   60   C  CA  . GLU A 1 39  ? 1.849   49.815 67.099 1.00 18.41 ? 35  GLU A CA  1 
ATOM   61   C  C   . GLU A 1 39  ? 1.936   48.750 66.007 1.00 18.26 ? 35  GLU A C   1 
ATOM   62   O  O   . GLU A 1 39  ? 2.692   48.903 65.035 1.00 17.24 ? 35  GLU A O   1 
ATOM   63   C  CB  . GLU A 1 39  ? 0.932   50.943 66.629 1.00 18.86 ? 35  GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 39  ? -0.480  50.504 66.501 1.00 22.66 ? 35  GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 39  ? -1.443  51.647 66.268 1.00 26.05 ? 35  GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 39  ? -1.022  52.760 65.848 1.00 26.24 ? 35  GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 39  ? -2.635  51.416 66.533 1.00 27.76 ? 35  GLU A OE2 1 
ATOM   68   N  N   . ASP A 1 40  ? 1.160   47.662 66.141 1.00 18.18 ? 36  ASP A N   1 
ATOM   69   C  CA  . ASP A 1 40  ? 1.207   46.615 65.113 1.00 19.23 ? 36  ASP A CA  1 
ATOM   70   C  C   . ASP A 1 40  ? 0.763   47.220 63.795 1.00 18.30 ? 36  ASP A C   1 
ATOM   71   O  O   . ASP A 1 40  ? -0.078  48.153 63.769 1.00 17.82 ? 36  ASP A O   1 
ATOM   72   C  CB  . ASP A 1 40  ? 0.241   45.471 65.399 1.00 20.14 ? 36  ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 40  ? 0.691   44.568 66.527 1.00 25.06 ? 36  ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 40  ? 1.707   44.838 67.188 1.00 25.71 ? 36  ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 40  ? -0.026  43.549 66.745 1.00 33.89 ? 36  ASP A OD2 1 
ATOM   76   N  N   . ARG A 1 41  ? 1.292   46.693 62.700 1.00 17.83 ? 37  ARG A N   1 
ATOM   77   C  CA  . ARG A 1 41  ? 0.925   47.183 61.359 1.00 18.85 ? 37  ARG A CA  1 
ATOM   78   C  C   . ARG A 1 41  ? 0.255   46.111 60.507 1.00 19.49 ? 37  ARG A C   1 
ATOM   79   O  O   . ARG A 1 41  ? 0.525   44.940 60.694 1.00 20.87 ? 37  ARG A O   1 
ATOM   80   C  CB  . ARG A 1 41  ? 2.213   47.594 60.589 1.00 17.73 ? 37  ARG A CB  1 
ATOM   81   C  CG  . ARG A 1 41  ? 3.133   48.612 61.264 1.00 21.76 ? 37  ARG A CG  1 
ATOM   82   C  CD  . ARG A 1 41  ? 2.412   49.929 61.487 1.00 18.75 ? 37  ARG A CD  1 
ATOM   83   N  NE  . ARG A 1 41  ? 3.362   50.978 61.915 1.00 20.49 ? 37  ARG A NE  1 
ATOM   84   C  CZ  . ARG A 1 41  ? 3.005   52.017 62.674 1.00 18.67 ? 37  ARG A CZ  1 
ATOM   85   N  NH1 . ARG A 1 41  ? 1.711   52.138 63.108 1.00 20.08 ? 37  ARG A NH1 1 
ATOM   86   N  NH2 . ARG A 1 41  ? 3.899   52.937 62.991 1.00 19.97 ? 37  ARG A NH2 1 
ATOM   87   N  N   . ASP A 1 42  ? -0.575  46.526 59.547 1.00 19.78 ? 38  ASP A N   1 
ATOM   88   C  CA  . ASP A 1 42  ? -1.131  45.595 58.563 1.00 21.05 ? 38  ASP A CA  1 
ATOM   89   C  C   . ASP A 1 42  ? -0.591  46.186 57.270 1.00 22.01 ? 38  ASP A C   1 
ATOM   90   O  O   . ASP A 1 42  ? -0.853  47.353 56.956 1.00 21.40 ? 38  ASP A O   1 
ATOM   91   C  CB  . ASP A 1 42  ? -2.656  45.520 58.567 1.00 22.80 ? 38  ASP A CB  1 
ATOM   92   C  CG  . ASP A 1 42  ? -3.187  44.424 59.486 1.00 27.91 ? 38  ASP A CG  1 
ATOM   93   O  OD1 . ASP A 1 42  ? -2.949  43.207 59.233 1.00 27.48 ? 38  ASP A OD1 1 
ATOM   94   O  OD2 . ASP A 1 42  ? -3.904  44.791 60.446 1.00 38.00 ? 38  ASP A OD2 1 
ATOM   95   N  N   . VAL A 1 43  ? 0.171   45.376 56.533 1.00 20.85 ? 39  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 43  ? 0.798   45.756 55.264 1.00 21.74 ? 39  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 43  ? 0.620   44.613 54.261 1.00 20.53 ? 39  VAL A C   1 
ATOM   98   O  O   . VAL A 1 43  ? 1.069   43.467 54.477 1.00 19.91 ? 39  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 43  ? 2.287   46.222 55.467 1.00 21.96 ? 39  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 43  ? 3.177   45.099 56.039 1.00 20.80 ? 39  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 43  ? 2.866   46.749 54.168 1.00 23.36 ? 39  VAL A CG2 1 
ATOM   102  N  N   . GLY A 1 44  ? -0.098  44.893 53.166 1.00 20.95 ? 40  GLY A N   1 
ATOM   103  C  CA  . GLY A 1 44  ? -0.366  43.829 52.192 1.00 20.74 ? 40  GLY A CA  1 
ATOM   104  C  C   . GLY A 1 44  ? -1.101  42.691 52.911 1.00 19.62 ? 40  GLY A C   1 
ATOM   105  O  O   . GLY A 1 44  ? -2.034  42.958 53.706 1.00 20.70 ? 40  GLY A O   1 
ATOM   106  N  N   . PRO A 1 45  ? -0.693  41.425 52.676 1.00 20.20 ? 41  PRO A N   1 
ATOM   107  C  CA  . PRO A 1 45  ? -1.316  40.291 53.331 1.00 19.27 ? 41  PRO A CA  1 
ATOM   108  C  C   . PRO A 1 45  ? -0.706  39.952 54.693 1.00 19.05 ? 41  PRO A C   1 
ATOM   109  O  O   . PRO A 1 45  ? -0.953  38.856 55.190 1.00 20.09 ? 41  PRO A O   1 
ATOM   110  C  CB  . PRO A 1 45  ? -0.973  39.122 52.376 1.00 19.96 ? 41  PRO A CB  1 
ATOM   111  C  CG  . PRO A 1 45  ? 0.399   39.472 51.875 1.00 19.75 ? 41  PRO A CG  1 
ATOM   112  C  CD  . PRO A 1 45  ? 0.384   40.986 51.744 1.00 20.54 ? 41  PRO A CD  1 
ATOM   113  N  N   . LEU A 1 46  ? 0.098   40.864 55.263 1.00 18.14 ? 42  LEU A N   1 
ATOM   114  C  CA  . LEU A 1 46  ? 0.778   40.566 56.527 1.00 16.90 ? 42  LEU A CA  1 
ATOM   115  C  C   . LEU A 1 46  ? 0.361   41.416 57.695 1.00 16.92 ? 42  LEU A C   1 
ATOM   116  O  O   . LEU A 1 46  ? 0.224   42.627 57.536 1.00 18.20 ? 42  LEU A O   1 
ATOM   117  C  CB  . LEU A 1 46  ? 2.290   40.814 56.345 1.00 16.91 ? 42  LEU A CB  1 
ATOM   118  C  CG  . LEU A 1 46  ? 2.963   40.051 55.182 1.00 18.78 ? 42  LEU A CG  1 
ATOM   119  C  CD1 . LEU A 1 46  ? 4.479   40.300 55.192 1.00 19.05 ? 42  LEU A CD1 1 
ATOM   120  C  CD2 . LEU A 1 46  ? 2.622   38.512 55.168 1.00 17.64 ? 42  LEU A CD2 1 
ATOM   121  N  N   . HIS A 1 47  ? 0.266   40.782 58.869 1.00 16.89 ? 43  HIS A N   1 
ATOM   122  C  CA  . HIS A 1 47  ? 0.024   41.510 60.112 1.00 17.51 ? 43  HIS A CA  1 
ATOM   123  C  C   . HIS A 1 47  ? 1.419   41.460 60.724 1.00 18.00 ? 43  HIS A C   1 
ATOM   124  O  O   . HIS A 1 47  ? 1.968   40.368 60.925 1.00 16.93 ? 43  HIS A O   1 
ATOM   125  C  CB  . HIS A 1 47  ? -0.966  40.793 61.019 1.00 19.19 ? 43  HIS A CB  1 
ATOM   126  C  CG  . HIS A 1 47  ? -1.182  41.539 62.298 1.00 21.03 ? 43  HIS A CG  1 
ATOM   127  N  ND1 . HIS A 1 47  ? -1.994  42.653 62.368 1.00 23.88 ? 43  HIS A ND1 1 
ATOM   128  C  CD2 . HIS A 1 47  ? -0.630  41.390 63.522 1.00 22.00 ? 43  HIS A CD2 1 
ATOM   129  C  CE1 . HIS A 1 47  ? -1.958  43.139 63.597 1.00 24.55 ? 43  HIS A CE1 1 
ATOM   130  N  NE2 . HIS A 1 47  ? -1.163  42.379 64.322 1.00 24.24 ? 43  HIS A NE2 1 
ATOM   131  N  N   . VAL A 1 48  ? 2.007   42.626 61.016 1.00 16.78 ? 44  VAL A N   1 
ATOM   132  C  CA  . VAL A 1 48  ? 3.385   42.654 61.540 1.00 17.16 ? 44  VAL A CA  1 
ATOM   133  C  C   . VAL A 1 48  ? 3.484   43.362 62.867 1.00 17.63 ? 44  VAL A C   1 
ATOM   134  O  O   . VAL A 1 48  ? 2.975   44.478 62.997 1.00 19.63 ? 44  VAL A O   1 
ATOM   135  C  CB  . VAL A 1 48  ? 4.297   43.425 60.560 1.00 17.36 ? 44  VAL A CB  1 
ATOM   136  C  CG1 . VAL A 1 48  ? 5.790   43.443 61.009 1.00 18.94 ? 44  VAL A CG1 1 
ATOM   137  C  CG2 . VAL A 1 48  ? 4.205   42.819 59.122 1.00 18.66 ? 44  VAL A CG2 1 
ATOM   138  N  N   . GLY A 1 49  ? 4.085   42.696 63.836 1.00 18.54 ? 45  GLY A N   1 
ATOM   139  C  CA  . GLY A 1 49  ? 4.293   43.255 65.156 1.00 19.19 ? 45  GLY A CA  1 
ATOM   140  C  C   . GLY A 1 49  ? 5.811   43.338 65.343 1.00 19.25 ? 45  GLY A C   1 
ATOM   141  O  O   . GLY A 1 49  ? 6.582   42.582 64.734 1.00 19.66 ? 45  GLY A O   1 
ATOM   142  N  N   . GLY A 1 50  ? 6.253   44.269 66.190 1.00 18.47 ? 46  GLY A N   1 
ATOM   143  C  CA  . GLY A 1 50  ? 7.662   44.424 66.471 1.00 19.26 ? 46  GLY A CA  1 
ATOM   144  C  C   . GLY A 1 50  ? 7.777   44.513 67.999 1.00 18.67 ? 46  GLY A C   1 
ATOM   145  O  O   . GLY A 1 50  ? 7.032   45.251 68.667 1.00 17.70 ? 46  GLY A O   1 
ATOM   146  N  N   . VAL A 1 51  ? 8.670   43.687 68.539 1.00 18.10 ? 47  VAL A N   1 
ATOM   147  C  CA  . VAL A 1 51  ? 8.964   43.687 69.978 1.00 17.34 ? 47  VAL A CA  1 
ATOM   148  C  C   . VAL A 1 51  ? 10.459  43.560 70.167 1.00 16.69 ? 47  VAL A C   1 
ATOM   149  O  O   . VAL A 1 51  ? 11.209  43.163 69.250 1.00 17.12 ? 47  VAL A O   1 
ATOM   150  C  CB  . VAL A 1 51  ? 8.275   42.540 70.784 1.00 17.73 ? 47  VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1 51  ? 6.726   42.654 70.755 1.00 19.30 ? 47  VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1 51  ? 8.745   41.173 70.292 1.00 19.41 ? 47  VAL A CG2 1 
ATOM   153  N  N   . TYR A 1 52  ? 10.894  43.901 71.387 1.00 16.67 ? 48  TYR A N   1 
ATOM   154  C  CA  . TYR A 1 52  ? 12.308  43.744 71.736 1.00 16.14 ? 48  TYR A CA  1 
ATOM   155  C  C   . TYR A 1 52  ? 12.337  43.256 73.200 1.00 17.04 ? 48  TYR A C   1 
ATOM   156  O  O   . TYR A 1 52  ? 11.383  43.440 73.972 1.00 18.23 ? 48  TYR A O   1 
ATOM   157  C  CB  . TYR A 1 52  ? 13.093  45.027 71.528 1.00 17.53 ? 48  TYR A CB  1 
ATOM   158  C  CG  . TYR A 1 52  ? 12.851  46.107 72.555 1.00 16.34 ? 48  TYR A CG  1 
ATOM   159  C  CD1 . TYR A 1 52  ? 11.691  46.888 72.529 1.00 17.25 ? 48  TYR A CD1 1 
ATOM   160  C  CD2 . TYR A 1 52  ? 13.839  46.367 73.539 1.00 18.70 ? 48  TYR A CD2 1 
ATOM   161  C  CE1 . TYR A 1 52  ? 11.488  47.900 73.441 1.00 18.36 ? 48  TYR A CE1 1 
ATOM   162  C  CE2 . TYR A 1 52  ? 13.644  47.364 74.500 1.00 19.25 ? 48  TYR A CE2 1 
ATOM   163  C  CZ  . TYR A 1 52  ? 12.474  48.140 74.419 1.00 17.12 ? 48  TYR A CZ  1 
ATOM   164  O  OH  . TYR A 1 52  ? 12.383  49.082 75.370 1.00 22.27 ? 48  TYR A OH  1 
ATOM   165  N  N   . PHE A 1 53  ? 13.422  42.600 73.547 1.00 17.38 ? 49  PHE A N   1 
ATOM   166  C  CA  . PHE A 1 53  ? 13.620  42.071 74.884 1.00 16.63 ? 49  PHE A CA  1 
ATOM   167  C  C   . PHE A 1 53  ? 15.076  41.735 75.047 1.00 16.87 ? 49  PHE A C   1 
ATOM   168  O  O   . PHE A 1 53  ? 15.924  42.117 74.212 1.00 17.22 ? 49  PHE A O   1 
ATOM   169  C  CB  . PHE A 1 53  ? 12.702  40.863 75.179 1.00 17.13 ? 49  PHE A CB  1 
ATOM   170  C  CG  . PHE A 1 53  ? 12.644  39.848 74.086 1.00 19.36 ? 49  PHE A CG  1 
ATOM   171  C  CD1 . PHE A 1 53  ? 13.636  38.862 73.961 1.00 18.85 ? 49  PHE A CD1 1 
ATOM   172  C  CD2 . PHE A 1 53  ? 11.602  39.851 73.136 1.00 21.54 ? 49  PHE A CD2 1 
ATOM   173  C  CE1 . PHE A 1 53  ? 13.564  37.898 72.921 1.00 24.09 ? 49  PHE A CE1 1 
ATOM   174  C  CE2 . PHE A 1 53  ? 11.534  38.899 72.101 1.00 21.25 ? 49  PHE A CE2 1 
ATOM   175  C  CZ  . PHE A 1 53  ? 12.512  37.915 71.994 1.00 24.58 ? 49  PHE A CZ  1 
ATOM   176  N  N   . GLN A 1 54  ? 15.415  41.160 76.202 1.00 16.49 ? 50  GLN A N   1 
ATOM   177  C  CA  . GLN A 1 54  ? 16.821  40.872 76.461 1.00 18.16 ? 50  GLN A CA  1 
ATOM   178  C  C   . GLN A 1 54  ? 17.495  40.026 75.355 1.00 17.00 ? 50  GLN A C   1 
ATOM   179  O  O   . GLN A 1 54  ? 16.845  39.195 74.714 1.00 17.12 ? 50  GLN A O   1 
ATOM   180  C  CB  . GLN A 1 54  ? 16.993  40.204 77.842 1.00 19.67 ? 50  GLN A CB  1 
ATOM   181  C  CG  . GLN A 1 54  ? 16.191  38.939 77.961 1.00 22.55 ? 50  GLN A CG  1 
ATOM   182  C  CD  . GLN A 1 54  ? 16.326  38.345 79.356 1.00 32.78 ? 50  GLN A CD  1 
ATOM   183  O  OE1 . GLN A 1 54  ? 15.918  38.962 80.355 1.00 38.07 ? 50  GLN A OE1 1 
ATOM   184  N  NE2 . GLN A 1 54  ? 16.926  37.169 79.439 1.00 34.93 ? 50  GLN A NE2 1 
ATOM   185  N  N   . PRO A 1 55  ? 18.803  40.238 75.153 1.00 18.85 ? 51  PRO A N   1 
ATOM   186  C  CA  . PRO A 1 55  ? 19.483  39.378 74.151 1.00 18.51 ? 51  PRO A CA  1 
ATOM   187  C  C   . PRO A 1 55  ? 19.330  37.907 74.471 1.00 18.43 ? 51  PRO A C   1 
ATOM   188  O  O   . PRO A 1 55  ? 19.287  37.504 75.644 1.00 19.10 ? 51  PRO A O   1 
ATOM   189  C  CB  . PRO A 1 55  ? 20.953  39.819 74.245 1.00 18.99 ? 51  PRO A CB  1 
ATOM   190  C  CG  . PRO A 1 55  ? 20.882  41.176 74.827 1.00 20.66 ? 51  PRO A CG  1 
ATOM   191  C  CD  . PRO A 1 55  ? 19.722  41.224 75.748 1.00 19.65 ? 51  PRO A CD  1 
ATOM   192  N  N   . VAL A 1 56  ? 19.301  37.095 73.427 1.00 19.08 ? 52  VAL A N   1 
ATOM   193  C  CA  . VAL A 1 56  ? 19.140  35.666 73.611 1.00 19.98 ? 52  VAL A CA  1 
ATOM   194  C  C   . VAL A 1 56  ? 20.338  34.862 73.098 1.00 20.71 ? 52  VAL A C   1 
ATOM   195  O  O   . VAL A 1 56  ? 21.220  35.387 72.404 1.00 19.89 ? 52  VAL A O   1 
ATOM   196  C  CB  . VAL A 1 56  ? 17.870  35.166 72.934 1.00 21.16 ? 52  VAL A CB  1 
ATOM   197  C  CG1 . VAL A 1 56  ? 16.641  35.982 73.384 1.00 24.52 ? 52  VAL A CG1 1 
ATOM   198  C  CG2 . VAL A 1 56  ? 18.017  35.245 71.448 1.00 21.19 ? 52  VAL A CG2 1 
ATOM   199  N  N   . GLU A 1 57  ? 20.343  33.584 73.416 1.00 20.26 ? 53  GLU A N   1 
ATOM   200  C  CA  . GLU A 1 57  ? 21.431  32.699 72.954 1.00 21.01 ? 53  GLU A CA  1 
ATOM   201  C  C   . GLU A 1 57  ? 20.758  31.807 71.942 1.00 21.97 ? 53  GLU A C   1 
ATOM   202  O  O   . GLU A 1 57  ? 19.789  31.106 72.276 1.00 22.45 ? 53  GLU A O   1 
ATOM   203  C  CB  . GLU A 1 57  ? 21.952  31.836 74.099 1.00 21.42 ? 53  GLU A CB  1 
ATOM   204  C  CG  . GLU A 1 57  ? 22.937  30.808 73.589 1.00 26.41 ? 53  GLU A CG  1 
ATOM   205  C  CD  . GLU A 1 57  ? 23.733  30.135 74.690 1.00 33.07 ? 53  GLU A CD  1 
ATOM   206  O  OE1 . GLU A 1 57  ? 23.306  30.161 75.875 1.00 35.69 ? 53  GLU A OE1 1 
ATOM   207  O  OE2 . GLU A 1 57  ? 24.793  29.565 74.350 1.00 35.95 ? 53  GLU A OE2 1 
HETATM 208  N  N   . MSE A 1 58  ? 21.232  31.869 70.701 1.00 22.05 ? 54  MSE A N   1 
HETATM 209  C  CA  . MSE A 1 58  ? 20.609  31.083 69.613 1.00 24.75 ? 54  MSE A CA  1 
HETATM 210  C  C   . MSE A 1 58  ? 21.494  29.940 69.148 1.00 23.12 ? 54  MSE A C   1 
HETATM 211  O  O   . MSE A 1 58  ? 22.733  30.037 69.184 1.00 22.99 ? 54  MSE A O   1 
HETATM 212  C  CB  . MSE A 1 58  ? 20.308  32.003 68.431 1.00 24.01 ? 54  MSE A CB  1 
HETATM 213  C  CG  . MSE A 1 58  ? 19.313  33.119 68.732 1.00 25.30 ? 54  MSE A CG  1 
HETATM 214  SE SE  . MSE A 1 58  ? 19.483  34.670 67.525 1.00 33.79 ? 54  MSE A SE  1 
HETATM 215  C  CE  . MSE A 1 58  ? 21.162  35.327 68.336 1.00 24.86 ? 54  MSE A CE  1 
ATOM   216  N  N   . HIS A 1 59  ? 20.860  28.839 68.750 1.00 22.24 ? 55  HIS A N   1 
ATOM   217  C  CA  . HIS A 1 59  ? 21.596  27.676 68.263 1.00 22.89 ? 55  HIS A CA  1 
ATOM   218  C  C   . HIS A 1 59  ? 21.012  27.138 66.952 1.00 22.52 ? 55  HIS A C   1 
ATOM   219  O  O   . HIS A 1 59  ? 19.824  26.821 66.895 1.00 21.47 ? 55  HIS A O   1 
ATOM   220  C  CB  . HIS A 1 59  ? 21.613  26.553 69.305 1.00 24.34 ? 55  HIS A CB  1 
ATOM   221  C  CG  . HIS A 1 59  ? 22.240  25.291 68.804 1.00 26.88 ? 55  HIS A CG  1 
ATOM   222  N  ND1 . HIS A 1 59  ? 23.603  25.098 68.776 1.00 31.80 ? 55  HIS A ND1 1 
ATOM   223  C  CD2 . HIS A 1 59  ? 21.690  24.172 68.268 1.00 29.80 ? 55  HIS A CD2 1 
ATOM   224  C  CE1 . HIS A 1 59  ? 23.869  23.911 68.257 1.00 31.90 ? 55  HIS A CE1 1 
ATOM   225  N  NE2 . HIS A 1 59  ? 22.726  23.329 67.939 1.00 31.03 ? 55  HIS A NE2 1 
ATOM   226  N  N   . PRO A 1 60  ? 21.818  27.084 65.866 1.00 24.14 ? 56  PRO A N   1 
ATOM   227  C  CA  . PRO A 1 60  ? 23.124  27.696 65.653 1.00 25.72 ? 56  PRO A CA  1 
ATOM   228  C  C   . PRO A 1 60  ? 22.979  29.216 65.737 1.00 26.84 ? 56  PRO A C   1 
ATOM   229  O  O   . PRO A 1 60  ? 21.896  29.753 65.495 1.00 28.40 ? 56  PRO A O   1 
ATOM   230  C  CB  . PRO A 1 60  ? 23.447  27.311 64.206 1.00 25.89 ? 56  PRO A CB  1 
ATOM   231  C  CG  . PRO A 1 60  ? 22.697  26.072 63.963 1.00 26.58 ? 56  PRO A CG  1 
ATOM   232  C  CD  . PRO A 1 60  ? 21.383  26.343 64.667 1.00 23.25 ? 56  PRO A CD  1 
ATOM   233  N  N   . ALA A 1 61  ? 24.052  29.912 66.069 1.00 28.42 ? 57  ALA A N   1 
ATOM   234  C  CA  . ALA A 1 61  ? 23.938  31.352 66.141 1.00 30.69 ? 57  ALA A CA  1 
ATOM   235  C  C   . ALA A 1 61  ? 24.039  31.898 64.718 1.00 31.62 ? 57  ALA A C   1 
ATOM   236  O  O   . ALA A 1 61  ? 24.964  31.503 63.980 1.00 32.38 ? 57  ALA A O   1 
ATOM   237  C  CB  . ALA A 1 61  ? 25.039  31.918 67.033 1.00 30.55 ? 57  ALA A CB  1 
ATOM   238  N  N   . PRO A 1 62  ? 23.106  32.802 64.320 1.00 32.83 ? 58  PRO A N   1 
ATOM   239  C  CA  . PRO A 1 62  ? 23.410  33.573 63.104 1.00 34.02 ? 58  PRO A CA  1 
ATOM   240  C  C   . PRO A 1 62  ? 24.776  34.263 63.334 1.00 35.31 ? 58  PRO A C   1 
ATOM   241  O  O   . PRO A 1 62  ? 24.978  35.063 64.264 1.00 36.54 ? 58  PRO A O   1 
ATOM   242  C  CB  . PRO A 1 62  ? 22.238  34.539 62.971 1.00 35.79 ? 58  PRO A CB  1 
ATOM   243  C  CG  . PRO A 1 62  ? 21.128  33.884 63.786 1.00 33.26 ? 58  PRO A CG  1 
ATOM   244  C  CD  . PRO A 1 62  ? 21.816  33.203 64.929 1.00 32.52 ? 58  PRO A CD  1 
ATOM   245  N  N   . GLY A 1 63  ? 25.729  33.849 62.509 1.00 35.09 ? 59  GLY A N   1 
ATOM   246  C  CA  . GLY A 1 63  ? 27.105  34.272 62.582 1.00 34.49 ? 59  GLY A CA  1 
ATOM   247  C  C   . GLY A 1 63  ? 27.511  35.716 62.660 1.00 33.83 ? 59  GLY A C   1 
ATOM   248  O  O   . GLY A 1 63  ? 28.587  36.024 63.224 1.00 33.85 ? 59  GLY A O   1 
ATOM   249  N  N   . ALA A 1 64  ? 26.711  36.590 62.054 1.00 32.63 ? 60  ALA A N   1 
ATOM   250  C  CA  . ALA A 1 64  ? 27.035  38.013 62.082 1.00 30.45 ? 60  ALA A CA  1 
ATOM   251  C  C   . ALA A 1 64  ? 26.368  38.712 63.256 1.00 28.67 ? 60  ALA A C   1 
ATOM   252  O  O   . ALA A 1 64  ? 26.791  39.790 63.617 1.00 28.75 ? 60  ALA A O   1 
ATOM   253  C  CB  . ALA A 1 64  ? 26.652  38.715 60.788 1.00 31.00 ? 60  ALA A CB  1 
ATOM   254  N  N   . GLN A 1 65  ? 25.342  38.096 63.844 1.00 26.12 ? 61  GLN A N   1 
ATOM   255  C  CA  . GLN A 1 65  ? 24.652  38.736 64.970 1.00 24.01 ? 61  GLN A CA  1 
ATOM   256  C  C   . GLN A 1 65  ? 25.497  38.729 66.233 1.00 23.24 ? 61  GLN A C   1 
ATOM   257  O  O   . GLN A 1 65  ? 26.215  37.730 66.503 1.00 24.11 ? 61  GLN A O   1 
ATOM   258  C  CB  . GLN A 1 65  ? 23.313  38.063 65.260 1.00 22.85 ? 61  GLN A CB  1 
ATOM   259  C  CG  . GLN A 1 65  ? 22.309  38.109 64.110 1.00 23.41 ? 61  GLN A CG  1 
ATOM   260  C  CD  . GLN A 1 65  ? 20.947  37.560 64.483 1.00 22.73 ? 61  GLN A CD  1 
ATOM   261  O  OE1 . GLN A 1 65  ? 20.642  37.376 65.662 1.00 20.62 ? 61  GLN A OE1 1 
ATOM   262  N  NE2 . GLN A 1 65  ? 20.137  37.255 63.470 1.00 22.30 ? 61  GLN A NE2 1 
ATOM   263  N  N   . PRO A 1 66  ? 25.416  39.826 67.016 1.00 22.80 ? 62  PRO A N   1 
ATOM   264  C  CA  . PRO A 1 66  ? 26.160  39.913 68.273 1.00 22.45 ? 62  PRO A CA  1 
ATOM   265  C  C   . PRO A 1 66  ? 25.730  38.801 69.238 1.00 21.46 ? 62  PRO A C   1 
ATOM   266  O  O   . PRO A 1 66  ? 24.552  38.357 69.233 1.00 20.51 ? 62  PRO A O   1 
ATOM   267  C  CB  . PRO A 1 66  ? 25.772  41.302 68.837 1.00 22.14 ? 62  PRO A CB  1 
ATOM   268  C  CG  . PRO A 1 66  ? 24.636  41.801 68.035 1.00 25.19 ? 62  PRO A CG  1 
ATOM   269  C  CD  . PRO A 1 66  ? 24.616  41.051 66.752 1.00 22.05 ? 62  PRO A CD  1 
ATOM   270  N  N   . SER A 1 67  ? 26.680  38.340 70.029 1.00 20.99 ? 63  SER A N   1 
ATOM   271  C  CA  . SER A 1 67  ? 26.391  37.315 71.039 1.00 20.89 ? 63  SER A CA  1 
ATOM   272  C  C   . SER A 1 67  ? 25.426  37.887 72.081 1.00 19.97 ? 63  SER A C   1 
ATOM   273  O  O   . SER A 1 67  ? 25.202  39.109 72.151 1.00 19.05 ? 63  SER A O   1 
ATOM   274  C  CB  . SER A 1 67  ? 27.703  36.929 71.761 1.00 18.77 ? 63  SER A CB  1 
ATOM   275  O  OG  . SER A 1 67  ? 28.179  37.988 72.615 1.00 20.20 ? 63  SER A OG  1 
ATOM   276  N  N   . LYS A 1 68  ? 24.894  37.016 72.937 1.00 20.13 ? 64  LYS A N   1 
ATOM   277  C  CA  . LYS A 1 68  ? 24.000  37.467 74.001 1.00 20.99 ? 64  LYS A CA  1 
ATOM   278  C  C   . LYS A 1 68  ? 24.720  38.522 74.880 1.00 19.83 ? 64  LYS A C   1 
ATOM   279  O  O   . LYS A 1 68  ? 24.070  39.474 75.328 1.00 20.98 ? 64  LYS A O   1 
ATOM   280  C  CB  . LYS A 1 68  ? 23.624  36.266 74.846 1.00 23.03 ? 64  LYS A CB  1 
ATOM   281  C  CG  . LYS A 1 68  ? 22.637  36.510 75.987 1.00 25.02 ? 64  LYS A CG  1 
ATOM   282  C  CD  . LYS A 1 68  ? 22.445  35.133 76.677 1.00 31.43 ? 64  LYS A CD  1 
ATOM   283  C  CE  . LYS A 1 68  ? 21.375  35.146 77.772 1.00 37.24 ? 64  LYS A CE  1 
ATOM   284  N  NZ  . LYS A 1 68  ? 21.937  35.583 79.082 1.00 39.33 ? 64  LYS A NZ  1 
ATOM   285  N  N   . GLU A 1 69  ? 26.034  38.334 75.129 1.00 20.31 ? 65  GLU A N   1 
ATOM   286  C  CA  . GLU A 1 69  ? 26.819  39.278 75.955 1.00 21.10 ? 65  GLU A CA  1 
ATOM   287  C  C   . GLU A 1 69  ? 27.081  40.620 75.282 1.00 20.14 ? 65  GLU A C   1 
ATOM   288  O  O   . GLU A 1 69  ? 27.058  41.651 75.966 1.00 21.36 ? 65  GLU A O   1 
ATOM   289  C  CB  . GLU A 1 69  ? 28.167  38.691 76.376 1.00 20.83 ? 65  GLU A CB  1 
ATOM   290  C  CG  . GLU A 1 69  ? 28.067  37.479 77.247 1.00 25.27 ? 65  GLU A CG  1 
ATOM   291  C  CD  . GLU A 1 69  ? 27.655  36.203 76.496 1.00 30.13 ? 65  GLU A CD  1 
ATOM   292  O  OE1 . GLU A 1 69  ? 27.844  36.070 75.244 1.00 27.18 ? 65  GLU A OE1 1 
ATOM   293  O  OE2 . GLU A 1 69  ? 27.096  35.322 77.189 1.00 35.72 ? 65  GLU A OE2 1 
ATOM   294  N  N   . GLU A 1 70  ? 27.382  40.605 73.993 1.00 19.66 ? 66  GLU A N   1 
ATOM   295  C  CA  . GLU A 1 70  ? 27.692  41.834 73.268 1.00 20.34 ? 66  GLU A CA  1 
ATOM   296  C  C   . GLU A 1 70  ? 26.477  42.619 72.773 1.00 19.21 ? 66  GLU A C   1 
ATOM   297  O  O   . GLU A 1 70  ? 26.536  43.859 72.663 1.00 20.88 ? 66  GLU A O   1 
ATOM   298  C  CB  . GLU A 1 70  ? 28.588  41.518 72.099 1.00 22.14 ? 66  GLU A CB  1 
ATOM   299  C  CG  . GLU A 1 70  ? 29.900  40.949 72.654 1.00 27.85 ? 66  GLU A CG  1 
ATOM   300  C  CD  . GLU A 1 70  ? 30.932  40.651 71.615 1.00 37.63 ? 66  GLU A CD  1 
ATOM   301  O  OE1 . GLU A 1 70  ? 30.678  40.855 70.401 1.00 40.22 ? 66  GLU A OE1 1 
ATOM   302  O  OE2 . GLU A 1 70  ? 32.011  40.187 72.028 1.00 43.39 ? 66  GLU A OE2 1 
ATOM   303  N  N   . ALA A 1 71  ? 25.352  41.933 72.611 1.00 16.46 ? 67  ALA A N   1 
ATOM   304  C  CA  . ALA A 1 71  ? 24.125  42.641 72.144 1.00 17.10 ? 67  ALA A CA  1 
ATOM   305  C  C   . ALA A 1 71  ? 23.493  43.588 73.122 1.00 17.47 ? 67  ALA A C   1 
ATOM   306  O  O   . ALA A 1 71  ? 23.626  43.418 74.311 1.00 19.56 ? 67  ALA A O   1 
ATOM   307  C  CB  . ALA A 1 71  ? 23.053  41.568 71.801 1.00 16.41 ? 67  ALA A CB  1 
ATOM   308  N  N   . ASP A 1 72  ? 22.702  44.542 72.626 1.00 16.97 ? 68  ASP A N   1 
ATOM   309  C  CA  . ASP A 1 72  ? 21.939  45.429 73.485 1.00 17.04 ? 68  ASP A CA  1 
ATOM   310  C  C   . ASP A 1 72  ? 20.598  44.732 73.773 1.00 17.78 ? 68  ASP A C   1 
ATOM   311  O  O   . ASP A 1 72  ? 20.062  44.796 74.879 1.00 18.98 ? 68  ASP A O   1 
ATOM   312  C  CB  . ASP A 1 72  ? 21.695  46.748 72.791 1.00 17.46 ? 68  ASP A CB  1 
ATOM   313  C  CG  . ASP A 1 72  ? 22.917  47.652 72.878 1.00 20.74 ? 68  ASP A CG  1 
ATOM   314  O  OD1 . ASP A 1 72  ? 23.517  47.695 73.984 1.00 19.55 ? 68  ASP A OD1 1 
ATOM   315  O  OD2 . ASP A 1 72  ? 23.266  48.330 71.894 1.00 24.71 ? 68  ASP A OD2 1 
ATOM   316  N  N   . CYS A 1 73  ? 20.013  44.152 72.727 1.00 17.19 ? 69  CYS A N   1 
ATOM   317  C  CA  . CYS A 1 73  ? 18.697  43.489 72.887 1.00 16.94 ? 69  CYS A CA  1 
ATOM   318  C  C   . CYS A 1 73  ? 18.468  42.548 71.736 1.00 18.65 ? 69  CYS A C   1 
ATOM   319  O  O   . CYS A 1 73  ? 19.342  42.414 70.858 1.00 17.56 ? 69  CYS A O   1 
ATOM   320  C  CB  . CYS A 1 73  ? 17.590  44.543 72.896 1.00 16.42 ? 69  CYS A CB  1 
ATOM   321  S  SG  . CYS A 1 73  ? 17.324  45.337 71.288 1.00 22.28 ? 69  CYS A SG  1 
ATOM   322  N  N   . HIS A 1 74  ? 17.319  41.877 71.788 1.00 16.06 ? 70  HIS A N   1 
ATOM   323  C  CA  . HIS A 1 74  ? 16.889  41.007 70.700 1.00 17.83 ? 70  HIS A CA  1 
ATOM   324  C  C   . HIS A 1 74  ? 15.695  41.740 70.140 1.00 18.92 ? 70  HIS A C   1 
ATOM   325  O  O   . HIS A 1 74  ? 14.848  42.228 70.940 1.00 18.42 ? 70  HIS A O   1 
ATOM   326  C  CB  . HIS A 1 74  ? 16.364  39.678 71.211 1.00 18.55 ? 70  HIS A CB  1 
ATOM   327  C  CG  . HIS A 1 74  ? 16.108  38.710 70.107 1.00 18.04 ? 70  HIS A CG  1 
ATOM   328  N  ND1 . HIS A 1 74  ? 17.132  38.046 69.443 1.00 19.28 ? 70  HIS A ND1 1 
ATOM   329  C  CD2 . HIS A 1 74  ? 14.950  38.308 69.523 1.00 21.57 ? 70  HIS A CD2 1 
ATOM   330  C  CE1 . HIS A 1 74  ? 16.605  37.274 68.512 1.00 21.75 ? 70  HIS A CE1 1 
ATOM   331  N  NE2 . HIS A 1 74  ? 15.290  37.421 68.529 1.00 22.69 ? 70  HIS A NE2 1 
ATOM   332  N  N   . ILE A 1 75  ? 15.594  41.857 68.801 1.00 18.63 ? 71  ILE A N   1 
ATOM   333  C  CA  . ILE A 1 75  ? 14.410  42.502 68.189 1.00 19.87 ? 71  ILE A CA  1 
ATOM   334  C  C   . ILE A 1 75  ? 13.728  41.400 67.386 1.00 20.21 ? 71  ILE A C   1 
ATOM   335  O  O   . ILE A 1 75  ? 14.396  40.529 66.790 1.00 18.87 ? 71  ILE A O   1 
ATOM   336  C  CB  . ILE A 1 75  ? 14.718  43.663 67.278 1.00 20.08 ? 71  ILE A CB  1 
ATOM   337  C  CG1 . ILE A 1 75  ? 15.302  44.822 68.092 1.00 21.04 ? 71  ILE A CG1 1 
ATOM   338  C  CG2 . ILE A 1 75  ? 13.420  44.122 66.549 1.00 23.91 ? 71  ILE A CG2 1 
ATOM   339  C  CD1 . ILE A 1 75  ? 15.690  46.012 67.250 1.00 29.33 ? 71  ILE A CD1 1 
ATOM   340  N  N   . GLU A 1 76  ? 12.408  41.445 67.371 1.00 22.15 ? 72  GLU A N   1 
ATOM   341  C  CA  . GLU A 1 76  ? 11.684  40.424 66.689 1.00 22.64 ? 72  GLU A CA  1 
ATOM   342  C  C   . GLU A 1 76  ? 10.557  41.004 65.848 1.00 22.05 ? 72  GLU A C   1 
ATOM   343  O  O   . GLU A 1 76  ? 9.903   41.938 66.288 1.00 21.51 ? 72  GLU A O   1 
ATOM   344  C  CB  . GLU A 1 76  ? 11.171  39.500 67.765 1.00 24.18 ? 72  GLU A CB  1 
ATOM   345  C  CG  . GLU A 1 76  ? 9.903   38.759 67.471 1.00 29.80 ? 72  GLU A CG  1 
ATOM   346  C  CD  . GLU A 1 76  ? 9.467   37.859 68.614 1.00 35.77 ? 72  GLU A CD  1 
ATOM   347  O  OE1 . GLU A 1 76  ? 10.289  37.500 69.483 1.00 34.69 ? 72  GLU A OE1 1 
ATOM   348  O  OE2 . GLU A 1 76  ? 8.294   37.462 68.602 1.00 37.75 ? 72  GLU A OE2 1 
ATOM   349  N  N   . ALA A 1 77  ? 10.372  40.434 64.645 1.00 20.81 ? 73  ALA A N   1 
ATOM   350  C  CA  . ALA A 1 77  ? 9.304   40.831 63.774 1.00 20.46 ? 73  ALA A CA  1 
ATOM   351  C  C   . ALA A 1 77  ? 8.380   39.605 63.837 1.00 20.64 ? 73  ALA A C   1 
ATOM   352  O  O   . ALA A 1 77  ? 8.790   38.478 63.473 1.00 21.33 ? 73  ALA A O   1 
ATOM   353  C  CB  . ALA A 1 77  ? 9.805   41.022 62.353 1.00 20.93 ? 73  ALA A CB  1 
ATOM   354  N  N   A ASP A 1 78  ? 7.148   39.794 64.298 0.50 20.36 ? 74  ASP A N   1 
ATOM   355  N  N   B ASP A 1 78  ? 7.165   39.853 64.288 0.50 20.32 ? 74  ASP A N   1 
ATOM   356  C  CA  A ASP A 1 78  ? 6.143   38.718 64.400 0.50 20.58 ? 74  ASP A CA  1 
ATOM   357  C  CA  B ASP A 1 78  ? 6.119   38.870 64.407 0.50 20.63 ? 74  ASP A CA  1 
ATOM   358  C  C   A ASP A 1 78  ? 5.235   38.906 63.218 0.50 19.94 ? 74  ASP A C   1 
ATOM   359  C  C   B ASP A 1 78  ? 5.393   39.013 63.082 0.50 19.71 ? 74  ASP A C   1 
ATOM   360  O  O   A ASP A 1 78  ? 4.510   39.900 63.137 0.50 18.38 ? 74  ASP A O   1 
ATOM   361  O  O   B ASP A 1 78  ? 4.952   40.116 62.740 0.50 18.65 ? 74  ASP A O   1 
ATOM   362  C  CB  A ASP A 1 78  ? 5.373   38.839 65.699 0.50 21.95 ? 74  ASP A CB  1 
ATOM   363  C  CB  B ASP A 1 78  ? 5.163   39.307 65.532 0.50 21.67 ? 74  ASP A CB  1 
ATOM   364  C  CG  A ASP A 1 78  ? 6.209   38.453 66.858 0.50 23.12 ? 74  ASP A CG  1 
ATOM   365  C  CG  B ASP A 1 78  ? 4.503   38.144 66.248 0.50 23.49 ? 74  ASP A CG  1 
ATOM   366  O  OD1 A ASP A 1 78  ? 6.832   37.388 66.735 0.50 26.71 ? 74  ASP A OD1 1 
ATOM   367  O  OD1 B ASP A 1 78  ? 4.870   36.980 66.017 0.50 25.39 ? 74  ASP A OD1 1 
ATOM   368  O  OD2 A ASP A 1 78  ? 6.280   39.204 67.854 0.50 28.25 ? 74  ASP A OD2 1 
ATOM   369  O  OD2 B ASP A 1 78  ? 3.609   38.405 67.087 0.50 28.13 ? 74  ASP A OD2 1 
ATOM   370  N  N   . ILE A 1 79  ? 5.258   37.932 62.317 1.00 19.16 ? 75  ILE A N   1 
ATOM   371  C  CA  . ILE A 1 79  ? 4.543   38.057 61.038 1.00 19.06 ? 75  ILE A CA  1 
ATOM   372  C  C   . ILE A 1 79  ? 3.537   36.954 60.796 1.00 19.11 ? 75  ILE A C   1 
ATOM   373  O  O   . ILE A 1 79  ? 3.916   35.802 60.724 1.00 19.72 ? 75  ILE A O   1 
ATOM   374  C  CB  . ILE A 1 79  ? 5.574   38.102 59.870 1.00 18.57 ? 75  ILE A CB  1 
ATOM   375  C  CG1 . ILE A 1 79  ? 6.613   39.253 60.091 1.00 18.97 ? 75  ILE A CG1 1 
ATOM   376  C  CG2 . ILE A 1 79  ? 4.883   38.208 58.430 1.00 19.52 ? 75  ILE A CG2 1 
ATOM   377  C  CD1 . ILE A 1 79  ? 7.671   39.367 59.005 1.00 20.07 ? 75  ILE A CD1 1 
ATOM   378  N  N   . HIS A 1 80  ? 2.289   37.339 60.646 1.00 19.09 ? 76  HIS A N   1 
ATOM   379  C  CA  . HIS A 1 80  ? 1.229   36.375 60.393 1.00 18.69 ? 76  HIS A CA  1 
ATOM   380  C  C   . HIS A 1 80  ? 0.373   36.866 59.280 1.00 18.64 ? 76  HIS A C   1 
ATOM   381  O  O   . HIS A 1 80  ? 0.264   38.054 59.009 1.00 18.71 ? 76  HIS A O   1 
ATOM   382  C  CB  . HIS A 1 80  ? 0.390   36.194 61.674 1.00 20.16 ? 76  HIS A CB  1 
ATOM   383  C  CG  . HIS A 1 80  ? 1.182   35.657 62.821 1.00 22.11 ? 76  HIS A CG  1 
ATOM   384  N  ND1 . HIS A 1 80  ? 1.967   36.464 63.622 1.00 27.13 ? 76  HIS A ND1 1 
ATOM   385  C  CD2 . HIS A 1 80  ? 1.355   34.390 63.272 1.00 24.88 ? 76  HIS A CD2 1 
ATOM   386  C  CE1 . HIS A 1 80  ? 2.578   35.715 64.527 1.00 29.15 ? 76  HIS A CE1 1 
ATOM   387  N  NE2 . HIS A 1 80  ? 2.232   34.453 64.333 1.00 28.23 ? 76  HIS A NE2 1 
ATOM   388  N  N   . ALA A 1 81  ? -0.267  35.934 58.605 1.00 17.46 ? 77  ALA A N   1 
ATOM   389  C  CA  . ALA A 1 81  ? -1.148  36.306 57.515 1.00 17.21 ? 77  ALA A CA  1 
ATOM   390  C  C   . ALA A 1 81  ? -2.396  37.009 58.032 1.00 18.24 ? 77  ALA A C   1 
ATOM   391  O  O   . ALA A 1 81  ? -2.998  36.564 59.012 1.00 18.60 ? 77  ALA A O   1 
ATOM   392  C  CB  . ALA A 1 81  ? -1.573  35.017 56.770 1.00 17.13 ? 77  ALA A CB  1 
ATOM   393  N  N   . ASN A 1 82  ? -2.810  38.067 57.349 1.00 18.62 ? 78  ASN A N   1 
ATOM   394  C  CA  . ASN A 1 82  ? -4.086  38.717 57.690 1.00 19.97 ? 78  ASN A CA  1 
ATOM   395  C  C   . ASN A 1 82  ? -5.138  38.205 56.684 1.00 20.80 ? 78  ASN A C   1 
ATOM   396  O  O   . ASN A 1 82  ? -4.907  37.241 55.926 1.00 19.95 ? 78  ASN A O   1 
ATOM   397  C  CB  . ASN A 1 82  ? -3.980  40.238 57.718 1.00 20.06 ? 78  ASN A CB  1 
ATOM   398  C  CG  . ASN A 1 82  ? -3.562  40.821 56.361 1.00 20.79 ? 78  ASN A CG  1 
ATOM   399  O  OD1 . ASN A 1 82  ? -3.805  40.240 55.317 1.00 19.37 ? 78  ASN A OD1 1 
ATOM   400  N  ND2 . ASN A 1 82  ? -2.839  41.928 56.409 1.00 23.19 ? 78  ASN A ND2 1 
ATOM   401  N  N   . GLU A 1 83  ? -6.310  38.834 56.654 1.00 20.32 ? 79  GLU A N   1 
ATOM   402  C  CA  . GLU A 1 83  ? -7.343  38.359 55.754 1.00 21.97 ? 79  GLU A CA  1 
ATOM   403  C  C   . GLU A 1 83  ? -6.914  38.343 54.280 1.00 21.40 ? 79  GLU A C   1 
ATOM   404  O  O   . GLU A 1 83  ? -7.285  37.430 53.546 1.00 22.08 ? 79  GLU A O   1 
ATOM   405  C  CB  . GLU A 1 83  ? -8.647  39.121 55.992 1.00 23.18 ? 79  GLU A CB  1 
ATOM   406  C  CG  . GLU A 1 83  ? -9.108  39.131 57.467 1.00 26.90 ? 79  GLU A CG  1 
ATOM   407  C  CD  . GLU A 1 83  ? -10.128 38.063 57.843 1.00 35.82 ? 79  GLU A CD  1 
ATOM   408  O  OE1 . GLU A 1 83  ? -10.345 37.079 57.068 1.00 35.64 ? 79  GLU A OE1 1 
ATOM   409  O  OE2 . GLU A 1 83  ? -10.729 38.239 58.946 1.00 36.78 ? 79  GLU A OE2 1 
ATOM   410  N  N   . ALA A 1 84  ? -6.132  39.332 53.865 1.00 22.12 ? 80  ALA A N   1 
ATOM   411  C  CA  . ALA A 1 84  ? -5.633  39.409 52.481 1.00 23.58 ? 80  ALA A CA  1 
ATOM   412  C  C   . ALA A 1 84  ? -4.684  38.252 52.189 1.00 22.91 ? 80  ALA A C   1 
ATOM   413  O  O   . ALA A 1 84  ? -4.541  37.867 51.035 1.00 23.83 ? 80  ALA A O   1 
ATOM   414  C  CB  . ALA A 1 84  ? -4.967  40.756 52.163 1.00 23.88 ? 80  ALA A CB  1 
ATOM   415  N  N   . GLY A 1 85  ? -4.143  37.630 53.233 1.00 22.57 ? 81  GLY A N   1 
ATOM   416  C  CA  . GLY A 1 85  ? -3.255  36.475 53.052 1.00 22.66 ? 81  GLY A CA  1 
ATOM   417  C  C   . GLY A 1 85  ? -3.956  35.214 52.567 1.00 22.00 ? 81  GLY A C   1 
ATOM   418  O  O   . GLY A 1 85  ? -3.326  34.315 52.032 1.00 21.54 ? 81  GLY A O   1 
ATOM   419  N  N   . LYS A 1 86  ? -5.287  35.133 52.748 1.00 21.34 ? 82  LYS A N   1 
ATOM   420  C  CA  . LYS A 1 86  ? -6.033  33.971 52.350 1.00 21.53 ? 82  LYS A CA  1 
ATOM   421  C  C   . LYS A 1 86  ? -5.907  33.699 50.836 1.00 21.14 ? 82  LYS A C   1 
ATOM   422  O  O   . LYS A 1 86  ? -5.859  32.533 50.377 1.00 21.14 ? 82  LYS A O   1 
ATOM   423  C  CB  . LYS A 1 86  ? -7.494  34.154 52.774 1.00 22.01 ? 82  LYS A CB  1 
ATOM   424  C  CG  . LYS A 1 86  ? -8.212  32.846 52.876 1.00 23.77 ? 82  LYS A CG  1 
ATOM   425  C  CD  . LYS A 1 86  ? -9.712  33.047 53.170 1.00 32.53 ? 82  LYS A CD  1 
ATOM   426  C  CE  . LYS A 1 86  ? -10.490 31.838 52.647 1.00 36.01 ? 82  LYS A CE  1 
ATOM   427  N  NZ  . LYS A 1 86  ? -11.938 32.138 52.430 1.00 36.61 ? 82  LYS A NZ  1 
ATOM   428  N  N   . ASP A 1 87  ? -5.810  34.786 50.071 1.00 20.90 ? 83  ASP A N   1 
ATOM   429  C  CA  . ASP A 1 87  ? -5.667  34.697 48.629 1.00 22.77 ? 83  ASP A CA  1 
ATOM   430  C  C   . ASP A 1 87  ? -4.335  34.042 48.184 1.00 21.22 ? 83  ASP A C   1 
ATOM   431  O  O   . ASP A 1 87  ? -4.217  33.563 47.054 1.00 20.35 ? 83  ASP A O   1 
ATOM   432  C  CB  . ASP A 1 87  ? -5.879  36.087 48.092 1.00 24.69 ? 83  ASP A CB  1 
ATOM   433  C  CG  . ASP A 1 87  ? -7.126  36.705 48.699 1.00 29.49 ? 83  ASP A CG  1 
ATOM   434  O  OD1 . ASP A 1 87  ? -8.222  36.217 48.340 1.00 35.18 ? 83  ASP A OD1 1 
ATOM   435  O  OD2 . ASP A 1 87  ? -7.023  37.564 49.609 1.00 34.67 ? 83  ASP A OD2 1 
ATOM   436  N  N   . LEU A 1 88  ? -3.358  34.027 49.088 1.00 19.61 ? 84  LEU A N   1 
ATOM   437  C  CA  . LEU A 1 88  ? -2.042  33.390 48.830 1.00 20.16 ? 84  LEU A CA  1 
ATOM   438  C  C   . LEU A 1 88  ? -2.048  31.942 49.323 1.00 20.16 ? 84  LEU A C   1 
ATOM   439  O  O   . LEU A 1 88  ? -1.045  31.219 49.175 1.00 20.61 ? 84  LEU A O   1 
ATOM   440  C  CB  . LEU A 1 88  ? -0.908  34.169 49.525 1.00 20.29 ? 84  LEU A CB  1 
ATOM   441  C  CG  . LEU A 1 88  ? -0.143  35.166 48.650 1.00 24.00 ? 84  LEU A CG  1 
ATOM   442  C  CD1 . LEU A 1 88  ? 0.796   36.009 49.499 1.00 23.06 ? 84  LEU A CD1 1 
ATOM   443  C  CD2 . LEU A 1 88  ? 0.637   34.416 47.594 1.00 28.62 ? 84  LEU A CD2 1 
ATOM   444  N  N   . GLY A 1 89  ? -3.150  31.524 49.958 1.00 19.83 ? 85  GLY A N   1 
ATOM   445  C  CA  . GLY A 1 89  ? -3.253  30.151 50.468 1.00 20.53 ? 85  GLY A CA  1 
ATOM   446  C  C   . GLY A 1 89  ? -2.885  29.964 51.928 1.00 22.01 ? 85  GLY A C   1 
ATOM   447  O  O   . GLY A 1 89  ? -3.008  28.853 52.455 1.00 23.76 ? 85  GLY A O   1 
ATOM   448  N  N   . TYR A 1 90  ? -2.500  31.041 52.613 1.00 19.40 ? 86  TYR A N   1 
ATOM   449  C  CA  . TYR A 1 90  ? -2.182  30.919 54.043 1.00 19.89 ? 86  TYR A CA  1 
ATOM   450  C  C   . TYR A 1 90  ? -3.471  30.887 54.842 1.00 21.27 ? 86  TYR A C   1 
ATOM   451  O  O   . TYR A 1 90  ? -4.469  31.478 54.427 1.00 20.30 ? 86  TYR A O   1 
ATOM   452  C  CB  . TYR A 1 90  ? -1.382  32.134 54.547 1.00 20.61 ? 86  TYR A CB  1 
ATOM   453  C  CG  . TYR A 1 90  ? -0.043  32.236 53.903 1.00 18.62 ? 86  TYR A CG  1 
ATOM   454  C  CD1 . TYR A 1 90  ? 1.014   31.366 54.272 1.00 20.52 ? 86  TYR A CD1 1 
ATOM   455  C  CD2 . TYR A 1 90  ? 0.186   33.190 52.924 1.00 18.90 ? 86  TYR A CD2 1 
ATOM   456  C  CE1 . TYR A 1 90  ? 2.235   31.432 53.664 1.00 21.24 ? 86  TYR A CE1 1 
ATOM   457  C  CE2 . TYR A 1 90  ? 1.425   33.276 52.300 1.00 21.42 ? 86  TYR A CE2 1 
ATOM   458  C  CZ  . TYR A 1 90  ? 2.446   32.393 52.683 1.00 21.05 ? 86  TYR A CZ  1 
ATOM   459  O  OH  . TYR A 1 90  ? 3.653   32.467 52.073 1.00 22.00 ? 86  TYR A OH  1 
ATOM   460  N  N   . GLY A 1 91  ? -3.433  30.232 55.996 1.00 22.86 ? 87  GLY A N   1 
ATOM   461  C  CA  . GLY A 1 91  ? -4.585  30.237 56.891 1.00 22.74 ? 87  GLY A CA  1 
ATOM   462  C  C   . GLY A 1 91  ? -4.415  31.587 57.570 1.00 22.89 ? 87  GLY A C   1 
ATOM   463  O  O   . GLY A 1 91  ? -3.290  31.995 57.897 1.00 21.27 ? 87  GLY A O   1 
ATOM   464  N  N   . VAL A 1 92  ? -5.516  32.299 57.765 1.00 22.31 ? 88  VAL A N   1 
ATOM   465  C  CA  . VAL A 1 92  ? -5.426  33.616 58.397 1.00 23.18 ? 88  VAL A CA  1 
ATOM   466  C  C   . VAL A 1 92  ? -4.978  33.444 59.850 1.00 21.99 ? 88  VAL A C   1 
ATOM   467  O  O   . VAL A 1 92  ? -5.490  32.567 60.563 1.00 21.75 ? 88  VAL A O   1 
ATOM   468  C  CB  . VAL A 1 92  ? -6.720  34.390 58.238 1.00 23.93 ? 88  VAL A CB  1 
ATOM   469  C  CG1 . VAL A 1 92  ? -6.618  35.755 58.889 1.00 26.75 ? 88  VAL A CG1 1 
ATOM   470  C  CG2 . VAL A 1 92  ? -7.030  34.523 56.739 1.00 25.63 ? 88  VAL A CG2 1 
ATOM   471  N  N   . GLY A 1 93  ? -4.020  34.266 60.240 1.00 22.44 ? 89  GLY A N   1 
ATOM   472  C  CA  . GLY A 1 93  ? -3.422  34.230 61.556 1.00 22.87 ? 89  GLY A CA  1 
ATOM   473  C  C   . GLY A 1 93  ? -2.206  33.314 61.623 1.00 23.60 ? 89  GLY A C   1 
ATOM   474  O  O   . GLY A 1 93  ? -1.525  33.313 62.621 1.00 25.58 ? 89  GLY A O   1 
ATOM   475  N  N   . ASP A 1 94  ? -1.931  32.527 60.579 1.00 22.68 ? 90  ASP A N   1 
ATOM   476  C  CA  . ASP A 1 94  ? -0.770  31.616 60.610 1.00 22.80 ? 90  ASP A CA  1 
ATOM   477  C  C   . ASP A 1 94  ? 0.544   32.377 60.425 1.00 20.29 ? 90  ASP A C   1 
ATOM   478  O  O   . ASP A 1 94  ? 0.612   33.387 59.733 1.00 19.26 ? 90  ASP A O   1 
ATOM   479  C  CB  . ASP A 1 94  ? -0.793  30.613 59.441 1.00 24.06 ? 90  ASP A CB  1 
ATOM   480  C  CG  . ASP A 1 94  ? -1.962  29.603 59.465 1.00 26.66 ? 90  ASP A CG  1 
ATOM   481  O  OD1 . ASP A 1 94  ? -2.642  29.392 60.484 1.00 29.53 ? 90  ASP A OD1 1 
ATOM   482  O  OD2 . ASP A 1 94  ? -2.129  28.970 58.418 1.00 31.48 ? 90  ASP A OD2 1 
ATOM   483  N  N   . PHE A 1 95  ? 1.615   31.844 61.002 1.00 19.77 ? 91  PHE A N   1 
ATOM   484  C  CA  . PHE A 1 95  ? 2.948   32.393 60.790 1.00 19.05 ? 91  PHE A CA  1 
ATOM   485  C  C   . PHE A 1 95  ? 3.244   32.251 59.278 1.00 19.52 ? 91  PHE A C   1 
ATOM   486  O  O   . PHE A 1 95  ? 2.848   31.250 58.630 1.00 21.03 ? 91  PHE A O   1 
ATOM   487  C  CB  . PHE A 1 95  ? 3.962   31.528 61.558 1.00 20.61 ? 91  PHE A CB  1 
ATOM   488  C  CG  . PHE A 1 95  ? 5.423   31.879 61.269 1.00 19.70 ? 91  PHE A CG  1 
ATOM   489  C  CD1 . PHE A 1 95  ? 5.928   33.124 61.621 1.00 21.74 ? 91  PHE A CD1 1 
ATOM   490  C  CD2 . PHE A 1 95  ? 6.277   30.973 60.636 1.00 24.08 ? 91  PHE A CD2 1 
ATOM   491  C  CE1 . PHE A 1 95  ? 7.246   33.474 61.374 1.00 22.04 ? 91  PHE A CE1 1 
ATOM   492  C  CE2 . PHE A 1 95  ? 7.636   31.303 60.368 1.00 22.38 ? 91  PHE A CE2 1 
ATOM   493  C  CZ  . PHE A 1 95  ? 8.110   32.566 60.735 1.00 21.47 ? 91  PHE A CZ  1 
ATOM   494  N  N   . VAL A 1 96  ? 3.955   33.222 58.702 1.00 19.31 ? 92  VAL A N   1 
ATOM   495  C  CA  . VAL A 1 96  ? 4.302   33.177 57.294 1.00 18.44 ? 92  VAL A CA  1 
ATOM   496  C  C   . VAL A 1 96  ? 5.807   32.904 57.164 1.00 18.57 ? 92  VAL A C   1 
ATOM   497  O  O   . VAL A 1 96  ? 6.599   33.801 57.350 1.00 17.85 ? 92  VAL A O   1 
ATOM   498  C  CB  . VAL A 1 96  ? 3.919   34.510 56.576 1.00 18.17 ? 92  VAL A CB  1 
ATOM   499  C  CG1 . VAL A 1 96  ? 4.306   34.395 55.065 1.00 19.36 ? 92  VAL A CG1 1 
ATOM   500  C  CG2 . VAL A 1 96  ? 2.397   34.748 56.665 1.00 21.14 ? 92  VAL A CG2 1 
ATOM   501  N  N   . PRO A 1 97  ? 6.184   31.649 56.828 1.00 18.52 ? 93  PRO A N   1 
ATOM   502  C  CA  . PRO A 1 97  ? 7.592   31.313 56.732 1.00 17.94 ? 93  PRO A CA  1 
ATOM   503  C  C   . PRO A 1 97  ? 8.205   31.640 55.358 1.00 16.71 ? 93  PRO A C   1 
ATOM   504  O  O   . PRO A 1 97  ? 7.489   31.980 54.413 1.00 16.87 ? 93  PRO A O   1 
ATOM   505  C  CB  . PRO A 1 97  ? 7.593   29.774 56.938 1.00 18.43 ? 93  PRO A CB  1 
ATOM   506  C  CG  . PRO A 1 97  ? 6.260   29.317 56.308 1.00 20.03 ? 93  PRO A CG  1 
ATOM   507  C  CD  . PRO A 1 97  ? 5.297   30.485 56.571 1.00 19.34 ? 93  PRO A CD  1 
ATOM   508  N  N   . TYR A 1 98  ? 9.533   31.501 55.277 1.00 16.30 ? 94  TYR A N   1 
ATOM   509  C  CA  . TYR A 1 98  ? 10.325  31.698 54.066 1.00 16.72 ? 94  TYR A CA  1 
ATOM   510  C  C   . TYR A 1 98  ? 10.489  33.114 53.599 1.00 17.58 ? 94  TYR A C   1 
ATOM   511  O  O   . TYR A 1 98  ? 11.039  33.343 52.536 1.00 18.18 ? 94  TYR A O   1 
ATOM   512  C  CB  . TYR A 1 98  ? 9.855   30.815 52.891 1.00 16.67 ? 94  TYR A CB  1 
ATOM   513  C  CG  . TYR A 1 98  ? 9.858   29.359 53.218 1.00 16.43 ? 94  TYR A CG  1 
ATOM   514  C  CD1 . TYR A 1 98  ? 10.989  28.596 53.001 1.00 17.80 ? 94  TYR A CD1 1 
ATOM   515  C  CD2 . TYR A 1 98  ? 8.718   28.760 53.724 1.00 16.27 ? 94  TYR A CD2 1 
ATOM   516  C  CE1 . TYR A 1 98  ? 10.994  27.202 53.308 1.00 19.82 ? 94  TYR A CE1 1 
ATOM   517  C  CE2 . TYR A 1 98  ? 8.702   27.381 54.030 1.00 17.96 ? 94  TYR A CE2 1 
ATOM   518  C  CZ  . TYR A 1 98  ? 9.849   26.621 53.814 1.00 17.44 ? 94  TYR A CZ  1 
ATOM   519  O  OH  . TYR A 1 98  ? 9.846   25.259 54.097 1.00 18.30 ? 94  TYR A OH  1 
ATOM   520  N  N   . LEU A 1 99  ? 10.063  34.079 54.416 1.00 17.67 ? 95  LEU A N   1 
ATOM   521  C  CA  . LEU A 1 99  ? 10.237  35.486 54.025 1.00 16.69 ? 95  LEU A CA  1 
ATOM   522  C  C   . LEU A 1 99  ? 11.680  35.928 54.321 1.00 17.26 ? 95  LEU A C   1 
ATOM   523  O  O   . LEU A 1 99  ? 12.425  35.243 55.056 1.00 17.39 ? 95  LEU A O   1 
ATOM   524  C  CB  . LEU A 1 99  ? 9.270   36.358 54.817 1.00 16.57 ? 95  LEU A CB  1 
ATOM   525  C  CG  . LEU A 1 99  ? 7.785   35.943 54.717 1.00 16.62 ? 95  LEU A CG  1 
ATOM   526  C  CD1 . LEU A 1 99  ? 6.966   36.951 55.479 1.00 17.50 ? 95  LEU A CD1 1 
ATOM   527  C  CD2 . LEU A 1 99  ? 7.313   35.865 53.255 1.00 17.48 ? 95  LEU A CD2 1 
ATOM   528  N  N   . ARG A 1 100 ? 12.067  37.071 53.755 1.00 17.50 ? 96  ARG A N   1 
ATOM   529  C  CA  . ARG A 1 100 ? 13.419  37.606 53.964 1.00 17.83 ? 96  ARG A CA  1 
ATOM   530  C  C   . ARG A 1 100 ? 13.174  38.958 54.605 1.00 18.00 ? 96  ARG A C   1 
ATOM   531  O  O   . ARG A 1 100 ? 12.646  39.889 53.966 1.00 18.48 ? 96  ARG A O   1 
ATOM   532  C  CB  . ARG A 1 100 ? 14.181  37.680 52.653 1.00 18.63 ? 96  ARG A CB  1 
ATOM   533  C  CG  . ARG A 1 100 ? 14.392  36.278 52.028 1.00 20.90 ? 96  ARG A CG  1 
ATOM   534  C  CD  . ARG A 1 100 ? 14.941  36.368 50.620 1.00 24.14 ? 96  ARG A CD  1 
ATOM   535  N  NE  . ARG A 1 100 ? 13.903  36.788 49.663 1.00 21.90 ? 96  ARG A NE  1 
ATOM   536  C  CZ  . ARG A 1 100 ? 14.136  37.202 48.426 1.00 26.15 ? 96  ARG A CZ  1 
ATOM   537  N  NH1 . ARG A 1 100 ? 15.398  37.256 47.966 1.00 26.64 ? 96  ARG A NH1 1 
ATOM   538  N  NH2 . ARG A 1 100 ? 13.116  37.558 47.639 1.00 24.07 ? 96  ARG A NH2 1 
ATOM   539  N  N   . VAL A 1 101 ? 13.540  39.054 55.866 1.00 16.91 ? 97  VAL A N   1 
ATOM   540  C  CA  . VAL A 1 101 ? 13.247  40.277 56.637 1.00 17.47 ? 97  VAL A CA  1 
ATOM   541  C  C   . VAL A 1 101 ? 14.528  40.980 57.013 1.00 17.71 ? 97  VAL A C   1 
ATOM   542  O  O   . VAL A 1 101 ? 15.456  40.351 57.543 1.00 18.46 ? 97  VAL A O   1 
ATOM   543  C  CB  . VAL A 1 101 ? 12.442  39.921 57.886 1.00 18.66 ? 97  VAL A CB  1 
ATOM   544  C  CG1 . VAL A 1 101 ? 12.058  41.205 58.673 1.00 19.10 ? 97  VAL A CG1 1 
ATOM   545  C  CG2 . VAL A 1 101 ? 11.138  39.131 57.512 1.00 18.13 ? 97  VAL A CG2 1 
ATOM   546  N  N   . VAL A 1 102 ? 14.567  42.285 56.771 1.00 17.39 ? 98  VAL A N   1 
ATOM   547  C  CA  . VAL A 1 102 ? 15.757  43.106 57.093 1.00 19.64 ? 98  VAL A CA  1 
ATOM   548  C  C   . VAL A 1 102 ? 15.262  44.322 57.853 1.00 20.01 ? 98  VAL A C   1 
ATOM   549  O  O   . VAL A 1 102 ? 14.226  44.882 57.512 1.00 21.08 ? 98  VAL A O   1 
ATOM   550  C  CB  . VAL A 1 102 ? 16.445  43.562 55.815 1.00 19.49 ? 98  VAL A CB  1 
ATOM   551  C  CG1 . VAL A 1 102 ? 17.657  44.487 56.106 1.00 22.29 ? 98  VAL A CG1 1 
ATOM   552  C  CG2 . VAL A 1 102 ? 16.901  42.351 54.967 1.00 21.61 ? 98  VAL A CG2 1 
ATOM   553  N  N   . ALA A 1 103 ? 15.965  44.713 58.917 1.00 18.56 ? 99  ALA A N   1 
ATOM   554  C  CA  . ALA A 1 103 ? 15.558  45.893 59.653 1.00 18.24 ? 99  ALA A CA  1 
ATOM   555  C  C   . ALA A 1 103 ? 16.605  46.973 59.392 1.00 18.47 ? 99  ALA A C   1 
ATOM   556  O  O   . ALA A 1 103 ? 17.797  46.673 59.257 1.00 18.51 ? 99  ALA A O   1 
ATOM   557  C  CB  . ALA A 1 103 ? 15.478  45.631 61.147 1.00 18.65 ? 99  ALA A CB  1 
ATOM   558  N  N   . PHE A 1 104 ? 16.150  48.223 59.343 1.00 17.14 ? 100 PHE A N   1 
ATOM   559  C  CA  . PHE A 1 104 ? 17.034  49.398 59.183 1.00 16.62 ? 100 PHE A CA  1 
ATOM   560  C  C   . PHE A 1 104 ? 16.778  50.286 60.396 1.00 17.77 ? 100 PHE A C   1 
ATOM   561  O  O   . PHE A 1 104 ? 15.621  50.574 60.720 1.00 18.43 ? 100 PHE A O   1 
ATOM   562  C  CB  . PHE A 1 104 ? 16.703  50.122 57.896 1.00 18.15 ? 100 PHE A CB  1 
ATOM   563  C  CG  . PHE A 1 104 ? 16.976  49.275 56.675 1.00 16.46 ? 100 PHE A CG  1 
ATOM   564  C  CD1 . PHE A 1 104 ? 18.248  49.252 56.102 1.00 18.24 ? 100 PHE A CD1 1 
ATOM   565  C  CD2 . PHE A 1 104 ? 15.983  48.458 56.154 1.00 19.92 ? 100 PHE A CD2 1 
ATOM   566  C  CE1 . PHE A 1 104 ? 18.482  48.436 54.971 1.00 17.33 ? 100 PHE A CE1 1 
ATOM   567  C  CE2 . PHE A 1 104 ? 16.214  47.684 55.040 1.00 19.48 ? 100 PHE A CE2 1 
ATOM   568  C  CZ  . PHE A 1 104 ? 17.474  47.678 54.448 1.00 20.33 ? 100 PHE A CZ  1 
ATOM   569  N  N   . LEU A 1 105 ? 17.836  50.647 61.104 1.00 17.49 ? 101 LEU A N   1 
ATOM   570  C  CA  . LEU A 1 105 ? 17.712  51.469 62.307 1.00 16.71 ? 101 LEU A CA  1 
ATOM   571  C  C   . LEU A 1 105 ? 18.429  52.770 62.055 1.00 17.00 ? 101 LEU A C   1 
ATOM   572  O  O   . LEU A 1 105 ? 19.584  52.767 61.590 1.00 16.75 ? 101 LEU A O   1 
ATOM   573  C  CB  . LEU A 1 105 ? 18.395  50.764 63.486 1.00 17.68 ? 101 LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 105 ? 18.002  49.308 63.718 1.00 20.12 ? 101 LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 105 ? 18.804  48.688 64.882 1.00 24.94 ? 101 LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 105 ? 16.538  49.339 64.047 1.00 21.62 ? 101 LEU A CD2 1 
ATOM   577  N  N   . GLN A 1 106 ? 17.782  53.885 62.338 1.00 15.25 ? 102 GLN A N   1 
ATOM   578  C  CA  . GLN A 1 106 ? 18.449  55.151 62.093 1.00 16.58 ? 102 GLN A CA  1 
ATOM   579  C  C   . GLN A 1 106 ? 18.146  56.121 63.223 1.00 16.26 ? 102 GLN A C   1 
ATOM   580  O  O   . GLN A 1 106 ? 16.979  56.508 63.402 1.00 17.09 ? 102 GLN A O   1 
ATOM   581  C  CB  . GLN A 1 106 ? 18.025  55.724 60.726 1.00 16.22 ? 102 GLN A CB  1 
ATOM   582  C  CG  . GLN A 1 106 ? 18.755  57.034 60.388 1.00 19.22 ? 102 GLN A CG  1 
ATOM   583  C  CD  . GLN A 1 106 ? 18.333  57.577 59.047 1.00 21.58 ? 102 GLN A CD  1 
ATOM   584  O  OE1 . GLN A 1 106 ? 17.414  57.048 58.417 1.00 22.97 ? 102 GLN A OE1 1 
ATOM   585  N  NE2 . GLN A 1 106 ? 19.007  58.639 58.599 1.00 23.59 ? 102 GLN A NE2 1 
ATOM   586  N  N   . LYS A 1 107 ? 19.179  56.537 63.970 1.00 16.92 ? 103 LYS A N   1 
ATOM   587  C  CA  . LYS A 1 107 ? 18.980  57.458 65.071 1.00 17.45 ? 103 LYS A CA  1 
ATOM   588  C  C   . LYS A 1 107 ? 18.530  58.824 64.543 1.00 18.31 ? 103 LYS A C   1 
ATOM   589  O  O   . LYS A 1 107 ? 19.024  59.303 63.515 1.00 18.40 ? 103 LYS A O   1 
ATOM   590  C  CB  . LYS A 1 107 ? 20.268  57.599 65.891 1.00 18.46 ? 103 LYS A CB  1 
ATOM   591  C  CG  . LYS A 1 107 ? 20.012  58.269 67.257 1.00 19.72 ? 103 LYS A CG  1 
ATOM   592  C  CD  . LYS A 1 107 ? 21.272  58.316 68.041 1.00 22.19 ? 103 LYS A CD  1 
ATOM   593  C  CE  . LYS A 1 107 ? 20.980  58.700 69.474 1.00 26.17 ? 103 LYS A CE  1 
ATOM   594  N  NZ  . LYS A 1 107 ? 22.251  58.950 70.212 1.00 29.63 ? 103 LYS A NZ  1 
ATOM   595  N  N   . HIS A 1 108 ? 17.598  59.454 65.251 1.00 18.71 ? 104 HIS A N   1 
ATOM   596  C  CA  . HIS A 1 108 ? 17.135  60.783 64.852 1.00 20.78 ? 104 HIS A CA  1 
ATOM   597  C  C   . HIS A 1 108 ? 18.299  61.731 64.821 1.00 21.91 ? 104 HIS A C   1 
ATOM   598  O  O   . HIS A 1 108 ? 19.149  61.686 65.710 1.00 22.83 ? 104 HIS A O   1 
ATOM   599  C  CB  . HIS A 1 108 ? 16.117  61.290 65.850 1.00 20.68 ? 104 HIS A CB  1 
ATOM   600  C  CG  . HIS A 1 108 ? 14.765  60.711 65.644 1.00 20.19 ? 104 HIS A CG  1 
ATOM   601  N  ND1 . HIS A 1 108 ? 13.616  61.311 66.124 1.00 23.86 ? 104 HIS A ND1 1 
ATOM   602  C  CD2 . HIS A 1 108 ? 14.367  59.600 64.979 1.00 22.93 ? 104 HIS A CD2 1 
ATOM   603  C  CE1 . HIS A 1 108 ? 12.571  60.582 65.774 1.00 22.93 ? 104 HIS A CE1 1 
ATOM   604  N  NE2 . HIS A 1 108 ? 12.997  59.538 65.083 1.00 24.40 ? 104 HIS A NE2 1 
ATOM   605  N  N   . GLY A 1 109 ? 18.351  62.573 63.789 1.00 24.06 ? 105 GLY A N   1 
ATOM   606  C  CA  . GLY A 1 109 ? 19.452  63.538 63.667 1.00 25.86 ? 105 GLY A CA  1 
ATOM   607  C  C   . GLY A 1 109 ? 20.746  62.947 63.105 1.00 26.71 ? 105 GLY A C   1 
ATOM   608  O  O   . GLY A 1 109 ? 21.777  63.652 63.034 1.00 27.36 ? 105 GLY A O   1 
ATOM   609  N  N   . SER A 1 110 ? 20.717  61.666 62.740 1.00 26.18 ? 106 SER A N   1 
ATOM   610  C  CA  . SER A 1 110 ? 21.892  60.994 62.176 1.00 26.14 ? 106 SER A CA  1 
ATOM   611  C  C   . SER A 1 110 ? 21.647  60.541 60.752 1.00 25.67 ? 106 SER A C   1 
ATOM   612  O  O   . SER A 1 110 ? 20.510  60.223 60.390 1.00 24.23 ? 106 SER A O   1 
ATOM   613  C  CB  . SER A 1 110 ? 22.281  59.783 63.034 1.00 26.40 ? 106 SER A CB  1 
ATOM   614  O  OG  . SER A 1 110 ? 23.329  59.019 62.428 1.00 25.22 ? 106 SER A OG  1 
ATOM   615  N  N   . GLU A 1 111 ? 22.705  60.494 59.939 1.00 26.22 ? 107 GLU A N   1 
ATOM   616  C  CA  . GLU A 1 111 ? 22.567  60.012 58.557 1.00 27.23 ? 107 GLU A CA  1 
ATOM   617  C  C   . GLU A 1 111 ? 23.005  58.542 58.495 1.00 25.32 ? 107 GLU A C   1 
ATOM   618  O  O   . GLU A 1 111 ? 22.856  57.888 57.474 1.00 25.80 ? 107 GLU A O   1 
ATOM   619  C  CB  . GLU A 1 111 ? 23.430  60.816 57.579 1.00 27.25 ? 107 GLU A CB  1 
ATOM   620  C  CG  . GLU A 1 111 ? 23.404  62.329 57.785 1.00 30.08 ? 107 GLU A CG  1 
ATOM   621  C  CD  . GLU A 1 111 ? 24.289  63.058 56.785 1.00 31.13 ? 107 GLU A CD  1 
ATOM   622  O  OE1 . GLU A 1 111 ? 24.374  62.592 55.623 1.00 37.63 ? 107 GLU A OE1 1 
ATOM   623  O  OE2 . GLU A 1 111 ? 24.890  64.087 57.158 1.00 36.05 ? 107 GLU A OE2 1 
ATOM   624  N  N   . LYS A 1 112 ? 23.526  58.014 59.599 1.00 24.20 ? 108 LYS A N   1 
ATOM   625  C  CA  . LYS A 1 112 ? 23.975  56.617 59.616 1.00 23.08 ? 108 LYS A CA  1 
ATOM   626  C  C   . LYS A 1 112 ? 22.789  55.673 59.725 1.00 22.04 ? 108 LYS A C   1 
ATOM   627  O  O   . LYS A 1 112 ? 21.926  55.840 60.584 1.00 20.43 ? 108 LYS A O   1 
ATOM   628  C  CB  . LYS A 1 112 ? 24.940  56.322 60.766 1.00 22.82 ? 108 LYS A CB  1 
ATOM   629  C  CG  . LYS A 1 112 ? 26.228  57.150 60.735 1.00 26.16 ? 108 LYS A CG  1 
ATOM   630  C  CD  . LYS A 1 112 ? 27.161  56.758 61.880 1.00 26.66 ? 108 LYS A CD  1 
ATOM   631  C  CE  . LYS A 1 112 ? 28.156  57.869 62.181 1.00 31.13 ? 108 LYS A CE  1 
ATOM   632  N  NZ  . LYS A 1 112 ? 28.671  58.504 60.926 1.00 35.91 ? 108 LYS A NZ  1 
ATOM   633  N  N   . VAL A 1 113 ? 22.797  54.670 58.880 1.00 20.47 ? 109 VAL A N   1 
ATOM   634  C  CA  . VAL A 1 113 ? 21.715  53.689 58.917 1.00 20.59 ? 109 VAL A CA  1 
ATOM   635  C  C   . VAL A 1 113 ? 22.308  52.301 59.161 1.00 21.20 ? 109 VAL A C   1 
ATOM   636  O  O   . VAL A 1 113 ? 23.215  51.879 58.406 1.00 21.48 ? 109 VAL A O   1 
ATOM   637  C  CB  . VAL A 1 113 ? 20.890  53.668 57.583 1.00 20.39 ? 109 VAL A CB  1 
ATOM   638  C  CG1 . VAL A 1 113 ? 19.865  52.502 57.620 1.00 20.72 ? 109 VAL A CG1 1 
ATOM   639  C  CG2 . VAL A 1 113 ? 20.195  55.008 57.309 1.00 20.57 ? 109 VAL A CG2 1 
ATOM   640  N  N   . GLN A 1 114 ? 21.818  51.599 60.185 1.00 19.63 ? 110 GLN A N   1 
ATOM   641  C  CA  . GLN A 1 114 ? 22.249  50.216 60.450 1.00 20.46 ? 110 GLN A CA  1 
ATOM   642  C  C   . GLN A 1 114 ? 21.330  49.270 59.724 1.00 21.32 ? 110 GLN A C   1 
ATOM   643  O  O   . GLN A 1 114 ? 20.108  49.385 59.825 1.00 22.06 ? 110 GLN A O   1 
ATOM   644  C  CB  . GLN A 1 114 ? 22.082  49.832 61.917 1.00 21.11 ? 110 GLN A CB  1 
ATOM   645  C  CG  . GLN A 1 114 ? 23.002  50.427 62.812 1.00 23.40 ? 110 GLN A CG  1 
ATOM   646  C  CD  . GLN A 1 114 ? 22.753  49.948 64.262 1.00 22.21 ? 110 GLN A CD  1 
ATOM   647  O  OE1 . GLN A 1 114 ? 22.443  50.751 65.122 1.00 25.95 ? 110 GLN A OE1 1 
ATOM   648  N  NE2 . GLN A 1 114 ? 22.865  48.640 64.497 1.00 21.43 ? 110 GLN A NE2 1 
ATOM   649  N  N   . LYS A 1 115 ? 21.928  48.298 59.037 1.00 20.62 ? 111 LYS A N   1 
ATOM   650  C  CA  . LYS A 1 115 ? 21.155  47.284 58.341 1.00 22.75 ? 111 LYS A CA  1 
ATOM   651  C  C   . LYS A 1 115 ? 21.319  45.980 59.133 1.00 23.99 ? 111 LYS A C   1 
ATOM   652  O  O   . LYS A 1 115 ? 22.451  45.521 59.409 1.00 25.12 ? 111 LYS A O   1 
ATOM   653  C  CB  . LYS A 1 115 ? 21.679  47.137 56.931 1.00 22.28 ? 111 LYS A CB  1 
ATOM   654  C  CG  . LYS A 1 115 ? 20.967  46.029 56.160 1.00 24.90 ? 111 LYS A CG  1 
ATOM   655  C  CD  . LYS A 1 115 ? 21.635  45.790 54.821 1.00 29.90 ? 111 LYS A CD  1 
ATOM   656  C  CE  . LYS A 1 115 ? 20.993  44.576 54.154 1.00 31.02 ? 111 LYS A CE  1 
ATOM   657  N  NZ  . LYS A 1 115 ? 21.516  44.360 52.763 1.00 33.94 ? 111 LYS A NZ  1 
ATOM   658  N  N   . VAL A 1 116 ? 20.210  45.393 59.526 1.00 22.54 ? 112 VAL A N   1 
ATOM   659  C  CA  . VAL A 1 116 ? 20.236  44.153 60.311 1.00 24.39 ? 112 VAL A CA  1 
ATOM   660  C  C   . VAL A 1 116 ? 19.446  43.051 59.612 1.00 24.40 ? 112 VAL A C   1 
ATOM   661  O  O   . VAL A 1 116 ? 18.246  43.196 59.407 1.00 23.45 ? 112 VAL A O   1 
ATOM   662  C  CB  . VAL A 1 116 ? 19.652  44.399 61.698 1.00 24.87 ? 112 VAL A CB  1 
ATOM   663  C  CG1 . VAL A 1 116 ? 19.624  43.122 62.496 1.00 30.49 ? 112 VAL A CG1 1 
ATOM   664  C  CG2 . VAL A 1 116 ? 20.496  45.458 62.452 1.00 27.66 ? 112 VAL A CG2 1 
HETATM 665  N  N   . MSE A 1 117 ? 20.118  41.953 59.265 1.00 25.19 ? 113 MSE A N   1 
HETATM 666  C  CA  . MSE A 1 117 ? 19.386  40.860 58.622 1.00 27.69 ? 113 MSE A CA  1 
HETATM 667  C  C   . MSE A 1 117 ? 18.747  39.963 59.711 1.00 24.28 ? 113 MSE A C   1 
HETATM 668  O  O   . MSE A 1 117 ? 19.417  39.552 60.682 1.00 24.42 ? 113 MSE A O   1 
HETATM 669  C  CB  . MSE A 1 117 ? 20.313  40.090 57.683 1.00 27.12 ? 113 MSE A CB  1 
HETATM 670  C  CG  . MSE A 1 117 ? 20.646  40.907 56.460 1.00 30.53 ? 113 MSE A CG  1 
HETATM 671  SE SE  . MSE A 1 117 ? 21.946  39.948 55.469 1.00 43.64 ? 113 MSE A SE  1 
HETATM 672  C  CE  . MSE A 1 117 ? 21.168  38.128 55.629 1.00 38.52 ? 113 MSE A CE  1 
ATOM   673  N  N   . PHE A 1 118 ? 17.442  39.743 59.611 1.00 21.24 ? 114 PHE A N   1 
ATOM   674  C  CA  . PHE A 1 118 ? 16.777  38.911 60.602 1.00 19.15 ? 114 PHE A CA  1 
ATOM   675  C  C   . PHE A 1 118 ? 16.883  37.468 60.118 1.00 19.55 ? 114 PHE A C   1 
ATOM   676  O  O   . PHE A 1 118 ? 17.142  37.198 58.931 1.00 21.73 ? 114 PHE A O   1 
ATOM   677  C  CB  . PHE A 1 118 ? 15.283  39.291 60.766 1.00 19.71 ? 114 PHE A CB  1 
ATOM   678  C  CG  . PHE A 1 118 ? 15.056  40.527 61.656 1.00 19.81 ? 114 PHE A CG  1 
ATOM   679  C  CD1 . PHE A 1 118 ? 16.144  41.367 62.020 1.00 21.35 ? 114 PHE A CD1 1 
ATOM   680  C  CD2 . PHE A 1 118 ? 13.775  40.865 62.077 1.00 26.31 ? 114 PHE A CD2 1 
ATOM   681  C  CE1 . PHE A 1 118 ? 15.952  42.494 62.870 1.00 21.62 ? 114 PHE A CE1 1 
ATOM   682  C  CE2 . PHE A 1 118 ? 13.552  42.011 62.888 1.00 24.76 ? 114 PHE A CE2 1 
ATOM   683  C  CZ  . PHE A 1 118 ? 14.606  42.806 63.283 1.00 24.39 ? 114 PHE A CZ  1 
ATOM   684  N  N   . ALA A 1 119 ? 16.700  36.545 61.053 1.00 18.40 ? 115 ALA A N   1 
ATOM   685  C  CA  . ALA A 1 119 ? 16.755  35.104 60.725 1.00 18.60 ? 115 ALA A CA  1 
ATOM   686  C  C   . ALA A 1 119 ? 15.523  34.444 61.316 1.00 18.79 ? 115 ALA A C   1 
ATOM   687  O  O   . ALA A 1 119 ? 15.020  34.890 62.377 1.00 18.39 ? 115 ALA A O   1 
ATOM   688  C  CB  . ALA A 1 119 ? 18.032  34.469 61.321 1.00 18.93 ? 115 ALA A CB  1 
ATOM   689  N  N   . PRO A 1 120 ? 15.042  33.370 60.677 1.00 18.49 ? 116 PRO A N   1 
ATOM   690  C  CA  . PRO A 1 120 ? 13.886  32.670 61.275 1.00 19.04 ? 116 PRO A CA  1 
ATOM   691  C  C   . PRO A 1 120 ? 14.349  31.783 62.439 1.00 18.22 ? 116 PRO A C   1 
ATOM   692  O  O   . PRO A 1 120 ? 15.406  31.135 62.370 1.00 18.81 ? 116 PRO A O   1 
ATOM   693  C  CB  . PRO A 1 120 ? 13.342  31.818 60.120 1.00 20.02 ? 116 PRO A CB  1 
ATOM   694  C  CG  . PRO A 1 120 ? 14.518  31.600 59.219 1.00 19.58 ? 116 PRO A CG  1 
ATOM   695  C  CD  . PRO A 1 120 ? 15.486  32.747 59.406 1.00 19.53 ? 116 PRO A CD  1 
HETATM 696  N  N   . MSE A 1 121 ? 13.559  31.763 63.501 1.00 18.61 ? 117 MSE A N   1 
HETATM 697  C  CA  . MSE A 1 121 ? 13.929  30.941 64.656 1.00 21.11 ? 117 MSE A CA  1 
HETATM 698  C  C   . MSE A 1 121 ? 12.736  30.688 65.573 1.00 21.55 ? 117 MSE A C   1 
HETATM 699  O  O   . MSE A 1 121 ? 11.704  31.383 65.486 1.00 21.63 ? 117 MSE A O   1 
HETATM 700  C  CB  . MSE A 1 121 ? 15.007  31.672 65.462 1.00 20.76 ? 117 MSE A CB  1 
HETATM 701  C  CG  . MSE A 1 121 ? 14.537  33.069 65.859 1.00 21.16 ? 117 MSE A CG  1 
HETATM 702  SE SE  . MSE A 1 121 ? 16.123  34.001 66.602 1.00 28.21 ? 117 MSE A SE  1 
HETATM 703  C  CE  . MSE A 1 121 ? 17.157  34.202 64.927 1.00 20.14 ? 117 MSE A CE  1 
ATOM   704  N  N   . ASN A 1 122 ? 12.857  29.674 66.423 1.00 20.88 ? 118 ASN A N   1 
ATOM   705  C  CA  . ASN A 1 122 ? 11.806  29.386 67.409 1.00 22.80 ? 118 ASN A CA  1 
ATOM   706  C  C   . ASN A 1 122 ? 12.287  29.754 68.785 1.00 23.57 ? 118 ASN A C   1 
ATOM   707  O  O   . ASN A 1 122 ? 13.440  29.482 69.162 1.00 22.45 ? 118 ASN A O   1 
ATOM   708  C  CB  . ASN A 1 122 ? 11.492  27.892 67.519 1.00 21.93 ? 118 ASN A CB  1 
ATOM   709  C  CG  . ASN A 1 122 ? 10.537  27.420 66.488 1.00 24.04 ? 118 ASN A CG  1 
ATOM   710  O  OD1 . ASN A 1 122 ? 10.066  28.196 65.644 1.00 23.06 ? 118 ASN A OD1 1 
ATOM   711  N  ND2 . ASN A 1 122 ? 10.233  26.114 66.531 1.00 24.28 ? 118 ASN A ND2 1 
ATOM   712  N  N   . ALA A 1 123 ? 11.364  30.311 69.558 1.00 26.38 ? 119 ALA A N   1 
ATOM   713  C  CA  . ALA A 1 123 ? 11.609  30.626 70.954 1.00 28.14 ? 119 ALA A CA  1 
ATOM   714  C  C   . ALA A 1 123 ? 10.510  29.802 71.655 1.00 29.98 ? 119 ALA A C   1 
ATOM   715  O  O   . ALA A 1 123 ? 9.749   29.054 71.006 1.00 29.68 ? 119 ALA A O   1 
ATOM   716  C  CB  . ALA A 1 123 ? 11.452  32.113 71.211 1.00 28.87 ? 119 ALA A CB  1 
ATOM   717  N  N   . GLY A 1 124 ? 10.420  29.933 72.970 1.00 31.35 ? 120 GLY A N   1 
ATOM   718  C  CA  . GLY A 1 124 ? 9.417   29.205 73.721 1.00 32.96 ? 120 GLY A CA  1 
ATOM   719  C  C   . GLY A 1 124 ? 7.994   29.499 73.281 1.00 33.35 ? 120 GLY A C   1 
ATOM   720  O  O   . GLY A 1 124 ? 7.104   28.682 73.474 1.00 34.85 ? 120 GLY A O   1 
ATOM   721  N  N   . ASP A 1 125 ? 7.789   30.658 72.659 1.00 33.90 ? 121 ASP A N   1 
ATOM   722  C  CA  . ASP A 1 125 ? 6.463   31.080 72.174 1.00 34.27 ? 121 ASP A CA  1 
ATOM   723  C  C   . ASP A 1 125 ? 6.250   30.925 70.660 1.00 33.19 ? 121 ASP A C   1 
ATOM   724  O  O   . ASP A 1 125 ? 5.338   31.529 70.075 1.00 34.08 ? 121 ASP A O   1 
ATOM   725  C  CB  . ASP A 1 125 ? 6.210   32.527 72.619 1.00 35.02 ? 121 ASP A CB  1 
ATOM   726  C  CG  . ASP A 1 125 ? 7.142   33.510 71.948 1.00 37.44 ? 121 ASP A CG  1 
ATOM   727  O  OD1 . ASP A 1 125 ? 8.273   33.096 71.584 1.00 38.74 ? 121 ASP A OD1 1 
ATOM   728  O  OD2 . ASP A 1 125 ? 6.727   34.689 71.784 1.00 41.72 ? 121 ASP A OD2 1 
ATOM   729  N  N   . GLY A 1 126 ? 7.088   30.124 70.007 1.00 30.78 ? 122 GLY A N   1 
ATOM   730  C  CA  . GLY A 1 126 ? 6.926   29.877 68.598 1.00 28.18 ? 122 GLY A CA  1 
ATOM   731  C  C   . GLY A 1 126 ? 7.865   30.589 67.647 1.00 27.25 ? 122 GLY A C   1 
ATOM   732  O  O   . GLY A 1 126 ? 8.840   31.229 68.086 1.00 26.23 ? 122 GLY A O   1 
ATOM   733  N  N   . PRO A 1 127 ? 7.594   30.453 66.342 1.00 26.39 ? 123 PRO A N   1 
ATOM   734  C  CA  . PRO A 1 127 ? 8.458   30.985 65.299 1.00 25.27 ? 123 PRO A CA  1 
ATOM   735  C  C   . PRO A 1 127 ? 8.356   32.487 65.119 1.00 23.76 ? 123 PRO A C   1 
ATOM   736  O  O   . PRO A 1 127 ? 7.266   33.097 65.280 1.00 25.30 ? 123 PRO A O   1 
ATOM   737  C  CB  . PRO A 1 127 ? 7.935   30.285 64.030 1.00 25.81 ? 123 PRO A CB  1 
ATOM   738  C  CG  . PRO A 1 127 ? 6.453   30.130 64.313 1.00 28.72 ? 123 PRO A CG  1 
ATOM   739  C  CD  . PRO A 1 127 ? 6.420   29.754 65.775 1.00 26.99 ? 123 PRO A CD  1 
ATOM   740  N  N   . HIS A 1 128 ? 9.498   33.113 64.854 1.00 22.05 ? 124 HIS A N   1 
ATOM   741  C  CA  . HIS A 1 128 ? 9.509   34.542 64.545 1.00 21.84 ? 124 HIS A CA  1 
ATOM   742  C  C   . HIS A 1 128 ? 10.713  34.815 63.661 1.00 20.11 ? 124 HIS A C   1 
ATOM   743  O  O   . HIS A 1 128 ? 11.499  33.890 63.393 1.00 20.54 ? 124 HIS A O   1 
ATOM   744  C  CB  . HIS A 1 128 ? 9.574   35.429 65.796 1.00 24.10 ? 124 HIS A CB  1 
ATOM   745  C  CG  . HIS A 1 128 ? 10.855  35.353 66.575 1.00 25.86 ? 124 HIS A CG  1 
ATOM   746  N  ND1 . HIS A 1 128 ? 11.911  36.228 66.377 1.00 32.55 ? 124 HIS A ND1 1 
ATOM   747  C  CD2 . HIS A 1 128 ? 11.208  34.589 67.645 1.00 30.63 ? 124 HIS A CD2 1 
ATOM   748  C  CE1 . HIS A 1 128 ? 12.868  35.987 67.269 1.00 32.16 ? 124 HIS A CE1 1 
ATOM   749  N  NE2 . HIS A 1 128 ? 12.472  34.992 68.043 1.00 34.53 ? 124 HIS A NE2 1 
ATOM   750  N  N   . TYR A 1 129 ? 10.852  36.060 63.210 1.00 18.08 ? 125 TYR A N   1 
ATOM   751  C  CA  . TYR A 1 129 ? 12.049  36.499 62.477 1.00 18.25 ? 125 TYR A CA  1 
ATOM   752  C  C   . TYR A 1 129 ? 12.726  37.433 63.491 1.00 19.79 ? 125 TYR A C   1 
ATOM   753  O  O   . TYR A 1 129 ? 12.070  38.328 64.031 1.00 20.57 ? 125 TYR A O   1 
ATOM   754  C  CB  . TYR A 1 129 ? 11.717  37.322 61.247 1.00 19.87 ? 125 TYR A CB  1 
ATOM   755  C  CG  . TYR A 1 129 ? 11.078  36.457 60.211 1.00 16.92 ? 125 TYR A CG  1 
ATOM   756  C  CD1 . TYR A 1 129 ? 11.853  35.733 59.309 1.00 16.33 ? 125 TYR A CD1 1 
ATOM   757  C  CD2 . TYR A 1 129 ? 9.683   36.391 60.128 1.00 16.53 ? 125 TYR A CD2 1 
ATOM   758  C  CE1 . TYR A 1 129 ? 11.221  34.896 58.333 1.00 16.40 ? 125 TYR A CE1 1 
ATOM   759  C  CE2 . TYR A 1 129 ? 9.044   35.580 59.170 1.00 16.30 ? 125 TYR A CE2 1 
ATOM   760  C  CZ  . TYR A 1 129 ? 9.832   34.838 58.290 1.00 17.31 ? 125 TYR A CZ  1 
ATOM   761  O  OH  . TYR A 1 129 ? 9.229   34.029 57.327 1.00 19.06 ? 125 TYR A OH  1 
ATOM   762  N  N   . GLY A 1 130 ? 14.015  37.278 63.701 1.00 18.91 ? 126 GLY A N   1 
ATOM   763  C  CA  . GLY A 1 130 ? 14.629  38.184 64.687 1.00 19.55 ? 126 GLY A CA  1 
ATOM   764  C  C   . GLY A 1 130 ? 16.116  38.221 64.647 1.00 18.93 ? 126 GLY A C   1 
ATOM   765  O  O   . GLY A 1 130 ? 16.769  37.482 63.883 1.00 16.89 ? 126 GLY A O   1 
ATOM   766  N  N   . ALA A 1 131 ? 16.646  39.103 65.508 1.00 18.37 ? 127 ALA A N   1 
ATOM   767  C  CA  . ALA A 1 131 ? 18.066  39.217 65.613 1.00 18.24 ? 127 ALA A CA  1 
ATOM   768  C  C   . ALA A 1 131 ? 18.479  39.857 66.912 1.00 17.46 ? 127 ALA A C   1 
ATOM   769  O  O   . ALA A 1 131 ? 17.767  40.721 67.431 1.00 19.08 ? 127 ALA A O   1 
ATOM   770  C  CB  . ALA A 1 131 ? 18.578  40.100 64.440 1.00 19.11 ? 127 ALA A CB  1 
ATOM   771  N  N   . ASN A 1 132 ? 19.632  39.435 67.414 1.00 17.65 ? 128 ASN A N   1 
ATOM   772  C  CA  . ASN A 1 132 ? 20.242  40.145 68.549 1.00 17.38 ? 128 ASN A CA  1 
ATOM   773  C  C   . ASN A 1 132 ? 20.800  41.363 67.815 1.00 17.51 ? 128 ASN A C   1 
ATOM   774  O  O   . ASN A 1 132 ? 21.311  41.244 66.695 1.00 18.20 ? 128 ASN A O   1 
ATOM   775  C  CB  . ASN A 1 132 ? 21.417  39.387 69.168 1.00 17.56 ? 128 ASN A CB  1 
ATOM   776  C  CG  . ASN A 1 132 ? 20.975  38.412 70.241 1.00 17.66 ? 128 ASN A CG  1 
ATOM   777  O  OD1 . ASN A 1 132 ? 19.759  38.343 70.597 1.00 17.10 ? 128 ASN A OD1 1 
ATOM   778  N  ND2 . ASN A 1 132 ? 21.943  37.701 70.799 1.00 18.75 ? 128 ASN A ND2 1 
ATOM   779  N  N   A VAL A 1 133 ? 20.823  42.516 68.480 0.50 17.41 ? 129 VAL A N   1 
ATOM   780  N  N   B VAL A 1 133 ? 20.698  42.541 68.441 0.50 17.55 ? 129 VAL A N   1 
ATOM   781  C  CA  A VAL A 1 133 ? 21.386  43.692 67.842 0.50 17.66 ? 129 VAL A CA  1 
ATOM   782  C  CA  B VAL A 1 133 ? 21.157  43.778 67.819 0.50 18.12 ? 129 VAL A CA  1 
ATOM   783  C  C   A VAL A 1 133 ? 22.058  44.601 68.864 0.50 17.90 ? 129 VAL A C   1 
ATOM   784  C  C   B VAL A 1 133 ? 21.835  44.742 68.821 0.50 18.02 ? 129 VAL A C   1 
ATOM   785  O  O   A VAL A 1 133 ? 21.927  44.420 70.093 0.50 17.15 ? 129 VAL A O   1 
ATOM   786  O  O   B VAL A 1 133 ? 21.511  44.705 70.023 0.50 17.10 ? 129 VAL A O   1 
ATOM   787  C  CB  A VAL A 1 133 ? 20.304  44.565 67.136 0.50 18.30 ? 129 VAL A CB  1 
ATOM   788  C  CB  B VAL A 1 133 ? 19.924  44.579 67.241 0.50 18.45 ? 129 VAL A CB  1 
ATOM   789  C  CG1 A VAL A 1 133 ? 19.662  43.855 65.948 0.50 19.62 ? 129 VAL A CG1 1 
ATOM   790  C  CG1 B VAL A 1 133 ? 20.412  45.769 66.419 0.50 19.28 ? 129 VAL A CG1 1 
ATOM   791  C  CG2 A VAL A 1 133 ? 19.257  45.082 68.151 0.50 13.01 ? 129 VAL A CG2 1 
ATOM   792  C  CG2 B VAL A 1 133 ? 18.930  43.691 66.427 0.50 17.94 ? 129 VAL A CG2 1 
ATOM   793  N  N   . LYS A 1 134 ? 22.752  45.592 68.323 1.00 18.35 ? 130 LYS A N   1 
ATOM   794  C  CA  . LYS A 1 134 ? 23.374  46.658 69.123 1.00 19.85 ? 130 LYS A CA  1 
ATOM   795  C  C   . LYS A 1 134 ? 22.779  47.953 68.529 1.00 21.23 ? 130 LYS A C   1 
ATOM   796  O  O   . LYS A 1 134 ? 22.593  48.053 67.300 1.00 22.27 ? 130 LYS A O   1 
ATOM   797  C  CB  . LYS A 1 134 ? 24.888  46.736 68.963 1.00 21.12 ? 130 LYS A CB  1 
ATOM   798  C  CG  . LYS A 1 134 ? 25.667  45.593 69.569 1.00 24.46 ? 130 LYS A CG  1 
ATOM   799  C  CD  . LYS A 1 134 ? 27.117  45.997 69.832 1.00 28.89 ? 130 LYS A CD  1 
ATOM   800  C  CE  . LYS A 1 134 ? 27.819  46.361 68.560 1.00 29.06 ? 130 LYS A CE  1 
ATOM   801  N  NZ  . LYS A 1 134 ? 29.268  46.584 68.797 1.00 24.21 ? 130 LYS A NZ  1 
ATOM   802  N  N   . PHE A 1 135 ? 22.421  48.924 69.360 1.00 17.66 ? 131 PHE A N   1 
ATOM   803  C  CA  . PHE A 1 135 ? 21.965  50.226 68.840 1.00 18.34 ? 131 PHE A CA  1 
ATOM   804  C  C   . PHE A 1 135 ? 23.285  51.020 68.775 1.00 19.24 ? 131 PHE A C   1 
ATOM   805  O  O   . PHE A 1 135 ? 23.811  51.507 69.804 1.00 18.69 ? 131 PHE A O   1 
ATOM   806  C  CB  . PHE A 1 135 ? 20.920  50.861 69.743 1.00 18.64 ? 131 PHE A CB  1 
ATOM   807  C  CG  . PHE A 1 135 ? 19.612  50.291 69.569 1.00 19.40 ? 131 PHE A CG  1 
ATOM   808  C  CD1 . PHE A 1 135 ? 18.790  50.756 68.556 1.00 18.13 ? 131 PHE A CD1 1 
ATOM   809  C  CD2 . PHE A 1 135 ? 19.176  49.250 70.393 1.00 21.57 ? 131 PHE A CD2 1 
ATOM   810  C  CE1 . PHE A 1 135 ? 17.507  50.213 68.360 1.00 20.98 ? 131 PHE A CE1 1 
ATOM   811  C  CE2 . PHE A 1 135 ? 17.867  48.741 70.226 1.00 21.49 ? 131 PHE A CE2 1 
ATOM   812  C  CZ  . PHE A 1 135 ? 17.069  49.223 69.197 1.00 22.04 ? 131 PHE A CZ  1 
ATOM   813  N  N   . GLU A 1 136 ? 23.869  51.055 67.574 1.00 18.88 ? 132 GLU A N   1 
ATOM   814  C  CA  . GLU A 1 136 ? 25.196  51.620 67.366 1.00 20.30 ? 132 GLU A CA  1 
ATOM   815  C  C   . GLU A 1 136 ? 25.449  53.061 67.737 1.00 19.66 ? 132 GLU A C   1 
ATOM   816  O  O   . GLU A 1 136 ? 26.596  53.403 68.035 1.00 20.08 ? 132 GLU A O   1 
ATOM   817  C  CB  . GLU A 1 136 ? 25.704  51.314 65.957 1.00 19.77 ? 132 GLU A CB  1 
ATOM   818  C  CG  . GLU A 1 136 ? 25.981  49.817 65.756 1.00 21.61 ? 132 GLU A CG  1 
ATOM   819  C  CD  . GLU A 1 136 ? 26.273  49.440 64.313 1.00 24.76 ? 132 GLU A CD  1 
ATOM   820  O  OE1 . GLU A 1 136 ? 26.465  50.345 63.456 1.00 29.54 ? 132 GLU A OE1 1 
ATOM   821  O  OE2 . GLU A 1 136 ? 26.282  48.219 64.044 1.00 30.03 ? 132 GLU A OE2 1 
ATOM   822  N  N   . GLU A 1 137 ? 24.401  53.884 67.714 1.00 19.77 ? 133 GLU A N   1 
ATOM   823  C  CA  . GLU A 1 137 ? 24.578  55.288 68.091 1.00 20.54 ? 133 GLU A CA  1 
ATOM   824  C  C   . GLU A 1 137 ? 24.030  55.596 69.486 1.00 20.00 ? 133 GLU A C   1 
ATOM   825  O  O   . GLU A 1 137 ? 23.774  56.748 69.799 1.00 20.64 ? 133 GLU A O   1 
ATOM   826  C  CB  . GLU A 1 137 ? 24.064  56.240 67.004 1.00 19.93 ? 133 GLU A CB  1 
ATOM   827  C  CG  . GLU A 1 137 ? 24.978  56.179 65.786 1.00 24.52 ? 133 GLU A CG  1 
ATOM   828  C  CD  . GLU A 1 137 ? 24.737  57.302 64.815 1.00 28.28 ? 133 GLU A CD  1 
ATOM   829  O  OE1 . GLU A 1 137 ? 23.688  57.295 64.156 1.00 33.60 ? 133 GLU A OE1 1 
ATOM   830  O  OE2 . GLU A 1 137 ? 25.598  58.205 64.716 1.00 28.40 ? 133 GLU A OE2 1 
ATOM   831  N  N   . GLY A 1 138 ? 23.902  54.553 70.313 1.00 18.46 ? 134 GLY A N   1 
ATOM   832  C  CA  . GLY A 1 138 ? 23.504  54.665 71.701 1.00 18.28 ? 134 GLY A CA  1 
ATOM   833  C  C   . GLY A 1 138 ? 22.061  55.022 71.994 1.00 17.47 ? 134 GLY A C   1 
ATOM   834  O  O   . GLY A 1 138 ? 21.183  54.898 71.138 1.00 16.19 ? 134 GLY A O   1 
ATOM   835  N  N   . LEU A 1 139 ? 21.846  55.445 73.237 1.00 17.51 ? 135 LEU A N   1 
ATOM   836  C  CA  . LEU A 1 139 ? 20.490  55.769 73.707 1.00 17.44 ? 135 LEU A CA  1 
ATOM   837  C  C   . LEU A 1 139 ? 19.890  56.896 72.907 1.00 16.26 ? 135 LEU A C   1 
ATOM   838  O  O   . LEU A 1 139 ? 20.588  57.879 72.563 1.00 17.40 ? 135 LEU A O   1 
ATOM   839  C  CB  . LEU A 1 139 ? 20.556  56.195 75.184 1.00 17.39 ? 135 LEU A CB  1 
ATOM   840  C  CG  . LEU A 1 139 ? 21.183  55.160 76.123 1.00 18.90 ? 135 LEU A CG  1 
ATOM   841  C  CD1 . LEU A 1 139 ? 21.502  55.778 77.512 1.00 21.68 ? 135 LEU A CD1 1 
ATOM   842  C  CD2 . LEU A 1 139 ? 20.266  53.962 76.291 1.00 19.53 ? 135 LEU A CD2 1 
ATOM   843  N  N   . GLY A 1 140 ? 18.606  56.779 72.648 1.00 16.97 ? 136 GLY A N   1 
ATOM   844  C  CA  . GLY A 1 140 ? 17.932  57.842 71.923 1.00 16.49 ? 136 GLY A CA  1 
ATOM   845  C  C   . GLY A 1 140 ? 16.744  57.341 71.130 1.00 17.26 ? 136 GLY A C   1 
ATOM   846  O  O   . GLY A 1 140 ? 16.331  56.186 71.291 1.00 17.13 ? 136 GLY A O   1 
ATOM   847  N  N   . THR A 1 141 ? 16.237  58.228 70.273 1.00 15.61 ? 137 THR A N   1 
ATOM   848  C  CA  . THR A 1 141 ? 15.089  57.920 69.434 1.00 16.32 ? 137 THR A CA  1 
ATOM   849  C  C   . THR A 1 141 ? 15.584  57.464 68.069 1.00 16.27 ? 137 THR A C   1 
ATOM   850  O  O   . THR A 1 141 ? 16.459  58.111 67.473 1.00 15.95 ? 137 THR A O   1 
ATOM   851  C  CB  . THR A 1 141 ? 14.238  59.185 69.239 1.00 17.91 ? 137 THR A CB  1 
ATOM   852  O  OG1 . THR A 1 141 ? 14.061  59.856 70.496 1.00 18.40 ? 137 THR A OG1 1 
ATOM   853  C  CG2 . THR A 1 141 ? 12.887  58.793 68.630 1.00 17.34 ? 137 THR A CG2 1 
ATOM   854  N  N   . TYR A 1 142 ? 15.055  56.326 67.610 1.00 16.53 ? 138 TYR A N   1 
ATOM   855  C  CA  . TYR A 1 142 ? 15.415  55.772 66.318 1.00 16.42 ? 138 TYR A CA  1 
ATOM   856  C  C   . TYR A 1 142 ? 14.214  55.564 65.426 1.00 17.12 ? 138 TYR A C   1 
ATOM   857  O  O   . TYR A 1 142 ? 13.138  55.260 65.917 1.00 17.75 ? 138 TYR A O   1 
ATOM   858  C  CB  . TYR A 1 142 ? 15.988  54.353 66.530 1.00 17.39 ? 138 TYR A CB  1 
ATOM   859  C  CG  . TYR A 1 142 ? 17.382  54.338 67.073 1.00 14.73 ? 138 TYR A CG  1 
ATOM   860  C  CD1 . TYR A 1 142 ? 17.649  54.618 68.423 1.00 15.60 ? 138 TYR A CD1 1 
ATOM   861  C  CD2 . TYR A 1 142 ? 18.464  54.067 66.234 1.00 14.80 ? 138 TYR A CD2 1 
ATOM   862  C  CE1 . TYR A 1 142 ? 18.975  54.617 68.934 1.00 15.77 ? 138 TYR A CE1 1 
ATOM   863  C  CE2 . TYR A 1 142 ? 19.795  54.075 66.726 1.00 17.15 ? 138 TYR A CE2 1 
ATOM   864  C  CZ  . TYR A 1 142 ? 20.039  54.342 68.072 1.00 16.76 ? 138 TYR A CZ  1 
ATOM   865  O  OH  . TYR A 1 142 ? 21.369  54.323 68.523 1.00 16.78 ? 138 TYR A OH  1 
ATOM   866  N  N   . LYS A 1 143 ? 14.418  55.644 64.109 1.00 17.39 ? 139 LYS A N   1 
ATOM   867  C  CA  . LYS A 1 143 ? 13.405  55.256 63.158 1.00 18.14 ? 139 LYS A CA  1 
ATOM   868  C  C   . LYS A 1 143 ? 13.764  53.764 62.991 1.00 18.03 ? 139 LYS A C   1 
ATOM   869  O  O   . LYS A 1 143 ? 14.966  53.410 62.892 1.00 17.62 ? 139 LYS A O   1 
ATOM   870  C  CB  . LYS A 1 143 ? 13.553  55.972 61.806 1.00 18.42 ? 139 LYS A CB  1 
ATOM   871  C  CG  . LYS A 1 143 ? 12.568  55.444 60.737 1.00 24.21 ? 139 LYS A CG  1 
ATOM   872  C  CD  . LYS A 1 143 ? 12.436  56.362 59.528 1.00 24.14 ? 139 LYS A CD  1 
ATOM   873  C  CE  . LYS A 1 143 ? 11.655  55.608 58.403 1.00 29.21 ? 139 LYS A CE  1 
ATOM   874  N  NZ  . LYS A 1 143 ? 11.495  56.311 57.043 1.00 32.43 ? 139 LYS A NZ  1 
ATOM   875  N  N   . VAL A 1 144 ? 12.760  52.887 63.051 1.00 17.12 ? 140 VAL A N   1 
ATOM   876  C  CA  . VAL A 1 144 ? 12.951  51.427 62.897 1.00 16.53 ? 140 VAL A CA  1 
ATOM   877  C  C   . VAL A 1 144 ? 12.059  50.986 61.741 1.00 17.60 ? 140 VAL A C   1 
ATOM   878  O  O   . VAL A 1 144 ? 10.838  51.190 61.738 1.00 18.24 ? 140 VAL A O   1 
ATOM   879  C  CB  . VAL A 1 144 ? 12.586  50.602 64.188 1.00 16.80 ? 140 VAL A CB  1 
ATOM   880  C  CG1 . VAL A 1 144 ? 12.649  49.085 63.942 1.00 18.49 ? 140 VAL A CG1 1 
ATOM   881  C  CG2 . VAL A 1 144 ? 13.459  50.987 65.368 1.00 16.69 ? 140 VAL A CG2 1 
ATOM   882  N  N   . ARG A 1 145 ? 12.691  50.417 60.728 1.00 17.43 ? 141 ARG A N   1 
ATOM   883  C  CA  . ARG A 1 145 ? 11.968  49.988 59.539 1.00 18.00 ? 141 ARG A CA  1 
ATOM   884  C  C   . ARG A 1 145 ? 12.211  48.523 59.256 1.00 18.41 ? 141 ARG A C   1 
ATOM   885  O  O   . ARG A 1 145 ? 13.381  48.106 59.191 1.00 18.83 ? 141 ARG A O   1 
ATOM   886  C  CB  . ARG A 1 145 ? 12.498  50.829 58.346 1.00 17.18 ? 141 ARG A CB  1 
ATOM   887  C  CG  . ARG A 1 145 ? 12.011  50.449 56.960 1.00 20.18 ? 141 ARG A CG  1 
ATOM   888  C  CD  . ARG A 1 145 ? 12.578  51.516 55.998 1.00 21.75 ? 141 ARG A CD  1 
ATOM   889  N  NE  . ARG A 1 145 ? 12.277  51.302 54.589 1.00 26.93 ? 141 ARG A NE  1 
ATOM   890  C  CZ  . ARG A 1 145 ? 11.435  52.050 53.886 1.00 26.93 ? 141 ARG A CZ  1 
ATOM   891  N  NH1 . ARG A 1 145 ? 10.828  53.079 54.463 1.00 28.91 ? 141 ARG A NH1 1 
ATOM   892  N  NH2 . ARG A 1 145 ? 11.221  51.786 52.596 1.00 28.95 ? 141 ARG A NH2 1 
ATOM   893  N  N   . PHE A 1 146 ? 11.138  47.738 59.058 1.00 17.44 ? 142 PHE A N   1 
ATOM   894  C  CA  . PHE A 1 146 ? 11.317  46.354 58.684 1.00 17.58 ? 142 PHE A CA  1 
ATOM   895  C  C   . PHE A 1 146 ? 10.918  46.295 57.200 1.00 18.04 ? 142 PHE A C   1 
ATOM   896  O  O   . PHE A 1 146 ? 9.829   46.775 56.840 1.00 17.87 ? 142 PHE A O   1 
ATOM   897  C  CB  . PHE A 1 146 ? 10.352  45.400 59.389 1.00 17.35 ? 142 PHE A CB  1 
ATOM   898  C  CG  . PHE A 1 146 ? 10.571  45.250 60.874 1.00 17.46 ? 142 PHE A CG  1 
ATOM   899  C  CD1 . PHE A 1 146 ? 11.755  45.670 61.494 1.00 16.73 ? 142 PHE A CD1 1 
ATOM   900  C  CD2 . PHE A 1 146 ? 9.603   44.625 61.652 1.00 20.07 ? 142 PHE A CD2 1 
ATOM   901  C  CE1 . PHE A 1 146 ? 11.923  45.502 62.888 1.00 20.68 ? 142 PHE A CE1 1 
ATOM   902  C  CE2 . PHE A 1 146 ? 9.756   44.456 62.986 1.00 19.87 ? 142 PHE A CE2 1 
ATOM   903  C  CZ  . PHE A 1 146 ? 10.915  44.855 63.619 1.00 17.95 ? 142 PHE A CZ  1 
ATOM   904  N  N   . GLU A 1 147 ? 11.776  45.715 56.367 1.00 16.77 ? 143 GLU A N   1 
ATOM   905  C  CA  . GLU A 1 147 ? 11.474  45.528 54.946 1.00 16.65 ? 143 GLU A CA  1 
ATOM   906  C  C   . GLU A 1 147 ? 11.312  44.017 54.816 1.00 16.72 ? 143 GLU A C   1 
ATOM   907  O  O   . GLU A 1 147 ? 12.207  43.238 55.203 1.00 16.77 ? 143 GLU A O   1 
ATOM   908  C  CB  . GLU A 1 147 ? 12.572  46.033 54.029 1.00 17.99 ? 143 GLU A CB  1 
ATOM   909  C  CG  . GLU A 1 147 ? 12.699  47.563 54.133 1.00 20.07 ? 143 GLU A CG  1 
ATOM   910  C  CD  . GLU A 1 147 ? 13.529  48.184 53.003 1.00 25.83 ? 143 GLU A CD  1 
ATOM   911  O  OE1 . GLU A 1 147 ? 14.179  47.441 52.218 1.00 27.81 ? 143 GLU A OE1 1 
ATOM   912  O  OE2 . GLU A 1 147 ? 13.525  49.429 52.918 1.00 25.68 ? 143 GLU A OE2 1 
ATOM   913  N  N   . ILE A 1 148 ? 10.172  43.613 54.275 1.00 16.71 ? 144 ILE A N   1 
ATOM   914  C  CA  . ILE A 1 148 ? 9.870   42.207 54.214 1.00 15.98 ? 144 ILE A CA  1 
ATOM   915  C  C   . ILE A 1 148 ? 9.700   41.737 52.762 1.00 17.11 ? 144 ILE A C   1 
ATOM   916  O  O   . ILE A 1 148 ? 8.733   42.135 52.091 1.00 17.14 ? 144 ILE A O   1 
ATOM   917  C  CB  . ILE A 1 148 ? 8.554   41.949 55.010 1.00 16.37 ? 144 ILE A CB  1 
ATOM   918  C  CG1 . ILE A 1 148 ? 8.675   42.486 56.454 1.00 16.73 ? 144 ILE A CG1 1 
ATOM   919  C  CG2 . ILE A 1 148 ? 8.195   40.451 54.929 1.00 17.65 ? 144 ILE A CG2 1 
ATOM   920  C  CD1 . ILE A 1 148 ? 7.358   42.760 57.133 1.00 18.78 ? 144 ILE A CD1 1 
ATOM   921  N  N   . ALA A 1 149 ? 10.639  40.931 52.296 1.00 15.36 ? 145 ALA A N   1 
ATOM   922  C  CA  . ALA A 1 149 ? 10.614  40.414 50.922 1.00 16.19 ? 145 ALA A CA  1 
ATOM   923  C  C   . ALA A 1 149 ? 9.960   39.059 50.917 1.00 15.47 ? 145 ALA A C   1 
ATOM   924  O  O   . ALA A 1 149 ? 10.085  38.247 51.899 1.00 15.58 ? 145 ALA A O   1 
ATOM   925  C  CB  . ALA A 1 149 ? 12.013  40.279 50.362 1.00 16.59 ? 145 ALA A CB  1 
ATOM   926  N  N   . ALA A 1 150 ? 9.304   38.764 49.790 1.00 15.04 ? 146 ALA A N   1 
ATOM   927  C  CA  . ALA A 1 150 ? 8.661   37.470 49.627 1.00 15.52 ? 146 ALA A CA  1 
ATOM   928  C  C   . ALA A 1 150 ? 9.786   36.412 49.545 1.00 16.47 ? 146 ALA A C   1 
ATOM   929  O  O   . ALA A 1 150 ? 10.963  36.747 49.361 1.00 17.24 ? 146 ALA A O   1 
ATOM   930  C  CB  . ALA A 1 150 ? 7.834   37.426 48.290 1.00 16.18 ? 146 ALA A CB  1 
ATOM   931  N  N   . PRO A 1 151 ? 9.416   35.114 49.534 1.00 17.98 ? 147 PRO A N   1 
ATOM   932  C  CA  . PRO A 1 151 ? 10.497  34.108 49.411 1.00 19.25 ? 147 PRO A CA  1 
ATOM   933  C  C   . PRO A 1 151 ? 11.270  34.225 48.117 1.00 20.17 ? 147 PRO A C   1 
ATOM   934  O  O   . PRO A 1 151 ? 10.693  34.633 47.078 1.00 20.14 ? 147 PRO A O   1 
ATOM   935  C  CB  . PRO A 1 151 ? 9.731   32.781 49.384 1.00 18.94 ? 147 PRO A CB  1 
ATOM   936  C  CG  . PRO A 1 151 ? 8.425   33.072 50.151 1.00 18.87 ? 147 PRO A CG  1 
ATOM   937  C  CD  . PRO A 1 151 ? 8.083   34.514 49.730 1.00 16.95 ? 147 PRO A CD  1 
ATOM   938  N  N   . SER A 1 152 ? 12.545  33.848 48.160 1.00 21.82 ? 148 SER A N   1 
ATOM   939  C  CA  . SER A 1 152 ? 13.367  33.820 46.949 1.00 23.30 ? 148 SER A CA  1 
ATOM   940  C  C   . SER A 1 152 ? 12.690  32.899 45.940 1.00 23.39 ? 148 SER A C   1 
ATOM   941  O  O   . SER A 1 152 ? 11.943  31.966 46.294 1.00 22.17 ? 148 SER A O   1 
ATOM   942  C  CB  . SER A 1 152 ? 14.754  33.259 47.251 1.00 24.35 ? 148 SER A CB  1 
ATOM   943  O  OG  . SER A 1 152 ? 15.396  34.085 48.190 1.00 30.45 ? 148 SER A OG  1 
ATOM   944  N  N   . HIS A 1 153 ? 12.959  33.194 44.677 1.00 24.32 ? 149 HIS A N   1 
ATOM   945  C  CA  . HIS A 1 153 ? 12.380  32.495 43.556 1.00 26.33 ? 149 HIS A CA  1 
ATOM   946  C  C   . HIS A 1 153 ? 12.371  30.976 43.706 1.00 26.45 ? 149 HIS A C   1 
ATOM   947  O  O   . HIS A 1 153 ? 11.323  30.347 43.550 1.00 27.55 ? 149 HIS A O   1 
ATOM   948  C  CB  . HIS A 1 153 ? 13.126  32.920 42.287 1.00 26.26 ? 149 HIS A CB  1 
ATOM   949  C  CG  . HIS A 1 153 ? 12.477  32.478 41.017 1.00 30.18 ? 149 HIS A CG  1 
ATOM   950  N  ND1 . HIS A 1 153 ? 12.774  31.276 40.409 1.00 33.12 ? 149 HIS A ND1 1 
ATOM   951  C  CD2 . HIS A 1 153 ? 11.551  33.080 40.232 1.00 32.24 ? 149 HIS A CD2 1 
ATOM   952  C  CE1 . HIS A 1 153 ? 12.066  31.160 39.297 1.00 33.39 ? 149 HIS A CE1 1 
ATOM   953  N  NE2 . HIS A 1 153 ? 11.313  32.238 39.167 1.00 34.22 ? 149 HIS A NE2 1 
ATOM   954  N  N   . ASP A 1 154 ? 13.527  30.403 44.047 1.00 26.45 ? 150 ASP A N   1 
ATOM   955  C  CA  . ASP A 1 154 ? 13.655  28.947 44.173 1.00 27.43 ? 150 ASP A CA  1 
ATOM   956  C  C   . ASP A 1 154 ? 13.305  28.345 45.525 1.00 25.87 ? 150 ASP A C   1 
ATOM   957  O  O   . ASP A 1 154 ? 13.559  27.164 45.736 1.00 26.69 ? 150 ASP A O   1 
ATOM   958  C  CB  . ASP A 1 154 ? 15.093  28.522 43.818 1.00 28.45 ? 150 ASP A CB  1 
ATOM   959  C  CG  . ASP A 1 154 ? 15.516  28.925 42.393 1.00 32.56 ? 150 ASP A CG  1 
ATOM   960  O  OD1 . ASP A 1 154 ? 14.648  29.060 41.491 1.00 39.33 ? 150 ASP A OD1 1 
ATOM   961  O  OD2 . ASP A 1 154 ? 16.739  29.074 42.166 1.00 38.71 ? 150 ASP A OD2 1 
ATOM   962  N  N   . GLU A 1 155 ? 12.761  29.127 46.452 1.00 24.51 ? 151 GLU A N   1 
ATOM   963  C  CA  . GLU A 1 155 ? 12.487  28.613 47.794 1.00 23.94 ? 151 GLU A CA  1 
ATOM   964  C  C   . GLU A 1 155 ? 11.022  28.350 48.150 1.00 22.86 ? 151 GLU A C   1 
ATOM   965  O  O   . GLU A 1 155 ? 10.726  27.805 49.222 1.00 23.09 ? 151 GLU A O   1 
ATOM   966  C  CB  . GLU A 1 155 ? 13.117  29.565 48.838 1.00 25.22 ? 151 GLU A CB  1 
ATOM   967  C  CG  . GLU A 1 155 ? 14.672  29.778 48.671 1.00 31.34 ? 151 GLU A CG  1 
ATOM   968  C  CD  . GLU A 1 155 ? 15.499  28.491 48.720 1.00 38.83 ? 151 GLU A CD  1 
ATOM   969  O  OE1 . GLU A 1 155 ? 15.231  27.631 49.592 1.00 41.61 ? 151 GLU A OE1 1 
ATOM   970  O  OE2 . GLU A 1 155 ? 16.441  28.344 47.895 1.00 41.49 ? 151 GLU A OE2 1 
ATOM   971  N  N   . TYR A 1 156 ? 10.100  28.756 47.276 1.00 19.30 ? 152 TYR A N   1 
ATOM   972  C  CA  . TYR A 1 156 ? 8.689   28.556 47.577 1.00 18.58 ? 152 TYR A CA  1 
ATOM   973  C  C   . TYR A 1 156 ? 7.893   28.649 46.294 1.00 18.13 ? 152 TYR A C   1 
ATOM   974  O  O   . TYR A 1 156 ? 8.313   29.342 45.355 1.00 18.57 ? 152 TYR A O   1 
ATOM   975  C  CB  . TYR A 1 156 ? 8.203   29.624 48.581 1.00 17.58 ? 152 TYR A CB  1 
ATOM   976  C  CG  . TYR A 1 156 ? 7.086   29.126 49.472 1.00 18.90 ? 152 TYR A CG  1 
ATOM   977  C  CD1 . TYR A 1 156 ? 7.387   28.302 50.550 1.00 18.68 ? 152 TYR A CD1 1 
ATOM   978  C  CD2 . TYR A 1 156 ? 5.752   29.426 49.209 1.00 18.16 ? 152 TYR A CD2 1 
ATOM   979  C  CE1 . TYR A 1 156 ? 6.400   27.804 51.394 1.00 20.90 ? 152 TYR A CE1 1 
ATOM   980  C  CE2 . TYR A 1 156 ? 4.718   28.935 50.039 1.00 19.30 ? 152 TYR A CE2 1 
ATOM   981  C  CZ  . TYR A 1 156 ? 5.074   28.129 51.166 1.00 19.63 ? 152 TYR A CZ  1 
ATOM   982  O  OH  . TYR A 1 156 ? 4.117   27.597 52.013 1.00 21.26 ? 152 TYR A OH  1 
ATOM   983  N  N   . SER A 1 157 ? 6.762   27.948 46.249 1.00 17.24 ? 153 SER A N   1 
ATOM   984  C  CA  . SER A 1 157 ? 5.895   28.008 45.071 1.00 16.66 ? 153 SER A CA  1 
ATOM   985  C  C   . SER A 1 157 ? 4.454   28.099 45.506 1.00 16.69 ? 153 SER A C   1 
ATOM   986  O  O   . SER A 1 157 ? 4.139   27.916 46.694 1.00 17.49 ? 153 SER A O   1 
ATOM   987  C  CB  . SER A 1 157 ? 6.127   26.752 44.192 1.00 17.83 ? 153 SER A CB  1 
ATOM   988  O  OG  . SER A 1 157 ? 7.489   26.656 43.825 1.00 19.50 ? 153 SER A OG  1 
ATOM   989  N  N   . LEU A 1 158 ? 3.593   28.442 44.544 1.00 15.54 ? 154 LEU A N   1 
ATOM   990  C  CA  . LEU A 1 158 ? 2.153   28.500 44.731 1.00 16.16 ? 154 LEU A CA  1 
ATOM   991  C  C   . LEU A 1 158 ? 1.527   27.584 43.702 1.00 17.39 ? 154 LEU A C   1 
ATOM   992  O  O   . LEU A 1 158 ? 1.986   27.574 42.542 1.00 16.27 ? 154 LEU A O   1 
ATOM   993  C  CB  . LEU A 1 158 ? 1.633   29.924 44.419 1.00 17.19 ? 154 LEU A CB  1 
ATOM   994  C  CG  . LEU A 1 158 ? 2.136   30.999 45.395 1.00 15.75 ? 154 LEU A CG  1 
ATOM   995  C  CD1 . LEU A 1 158 ? 1.593   32.332 44.893 1.00 18.89 ? 154 LEU A CD1 1 
ATOM   996  C  CD2 . LEU A 1 158 ? 1.719   30.666 46.879 1.00 17.52 ? 154 LEU A CD2 1 
ATOM   997  N  N   . HIS A 1 159 ? 0.446   26.875 44.073 1.00 16.08 ? 155 HIS A N   1 
ATOM   998  C  CA  . HIS A 1 159 ? -0.316  26.101 43.082 1.00 16.12 ? 155 HIS A CA  1 
ATOM   999  C  C   . HIS A 1 159 ? -1.126  27.207 42.371 1.00 16.81 ? 155 HIS A C   1 
ATOM   1000 O  O   . HIS A 1 159 ? -1.752  28.067 43.038 1.00 16.54 ? 155 HIS A O   1 
ATOM   1001 C  CB  . HIS A 1 159 ? -1.362  25.232 43.741 1.00 16.08 ? 155 HIS A CB  1 
ATOM   1002 C  CG  . HIS A 1 159 ? -0.827  24.015 44.420 1.00 17.84 ? 155 HIS A CG  1 
ATOM   1003 N  ND1 . HIS A 1 159 ? -1.550  22.845 44.488 1.00 17.93 ? 155 HIS A ND1 1 
ATOM   1004 C  CD2 . HIS A 1 159 ? 0.343   23.778 45.058 1.00 20.08 ? 155 HIS A CD2 1 
ATOM   1005 C  CE1 . HIS A 1 159 ? -0.859  21.944 45.167 1.00 16.84 ? 155 HIS A CE1 1 
ATOM   1006 N  NE2 . HIS A 1 159 ? 0.291   22.486 45.533 1.00 18.43 ? 155 HIS A NE2 1 
ATOM   1007 N  N   . ILE A 1 160 ? -1.130  27.168 41.038 1.00 16.08 ? 156 ILE A N   1 
ATOM   1008 C  CA  . ILE A 1 160 ? -1.866  28.172 40.234 1.00 17.27 ? 156 ILE A CA  1 
ATOM   1009 C  C   . ILE A 1 160 ? -2.942  27.607 39.303 1.00 18.96 ? 156 ILE A C   1 
ATOM   1010 O  O   . ILE A 1 160 ? -3.596  28.362 38.586 1.00 17.12 ? 156 ILE A O   1 
ATOM   1011 C  CB  . ILE A 1 160 ? -0.897  29.116 39.513 1.00 17.38 ? 156 ILE A CB  1 
ATOM   1012 C  CG1 . ILE A 1 160 ? -0.058  28.335 38.490 1.00 18.30 ? 156 ILE A CG1 1 
ATOM   1013 C  CG2 . ILE A 1 160 ? -0.025  29.852 40.571 1.00 16.62 ? 156 ILE A CG2 1 
ATOM   1014 C  CD1 . ILE A 1 160 ? 0.629   29.273 37.433 1.00 18.53 ? 156 ILE A CD1 1 
ATOM   1015 N  N   . ASP A 1 161 ? -3.115  26.287 39.292 1.00 17.84 ? 157 ASP A N   1 
ATOM   1016 C  CA  . ASP A 1 161 ? -4.143  25.668 38.478 1.00 20.78 ? 157 ASP A CA  1 
ATOM   1017 C  C   . ASP A 1 161 ? -5.487  26.047 39.092 1.00 22.10 ? 157 ASP A C   1 
ATOM   1018 O  O   . ASP A 1 161 ? -5.598  26.272 40.291 1.00 22.74 ? 157 ASP A O   1 
ATOM   1019 C  CB  . ASP A 1 161 ? -3.999  24.130 38.452 1.00 19.89 ? 157 ASP A CB  1 
ATOM   1020 C  CG  . ASP A 1 161 ? -3.765  23.535 39.836 1.00 19.51 ? 157 ASP A CG  1 
ATOM   1021 O  OD1 . ASP A 1 161 ? -2.684  23.772 40.354 1.00 20.21 ? 157 ASP A OD1 1 
ATOM   1022 O  OD2 . ASP A 1 161 ? -4.650  22.822 40.369 1.00 21.44 ? 157 ASP A OD2 1 
ATOM   1023 N  N   . GLU A 1 162 ? -6.518  26.090 38.268 1.00 25.04 ? 158 GLU A N   1 
ATOM   1024 C  CA  . GLU A 1 162 ? -7.850  26.446 38.727 1.00 26.60 ? 158 GLU A CA  1 
ATOM   1025 C  C   . GLU A 1 162 ? -8.386  25.529 39.833 1.00 26.00 ? 158 GLU A C   1 
ATOM   1026 O  O   . GLU A 1 162 ? -8.934  26.004 40.828 1.00 26.26 ? 158 GLU A O   1 
ATOM   1027 C  CB  . GLU A 1 162 ? -8.808  26.460 37.520 1.00 28.33 ? 158 GLU A CB  1 
ATOM   1028 C  CG  . GLU A 1 162 ? -10.268 26.114 37.840 1.00 34.04 ? 158 GLU A CG  1 
ATOM   1029 C  CD  . GLU A 1 162 ? -11.070 27.330 38.316 1.00 39.55 ? 158 GLU A CD  1 
ATOM   1030 O  OE1 . GLU A 1 162 ? -10.460 28.373 38.648 1.00 42.80 ? 158 GLU A OE1 1 
ATOM   1031 O  OE2 . GLU A 1 162 ? -12.322 27.240 38.355 1.00 42.05 ? 158 GLU A OE2 1 
ATOM   1032 N  N   . GLN A 1 163 ? -8.174  24.225 39.703 1.00 24.97 ? 159 GLN A N   1 
ATOM   1033 C  CA  . GLN A 1 163 ? -8.698  23.279 40.688 1.00 24.53 ? 159 GLN A CA  1 
ATOM   1034 C  C   . GLN A 1 163 ? -8.138  23.322 42.131 1.00 24.23 ? 159 GLN A C   1 
ATOM   1035 O  O   . GLN A 1 163 ? -8.890  23.257 43.111 1.00 25.38 ? 159 GLN A O   1 
ATOM   1036 C  CB  . GLN A 1 163 ? -8.518  21.866 40.154 1.00 25.34 ? 159 GLN A CB  1 
ATOM   1037 C  CG  . GLN A 1 163 ? -9.254  20.821 40.955 1.00 30.15 ? 159 GLN A CG  1 
ATOM   1038 C  CD  . GLN A 1 163 ? -10.680 20.631 40.468 1.00 36.71 ? 159 GLN A CD  1 
ATOM   1039 O  OE1 . GLN A 1 163 ? -11.152 21.368 39.596 1.00 38.88 ? 159 GLN A OE1 1 
ATOM   1040 N  NE2 . GLN A 1 163 ? -11.377 19.640 41.036 1.00 37.57 ? 159 GLN A NE2 1 
ATOM   1041 N  N   . THR A 1 164 ? -6.824  23.364 42.253 1.00 21.28 ? 160 THR A N   1 
ATOM   1042 C  CA  . THR A 1 164 ? -6.188  23.321 43.571 1.00 20.68 ? 160 THR A CA  1 
ATOM   1043 C  C   . THR A 1 164 ? -5.486  24.622 43.930 1.00 20.23 ? 160 THR A C   1 
ATOM   1044 O  O   . THR A 1 164 ? -5.059  24.810 45.080 1.00 21.25 ? 160 THR A O   1 
ATOM   1045 C  CB  . THR A 1 164 ? -5.151  22.173 43.661 1.00 20.88 ? 160 THR A CB  1 
ATOM   1046 O  OG1 . THR A 1 164 ? -3.926  22.543 43.002 1.00 19.20 ? 160 THR A OG1 1 
ATOM   1047 C  CG2 . THR A 1 164 ? -5.704  20.863 43.059 1.00 19.55 ? 160 THR A CG2 1 
ATOM   1048 N  N   . GLY A 1 165 ? -5.369  25.511 42.942 1.00 20.03 ? 161 GLY A N   1 
ATOM   1049 C  CA  . GLY A 1 165 ? -4.623  26.761 43.151 1.00 19.12 ? 161 GLY A CA  1 
ATOM   1050 C  C   . GLY A 1 165 ? -5.185  27.951 43.901 1.00 20.22 ? 161 GLY A C   1 
ATOM   1051 O  O   . GLY A 1 165 ? -6.301  27.928 44.418 1.00 20.18 ? 161 GLY A O   1 
ATOM   1052 N  N   . VAL A 1 166 ? -4.363  28.997 43.935 1.00 18.30 ? 162 VAL A N   1 
ATOM   1053 C  CA  . VAL A 1 166 ? -4.706  30.244 44.578 1.00 19.56 ? 162 VAL A CA  1 
ATOM   1054 C  C   . VAL A 1 166 ? -4.778  31.335 43.535 1.00 19.24 ? 162 VAL A C   1 
ATOM   1055 O  O   . VAL A 1 166 ? -4.238  31.183 42.442 1.00 19.64 ? 162 VAL A O   1 
ATOM   1056 C  CB  . VAL A 1 166 ? -3.683  30.630 45.654 1.00 19.36 ? 162 VAL A CB  1 
ATOM   1057 C  CG1 . VAL A 1 166 ? -3.494  29.440 46.635 1.00 22.40 ? 162 VAL A CG1 1 
ATOM   1058 C  CG2 . VAL A 1 166 ? -2.333  31.058 45.033 1.00 20.43 ? 162 VAL A CG2 1 
ATOM   1059 N  N   . SER A 1 167 ? -5.502  32.391 43.872 1.00 19.08 ? 163 SER A N   1 
ATOM   1060 C  CA  . SER A 1 167 ? -5.694  33.526 42.948 1.00 18.29 ? 163 SER A CA  1 
ATOM   1061 C  C   . SER A 1 167 ? -4.776  34.709 43.275 1.00 19.26 ? 163 SER A C   1 
ATOM   1062 O  O   . SER A 1 167 ? -4.745  35.690 42.510 1.00 19.58 ? 163 SER A O   1 
ATOM   1063 C  CB  . SER A 1 167 ? -7.169  33.968 42.963 1.00 20.03 ? 163 SER A CB  1 
ATOM   1064 O  OG  . SER A 1 167 ? -7.425  34.596 44.207 1.00 22.46 ? 163 SER A OG  1 
ATOM   1065 N  N   . GLY A 1 168 ? -4.078  34.633 44.409 1.00 17.53 ? 164 GLY A N   1 
ATOM   1066 C  CA  . GLY A 1 168 ? -3.154  35.684 44.827 1.00 17.46 ? 164 GLY A CA  1 
ATOM   1067 C  C   . GLY A 1 168 ? -1.760  35.392 44.298 1.00 17.32 ? 164 GLY A C   1 
ATOM   1068 O  O   . GLY A 1 168 ? -1.520  34.413 43.568 1.00 17.46 ? 164 GLY A O   1 
ATOM   1069 N  N   . ARG A 1 169 ? -0.831  36.273 44.654 1.00 17.50 ? 165 ARG A N   1 
ATOM   1070 C  CA  . ARG A 1 169 ? 0.549   36.083 44.263 1.00 16.77 ? 165 ARG A CA  1 
ATOM   1071 C  C   . ARG A 1 169 ? 1.451   36.805 45.272 1.00 15.73 ? 165 ARG A C   1 
ATOM   1072 O  O   . ARG A 1 169 ? 0.997   37.674 46.038 1.00 16.27 ? 165 ARG A O   1 
ATOM   1073 C  CB  . ARG A 1 169 ? 0.849   36.671 42.878 1.00 16.87 ? 165 ARG A CB  1 
ATOM   1074 C  CG  . ARG A 1 169 ? 0.584   38.187 42.766 1.00 16.17 ? 165 ARG A CG  1 
ATOM   1075 C  CD  . ARG A 1 169 ? 1.124   38.727 41.433 1.00 16.97 ? 165 ARG A CD  1 
ATOM   1076 N  NE  . ARG A 1 169 ? 0.798   40.166 41.332 1.00 15.98 ? 165 ARG A NE  1 
ATOM   1077 C  CZ  . ARG A 1 169 ? 1.528   41.141 41.864 1.00 18.82 ? 165 ARG A CZ  1 
ATOM   1078 N  NH1 . ARG A 1 169 ? 2.652   40.860 42.532 1.00 18.07 ? 165 ARG A NH1 1 
ATOM   1079 N  NH2 . ARG A 1 169 ? 1.125   42.409 41.760 1.00 16.53 ? 165 ARG A NH2 1 
ATOM   1080 N  N   . PHE A 1 170 ? 2.718   36.436 45.272 1.00 16.29 ? 166 PHE A N   1 
ATOM   1081 C  CA  . PHE A 1 170 ? 3.662   37.126 46.151 1.00 15.74 ? 166 PHE A CA  1 
ATOM   1082 C  C   . PHE A 1 170 ? 3.905   38.569 45.641 1.00 16.96 ? 166 PHE A C   1 
ATOM   1083 O  O   . PHE A 1 170 ? 3.789   38.854 44.443 1.00 16.82 ? 166 PHE A O   1 
ATOM   1084 C  CB  . PHE A 1 170 ? 4.949   36.328 46.268 1.00 17.01 ? 166 PHE A CB  1 
ATOM   1085 C  CG  . PHE A 1 170 ? 4.846   35.177 47.212 1.00 16.26 ? 166 PHE A CG  1 
ATOM   1086 C  CD1 . PHE A 1 170 ? 4.682   35.399 48.577 1.00 16.59 ? 166 PHE A CD1 1 
ATOM   1087 C  CD2 . PHE A 1 170 ? 4.855   33.888 46.716 1.00 18.99 ? 166 PHE A CD2 1 
ATOM   1088 C  CE1 . PHE A 1 170 ? 4.579   34.300 49.467 1.00 17.79 ? 166 PHE A CE1 1 
ATOM   1089 C  CE2 . PHE A 1 170 ? 4.739   32.779 47.555 1.00 19.77 ? 166 PHE A CE2 1 
ATOM   1090 C  CZ  . PHE A 1 170 ? 4.580   32.990 48.922 1.00 17.94 ? 166 PHE A CZ  1 
ATOM   1091 N  N   . TRP A 1 171 ? 4.209   39.468 46.575 1.00 16.76 ? 167 TRP A N   1 
ATOM   1092 C  CA  . TRP A 1 171 ? 4.493   40.877 46.304 1.00 17.80 ? 167 TRP A CA  1 
ATOM   1093 C  C   . TRP A 1 171 ? 5.902   40.963 45.740 1.00 19.47 ? 167 TRP A C   1 
ATOM   1094 O  O   . TRP A 1 171 ? 6.773   40.152 46.098 1.00 20.93 ? 167 TRP A O   1 
ATOM   1095 C  CB  . TRP A 1 171 ? 4.350   41.716 47.574 1.00 17.83 ? 167 TRP A CB  1 
ATOM   1096 C  CG  . TRP A 1 171 ? 5.188   41.206 48.742 1.00 16.02 ? 167 TRP A CG  1 
ATOM   1097 C  CD1 . TRP A 1 171 ? 6.448   41.652 49.134 1.00 16.62 ? 167 TRP A CD1 1 
ATOM   1098 C  CD2 . TRP A 1 171 ? 4.841   40.127 49.642 1.00 18.42 ? 167 TRP A CD2 1 
ATOM   1099 N  NE1 . TRP A 1 171 ? 6.885   40.892 50.240 1.00 16.13 ? 167 TRP A NE1 1 
ATOM   1100 C  CE2 . TRP A 1 171 ? 5.914   39.983 50.571 1.00 17.57 ? 167 TRP A CE2 1 
ATOM   1101 C  CE3 . TRP A 1 171 ? 3.722   39.278 49.763 1.00 16.68 ? 167 TRP A CE3 1 
ATOM   1102 C  CZ2 . TRP A 1 171 ? 5.899   39.010 51.595 1.00 17.37 ? 167 TRP A CZ2 1 
ATOM   1103 C  CZ3 . TRP A 1 171 ? 3.714   38.313 50.820 1.00 16.33 ? 167 TRP A CZ3 1 
ATOM   1104 C  CH2 . TRP A 1 171 ? 4.814   38.178 51.681 1.00 17.95 ? 167 TRP A CH2 1 
ATOM   1105 N  N   . SER A 1 172 ? 6.118   41.923 44.859 1.00 19.49 ? 168 SER A N   1 
ATOM   1106 C  CA  . SER A 1 172 ? 7.387   42.066 44.223 1.00 22.15 ? 168 SER A CA  1 
ATOM   1107 C  C   . SER A 1 172 ? 8.231   43.088 45.018 1.00 23.76 ? 168 SER A C   1 
ATOM   1108 O  O   . SER A 1 172 ? 9.316   42.778 45.444 1.00 26.24 ? 168 SER A O   1 
ATOM   1109 C  CB  . SER A 1 172 ? 7.198   42.418 42.750 1.00 23.40 ? 168 SER A CB  1 
ATOM   1110 O  OG  . SER A 1 172 ? 8.447   42.762 42.241 1.00 28.15 ? 168 SER A OG  1 
ATOM   1111 N  N   . GLU A 1 173 ? 7.709   44.274 45.260 1.00 24.16 ? 169 GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 173 ? 8.447   45.244 46.082 1.00 25.92 ? 169 GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 173 ? 8.278   44.815 47.554 1.00 24.06 ? 169 GLU A C   1 
ATOM   1114 O  O   . GLU A 1 173 ? 7.169   44.487 47.974 1.00 23.30 ? 169 GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 173 ? 7.947   46.655 45.872 1.00 27.24 ? 169 GLU A CB  1 
ATOM   1116 C  CG  . GLU A 1 173 ? 6.436   46.851 45.867 1.00 32.83 ? 169 GLU A CG  1 
ATOM   1117 C  CD  . GLU A 1 173 ? 6.036   48.264 46.339 1.00 39.77 ? 169 GLU A CD  1 
ATOM   1118 O  OE1 . GLU A 1 173 ? 6.558   49.275 45.836 1.00 41.46 ? 169 GLU A OE1 1 
ATOM   1119 O  OE2 . GLU A 1 173 ? 5.096   48.333 47.310 1.00 39.03 ? 169 GLU A OE2 1 
ATOM   1120 N  N   . PRO A 1 174 ? 9.378   44.824 48.335 1.00 24.64 ? 170 PRO A N   1 
ATOM   1121 C  CA  . PRO A 1 174 ? 9.267   44.500 49.761 1.00 22.86 ? 170 PRO A CA  1 
ATOM   1122 C  C   . PRO A 1 174 ? 8.209   45.330 50.481 1.00 22.18 ? 170 PRO A C   1 
ATOM   1123 O  O   . PRO A 1 174 ? 8.010   46.511 50.184 1.00 23.09 ? 170 PRO A O   1 
ATOM   1124 C  CB  . PRO A 1 174 ? 10.652  44.825 50.308 1.00 24.40 ? 170 PRO A CB  1 
ATOM   1125 C  CG  . PRO A 1 174 ? 11.556  44.560 49.104 1.00 24.60 ? 170 PRO A CG  1 
ATOM   1126 C  CD  . PRO A 1 174 ? 10.776  45.070 47.937 1.00 24.27 ? 170 PRO A CD  1 
ATOM   1127 N  N   . LEU A 1 175 ? 7.532   44.687 51.429 1.00 19.06 ? 171 LEU A N   1 
ATOM   1128 C  CA  . LEU A 1 175 ? 6.502   45.324 52.252 1.00 17.48 ? 171 LEU A CA  1 
ATOM   1129 C  C   . LEU A 1 175 ? 7.237   46.015 53.377 1.00 18.26 ? 171 LEU A C   1 
ATOM   1130 O  O   . LEU A 1 175 ? 8.301   45.528 53.801 1.00 18.65 ? 171 LEU A O   1 
ATOM   1131 C  CB  . LEU A 1 175 ? 5.543   44.260 52.793 1.00 16.99 ? 171 LEU A CB  1 
ATOM   1132 C  CG  . LEU A 1 175 ? 4.709   43.575 51.676 1.00 17.49 ? 171 LEU A CG  1 
ATOM   1133 C  CD1 . LEU A 1 175 ? 3.875   42.471 52.292 1.00 19.63 ? 171 LEU A CD1 1 
ATOM   1134 C  CD2 . LEU A 1 175 ? 3.764   44.586 50.980 1.00 19.72 ? 171 LEU A CD2 1 
ATOM   1135 N  N   . VAL A 1 176 ? 6.724   47.145 53.837 1.00 17.07 ? 172 VAL A N   1 
ATOM   1136 C  CA  . VAL A 1 176 ? 7.405   47.923 54.898 1.00 18.80 ? 172 VAL A CA  1 
ATOM   1137 C  C   . VAL A 1 176 ? 6.550   48.156 56.100 1.00 18.25 ? 172 VAL A C   1 
ATOM   1138 O  O   . VAL A 1 176 ? 5.369   48.591 55.964 1.00 18.78 ? 172 VAL A O   1 
ATOM   1139 C  CB  . VAL A 1 176 ? 7.792   49.340 54.355 1.00 19.68 ? 172 VAL A CB  1 
ATOM   1140 C  CG1 . VAL A 1 176 ? 8.345   50.274 55.467 1.00 20.16 ? 172 VAL A CG1 1 
ATOM   1141 C  CG2 . VAL A 1 176 ? 8.750   49.208 53.198 1.00 20.72 ? 172 VAL A CG2 1 
ATOM   1142 N  N   . ALA A 1 177 ? 7.113   47.894 57.275 1.00 18.29 ? 173 ALA A N   1 
ATOM   1143 C  CA  . ALA A 1 177 ? 6.403   48.178 58.534 1.00 19.19 ? 173 ALA A CA  1 
ATOM   1144 C  C   . ALA A 1 177 ? 7.415   49.069 59.214 1.00 19.74 ? 173 ALA A C   1 
ATOM   1145 O  O   . ALA A 1 177 ? 8.598   48.685 59.336 1.00 19.63 ? 173 ALA A O   1 
ATOM   1146 C  CB  . ALA A 1 177 ? 6.172   46.970 59.322 1.00 21.28 ? 173 ALA A CB  1 
ATOM   1147 N  N   . GLU A 1 178 ? 6.997   50.254 59.630 1.00 18.83 ? 174 GLU A N   1 
ATOM   1148 C  CA  . GLU A 1 178 ? 7.997   51.108 60.295 1.00 20.64 ? 174 GLU A CA  1 
ATOM   1149 C  C   . GLU A 1 178 ? 7.416   51.966 61.377 1.00 18.77 ? 174 GLU A C   1 
ATOM   1150 O  O   . GLU A 1 178 ? 6.201   52.225 61.426 1.00 18.61 ? 174 GLU A O   1 
ATOM   1151 C  CB  . GLU A 1 178 ? 8.764   51.938 59.293 1.00 22.30 ? 174 GLU A CB  1 
ATOM   1152 C  CG  . GLU A 1 178 ? 7.914   52.811 58.480 1.00 27.72 ? 174 GLU A CG  1 
ATOM   1153 C  CD  . GLU A 1 178 ? 8.727   53.662 57.492 1.00 37.80 ? 174 GLU A CD  1 
ATOM   1154 O  OE1 . GLU A 1 178 ? 9.968   53.461 57.351 1.00 37.21 ? 174 GLU A OE1 1 
ATOM   1155 O  OE2 . GLU A 1 178 ? 8.088   54.532 56.857 1.00 39.92 ? 174 GLU A OE2 1 
ATOM   1156 N  N   . TRP A 1 179 ? 8.321   52.361 62.269 1.00 16.04 ? 175 TRP A N   1 
ATOM   1157 C  CA  . TRP A 1 179 ? 8.024   53.181 63.442 1.00 17.33 ? 175 TRP A CA  1 
ATOM   1158 C  C   . TRP A 1 179 ? 9.012   54.293 63.449 1.00 17.94 ? 175 TRP A C   1 
ATOM   1159 O  O   . TRP A 1 179 ? 10.204  54.029 63.509 1.00 17.67 ? 175 TRP A O   1 
ATOM   1160 C  CB  . TRP A 1 179 ? 8.199   52.316 64.685 1.00 17.37 ? 175 TRP A CB  1 
ATOM   1161 C  CG  . TRP A 1 179 ? 7.196   51.160 64.615 1.00 15.77 ? 175 TRP A CG  1 
ATOM   1162 C  CD1 . TRP A 1 179 ? 5.879   51.213 64.964 1.00 17.45 ? 175 TRP A CD1 1 
ATOM   1163 C  CD2 . TRP A 1 179 ? 7.423   49.820 64.121 1.00 16.83 ? 175 TRP A CD2 1 
ATOM   1164 N  NE1 . TRP A 1 179 ? 5.268   49.994 64.766 1.00 19.13 ? 175 TRP A NE1 1 
ATOM   1165 C  CE2 . TRP A 1 179 ? 6.199   49.115 64.256 1.00 16.65 ? 175 TRP A CE2 1 
ATOM   1166 C  CE3 . TRP A 1 179 ? 8.557   49.141 63.589 1.00 17.91 ? 175 TRP A CE3 1 
ATOM   1167 C  CZ2 . TRP A 1 179 ? 6.048   47.762 63.857 1.00 17.95 ? 175 TRP A CZ2 1 
ATOM   1168 C  CZ3 . TRP A 1 179 ? 8.426   47.785 63.209 1.00 18.33 ? 175 TRP A CZ3 1 
ATOM   1169 C  CH2 . TRP A 1 179 ? 7.174   47.104 63.357 1.00 18.40 ? 175 TRP A CH2 1 
ATOM   1170 N  N   . ASP A 1 180 ? 8.528   55.523 63.427 1.00 18.75 ? 176 ASP A N   1 
ATOM   1171 C  CA  . ASP A 1 180 ? 9.466   56.624 63.352 1.00 20.55 ? 176 ASP A CA  1 
ATOM   1172 C  C   . ASP A 1 180 ? 10.058  57.091 64.631 1.00 20.35 ? 176 ASP A C   1 
ATOM   1173 O  O   . ASP A 1 180 ? 11.052  57.796 64.575 1.00 23.01 ? 176 ASP A O   1 
ATOM   1174 C  CB  . ASP A 1 180 ? 8.807   57.862 62.721 1.00 20.72 ? 176 ASP A CB  1 
ATOM   1175 C  CG  . ASP A 1 180 ? 8.351   57.632 61.269 1.00 27.55 ? 176 ASP A CG  1 
ATOM   1176 O  OD1 . ASP A 1 180 ? 8.865   56.734 60.571 1.00 34.41 ? 176 ASP A OD1 1 
ATOM   1177 O  OD2 . ASP A 1 180 ? 7.464   58.397 60.840 1.00 34.08 ? 176 ASP A OD2 1 
ATOM   1178 N  N   . ASP A 1 181 ? 9.481   56.728 65.774 1.00 20.36 ? 177 ASP A N   1 
ATOM   1179 C  CA  . ASP A 1 181 ? 9.947   57.257 67.033 1.00 20.32 ? 177 ASP A CA  1 
ATOM   1180 C  C   . ASP A 1 181 ? 10.151  56.192 68.099 1.00 20.59 ? 177 ASP A C   1 
ATOM   1181 O  O   . ASP A 1 181 ? 9.591   56.276 69.205 1.00 22.95 ? 177 ASP A O   1 
ATOM   1182 C  CB  . ASP A 1 181 ? 8.952   58.331 67.534 1.00 23.55 ? 177 ASP A CB  1 
ATOM   1183 C  CG  . ASP A 1 181 ? 8.965   59.606 66.677 1.00 25.34 ? 177 ASP A CG  1 
ATOM   1184 O  OD1 . ASP A 1 181 ? 9.844   60.492 66.916 1.00 32.60 ? 177 ASP A OD1 1 
ATOM   1185 O  OD2 . ASP A 1 181 ? 8.058   59.757 65.823 1.00 34.05 ? 177 ASP A OD2 1 
ATOM   1186 N  N   . PHE A 1 182 ? 10.944  55.180 67.776 1.00 18.24 ? 178 PHE A N   1 
ATOM   1187 C  CA  . PHE A 1 182 ? 11.173  54.146 68.788 1.00 16.79 ? 178 PHE A CA  1 
ATOM   1188 C  C   . PHE A 1 182 ? 12.191  54.681 69.793 1.00 17.79 ? 178 PHE A C   1 
ATOM   1189 O  O   . PHE A 1 182 ? 13.240  55.171 69.391 1.00 18.68 ? 178 PHE A O   1 
ATOM   1190 C  CB  . PHE A 1 182 ? 11.682  52.850 68.132 1.00 15.88 ? 178 PHE A CB  1 
ATOM   1191 C  CG  . PHE A 1 182 ? 12.194  51.862 69.130 1.00 16.70 ? 178 PHE A CG  1 
ATOM   1192 C  CD1 . PHE A 1 182 ? 11.294  51.221 69.986 1.00 16.87 ? 178 PHE A CD1 1 
ATOM   1193 C  CD2 . PHE A 1 182 ? 13.575  51.676 69.313 1.00 17.33 ? 178 PHE A CD2 1 
ATOM   1194 C  CE1 . PHE A 1 182 ? 11.770  50.316 70.968 1.00 18.16 ? 178 PHE A CE1 1 
ATOM   1195 C  CE2 . PHE A 1 182 ? 14.054  50.797 70.287 1.00 19.54 ? 178 PHE A CE2 1 
ATOM   1196 C  CZ  . PHE A 1 182 ? 13.132  50.123 71.126 1.00 16.99 ? 178 PHE A CZ  1 
ATOM   1197 N  N   . GLU A 1 183 ? 11.898  54.565 71.097 1.00 16.80 ? 179 GLU A N   1 
ATOM   1198 C  CA  . GLU A 1 183 ? 12.856  55.027 72.115 1.00 17.54 ? 179 GLU A CA  1 
ATOM   1199 C  C   . GLU A 1 183 ? 13.720  53.914 72.677 1.00 18.93 ? 179 GLU A C   1 
ATOM   1200 O  O   . GLU A 1 183 ? 13.226  53.015 73.371 1.00 19.20 ? 179 GLU A O   1 
ATOM   1201 C  CB  . GLU A 1 183 ? 12.119  55.729 73.284 1.00 18.46 ? 179 GLU A CB  1 
ATOM   1202 C  CG  . GLU A 1 183 ? 13.053  56.583 74.123 1.00 17.72 ? 179 GLU A CG  1 
ATOM   1203 C  CD  . GLU A 1 183 ? 13.578  57.816 73.372 1.00 20.16 ? 179 GLU A CD  1 
ATOM   1204 O  OE1 . GLU A 1 183 ? 12.966  58.221 72.351 1.00 18.79 ? 179 GLU A OE1 1 
ATOM   1205 O  OE2 . GLU A 1 183 ? 14.547  58.421 73.854 1.00 22.73 ? 179 GLU A OE2 1 
ATOM   1206 N  N   . TRP A 1 184 ? 15.020  53.964 72.376 1.00 17.19 ? 180 TRP A N   1 
ATOM   1207 C  CA  . TRP A 1 184 ? 15.943  53.029 72.990 1.00 17.65 ? 180 TRP A CA  1 
ATOM   1208 C  C   . TRP A 1 184 ? 16.416  53.769 74.248 1.00 18.05 ? 180 TRP A C   1 
ATOM   1209 O  O   . TRP A 1 184 ? 17.236  54.706 74.178 1.00 17.66 ? 180 TRP A O   1 
ATOM   1210 C  CB  . TRP A 1 184 ? 17.123  52.748 72.057 1.00 17.28 ? 180 TRP A CB  1 
ATOM   1211 C  CG  . TRP A 1 184 ? 18.299  52.044 72.711 1.00 17.99 ? 180 TRP A CG  1 
ATOM   1212 C  CD1 . TRP A 1 184 ? 19.654  52.401 72.573 1.00 17.27 ? 180 TRP A CD1 1 
ATOM   1213 C  CD2 . TRP A 1 184 ? 18.296  50.824 73.490 1.00 20.09 ? 180 TRP A CD2 1 
ATOM   1214 N  NE1 . TRP A 1 184 ? 20.445  51.519 73.257 1.00 17.29 ? 180 TRP A NE1 1 
ATOM   1215 C  CE2 . TRP A 1 184 ? 19.654  50.552 73.840 1.00 19.65 ? 180 TRP A CE2 1 
ATOM   1216 C  CE3 . TRP A 1 184 ? 17.286  49.937 73.923 1.00 19.32 ? 180 TRP A CE3 1 
ATOM   1217 C  CZ2 . TRP A 1 184 ? 20.049  49.398 74.574 1.00 18.09 ? 180 TRP A CZ2 1 
ATOM   1218 C  CZ3 . TRP A 1 184 ? 17.687  48.772 74.691 1.00 18.74 ? 180 TRP A CZ3 1 
ATOM   1219 C  CH2 . TRP A 1 184 ? 19.061  48.548 75.021 1.00 18.93 ? 180 TRP A CH2 1 
ATOM   1220 N  N   . LYS A 1 185 ? 15.858  53.356 75.388 1.00 19.49 ? 181 LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 185 ? 16.249  53.962 76.650 1.00 20.43 ? 181 LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 185 ? 17.079  53.017 77.514 1.00 20.74 ? 181 LYS A C   1 
ATOM   1223 O  O   . LYS A 1 185 ? 17.254  53.267 78.722 1.00 21.77 ? 181 LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 185 ? 15.060  54.576 77.404 1.00 22.78 ? 181 LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 185 ? 14.008  53.570 77.773 1.00 23.20 ? 181 LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 185 ? 12.727  53.816 77.042 1.00 24.00 ? 181 LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 185 ? 11.747  52.799 77.508 1.00 23.01 ? 181 LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 185 ? 10.377  52.947 76.928 1.00 24.34 ? 181 LYS A NZ  1 
ATOM   1229 N  N   . GLY A 1 186 ? 17.616  51.976 76.887 1.00 19.74 ? 182 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 186 ? 18.503  51.026 77.585 1.00 18.99 ? 182 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 186 ? 17.736  49.782 78.016 1.00 19.30 ? 182 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 186 ? 16.487  49.708 77.809 1.00 18.88 ? 182 GLY A O   1 
ATOM   1233 N  N   . PRO A 1 187 ? 18.454  48.821 78.596 1.00 17.90 ? 183 PRO A N   1 
ATOM   1234 C  CA  . PRO A 1 187 ? 17.818  47.576 78.969 1.00 18.54 ? 183 PRO A CA  1 
ATOM   1235 C  C   . PRO A 1 187 ? 16.718  47.810 79.980 1.00 17.70 ? 183 PRO A C   1 
ATOM   1236 O  O   . PRO A 1 187 ? 16.863  48.625 80.928 1.00 18.37 ? 183 PRO A O   1 
ATOM   1237 C  CB  . PRO A 1 187 ? 18.934  46.780 79.628 1.00 19.41 ? 183 PRO A CB  1 
ATOM   1238 C  CG  . PRO A 1 187 ? 19.978  47.771 79.978 1.00 19.41 ? 183 PRO A CG  1 
ATOM   1239 C  CD  . PRO A 1 187 ? 19.885  48.839 78.933 1.00 18.40 ? 183 PRO A CD  1 
ATOM   1240 N  N   . GLN A 1 188 ? 15.651  47.047 79.805 1.00 18.39 ? 184 GLN A N   1 
ATOM   1241 C  CA  . GLN A 1 188 ? 14.491  47.094 80.724 1.00 19.08 ? 184 GLN A CA  1 
ATOM   1242 C  C   . GLN A 1 188 ? 14.493  45.746 81.506 1.00 20.95 ? 184 GLN A C   1 
ATOM   1243 O  O   . GLN A 1 188 ? 13.438  45.187 81.880 1.00 21.64 ? 184 GLN A O   1 
ATOM   1244 C  CB  . GLN A 1 188 ? 13.192  47.256 79.912 1.00 20.90 ? 184 GLN A CB  1 
ATOM   1245 C  CG  . GLN A 1 188 ? 13.112  48.542 79.063 1.00 20.39 ? 184 GLN A CG  1 
ATOM   1246 C  CD  . GLN A 1 188 ? 13.289  49.828 79.887 1.00 23.51 ? 184 GLN A CD  1 
ATOM   1247 O  OE1 . GLN A 1 188 ? 12.419  50.206 80.654 1.00 23.26 ? 184 GLN A OE1 1 
ATOM   1248 N  NE2 . GLN A 1 188 ? 14.427  50.504 79.724 1.00 21.65 ? 184 GLN A NE2 1 
ATOM   1249 N  N   . TRP A 1 189 ? 15.706  45.245 81.731 1.00 20.20 ? 185 TRP A N   1 
ATOM   1250 C  CA  . TRP A 1 189 ? 16.035  43.969 82.373 1.00 21.23 ? 185 TRP A CA  1 
ATOM   1251 C  C   . TRP A 1 189 ? 17.451  44.050 82.952 1.00 22.82 ? 185 TRP A C   1 
ATOM   1252 O  O   . TRP A 1 189 ? 17.805  43.180 83.748 1.00 24.05 ? 185 TRP A O   1 
ATOM   1253 C  CB  . TRP A 1 189 ? 15.966  42.810 81.354 1.00 20.59 ? 185 TRP A CB  1 
ATOM   1254 C  CG  . TRP A 1 189 ? 16.784  43.113 80.137 1.00 20.08 ? 185 TRP A CG  1 
ATOM   1255 C  CD1 . TRP A 1 189 ? 18.126  42.950 79.977 1.00 19.55 ? 185 TRP A CD1 1 
ATOM   1256 C  CD2 . TRP A 1 189 ? 16.303  43.754 78.941 1.00 19.91 ? 185 TRP A CD2 1 
ATOM   1257 N  NE1 . TRP A 1 189 ? 18.529  43.436 78.733 1.00 18.93 ? 185 TRP A NE1 1 
ATOM   1258 C  CE2 . TRP A 1 189 ? 17.418  43.939 78.084 1.00 19.65 ? 185 TRP A CE2 1 
ATOM   1259 C  CE3 . TRP A 1 189 ? 15.035  44.194 78.519 1.00 19.59 ? 185 TRP A CE3 1 
ATOM   1260 C  CZ2 . TRP A 1 189 ? 17.294  44.543 76.815 1.00 19.31 ? 185 TRP A CZ2 1 
ATOM   1261 C  CZ3 . TRP A 1 189 ? 14.920  44.795 77.246 1.00 19.76 ? 185 TRP A CZ3 1 
ATOM   1262 C  CH2 . TRP A 1 189 ? 16.035  44.968 76.431 1.00 19.52 ? 185 TRP A CH2 1 
ATOM   1263 O  OXT . TRP A 1 189 ? 18.274  44.938 82.634 1.00 21.53 ? 185 TRP A OXT 1 
ATOM   1264 N  N   . ASP B 1 33  ? -10.942 16.027 45.223 1.00 44.68 ? 29  ASP B N   1 
ATOM   1265 C  CA  . ASP B 1 33  ? -10.744 14.566 45.492 1.00 43.88 ? 29  ASP B CA  1 
ATOM   1266 C  C   . ASP B 1 33  ? -9.288  14.224 45.793 1.00 43.33 ? 29  ASP B C   1 
ATOM   1267 O  O   . ASP B 1 33  ? -8.448  14.189 44.887 1.00 43.34 ? 29  ASP B O   1 
ATOM   1268 C  CB  . ASP B 1 33  ? -11.245 13.713 44.325 1.00 44.67 ? 29  ASP B CB  1 
ATOM   1269 C  CG  . ASP B 1 33  ? -12.715 13.312 44.474 1.00 45.38 ? 29  ASP B CG  1 
ATOM   1270 O  OD1 . ASP B 1 33  ? -13.359 13.743 45.460 1.00 45.17 ? 29  ASP B OD1 1 
ATOM   1271 O  OD2 . ASP B 1 33  ? -13.223 12.559 43.604 1.00 47.37 ? 29  ASP B OD2 1 
ATOM   1272 N  N   . GLU B 1 34  ? -9.020  13.973 47.074 1.00 41.99 ? 30  GLU B N   1 
ATOM   1273 C  CA  . GLU B 1 34  ? -7.708  13.607 47.588 1.00 40.70 ? 30  GLU B CA  1 
ATOM   1274 C  C   . GLU B 1 34  ? -7.731  12.152 48.044 1.00 38.97 ? 30  GLU B C   1 
ATOM   1275 O  O   . GLU B 1 34  ? -8.745  11.666 48.560 1.00 39.05 ? 30  GLU B O   1 
ATOM   1276 C  CB  . GLU B 1 34  ? -7.334  14.510 48.755 1.00 41.41 ? 30  GLU B CB  1 
ATOM   1277 C  CG  . GLU B 1 34  ? -6.865  15.873 48.309 1.00 43.81 ? 30  GLU B CG  1 
ATOM   1278 C  CD  . GLU B 1 34  ? -6.494  16.775 49.456 1.00 47.31 ? 30  GLU B CD  1 
ATOM   1279 O  OE1 . GLU B 1 34  ? -5.911  16.304 50.466 1.00 50.35 ? 30  GLU B OE1 1 
ATOM   1280 O  OE2 . GLU B 1 34  ? -6.787  17.978 49.344 1.00 51.08 ? 30  GLU B OE2 1 
ATOM   1281 N  N   . PHE B 1 35  ? -6.621  11.453 47.837 1.00 36.26 ? 31  PHE B N   1 
ATOM   1282 C  CA  . PHE B 1 35  ? -6.524  10.049 48.206 1.00 34.13 ? 31  PHE B CA  1 
ATOM   1283 C  C   . PHE B 1 35  ? -5.304  9.797  49.090 1.00 33.96 ? 31  PHE B C   1 
ATOM   1284 O  O   . PHE B 1 35  ? -4.204  10.237 48.760 1.00 32.69 ? 31  PHE B O   1 
ATOM   1285 C  CB  . PHE B 1 35  ? -6.469  9.175  46.954 1.00 33.84 ? 31  PHE B CB  1 
ATOM   1286 C  CG  . PHE B 1 35  ? -7.600  9.431  45.987 1.00 32.82 ? 31  PHE B CG  1 
ATOM   1287 C  CD1 . PHE B 1 35  ? -7.494  10.417 45.024 1.00 32.61 ? 31  PHE B CD1 1 
ATOM   1288 C  CD2 . PHE B 1 35  ? -8.773  8.712  46.076 1.00 33.41 ? 31  PHE B CD2 1 
ATOM   1289 C  CE1 . PHE B 1 35  ? -8.549  10.675 44.140 1.00 33.86 ? 31  PHE B CE1 1 
ATOM   1290 C  CE2 . PHE B 1 35  ? -9.835  8.949  45.187 1.00 34.01 ? 31  PHE B CE2 1 
ATOM   1291 C  CZ  . PHE B 1 35  ? -9.716  9.930  44.223 1.00 33.31 ? 31  PHE B CZ  1 
ATOM   1292 N  N   . PRO B 1 36  ? -5.494  9.057  50.198 1.00 33.48 ? 32  PRO B N   1 
ATOM   1293 C  CA  . PRO B 1 36  ? -4.387  8.779  51.105 1.00 32.68 ? 32  PRO B CA  1 
ATOM   1294 C  C   . PRO B 1 36  ? -3.366  7.791  50.531 1.00 31.79 ? 32  PRO B C   1 
ATOM   1295 O  O   . PRO B 1 36  ? -3.728  6.883  49.774 1.00 31.56 ? 32  PRO B O   1 
ATOM   1296 C  CB  . PRO B 1 36  ? -5.087  8.139  52.313 1.00 33.34 ? 32  PRO B CB  1 
ATOM   1297 C  CG  . PRO B 1 36  ? -6.273  7.450  51.728 1.00 33.85 ? 32  PRO B CG  1 
ATOM   1298 C  CD  . PRO B 1 36  ? -6.743  8.395  50.636 1.00 33.88 ? 32  PRO B CD  1 
ATOM   1299 N  N   . ILE B 1 37  ? -2.098  7.961  50.906 1.00 30.71 ? 33  ILE B N   1 
ATOM   1300 C  CA  . ILE B 1 37  ? -1.042  7.045  50.487 1.00 30.91 ? 33  ILE B CA  1 
ATOM   1301 C  C   . ILE B 1 37  ? -1.100  5.883  51.480 1.00 30.65 ? 33  ILE B C   1 
ATOM   1302 O  O   . ILE B 1 37  ? -0.779  4.723  51.162 1.00 31.07 ? 33  ILE B O   1 
ATOM   1303 C  CB  . ILE B 1 37  ? 0.352   7.727  50.525 1.00 30.66 ? 33  ILE B CB  1 
ATOM   1304 C  CG1 . ILE B 1 37  ? 0.491   8.673  49.337 1.00 31.43 ? 33  ILE B CG1 1 
ATOM   1305 C  CG2 . ILE B 1 37  ? 1.497   6.704  50.483 1.00 30.69 ? 33  ILE B CG2 1 
ATOM   1306 C  CD1 . ILE B 1 37  ? 1.635   9.595  49.486 1.00 35.40 ? 33  ILE B CD1 1 
ATOM   1307 N  N   . GLY B 1 38  ? -1.542  6.211  52.691 1.00 30.12 ? 34  GLY B N   1 
ATOM   1308 C  CA  . GLY B 1 38  ? -1.673  5.259  53.790 1.00 30.58 ? 34  GLY B CA  1 
ATOM   1309 C  C   . GLY B 1 38  ? -2.062  6.015  55.041 1.00 30.59 ? 34  GLY B C   1 
ATOM   1310 O  O   . GLY B 1 38  ? -2.426  7.182  54.973 1.00 30.11 ? 34  GLY B O   1 
ATOM   1311 N  N   . GLU B 1 39  ? -2.001  5.355  56.191 1.00 30.77 ? 35  GLU B N   1 
ATOM   1312 C  CA  . GLU B 1 39  ? -2.369  6.017  57.424 1.00 32.02 ? 35  GLU B CA  1 
ATOM   1313 C  C   . GLU B 1 39  ? -1.292  7.013  57.849 1.00 31.65 ? 35  GLU B C   1 
ATOM   1314 O  O   . GLU B 1 39  ? -0.109  6.800  57.567 1.00 31.28 ? 35  GLU B O   1 
ATOM   1315 C  CB  . GLU B 1 39  ? -2.609  4.999  58.536 1.00 33.63 ? 35  GLU B CB  1 
ATOM   1316 C  CG  . GLU B 1 39  ? -3.951  5.182  59.249 1.00 38.29 ? 35  GLU B CG  1 
ATOM   1317 C  CD  . GLU B 1 39  ? -5.136  4.723  58.397 1.00 42.03 ? 35  GLU B CD  1 
ATOM   1318 O  OE1 . GLU B 1 39  ? -5.288  5.200  57.248 1.00 44.74 ? 35  GLU B OE1 1 
ATOM   1319 O  OE2 . GLU B 1 39  ? -5.917  3.873  58.867 1.00 45.96 ? 35  GLU B OE2 1 
ATOM   1320 N  N   . ASP B 1 40  ? -1.720  8.076  58.536 1.00 31.59 ? 36  ASP B N   1 
ATOM   1321 C  CA  . ASP B 1 40  ? -0.820  9.106  59.068 1.00 31.33 ? 36  ASP B CA  1 
ATOM   1322 C  C   . ASP B 1 40  ? 0.149   8.441  60.054 1.00 31.32 ? 36  ASP B C   1 
ATOM   1323 O  O   . ASP B 1 40  ? -0.180  7.424  60.700 1.00 30.81 ? 36  ASP B O   1 
ATOM   1324 C  CB  . ASP B 1 40  ? -1.603  10.219 59.796 1.00 32.38 ? 36  ASP B CB  1 
ATOM   1325 C  CG  . ASP B 1 40  ? -2.373  11.157 58.846 1.00 33.51 ? 36  ASP B CG  1 
ATOM   1326 O  OD1 . ASP B 1 40  ? -2.464  10.890 57.629 1.00 33.66 ? 36  ASP B OD1 1 
ATOM   1327 O  OD2 . ASP B 1 40  ? -2.903  12.181 59.340 1.00 37.16 ? 36  ASP B OD2 1 
ATOM   1328 N  N   . ARG B 1 41  ? 1.340   9.009  60.168 1.00 30.53 ? 37  ARG B N   1 
ATOM   1329 C  CA  . ARG B 1 41  ? 2.366   8.496  61.056 1.00 30.66 ? 37  ARG B CA  1 
ATOM   1330 C  C   . ARG B 1 41  ? 2.775   9.573  62.034 1.00 31.20 ? 37  ARG B C   1 
ATOM   1331 O  O   . ARG B 1 41  ? 2.693   10.760 61.732 1.00 31.83 ? 37  ARG B O   1 
ATOM   1332 C  CB  . ARG B 1 41  ? 3.612   8.122  60.249 1.00 30.02 ? 37  ARG B CB  1 
ATOM   1333 C  CG  . ARG B 1 41  ? 3.385   7.112  59.122 1.00 31.53 ? 37  ARG B CG  1 
ATOM   1334 C  CD  . ARG B 1 41  ? 3.045   5.734  59.710 1.00 31.65 ? 37  ARG B CD  1 
ATOM   1335 N  NE  . ARG B 1 41  ? 3.136   4.698  58.687 1.00 32.80 ? 37  ARG B NE  1 
ATOM   1336 C  CZ  . ARG B 1 41  ? 2.187   3.807  58.424 1.00 33.18 ? 37  ARG B CZ  1 
ATOM   1337 N  NH1 . ARG B 1 41  ? 1.058   3.784  59.130 1.00 35.17 ? 37  ARG B NH1 1 
ATOM   1338 N  NH2 . ARG B 1 41  ? 2.392   2.904  57.478 1.00 31.43 ? 37  ARG B NH2 1 
ATOM   1339 N  N   . ASP B 1 42  ? 3.232   9.157  63.207 1.00 31.51 ? 38  ASP B N   1 
ATOM   1340 C  CA  . ASP B 1 42  ? 3.746   10.086 64.186 1.00 31.61 ? 38  ASP B CA  1 
ATOM   1341 C  C   . ASP B 1 42  ? 5.176   9.631  64.339 1.00 30.67 ? 38  ASP B C   1 
ATOM   1342 O  O   . ASP B 1 42  ? 5.428   8.490  64.723 1.00 30.15 ? 38  ASP B O   1 
ATOM   1343 C  CB  . ASP B 1 42  ? 2.993   10.065 65.523 1.00 32.40 ? 38  ASP B CB  1 
ATOM   1344 C  CG  . ASP B 1 42  ? 1.791   10.998 65.518 1.00 35.25 ? 38  ASP B CG  1 
ATOM   1345 O  OD1 . ASP B 1 42  ? 1.985   12.238 65.602 1.00 36.61 ? 38  ASP B OD1 1 
ATOM   1346 O  OD2 . ASP B 1 42  ? 0.654   10.489 65.380 1.00 35.00 ? 38  ASP B OD2 1 
ATOM   1347 N  N   . VAL B 1 43  ? 6.103   10.499 63.959 1.00 29.58 ? 39  VAL B N   1 
ATOM   1348 C  CA  . VAL B 1 43  ? 7.527   10.205 64.058 1.00 29.44 ? 39  VAL B CA  1 
ATOM   1349 C  C   . VAL B 1 43  ? 8.224   11.372 64.749 1.00 28.74 ? 39  VAL B C   1 
ATOM   1350 O  O   . VAL B 1 43  ? 8.335   12.474 64.200 1.00 26.70 ? 39  VAL B O   1 
ATOM   1351 C  CB  . VAL B 1 43  ? 8.186   9.856  62.694 1.00 30.12 ? 39  VAL B CB  1 
ATOM   1352 C  CG1 . VAL B 1 43  ? 9.603   9.354  62.943 1.00 30.23 ? 39  VAL B CG1 1 
ATOM   1353 C  CG2 . VAL B 1 43  ? 7.436   8.732  62.009 1.00 32.03 ? 39  VAL B CG2 1 
ATOM   1354 N  N   . GLY B 1 44  ? 8.659   11.132 65.982 1.00 28.03 ? 40  GLY B N   1 
ATOM   1355 C  CA  . GLY B 1 44  ? 9.305   12.168 66.764 1.00 28.32 ? 40  GLY B CA  1 
ATOM   1356 C  C   . GLY B 1 44  ? 8.301   13.289 66.956 1.00 28.13 ? 40  GLY B C   1 
ATOM   1357 O  O   . GLY B 1 44  ? 7.134   13.035 67.298 1.00 28.41 ? 40  GLY B O   1 
ATOM   1358 N  N   . PRO B 1 45  ? 8.722   14.525 66.689 1.00 28.32 ? 41  PRO B N   1 
ATOM   1359 C  CA  . PRO B 1 45  ? 7.824   15.639 66.940 1.00 28.46 ? 41  PRO B CA  1 
ATOM   1360 C  C   . PRO B 1 45  ? 6.908   15.944 65.751 1.00 27.91 ? 41  PRO B C   1 
ATOM   1361 O  O   . PRO B 1 45  ? 6.237   16.977 65.719 1.00 27.84 ? 41  PRO B O   1 
ATOM   1362 C  CB  . PRO B 1 45  ? 8.797   16.801 67.157 1.00 29.15 ? 41  PRO B CB  1 
ATOM   1363 C  CG  . PRO B 1 45  ? 9.969   16.495 66.281 1.00 28.87 ? 41  PRO B CG  1 
ATOM   1364 C  CD  . PRO B 1 45  ? 10.040  14.978 66.189 1.00 28.56 ? 41  PRO B CD  1 
ATOM   1365 N  N   . LEU B 1 46  ? 6.864   15.039 64.783 1.00 26.93 ? 42  LEU B N   1 
ATOM   1366 C  CA  . LEU B 1 46  ? 6.074   15.283 63.595 1.00 26.79 ? 42  LEU B CA  1 
ATOM   1367 C  C   . LEU B 1 46  ? 4.896   14.364 63.366 1.00 26.90 ? 42  LEU B C   1 
ATOM   1368 O  O   . LEU B 1 46  ? 5.029   13.159 63.524 1.00 28.02 ? 42  LEU B O   1 
ATOM   1369 C  CB  . LEU B 1 46  ? 7.006   15.183 62.363 1.00 26.97 ? 42  LEU B CB  1 
ATOM   1370 C  CG  . LEU B 1 46  ? 8.300   16.017 62.360 1.00 25.47 ? 42  LEU B CG  1 
ATOM   1371 C  CD1 . LEU B 1 46  ? 9.104   15.804 61.064 1.00 26.68 ? 42  LEU B CD1 1 
ATOM   1372 C  CD2 . LEU B 1 46  ? 7.916   17.453 62.536 1.00 23.57 ? 42  LEU B CD2 1 
ATOM   1373 N  N   . HIS B 1 47  ? 3.773   14.953 62.934 1.00 27.37 ? 43  HIS B N   1 
ATOM   1374 C  CA  . HIS B 1 47  ? 2.572   14.217 62.543 1.00 27.67 ? 43  HIS B CA  1 
ATOM   1375 C  C   . HIS B 1 47  ? 2.680   14.323 61.017 1.00 27.20 ? 43  HIS B C   1 
ATOM   1376 O  O   . HIS B 1 47  ? 2.697   15.434 60.464 1.00 26.69 ? 43  HIS B O   1 
ATOM   1377 C  CB  . HIS B 1 47  ? 1.277   14.850 63.046 1.00 28.38 ? 43  HIS B CB  1 
ATOM   1378 C  CG  . HIS B 1 47  ? 0.057   14.091 62.626 1.00 29.54 ? 43  HIS B CG  1 
ATOM   1379 N  ND1 . HIS B 1 47  ? -0.385  12.966 63.291 1.00 33.34 ? 43  HIS B ND1 1 
ATOM   1380 C  CD2 . HIS B 1 47  ? -0.780  14.259 61.575 1.00 31.63 ? 43  HIS B CD2 1 
ATOM   1381 C  CE1 . HIS B 1 47  ? -1.460  12.494 62.686 1.00 32.60 ? 43  HIS B CE1 1 
ATOM   1382 N  NE2 . HIS B 1 47  ? -1.723  13.260 61.642 1.00 33.71 ? 43  HIS B NE2 1 
ATOM   1383 N  N   . VAL B 1 48  ? 2.846   13.172 60.368 1.00 26.92 ? 44  VAL B N   1 
ATOM   1384 C  CA  . VAL B 1 48  ? 3.072   13.093 58.928 1.00 26.53 ? 44  VAL B CA  1 
ATOM   1385 C  C   . VAL B 1 48  ? 1.968   12.352 58.173 1.00 27.22 ? 44  VAL B C   1 
ATOM   1386 O  O   . VAL B 1 48  ? 1.639   11.182 58.483 1.00 27.36 ? 44  VAL B O   1 
ATOM   1387 C  CB  . VAL B 1 48  ? 4.450   12.387 58.647 1.00 27.32 ? 44  VAL B CB  1 
ATOM   1388 C  CG1 . VAL B 1 48  ? 4.801   12.400 57.156 1.00 26.54 ? 44  VAL B CG1 1 
ATOM   1389 C  CG2 . VAL B 1 48  ? 5.598   13.043 59.476 1.00 26.25 ? 44  VAL B CG2 1 
ATOM   1390 N  N   . GLY B 1 49  ? 1.415   13.040 57.173 1.00 26.98 ? 45  GLY B N   1 
ATOM   1391 C  CA  . GLY B 1 49  ? 0.370   12.471 56.339 1.00 27.31 ? 45  GLY B CA  1 
ATOM   1392 C  C   . GLY B 1 49  ? 0.838   12.462 54.902 1.00 27.23 ? 45  GLY B C   1 
ATOM   1393 O  O   . GLY B 1 49  ? 1.633   13.320 54.492 1.00 27.38 ? 45  GLY B O   1 
ATOM   1394 N  N   . GLY B 1 50  ? 0.339   11.518 54.104 1.00 26.58 ? 46  GLY B N   1 
ATOM   1395 C  CA  . GLY B 1 50  ? 0.713   11.493 52.695 1.00 26.55 ? 46  GLY B CA  1 
ATOM   1396 C  C   . GLY B 1 50  ? -0.559  11.324 51.890 1.00 26.11 ? 46  GLY B C   1 
ATOM   1397 O  O   . GLY B 1 50  ? -1.381  10.462 52.208 1.00 25.85 ? 46  GLY B O   1 
ATOM   1398 N  N   . VAL B 1 51  ? -0.751  12.162 50.869 1.00 27.00 ? 47  VAL B N   1 
ATOM   1399 C  CA  . VAL B 1 51  ? -1.920  12.043 49.998 1.00 27.35 ? 47  VAL B CA  1 
ATOM   1400 C  C   . VAL B 1 51  ? -1.486  12.268 48.542 1.00 26.09 ? 47  VAL B C   1 
ATOM   1401 O  O   . VAL B 1 51  ? -0.387  12.762 48.285 1.00 24.72 ? 47  VAL B O   1 
ATOM   1402 C  CB  . VAL B 1 51  ? -3.099  13.023 50.345 1.00 28.46 ? 47  VAL B CB  1 
ATOM   1403 C  CG1 . VAL B 1 51  ? -3.477  12.968 51.806 1.00 30.52 ? 47  VAL B CG1 1 
ATOM   1404 C  CG2 . VAL B 1 51  ? -2.754  14.464 49.933 1.00 29.17 ? 47  VAL B CG2 1 
ATOM   1405 N  N   . TYR B 1 52  ? -2.326  11.841 47.606 1.00 25.77 ? 48  TYR B N   1 
ATOM   1406 C  CA  . TYR B 1 52  ? -2.058  12.070 46.204 1.00 24.56 ? 48  TYR B CA  1 
ATOM   1407 C  C   . TYR B 1 52  ? -3.371  12.489 45.558 1.00 24.16 ? 48  TYR B C   1 
ATOM   1408 O  O   . TYR B 1 52  ? -4.457  12.194 46.090 1.00 24.23 ? 48  TYR B O   1 
ATOM   1409 C  CB  . TYR B 1 52  ? -1.409  10.898 45.507 1.00 25.70 ? 48  TYR B CB  1 
ATOM   1410 C  CG  . TYR B 1 52  ? -2.321  9.734  45.170 1.00 25.64 ? 48  TYR B CG  1 
ATOM   1411 C  CD1 . TYR B 1 52  ? -2.583  8.727  46.103 1.00 25.68 ? 48  TYR B CD1 1 
ATOM   1412 C  CD2 . TYR B 1 52  ? -2.880  9.616  43.884 1.00 27.80 ? 48  TYR B CD2 1 
ATOM   1413 C  CE1 . TYR B 1 52  ? -3.395  7.626  45.756 1.00 27.79 ? 48  TYR B CE1 1 
ATOM   1414 C  CE2 . TYR B 1 52  ? -3.687  8.543  43.542 1.00 26.17 ? 48  TYR B CE2 1 
ATOM   1415 C  CZ  . TYR B 1 52  ? -3.951  7.561  44.477 1.00 26.95 ? 48  TYR B CZ  1 
ATOM   1416 O  OH  . TYR B 1 52  ? -4.760  6.484  44.100 1.00 29.41 ? 48  TYR B OH  1 
ATOM   1417 N  N   . PHE B 1 53  ? -3.261  13.163 44.420 1.00 23.45 ? 49  PHE B N   1 
ATOM   1418 C  CA  . PHE B 1 53  ? -4.418  13.623 43.660 1.00 23.43 ? 49  PHE B CA  1 
ATOM   1419 C  C   . PHE B 1 53  ? -3.906  14.065 42.300 1.00 23.56 ? 49  PHE B C   1 
ATOM   1420 O  O   . PHE B 1 53  ? -2.748  13.787 41.953 1.00 23.55 ? 49  PHE B O   1 
ATOM   1421 C  CB  . PHE B 1 53  ? -5.194  14.728 44.404 1.00 24.70 ? 49  PHE B CB  1 
ATOM   1422 C  CG  . PHE B 1 53  ? -4.326  15.813 44.960 1.00 23.33 ? 49  PHE B CG  1 
ATOM   1423 C  CD1 . PHE B 1 53  ? -3.912  16.889 44.152 1.00 26.43 ? 49  PHE B CD1 1 
ATOM   1424 C  CD2 . PHE B 1 53  ? -3.950  15.825 46.318 1.00 23.94 ? 49  PHE B CD2 1 
ATOM   1425 C  CE1 . PHE B 1 53  ? -3.099  17.913 44.677 1.00 25.60 ? 49  PHE B CE1 1 
ATOM   1426 C  CE2 . PHE B 1 53  ? -3.158  16.843 46.866 1.00 26.02 ? 49  PHE B CE2 1 
ATOM   1427 C  CZ  . PHE B 1 53  ? -2.727  17.910 46.047 1.00 26.04 ? 49  PHE B CZ  1 
ATOM   1428 N  N   . GLN B 1 54  ? -4.759  14.709 41.511 1.00 23.05 ? 50  GLN B N   1 
ATOM   1429 C  CA  . GLN B 1 54  ? -4.382  15.135 40.168 1.00 23.87 ? 50  GLN B CA  1 
ATOM   1430 C  C   . GLN B 1 54  ? -3.152  16.058 40.123 1.00 22.49 ? 50  GLN B C   1 
ATOM   1431 O  O   . GLN B 1 54  ? -2.866  16.789 41.098 1.00 22.51 ? 50  GLN B O   1 
ATOM   1432 C  CB  . GLN B 1 54  ? -5.571  15.811 39.456 1.00 24.50 ? 50  GLN B CB  1 
ATOM   1433 C  CG  . GLN B 1 54  ? -5.999  17.103 40.146 1.00 25.41 ? 50  GLN B CG  1 
ATOM   1434 C  CD  . GLN B 1 54  ? -7.323  17.625 39.626 1.00 34.86 ? 50  GLN B CD  1 
ATOM   1435 O  OE1 . GLN B 1 54  ? -8.348  16.938 39.702 1.00 38.88 ? 50  GLN B OE1 1 
ATOM   1436 N  NE2 . GLN B 1 54  ? -7.313  18.833 39.084 1.00 35.57 ? 50  GLN B NE2 1 
ATOM   1437 N  N   . PRO B 1 55  ? -2.396  16.017 39.007 1.00 22.74 ? 51  PRO B N   1 
ATOM   1438 C  CA  . PRO B 1 55  ? -1.257  16.924 38.888 1.00 22.56 ? 51  PRO B CA  1 
ATOM   1439 C  C   . PRO B 1 55  ? -1.697  18.381 39.012 1.00 23.11 ? 51  PRO B C   1 
ATOM   1440 O  O   . PRO B 1 55  ? -2.836  18.729 38.659 1.00 23.63 ? 51  PRO B O   1 
ATOM   1441 C  CB  . PRO B 1 55  ? -0.771  16.673 37.450 1.00 21.93 ? 51  PRO B CB  1 
ATOM   1442 C  CG  . PRO B 1 55  ? -1.097  15.229 37.229 1.00 22.42 ? 51  PRO B CG  1 
ATOM   1443 C  CD  . PRO B 1 55  ? -2.501  15.143 37.809 1.00 23.77 ? 51  PRO B CD  1 
ATOM   1444 N  N   . VAL B 1 56  ? -0.780  19.214 39.473 1.00 23.92 ? 52  VAL B N   1 
ATOM   1445 C  CA  . VAL B 1 56  ? -1.088  20.650 39.622 1.00 22.77 ? 52  VAL B CA  1 
ATOM   1446 C  C   . VAL B 1 56  ? -0.093  21.510 38.819 1.00 23.28 ? 52  VAL B C   1 
ATOM   1447 O  O   . VAL B 1 56  ? 0.901   20.977 38.311 1.00 22.56 ? 52  VAL B O   1 
ATOM   1448 C  CB  . VAL B 1 56  ? -1.060  21.084 41.104 1.00 23.79 ? 52  VAL B CB  1 
ATOM   1449 C  CG1 . VAL B 1 56  ? -1.910  20.165 41.961 1.00 23.52 ? 52  VAL B CG1 1 
ATOM   1450 C  CG2 . VAL B 1 56  ? 0.369   21.107 41.642 1.00 23.94 ? 52  VAL B CG2 1 
ATOM   1451 N  N   . GLU B 1 57  ? -0.397  22.805 38.669 1.00 22.34 ? 53  GLU B N   1 
ATOM   1452 C  CA  . GLU B 1 57  ? 0.511   23.741 37.993 1.00 23.06 ? 53  GLU B CA  1 
ATOM   1453 C  C   . GLU B 1 57  ? 1.102   24.562 39.131 1.00 22.34 ? 53  GLU B C   1 
ATOM   1454 O  O   . GLU B 1 57  ? 0.355   25.093 39.938 1.00 22.14 ? 53  GLU B O   1 
ATOM   1455 C  CB  . GLU B 1 57  ? -0.180  24.673 36.988 1.00 23.04 ? 53  GLU B CB  1 
ATOM   1456 C  CG  . GLU B 1 57  ? 0.865   25.515 36.220 1.00 25.95 ? 53  GLU B CG  1 
ATOM   1457 C  CD  . GLU B 1 57  ? 0.270   26.470 35.197 1.00 27.75 ? 53  GLU B CD  1 
ATOM   1458 O  OE1 . GLU B 1 57  ? -0.976  26.495 35.062 1.00 31.72 ? 53  GLU B OE1 1 
ATOM   1459 O  OE2 . GLU B 1 57  ? 1.065   27.211 34.554 1.00 31.39 ? 53  GLU B OE2 1 
HETATM 1460 N  N   . MSE B 1 58  ? 2.423   24.663 39.183 1.00 22.40 ? 54  MSE B N   1 
HETATM 1461 C  CA  . MSE B 1 58  ? 3.094   25.415 40.258 1.00 24.12 ? 54  MSE B CA  1 
HETATM 1462 C  C   . MSE B 1 58  ? 3.896   26.571 39.702 1.00 23.26 ? 54  MSE B C   1 
HETATM 1463 O  O   . MSE B 1 58  ? 4.439   26.471 38.594 1.00 24.12 ? 54  MSE B O   1 
HETATM 1464 C  CB  . MSE B 1 58  ? 4.053   24.471 41.008 1.00 23.17 ? 54  MSE B CB  1 
HETATM 1465 C  CG  . MSE B 1 58  ? 3.375   23.355 41.785 1.00 25.47 ? 54  MSE B CG  1 
HETATM 1466 SE SE  . MSE B 1 58  ? 4.532   21.803 42.139 1.00 32.09 ? 54  MSE B SE  1 
HETATM 1467 C  CE  . MSE B 1 58  ? 4.538   21.063 40.302 1.00 27.45 ? 54  MSE B CE  1 
ATOM   1468 N  N   . HIS B 1 59  ? 3.934   27.678 40.434 1.00 21.17 ? 55  HIS B N   1 
ATOM   1469 C  CA  . HIS B 1 59  ? 4.745   28.815 40.030 1.00 21.40 ? 55  HIS B CA  1 
ATOM   1470 C  C   . HIS B 1 59  ? 5.558   29.337 41.227 1.00 22.13 ? 55  HIS B C   1 
ATOM   1471 O  O   . HIS B 1 59  ? 4.969   29.680 42.245 1.00 21.01 ? 55  HIS B O   1 
ATOM   1472 C  CB  . HIS B 1 59  ? 3.942   29.997 39.512 1.00 21.37 ? 55  HIS B CB  1 
ATOM   1473 C  CG  . HIS B 1 59  ? 4.831   31.116 39.092 1.00 24.19 ? 55  HIS B CG  1 
ATOM   1474 N  ND1 . HIS B 1 59  ? 5.574   31.065 37.927 1.00 27.71 ? 55  HIS B ND1 1 
ATOM   1475 C  CD2 . HIS B 1 59  ? 5.187   32.253 39.724 1.00 25.87 ? 55  HIS B CD2 1 
ATOM   1476 C  CE1 . HIS B 1 59  ? 6.307   32.164 37.838 1.00 28.39 ? 55  HIS B CE1 1 
ATOM   1477 N  NE2 . HIS B 1 59  ? 6.089   32.902 38.913 1.00 29.62 ? 55  HIS B NE2 1 
ATOM   1478 N  N   . PRO B 1 60  ? 6.902   29.421 41.097 1.00 22.92 ? 56  PRO B N   1 
ATOM   1479 C  CA  . PRO B 1 60  ? 7.679   28.823 39.990 1.00 24.58 ? 56  PRO B CA  1 
ATOM   1480 C  C   . PRO B 1 60  ? 7.604   27.287 40.001 1.00 25.55 ? 56  PRO B C   1 
ATOM   1481 O  O   . PRO B 1 60  ? 7.265   26.666 41.014 1.00 25.77 ? 56  PRO B O   1 
ATOM   1482 C  CB  . PRO B 1 60  ? 9.117   29.288 40.299 1.00 24.40 ? 56  PRO B CB  1 
ATOM   1483 C  CG  . PRO B 1 60  ? 8.938   30.584 41.152 1.00 24.40 ? 56  PRO B CG  1 
ATOM   1484 C  CD  . PRO B 1 60  ? 7.774   30.166 42.036 1.00 23.40 ? 56  PRO B CD  1 
ATOM   1485 N  N   . ALA B 1 61  ? 7.897   26.677 38.867 1.00 26.44 ? 57  ALA B N   1 
ATOM   1486 C  CA  . ALA B 1 61  ? 7.872   25.227 38.776 1.00 28.88 ? 57  ALA B CA  1 
ATOM   1487 C  C   . ALA B 1 61  ? 9.167   24.702 39.426 1.00 31.08 ? 57  ALA B C   1 
ATOM   1488 O  O   . ALA B 1 61  ? 10.275  25.080 39.022 1.00 30.89 ? 57  ALA B O   1 
ATOM   1489 C  CB  . ALA B 1 61  ? 7.724   24.781 37.329 1.00 29.55 ? 57  ALA B CB  1 
ATOM   1490 N  N   . PRO B 1 62  ? 9.031   23.864 40.471 1.00 31.83 ? 58  PRO B N   1 
ATOM   1491 C  CA  . PRO B 1 62  ? 10.198  23.470 41.247 1.00 33.45 ? 58  PRO B CA  1 
ATOM   1492 C  C   . PRO B 1 62  ? 11.099  22.454 40.581 1.00 34.74 ? 58  PRO B C   1 
ATOM   1493 O  O   . PRO B 1 62  ? 10.633  21.620 39.782 1.00 35.53 ? 58  PRO B O   1 
ATOM   1494 C  CB  . PRO B 1 62  ? 9.595   22.820 42.503 1.00 33.68 ? 58  PRO B CB  1 
ATOM   1495 C  CG  . PRO B 1 62  ? 8.175   22.969 42.410 1.00 32.73 ? 58  PRO B CG  1 
ATOM   1496 C  CD  . PRO B 1 62  ? 7.800   23.282 41.023 1.00 31.86 ? 58  PRO B CD  1 
ATOM   1497 N  N   . GLY B 1 63  ? 12.383  22.541 40.931 1.00 35.59 ? 59  GLY B N   1 
ATOM   1498 C  CA  . GLY B 1 63  ? 13.433  21.643 40.441 1.00 37.05 ? 59  GLY B CA  1 
ATOM   1499 C  C   . GLY B 1 63  ? 13.208  20.981 39.106 1.00 37.34 ? 59  GLY B C   1 
ATOM   1500 O  O   . GLY B 1 63  ? 13.065  21.662 38.080 1.00 38.17 ? 59  GLY B O   1 
ATOM   1501 N  N   . ALA B 1 64  ? 13.171  19.650 39.117 1.00 36.34 ? 60  ALA B N   1 
ATOM   1502 C  CA  . ALA B 1 64  ? 12.986  18.879 37.905 1.00 35.94 ? 60  ALA B CA  1 
ATOM   1503 C  C   . ALA B 1 64  ? 11.646  18.144 37.883 1.00 34.39 ? 60  ALA B C   1 
ATOM   1504 O  O   . ALA B 1 64  ? 11.509  17.087 37.242 1.00 34.90 ? 60  ALA B O   1 
ATOM   1505 C  CB  . ALA B 1 64  ? 14.144  17.883 37.738 1.00 36.33 ? 60  ALA B CB  1 
ATOM   1506 N  N   . GLN B 1 65  ? 10.654  18.715 38.564 1.00 31.54 ? 61  GLN B N   1 
ATOM   1507 C  CA  . GLN B 1 65  ? 9.324   18.102 38.630 1.00 29.53 ? 61  GLN B CA  1 
ATOM   1508 C  C   . GLN B 1 65  ? 8.608   18.159 37.281 1.00 28.35 ? 61  GLN B C   1 
ATOM   1509 O  O   . GLN B 1 65  ? 8.719   19.150 36.548 1.00 27.56 ? 61  GLN B O   1 
ATOM   1510 C  CB  . GLN B 1 65  ? 8.485   18.817 39.688 1.00 29.02 ? 61  GLN B CB  1 
ATOM   1511 C  CG  . GLN B 1 65  ? 8.948   18.561 41.110 1.00 28.62 ? 61  GLN B CG  1 
ATOM   1512 C  CD  . GLN B 1 65  ? 7.972   19.107 42.122 1.00 26.44 ? 61  GLN B CD  1 
ATOM   1513 O  OE1 . GLN B 1 65  ? 6.785   19.245 41.830 1.00 25.12 ? 61  GLN B OE1 1 
ATOM   1514 N  NE2 . GLN B 1 65  ? 8.459   19.415 43.320 1.00 26.43 ? 61  GLN B NE2 1 
ATOM   1515 N  N   . PRO B 1 66  ? 7.869   17.093 36.936 1.00 27.65 ? 62  PRO B N   1 
ATOM   1516 C  CA  . PRO B 1 66  ? 7.124   17.150 35.675 1.00 26.83 ? 62  PRO B CA  1 
ATOM   1517 C  C   . PRO B 1 66  ? 6.012   18.198 35.707 1.00 26.40 ? 62  PRO B C   1 
ATOM   1518 O  O   . PRO B 1 66  ? 5.484   18.526 36.792 1.00 25.75 ? 62  PRO B O   1 
ATOM   1519 C  CB  . PRO B 1 66  ? 6.485   15.750 35.573 1.00 26.85 ? 62  PRO B CB  1 
ATOM   1520 C  CG  . PRO B 1 66  ? 6.454   15.234 36.979 1.00 28.11 ? 62  PRO B CG  1 
ATOM   1521 C  CD  . PRO B 1 66  ? 7.670   15.813 37.644 1.00 27.09 ? 62  PRO B CD  1 
ATOM   1522 N  N   . SER B 1 67  ? 5.678   18.721 34.526 1.00 25.66 ? 63  SER B N   1 
ATOM   1523 C  CA  . SER B 1 67  ? 4.602   19.700 34.368 1.00 25.50 ? 63  SER B CA  1 
ATOM   1524 C  C   . SER B 1 67  ? 3.275   19.009 34.695 1.00 25.60 ? 63  SER B C   1 
ATOM   1525 O  O   . SER B 1 67  ? 3.221   17.780 34.824 1.00 24.84 ? 63  SER B O   1 
ATOM   1526 C  CB  . SER B 1 67  ? 4.533   20.185 32.896 1.00 25.00 ? 63  SER B CB  1 
ATOM   1527 O  OG  . SER B 1 67  ? 4.079   19.142 32.050 1.00 25.14 ? 63  SER B OG  1 
ATOM   1528 N  N   . LYS B 1 68  ? 2.206   19.792 34.802 1.00 24.52 ? 64  LYS B N   1 
ATOM   1529 C  CA  . LYS B 1 68  ? 0.893   19.272 35.081 1.00 25.47 ? 64  LYS B CA  1 
ATOM   1530 C  C   . LYS B 1 68  ? 0.500   18.250 34.000 1.00 25.69 ? 64  LYS B C   1 
ATOM   1531 O  O   . LYS B 1 68  ? -0.082  17.216 34.298 1.00 24.71 ? 64  LYS B O   1 
ATOM   1532 C  CB  . LYS B 1 68  ? -0.120  20.430 35.084 1.00 25.17 ? 64  LYS B CB  1 
ATOM   1533 C  CG  . LYS B 1 68  ? -1.556  20.028 35.412 1.00 25.92 ? 64  LYS B CG  1 
ATOM   1534 C  CD  . LYS B 1 68  ? -2.513  21.214 35.411 1.00 27.35 ? 64  LYS B CD  1 
ATOM   1535 C  CE  . LYS B 1 68  ? -3.786  20.821 36.191 1.00 34.94 ? 64  LYS B CE  1 
ATOM   1536 N  NZ  . LYS B 1 68  ? -5.057  21.588 35.884 1.00 37.26 ? 64  LYS B NZ  1 
ATOM   1537 N  N   . GLU B 1 69  ? 0.845   18.554 32.755 1.00 27.14 ? 65  GLU B N   1 
ATOM   1538 C  CA  . GLU B 1 69  ? 0.515   17.661 31.646 1.00 29.57 ? 65  GLU B CA  1 
ATOM   1539 C  C   . GLU B 1 69  ? 1.357   16.392 31.593 1.00 29.40 ? 65  GLU B C   1 
ATOM   1540 O  O   . GLU B 1 69  ? 0.833   15.334 31.243 1.00 31.61 ? 65  GLU B O   1 
ATOM   1541 C  CB  . GLU B 1 69  ? 0.594   18.416 30.321 1.00 30.85 ? 65  GLU B CB  1 
ATOM   1542 C  CG  . GLU B 1 69  ? -0.580  19.395 30.116 1.00 36.84 ? 65  GLU B CG  1 
ATOM   1543 C  CD  . GLU B 1 69  ? -1.954  18.711 30.274 1.00 43.58 ? 65  GLU B CD  1 
ATOM   1544 O  OE1 . GLU B 1 69  ? -2.221  17.722 29.549 1.00 46.80 ? 65  GLU B OE1 1 
ATOM   1545 O  OE2 . GLU B 1 69  ? -2.756  19.158 31.137 1.00 47.22 ? 65  GLU B OE2 1 
ATOM   1546 N  N   . GLU B 1 70  ? 2.645   16.480 31.936 1.00 28.39 ? 66  GLU B N   1 
ATOM   1547 C  CA  . GLU B 1 70  ? 3.561   15.314 31.911 1.00 29.64 ? 66  GLU B CA  1 
ATOM   1548 C  C   . GLU B 1 70  ? 3.393   14.354 33.101 1.00 27.12 ? 66  GLU B C   1 
ATOM   1549 O  O   . GLU B 1 70  ? 3.666   13.155 33.012 1.00 27.20 ? 66  GLU B O   1 
ATOM   1550 C  CB  . GLU B 1 70  ? 5.043   15.769 31.936 1.00 29.54 ? 66  GLU B CB  1 
ATOM   1551 C  CG  . GLU B 1 70  ? 5.527   16.577 30.700 1.00 34.11 ? 66  GLU B CG  1 
ATOM   1552 C  CD  . GLU B 1 70  ? 6.602   17.666 31.004 1.00 34.77 ? 66  GLU B CD  1 
ATOM   1553 O  OE1 . GLU B 1 70  ? 7.206   17.751 32.141 1.00 42.41 ? 66  GLU B OE1 1 
ATOM   1554 O  OE2 . GLU B 1 70  ? 6.816   18.488 30.055 1.00 36.49 ? 66  GLU B OE2 1 
ATOM   1555 N  N   . ALA B 1 71  ? 2.964   14.896 34.224 1.00 25.33 ? 67  ALA B N   1 
ATOM   1556 C  CA  . ALA B 1 71  ? 2.847   14.133 35.481 1.00 23.71 ? 67  ALA B CA  1 
ATOM   1557 C  C   . ALA B 1 71  ? 1.716   13.125 35.581 1.00 23.68 ? 67  ALA B C   1 
ATOM   1558 O  O   . ALA B 1 71  ? 0.656   13.289 34.966 1.00 23.99 ? 67  ALA B O   1 
ATOM   1559 C  CB  . ALA B 1 71  ? 2.700   15.148 36.647 1.00 22.27 ? 67  ALA B CB  1 
ATOM   1560 N  N   . ASP B 1 72  ? 1.926   12.113 36.420 1.00 23.74 ? 68  ASP B N   1 
ATOM   1561 C  CA  . ASP B 1 72  ? 0.888   11.150 36.706 1.00 22.73 ? 68  ASP B CA  1 
ATOM   1562 C  C   . ASP B 1 72  ? -0.048  11.702 37.799 1.00 23.33 ? 68  ASP B C   1 
ATOM   1563 O  O   . ASP B 1 72  ? -1.286  11.560 37.731 1.00 23.02 ? 68  ASP B O   1 
ATOM   1564 C  CB  . ASP B 1 72  ? 1.504   9.864  37.230 1.00 22.12 ? 68  ASP B CB  1 
ATOM   1565 C  CG  . ASP B 1 72  ? 2.001   8.976  36.120 1.00 24.10 ? 68  ASP B CG  1 
ATOM   1566 O  OD1 . ASP B 1 72  ? 1.420   8.993  35.003 1.00 22.23 ? 68  ASP B OD1 1 
ATOM   1567 O  OD2 . ASP B 1 72  ? 2.959   8.253  36.375 1.00 22.78 ? 68  ASP B OD2 1 
ATOM   1568 N  N   . CYS B 1 73  ? 0.549   12.321 38.818 1.00 22.76 ? 69  CYS B N   1 
ATOM   1569 C  CA  . CYS B 1 73  ? -0.215  12.859 39.928 1.00 22.63 ? 69  CYS B CA  1 
ATOM   1570 C  C   . CYS B 1 73  ? 0.642   13.881 40.699 1.00 22.89 ? 69  CYS B C   1 
ATOM   1571 O  O   . CYS B 1 73  ? 1.772   14.174 40.317 1.00 23.55 ? 69  CYS B O   1 
ATOM   1572 C  CB  . CYS B 1 73  ? -0.579  11.711 40.884 1.00 22.46 ? 69  CYS B CB  1 
ATOM   1573 S  SG  . CYS B 1 73  ? 0.845   11.012 41.816 1.00 25.30 ? 69  CYS B SG  1 
ATOM   1574 N  N   . HIS B 1 74  ? 0.069   14.386 41.790 1.00 22.09 ? 70  HIS B N   1 
ATOM   1575 C  CA  . HIS B 1 74  ? 0.731   15.287 42.722 1.00 22.73 ? 70  HIS B CA  1 
ATOM   1576 C  C   . HIS B 1 74  ? 0.691   14.529 44.050 1.00 22.48 ? 70  HIS B C   1 
ATOM   1577 O  O   . HIS B 1 74  ? -0.333  13.952 44.397 1.00 22.78 ? 70  HIS B O   1 
ATOM   1578 C  CB  . HIS B 1 74  ? -0.030  16.591 42.888 1.00 23.26 ? 70  HIS B CB  1 
ATOM   1579 C  CG  . HIS B 1 74  ? 0.729   17.605 43.673 1.00 24.52 ? 70  HIS B CG  1 
ATOM   1580 N  ND1 . HIS B 1 74  ? 1.814   18.284 43.155 1.00 22.12 ? 70  HIS B ND1 1 
ATOM   1581 C  CD2 . HIS B 1 74  ? 0.581   18.026 44.953 1.00 26.69 ? 70  HIS B CD2 1 
ATOM   1582 C  CE1 . HIS B 1 74  ? 2.291   19.103 44.085 1.00 26.47 ? 70  HIS B CE1 1 
ATOM   1583 N  NE2 . HIS B 1 74  ? 1.581   18.947 45.191 1.00 25.58 ? 70  HIS B NE2 1 
ATOM   1584 N  N   . ILE B 1 75  ? 1.822   14.463 44.743 1.00 23.41 ? 71  ILE B N   1 
ATOM   1585 C  CA  . ILE B 1 75  ? 1.881   13.814 46.043 1.00 24.38 ? 71  ILE B CA  1 
ATOM   1586 C  C   . ILE B 1 75  ? 2.254   14.926 47.039 1.00 25.68 ? 71  ILE B C   1 
ATOM   1587 O  O   . ILE B 1 75  ? 3.075   15.763 46.712 1.00 24.63 ? 71  ILE B O   1 
ATOM   1588 C  CB  . ILE B 1 75  ? 2.910   12.690 46.112 1.00 25.08 ? 71  ILE B CB  1 
ATOM   1589 C  CG1 . ILE B 1 75  ? 2.549   11.597 45.079 1.00 25.52 ? 71  ILE B CG1 1 
ATOM   1590 C  CG2 . ILE B 1 75  ? 3.001   12.150 47.580 1.00 27.10 ? 71  ILE B CG2 1 
ATOM   1591 C  CD1 . ILE B 1 75  ? 3.533   10.449 45.037 1.00 29.10 ? 71  ILE B CD1 1 
ATOM   1592 N  N   . GLU B 1 76  ? 1.592   14.947 48.193 1.00 26.37 ? 72  GLU B N   1 
ATOM   1593 C  CA  . GLU B 1 76  ? 1.857   15.928 49.244 1.00 28.44 ? 72  GLU B CA  1 
ATOM   1594 C  C   . GLU B 1 76  ? 2.215   15.201 50.521 1.00 27.04 ? 72  GLU B C   1 
ATOM   1595 O  O   . GLU B 1 76  ? 1.604   14.183 50.842 1.00 26.26 ? 72  GLU B O   1 
ATOM   1596 C  CB  . GLU B 1 76  ? 0.640   16.789 49.567 1.00 28.91 ? 72  GLU B CB  1 
ATOM   1597 C  CG  . GLU B 1 76  ? 0.274   17.822 48.532 1.00 32.84 ? 72  GLU B CG  1 
ATOM   1598 C  CD  . GLU B 1 76  ? -0.946  18.662 48.927 1.00 33.03 ? 72  GLU B CD  1 
ATOM   1599 O  OE1 . GLU B 1 76  ? -1.758  18.222 49.782 1.00 38.35 ? 72  GLU B OE1 1 
ATOM   1600 O  OE2 . GLU B 1 76  ? -1.110  19.778 48.355 1.00 37.08 ? 72  GLU B OE2 1 
ATOM   1601 N  N   . ALA B 1 77  ? 3.195   15.756 51.237 1.00 26.48 ? 73  ALA B N   1 
ATOM   1602 C  CA  . ALA B 1 77  ? 3.627   15.279 52.522 1.00 27.74 ? 73  ALA B CA  1 
ATOM   1603 C  C   . ALA B 1 77  ? 3.062   16.400 53.389 1.00 28.21 ? 73  ALA B C   1 
ATOM   1604 O  O   . ALA B 1 77  ? 3.442   17.593 53.213 1.00 27.80 ? 73  ALA B O   1 
ATOM   1605 C  CB  . ALA B 1 77  ? 5.137   15.271 52.590 1.00 27.69 ? 73  ALA B CB  1 
ATOM   1606 N  N   . ASP B 1 78  ? 2.135   16.057 54.276 1.00 29.07 ? 74  ASP B N   1 
ATOM   1607 C  CA  . ASP B 1 78  ? 1.547   17.060 55.190 1.00 30.23 ? 74  ASP B CA  1 
ATOM   1608 C  C   . ASP B 1 78  ? 2.265   16.851 56.508 1.00 29.86 ? 74  ASP B C   1 
ATOM   1609 O  O   . ASP B 1 78  ? 2.160   15.783 57.084 1.00 29.99 ? 74  ASP B O   1 
ATOM   1610 C  CB  . ASP B 1 78  ? 0.041   16.840 55.327 1.00 31.28 ? 74  ASP B CB  1 
ATOM   1611 C  CG  . ASP B 1 78  ? -0.686  17.148 54.045 1.00 35.53 ? 74  ASP B CG  1 
ATOM   1612 O  OD1 . ASP B 1 78  ? -0.389  18.244 53.496 1.00 38.32 ? 74  ASP B OD1 1 
ATOM   1613 O  OD2 . ASP B 1 78  ? -1.474  16.282 53.563 1.00 39.51 ? 74  ASP B OD2 1 
ATOM   1614 N  N   . ILE B 1 79  ? 3.035   17.853 56.940 1.00 28.34 ? 75  ILE B N   1 
ATOM   1615 C  CA  . ILE B 1 79  ? 3.831   17.768 58.169 1.00 27.96 ? 75  ILE B CA  1 
ATOM   1616 C  C   . ILE B 1 79  ? 3.405   18.841 59.172 1.00 28.25 ? 75  ILE B C   1 
ATOM   1617 O  O   . ILE B 1 79  ? 3.501   20.042 58.906 1.00 27.44 ? 75  ILE B O   1 
ATOM   1618 C  CB  . ILE B 1 79  ? 5.356   17.873 57.854 1.00 27.75 ? 75  ILE B CB  1 
ATOM   1619 C  CG1 . ILE B 1 79  ? 5.786   16.747 56.885 1.00 28.12 ? 75  ILE B CG1 1 
ATOM   1620 C  CG2 . ILE B 1 79  ? 6.189   17.879 59.168 1.00 27.73 ? 75  ILE B CG2 1 
ATOM   1621 C  CD1 . ILE B 1 79  ? 7.178   16.874 56.331 1.00 28.41 ? 75  ILE B CD1 1 
ATOM   1622 N  N   . HIS B 1 80  ? 2.961   18.398 60.343 1.00 28.21 ? 76  HIS B N   1 
ATOM   1623 C  CA  . HIS B 1 80  ? 2.508   19.305 61.392 1.00 28.91 ? 76  HIS B CA  1 
ATOM   1624 C  C   . HIS B 1 80  ? 3.083   18.852 62.723 1.00 28.70 ? 76  HIS B C   1 
ATOM   1625 O  O   . HIS B 1 80  ? 3.332   17.669 62.926 1.00 28.98 ? 76  HIS B O   1 
ATOM   1626 C  CB  . HIS B 1 80  ? 0.975   19.320 61.438 1.00 29.99 ? 76  HIS B CB  1 
ATOM   1627 C  CG  . HIS B 1 80  ? 0.348   19.875 60.196 1.00 32.01 ? 76  HIS B CG  1 
ATOM   1628 N  ND1 . HIS B 1 80  ? 0.060   19.101 59.093 1.00 35.34 ? 76  HIS B ND1 1 
ATOM   1629 C  CD2 . HIS B 1 80  ? -0.026  21.135 59.875 1.00 35.02 ? 76  HIS B CD2 1 
ATOM   1630 C  CE1 . HIS B 1 80  ? -0.470  19.856 58.147 1.00 36.46 ? 76  HIS B CE1 1 
ATOM   1631 N  NE2 . HIS B 1 80  ? -0.534  21.097 58.598 1.00 36.66 ? 76  HIS B NE2 1 
ATOM   1632 N  N   . ALA B 1 81  ? 3.304   19.793 63.637 1.00 28.13 ? 77  ALA B N   1 
ATOM   1633 C  CA  . ALA B 1 81  ? 3.853   19.427 64.931 1.00 28.31 ? 77  ALA B CA  1 
ATOM   1634 C  C   . ALA B 1 81  ? 2.840   18.638 65.754 1.00 28.86 ? 77  ALA B C   1 
ATOM   1635 O  O   . ALA B 1 81  ? 1.645   18.949 65.723 1.00 30.34 ? 77  ALA B O   1 
ATOM   1636 C  CB  . ALA B 1 81  ? 4.242   20.691 65.696 1.00 26.75 ? 77  ALA B CB  1 
ATOM   1637 N  N   . ASN B 1 82  ? 3.316   17.626 66.479 1.00 29.33 ? 78  ASN B N   1 
ATOM   1638 C  CA  . ASN B 1 82  ? 2.479   16.843 67.397 1.00 30.02 ? 78  ASN B CA  1 
ATOM   1639 C  C   . ASN B 1 82  ? 2.811   17.359 68.811 1.00 30.31 ? 78  ASN B C   1 
ATOM   1640 O  O   . ASN B 1 82  ? 3.498   18.383 68.952 1.00 30.49 ? 78  ASN B O   1 
ATOM   1641 C  CB  . ASN B 1 82  ? 2.702   15.329 67.258 1.00 30.50 ? 78  ASN B CB  1 
ATOM   1642 C  CG  . ASN B 1 82  ? 4.166   14.917 67.411 1.00 30.98 ? 78  ASN B CG  1 
ATOM   1643 O  OD1 . ASN B 1 82  ? 4.948   15.552 68.130 1.00 31.04 ? 78  ASN B OD1 1 
ATOM   1644 N  ND2 . ASN B 1 82  ? 4.538   13.830 66.729 1.00 32.30 ? 78  ASN B ND2 1 
ATOM   1645 N  N   . GLU B 1 83  ? 2.363   16.664 69.858 1.00 30.78 ? 79  GLU B N   1 
ATOM   1646 C  CA  . GLU B 1 83  ? 2.654   17.096 71.233 1.00 31.79 ? 79  GLU B CA  1 
ATOM   1647 C  C   . GLU B 1 83  ? 4.153   17.269 71.523 1.00 31.49 ? 79  GLU B C   1 
ATOM   1648 O  O   . GLU B 1 83  ? 4.544   18.178 72.254 1.00 31.97 ? 79  GLU B O   1 
ATOM   1649 C  CB  . GLU B 1 83  ? 2.030   16.138 72.261 1.00 32.73 ? 79  GLU B CB  1 
ATOM   1650 C  CG  . GLU B 1 83  ? 0.501   15.985 72.168 1.00 35.68 ? 79  GLU B CG  1 
ATOM   1651 C  CD  . GLU B 1 83  ? -0.276  17.293 72.359 1.00 39.47 ? 79  GLU B CD  1 
ATOM   1652 O  OE1 . GLU B 1 83  ? 0.145   18.131 73.183 1.00 40.45 ? 79  GLU B OE1 1 
ATOM   1653 O  OE2 . GLU B 1 83  ? -1.324  17.465 71.681 1.00 43.06 ? 79  GLU B OE2 1 
ATOM   1654 N  N   . ALA B 1 84  ? 4.983   16.420 70.924 1.00 31.78 ? 80  ALA B N   1 
ATOM   1655 C  CA  . ALA B 1 84  ? 6.450   16.442 71.106 1.00 32.49 ? 80  ALA B CA  1 
ATOM   1656 C  C   . ALA B 1 84  ? 7.447   17.461 70.430 1.00 32.88 ? 80  ALA B C   1 
ATOM   1657 O  O   . ALA B 1 84  ? 8.501   17.687 71.014 1.00 33.43 ? 80  ALA B O   1 
ATOM   1658 C  CB  . ALA B 1 84  ? 6.977   15.026 70.881 1.00 31.67 ? 80  ALA B CB  1 
ATOM   1659 N  N   . GLY B 1 85  ? 7.178   18.183 69.332 1.00 34.38 ? 81  GLY B N   1 
ATOM   1660 C  CA  . GLY B 1 85  ? 6.114   19.148 69.161 1.00 34.30 ? 81  GLY B CA  1 
ATOM   1661 C  C   . GLY B 1 85  ? 6.527   20.443 69.870 1.00 34.28 ? 81  GLY B C   1 
ATOM   1662 O  O   . GLY B 1 85  ? 7.401   21.228 69.419 1.00 33.59 ? 81  GLY B O   1 
ATOM   1663 N  N   . LYS B 1 86  ? 5.889   20.647 71.013 1.00 33.99 ? 82  LYS B N   1 
ATOM   1664 C  CA  . LYS B 1 86  ? 6.091   21.814 71.874 1.00 34.18 ? 82  LYS B CA  1 
ATOM   1665 C  C   . LYS B 1 86  ? 7.535   22.006 72.383 1.00 33.65 ? 82  LYS B C   1 
ATOM   1666 O  O   . LYS B 1 86  ? 7.978   23.129 72.640 1.00 33.55 ? 82  LYS B O   1 
ATOM   1667 C  CB  . LYS B 1 86  ? 5.073   21.747 73.016 1.00 34.33 ? 82  LYS B CB  1 
ATOM   1668 C  CG  . LYS B 1 86  ? 3.636   21.596 72.489 1.00 36.06 ? 82  LYS B CG  1 
ATOM   1669 C  CD  . LYS B 1 86  ? 2.663   21.085 73.548 1.00 39.73 ? 82  LYS B CD  1 
ATOM   1670 C  CE  . LYS B 1 86  ? 2.047   22.220 74.350 1.00 42.18 ? 82  LYS B CE  1 
ATOM   1671 N  NZ  . LYS B 1 86  ? 0.728   21.794 74.920 1.00 42.77 ? 82  LYS B NZ  1 
ATOM   1672 N  N   . ASP B 1 87  ? 8.269   20.906 72.488 1.00 33.54 ? 83  ASP B N   1 
ATOM   1673 C  CA  . ASP B 1 87  ? 9.663   20.903 72.939 1.00 33.65 ? 83  ASP B CA  1 
ATOM   1674 C  C   . ASP B 1 87  ? 10.608  21.759 72.080 1.00 32.52 ? 83  ASP B C   1 
ATOM   1675 O  O   . ASP B 1 87  ? 11.645  22.231 72.558 1.00 31.84 ? 83  ASP B O   1 
ATOM   1676 C  CB  . ASP B 1 87  ? 10.160  19.467 72.878 1.00 35.96 ? 83  ASP B CB  1 
ATOM   1677 C  CG  . ASP B 1 87  ? 11.050  19.115 74.014 1.00 38.91 ? 83  ASP B CG  1 
ATOM   1678 O  OD1 . ASP B 1 87  ? 11.470  20.032 74.763 1.00 45.35 ? 83  ASP B OD1 1 
ATOM   1679 O  OD2 . ASP B 1 87  ? 11.315  17.894 74.176 1.00 46.01 ? 83  ASP B OD2 1 
ATOM   1680 N  N   . LEU B 1 88  ? 10.259  21.918 70.801 1.00 30.35 ? 84  LEU B N   1 
ATOM   1681 C  CA  . LEU B 1 88  ? 11.054  22.693 69.867 1.00 30.16 ? 84  LEU B CA  1 
ATOM   1682 C  C   . LEU B 1 88  ? 10.486  24.089 69.709 1.00 30.37 ? 84  LEU B C   1 
ATOM   1683 O  O   . LEU B 1 88  ? 10.999  24.895 68.904 1.00 29.87 ? 84  LEU B O   1 
ATOM   1684 C  CB  . LEU B 1 88  ? 11.077  22.009 68.491 1.00 30.30 ? 84  LEU B CB  1 
ATOM   1685 C  CG  . LEU B 1 88  ? 11.931  20.741 68.449 1.00 30.13 ? 84  LEU B CG  1 
ATOM   1686 C  CD1 . LEU B 1 88  ? 11.658  19.890 67.204 1.00 28.90 ? 84  LEU B CD1 1 
ATOM   1687 C  CD2 . LEU B 1 88  ? 13.412  21.102 68.569 1.00 29.92 ? 84  LEU B CD2 1 
ATOM   1688 N  N   . GLY B 1 89  ? 9.409   24.360 70.440 1.00 29.57 ? 85  GLY B N   1 
ATOM   1689 C  CA  . GLY B 1 89  ? 8.755   25.642 70.368 1.00 30.19 ? 85  GLY B CA  1 
ATOM   1690 C  C   . GLY B 1 89  ? 7.525   25.717 69.478 1.00 30.49 ? 85  GLY B C   1 
ATOM   1691 O  O   . GLY B 1 89  ? 6.850   26.740 69.475 1.00 31.13 ? 85  GLY B O   1 
ATOM   1692 N  N   . TYR B 1 90  ? 7.196   24.664 68.734 1.00 30.49 ? 86  TYR B N   1 
ATOM   1693 C  CA  . TYR B 1 90  ? 5.989   24.740 67.882 1.00 30.91 ? 86  TYR B CA  1 
ATOM   1694 C  C   . TYR B 1 90  ? 4.724   24.515 68.669 1.00 31.80 ? 86  TYR B C   1 
ATOM   1695 O  O   . TYR B 1 90  ? 4.744   23.994 69.783 1.00 31.71 ? 86  TYR B O   1 
ATOM   1696 C  CB  . TYR B 1 90  ? 5.997   23.706 66.749 1.00 30.75 ? 86  TYR B CB  1 
ATOM   1697 C  CG  . TYR B 1 90  ? 7.201   23.744 65.858 1.00 29.63 ? 86  TYR B CG  1 
ATOM   1698 C  CD1 . TYR B 1 90  ? 7.284   24.643 64.785 1.00 25.68 ? 86  TYR B CD1 1 
ATOM   1699 C  CD2 . TYR B 1 90  ? 8.260   22.863 66.084 1.00 30.63 ? 86  TYR B CD2 1 
ATOM   1700 C  CE1 . TYR B 1 90  ? 8.421   24.671 63.976 1.00 30.59 ? 86  TYR B CE1 1 
ATOM   1701 C  CE2 . TYR B 1 90  ? 9.383   22.873 65.288 1.00 29.70 ? 86  TYR B CE2 1 
ATOM   1702 C  CZ  . TYR B 1 90  ? 9.468   23.771 64.243 1.00 29.72 ? 86  TYR B CZ  1 
ATOM   1703 O  OH  . TYR B 1 90  ? 10.619  23.733 63.490 1.00 30.82 ? 86  TYR B OH  1 
ATOM   1704 N  N   . GLY B 1 91  ? 3.604   24.897 68.071 1.00 32.89 ? 87  GLY B N   1 
ATOM   1705 C  CA  . GLY B 1 91  ? 2.309   24.674 68.676 1.00 33.90 ? 87  GLY B CA  1 
ATOM   1706 C  C   . GLY B 1 91  ? 1.753   23.413 68.033 1.00 34.74 ? 87  GLY B C   1 
ATOM   1707 O  O   . GLY B 1 91  ? 2.027   23.133 66.852 1.00 34.08 ? 87  GLY B O   1 
ATOM   1708 N  N   . VAL B 1 92  ? 0.981   22.626 68.783 1.00 35.17 ? 88  VAL B N   1 
ATOM   1709 C  CA  . VAL B 1 92  ? 0.416   21.403 68.200 1.00 35.83 ? 88  VAL B CA  1 
ATOM   1710 C  C   . VAL B 1 92  ? -0.455  21.792 67.002 1.00 35.90 ? 88  VAL B C   1 
ATOM   1711 O  O   . VAL B 1 92  ? -1.250  22.739 67.087 1.00 36.30 ? 88  VAL B O   1 
ATOM   1712 C  CB  . VAL B 1 92  ? -0.397  20.562 69.219 1.00 36.19 ? 88  VAL B CB  1 
ATOM   1713 C  CG1 . VAL B 1 92  ? -0.958  19.302 68.563 1.00 36.30 ? 88  VAL B CG1 1 
ATOM   1714 C  CG2 . VAL B 1 92  ? 0.467   20.191 70.399 1.00 37.68 ? 88  VAL B CG2 1 
ATOM   1715 N  N   . GLY B 1 93  ? -0.277  21.082 65.884 1.00 35.72 ? 89  GLY B N   1 
ATOM   1716 C  CA  . GLY B 1 93  ? -1.029  21.333 64.662 1.00 34.61 ? 89  GLY B CA  1 
ATOM   1717 C  C   . GLY B 1 93  ? -0.381  22.298 63.690 1.00 34.14 ? 89  GLY B C   1 
ATOM   1718 O  O   . GLY B 1 93  ? -0.804  22.386 62.535 1.00 35.33 ? 89  GLY B O   1 
ATOM   1719 N  N   . ASP B 1 94  ? 0.657   23.014 64.132 1.00 33.13 ? 90  ASP B N   1 
ATOM   1720 C  CA  . ASP B 1 94  ? 1.334   23.980 63.270 1.00 32.56 ? 90  ASP B CA  1 
ATOM   1721 C  C   . ASP B 1 94  ? 2.075   23.308 62.127 1.00 31.68 ? 90  ASP B C   1 
ATOM   1722 O  O   . ASP B 1 94  ? 2.759   22.303 62.331 1.00 31.69 ? 90  ASP B O   1 
ATOM   1723 C  CB  . ASP B 1 94  ? 2.434   24.722 64.037 1.00 32.51 ? 90  ASP B CB  1 
ATOM   1724 C  CG  . ASP B 1 94  ? 1.912   25.744 65.045 1.00 34.91 ? 90  ASP B CG  1 
ATOM   1725 O  OD1 . ASP B 1 94  ? 0.688   25.921 65.240 1.00 33.47 ? 90  ASP B OD1 1 
ATOM   1726 O  OD2 . ASP B 1 94  ? 2.787   26.383 65.653 1.00 35.62 ? 90  ASP B OD2 1 
ATOM   1727 N  N   . PHE B 1 95  ? 2.018   23.906 60.943 1.00 30.34 ? 91  PHE B N   1 
ATOM   1728 C  CA  . PHE B 1 95  ? 2.818   23.420 59.827 1.00 28.74 ? 91  PHE B CA  1 
ATOM   1729 C  C   . PHE B 1 95  ? 4.293   23.626 60.270 1.00 27.21 ? 91  PHE B C   1 
ATOM   1730 O  O   . PHE B 1 95  ? 4.607   24.624 60.939 1.00 27.89 ? 91  PHE B O   1 
ATOM   1731 C  CB  . PHE B 1 95  ? 2.538   24.278 58.590 1.00 28.80 ? 91  PHE B CB  1 
ATOM   1732 C  CG  . PHE B 1 95  ? 3.492   24.015 57.435 1.00 30.68 ? 91  PHE B CG  1 
ATOM   1733 C  CD1 . PHE B 1 95  ? 3.468   22.794 56.797 1.00 29.94 ? 91  PHE B CD1 1 
ATOM   1734 C  CD2 . PHE B 1 95  ? 4.407   24.993 56.991 1.00 29.33 ? 91  PHE B CD2 1 
ATOM   1735 C  CE1 . PHE B 1 95  ? 4.331   22.505 55.733 1.00 26.98 ? 91  PHE B CE1 1 
ATOM   1736 C  CE2 . PHE B 1 95  ? 5.291   24.719 55.924 1.00 29.91 ? 91  PHE B CE2 1 
ATOM   1737 C  CZ  . PHE B 1 95  ? 5.249   23.465 55.304 1.00 27.45 ? 91  PHE B CZ  1 
ATOM   1738 N  N   . VAL B 1 96  ? 5.197   22.701 59.924 1.00 25.80 ? 92  VAL B N   1 
ATOM   1739 C  CA  . VAL B 1 96  ? 6.621   22.808 60.283 1.00 24.28 ? 92  VAL B CA  1 
ATOM   1740 C  C   . VAL B 1 96  ? 7.432   23.150 59.033 1.00 24.02 ? 92  VAL B C   1 
ATOM   1741 O  O   . VAL B 1 96  ? 7.681   22.276 58.209 1.00 23.17 ? 92  VAL B O   1 
ATOM   1742 C  CB  . VAL B 1 96  ? 7.161   21.500 60.950 1.00 23.81 ? 92  VAL B CB  1 
ATOM   1743 C  CG1 . VAL B 1 96  ? 8.645   21.628 61.357 1.00 23.41 ? 92  VAL B CG1 1 
ATOM   1744 C  CG2 . VAL B 1 96  ? 6.322   21.165 62.177 1.00 24.15 ? 92  VAL B CG2 1 
ATOM   1745 N  N   . PRO B 1 97  ? 7.814   24.429 58.879 1.00 24.27 ? 93  PRO B N   1 
ATOM   1746 C  CA  . PRO B 1 97  ? 8.508   24.885 57.695 1.00 24.28 ? 93  PRO B CA  1 
ATOM   1747 C  C   . PRO B 1 97  ? 10.015  24.615 57.782 1.00 22.35 ? 93  PRO B C   1 
ATOM   1748 O  O   . PRO B 1 97  ? 10.525  24.250 58.874 1.00 23.37 ? 93  PRO B O   1 
ATOM   1749 C  CB  . PRO B 1 97  ? 8.225   26.408 57.691 1.00 23.35 ? 93  PRO B CB  1 
ATOM   1750 C  CG  . PRO B 1 97  ? 8.078   26.757 59.134 1.00 26.20 ? 93  PRO B CG  1 
ATOM   1751 C  CD  . PRO B 1 97  ? 7.622   25.524 59.865 1.00 25.58 ? 93  PRO B CD  1 
ATOM   1752 N  N   . TYR B 1 98  ? 10.707  24.822 56.660 1.00 23.27 ? 94  TYR B N   1 
ATOM   1753 C  CA  . TYR B 1 98  ? 12.168  24.705 56.524 1.00 23.10 ? 94  TYR B CA  1 
ATOM   1754 C  C   . TYR B 1 98  ? 12.744  23.295 56.561 1.00 23.65 ? 94  TYR B C   1 
ATOM   1755 O  O   . TYR B 1 98  ? 13.968  23.127 56.600 1.00 24.97 ? 94  TYR B O   1 
ATOM   1756 C  CB  . TYR B 1 98  ? 12.920  25.611 57.537 1.00 22.58 ? 94  TYR B CB  1 
ATOM   1757 C  CG  . TYR B 1 98  ? 12.527  27.066 57.453 1.00 22.79 ? 94  TYR B CG  1 
ATOM   1758 C  CD1 . TYR B 1 98  ? 13.118  27.924 56.501 1.00 23.54 ? 94  TYR B CD1 1 
ATOM   1759 C  CD2 . TYR B 1 98  ? 11.594  27.591 58.325 1.00 25.07 ? 94  TYR B CD2 1 
ATOM   1760 C  CE1 . TYR B 1 98  ? 12.789  29.279 56.465 1.00 22.66 ? 94  TYR B CE1 1 
ATOM   1761 C  CE2 . TYR B 1 98  ? 11.210  28.938 58.250 1.00 25.46 ? 94  TYR B CE2 1 
ATOM   1762 C  CZ  . TYR B 1 98  ? 11.813  29.758 57.330 1.00 22.53 ? 94  TYR B CZ  1 
ATOM   1763 O  OH  . TYR B 1 98  ? 11.475  31.087 57.299 1.00 21.75 ? 94  TYR B OH  1 
ATOM   1764 N  N   . LEU B 1 99  ? 11.863  22.302 56.478 1.00 23.74 ? 95  LEU B N   1 
ATOM   1765 C  CA  . LEU B 1 99  ? 12.308  20.893 56.463 1.00 23.30 ? 95  LEU B CA  1 
ATOM   1766 C  C   . LEU B 1 99  ? 12.700  20.539 55.046 1.00 24.28 ? 95  LEU B C   1 
ATOM   1767 O  O   . LEU B 1 99  ? 12.289  21.223 54.076 1.00 24.04 ? 95  LEU B O   1 
ATOM   1768 C  CB  . LEU B 1 99  ? 11.177  19.964 56.919 1.00 22.94 ? 95  LEU B CB  1 
ATOM   1769 C  CG  . LEU B 1 99  ? 10.647  20.261 58.315 1.00 23.85 ? 95  LEU B CG  1 
ATOM   1770 C  CD1 . LEU B 1 99  ? 9.637   19.249 58.727 1.00 25.64 ? 95  LEU B CD1 1 
ATOM   1771 C  CD2 . LEU B 1 99  ? 11.779  20.356 59.380 1.00 24.97 ? 95  LEU B CD2 1 
ATOM   1772 N  N   . ARG B 1 100 ? 13.470  19.463 54.904 1.00 22.96 ? 96  ARG B N   1 
ATOM   1773 C  CA  . ARG B 1 100 ? 13.896  18.989 53.591 1.00 25.18 ? 96  ARG B CA  1 
ATOM   1774 C  C   . ARG B 1 100 ? 13.293  17.605 53.470 1.00 24.32 ? 96  ARG B C   1 
ATOM   1775 O  O   . ARG B 1 100 ? 13.629  16.711 54.230 1.00 24.09 ? 96  ARG B O   1 
ATOM   1776 C  CB  . ARG B 1 100 ? 15.421  19.041 53.455 1.00 26.67 ? 96  ARG B CB  1 
ATOM   1777 C  CG  . ARG B 1 100 ? 16.001  20.430 53.787 1.00 30.96 ? 96  ARG B CG  1 
ATOM   1778 C  CD  . ARG B 1 100 ? 16.909  20.385 55.040 1.00 38.03 ? 96  ARG B CD  1 
ATOM   1779 N  NE  . ARG B 1 100 ? 18.307  20.216 54.680 1.00 41.78 ? 96  ARG B NE  1 
ATOM   1780 C  CZ  . ARG B 1 100 ? 19.283  19.836 55.502 1.00 45.21 ? 96  ARG B CZ  1 
ATOM   1781 N  NH1 . ARG B 1 100 ? 19.052  19.545 56.776 1.00 46.06 ? 96  ARG B NH1 1 
ATOM   1782 N  NH2 . ARG B 1 100 ? 20.517  19.736 55.031 1.00 48.51 ? 96  ARG B NH2 1 
ATOM   1783 N  N   . VAL B 1 101 ? 12.310  17.470 52.576 1.00 24.20 ? 97  VAL B N   1 
ATOM   1784 C  CA  . VAL B 1 101 ? 11.566  16.224 52.455 1.00 24.34 ? 97  VAL B CA  1 
ATOM   1785 C  C   . VAL B 1 101 ? 11.798  15.535 51.102 1.00 24.97 ? 97  VAL B C   1 
ATOM   1786 O  O   . VAL B 1 101 ? 11.720  16.162 50.036 1.00 25.85 ? 97  VAL B O   1 
ATOM   1787 C  CB  . VAL B 1 101 ? 10.046  16.515 52.720 1.00 24.55 ? 97  VAL B CB  1 
ATOM   1788 C  CG1 . VAL B 1 101 ? 9.197   15.236 52.700 1.00 24.48 ? 97  VAL B CG1 1 
ATOM   1789 C  CG2 . VAL B 1 101 ? 9.839   17.266 54.053 1.00 24.87 ? 97  VAL B CG2 1 
ATOM   1790 N  N   . VAL B 1 102 ? 12.093  14.238 51.145 1.00 24.40 ? 98  VAL B N   1 
ATOM   1791 C  CA  . VAL B 1 102 ? 12.334  13.466 49.935 1.00 25.58 ? 98  VAL B CA  1 
ATOM   1792 C  C   . VAL B 1 102 ? 11.527  12.177 50.053 1.00 25.34 ? 98  VAL B C   1 
ATOM   1793 O  O   . VAL B 1 102 ? 11.336  11.662 51.168 1.00 25.08 ? 98  VAL B O   1 
ATOM   1794 C  CB  . VAL B 1 102 ? 13.854  13.145 49.737 1.00 25.72 ? 98  VAL B CB  1 
ATOM   1795 C  CG1 . VAL B 1 102 ? 14.104  12.356 48.470 1.00 28.08 ? 98  VAL B CG1 1 
ATOM   1796 C  CG2 . VAL B 1 102 ? 14.675  14.426 49.675 1.00 28.45 ? 98  VAL B CG2 1 
ATOM   1797 N  N   . ALA B 1 103 ? 11.023  11.692 48.919 1.00 25.11 ? 99  ALA B N   1 
ATOM   1798 C  CA  . ALA B 1 103 ? 10.277  10.430 48.898 1.00 24.80 ? 99  ALA B CA  1 
ATOM   1799 C  C   . ALA B 1 103 ? 11.033  9.458  48.047 1.00 25.06 ? 99  ALA B C   1 
ATOM   1800 O  O   . ALA B 1 103 ? 11.659  9.832  47.048 1.00 24.55 ? 99  ALA B O   1 
ATOM   1801 C  CB  . ALA B 1 103 ? 8.827   10.604 48.357 1.00 25.17 ? 99  ALA B CB  1 
ATOM   1802 N  N   . PHE B 1 104 ? 11.015  8.195  48.474 1.00 24.85 ? 100 PHE B N   1 
ATOM   1803 C  CA  . PHE B 1 104 ? 11.642  7.129  47.699 1.00 24.95 ? 100 PHE B CA  1 
ATOM   1804 C  C   . PHE B 1 104 ? 10.519  6.169  47.349 1.00 25.49 ? 100 PHE B C   1 
ATOM   1805 O  O   . PHE B 1 104 ? 9.764   5.753  48.235 1.00 24.91 ? 100 PHE B O   1 
ATOM   1806 C  CB  . PHE B 1 104 ? 12.736  6.421  48.480 1.00 26.11 ? 100 PHE B CB  1 
ATOM   1807 C  CG  . PHE B 1 104 ? 13.911  7.299  48.771 1.00 27.09 ? 100 PHE B CG  1 
ATOM   1808 C  CD1 . PHE B 1 104 ? 13.934  8.071  49.927 1.00 29.01 ? 100 PHE B CD1 1 
ATOM   1809 C  CD2 . PHE B 1 104 ? 14.966  7.403  47.867 1.00 29.93 ? 100 PHE B CD2 1 
ATOM   1810 C  CE1 . PHE B 1 104 ? 15.008  8.921  50.216 1.00 29.79 ? 100 PHE B CE1 1 
ATOM   1811 C  CE2 . PHE B 1 104 ? 16.051  8.263  48.155 1.00 29.71 ? 100 PHE B CE2 1 
ATOM   1812 C  CZ  . PHE B 1 104 ? 16.061  9.008  49.317 1.00 29.90 ? 100 PHE B CZ  1 
ATOM   1813 N  N   . LEU B 1 105 ? 10.415  5.831  46.058 1.00 24.51 ? 101 LEU B N   1 
ATOM   1814 C  CA  . LEU B 1 105 ? 9.387   4.936  45.572 1.00 24.20 ? 101 LEU B CA  1 
ATOM   1815 C  C   . LEU B 1 105 ? 9.986   3.662  45.012 1.00 23.78 ? 101 LEU B C   1 
ATOM   1816 O  O   . LEU B 1 105 ? 10.867  3.719  44.157 1.00 23.97 ? 101 LEU B O   1 
ATOM   1817 C  CB  . LEU B 1 105 ? 8.608   5.621  44.441 1.00 24.03 ? 101 LEU B CB  1 
ATOM   1818 C  CG  . LEU B 1 105 ? 8.111   7.034  44.687 1.00 27.67 ? 101 LEU B CG  1 
ATOM   1819 C  CD1 . LEU B 1 105 ? 7.472   7.579  43.396 1.00 24.85 ? 101 LEU B CD1 1 
ATOM   1820 C  CD2 . LEU B 1 105 ? 7.129   7.032  45.844 1.00 29.61 ? 101 LEU B CD2 1 
ATOM   1821 N  N   . GLN B 1 106 ? 9.494   2.519  45.460 1.00 23.74 ? 102 GLN B N   1 
ATOM   1822 C  CA  . GLN B 1 106 ? 10.001  1.253  44.963 1.00 24.75 ? 102 GLN B CA  1 
ATOM   1823 C  C   . GLN B 1 106 ? 8.829   0.311  44.670 1.00 24.60 ? 102 GLN B C   1 
ATOM   1824 O  O   . GLN B 1 106 ? 8.086   -0.059 45.588 1.00 23.72 ? 102 GLN B O   1 
ATOM   1825 C  CB  . GLN B 1 106 ? 10.994  0.617  45.960 1.00 26.20 ? 102 GLN B CB  1 
ATOM   1826 C  CG  . GLN B 1 106 ? 11.579  -0.677 45.429 1.00 27.40 ? 102 GLN B CG  1 
ATOM   1827 C  CD  . GLN B 1 106 ? 12.655  -1.246 46.336 1.00 28.88 ? 102 GLN B CD  1 
ATOM   1828 O  OE1 . GLN B 1 106 ? 12.894  -0.741 47.427 1.00 29.07 ? 102 GLN B OE1 1 
ATOM   1829 N  NE2 . GLN B 1 106 ? 13.292  -2.310 45.885 1.00 34.22 ? 102 GLN B NE2 1 
ATOM   1830 N  N   . LYS B 1 107 ? 8.650   -0.034 43.392 1.00 23.94 ? 103 LYS B N   1 
ATOM   1831 C  CA  . LYS B 1 107 ? 7.566   -0.931 42.981 1.00 24.31 ? 103 LYS B CA  1 
ATOM   1832 C  C   . LYS B 1 107 ? 7.877   -2.356 43.442 1.00 25.64 ? 103 LYS B C   1 
ATOM   1833 O  O   . LYS B 1 107 ? 9.008   -2.835 43.295 1.00 25.87 ? 103 LYS B O   1 
ATOM   1834 C  CB  . LYS B 1 107 ? 7.407   -0.932 41.459 1.00 24.05 ? 103 LYS B CB  1 
ATOM   1835 C  CG  . LYS B 1 107 ? 6.258   -1.811 40.933 1.00 22.69 ? 103 LYS B CG  1 
ATOM   1836 C  CD  . LYS B 1 107 ? 6.047   -1.517 39.440 1.00 26.67 ? 103 LYS B CD  1 
ATOM   1837 C  CE  . LYS B 1 107 ? 5.197   -2.565 38.781 1.00 28.00 ? 103 LYS B CE  1 
ATOM   1838 N  NZ  . LYS B 1 107 ? 4.934   -2.126 37.371 1.00 26.76 ? 103 LYS B NZ  1 
ATOM   1839 N  N   . HIS B 1 108 ? 6.871   -3.013 44.020 1.00 26.29 ? 104 HIS B N   1 
ATOM   1840 C  CA  . HIS B 1 108 ? 7.009   -4.386 44.486 1.00 27.58 ? 104 HIS B CA  1 
ATOM   1841 C  C   . HIS B 1 108 ? 7.402   -5.251 43.293 1.00 27.80 ? 104 HIS B C   1 
ATOM   1842 O  O   . HIS B 1 108 ? 6.725   -5.223 42.253 1.00 27.29 ? 104 HIS B O   1 
ATOM   1843 C  CB  . HIS B 1 108 ? 5.666   -4.885 44.997 1.00 27.68 ? 104 HIS B CB  1 
ATOM   1844 C  CG  . HIS B 1 108 ? 5.293   -4.358 46.342 1.00 30.13 ? 104 HIS B CG  1 
ATOM   1845 N  ND1 . HIS B 1 108 ? 4.260   -4.892 47.080 1.00 32.73 ? 104 HIS B ND1 1 
ATOM   1846 C  CD2 . HIS B 1 108 ? 5.804   -3.345 47.080 1.00 30.21 ? 104 HIS B CD2 1 
ATOM   1847 C  CE1 . HIS B 1 108 ? 4.153   -4.224 48.218 1.00 32.35 ? 104 HIS B CE1 1 
ATOM   1848 N  NE2 . HIS B 1 108 ? 5.080   -3.287 48.244 1.00 31.98 ? 104 HIS B NE2 1 
ATOM   1849 N  N   . GLY B 1 109 ? 8.497   -5.993 43.450 1.00 28.81 ? 105 GLY B N   1 
ATOM   1850 C  CA  . GLY B 1 109 ? 9.002   -6.884 42.408 1.00 30.91 ? 105 GLY B CA  1 
ATOM   1851 C  C   . GLY B 1 109 ? 10.161  -6.282 41.650 1.00 31.48 ? 105 GLY B C   1 
ATOM   1852 O  O   . GLY B 1 109 ? 10.775  -6.958 40.831 1.00 32.01 ? 105 GLY B O   1 
ATOM   1853 N  N   . SER B 1 110 ? 10.443  -5.007 41.926 1.00 32.09 ? 106 SER B N   1 
ATOM   1854 C  CA  . SER B 1 110 ? 11.536  -4.278 41.293 1.00 32.53 ? 106 SER B CA  1 
ATOM   1855 C  C   . SER B 1 110 ? 12.639  -3.886 42.295 1.00 33.10 ? 106 SER B C   1 
ATOM   1856 O  O   . SER B 1 110 ? 12.377  -3.646 43.483 1.00 32.72 ? 106 SER B O   1 
ATOM   1857 C  CB  . SER B 1 110 ? 10.996  -3.032 40.570 1.00 32.80 ? 106 SER B CB  1 
ATOM   1858 O  OG  . SER B 1 110 ? 12.038  -2.138 40.215 1.00 32.70 ? 106 SER B OG  1 
ATOM   1859 N  N   . GLU B 1 111 ? 13.870  -3.814 41.791 1.00 34.05 ? 107 GLU B N   1 
ATOM   1860 C  CA  . GLU B 1 111 ? 15.026  -3.411 42.578 1.00 34.62 ? 107 GLU B CA  1 
ATOM   1861 C  C   . GLU B 1 111 ? 15.247  -1.905 42.437 1.00 34.41 ? 107 GLU B C   1 
ATOM   1862 O  O   . GLU B 1 111 ? 16.005  -1.319 43.201 1.00 33.66 ? 107 GLU B O   1 
ATOM   1863 C  CB  . GLU B 1 111 ? 16.299  -4.129 42.100 1.00 36.43 ? 107 GLU B CB  1 
ATOM   1864 C  CG  . GLU B 1 111 ? 16.420  -5.597 42.528 1.00 39.36 ? 107 GLU B CG  1 
ATOM   1865 C  CD  . GLU B 1 111 ? 16.932  -5.736 43.957 1.00 44.38 ? 107 GLU B CD  1 
ATOM   1866 O  OE1 . GLU B 1 111 ? 16.347  -5.095 44.863 1.00 47.10 ? 107 GLU B OE1 1 
ATOM   1867 O  OE2 . GLU B 1 111 ? 17.923  -6.480 44.178 1.00 46.02 ? 107 GLU B OE2 1 
ATOM   1868 N  N   . LYS B 1 112 ? 14.604  -1.298 41.440 1.00 33.27 ? 108 LYS B N   1 
ATOM   1869 C  CA  . LYS B 1 112 ? 14.756  0.142  41.176 1.00 33.60 ? 108 LYS B CA  1 
ATOM   1870 C  C   . LYS B 1 112 ? 14.072  1.045  42.197 1.00 32.19 ? 108 LYS B C   1 
ATOM   1871 O  O   . LYS B 1 112 ? 12.978  0.739  42.687 1.00 32.11 ? 108 LYS B O   1 
ATOM   1872 C  CB  . LYS B 1 112 ? 14.231  0.490  39.770 1.00 32.79 ? 108 LYS B CB  1 
ATOM   1873 C  CG  . LYS B 1 112 ? 14.920  -0.247 38.636 1.00 34.56 ? 108 LYS B CG  1 
ATOM   1874 C  CD  . LYS B 1 112 ? 14.472  0.251  37.282 1.00 35.93 ? 108 LYS B CD  1 
ATOM   1875 C  CE  . LYS B 1 112 ? 15.060  -0.604 36.140 1.00 40.20 ? 108 LYS B CE  1 
ATOM   1876 N  NZ  . LYS B 1 112 ? 14.536  -2.015 36.051 1.00 44.31 ? 108 LYS B NZ  1 
ATOM   1877 N  N   . VAL B 1 113 ? 14.720  2.167  42.509 1.00 31.63 ? 109 VAL B N   1 
ATOM   1878 C  CA  . VAL B 1 113 ? 14.145  3.134  43.432 1.00 30.53 ? 109 VAL B CA  1 
ATOM   1879 C  C   . VAL B 1 113 ? 14.113  4.511  42.739 1.00 29.83 ? 109 VAL B C   1 
ATOM   1880 O  O   . VAL B 1 113 ? 15.120  4.956  42.178 1.00 31.55 ? 109 VAL B O   1 
ATOM   1881 C  CB  . VAL B 1 113 ? 14.928  3.245  44.773 1.00 30.68 ? 109 VAL B CB  1 
ATOM   1882 C  CG1 . VAL B 1 113 ? 14.462  4.453  45.575 1.00 32.37 ? 109 VAL B CG1 1 
ATOM   1883 C  CG2 . VAL B 1 113 ? 14.791  1.953  45.612 1.00 31.35 ? 109 VAL B CG2 1 
ATOM   1884 N  N   . GLN B 1 114 ? 12.974  5.190  42.795 1.00 27.61 ? 110 GLN B N   1 
ATOM   1885 C  CA  . GLN B 1 114 ? 12.857  6.522  42.211 1.00 26.11 ? 110 GLN B CA  1 
ATOM   1886 C  C   . GLN B 1 114 ? 12.863  7.509  43.376 1.00 25.78 ? 110 GLN B C   1 
ATOM   1887 O  O   . GLN B 1 114 ? 12.129  7.329  44.343 1.00 24.91 ? 110 GLN B O   1 
ATOM   1888 C  CB  . GLN B 1 114 ? 11.526  6.666  41.463 1.00 25.18 ? 110 GLN B CB  1 
ATOM   1889 C  CG  . GLN B 1 114 ? 11.301  7.998  40.767 1.00 26.25 ? 110 GLN B CG  1 
ATOM   1890 C  CD  . GLN B 1 114 ? 9.909   8.064  40.121 1.00 26.05 ? 110 GLN B CD  1 
ATOM   1891 O  OE1 . GLN B 1 114 ? 9.286   7.022  39.861 1.00 25.28 ? 110 GLN B OE1 1 
ATOM   1892 N  NE2 . GLN B 1 114 ? 9.429   9.274  39.874 1.00 27.70 ? 110 GLN B NE2 1 
ATOM   1893 N  N   . LYS B 1 115 ? 13.658  8.561  43.260 1.00 26.24 ? 111 LYS B N   1 
ATOM   1894 C  CA  . LYS B 1 115 ? 13.722  9.584  44.308 1.00 27.67 ? 111 LYS B CA  1 
ATOM   1895 C  C   . LYS B 1 115 ? 12.884  10.790 43.884 1.00 26.63 ? 111 LYS B C   1 
ATOM   1896 O  O   . LYS B 1 115 ? 13.022  11.237 42.757 1.00 27.57 ? 111 LYS B O   1 
ATOM   1897 C  CB  . LYS B 1 115 ? 15.178  10.010 44.560 1.00 28.14 ? 111 LYS B CB  1 
ATOM   1898 C  CG  . LYS B 1 115 ? 15.364  10.825 45.827 1.00 30.35 ? 111 LYS B CG  1 
ATOM   1899 C  CD  . LYS B 1 115 ? 16.828  11.239 46.081 1.00 31.62 ? 111 LYS B CD  1 
ATOM   1900 C  CE  . LYS B 1 115 ? 16.991  12.773 46.047 1.00 37.70 ? 111 LYS B CE  1 
ATOM   1901 N  NZ  . LYS B 1 115 ? 18.037  13.265 47.026 1.00 41.55 ? 111 LYS B NZ  1 
ATOM   1902 N  N   . VAL B 1 116 ? 12.040  11.310 44.785 1.00 26.40 ? 112 VAL B N   1 
ATOM   1903 C  CA  . VAL B 1 116 ? 11.207  12.502 44.524 1.00 26.90 ? 112 VAL B CA  1 
ATOM   1904 C  C   . VAL B 1 116 ? 11.538  13.583 45.578 1.00 28.35 ? 112 VAL B C   1 
ATOM   1905 O  O   . VAL B 1 116 ? 11.366  13.371 46.769 1.00 27.51 ? 112 VAL B O   1 
ATOM   1906 C  CB  . VAL B 1 116 ? 9.718   12.190 44.616 1.00 26.87 ? 112 VAL B CB  1 
ATOM   1907 C  CG1 . VAL B 1 116 ? 8.883   13.443 44.360 1.00 28.88 ? 112 VAL B CG1 1 
ATOM   1908 C  CG2 . VAL B 1 116 ? 9.328   11.057 43.631 1.00 26.61 ? 112 VAL B CG2 1 
HETATM 1909 N  N   . MSE B 1 117 ? 12.038  14.723 45.136 1.00 29.73 ? 113 MSE B N   1 
HETATM 1910 C  CA  . MSE B 1 117 ? 12.379  15.764 46.065 1.00 33.77 ? 113 MSE B CA  1 
HETATM 1911 C  C   . MSE B 1 117 ? 11.171  16.662 46.175 1.00 28.68 ? 113 MSE B C   1 
HETATM 1912 O  O   . MSE B 1 117 ? 10.740  17.244 45.192 1.00 29.41 ? 113 MSE B O   1 
HETATM 1913 C  CB  . MSE B 1 117 ? 13.608  16.524 45.575 1.00 32.80 ? 113 MSE B CB  1 
HETATM 1914 C  CG  . MSE B 1 117 ? 14.788  15.595 45.328 1.00 40.92 ? 113 MSE B CG  1 
HETATM 1915 SE SE  . MSE B 1 117 ? 16.373  16.605 44.822 1.00 54.00 ? 113 MSE B SE  1 
HETATM 1916 C  CE  . MSE B 1 117 ? 16.056  16.815 42.877 1.00 49.65 ? 113 MSE B CE  1 
ATOM   1917 N  N   A PHE B 1 118 ? 10.635  16.768 47.385 0.50 27.37 ? 114 PHE B N   1 
ATOM   1918 N  N   B PHE B 1 118 ? 10.584  16.747 47.359 0.50 27.33 ? 114 PHE B N   1 
ATOM   1919 C  CA  A PHE B 1 118 ? 9.467   17.596 47.654 0.50 25.36 ? 114 PHE B CA  1 
ATOM   1920 C  CA  B PHE B 1 118 ? 9.426   17.601 47.504 0.50 25.34 ? 114 PHE B CA  1 
ATOM   1921 C  C   A PHE B 1 118 ? 9.872   19.051 47.867 0.50 25.02 ? 114 PHE B C   1 
ATOM   1922 C  C   B PHE B 1 118 ? 9.918   19.039 47.602 0.50 25.09 ? 114 PHE B C   1 
ATOM   1923 O  O   A PHE B 1 118 ? 10.974  19.337 48.338 0.50 23.30 ? 114 PHE B O   1 
ATOM   1924 O  O   B PHE B 1 118 ? 11.121  19.298 47.742 0.50 23.65 ? 114 PHE B O   1 
ATOM   1925 C  CB  A PHE B 1 118 ? 8.690   17.082 48.868 0.50 26.31 ? 114 PHE B CB  1 
ATOM   1926 C  CB  B PHE B 1 118 ? 8.600   17.286 48.758 0.50 25.89 ? 114 PHE B CB  1 
ATOM   1927 C  CG  A PHE B 1 118 ? 7.803   15.893 48.577 0.50 26.33 ? 114 PHE B CG  1 
ATOM   1928 C  CG  B PHE B 1 118 ? 7.873   15.965 48.719 0.50 26.42 ? 114 PHE B CG  1 
ATOM   1929 C  CD1 A PHE B 1 118 ? 8.095   15.013 47.544 0.50 25.36 ? 114 PHE B CD1 1 
ATOM   1930 C  CD1 B PHE B 1 118 ? 6.677   15.819 48.004 0.50 27.94 ? 114 PHE B CD1 1 
ATOM   1931 C  CD2 A PHE B 1 118 ? 6.665   15.664 49.341 0.50 28.18 ? 114 PHE B CD2 1 
ATOM   1932 C  CD2 B PHE B 1 118 ? 8.351   14.886 49.443 0.50 27.26 ? 114 PHE B CD2 1 
ATOM   1933 C  CE1 A PHE B 1 118 ? 7.254   13.900 47.271 0.50 27.61 ? 114 PHE B CE1 1 
ATOM   1934 C  CE1 B PHE B 1 118 ? 5.988   14.590 47.987 0.50 28.86 ? 114 PHE B CE1 1 
ATOM   1935 C  CE2 A PHE B 1 118 ? 5.831   14.576 49.087 0.50 27.06 ? 114 PHE B CE2 1 
ATOM   1936 C  CE2 B PHE B 1 118 ? 7.672   13.656 49.431 0.50 25.96 ? 114 PHE B CE2 1 
ATOM   1937 C  CZ  A PHE B 1 118 ? 6.128   13.686 48.050 0.50 28.20 ? 114 PHE B CZ  1 
ATOM   1938 C  CZ  B PHE B 1 118 ? 6.502   13.504 48.708 0.50 26.65 ? 114 PHE B CZ  1 
ATOM   1939 N  N   . ALA B 1 119 ? 8.960   19.955 47.520 1.00 23.51 ? 115 ALA B N   1 
ATOM   1940 C  CA  . ALA B 1 119 ? 9.224   21.407 47.637 1.00 23.76 ? 115 ALA B CA  1 
ATOM   1941 C  C   . ALA B 1 119 ? 8.117   22.050 48.457 1.00 23.02 ? 115 ALA B C   1 
ATOM   1942 O  O   . ALA B 1 119 ? 6.948   21.620 48.399 1.00 23.59 ? 115 ALA B O   1 
ATOM   1943 C  CB  . ALA B 1 119 ? 9.315   22.039 46.249 1.00 23.71 ? 115 ALA B CB  1 
ATOM   1944 N  N   . PRO B 1 120 ? 8.456   23.120 49.209 1.00 22.93 ? 116 PRO B N   1 
ATOM   1945 C  CA  . PRO B 1 120 ? 7.431   23.820 49.973 1.00 22.21 ? 116 PRO B CA  1 
ATOM   1946 C  C   . PRO B 1 120 ? 6.572   24.692 49.057 1.00 21.92 ? 116 PRO B C   1 
ATOM   1947 O  O   . PRO B 1 120 ? 7.091   25.398 48.189 1.00 21.90 ? 116 PRO B O   1 
ATOM   1948 C  CB  . PRO B 1 120 ? 8.242   24.689 50.976 1.00 22.41 ? 116 PRO B CB  1 
ATOM   1949 C  CG  . PRO B 1 120 ? 9.556   24.868 50.307 1.00 23.91 ? 116 PRO B CG  1 
ATOM   1950 C  CD  . PRO B 1 120 ? 9.807   23.711 49.375 1.00 23.21 ? 116 PRO B CD  1 
HETATM 1951 N  N   . MSE B 1 121 ? 5.258   24.660 49.278 1.00 20.62 ? 117 MSE B N   1 
HETATM 1952 C  CA  . MSE B 1 121 ? 4.359   25.470 48.438 1.00 22.25 ? 117 MSE B CA  1 
HETATM 1953 C  C   . MSE B 1 121 ? 2.994   25.635 49.102 1.00 22.61 ? 117 MSE B C   1 
HETATM 1954 O  O   . MSE B 1 121 ? 2.622   24.820 49.958 1.00 22.94 ? 117 MSE B O   1 
HETATM 1955 C  CB  . MSE B 1 121 ? 4.127   24.739 47.078 1.00 20.79 ? 117 MSE B CB  1 
HETATM 1956 C  CG  . MSE B 1 121 ? 3.555   23.318 47.204 1.00 22.07 ? 117 MSE B CG  1 
HETATM 1957 SE SE  . MSE B 1 121 ? 3.741   22.398 45.522 1.00 28.40 ? 117 MSE B SE  1 
HETATM 1958 C  CE  . MSE B 1 121 ? 5.701   22.320 45.405 1.00 26.81 ? 117 MSE B CE  1 
ATOM   1959 N  N   . ASN B 1 122 ? 2.229   26.640 48.663 1.00 20.79 ? 118 ASN B N   1 
ATOM   1960 C  CA  . ASN B 1 122 ? 0.894   26.798 49.147 1.00 21.15 ? 118 ASN B CA  1 
ATOM   1961 C  C   . ASN B 1 122 ? -0.070  26.357 48.068 1.00 22.11 ? 118 ASN B C   1 
ATOM   1962 O  O   . ASN B 1 122 ? 0.128   26.702 46.892 1.00 21.53 ? 118 ASN B O   1 
ATOM   1963 C  CB  . ASN B 1 122 ? 0.558   28.270 49.381 1.00 20.95 ? 118 ASN B CB  1 
ATOM   1964 C  CG  . ASN B 1 122 ? 0.990   28.756 50.748 1.00 19.61 ? 118 ASN B CG  1 
ATOM   1965 O  OD1 . ASN B 1 122 ? 1.523   27.999 51.577 1.00 20.38 ? 118 ASN B OD1 1 
ATOM   1966 N  ND2 . ASN B 1 122 ? 0.799   30.025 50.965 1.00 23.44 ? 118 ASN B ND2 1 
ATOM   1967 N  N   . ALA B 1 123 ? -1.153  25.691 48.472 1.00 23.28 ? 119 ALA B N   1 
ATOM   1968 C  CA  . ALA B 1 123 ? -2.255  25.360 47.579 1.00 24.68 ? 119 ALA B CA  1 
ATOM   1969 C  C   . ALA B 1 123 ? -3.424  26.193 48.158 1.00 25.63 ? 119 ALA B C   1 
ATOM   1970 O  O   . ALA B 1 123 ? -3.243  26.941 49.131 1.00 25.39 ? 119 ALA B O   1 
ATOM   1971 C  CB  . ALA B 1 123 ? -2.585  23.873 47.620 1.00 24.20 ? 119 ALA B CB  1 
ATOM   1972 N  N   . GLY B 1 124 ? -4.625  26.059 47.603 1.00 27.51 ? 120 GLY B N   1 
ATOM   1973 C  CA  . GLY B 1 124 ? -5.774  26.786 48.133 1.00 29.15 ? 120 GLY B CA  1 
ATOM   1974 C  C   . GLY B 1 124 ? -6.067  26.381 49.583 1.00 29.48 ? 120 GLY B C   1 
ATOM   1975 O  O   . GLY B 1 124 ? -6.715  27.121 50.328 1.00 31.38 ? 120 GLY B O   1 
ATOM   1976 N  N   . ASP B 1 125 ? -5.622  25.197 49.987 1.00 30.57 ? 121 ASP B N   1 
ATOM   1977 C  CA  . ASP B 1 125 ? -5.869  24.727 51.351 1.00 31.61 ? 121 ASP B CA  1 
ATOM   1978 C  C   . ASP B 1 125 ? -4.669  24.853 52.274 1.00 31.65 ? 121 ASP B C   1 
ATOM   1979 O  O   . ASP B 1 125 ? -4.571  24.154 53.288 1.00 33.20 ? 121 ASP B O   1 
ATOM   1980 C  CB  . ASP B 1 125 ? -6.377  23.275 51.331 1.00 32.26 ? 121 ASP B CB  1 
ATOM   1981 C  CG  . ASP B 1 125 ? -5.301  22.283 50.894 1.00 34.85 ? 121 ASP B CG  1 
ATOM   1982 O  OD1 . ASP B 1 125 ? -4.288  22.712 50.291 1.00 34.67 ? 121 ASP B OD1 1 
ATOM   1983 O  OD2 . ASP B 1 125 ? -5.465  21.064 51.132 1.00 39.18 ? 121 ASP B OD2 1 
ATOM   1984 N  N   . GLY B 1 126 ? -3.744  25.749 51.950 1.00 31.12 ? 122 GLY B N   1 
ATOM   1985 C  CA  . GLY B 1 126 ? -2.572  25.951 52.795 1.00 29.21 ? 122 GLY B CA  1 
ATOM   1986 C  C   . GLY B 1 126 ? -1.214  25.370 52.406 1.00 28.54 ? 122 GLY B C   1 
ATOM   1987 O  O   . GLY B 1 126 ? -1.040  24.806 51.304 1.00 28.08 ? 122 GLY B O   1 
ATOM   1988 N  N   . PRO B 1 127 ? -0.226  25.537 53.282 1.00 27.61 ? 123 PRO B N   1 
ATOM   1989 C  CA  . PRO B 1 127 ? 1.119   25.063 52.998 1.00 26.92 ? 123 PRO B CA  1 
ATOM   1990 C  C   . PRO B 1 127 ? 1.256   23.544 53.020 1.00 26.58 ? 123 PRO B C   1 
ATOM   1991 O  O   . PRO B 1 127 ? 0.538   22.868 53.790 1.00 27.42 ? 123 PRO B O   1 
ATOM   1992 C  CB  . PRO B 1 127 ? 1.932   25.640 54.162 1.00 27.32 ? 123 PRO B CB  1 
ATOM   1993 C  CG  . PRO B 1 127 ? 0.936   25.655 55.292 1.00 29.17 ? 123 PRO B CG  1 
ATOM   1994 C  CD  . PRO B 1 127 ? -0.262  26.236 54.593 1.00 28.28 ? 123 PRO B CD  1 
ATOM   1995 N  N   . HIS B 1 128 ? 2.165   23.028 52.185 1.00 25.86 ? 124 HIS B N   1 
ATOM   1996 C  CA  . HIS B 1 128 ? 2.497   21.585 52.094 1.00 25.50 ? 124 HIS B CA  1 
ATOM   1997 C  C   . HIS B 1 128 ? 3.922   21.435 51.556 1.00 24.82 ? 124 HIS B C   1 
ATOM   1998 O  O   . HIS B 1 128 ? 4.513   22.391 51.055 1.00 24.08 ? 124 HIS B O   1 
ATOM   1999 C  CB  . HIS B 1 128 ? 1.611   20.824 51.059 1.00 27.90 ? 124 HIS B CB  1 
ATOM   2000 C  CG  . HIS B 1 128 ? 0.141   21.120 51.134 1.00 31.53 ? 124 HIS B CG  1 
ATOM   2001 N  ND1 . HIS B 1 128 ? -0.718  20.439 51.978 1.00 33.82 ? 124 HIS B ND1 1 
ATOM   2002 C  CD2 . HIS B 1 128 ? -0.624  22.018 50.464 1.00 32.49 ? 124 HIS B CD2 1 
ATOM   2003 C  CE1 . HIS B 1 128 ? -1.949  20.910 51.821 1.00 35.24 ? 124 HIS B CE1 1 
ATOM   2004 N  NE2 . HIS B 1 128 ? -1.918  21.869 50.908 1.00 32.96 ? 124 HIS B NE2 1 
ATOM   2005 N  N   . TYR B 1 129 ? 4.441   20.206 51.607 1.00 22.66 ? 125 TYR B N   1 
ATOM   2006 C  CA  . TYR B 1 129 ? 5.669   19.831 50.938 1.00 22.28 ? 125 TYR B CA  1 
ATOM   2007 C  C   . TYR B 1 129 ? 5.052   18.989 49.807 1.00 23.52 ? 125 TYR B C   1 
ATOM   2008 O  O   . TYR B 1 129 ? 4.303   18.028 50.077 1.00 23.32 ? 125 TYR B O   1 
ATOM   2009 C  CB  . TYR B 1 129 ? 6.569   18.985 51.796 1.00 21.11 ? 125 TYR B CB  1 
ATOM   2010 C  CG  . TYR B 1 129 ? 7.188   19.835 52.888 1.00 21.14 ? 125 TYR B CG  1 
ATOM   2011 C  CD1 . TYR B 1 129 ? 8.292   20.633 52.620 1.00 23.44 ? 125 TYR B CD1 1 
ATOM   2012 C  CD2 . TYR B 1 129 ? 6.646   19.834 54.175 1.00 22.26 ? 125 TYR B CD2 1 
ATOM   2013 C  CE1 . TYR B 1 129 ? 8.852   21.446 53.620 1.00 22.47 ? 125 TYR B CE1 1 
ATOM   2014 C  CE2 . TYR B 1 129 ? 7.201   20.641 55.196 1.00 22.35 ? 125 TYR B CE2 1 
ATOM   2015 C  CZ  . TYR B 1 129 ? 8.298   21.432 54.904 1.00 22.76 ? 125 TYR B CZ  1 
ATOM   2016 O  OH  . TYR B 1 129 ? 8.884   22.209 55.906 1.00 22.64 ? 125 TYR B OH  1 
ATOM   2017 N  N   . GLY B 1 130 ? 5.290   19.358 48.558 1.00 23.74 ? 126 GLY B N   1 
ATOM   2018 C  CA  . GLY B 1 130 ? 4.650   18.616 47.493 1.00 24.21 ? 126 GLY B CA  1 
ATOM   2019 C  C   . GLY B 1 130 ? 5.459   18.447 46.243 1.00 23.27 ? 126 GLY B C   1 
ATOM   2020 O  O   . GLY B 1 130 ? 6.507   19.068 46.073 1.00 23.01 ? 126 GLY B O   1 
ATOM   2021 N  N   . ALA B 1 131 ? 4.976   17.554 45.371 1.00 22.59 ? 127 ALA B N   1 
ATOM   2022 C  CA  . ALA B 1 131 ? 5.648   17.358 44.125 1.00 23.11 ? 127 ALA B CA  1 
ATOM   2023 C  C   . ALA B 1 131 ? 4.740   16.696 43.116 1.00 22.56 ? 127 ALA B C   1 
ATOM   2024 O  O   . ALA B 1 131 ? 3.990   15.777 43.492 1.00 21.69 ? 127 ALA B O   1 
ATOM   2025 C  CB  . ALA B 1 131 ? 6.900   16.479 44.313 1.00 24.15 ? 127 ALA B CB  1 
ATOM   2026 N  N   . ASN B 1 132 ? 4.831   17.148 41.862 1.00 21.83 ? 128 ASN B N   1 
ATOM   2027 C  CA  . ASN B 1 132 ? 4.160   16.452 40.767 1.00 21.17 ? 128 ASN B CA  1 
ATOM   2028 C  C   . ASN B 1 132 ? 5.085   15.266 40.545 1.00 21.84 ? 128 ASN B C   1 
ATOM   2029 O  O   . ASN B 1 132 ? 6.312   15.399 40.671 1.00 21.89 ? 128 ASN B O   1 
ATOM   2030 C  CB  . ASN B 1 132 ? 4.155   17.288 39.500 1.00 21.77 ? 128 ASN B CB  1 
ATOM   2031 C  CG  . ASN B 1 132 ? 2.926   18.161 39.392 1.00 20.50 ? 128 ASN B CG  1 
ATOM   2032 O  OD1 . ASN B 1 132 ? 2.072   18.175 40.273 1.00 21.41 ? 128 ASN B OD1 1 
ATOM   2033 N  ND2 . ASN B 1 132 ? 2.798   18.834 38.266 1.00 20.38 ? 128 ASN B ND2 1 
ATOM   2034 N  N   A VAL B 1 133 ? 4.510   14.088 40.267 0.50 20.65 ? 129 VAL B N   1 
ATOM   2035 N  N   B VAL B 1 133 ? 4.526   14.124 40.163 0.50 20.97 ? 129 VAL B N   1 
ATOM   2036 C  CA  A VAL B 1 133 ? 5.283   12.855 40.115 0.50 21.10 ? 129 VAL B CA  1 
ATOM   2037 C  CA  B VAL B 1 133 ? 5.369   12.976 39.934 0.50 22.12 ? 129 VAL B CA  1 
ATOM   2038 C  C   A VAL B 1 133 ? 4.850   12.019 38.920 0.50 21.22 ? 129 VAL B C   1 
ATOM   2039 C  C   B VAL B 1 133 ? 4.885   12.149 38.772 0.50 21.69 ? 129 VAL B C   1 
ATOM   2040 O  O   A VAL B 1 133 ? 3.651   11.923 38.674 0.50 20.19 ? 129 VAL B O   1 
ATOM   2041 O  O   B VAL B 1 133 ? 3.720   12.208 38.376 0.50 20.89 ? 129 VAL B O   1 
ATOM   2042 C  CB  A VAL B 1 133 ? 5.036   11.921 41.352 0.50 21.20 ? 129 VAL B CB  1 
ATOM   2043 C  CB  B VAL B 1 133 ? 5.489   12.062 41.179 0.50 22.09 ? 129 VAL B CB  1 
ATOM   2044 C  CG1 A VAL B 1 133 ? 5.757   10.569 41.195 0.50 18.81 ? 129 VAL B CG1 1 
ATOM   2045 C  CG1 B VAL B 1 133 ? 6.195   12.768 42.352 0.50 23.74 ? 129 VAL B CG1 1 
ATOM   2046 C  CG2 A VAL B 1 133 ? 5.392   12.595 42.700 0.50 21.12 ? 129 VAL B CG2 1 
ATOM   2047 C  CG2 B VAL B 1 133 ? 4.135   11.554 41.619 0.50 22.94 ? 129 VAL B CG2 1 
ATOM   2048 N  N   . LYS B 1 134 ? 5.809   11.373 38.234 1.00 22.87 ? 130 LYS B N   1 
ATOM   2049 C  CA  . LYS B 1 134 ? 5.514   10.454 37.101 1.00 23.48 ? 130 LYS B CA  1 
ATOM   2050 C  C   . LYS B 1 134 ? 6.144   9.178  37.630 1.00 24.22 ? 130 LYS B C   1 
ATOM   2051 O  O   . LYS B 1 134 ? 7.342   9.151  37.921 1.00 24.60 ? 130 LYS B O   1 
ATOM   2052 C  CB  . LYS B 1 134 ? 6.157   10.842 35.766 1.00 25.00 ? 130 LYS B CB  1 
ATOM   2053 C  CG  . LYS B 1 134 ? 5.803   9.927  34.574 1.00 27.35 ? 130 LYS B CG  1 
ATOM   2054 C  CD  . LYS B 1 134 ? 6.022   10.695 33.256 1.00 35.38 ? 130 LYS B CD  1 
ATOM   2055 C  CE  . LYS B 1 134 ? 6.377   9.798  32.088 1.00 38.82 ? 130 LYS B CE  1 
ATOM   2056 N  NZ  . LYS B 1 134 ? 6.849   10.660 30.940 1.00 40.19 ? 130 LYS B NZ  1 
ATOM   2057 N  N   . PHE B 1 135 ? 5.335   8.140  37.790 1.00 23.36 ? 131 PHE B N   1 
ATOM   2058 C  CA  . PHE B 1 135 ? 5.811   6.838  38.310 1.00 23.80 ? 131 PHE B CA  1 
ATOM   2059 C  C   . PHE B 1 135 ? 6.615   6.147  37.204 1.00 24.72 ? 131 PHE B C   1 
ATOM   2060 O  O   . PHE B 1 135 ? 6.041   5.660  36.223 1.00 24.97 ? 131 PHE B O   1 
ATOM   2061 C  CB  . PHE B 1 135 ? 4.642   5.985  38.746 1.00 25.13 ? 131 PHE B CB  1 
ATOM   2062 C  CG  . PHE B 1 135 ? 3.953   6.472  39.973 1.00 25.55 ? 131 PHE B CG  1 
ATOM   2063 C  CD1 . PHE B 1 135 ? 4.452   6.141  41.255 1.00 25.22 ? 131 PHE B CD1 1 
ATOM   2064 C  CD2 . PHE B 1 135 ? 2.803   7.276  39.871 1.00 23.42 ? 131 PHE B CD2 1 
ATOM   2065 C  CE1 . PHE B 1 135 ? 3.801   6.604  42.401 1.00 27.88 ? 131 PHE B CE1 1 
ATOM   2066 C  CE2 . PHE B 1 135 ? 2.144   7.716  41.005 1.00 27.86 ? 131 PHE B CE2 1 
ATOM   2067 C  CZ  . PHE B 1 135 ? 2.634   7.396  42.260 1.00 26.39 ? 131 PHE B CZ  1 
ATOM   2068 N  N   . GLU B 1 136 ? 7.943   6.165  37.350 1.00 25.37 ? 132 GLU B N   1 
ATOM   2069 C  CA  . GLU B 1 136 ? 8.821   5.590  36.333 1.00 26.24 ? 132 GLU B CA  1 
ATOM   2070 C  C   . GLU B 1 136 ? 8.518   4.143  35.983 1.00 25.31 ? 132 GLU B C   1 
ATOM   2071 O  O   . GLU B 1 136 ? 8.540   3.785  34.805 1.00 25.74 ? 132 GLU B O   1 
ATOM   2072 C  CB  . GLU B 1 136 ? 10.278  5.779  36.683 1.00 27.91 ? 132 GLU B CB  1 
ATOM   2073 C  CG  . GLU B 1 136 ? 10.708  7.202  36.402 1.00 30.92 ? 132 GLU B CG  1 
ATOM   2074 C  CD  . GLU B 1 136 ? 11.955  7.587  37.135 1.00 36.81 ? 132 GLU B CD  1 
ATOM   2075 O  OE1 . GLU B 1 136 ? 12.723  6.688  37.578 1.00 40.04 ? 132 GLU B OE1 1 
ATOM   2076 O  OE2 . GLU B 1 136 ? 12.149  8.821  37.265 1.00 39.21 ? 132 GLU B OE2 1 
ATOM   2077 N  N   . GLU B 1 137 ? 8.195   3.340  36.991 1.00 24.92 ? 133 GLU B N   1 
ATOM   2078 C  CA  . GLU B 1 137 ? 7.894   1.920  36.751 1.00 24.95 ? 133 GLU B CA  1 
ATOM   2079 C  C   . GLU B 1 137 ? 6.417   1.627  36.501 1.00 24.34 ? 133 GLU B C   1 
ATOM   2080 O  O   . GLU B 1 137 ? 6.001   0.470  36.410 1.00 24.19 ? 133 GLU B O   1 
ATOM   2081 C  CB  . GLU B 1 137 ? 8.450   1.051  37.901 1.00 25.65 ? 133 GLU B CB  1 
ATOM   2082 C  CG  . GLU B 1 137 ? 9.931   1.264  38.249 1.00 32.17 ? 133 GLU B CG  1 
ATOM   2083 C  CD  . GLU B 1 137 ? 10.897  1.211  37.044 1.00 38.61 ? 133 GLU B CD  1 
ATOM   2084 O  OE1 . GLU B 1 137 ? 10.795  0.282  36.197 1.00 43.10 ? 133 GLU B OE1 1 
ATOM   2085 O  OE2 . GLU B 1 137 ? 11.782  2.108  36.979 1.00 41.23 ? 133 GLU B OE2 1 
ATOM   2086 N  N   . GLY B 1 138 ? 5.615   2.675  36.405 1.00 23.16 ? 134 GLY B N   1 
ATOM   2087 C  CA  . GLY B 1 138 ? 4.183   2.488  36.082 1.00 21.66 ? 134 GLY B CA  1 
ATOM   2088 C  C   . GLY B 1 138 ? 3.258   1.939  37.145 1.00 20.03 ? 134 GLY B C   1 
ATOM   2089 O  O   . GLY B 1 138 ? 3.487   2.121  38.348 1.00 20.67 ? 134 GLY B O   1 
ATOM   2090 N  N   . LEU B 1 139 ? 2.204   1.263  36.687 1.00 20.49 ? 135 LEU B N   1 
ATOM   2091 C  CA  . LEU B 1 139 ? 1.186   0.727  37.570 1.00 19.33 ? 135 LEU B CA  1 
ATOM   2092 C  C   . LEU B 1 139 ? 1.716   -0.356 38.469 1.00 19.48 ? 135 LEU B C   1 
ATOM   2093 O  O   . LEU B 1 139 ? 2.543   -1.170 38.052 1.00 19.24 ? 135 LEU B O   1 
ATOM   2094 C  CB  . LEU B 1 139 ? 0.005   0.182  36.744 1.00 18.81 ? 135 LEU B CB  1 
ATOM   2095 C  CG  . LEU B 1 139 ? -0.581  1.185  35.743 1.00 18.90 ? 135 LEU B CG  1 
ATOM   2096 C  CD1 . LEU B 1 139 ? -1.558  0.489  34.829 1.00 22.80 ? 135 LEU B CD1 1 
ATOM   2097 C  CD2 . LEU B 1 139 ? -1.183  2.353  36.502 1.00 22.89 ? 135 LEU B CD2 1 
ATOM   2098 N  N   . GLY B 1 140 ? 1.164   -0.427 39.677 1.00 19.57 ? 136 GLY B N   1 
ATOM   2099 C  CA  . GLY B 1 140 ? 1.579   -1.482 40.604 1.00 21.46 ? 136 GLY B CA  1 
ATOM   2100 C  C   . GLY B 1 140 ? 1.512   -1.046 42.035 1.00 22.11 ? 136 GLY B C   1 
ATOM   2101 O  O   . GLY B 1 140 ? 1.024   0.036  42.325 1.00 23.77 ? 136 GLY B O   1 
ATOM   2102 N  N   . THR B 1 141 ? 2.006   -1.921 42.918 1.00 22.28 ? 137 THR B N   1 
ATOM   2103 C  CA  . THR B 1 141 ? 2.060   -1.644 44.358 1.00 22.86 ? 137 THR B CA  1 
ATOM   2104 C  C   . THR B 1 141 ? 3.466   -1.187 44.697 1.00 22.85 ? 137 THR B C   1 
ATOM   2105 O  O   . THR B 1 141 ? 4.470   -1.792 44.287 1.00 22.79 ? 137 THR B O   1 
ATOM   2106 C  CB  . THR B 1 141 ? 1.625   -2.871 45.198 1.00 23.14 ? 137 THR B CB  1 
ATOM   2107 O  OG1 . THR B 1 141 ? 0.384   -3.375 44.686 1.00 23.73 ? 137 THR B OG1 1 
ATOM   2108 C  CG2 . THR B 1 141 ? 1.458   -2.489 46.665 1.00 25.11 ? 137 THR B CG2 1 
ATOM   2109 N  N   . TYR B 1 142 ? 3.517   -0.117 45.470 1.00 23.32 ? 138 TYR B N   1 
ATOM   2110 C  CA  . TYR B 1 142 ? 4.776   0.496  45.874 1.00 22.73 ? 138 TYR B CA  1 
ATOM   2111 C  C   . TYR B 1 142 ? 5.035   0.606  47.362 1.00 23.51 ? 138 TYR B C   1 
ATOM   2112 O  O   . TYR B 1 142 ? 4.108   0.762  48.146 1.00 24.65 ? 138 TYR B O   1 
ATOM   2113 C  CB  . TYR B 1 142 ? 4.777   1.964  45.358 1.00 23.06 ? 138 TYR B CB  1 
ATOM   2114 C  CG  . TYR B 1 142 ? 5.013   2.117  43.881 1.00 21.57 ? 138 TYR B CG  1 
ATOM   2115 C  CD1 . TYR B 1 142 ? 3.978   1.899  42.967 1.00 20.57 ? 138 TYR B CD1 1 
ATOM   2116 C  CD2 . TYR B 1 142 ? 6.262   2.492  43.386 1.00 21.66 ? 138 TYR B CD2 1 
ATOM   2117 C  CE1 . TYR B 1 142 ? 4.203   2.011  41.582 1.00 22.11 ? 138 TYR B CE1 1 
ATOM   2118 C  CE2 . TYR B 1 142 ? 6.490   2.634  42.008 1.00 21.74 ? 138 TYR B CE2 1 
ATOM   2119 C  CZ  . TYR B 1 142 ? 5.450   2.386  41.112 1.00 23.68 ? 138 TYR B CZ  1 
ATOM   2120 O  OH  . TYR B 1 142 ? 5.655   2.510  39.755 1.00 22.38 ? 138 TYR B OH  1 
ATOM   2121 N  N   . LYS B 1 143 ? 6.325   0.571  47.707 1.00 23.14 ? 139 LYS B N   1 
ATOM   2122 C  CA  . LYS B 1 143 ? 6.804   0.875  49.042 1.00 23.83 ? 139 LYS B CA  1 
ATOM   2123 C  C   . LYS B 1 143 ? 7.049   2.416  48.865 1.00 23.89 ? 139 LYS B C   1 
ATOM   2124 O  O   . LYS B 1 143 ? 7.660   2.848  47.860 1.00 23.99 ? 139 LYS B O   1 
ATOM   2125 C  CB  . LYS B 1 143 ? 8.088   0.118  49.355 1.00 23.89 ? 139 LYS B CB  1 
ATOM   2126 C  CG  . LYS B 1 143 ? 7.874   -1.363 49.627 1.00 30.41 ? 139 LYS B CG  1 
ATOM   2127 C  CD  . LYS B 1 143 ? 9.118   -1.997 50.247 1.00 35.66 ? 139 LYS B CD  1 
ATOM   2128 C  CE  . LYS B 1 143 ? 8.839   -3.401 50.724 1.00 38.49 ? 139 LYS B CE  1 
ATOM   2129 N  NZ  . LYS B 1 143 ? 9.826   -3.767 51.817 1.00 40.67 ? 139 LYS B NZ  1 
ATOM   2130 N  N   . VAL B 1 144 ? 6.525   3.243  49.778 1.00 23.69 ? 140 VAL B N   1 
ATOM   2131 C  CA  . VAL B 1 144 ? 6.666   4.713  49.680 1.00 24.37 ? 140 VAL B CA  1 
ATOM   2132 C  C   . VAL B 1 144 ? 7.288   5.163  51.008 1.00 24.78 ? 140 VAL B C   1 
ATOM   2133 O  O   . VAL B 1 144 ? 6.717   4.891  52.056 1.00 24.42 ? 140 VAL B O   1 
ATOM   2134 C  CB  . VAL B 1 144 ? 5.319   5.414  49.391 1.00 23.97 ? 140 VAL B CB  1 
ATOM   2135 C  CG1 . VAL B 1 144 ? 5.454   6.974  49.388 1.00 26.21 ? 140 VAL B CG1 1 
ATOM   2136 C  CG2 . VAL B 1 144 ? 4.738   4.966  48.014 1.00 24.16 ? 140 VAL B CG2 1 
ATOM   2137 N  N   . ARG B 1 145 ? 8.466   5.794  50.934 1.00 25.58 ? 141 ARG B N   1 
ATOM   2138 C  CA  . ARG B 1 145 ? 9.218   6.238  52.116 1.00 26.73 ? 141 ARG B CA  1 
ATOM   2139 C  C   . ARG B 1 145 ? 9.536   7.721  52.038 1.00 26.14 ? 141 ARG B C   1 
ATOM   2140 O  O   . ARG B 1 145 ? 10.156  8.162  51.061 1.00 26.67 ? 141 ARG B O   1 
ATOM   2141 C  CB  . ARG B 1 145 ? 10.536  5.457  52.212 1.00 25.77 ? 141 ARG B CB  1 
ATOM   2142 C  CG  . ARG B 1 145 ? 11.606  5.967  53.207 1.00 29.76 ? 141 ARG B CG  1 
ATOM   2143 C  CD  . ARG B 1 145 ? 12.868  5.111  53.015 1.00 29.35 ? 141 ARG B CD  1 
ATOM   2144 N  NE  . ARG B 1 145 ? 13.843  5.293  54.084 1.00 35.10 ? 141 ARG B NE  1 
ATOM   2145 C  CZ  . ARG B 1 145 ? 14.041  4.437  55.086 1.00 34.14 ? 141 ARG B CZ  1 
ATOM   2146 N  NH1 . ARG B 1 145 ? 13.345  3.294  55.165 1.00 36.32 ? 141 ARG B NH1 1 
ATOM   2147 N  NH2 . ARG B 1 145 ? 14.954  4.720  56.005 1.00 35.65 ? 141 ARG B NH2 1 
ATOM   2148 N  N   . PHE B 1 146 ? 9.083   8.465  53.044 1.00 25.35 ? 142 PHE B N   1 
ATOM   2149 C  CA  . PHE B 1 146 ? 9.390   9.885  53.139 1.00 24.98 ? 142 PHE B CA  1 
ATOM   2150 C  C   . PHE B 1 146 ? 10.546  10.000 54.124 1.00 24.58 ? 142 PHE B C   1 
ATOM   2151 O  O   . PHE B 1 146 ? 10.495  9.409  55.230 1.00 24.40 ? 142 PHE B O   1 
ATOM   2152 C  CB  . PHE B 1 146 ? 8.237   10.717 53.722 1.00 25.03 ? 142 PHE B CB  1 
ATOM   2153 C  CG  . PHE B 1 146 ? 7.026   10.860 52.818 1.00 26.57 ? 142 PHE B CG  1 
ATOM   2154 C  CD1 . PHE B 1 146 ? 7.008   10.350 51.506 1.00 24.50 ? 142 PHE B CD1 1 
ATOM   2155 C  CD2 . PHE B 1 146 ? 5.881   11.489 53.313 1.00 25.81 ? 142 PHE B CD2 1 
ATOM   2156 C  CE1 . PHE B 1 146 ? 5.873   10.516 50.689 1.00 27.29 ? 142 PHE B CE1 1 
ATOM   2157 C  CE2 . PHE B 1 146 ? 4.746   11.642 52.535 1.00 26.73 ? 142 PHE B CE2 1 
ATOM   2158 C  CZ  . PHE B 1 146 ? 4.735   11.152 51.206 1.00 26.97 ? 142 PHE B CZ  1 
ATOM   2159 N  N   . GLU B 1 147 ? 11.599  10.709 53.728 1.00 24.42 ? 143 GLU B N   1 
ATOM   2160 C  CA  . GLU B 1 147 ? 12.735  10.976 54.632 1.00 24.18 ? 143 GLU B CA  1 
ATOM   2161 C  C   . GLU B 1 147 ? 12.634  12.477 54.912 1.00 23.98 ? 143 GLU B C   1 
ATOM   2162 O  O   . GLU B 1 147 ? 12.560  13.274 53.998 1.00 22.24 ? 143 GLU B O   1 
ATOM   2163 C  CB  . GLU B 1 147 ? 14.076  10.558 54.047 1.00 25.68 ? 143 GLU B CB  1 
ATOM   2164 C  CG  . GLU B 1 147 ? 14.200  9.022  54.041 1.00 26.42 ? 143 GLU B CG  1 
ATOM   2165 C  CD  . GLU B 1 147 ? 15.586  8.512  53.748 1.00 31.58 ? 143 GLU B CD  1 
ATOM   2166 O  OE1 . GLU B 1 147 ? 16.527  9.334  53.666 1.00 35.26 ? 143 GLU B OE1 1 
ATOM   2167 O  OE2 . GLU B 1 147 ? 15.746  7.264  53.642 1.00 33.97 ? 143 GLU B OE2 1 
ATOM   2168 N  N   . ILE B 1 148 ? 12.594  12.838 56.194 1.00 23.33 ? 144 ILE B N   1 
ATOM   2169 C  CA  . ILE B 1 148 ? 12.407  14.235 56.552 1.00 24.05 ? 144 ILE B CA  1 
ATOM   2170 C  C   . ILE B 1 148 ? 13.576  14.722 57.378 1.00 24.65 ? 144 ILE B C   1 
ATOM   2171 O  O   . ILE B 1 148 ? 13.769  14.245 58.495 1.00 23.54 ? 144 ILE B O   1 
ATOM   2172 C  CB  . ILE B 1 148 ? 11.068  14.417 57.310 1.00 23.74 ? 144 ILE B CB  1 
ATOM   2173 C  CG1 . ILE B 1 148 ? 9.861   13.906 56.492 1.00 24.10 ? 144 ILE B CG1 1 
ATOM   2174 C  CG2 . ILE B 1 148 ? 10.890  15.849 57.754 1.00 23.54 ? 144 ILE B CG2 1 
ATOM   2175 C  CD1 . ILE B 1 148 ? 8.812   13.278 57.387 1.00 23.96 ? 144 ILE B CD1 1 
ATOM   2176 N  N   . ALA B 1 149 ? 14.356  15.633 56.792 1.00 24.84 ? 145 ALA B N   1 
ATOM   2177 C  CA  . ALA B 1 149 ? 15.529  16.200 57.458 1.00 25.65 ? 145 ALA B CA  1 
ATOM   2178 C  C   . ALA B 1 149 ? 15.170  17.543 58.096 1.00 25.25 ? 145 ALA B C   1 
ATOM   2179 O  O   . ALA B 1 149 ? 14.347  18.324 57.575 1.00 25.50 ? 145 ALA B O   1 
ATOM   2180 C  CB  . ALA B 1 149 ? 16.685  16.380 56.479 1.00 24.90 ? 145 ALA B CB  1 
ATOM   2181 N  N   . ALA B 1 150 ? 15.811  17.798 59.230 1.00 25.14 ? 146 ALA B N   1 
ATOM   2182 C  CA  . ALA B 1 150 ? 15.619  19.014 59.961 1.00 25.69 ? 146 ALA B CA  1 
ATOM   2183 C  C   . ALA B 1 150 ? 16.151  20.160 59.114 1.00 26.18 ? 146 ALA B C   1 
ATOM   2184 O  O   . ALA B 1 150 ? 16.837  19.926 58.111 1.00 25.59 ? 146 ALA B O   1 
ATOM   2185 C  CB  . ALA B 1 150 ? 16.369  18.939 61.309 1.00 25.88 ? 146 ALA B CB  1 
ATOM   2186 N  N   . PRO B 1 151 ? 15.831  21.403 59.488 1.00 27.00 ? 147 PRO B N   1 
ATOM   2187 C  CA  . PRO B 1 151 ? 16.388  22.501 58.698 1.00 27.70 ? 147 PRO B CA  1 
ATOM   2188 C  C   . PRO B 1 151 ? 17.920  22.470 58.599 1.00 28.87 ? 147 PRO B C   1 
ATOM   2189 O  O   . PRO B 1 151 ? 18.607  21.939 59.481 1.00 28.68 ? 147 PRO B O   1 
ATOM   2190 C  CB  . PRO B 1 151 ? 15.938  23.752 59.472 1.00 28.11 ? 147 PRO B CB  1 
ATOM   2191 C  CG  . PRO B 1 151 ? 14.637  23.334 60.133 1.00 26.97 ? 147 PRO B CG  1 
ATOM   2192 C  CD  . PRO B 1 151 ? 14.917  21.881 60.553 1.00 26.19 ? 147 PRO B CD  1 
ATOM   2193 N  N   . SER B 1 152 ? 18.441  23.024 57.512 1.00 30.57 ? 148 SER B N   1 
ATOM   2194 C  CA  . SER B 1 152 ? 19.884  23.131 57.326 1.00 32.88 ? 148 SER B CA  1 
ATOM   2195 C  C   . SER B 1 152 ? 20.463  24.023 58.437 1.00 33.13 ? 148 SER B C   1 
ATOM   2196 O  O   . SER B 1 152 ? 19.779  24.891 58.981 1.00 31.56 ? 148 SER B O   1 
ATOM   2197 C  CB  . SER B 1 152 ? 20.187  23.745 55.956 1.00 33.63 ? 148 SER B CB  1 
ATOM   2198 O  OG  . SER B 1 152 ? 19.679  22.924 54.912 1.00 38.90 ? 148 SER B OG  1 
ATOM   2199 N  N   . HIS B 1 153 ? 21.722  23.785 58.777 1.00 34.09 ? 149 HIS B N   1 
ATOM   2200 C  CA  . HIS B 1 153 ? 22.427  24.522 59.815 1.00 35.10 ? 149 HIS B CA  1 
ATOM   2201 C  C   . HIS B 1 153 ? 22.215  26.050 59.757 1.00 34.72 ? 149 HIS B C   1 
ATOM   2202 O  O   . HIS B 1 153 ? 21.892  26.694 60.762 1.00 35.19 ? 149 HIS B O   1 
ATOM   2203 C  CB  . HIS B 1 153 ? 23.929  24.153 59.730 1.00 36.04 ? 149 HIS B CB  1 
ATOM   2204 C  CG  . HIS B 1 153 ? 24.767  24.672 60.866 1.00 37.41 ? 149 HIS B CG  1 
ATOM   2205 N  ND1 . HIS B 1 153 ? 25.351  25.920 60.846 1.00 41.24 ? 149 HIS B ND1 1 
ATOM   2206 C  CD2 . HIS B 1 153 ? 25.154  24.094 62.031 1.00 38.94 ? 149 HIS B CD2 1 
ATOM   2207 C  CE1 . HIS B 1 153 ? 26.037  26.105 61.962 1.00 40.78 ? 149 HIS B CE1 1 
ATOM   2208 N  NE2 . HIS B 1 153 ? 25.939  25.009 62.695 1.00 42.40 ? 149 HIS B NE2 1 
ATOM   2209 N  N   . ASP B 1 154 ? 22.377  26.622 58.574 1.00 34.42 ? 150 ASP B N   1 
ATOM   2210 C  CA  . ASP B 1 154 ? 22.248  28.067 58.398 1.00 35.93 ? 150 ASP B CA  1 
ATOM   2211 C  C   . ASP B 1 154 ? 20.844  28.567 58.054 1.00 34.25 ? 150 ASP B C   1 
ATOM   2212 O  O   . ASP B 1 154 ? 20.662  29.771 57.811 1.00 35.55 ? 150 ASP B O   1 
ATOM   2213 C  CB  . ASP B 1 154 ? 23.227  28.530 57.301 1.00 36.93 ? 150 ASP B CB  1 
ATOM   2214 C  CG  . ASP B 1 154 ? 22.955  27.876 55.952 1.00 41.28 ? 150 ASP B CG  1 
ATOM   2215 O  OD1 . ASP B 1 154 ? 22.139  26.917 55.886 1.00 44.27 ? 150 ASP B OD1 1 
ATOM   2216 O  OD2 . ASP B 1 154 ? 23.580  28.311 54.946 1.00 45.17 ? 150 ASP B OD2 1 
ATOM   2217 N  N   . GLU B 1 155 ? 19.860  27.677 58.072 1.00 33.28 ? 151 GLU B N   1 
ATOM   2218 C  CA  . GLU B 1 155 ? 18.480  28.043 57.711 1.00 31.96 ? 151 GLU B CA  1 
ATOM   2219 C  C   . GLU B 1 155 ? 17.499  28.262 58.855 1.00 30.88 ? 151 GLU B C   1 
ATOM   2220 O  O   . GLU B 1 155 ? 16.369  28.761 58.617 1.00 30.59 ? 151 GLU B O   1 
ATOM   2221 C  CB  . GLU B 1 155 ? 17.869  26.985 56.761 1.00 33.74 ? 151 GLU B CB  1 
ATOM   2222 C  CG  . GLU B 1 155 ? 18.662  26.743 55.475 1.00 38.31 ? 151 GLU B CG  1 
ATOM   2223 C  CD  . GLU B 1 155 ? 18.981  28.023 54.707 1.00 47.18 ? 151 GLU B CD  1 
ATOM   2224 O  OE1 . GLU B 1 155 ? 18.043  28.832 54.447 1.00 49.57 ? 151 GLU B OE1 1 
ATOM   2225 O  OE2 . GLU B 1 155 ? 20.173  28.223 54.352 1.00 51.18 ? 151 GLU B OE2 1 
ATOM   2226 N  N   . TYR B 1 156 ? 17.868  27.854 60.064 1.00 28.31 ? 152 TYR B N   1 
ATOM   2227 C  CA  . TYR B 1 156 ? 16.930  28.009 61.191 1.00 26.81 ? 152 TYR B CA  1 
ATOM   2228 C  C   . TYR B 1 156 ? 17.678  27.938 62.508 1.00 26.15 ? 152 TYR B C   1 
ATOM   2229 O  O   . TYR B 1 156 ? 18.774  27.359 62.589 1.00 26.29 ? 152 TYR B O   1 
ATOM   2230 C  CB  . TYR B 1 156 ? 15.831  26.917 61.118 1.00 26.54 ? 152 TYR B CB  1 
ATOM   2231 C  CG  . TYR B 1 156 ? 14.502  27.323 61.717 1.00 25.69 ? 152 TYR B CG  1 
ATOM   2232 C  CD1 . TYR B 1 156 ? 13.642  28.146 60.994 1.00 25.18 ? 152 TYR B CD1 1 
ATOM   2233 C  CD2 . TYR B 1 156 ? 14.098  26.887 62.986 1.00 27.30 ? 152 TYR B CD2 1 
ATOM   2234 C  CE1 . TYR B 1 156 ? 12.451  28.564 61.512 1.00 26.57 ? 152 TYR B CE1 1 
ATOM   2235 C  CE2 . TYR B 1 156 ? 12.850  27.287 63.528 1.00 26.84 ? 152 TYR B CE2 1 
ATOM   2236 C  CZ  . TYR B 1 156 ? 12.038  28.133 62.760 1.00 28.04 ? 152 TYR B CZ  1 
ATOM   2237 O  OH  . TYR B 1 156 ? 10.798  28.602 63.179 1.00 28.64 ? 152 TYR B OH  1 
ATOM   2238 N  N   . SER B 1 157 ? 17.108  28.529 63.547 1.00 24.24 ? 153 SER B N   1 
ATOM   2239 C  CA  . SER B 1 157 ? 17.756  28.495 64.850 1.00 23.76 ? 153 SER B CA  1 
ATOM   2240 C  C   . SER B 1 157 ? 16.720  28.305 65.951 1.00 24.21 ? 153 SER B C   1 
ATOM   2241 O  O   . SER B 1 157 ? 15.500  28.464 65.724 1.00 23.96 ? 153 SER B O   1 
ATOM   2242 C  CB  . SER B 1 157 ? 18.547  29.790 65.156 1.00 24.98 ? 153 SER B CB  1 
ATOM   2243 O  OG  . SER B 1 157 ? 19.548  30.026 64.174 1.00 26.82 ? 153 SER B OG  1 
ATOM   2244 N  N   . LEU B 1 158 ? 17.230  27.961 67.123 1.00 23.18 ? 154 LEU B N   1 
ATOM   2245 C  CA  . LEU B 1 158 ? 16.419  27.806 68.329 1.00 24.00 ? 154 LEU B CA  1 
ATOM   2246 C  C   . LEU B 1 158 ? 17.002  28.686 69.420 1.00 23.90 ? 154 LEU B C   1 
ATOM   2247 O  O   . LEU B 1 158 ? 18.243  28.775 69.592 1.00 23.47 ? 154 LEU B O   1 
ATOM   2248 C  CB  . LEU B 1 158 ? 16.414  26.340 68.834 1.00 23.69 ? 154 LEU B CB  1 
ATOM   2249 C  CG  . LEU B 1 158 ? 15.856  25.274 67.874 1.00 23.97 ? 154 LEU B CG  1 
ATOM   2250 C  CD1 . LEU B 1 158 ? 16.002  23.854 68.490 1.00 24.45 ? 154 LEU B CD1 1 
ATOM   2251 C  CD2 . LEU B 1 158 ? 14.387  25.518 67.502 1.00 25.93 ? 154 LEU B CD2 1 
ATOM   2252 N  N   . HIS B 1 159 ? 16.125  29.339 70.181 1.00 23.85 ? 155 HIS B N   1 
ATOM   2253 C  CA  . HIS B 1 159 ? 16.596  30.117 71.331 1.00 24.86 ? 155 HIS B CA  1 
ATOM   2254 C  C   . HIS B 1 159 ? 16.863  29.008 72.330 1.00 25.68 ? 155 HIS B C   1 
ATOM   2255 O  O   . HIS B 1 159 ? 15.993  28.131 72.543 1.00 24.82 ? 155 HIS B O   1 
ATOM   2256 C  CB  . HIS B 1 159 ? 15.496  30.940 71.965 1.00 24.19 ? 155 HIS B CB  1 
ATOM   2257 C  CG  . HIS B 1 159 ? 15.099  32.147 71.194 1.00 26.24 ? 155 HIS B CG  1 
ATOM   2258 N  ND1 . HIS B 1 159 ? 14.662  33.302 71.810 1.00 27.13 ? 155 HIS B ND1 1 
ATOM   2259 C  CD2 . HIS B 1 159 ? 15.028  32.371 69.861 1.00 28.30 ? 155 HIS B CD2 1 
ATOM   2260 C  CE1 . HIS B 1 159 ? 14.335  34.185 70.879 1.00 27.02 ? 155 HIS B CE1 1 
ATOM   2261 N  NE2 . HIS B 1 159 ? 14.562  33.647 69.693 1.00 27.68 ? 155 HIS B NE2 1 
ATOM   2262 N  N   . ILE B 1 160 ? 18.023  29.076 72.979 1.00 26.12 ? 156 ILE B N   1 
ATOM   2263 C  CA  . ILE B 1 160 ? 18.414  28.064 73.963 1.00 26.91 ? 156 ILE B CA  1 
ATOM   2264 C  C   . ILE B 1 160 ? 18.735  28.614 75.354 1.00 27.36 ? 156 ILE B C   1 
ATOM   2265 O  O   . ILE B 1 160 ? 19.111  27.852 76.259 1.00 26.99 ? 156 ILE B O   1 
ATOM   2266 C  CB  . ILE B 1 160 ? 19.562  27.150 73.428 1.00 26.23 ? 156 ILE B CB  1 
ATOM   2267 C  CG1 . ILE B 1 160 ? 20.881  27.916 73.285 1.00 27.73 ? 156 ILE B CG1 1 
ATOM   2268 C  CG2 . ILE B 1 160 ? 19.142  26.474 72.112 1.00 25.23 ? 156 ILE B CG2 1 
ATOM   2269 C  CD1 . ILE B 1 160 ? 22.129  27.000 73.051 1.00 25.84 ? 156 ILE B CD1 1 
ATOM   2270 N  N   . ASP B 1 161 ? 18.614  29.933 75.534 1.00 28.26 ? 157 ASP B N   1 
ATOM   2271 C  CA  . ASP B 1 161 ? 18.845  30.534 76.840 1.00 30.00 ? 157 ASP B CA  1 
ATOM   2272 C  C   . ASP B 1 161 ? 17.687  30.095 77.753 1.00 31.20 ? 157 ASP B C   1 
ATOM   2273 O  O   . ASP B 1 161 ? 16.578  29.789 77.274 1.00 31.61 ? 157 ASP B O   1 
ATOM   2274 C  CB  . ASP B 1 161 ? 18.927  32.070 76.734 1.00 29.59 ? 157 ASP B CB  1 
ATOM   2275 C  CG  . ASP B 1 161 ? 17.798  32.644 75.914 1.00 28.32 ? 157 ASP B CG  1 
ATOM   2276 O  OD1 . ASP B 1 161 ? 17.748  32.403 74.695 1.00 28.19 ? 157 ASP B OD1 1 
ATOM   2277 O  OD2 . ASP B 1 161 ? 16.948  33.327 76.496 1.00 30.86 ? 157 ASP B OD2 1 
ATOM   2278 N  N   . GLU B 1 162 ? 17.945  30.068 79.060 1.00 32.66 ? 158 GLU B N   1 
ATOM   2279 C  CA  . GLU B 1 162 ? 16.942  29.661 80.046 1.00 34.40 ? 158 GLU B CA  1 
ATOM   2280 C  C   . GLU B 1 162 ? 15.674  30.499 79.935 1.00 34.23 ? 158 GLU B C   1 
ATOM   2281 O  O   . GLU B 1 162 ? 14.558  29.978 79.922 1.00 34.88 ? 158 GLU B O   1 
ATOM   2282 C  CB  . GLU B 1 162 ? 17.510  29.781 81.466 1.00 34.64 ? 158 GLU B CB  1 
ATOM   2283 C  CG  . GLU B 1 162 ? 16.429  29.709 82.552 1.00 38.57 ? 158 GLU B CG  1 
ATOM   2284 C  CD  . GLU B 1 162 ? 16.943  29.228 83.901 1.00 42.22 ? 158 GLU B CD  1 
ATOM   2285 O  OE1 . GLU B 1 162 ? 17.915  29.820 84.418 1.00 42.58 ? 158 GLU B OE1 1 
ATOM   2286 O  OE2 . GLU B 1 162 ? 16.356  28.259 84.449 1.00 44.68 ? 158 GLU B OE2 1 
ATOM   2287 N  N   . GLN B 1 163 ? 15.871  31.809 79.852 1.00 34.50 ? 159 GLN B N   1 
ATOM   2288 C  CA  . GLN B 1 163 ? 14.782  32.758 79.792 1.00 34.50 ? 159 GLN B CA  1 
ATOM   2289 C  C   . GLN B 1 163 ? 13.797  32.629 78.633 1.00 33.94 ? 159 GLN B C   1 
ATOM   2290 O  O   . GLN B 1 163 ? 12.595  32.725 78.870 1.00 32.93 ? 159 GLN B O   1 
ATOM   2291 C  CB  . GLN B 1 163 ? 15.352  34.190 79.859 1.00 35.27 ? 159 GLN B CB  1 
ATOM   2292 C  CG  . GLN B 1 163 ? 14.322  35.297 80.096 1.00 39.45 ? 159 GLN B CG  1 
ATOM   2293 C  CD  . GLN B 1 163 ? 13.596  35.181 81.434 1.00 44.11 ? 159 GLN B CD  1 
ATOM   2294 O  OE1 . GLN B 1 163 ? 12.396  34.898 81.474 1.00 46.35 ? 159 GLN B OE1 1 
ATOM   2295 N  NE2 . GLN B 1 163 ? 14.319  35.387 82.530 1.00 44.20 ? 159 GLN B NE2 1 
ATOM   2296 N  N   . THR B 1 164 ? 14.262  32.451 77.410 1.00 32.91 ? 160 THR B N   1 
ATOM   2297 C  CA  . THR B 1 164 ? 13.366  32.585 76.273 1.00 33.00 ? 160 THR B CA  1 
ATOM   2298 C  C   . THR B 1 164 ? 13.263  31.341 75.430 1.00 33.82 ? 160 THR B C   1 
ATOM   2299 O  O   . THR B 1 164 ? 12.581  31.310 74.462 1.00 34.06 ? 160 THR B O   1 
ATOM   2300 C  CB  . THR B 1 164 ? 13.743  33.743 75.360 1.00 32.14 ? 160 THR B CB  1 
ATOM   2301 O  OG1 . THR B 1 164 ? 14.912  33.426 74.631 1.00 30.78 ? 160 THR B OG1 1 
ATOM   2302 C  CG2 . THR B 1 164 ? 13.935  35.020 76.134 1.00 30.80 ? 160 THR B CG2 1 
ATOM   2303 N  N   . GLY B 1 165 ? 13.945  30.315 75.868 1.00 35.80 ? 161 GLY B N   1 
ATOM   2304 C  CA  . GLY B 1 165 ? 14.427  29.315 74.996 1.00 34.70 ? 161 GLY B CA  1 
ATOM   2305 C  C   . GLY B 1 165 ? 13.664  28.047 75.207 1.00 34.24 ? 161 GLY B C   1 
ATOM   2306 O  O   . GLY B 1 165 ? 12.753  27.946 75.979 1.00 34.79 ? 161 GLY B O   1 
ATOM   2307 N  N   . VAL B 1 166 ? 14.109  27.077 74.457 1.00 32.82 ? 162 VAL B N   1 
ATOM   2308 C  CA  . VAL B 1 166 ? 13.433  25.765 74.268 1.00 32.35 ? 162 VAL B CA  1 
ATOM   2309 C  C   . VAL B 1 166 ? 14.373  24.625 74.721 1.00 32.11 ? 162 VAL B C   1 
ATOM   2310 O  O   . VAL B 1 166 ? 15.595  24.762 74.667 1.00 32.02 ? 162 VAL B O   1 
ATOM   2311 C  CB  . VAL B 1 166 ? 12.897  25.481 72.817 1.00 32.02 ? 162 VAL B CB  1 
ATOM   2312 C  CG1 . VAL B 1 166 ? 12.000  26.624 72.327 1.00 33.21 ? 162 VAL B CG1 1 
ATOM   2313 C  CG2 . VAL B 1 166 ? 14.046  25.199 71.837 1.00 32.05 ? 162 VAL B CG2 1 
ATOM   2314 N  N   . SER B 1 167 ? 13.821  23.493 75.164 1.00 32.95 ? 163 SER B N   1 
ATOM   2315 C  CA  . SER B 1 167 ? 14.681  22.386 75.628 1.00 32.67 ? 163 SER B CA  1 
ATOM   2316 C  C   . SER B 1 167 ? 15.008  21.351 74.549 1.00 32.58 ? 163 SER B C   1 
ATOM   2317 O  O   . SER B 1 167 ? 16.043  20.680 74.618 1.00 33.37 ? 163 SER B O   1 
ATOM   2318 C  CB  . SER B 1 167 ? 14.062  21.687 76.845 1.00 33.84 ? 163 SER B CB  1 
ATOM   2319 O  OG  . SER B 1 167 ? 12.834  21.086 76.479 1.00 33.92 ? 163 SER B OG  1 
ATOM   2320 N  N   . GLY B 1 168 ? 14.129  21.239 73.562 1.00 31.17 ? 164 GLY B N   1 
ATOM   2321 C  CA  . GLY B 1 168 ? 14.300  20.296 72.460 1.00 29.85 ? 164 GLY B CA  1 
ATOM   2322 C  C   . GLY B 1 168 ? 15.360  20.746 71.476 1.00 29.02 ? 164 GLY B C   1 
ATOM   2323 O  O   . GLY B 1 168 ? 15.761  21.924 71.441 1.00 28.56 ? 164 GLY B O   1 
ATOM   2324 N  N   . ARG B 1 169 ? 15.833  19.796 70.683 1.00 28.13 ? 165 ARG B N   1 
ATOM   2325 C  CA  . ARG B 1 169 ? 16.834  20.079 69.670 1.00 28.03 ? 165 ARG B CA  1 
ATOM   2326 C  C   . ARG B 1 169 ? 16.408  19.332 68.426 1.00 27.19 ? 165 ARG B C   1 
ATOM   2327 O  O   . ARG B 1 169 ? 15.718  18.312 68.517 1.00 27.92 ? 165 ARG B O   1 
ATOM   2328 C  CB  . ARG B 1 169 ? 18.235  19.636 70.099 1.00 28.20 ? 165 ARG B CB  1 
ATOM   2329 C  CG  . ARG B 1 169 ? 18.801  20.304 71.358 1.00 28.76 ? 165 ARG B CG  1 
ATOM   2330 C  CD  . ARG B 1 169 ? 19.097  21.796 71.137 1.00 31.01 ? 165 ARG B CD  1 
ATOM   2331 N  NE  . ARG B 1 169 ? 19.687  22.424 72.334 1.00 28.28 ? 165 ARG B NE  1 
ATOM   2332 C  CZ  . ARG B 1 169 ? 18.983  23.058 73.271 1.00 28.15 ? 165 ARG B CZ  1 
ATOM   2333 N  NH1 . ARG B 1 169 ? 17.658  23.157 73.167 1.00 25.53 ? 165 ARG B NH1 1 
ATOM   2334 N  NH2 . ARG B 1 169 ? 19.598  23.613 74.305 1.00 30.72 ? 165 ARG B NH2 1 
ATOM   2335 N  N   . PHE B 1 170 ? 16.789  19.850 67.262 1.00 26.87 ? 166 PHE B N   1 
ATOM   2336 C  CA  . PHE B 1 170 ? 16.402  19.192 66.010 1.00 26.60 ? 166 PHE B CA  1 
ATOM   2337 C  C   . PHE B 1 170 ? 17.083  17.818 65.908 1.00 26.52 ? 166 PHE B C   1 
ATOM   2338 O  O   . PHE B 1 170 ? 18.132  17.565 66.501 1.00 26.04 ? 166 PHE B O   1 
ATOM   2339 C  CB  . PHE B 1 170 ? 16.765  20.058 64.817 1.00 26.23 ? 166 PHE B CB  1 
ATOM   2340 C  CG  . PHE B 1 170 ? 15.773  21.157 64.539 1.00 28.34 ? 166 PHE B CG  1 
ATOM   2341 C  CD1 . PHE B 1 170 ? 14.493  20.864 64.073 1.00 29.35 ? 166 PHE B CD1 1 
ATOM   2342 C  CD2 . PHE B 1 170 ? 16.125  22.478 64.758 1.00 29.33 ? 166 PHE B CD2 1 
ATOM   2343 C  CE1 . PHE B 1 170 ? 13.562  21.900 63.809 1.00 29.62 ? 166 PHE B CE1 1 
ATOM   2344 C  CE2 . PHE B 1 170 ? 15.217  23.517 64.514 1.00 28.89 ? 166 PHE B CE2 1 
ATOM   2345 C  CZ  . PHE B 1 170 ? 13.936  23.226 64.045 1.00 29.43 ? 166 PHE B CZ  1 
ATOM   2346 N  N   . TRP B 1 171 ? 16.448  16.924 65.182 1.00 26.46 ? 167 TRP B N   1 
ATOM   2347 C  CA  . TRP B 1 171 ? 16.972  15.585 64.970 1.00 27.02 ? 167 TRP B CA  1 
ATOM   2348 C  C   . TRP B 1 171 ? 18.130  15.616 63.963 1.00 28.64 ? 167 TRP B C   1 
ATOM   2349 O  O   . TRP B 1 171 ? 18.136  16.446 63.039 1.00 28.60 ? 167 TRP B O   1 
ATOM   2350 C  CB  . TRP B 1 171 ? 15.853  14.676 64.474 1.00 26.01 ? 167 TRP B CB  1 
ATOM   2351 C  CG  . TRP B 1 171 ? 15.140  15.189 63.233 1.00 24.28 ? 167 TRP B CG  1 
ATOM   2352 C  CD1 . TRP B 1 171 ? 15.384  14.829 61.937 1.00 24.65 ? 167 TRP B CD1 1 
ATOM   2353 C  CD2 . TRP B 1 171 ? 14.091  16.157 63.199 1.00 25.92 ? 167 TRP B CD2 1 
ATOM   2354 N  NE1 . TRP B 1 171 ? 14.531  15.515 61.089 1.00 25.18 ? 167 TRP B NE1 1 
ATOM   2355 C  CE2 . TRP B 1 171 ? 13.727  16.333 61.841 1.00 24.49 ? 167 TRP B CE2 1 
ATOM   2356 C  CE3 . TRP B 1 171 ? 13.417  16.904 64.193 1.00 26.48 ? 167 TRP B CE3 1 
ATOM   2357 C  CZ2 . TRP B 1 171 ? 12.720  17.230 61.442 1.00 26.39 ? 167 TRP B CZ2 1 
ATOM   2358 C  CZ3 . TRP B 1 171 ? 12.406  17.802 63.786 1.00 25.88 ? 167 TRP B CZ3 1 
ATOM   2359 C  CH2 . TRP B 1 171 ? 12.069  17.942 62.425 1.00 25.37 ? 167 TRP B CH2 1 
ATOM   2360 N  N   . SER B 1 172 ? 19.098  14.708 64.118 1.00 29.83 ? 168 SER B N   1 
ATOM   2361 C  CA  . SER B 1 172 ? 20.238  14.689 63.197 1.00 32.30 ? 168 SER B CA  1 
ATOM   2362 C  C   . SER B 1 172 ? 19.944  13.891 61.953 1.00 33.13 ? 168 SER B C   1 
ATOM   2363 O  O   . SER B 1 172 ? 19.912  14.446 60.834 1.00 35.52 ? 168 SER B O   1 
ATOM   2364 C  CB  . SER B 1 172 ? 21.517  14.189 63.883 1.00 32.74 ? 168 SER B CB  1 
ATOM   2365 O  OG  . SER B 1 172 ? 22.556  15.113 63.615 1.00 37.67 ? 168 SER B OG  1 
ATOM   2366 N  N   . GLU B 1 173 ? 19.639  12.612 62.143 1.00 32.59 ? 169 GLU B N   1 
ATOM   2367 C  CA  . GLU B 1 173 ? 19.307  11.731 61.026 1.00 32.32 ? 169 GLU B CA  1 
ATOM   2368 C  C   . GLU B 1 173 ? 17.844  11.934 60.621 1.00 30.67 ? 169 GLU B C   1 
ATOM   2369 O  O   . GLU B 1 173 ? 16.969  12.095 61.472 1.00 29.40 ? 169 GLU B O   1 
ATOM   2370 C  CB  . GLU B 1 173 ? 19.562  10.274 61.395 1.00 33.70 ? 169 GLU B CB  1 
ATOM   2371 C  CG  . GLU B 1 173 ? 21.042  9.963  61.668 1.00 37.01 ? 169 GLU B CG  1 
ATOM   2372 C  CD  . GLU B 1 173 ? 21.756  9.266  60.498 1.00 43.01 ? 169 GLU B CD  1 
ATOM   2373 O  OE1 . GLU B 1 173 ? 21.248  9.281  59.340 1.00 44.12 ? 169 GLU B OE1 1 
ATOM   2374 O  OE2 . GLU B 1 173 ? 22.846  8.689  60.759 1.00 45.32 ? 169 GLU B OE2 1 
ATOM   2375 N  N   . PRO B 1 174 ? 17.574  11.959 59.307 1.00 29.94 ? 170 PRO B N   1 
ATOM   2376 C  CA  . PRO B 1 174 ? 16.191  12.166 58.847 1.00 29.04 ? 170 PRO B CA  1 
ATOM   2377 C  C   . PRO B 1 174 ? 15.156  11.212 59.463 1.00 28.02 ? 170 PRO B C   1 
ATOM   2378 O  O   . PRO B 1 174 ? 15.434  10.020 59.663 1.00 28.24 ? 170 PRO B O   1 
ATOM   2379 C  CB  . PRO B 1 174 ? 16.289  11.934 57.334 1.00 29.25 ? 170 PRO B CB  1 
ATOM   2380 C  CG  . PRO B 1 174 ? 17.672  12.385 57.007 1.00 31.09 ? 170 PRO B CG  1 
ATOM   2381 C  CD  . PRO B 1 174 ? 18.517  11.871 58.182 1.00 30.17 ? 170 PRO B CD  1 
ATOM   2382 N  N   . LEU B 1 175 ? 13.992  11.768 59.785 1.00 26.58 ? 171 LEU B N   1 
ATOM   2383 C  CA  . LEU B 1 175 ? 12.883  11.017 60.333 1.00 25.58 ? 171 LEU B CA  1 
ATOM   2384 C  C   . LEU B 1 175 ? 12.237  10.295 59.143 1.00 25.64 ? 171 LEU B C   1 
ATOM   2385 O  O   . LEU B 1 175 ? 12.218  10.828 58.040 1.00 26.07 ? 171 LEU B O   1 
ATOM   2386 C  CB  . LEU B 1 175 ? 11.875  11.937 61.009 1.00 24.95 ? 171 LEU B CB  1 
ATOM   2387 C  CG  . LEU B 1 175 ? 12.445  12.665 62.241 1.00 26.18 ? 171 LEU B CG  1 
ATOM   2388 C  CD1 . LEU B 1 175 ? 11.428  13.608 62.886 1.00 26.05 ? 171 LEU B CD1 1 
ATOM   2389 C  CD2 . LEU B 1 175 ? 12.962  11.657 63.241 1.00 27.81 ? 171 LEU B CD2 1 
ATOM   2390 N  N   . VAL B 1 176 ? 11.735  9.096  59.387 1.00 26.24 ? 172 VAL B N   1 
ATOM   2391 C  CA  . VAL B 1 176 ? 11.123  8.296  58.307 1.00 27.46 ? 172 VAL B CA  1 
ATOM   2392 C  C   . VAL B 1 176 ? 9.652   7.974  58.533 1.00 27.40 ? 172 VAL B C   1 
ATOM   2393 O  O   . VAL B 1 176 ? 9.252   7.606  59.634 1.00 28.30 ? 172 VAL B O   1 
ATOM   2394 C  CB  . VAL B 1 176 ? 11.927  6.983  58.095 1.00 27.88 ? 172 VAL B CB  1 
ATOM   2395 C  CG1 . VAL B 1 176 ? 11.331  6.148  56.966 1.00 29.00 ? 172 VAL B CG1 1 
ATOM   2396 C  CG2 . VAL B 1 176 ? 13.379  7.298  57.781 1.00 28.16 ? 172 VAL B CG2 1 
ATOM   2397 N  N   . ALA B 1 177 ? 8.861   8.140  57.479 1.00 28.18 ? 173 ALA B N   1 
ATOM   2398 C  CA  . ALA B 1 177 ? 7.441   7.801  57.456 1.00 28.82 ? 173 ALA B CA  1 
ATOM   2399 C  C   . ALA B 1 177 ? 7.376   6.888  56.213 1.00 29.40 ? 173 ALA B C   1 
ATOM   2400 O  O   . ALA B 1 177 ? 7.821   7.264  55.131 1.00 29.12 ? 173 ALA B O   1 
ATOM   2401 C  CB  . ALA B 1 177 ? 6.565   9.030  57.296 1.00 28.83 ? 173 ALA B CB  1 
ATOM   2402 N  N   . GLU B 1 178 ? 6.876   5.676  56.394 1.00 29.92 ? 174 GLU B N   1 
ATOM   2403 C  CA  . GLU B 1 178 ? 6.836   4.703  55.312 1.00 31.74 ? 174 GLU B CA  1 
ATOM   2404 C  C   . GLU B 1 178 ? 5.533   3.922  55.252 1.00 30.56 ? 174 GLU B C   1 
ATOM   2405 O  O   . GLU B 1 178 ? 4.971   3.565  56.282 1.00 30.82 ? 174 GLU B O   1 
ATOM   2406 C  CB  . GLU B 1 178 ? 8.003   3.735  55.536 1.00 32.33 ? 174 GLU B CB  1 
ATOM   2407 C  CG  . GLU B 1 178 ? 8.367   2.840  54.360 1.00 36.25 ? 174 GLU B CG  1 
ATOM   2408 C  CD  . GLU B 1 178 ? 9.795   2.302  54.459 1.00 35.70 ? 174 GLU B CD  1 
ATOM   2409 O  OE1 . GLU B 1 178 ? 10.449  2.460  55.517 1.00 41.29 ? 174 GLU B OE1 1 
ATOM   2410 O  OE2 . GLU B 1 178 ? 10.255  1.709  53.458 1.00 43.28 ? 174 GLU B OE2 1 
ATOM   2411 N  N   . TRP B 1 179 ? 5.097   3.641  54.025 1.00 30.18 ? 175 TRP B N   1 
ATOM   2412 C  CA  . TRP B 1 179 ? 3.877   2.873  53.715 1.00 30.72 ? 175 TRP B CA  1 
ATOM   2413 C  C   . TRP B 1 179 ? 4.401   1.813  52.763 1.00 31.03 ? 175 TRP B C   1 
ATOM   2414 O  O   . TRP B 1 179 ? 5.079   2.143  51.786 1.00 31.17 ? 175 TRP B O   1 
ATOM   2415 C  CB  . TRP B 1 179 ? 2.807   3.747  53.046 1.00 30.21 ? 175 TRP B CB  1 
ATOM   2416 C  CG  . TRP B 1 179 ? 2.360   4.846  53.935 1.00 28.36 ? 175 TRP B CG  1 
ATOM   2417 C  CD1 . TRP B 1 179 ? 1.389   4.789  54.878 1.00 28.27 ? 175 TRP B CD1 1 
ATOM   2418 C  CD2 . TRP B 1 179 ? 2.916   6.170  54.009 1.00 27.18 ? 175 TRP B CD2 1 
ATOM   2419 N  NE1 . TRP B 1 179 ? 1.270   5.992  55.523 1.00 30.39 ? 175 TRP B NE1 1 
ATOM   2420 C  CE2 . TRP B 1 179 ? 2.198   6.865  55.018 1.00 28.25 ? 175 TRP B CE2 1 
ATOM   2421 C  CE3 . TRP B 1 179 ? 3.917   6.842  53.301 1.00 27.11 ? 175 TRP B CE3 1 
ATOM   2422 C  CZ2 . TRP B 1 179 ? 2.468   8.213  55.358 1.00 29.66 ? 175 TRP B CZ2 1 
ATOM   2423 C  CZ3 . TRP B 1 179 ? 4.194   8.190  53.638 1.00 29.75 ? 175 TRP B CZ3 1 
ATOM   2424 C  CH2 . TRP B 1 179 ? 3.469   8.852  54.664 1.00 29.73 ? 175 TRP B CH2 1 
ATOM   2425 N  N   . ASP B 1 180 ? 4.101   0.550  53.052 1.00 31.55 ? 176 ASP B N   1 
ATOM   2426 C  CA  . ASP B 1 180 ? 4.630   -0.566 52.268 1.00 33.11 ? 176 ASP B CA  1 
ATOM   2427 C  C   . ASP B 1 180 ? 3.807   -1.079 51.116 1.00 32.74 ? 176 ASP B C   1 
ATOM   2428 O  O   . ASP B 1 180 ? 4.345   -1.798 50.269 1.00 33.35 ? 176 ASP B O   1 
ATOM   2429 C  CB  . ASP B 1 180 ? 4.879   -1.774 53.197 1.00 33.89 ? 176 ASP B CB  1 
ATOM   2430 C  CG  . ASP B 1 180 ? 6.191   -1.678 53.998 1.00 38.51 ? 176 ASP B CG  1 
ATOM   2431 O  OD1 . ASP B 1 180 ? 6.976   -0.709 53.826 1.00 43.82 ? 176 ASP B OD1 1 
ATOM   2432 O  OD2 . ASP B 1 180 ? 6.445   -2.599 54.818 1.00 42.26 ? 176 ASP B OD2 1 
ATOM   2433 N  N   . ASP B 1 181 ? 2.510   -0.780 51.122 1.00 31.95 ? 177 ASP B N   1 
ATOM   2434 C  CA  . ASP B 1 181 ? 1.587   -1.304 50.118 1.00 31.37 ? 177 ASP B CA  1 
ATOM   2435 C  C   . ASP B 1 181 ? 0.745   -0.241 49.403 1.00 30.41 ? 177 ASP B C   1 
ATOM   2436 O  O   . ASP B 1 181 ? -0.481  -0.341 49.335 1.00 30.56 ? 177 ASP B O   1 
ATOM   2437 C  CB  . ASP B 1 181 ? 0.674   -2.336 50.799 1.00 33.00 ? 177 ASP B CB  1 
ATOM   2438 C  CG  . ASP B 1 181 ? 1.421   -3.627 51.215 1.00 35.91 ? 177 ASP B CG  1 
ATOM   2439 O  OD1 . ASP B 1 181 ? 1.726   -4.476 50.337 1.00 39.62 ? 177 ASP B OD1 1 
ATOM   2440 O  OD2 . ASP B 1 181 ? 1.682   -3.810 52.427 1.00 39.80 ? 177 ASP B OD2 1 
ATOM   2441 N  N   . PHE B 1 182 ? 1.408   0.756  48.843 1.00 28.23 ? 178 PHE B N   1 
ATOM   2442 C  CA  . PHE B 1 182 ? 0.699   1.817  48.139 1.00 27.05 ? 178 PHE B CA  1 
ATOM   2443 C  C   . PHE B 1 182 ? 0.343   1.362  46.728 1.00 26.97 ? 178 PHE B C   1 
ATOM   2444 O  O   . PHE B 1 182 ? 1.238   1.027  45.940 1.00 26.02 ? 178 PHE B O   1 
ATOM   2445 C  CB  . PHE B 1 182 ? 1.552   3.075  48.048 1.00 26.62 ? 178 PHE B CB  1 
ATOM   2446 C  CG  . PHE B 1 182 ? 0.957   4.127  47.163 1.00 25.28 ? 178 PHE B CG  1 
ATOM   2447 C  CD1 . PHE B 1 182 ? -0.222  4.751  47.521 1.00 26.89 ? 178 PHE B CD1 1 
ATOM   2448 C  CD2 . PHE B 1 182 ? 1.537   4.432  45.932 1.00 25.51 ? 178 PHE B CD2 1 
ATOM   2449 C  CE1 . PHE B 1 182 ? -0.798  5.705  46.682 1.00 26.56 ? 178 PHE B CE1 1 
ATOM   2450 C  CE2 . PHE B 1 182 ? 0.980   5.421  45.084 1.00 23.81 ? 178 PHE B CE2 1 
ATOM   2451 C  CZ  . PHE B 1 182 ? -0.195  6.035  45.453 1.00 26.79 ? 178 PHE B CZ  1 
ATOM   2452 N  N   . GLU B 1 183 ? -0.949  1.391  46.414 1.00 26.56 ? 179 GLU B N   1 
ATOM   2453 C  CA  . GLU B 1 183 ? -1.418  0.952  45.106 1.00 27.24 ? 179 GLU B CA  1 
ATOM   2454 C  C   . GLU B 1 183 ? -1.676  2.060  44.087 1.00 27.08 ? 179 GLU B C   1 
ATOM   2455 O  O   . GLU B 1 183 ? -2.596  2.864  44.247 1.00 27.88 ? 179 GLU B O   1 
ATOM   2456 C  CB  . GLU B 1 183 ? -2.662  0.095  45.262 1.00 28.29 ? 179 GLU B CB  1 
ATOM   2457 C  CG  . GLU B 1 183 ? -2.369  -1.302 45.809 1.00 32.70 ? 179 GLU B CG  1 
ATOM   2458 C  CD  . GLU B 1 183 ? -3.619  -2.120 46.055 1.00 38.89 ? 179 GLU B CD  1 
ATOM   2459 O  OE1 . GLU B 1 183 ? -4.711  -1.717 45.589 1.00 43.76 ? 179 GLU B OE1 1 
ATOM   2460 O  OE2 . GLU B 1 183 ? -3.505  -3.175 46.713 1.00 42.56 ? 179 GLU B OE2 1 
ATOM   2461 N  N   . TRP B 1 184 ? -0.828  2.109  43.064 1.00 25.55 ? 180 TRP B N   1 
ATOM   2462 C  CA  . TRP B 1 184 ? -0.969  3.081  41.997 1.00 24.42 ? 180 TRP B CA  1 
ATOM   2463 C  C   . TRP B 1 184 ? -1.639  2.345  40.834 1.00 24.44 ? 180 TRP B C   1 
ATOM   2464 O  O   . TRP B 1 184 ? -1.023  1.471  40.230 1.00 23.20 ? 180 TRP B O   1 
ATOM   2465 C  CB  . TRP B 1 184 ? 0.397   3.665  41.596 1.00 23.94 ? 180 TRP B CB  1 
ATOM   2466 C  CG  . TRP B 1 184 ? 0.345   4.465  40.309 1.00 25.24 ? 180 TRP B CG  1 
ATOM   2467 C  CD1 . TRP B 1 184 ? 1.025   4.197  39.141 1.00 23.30 ? 180 TRP B CD1 1 
ATOM   2468 C  CD2 . TRP B 1 184 ? -0.435  5.649  40.061 1.00 23.66 ? 180 TRP B CD2 1 
ATOM   2469 N  NE1 . TRP B 1 184 ? 0.686   5.114  38.185 1.00 23.74 ? 180 TRP B NE1 1 
ATOM   2470 C  CE2 . TRP B 1 184 ? -0.191  6.030  38.722 1.00 24.36 ? 180 TRP B CE2 1 
ATOM   2471 C  CE3 . TRP B 1 184 ? -1.324  6.417  40.834 1.00 24.61 ? 180 TRP B CE3 1 
ATOM   2472 C  CZ2 . TRP B 1 184 ? -0.802  7.141  38.130 1.00 24.25 ? 180 TRP B CZ2 1 
ATOM   2473 C  CZ3 . TRP B 1 184 ? -1.922  7.549  40.244 1.00 24.50 ? 180 TRP B CZ3 1 
ATOM   2474 C  CH2 . TRP B 1 184 ? -1.657  7.895  38.901 1.00 25.56 ? 180 TRP B CH2 1 
ATOM   2475 N  N   A LYS B 1 185 ? -2.893  2.690  40.535 0.50 25.02 ? 181 LYS B N   1 
ATOM   2476 N  N   B LYS B 1 185 ? -2.894  2.713  40.571 0.50 24.84 ? 181 LYS B N   1 
ATOM   2477 C  CA  A LYS B 1 185 ? -3.648  2.064  39.446 0.50 25.13 ? 181 LYS B CA  1 
ATOM   2478 C  CA  B LYS B 1 185 ? -3.742  2.141  39.529 0.50 24.56 ? 181 LYS B CA  1 
ATOM   2479 C  C   A LYS B 1 185 ? -3.984  3.043  38.308 0.50 25.35 ? 181 LYS B C   1 
ATOM   2480 C  C   B LYS B 1 185 ? -4.090  3.103  38.395 0.50 25.14 ? 181 LYS B C   1 
ATOM   2481 O  O   A LYS B 1 185 ? -4.718  2.703  37.369 0.50 25.07 ? 181 LYS B O   1 
ATOM   2482 O  O   B LYS B 1 185 ? -4.941  2.811  37.550 0.50 25.00 ? 181 LYS B O   1 
ATOM   2483 C  CB  A LYS B 1 185 ? -4.937  1.417  39.975 0.50 25.78 ? 181 LYS B CB  1 
ATOM   2484 C  CB  B LYS B 1 185 ? -5.049  1.674  40.167 0.50 25.33 ? 181 LYS B CB  1 
ATOM   2485 C  CG  A LYS B 1 185 ? -4.785  0.649  41.287 0.50 26.03 ? 181 LYS B CG  1 
ATOM   2486 C  CG  B LYS B 1 185 ? -5.165  0.189  40.401 0.50 25.15 ? 181 LYS B CG  1 
ATOM   2487 C  CD  A LYS B 1 185 ? -6.017  -0.206 41.606 0.50 26.60 ? 181 LYS B CD  1 
ATOM   2488 C  CD  B LYS B 1 185 ? -3.968  -0.403 41.110 0.50 23.49 ? 181 LYS B CD  1 
ATOM   2489 C  CE  A LYS B 1 185 ? -7.200  0.633  42.087 0.50 28.32 ? 181 LYS B CE  1 
ATOM   2490 C  CE  B LYS B 1 185 ? -3.059  -1.175 40.161 0.50 22.71 ? 181 LYS B CE  1 
ATOM   2491 N  NZ  A LYS B 1 185 ? -6.998  1.103  43.484 0.50 29.07 ? 181 LYS B NZ  1 
ATOM   2492 N  NZ  B LYS B 1 185 ? -1.892  -1.633 40.950 0.50 21.99 ? 181 LYS B NZ  1 
ATOM   2493 N  N   . GLY B 1 186 ? -3.426  4.244  38.381 1.00 25.19 ? 182 GLY B N   1 
ATOM   2494 C  CA  . GLY B 1 186 ? -3.682  5.252  37.376 1.00 25.83 ? 182 GLY B CA  1 
ATOM   2495 C  C   . GLY B 1 186 ? -4.559  6.343  37.993 1.00 26.62 ? 182 GLY B C   1 
ATOM   2496 O  O   . GLY B 1 186 ? -4.944  6.256  39.183 1.00 26.36 ? 182 GLY B O   1 
ATOM   2497 N  N   . PRO B 1 187 ? -4.823  7.402  37.222 1.00 26.24 ? 183 PRO B N   1 
ATOM   2498 C  CA  . PRO B 1 187 ? -5.686  8.495  37.669 1.00 27.30 ? 183 PRO B CA  1 
ATOM   2499 C  C   . PRO B 1 187 ? -7.040  8.061  38.209 1.00 27.69 ? 183 PRO B C   1 
ATOM   2500 O  O   . PRO B 1 187 ? -7.709  7.200  37.636 1.00 28.55 ? 183 PRO B O   1 
ATOM   2501 C  CB  . PRO B 1 187 ? -5.849  9.353  36.408 1.00 26.77 ? 183 PRO B CB  1 
ATOM   2502 C  CG  . PRO B 1 187 ? -4.552  9.193  35.701 1.00 27.85 ? 183 PRO B CG  1 
ATOM   2503 C  CD  . PRO B 1 187 ? -4.225  7.695  35.910 1.00 27.01 ? 183 PRO B CD  1 
ATOM   2504 N  N   . GLN B 1 188 ? -7.424  8.695  39.313 1.00 29.41 ? 184 GLN B N   1 
ATOM   2505 C  CA  . GLN B 1 188 ? -8.704  8.474  39.967 1.00 30.93 ? 184 GLN B CA  1 
ATOM   2506 C  C   . GLN B 1 188 ? -9.477  9.786  39.836 1.00 31.83 ? 184 GLN B C   1 
ATOM   2507 O  O   . GLN B 1 188 ? -10.190 10.187 40.756 1.00 32.47 ? 184 GLN B O   1 
ATOM   2508 C  CB  . GLN B 1 188 ? -8.476  8.183  41.447 1.00 31.35 ? 184 GLN B CB  1 
ATOM   2509 C  CG  . GLN B 1 188 ? -7.539  7.020  41.748 1.00 35.47 ? 184 GLN B CG  1 
ATOM   2510 C  CD  . GLN B 1 188 ? -8.162  5.695  41.415 1.00 41.17 ? 184 GLN B CD  1 
ATOM   2511 O  OE1 . GLN B 1 188 ? -7.772  5.029  40.449 1.00 45.81 ? 184 GLN B OE1 1 
ATOM   2512 N  NE2 . GLN B 1 188 ? -9.153  5.297  42.210 1.00 43.51 ? 184 GLN B NE2 1 
ATOM   2513 N  N   . TRP B 1 189 ? -9.283  10.476 38.703 1.00 32.59 ? 185 TRP B N   1 
ATOM   2514 C  CA  . TRP B 1 189 ? -9.900  11.788 38.427 1.00 32.30 ? 185 TRP B CA  1 
ATOM   2515 C  C   . TRP B 1 189 ? -10.005 11.965 36.938 1.00 33.56 ? 185 TRP B C   1 
ATOM   2516 O  O   . TRP B 1 189 ? -10.563 12.978 36.495 1.00 34.94 ? 185 TRP B O   1 
ATOM   2517 C  CB  . TRP B 1 189 ? -9.025  12.928 38.993 1.00 30.93 ? 185 TRP B CB  1 
ATOM   2518 C  CG  . TRP B 1 189 ? -7.569  12.722 38.685 1.00 29.60 ? 185 TRP B CG  1 
ATOM   2519 C  CD1 . TRP B 1 189 ? -6.899  13.051 37.535 1.00 27.67 ? 185 TRP B CD1 1 
ATOM   2520 C  CD2 . TRP B 1 189 ? -6.616  12.078 39.534 1.00 26.36 ? 185 TRP B CD2 1 
ATOM   2521 N  NE1 . TRP B 1 189 ? -5.576  12.672 37.633 1.00 26.92 ? 185 TRP B NE1 1 
ATOM   2522 C  CE2 . TRP B 1 189 ? -5.383  12.041 38.837 1.00 26.91 ? 185 TRP B CE2 1 
ATOM   2523 C  CE3 . TRP B 1 189 ? -6.689  11.520 40.816 1.00 26.44 ? 185 TRP B CE3 1 
ATOM   2524 C  CZ2 . TRP B 1 189 ? -4.209  11.473 39.401 1.00 26.92 ? 185 TRP B CZ2 1 
ATOM   2525 C  CZ3 . TRP B 1 189 ? -5.529  10.937 41.365 1.00 25.60 ? 185 TRP B CZ3 1 
ATOM   2526 C  CH2 . TRP B 1 189 ? -4.317  10.927 40.647 1.00 27.19 ? 185 TRP B CH2 1 
ATOM   2527 O  OXT . TRP B 1 189 ? -9.535  11.119 36.157 1.00 34.39 ? 185 TRP B OXT 1 
HETATM 2528 CL CL  . CL  C 2 .   ? 14.599  36.169 44.145 1.00 51.77 ? 301 CL  A CL  1 
HETATM 2529 CL CL  . CL  D 2 .   ? 8.582   53.556 51.604 1.00 67.78 ? 302 CL  A CL  1 
HETATM 2530 CL CL  . CL  E 2 .   ? 15.597  53.961 57.448 1.00 68.50 ? 304 CL  A CL  1 
HETATM 2531 C  C1  . EDO F 3 .   ? 9.332   49.656 76.810 1.00 29.08 ? 401 EDO A C1  1 
HETATM 2532 O  O1  . EDO F 3 .   ? 7.966   49.210 76.733 1.00 25.84 ? 401 EDO A O1  1 
HETATM 2533 C  C2  . EDO F 3 .   ? 9.620   49.875 78.278 1.00 28.15 ? 401 EDO A C2  1 
HETATM 2534 O  O2  . EDO F 3 .   ? 8.924   51.054 78.649 1.00 28.65 ? 401 EDO A O2  1 
HETATM 2535 C  C1  . EDO G 3 .   ? 4.649   55.941 64.046 1.00 30.74 ? 403 EDO A C1  1 
HETATM 2536 O  O1  . EDO G 3 .   ? 5.786   56.057 63.207 1.00 33.18 ? 403 EDO A O1  1 
HETATM 2537 C  C2  . EDO G 3 .   ? 5.166   55.765 65.430 1.00 31.60 ? 403 EDO A C2  1 
HETATM 2538 O  O2  . EDO G 3 .   ? 4.948   54.402 65.700 1.00 31.74 ? 403 EDO A O2  1 
HETATM 2539 S  S   . SO4 H 4 .   ? -3.614  11.465 31.763 1.00 26.96 ? 501 SO4 B S   1 
HETATM 2540 O  O1  . SO4 H 4 .   ? -3.013  12.212 30.681 1.00 29.48 ? 501 SO4 B O1  1 
HETATM 2541 O  O2  . SO4 H 4 .   ? -4.971  11.880 31.944 1.00 27.98 ? 501 SO4 B O2  1 
HETATM 2542 O  O3  . SO4 H 4 .   ? -3.658  10.038 31.458 1.00 26.30 ? 501 SO4 B O3  1 
HETATM 2543 O  O4  . SO4 H 4 .   ? -2.877  11.668 32.993 1.00 28.84 ? 501 SO4 B O4  1 
HETATM 2544 S  S   . SO4 I 4 .   ? -0.687  1.546  56.091 1.00 71.99 ? 502 SO4 B S   1 
HETATM 2545 O  O1  . SO4 I 4 .   ? 0.695   1.406  55.639 1.00 70.68 ? 502 SO4 B O1  1 
HETATM 2546 O  O2  . SO4 I 4 .   ? -1.512  2.114  55.031 1.00 72.24 ? 502 SO4 B O2  1 
HETATM 2547 O  O3  . SO4 I 4 .   ? -1.205  0.217  56.431 1.00 72.91 ? 502 SO4 B O3  1 
HETATM 2548 O  O4  . SO4 I 4 .   ? -0.769  2.410  57.268 1.00 72.43 ? 502 SO4 B O4  1 
HETATM 2549 CL CL  . CL  J 2 .   ? 12.389  2.538  49.075 1.00 60.57 ? 303 CL  B CL  1 
HETATM 2550 O  O   . HOH K 5 .   ? 14.683  50.675 75.913 1.00 16.73 ? 404 HOH A O   1 
HETATM 2551 O  O   . HOH K 5 .   ? 3.866   34.695 43.246 1.00 18.31 ? 405 HOH A O   1 
HETATM 2552 O  O   . HOH K 5 .   ? 9.206   53.759 71.904 1.00 20.36 ? 406 HOH A O   1 
HETATM 2553 O  O   . HOH K 5 .   ? -2.511  33.054 41.385 1.00 22.21 ? 407 HOH A O   1 
HETATM 2554 O  O   . HOH K 5 .   ? 23.200  51.361 72.662 1.00 16.12 ? 408 HOH A O   1 
HETATM 2555 O  O   . HOH K 5 .   ? 8.695   51.245 73.127 1.00 20.11 ? 409 HOH A O   1 
HETATM 2556 O  O   . HOH K 5 .   ? 11.092  51.428 74.385 1.00 18.51 ? 410 HOH A O   1 
HETATM 2557 O  O   . HOH K 5 .   ? 9.351   40.695 47.775 1.00 23.64 ? 411 HOH A O   1 
HETATM 2558 O  O   . HOH K 5 .   ? 17.544  60.856 70.431 1.00 26.30 ? 412 HOH A O   1 
HETATM 2559 O  O   . HOH K 5 .   ? 14.766  36.750 57.286 1.00 24.70 ? 413 HOH A O   1 
HETATM 2560 O  O   . HOH K 5 .   ? 4.002   45.985 67.026 1.00 17.66 ? 414 HOH A O   1 
HETATM 2561 O  O   . HOH K 5 .   ? 7.609   53.584 69.038 1.00 26.64 ? 415 HOH A O   1 
HETATM 2562 O  O   . HOH K 5 .   ? 22.908  59.070 72.996 1.00 23.32 ? 416 HOH A O   1 
HETATM 2563 O  O   . HOH K 5 .   ? 5.494   30.816 52.891 1.00 22.92 ? 417 HOH A O   1 
HETATM 2564 O  O   . HOH K 5 .   ? 23.437  44.981 65.432 1.00 24.87 ? 418 HOH A O   1 
HETATM 2565 O  O   . HOH K 5 .   ? 25.344  34.254 72.373 1.00 25.52 ? 419 HOH A O   1 
HETATM 2566 O  O   . HOH K 5 .   ? 17.367  38.771 55.880 1.00 28.01 ? 420 HOH A O   1 
HETATM 2567 O  O   . HOH K 5 .   ? 22.431  42.269 64.415 1.00 22.35 ? 421 HOH A O   1 
HETATM 2568 O  O   . HOH K 5 .   ? 1.855   39.332 63.740 1.00 22.47 ? 422 HOH A O   1 
HETATM 2569 O  O   . HOH K 5 .   ? 21.913  55.644 63.452 1.00 26.11 ? 423 HOH A O   1 
HETATM 2570 O  O   . HOH K 5 .   ? 4.422   51.159 58.838 1.00 22.05 ? 424 HOH A O   1 
HETATM 2571 O  O   . HOH K 5 .   ? 20.614  45.790 83.515 1.00 22.89 ? 425 HOH A O   1 
HETATM 2572 O  O   . HOH K 5 .   ? -1.257  47.646 52.562 1.00 38.17 ? 426 HOH A O   1 
HETATM 2573 O  O   . HOH K 5 .   ? 16.626  57.211 75.411 1.00 21.87 ? 427 HOH A O   1 
HETATM 2574 O  O   . HOH K 5 .   ? 13.291  32.744 50.819 1.00 26.45 ? 428 HOH A O   1 
HETATM 2575 O  O   . HOH K 5 .   ? 11.491  25.142 45.837 1.00 30.01 ? 429 HOH A O   1 
HETATM 2576 O  O   . HOH K 5 .   ? 4.457   45.007 70.098 1.00 21.53 ? 430 HOH A O   1 
HETATM 2577 O  O   . HOH K 5 .   ? 10.443  58.406 71.260 1.00 23.87 ? 431 HOH A O   1 
HETATM 2578 O  O   . HOH K 5 .   ? 22.110  45.162 80.991 1.00 24.61 ? 432 HOH A O   1 
HETATM 2579 O  O   . HOH K 5 .   ? -2.962  37.798 42.179 1.00 28.13 ? 433 HOH A O   1 
HETATM 2580 O  O   . HOH K 5 .   ? -0.856  50.600 62.497 1.00 27.88 ? 434 HOH A O   1 
HETATM 2581 O  O   . HOH K 5 .   ? 24.797  48.257 59.082 1.00 24.54 ? 435 HOH A O   1 
HETATM 2582 O  O   . HOH K 5 .   ? 13.953  42.563 52.661 1.00 28.96 ? 436 HOH A O   1 
HETATM 2583 O  O   . HOH K 5 .   ? 15.305  60.839 73.105 1.00 30.31 ? 437 HOH A O   1 
HETATM 2584 O  O   . HOH K 5 .   ? 4.723   48.519 52.058 1.00 22.44 ? 438 HOH A O   1 
HETATM 2585 O  O   . HOH K 5 .   ? 18.182  31.123 61.666 1.00 26.23 ? 439 HOH A O   1 
HETATM 2586 O  O   . HOH K 5 .   ? 23.682  33.452 70.267 1.00 29.28 ? 440 HOH A O   1 
HETATM 2587 O  O   . HOH K 5 .   ? 6.044   35.500 64.130 1.00 26.34 ? 441 HOH A O   1 
HETATM 2588 O  O   . HOH K 5 .   ? 17.350  51.355 81.621 1.00 26.96 ? 442 HOH A O   1 
HETATM 2589 O  O   . HOH K 5 .   ? 18.659  44.498 86.206 1.00 29.66 ? 443 HOH A O   1 
HETATM 2590 O  O   . HOH K 5 .   ? 11.844  23.740 53.293 1.00 25.19 ? 444 HOH A O   1 
HETATM 2591 O  O   . HOH K 5 .   ? -5.141  20.469 39.137 1.00 27.83 ? 445 HOH A O   1 
HETATM 2592 O  O   . HOH K 5 .   ? 9.102   54.605 75.001 1.00 25.78 ? 446 HOH A O   1 
HETATM 2593 O  O   . HOH K 5 .   ? 22.921  41.732 59.485 1.00 29.70 ? 447 HOH A O   1 
HETATM 2594 O  O   . HOH K 5 .   ? 23.986  46.746 76.438 1.00 26.49 ? 448 HOH A O   1 
HETATM 2595 O  O   . HOH K 5 .   ? -7.120  41.282 58.171 1.00 31.28 ? 449 HOH A O   1 
HETATM 2596 O  O   . HOH K 5 .   ? 4.422   45.268 47.434 1.00 29.38 ? 450 HOH A O   1 
HETATM 2597 O  O   . HOH K 5 .   ? 21.234  37.271 60.700 1.00 31.64 ? 451 HOH A O   1 
HETATM 2598 O  O   . HOH K 5 .   ? 15.517  40.996 51.667 1.00 37.92 ? 452 HOH A O   1 
HETATM 2599 O  O   . HOH K 5 .   ? 2.506   47.080 70.181 1.00 27.62 ? 453 HOH A O   1 
HETATM 2600 O  O   . HOH K 5 .   ? 8.458   34.259 68.864 1.00 39.23 ? 454 HOH A O   1 
HETATM 2601 O  O   . HOH K 5 .   ? 23.259  23.300 71.616 1.00 53.15 ? 455 HOH A O   1 
HETATM 2602 O  O   . HOH K 5 .   ? 26.521  27.935 67.071 1.00 44.58 ? 456 HOH A O   1 
HETATM 2603 O  O   . HOH K 5 .   ? 13.457  40.923 78.386 1.00 26.43 ? 457 HOH A O   1 
HETATM 2604 O  O   . HOH K 5 .   ? 14.996  52.824 81.525 1.00 25.99 ? 458 HOH A O   1 
HETATM 2605 O  O   . HOH K 5 .   ? -0.989  49.682 59.719 1.00 33.54 ? 459 HOH A O   1 
HETATM 2606 O  O   . HOH K 5 .   ? 12.371  42.443 82.216 1.00 37.86 ? 460 HOH A O   1 
HETATM 2607 O  O   . HOH K 5 .   ? 10.101  61.070 69.859 1.00 30.43 ? 461 HOH A O   1 
HETATM 2608 O  O   . HOH K 5 .   ? 24.531  54.584 56.645 1.00 33.54 ? 462 HOH A O   1 
HETATM 2609 O  O   . HOH K 5 .   ? 23.772  46.186 62.732 1.00 33.30 ? 463 HOH A O   1 
HETATM 2610 O  O   . HOH K 5 .   ? 30.517  37.309 73.652 1.00 38.10 ? 464 HOH A O   1 
HETATM 2611 O  O   . HOH K 5 .   ? 7.890   38.031 44.543 1.00 33.46 ? 465 HOH A O   1 
HETATM 2612 O  O   . HOH K 5 .   ? 18.782  24.369 65.935 1.00 27.19 ? 466 HOH A O   1 
HETATM 2613 O  O   . HOH K 5 .   ? -7.175  32.114 46.083 1.00 29.56 ? 467 HOH A O   1 
HETATM 2614 O  O   . HOH K 5 .   ? 25.185  61.553 60.712 1.00 38.75 ? 468 HOH A O   1 
HETATM 2615 O  O   . HOH K 5 .   ? 2.623   28.520 58.804 1.00 35.89 ? 469 HOH A O   1 
HETATM 2616 O  O   . HOH K 5 .   ? 24.515  35.401 68.495 1.00 29.33 ? 470 HOH A O   1 
HETATM 2617 O  O   . HOH K 5 .   ? 23.099  53.382 64.722 1.00 27.47 ? 471 HOH A O   1 
HETATM 2618 O  O   . HOH K 5 .   ? 29.288  39.227 69.402 1.00 31.13 ? 472 HOH A O   1 
HETATM 2619 O  O   . HOH K 5 .   ? 16.227  41.328 84.592 1.00 31.55 ? 473 HOH A O   1 
HETATM 2620 O  O   . HOH K 5 .   ? 18.024  36.934 48.928 1.00 42.83 ? 474 HOH A O   1 
HETATM 2621 O  O   . HOH K 5 .   ? 10.270  27.649 43.785 1.00 28.63 ? 475 HOH A O   1 
HETATM 2622 O  O   . HOH K 5 .   ? 21.521  45.809 77.241 1.00 39.23 ? 476 HOH A O   1 
HETATM 2623 O  O   . HOH K 5 .   ? 20.459  38.522 78.070 1.00 25.43 ? 477 HOH A O   1 
HETATM 2624 O  O   . HOH K 5 .   ? -3.540  38.046 61.368 1.00 35.01 ? 478 HOH A O   1 
HETATM 2625 O  O   . HOH K 5 .   ? 30.339  44.112 69.877 1.00 30.94 ? 479 HOH A O   1 
HETATM 2626 O  O   . HOH K 5 .   ? 4.728   38.211 41.917 1.00 29.83 ? 480 HOH A O   1 
HETATM 2627 O  O   . HOH K 5 .   ? 3.151   42.652 69.815 1.00 31.09 ? 481 HOH A O   1 
HETATM 2628 O  O   . HOH K 5 .   ? 20.276  42.075 83.202 1.00 33.27 ? 482 HOH A O   1 
HETATM 2629 O  O   . HOH K 5 .   ? 15.894  58.827 61.960 1.00 35.69 ? 483 HOH A O   1 
HETATM 2630 O  O   . HOH K 5 .   ? 11.777  26.831 41.696 1.00 39.88 ? 484 HOH A O   1 
HETATM 2631 O  O   . HOH K 5 .   ? -6.383  41.920 55.185 1.00 35.70 ? 485 HOH A O   1 
HETATM 2632 O  O   . HOH K 5 .   ? 5.783   38.065 70.211 1.00 41.02 ? 486 HOH A O   1 
HETATM 2633 O  O   . HOH K 5 .   ? -7.954  31.166 56.851 1.00 37.99 ? 487 HOH A O   1 
HETATM 2634 O  O   . HOH K 5 .   ? 12.543  62.173 70.324 1.00 30.56 ? 488 HOH A O   1 
HETATM 2635 O  O   . HOH K 5 .   ? -6.114  26.008 35.572 1.00 39.14 ? 489 HOH A O   1 
HETATM 2636 O  O   . HOH K 5 .   ? 18.037  44.833 52.060 1.00 37.71 ? 490 HOH A O   1 
HETATM 2637 O  O   . HOH K 5 .   ? 1.985   40.382 66.275 1.00 31.08 ? 491 HOH A O   1 
HETATM 2638 O  O   . HOH K 5 .   ? 7.895   32.441 44.867 1.00 44.07 ? 492 HOH A O   1 
HETATM 2639 O  O   . HOH K 5 .   ? 4.435   27.828 71.906 1.00 51.53 ? 493 HOH A O   1 
HETATM 2640 O  O   . HOH K 5 .   ? 13.445  40.142 80.755 1.00 35.61 ? 494 HOH A O   1 
HETATM 2641 O  O   . HOH K 5 .   ? -7.064  30.202 53.800 1.00 44.68 ? 495 HOH A O   1 
HETATM 2642 O  O   . HOH K 5 .   ? 0.653   39.593 47.904 1.00 35.27 ? 496 HOH A O   1 
HETATM 2643 O  O   . HOH K 5 .   ? 15.402  44.925 52.090 1.00 36.02 ? 497 HOH A O   1 
HETATM 2644 O  O   . HOH K 5 .   ? 25.663  42.478 78.662 1.00 36.19 ? 498 HOH A O   1 
HETATM 2645 O  O   . HOH K 5 .   ? -2.310  38.550 45.994 1.00 34.62 ? 499 HOH A O   1 
HETATM 2646 O  O   . HOH K 5 .   ? 21.210  43.405 78.388 1.00 41.54 ? 500 HOH A O   1 
HETATM 2647 O  O   . HOH K 5 .   ? 0.758   49.674 56.279 1.00 37.07 ? 501 HOH A O   1 
HETATM 2648 O  O   . HOH K 5 .   ? 9.757   31.190 36.833 1.00 57.05 ? 502 HOH A O   1 
HETATM 2649 O  O   . HOH K 5 .   ? 12.863  26.442 50.185 1.00 34.00 ? 503 HOH A O   1 
HETATM 2650 O  O   . HOH K 5 .   ? 13.560  24.417 51.939 1.00 42.50 ? 504 HOH A O   1 
HETATM 2651 O  O   . HOH K 5 .   ? 8.379   34.788 45.796 1.00 39.46 ? 505 HOH A O   1 
HETATM 2652 O  O   . HOH K 5 .   ? 7.361   55.314 66.827 1.00 30.05 ? 506 HOH A O   1 
HETATM 2653 O  O   . HOH K 5 .   ? 1.301   29.643 62.864 1.00 31.88 ? 507 HOH A O   1 
HETATM 2654 O  O   . HOH K 5 .   ? 8.680   36.385 71.310 1.00 48.25 ? 508 HOH A O   1 
HETATM 2655 O  O   . HOH K 5 .   ? 16.167  31.680 44.416 1.00 42.02 ? 509 HOH A O   1 
HETATM 2656 O  O   . HOH K 5 .   ? 24.423  35.841 60.661 1.00 44.95 ? 510 HOH A O   1 
HETATM 2657 O  O   . HOH K 5 .   ? 10.874  49.031 82.444 1.00 34.49 ? 511 HOH A O   1 
HETATM 2658 O  O   . HOH K 5 .   ? 11.616  50.086 50.284 1.00 48.08 ? 512 HOH A O   1 
HETATM 2659 O  O   . HOH K 5 .   ? -3.060  47.313 62.041 1.00 46.36 ? 513 HOH A O   1 
HETATM 2660 O  O   . HOH K 5 .   ? 15.018  53.349 59.687 1.00 30.81 ? 514 HOH A O   1 
HETATM 2661 O  O   . HOH K 5 .   ? -0.337  29.030 56.623 1.00 45.28 ? 515 HOH A O   1 
HETATM 2662 O  O   . HOH K 5 .   ? 22.064  31.782 77.770 1.00 41.60 ? 516 HOH A O   1 
HETATM 2663 O  O   . HOH K 5 .   ? 18.575  59.368 75.308 1.00 33.98 ? 517 HOH A O   1 
HETATM 2664 O  O   . HOH K 5 .   ? 17.642  39.707 53.063 1.00 30.65 ? 518 HOH A O   1 
HETATM 2665 O  O   . HOH K 5 .   ? 21.859  40.767 61.900 1.00 31.47 ? 519 HOH A O   1 
HETATM 2666 O  O   . HOH K 5 .   ? 20.900  35.880 58.737 1.00 40.61 ? 520 HOH A O   1 
HETATM 2667 O  O   . HOH K 5 .   ? 15.780  34.844 55.998 1.00 37.01 ? 521 HOH A O   1 
HETATM 2668 O  O   . HOH K 5 .   ? 27.608  33.797 70.357 1.00 43.55 ? 522 HOH A O   1 
HETATM 2669 O  O   . HOH K 5 .   ? 18.698  62.043 68.105 1.00 42.06 ? 523 HOH A O   1 
HETATM 2670 O  O   . HOH K 5 .   ? -1.916  37.531 63.767 1.00 41.60 ? 524 HOH A O   1 
HETATM 2671 O  O   . HOH K 5 .   ? -6.010  23.093 47.398 1.00 42.41 ? 525 HOH A O   1 
HETATM 2672 O  O   . HOH K 5 .   ? 25.341  53.027 62.952 1.00 36.55 ? 526 HOH A O   1 
HETATM 2673 O  O   . HOH K 5 .   ? 2.100   47.905 50.891 1.00 37.79 ? 527 HOH A O   1 
HETATM 2674 O  O   . HOH K 5 .   ? 9.678   48.532 49.497 1.00 41.96 ? 528 HOH A O   1 
HETATM 2675 O  O   . HOH K 5 .   ? 14.225  63.693 67.602 1.00 40.39 ? 529 HOH A O   1 
HETATM 2676 O  O   . HOH K 5 .   ? -5.781  28.114 53.436 1.00 46.49 ? 530 HOH A O   1 
HETATM 2677 O  O   . HOH K 5 .   ? 23.849  42.016 76.887 1.00 34.37 ? 531 HOH A O   1 
HETATM 2678 O  O   . HOH K 5 .   ? 23.955  41.859 62.236 1.00 38.32 ? 532 HOH A O   1 
HETATM 2679 O  O   . HOH K 5 .   ? 5.366   55.352 60.535 1.00 39.53 ? 533 HOH A O   1 
HETATM 2680 O  O   . HOH K 5 .   ? 5.766   59.156 65.002 1.00 41.30 ? 534 HOH A O   1 
HETATM 2681 O  O   . HOH L 5 .   ? 1.805   5.821  35.735 1.00 20.92 ? 503 HOH B O   1 
HETATM 2682 O  O   . HOH L 5 .   ? 5.117   32.240 43.605 1.00 19.76 ? 504 HOH B O   1 
HETATM 2683 O  O   . HOH L 5 .   ? 8.798   25.499 46.080 1.00 25.19 ? 505 HOH B O   1 
HETATM 2684 O  O   . HOH L 5 .   ? 4.098   23.284 37.182 1.00 23.41 ? 506 HOH B O   1 
HETATM 2685 O  O   . HOH L 5 .   ? -4.555  4.958  41.553 1.00 26.32 ? 507 HOH B O   1 
HETATM 2686 O  O   . HOH L 5 .   ? 18.112  35.431 77.404 1.00 32.79 ? 508 HOH B O   1 
HETATM 2687 O  O   . HOH L 5 .   ? 1.205   20.580 47.380 1.00 22.55 ? 509 HOH B O   1 
HETATM 2688 O  O   . HOH L 5 .   ? 2.829   22.654 34.798 1.00 25.45 ? 510 HOH B O   1 
HETATM 2689 O  O   . HOH L 5 .   ? 11.371  11.405 40.343 1.00 30.80 ? 511 HOH B O   1 
HETATM 2690 O  O   . HOH L 5 .   ? 6.045   21.429 37.352 1.00 24.99 ? 512 HOH B O   1 
HETATM 2691 O  O   . HOH L 5 .   ? 11.577  19.677 50.941 1.00 28.54 ? 513 HOH B O   1 
HETATM 2692 O  O   . HOH L 5 .   ? -3.123  12.465 35.785 1.00 27.79 ? 514 HOH B O   1 
HETATM 2693 O  O   . HOH L 5 .   ? 10.618  25.321 61.429 1.00 28.71 ? 515 HOH B O   1 
HETATM 2694 O  O   . HOH L 5 .   ? 18.829  21.901 67.432 1.00 31.48 ? 516 HOH B O   1 
HETATM 2695 O  O   . HOH L 5 .   ? 11.440  19.213 43.534 1.00 35.98 ? 517 HOH B O   1 
HETATM 2696 O  O   . HOH L 5 .   ? 15.596  14.135 53.649 1.00 33.47 ? 518 HOH B O   1 
HETATM 2697 O  O   . HOH L 5 .   ? -11.636 10.338 48.337 1.00 49.72 ? 519 HOH B O   1 
HETATM 2698 O  O   . HOH L 5 .   ? -1.228  9.589  55.618 1.00 28.76 ? 520 HOH B O   1 
HETATM 2699 O  O   . HOH L 5 .   ? 8.468   12.254 38.695 1.00 30.86 ? 521 HOH B O   1 
HETATM 2700 O  O   . HOH L 5 .   ? -4.902  2.766  34.556 1.00 30.06 ? 522 HOH B O   1 
HETATM 2701 O  O   . HOH L 5 .   ? 15.255  8.973  40.638 1.00 32.73 ? 523 HOH B O   1 
HETATM 2702 O  O   . HOH L 5 .   ? 8.603   28.286 36.563 1.00 39.48 ? 524 HOH B O   1 
HETATM 2703 O  O   . HOH L 5 .   ? 11.261  15.653 42.394 1.00 40.28 ? 525 HOH B O   1 
HETATM 2704 O  O   . HOH L 5 .   ? 19.528  12.541 65.884 1.00 55.75 ? 526 HOH B O   1 
HETATM 2705 O  O   . HOH L 5 .   ? 6.182   4.764  59.144 1.00 32.42 ? 527 HOH B O   1 
HETATM 2706 O  O   . HOH L 5 .   ? -0.069  16.344 59.318 1.00 32.86 ? 528 HOH B O   1 
HETATM 2707 O  O   . HOH L 5 .   ? 12.462  7.846  61.745 1.00 35.15 ? 529 HOH B O   1 
HETATM 2708 O  O   . HOH L 5 .   ? 1.295   21.271 31.435 1.00 34.71 ? 530 HOH B O   1 
HETATM 2709 O  O   . HOH L 5 .   ? 9.064   14.679 40.915 1.00 31.46 ? 531 HOH B O   1 
HETATM 2710 O  O   . HOH L 5 .   ? 3.513   -4.173 41.902 1.00 29.52 ? 532 HOH B O   1 
HETATM 2711 O  O   . HOH L 5 .   ? 17.915  15.966 59.932 1.00 35.83 ? 533 HOH B O   1 
HETATM 2712 O  O   . HOH L 5 .   ? 18.437  21.529 62.150 1.00 38.46 ? 534 HOH B O   1 
HETATM 2713 O  O   . HOH L 5 .   ? 19.277  24.490 62.201 1.00 43.94 ? 535 HOH B O   1 
HETATM 2714 O  O   . HOH L 5 .   ? 10.575  0.607  41.455 1.00 35.32 ? 536 HOH B O   1 
HETATM 2715 O  O   . HOH L 5 .   ? 10.697  3.146  41.248 1.00 35.20 ? 537 HOH B O   1 
HETATM 2716 O  O   . HOH L 5 .   ? 20.680  30.573 79.985 1.00 45.68 ? 538 HOH B O   1 
HETATM 2717 O  O   . HOH L 5 .   ? -1.434  14.407 33.439 1.00 34.44 ? 539 HOH B O   1 
HETATM 2718 O  O   . HOH L 5 .   ? -3.239  24.898 35.092 1.00 32.41 ? 540 HOH B O   1 
HETATM 2719 O  O   . HOH L 5 .   ? -2.873  2.115  48.363 1.00 31.93 ? 541 HOH B O   1 
HETATM 2720 O  O   . HOH L 5 .   ? 14.662  -4.641 39.128 1.00 49.71 ? 542 HOH B O   1 
HETATM 2721 O  O   . HOH L 5 .   ? -4.254  17.635 36.432 1.00 26.96 ? 543 HOH B O   1 
HETATM 2722 O  O   . HOH L 5 .   ? 8.875   4.164  39.761 1.00 34.33 ? 544 HOH B O   1 
HETATM 2723 O  O   . HOH L 5 .   ? 13.021  32.708 55.785 1.00 19.61 ? 545 HOH B O   1 
HETATM 2724 O  O   . HOH L 5 .   ? 16.424  30.203 56.300 1.00 32.95 ? 546 HOH B O   1 
HETATM 2725 O  O   . HOH L 5 .   ? 16.918  15.327 69.310 1.00 55.30 ? 547 HOH B O   1 
HETATM 2726 O  O   . HOH L 5 .   ? 22.831  21.138 57.012 1.00 53.76 ? 548 HOH B O   1 
HETATM 2727 O  O   . HOH L 5 .   ? 0.601   11.954 31.592 1.00 49.91 ? 549 HOH B O   1 
HETATM 2728 O  O   . HOH L 5 .   ? 8.656   8.432  67.208 1.00 42.08 ? 550 HOH B O   1 
HETATM 2729 O  O   . HOH L 5 .   ? 0.946   20.441 55.294 1.00 34.68 ? 551 HOH B O   1 
HETATM 2730 O  O   . HOH L 5 .   ? -2.750  15.084 30.719 1.00 40.98 ? 552 HOH B O   1 
HETATM 2731 O  O   . HOH L 5 .   ? 19.380  31.718 59.469 1.00 36.28 ? 553 HOH B O   1 
HETATM 2732 O  O   . HOH L 5 .   ? 19.987  18.881 62.838 1.00 39.54 ? 554 HOH B O   1 
HETATM 2733 O  O   . HOH L 5 .   ? 18.536  33.140 80.240 1.00 45.52 ? 555 HOH B O   1 
HETATM 2734 O  O   . HOH L 5 .   ? 4.518   27.478 61.587 1.00 47.08 ? 556 HOH B O   1 
HETATM 2735 O  O   . HOH L 5 .   ? 4.206   27.231 36.102 1.00 43.63 ? 557 HOH B O   1 
HETATM 2736 O  O   . HOH L 5 .   ? 17.149  8.300  58.372 1.00 45.69 ? 558 HOH B O   1 
HETATM 2737 O  O   . HOH L 5 .   ? 13.687  16.612 67.672 1.00 42.71 ? 559 HOH B O   1 
HETATM 2738 O  O   . HOH L 5 .   ? 0.267   5.003  61.607 1.00 41.69 ? 560 HOH B O   1 
HETATM 2739 O  O   . HOH L 5 .   ? 12.549  21.775 50.651 1.00 42.21 ? 561 HOH B O   1 
HETATM 2740 O  O   . HOH L 5 .   ? -6.438  14.353 52.589 1.00 58.48 ? 562 HOH B O   1 
HETATM 2741 O  O   . HOH L 5 .   ? 15.277  16.896 71.619 1.00 47.81 ? 563 HOH B O   1 
HETATM 2742 O  O   . HOH L 5 .   ? 13.929  17.770 48.675 1.00 41.19 ? 564 HOH B O   1 
HETATM 2743 O  O   . HOH L 5 .   ? -2.498  14.660 55.328 1.00 35.90 ? 565 HOH B O   1 
HETATM 2744 O  O   . HOH L 5 .   ? 14.926  2.869  58.499 1.00 49.58 ? 566 HOH B O   1 
HETATM 2745 O  O   . HOH L 5 .   ? -4.423  4.115  45.796 1.00 32.88 ? 567 HOH B O   1 
HETATM 2746 O  O   . HOH L 5 .   ? -0.496  17.145 64.483 1.00 55.41 ? 568 HOH B O   1 
HETATM 2747 O  O   . HOH L 5 .   ? -7.754  15.073 42.012 1.00 44.76 ? 569 HOH B O   1 
HETATM 2748 O  O   . HOH L 5 .   ? 10.795  -4.707 45.264 1.00 46.88 ? 570 HOH B O   1 
HETATM 2749 O  O   . HOH L 5 .   ? -1.205  2.144  51.642 1.00 38.71 ? 571 HOH B O   1 
HETATM 2750 O  O   . HOH L 5 .   ? 0.330   23.546 71.469 1.00 47.76 ? 572 HOH B O   1 
HETATM 2751 O  O   . HOH L 5 .   ? 9.282   19.833 33.600 1.00 44.26 ? 573 HOH B O   1 
HETATM 2752 O  O   . HOH L 5 .   ? 0.732   26.661 60.530 1.00 46.36 ? 574 HOH B O   1 
HETATM 2753 O  O   . HOH L 5 .   ? 17.273  2.414  41.639 1.00 49.61 ? 575 HOH B O   1 
HETATM 2754 O  O   . HOH L 5 .   ? 7.049   22.252 34.572 1.00 36.97 ? 576 HOH B O   1 
HETATM 2755 O  O   . HOH L 5 .   ? 9.157   -2.823 47.087 1.00 49.42 ? 577 HOH B O   1 
HETATM 2756 O  O   . HOH L 5 .   ? -0.960  8.752  29.940 1.00 45.51 ? 578 HOH B O   1 
HETATM 2757 O  O   . HOH L 5 .   ? 16.535  24.037 55.493 1.00 43.64 ? 579 HOH B O   1 
HETATM 2758 O  O   . HOH L 5 .   ? 2.540   0.004  55.439 1.00 44.32 ? 580 HOH B O   1 
HETATM 2759 O  O   . HOH L 5 .   ? -2.614  28.177 35.837 1.00 33.55 ? 581 HOH B O   1 
HETATM 2760 O  O   . HOH L 5 .   ? 13.533  15.161 42.163 1.00 55.43 ? 582 HOH B O   1 
HETATM 2761 O  O   . HOH L 5 .   ? 13.103  20.930 44.448 1.00 36.48 ? 583 HOH B O   1 
HETATM 2762 O  O   . HOH L 5 .   ? 8.937   21.533 37.698 1.00 40.50 ? 584 HOH B O   1 
HETATM 2763 O  O   . HOH L 5 .   ? 3.141   6.245  63.661 1.00 40.98 ? 585 HOH B O   1 
HETATM 2764 O  O   . HOH L 5 .   ? 5.906   29.283 35.898 1.00 45.11 ? 586 HOH B O   1 
HETATM 2765 O  O   . HOH L 5 .   ? 0.764   0.802  52.572 1.00 49.98 ? 587 HOH B O   1 
HETATM 2766 O  O   . HOH L 5 .   ? -3.755  10.443 54.085 1.00 43.06 ? 588 HOH B O   1 
HETATM 2767 O  O   . HOH L 5 .   ? 0.623   14.066 69.539 1.00 46.40 ? 589 HOH B O   1 
HETATM 2768 O  O   . HOH L 5 .   ? -3.518  15.879 34.492 1.00 36.04 ? 590 HOH B O   1 
HETATM 2769 O  O   . HOH L 5 .   ? 12.910  17.756 41.208 1.00 50.04 ? 591 HOH B O   1 
HETATM 2770 O  O   . HOH L 5 .   ? 12.341  3.997  39.239 1.00 53.18 ? 592 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   ALA 2   -2  ?   ?   ?   A . n 
A 1 3   MSE 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   GLY 6   2   ?   ?   ?   A . n 
A 1 7   GLY 7   3   ?   ?   ?   A . n 
A 1 8   GLY 8   4   ?   ?   ?   A . n 
A 1 9   GLY 9   5   ?   ?   ?   A . n 
A 1 10  GLU 10  6   ?   ?   ?   A . n 
A 1 11  HIS 11  7   ?   ?   ?   A . n 
A 1 12  GLN 12  8   ?   ?   ?   A . n 
A 1 13  HIS 13  9   ?   ?   ?   A . n 
A 1 14  GLY 14  10  ?   ?   ?   A . n 
A 1 15  GLU 15  11  ?   ?   ?   A . n 
A 1 16  GLU 16  12  ?   ?   ?   A . n 
A 1 17  MSE 17  13  ?   ?   ?   A . n 
A 1 18  MSE 18  14  ?   ?   ?   A . n 
A 1 19  ALA 19  15  ?   ?   ?   A . n 
A 1 20  ALA 20  16  ?   ?   ?   A . n 
A 1 21  VAL 21  17  ?   ?   ?   A . n 
A 1 22  PRO 22  18  ?   ?   ?   A . n 
A 1 23  ALA 23  19  ?   ?   ?   A . n 
A 1 24  PRO 24  20  ?   ?   ?   A . n 
A 1 25  ASP 25  21  ?   ?   ?   A . n 
A 1 26  ALA 26  22  ?   ?   ?   A . n 
A 1 27  GLU 27  23  ?   ?   ?   A . n 
A 1 28  GLY 28  24  ?   ?   ?   A . n 
A 1 29  ALA 29  25  ?   ?   ?   A . n 
A 1 30  ALA 30  26  ?   ?   ?   A . n 
A 1 31  GLY 31  27  ?   ?   ?   A . n 
A 1 32  PHE 32  28  28  PHE PHE A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  PHE 35  31  31  PHE PHE A . n 
A 1 36  PRO 36  32  32  PRO PRO A . n 
A 1 37  ILE 37  33  33  ILE ILE A . n 
A 1 38  GLY 38  34  34  GLY GLY A . n 
A 1 39  GLU 39  35  35  GLU GLU A . n 
A 1 40  ASP 40  36  36  ASP ASP A . n 
A 1 41  ARG 41  37  37  ARG ARG A . n 
A 1 42  ASP 42  38  38  ASP ASP A . n 
A 1 43  VAL 43  39  39  VAL VAL A . n 
A 1 44  GLY 44  40  40  GLY GLY A . n 
A 1 45  PRO 45  41  41  PRO PRO A . n 
A 1 46  LEU 46  42  42  LEU LEU A . n 
A 1 47  HIS 47  43  43  HIS HIS A . n 
A 1 48  VAL 48  44  44  VAL VAL A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  GLY 50  46  46  GLY GLY A . n 
A 1 51  VAL 51  47  47  VAL VAL A . n 
A 1 52  TYR 52  48  48  TYR TYR A . n 
A 1 53  PHE 53  49  49  PHE PHE A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  PRO 55  51  51  PRO PRO A . n 
A 1 56  VAL 56  52  52  VAL VAL A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  MSE 58  54  54  MSE MSE A . n 
A 1 59  HIS 59  55  55  HIS HIS A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  ALA 61  57  57  ALA ALA A . n 
A 1 62  PRO 62  58  58  PRO PRO A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  ALA 64  60  60  ALA ALA A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  PRO 66  62  62  PRO PRO A . n 
A 1 67  SER 67  63  63  SER SER A . n 
A 1 68  LYS 68  64  64  LYS LYS A . n 
A 1 69  GLU 69  65  65  GLU GLU A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  ALA 71  67  67  ALA ALA A . n 
A 1 72  ASP 72  68  68  ASP ASP A . n 
A 1 73  CYS 73  69  69  CYS CYS A . n 
A 1 74  HIS 74  70  70  HIS HIS A . n 
A 1 75  ILE 75  71  71  ILE ILE A . n 
A 1 76  GLU 76  72  72  GLU GLU A . n 
A 1 77  ALA 77  73  73  ALA ALA A . n 
A 1 78  ASP 78  74  74  ASP ASP A . n 
A 1 79  ILE 79  75  75  ILE ILE A . n 
A 1 80  HIS 80  76  76  HIS HIS A . n 
A 1 81  ALA 81  77  77  ALA ALA A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  GLU 83  79  79  GLU GLU A . n 
A 1 84  ALA 84  80  80  ALA ALA A . n 
A 1 85  GLY 85  81  81  GLY GLY A . n 
A 1 86  LYS 86  82  82  LYS LYS A . n 
A 1 87  ASP 87  83  83  ASP ASP A . n 
A 1 88  LEU 88  84  84  LEU LEU A . n 
A 1 89  GLY 89  85  85  GLY GLY A . n 
A 1 90  TYR 90  86  86  TYR TYR A . n 
A 1 91  GLY 91  87  87  GLY GLY A . n 
A 1 92  VAL 92  88  88  VAL VAL A . n 
A 1 93  GLY 93  89  89  GLY GLY A . n 
A 1 94  ASP 94  90  90  ASP ASP A . n 
A 1 95  PHE 95  91  91  PHE PHE A . n 
A 1 96  VAL 96  92  92  VAL VAL A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  TYR 98  94  94  TYR TYR A . n 
A 1 99  LEU 99  95  95  LEU LEU A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 VAL 102 98  98  VAL VAL A . n 
A 1 103 ALA 103 99  99  ALA ALA A . n 
A 1 104 PHE 104 100 100 PHE PHE A . n 
A 1 105 LEU 105 101 101 LEU LEU A . n 
A 1 106 GLN 106 102 102 GLN GLN A . n 
A 1 107 LYS 107 103 103 LYS LYS A . n 
A 1 108 HIS 108 104 104 HIS HIS A . n 
A 1 109 GLY 109 105 105 GLY GLY A . n 
A 1 110 SER 110 106 106 SER SER A . n 
A 1 111 GLU 111 107 107 GLU GLU A . n 
A 1 112 LYS 112 108 108 LYS LYS A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 GLN 114 110 110 GLN GLN A . n 
A 1 115 LYS 115 111 111 LYS LYS A . n 
A 1 116 VAL 116 112 112 VAL VAL A . n 
A 1 117 MSE 117 113 113 MSE MSE A . n 
A 1 118 PHE 118 114 114 PHE PHE A . n 
A 1 119 ALA 119 115 115 ALA ALA A . n 
A 1 120 PRO 120 116 116 PRO PRO A . n 
A 1 121 MSE 121 117 117 MSE MSE A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ALA 123 119 119 ALA ALA A . n 
A 1 124 GLY 124 120 120 GLY GLY A . n 
A 1 125 ASP 125 121 121 ASP ASP A . n 
A 1 126 GLY 126 122 122 GLY GLY A . n 
A 1 127 PRO 127 123 123 PRO PRO A . n 
A 1 128 HIS 128 124 124 HIS HIS A . n 
A 1 129 TYR 129 125 125 TYR TYR A . n 
A 1 130 GLY 130 126 126 GLY GLY A . n 
A 1 131 ALA 131 127 127 ALA ALA A . n 
A 1 132 ASN 132 128 128 ASN ASN A . n 
A 1 133 VAL 133 129 129 VAL VAL A . n 
A 1 134 LYS 134 130 130 LYS LYS A . n 
A 1 135 PHE 135 131 131 PHE PHE A . n 
A 1 136 GLU 136 132 132 GLU GLU A . n 
A 1 137 GLU 137 133 133 GLU GLU A . n 
A 1 138 GLY 138 134 134 GLY GLY A . n 
A 1 139 LEU 139 135 135 LEU LEU A . n 
A 1 140 GLY 140 136 136 GLY GLY A . n 
A 1 141 THR 141 137 137 THR THR A . n 
A 1 142 TYR 142 138 138 TYR TYR A . n 
A 1 143 LYS 143 139 139 LYS LYS A . n 
A 1 144 VAL 144 140 140 VAL VAL A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 PHE 146 142 142 PHE PHE A . n 
A 1 147 GLU 147 143 143 GLU GLU A . n 
A 1 148 ILE 148 144 144 ILE ILE A . n 
A 1 149 ALA 149 145 145 ALA ALA A . n 
A 1 150 ALA 150 146 146 ALA ALA A . n 
A 1 151 PRO 151 147 147 PRO PRO A . n 
A 1 152 SER 152 148 148 SER SER A . n 
A 1 153 HIS 153 149 149 HIS HIS A . n 
A 1 154 ASP 154 150 150 ASP ASP A . n 
A 1 155 GLU 155 151 151 GLU GLU A . n 
A 1 156 TYR 156 152 152 TYR TYR A . n 
A 1 157 SER 157 153 153 SER SER A . n 
A 1 158 LEU 158 154 154 LEU LEU A . n 
A 1 159 HIS 159 155 155 HIS HIS A . n 
A 1 160 ILE 160 156 156 ILE ILE A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 GLU 162 158 158 GLU GLU A . n 
A 1 163 GLN 163 159 159 GLN GLN A . n 
A 1 164 THR 164 160 160 THR THR A . n 
A 1 165 GLY 165 161 161 GLY GLY A . n 
A 1 166 VAL 166 162 162 VAL VAL A . n 
A 1 167 SER 167 163 163 SER SER A . n 
A 1 168 GLY 168 164 164 GLY GLY A . n 
A 1 169 ARG 169 165 165 ARG ARG A . n 
A 1 170 PHE 170 166 166 PHE PHE A . n 
A 1 171 TRP 171 167 167 TRP TRP A . n 
A 1 172 SER 172 168 168 SER SER A . n 
A 1 173 GLU 173 169 169 GLU GLU A . n 
A 1 174 PRO 174 170 170 PRO PRO A . n 
A 1 175 LEU 175 171 171 LEU LEU A . n 
A 1 176 VAL 176 172 172 VAL VAL A . n 
A 1 177 ALA 177 173 173 ALA ALA A . n 
A 1 178 GLU 178 174 174 GLU GLU A . n 
A 1 179 TRP 179 175 175 TRP TRP A . n 
A 1 180 ASP 180 176 176 ASP ASP A . n 
A 1 181 ASP 181 177 177 ASP ASP A . n 
A 1 182 PHE 182 178 178 PHE PHE A . n 
A 1 183 GLU 183 179 179 GLU GLU A . n 
A 1 184 TRP 184 180 180 TRP TRP A . n 
A 1 185 LYS 185 181 181 LYS LYS A . n 
A 1 186 GLY 186 182 182 GLY GLY A . n 
A 1 187 PRO 187 183 183 PRO PRO A . n 
A 1 188 GLN 188 184 184 GLN GLN A . n 
A 1 189 TRP 189 185 185 TRP TRP A . n 
B 1 1   GLY 1   -3  ?   ?   ?   B . n 
B 1 2   ALA 2   -2  ?   ?   ?   B . n 
B 1 3   MSE 3   -1  ?   ?   ?   B . n 
B 1 4   GLY 4   0   ?   ?   ?   B . n 
B 1 5   SER 5   1   ?   ?   ?   B . n 
B 1 6   GLY 6   2   ?   ?   ?   B . n 
B 1 7   GLY 7   3   ?   ?   ?   B . n 
B 1 8   GLY 8   4   ?   ?   ?   B . n 
B 1 9   GLY 9   5   ?   ?   ?   B . n 
B 1 10  GLU 10  6   ?   ?   ?   B . n 
B 1 11  HIS 11  7   ?   ?   ?   B . n 
B 1 12  GLN 12  8   ?   ?   ?   B . n 
B 1 13  HIS 13  9   ?   ?   ?   B . n 
B 1 14  GLY 14  10  ?   ?   ?   B . n 
B 1 15  GLU 15  11  ?   ?   ?   B . n 
B 1 16  GLU 16  12  ?   ?   ?   B . n 
B 1 17  MSE 17  13  ?   ?   ?   B . n 
B 1 18  MSE 18  14  ?   ?   ?   B . n 
B 1 19  ALA 19  15  ?   ?   ?   B . n 
B 1 20  ALA 20  16  ?   ?   ?   B . n 
B 1 21  VAL 21  17  ?   ?   ?   B . n 
B 1 22  PRO 22  18  ?   ?   ?   B . n 
B 1 23  ALA 23  19  ?   ?   ?   B . n 
B 1 24  PRO 24  20  ?   ?   ?   B . n 
B 1 25  ASP 25  21  ?   ?   ?   B . n 
B 1 26  ALA 26  22  ?   ?   ?   B . n 
B 1 27  GLU 27  23  ?   ?   ?   B . n 
B 1 28  GLY 28  24  ?   ?   ?   B . n 
B 1 29  ALA 29  25  ?   ?   ?   B . n 
B 1 30  ALA 30  26  ?   ?   ?   B . n 
B 1 31  GLY 31  27  ?   ?   ?   B . n 
B 1 32  PHE 32  28  ?   ?   ?   B . n 
B 1 33  ASP 33  29  29  ASP ASP B . n 
B 1 34  GLU 34  30  30  GLU GLU B . n 
B 1 35  PHE 35  31  31  PHE PHE B . n 
B 1 36  PRO 36  32  32  PRO PRO B . n 
B 1 37  ILE 37  33  33  ILE ILE B . n 
B 1 38  GLY 38  34  34  GLY GLY B . n 
B 1 39  GLU 39  35  35  GLU GLU B . n 
B 1 40  ASP 40  36  36  ASP ASP B . n 
B 1 41  ARG 41  37  37  ARG ARG B . n 
B 1 42  ASP 42  38  38  ASP ASP B . n 
B 1 43  VAL 43  39  39  VAL VAL B . n 
B 1 44  GLY 44  40  40  GLY GLY B . n 
B 1 45  PRO 45  41  41  PRO PRO B . n 
B 1 46  LEU 46  42  42  LEU LEU B . n 
B 1 47  HIS 47  43  43  HIS HIS B . n 
B 1 48  VAL 48  44  44  VAL VAL B . n 
B 1 49  GLY 49  45  45  GLY GLY B . n 
B 1 50  GLY 50  46  46  GLY GLY B . n 
B 1 51  VAL 51  47  47  VAL VAL B . n 
B 1 52  TYR 52  48  48  TYR TYR B . n 
B 1 53  PHE 53  49  49  PHE PHE B . n 
B 1 54  GLN 54  50  50  GLN GLN B . n 
B 1 55  PRO 55  51  51  PRO PRO B . n 
B 1 56  VAL 56  52  52  VAL VAL B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  MSE 58  54  54  MSE MSE B . n 
B 1 59  HIS 59  55  55  HIS HIS B . n 
B 1 60  PRO 60  56  56  PRO PRO B . n 
B 1 61  ALA 61  57  57  ALA ALA B . n 
B 1 62  PRO 62  58  58  PRO PRO B . n 
B 1 63  GLY 63  59  59  GLY GLY B . n 
B 1 64  ALA 64  60  60  ALA ALA B . n 
B 1 65  GLN 65  61  61  GLN GLN B . n 
B 1 66  PRO 66  62  62  PRO PRO B . n 
B 1 67  SER 67  63  63  SER SER B . n 
B 1 68  LYS 68  64  64  LYS LYS B . n 
B 1 69  GLU 69  65  65  GLU GLU B . n 
B 1 70  GLU 70  66  66  GLU GLU B . n 
B 1 71  ALA 71  67  67  ALA ALA B . n 
B 1 72  ASP 72  68  68  ASP ASP B . n 
B 1 73  CYS 73  69  69  CYS CYS B . n 
B 1 74  HIS 74  70  70  HIS HIS B . n 
B 1 75  ILE 75  71  71  ILE ILE B . n 
B 1 76  GLU 76  72  72  GLU GLU B . n 
B 1 77  ALA 77  73  73  ALA ALA B . n 
B 1 78  ASP 78  74  74  ASP ASP B . n 
B 1 79  ILE 79  75  75  ILE ILE B . n 
B 1 80  HIS 80  76  76  HIS HIS B . n 
B 1 81  ALA 81  77  77  ALA ALA B . n 
B 1 82  ASN 82  78  78  ASN ASN B . n 
B 1 83  GLU 83  79  79  GLU GLU B . n 
B 1 84  ALA 84  80  80  ALA ALA B . n 
B 1 85  GLY 85  81  81  GLY GLY B . n 
B 1 86  LYS 86  82  82  LYS LYS B . n 
B 1 87  ASP 87  83  83  ASP ASP B . n 
B 1 88  LEU 88  84  84  LEU LEU B . n 
B 1 89  GLY 89  85  85  GLY GLY B . n 
B 1 90  TYR 90  86  86  TYR TYR B . n 
B 1 91  GLY 91  87  87  GLY GLY B . n 
B 1 92  VAL 92  88  88  VAL VAL B . n 
B 1 93  GLY 93  89  89  GLY GLY B . n 
B 1 94  ASP 94  90  90  ASP ASP B . n 
B 1 95  PHE 95  91  91  PHE PHE B . n 
B 1 96  VAL 96  92  92  VAL VAL B . n 
B 1 97  PRO 97  93  93  PRO PRO B . n 
B 1 98  TYR 98  94  94  TYR TYR B . n 
B 1 99  LEU 99  95  95  LEU LEU B . n 
B 1 100 ARG 100 96  96  ARG ARG B . n 
B 1 101 VAL 101 97  97  VAL VAL B . n 
B 1 102 VAL 102 98  98  VAL VAL B . n 
B 1 103 ALA 103 99  99  ALA ALA B . n 
B 1 104 PHE 104 100 100 PHE PHE B . n 
B 1 105 LEU 105 101 101 LEU LEU B . n 
B 1 106 GLN 106 102 102 GLN GLN B . n 
B 1 107 LYS 107 103 103 LYS LYS B . n 
B 1 108 HIS 108 104 104 HIS HIS B . n 
B 1 109 GLY 109 105 105 GLY GLY B . n 
B 1 110 SER 110 106 106 SER SER B . n 
B 1 111 GLU 111 107 107 GLU GLU B . n 
B 1 112 LYS 112 108 108 LYS LYS B . n 
B 1 113 VAL 113 109 109 VAL VAL B . n 
B 1 114 GLN 114 110 110 GLN GLN B . n 
B 1 115 LYS 115 111 111 LYS LYS B . n 
B 1 116 VAL 116 112 112 VAL VAL B . n 
B 1 117 MSE 117 113 113 MSE MSE B . n 
B 1 118 PHE 118 114 114 PHE PHE B . n 
B 1 119 ALA 119 115 115 ALA ALA B . n 
B 1 120 PRO 120 116 116 PRO PRO B . n 
B 1 121 MSE 121 117 117 MSE MSE B . n 
B 1 122 ASN 122 118 118 ASN ASN B . n 
B 1 123 ALA 123 119 119 ALA ALA B . n 
B 1 124 GLY 124 120 120 GLY GLY B . n 
B 1 125 ASP 125 121 121 ASP ASP B . n 
B 1 126 GLY 126 122 122 GLY GLY B . n 
B 1 127 PRO 127 123 123 PRO PRO B . n 
B 1 128 HIS 128 124 124 HIS HIS B . n 
B 1 129 TYR 129 125 125 TYR TYR B . n 
B 1 130 GLY 130 126 126 GLY GLY B . n 
B 1 131 ALA 131 127 127 ALA ALA B . n 
B 1 132 ASN 132 128 128 ASN ASN B . n 
B 1 133 VAL 133 129 129 VAL VAL B . n 
B 1 134 LYS 134 130 130 LYS LYS B . n 
B 1 135 PHE 135 131 131 PHE PHE B . n 
B 1 136 GLU 136 132 132 GLU GLU B . n 
B 1 137 GLU 137 133 133 GLU GLU B . n 
B 1 138 GLY 138 134 134 GLY GLY B . n 
B 1 139 LEU 139 135 135 LEU LEU B . n 
B 1 140 GLY 140 136 136 GLY GLY B . n 
B 1 141 THR 141 137 137 THR THR B . n 
B 1 142 TYR 142 138 138 TYR TYR B . n 
B 1 143 LYS 143 139 139 LYS LYS B . n 
B 1 144 VAL 144 140 140 VAL VAL B . n 
B 1 145 ARG 145 141 141 ARG ARG B . n 
B 1 146 PHE 146 142 142 PHE PHE B . n 
B 1 147 GLU 147 143 143 GLU GLU B . n 
B 1 148 ILE 148 144 144 ILE ILE B . n 
B 1 149 ALA 149 145 145 ALA ALA B . n 
B 1 150 ALA 150 146 146 ALA ALA B . n 
B 1 151 PRO 151 147 147 PRO PRO B . n 
B 1 152 SER 152 148 148 SER SER B . n 
B 1 153 HIS 153 149 149 HIS HIS B . n 
B 1 154 ASP 154 150 150 ASP ASP B . n 
B 1 155 GLU 155 151 151 GLU GLU B . n 
B 1 156 TYR 156 152 152 TYR TYR B . n 
B 1 157 SER 157 153 153 SER SER B . n 
B 1 158 LEU 158 154 154 LEU LEU B . n 
B 1 159 HIS 159 155 155 HIS HIS B . n 
B 1 160 ILE 160 156 156 ILE ILE B . n 
B 1 161 ASP 161 157 157 ASP ASP B . n 
B 1 162 GLU 162 158 158 GLU GLU B . n 
B 1 163 GLN 163 159 159 GLN GLN B . n 
B 1 164 THR 164 160 160 THR THR B . n 
B 1 165 GLY 165 161 161 GLY GLY B . n 
B 1 166 VAL 166 162 162 VAL VAL B . n 
B 1 167 SER 167 163 163 SER SER B . n 
B 1 168 GLY 168 164 164 GLY GLY B . n 
B 1 169 ARG 169 165 165 ARG ARG B . n 
B 1 170 PHE 170 166 166 PHE PHE B . n 
B 1 171 TRP 171 167 167 TRP TRP B . n 
B 1 172 SER 172 168 168 SER SER B . n 
B 1 173 GLU 173 169 169 GLU GLU B . n 
B 1 174 PRO 174 170 170 PRO PRO B . n 
B 1 175 LEU 175 171 171 LEU LEU B . n 
B 1 176 VAL 176 172 172 VAL VAL B . n 
B 1 177 ALA 177 173 173 ALA ALA B . n 
B 1 178 GLU 178 174 174 GLU GLU B . n 
B 1 179 TRP 179 175 175 TRP TRP B . n 
B 1 180 ASP 180 176 176 ASP ASP B . n 
B 1 181 ASP 181 177 177 ASP ASP B . n 
B 1 182 PHE 182 178 178 PHE PHE B . n 
B 1 183 GLU 183 179 179 GLU GLU B . n 
B 1 184 TRP 184 180 180 TRP TRP B . n 
B 1 185 LYS 185 181 181 LYS LYS B . n 
B 1 186 GLY 186 182 182 GLY GLY B . n 
B 1 187 PRO 187 183 183 PRO PRO B . n 
B 1 188 GLN 188 184 184 GLN GLN B . n 
B 1 189 TRP 189 185 185 TRP TRP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CL  1   301 301 CL  CL  A . 
D 2 CL  1   302 302 CL  CL  A . 
E 2 CL  1   304 304 CL  CL  A . 
F 3 EDO 1   401 401 EDO EDO A . 
G 3 EDO 1   403 403 EDO EDO A . 
H 4 SO4 1   501 201 SO4 SO4 B . 
I 4 SO4 1   502 202 SO4 SO4 B . 
J 2 CL  1   303 303 CL  CL  B . 
K 5 HOH 1   404 1   HOH HOH A . 
K 5 HOH 2   405 2   HOH HOH A . 
K 5 HOH 3   406 3   HOH HOH A . 
K 5 HOH 4   407 4   HOH HOH A . 
K 5 HOH 5   408 6   HOH HOH A . 
K 5 HOH 6   409 7   HOH HOH A . 
K 5 HOH 7   410 8   HOH HOH A . 
K 5 HOH 8   411 9   HOH HOH A . 
K 5 HOH 9   412 10  HOH HOH A . 
K 5 HOH 10  413 11  HOH HOH A . 
K 5 HOH 11  414 12  HOH HOH A . 
K 5 HOH 12  415 13  HOH HOH A . 
K 5 HOH 13  416 14  HOH HOH A . 
K 5 HOH 14  417 15  HOH HOH A . 
K 5 HOH 15  418 16  HOH HOH A . 
K 5 HOH 16  419 17  HOH HOH A . 
K 5 HOH 17  420 18  HOH HOH A . 
K 5 HOH 18  421 19  HOH HOH A . 
K 5 HOH 19  422 20  HOH HOH A . 
K 5 HOH 20  423 21  HOH HOH A . 
K 5 HOH 21  424 22  HOH HOH A . 
K 5 HOH 22  425 23  HOH HOH A . 
K 5 HOH 23  426 24  HOH HOH A . 
K 5 HOH 24  427 25  HOH HOH A . 
K 5 HOH 25  428 26  HOH HOH A . 
K 5 HOH 26  429 27  HOH HOH A . 
K 5 HOH 27  430 28  HOH HOH A . 
K 5 HOH 28  431 29  HOH HOH A . 
K 5 HOH 29  432 31  HOH HOH A . 
K 5 HOH 30  433 32  HOH HOH A . 
K 5 HOH 31  434 36  HOH HOH A . 
K 5 HOH 32  435 37  HOH HOH A . 
K 5 HOH 33  436 38  HOH HOH A . 
K 5 HOH 34  437 42  HOH HOH A . 
K 5 HOH 35  438 43  HOH HOH A . 
K 5 HOH 36  439 44  HOH HOH A . 
K 5 HOH 37  440 45  HOH HOH A . 
K 5 HOH 38  441 46  HOH HOH A . 
K 5 HOH 39  442 47  HOH HOH A . 
K 5 HOH 40  443 51  HOH HOH A . 
K 5 HOH 41  444 54  HOH HOH A . 
K 5 HOH 42  445 55  HOH HOH A . 
K 5 HOH 43  446 56  HOH HOH A . 
K 5 HOH 44  447 57  HOH HOH A . 
K 5 HOH 45  448 59  HOH HOH A . 
K 5 HOH 46  449 60  HOH HOH A . 
K 5 HOH 47  450 61  HOH HOH A . 
K 5 HOH 48  451 62  HOH HOH A . 
K 5 HOH 49  452 64  HOH HOH A . 
K 5 HOH 50  453 65  HOH HOH A . 
K 5 HOH 51  454 67  HOH HOH A . 
K 5 HOH 52  455 68  HOH HOH A . 
K 5 HOH 53  456 70  HOH HOH A . 
K 5 HOH 54  457 71  HOH HOH A . 
K 5 HOH 55  458 72  HOH HOH A . 
K 5 HOH 56  459 73  HOH HOH A . 
K 5 HOH 57  460 76  HOH HOH A . 
K 5 HOH 58  461 78  HOH HOH A . 
K 5 HOH 59  462 81  HOH HOH A . 
K 5 HOH 60  463 83  HOH HOH A . 
K 5 HOH 61  464 86  HOH HOH A . 
K 5 HOH 62  465 87  HOH HOH A . 
K 5 HOH 63  466 88  HOH HOH A . 
K 5 HOH 64  467 89  HOH HOH A . 
K 5 HOH 65  468 91  HOH HOH A . 
K 5 HOH 66  469 92  HOH HOH A . 
K 5 HOH 67  470 93  HOH HOH A . 
K 5 HOH 68  471 94  HOH HOH A . 
K 5 HOH 69  472 98  HOH HOH A . 
K 5 HOH 70  473 99  HOH HOH A . 
K 5 HOH 71  474 101 HOH HOH A . 
K 5 HOH 72  475 102 HOH HOH A . 
K 5 HOH 73  476 105 HOH HOH A . 
K 5 HOH 74  477 107 HOH HOH A . 
K 5 HOH 75  478 108 HOH HOH A . 
K 5 HOH 76  479 112 HOH HOH A . 
K 5 HOH 77  480 114 HOH HOH A . 
K 5 HOH 78  481 118 HOH HOH A . 
K 5 HOH 79  482 119 HOH HOH A . 
K 5 HOH 80  483 121 HOH HOH A . 
K 5 HOH 81  484 122 HOH HOH A . 
K 5 HOH 82  485 124 HOH HOH A . 
K 5 HOH 83  486 125 HOH HOH A . 
K 5 HOH 84  487 127 HOH HOH A . 
K 5 HOH 85  488 128 HOH HOH A . 
K 5 HOH 86  489 129 HOH HOH A . 
K 5 HOH 87  490 130 HOH HOH A . 
K 5 HOH 88  491 131 HOH HOH A . 
K 5 HOH 89  492 134 HOH HOH A . 
K 5 HOH 90  493 138 HOH HOH A . 
K 5 HOH 91  494 139 HOH HOH A . 
K 5 HOH 92  495 140 HOH HOH A . 
K 5 HOH 93  496 141 HOH HOH A . 
K 5 HOH 94  497 146 HOH HOH A . 
K 5 HOH 95  498 147 HOH HOH A . 
K 5 HOH 96  499 149 HOH HOH A . 
K 5 HOH 97  500 151 HOH HOH A . 
K 5 HOH 98  501 153 HOH HOH A . 
K 5 HOH 99  502 154 HOH HOH A . 
K 5 HOH 100 503 155 HOH HOH A . 
K 5 HOH 101 504 160 HOH HOH A . 
K 5 HOH 102 505 162 HOH HOH A . 
K 5 HOH 103 506 163 HOH HOH A . 
K 5 HOH 104 507 167 HOH HOH A . 
K 5 HOH 105 508 169 HOH HOH A . 
K 5 HOH 106 509 170 HOH HOH A . 
K 5 HOH 107 510 173 HOH HOH A . 
K 5 HOH 108 511 178 HOH HOH A . 
K 5 HOH 109 512 180 HOH HOH A . 
K 5 HOH 110 513 184 HOH HOH A . 
K 5 HOH 111 514 186 HOH HOH A . 
K 5 HOH 112 515 187 HOH HOH A . 
K 5 HOH 113 516 189 HOH HOH A . 
K 5 HOH 114 517 191 HOH HOH A . 
K 5 HOH 115 518 192 HOH HOH A . 
K 5 HOH 116 519 195 HOH HOH A . 
K 5 HOH 117 520 196 HOH HOH A . 
K 5 HOH 118 521 197 HOH HOH A . 
K 5 HOH 119 522 201 HOH HOH A . 
K 5 HOH 120 523 207 HOH HOH A . 
K 5 HOH 121 524 209 HOH HOH A . 
K 5 HOH 122 525 213 HOH HOH A . 
K 5 HOH 123 526 216 HOH HOH A . 
K 5 HOH 124 527 217 HOH HOH A . 
K 5 HOH 125 528 218 HOH HOH A . 
K 5 HOH 126 529 219 HOH HOH A . 
K 5 HOH 127 530 223 HOH HOH A . 
K 5 HOH 128 531 226 HOH HOH A . 
K 5 HOH 129 532 229 HOH HOH A . 
K 5 HOH 130 533 230 HOH HOH A . 
K 5 HOH 131 534 235 HOH HOH A . 
L 5 HOH 1   503 5   HOH HOH B . 
L 5 HOH 2   504 30  HOH HOH B . 
L 5 HOH 3   505 33  HOH HOH B . 
L 5 HOH 4   506 34  HOH HOH B . 
L 5 HOH 5   507 35  HOH HOH B . 
L 5 HOH 6   508 39  HOH HOH B . 
L 5 HOH 7   509 40  HOH HOH B . 
L 5 HOH 8   510 41  HOH HOH B . 
L 5 HOH 9   511 48  HOH HOH B . 
L 5 HOH 10  512 49  HOH HOH B . 
L 5 HOH 11  513 50  HOH HOH B . 
L 5 HOH 12  514 52  HOH HOH B . 
L 5 HOH 13  515 53  HOH HOH B . 
L 5 HOH 14  516 58  HOH HOH B . 
L 5 HOH 15  517 63  HOH HOH B . 
L 5 HOH 16  518 66  HOH HOH B . 
L 5 HOH 17  519 69  HOH HOH B . 
L 5 HOH 18  520 74  HOH HOH B . 
L 5 HOH 19  521 75  HOH HOH B . 
L 5 HOH 20  522 77  HOH HOH B . 
L 5 HOH 21  523 79  HOH HOH B . 
L 5 HOH 22  524 80  HOH HOH B . 
L 5 HOH 23  525 82  HOH HOH B . 
L 5 HOH 24  526 84  HOH HOH B . 
L 5 HOH 25  527 85  HOH HOH B . 
L 5 HOH 26  528 90  HOH HOH B . 
L 5 HOH 27  529 95  HOH HOH B . 
L 5 HOH 28  530 96  HOH HOH B . 
L 5 HOH 29  531 97  HOH HOH B . 
L 5 HOH 30  532 100 HOH HOH B . 
L 5 HOH 31  533 103 HOH HOH B . 
L 5 HOH 32  534 104 HOH HOH B . 
L 5 HOH 33  535 106 HOH HOH B . 
L 5 HOH 34  536 110 HOH HOH B . 
L 5 HOH 35  537 111 HOH HOH B . 
L 5 HOH 36  538 113 HOH HOH B . 
L 5 HOH 37  539 115 HOH HOH B . 
L 5 HOH 38  540 116 HOH HOH B . 
L 5 HOH 39  541 117 HOH HOH B . 
L 5 HOH 40  542 120 HOH HOH B . 
L 5 HOH 41  543 123 HOH HOH B . 
L 5 HOH 42  544 126 HOH HOH B . 
L 5 HOH 43  545 132 HOH HOH B . 
L 5 HOH 44  546 133 HOH HOH B . 
L 5 HOH 45  547 135 HOH HOH B . 
L 5 HOH 46  548 136 HOH HOH B . 
L 5 HOH 47  549 137 HOH HOH B . 
L 5 HOH 48  550 142 HOH HOH B . 
L 5 HOH 49  551 143 HOH HOH B . 
L 5 HOH 50  552 144 HOH HOH B . 
L 5 HOH 51  553 145 HOH HOH B . 
L 5 HOH 52  554 148 HOH HOH B . 
L 5 HOH 53  555 150 HOH HOH B . 
L 5 HOH 54  556 152 HOH HOH B . 
L 5 HOH 55  557 156 HOH HOH B . 
L 5 HOH 56  558 157 HOH HOH B . 
L 5 HOH 57  559 158 HOH HOH B . 
L 5 HOH 58  560 159 HOH HOH B . 
L 5 HOH 59  561 161 HOH HOH B . 
L 5 HOH 60  562 164 HOH HOH B . 
L 5 HOH 61  563 165 HOH HOH B . 
L 5 HOH 62  564 166 HOH HOH B . 
L 5 HOH 63  565 168 HOH HOH B . 
L 5 HOH 64  566 171 HOH HOH B . 
L 5 HOH 65  567 172 HOH HOH B . 
L 5 HOH 66  568 174 HOH HOH B . 
L 5 HOH 67  569 175 HOH HOH B . 
L 5 HOH 68  570 176 HOH HOH B . 
L 5 HOH 69  571 177 HOH HOH B . 
L 5 HOH 70  572 179 HOH HOH B . 
L 5 HOH 71  573 181 HOH HOH B . 
L 5 HOH 72  574 182 HOH HOH B . 
L 5 HOH 73  575 183 HOH HOH B . 
L 5 HOH 74  576 185 HOH HOH B . 
L 5 HOH 75  577 188 HOH HOH B . 
L 5 HOH 76  578 190 HOH HOH B . 
L 5 HOH 77  579 193 HOH HOH B . 
L 5 HOH 78  580 194 HOH HOH B . 
L 5 HOH 79  581 199 HOH HOH B . 
L 5 HOH 80  582 202 HOH HOH B . 
L 5 HOH 81  583 204 HOH HOH B . 
L 5 HOH 82  584 205 HOH HOH B . 
L 5 HOH 83  585 212 HOH HOH B . 
L 5 HOH 84  586 214 HOH HOH B . 
L 5 HOH 85  587 215 HOH HOH B . 
L 5 HOH 86  588 221 HOH HOH B . 
L 5 HOH 87  589 225 HOH HOH B . 
L 5 HOH 88  590 232 HOH HOH B . 
L 5 HOH 89  591 234 HOH HOH B . 
L 5 HOH 90  592 236 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 58  A MSE 54  ? MET SELENOMETHIONINE 
2 A MSE 117 A MSE 113 ? MET SELENOMETHIONINE 
3 A MSE 121 A MSE 117 ? MET SELENOMETHIONINE 
4 B MSE 58  B MSE 54  ? MET SELENOMETHIONINE 
5 B MSE 117 B MSE 113 ? MET SELENOMETHIONINE 
6 B MSE 121 B MSE 117 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4310  ? 
1 MORE         -76   ? 
1 'SSA (A^2)'  15020 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
4 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
5 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 10.8892 41.3041 61.4519 -0.0941 -0.0057 -0.0273 0.0047  -0.0077 -0.0419 0.4497 1.2875 1.5910 0.3241 0.7853 0.8214 
-0.0099 0.0436  -0.0337 -0.0339 0.0082  0.0097  -0.1420 -0.0209 0.0189  'X-RAY DIFFRACTION' 
2 ? refined 6.4390  14.8969 52.3489 0.0825  -0.0881 -0.0582 -0.0219 -0.1119 0.0028  0.7633 1.8678 1.6773 0.8534 0.8336 1.7691 
0.2190  -0.0041 -0.2149 -0.1041 -0.1284 -0.1067 0.2225  0.3619  -0.0805 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 32 A 189 ALL A 28 A 185 'X-RAY DIFFRACTION' ? 
2 2 B 33 B 189 ALL B 29 B 185 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0005 ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-2000    .        ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-2000    .        ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
HKL-2000    .        ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .        ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             169 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             169 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.353 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.101 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     78 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -102.45 
_pdbx_validate_torsion.psi             -168.60 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    80 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    81 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            59.90 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -3 ? A GLY 1  
2  1 Y 1 A ALA -2 ? A ALA 2  
3  1 Y 1 A MSE -1 ? A MSE 3  
4  1 Y 1 A GLY 0  ? A GLY 4  
5  1 Y 1 A SER 1  ? A SER 5  
6  1 Y 1 A GLY 2  ? A GLY 6  
7  1 Y 1 A GLY 3  ? A GLY 7  
8  1 Y 1 A GLY 4  ? A GLY 8  
9  1 Y 1 A GLY 5  ? A GLY 9  
10 1 Y 1 A GLU 6  ? A GLU 10 
11 1 Y 1 A HIS 7  ? A HIS 11 
12 1 Y 1 A GLN 8  ? A GLN 12 
13 1 Y 1 A HIS 9  ? A HIS 13 
14 1 Y 1 A GLY 10 ? A GLY 14 
15 1 Y 1 A GLU 11 ? A GLU 15 
16 1 Y 1 A GLU 12 ? A GLU 16 
17 1 Y 1 A MSE 13 ? A MSE 17 
18 1 Y 1 A MSE 14 ? A MSE 18 
19 1 Y 1 A ALA 15 ? A ALA 19 
20 1 Y 1 A ALA 16 ? A ALA 20 
21 1 Y 1 A VAL 17 ? A VAL 21 
22 1 Y 1 A PRO 18 ? A PRO 22 
23 1 Y 1 A ALA 19 ? A ALA 23 
24 1 Y 1 A PRO 20 ? A PRO 24 
25 1 Y 1 A ASP 21 ? A ASP 25 
26 1 Y 1 A ALA 22 ? A ALA 26 
27 1 Y 1 A GLU 23 ? A GLU 27 
28 1 Y 1 A GLY 24 ? A GLY 28 
29 1 Y 1 A ALA 25 ? A ALA 29 
30 1 Y 1 A ALA 26 ? A ALA 30 
31 1 Y 1 A GLY 27 ? A GLY 31 
32 1 Y 1 B GLY -3 ? B GLY 1  
33 1 Y 1 B ALA -2 ? B ALA 2  
34 1 Y 1 B MSE -1 ? B MSE 3  
35 1 Y 1 B GLY 0  ? B GLY 4  
36 1 Y 1 B SER 1  ? B SER 5  
37 1 Y 1 B GLY 2  ? B GLY 6  
38 1 Y 1 B GLY 3  ? B GLY 7  
39 1 Y 1 B GLY 4  ? B GLY 8  
40 1 Y 1 B GLY 5  ? B GLY 9  
41 1 Y 1 B GLU 6  ? B GLU 10 
42 1 Y 1 B HIS 7  ? B HIS 11 
43 1 Y 1 B GLN 8  ? B GLN 12 
44 1 Y 1 B HIS 9  ? B HIS 13 
45 1 Y 1 B GLY 10 ? B GLY 14 
46 1 Y 1 B GLU 11 ? B GLU 15 
47 1 Y 1 B GLU 12 ? B GLU 16 
48 1 Y 1 B MSE 13 ? B MSE 17 
49 1 Y 1 B MSE 14 ? B MSE 18 
50 1 Y 1 B ALA 15 ? B ALA 19 
51 1 Y 1 B ALA 16 ? B ALA 20 
52 1 Y 1 B VAL 17 ? B VAL 21 
53 1 Y 1 B PRO 18 ? B PRO 22 
54 1 Y 1 B ALA 19 ? B ALA 23 
55 1 Y 1 B PRO 20 ? B PRO 24 
56 1 Y 1 B ASP 21 ? B ASP 25 
57 1 Y 1 B ALA 22 ? B ALA 26 
58 1 Y 1 B GLU 23 ? B GLU 27 
59 1 Y 1 B GLY 24 ? B GLY 28 
60 1 Y 1 B ALA 25 ? B ALA 29 
61 1 Y 1 B ALA 26 ? B ALA 30 
62 1 Y 1 B GLY 27 ? B GLY 31 
63 1 Y 1 B PHE 28 ? B PHE 32 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 1,2-ETHANEDIOL EDO 
4 'SULFATE ION'  SO4 
5 water          HOH 
#