data_2O6E
# 
_entry.id   2O6E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2O6E         pdb_00002o6e 10.2210/pdb2o6e/pdb 
RCSB  RCSB040744   ?            ?                   
WWPDB D_1000040744 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6C . unspecified 
PDB 2O6D . unspecified 
PDB 2O6F . unspecified 
# 
_pdbx_database_status.entry_id                        2O6E 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Machius, M.'     1 
'Brautigam, C.A.' 2 
'Deka, R.K.'      3 
'Tomchick, D.R.'  4 
'Lumpkins, S.B.'  5 
'Norgard, M.V.'   6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                5944 
_citation.page_last                 5958 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17192261 
_citation.pdbx_database_id_DOI      10.1074/jbc.M610215200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Deka, R.K.'      1 ? 
primary 'Brautigam, C.A.' 2 ? 
primary 'Tomson, F.L.'    3 ? 
primary 'Lumpkins, S.B.'  4 ? 
primary 'Tomchick, D.R.'  5 ? 
primary 'Machius, M.'     6 ? 
primary 'Norgard, M.V.'   7 ? 
# 
_cell.length_a           34.451 
_cell.length_b           65.921 
_cell.length_c           151.744 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2O6E 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2O6E 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '34 kDa membrane antigen' 20443.449 2   ? 'V16G, F17A, S18M, A19G, C20S' ? ? 
2 non-polymer syn 'ZINC ION'                65.409    8   ? ?                              ? ? 
3 non-polymer syn 'SULFATE ION'             96.063    2   ? ?                              ? ? 
4 non-polymer syn 'CHLORIDE ION'            35.453    2   ? ?                              ? ? 
5 non-polymer syn 1,2-ETHANEDIOL            62.068    2   ? ?                              ? ? 
6 water       nat water                     18.015    202 ? ?                              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pathogen-specific membrane antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGSGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   GLY n 
1 8   GLY n 
1 9   GLY n 
1 10  GLU n 
1 11  HIS n 
1 12  GLN n 
1 13  HIS n 
1 14  GLY n 
1 15  GLU n 
1 16  GLU n 
1 17  MET n 
1 18  MET n 
1 19  ALA n 
1 20  ALA n 
1 21  VAL n 
1 22  PRO n 
1 23  ALA n 
1 24  PRO n 
1 25  ASP n 
1 26  ALA n 
1 27  GLU n 
1 28  GLY n 
1 29  ALA n 
1 30  ALA n 
1 31  GLY n 
1 32  PHE n 
1 33  ASP n 
1 34  GLU n 
1 35  PHE n 
1 36  PRO n 
1 37  ILE n 
1 38  GLY n 
1 39  GLU n 
1 40  ASP n 
1 41  ARG n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  PRO n 
1 46  LEU n 
1 47  HIS n 
1 48  VAL n 
1 49  GLY n 
1 50  GLY n 
1 51  VAL n 
1 52  TYR n 
1 53  PHE n 
1 54  GLN n 
1 55  PRO n 
1 56  VAL n 
1 57  GLU n 
1 58  MET n 
1 59  HIS n 
1 60  PRO n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  GLN n 
1 66  PRO n 
1 67  SER n 
1 68  LYS n 
1 69  GLU n 
1 70  GLU n 
1 71  ALA n 
1 72  ASP n 
1 73  CYS n 
1 74  HIS n 
1 75  ILE n 
1 76  GLU n 
1 77  ALA n 
1 78  ASP n 
1 79  ILE n 
1 80  HIS n 
1 81  ALA n 
1 82  ASN n 
1 83  GLU n 
1 84  ALA n 
1 85  GLY n 
1 86  LYS n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  TYR n 
1 91  GLY n 
1 92  VAL n 
1 93  GLY n 
1 94  ASP n 
1 95  PHE n 
1 96  VAL n 
1 97  PRO n 
1 98  TYR n 
1 99  LEU n 
1 100 ARG n 
1 101 VAL n 
1 102 VAL n 
1 103 ALA n 
1 104 PHE n 
1 105 LEU n 
1 106 GLN n 
1 107 LYS n 
1 108 HIS n 
1 109 GLY n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 GLN n 
1 115 LYS n 
1 116 VAL n 
1 117 MET n 
1 118 PHE n 
1 119 ALA n 
1 120 PRO n 
1 121 MET n 
1 122 ASN n 
1 123 ALA n 
1 124 GLY n 
1 125 ASP n 
1 126 GLY n 
1 127 PRO n 
1 128 HIS n 
1 129 TYR n 
1 130 GLY n 
1 131 ALA n 
1 132 ASN n 
1 133 VAL n 
1 134 LYS n 
1 135 PHE n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
1 141 THR n 
1 142 TYR n 
1 143 LYS n 
1 144 VAL n 
1 145 ARG n 
1 146 PHE n 
1 147 GLU n 
1 148 ILE n 
1 149 ALA n 
1 150 ALA n 
1 151 PRO n 
1 152 SER n 
1 153 HIS n 
1 154 ASP n 
1 155 GLU n 
1 156 TYR n 
1 157 SER n 
1 158 LEU n 
1 159 HIS n 
1 160 ILE n 
1 161 ASP n 
1 162 GLU n 
1 163 GLN n 
1 164 THR n 
1 165 GLY n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 ARG n 
1 170 PHE n 
1 171 TRP n 
1 172 SER n 
1 173 GLU n 
1 174 PRO n 
1 175 LEU n 
1 176 VAL n 
1 177 ALA n 
1 178 GLU n 
1 179 TRP n 
1 180 ASP n 
1 181 ASP n 
1 182 PHE n 
1 183 GLU n 
1 184 TRP n 
1 185 LYS n 
1 186 GLY n 
1 187 PRO n 
1 188 GLN n 
1 189 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Treponema 
_entity_src_gen.pdbx_gene_src_gene                 tpd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Treponema pallidum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     160 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XL1-Blue 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pProExHTa 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TA34_TREPA 
_struct_ref.pdbx_db_accession          P19478 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VFSACGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O6E A 1 ? 189 ? P19478 16 ? 204 ? -3 185 
2 1 2O6E B 1 ? 189 ? P19478 16 ? 204 ? -3 185 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O6E GLY A 1 ? UNP P19478 VAL 16 'engineered mutation' -3 1  
1 2O6E ALA A 2 ? UNP P19478 PHE 17 'engineered mutation' -2 2  
1 2O6E MET A 3 ? UNP P19478 SER 18 'engineered mutation' -1 3  
1 2O6E GLY A 4 ? UNP P19478 ALA 19 'engineered mutation' 0  4  
1 2O6E SER A 5 ? UNP P19478 CYS 20 'engineered mutation' 1  5  
2 2O6E GLY B 1 ? UNP P19478 VAL 16 'engineered mutation' -3 6  
2 2O6E ALA B 2 ? UNP P19478 PHE 17 'engineered mutation' -2 7  
2 2O6E MET B 3 ? UNP P19478 SER 18 'engineered mutation' -1 8  
2 2O6E GLY B 4 ? UNP P19478 ALA 19 'engineered mutation' 0  9  
2 2O6E SER B 5 ? UNP P19478 CYS 20 'engineered mutation' 1  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                 'Zn 2'           65.409  
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O6E 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.11 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.59 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '2.4 M Ammonium sulfate, 0.1 M Bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2006-07-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double-crystal Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.28230 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.28230 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
# 
_reflns.entry_id                     2O6E 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            1.87 
_reflns.d_resolution_low             33.6 
_reflns.number_all                   29534 
_reflns.number_obs                   29534 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.106 
_reflns.pdbx_netI_over_sigmaI        19.5 
_reflns.B_iso_Wilson_estimate        19.4 
_reflns.pdbx_redundancy              7.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.87 
_reflns_shell.d_res_low              1.90 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   98.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    1.8 
_reflns_shell.pdbx_Rsym_value        0.745 
_reflns_shell.pdbx_redundancy        5.5 
_reflns_shell.number_unique_all      1449 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O6E 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             33.600 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.640 
_refine.ls_number_reflns_obs                     28101 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.192 
_refine.ls_R_factor_R_work                       0.19 
_refine.ls_R_factor_R_free                       0.233 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1413 
_refine.B_iso_mean                               23.776 
_refine.aniso_B[1][1]                            1.020 
_refine.aniso_B[2][2]                            -0.450 
_refine.aniso_B[3][3]                            -0.560 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.929 
_refine.pdbx_overall_ESU_R                       0.156 
_refine.pdbx_overall_ESU_R_Free                  0.146 
_refine.overall_SU_ML                            0.106 
_refine.overall_SU_B                             6.870 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'native protein' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2O6E 
_refine_analyze.Luzzati_coordinate_error_obs    0.269 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2485 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             202 
_refine_hist.number_atoms_total               2715 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        33.600 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2675 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3648 1.962  1.935  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   332  6.802  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   141  34.758 24.894 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   390  16.164 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   8    19.528 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           348  0.145  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2501 0.013  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1138 0.194  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1744 0.323  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    201  0.161  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      1    0.075  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   41   0.199  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 9    0.178  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1660 1.036  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2609 1.564  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1169 2.446  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1039 3.772  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.9 
_refine_ls_shell.d_res_low                        1.948 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.780 
_refine_ls_shell.number_reflns_R_work             1917 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.228 
_refine_ls_shell.R_factor_R_free                  0.25 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             112 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2029 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O6E 
_struct.title                     'Structure of native rTp34 from Treponema pallidum from zinc-soaked crystals' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O6E 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN, PROTEIN BINDING' 
_struct_keywords.text            'Ig-fold, syphilis, metal-ion binding, dimer, MEMBRANE PROTEIN, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 5 ? 
M N N 2 ? 
N N N 2 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 6 ? 
R N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 83 ? GLY A 89 ? GLU A 79 GLY A 85 5 ? 7 
HELX_P HELX_P2 2 GLU B 83 ? GLY B 89 ? GLU B 79 GLY B 85 5 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A GLU 34  OE2 ? ? ? 1_555 E ZN  .   ZN  ? ? A GLU 30  A ZN  305 1_555 ? ? ? ? ? ? ? 2.665 ? ? 
metalc2  metalc ? ? A HIS 59  NE2 ? ? ? 1_555 F ZN  .   ZN  ? ? A HIS 55  A ZN  306 1_555 ? ? ? ? ? ? ? 2.381 ? ? 
metalc3  metalc ? ? A HIS 74  NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 70  A ZN  301 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
metalc4  metalc ? ? A GLU 76  OE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A GLU 72  A ZN  301 1_555 ? ? ? ? ? ? ? 2.073 ? ? 
metalc5  metalc ? ? A ASP 78  OD1 B ? ? 1_555 D ZN  .   ZN  ? ? A ASP 74  A ZN  304 1_555 ? ? ? ? ? ? ? 2.212 ? ? 
metalc6  metalc ? ? A HIS 80  ND1 ? ? ? 1_555 D ZN  .   ZN  ? ? A HIS 76  A ZN  304 1_555 ? ? ? ? ? ? ? 2.491 ? ? 
metalc7  metalc ? ? A HIS 108 ND1 ? ? ? 1_555 G ZN  .   ZN  ? ? A HIS 104 A ZN  307 1_555 ? ? ? ? ? ? ? 2.297 ? ? 
metalc8  metalc ? ? A ASP 125 OD2 ? ? ? 1_555 E ZN  .   ZN  ? ? A ASP 121 A ZN  305 1_555 ? ? ? ? ? ? ? 2.663 ? ? 
metalc9  metalc ? ? A HIS 128 NE2 ? ? ? 1_555 C ZN  .   ZN  ? ? A HIS 124 A ZN  301 1_555 ? ? ? ? ? ? ? 2.139 ? ? 
metalc10 metalc ? ? A HIS 159 NE2 ? ? ? 1_555 M ZN  .   ZN  ? ? A HIS 155 B ZN  302 1_555 ? ? ? ? ? ? ? 2.078 ? ? 
metalc11 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 B HIS 159 NE2 ? ? A ZN  301 B HIS 155 1_555 ? ? ? ? ? ? ? 1.986 ? ? 
metalc12 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 Q HOH .   O   ? ? A ZN  305 A HOH 572 1_555 ? ? ? ? ? ? ? 2.737 ? ? 
metalc13 metalc ? ? F ZN  .   ZN  ? ? ? 1_555 B HIS 153 NE2 ? ? A ZN  306 B HIS 149 1_555 ? ? ? ? ? ? ? 2.718 ? ? 
metalc14 metalc ? ? H ZN  .   ZN  ? ? ? 1_555 Q HOH .   O   ? ? A ZN  308 A HOH 608 1_655 ? ? ? ? ? ? ? 2.363 ? ? 
metalc15 metalc ? ? B HIS 59  NE2 ? ? ? 1_555 N ZN  .   ZN  ? ? B HIS 55  B ZN  303 1_555 ? ? ? ? ? ? ? 2.210 ? ? 
metalc16 metalc ? ? B HIS 74  NE2 ? ? ? 1_555 M ZN  .   ZN  ? ? B HIS 70  B ZN  302 1_555 ? ? ? ? ? ? ? 2.185 ? ? 
metalc17 metalc ? ? B GLU 76  OE2 ? ? ? 1_555 M ZN  .   ZN  ? ? B GLU 72  B ZN  302 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
metalc18 metalc ? ? B HIS 128 NE2 ? ? ? 1_555 M ZN  .   ZN  ? ? B HIS 124 B ZN  302 1_555 ? ? ? ? ? ? ? 2.109 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 59 A . ? HIS 55 A PRO 60 A ? PRO 56 A 1 -11.46 
2 HIS 59 B . ? HIS 55 B PRO 60 B ? PRO 56 B 1 -6.72  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 7 ? 
C ? 4 ? 
D ? 3 ? 
E ? 7 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
A 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
A 3 ARG A 41  ? VAL A 43  ? ARG A 37  VAL A 39  
B 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
B 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
B 3 CYS A 73  ? ALA A 81  ? CYS A 69  ALA A 77  
B 4 GLY A 126 ? VAL A 133 ? GLY A 122 VAL A 129 
B 5 ALA A 119 ? ALA A 123 ? ALA A 115 ALA A 119 
B 6 SER B 157 ? HIS B 159 ? SER B 153 HIS B 155 
B 7 MET A 58  ? HIS A 59  ? MET A 54  HIS A 55  
C 1 GLN A 114 ? MET A 117 ? GLN A 110 MET A 113 
C 2 ARG A 100 ? LYS A 107 ? ARG A 96  LYS A 103 
C 3 GLY A 140 ? ALA A 149 ? GLY A 136 ALA A 145 
C 4 LEU A 175 ? TRP A 184 ? LEU A 171 TRP A 180 
D 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
D 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
D 3 ARG B 41  ? VAL B 43  ? ARG B 37  VAL B 39  
E 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
E 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
E 3 CYS B 73  ? ALA B 81  ? CYS B 69  ALA B 77  
E 4 GLY B 126 ? VAL B 133 ? GLY B 122 VAL B 129 
E 5 ALA B 119 ? ALA B 123 ? ALA B 115 ALA B 119 
E 6 SER A 157 ? HIS A 159 ? SER A 153 HIS A 155 
E 7 MET B 58  ? HIS B 59  ? MET B 54  HIS B 55  
F 1 GLN B 114 ? MET B 117 ? GLN B 110 MET B 113 
F 2 ARG B 100 ? LYS B 107 ? ARG B 96  LYS B 103 
F 3 GLY B 140 ? ALA B 149 ? GLY B 136 ALA B 145 
F 4 LEU B 175 ? TRP B 184 ? LEU B 171 TRP B 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
A 2 3 O VAL A 48  ? O VAL A 44  N ARG A 41  ? N ARG A 37  
B 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
B 2 3 N HIS A 47  ? N HIS A 43  O HIS A 80  ? O HIS A 76  
B 3 4 N ALA A 77  ? N ALA A 73  O TYR A 129 ? O TYR A 125 
B 4 5 O GLY A 130 ? O GLY A 126 N ALA A 119 ? N ALA A 115 
B 5 6 N ASN A 122 ? N ASN A 118 O HIS B 159 ? O HIS B 155 
B 6 7 O LEU B 158 ? O LEU B 154 N HIS A 59  ? N HIS A 55  
C 1 2 O VAL A 116 ? O VAL A 112 N ALA A 103 ? N ALA A 99  
C 2 3 N GLN A 106 ? N GLN A 102 O LYS A 143 ? O LYS A 139 
C 3 4 N ILE A 148 ? N ILE A 144 O LEU A 175 ? O LEU A 171 
D 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
D 2 3 O VAL B 48  ? O VAL B 44  N ARG B 41  ? N ARG B 37  
E 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
E 2 3 N HIS B 47  ? N HIS B 43  O HIS B 80  ? O HIS B 76  
E 3 4 N CYS B 73  ? N CYS B 69  O VAL B 133 ? O VAL B 129 
E 4 5 O GLY B 130 ? O GLY B 126 N ALA B 119 ? N ALA B 115 
E 5 6 O ASN B 122 ? O ASN B 118 N HIS A 159 ? N HIS A 155 
E 6 7 N LEU A 158 ? N LEU A 154 O HIS B 59  ? O HIS B 55  
F 1 2 O VAL B 116 ? O VAL B 112 N ALA B 103 ? N ALA B 99  
F 2 3 N VAL B 102 ? N VAL B 98  O GLU B 147 ? O GLU B 143 
F 3 4 N VAL B 144 ? N VAL B 140 O TRP B 179 ? O TRP B 175 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  301 ? 5 'BINDING SITE FOR RESIDUE ZN A 301'  
AC2 Software B ZN  302 ? 5 'BINDING SITE FOR RESIDUE ZN B 302'  
AC3 Software B ZN  303 ? 3 'BINDING SITE FOR RESIDUE ZN B 303'  
AC4 Software A ZN  304 ? 2 'BINDING SITE FOR RESIDUE ZN A 304'  
AC5 Software A ZN  305 ? 5 'BINDING SITE FOR RESIDUE ZN A 305'  
AC6 Software A ZN  306 ? 2 'BINDING SITE FOR RESIDUE ZN A 306'  
AC7 Software A ZN  307 ? 1 'BINDING SITE FOR RESIDUE ZN A 307'  
AC8 Software A ZN  308 ? 3 'BINDING SITE FOR RESIDUE ZN A 308'  
AC9 Software A SO4 501 ? 6 'BINDING SITE FOR RESIDUE SO4 A 501' 
BC1 Software B SO4 502 ? 5 'BINDING SITE FOR RESIDUE SO4 B 502' 
BC2 Software A CL  311 ? 1 'BINDING SITE FOR RESIDUE CL A 311'  
BC3 Software B CL  312 ? 2 'BINDING SITE FOR RESIDUE CL B 312'  
BC4 Software A EDO 401 ? 8 'BINDING SITE FOR RESIDUE EDO A 401' 
BC5 Software A EDO 402 ? 5 'BINDING SITE FOR RESIDUE EDO A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 74  ? HIS A 70  . ? 1_555 ? 
2  AC1 5 GLU A 76  ? GLU A 72  . ? 1_555 ? 
3  AC1 5 MET A 121 ? MET A 117 . ? 1_555 ? 
4  AC1 5 HIS A 128 ? HIS A 124 . ? 1_555 ? 
5  AC1 5 HIS B 159 ? HIS B 155 . ? 1_555 ? 
6  AC2 5 HIS A 159 ? HIS A 155 . ? 1_555 ? 
7  AC2 5 HIS B 74  ? HIS B 70  . ? 1_555 ? 
8  AC2 5 GLU B 76  ? GLU B 72  . ? 1_555 ? 
9  AC2 5 MET B 121 ? MET B 117 . ? 1_555 ? 
10 AC2 5 HIS B 128 ? HIS B 124 . ? 1_555 ? 
11 AC3 3 HIS A 153 ? HIS A 149 . ? 1_555 ? 
12 AC3 3 HIS B 59  ? HIS B 55  . ? 1_555 ? 
13 AC3 3 LYS B 185 ? LYS B 181 . ? 3_555 ? 
14 AC4 2 ASP A 78  ? ASP A 74  . ? 1_555 ? 
15 AC4 2 HIS A 80  ? HIS A 76  . ? 1_555 ? 
16 AC5 5 GLU A 34  ? GLU A 30  . ? 1_555 ? 
17 AC5 5 GLU A 76  ? GLU A 72  . ? 1_555 ? 
18 AC5 5 ASP A 78  ? ASP A 74  . ? 1_555 ? 
19 AC5 5 ASP A 125 ? ASP A 121 . ? 1_555 ? 
20 AC5 5 HOH Q .   ? HOH A 572 . ? 1_555 ? 
21 AC6 2 HIS A 59  ? HIS A 55  . ? 1_555 ? 
22 AC6 2 HIS B 153 ? HIS B 149 . ? 1_555 ? 
23 AC7 1 HIS A 108 ? HIS A 104 . ? 1_555 ? 
24 AC8 3 HIS A 47  ? HIS A 43  . ? 1_655 ? 
25 AC8 3 HIS A 80  ? HIS A 76  . ? 1_655 ? 
26 AC8 3 HOH Q .   ? HOH A 608 . ? 1_655 ? 
27 AC9 6 ARG A 169 ? ARG A 165 . ? 1_555 ? 
28 AC9 6 TRP A 171 ? TRP A 167 . ? 1_555 ? 
29 AC9 6 SER A 172 ? SER A 168 . ? 1_555 ? 
30 AC9 6 GLU A 173 ? GLU A 169 . ? 1_555 ? 
31 AC9 6 HOH Q .   ? HOH A 582 . ? 1_555 ? 
32 AC9 6 HOH R .   ? HOH B 512 . ? 3_555 ? 
33 BC1 5 GLY B 38  ? GLY B 34  . ? 1_555 ? 
34 BC1 5 GLU B 39  ? GLU B 35  . ? 1_555 ? 
35 BC1 5 ARG B 41  ? ARG B 37  . ? 1_555 ? 
36 BC1 5 TRP B 179 ? TRP B 175 . ? 1_555 ? 
37 BC1 5 HOH R .   ? HOH B 545 . ? 1_555 ? 
38 BC2 1 SER A 152 ? SER A 148 . ? 1_555 ? 
39 BC3 2 GLN B 106 ? GLN B 102 . ? 1_555 ? 
40 BC3 2 HOH R .   ? HOH B 562 . ? 1_555 ? 
41 BC4 8 PHE A 35  ? PHE A 31  . ? 4_566 ? 
42 BC4 8 PRO A 36  ? PRO A 32  . ? 4_566 ? 
43 BC4 8 TYR A 52  ? TYR A 48  . ? 4_566 ? 
44 BC4 8 ASP A 72  ? ASP A 68  . ? 1_555 ? 
45 BC4 8 LYS A 134 ? LYS A 130 . ? 1_555 ? 
46 BC4 8 LYS A 185 ? LYS A 181 . ? 4_566 ? 
47 BC4 8 GLN A 188 ? GLN A 184 . ? 4_566 ? 
48 BC4 8 HOH Q .   ? HOH A 506 . ? 1_555 ? 
49 BC5 5 ARG A 41  ? ARG A 37  . ? 1_555 ? 
50 BC5 5 TRP A 179 ? TRP A 175 . ? 1_555 ? 
51 BC5 5 ASP A 180 ? ASP A 176 . ? 1_555 ? 
52 BC5 5 HOH Q .   ? HOH A 520 . ? 1_555 ? 
53 BC5 5 HOH Q .   ? HOH A 571 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2O6E 
_atom_sites.fract_transf_matrix[1][1]   0.029027 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015170 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006590 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 32  ? 8.107   34.805 79.323 1.00 35.19  ? 28  PHE A N   1 
ATOM   2    C  CA  . PHE A 1 32  ? 9.128   35.873 79.512 1.00 34.93  ? 28  PHE A CA  1 
ATOM   3    C  C   . PHE A 1 32  ? 8.487   37.233 79.220 1.00 34.32  ? 28  PHE A C   1 
ATOM   4    O  O   . PHE A 1 32  ? 7.417   37.307 78.568 1.00 34.44  ? 28  PHE A O   1 
ATOM   5    C  CB  . PHE A 1 32  ? 10.372  35.629 78.620 1.00 34.87  ? 28  PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 32  ? 10.046  35.146 77.204 1.00 34.97  ? 28  PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 32  ? 9.737   33.809 76.959 1.00 36.73  ? 28  PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 32  ? 10.083  36.030 76.123 1.00 34.38  ? 28  PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 32  ? 9.434   33.343 75.654 1.00 37.27  ? 28  PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 32  ? 9.794   35.582 74.822 1.00 35.63  ? 28  PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 32  ? 9.472   34.227 74.589 1.00 36.27  ? 28  PHE A CZ  1 
ATOM   12   N  N   . ASP A 1 33  ? 9.135   38.284 79.721 1.00 33.00  ? 29  ASP A N   1 
ATOM   13   C  CA  . ASP A 1 33  ? 8.678   39.667 79.549 1.00 31.55  ? 29  ASP A CA  1 
ATOM   14   C  C   . ASP A 1 33  ? 9.035   40.175 78.151 1.00 30.01  ? 29  ASP A C   1 
ATOM   15   O  O   . ASP A 1 33  ? 10.196  40.117 77.769 1.00 29.90  ? 29  ASP A O   1 
ATOM   16   C  CB  . ASP A 1 33  ? 9.411   40.594 80.543 1.00 31.95  ? 29  ASP A CB  1 
ATOM   17   C  CG  . ASP A 1 33  ? 8.999   40.407 81.998 1.00 32.14  ? 29  ASP A CG  1 
ATOM   18   O  OD1 . ASP A 1 33  ? 8.143   39.572 82.334 1.00 32.39  ? 29  ASP A OD1 1 
ATOM   19   O  OD2 . ASP A 1 33  ? 9.551   41.156 82.821 1.00 36.71  ? 29  ASP A OD2 1 
ATOM   20   N  N   . GLU A 1 34  ? 8.074   40.709 77.404 1.00 26.64  ? 30  GLU A N   1 
ATOM   21   C  CA  . GLU A 1 34  ? 8.363   41.273 76.083 1.00 25.81  ? 30  GLU A CA  1 
ATOM   22   C  C   . GLU A 1 34  ? 7.964   42.746 76.143 1.00 23.16  ? 30  GLU A C   1 
ATOM   23   O  O   . GLU A 1 34  ? 6.960   43.085 76.759 1.00 22.69  ? 30  GLU A O   1 
ATOM   24   C  CB  . GLU A 1 34  ? 7.587   40.574 74.940 1.00 25.68  ? 30  GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 34  ? 8.045   39.101 74.673 1.00 29.12  ? 30  GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 34  ? 7.308   38.384 73.541 1.00 30.77  ? 30  GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 34  ? 6.413   38.981 72.882 1.00 36.96  ? 30  GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 34  ? 7.607   37.181 73.332 1.00 37.35  ? 30  GLU A OE2 1 
ATOM   29   N  N   . PHE A 1 35  ? 8.730   43.608 75.491 1.00 20.74  ? 31  PHE A N   1 
ATOM   30   C  CA  . PHE A 1 35  ? 8.422   45.038 75.481 1.00 19.17  ? 31  PHE A CA  1 
ATOM   31   C  C   . PHE A 1 35  ? 8.052   45.453 74.050 1.00 19.33  ? 31  PHE A C   1 
ATOM   32   O  O   . PHE A 1 35  ? 8.583   44.902 73.087 1.00 20.25  ? 31  PHE A O   1 
ATOM   33   C  CB  . PHE A 1 35  ? 9.636   45.790 76.015 1.00 18.84  ? 31  PHE A CB  1 
ATOM   34   C  CG  . PHE A 1 35  ? 9.948   45.451 77.448 1.00 18.32  ? 31  PHE A CG  1 
ATOM   35   C  CD1 . PHE A 1 35  ? 9.291   46.113 78.496 1.00 16.90  ? 31  PHE A CD1 1 
ATOM   36   C  CD2 . PHE A 1 35  ? 10.858  44.438 77.755 1.00 18.43  ? 31  PHE A CD2 1 
ATOM   37   C  CE1 . PHE A 1 35  ? 9.565   45.775 79.818 1.00 16.92  ? 31  PHE A CE1 1 
ATOM   38   C  CE2 . PHE A 1 35  ? 11.135  44.088 79.098 1.00 18.88  ? 31  PHE A CE2 1 
ATOM   39   C  CZ  . PHE A 1 35  ? 10.489  44.767 80.113 1.00 17.05  ? 31  PHE A CZ  1 
ATOM   40   N  N   . PRO A 1 36  ? 7.092   46.375 73.888 1.00 19.26  ? 32  PRO A N   1 
ATOM   41   C  CA  . PRO A 1 36  ? 6.681   46.651 72.508 1.00 19.80  ? 32  PRO A CA  1 
ATOM   42   C  C   . PRO A 1 36  ? 7.639   47.598 71.775 1.00 20.85  ? 32  PRO A C   1 
ATOM   43   O  O   . PRO A 1 36  ? 8.245   48.485 72.406 1.00 19.87  ? 32  PRO A O   1 
ATOM   44   C  CB  . PRO A 1 36  ? 5.349   47.369 72.694 1.00 19.73  ? 32  PRO A CB  1 
ATOM   45   C  CG  . PRO A 1 36  ? 5.573   48.171 74.021 1.00 18.78  ? 32  PRO A CG  1 
ATOM   46   C  CD  . PRO A 1 36  ? 6.378   47.210 74.880 1.00 18.35  ? 32  PRO A CD  1 
ATOM   47   N  N   . ILE A 1 37  ? 7.741   47.446 70.445 1.00 21.16  ? 33  ILE A N   1 
ATOM   48   C  CA  . ILE A 1 37  ? 8.557   48.384 69.656 1.00 21.89  ? 33  ILE A CA  1 
ATOM   49   C  C   . ILE A 1 37  ? 7.601   49.562 69.308 1.00 21.14  ? 33  ILE A C   1 
ATOM   50   O  O   . ILE A 1 37  ? 7.982   50.745 69.352 1.00 22.40  ? 33  ILE A O   1 
ATOM   51   C  CB  . ILE A 1 37  ? 9.183   47.738 68.410 1.00 22.55  ? 33  ILE A CB  1 
ATOM   52   C  CG1 . ILE A 1 37  ? 10.409  46.939 68.863 1.00 24.72  ? 33  ILE A CG1 1 
ATOM   53   C  CG2 . ILE A 1 37  ? 9.654   48.858 67.402 1.00 24.68  ? 33  ILE A CG2 1 
ATOM   54   C  CD1 . ILE A 1 37  ? 10.966  46.080 67.837 1.00 31.96  ? 33  ILE A CD1 1 
ATOM   55   N  N   . GLY A 1 38  ? 6.359   49.230 69.009 1.00 20.51  ? 34  GLY A N   1 
ATOM   56   C  CA  . GLY A 1 38  ? 5.300   50.215 68.687 1.00 19.48  ? 34  GLY A CA  1 
ATOM   57   C  C   . GLY A 1 38  ? 4.033   49.492 68.323 1.00 19.17  ? 34  GLY A C   1 
ATOM   58   O  O   . GLY A 1 38  ? 3.933   48.298 68.533 1.00 18.09  ? 34  GLY A O   1 
ATOM   59   N  N   . GLU A 1 39  ? 3.057   50.206 67.753 1.00 19.04  ? 35  GLU A N   1 
ATOM   60   C  CA  . GLU A 1 39  ? 1.801   49.605 67.361 1.00 20.01  ? 35  GLU A CA  1 
ATOM   61   C  C   . GLU A 1 39  ? 1.953   48.551 66.257 1.00 20.77  ? 35  GLU A C   1 
ATOM   62   O  O   . GLU A 1 39  ? 2.760   48.730 65.338 1.00 19.39  ? 35  GLU A O   1 
ATOM   63   C  CB  . GLU A 1 39  ? 0.861   50.715 66.872 1.00 19.79  ? 35  GLU A CB  1 
ATOM   64   C  CG  . GLU A 1 39  ? -0.515  50.455 67.224 1.00 21.81  ? 35  GLU A CG  1 
ATOM   65   C  CD  . GLU A 1 39  ? -1.477  51.536 66.749 1.00 23.52  ? 35  GLU A CD  1 
ATOM   66   O  OE1 . GLU A 1 39  ? -1.064  52.636 66.279 1.00 23.31  ? 35  GLU A OE1 1 
ATOM   67   O  OE2 . GLU A 1 39  ? -2.656  51.236 66.852 1.00 22.43  ? 35  GLU A OE2 1 
ATOM   68   N  N   . ASP A 1 40  ? 1.190   47.450 66.345 1.00 21.00  ? 36  ASP A N   1 
ATOM   69   C  CA  . ASP A 1 40  ? 1.248   46.419 65.333 1.00 21.48  ? 36  ASP A CA  1 
ATOM   70   C  C   . ASP A 1 40  ? 0.827   47.069 64.023 1.00 21.10  ? 36  ASP A C   1 
ATOM   71   O  O   . ASP A 1 40  ? 0.045   48.025 64.020 1.00 20.66  ? 36  ASP A O   1 
ATOM   72   C  CB  . ASP A 1 40  ? 0.262   45.293 65.587 1.00 22.98  ? 36  ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 40  ? 0.653   44.417 66.743 1.00 27.34  ? 36  ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 40  ? 1.725   44.623 67.319 1.00 27.29  ? 36  ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 40  ? -0.155  43.517 67.080 1.00 35.59  ? 36  ASP A OD2 1 
ATOM   76   N  N   . ARG A 1 41  ? 1.355   46.557 62.925 1.00 20.71  ? 37  ARG A N   1 
ATOM   77   C  CA  . ARG A 1 41  ? 1.043   47.074 61.601 1.00 20.87  ? 37  ARG A CA  1 
ATOM   78   C  C   . ARG A 1 41  ? 0.391   46.032 60.722 1.00 22.22  ? 37  ARG A C   1 
ATOM   79   O  O   . ARG A 1 41  ? 0.701   44.862 60.826 1.00 22.62  ? 37  ARG A O   1 
ATOM   80   C  CB  . ARG A 1 41  ? 2.344   47.507 60.874 1.00 20.46  ? 37  ARG A CB  1 
ATOM   81   C  CG  . ARG A 1 41  ? 3.268   48.479 61.606 1.00 18.39  ? 37  ARG A CG  1 
ATOM   82   C  CD  . ARG A 1 41  ? 2.527   49.760 61.967 1.00 18.68  ? 37  ARG A CD  1 
ATOM   83   N  NE  . ARG A 1 41  ? 3.428   50.865 62.320 1.00 18.06  ? 37  ARG A NE  1 
ATOM   84   C  CZ  . ARG A 1 41  ? 3.054   51.915 63.045 1.00 18.79  ? 37  ARG A CZ  1 
ATOM   85   N  NH1 . ARG A 1 41  ? 1.841   51.965 63.577 1.00 18.04  ? 37  ARG A NH1 1 
ATOM   86   N  NH2 . ARG A 1 41  ? 3.922   52.875 63.309 1.00 15.07  ? 37  ARG A NH2 1 
ATOM   87   N  N   . ASP A 1 42  ? -0.467  46.470 59.808 1.00 22.68  ? 38  ASP A N   1 
ATOM   88   C  CA  . ASP A 1 42  ? -1.050  45.573 58.824 1.00 23.46  ? 38  ASP A CA  1 
ATOM   89   C  C   . ASP A 1 42  ? -0.544  46.126 57.507 1.00 23.35  ? 38  ASP A C   1 
ATOM   90   O  O   . ASP A 1 42  ? -0.802  47.274 57.157 1.00 21.83  ? 38  ASP A O   1 
ATOM   91   C  CB  . ASP A 1 42  ? -2.587  45.527 58.872 1.00 25.29  ? 38  ASP A CB  1 
ATOM   92   C  CG  . ASP A 1 42  ? -3.086  44.340 59.683 1.00 27.16  ? 38  ASP A CG  1 
ATOM   93   O  OD1 . ASP A 1 42  ? -3.122  43.196 59.176 1.00 29.88  ? 38  ASP A OD1 1 
ATOM   94   O  OD2 . ASP A 1 42  ? -3.429  44.557 60.847 1.00 33.39  ? 38  ASP A OD2 1 
ATOM   95   N  N   . VAL A 1 43  ? 0.227   45.318 56.798 1.00 22.05  ? 39  VAL A N   1 
ATOM   96   C  CA  . VAL A 1 43  ? 0.783   45.751 55.529 1.00 22.87  ? 39  VAL A CA  1 
ATOM   97   C  C   . VAL A 1 43  ? 0.641   44.626 54.514 1.00 21.96  ? 39  VAL A C   1 
ATOM   98   O  O   . VAL A 1 43  ? 1.107   43.518 54.740 1.00 22.31  ? 39  VAL A O   1 
ATOM   99   C  CB  . VAL A 1 43  ? 2.263   46.226 55.686 1.00 22.25  ? 39  VAL A CB  1 
ATOM   100  C  CG1 . VAL A 1 43  ? 3.169   45.105 56.217 1.00 21.76  ? 39  VAL A CG1 1 
ATOM   101  C  CG2 . VAL A 1 43  ? 2.775   46.783 54.362 1.00 25.66  ? 39  VAL A CG2 1 
ATOM   102  N  N   . GLY A 1 44  ? -0.045  44.904 53.414 1.00 22.12  ? 40  GLY A N   1 
ATOM   103  C  CA  . GLY A 1 44  ? -0.288  43.876 52.410 1.00 21.24  ? 40  GLY A CA  1 
ATOM   104  C  C   . GLY A 1 44  ? -1.007  42.730 53.110 1.00 20.93  ? 40  GLY A C   1 
ATOM   105  O  O   . GLY A 1 44  ? -1.917  42.959 53.906 1.00 20.67  ? 40  GLY A O   1 
ATOM   106  N  N   . PRO A 1 45  ? -0.582  41.488 52.864 1.00 20.89  ? 41  PRO A N   1 
ATOM   107  C  CA  . PRO A 1 45  ? -1.286  40.373 53.481 1.00 20.28  ? 41  PRO A CA  1 
ATOM   108  C  C   . PRO A 1 45  ? -0.707  39.976 54.865 1.00 19.54  ? 41  PRO A C   1 
ATOM   109  O  O   . PRO A 1 45  ? -0.960  38.900 55.362 1.00 18.36  ? 41  PRO A O   1 
ATOM   110  C  CB  . PRO A 1 45  ? -1.053  39.275 52.444 1.00 20.24  ? 41  PRO A CB  1 
ATOM   111  C  CG  . PRO A 1 45  ? 0.394   39.507 52.075 1.00 20.66  ? 41  PRO A CG  1 
ATOM   112  C  CD  . PRO A 1 45  ? 0.476   41.005 51.948 1.00 20.48  ? 41  PRO A CD  1 
ATOM   113  N  N   . LEU A 1 46  ? 0.044   40.866 55.498 1.00 19.75  ? 42  LEU A N   1 
ATOM   114  C  CA  . LEU A 1 46  ? 0.666   40.550 56.768 1.00 18.92  ? 42  LEU A CA  1 
ATOM   115  C  C   . LEU A 1 46  ? 0.253   41.423 57.908 1.00 19.26  ? 42  LEU A C   1 
ATOM   116  O  O   . LEU A 1 46  ? 0.026   42.628 57.715 1.00 20.09  ? 42  LEU A O   1 
ATOM   117  C  CB  . LEU A 1 46  ? 2.203   40.731 56.599 1.00 19.15  ? 42  LEU A CB  1 
ATOM   118  C  CG  . LEU A 1 46  ? 2.886   40.011 55.432 1.00 20.10  ? 42  LEU A CG  1 
ATOM   119  C  CD1 . LEU A 1 46  ? 4.402   40.225 55.462 1.00 15.48  ? 42  LEU A CD1 1 
ATOM   120  C  CD2 . LEU A 1 46  ? 2.598   38.494 55.452 1.00 19.33  ? 42  LEU A CD2 1 
ATOM   121  N  N   . HIS A 1 47  ? 0.170   40.821 59.096 1.00 19.10  ? 43  HIS A N   1 
ATOM   122  C  CA  . HIS A 1 47  ? -0.045  41.536 60.349 1.00 19.55  ? 43  HIS A CA  1 
ATOM   123  C  C   . HIS A 1 47  ? 1.368   41.407 60.974 1.00 19.61  ? 43  HIS A C   1 
ATOM   124  O  O   . HIS A 1 47  ? 1.871   40.286 61.107 1.00 20.03  ? 43  HIS A O   1 
ATOM   125  C  CB  . HIS A 1 47  ? -1.088  40.874 61.219 1.00 20.58  ? 43  HIS A CB  1 
ATOM   126  C  CG  . HIS A 1 47  ? -1.329  41.607 62.500 1.00 22.66  ? 43  HIS A CG  1 
ATOM   127  N  ND1 . HIS A 1 47  ? -2.066  42.770 62.560 1.00 25.77  ? 43  HIS A ND1 1 
ATOM   128  C  CD2 . HIS A 1 47  ? -0.898  41.367 63.764 1.00 25.72  ? 43  HIS A CD2 1 
ATOM   129  C  CE1 . HIS A 1 47  ? -2.104  43.205 63.808 1.00 26.33  ? 43  HIS A CE1 1 
ATOM   130  N  NE2 . HIS A 1 47  ? -1.407  42.371 64.561 1.00 27.43  ? 43  HIS A NE2 1 
ATOM   131  N  N   . VAL A 1 48  ? 2.047   42.527 61.281 1.00 19.08  ? 44  VAL A N   1 
ATOM   132  C  CA  . VAL A 1 48  ? 3.418   42.500 61.816 1.00 18.55  ? 44  VAL A CA  1 
ATOM   133  C  C   . VAL A 1 48  ? 3.498   43.229 63.170 1.00 19.83  ? 44  VAL A C   1 
ATOM   134  O  O   . VAL A 1 48  ? 3.004   44.355 63.328 1.00 19.82  ? 44  VAL A O   1 
ATOM   135  C  CB  . VAL A 1 48  ? 4.403   43.194 60.814 1.00 18.65  ? 44  VAL A CB  1 
ATOM   136  C  CG1 . VAL A 1 48  ? 5.897   43.230 61.324 1.00 19.39  ? 44  VAL A CG1 1 
ATOM   137  C  CG2 . VAL A 1 48  ? 4.279   42.632 59.348 1.00 16.86  ? 44  VAL A CG2 1 
ATOM   138  N  N   . GLY A 1 49  ? 4.015   42.519 64.156 1.00 20.18  ? 45  GLY A N   1 
ATOM   139  C  CA  . GLY A 1 49  ? 4.199   43.043 65.473 1.00 20.59  ? 45  GLY A CA  1 
ATOM   140  C  C   . GLY A 1 49  ? 5.696   43.070 65.672 1.00 20.72  ? 45  GLY A C   1 
ATOM   141  O  O   . GLY A 1 49  ? 6.433   42.255 65.104 1.00 20.99  ? 45  GLY A O   1 
ATOM   142  N  N   . GLY A 1 50  ? 6.162   44.006 66.478 1.00 19.49  ? 46  GLY A N   1 
ATOM   143  C  CA  . GLY A 1 50  ? 7.587   44.111 66.771 1.00 19.70  ? 46  GLY A CA  1 
ATOM   144  C  C   . GLY A 1 50  ? 7.790   44.181 68.281 1.00 19.72  ? 46  GLY A C   1 
ATOM   145  O  O   . GLY A 1 50  ? 7.121   44.958 68.991 1.00 16.85  ? 46  GLY A O   1 
ATOM   146  N  N   . VAL A 1 51  ? 8.672   43.337 68.800 1.00 19.58  ? 47  VAL A N   1 
ATOM   147  C  CA  . VAL A 1 51  ? 8.930   43.388 70.241 1.00 19.66  ? 47  VAL A CA  1 
ATOM   148  C  C   . VAL A 1 51  ? 10.420  43.330 70.461 1.00 19.52  ? 47  VAL A C   1 
ATOM   149  O  O   . VAL A 1 51  ? 11.179  42.959 69.560 1.00 20.11  ? 47  VAL A O   1 
ATOM   150  C  CB  . VAL A 1 51  ? 8.265   42.259 71.074 1.00 19.62  ? 47  VAL A CB  1 
ATOM   151  C  CG1 . VAL A 1 51  ? 6.695   42.313 71.070 1.00 19.73  ? 47  VAL A CG1 1 
ATOM   152  C  CG2 . VAL A 1 51  ? 8.809   40.883 70.685 1.00 24.01  ? 47  VAL A CG2 1 
ATOM   153  N  N   . TYR A 1 52  ? 10.830  43.661 71.690 1.00 19.10  ? 48  TYR A N   1 
ATOM   154  C  CA  . TYR A 1 52  ? 12.235  43.564 72.102 1.00 18.88  ? 48  TYR A CA  1 
ATOM   155  C  C   . TYR A 1 52  ? 12.307  43.151 73.569 1.00 18.39  ? 48  TYR A C   1 
ATOM   156  O  O   . TYR A 1 52  ? 11.416  43.442 74.342 1.00 19.23  ? 48  TYR A O   1 
ATOM   157  C  CB  . TYR A 1 52  ? 12.998  44.858 71.848 1.00 18.79  ? 48  TYR A CB  1 
ATOM   158  C  CG  . TYR A 1 52  ? 12.781  45.943 72.850 1.00 18.86  ? 48  TYR A CG  1 
ATOM   159  C  CD1 . TYR A 1 52  ? 11.628  46.737 72.814 1.00 22.69  ? 48  TYR A CD1 1 
ATOM   160  C  CD2 . TYR A 1 52  ? 13.795  46.259 73.782 1.00 17.70  ? 48  TYR A CD2 1 
ATOM   161  C  CE1 . TYR A 1 52  ? 11.443  47.775 73.745 1.00 19.92  ? 48  TYR A CE1 1 
ATOM   162  C  CE2 . TYR A 1 52  ? 13.612  47.295 74.709 1.00 17.61  ? 48  TYR A CE2 1 
ATOM   163  C  CZ  . TYR A 1 52  ? 12.442  48.025 74.664 1.00 22.20  ? 48  TYR A CZ  1 
ATOM   164  O  OH  . TYR A 1 52  ? 12.280  49.000 75.571 1.00 21.27  ? 48  TYR A OH  1 
ATOM   165  N  N   . PHE A 1 53  ? 13.378  42.476 73.950 1.00 17.61  ? 49  PHE A N   1 
ATOM   166  C  CA  . PHE A 1 53  ? 13.579  42.057 75.335 1.00 17.59  ? 49  PHE A CA  1 
ATOM   167  C  C   . PHE A 1 53  ? 15.070  41.754 75.485 1.00 18.48  ? 49  PHE A C   1 
ATOM   168  O  O   . PHE A 1 53  ? 15.825  42.063 74.564 1.00 18.89  ? 49  PHE A O   1 
ATOM   169  C  CB  . PHE A 1 53  ? 12.639  40.920 75.757 1.00 17.15  ? 49  PHE A CB  1 
ATOM   170  C  CG  . PHE A 1 53  ? 12.532  39.787 74.763 1.00 17.29  ? 49  PHE A CG  1 
ATOM   171  C  CD1 . PHE A 1 53  ? 13.445  38.729 74.808 1.00 20.24  ? 49  PHE A CD1 1 
ATOM   172  C  CD2 . PHE A 1 53  ? 11.523  39.768 73.823 1.00 18.46  ? 49  PHE A CD2 1 
ATOM   173  C  CE1 . PHE A 1 53  ? 13.365  37.675 73.907 1.00 17.87  ? 49  PHE A CE1 1 
ATOM   174  C  CE2 . PHE A 1 53  ? 11.397  38.699 72.922 1.00 19.43  ? 49  PHE A CE2 1 
ATOM   175  C  CZ  . PHE A 1 53  ? 12.311  37.639 72.977 1.00 17.95  ? 49  PHE A CZ  1 
ATOM   176  N  N   A GLN A 1 54  ? 15.478  41.147 76.606 0.50 18.96  ? 50  GLN A N   1 
ATOM   177  N  N   B GLN A 1 54  ? 15.503  41.209 76.624 0.50 18.84  ? 50  GLN A N   1 
ATOM   178  C  CA  A GLN A 1 54  ? 16.890  40.819 76.864 0.50 19.94  ? 50  GLN A CA  1 
ATOM   179  C  CA  B GLN A 1 54  ? 16.931  40.939 76.835 0.50 19.43  ? 50  GLN A CA  1 
ATOM   180  C  C   A GLN A 1 54  ? 17.532  40.029 75.725 0.50 19.57  ? 50  GLN A C   1 
ATOM   181  C  C   B GLN A 1 54  ? 17.532  40.079 75.729 0.50 19.37  ? 50  GLN A C   1 
ATOM   182  O  O   A GLN A 1 54  ? 16.850  39.226 75.085 0.50 19.84  ? 50  GLN A O   1 
ATOM   183  O  O   B GLN A 1 54  ? 16.822  39.274 75.122 0.50 19.60  ? 50  GLN A O   1 
ATOM   184  C  CB  A GLN A 1 54  ? 17.049  40.040 78.193 0.50 19.81  ? 50  GLN A CB  1 
ATOM   185  C  CB  B GLN A 1 54  ? 17.191  40.276 78.199 0.50 19.63  ? 50  GLN A CB  1 
ATOM   186  C  CG  A GLN A 1 54  ? 16.228  38.750 78.279 0.50 20.08  ? 50  GLN A CG  1 
ATOM   187  C  CG  B GLN A 1 54  ? 16.857  38.803 78.227 0.50 19.96  ? 50  GLN A CG  1 
ATOM   188  C  CD  A GLN A 1 54  ? 16.804  37.703 79.248 0.50 21.84  ? 50  GLN A CD  1 
ATOM   189  C  CD  B GLN A 1 54  ? 15.635  38.506 79.033 0.50 23.22  ? 50  GLN A CD  1 
ATOM   190  O  OE1 A GLN A 1 54  ? 17.298  38.025 80.331 0.50 25.67  ? 50  GLN A OE1 1 
ATOM   191  O  OE1 B GLN A 1 54  ? 15.644  38.639 80.259 0.50 24.47  ? 50  GLN A OE1 1 
ATOM   192  N  NE2 A GLN A 1 54  ? 16.723  36.437 78.849 0.50 25.35  ? 50  GLN A NE2 1 
ATOM   193  N  NE2 B GLN A 1 54  ? 14.575  38.074 78.364 0.50 22.88  ? 50  GLN A NE2 1 
ATOM   194  N  N   . PRO A 1 55  ? 18.853  40.211 75.502 1.00 19.36  ? 51  PRO A N   1 
ATOM   195  C  CA  . PRO A 1 55  ? 19.502  39.364 74.523 1.00 19.23  ? 51  PRO A CA  1 
ATOM   196  C  C   . PRO A 1 55  ? 19.318  37.886 74.875 1.00 19.70  ? 51  PRO A C   1 
ATOM   197  O  O   . PRO A 1 55  ? 19.191  37.516 76.053 1.00 18.56  ? 51  PRO A O   1 
ATOM   198  C  CB  . PRO A 1 55  ? 20.975  39.732 74.640 1.00 18.86  ? 51  PRO A CB  1 
ATOM   199  C  CG  . PRO A 1 55  ? 20.992  41.097 75.222 1.00 19.61  ? 51  PRO A CG  1 
ATOM   200  C  CD  . PRO A 1 55  ? 19.807  41.162 76.118 1.00 18.64  ? 51  PRO A CD  1 
ATOM   201  N  N   . VAL A 1 56  ? 19.304  37.059 73.852 1.00 19.45  ? 52  VAL A N   1 
ATOM   202  C  CA  . VAL A 1 56  ? 19.095  35.621 74.050 1.00 20.02  ? 52  VAL A CA  1 
ATOM   203  C  C   . VAL A 1 56  ? 20.253  34.794 73.494 1.00 20.52  ? 52  VAL A C   1 
ATOM   204  O  O   . VAL A 1 56  ? 21.130  35.314 72.800 1.00 19.12  ? 52  VAL A O   1 
ATOM   205  C  CB  . VAL A 1 56  ? 17.732  35.169 73.452 1.00 19.65  ? 52  VAL A CB  1 
ATOM   206  C  CG1 . VAL A 1 56  ? 16.609  36.060 73.961 1.00 22.01  ? 52  VAL A CG1 1 
ATOM   207  C  CG2 . VAL A 1 56  ? 17.754  35.215 71.946 1.00 18.61  ? 52  VAL A CG2 1 
ATOM   208  N  N   . GLU A 1 57  ? 20.288  33.517 73.849 1.00 21.24  ? 53  GLU A N   1 
ATOM   209  C  CA  . GLU A 1 57  ? 21.349  32.668 73.350 1.00 21.45  ? 53  GLU A CA  1 
ATOM   210  C  C   . GLU A 1 57  ? 20.646  31.782 72.351 1.00 22.03  ? 53  GLU A C   1 
ATOM   211  O  O   . GLU A 1 57  ? 19.603  31.168 72.676 1.00 21.19  ? 53  GLU A O   1 
ATOM   212  C  CB  . GLU A 1 57  ? 21.989  31.825 74.451 1.00 22.64  ? 53  GLU A CB  1 
ATOM   213  C  CG  . GLU A 1 57  ? 23.102  30.934 73.893 1.00 26.55  ? 53  GLU A CG  1 
ATOM   214  C  CD  . GLU A 1 57  ? 23.636  29.928 74.895 1.00 33.77  ? 53  GLU A CD  1 
ATOM   215  O  OE1 . GLU A 1 57  ? 23.098  29.852 76.026 1.00 34.92  ? 53  GLU A OE1 1 
ATOM   216  O  OE2 . GLU A 1 57  ? 24.589  29.195 74.535 1.00 37.19  ? 53  GLU A OE2 1 
ATOM   217  N  N   . MET A 1 58  ? 21.174  31.743 71.127 1.00 21.60  ? 54  MET A N   1 
ATOM   218  C  CA  . MET A 1 58  ? 20.566  30.950 70.073 1.00 21.79  ? 54  MET A CA  1 
ATOM   219  C  C   . MET A 1 58  ? 21.471  29.828 69.594 1.00 22.29  ? 54  MET A C   1 
ATOM   220  O  O   . MET A 1 58  ? 22.693  29.980 69.599 1.00 21.86  ? 54  MET A O   1 
ATOM   221  C  CB  . MET A 1 58  ? 20.185  31.851 68.892 1.00 21.55  ? 54  MET A CB  1 
ATOM   222  C  CG  . MET A 1 58  ? 19.013  32.829 69.176 1.00 21.00  ? 54  MET A CG  1 
ATOM   223  S  SD  . MET A 1 58  ? 19.068  34.217 68.064 1.00 24.70  ? 54  MET A SD  1 
ATOM   224  C  CE  . MET A 1 58  ? 20.540  35.086 68.601 1.00 23.09  ? 54  MET A CE  1 
ATOM   225  N  N   . HIS A 1 59  ? 20.853  28.728 69.166 1.00 22.09  ? 55  HIS A N   1 
ATOM   226  C  CA  . HIS A 1 59  ? 21.555  27.554 68.615 1.00 24.06  ? 55  HIS A CA  1 
ATOM   227  C  C   . HIS A 1 59  ? 20.969  27.155 67.261 1.00 24.97  ? 55  HIS A C   1 
ATOM   228  O  O   . HIS A 1 59  ? 19.764  26.878 67.180 1.00 24.54  ? 55  HIS A O   1 
ATOM   229  C  CB  . HIS A 1 59  ? 21.468  26.339 69.517 1.00 24.18  ? 55  HIS A CB  1 
ATOM   230  C  CG  . HIS A 1 59  ? 22.209  25.158 68.961 1.00 25.61  ? 55  HIS A CG  1 
ATOM   231  N  ND1 . HIS A 1 59  ? 23.580  25.052 69.028 1.00 26.92  ? 55  HIS A ND1 1 
ATOM   232  C  CD2 . HIS A 1 59  ? 21.784  24.078 68.263 1.00 27.08  ? 55  HIS A CD2 1 
ATOM   233  C  CE1 . HIS A 1 59  ? 23.968  23.942 68.423 1.00 27.90  ? 55  HIS A CE1 1 
ATOM   234  N  NE2 . HIS A 1 59  ? 22.897  23.328 67.957 1.00 27.22  ? 55  HIS A NE2 1 
ATOM   235  N  N   . PRO A 1 60  ? 21.793  27.166 66.191 1.00 26.58  ? 56  PRO A N   1 
ATOM   236  C  CA  . PRO A 1 60  ? 23.162  27.741 66.100 1.00 28.19  ? 56  PRO A CA  1 
ATOM   237  C  C   . PRO A 1 60  ? 23.118  29.262 66.258 1.00 29.68  ? 56  PRO A C   1 
ATOM   238  O  O   . PRO A 1 60  ? 22.040  29.861 66.121 1.00 29.16  ? 56  PRO A O   1 
ATOM   239  C  CB  . PRO A 1 60  ? 23.571  27.424 64.674 1.00 28.56  ? 56  PRO A CB  1 
ATOM   240  C  CG  . PRO A 1 60  ? 22.688  26.276 64.266 1.00 28.62  ? 56  PRO A CG  1 
ATOM   241  C  CD  . PRO A 1 60  ? 21.384  26.549 64.917 1.00 26.56  ? 56  PRO A CD  1 
ATOM   242  N  N   . ALA A 1 61  ? 24.259  29.889 66.533 1.00 31.22  ? 57  ALA A N   1 
ATOM   243  C  CA  . ALA A 1 61  ? 24.278  31.343 66.703 1.00 32.82  ? 57  ALA A CA  1 
ATOM   244  C  C   . ALA A 1 61  ? 24.121  31.957 65.300 1.00 33.90  ? 57  ALA A C   1 
ATOM   245  O  O   . ALA A 1 61  ? 24.973  31.729 64.452 1.00 34.42  ? 57  ALA A O   1 
ATOM   246  C  CB  . ALA A 1 61  ? 25.581  31.788 67.413 1.00 32.96  ? 57  ALA A CB  1 
ATOM   247  N  N   . PRO A 1 62  ? 22.995  32.665 65.029 1.00 34.54  ? 58  PRO A N   1 
ATOM   248  C  CA  . PRO A 1 62  ? 22.656  33.072 63.645 1.00 35.86  ? 58  PRO A CA  1 
ATOM   249  C  C   . PRO A 1 62  ? 23.526  34.154 62.995 1.00 36.59  ? 58  PRO A C   1 
ATOM   250  O  O   . PRO A 1 62  ? 23.765  35.216 63.576 1.00 36.63  ? 58  PRO A O   1 
ATOM   251  C  CB  . PRO A 1 62  ? 21.205  33.543 63.747 1.00 35.37  ? 58  PRO A CB  1 
ATOM   252  C  CG  . PRO A 1 62  ? 21.062  33.941 65.141 1.00 35.16  ? 58  PRO A CG  1 
ATOM   253  C  CD  . PRO A 1 62  ? 21.956  33.095 65.975 1.00 34.63  ? 58  PRO A CD  1 
ATOM   254  N  N   . GLY A 1 63  ? 23.971  33.863 61.773 1.00 36.73  ? 59  GLY A N   1 
ATOM   255  C  CA  . GLY A 1 63  ? 24.793  34.769 61.002 1.00 36.21  ? 59  GLY A CA  1 
ATOM   256  C  C   . GLY A 1 63  ? 25.849  35.537 61.782 1.00 35.66  ? 59  GLY A C   1 
ATOM   257  O  O   . GLY A 1 63  ? 26.636  34.960 62.567 1.00 35.68  ? 59  GLY A O   1 
ATOM   258  N  N   . ALA A 1 64  ? 25.842  36.857 61.581 1.00 34.36  ? 60  ALA A N   1 
ATOM   259  C  CA  . ALA A 1 64  ? 26.821  37.719 62.227 1.00 33.31  ? 60  ALA A CA  1 
ATOM   260  C  C   . ALA A 1 64  ? 26.187  38.504 63.381 1.00 31.56  ? 60  ALA A C   1 
ATOM   261  O  O   . ALA A 1 64  ? 26.585  39.630 63.657 1.00 31.70  ? 60  ALA A O   1 
ATOM   262  C  CB  . ALA A 1 64  ? 27.451  38.663 61.196 1.00 33.22  ? 60  ALA A CB  1 
ATOM   263  N  N   . GLN A 1 65  ? 25.241  37.874 64.068 1.00 29.48  ? 61  GLN A N   1 
ATOM   264  C  CA  . GLN A 1 65  ? 24.555  38.500 65.191 1.00 27.01  ? 61  GLN A CA  1 
ATOM   265  C  C   . GLN A 1 65  ? 25.410  38.503 66.460 1.00 25.92  ? 61  GLN A C   1 
ATOM   266  O  O   . GLN A 1 65  ? 26.090  37.527 66.758 1.00 25.50  ? 61  GLN A O   1 
ATOM   267  C  CB  . GLN A 1 65  ? 23.199  37.827 65.455 1.00 27.25  ? 61  GLN A CB  1 
ATOM   268  C  CG  . GLN A 1 65  ? 22.192  37.943 64.304 1.00 24.53  ? 61  GLN A CG  1 
ATOM   269  C  CD  . GLN A 1 65  ? 20.877  37.366 64.684 1.00 22.00  ? 61  GLN A CD  1 
ATOM   270  O  OE1 . GLN A 1 65  ? 20.596  37.233 65.873 1.00 18.70  ? 61  GLN A OE1 1 
ATOM   271  N  NE2 . GLN A 1 65  ? 20.040  37.021 63.690 1.00 22.41  ? 61  GLN A NE2 1 
ATOM   272  N  N   . PRO A 1 66  ? 25.393  39.620 67.191 1.00 24.58  ? 62  PRO A N   1 
ATOM   273  C  CA  . PRO A 1 66  ? 26.108  39.715 68.465 1.00 24.16  ? 62  PRO A CA  1 
ATOM   274  C  C   . PRO A 1 66  ? 25.688  38.619 69.467 1.00 23.14  ? 62  PRO A C   1 
ATOM   275  O  O   . PRO A 1 66  ? 24.547  38.185 69.456 1.00 21.75  ? 62  PRO A O   1 
ATOM   276  C  CB  . PRO A 1 66  ? 25.711  41.095 68.996 1.00 24.06  ? 62  PRO A CB  1 
ATOM   277  C  CG  . PRO A 1 66  ? 24.573  41.553 68.166 1.00 25.10  ? 62  PRO A CG  1 
ATOM   278  C  CD  . PRO A 1 66  ? 24.737  40.888 66.837 1.00 24.49  ? 62  PRO A CD  1 
ATOM   279  N  N   . SER A 1 67  ? 26.632  38.164 70.291 1.00 21.42  ? 63  SER A N   1 
ATOM   280  C  CA  . SER A 1 67  ? 26.354  37.131 71.299 1.00 20.89  ? 63  SER A CA  1 
ATOM   281  C  C   . SER A 1 67  ? 25.389  37.672 72.355 1.00 20.47  ? 63  SER A C   1 
ATOM   282  O  O   . SER A 1 67  ? 25.099  38.881 72.408 1.00 20.97  ? 63  SER A O   1 
ATOM   283  C  CB  . SER A 1 67  ? 27.661  36.756 72.021 1.00 20.13  ? 63  SER A CB  1 
ATOM   284  O  OG  . SER A 1 67  ? 28.108  37.873 72.774 1.00 19.18  ? 63  SER A OG  1 
ATOM   285  N  N   . LYS A 1 68  ? 24.921  36.798 73.233 1.00 20.06  ? 64  LYS A N   1 
ATOM   286  C  CA  . LYS A 1 68  ? 24.056  37.235 74.323 1.00 21.01  ? 64  LYS A CA  1 
ATOM   287  C  C   . LYS A 1 68  ? 24.748  38.353 75.124 1.00 20.86  ? 64  LYS A C   1 
ATOM   288  O  O   . LYS A 1 68  ? 24.087  39.295 75.540 1.00 20.95  ? 64  LYS A O   1 
ATOM   289  C  CB  . LYS A 1 68  ? 23.763  36.074 75.253 1.00 22.00  ? 64  LYS A CB  1 
ATOM   290  C  CG  . LYS A 1 68  ? 22.762  36.381 76.358 1.00 26.79  ? 64  LYS A CG  1 
ATOM   291  C  CD  . LYS A 1 68  ? 22.209  35.062 76.950 1.00 32.13  ? 64  LYS A CD  1 
ATOM   292  C  CE  . LYS A 1 68  ? 22.242  35.087 78.488 1.00 37.08  ? 64  LYS A CE  1 
ATOM   293  N  NZ  . LYS A 1 68  ? 22.142  33.696 79.054 1.00 39.80  ? 64  LYS A NZ  1 
ATOM   294  N  N   . GLU A 1 69  ? 26.063  38.206 75.393 1.00 21.17  ? 65  GLU A N   1 
ATOM   295  C  CA  . GLU A 1 69  ? 26.812  39.216 76.166 1.00 22.14  ? 65  GLU A CA  1 
ATOM   296  C  C   . GLU A 1 69  ? 27.098  40.531 75.416 1.00 21.99  ? 65  GLU A C   1 
ATOM   297  O  O   . GLU A 1 69  ? 27.100  41.616 76.030 1.00 23.10  ? 65  GLU A O   1 
ATOM   298  C  CB  . GLU A 1 69  ? 28.166  38.633 76.671 1.00 21.92  ? 65  GLU A CB  1 
ATOM   299  C  CG  . GLU A 1 69  ? 27.978  37.543 77.712 1.00 24.91  ? 65  GLU A CG  1 
ATOM   300  C  CD  . GLU A 1 69  ? 27.459  36.246 77.119 1.00 30.56  ? 65  GLU A CD  1 
ATOM   301  O  OE1 . GLU A 1 69  ? 27.734  35.980 75.921 1.00 27.97  ? 65  GLU A OE1 1 
ATOM   302  O  OE2 . GLU A 1 69  ? 26.753  35.496 77.845 1.00 34.98  ? 65  GLU A OE2 1 
ATOM   303  N  N   . GLU A 1 70  ? 27.388  40.434 74.115 1.00 22.71  ? 66  GLU A N   1 
ATOM   304  C  CA  . GLU A 1 70  ? 27.722  41.601 73.269 1.00 22.84  ? 66  GLU A CA  1 
ATOM   305  C  C   . GLU A 1 70  ? 26.476  42.426 72.928 1.00 21.77  ? 66  GLU A C   1 
ATOM   306  O  O   . GLU A 1 70  ? 26.515  43.653 72.854 1.00 21.56  ? 66  GLU A O   1 
ATOM   307  C  CB  . GLU A 1 70  ? 28.398  41.120 71.972 1.00 23.92  ? 66  GLU A CB  1 
ATOM   308  C  CG  . GLU A 1 70  ? 28.776  42.190 70.877 1.00 26.14  ? 66  GLU A CG  1 
ATOM   309  C  CD  . GLU A 1 70  ? 30.147  42.889 71.107 1.00 32.37  ? 66  GLU A CD  1 
ATOM   310  O  OE1 . GLU A 1 70  ? 31.012  42.347 71.857 1.00 31.03  ? 66  GLU A OE1 1 
ATOM   311  O  OE2 . GLU A 1 70  ? 30.343  43.993 70.514 1.00 34.26  ? 66  GLU A OE2 1 
ATOM   312  N  N   . ALA A 1 71  ? 25.354  41.752 72.761 1.00 19.65  ? 67  ALA A N   1 
ATOM   313  C  CA  . ALA A 1 71  ? 24.139  42.472 72.395 1.00 18.53  ? 67  ALA A CA  1 
ATOM   314  C  C   . ALA A 1 71  ? 23.514  43.422 73.390 1.00 17.74  ? 67  ALA A C   1 
ATOM   315  O  O   . ALA A 1 71  ? 23.664  43.239 74.582 1.00 19.00  ? 67  ALA A O   1 
ATOM   316  C  CB  . ALA A 1 71  ? 23.066  41.425 71.956 1.00 18.11  ? 67  ALA A CB  1 
ATOM   317  N  N   . ASP A 1 72  ? 22.713  44.385 72.909 1.00 18.02  ? 68  ASP A N   1 
ATOM   318  C  CA  . ASP A 1 72  ? 21.948  45.260 73.807 1.00 17.86  ? 68  ASP A CA  1 
ATOM   319  C  C   . ASP A 1 72  ? 20.591  44.604 74.056 1.00 18.56  ? 68  ASP A C   1 
ATOM   320  O  O   . ASP A 1 72  ? 20.018  44.672 75.158 1.00 17.45  ? 68  ASP A O   1 
ATOM   321  C  CB  . ASP A 1 72  ? 21.691  46.612 73.155 1.00 16.82  ? 68  ASP A CB  1 
ATOM   322  C  CG  . ASP A 1 72  ? 22.853  47.501 73.257 1.00 19.10  ? 68  ASP A CG  1 
ATOM   323  O  OD1 . ASP A 1 72  ? 23.408  47.594 74.374 1.00 22.88  ? 68  ASP A OD1 1 
ATOM   324  O  OD2 . ASP A 1 72  ? 23.230  48.118 72.226 1.00 22.88  ? 68  ASP A OD2 1 
ATOM   325  N  N   . CYS A 1 73  ? 20.024  43.996 73.007 1.00 19.10  ? 69  CYS A N   1 
ATOM   326  C  CA  . CYS A 1 73  ? 18.711  43.360 73.165 1.00 18.80  ? 69  CYS A CA  1 
ATOM   327  C  C   . CYS A 1 73  ? 18.490  42.350 72.062 1.00 18.80  ? 69  CYS A C   1 
ATOM   328  O  O   . CYS A 1 73  ? 19.373  42.173 71.218 1.00 17.45  ? 69  CYS A O   1 
ATOM   329  C  CB  . CYS A 1 73  ? 17.590  44.389 73.124 1.00 19.48  ? 69  CYS A CB  1 
ATOM   330  S  SG  . CYS A 1 73  ? 17.297  45.153 71.493 1.00 21.22  ? 69  CYS A SG  1 
ATOM   331  N  N   . HIS A 1 74  ? 17.326  41.687 72.127 1.00 17.25  ? 70  HIS A N   1 
ATOM   332  C  CA  . HIS A 1 74  ? 16.869  40.762 71.105 1.00 17.81  ? 70  HIS A CA  1 
ATOM   333  C  C   . HIS A 1 74  ? 15.585  41.399 70.569 1.00 18.03  ? 70  HIS A C   1 
ATOM   334  O  O   . HIS A 1 74  ? 14.725  41.826 71.355 1.00 18.89  ? 70  HIS A O   1 
ATOM   335  C  CB  . HIS A 1 74  ? 16.530  39.400 71.692 1.00 16.65  ? 70  HIS A CB  1 
ATOM   336  C  CG  . HIS A 1 74  ? 16.146  38.397 70.651 1.00 19.35  ? 70  HIS A CG  1 
ATOM   337  N  ND1 . HIS A 1 74  ? 17.053  37.893 69.740 1.00 16.59  ? 70  HIS A ND1 1 
ATOM   338  C  CD2 . HIS A 1 74  ? 14.964  37.799 70.379 1.00 14.93  ? 70  HIS A CD2 1 
ATOM   339  C  CE1 . HIS A 1 74  ? 16.460  36.980 68.993 1.00 16.22  ? 70  HIS A CE1 1 
ATOM   340  N  NE2 . HIS A 1 74  ? 15.185  36.921 69.349 1.00 18.01  ? 70  HIS A NE2 1 
ATOM   341  N  N   . ILE A 1 75  ? 15.494  41.552 69.253 1.00 17.06  ? 71  ILE A N   1 
ATOM   342  C  CA  . ILE A 1 75  ? 14.321  42.130 68.615 1.00 18.84  ? 71  ILE A CA  1 
ATOM   343  C  C   . ILE A 1 75  ? 13.648  41.042 67.775 1.00 18.14  ? 71  ILE A C   1 
ATOM   344  O  O   . ILE A 1 75  ? 14.325  40.229 67.133 1.00 17.67  ? 71  ILE A O   1 
ATOM   345  C  CB  . ILE A 1 75  ? 14.640  43.343 67.719 1.00 17.92  ? 71  ILE A CB  1 
ATOM   346  C  CG1 . ILE A 1 75  ? 15.136  44.518 68.571 1.00 20.60  ? 71  ILE A CG1 1 
ATOM   347  C  CG2 . ILE A 1 75  ? 13.351  43.744 66.875 1.00 21.15  ? 71  ILE A CG2 1 
ATOM   348  C  CD1 . ILE A 1 75  ? 15.490  45.761 67.764 1.00 23.31  ? 71  ILE A CD1 1 
ATOM   349  N  N   . GLU A 1 76  ? 12.324  41.040 67.778 1.00 19.53  ? 72  GLU A N   1 
ATOM   350  C  CA  . GLU A 1 76  ? 11.562  40.057 66.998 1.00 19.97  ? 72  GLU A CA  1 
ATOM   351  C  C   . GLU A 1 76  ? 10.434  40.683 66.173 1.00 20.87  ? 72  GLU A C   1 
ATOM   352  O  O   . GLU A 1 76  ? 9.749   41.618 66.620 1.00 20.33  ? 72  GLU A O   1 
ATOM   353  C  CB  . GLU A 1 76  ? 10.937  39.012 67.922 1.00 19.94  ? 72  GLU A CB  1 
ATOM   354  C  CG  . GLU A 1 76  ? 11.973  38.147 68.607 1.00 18.69  ? 72  GLU A CG  1 
ATOM   355  C  CD  . GLU A 1 76  ? 11.428  37.153 69.589 1.00 20.88  ? 72  GLU A CD  1 
ATOM   356  O  OE1 . GLU A 1 76  ? 10.223  37.180 69.968 1.00 25.13  ? 72  GLU A OE1 1 
ATOM   357  O  OE2 . GLU A 1 76  ? 12.251  36.334 70.039 1.00 20.85  ? 72  GLU A OE2 1 
ATOM   358  N  N   . ALA A 1 77  ? 10.185  40.077 65.013 1.00 21.19  ? 73  ALA A N   1 
ATOM   359  C  CA  . ALA A 1 77  ? 9.103   40.466 64.170 1.00 20.75  ? 73  ALA A CA  1 
ATOM   360  C  C   . ALA A 1 77  ? 8.173   39.273 64.205 1.00 22.16  ? 73  ALA A C   1 
ATOM   361  O  O   . ALA A 1 77  ? 8.564   38.155 63.828 1.00 22.77  ? 73  ALA A O   1 
ATOM   362  C  CB  . ALA A 1 77  ? 9.575   40.733 62.696 1.00 20.63  ? 73  ALA A CB  1 
ATOM   363  N  N   A ASP A 1 78  ? 6.947   39.483 64.662 0.50 22.30  ? 74  ASP A N   1 
ATOM   364  N  N   B ASP A 1 78  ? 6.957   39.527 64.648 0.50 21.88  ? 74  ASP A N   1 
ATOM   365  C  CA  A ASP A 1 78  ? 5.937   38.411 64.731 0.50 23.24  ? 74  ASP A CA  1 
ATOM   366  C  CA  B ASP A 1 78  ? 5.921   38.522 64.712 0.50 22.50  ? 74  ASP A CA  1 
ATOM   367  C  C   A ASP A 1 78  ? 5.025   38.636 63.525 0.50 22.64  ? 74  ASP A C   1 
ATOM   368  C  C   B ASP A 1 78  ? 5.154   38.759 63.423 0.50 22.18  ? 74  ASP A C   1 
ATOM   369  O  O   A ASP A 1 78  ? 4.216   39.566 63.485 0.50 22.15  ? 74  ASP A O   1 
ATOM   370  O  O   B ASP A 1 78  ? 4.585   39.831 63.217 0.50 21.72  ? 74  ASP A O   1 
ATOM   371  C  CB  A ASP A 1 78  ? 5.224   38.431 66.090 0.50 23.72  ? 74  ASP A CB  1 
ATOM   372  C  CB  B ASP A 1 78  ? 5.045   38.754 65.950 0.50 22.52  ? 74  ASP A CB  1 
ATOM   373  C  CG  A ASP A 1 78  ? 6.207   38.373 67.261 0.50 26.69  ? 74  ASP A CG  1 
ATOM   374  C  CG  B ASP A 1 78  ? 4.105   37.595 66.236 0.50 23.43  ? 74  ASP A CG  1 
ATOM   375  O  OD1 A ASP A 1 78  ? 6.991   37.393 67.357 0.50 31.25  ? 74  ASP A OD1 1 
ATOM   376  O  OD1 B ASP A 1 78  ? 4.382   36.471 65.783 0.50 22.75  ? 74  ASP A OD1 1 
ATOM   377  O  OD2 A ASP A 1 78  ? 6.242   39.331 68.068 0.50 29.60  ? 74  ASP A OD2 1 
ATOM   378  O  OD2 B ASP A 1 78  ? 3.079   37.813 66.910 0.50 26.66  ? 74  ASP A OD2 1 
ATOM   379  N  N   . ILE A 1 79  ? 5.202   37.793 62.514 1.00 21.76  ? 75  ILE A N   1 
ATOM   380  C  CA  . ILE A 1 79  ? 4.497   37.930 61.253 1.00 21.63  ? 75  ILE A CA  1 
ATOM   381  C  C   . ILE A 1 79  ? 3.484   36.844 60.971 1.00 23.21  ? 75  ILE A C   1 
ATOM   382  O  O   . ILE A 1 79  ? 3.835   35.670 60.961 1.00 23.60  ? 75  ILE A O   1 
ATOM   383  C  CB  . ILE A 1 79  ? 5.519   37.989 60.068 1.00 21.95  ? 75  ILE A CB  1 
ATOM   384  C  CG1 . ILE A 1 79  ? 6.563   39.092 60.309 1.00 21.43  ? 75  ILE A CG1 1 
ATOM   385  C  CG2 . ILE A 1 79  ? 4.818   38.178 58.666 1.00 18.73  ? 75  ILE A CG2 1 
ATOM   386  C  CD1 . ILE A 1 79  ? 7.527   39.319 59.170 1.00 20.09  ? 75  ILE A CD1 1 
ATOM   387  N  N   . HIS A 1 80  ? 2.238   37.255 60.781 1.00 23.34  ? 76  HIS A N   1 
ATOM   388  C  CA  . HIS A 1 80  ? 1.210   36.318 60.362 1.00 23.70  ? 76  HIS A CA  1 
ATOM   389  C  C   . HIS A 1 80  ? 0.300   36.855 59.323 1.00 22.06  ? 76  HIS A C   1 
ATOM   390  O  O   . HIS A 1 80  ? 0.257   38.047 59.074 1.00 21.26  ? 76  HIS A O   1 
ATOM   391  C  CB  . HIS A 1 80  ? 0.491   35.527 61.427 1.00 25.39  ? 76  HIS A CB  1 
ATOM   392  C  CG  . HIS A 1 80  ? 0.235   36.241 62.688 1.00 28.99  ? 76  HIS A CG  1 
ATOM   393  N  ND1 . HIS A 1 80  ? 1.016   36.041 63.807 1.00 34.18  ? 76  HIS A ND1 1 
ATOM   394  C  CD2 . HIS A 1 80  ? -0.760  37.080 63.052 1.00 32.18  ? 76  HIS A CD2 1 
ATOM   395  C  CE1 . HIS A 1 80  ? 0.519   36.759 64.803 1.00 37.18  ? 76  HIS A CE1 1 
ATOM   396  N  NE2 . HIS A 1 80  ? -0.547  37.409 64.365 1.00 35.26  ? 76  HIS A NE2 1 
ATOM   397  N  N   . ALA A 1 81  ? -0.396  35.944 58.668 1.00 21.82  ? 77  ALA A N   1 
ATOM   398  C  CA  . ALA A 1 81  ? -1.266  36.342 57.613 1.00 21.66  ? 77  ALA A CA  1 
ATOM   399  C  C   . ALA A 1 81  ? -2.500  36.997 58.156 1.00 20.93  ? 77  ALA A C   1 
ATOM   400  O  O   . ALA A 1 81  ? -3.053  36.562 59.184 1.00 20.75  ? 77  ALA A O   1 
ATOM   401  C  CB  . ALA A 1 81  ? -1.622  35.135 56.747 1.00 21.42  ? 77  ALA A CB  1 
ATOM   402  N  N   . ASN A 1 82  ? -2.946  38.031 57.453 1.00 21.10  ? 78  ASN A N   1 
ATOM   403  C  CA  . ASN A 1 82  ? -4.180  38.694 57.792 1.00 21.15  ? 78  ASN A CA  1 
ATOM   404  C  C   . ASN A 1 82  ? -5.185  38.161 56.781 1.00 21.56  ? 78  ASN A C   1 
ATOM   405  O  O   . ASN A 1 82  ? -4.914  37.146 56.089 1.00 20.00  ? 78  ASN A O   1 
ATOM   406  C  CB  . ASN A 1 82  ? -4.072  40.233 57.808 1.00 21.79  ? 78  ASN A CB  1 
ATOM   407  C  CG  . ASN A 1 82  ? -3.649  40.818 56.480 1.00 22.88  ? 78  ASN A CG  1 
ATOM   408  O  OD1 . ASN A 1 82  ? -3.849  40.218 55.421 1.00 24.46  ? 78  ASN A OD1 1 
ATOM   409  N  ND2 . ASN A 1 82  ? -3.076  42.018 56.526 1.00 22.05  ? 78  ASN A ND2 1 
ATOM   410  N  N   . GLU A 1 83  ? -6.328  38.815 56.682 1.00 21.68  ? 79  GLU A N   1 
ATOM   411  C  CA  . GLU A 1 83  ? -7.383  38.401 55.766 1.00 23.46  ? 79  GLU A CA  1 
ATOM   412  C  C   . GLU A 1 83  ? -6.956  38.401 54.287 1.00 22.89  ? 79  GLU A C   1 
ATOM   413  O  O   . GLU A 1 83  ? -7.376  37.555 53.503 1.00 22.64  ? 79  GLU A O   1 
ATOM   414  C  CB  . GLU A 1 83  ? -8.602  39.293 55.975 1.00 23.79  ? 79  GLU A CB  1 
ATOM   415  C  CG  . GLU A 1 83  ? -9.483  38.848 57.151 1.00 27.37  ? 79  GLU A CG  1 
ATOM   416  C  CD  . GLU A 1 83  ? -10.166 37.506 56.874 1.00 30.50  ? 79  GLU A CD  1 
ATOM   417  O  OE1 . GLU A 1 83  ? -10.338 37.128 55.679 1.00 32.99  ? 79  GLU A OE1 1 
ATOM   418  O  OE2 . GLU A 1 83  ? -10.515 36.818 57.856 1.00 32.90  ? 79  GLU A OE2 1 
ATOM   419  N  N   . ALA A 1 84  ? -6.124  39.357 53.919 1.00 23.03  ? 80  ALA A N   1 
ATOM   420  C  CA  . ALA A 1 84  ? -5.619  39.459 52.551 1.00 23.61  ? 80  ALA A CA  1 
ATOM   421  C  C   . ALA A 1 84  ? -4.711  38.259 52.251 1.00 24.59  ? 80  ALA A C   1 
ATOM   422  O  O   . ALA A 1 84  ? -4.635  37.778 51.113 1.00 25.44  ? 80  ALA A O   1 
ATOM   423  C  CB  . ALA A 1 84  ? -4.884  40.791 52.364 1.00 23.40  ? 80  ALA A CB  1 
ATOM   424  N  N   . GLY A 1 85  ? -4.063  37.742 53.285 1.00 23.84  ? 81  GLY A N   1 
ATOM   425  C  CA  . GLY A 1 85  ? -3.164  36.588 53.140 1.00 24.66  ? 81  GLY A CA  1 
ATOM   426  C  C   . GLY A 1 85  ? -3.888  35.316 52.762 1.00 23.99  ? 81  GLY A C   1 
ATOM   427  O  O   . GLY A 1 85  ? -3.284  34.367 52.277 1.00 22.45  ? 81  GLY A O   1 
ATOM   428  N  N   . LYS A 1 86  ? -5.202  35.293 52.976 1.00 24.63  ? 82  LYS A N   1 
ATOM   429  C  CA  . LYS A 1 86  ? -5.960  34.105 52.652 1.00 24.69  ? 82  LYS A CA  1 
ATOM   430  C  C   . LYS A 1 86  ? -5.903  33.753 51.159 1.00 24.43  ? 82  LYS A C   1 
ATOM   431  O  O   . LYS A 1 86  ? -5.917  32.566 50.797 1.00 23.21  ? 82  LYS A O   1 
ATOM   432  C  CB  . LYS A 1 86  ? -7.408  34.233 53.139 1.00 25.28  ? 82  LYS A CB  1 
ATOM   433  C  CG  . LYS A 1 86  ? -8.008  32.925 53.506 1.00 28.01  ? 82  LYS A CG  1 
ATOM   434  C  CD  . LYS A 1 86  ? -9.423  33.094 54.038 1.00 32.63  ? 82  LYS A CD  1 
ATOM   435  C  CE  . LYS A 1 86  ? -10.201 34.127 53.236 1.00 35.22  ? 82  LYS A CE  1 
ATOM   436  N  NZ  . LYS A 1 86  ? -11.637 34.119 53.601 1.00 36.62  ? 82  LYS A NZ  1 
ATOM   437  N  N   . ASP A 1 87  ? -5.815  34.774 50.301 1.00 24.06  ? 83  ASP A N   1 
ATOM   438  C  CA  . ASP A 1 87  ? -5.726  34.581 48.844 1.00 24.56  ? 83  ASP A CA  1 
ATOM   439  C  C   . ASP A 1 87  ? -4.385  33.972 48.396 1.00 23.11  ? 83  ASP A C   1 
ATOM   440  O  O   . ASP A 1 87  ? -4.265  33.496 47.278 1.00 22.99  ? 83  ASP A O   1 
ATOM   441  C  CB  . ASP A 1 87  ? -5.942  35.896 48.146 1.00 25.43  ? 83  ASP A CB  1 
ATOM   442  C  CG  . ASP A 1 87  ? -7.207  36.535 48.578 1.00 29.51  ? 83  ASP A CG  1 
ATOM   443  O  OD1 . ASP A 1 87  ? -8.261  35.960 48.234 1.00 33.65  ? 83  ASP A OD1 1 
ATOM   444  O  OD2 . ASP A 1 87  ? -7.150  37.545 49.320 1.00 33.52  ? 83  ASP A OD2 1 
ATOM   445  N  N   . LEU A 1 88  ? -3.403  33.985 49.282 1.00 22.39  ? 84  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 88  ? -2.083  33.399 48.988 1.00 21.85  ? 84  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 88  ? -2.071  31.962 49.466 1.00 21.30  ? 84  LEU A C   1 
ATOM   448  O  O   . LEU A 1 88  ? -1.102  31.229 49.245 1.00 20.85  ? 84  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 88  ? -0.973  34.185 49.683 1.00 22.84  ? 84  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 88  ? -0.175  35.161 48.831 1.00 26.06  ? 84  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 88  ? 0.742   35.921 49.717 1.00 27.29  ? 84  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 88  ? 0.653   34.401 47.837 1.00 25.45  ? 84  LEU A CD2 1 
ATOM   453  N  N   . GLY A 1 89  ? -3.131  31.571 50.169 1.00 20.79  ? 85  GLY A N   1 
ATOM   454  C  CA  . GLY A 1 89  ? -3.237  30.213 50.691 1.00 21.40  ? 85  GLY A CA  1 
ATOM   455  C  C   . GLY A 1 89  ? -2.915  30.002 52.155 1.00 22.15  ? 85  GLY A C   1 
ATOM   456  O  O   . GLY A 1 89  ? -3.047  28.889 52.645 1.00 23.51  ? 85  GLY A O   1 
ATOM   457  N  N   . TYR A 1 90  ? -2.543  31.061 52.869 1.00 21.17  ? 86  TYR A N   1 
ATOM   458  C  CA  . TYR A 1 90  ? -2.253  30.938 54.302 1.00 20.66  ? 86  TYR A CA  1 
ATOM   459  C  C   . TYR A 1 90  ? -3.525  30.907 55.101 1.00 21.41  ? 86  TYR A C   1 
ATOM   460  O  O   . TYR A 1 90  ? -4.532  31.472 54.690 1.00 20.37  ? 86  TYR A O   1 
ATOM   461  C  CB  . TYR A 1 90  ? -1.411  32.109 54.845 1.00 20.88  ? 86  TYR A CB  1 
ATOM   462  C  CG  . TYR A 1 90  ? -0.075  32.212 54.195 1.00 18.67  ? 86  TYR A CG  1 
ATOM   463  C  CD1 . TYR A 1 90  ? 0.954   31.295 54.504 1.00 20.09  ? 86  TYR A CD1 1 
ATOM   464  C  CD2 . TYR A 1 90  ? 0.155   33.173 53.221 1.00 19.30  ? 86  TYR A CD2 1 
ATOM   465  C  CE1 . TYR A 1 90  ? 2.180   31.359 53.846 1.00 16.61  ? 86  TYR A CE1 1 
ATOM   466  C  CE2 . TYR A 1 90  ? 1.363   33.249 52.554 1.00 18.18  ? 86  TYR A CE2 1 
ATOM   467  C  CZ  . TYR A 1 90  ? 2.375   32.349 52.885 1.00 19.49  ? 86  TYR A CZ  1 
ATOM   468  O  OH  . TYR A 1 90  ? 3.555   32.465 52.238 1.00 17.26  ? 86  TYR A OH  1 
ATOM   469  N  N   . GLY A 1 91  ? -3.442  30.289 56.279 1.00 22.88  ? 87  GLY A N   1 
ATOM   470  C  CA  . GLY A 1 91  ? -4.566  30.257 57.218 1.00 22.54  ? 87  GLY A CA  1 
ATOM   471  C  C   . GLY A 1 91  ? -4.450  31.628 57.867 1.00 22.57  ? 87  GLY A C   1 
ATOM   472  O  O   . GLY A 1 91  ? -3.350  32.072 58.212 1.00 21.90  ? 87  GLY A O   1 
ATOM   473  N  N   . VAL A 1 92  ? -5.552  32.344 58.001 1.00 23.16  ? 88  VAL A N   1 
ATOM   474  C  CA  . VAL A 1 92  ? -5.454  33.677 58.599 1.00 23.33  ? 88  VAL A CA  1 
ATOM   475  C  C   . VAL A 1 92  ? -4.975  33.549 60.054 1.00 23.12  ? 88  VAL A C   1 
ATOM   476  O  O   . VAL A 1 92  ? -5.400  32.643 60.756 1.00 22.11  ? 88  VAL A O   1 
ATOM   477  C  CB  . VAL A 1 92  ? -6.806  34.412 58.478 1.00 23.85  ? 88  VAL A CB  1 
ATOM   478  C  CG1 . VAL A 1 92  ? -6.761  35.729 59.193 1.00 24.22  ? 88  VAL A CG1 1 
ATOM   479  C  CG2 . VAL A 1 92  ? -7.115  34.638 57.011 1.00 25.08  ? 88  VAL A CG2 1 
ATOM   480  N  N   . GLY A 1 93  ? -4.050  34.407 60.483 1.00 23.16  ? 89  GLY A N   1 
ATOM   481  C  CA  . GLY A 1 93  ? -3.548  34.328 61.838 1.00 23.68  ? 89  GLY A CA  1 
ATOM   482  C  C   . GLY A 1 93  ? -2.392  33.368 61.961 1.00 24.76  ? 89  GLY A C   1 
ATOM   483  O  O   . GLY A 1 93  ? -1.760  33.294 63.013 1.00 27.20  ? 89  GLY A O   1 
ATOM   484  N  N   . ASP A 1 94  ? -2.056  32.642 60.903 1.00 24.00  ? 90  ASP A N   1 
ATOM   485  C  CA  . ASP A 1 94  ? -0.901  31.756 61.033 1.00 23.38  ? 90  ASP A CA  1 
ATOM   486  C  C   . ASP A 1 94  ? 0.446   32.388 60.660 1.00 21.76  ? 90  ASP A C   1 
ATOM   487  O  O   . ASP A 1 94  ? 0.506   33.335 59.852 1.00 20.57  ? 90  ASP A O   1 
ATOM   488  C  CB  . ASP A 1 94  ? -1.083  30.495 60.238 1.00 23.94  ? 90  ASP A CB  1 
ATOM   489  C  CG  . ASP A 1 94  ? -2.330  29.718 60.641 1.00 27.44  ? 90  ASP A CG  1 
ATOM   490  O  OD1 . ASP A 1 94  ? -2.838  29.829 61.815 1.00 25.13  ? 90  ASP A OD1 1 
ATOM   491  O  OD2 . ASP A 1 94  ? -2.784  28.997 59.747 1.00 28.28  ? 90  ASP A OD2 1 
ATOM   492  N  N   . PHE A 1 95  ? 1.517   31.841 61.230 1.00 20.27  ? 91  PHE A N   1 
ATOM   493  C  CA  . PHE A 1 95  ? 2.885   32.296 60.937 1.00 20.29  ? 91  PHE A CA  1 
ATOM   494  C  C   . PHE A 1 95  ? 3.099   32.229 59.426 1.00 20.73  ? 91  PHE A C   1 
ATOM   495  O  O   . PHE A 1 95  ? 2.582   31.328 58.759 1.00 20.89  ? 91  PHE A O   1 
ATOM   496  C  CB  . PHE A 1 95  ? 3.920   31.406 61.676 1.00 20.17  ? 91  PHE A CB  1 
ATOM   497  C  CG  . PHE A 1 95  ? 5.380   31.778 61.404 1.00 19.05  ? 91  PHE A CG  1 
ATOM   498  C  CD1 . PHE A 1 95  ? 5.877   33.029 61.758 1.00 19.91  ? 91  PHE A CD1 1 
ATOM   499  C  CD2 . PHE A 1 95  ? 6.242   30.865 60.788 1.00 19.06  ? 91  PHE A CD2 1 
ATOM   500  C  CE1 . PHE A 1 95  ? 7.245   33.370 61.518 1.00 19.75  ? 91  PHE A CE1 1 
ATOM   501  C  CE2 . PHE A 1 95  ? 7.567   31.200 60.531 1.00 21.09  ? 91  PHE A CE2 1 
ATOM   502  C  CZ  . PHE A 1 95  ? 8.066   32.448 60.896 1.00 19.20  ? 91  PHE A CZ  1 
ATOM   503  N  N   . VAL A 1 96  ? 3.885   33.171 58.875 1.00 20.51  ? 92  VAL A N   1 
ATOM   504  C  CA  . VAL A 1 96  ? 4.199   33.160 57.436 1.00 18.52  ? 92  VAL A CA  1 
ATOM   505  C  C   . VAL A 1 96  ? 5.710   32.893 57.315 1.00 18.56  ? 92  VAL A C   1 
ATOM   506  O  O   . VAL A 1 96  ? 6.514   33.798 57.509 1.00 16.73  ? 92  VAL A O   1 
ATOM   507  C  CB  . VAL A 1 96  ? 3.823   34.511 56.757 1.00 18.75  ? 92  VAL A CB  1 
ATOM   508  C  CG1 . VAL A 1 96  ? 4.277   34.510 55.251 1.00 18.25  ? 92  VAL A CG1 1 
ATOM   509  C  CG2 . VAL A 1 96  ? 2.305   34.751 56.884 1.00 18.30  ? 92  VAL A CG2 1 
ATOM   510  N  N   . PRO A 1 97  ? 6.094   31.638 56.992 1.00 17.15  ? 93  PRO A N   1 
ATOM   511  C  CA  . PRO A 1 97  ? 7.494   31.262 56.880 1.00 18.27  ? 93  PRO A CA  1 
ATOM   512  C  C   . PRO A 1 97  ? 8.127   31.618 55.531 1.00 18.74  ? 93  PRO A C   1 
ATOM   513  O  O   . PRO A 1 97  ? 7.402   32.003 54.606 1.00 19.74  ? 93  PRO A O   1 
ATOM   514  C  CB  . PRO A 1 97  ? 7.446   29.721 57.077 1.00 18.03  ? 93  PRO A CB  1 
ATOM   515  C  CG  . PRO A 1 97  ? 6.090   29.317 56.505 1.00 17.53  ? 93  PRO A CG  1 
ATOM   516  C  CD  . PRO A 1 97  ? 5.163   30.516 56.702 1.00 17.17  ? 93  PRO A CD  1 
ATOM   517  N  N   . TYR A 1 98  ? 9.458   31.462 55.447 1.00 17.08  ? 94  TYR A N   1 
ATOM   518  C  CA  . TYR A 1 98  ? 10.299  31.668 54.256 1.00 17.25  ? 94  TYR A CA  1 
ATOM   519  C  C   . TYR A 1 98  ? 10.498  33.112 53.785 1.00 17.64  ? 94  TYR A C   1 
ATOM   520  O  O   . TYR A 1 98  ? 11.073  33.333 52.730 1.00 18.82  ? 94  TYR A O   1 
ATOM   521  C  CB  . TYR A 1 98  ? 9.840   30.779 53.076 1.00 18.06  ? 94  TYR A CB  1 
ATOM   522  C  CG  . TYR A 1 98  ? 9.860   29.322 53.400 1.00 16.39  ? 94  TYR A CG  1 
ATOM   523  C  CD1 . TYR A 1 98  ? 11.000  28.571 53.189 1.00 18.10  ? 94  TYR A CD1 1 
ATOM   524  C  CD2 . TYR A 1 98  ? 8.720   28.689 53.912 1.00 17.24  ? 94  TYR A CD2 1 
ATOM   525  C  CE1 . TYR A 1 98  ? 11.019  27.196 53.483 1.00 17.02  ? 94  TYR A CE1 1 
ATOM   526  C  CE2 . TYR A 1 98  ? 8.725   27.308 54.194 1.00 20.32  ? 94  TYR A CE2 1 
ATOM   527  C  CZ  . TYR A 1 98  ? 9.880   26.586 53.979 1.00 19.74  ? 94  TYR A CZ  1 
ATOM   528  O  OH  . TYR A 1 98  ? 9.925   25.243 54.247 1.00 16.64  ? 94  TYR A OH  1 
ATOM   529  N  N   . LEU A 1 99  ? 10.026  34.075 54.571 1.00 17.93  ? 95  LEU A N   1 
ATOM   530  C  CA  . LEU A 1 99  ? 10.201  35.509 54.222 1.00 17.52  ? 95  LEU A CA  1 
ATOM   531  C  C   . LEU A 1 99  ? 11.628  35.915 54.551 1.00 18.47  ? 95  LEU A C   1 
ATOM   532  O  O   . LEU A 1 99  ? 12.324  35.203 55.290 1.00 17.11  ? 95  LEU A O   1 
ATOM   533  C  CB  . LEU A 1 99  ? 9.204   36.378 54.998 1.00 17.42  ? 95  LEU A CB  1 
ATOM   534  C  CG  . LEU A 1 99  ? 7.730   35.943 54.941 1.00 17.52  ? 95  LEU A CG  1 
ATOM   535  C  CD1 . LEU A 1 99  ? 6.869   36.866 55.791 1.00 20.06  ? 95  LEU A CD1 1 
ATOM   536  C  CD2 . LEU A 1 99  ? 7.147   35.805 53.494 1.00 18.01  ? 95  LEU A CD2 1 
ATOM   537  N  N   . ARG A 1 100 ? 12.074  37.050 53.996 1.00 18.27  ? 96  ARG A N   1 
ATOM   538  C  CA  . ARG A 1 100 ? 13.415  37.535 54.229 1.00 18.75  ? 96  ARG A CA  1 
ATOM   539  C  C   . ARG A 1 100 ? 13.142  38.897 54.855 1.00 18.77  ? 96  ARG A C   1 
ATOM   540  O  O   . ARG A 1 100 ? 12.710  39.848 54.182 1.00 19.03  ? 96  ARG A O   1 
ATOM   541  C  CB  . ARG A 1 100 ? 14.169  37.619 52.925 1.00 19.14  ? 96  ARG A CB  1 
ATOM   542  C  CG  . ARG A 1 100 ? 14.314  36.252 52.218 1.00 20.37  ? 96  ARG A CG  1 
ATOM   543  C  CD  . ARG A 1 100 ? 14.811  36.358 50.793 1.00 26.00  ? 96  ARG A CD  1 
ATOM   544  N  NE  . ARG A 1 100 ? 13.762  36.726 49.831 1.00 25.66  ? 96  ARG A NE  1 
ATOM   545  C  CZ  . ARG A 1 100 ? 14.012  37.192 48.607 1.00 29.22  ? 96  ARG A CZ  1 
ATOM   546  N  NH1 . ARG A 1 100 ? 15.270  37.315 48.191 1.00 32.56  ? 96  ARG A NH1 1 
ATOM   547  N  NH2 . ARG A 1 100 ? 13.024  37.533 47.790 1.00 26.00  ? 96  ARG A NH2 1 
ATOM   548  N  N   . VAL A 1 101 ? 13.392  38.978 56.151 1.00 18.81  ? 97  VAL A N   1 
ATOM   549  C  CA  . VAL A 1 101 ? 13.121  40.195 56.935 1.00 18.32  ? 97  VAL A CA  1 
ATOM   550  C  C   . VAL A 1 101 ? 14.417  40.826 57.303 1.00 19.07  ? 97  VAL A C   1 
ATOM   551  O  O   . VAL A 1 101 ? 15.352  40.125 57.747 1.00 18.12  ? 97  VAL A O   1 
ATOM   552  C  CB  . VAL A 1 101 ? 12.352  39.833 58.186 1.00 19.26  ? 97  VAL A CB  1 
ATOM   553  C  CG1 . VAL A 1 101 ? 12.073  41.077 59.041 1.00 18.61  ? 97  VAL A CG1 1 
ATOM   554  C  CG2 . VAL A 1 101 ? 10.997  39.212 57.806 1.00 18.87  ? 97  VAL A CG2 1 
ATOM   555  N  N   . VAL A 1 102 ? 14.510  42.132 57.067 1.00 19.00  ? 98  VAL A N   1 
ATOM   556  C  CA  . VAL A 1 102 ? 15.718  42.902 57.349 1.00 18.90  ? 98  VAL A CA  1 
ATOM   557  C  C   . VAL A 1 102 ? 15.286  44.147 58.126 1.00 19.49  ? 98  VAL A C   1 
ATOM   558  O  O   . VAL A 1 102 ? 14.317  44.825 57.721 1.00 18.51  ? 98  VAL A O   1 
ATOM   559  C  CB  . VAL A 1 102 ? 16.446  43.346 56.013 1.00 19.37  ? 98  VAL A CB  1 
ATOM   560  C  CG1 . VAL A 1 102 ? 17.685  44.196 56.295 1.00 20.80  ? 98  VAL A CG1 1 
ATOM   561  C  CG2 . VAL A 1 102 ? 16.922  42.134 55.167 1.00 17.90  ? 98  VAL A CG2 1 
ATOM   562  N  N   . ALA A 1 103 ? 15.976  44.462 59.228 1.00 18.33  ? 99  ALA A N   1 
ATOM   563  C  CA  . ALA A 1 103 ? 15.625  45.651 59.975 1.00 17.94  ? 99  ALA A CA  1 
ATOM   564  C  C   . ALA A 1 103 ? 16.641  46.741 59.740 1.00 18.02  ? 99  ALA A C   1 
ATOM   565  O  O   . ALA A 1 103 ? 17.834  46.471 59.604 1.00 18.20  ? 99  ALA A O   1 
ATOM   566  C  CB  . ALA A 1 103 ? 15.509  45.374 61.495 1.00 18.32  ? 99  ALA A CB  1 
ATOM   567  N  N   . PHE A 1 104 ? 16.171  47.980 59.772 1.00 17.71  ? 100 PHE A N   1 
ATOM   568  C  CA  . PHE A 1 104 ? 17.051  49.143 59.626 1.00 17.89  ? 100 PHE A CA  1 
ATOM   569  C  C   . PHE A 1 104 ? 16.778  50.003 60.835 1.00 17.92  ? 100 PHE A C   1 
ATOM   570  O  O   . PHE A 1 104 ? 15.621  50.270 61.144 1.00 17.68  ? 100 PHE A O   1 
ATOM   571  C  CB  . PHE A 1 104 ? 16.731  49.918 58.349 1.00 18.12  ? 100 PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 104 ? 16.990  49.114 57.098 1.00 19.54  ? 100 PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 104 ? 16.035  48.245 56.603 1.00 19.98  ? 100 PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 104 ? 18.236  49.168 56.478 1.00 18.08  ? 100 PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 104 ? 16.300  47.464 55.473 1.00 17.70  ? 100 PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 104 ? 18.483  48.408 55.348 1.00 19.94  ? 100 PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 104 ? 17.506  47.566 54.852 1.00 20.48  ? 100 PHE A CZ  1 
ATOM   578  N  N   . LEU A 1 105 ? 17.840  50.469 61.489 1.00 18.15  ? 101 LEU A N   1 
ATOM   579  C  CA  . LEU A 1 105 ? 17.709  51.301 62.675 1.00 18.12  ? 101 LEU A CA  1 
ATOM   580  C  C   . LEU A 1 105 ? 18.462  52.579 62.389 1.00 17.91  ? 101 LEU A C   1 
ATOM   581  O  O   . LEU A 1 105 ? 19.611  52.533 61.921 1.00 18.34  ? 101 LEU A O   1 
ATOM   582  C  CB  . LEU A 1 105 ? 18.338  50.611 63.891 1.00 18.15  ? 101 LEU A CB  1 
ATOM   583  C  CG  . LEU A 1 105 ? 18.069  49.118 64.084 1.00 23.10  ? 101 LEU A CG  1 
ATOM   584  C  CD1 . LEU A 1 105 ? 18.875  48.567 65.249 1.00 23.07  ? 101 LEU A CD1 1 
ATOM   585  C  CD2 . LEU A 1 105 ? 16.649  48.998 64.393 1.00 21.76  ? 101 LEU A CD2 1 
ATOM   586  N  N   . GLN A 1 106 ? 17.853  53.709 62.695 1.00 17.16  ? 102 GLN A N   1 
ATOM   587  C  CA  . GLN A 1 106 ? 18.508  54.985 62.451 1.00 18.55  ? 102 GLN A CA  1 
ATOM   588  C  C   . GLN A 1 106 ? 18.149  55.968 63.579 1.00 18.75  ? 102 GLN A C   1 
ATOM   589  O  O   . GLN A 1 106 ? 16.980  56.306 63.778 1.00 18.91  ? 102 GLN A O   1 
ATOM   590  C  CB  . GLN A 1 106 ? 18.131  55.511 61.061 1.00 18.32  ? 102 GLN A CB  1 
ATOM   591  C  CG  . GLN A 1 106 ? 18.805  56.824 60.694 1.00 19.38  ? 102 GLN A CG  1 
ATOM   592  C  CD  . GLN A 1 106 ? 18.286  57.370 59.393 1.00 22.01  ? 102 GLN A CD  1 
ATOM   593  O  OE1 . GLN A 1 106 ? 17.442  56.748 58.741 1.00 23.41  ? 102 GLN A OE1 1 
ATOM   594  N  NE2 . GLN A 1 106 ? 18.789  58.536 58.999 1.00 22.14  ? 102 GLN A NE2 1 
ATOM   595  N  N   . LYS A 1 107 ? 19.157  56.376 64.333 1.00 19.08  ? 103 LYS A N   1 
ATOM   596  C  CA  . LYS A 1 107 ? 18.941  57.297 65.462 1.00 19.63  ? 103 LYS A CA  1 
ATOM   597  C  C   . LYS A 1 107 ? 18.497  58.636 64.924 1.00 20.25  ? 103 LYS A C   1 
ATOM   598  O  O   . LYS A 1 107 ? 18.967  59.070 63.877 1.00 20.27  ? 103 LYS A O   1 
ATOM   599  C  CB  . LYS A 1 107 ? 20.216  57.468 66.287 1.00 19.91  ? 103 LYS A CB  1 
ATOM   600  C  CG  . LYS A 1 107 ? 19.992  58.200 67.621 1.00 18.93  ? 103 LYS A CG  1 
ATOM   601  C  CD  . LYS A 1 107 ? 21.198  58.103 68.500 1.00 23.81  ? 103 LYS A CD  1 
ATOM   602  C  CE  . LYS A 1 107 ? 20.856  58.648 69.884 1.00 26.62  ? 103 LYS A CE  1 
ATOM   603  N  NZ  . LYS A 1 107 ? 22.109  58.827 70.718 1.00 28.60  ? 103 LYS A NZ  1 
ATOM   604  N  N   . HIS A 1 108 ? 17.581  59.288 65.638 1.00 20.83  ? 104 HIS A N   1 
ATOM   605  C  CA  . HIS A 1 108 ? 17.087  60.572 65.214 1.00 21.13  ? 104 HIS A CA  1 
ATOM   606  C  C   . HIS A 1 108 ? 18.236  61.535 65.189 1.00 21.85  ? 104 HIS A C   1 
ATOM   607  O  O   . HIS A 1 108 ? 19.108  61.482 66.047 1.00 21.42  ? 104 HIS A O   1 
ATOM   608  C  CB  . HIS A 1 108 ? 16.025  61.053 66.189 1.00 21.57  ? 104 HIS A CB  1 
ATOM   609  C  CG  . HIS A 1 108 ? 14.682  60.448 65.944 1.00 21.07  ? 104 HIS A CG  1 
ATOM   610  N  ND1 . HIS A 1 108 ? 13.510  61.077 66.296 1.00 23.76  ? 104 HIS A ND1 1 
ATOM   611  C  CD2 . HIS A 1 108 ? 14.320  59.272 65.372 1.00 21.00  ? 104 HIS A CD2 1 
ATOM   612  C  CE1 . HIS A 1 108 ? 12.483  60.314 65.965 1.00 19.19  ? 104 HIS A CE1 1 
ATOM   613  N  NE2 . HIS A 1 108 ? 12.949  59.214 65.399 1.00 19.98  ? 104 HIS A NE2 1 
ATOM   614  N  N   . GLY A 1 109 ? 18.262  62.387 64.175 1.00 23.04  ? 105 GLY A N   1 
ATOM   615  C  CA  . GLY A 1 109 ? 19.352  63.363 64.046 1.00 23.94  ? 105 GLY A CA  1 
ATOM   616  C  C   . GLY A 1 109 ? 20.656  62.777 63.517 1.00 24.58  ? 105 GLY A C   1 
ATOM   617  O  O   . GLY A 1 109 ? 21.675  63.476 63.522 1.00 25.18  ? 105 GLY A O   1 
ATOM   618  N  N   . SER A 1 110 ? 20.629  61.516 63.060 1.00 23.08  ? 106 SER A N   1 
ATOM   619  C  CA  . SER A 1 110 ? 21.807  60.821 62.527 1.00 23.01  ? 106 SER A CA  1 
ATOM   620  C  C   . SER A 1 110 ? 21.640  60.365 61.100 1.00 22.64  ? 106 SER A C   1 
ATOM   621  O  O   . SER A 1 110 ? 20.535  60.038 60.681 1.00 22.50  ? 106 SER A O   1 
ATOM   622  C  CB  . SER A 1 110 ? 22.095  59.572 63.364 1.00 23.05  ? 106 SER A CB  1 
ATOM   623  O  OG  . SER A 1 110 ? 23.301  58.934 62.951 1.00 23.69  ? 106 SER A OG  1 
ATOM   624  N  N   . GLU A 1 111 ? 22.735  60.285 60.351 1.00 23.04  ? 107 GLU A N   1 
ATOM   625  C  CA  . GLU A 1 111 ? 22.640  59.794 58.960 1.00 23.98  ? 107 GLU A CA  1 
ATOM   626  C  C   . GLU A 1 111 ? 23.037  58.319 58.869 1.00 22.71  ? 107 GLU A C   1 
ATOM   627  O  O   . GLU A 1 111 ? 22.853  57.666 57.832 1.00 22.98  ? 107 GLU A O   1 
ATOM   628  C  CB  . GLU A 1 111 ? 23.492  60.636 58.001 1.00 23.88  ? 107 GLU A CB  1 
ATOM   629  C  CG  . GLU A 1 111 ? 22.796  61.911 57.514 1.00 26.17  ? 107 GLU A CG  1 
ATOM   630  C  CD  . GLU A 1 111 ? 23.498  62.545 56.319 1.00 28.08  ? 107 GLU A CD  1 
ATOM   631  O  OE1 . GLU A 1 111 ? 23.417  61.968 55.194 1.00 34.85  ? 107 GLU A OE1 1 
ATOM   632  O  OE2 . GLU A 1 111 ? 24.118  63.622 56.497 1.00 30.23  ? 107 GLU A OE2 1 
ATOM   633  N  N   . LYS A 1 112 ? 23.553  57.785 59.968 1.00 21.22  ? 108 LYS A N   1 
ATOM   634  C  CA  . LYS A 1 112 ? 23.998  56.399 60.005 1.00 21.57  ? 108 LYS A CA  1 
ATOM   635  C  C   . LYS A 1 112 ? 22.813  55.477 60.111 1.00 20.44  ? 108 LYS A C   1 
ATOM   636  O  O   . LYS A 1 112 ? 21.916  55.685 60.929 1.00 20.59  ? 108 LYS A O   1 
ATOM   637  C  CB  . LYS A 1 112 ? 24.949  56.143 61.178 1.00 20.38  ? 108 LYS A CB  1 
ATOM   638  C  CG  . LYS A 1 112 ? 26.193  56.989 61.193 1.00 24.29  ? 108 LYS A CG  1 
ATOM   639  C  CD  . LYS A 1 112 ? 27.237  56.430 62.194 1.00 25.05  ? 108 LYS A CD  1 
ATOM   640  C  CE  . LYS A 1 112 ? 28.354  57.423 62.490 1.00 31.18  ? 108 LYS A CE  1 
ATOM   641  N  NZ  . LYS A 1 112 ? 29.577  56.779 63.114 1.00 30.95  ? 108 LYS A NZ  1 
ATOM   642  N  N   . VAL A 1 113 ? 22.818  54.431 59.300 1.00 19.88  ? 109 VAL A N   1 
ATOM   643  C  CA  . VAL A 1 113 ? 21.747  53.478 59.336 1.00 20.09  ? 109 VAL A CA  1 
ATOM   644  C  C   . VAL A 1 113 ? 22.359  52.104 59.598 1.00 20.09  ? 109 VAL A C   1 
ATOM   645  O  O   . VAL A 1 113 ? 23.359  51.762 58.979 1.00 19.84  ? 109 VAL A O   1 
ATOM   646  C  CB  . VAL A 1 113 ? 20.969  53.493 57.983 1.00 20.40  ? 109 VAL A CB  1 
ATOM   647  C  CG1 . VAL A 1 113 ? 19.828  52.443 57.941 1.00 21.87  ? 109 VAL A CG1 1 
ATOM   648  C  CG2 . VAL A 1 113 ? 20.426  54.904 57.714 1.00 19.09  ? 109 VAL A CG2 1 
ATOM   649  N  N   . GLN A 1 114 ? 21.761  51.324 60.506 1.00 19.73  ? 110 GLN A N   1 
ATOM   650  C  CA  . GLN A 1 114 ? 22.249  49.975 60.779 1.00 20.21  ? 110 GLN A CA  1 
ATOM   651  C  C   . GLN A 1 114 ? 21.370  49.040 60.005 1.00 20.33  ? 110 GLN A C   1 
ATOM   652  O  O   . GLN A 1 114 ? 20.151  49.211 59.990 1.00 19.15  ? 110 GLN A O   1 
ATOM   653  C  CB  . GLN A 1 114 ? 22.059  49.591 62.244 1.00 21.08  ? 110 GLN A CB  1 
ATOM   654  C  CG  . GLN A 1 114 ? 23.043  50.173 63.193 1.00 22.89  ? 110 GLN A CG  1 
ATOM   655  C  CD  . GLN A 1 114 ? 22.719  49.811 64.655 1.00 21.16  ? 110 GLN A CD  1 
ATOM   656  O  OE1 . GLN A 1 114 ? 22.487  50.710 65.504 1.00 23.95  ? 110 GLN A OE1 1 
ATOM   657  N  NE2 . GLN A 1 114 ? 22.676  48.508 64.947 1.00 23.22  ? 110 GLN A NE2 1 
ATOM   658  N  N   . LYS A 1 115 ? 21.953  48.046 59.367 1.00 20.17  ? 111 LYS A N   1 
ATOM   659  C  CA  . LYS A 1 115 ? 21.141  47.087 58.642 1.00 20.08  ? 111 LYS A CA  1 
ATOM   660  C  C   . LYS A 1 115 ? 21.346  45.793 59.380 1.00 21.35  ? 111 LYS A C   1 
ATOM   661  O  O   . LYS A 1 115 ? 22.500  45.382 59.597 1.00 21.72  ? 111 LYS A O   1 
ATOM   662  C  CB  . LYS A 1 115 ? 21.629  46.951 57.209 1.00 21.01  ? 111 LYS A CB  1 
ATOM   663  C  CG  . LYS A 1 115 ? 20.924  45.828 56.440 1.00 22.96  ? 111 LYS A CG  1 
ATOM   664  C  CD  . LYS A 1 115 ? 21.406  45.844 55.005 1.00 27.31  ? 111 LYS A CD  1 
ATOM   665  C  CE  . LYS A 1 115 ? 20.990  44.585 54.300 1.00 28.29  ? 111 LYS A CE  1 
ATOM   666  N  NZ  . LYS A 1 115 ? 21.535  44.645 52.910 1.00 33.96  ? 111 LYS A NZ  1 
ATOM   667  N  N   . VAL A 1 116 ? 20.264  45.157 59.783 1.00 20.12  ? 112 VAL A N   1 
ATOM   668  C  CA  . VAL A 1 116 ? 20.343  43.922 60.551 1.00 21.65  ? 112 VAL A CA  1 
ATOM   669  C  C   . VAL A 1 116 ? 19.499  42.845 59.900 1.00 22.48  ? 112 VAL A C   1 
ATOM   670  O  O   . VAL A 1 116 ? 18.269  42.988 59.781 1.00 20.90  ? 112 VAL A O   1 
ATOM   671  C  CB  . VAL A 1 116 ? 19.756  44.136 61.963 1.00 21.82  ? 112 VAL A CB  1 
ATOM   672  C  CG1 . VAL A 1 116 ? 19.693  42.826 62.756 1.00 22.86  ? 112 VAL A CG1 1 
ATOM   673  C  CG2 . VAL A 1 116 ? 20.489  45.214 62.719 1.00 24.31  ? 112 VAL A CG2 1 
ATOM   674  N  N   . MET A 1 117 ? 20.131  41.748 59.502 1.00 22.08  ? 113 MET A N   1 
ATOM   675  C  CA  . MET A 1 117 ? 19.365  40.680 58.884 1.00 25.91  ? 113 MET A CA  1 
ATOM   676  C  C   . MET A 1 117 ? 18.713  39.770 59.952 1.00 24.11  ? 113 MET A C   1 
ATOM   677  O  O   . MET A 1 117 ? 19.398  39.207 60.778 1.00 25.19  ? 113 MET A O   1 
ATOM   678  C  CB  . MET A 1 117 ? 20.271  39.876 57.961 1.00 25.88  ? 113 MET A CB  1 
ATOM   679  C  CG  . MET A 1 117 ? 20.741  40.626 56.683 1.00 28.09  ? 113 MET A CG  1 
ATOM   680  S  SD  . MET A 1 117 ? 21.652  39.430 55.682 1.00 37.03  ? 113 MET A SD  1 
ATOM   681  C  CE  . MET A 1 117 ? 20.660  37.906 55.794 1.00 35.25  ? 113 MET A CE  1 
ATOM   682  N  N   . PHE A 1 118 ? 17.389  39.650 59.947 1.00 21.02  ? 114 PHE A N   1 
ATOM   683  C  CA  . PHE A 1 118 ? 16.711  38.804 60.916 1.00 19.51  ? 114 PHE A CA  1 
ATOM   684  C  C   . PHE A 1 118 ? 16.807  37.351 60.451 1.00 19.55  ? 114 PHE A C   1 
ATOM   685  O  O   . PHE A 1 118 ? 16.995  37.077 59.247 1.00 20.03  ? 114 PHE A O   1 
ATOM   686  C  CB  . PHE A 1 118 ? 15.243  39.231 61.071 1.00 19.72  ? 114 PHE A CB  1 
ATOM   687  C  CG  . PHE A 1 118 ? 15.033  40.412 62.000 1.00 19.99  ? 114 PHE A CG  1 
ATOM   688  C  CD1 . PHE A 1 118 ? 16.084  41.261 62.350 1.00 17.80  ? 114 PHE A CD1 1 
ATOM   689  C  CD2 . PHE A 1 118 ? 13.756  40.674 62.498 1.00 20.46  ? 114 PHE A CD2 1 
ATOM   690  C  CE1 . PHE A 1 118 ? 15.881  42.366 63.244 1.00 19.90  ? 114 PHE A CE1 1 
ATOM   691  C  CE2 . PHE A 1 118 ? 13.528  41.748 63.343 1.00 22.04  ? 114 PHE A CE2 1 
ATOM   692  C  CZ  . PHE A 1 118 ? 14.583  42.596 63.735 1.00 20.61  ? 114 PHE A CZ  1 
ATOM   693  N  N   . ALA A 1 119 ? 16.725  36.409 61.387 1.00 17.38  ? 115 ALA A N   1 
ATOM   694  C  CA  . ALA A 1 119 ? 16.796  34.998 61.016 1.00 16.04  ? 115 ALA A CA  1 
ATOM   695  C  C   . ALA A 1 119 ? 15.514  34.356 61.509 1.00 16.51  ? 115 ALA A C   1 
ATOM   696  O  O   . ALA A 1 119 ? 14.981  34.811 62.502 1.00 15.47  ? 115 ALA A O   1 
ATOM   697  C  CB  . ALA A 1 119 ? 17.951  34.372 61.737 1.00 18.53  ? 115 ALA A CB  1 
ATOM   698  N  N   . PRO A 1 120 ? 15.025  33.291 60.851 1.00 15.71  ? 116 PRO A N   1 
ATOM   699  C  CA  . PRO A 1 120 ? 13.834  32.615 61.413 1.00 16.77  ? 116 PRO A CA  1 
ATOM   700  C  C   . PRO A 1 120 ? 14.267  31.707 62.582 1.00 16.77  ? 116 PRO A C   1 
ATOM   701  O  O   . PRO A 1 120 ? 15.372  31.141 62.572 1.00 15.48  ? 116 PRO A O   1 
ATOM   702  C  CB  . PRO A 1 120 ? 13.307  31.770 60.246 1.00 17.17  ? 116 PRO A CB  1 
ATOM   703  C  CG  . PRO A 1 120 ? 14.536  31.505 59.412 1.00 17.05  ? 116 PRO A CG  1 
ATOM   704  C  CD  . PRO A 1 120 ? 15.487  32.663 59.586 1.00 16.59  ? 116 PRO A CD  1 
ATOM   705  N  N   . MET A 1 121 ? 13.430  31.631 63.601 1.00 16.35  ? 117 MET A N   1 
ATOM   706  C  CA  . MET A 1 121 ? 13.797  30.847 64.779 1.00 18.08  ? 117 MET A CA  1 
ATOM   707  C  C   . MET A 1 121 ? 12.619  30.614 65.680 1.00 17.73  ? 117 MET A C   1 
ATOM   708  O  O   . MET A 1 121 ? 11.573  31.286 65.542 1.00 19.93  ? 117 MET A O   1 
ATOM   709  C  CB  . MET A 1 121 ? 14.888  31.630 65.585 1.00 17.24  ? 117 MET A CB  1 
ATOM   710  C  CG  . MET A 1 121 ? 14.332  32.954 66.212 1.00 19.35  ? 117 MET A CG  1 
ATOM   711  S  SD  . MET A 1 121 ? 15.604  33.951 67.047 1.00 19.44  ? 117 MET A SD  1 
ATOM   712  C  CE  . MET A 1 121 ? 16.561  34.444 65.629 1.00 17.59  ? 117 MET A CE  1 
ATOM   713  N  N   . ASN A 1 122 ? 12.769  29.665 66.593 1.00 17.81  ? 118 ASN A N   1 
ATOM   714  C  CA  . ASN A 1 122 ? 11.740  29.403 67.580 1.00 20.03  ? 118 ASN A CA  1 
ATOM   715  C  C   . ASN A 1 122 ? 12.202  29.879 68.959 1.00 20.24  ? 118 ASN A C   1 
ATOM   716  O  O   . ASN A 1 122 ? 13.385  29.701 69.332 1.00 18.64  ? 118 ASN A O   1 
ATOM   717  C  CB  . ASN A 1 122 ? 11.446  27.900 67.760 1.00 20.56  ? 118 ASN A CB  1 
ATOM   718  C  CG  . ASN A 1 122 ? 10.572  27.319 66.678 1.00 23.30  ? 118 ASN A CG  1 
ATOM   719  O  OD1 . ASN A 1 122 ? 10.125  28.004 65.755 1.00 20.84  ? 118 ASN A OD1 1 
ATOM   720  N  ND2 . ASN A 1 122 ? 10.340  26.016 66.773 1.00 23.35  ? 118 ASN A ND2 1 
ATOM   721  N  N   . ALA A 1 123 ? 11.246  30.422 69.720 1.00 20.42  ? 119 ALA A N   1 
ATOM   722  C  CA  . ALA A 1 123 ? 11.409  30.801 71.127 1.00 21.30  ? 119 ALA A CA  1 
ATOM   723  C  C   . ALA A 1 123 ? 10.313  29.935 71.781 1.00 22.52  ? 119 ALA A C   1 
ATOM   724  O  O   . ALA A 1 123 ? 9.666   29.118 71.111 1.00 21.40  ? 119 ALA A O   1 
ATOM   725  C  CB  . ALA A 1 123 ? 11.156  32.293 71.365 1.00 20.71  ? 119 ALA A CB  1 
ATOM   726  N  N   . GLY A 1 124 ? 10.118  30.067 73.084 1.00 23.68  ? 120 GLY A N   1 
ATOM   727  C  CA  . GLY A 1 124 ? 9.101   29.266 73.757 1.00 25.43  ? 120 GLY A CA  1 
ATOM   728  C  C   . GLY A 1 124 ? 7.717   29.605 73.262 1.00 26.72  ? 120 GLY A C   1 
ATOM   729  O  O   . GLY A 1 124 ? 6.801   28.806 73.391 1.00 28.26  ? 120 GLY A O   1 
ATOM   730  N  N   . ASP A 1 125 ? 7.566   30.765 72.642 1.00 27.41  ? 121 ASP A N   1 
ATOM   731  C  CA  . ASP A 1 125 ? 6.260   31.113 72.128 1.00 28.21  ? 121 ASP A CA  1 
ATOM   732  C  C   . ASP A 1 125 ? 6.099   30.882 70.622 1.00 27.46  ? 121 ASP A C   1 
ATOM   733  O  O   . ASP A 1 125 ? 5.161   31.392 70.026 1.00 28.25  ? 121 ASP A O   1 
ATOM   734  C  CB  . ASP A 1 125 ? 5.817   32.503 72.585 1.00 29.36  ? 121 ASP A CB  1 
ATOM   735  C  CG  . ASP A 1 125 ? 6.663   33.607 71.994 1.00 32.77  ? 121 ASP A CG  1 
ATOM   736  O  OD1 . ASP A 1 125 ? 7.833   33.337 71.632 1.00 33.83  ? 121 ASP A OD1 1 
ATOM   737  O  OD2 . ASP A 1 125 ? 6.142   34.747 71.900 1.00 38.24  ? 121 ASP A OD2 1 
ATOM   738  N  N   . GLY A 1 126 ? 6.987   30.079 70.026 1.00 25.86  ? 122 GLY A N   1 
ATOM   739  C  CA  . GLY A 1 126 ? 6.879   29.697 68.626 1.00 23.73  ? 122 GLY A CA  1 
ATOM   740  C  C   . GLY A 1 126 ? 7.741   30.411 67.598 1.00 23.34  ? 122 GLY A C   1 
ATOM   741  O  O   . GLY A 1 126 ? 8.594   31.234 67.944 1.00 22.77  ? 122 GLY A O   1 
ATOM   742  N  N   . PRO A 1 127 ? 7.513   30.095 66.315 1.00 21.70  ? 123 PRO A N   1 
ATOM   743  C  CA  . PRO A 1 127 ? 8.334   30.669 65.279 1.00 21.28  ? 123 PRO A CA  1 
ATOM   744  C  C   . PRO A 1 127 ? 8.130   32.170 65.083 1.00 20.11  ? 123 PRO A C   1 
ATOM   745  O  O   . PRO A 1 127 ? 6.990   32.696 65.245 1.00 19.38  ? 123 PRO A O   1 
ATOM   746  C  CB  . PRO A 1 127 ? 7.900   29.921 64.015 1.00 20.21  ? 123 PRO A CB  1 
ATOM   747  C  CG  . PRO A 1 127 ? 7.204   28.702 64.485 1.00 23.66  ? 123 PRO A CG  1 
ATOM   748  C  CD  . PRO A 1 127 ? 6.510   29.158 65.760 1.00 22.60  ? 123 PRO A CD  1 
ATOM   749  N  N   . HIS A 1 128 ? 9.217   32.844 64.711 1.00 17.76  ? 124 HIS A N   1 
ATOM   750  C  CA  . HIS A 1 128 ? 9.210   34.310 64.420 1.00 17.56  ? 124 HIS A CA  1 
ATOM   751  C  C   . HIS A 1 128 ? 10.532  34.645 63.716 1.00 17.21  ? 124 HIS A C   1 
ATOM   752  O  O   . HIS A 1 128 ? 11.341  33.774 63.528 1.00 16.84  ? 124 HIS A O   1 
ATOM   753  C  CB  . HIS A 1 128 ? 9.145   35.124 65.720 1.00 18.04  ? 124 HIS A CB  1 
ATOM   754  C  CG  . HIS A 1 128 ? 10.290  34.838 66.643 1.00 18.24  ? 124 HIS A CG  1 
ATOM   755  N  ND1 . HIS A 1 128 ? 10.315  33.742 67.487 1.00 19.54  ? 124 HIS A ND1 1 
ATOM   756  C  CD2 . HIS A 1 128 ? 11.471  35.479 66.820 1.00 18.89  ? 124 HIS A CD2 1 
ATOM   757  C  CE1 . HIS A 1 128 ? 11.453  33.743 68.161 1.00 19.24  ? 124 HIS A CE1 1 
ATOM   758  N  NE2 . HIS A 1 128 ? 12.172  34.776 67.762 1.00 19.34  ? 124 HIS A NE2 1 
ATOM   759  N  N   . TYR A 1 129 ? 10.757  35.912 63.343 1.00 16.29  ? 125 TYR A N   1 
ATOM   760  C  CA  . TYR A 1 129 ? 12.006  36.294 62.716 1.00 16.90  ? 125 TYR A CA  1 
ATOM   761  C  C   . TYR A 1 129 ? 12.646  37.203 63.758 1.00 17.48  ? 125 TYR A C   1 
ATOM   762  O  O   . TYR A 1 129 ? 11.931  37.961 64.437 1.00 15.67  ? 125 TYR A O   1 
ATOM   763  C  CB  . TYR A 1 129 ? 11.748  37.099 61.445 1.00 17.43  ? 125 TYR A CB  1 
ATOM   764  C  CG  . TYR A 1 129 ? 11.036  36.272 60.379 1.00 17.37  ? 125 TYR A CG  1 
ATOM   765  C  CD1 . TYR A 1 129 ? 9.643   36.229 60.333 1.00 18.14  ? 125 TYR A CD1 1 
ATOM   766  C  CD2 . TYR A 1 129 ? 11.773  35.510 59.463 1.00 18.55  ? 125 TYR A CD2 1 
ATOM   767  C  CE1 . TYR A 1 129 ? 8.990   35.456 59.354 1.00 16.72  ? 125 TYR A CE1 1 
ATOM   768  C  CE2 . TYR A 1 129 ? 11.127  34.745 58.478 1.00 16.32  ? 125 TYR A CE2 1 
ATOM   769  C  CZ  . TYR A 1 129 ? 9.746   34.716 58.464 1.00 17.17  ? 125 TYR A CZ  1 
ATOM   770  O  OH  . TYR A 1 129 ? 9.104   33.964 57.513 1.00 17.60  ? 125 TYR A OH  1 
ATOM   771  N  N   . GLY A 1 130 ? 13.960  37.144 63.928 1.00 16.70  ? 126 GLY A N   1 
ATOM   772  C  CA  . GLY A 1 130 ? 14.527  38.060 64.951 1.00 18.12  ? 126 GLY A CA  1 
ATOM   773  C  C   . GLY A 1 130 ? 16.037  38.115 64.959 1.00 18.07  ? 126 GLY A C   1 
ATOM   774  O  O   . GLY A 1 130 ? 16.690  37.425 64.189 1.00 18.76  ? 126 GLY A O   1 
ATOM   775  N  N   . ALA A 1 131 ? 16.592  38.971 65.817 1.00 17.85  ? 127 ALA A N   1 
ATOM   776  C  CA  . ALA A 1 131 ? 18.041  39.083 65.940 1.00 17.32  ? 127 ALA A CA  1 
ATOM   777  C  C   . ALA A 1 131 ? 18.434  39.686 67.260 1.00 17.37  ? 127 ALA A C   1 
ATOM   778  O  O   . ALA A 1 131 ? 17.690  40.496 67.791 1.00 17.61  ? 127 ALA A O   1 
ATOM   779  C  CB  . ALA A 1 131 ? 18.637  40.006 64.829 1.00 17.10  ? 127 ALA A CB  1 
ATOM   780  N  N   . ASN A 1 132 ? 19.620  39.318 67.738 1.00 18.39  ? 128 ASN A N   1 
ATOM   781  C  CA  . ASN A 1 132 ? 20.232  39.995 68.880 1.00 18.35  ? 128 ASN A CA  1 
ATOM   782  C  C   . ASN A 1 132 ? 20.784  41.213 68.132 1.00 18.50  ? 128 ASN A C   1 
ATOM   783  O  O   . ASN A 1 132 ? 21.286  41.067 67.018 1.00 18.44  ? 128 ASN A O   1 
ATOM   784  C  CB  . ASN A 1 132 ? 21.379  39.209 69.477 1.00 18.16  ? 128 ASN A CB  1 
ATOM   785  C  CG  . ASN A 1 132 ? 20.921  38.217 70.532 1.00 18.90  ? 128 ASN A CG  1 
ATOM   786  O  OD1 . ASN A 1 132 ? 19.732  38.158 70.885 1.00 14.64  ? 128 ASN A OD1 1 
ATOM   787  N  ND2 . ASN A 1 132 ? 21.848  37.451 71.039 1.00 18.00  ? 128 ASN A ND2 1 
ATOM   788  N  N   A VAL A 1 133 ? 20.642  42.399 68.729 0.50 18.90  ? 129 VAL A N   1 
ATOM   789  N  N   B VAL A 1 133 ? 20.749  42.390 68.744 0.50 18.40  ? 129 VAL A N   1 
ATOM   790  C  CA  A VAL A 1 133 ? 21.012  43.675 68.126 0.50 18.42  ? 129 VAL A CA  1 
ATOM   791  C  CA  B VAL A 1 133 ? 21.279  43.581 68.098 0.50 17.46  ? 129 VAL A CA  1 
ATOM   792  C  C   A VAL A 1 133 ? 21.681  44.636 69.113 0.50 18.49  ? 129 VAL A C   1 
ATOM   793  C  C   B VAL A 1 133 ? 21.932  44.467 69.134 0.50 17.92  ? 129 VAL A C   1 
ATOM   794  O  O   A VAL A 1 133 ? 21.309  44.614 70.286 0.50 17.06  ? 129 VAL A O   1 
ATOM   795  O  O   B VAL A 1 133 ? 21.804  44.241 70.337 0.50 16.94  ? 129 VAL A O   1 
ATOM   796  C  CB  A VAL A 1 133 ? 19.657  44.385 67.733 0.50 19.42  ? 129 VAL A CB  1 
ATOM   797  C  CB  B VAL A 1 133 ? 20.170  44.432 67.380 0.50 18.05  ? 129 VAL A CB  1 
ATOM   798  C  CG1 A VAL A 1 133 ? 19.831  45.875 67.421 0.50 19.63  ? 129 VAL A CG1 1 
ATOM   799  C  CG1 B VAL A 1 133 ? 19.568  43.688 66.225 0.50 16.96  ? 129 VAL A CG1 1 
ATOM   800  C  CG2 A VAL A 1 133 ? 18.935  43.661 66.622 0.50 18.03  ? 129 VAL A CG2 1 
ATOM   801  C  CG2 B VAL A 1 133 ? 19.049  44.891 68.371 0.50 15.81  ? 129 VAL A CG2 1 
ATOM   802  N  N   . LYS A 1 134 ? 22.619  45.490 68.637 1.00 18.25  ? 130 LYS A N   1 
ATOM   803  C  CA  . LYS A 1 134 ? 23.237  46.522 69.463 1.00 19.63  ? 130 LYS A CA  1 
ATOM   804  C  C   . LYS A 1 134 ? 22.645  47.833 68.919 1.00 20.42  ? 130 LYS A C   1 
ATOM   805  O  O   . LYS A 1 134 ? 22.423  47.955 67.697 1.00 21.40  ? 130 LYS A O   1 
ATOM   806  C  CB  . LYS A 1 134 ? 24.751  46.583 69.280 1.00 21.06  ? 130 LYS A CB  1 
ATOM   807  C  CG  . LYS A 1 134 ? 25.461  45.463 69.980 1.00 20.76  ? 130 LYS A CG  1 
ATOM   808  C  CD  . LYS A 1 134 ? 26.959  45.793 70.341 1.00 26.40  ? 130 LYS A CD  1 
ATOM   809  C  CE  . LYS A 1 134 ? 27.794  46.372 69.215 1.00 23.55  ? 130 LYS A CE  1 
ATOM   810  N  NZ  . LYS A 1 134 ? 29.309  46.422 69.528 1.00 21.36  ? 130 LYS A NZ  1 
ATOM   811  N  N   . PHE A 1 135 ? 22.362  48.819 69.762 1.00 18.59  ? 131 PHE A N   1 
ATOM   812  C  CA  . PHE A 1 135 ? 21.907  50.092 69.203 1.00 19.46  ? 131 PHE A CA  1 
ATOM   813  C  C   . PHE A 1 135 ? 23.220  50.869 69.158 1.00 19.31  ? 131 PHE A C   1 
ATOM   814  O  O   . PHE A 1 135 ? 23.714  51.382 70.158 1.00 18.56  ? 131 PHE A O   1 
ATOM   815  C  CB  . PHE A 1 135 ? 20.867  50.733 70.059 1.00 18.75  ? 131 PHE A CB  1 
ATOM   816  C  CG  . PHE A 1 135 ? 19.518  50.130 69.893 1.00 20.98  ? 131 PHE A CG  1 
ATOM   817  C  CD1 . PHE A 1 135 ? 18.670  50.569 68.870 1.00 22.11  ? 131 PHE A CD1 1 
ATOM   818  C  CD2 . PHE A 1 135 ? 19.080  49.121 70.753 1.00 20.33  ? 131 PHE A CD2 1 
ATOM   819  C  CE1 . PHE A 1 135 ? 17.396  50.028 68.731 1.00 22.01  ? 131 PHE A CE1 1 
ATOM   820  C  CE2 . PHE A 1 135 ? 17.792  48.588 70.624 1.00 21.09  ? 131 PHE A CE2 1 
ATOM   821  C  CZ  . PHE A 1 135 ? 16.968  49.030 69.624 1.00 22.40  ? 131 PHE A CZ  1 
ATOM   822  N  N   . GLU A 1 136 ? 23.815  50.896 67.982 1.00 20.35  ? 132 GLU A N   1 
ATOM   823  C  CA  . GLU A 1 136 ? 25.164  51.452 67.837 1.00 20.44  ? 132 GLU A CA  1 
ATOM   824  C  C   . GLU A 1 136 ? 25.399  52.913 68.162 1.00 20.75  ? 132 GLU A C   1 
ATOM   825  O  O   . GLU A 1 136 ? 26.511  53.265 68.418 1.00 20.63  ? 132 GLU A O   1 
ATOM   826  C  CB  . GLU A 1 136 ? 25.739  51.066 66.475 1.00 22.33  ? 132 GLU A CB  1 
ATOM   827  C  CG  . GLU A 1 136 ? 25.714  49.555 66.254 1.00 24.27  ? 132 GLU A CG  1 
ATOM   828  C  CD  . GLU A 1 136 ? 26.196  49.164 64.878 1.00 30.84  ? 132 GLU A CD  1 
ATOM   829  O  OE1 . GLU A 1 136 ? 26.490  50.082 64.063 1.00 32.27  ? 132 GLU A OE1 1 
ATOM   830  O  OE2 . GLU A 1 136 ? 26.285  47.932 64.617 1.00 33.53  ? 132 GLU A OE2 1 
ATOM   831  N  N   . GLU A 1 137 ? 24.342  53.732 68.211 1.00 20.57  ? 133 GLU A N   1 
ATOM   832  C  CA  . GLU A 1 137 ? 24.513  55.130 68.548 1.00 21.41  ? 133 GLU A CA  1 
ATOM   833  C  C   . GLU A 1 137 ? 24.009  55.468 69.958 1.00 20.13  ? 133 GLU A C   1 
ATOM   834  O  O   . GLU A 1 137 ? 23.838  56.635 70.323 1.00 21.38  ? 133 GLU A O   1 
ATOM   835  C  CB  . GLU A 1 137 ? 23.967  56.044 67.449 1.00 21.16  ? 133 GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 137 ? 24.831  55.988 66.202 1.00 26.30  ? 133 GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 137 ? 24.648  57.196 65.320 1.00 28.85  ? 133 GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 137 ? 23.573  57.311 64.720 1.00 30.28  ? 133 GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 137 ? 25.571  58.028 65.237 1.00 30.59  ? 133 GLU A OE2 1 
ATOM   840  N  N   . GLY A 1 138 ? 23.852  54.427 70.768 1.00 18.25  ? 134 GLY A N   1 
ATOM   841  C  CA  . GLY A 1 138 ? 23.477  54.605 72.136 1.00 17.89  ? 134 GLY A CA  1 
ATOM   842  C  C   . GLY A 1 138 ? 22.032  54.908 72.394 1.00 17.54  ? 134 GLY A C   1 
ATOM   843  O  O   . GLY A 1 138 ? 21.192  54.735 71.507 1.00 17.96  ? 134 GLY A O   1 
ATOM   844  N  N   . LEU A 1 139 ? 21.766  55.370 73.608 1.00 17.87  ? 135 LEU A N   1 
ATOM   845  C  CA  . LEU A 1 139 ? 20.418  55.696 74.098 1.00 18.18  ? 135 LEU A CA  1 
ATOM   846  C  C   . LEU A 1 139 ? 19.808  56.811 73.311 1.00 18.25  ? 135 LEU A C   1 
ATOM   847  O  O   . LEU A 1 139 ? 20.488  57.804 72.982 1.00 19.49  ? 135 LEU A O   1 
ATOM   848  C  CB  . LEU A 1 139 ? 20.481  56.164 75.558 1.00 18.72  ? 135 LEU A CB  1 
ATOM   849  C  CG  . LEU A 1 139 ? 20.995  55.169 76.591 1.00 19.45  ? 135 LEU A CG  1 
ATOM   850  C  CD1 . LEU A 1 139 ? 21.176  55.914 77.917 1.00 25.00  ? 135 LEU A CD1 1 
ATOM   851  C  CD2 . LEU A 1 139 ? 20.044  53.971 76.742 1.00 20.16  ? 135 LEU A CD2 1 
ATOM   852  N  N   . GLY A 1 140 ? 18.534  56.677 73.028 1.00 19.31  ? 136 GLY A N   1 
ATOM   853  C  CA  . GLY A 1 140 ? 17.828  57.743 72.310 1.00 20.27  ? 136 GLY A CA  1 
ATOM   854  C  C   . GLY A 1 140 ? 16.688  57.231 71.475 1.00 19.31  ? 136 GLY A C   1 
ATOM   855  O  O   . GLY A 1 140 ? 16.343  56.055 71.552 1.00 20.29  ? 136 GLY A O   1 
ATOM   856  N  N   . THR A 1 141 ? 16.132  58.116 70.642 1.00 18.16  ? 137 THR A N   1 
ATOM   857  C  CA  . THR A 1 141 ? 14.998  57.764 69.787 1.00 17.49  ? 137 THR A CA  1 
ATOM   858  C  C   . THR A 1 141 ? 15.530  57.282 68.457 1.00 17.82  ? 137 THR A C   1 
ATOM   859  O  O   . THR A 1 141 ? 16.429  57.887 67.890 1.00 17.31  ? 137 THR A O   1 
ATOM   860  C  CB  . THR A 1 141 ? 14.097  58.974 69.571 1.00 18.34  ? 137 THR A CB  1 
ATOM   861  O  OG1 . THR A 1 141 ? 13.934  59.683 70.824 1.00 18.20  ? 137 THR A OG1 1 
ATOM   862  C  CG2 . THR A 1 141 ? 12.731  58.547 69.025 1.00 15.94  ? 137 THR A CG2 1 
ATOM   863  N  N   . TYR A 1 142 ? 14.982  56.167 67.992 1.00 17.36  ? 138 TYR A N   1 
ATOM   864  C  CA  . TYR A 1 142 ? 15.387  55.576 66.745 1.00 18.69  ? 138 TYR A CA  1 
ATOM   865  C  C   . TYR A 1 142 ? 14.199  55.337 65.830 1.00 19.29  ? 138 TYR A C   1 
ATOM   866  O  O   . TYR A 1 142 ? 13.090  55.044 66.306 1.00 19.79  ? 138 TYR A O   1 
ATOM   867  C  CB  . TYR A 1 142 ? 15.978  54.165 66.997 1.00 18.39  ? 138 TYR A CB  1 
ATOM   868  C  CG  . TYR A 1 142 ? 17.390  54.164 67.517 1.00 15.80  ? 138 TYR A CG  1 
ATOM   869  C  CD1 . TYR A 1 142 ? 17.656  54.458 68.845 1.00 19.30  ? 138 TYR A CD1 1 
ATOM   870  C  CD2 . TYR A 1 142 ? 18.449  53.871 66.685 1.00 17.91  ? 138 TYR A CD2 1 
ATOM   871  C  CE1 . TYR A 1 142 ? 18.998  54.445 69.337 1.00 11.85  ? 138 TYR A CE1 1 
ATOM   872  C  CE2 . TYR A 1 142 ? 19.780  53.859 67.157 1.00 17.87  ? 138 TYR A CE2 1 
ATOM   873  C  CZ  . TYR A 1 142 ? 20.022  54.159 68.475 1.00 17.63  ? 138 TYR A CZ  1 
ATOM   874  O  OH  . TYR A 1 142 ? 21.313  54.199 68.954 1.00 17.14  ? 138 TYR A OH  1 
ATOM   875  N  N   . LYS A 1 143 ? 14.443  55.423 64.513 1.00 19.48  ? 139 LYS A N   1 
ATOM   876  C  CA  . LYS A 1 143 ? 13.454  55.050 63.527 1.00 20.79  ? 139 LYS A CA  1 
ATOM   877  C  C   . LYS A 1 143 ? 13.789  53.556 63.376 1.00 19.83  ? 139 LYS A C   1 
ATOM   878  O  O   . LYS A 1 143 ? 14.989  53.201 63.269 1.00 18.41  ? 139 LYS A O   1 
ATOM   879  C  CB  . LYS A 1 143 ? 13.685  55.825 62.225 1.00 19.67  ? 139 LYS A CB  1 
ATOM   880  C  CG  . LYS A 1 143 ? 13.048  55.244 61.021 1.00 26.53  ? 139 LYS A CG  1 
ATOM   881  C  CD  . LYS A 1 143 ? 13.024  56.247 59.824 1.00 25.90  ? 139 LYS A CD  1 
ATOM   882  C  CE  . LYS A 1 143 ? 13.176  55.507 58.469 1.00 36.37  ? 139 LYS A CE  1 
ATOM   883  N  NZ  . LYS A 1 143 ? 13.011  53.998 58.605 1.00 36.12  ? 139 LYS A NZ  1 
ATOM   884  N  N   . VAL A 1 144 ? 12.771  52.685 63.385 1.00 17.74  ? 140 VAL A N   1 
ATOM   885  C  CA  . VAL A 1 144 ? 12.983  51.229 63.264 1.00 17.46  ? 140 VAL A CA  1 
ATOM   886  C  C   . VAL A 1 144 ? 12.100  50.807 62.110 1.00 18.62  ? 140 VAL A C   1 
ATOM   887  O  O   . VAL A 1 144 ? 10.895  51.120 62.093 1.00 19.08  ? 140 VAL A O   1 
ATOM   888  C  CB  . VAL A 1 144 ? 12.600  50.451 64.543 1.00 17.41  ? 140 VAL A CB  1 
ATOM   889  C  CG1 . VAL A 1 144 ? 12.623  48.899 64.285 1.00 17.24  ? 140 VAL A CG1 1 
ATOM   890  C  CG2 . VAL A 1 144 ? 13.503  50.836 65.720 1.00 17.20  ? 140 VAL A CG2 1 
ATOM   891  N  N   . ARG A 1 145 ? 12.695  50.146 61.131 1.00 17.39  ? 141 ARG A N   1 
ATOM   892  C  CA  . ARG A 1 145 ? 11.958  49.747 59.941 1.00 19.62  ? 141 ARG A CA  1 
ATOM   893  C  C   . ARG A 1 145 ? 12.255  48.319 59.583 1.00 18.82  ? 141 ARG A C   1 
ATOM   894  O  O   . ARG A 1 145 ? 13.424  47.932 59.493 1.00 20.39  ? 141 ARG A O   1 
ATOM   895  C  CB  . ARG A 1 145 ? 12.375  50.700 58.800 1.00 19.07  ? 141 ARG A CB  1 
ATOM   896  C  CG  . ARG A 1 145 ? 12.083  50.267 57.350 1.00 22.53  ? 141 ARG A CG  1 
ATOM   897  C  CD  . ARG A 1 145 ? 12.679  51.367 56.434 1.00 21.84  ? 141 ARG A CD  1 
ATOM   898  N  NE  . ARG A 1 145 ? 12.336  51.186 55.022 1.00 27.13  ? 141 ARG A NE  1 
ATOM   899  C  CZ  . ARG A 1 145 ? 11.536  51.995 54.314 1.00 27.51  ? 141 ARG A CZ  1 
ATOM   900  N  NH1 . ARG A 1 145 ? 11.000  53.078 54.862 1.00 30.46  ? 141 ARG A NH1 1 
ATOM   901  N  NH2 . ARG A 1 145 ? 11.287  51.732 53.033 1.00 26.40  ? 141 ARG A NH2 1 
ATOM   902  N  N   . PHE A 1 146 ? 11.205  47.536 59.411 1.00 18.19  ? 142 PHE A N   1 
ATOM   903  C  CA  . PHE A 1 146 ? 11.361  46.153 59.028 1.00 19.17  ? 142 PHE A CA  1 
ATOM   904  C  C   . PHE A 1 146 ? 10.939  46.112 57.555 1.00 18.82  ? 142 PHE A C   1 
ATOM   905  O  O   . PHE A 1 146 ? 9.802   46.544 57.235 1.00 20.05  ? 142 PHE A O   1 
ATOM   906  C  CB  . PHE A 1 146 ? 10.382  45.252 59.779 1.00 18.58  ? 142 PHE A CB  1 
ATOM   907  C  CG  . PHE A 1 146 ? 10.620  45.087 61.287 1.00 21.98  ? 142 PHE A CG  1 
ATOM   908  C  CD1 . PHE A 1 146 ? 11.790  45.537 61.935 1.00 21.89  ? 142 PHE A CD1 1 
ATOM   909  C  CD2 . PHE A 1 146 ? 9.630   44.437 62.062 1.00 23.86  ? 142 PHE A CD2 1 
ATOM   910  C  CE1 . PHE A 1 146 ? 11.938  45.349 63.324 1.00 18.87  ? 142 PHE A CE1 1 
ATOM   911  C  CE2 . PHE A 1 146 ? 9.790   44.236 63.451 1.00 23.20  ? 142 PHE A CE2 1 
ATOM   912  C  CZ  . PHE A 1 146 ? 10.912  44.698 64.070 1.00 22.35  ? 142 PHE A CZ  1 
ATOM   913  N  N   . GLU A 1 147 ? 11.787  45.589 56.662 1.00 18.19  ? 143 GLU A N   1 
ATOM   914  C  CA  . GLU A 1 147 ? 11.450  45.449 55.222 1.00 17.16  ? 143 GLU A CA  1 
ATOM   915  C  C   . GLU A 1 147 ? 11.305  43.969 55.042 1.00 18.03  ? 143 GLU A C   1 
ATOM   916  O  O   . GLU A 1 147 ? 12.209  43.219 55.390 1.00 17.55  ? 143 GLU A O   1 
ATOM   917  C  CB  . GLU A 1 147 ? 12.508  46.012 54.273 1.00 18.48  ? 143 GLU A CB  1 
ATOM   918  C  CG  . GLU A 1 147 ? 12.607  47.555 54.403 1.00 19.10  ? 143 GLU A CG  1 
ATOM   919  C  CD  . GLU A 1 147 ? 13.529  48.179 53.384 1.00 21.77  ? 143 GLU A CD  1 
ATOM   920  O  OE1 . GLU A 1 147 ? 14.112  47.441 52.573 1.00 20.23  ? 143 GLU A OE1 1 
ATOM   921  O  OE2 . GLU A 1 147 ? 13.689  49.417 53.404 1.00 23.00  ? 143 GLU A OE2 1 
ATOM   922  N  N   . ILE A 1 148 ? 10.128  43.554 54.566 1.00 17.41  ? 144 ILE A N   1 
ATOM   923  C  CA  . ILE A 1 148 ? 9.812   42.153 54.467 1.00 17.23  ? 144 ILE A CA  1 
ATOM   924  C  C   . ILE A 1 148 ? 9.626   41.727 53.011 1.00 18.72  ? 144 ILE A C   1 
ATOM   925  O  O   . ILE A 1 148 ? 8.638   42.116 52.371 1.00 19.13  ? 144 ILE A O   1 
ATOM   926  C  CB  . ILE A 1 148 ? 8.503   41.877 55.268 1.00 18.28  ? 144 ILE A CB  1 
ATOM   927  C  CG1 . ILE A 1 148 ? 8.606   42.465 56.709 1.00 17.92  ? 144 ILE A CG1 1 
ATOM   928  C  CG2 . ILE A 1 148 ? 8.134   40.332 55.205 1.00 17.24  ? 144 ILE A CG2 1 
ATOM   929  C  CD1 . ILE A 1 148 ? 7.297   42.757 57.379 1.00 16.89  ? 144 ILE A CD1 1 
ATOM   930  N  N   . ALA A 1 149 ? 10.562  40.922 52.528 1.00 17.21  ? 145 ALA A N   1 
ATOM   931  C  CA  . ALA A 1 149 ? 10.555  40.423 51.157 1.00 17.14  ? 145 ALA A CA  1 
ATOM   932  C  C   . ALA A 1 149 ? 9.930   39.039 51.147 1.00 17.31  ? 145 ALA A C   1 
ATOM   933  O  O   . ALA A 1 149 ? 10.036  38.290 52.154 1.00 16.77  ? 145 ALA A O   1 
ATOM   934  C  CB  . ALA A 1 149 ? 11.970  40.365 50.613 1.00 16.21  ? 145 ALA A CB  1 
ATOM   935  N  N   . ALA A 1 150 ? 9.291   38.714 50.012 1.00 17.10  ? 146 ALA A N   1 
ATOM   936  C  CA  . ALA A 1 150 ? 8.647   37.433 49.815 1.00 17.83  ? 146 ALA A CA  1 
ATOM   937  C  C   . ALA A 1 150 ? 9.722   36.397 49.695 1.00 18.49  ? 146 ALA A C   1 
ATOM   938  O  O   . ALA A 1 150 ? 10.906  36.738 49.479 1.00 18.47  ? 146 ALA A O   1 
ATOM   939  C  CB  . ALA A 1 150 ? 7.837   37.449 48.514 1.00 17.64  ? 146 ALA A CB  1 
ATOM   940  N  N   . PRO A 1 151 ? 9.329   35.110 49.760 1.00 19.85  ? 147 PRO A N   1 
ATOM   941  C  CA  . PRO A 1 151 ? 10.357  34.091 49.630 1.00 21.04  ? 147 PRO A CA  1 
ATOM   942  C  C   . PRO A 1 151 ? 11.123  34.164 48.335 1.00 22.87  ? 147 PRO A C   1 
ATOM   943  O  O   . PRO A 1 151 ? 10.638  34.658 47.293 1.00 22.47  ? 147 PRO A O   1 
ATOM   944  C  CB  . PRO A 1 151 ? 9.582   32.754 49.750 1.00 20.31  ? 147 PRO A CB  1 
ATOM   945  C  CG  . PRO A 1 151 ? 8.290   33.118 50.422 1.00 20.11  ? 147 PRO A CG  1 
ATOM   946  C  CD  . PRO A 1 151 ? 7.983   34.533 49.952 1.00 19.16  ? 147 PRO A CD  1 
ATOM   947  N  N   . SER A 1 152 ? 12.368  33.725 48.409 1.00 25.73  ? 148 SER A N   1 
ATOM   948  C  CA  . SER A 1 152 ? 13.180  33.721 47.227 1.00 27.86  ? 148 SER A CA  1 
ATOM   949  C  C   . SER A 1 152 ? 12.532  32.803 46.200 1.00 28.45  ? 148 SER A C   1 
ATOM   950  O  O   . SER A 1 152 ? 11.833  31.817 46.528 1.00 27.43  ? 148 SER A O   1 
ATOM   951  C  CB  . SER A 1 152 ? 14.626  33.334 47.531 1.00 29.09  ? 148 SER A CB  1 
ATOM   952  O  OG  . SER A 1 152 ? 15.397  33.560 46.360 1.00 33.59  ? 148 SER A OG  1 
ATOM   953  N  N   . HIS A 1 153 ? 12.719  33.170 44.945 1.00 29.24  ? 149 HIS A N   1 
ATOM   954  C  CA  . HIS A 1 153 ? 12.154  32.451 43.822 1.00 31.08  ? 149 HIS A CA  1 
ATOM   955  C  C   . HIS A 1 153 ? 12.289  30.929 43.903 1.00 31.25  ? 149 HIS A C   1 
ATOM   956  O  O   . HIS A 1 153 ? 11.331  30.211 43.641 1.00 31.61  ? 149 HIS A O   1 
ATOM   957  C  CB  . HIS A 1 153 ? 12.771  32.991 42.518 1.00 32.14  ? 149 HIS A CB  1 
ATOM   958  C  CG  . HIS A 1 153 ? 11.876  32.851 41.323 1.00 35.22  ? 149 HIS A CG  1 
ATOM   959  N  ND1 . HIS A 1 153 ? 12.171  32.016 40.264 1.00 38.77  ? 149 HIS A ND1 1 
ATOM   960  C  CD2 . HIS A 1 153 ? 10.695  33.444 41.020 1.00 38.16  ? 149 HIS A CD2 1 
ATOM   961  C  CE1 . HIS A 1 153 ? 11.210  32.102 39.359 1.00 39.90  ? 149 HIS A CE1 1 
ATOM   962  N  NE2 . HIS A 1 153 ? 10.303  32.961 39.795 1.00 40.15  ? 149 HIS A NE2 1 
ATOM   963  N  N   . ASP A 1 154 ? 13.458  30.444 44.319 1.00 31.01  ? 150 ASP A N   1 
ATOM   964  C  CA  . ASP A 1 154 ? 13.707  28.999 44.425 1.00 31.82  ? 150 ASP A CA  1 
ATOM   965  C  C   . ASP A 1 154 ? 13.397  28.368 45.793 1.00 30.42  ? 150 ASP A C   1 
ATOM   966  O  O   . ASP A 1 154 ? 13.668  27.182 46.010 1.00 30.09  ? 150 ASP A O   1 
ATOM   967  C  CB  . ASP A 1 154 ? 15.166  28.704 44.029 1.00 33.17  ? 150 ASP A CB  1 
ATOM   968  C  CG  . ASP A 1 154 ? 15.480  29.093 42.565 1.00 37.11  ? 150 ASP A CG  1 
ATOM   969  O  OD1 . ASP A 1 154 ? 14.720  28.710 41.631 1.00 41.88  ? 150 ASP A OD1 1 
ATOM   970  O  OD2 . ASP A 1 154 ? 16.497  29.792 42.346 1.00 43.17  ? 150 ASP A OD2 1 
ATOM   971  N  N   . GLU A 1 155 ? 12.830  29.158 46.697 1.00 28.31  ? 151 GLU A N   1 
ATOM   972  C  CA  . GLU A 1 155 ? 12.505  28.732 48.074 1.00 27.28  ? 151 GLU A CA  1 
ATOM   973  C  C   . GLU A 1 155 ? 11.031  28.417 48.373 1.00 25.42  ? 151 GLU A C   1 
ATOM   974  O  O   . GLU A 1 155 ? 10.711  27.890 49.442 1.00 23.94  ? 151 GLU A O   1 
ATOM   975  C  CB  . GLU A 1 155 ? 12.918  29.847 49.066 1.00 27.37  ? 151 GLU A CB  1 
ATOM   976  C  CG  . GLU A 1 155 ? 14.443  30.039 49.239 1.00 32.53  ? 151 GLU A CG  1 
ATOM   977  C  CD  . GLU A 1 155 ? 15.224  28.787 48.947 1.00 39.72  ? 151 GLU A CD  1 
ATOM   978  O  OE1 . GLU A 1 155 ? 15.119  27.797 49.720 1.00 43.75  ? 151 GLU A OE1 1 
ATOM   979  O  OE2 . GLU A 1 155 ? 15.949  28.788 47.928 1.00 44.27  ? 151 GLU A OE2 1 
ATOM   980  N  N   . TYR A 1 156 ? 10.132  28.770 47.468 1.00 22.52  ? 152 TYR A N   1 
ATOM   981  C  CA  . TYR A 1 156 ? 8.722   28.520 47.744 1.00 20.81  ? 152 TYR A CA  1 
ATOM   982  C  C   . TYR A 1 156 ? 7.919   28.626 46.451 1.00 20.63  ? 152 TYR A C   1 
ATOM   983  O  O   . TYR A 1 156 ? 8.329   29.347 45.521 1.00 19.59  ? 152 TYR A O   1 
ATOM   984  C  CB  . TYR A 1 156 ? 8.224   29.580 48.768 1.00 20.17  ? 152 TYR A CB  1 
ATOM   985  C  CG  . TYR A 1 156 ? 7.110   29.099 49.653 1.00 18.93  ? 152 TYR A CG  1 
ATOM   986  C  CD1 . TYR A 1 156 ? 7.385   28.334 50.773 1.00 18.78  ? 152 TYR A CD1 1 
ATOM   987  C  CD2 . TYR A 1 156 ? 5.795   29.402 49.377 1.00 17.60  ? 152 TYR A CD2 1 
ATOM   988  C  CE1 . TYR A 1 156 ? 6.359   27.881 51.616 1.00 16.44  ? 152 TYR A CE1 1 
ATOM   989  C  CE2 . TYR A 1 156 ? 4.745   28.913 50.194 1.00 18.17  ? 152 TYR A CE2 1 
ATOM   990  C  CZ  . TYR A 1 156 ? 5.063   28.169 51.330 1.00 20.08  ? 152 TYR A CZ  1 
ATOM   991  O  OH  . TYR A 1 156 ? 4.100   27.648 52.167 1.00 21.74  ? 152 TYR A OH  1 
ATOM   992  N  N   . SER A 1 157 ? 6.767   27.942 46.402 1.00 18.43  ? 153 SER A N   1 
ATOM   993  C  CA  . SER A 1 157 ? 5.882   27.985 45.240 1.00 18.59  ? 153 SER A CA  1 
ATOM   994  C  C   . SER A 1 157 ? 4.419   28.059 45.641 1.00 17.14  ? 153 SER A C   1 
ATOM   995  O  O   . SER A 1 157 ? 4.065   27.869 46.797 1.00 17.62  ? 153 SER A O   1 
ATOM   996  C  CB  . SER A 1 157 ? 6.012   26.715 44.381 1.00 18.54  ? 153 SER A CB  1 
ATOM   997  O  OG  . SER A 1 157 ? 7.327   26.575 43.931 1.00 24.60  ? 153 SER A OG  1 
ATOM   998  N  N   . LEU A 1 158 ? 3.575   28.317 44.657 1.00 17.05  ? 154 LEU A N   1 
ATOM   999  C  CA  . LEU A 1 158 ? 2.142   28.376 44.869 1.00 16.47  ? 154 LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 158 ? 1.494   27.453 43.863 1.00 16.35  ? 154 LEU A C   1 
ATOM   1001 O  O   . LEU A 1 158 ? 1.941   27.411 42.711 1.00 16.90  ? 154 LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 158 ? 1.624   29.824 44.637 1.00 15.07  ? 154 LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 158 ? 2.122   30.882 45.644 1.00 14.99  ? 154 LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 158 ? 1.723   32.272 45.173 1.00 15.28  ? 154 LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 158 ? 1.636   30.645 47.101 1.00 14.81  ? 154 LEU A CD2 1 
ATOM   1006 N  N   . HIS A 1 159 ? 0.415   26.753 44.248 1.00 15.65  ? 155 HIS A N   1 
ATOM   1007 C  CA  . HIS A 1 159 ? -0.342  25.973 43.280 1.00 14.87  ? 155 HIS A CA  1 
ATOM   1008 C  C   . HIS A 1 159 ? -1.113  27.110 42.595 1.00 16.10  ? 155 HIS A C   1 
ATOM   1009 O  O   . HIS A 1 159 ? -1.678  27.975 43.301 1.00 15.15  ? 155 HIS A O   1 
ATOM   1010 C  CB  . HIS A 1 159 ? -1.451  25.192 43.929 1.00 15.18  ? 155 HIS A CB  1 
ATOM   1011 C  CG  . HIS A 1 159 ? -1.029  23.919 44.562 1.00 13.04  ? 155 HIS A CG  1 
ATOM   1012 N  ND1 . HIS A 1 159 ? -1.871  22.832 44.606 1.00 12.42  ? 155 HIS A ND1 1 
ATOM   1013 C  CD2 . HIS A 1 159 ? 0.128   23.540 45.158 1.00 14.83  ? 155 HIS A CD2 1 
ATOM   1014 C  CE1 . HIS A 1 159 ? -1.256  21.839 45.235 1.00 10.57  ? 155 HIS A CE1 1 
ATOM   1015 N  NE2 . HIS A 1 159 ? -0.052  22.247 45.586 1.00 12.34  ? 155 HIS A NE2 1 
ATOM   1016 N  N   . ILE A 1 160 ? -1.180  27.110 41.259 1.00 16.39  ? 156 ILE A N   1 
ATOM   1017 C  CA  . ILE A 1 160 ? -1.922  28.172 40.559 1.00 16.82  ? 156 ILE A CA  1 
ATOM   1018 C  C   . ILE A 1 160 ? -2.987  27.634 39.607 1.00 18.90  ? 156 ILE A C   1 
ATOM   1019 O  O   . ILE A 1 160 ? -3.565  28.389 38.831 1.00 18.19  ? 156 ILE A O   1 
ATOM   1020 C  CB  . ILE A 1 160 ? -0.999  29.121 39.816 1.00 16.59  ? 156 ILE A CB  1 
ATOM   1021 C  CG1 . ILE A 1 160 ? -0.229  28.382 38.727 1.00 16.91  ? 156 ILE A CG1 1 
ATOM   1022 C  CG2 . ILE A 1 160 ? -0.069  29.790 40.794 1.00 14.62  ? 156 ILE A CG2 1 
ATOM   1023 C  CD1 . ILE A 1 160 ? 0.217   29.256 37.607 1.00 19.01  ? 156 ILE A CD1 1 
ATOM   1024 N  N   . ASP A 1 161 ? -3.227  26.329 39.646 1.00 19.58  ? 157 ASP A N   1 
ATOM   1025 C  CA  . ASP A 1 161 ? -4.244  25.744 38.827 1.00 21.55  ? 157 ASP A CA  1 
ATOM   1026 C  C   . ASP A 1 161 ? -5.594  26.142 39.434 1.00 23.26  ? 157 ASP A C   1 
ATOM   1027 O  O   . ASP A 1 161 ? -5.701  26.416 40.636 1.00 23.15  ? 157 ASP A O   1 
ATOM   1028 C  CB  . ASP A 1 161 ? -4.101  24.222 38.771 1.00 21.56  ? 157 ASP A CB  1 
ATOM   1029 C  CG  . ASP A 1 161 ? -3.842  23.599 40.124 1.00 22.20  ? 157 ASP A CG  1 
ATOM   1030 O  OD1 . ASP A 1 161 ? -2.786  23.891 40.727 1.00 23.63  ? 157 ASP A OD1 1 
ATOM   1031 O  OD2 . ASP A 1 161 ? -4.695  22.796 40.590 1.00 25.36  ? 157 ASP A OD2 1 
ATOM   1032 N  N   . GLU A 1 162 ? -6.644  26.171 38.619 1.00 25.79  ? 158 GLU A N   1 
ATOM   1033 C  CA  . GLU A 1 162 ? -7.948  26.577 39.156 1.00 27.89  ? 158 GLU A CA  1 
ATOM   1034 C  C   . GLU A 1 162 ? -8.486  25.631 40.224 1.00 27.61  ? 158 GLU A C   1 
ATOM   1035 O  O   . GLU A 1 162 ? -8.930  26.072 41.279 1.00 28.05  ? 158 GLU A O   1 
ATOM   1036 C  CB  . GLU A 1 162 ? -8.959  26.838 38.041 1.00 29.13  ? 158 GLU A CB  1 
ATOM   1037 C  CG  . GLU A 1 162 ? -9.436  28.295 38.014 1.00 34.03  ? 158 GLU A CG  1 
ATOM   1038 C  CD  . GLU A 1 162 ? -10.921 28.436 38.377 1.00 41.61  ? 158 GLU A CD  1 
ATOM   1039 O  OE1 . GLU A 1 162 ? -11.632 27.392 38.415 1.00 42.59  ? 158 GLU A OE1 1 
ATOM   1040 O  OE2 . GLU A 1 162 ? -11.383 29.595 38.595 1.00 45.95  ? 158 GLU A OE2 1 
ATOM   1041 N  N   . GLN A 1 163 ? -8.394  24.331 39.967 1.00 27.83  ? 159 GLN A N   1 
ATOM   1042 C  CA  . GLN A 1 163 ? -8.887  23.328 40.898 1.00 27.79  ? 159 GLN A CA  1 
ATOM   1043 C  C   . GLN A 1 163 ? -8.376  23.419 42.343 1.00 27.15  ? 159 GLN A C   1 
ATOM   1044 O  O   . GLN A 1 163 ? -9.177  23.490 43.303 1.00 27.46  ? 159 GLN A O   1 
ATOM   1045 C  CB  . GLN A 1 163 ? -8.608  21.918 40.342 1.00 28.72  ? 159 GLN A CB  1 
ATOM   1046 C  CG  . GLN A 1 163 ? -9.690  21.358 39.469 1.00 33.12  ? 159 GLN A CG  1 
ATOM   1047 C  CD  . GLN A 1 163 ? -11.043 21.289 40.177 1.00 38.57  ? 159 GLN A CD  1 
ATOM   1048 O  OE1 . GLN A 1 163 ? -12.052 21.754 39.643 1.00 41.09  ? 159 GLN A OE1 1 
ATOM   1049 N  NE2 . GLN A 1 163 ? -11.062 20.729 41.388 1.00 40.20  ? 159 GLN A NE2 1 
ATOM   1050 N  N   . THR A 1 164 ? -7.049  23.400 42.518 1.00 24.49  ? 160 THR A N   1 
ATOM   1051 C  CA  . THR A 1 164 ? -6.508  23.412 43.835 1.00 22.64  ? 160 THR A CA  1 
ATOM   1052 C  C   . THR A 1 164 ? -5.661  24.651 44.208 1.00 22.20  ? 160 THR A C   1 
ATOM   1053 O  O   . THR A 1 164 ? -5.168  24.738 45.318 1.00 22.71  ? 160 THR A O   1 
ATOM   1054 C  CB  . THR A 1 164 ? -5.608  22.167 44.020 1.00 22.66  ? 160 THR A CB  1 
ATOM   1055 O  OG1 . THR A 1 164 ? -4.375  22.373 43.330 1.00 21.59  ? 160 THR A OG1 1 
ATOM   1056 C  CG2 . THR A 1 164 ? -6.274  20.903 43.443 1.00 23.73  ? 160 THR A CG2 1 
ATOM   1057 N  N   . GLY A 1 165 ? -5.487  25.593 43.291 1.00 21.28  ? 161 GLY A N   1 
ATOM   1058 C  CA  . GLY A 1 165 ? -4.604  26.725 43.586 1.00 21.18  ? 161 GLY A CA  1 
ATOM   1059 C  C   . GLY A 1 165 ? -5.186  27.950 44.229 1.00 21.26  ? 161 GLY A C   1 
ATOM   1060 O  O   . GLY A 1 165 ? -6.361  27.974 44.598 1.00 22.84  ? 161 GLY A O   1 
ATOM   1061 N  N   . VAL A 1 166 ? -4.346  28.976 44.303 1.00 19.47  ? 162 VAL A N   1 
ATOM   1062 C  CA  . VAL A 1 166 ? -4.656  30.253 44.921 1.00 18.94  ? 162 VAL A CA  1 
ATOM   1063 C  C   . VAL A 1 166 ? -4.756  31.318 43.842 1.00 18.58  ? 162 VAL A C   1 
ATOM   1064 O  O   . VAL A 1 166 ? -4.183  31.159 42.744 1.00 17.61  ? 162 VAL A O   1 
ATOM   1065 C  CB  . VAL A 1 166 ? -3.563  30.621 45.961 1.00 19.06  ? 162 VAL A CB  1 
ATOM   1066 C  CG1 . VAL A 1 166 ? -3.381  29.493 47.004 1.00 19.20  ? 162 VAL A CG1 1 
ATOM   1067 C  CG2 . VAL A 1 166 ? -2.252  30.897 45.281 1.00 18.18  ? 162 VAL A CG2 1 
ATOM   1068 N  N   A SER A 1 167 ? -5.501  32.385 44.139 0.50 17.75  ? 163 SER A N   1 
ATOM   1069 N  N   B SER A 1 167 ? -5.495  32.387 44.145 0.50 18.42  ? 163 SER A N   1 
ATOM   1070 C  CA  A SER A 1 167 ? -5.692  33.479 43.189 0.50 16.97  ? 163 SER A CA  1 
ATOM   1071 C  CA  B SER A 1 167 ? -5.686  33.492 43.206 0.50 18.43  ? 163 SER A CA  1 
ATOM   1072 C  C   A SER A 1 167 ? -4.782  34.675 43.501 0.50 17.20  ? 163 SER A C   1 
ATOM   1073 C  C   B SER A 1 167 ? -4.783  34.682 43.508 0.50 17.98  ? 163 SER A C   1 
ATOM   1074 O  O   A SER A 1 167 ? -4.730  35.626 42.721 0.50 17.00  ? 163 SER A O   1 
ATOM   1075 O  O   B SER A 1 167 ? -4.734  35.635 42.730 0.50 17.79  ? 163 SER A O   1 
ATOM   1076 C  CB  A SER A 1 167 ? -7.161  33.928 43.174 0.50 16.30  ? 163 SER A CB  1 
ATOM   1077 C  CB  B SER A 1 167 ? -7.145  33.950 43.200 0.50 18.09  ? 163 SER A CB  1 
ATOM   1078 O  OG  A SER A 1 167 ? -7.474  34.649 44.354 0.50 15.00  ? 163 SER A OG  1 
ATOM   1079 O  OG  B SER A 1 167 ? -7.800  33.447 42.064 0.50 21.93  ? 163 SER A OG  1 
ATOM   1080 N  N   . GLY A 1 168 ? -4.064  34.617 44.626 1.00 17.33  ? 164 GLY A N   1 
ATOM   1081 C  CA  . GLY A 1 168 ? -3.159  35.687 45.030 1.00 17.03  ? 164 GLY A CA  1 
ATOM   1082 C  C   . GLY A 1 168 ? -1.735  35.373 44.579 1.00 16.64  ? 164 GLY A C   1 
ATOM   1083 O  O   . GLY A 1 168 ? -1.459  34.340 43.929 1.00 16.39  ? 164 GLY A O   1 
ATOM   1084 N  N   . ARG A 1 169 ? -0.834  36.276 44.887 1.00 16.30  ? 165 ARG A N   1 
ATOM   1085 C  CA  . ARG A 1 169 ? 0.572   36.100 44.508 1.00 16.15  ? 165 ARG A CA  1 
ATOM   1086 C  C   . ARG A 1 169 ? 1.467   36.823 45.500 1.00 16.56  ? 165 ARG A C   1 
ATOM   1087 O  O   . ARG A 1 169 ? 0.991   37.654 46.257 1.00 17.58  ? 165 ARG A O   1 
ATOM   1088 C  CB  . ARG A 1 169 ? 0.815   36.679 43.118 1.00 15.96  ? 165 ARG A CB  1 
ATOM   1089 C  CG  . ARG A 1 169 ? 0.535   38.223 43.008 1.00 13.61  ? 165 ARG A CG  1 
ATOM   1090 C  CD  . ARG A 1 169 ? 1.044   38.799 41.667 1.00 15.87  ? 165 ARG A CD  1 
ATOM   1091 N  NE  . ARG A 1 169 ? 0.701   40.218 41.501 1.00 14.85  ? 165 ARG A NE  1 
ATOM   1092 C  CZ  . ARG A 1 169 ? 1.408   41.212 42.036 1.00 18.09  ? 165 ARG A CZ  1 
ATOM   1093 N  NH1 . ARG A 1 169 ? 2.484   40.933 42.739 1.00 15.38  ? 165 ARG A NH1 1 
ATOM   1094 N  NH2 . ARG A 1 169 ? 1.047   42.474 41.854 1.00 16.83  ? 165 ARG A NH2 1 
ATOM   1095 N  N   . PHE A 1 170 ? 2.756   36.518 45.486 1.00 16.70  ? 166 PHE A N   1 
ATOM   1096 C  CA  . PHE A 1 170 ? 3.669   37.183 46.390 1.00 17.53  ? 166 PHE A CA  1 
ATOM   1097 C  C   . PHE A 1 170 ? 3.889   38.597 45.872 1.00 18.38  ? 166 PHE A C   1 
ATOM   1098 O  O   . PHE A 1 170 ? 3.742   38.858 44.675 1.00 18.25  ? 166 PHE A O   1 
ATOM   1099 C  CB  . PHE A 1 170 ? 4.980   36.390 46.514 1.00 16.64  ? 166 PHE A CB  1 
ATOM   1100 C  CG  . PHE A 1 170 ? 4.856   35.157 47.403 1.00 17.56  ? 166 PHE A CG  1 
ATOM   1101 C  CD1 . PHE A 1 170 ? 4.688   35.296 48.772 1.00 19.48  ? 166 PHE A CD1 1 
ATOM   1102 C  CD2 . PHE A 1 170 ? 4.885   33.869 46.858 1.00 17.55  ? 166 PHE A CD2 1 
ATOM   1103 C  CE1 . PHE A 1 170 ? 4.536   34.167 49.607 1.00 17.28  ? 166 PHE A CE1 1 
ATOM   1104 C  CE2 . PHE A 1 170 ? 4.721   32.722 47.683 1.00 17.96  ? 166 PHE A CE2 1 
ATOM   1105 C  CZ  . PHE A 1 170 ? 4.574   32.878 49.040 1.00 19.88  ? 166 PHE A CZ  1 
ATOM   1106 N  N   . TRP A 1 171 ? 4.196   39.494 46.801 1.00 18.87  ? 167 TRP A N   1 
ATOM   1107 C  CA  . TRP A 1 171 ? 4.448   40.891 46.549 1.00 19.13  ? 167 TRP A CA  1 
ATOM   1108 C  C   . TRP A 1 171 ? 5.855   40.985 45.969 1.00 20.86  ? 167 TRP A C   1 
ATOM   1109 O  O   . TRP A 1 171 ? 6.744   40.174 46.280 1.00 20.64  ? 167 TRP A O   1 
ATOM   1110 C  CB  . TRP A 1 171 ? 4.275   41.684 47.865 1.00 17.82  ? 167 TRP A CB  1 
ATOM   1111 C  CG  . TRP A 1 171 ? 5.102   41.155 49.024 1.00 17.01  ? 167 TRP A CG  1 
ATOM   1112 C  CD1 . TRP A 1 171 ? 6.340   41.596 49.412 1.00 14.48  ? 167 TRP A CD1 1 
ATOM   1113 C  CD2 . TRP A 1 171 ? 4.762   40.076 49.930 1.00 17.82  ? 167 TRP A CD2 1 
ATOM   1114 N  NE1 . TRP A 1 171 ? 6.789   40.855 50.484 1.00 17.33  ? 167 TRP A NE1 1 
ATOM   1115 C  CE2 . TRP A 1 171 ? 5.839   39.921 50.821 1.00 15.04  ? 167 TRP A CE2 1 
ATOM   1116 C  CE3 . TRP A 1 171 ? 3.651   39.232 50.067 1.00 18.02  ? 167 TRP A CE3 1 
ATOM   1117 C  CZ2 . TRP A 1 171 ? 5.849   38.944 51.825 1.00 14.05  ? 167 TRP A CZ2 1 
ATOM   1118 C  CZ3 . TRP A 1 171 ? 3.665   38.260 51.091 1.00 17.84  ? 167 TRP A CZ3 1 
ATOM   1119 C  CH2 . TRP A 1 171 ? 4.757   38.127 51.936 1.00 16.76  ? 167 TRP A CH2 1 
ATOM   1120 N  N   . SER A 1 172 ? 6.049   41.968 45.110 1.00 21.19  ? 168 SER A N   1 
ATOM   1121 C  CA  . SER A 1 172 ? 7.304   42.142 44.455 1.00 24.36  ? 168 SER A CA  1 
ATOM   1122 C  C   . SER A 1 172 ? 8.142   43.111 45.282 1.00 25.63  ? 168 SER A C   1 
ATOM   1123 O  O   . SER A 1 172 ? 9.231   42.768 45.694 1.00 26.97  ? 168 SER A O   1 
ATOM   1124 C  CB  . SER A 1 172 ? 7.066   42.640 43.020 1.00 24.56  ? 168 SER A CB  1 
ATOM   1125 O  OG  . SER A 1 172 ? 8.269   42.618 42.307 1.00 29.41  ? 168 SER A OG  1 
ATOM   1126 N  N   . GLU A 1 173 ? 7.609   44.291 45.571 1.00 26.67  ? 169 GLU A N   1 
ATOM   1127 C  CA  . GLU A 1 173 ? 8.314   45.289 46.389 1.00 27.91  ? 169 GLU A CA  1 
ATOM   1128 C  C   . GLU A 1 173 ? 8.175   44.817 47.855 1.00 26.50  ? 169 GLU A C   1 
ATOM   1129 O  O   . GLU A 1 173 ? 7.055   44.515 48.262 1.00 26.14  ? 169 GLU A O   1 
ATOM   1130 C  CB  . GLU A 1 173 ? 7.634   46.642 46.155 1.00 28.05  ? 169 GLU A CB  1 
ATOM   1131 C  CG  . GLU A 1 173 ? 8.182   47.863 46.946 1.00 31.46  ? 169 GLU A CG  1 
ATOM   1132 C  CD  . GLU A 1 173 ? 7.351   49.156 46.736 1.00 32.18  ? 169 GLU A CD  1 
ATOM   1133 O  OE1 . GLU A 1 173 ? 6.350   49.145 45.970 1.00 37.36  ? 169 GLU A OE1 1 
ATOM   1134 O  OE2 . GLU A 1 173 ? 7.700   50.206 47.332 1.00 37.25  ? 169 GLU A OE2 1 
ATOM   1135 N  N   . PRO A 1 174 ? 9.292   44.733 48.632 1.00 26.08  ? 170 PRO A N   1 
ATOM   1136 C  CA  . PRO A 1 174 ? 9.207   44.359 50.059 1.00 25.83  ? 170 PRO A CA  1 
ATOM   1137 C  C   . PRO A 1 174 ? 8.231   45.244 50.824 1.00 24.75  ? 170 PRO A C   1 
ATOM   1138 O  O   . PRO A 1 174 ? 8.144   46.452 50.571 1.00 24.15  ? 170 PRO A O   1 
ATOM   1139 C  CB  . PRO A 1 174 ? 10.622  44.606 50.583 1.00 26.06  ? 170 PRO A CB  1 
ATOM   1140 C  CG  . PRO A 1 174 ? 11.488  44.364 49.365 1.00 28.05  ? 170 PRO A CG  1 
ATOM   1141 C  CD  . PRO A 1 174 ? 10.696  44.987 48.245 1.00 26.50  ? 170 PRO A CD  1 
ATOM   1142 N  N   . LEU A 1 175 ? 7.508   44.623 51.746 1.00 22.98  ? 171 LEU A N   1 
ATOM   1143 C  CA  . LEU A 1 175 ? 6.525   45.323 52.561 1.00 20.40  ? 171 LEU A CA  1 
ATOM   1144 C  C   . LEU A 1 175 ? 7.284   45.984 53.673 1.00 20.33  ? 171 LEU A C   1 
ATOM   1145 O  O   . LEU A 1 175 ? 8.327   45.492 54.073 1.00 19.20  ? 171 LEU A O   1 
ATOM   1146 C  CB  . LEU A 1 175 ? 5.515   44.312 53.089 1.00 20.09  ? 171 LEU A CB  1 
ATOM   1147 C  CG  . LEU A 1 175 ? 4.716   43.591 51.986 1.00 19.24  ? 171 LEU A CG  1 
ATOM   1148 C  CD1 . LEU A 1 175 ? 3.871   42.485 52.574 1.00 16.95  ? 171 LEU A CD1 1 
ATOM   1149 C  CD2 . LEU A 1 175 ? 3.843   44.563 51.157 1.00 20.12  ? 171 LEU A CD2 1 
ATOM   1150 N  N   . VAL A 1 176 ? 6.759   47.086 54.190 1.00 18.99  ? 172 VAL A N   1 
ATOM   1151 C  CA  . VAL A 1 176 ? 7.423   47.836 55.246 1.00 20.61  ? 172 VAL A CA  1 
ATOM   1152 C  C   . VAL A 1 176 ? 6.525   48.015 56.455 1.00 20.91  ? 172 VAL A C   1 
ATOM   1153 O  O   . VAL A 1 176 ? 5.365   48.450 56.293 1.00 20.08  ? 172 VAL A O   1 
ATOM   1154 C  CB  . VAL A 1 176 ? 7.760   49.286 54.737 1.00 20.86  ? 172 VAL A CB  1 
ATOM   1155 C  CG1 . VAL A 1 176 ? 8.274   50.221 55.860 1.00 21.33  ? 172 VAL A CG1 1 
ATOM   1156 C  CG2 . VAL A 1 176 ? 8.747   49.228 53.582 1.00 22.80  ? 172 VAL A CG2 1 
ATOM   1157 N  N   . ALA A 1 177 ? 7.055   47.696 57.641 1.00 19.25  ? 173 ALA A N   1 
ATOM   1158 C  CA  . ALA A 1 177 ? 6.382   47.924 58.917 1.00 19.85  ? 173 ALA A CA  1 
ATOM   1159 C  C   . ALA A 1 177 ? 7.376   48.840 59.619 1.00 20.55  ? 173 ALA A C   1 
ATOM   1160 O  O   . ALA A 1 177 ? 8.529   48.451 59.803 1.00 21.34  ? 173 ALA A O   1 
ATOM   1161 C  CB  . ALA A 1 177 ? 6.214   46.668 59.681 1.00 20.38  ? 173 ALA A CB  1 
ATOM   1162 N  N   . GLU A 1 178 ? 6.981   50.039 60.009 1.00 20.39  ? 174 GLU A N   1 
ATOM   1163 C  CA  . GLU A 1 178 ? 7.987   50.886 60.638 1.00 21.44  ? 174 GLU A CA  1 
ATOM   1164 C  C   . GLU A 1 178 ? 7.418   51.764 61.729 1.00 19.47  ? 174 GLU A C   1 
ATOM   1165 O  O   . GLU A 1 178 ? 6.213   52.081 61.734 1.00 17.71  ? 174 GLU A O   1 
ATOM   1166 C  CB  . GLU A 1 178 ? 8.743   51.717 59.599 1.00 21.48  ? 174 GLU A CB  1 
ATOM   1167 C  CG  . GLU A 1 178 ? 7.906   52.720 58.903 1.00 25.55  ? 174 GLU A CG  1 
ATOM   1168 C  CD  . GLU A 1 178 ? 8.694   53.538 57.854 1.00 27.90  ? 174 GLU A CD  1 
ATOM   1169 O  OE1 . GLU A 1 178 ? 9.970   53.558 57.876 1.00 32.59  ? 174 GLU A OE1 1 
ATOM   1170 O  OE2 . GLU A 1 178 ? 7.995   54.153 57.010 1.00 30.57  ? 174 GLU A OE2 1 
ATOM   1171 N  N   . TRP A 1 179 ? 8.309   52.104 62.645 1.00 18.15  ? 175 TRP A N   1 
ATOM   1172 C  CA  . TRP A 1 179 ? 8.016   52.914 63.832 1.00 19.11  ? 175 TRP A CA  1 
ATOM   1173 C  C   . TRP A 1 179 ? 9.032   54.048 63.854 1.00 19.53  ? 175 TRP A C   1 
ATOM   1174 O  O   . TRP A 1 179 ? 10.250  53.801 63.942 1.00 18.16  ? 175 TRP A O   1 
ATOM   1175 C  CB  . TRP A 1 179 ? 8.101   52.023 65.096 1.00 18.58  ? 175 TRP A CB  1 
ATOM   1176 C  CG  . TRP A 1 179 ? 7.112   50.848 65.017 1.00 16.62  ? 175 TRP A CG  1 
ATOM   1177 C  CD1 . TRP A 1 179 ? 5.804   50.849 65.386 1.00 17.56  ? 175 TRP A CD1 1 
ATOM   1178 C  CD2 . TRP A 1 179 ? 7.380   49.542 64.473 1.00 17.71  ? 175 TRP A CD2 1 
ATOM   1179 N  NE1 . TRP A 1 179 ? 5.234   49.614 65.140 1.00 16.86  ? 175 TRP A NE1 1 
ATOM   1180 C  CE2 . TRP A 1 179 ? 6.179   48.796 64.570 1.00 18.13  ? 175 TRP A CE2 1 
ATOM   1181 C  CE3 . TRP A 1 179 ? 8.526   48.938 63.914 1.00 18.95  ? 175 TRP A CE3 1 
ATOM   1182 C  CZ2 . TRP A 1 179 ? 6.079   47.467 64.133 1.00 16.63  ? 175 TRP A CZ2 1 
ATOM   1183 C  CZ3 . TRP A 1 179 ? 8.446   47.594 63.472 1.00 18.64  ? 175 TRP A CZ3 1 
ATOM   1184 C  CH2 . TRP A 1 179 ? 7.218   46.874 63.601 1.00 19.09  ? 175 TRP A CH2 1 
ATOM   1185 N  N   . ASP A 1 180 ? 8.543   55.274 63.736 1.00 19.80  ? 176 ASP A N   1 
ATOM   1186 C  CA  . ASP A 1 180 ? 9.419   56.425 63.667 1.00 23.17  ? 176 ASP A CA  1 
ATOM   1187 C  C   . ASP A 1 180 ? 9.993   56.893 64.982 1.00 22.71  ? 176 ASP A C   1 
ATOM   1188 O  O   . ASP A 1 180 ? 11.029  57.541 64.995 1.00 24.52  ? 176 ASP A O   1 
ATOM   1189 C  CB  . ASP A 1 180 ? 8.705   57.628 63.010 1.00 23.73  ? 176 ASP A CB  1 
ATOM   1190 C  CG  . ASP A 1 180 ? 8.378   57.393 61.548 1.00 27.89  ? 176 ASP A CG  1 
ATOM   1191 O  OD1 . ASP A 1 180 ? 8.910   56.440 60.918 1.00 28.43  ? 176 ASP A OD1 1 
ATOM   1192 O  OD2 . ASP A 1 180 ? 7.560   58.194 61.022 1.00 33.84  ? 176 ASP A OD2 1 
ATOM   1193 N  N   . ASP A 1 181 ? 9.333   56.590 66.086 1.00 22.89  ? 177 ASP A N   1 
ATOM   1194 C  CA  . ASP A 1 181 ? 9.817   57.082 67.375 1.00 23.30  ? 177 ASP A CA  1 
ATOM   1195 C  C   . ASP A 1 181 ? 10.055  56.029 68.451 1.00 22.50  ? 177 ASP A C   1 
ATOM   1196 O  O   . ASP A 1 181 ? 9.584   56.170 69.573 1.00 23.21  ? 177 ASP A O   1 
ATOM   1197 C  CB  . ASP A 1 181 ? 8.850   58.168 67.870 1.00 24.84  ? 177 ASP A CB  1 
ATOM   1198 C  CG  . ASP A 1 181 ? 8.913   59.452 67.020 1.00 28.41  ? 177 ASP A CG  1 
ATOM   1199 O  OD1 . ASP A 1 181 ? 9.748   60.335 67.309 1.00 35.50  ? 177 ASP A OD1 1 
ATOM   1200 O  OD2 . ASP A 1 181 ? 8.101   59.602 66.090 1.00 34.02  ? 177 ASP A OD2 1 
ATOM   1201 N  N   . PHE A 1 182 ? 10.817  54.988 68.129 1.00 21.57  ? 178 PHE A N   1 
ATOM   1202 C  CA  . PHE A 1 182 ? 11.133  53.943 69.114 1.00 20.24  ? 178 PHE A CA  1 
ATOM   1203 C  C   . PHE A 1 182 ? 12.150  54.466 70.111 1.00 19.88  ? 178 PHE A C   1 
ATOM   1204 O  O   . PHE A 1 182 ? 13.174  55.023 69.722 1.00 20.96  ? 178 PHE A O   1 
ATOM   1205 C  CB  . PHE A 1 182 ? 11.750  52.722 68.445 1.00 20.04  ? 178 PHE A CB  1 
ATOM   1206 C  CG  . PHE A 1 182 ? 12.236  51.711 69.438 1.00 18.11  ? 178 PHE A CG  1 
ATOM   1207 C  CD1 . PHE A 1 182 ? 11.309  51.017 70.192 1.00 15.32  ? 178 PHE A CD1 1 
ATOM   1208 C  CD2 . PHE A 1 182 ? 13.602  51.494 69.677 1.00 19.14  ? 178 PHE A CD2 1 
ATOM   1209 C  CE1 . PHE A 1 182 ? 11.700  50.078 71.156 1.00 17.59  ? 178 PHE A CE1 1 
ATOM   1210 C  CE2 . PHE A 1 182 ? 13.997  50.567 70.655 1.00 17.20  ? 178 PHE A CE2 1 
ATOM   1211 C  CZ  . PHE A 1 182 ? 13.051  49.876 71.404 1.00 17.48  ? 178 PHE A CZ  1 
ATOM   1212 N  N   . GLU A 1 183 ? 11.877  54.322 71.404 1.00 20.40  ? 179 GLU A N   1 
ATOM   1213 C  CA  . GLU A 1 183 ? 12.791  54.845 72.405 1.00 20.17  ? 179 GLU A CA  1 
ATOM   1214 C  C   . GLU A 1 183 ? 13.686  53.766 73.000 1.00 20.04  ? 179 GLU A C   1 
ATOM   1215 O  O   . GLU A 1 183 ? 13.190  52.854 73.678 1.00 20.01  ? 179 GLU A O   1 
ATOM   1216 C  CB  . GLU A 1 183 ? 12.013  55.556 73.513 1.00 20.55  ? 179 GLU A CB  1 
ATOM   1217 C  CG  . GLU A 1 183 ? 12.947  56.390 74.437 1.00 20.49  ? 179 GLU A CG  1 
ATOM   1218 C  CD  . GLU A 1 183 ? 13.470  57.612 73.754 1.00 21.17  ? 179 GLU A CD  1 
ATOM   1219 O  OE1 . GLU A 1 183 ? 12.869  57.971 72.725 1.00 18.19  ? 179 GLU A OE1 1 
ATOM   1220 O  OE2 . GLU A 1 183 ? 14.486  58.195 74.240 1.00 20.67  ? 179 GLU A OE2 1 
ATOM   1221 N  N   . TRP A 1 184 ? 14.981  53.825 72.688 1.00 19.24  ? 180 TRP A N   1 
ATOM   1222 C  CA  . TRP A 1 184 ? 15.915  52.873 73.274 1.00 19.40  ? 180 TRP A CA  1 
ATOM   1223 C  C   . TRP A 1 184 ? 16.266  53.599 74.580 1.00 19.74  ? 180 TRP A C   1 
ATOM   1224 O  O   . TRP A 1 184 ? 17.025  54.584 74.586 1.00 21.44  ? 180 TRP A O   1 
ATOM   1225 C  CB  . TRP A 1 184 ? 17.177  52.628 72.400 1.00 18.49  ? 180 TRP A CB  1 
ATOM   1226 C  CG  . TRP A 1 184 ? 18.344  51.877 73.069 1.00 17.98  ? 180 TRP A CG  1 
ATOM   1227 C  CD1 . TRP A 1 184 ? 19.686  52.228 73.050 1.00 17.02  ? 180 TRP A CD1 1 
ATOM   1228 C  CD2 . TRP A 1 184 ? 18.276  50.661 73.837 1.00 19.02  ? 180 TRP A CD2 1 
ATOM   1229 N  NE1 . TRP A 1 184 ? 20.426  51.301 73.727 1.00 17.63  ? 180 TRP A NE1 1 
ATOM   1230 C  CE2 . TRP A 1 184 ? 19.589  50.338 74.228 1.00 18.13  ? 180 TRP A CE2 1 
ATOM   1231 C  CE3 . TRP A 1 184 ? 17.234  49.786 74.187 1.00 19.52  ? 180 TRP A CE3 1 
ATOM   1232 C  CZ2 . TRP A 1 184 ? 19.889  49.192 74.948 1.00 18.55  ? 180 TRP A CZ2 1 
ATOM   1233 C  CZ3 . TRP A 1 184 ? 17.543  48.634 74.925 1.00 18.60  ? 180 TRP A CZ3 1 
ATOM   1234 C  CH2 . TRP A 1 184 ? 18.843  48.374 75.322 1.00 17.73  ? 180 TRP A CH2 1 
ATOM   1235 N  N   A LYS A 1 185 ? 15.759  53.137 75.708 0.50 20.25  ? 181 LYS A N   1 
ATOM   1236 N  N   B LYS A 1 185 ? 15.693  53.084 75.667 0.50 20.54  ? 181 LYS A N   1 
ATOM   1237 C  CA  A LYS A 1 185 ? 16.147  53.834 76.930 0.50 20.68  ? 181 LYS A CA  1 
ATOM   1238 C  CA  B LYS A 1 185 ? 15.856  53.622 77.020 0.50 21.18  ? 181 LYS A CA  1 
ATOM   1239 C  C   A LYS A 1 185 ? 17.035  52.966 77.799 0.50 20.42  ? 181 LYS A C   1 
ATOM   1240 C  C   B LYS A 1 185 ? 16.822  52.781 77.857 0.50 20.86  ? 181 LYS A C   1 
ATOM   1241 O  O   A LYS A 1 185 ? 17.232  53.268 78.972 0.50 20.67  ? 181 LYS A O   1 
ATOM   1242 O  O   B LYS A 1 185 ? 16.879  52.933 79.084 0.50 20.99  ? 181 LYS A O   1 
ATOM   1243 C  CB  A LYS A 1 185 ? 14.954  54.435 77.696 0.50 20.70  ? 181 LYS A CB  1 
ATOM   1244 C  CB  B LYS A 1 185 ? 14.491  53.602 77.746 0.50 21.37  ? 181 LYS A CB  1 
ATOM   1245 C  CG  A LYS A 1 185 ? 13.896  53.430 78.146 0.50 20.26  ? 181 LYS A CG  1 
ATOM   1246 C  CG  B LYS A 1 185 ? 13.250  53.858 76.890 0.50 21.41  ? 181 LYS A CG  1 
ATOM   1247 C  CD  A LYS A 1 185 ? 12.624  53.574 77.343 0.50 18.92  ? 181 LYS A CD  1 
ATOM   1248 C  CD  B LYS A 1 185 ? 11.966  53.654 77.685 0.50 21.24  ? 181 LYS A CD  1 
ATOM   1249 C  CE  A LYS A 1 185 ? 11.548  52.666 77.905 0.50 15.37  ? 181 LYS A CE  1 
ATOM   1250 C  CE  B LYS A 1 185 ? 10.818  53.250 76.777 0.50 19.76  ? 181 LYS A CE  1 
ATOM   1251 N  NZ  A LYS A 1 185 ? 10.204  52.962 77.326 0.50 18.18  ? 181 LYS A NZ  1 
ATOM   1252 N  NZ  B LYS A 1 185 ? 9.478   53.239 77.457 0.50 18.50  ? 181 LYS A NZ  1 
ATOM   1253 N  N   . GLY A 1 186 ? 17.553  51.886 77.201 1.00 19.86  ? 182 GLY A N   1 
ATOM   1254 C  CA  . GLY A 1 186 ? 18.455  50.962 77.886 1.00 20.18  ? 182 GLY A CA  1 
ATOM   1255 C  C   . GLY A 1 186 ? 17.694  49.699 78.312 1.00 20.13  ? 182 GLY A C   1 
ATOM   1256 O  O   . GLY A 1 186 ? 16.473  49.610 78.108 1.00 19.91  ? 182 GLY A O   1 
ATOM   1257 N  N   . PRO A 1 187 ? 18.396  48.752 78.949 1.00 19.73  ? 183 PRO A N   1 
ATOM   1258 C  CA  . PRO A 1 187 ? 17.812  47.493 79.366 1.00 19.62  ? 183 PRO A CA  1 
ATOM   1259 C  C   . PRO A 1 187 ? 16.726  47.715 80.403 1.00 20.28  ? 183 PRO A C   1 
ATOM   1260 O  O   . PRO A 1 187 ? 16.887  48.543 81.299 1.00 19.16  ? 183 PRO A O   1 
ATOM   1261 C  CB  . PRO A 1 187 ? 19.010  46.715 79.969 1.00 19.99  ? 183 PRO A CB  1 
ATOM   1262 C  CG  . PRO A 1 187 ? 20.024  47.707 80.289 1.00 21.41  ? 183 PRO A CG  1 
ATOM   1263 C  CD  . PRO A 1 187 ? 19.813  48.864 79.335 1.00 20.14  ? 183 PRO A CD  1 
ATOM   1264 N  N   . GLN A 1 188 ? 15.609  46.999 80.241 1.00 20.13  ? 184 GLN A N   1 
ATOM   1265 C  CA  . GLN A 1 188 ? 14.462  47.042 81.157 1.00 20.53  ? 184 GLN A CA  1 
ATOM   1266 C  C   . GLN A 1 188 ? 14.488  45.701 81.890 1.00 21.25  ? 184 GLN A C   1 
ATOM   1267 O  O   . GLN A 1 188 ? 13.449  45.161 82.299 1.00 21.80  ? 184 GLN A O   1 
ATOM   1268 C  CB  . GLN A 1 188 ? 13.166  47.193 80.365 1.00 20.51  ? 184 GLN A CB  1 
ATOM   1269 C  CG  . GLN A 1 188 ? 13.173  48.429 79.449 1.00 20.09  ? 184 GLN A CG  1 
ATOM   1270 C  CD  . GLN A 1 188 ? 13.292  49.699 80.241 1.00 24.13  ? 184 GLN A CD  1 
ATOM   1271 O  OE1 . GLN A 1 188 ? 12.439  49.998 81.062 1.00 22.94  ? 184 GLN A OE1 1 
ATOM   1272 N  NE2 . GLN A 1 188 ? 14.358  50.443 80.024 1.00 24.39  ? 184 GLN A NE2 1 
ATOM   1273 N  N   . TRP A 1 189 ? 15.696  45.210 82.094 1.00 19.49  ? 185 TRP A N   1 
ATOM   1274 C  CA  . TRP A 1 189 ? 15.992  43.927 82.719 1.00 20.12  ? 185 TRP A CA  1 
ATOM   1275 C  C   . TRP A 1 189 ? 17.422  44.011 83.257 1.00 21.74  ? 185 TRP A C   1 
ATOM   1276 O  O   . TRP A 1 189 ? 17.874  43.029 83.847 1.00 22.78  ? 185 TRP A O   1 
ATOM   1277 C  CB  . TRP A 1 189 ? 15.943  42.795 81.683 1.00 19.53  ? 185 TRP A CB  1 
ATOM   1278 C  CG  . TRP A 1 189 ? 16.735  43.133 80.481 1.00 19.86  ? 185 TRP A CG  1 
ATOM   1279 C  CD1 . TRP A 1 189 ? 18.090  42.918 80.279 1.00 20.15  ? 185 TRP A CD1 1 
ATOM   1280 C  CD2 . TRP A 1 189 ? 16.248  43.783 79.301 1.00 20.08  ? 185 TRP A CD2 1 
ATOM   1281 N  NE1 . TRP A 1 189 ? 18.461  43.425 79.033 1.00 20.13  ? 185 TRP A NE1 1 
ATOM   1282 C  CE2 . TRP A 1 189 ? 17.343  43.938 78.416 1.00 18.79  ? 185 TRP A CE2 1 
ATOM   1283 C  CE3 . TRP A 1 189 ? 14.964  44.216 78.882 1.00 18.23  ? 185 TRP A CE3 1 
ATOM   1284 C  CZ2 . TRP A 1 189 ? 17.207  44.554 77.164 1.00 19.86  ? 185 TRP A CZ2 1 
ATOM   1285 C  CZ3 . TRP A 1 189 ? 14.840  44.829 77.629 1.00 19.45  ? 185 TRP A CZ3 1 
ATOM   1286 C  CH2 . TRP A 1 189 ? 15.953  44.978 76.787 1.00 19.07  ? 185 TRP A CH2 1 
ATOM   1287 O  OXT . TRP A 1 189 ? 18.146  45.024 83.072 1.00 19.68  ? 185 TRP A OXT 1 
ATOM   1288 N  N   . ASP B 1 33  ? -10.990 16.274 45.379 1.00 35.57  ? 29  ASP B N   1 
ATOM   1289 C  CA  . ASP B 1 33  ? -10.802 14.934 46.027 1.00 35.34  ? 29  ASP B CA  1 
ATOM   1290 C  C   . ASP B 1 33  ? -9.336  14.558 46.245 1.00 34.29  ? 29  ASP B C   1 
ATOM   1291 O  O   . ASP B 1 33  ? -8.571  14.448 45.295 1.00 34.00  ? 29  ASP B O   1 
ATOM   1292 C  CB  . ASP B 1 33  ? -11.494 13.816 45.236 1.00 36.41  ? 29  ASP B CB  1 
ATOM   1293 C  CG  . ASP B 1 33  ? -12.697 13.213 45.982 1.00 38.81  ? 29  ASP B CG  1 
ATOM   1294 O  OD1 . ASP B 1 33  ? -13.036 13.699 47.091 1.00 41.64  ? 29  ASP B OD1 1 
ATOM   1295 O  OD2 . ASP B 1 33  ? -13.300 12.245 45.453 1.00 40.98  ? 29  ASP B OD2 1 
ATOM   1296 N  N   . GLU B 1 34  ? -8.972  14.363 47.507 1.00 32.89  ? 30  GLU B N   1 
ATOM   1297 C  CA  . GLU B 1 34  ? -7.635  13.978 47.870 1.00 31.69  ? 30  GLU B CA  1 
ATOM   1298 C  C   . GLU B 1 34  ? -7.710  12.521 48.245 1.00 30.50  ? 30  GLU B C   1 
ATOM   1299 O  O   . GLU B 1 34  ? -8.752  12.052 48.720 1.00 30.94  ? 30  GLU B O   1 
ATOM   1300 C  CB  . GLU B 1 34  ? -7.149  14.805 49.037 1.00 32.37  ? 30  GLU B CB  1 
ATOM   1301 C  CG  . GLU B 1 34  ? -6.960  16.264 48.683 1.00 35.17  ? 30  GLU B CG  1 
ATOM   1302 C  CD  . GLU B 1 34  ? -6.350  17.064 49.812 1.00 39.04  ? 30  GLU B CD  1 
ATOM   1303 O  OE1 . GLU B 1 34  ? -5.887  16.449 50.802 1.00 41.78  ? 30  GLU B OE1 1 
ATOM   1304 O  OE2 . GLU B 1 34  ? -6.334  18.314 49.718 1.00 42.53  ? 30  GLU B OE2 1 
ATOM   1305 N  N   . PHE B 1 35  ? -6.637  11.787 47.988 1.00 28.51  ? 31  PHE B N   1 
ATOM   1306 C  CA  . PHE B 1 35  ? -6.594  10.353 48.302 1.00 27.00  ? 31  PHE B CA  1 
ATOM   1307 C  C   . PHE B 1 35  ? -5.415  10.101 49.211 1.00 26.67  ? 31  PHE B C   1 
ATOM   1308 O  O   . PHE B 1 35  ? -4.322  10.610 48.952 1.00 25.65  ? 31  PHE B O   1 
ATOM   1309 C  CB  . PHE B 1 35  ? -6.481  9.511  47.029 1.00 26.28  ? 31  PHE B CB  1 
ATOM   1310 C  CG  . PHE B 1 35  ? -7.608  9.737  46.078 1.00 25.36  ? 31  PHE B CG  1 
ATOM   1311 C  CD1 . PHE B 1 35  ? -8.777  8.999  46.197 1.00 25.24  ? 31  PHE B CD1 1 
ATOM   1312 C  CD2 . PHE B 1 35  ? -7.526  10.723 45.094 1.00 25.12  ? 31  PHE B CD2 1 
ATOM   1313 C  CE1 . PHE B 1 35  ? -9.845  9.222  45.330 1.00 22.62  ? 31  PHE B CE1 1 
ATOM   1314 C  CE2 . PHE B 1 35  ? -8.596  10.964 44.231 1.00 25.38  ? 31  PHE B CE2 1 
ATOM   1315 C  CZ  . PHE B 1 35  ? -9.747  10.210 44.357 1.00 25.50  ? 31  PHE B CZ  1 
ATOM   1316 N  N   . PRO B 1 36  ? -5.619  9.297  50.267 1.00 26.27  ? 32  PRO B N   1 
ATOM   1317 C  CA  . PRO B 1 36  ? -4.530  9.103  51.199 1.00 26.03  ? 32  PRO B CA  1 
ATOM   1318 C  C   . PRO B 1 36  ? -3.510  8.077  50.712 1.00 25.42  ? 32  PRO B C   1 
ATOM   1319 O  O   . PRO B 1 36  ? -3.874  7.082  50.065 1.00 25.38  ? 32  PRO B O   1 
ATOM   1320 C  CB  . PRO B 1 36  ? -5.245  8.587  52.460 1.00 26.38  ? 32  PRO B CB  1 
ATOM   1321 C  CG  . PRO B 1 36  ? -6.426  7.875  51.964 1.00 26.66  ? 32  PRO B CG  1 
ATOM   1322 C  CD  . PRO B 1 36  ? -6.815  8.516  50.639 1.00 27.41  ? 32  PRO B CD  1 
ATOM   1323 N  N   . ILE B 1 37  ? -2.243  8.312  51.037 1.00 24.46  ? 33  ILE B N   1 
ATOM   1324 C  CA  . ILE B 1 37  ? -1.170  7.388  50.701 1.00 24.40  ? 33  ILE B CA  1 
ATOM   1325 C  C   . ILE B 1 37  ? -1.226  6.250  51.705 1.00 24.51  ? 33  ILE B C   1 
ATOM   1326 O  O   . ILE B 1 37  ? -0.807  5.132  51.407 1.00 24.98  ? 33  ILE B O   1 
ATOM   1327 C  CB  . ILE B 1 37  ? 0.206   8.055  50.780 1.00 25.04  ? 33  ILE B CB  1 
ATOM   1328 C  CG1 . ILE B 1 37  ? 0.367   9.021  49.602 1.00 24.61  ? 33  ILE B CG1 1 
ATOM   1329 C  CG2 . ILE B 1 37  ? 1.367   7.016  50.770 1.00 24.03  ? 33  ILE B CG2 1 
ATOM   1330 C  CD1 . ILE B 1 37  ? 1.729   9.640  49.586 1.00 29.50  ? 33  ILE B CD1 1 
ATOM   1331 N  N   . GLY B 1 38  ? -1.747  6.553  52.893 1.00 23.98  ? 34  GLY B N   1 
ATOM   1332 C  CA  . GLY B 1 38  ? -1.890  5.593  53.991 1.00 24.38  ? 34  GLY B CA  1 
ATOM   1333 C  C   . GLY B 1 38  ? -2.299  6.341  55.239 1.00 24.51  ? 34  GLY B C   1 
ATOM   1334 O  O   . GLY B 1 38  ? -2.646  7.522  55.166 1.00 24.09  ? 34  GLY B O   1 
ATOM   1335 N  N   . GLU B 1 39  ? -2.266  5.689  56.398 1.00 25.12  ? 35  GLU B N   1 
ATOM   1336 C  CA  . GLU B 1 39  ? -2.666  6.384  57.623 1.00 26.32  ? 35  GLU B CA  1 
ATOM   1337 C  C   . GLU B 1 39  ? -1.590  7.358  58.070 1.00 25.99  ? 35  GLU B C   1 
ATOM   1338 O  O   . GLU B 1 39  ? -0.419  7.123  57.795 1.00 25.37  ? 35  GLU B O   1 
ATOM   1339 C  CB  . GLU B 1 39  ? -2.986  5.414  58.744 1.00 27.46  ? 35  GLU B CB  1 
ATOM   1340 C  CG  . GLU B 1 39  ? -4.188  5.858  59.564 1.00 32.07  ? 35  GLU B CG  1 
ATOM   1341 C  CD  . GLU B 1 39  ? -5.482  5.147  59.160 1.00 37.70  ? 35  GLU B CD  1 
ATOM   1342 O  OE1 . GLU B 1 39  ? -5.747  4.978  57.938 1.00 40.14  ? 35  GLU B OE1 1 
ATOM   1343 O  OE2 . GLU B 1 39  ? -6.236  4.746  60.075 1.00 39.27  ? 35  GLU B OE2 1 
ATOM   1344 N  N   . ASP B 1 40  ? -1.999  8.454  58.718 1.00 26.15  ? 36  ASP B N   1 
ATOM   1345 C  CA  . ASP B 1 40  ? -1.063  9.475  59.209 1.00 26.16  ? 36  ASP B CA  1 
ATOM   1346 C  C   . ASP B 1 40  ? -0.094  8.859  60.214 1.00 25.76  ? 36  ASP B C   1 
ATOM   1347 O  O   . ASP B 1 40  ? -0.458  7.967  60.985 1.00 25.72  ? 36  ASP B O   1 
ATOM   1348 C  CB  . ASP B 1 40  ? -1.804  10.659 59.851 1.00 26.38  ? 36  ASP B CB  1 
ATOM   1349 C  CG  . ASP B 1 40  ? -2.659  11.444 58.855 1.00 28.47  ? 36  ASP B CG  1 
ATOM   1350 O  OD1 . ASP B 1 40  ? -2.610  11.180 57.628 1.00 27.75  ? 36  ASP B OD1 1 
ATOM   1351 O  OD2 . ASP B 1 40  ? -3.381  12.348 59.317 1.00 30.82  ? 36  ASP B OD2 1 
ATOM   1352 N  N   . ARG B 1 41  ? 1.141   9.331  60.200 1.00 24.92  ? 37  ARG B N   1 
ATOM   1353 C  CA  . ARG B 1 41  ? 2.160   8.802  61.087 1.00 24.61  ? 37  ARG B CA  1 
ATOM   1354 C  C   . ARG B 1 41  ? 2.630   9.816  62.129 1.00 24.34  ? 37  ARG B C   1 
ATOM   1355 O  O   . ARG B 1 41  ? 2.764   10.988 61.830 1.00 23.91  ? 37  ARG B O   1 
ATOM   1356 C  CB  . ARG B 1 41  ? 3.372   8.410  60.237 1.00 23.96  ? 37  ARG B CB  1 
ATOM   1357 C  CG  . ARG B 1 41  ? 3.073   7.436  59.128 1.00 23.72  ? 37  ARG B CG  1 
ATOM   1358 C  CD  . ARG B 1 41  ? 2.916   6.047  59.691 1.00 23.94  ? 37  ARG B CD  1 
ATOM   1359 N  NE  . ARG B 1 41  ? 2.980   5.022  58.659 1.00 23.66  ? 37  ARG B NE  1 
ATOM   1360 C  CZ  . ARG B 1 41  ? 2.074   4.064  58.495 1.00 24.95  ? 37  ARG B CZ  1 
ATOM   1361 N  NH1 . ARG B 1 41  ? 1.019   3.982  59.302 1.00 26.05  ? 37  ARG B NH1 1 
ATOM   1362 N  NH2 . ARG B 1 41  ? 2.237   3.166  57.535 1.00 23.00  ? 37  ARG B NH2 1 
ATOM   1363 N  N   . ASP B 1 42  ? 2.905   9.351  63.346 1.00 24.54  ? 38  ASP B N   1 
ATOM   1364 C  CA  . ASP B 1 42  ? 3.441   10.231 64.366 1.00 24.65  ? 38  ASP B CA  1 
ATOM   1365 C  C   . ASP B 1 42  ? 4.898   9.791  64.533 1.00 23.71  ? 38  ASP B C   1 
ATOM   1366 O  O   . ASP B 1 42  ? 5.165   8.668  64.914 1.00 22.91  ? 38  ASP B O   1 
ATOM   1367 C  CB  . ASP B 1 42  ? 2.645   10.180 65.677 1.00 25.94  ? 38  ASP B CB  1 
ATOM   1368 C  CG  . ASP B 1 42  ? 1.595   11.298 65.771 1.00 28.67  ? 38  ASP B CG  1 
ATOM   1369 O  OD1 . ASP B 1 42  ? 1.953   12.470 66.098 1.00 33.24  ? 38  ASP B OD1 1 
ATOM   1370 O  OD2 . ASP B 1 42  ? 0.410   10.996 65.501 1.00 29.42  ? 38  ASP B OD2 1 
ATOM   1371 N  N   A VAL B 1 43  ? 5.836   10.671 64.193 0.50 23.38  ? 39  VAL B N   1 
ATOM   1372 N  N   B VAL B 1 43  ? 5.832   10.677 64.200 0.50 23.20  ? 39  VAL B N   1 
ATOM   1373 C  CA  A VAL B 1 43  ? 7.259   10.343 64.302 0.50 22.92  ? 39  VAL B CA  1 
ATOM   1374 C  CA  B VAL B 1 43  ? 7.256   10.364 64.333 0.50 22.53  ? 39  VAL B CA  1 
ATOM   1375 C  C   A VAL B 1 43  ? 7.979   11.486 64.999 0.50 22.73  ? 39  VAL B C   1 
ATOM   1376 C  C   B VAL B 1 43  ? 7.961   11.506 65.019 0.50 22.55  ? 39  VAL B C   1 
ATOM   1377 O  O   A VAL B 1 43  ? 8.074   12.585 64.448 0.50 22.22  ? 39  VAL B O   1 
ATOM   1378 O  O   B VAL B 1 43  ? 8.028   12.618 64.490 0.50 22.04  ? 39  VAL B O   1 
ATOM   1379 C  CB  A VAL B 1 43  ? 7.913   10.088 62.921 0.50 23.11  ? 39  VAL B CB  1 
ATOM   1380 C  CB  B VAL B 1 43  ? 7.959   10.049 62.994 0.50 22.68  ? 39  VAL B CB  1 
ATOM   1381 C  CG1 A VAL B 1 43  ? 9.235   9.338  63.093 0.50 22.17  ? 39  VAL B CG1 1 
ATOM   1382 C  CG1 B VAL B 1 43  ? 7.669   8.624  62.584 0.50 22.53  ? 39  VAL B CG1 1 
ATOM   1383 C  CG2 A VAL B 1 43  ? 6.975   9.297  62.004 0.50 23.01  ? 39  VAL B CG2 1 
ATOM   1384 C  CG2 B VAL B 1 43  ? 7.588   11.061 61.902 0.50 20.28  ? 39  VAL B CG2 1 
ATOM   1385 N  N   . GLY B 1 44  ? 8.474   11.233 66.210 1.00 22.47  ? 40  GLY B N   1 
ATOM   1386 C  CA  . GLY B 1 44  ? 9.160   12.273 66.985 1.00 22.30  ? 40  GLY B CA  1 
ATOM   1387 C  C   . GLY B 1 44  ? 8.157   13.407 67.202 1.00 22.44  ? 40  GLY B C   1 
ATOM   1388 O  O   . GLY B 1 44  ? 6.980   13.163 67.552 1.00 22.02  ? 40  GLY B O   1 
ATOM   1389 N  N   . PRO B 1 45  ? 8.588   14.647 66.940 1.00 22.63  ? 41  PRO B N   1 
ATOM   1390 C  CA  . PRO B 1 45  ? 7.718   15.786 67.140 1.00 22.99  ? 41  PRO B CA  1 
ATOM   1391 C  C   . PRO B 1 45  ? 6.769   16.084 65.970 1.00 23.06  ? 41  PRO B C   1 
ATOM   1392 O  O   . PRO B 1 45  ? 6.115   17.134 65.973 1.00 23.07  ? 41  PRO B O   1 
ATOM   1393 C  CB  . PRO B 1 45  ? 8.721   16.938 67.268 1.00 22.76  ? 41  PRO B CB  1 
ATOM   1394 C  CG  . PRO B 1 45  ? 9.824   16.553 66.373 1.00 23.54  ? 41  PRO B CG  1 
ATOM   1395 C  CD  . PRO B 1 45  ? 9.933   15.063 66.489 1.00 22.75  ? 41  PRO B CD  1 
ATOM   1396 N  N   . LEU B 1 46  ? 6.686   15.176 64.991 1.00 22.40  ? 42  LEU B N   1 
ATOM   1397 C  CA  . LEU B 1 46  ? 5.841   15.421 63.827 1.00 22.25  ? 42  LEU B CA  1 
ATOM   1398 C  C   . LEU B 1 46  ? 4.655   14.513 63.619 1.00 21.97  ? 42  LEU B C   1 
ATOM   1399 O  O   . LEU B 1 46  ? 4.766   13.328 63.854 1.00 22.61  ? 42  LEU B O   1 
ATOM   1400 C  CB  . LEU B 1 46  ? 6.709   15.353 62.548 1.00 21.57  ? 42  LEU B CB  1 
ATOM   1401 C  CG  . LEU B 1 46  ? 7.994   16.188 62.530 1.00 21.70  ? 42  LEU B CG  1 
ATOM   1402 C  CD1 . LEU B 1 46  ? 8.801   15.940 61.254 1.00 23.45  ? 42  LEU B CD1 1 
ATOM   1403 C  CD2 . LEU B 1 46  ? 7.638   17.657 62.667 1.00 20.77  ? 42  LEU B CD2 1 
ATOM   1404 N  N   . HIS B 1 47  ? 3.543   15.090 63.146 1.00 22.63  ? 43  HIS B N   1 
ATOM   1405 C  CA  . HIS B 1 47  ? 2.337   14.346 62.745 1.00 24.11  ? 43  HIS B CA  1 
ATOM   1406 C  C   . HIS B 1 47  ? 2.480   14.461 61.232 1.00 23.97  ? 43  HIS B C   1 
ATOM   1407 O  O   . HIS B 1 47  ? 2.503   15.574 60.701 1.00 24.32  ? 43  HIS B O   1 
ATOM   1408 C  CB  . HIS B 1 47  ? 1.024   14.996 63.190 1.00 24.82  ? 43  HIS B CB  1 
ATOM   1409 C  CG  . HIS B 1 47  ? -0.191  14.207 62.800 1.00 26.61  ? 43  HIS B CG  1 
ATOM   1410 N  ND1 . HIS B 1 47  ? -0.561  13.043 63.442 1.00 29.57  ? 43  HIS B ND1 1 
ATOM   1411 C  CD2 . HIS B 1 47  ? -1.100  14.392 61.809 1.00 30.33  ? 43  HIS B CD2 1 
ATOM   1412 C  CE1 . HIS B 1 47  ? -1.656  12.559 62.881 1.00 30.02  ? 43  HIS B CE1 1 
ATOM   1413 N  NE2 . HIS B 1 47  ? -2.002  13.357 61.885 1.00 32.22  ? 43  HIS B NE2 1 
ATOM   1414 N  N   . VAL B 1 48  ? 2.615   13.335 60.533 1.00 23.45  ? 44  VAL B N   1 
ATOM   1415 C  CA  . VAL B 1 48  ? 2.835   13.374 59.098 1.00 23.27  ? 44  VAL B CA  1 
ATOM   1416 C  C   . VAL B 1 48  ? 1.730   12.653 58.331 1.00 23.25  ? 44  VAL B C   1 
ATOM   1417 O  O   . VAL B 1 48  ? 1.459   11.460 58.559 1.00 23.46  ? 44  VAL B O   1 
ATOM   1418 C  CB  . VAL B 1 48  ? 4.234   12.753 58.734 1.00 22.85  ? 44  VAL B CB  1 
ATOM   1419 C  CG1 . VAL B 1 48  ? 4.514   12.775 57.215 1.00 23.70  ? 44  VAL B CG1 1 
ATOM   1420 C  CG2 . VAL B 1 48  ? 5.348   13.453 59.487 1.00 24.17  ? 44  VAL B CG2 1 
ATOM   1421 N  N   . GLY B 1 49  ? 1.098   13.379 57.417 1.00 23.46  ? 45  GLY B N   1 
ATOM   1422 C  CA  . GLY B 1 49  ? 0.036   12.817 56.588 1.00 23.16  ? 45  GLY B CA  1 
ATOM   1423 C  C   . GLY B 1 49  ? 0.552   12.794 55.158 1.00 23.62  ? 45  GLY B C   1 
ATOM   1424 O  O   . GLY B 1 49  ? 1.362   13.649 54.772 1.00 23.92  ? 45  GLY B O   1 
ATOM   1425 N  N   . GLY B 1 50  ? 0.096   11.823 54.377 1.00 22.84  ? 46  GLY B N   1 
ATOM   1426 C  CA  . GLY B 1 50  ? 0.515   11.712 52.982 1.00 22.21  ? 46  GLY B CA  1 
ATOM   1427 C  C   . GLY B 1 50  ? -0.714  11.566 52.105 1.00 22.77  ? 46  GLY B C   1 
ATOM   1428 O  O   . GLY B 1 50  ? -1.526  10.674 52.336 1.00 22.23  ? 46  GLY B O   1 
ATOM   1429 N  N   . VAL B 1 51  ? -0.868  12.459 51.116 1.00 22.44  ? 47  VAL B N   1 
ATOM   1430 C  CA  . VAL B 1 51  ? -2.000  12.401 50.171 1.00 23.15  ? 47  VAL B CA  1 
ATOM   1431 C  C   . VAL B 1 51  ? -1.505  12.562 48.734 1.00 22.28  ? 47  VAL B C   1 
ATOM   1432 O  O   . VAL B 1 51  ? -0.384  13.024 48.480 1.00 22.22  ? 47  VAL B O   1 
ATOM   1433 C  CB  . VAL B 1 51  ? -3.171  13.465 50.432 1.00 23.67  ? 47  VAL B CB  1 
ATOM   1434 C  CG1 . VAL B 1 51  ? -3.650  13.437 51.852 1.00 24.89  ? 47  VAL B CG1 1 
ATOM   1435 C  CG2 . VAL B 1 51  ? -2.755  14.902 50.066 1.00 24.74  ? 47  VAL B CG2 1 
ATOM   1436 N  N   . TYR B 1 52  ? -2.348  12.169 47.786 1.00 22.09  ? 48  TYR B N   1 
ATOM   1437 C  CA  . TYR B 1 52  ? -2.040  12.325 46.381 1.00 20.85  ? 48  TYR B CA  1 
ATOM   1438 C  C   . TYR B 1 52  ? -3.344  12.668 45.672 1.00 20.30  ? 48  TYR B C   1 
ATOM   1439 O  O   . TYR B 1 52  ? -4.417  12.321 46.142 1.00 18.53  ? 48  TYR B O   1 
ATOM   1440 C  CB  . TYR B 1 52  ? -1.371  11.100 45.766 1.00 21.78  ? 48  TYR B CB  1 
ATOM   1441 C  CG  . TYR B 1 52  ? -2.295  9.953  45.391 1.00 21.90  ? 48  TYR B CG  1 
ATOM   1442 C  CD1 . TYR B 1 52  ? -2.690  9.001  46.344 1.00 23.02  ? 48  TYR B CD1 1 
ATOM   1443 C  CD2 . TYR B 1 52  ? -2.736  9.785  44.077 1.00 24.23  ? 48  TYR B CD2 1 
ATOM   1444 C  CE1 . TYR B 1 52  ? -3.536  7.914  45.975 1.00 23.81  ? 48  TYR B CE1 1 
ATOM   1445 C  CE2 . TYR B 1 52  ? -3.574  8.704  43.721 1.00 20.94  ? 48  TYR B CE2 1 
ATOM   1446 C  CZ  . TYR B 1 52  ? -3.957  7.781  44.682 1.00 22.78  ? 48  TYR B CZ  1 
ATOM   1447 O  OH  . TYR B 1 52  ? -4.786  6.712  44.323 1.00 25.09  ? 48  TYR B OH  1 
ATOM   1448 N  N   . PHE B 1 53  ? -3.227  13.373 44.554 1.00 19.67  ? 49  PHE B N   1 
ATOM   1449 C  CA  . PHE B 1 53  ? -4.390  13.752 43.735 1.00 19.19  ? 49  PHE B CA  1 
ATOM   1450 C  C   . PHE B 1 53  ? -3.862  14.198 42.355 1.00 19.39  ? 49  PHE B C   1 
ATOM   1451 O  O   . PHE B 1 53  ? -2.688  13.995 42.035 1.00 19.25  ? 49  PHE B O   1 
ATOM   1452 C  CB  . PHE B 1 53  ? -5.263  14.807 44.444 1.00 19.16  ? 49  PHE B CB  1 
ATOM   1453 C  CG  . PHE B 1 53  ? -4.471  15.977 45.037 1.00 19.30  ? 49  PHE B CG  1 
ATOM   1454 C  CD1 . PHE B 1 53  ? -4.192  17.103 44.264 1.00 20.47  ? 49  PHE B CD1 1 
ATOM   1455 C  CD2 . PHE B 1 53  ? -4.084  15.967 46.350 1.00 20.19  ? 49  PHE B CD2 1 
ATOM   1456 C  CE1 . PHE B 1 53  ? -3.477  18.185 44.794 1.00 20.25  ? 49  PHE B CE1 1 
ATOM   1457 C  CE2 . PHE B 1 53  ? -3.354  17.037 46.896 1.00 20.80  ? 49  PHE B CE2 1 
ATOM   1458 C  CZ  . PHE B 1 53  ? -3.073  18.148 46.108 1.00 20.25  ? 49  PHE B CZ  1 
ATOM   1459 N  N   . GLN B 1 54  ? -4.695  14.794 41.522 1.00 18.96  ? 50  GLN B N   1 
ATOM   1460 C  CA  . GLN B 1 54  ? -4.225  15.206 40.209 1.00 19.63  ? 50  GLN B CA  1 
ATOM   1461 C  C   . GLN B 1 54  ? -3.034  16.135 40.210 1.00 19.49  ? 50  GLN B C   1 
ATOM   1462 O  O   . GLN B 1 54  ? -2.816  16.893 41.157 1.00 19.67  ? 50  GLN B O   1 
ATOM   1463 C  CB  . GLN B 1 54  ? -5.348  15.813 39.373 1.00 20.56  ? 50  GLN B CB  1 
ATOM   1464 C  CG  . GLN B 1 54  ? -5.690  17.221 39.743 1.00 23.86  ? 50  GLN B CG  1 
ATOM   1465 C  CD  . GLN B 1 54  ? -6.847  17.247 40.664 1.00 30.92  ? 50  GLN B CD  1 
ATOM   1466 O  OE1 . GLN B 1 54  ? -7.073  16.286 41.428 1.00 32.35  ? 50  GLN B OE1 1 
ATOM   1467 N  NE2 . GLN B 1 54  ? -7.621  18.330 40.603 1.00 32.36  ? 50  GLN B NE2 1 
ATOM   1468 N  N   . PRO B 1 55  ? -2.232  16.067 39.146 1.00 19.72  ? 51  PRO B N   1 
ATOM   1469 C  CA  . PRO B 1 55  ? -1.094  16.970 39.066 1.00 18.63  ? 51  PRO B CA  1 
ATOM   1470 C  C   . PRO B 1 55  ? -1.583  18.417 39.094 1.00 18.59  ? 51  PRO B C   1 
ATOM   1471 O  O   . PRO B 1 55  ? -2.707  18.718 38.661 1.00 17.43  ? 51  PRO B O   1 
ATOM   1472 C  CB  . PRO B 1 55  ? -0.476  16.645 37.719 1.00 19.13  ? 51  PRO B CB  1 
ATOM   1473 C  CG  . PRO B 1 55  ? -1.029  15.304 37.322 1.00 18.98  ? 51  PRO B CG  1 
ATOM   1474 C  CD  . PRO B 1 55  ? -2.351  15.183 37.962 1.00 19.51  ? 51  PRO B CD  1 
ATOM   1475 N  N   . VAL B 1 56  ? -0.762  19.297 39.644 1.00 17.58  ? 52  VAL B N   1 
ATOM   1476 C  CA  . VAL B 1 56  ? -1.117  20.714 39.723 1.00 18.34  ? 52  VAL B CA  1 
ATOM   1477 C  C   . VAL B 1 56  ? -0.064  21.583 39.005 1.00 18.46  ? 52  VAL B C   1 
ATOM   1478 O  O   . VAL B 1 56  ? 1.044   21.119 38.680 1.00 18.24  ? 52  VAL B O   1 
ATOM   1479 C  CB  . VAL B 1 56  ? -1.272  21.169 41.199 1.00 18.92  ? 52  VAL B CB  1 
ATOM   1480 C  CG1 . VAL B 1 56  ? -2.287  20.268 41.967 1.00 21.16  ? 52  VAL B CG1 1 
ATOM   1481 C  CG2 . VAL B 1 56  ? 0.064   21.100 41.919 1.00 17.79  ? 52  VAL B CG2 1 
ATOM   1482 N  N   . GLU B 1 57  ? -0.425  22.835 38.737 1.00 18.13  ? 53  GLU B N   1 
ATOM   1483 C  CA  . GLU B 1 57  ? 0.504   23.776 38.120 1.00 18.51  ? 53  GLU B CA  1 
ATOM   1484 C  C   . GLU B 1 57  ? 0.981   24.614 39.280 1.00 18.06  ? 53  GLU B C   1 
ATOM   1485 O  O   . GLU B 1 57  ? 0.173   25.112 40.053 1.00 17.92  ? 53  GLU B O   1 
ATOM   1486 C  CB  . GLU B 1 57  ? -0.155  24.696 37.093 1.00 18.60  ? 53  GLU B CB  1 
ATOM   1487 C  CG  . GLU B 1 57  ? 0.859   25.663 36.478 1.00 21.46  ? 53  GLU B CG  1 
ATOM   1488 C  CD  . GLU B 1 57  ? 0.308   26.457 35.308 1.00 27.98  ? 53  GLU B CD  1 
ATOM   1489 O  OE1 . GLU B 1 57  ? -0.919  26.378 35.038 1.00 28.69  ? 53  GLU B OE1 1 
ATOM   1490 O  OE2 . GLU B 1 57  ? 1.109   27.177 34.667 1.00 30.31  ? 53  GLU B OE2 1 
ATOM   1491 N  N   . MET B 1 58  ? 2.294   24.771 39.379 1.00 18.29  ? 54  MET B N   1 
ATOM   1492 C  CA  . MET B 1 58  ? 2.922   25.499 40.443 1.00 19.65  ? 54  MET B CA  1 
ATOM   1493 C  C   . MET B 1 58  ? 3.763   26.655 39.908 1.00 20.33  ? 54  MET B C   1 
ATOM   1494 O  O   . MET B 1 58  ? 4.382   26.559 38.831 1.00 20.99  ? 54  MET B O   1 
ATOM   1495 C  CB  . MET B 1 58  ? 3.843   24.564 41.233 1.00 18.80  ? 54  MET B CB  1 
ATOM   1496 C  CG  . MET B 1 58  ? 3.136   23.484 42.107 1.00 18.70  ? 54  MET B CG  1 
ATOM   1497 S  SD  . MET B 1 58  ? 4.277   22.155 42.518 1.00 23.24  ? 54  MET B SD  1 
ATOM   1498 C  CE  . MET B 1 58  ? 4.326   21.159 41.020 1.00 22.53  ? 54  MET B CE  1 
ATOM   1499 N  N   . HIS B 1 59  ? 3.781   27.754 40.642 1.00 20.28  ? 55  HIS B N   1 
ATOM   1500 C  CA  . HIS B 1 59  ? 4.611   28.853 40.247 1.00 21.18  ? 55  HIS B CA  1 
ATOM   1501 C  C   . HIS B 1 59  ? 5.489   29.319 41.434 1.00 21.23  ? 55  HIS B C   1 
ATOM   1502 O  O   . HIS B 1 59  ? 4.956   29.637 42.510 1.00 20.26  ? 55  HIS B O   1 
ATOM   1503 C  CB  . HIS B 1 59  ? 3.837   30.039 39.710 1.00 21.56  ? 55  HIS B CB  1 
ATOM   1504 C  CG  . HIS B 1 59  ? 4.725   31.210 39.429 1.00 23.04  ? 55  HIS B CG  1 
ATOM   1505 N  ND1 . HIS B 1 59  ? 5.415   31.341 38.245 1.00 23.32  ? 55  HIS B ND1 1 
ATOM   1506 C  CD2 . HIS B 1 59  ? 5.102   32.256 40.204 1.00 23.02  ? 55  HIS B CD2 1 
ATOM   1507 C  CE1 . HIS B 1 59  ? 6.146   32.441 38.288 1.00 24.81  ? 55  HIS B CE1 1 
ATOM   1508 N  NE2 . HIS B 1 59  ? 5.966   33.019 39.463 1.00 22.10  ? 55  HIS B NE2 1 
ATOM   1509 N  N   . PRO B 1 60  ? 6.829   29.376 41.235 1.00 21.53  ? 56  PRO B N   1 
ATOM   1510 C  CA  . PRO B 1 60  ? 7.527   28.906 40.046 1.00 22.60  ? 56  PRO B CA  1 
ATOM   1511 C  C   . PRO B 1 60  ? 7.473   27.374 40.009 1.00 22.40  ? 56  PRO B C   1 
ATOM   1512 O  O   . PRO B 1 60  ? 7.187   26.752 41.026 1.00 21.80  ? 56  PRO B O   1 
ATOM   1513 C  CB  . PRO B 1 60  ? 8.976   29.334 40.294 1.00 21.89  ? 56  PRO B CB  1 
ATOM   1514 C  CG  . PRO B 1 60  ? 8.951   30.281 41.433 1.00 22.78  ? 56  PRO B CG  1 
ATOM   1515 C  CD  . PRO B 1 60  ? 7.780   29.877 42.248 1.00 22.55  ? 56  PRO B CD  1 
ATOM   1516 N  N   . ALA B 1 61  ? 7.726   26.764 38.858 1.00 24.18  ? 57  ALA B N   1 
ATOM   1517 C  CA  . ALA B 1 61  ? 7.704   25.297 38.781 1.00 25.61  ? 57  ALA B CA  1 
ATOM   1518 C  C   . ALA B 1 61  ? 8.948   24.775 39.522 1.00 27.50  ? 57  ALA B C   1 
ATOM   1519 O  O   . ALA B 1 61  ? 10.063  25.164 39.194 1.00 27.92  ? 57  ALA B O   1 
ATOM   1520 C  CB  . ALA B 1 61  ? 7.710   24.842 37.342 1.00 26.34  ? 57  ALA B CB  1 
ATOM   1521 N  N   . PRO B 1 62  ? 8.766   23.916 40.543 1.00 28.99  ? 58  PRO B N   1 
ATOM   1522 C  CA  . PRO B 1 62  ? 9.934   23.632 41.375 1.00 30.22  ? 58  PRO B CA  1 
ATOM   1523 C  C   . PRO B 1 62  ? 10.907  22.619 40.785 1.00 31.08  ? 58  PRO B C   1 
ATOM   1524 O  O   . PRO B 1 62  ? 10.536  21.790 39.959 1.00 31.18  ? 58  PRO B O   1 
ATOM   1525 C  CB  . PRO B 1 62  ? 9.330   23.095 42.684 1.00 30.21  ? 58  PRO B CB  1 
ATOM   1526 C  CG  . PRO B 1 62  ? 7.852   23.006 42.462 1.00 30.41  ? 58  PRO B CG  1 
ATOM   1527 C  CD  . PRO B 1 62  ? 7.584   23.179 41.006 1.00 29.09  ? 58  PRO B CD  1 
ATOM   1528 N  N   . GLY B 1 63  ? 12.159  22.730 41.228 1.00 32.20  ? 59  GLY B N   1 
ATOM   1529 C  CA  . GLY B 1 63  ? 13.259  21.855 40.830 1.00 32.99  ? 59  GLY B CA  1 
ATOM   1530 C  C   . GLY B 1 63  ? 13.176  21.201 39.479 1.00 33.26  ? 59  GLY B C   1 
ATOM   1531 O  O   . GLY B 1 63  ? 13.134  21.891 38.454 1.00 34.15  ? 59  GLY B O   1 
ATOM   1532 N  N   . ALA B 1 64  ? 13.160  19.868 39.485 1.00 32.63  ? 60  ALA B N   1 
ATOM   1533 C  CA  . ALA B 1 64  ? 13.091  19.087 38.262 1.00 32.52  ? 60  ALA B CA  1 
ATOM   1534 C  C   . ALA B 1 64  ? 11.808  18.256 38.192 1.00 31.59  ? 60  ALA B C   1 
ATOM   1535 O  O   . ALA B 1 64  ? 11.791  17.193 37.569 1.00 32.16  ? 60  ALA B O   1 
ATOM   1536 C  CB  . ALA B 1 64  ? 14.315  18.176 38.146 1.00 33.02  ? 60  ALA B CB  1 
ATOM   1537 N  N   . GLN B 1 65  ? 10.743  18.744 38.826 1.00 29.94  ? 61  GLN B N   1 
ATOM   1538 C  CA  . GLN B 1 65  ? 9.459   18.037 38.834 1.00 29.00  ? 61  GLN B CA  1 
ATOM   1539 C  C   . GLN B 1 65  ? 8.793   18.123 37.458 1.00 28.22  ? 61  GLN B C   1 
ATOM   1540 O  O   . GLN B 1 65  ? 8.923   19.148 36.776 1.00 28.42  ? 61  GLN B O   1 
ATOM   1541 C  CB  . GLN B 1 65  ? 8.527   18.620 39.905 1.00 28.94  ? 61  GLN B CB  1 
ATOM   1542 C  CG  . GLN B 1 65  ? 9.122   18.650 41.347 1.00 28.31  ? 61  GLN B CG  1 
ATOM   1543 C  CD  . GLN B 1 65  ? 8.180   19.259 42.343 1.00 28.26  ? 61  GLN B CD  1 
ATOM   1544 O  OE1 . GLN B 1 65  ? 6.988   19.428 42.068 1.00 27.36  ? 61  GLN B OE1 1 
ATOM   1545 N  NE2 . GLN B 1 65  ? 8.701   19.610 43.516 1.00 26.92  ? 61  GLN B NE2 1 
ATOM   1546 N  N   . PRO B 1 66  ? 8.057   17.067 37.053 1.00 26.80  ? 62  PRO B N   1 
ATOM   1547 C  CA  . PRO B 1 66  ? 7.308   17.152 35.793 1.00 25.87  ? 62  PRO B CA  1 
ATOM   1548 C  C   . PRO B 1 66  ? 6.191   18.191 35.866 1.00 25.22  ? 62  PRO B C   1 
ATOM   1549 O  O   . PRO B 1 66  ? 5.705   18.500 36.953 1.00 25.09  ? 62  PRO B O   1 
ATOM   1550 C  CB  . PRO B 1 66  ? 6.698   15.752 35.641 1.00 25.14  ? 62  PRO B CB  1 
ATOM   1551 C  CG  . PRO B 1 66  ? 6.634   15.198 37.030 1.00 25.79  ? 62  PRO B CG  1 
ATOM   1552 C  CD  . PRO B 1 66  ? 7.855   15.774 37.732 1.00 27.16  ? 62  PRO B CD  1 
ATOM   1553 N  N   . SER B 1 67  ? 5.840   18.756 34.712 1.00 24.42  ? 63  SER B N   1 
ATOM   1554 C  CA  . SER B 1 67  ? 4.778   19.735 34.573 1.00 23.78  ? 63  SER B CA  1 
ATOM   1555 C  C   . SER B 1 67  ? 3.430   19.067 34.868 1.00 23.67  ? 63  SER B C   1 
ATOM   1556 O  O   . SER B 1 67  ? 3.328   17.822 34.933 1.00 23.54  ? 63  SER B O   1 
ATOM   1557 C  CB  . SER B 1 67  ? 4.727   20.234 33.113 1.00 23.66  ? 63  SER B CB  1 
ATOM   1558 O  OG  . SER B 1 67  ? 4.373   19.158 32.246 1.00 22.99  ? 63  SER B OG  1 
ATOM   1559 N  N   . LYS B 1 68  ? 2.396   19.887 35.013 1.00 23.20  ? 64  LYS B N   1 
ATOM   1560 C  CA  . LYS B 1 68  ? 1.065   19.376 35.251 1.00 23.65  ? 64  LYS B CA  1 
ATOM   1561 C  C   . LYS B 1 68  ? 0.703   18.364 34.160 1.00 24.20  ? 64  LYS B C   1 
ATOM   1562 O  O   . LYS B 1 68  ? 0.099   17.313 34.422 1.00 23.45  ? 64  LYS B O   1 
ATOM   1563 C  CB  . LYS B 1 68  ? 0.070   20.531 35.238 1.00 23.81  ? 64  LYS B CB  1 
ATOM   1564 C  CG  . LYS B 1 68  ? -1.363  20.094 35.492 1.00 25.51  ? 64  LYS B CG  1 
ATOM   1565 C  CD  . LYS B 1 68  ? -2.323  21.257 35.272 1.00 30.49  ? 64  LYS B CD  1 
ATOM   1566 C  CE  . LYS B 1 68  ? -3.547  21.100 36.160 1.00 33.68  ? 64  LYS B CE  1 
ATOM   1567 N  NZ  . LYS B 1 68  ? -4.820  21.431 35.422 1.00 34.43  ? 64  LYS B NZ  1 
ATOM   1568 N  N   . GLU B 1 69  ? 1.102   18.674 32.932 1.00 24.31  ? 65  GLU B N   1 
ATOM   1569 C  CA  . GLU B 1 69  ? 0.799   17.790 31.809 1.00 25.75  ? 65  GLU B CA  1 
ATOM   1570 C  C   . GLU B 1 69  ? 1.610   16.490 31.778 1.00 24.81  ? 65  GLU B C   1 
ATOM   1571 O  O   . GLU B 1 69  ? 1.062   15.438 31.442 1.00 25.40  ? 65  GLU B O   1 
ATOM   1572 C  CB  . GLU B 1 69  ? 0.899   18.568 30.482 1.00 26.39  ? 65  GLU B CB  1 
ATOM   1573 C  CG  . GLU B 1 69  ? -0.158  19.687 30.345 1.00 32.51  ? 65  GLU B CG  1 
ATOM   1574 C  CD  . GLU B 1 69  ? -1.624  19.168 30.374 1.00 38.74  ? 65  GLU B CD  1 
ATOM   1575 O  OE1 . GLU B 1 69  ? -1.872  18.037 29.904 1.00 42.16  ? 65  GLU B OE1 1 
ATOM   1576 O  OE2 . GLU B 1 69  ? -2.525  19.899 30.866 1.00 41.86  ? 65  GLU B OE2 1 
ATOM   1577 N  N   . GLU B 1 70  ? 2.894   16.549 32.136 1.00 24.04  ? 66  GLU B N   1 
ATOM   1578 C  CA  . GLU B 1 70  ? 3.763   15.360 32.132 1.00 24.46  ? 66  GLU B CA  1 
ATOM   1579 C  C   . GLU B 1 70  ? 3.586   14.424 33.347 1.00 22.12  ? 66  GLU B C   1 
ATOM   1580 O  O   . GLU B 1 70  ? 3.893   13.229 33.296 1.00 20.79  ? 66  GLU B O   1 
ATOM   1581 C  CB  . GLU B 1 70  ? 5.238   15.780 32.109 1.00 24.58  ? 66  GLU B CB  1 
ATOM   1582 C  CG  . GLU B 1 70  ? 5.686   16.589 30.880 1.00 28.08  ? 66  GLU B CG  1 
ATOM   1583 C  CD  . GLU B 1 70  ? 7.025   17.344 31.095 1.00 28.85  ? 66  GLU B CD  1 
ATOM   1584 O  OE1 . GLU B 1 70  ? 7.383   17.748 32.260 1.00 34.68  ? 66  GLU B OE1 1 
ATOM   1585 O  OE2 . GLU B 1 70  ? 7.722   17.542 30.059 1.00 30.69  ? 66  GLU B OE2 1 
ATOM   1586 N  N   . ALA B 1 71  ? 3.121   14.982 34.451 1.00 19.47  ? 67  ALA B N   1 
ATOM   1587 C  CA  . ALA B 1 71  ? 2.987   14.219 35.656 1.00 18.16  ? 67  ALA B CA  1 
ATOM   1588 C  C   . ALA B 1 71  ? 1.838   13.239 35.722 1.00 17.77  ? 67  ALA B C   1 
ATOM   1589 O  O   . ALA B 1 71  ? 0.850   13.368 35.022 1.00 16.88  ? 67  ALA B O   1 
ATOM   1590 C  CB  . ALA B 1 71  ? 2.915   15.188 36.847 1.00 17.88  ? 67  ALA B CB  1 
ATOM   1591 N  N   . ASP B 1 72  ? 1.991   12.257 36.611 1.00 17.76  ? 68  ASP B N   1 
ATOM   1592 C  CA  . ASP B 1 72  ? 0.974   11.270 36.891 1.00 17.54  ? 68  ASP B CA  1 
ATOM   1593 C  C   . ASP B 1 72  ? 0.054   11.827 37.971 1.00 18.15  ? 68  ASP B C   1 
ATOM   1594 O  O   . ASP B 1 72  ? -1.177  11.719 37.866 1.00 19.14  ? 68  ASP B O   1 
ATOM   1595 C  CB  . ASP B 1 72  ? 1.569   9.997  37.433 1.00 16.89  ? 68  ASP B CB  1 
ATOM   1596 C  CG  . ASP B 1 72  ? 2.023   9.035  36.349 1.00 17.53  ? 68  ASP B CG  1 
ATOM   1597 O  OD1 . ASP B 1 72  ? 1.483   9.048  35.224 1.00 17.92  ? 68  ASP B OD1 1 
ATOM   1598 O  OD2 . ASP B 1 72  ? 2.916   8.231  36.670 1.00 16.07  ? 68  ASP B OD2 1 
ATOM   1599 N  N   . CYS B 1 73  ? 0.654   12.443 38.995 1.00 18.45  ? 69  CYS B N   1 
ATOM   1600 C  CA  . CYS B 1 73  ? -0.089  13.008 40.124 1.00 17.75  ? 69  CYS B CA  1 
ATOM   1601 C  C   . CYS B 1 73  ? 0.731   14.033 40.877 1.00 17.60  ? 69  CYS B C   1 
ATOM   1602 O  O   . CYS B 1 73  ? 1.882   14.259 40.549 1.00 17.65  ? 69  CYS B O   1 
ATOM   1603 C  CB  . CYS B 1 73  ? -0.446  11.898 41.138 1.00 17.75  ? 69  CYS B CB  1 
ATOM   1604 S  SG  . CYS B 1 73  ? 0.940   11.124 42.061 1.00 21.49  ? 69  CYS B SG  1 
ATOM   1605 N  N   . HIS B 1 74  ? 0.096   14.637 41.886 1.00 17.70  ? 70  HIS B N   1 
ATOM   1606 C  CA  . HIS B 1 74  ? 0.729   15.557 42.830 1.00 17.10  ? 70  HIS B CA  1 
ATOM   1607 C  C   . HIS B 1 74  ? 0.698   14.822 44.174 1.00 16.56  ? 70  HIS B C   1 
ATOM   1608 O  O   . HIS B 1 74  ? -0.362  14.347 44.605 1.00 16.83  ? 70  HIS B O   1 
ATOM   1609 C  CB  . HIS B 1 74  ? -0.036  16.861 43.001 1.00 16.12  ? 70  HIS B CB  1 
ATOM   1610 C  CG  . HIS B 1 74  ? 0.727   17.890 43.783 1.00 16.64  ? 70  HIS B CG  1 
ATOM   1611 N  ND1 . HIS B 1 74  ? 1.872   18.477 43.293 1.00 16.39  ? 70  HIS B ND1 1 
ATOM   1612 C  CD2 . HIS B 1 74  ? 0.528   18.426 45.017 1.00 17.02  ? 70  HIS B CD2 1 
ATOM   1613 C  CE1 . HIS B 1 74  ? 2.336   19.348 44.175 1.00 16.94  ? 70  HIS B CE1 1 
ATOM   1614 N  NE2 . HIS B 1 74  ? 1.548   19.324 45.235 1.00 17.21  ? 70  HIS B NE2 1 
ATOM   1615 N  N   . ILE B 1 75  ? 1.854   14.689 44.827 1.00 18.13  ? 71  ILE B N   1 
ATOM   1616 C  CA  . ILE B 1 75  ? 1.908   14.036 46.142 1.00 18.36  ? 71  ILE B CA  1 
ATOM   1617 C  C   . ILE B 1 75  ? 2.265   15.112 47.194 1.00 18.72  ? 71  ILE B C   1 
ATOM   1618 O  O   . ILE B 1 75  ? 3.126   15.970 46.948 1.00 18.10  ? 71  ILE B O   1 
ATOM   1619 C  CB  . ILE B 1 75  ? 2.925   12.868 46.233 1.00 18.58  ? 71  ILE B CB  1 
ATOM   1620 C  CG1 . ILE B 1 75  ? 2.510   11.709 45.300 1.00 20.56  ? 71  ILE B CG1 1 
ATOM   1621 C  CG2 . ILE B 1 75  ? 2.966   12.327 47.644 1.00 19.20  ? 71  ILE B CG2 1 
ATOM   1622 C  CD1 . ILE B 1 75  ? 3.519   10.574 45.320 1.00 19.58  ? 71  ILE B CD1 1 
ATOM   1623 N  N   . GLU B 1 76  ? 1.574   15.082 48.325 1.00 19.80  ? 72  GLU B N   1 
ATOM   1624 C  CA  . GLU B 1 76  ? 1.842   16.048 49.404 1.00 20.92  ? 72  GLU B CA  1 
ATOM   1625 C  C   . GLU B 1 76  ? 2.042   15.398 50.769 1.00 21.87  ? 72  GLU B C   1 
ATOM   1626 O  O   . GLU B 1 76  ? 1.358   14.407 51.115 1.00 21.97  ? 72  GLU B O   1 
ATOM   1627 C  CB  . GLU B 1 76  ? 0.735   17.081 49.506 1.00 19.71  ? 72  GLU B CB  1 
ATOM   1628 C  CG  . GLU B 1 76  ? 0.559   17.884 48.237 1.00 22.01  ? 72  GLU B CG  1 
ATOM   1629 C  CD  . GLU B 1 76  ? -0.622  18.836 48.310 1.00 22.75  ? 72  GLU B CD  1 
ATOM   1630 O  OE1 . GLU B 1 76  ? -1.434  18.670 49.241 1.00 19.56  ? 72  GLU B OE1 1 
ATOM   1631 O  OE2 . GLU B 1 76  ? -0.751  19.748 47.430 1.00 22.12  ? 72  GLU B OE2 1 
ATOM   1632 N  N   . ALA B 1 77  ? 2.977   15.978 51.532 1.00 21.48  ? 73  ALA B N   1 
ATOM   1633 C  CA  . ALA B 1 77  ? 3.265   15.579 52.882 1.00 21.83  ? 73  ALA B CA  1 
ATOM   1634 C  C   . ALA B 1 77  ? 2.757   16.747 53.703 1.00 22.43  ? 73  ALA B C   1 
ATOM   1635 O  O   . ALA B 1 77  ? 3.208   17.875 53.520 1.00 21.64  ? 73  ALA B O   1 
ATOM   1636 C  CB  . ALA B 1 77  ? 4.789   15.404 53.117 1.00 22.07  ? 73  ALA B CB  1 
ATOM   1637 N  N   . ASP B 1 78  ? 1.795   16.464 54.573 1.00 23.56  ? 74  ASP B N   1 
ATOM   1638 C  CA  . ASP B 1 78  ? 1.224   17.450 55.488 1.00 25.10  ? 74  ASP B CA  1 
ATOM   1639 C  C   . ASP B 1 78  ? 1.989   17.170 56.785 1.00 23.83  ? 74  ASP B C   1 
ATOM   1640 O  O   . ASP B 1 78  ? 1.924   16.072 57.335 1.00 24.08  ? 74  ASP B O   1 
ATOM   1641 C  CB  . ASP B 1 78  ? -0.298  17.230 55.655 1.00 25.84  ? 74  ASP B CB  1 
ATOM   1642 C  CG  . ASP B 1 78  ? -1.047  17.204 54.320 1.00 32.97  ? 74  ASP B CG  1 
ATOM   1643 O  OD1 . ASP B 1 78  ? -0.978  18.225 53.577 1.00 40.22  ? 74  ASP B OD1 1 
ATOM   1644 O  OD2 . ASP B 1 78  ? -1.710  16.167 53.991 1.00 39.44  ? 74  ASP B OD2 1 
ATOM   1645 N  N   . ILE B 1 79  ? 2.785   18.133 57.228 1.00 23.53  ? 75  ILE B N   1 
ATOM   1646 C  CA  . ILE B 1 79  ? 3.614   17.961 58.408 1.00 22.89  ? 75  ILE B CA  1 
ATOM   1647 C  C   . ILE B 1 79  ? 3.305   19.051 59.441 1.00 23.39  ? 75  ILE B C   1 
ATOM   1648 O  O   . ILE B 1 79  ? 3.564   20.227 59.204 1.00 23.03  ? 75  ILE B O   1 
ATOM   1649 C  CB  . ILE B 1 79  ? 5.145   18.001 58.039 1.00 23.35  ? 75  ILE B CB  1 
ATOM   1650 C  CG1 . ILE B 1 79  ? 5.476   16.957 56.942 1.00 22.75  ? 75  ILE B CG1 1 
ATOM   1651 C  CG2 . ILE B 1 79  ? 6.015   17.799 59.300 1.00 21.50  ? 75  ILE B CG2 1 
ATOM   1652 C  CD1 . ILE B 1 79  ? 6.930   16.855 56.531 1.00 21.30  ? 75  ILE B CD1 1 
ATOM   1653 N  N   . HIS B 1 80  ? 2.708   18.645 60.555 1.00 23.75  ? 76  HIS B N   1 
ATOM   1654 C  CA  . HIS B 1 80  ? 2.358   19.556 61.654 1.00 24.29  ? 76  HIS B CA  1 
ATOM   1655 C  C   . HIS B 1 80  ? 2.965   19.053 62.965 1.00 23.58  ? 76  HIS B C   1 
ATOM   1656 O  O   . HIS B 1 80  ? 3.134   17.854 63.138 1.00 23.45  ? 76  HIS B O   1 
ATOM   1657 C  CB  . HIS B 1 80  ? 0.831   19.631 61.774 1.00 25.19  ? 76  HIS B CB  1 
ATOM   1658 C  CG  . HIS B 1 80  ? 0.168   20.054 60.502 1.00 30.21  ? 76  HIS B CG  1 
ATOM   1659 N  ND1 . HIS B 1 80  ? 0.157   21.364 60.073 1.00 33.43  ? 76  HIS B ND1 1 
ATOM   1660 C  CD2 . HIS B 1 80  ? -0.442  19.335 59.529 1.00 33.26  ? 76  HIS B CD2 1 
ATOM   1661 C  CE1 . HIS B 1 80  ? -0.453  21.440 58.902 1.00 34.73  ? 76  HIS B CE1 1 
ATOM   1662 N  NE2 . HIS B 1 80  ? -0.828  20.221 58.551 1.00 36.45  ? 76  HIS B NE2 1 
ATOM   1663 N  N   . ALA B 1 81  ? 3.280   19.964 63.893 1.00 22.49  ? 77  ALA B N   1 
ATOM   1664 C  CA  . ALA B 1 81  ? 3.831   19.583 65.192 1.00 22.66  ? 77  ALA B CA  1 
ATOM   1665 C  C   . ALA B 1 81  ? 2.808   18.804 66.019 1.00 23.24  ? 77  ALA B C   1 
ATOM   1666 O  O   . ALA B 1 81  ? 1.622   19.140 66.037 1.00 23.11  ? 77  ALA B O   1 
ATOM   1667 C  CB  . ALA B 1 81  ? 4.242   20.851 65.985 1.00 21.50  ? 77  ALA B CB  1 
ATOM   1668 N  N   . ASN B 1 82  ? 3.276   17.800 66.754 1.00 24.12  ? 78  ASN B N   1 
ATOM   1669 C  CA  . ASN B 1 82  ? 2.390   17.057 67.638 1.00 24.71  ? 78  ASN B CA  1 
ATOM   1670 C  C   . ASN B 1 82  ? 2.702   17.514 69.061 1.00 24.85  ? 78  ASN B C   1 
ATOM   1671 O  O   . ASN B 1 82  ? 3.416   18.518 69.272 1.00 24.50  ? 78  ASN B O   1 
ATOM   1672 C  CB  . ASN B 1 82  ? 2.537   15.544 67.447 1.00 24.68  ? 78  ASN B CB  1 
ATOM   1673 C  CG  . ASN B 1 82  ? 3.948   15.057 67.673 1.00 25.72  ? 78  ASN B CG  1 
ATOM   1674 O  OD1 . ASN B 1 82  ? 4.747   15.718 68.344 1.00 24.96  ? 78  ASN B OD1 1 
ATOM   1675 N  ND2 . ASN B 1 82  ? 4.260   13.877 67.138 1.00 27.49  ? 78  ASN B ND2 1 
ATOM   1676 N  N   . GLU B 1 83  ? 2.176   16.795 70.050 1.00 25.53  ? 79  GLU B N   1 
ATOM   1677 C  CA  . GLU B 1 83  ? 2.419   17.162 71.432 1.00 26.16  ? 79  GLU B CA  1 
ATOM   1678 C  C   . GLU B 1 83  ? 3.905   17.317 71.737 1.00 25.62  ? 79  GLU B C   1 
ATOM   1679 O  O   . GLU B 1 83  ? 4.281   18.225 72.458 1.00 25.69  ? 79  GLU B O   1 
ATOM   1680 C  CB  . GLU B 1 83  ? 1.759   16.161 72.395 1.00 26.83  ? 79  GLU B CB  1 
ATOM   1681 C  CG  . GLU B 1 83  ? 0.214   16.230 72.442 1.00 30.54  ? 79  GLU B CG  1 
ATOM   1682 C  CD  . GLU B 1 83  ? -0.308  17.592 72.919 1.00 33.23  ? 79  GLU B CD  1 
ATOM   1683 O  OE1 . GLU B 1 83  ? 0.314   18.195 73.823 1.00 34.87  ? 79  GLU B OE1 1 
ATOM   1684 O  OE2 . GLU B 1 83  ? -1.345  18.052 72.384 1.00 34.55  ? 79  GLU B OE2 1 
ATOM   1685 N  N   . ALA B 1 84  ? 4.743   16.464 71.148 1.00 25.90  ? 80  ALA B N   1 
ATOM   1686 C  CA  . ALA B 1 84  ? 6.219   16.488 71.367 1.00 26.38  ? 80  ALA B CA  1 
ATOM   1687 C  C   . ALA B 1 84  ? 7.236   17.522 70.761 1.00 26.54  ? 80  ALA B C   1 
ATOM   1688 O  O   . ALA B 1 84  ? 8.272   17.722 71.383 1.00 26.90  ? 80  ALA B O   1 
ATOM   1689 C  CB  . ALA B 1 84  ? 6.771   15.091 71.107 1.00 25.11  ? 80  ALA B CB  1 
ATOM   1690 N  N   . GLY B 1 85  ? 7.026   18.258 69.667 1.00 28.06  ? 81  GLY B N   1 
ATOM   1691 C  CA  . GLY B 1 85  ? 5.963   19.198 69.410 1.00 28.16  ? 81  GLY B CA  1 
ATOM   1692 C  C   . GLY B 1 85  ? 6.372   20.485 70.131 1.00 28.17  ? 81  GLY B C   1 
ATOM   1693 O  O   . GLY B 1 85  ? 7.259   21.261 69.706 1.00 28.18  ? 81  GLY B O   1 
ATOM   1694 N  N   . LYS B 1 86  ? 5.726   20.679 71.265 1.00 27.64  ? 82  LYS B N   1 
ATOM   1695 C  CA  . LYS B 1 86  ? 5.930   21.820 72.133 1.00 28.01  ? 82  LYS B CA  1 
ATOM   1696 C  C   . LYS B 1 86  ? 7.370   22.029 72.651 1.00 27.76  ? 82  LYS B C   1 
ATOM   1697 O  O   . LYS B 1 86  ? 7.752   23.180 72.916 1.00 27.85  ? 82  LYS B O   1 
ATOM   1698 C  CB  . LYS B 1 86  ? 4.927   21.727 73.297 1.00 28.29  ? 82  LYS B CB  1 
ATOM   1699 C  CG  . LYS B 1 86  ? 3.461   21.529 72.821 1.00 28.66  ? 82  LYS B CG  1 
ATOM   1700 C  CD  . LYS B 1 86  ? 2.505   21.213 73.971 1.00 28.83  ? 82  LYS B CD  1 
ATOM   1701 C  CE  . LYS B 1 86  ? 2.017   22.487 74.635 1.00 31.75  ? 82  LYS B CE  1 
ATOM   1702 N  NZ  . LYS B 1 86  ? 1.759   22.315 76.099 1.00 34.48  ? 82  LYS B NZ  1 
ATOM   1703 N  N   . ASP B 1 87  ? 8.166   20.957 72.809 1.00 27.09  ? 83  ASP B N   1 
ATOM   1704 C  CA  . ASP B 1 87  ? 9.570   21.106 73.315 1.00 27.13  ? 83  ASP B CA  1 
ATOM   1705 C  C   . ASP B 1 87  ? 10.485  21.895 72.388 1.00 25.91  ? 83  ASP B C   1 
ATOM   1706 O  O   . ASP B 1 87  ? 11.530  22.383 72.821 1.00 25.98  ? 83  ASP B O   1 
ATOM   1707 C  CB  . ASP B 1 87  ? 10.249  19.758 73.602 1.00 27.80  ? 83  ASP B CB  1 
ATOM   1708 C  CG  . ASP B 1 87  ? 9.514   18.934 74.641 1.00 31.56  ? 83  ASP B CG  1 
ATOM   1709 O  OD1 . ASP B 1 87  ? 8.831   19.518 75.525 1.00 33.91  ? 83  ASP B OD1 1 
ATOM   1710 O  OD2 . ASP B 1 87  ? 9.634   17.683 74.578 1.00 35.88  ? 83  ASP B OD2 1 
ATOM   1711 N  N   . LEU B 1 88  ? 10.111  21.996 71.116 1.00 24.11  ? 84  LEU B N   1 
ATOM   1712 C  CA  . LEU B 1 88  ? 10.906  22.740 70.135 1.00 23.49  ? 84  LEU B CA  1 
ATOM   1713 C  C   . LEU B 1 88  ? 10.365  24.169 69.972 1.00 23.39  ? 84  LEU B C   1 
ATOM   1714 O  O   . LEU B 1 88  ? 10.966  24.993 69.268 1.00 22.75  ? 84  LEU B O   1 
ATOM   1715 C  CB  . LEU B 1 88  ? 10.924  22.027 68.782 1.00 23.55  ? 84  LEU B CB  1 
ATOM   1716 C  CG  . LEU B 1 88  ? 11.782  20.762 68.683 1.00 23.40  ? 84  LEU B CG  1 
ATOM   1717 C  CD1 . LEU B 1 88  ? 11.545  20.122 67.345 1.00 21.30  ? 84  LEU B CD1 1 
ATOM   1718 C  CD2 . LEU B 1 88  ? 13.265  21.100 68.816 1.00 22.61  ? 84  LEU B CD2 1 
ATOM   1719 N  N   . GLY B 1 89  ? 9.228   24.442 70.610 1.00 22.79  ? 85  GLY B N   1 
ATOM   1720 C  CA  . GLY B 1 89  ? 8.598   25.769 70.550 1.00 23.78  ? 85  GLY B CA  1 
ATOM   1721 C  C   . GLY B 1 89  ? 7.344   25.855 69.694 1.00 23.87  ? 85  GLY B C   1 
ATOM   1722 O  O   . GLY B 1 89  ? 6.677   26.890 69.669 1.00 23.46  ? 85  GLY B O   1 
ATOM   1723 N  N   . TYR B 1 90  ? 7.017   24.772 68.989 1.00 23.85  ? 86  TYR B N   1 
ATOM   1724 C  CA  . TYR B 1 90  ? 5.838   24.774 68.136 1.00 23.79  ? 86  TYR B CA  1 
ATOM   1725 C  C   . TYR B 1 90  ? 4.565   24.598 68.906 1.00 24.57  ? 86  TYR B C   1 
ATOM   1726 O  O   . TYR B 1 90  ? 4.525   23.973 69.955 1.00 22.97  ? 86  TYR B O   1 
ATOM   1727 C  CB  . TYR B 1 90  ? 5.881   23.659 67.074 1.00 23.52  ? 86  TYR B CB  1 
ATOM   1728 C  CG  . TYR B 1 90  ? 7.097   23.718 66.199 1.00 23.76  ? 86  TYR B CG  1 
ATOM   1729 C  CD1 . TYR B 1 90  ? 7.200   24.652 65.174 1.00 21.13  ? 86  TYR B CD1 1 
ATOM   1730 C  CD2 . TYR B 1 90  ? 8.168   22.847 66.420 1.00 23.39  ? 86  TYR B CD2 1 
ATOM   1731 C  CE1 . TYR B 1 90  ? 8.356   24.735 64.391 1.00 22.68  ? 86  TYR B CE1 1 
ATOM   1732 C  CE2 . TYR B 1 90  ? 9.310   22.901 65.624 1.00 21.99  ? 86  TYR B CE2 1 
ATOM   1733 C  CZ  . TYR B 1 90  ? 9.404   23.846 64.627 1.00 22.95  ? 86  TYR B CZ  1 
ATOM   1734 O  OH  . TYR B 1 90  ? 10.555  23.882 63.856 1.00 22.81  ? 86  TYR B OH  1 
ATOM   1735 N  N   . GLY B 1 91  ? 3.496   25.123 68.324 1.00 26.01  ? 87  GLY B N   1 
ATOM   1736 C  CA  . GLY B 1 91  ? 2.188   24.954 68.892 1.00 25.50  ? 87  GLY B CA  1 
ATOM   1737 C  C   . GLY B 1 91  ? 1.746   23.657 68.265 1.00 25.88  ? 87  GLY B C   1 
ATOM   1738 O  O   . GLY B 1 91  ? 2.154   23.317 67.143 1.00 24.43  ? 87  GLY B O   1 
ATOM   1739 N  N   . VAL B 1 92  ? 0.914   22.913 68.982 1.00 26.50  ? 88  VAL B N   1 
ATOM   1740 C  CA  . VAL B 1 92  ? 0.409   21.659 68.457 1.00 27.36  ? 88  VAL B CA  1 
ATOM   1741 C  C   . VAL B 1 92  ? -0.444  22.019 67.237 1.00 28.22  ? 88  VAL B C   1 
ATOM   1742 O  O   . VAL B 1 92  ? -1.248  22.960 67.295 1.00 29.32  ? 88  VAL B O   1 
ATOM   1743 C  CB  . VAL B 1 92  ? -0.418  20.902 69.517 1.00 27.93  ? 88  VAL B CB  1 
ATOM   1744 C  CG1 . VAL B 1 92  ? -1.045  19.646 68.914 1.00 27.16  ? 88  VAL B CG1 1 
ATOM   1745 C  CG2 . VAL B 1 92  ? 0.458   20.566 70.705 1.00 27.16  ? 88  VAL B CG2 1 
ATOM   1746 N  N   . GLY B 1 93  ? -0.244  21.307 66.129 1.00 28.44  ? 89  GLY B N   1 
ATOM   1747 C  CA  . GLY B 1 93  ? -1.007  21.560 64.907 1.00 28.00  ? 89  GLY B CA  1 
ATOM   1748 C  C   . GLY B 1 93  ? -0.371  22.546 63.956 1.00 27.42  ? 89  GLY B C   1 
ATOM   1749 O  O   . GLY B 1 93  ? -0.778  22.623 62.805 1.00 28.76  ? 89  GLY B O   1 
ATOM   1750 N  N   . ASP B 1 94  ? 0.624   23.295 64.428 1.00 26.87  ? 90  ASP B N   1 
ATOM   1751 C  CA  . ASP B 1 94  ? 1.336   24.270 63.616 1.00 25.72  ? 90  ASP B CA  1 
ATOM   1752 C  C   . ASP B 1 94  ? 2.017   23.525 62.486 1.00 24.96  ? 90  ASP B C   1 
ATOM   1753 O  O   . ASP B 1 94  ? 2.567   22.445 62.707 1.00 24.96  ? 90  ASP B O   1 
ATOM   1754 C  CB  . ASP B 1 94  ? 2.490   24.934 64.405 1.00 26.01  ? 90  ASP B CB  1 
ATOM   1755 C  CG  . ASP B 1 94  ? 2.030   26.017 65.383 1.00 26.74  ? 90  ASP B CG  1 
ATOM   1756 O  OD1 . ASP B 1 94  ? 0.813   26.167 65.637 1.00 29.04  ? 90  ASP B OD1 1 
ATOM   1757 O  OD2 . ASP B 1 94  ? 2.923   26.726 65.907 1.00 23.94  ? 90  ASP B OD2 1 
ATOM   1758 N  N   . PHE B 1 95  ? 2.051   24.130 61.301 1.00 23.29  ? 91  PHE B N   1 
ATOM   1759 C  CA  . PHE B 1 95  ? 2.780   23.583 60.185 1.00 21.91  ? 91  PHE B CA  1 
ATOM   1760 C  C   . PHE B 1 95  ? 4.248   23.718 60.628 1.00 21.68  ? 91  PHE B C   1 
ATOM   1761 O  O   . PHE B 1 95  ? 4.592   24.673 61.339 1.00 21.63  ? 91  PHE B O   1 
ATOM   1762 C  CB  . PHE B 1 95  ? 2.553   24.487 58.970 1.00 22.17  ? 91  PHE B CB  1 
ATOM   1763 C  CG  . PHE B 1 95  ? 3.520   24.252 57.832 1.00 21.87  ? 91  PHE B CG  1 
ATOM   1764 C  CD1 . PHE B 1 95  ? 3.563   23.010 57.175 1.00 22.45  ? 91  PHE B CD1 1 
ATOM   1765 C  CD2 . PHE B 1 95  ? 4.366   25.276 57.384 1.00 21.52  ? 91  PHE B CD2 1 
ATOM   1766 C  CE1 . PHE B 1 95  ? 4.449   22.806 56.095 1.00 20.38  ? 91  PHE B CE1 1 
ATOM   1767 C  CE2 . PHE B 1 95  ? 5.259   25.056 56.303 1.00 21.66  ? 91  PHE B CE2 1 
ATOM   1768 C  CZ  . PHE B 1 95  ? 5.275   23.835 55.665 1.00 20.36  ? 91  PHE B CZ  1 
ATOM   1769 N  N   . VAL B 1 96  ? 5.117   22.786 60.244 1.00 20.25  ? 92  VAL B N   1 
ATOM   1770 C  CA  . VAL B 1 96  ? 6.533   22.883 60.643 1.00 18.48  ? 92  VAL B CA  1 
ATOM   1771 C  C   . VAL B 1 96  ? 7.334   23.239 59.392 1.00 18.85  ? 92  VAL B C   1 
ATOM   1772 O  O   . VAL B 1 96  ? 7.609   22.346 58.572 1.00 18.00  ? 92  VAL B O   1 
ATOM   1773 C  CB  . VAL B 1 96  ? 7.085   21.542 61.285 1.00 18.01  ? 92  VAL B CB  1 
ATOM   1774 C  CG1 . VAL B 1 96  ? 8.556   21.635 61.673 1.00 17.21  ? 92  VAL B CG1 1 
ATOM   1775 C  CG2 . VAL B 1 96  ? 6.298   21.186 62.537 1.00 17.33  ? 92  VAL B CG2 1 
ATOM   1776 N  N   . PRO B 1 97  ? 7.732   24.529 59.249 1.00 18.51  ? 93  PRO B N   1 
ATOM   1777 C  CA  . PRO B 1 97  ? 8.473   24.948 58.061 1.00 18.48  ? 93  PRO B CA  1 
ATOM   1778 C  C   . PRO B 1 97  ? 9.993   24.678 58.121 1.00 19.21  ? 93  PRO B C   1 
ATOM   1779 O  O   . PRO B 1 97  ? 10.529  24.310 59.179 1.00 18.79  ? 93  PRO B O   1 
ATOM   1780 C  CB  . PRO B 1 97  ? 8.224   26.476 58.031 1.00 18.69  ? 93  PRO B CB  1 
ATOM   1781 C  CG  . PRO B 1 97  ? 8.098   26.854 59.485 1.00 18.88  ? 93  PRO B CG  1 
ATOM   1782 C  CD  . PRO B 1 97  ? 7.531   25.644 60.203 1.00 18.42  ? 93  PRO B CD  1 
ATOM   1783 N  N   . TYR B 1 98  ? 10.662  24.899 56.990 1.00 19.16  ? 94  TYR B N   1 
ATOM   1784 C  CA  . TYR B 1 98  ? 12.122  24.767 56.812 1.00 19.07  ? 94  TYR B CA  1 
ATOM   1785 C  C   . TYR B 1 98  ? 12.670  23.342 56.823 1.00 19.77  ? 94  TYR B C   1 
ATOM   1786 O  O   . TYR B 1 98  ? 13.867  23.147 56.898 1.00 20.04  ? 94  TYR B O   1 
ATOM   1787 C  CB  . TYR B 1 98  ? 12.913  25.661 57.797 1.00 18.82  ? 94  TYR B CB  1 
ATOM   1788 C  CG  . TYR B 1 98  ? 12.553  27.133 57.659 1.00 17.93  ? 94  TYR B CG  1 
ATOM   1789 C  CD1 . TYR B 1 98  ? 13.206  27.956 56.744 1.00 18.58  ? 94  TYR B CD1 1 
ATOM   1790 C  CD2 . TYR B 1 98  ? 11.544  27.685 58.431 1.00 16.57  ? 94  TYR B CD2 1 
ATOM   1791 C  CE1 . TYR B 1 98  ? 12.840  29.311 56.615 1.00 16.93  ? 94  TYR B CE1 1 
ATOM   1792 C  CE2 . TYR B 1 98  ? 11.176  29.037 58.323 1.00 19.97  ? 94  TYR B CE2 1 
ATOM   1793 C  CZ  . TYR B 1 98  ? 11.834  29.842 57.435 1.00 18.71  ? 94  TYR B CZ  1 
ATOM   1794 O  OH  . TYR B 1 98  ? 11.490  31.173 57.321 1.00 13.76  ? 94  TYR B OH  1 
ATOM   1795 N  N   . LEU B 1 99  ? 11.779  22.369 56.718 1.00 19.64  ? 95  LEU B N   1 
ATOM   1796 C  CA  . LEU B 1 99  ? 12.187  20.970 56.680 1.00 19.75  ? 95  LEU B CA  1 
ATOM   1797 C  C   . LEU B 1 99  ? 12.627  20.615 55.258 1.00 20.46  ? 95  LEU B C   1 
ATOM   1798 O  O   . LEU B 1 99  ? 12.245  21.290 54.274 1.00 20.68  ? 95  LEU B O   1 
ATOM   1799 C  CB  . LEU B 1 99  ? 11.026  20.044 57.143 1.00 18.12  ? 95  LEU B CB  1 
ATOM   1800 C  CG  . LEU B 1 99  ? 10.393  20.340 58.511 1.00 18.93  ? 95  LEU B CG  1 
ATOM   1801 C  CD1 . LEU B 1 99  ? 9.241   19.425 58.837 1.00 20.85  ? 95  LEU B CD1 1 
ATOM   1802 C  CD2 . LEU B 1 99  ? 11.459  20.320 59.660 1.00 22.78  ? 95  LEU B CD2 1 
ATOM   1803 N  N   . ARG B 1 100 ? 13.398  19.539 55.143 1.00 19.97  ? 96  ARG B N   1 
ATOM   1804 C  CA  . ARG B 1 100 ? 13.855  19.075 53.845 1.00 21.24  ? 96  ARG B CA  1 
ATOM   1805 C  C   . ARG B 1 100 ? 13.269  17.677 53.726 1.00 21.00  ? 96  ARG B C   1 
ATOM   1806 O  O   . ARG B 1 100 ? 13.706  16.754 54.397 1.00 20.91  ? 96  ARG B O   1 
ATOM   1807 C  CB  . ARG B 1 100 ? 15.362  19.093 53.784 1.00 22.01  ? 96  ARG B CB  1 
ATOM   1808 C  CG  . ARG B 1 100 ? 15.916  20.517 54.035 1.00 25.08  ? 96  ARG B CG  1 
ATOM   1809 C  CD  . ARG B 1 100 ? 17.438  20.548 54.263 1.00 33.48  ? 96  ARG B CD  1 
ATOM   1810 N  NE  . ARG B 1 100 ? 17.879  20.046 55.566 1.00 35.41  ? 96  ARG B NE  1 
ATOM   1811 C  CZ  . ARG B 1 100 ? 19.160  19.931 55.914 1.00 39.18  ? 96  ARG B CZ  1 
ATOM   1812 N  NH1 . ARG B 1 100 ? 20.107  20.307 55.062 1.00 42.45  ? 96  ARG B NH1 1 
ATOM   1813 N  NH2 . ARG B 1 100 ? 19.509  19.473 57.118 1.00 39.88  ? 96  ARG B NH2 1 
ATOM   1814 N  N   . VAL B 1 101 ? 12.216  17.570 52.922 1.00 21.36  ? 97  VAL B N   1 
ATOM   1815 C  CA  . VAL B 1 101 ? 11.467  16.318 52.716 1.00 21.00  ? 97  VAL B CA  1 
ATOM   1816 C  C   . VAL B 1 101 ? 11.767  15.656 51.366 1.00 21.35  ? 97  VAL B C   1 
ATOM   1817 O  O   . VAL B 1 101 ? 11.722  16.298 50.307 1.00 21.04  ? 97  VAL B O   1 
ATOM   1818 C  CB  . VAL B 1 101 ? 9.963   16.594 52.885 1.00 21.45  ? 97  VAL B CB  1 
ATOM   1819 C  CG1 . VAL B 1 101 ? 9.128   15.316 52.713 1.00 22.04  ? 97  VAL B CG1 1 
ATOM   1820 C  CG2 . VAL B 1 101 ? 9.718   17.284 54.265 1.00 20.65  ? 97  VAL B CG2 1 
ATOM   1821 N  N   . VAL B 1 102 ? 12.105  14.366 51.412 1.00 20.60  ? 98  VAL B N   1 
ATOM   1822 C  CA  . VAL B 1 102 ? 12.389  13.617 50.224 1.00 20.53  ? 98  VAL B CA  1 
ATOM   1823 C  C   . VAL B 1 102 ? 11.591  12.309 50.293 1.00 21.07  ? 98  VAL B C   1 
ATOM   1824 O  O   . VAL B 1 102 ? 11.542  11.668 51.347 1.00 20.80  ? 98  VAL B O   1 
ATOM   1825 C  CB  . VAL B 1 102 ? 13.892  13.300 50.097 1.00 21.14  ? 98  VAL B CB  1 
ATOM   1826 C  CG1 . VAL B 1 102 ? 14.166  12.652 48.779 1.00 21.65  ? 98  VAL B CG1 1 
ATOM   1827 C  CG2 . VAL B 1 102 ? 14.720  14.561 50.215 1.00 21.28  ? 98  VAL B CG2 1 
ATOM   1828 N  N   . ALA B 1 103 ? 10.987  11.920 49.167 1.00 20.50  ? 99  ALA B N   1 
ATOM   1829 C  CA  . ALA B 1 103 ? 10.200  10.693 49.077 1.00 21.01  ? 99  ALA B CA  1 
ATOM   1830 C  C   . ALA B 1 103 ? 10.945  9.656  48.272 1.00 20.15  ? 99  ALA B C   1 
ATOM   1831 O  O   . ALA B 1 103 ? 11.585  10.000 47.280 1.00 20.31  ? 99  ALA B O   1 
ATOM   1832 C  CB  . ALA B 1 103 ? 8.851   10.978 48.411 1.00 20.20  ? 99  ALA B CB  1 
ATOM   1833 N  N   . PHE B 1 104 ? 10.855  8.392  48.685 1.00 20.65  ? 100 PHE B N   1 
ATOM   1834 C  CA  . PHE B 1 104 ? 11.515  7.299  47.962 1.00 20.38  ? 100 PHE B CA  1 
ATOM   1835 C  C   . PHE B 1 104 ? 10.418  6.338  47.578 1.00 20.48  ? 100 PHE B C   1 
ATOM   1836 O  O   . PHE B 1 104 ? 9.605   5.980  48.426 1.00 20.03  ? 100 PHE B O   1 
ATOM   1837 C  CB  . PHE B 1 104 ? 12.568  6.618  48.825 1.00 21.80  ? 100 PHE B CB  1 
ATOM   1838 C  CG  . PHE B 1 104 ? 13.727  7.519  49.171 1.00 22.07  ? 100 PHE B CG  1 
ATOM   1839 C  CD1 . PHE B 1 104 ? 13.630  8.415  50.223 1.00 24.37  ? 100 PHE B CD1 1 
ATOM   1840 C  CD2 . PHE B 1 104 ? 14.909  7.474  48.430 1.00 24.10  ? 100 PHE B CD2 1 
ATOM   1841 C  CE1 . PHE B 1 104 ? 14.710  9.263  50.558 1.00 25.39  ? 100 PHE B CE1 1 
ATOM   1842 C  CE2 . PHE B 1 104 ? 15.976  8.315  48.748 1.00 25.72  ? 100 PHE B CE2 1 
ATOM   1843 C  CZ  . PHE B 1 104 ? 15.872  9.204  49.809 1.00 23.92  ? 100 PHE B CZ  1 
ATOM   1844 N  N   . LEU B 1 105 ? 10.382  5.936  46.308 1.00 18.88  ? 101 LEU B N   1 
ATOM   1845 C  CA  . LEU B 1 105 ? 9.328   5.069  45.831 1.00 18.57  ? 101 LEU B CA  1 
ATOM   1846 C  C   . LEU B 1 105 ? 9.928   3.824  45.248 1.00 17.76  ? 101 LEU B C   1 
ATOM   1847 O  O   . LEU B 1 105 ? 10.803  3.914  44.396 1.00 16.86  ? 101 LEU B O   1 
ATOM   1848 C  CB  . LEU B 1 105 ? 8.472   5.780  44.753 1.00 18.87  ? 101 LEU B CB  1 
ATOM   1849 C  CG  . LEU B 1 105 ? 8.093   7.261  44.894 1.00 20.42  ? 101 LEU B CG  1 
ATOM   1850 C  CD1 . LEU B 1 105 ? 7.625   7.880  43.551 1.00 21.27  ? 101 LEU B CD1 1 
ATOM   1851 C  CD2 . LEU B 1 105 ? 7.044   7.457  45.993 1.00 22.13  ? 101 LEU B CD2 1 
ATOM   1852 N  N   . GLN B 1 106 ? 9.457   2.663  45.694 1.00 17.32  ? 102 GLN B N   1 
ATOM   1853 C  CA  . GLN B 1 106 ? 9.990   1.424  45.180 1.00 19.21  ? 102 GLN B CA  1 
ATOM   1854 C  C   . GLN B 1 106 ? 8.866   0.434  44.940 1.00 20.03  ? 102 GLN B C   1 
ATOM   1855 O  O   . GLN B 1 106 ? 8.187   0.013  45.885 1.00 19.97  ? 102 GLN B O   1 
ATOM   1856 C  CB  . GLN B 1 106 ? 11.043  0.850  46.127 1.00 20.58  ? 102 GLN B CB  1 
ATOM   1857 C  CG  . GLN B 1 106 ? 11.516  -0.522 45.724 1.00 20.20  ? 102 GLN B CG  1 
ATOM   1858 C  CD  . GLN B 1 106 ? 12.579  -1.071 46.677 1.00 23.28  ? 102 GLN B CD  1 
ATOM   1859 O  OE1 . GLN B 1 106 ? 12.905  -0.456 47.679 1.00 23.70  ? 102 GLN B OE1 1 
ATOM   1860 N  NE2 . GLN B 1 106 ? 13.114  -2.229 46.349 1.00 23.73  ? 102 GLN B NE2 1 
ATOM   1861 N  N   . LYS B 1 107 ? 8.685   0.090  43.670 1.00 20.27  ? 103 LYS B N   1 
ATOM   1862 C  CA  . LYS B 1 107 ? 7.648   -0.830 43.247 1.00 21.41  ? 103 LYS B CA  1 
ATOM   1863 C  C   . LYS B 1 107 ? 7.947   -2.238 43.754 1.00 22.46  ? 103 LYS B C   1 
ATOM   1864 O  O   . LYS B 1 107 ? 9.093   -2.702 43.699 1.00 22.71  ? 103 LYS B O   1 
ATOM   1865 C  CB  . LYS B 1 107 ? 7.530   -0.813 41.706 1.00 21.68  ? 103 LYS B CB  1 
ATOM   1866 C  CG  . LYS B 1 107 ? 6.394   -1.649 41.118 1.00 22.04  ? 103 LYS B CG  1 
ATOM   1867 C  CD  . LYS B 1 107 ? 6.266   -1.427 39.575 1.00 21.39  ? 103 LYS B CD  1 
ATOM   1868 C  CE  . LYS B 1 107 ? 5.342   -2.451 38.932 1.00 24.24  ? 103 LYS B CE  1 
ATOM   1869 N  NZ  . LYS B 1 107 ? 4.922   -2.027 37.551 1.00 22.24  ? 103 LYS B NZ  1 
ATOM   1870 N  N   . HIS B 1 108 ? 6.907   -2.908 44.250 1.00 23.25  ? 104 HIS B N   1 
ATOM   1871 C  CA  . HIS B 1 108 ? 7.030   -4.267 44.742 1.00 23.54  ? 104 HIS B CA  1 
ATOM   1872 C  C   . HIS B 1 108 ? 7.393   -5.133 43.540 1.00 24.35  ? 104 HIS B C   1 
ATOM   1873 O  O   . HIS B 1 108 ? 6.675   -5.137 42.513 1.00 23.54  ? 104 HIS B O   1 
ATOM   1874 C  CB  . HIS B 1 108 ? 5.691   -4.741 45.283 1.00 23.83  ? 104 HIS B CB  1 
ATOM   1875 C  CG  . HIS B 1 108 ? 5.320   -4.163 46.611 1.00 22.37  ? 104 HIS B CG  1 
ATOM   1876 N  ND1 . HIS B 1 108 ? 4.506   -4.827 47.496 1.00 23.87  ? 104 HIS B ND1 1 
ATOM   1877 C  CD2 . HIS B 1 108 ? 5.611   -2.980 47.188 1.00 23.51  ? 104 HIS B CD2 1 
ATOM   1878 C  CE1 . HIS B 1 108 ? 4.318   -4.083 48.568 1.00 23.94  ? 104 HIS B CE1 1 
ATOM   1879 N  NE2 . HIS B 1 108 ? 4.982   -2.958 48.409 1.00 22.70  ? 104 HIS B NE2 1 
ATOM   1880 N  N   . GLY B 1 109 ? 8.512   -5.838 43.652 1.00 25.05  ? 105 GLY B N   1 
ATOM   1881 C  CA  . GLY B 1 109 ? 8.990   -6.718 42.574 1.00 26.01  ? 105 GLY B CA  1 
ATOM   1882 C  C   . GLY B 1 109 ? 10.172  -6.110 41.841 1.00 26.39  ? 105 GLY B C   1 
ATOM   1883 O  O   . GLY B 1 109 ? 10.812  -6.763 41.017 1.00 26.27  ? 105 GLY B O   1 
ATOM   1884 N  N   . SER B 1 110 ? 10.451  -4.849 42.153 1.00 26.89  ? 106 SER B N   1 
ATOM   1885 C  CA  . SER B 1 110 ? 11.548  -4.109 41.552 1.00 27.45  ? 106 SER B CA  1 
ATOM   1886 C  C   . SER B 1 110 ? 12.542  -3.677 42.621 1.00 27.90  ? 106 SER B C   1 
ATOM   1887 O  O   . SER B 1 110 ? 12.170  -3.494 43.782 1.00 28.38  ? 106 SER B O   1 
ATOM   1888 C  CB  . SER B 1 110 ? 11.000  -2.888 40.820 1.00 26.86  ? 106 SER B CB  1 
ATOM   1889 O  OG  . SER B 1 110 ? 12.023  -1.959 40.476 1.00 26.72  ? 106 SER B OG  1 
ATOM   1890 N  N   . GLU B 1 111 ? 13.808  -3.541 42.220 1.00 28.93  ? 107 GLU B N   1 
ATOM   1891 C  CA  . GLU B 1 111 ? 14.897  -3.098 43.104 1.00 28.87  ? 107 GLU B CA  1 
ATOM   1892 C  C   . GLU B 1 111 ? 15.233  -1.646 42.779 1.00 28.11  ? 107 GLU B C   1 
ATOM   1893 O  O   . GLU B 1 111 ? 16.162  -1.087 43.337 1.00 28.76  ? 107 GLU B O   1 
ATOM   1894 C  CB  . GLU B 1 111 ? 16.165  -3.923 42.902 1.00 29.62  ? 107 GLU B CB  1 
ATOM   1895 C  CG  . GLU B 1 111 ? 16.049  -5.407 43.297 1.00 34.12  ? 107 GLU B CG  1 
ATOM   1896 C  CD  . GLU B 1 111 ? 15.596  -5.608 44.750 1.00 38.11  ? 107 GLU B CD  1 
ATOM   1897 O  OE1 . GLU B 1 111 ? 16.082  -4.865 45.649 1.00 37.93  ? 107 GLU B OE1 1 
ATOM   1898 O  OE2 . GLU B 1 111 ? 14.750  -6.513 44.976 1.00 40.45  ? 107 GLU B OE2 1 
ATOM   1899 N  N   . LYS B 1 112 ? 14.508  -1.067 41.831 1.00 27.64  ? 108 LYS B N   1 
ATOM   1900 C  CA  . LYS B 1 112 ? 14.734  0.315  41.425 1.00 26.70  ? 108 LYS B CA  1 
ATOM   1901 C  C   . LYS B 1 112 ? 14.063  1.221  42.450 1.00 25.69  ? 108 LYS B C   1 
ATOM   1902 O  O   . LYS B 1 112 ? 12.991  0.889  42.968 1.00 24.82  ? 108 LYS B O   1 
ATOM   1903 C  CB  . LYS B 1 112 ? 14.181  0.578  40.021 1.00 26.96  ? 108 LYS B CB  1 
ATOM   1904 C  CG  . LYS B 1 112 ? 14.872  -0.207 38.908 1.00 27.08  ? 108 LYS B CG  1 
ATOM   1905 C  CD  . LYS B 1 112 ? 14.574  0.371  37.521 1.00 27.90  ? 108 LYS B CD  1 
ATOM   1906 C  CE  . LYS B 1 112 ? 15.360  -0.361 36.404 1.00 30.33  ? 108 LYS B CE  1 
ATOM   1907 N  NZ  . LYS B 1 112 ? 14.672  -1.577 35.869 1.00 31.31  ? 108 LYS B NZ  1 
ATOM   1908 N  N   . VAL B 1 113 ? 14.723  2.335  42.776 1.00 24.94  ? 109 VAL B N   1 
ATOM   1909 C  CA  . VAL B 1 113 ? 14.193  3.293  43.732 1.00 23.96  ? 109 VAL B CA  1 
ATOM   1910 C  C   . VAL B 1 113 ? 14.180  4.678  43.071 1.00 23.63  ? 109 VAL B C   1 
ATOM   1911 O  O   . VAL B 1 113 ? 15.195  5.147  42.551 1.00 24.04  ? 109 VAL B O   1 
ATOM   1912 C  CB  . VAL B 1 113 ? 14.989  3.356  45.066 1.00 24.12  ? 109 VAL B CB  1 
ATOM   1913 C  CG1 . VAL B 1 113 ? 14.491  4.499  45.940 1.00 24.18  ? 109 VAL B CG1 1 
ATOM   1914 C  CG2 . VAL B 1 113 ? 14.900  2.028  45.848 1.00 23.42  ? 109 VAL B CG2 1 
ATOM   1915 N  N   . GLN B 1 114 ? 13.021  5.318  43.088 1.00 22.16  ? 110 GLN B N   1 
ATOM   1916 C  CA  . GLN B 1 114 ? 12.877  6.639  42.515 1.00 20.95  ? 110 GLN B CA  1 
ATOM   1917 C  C   . GLN B 1 114 ? 12.858  7.616  43.665 1.00 20.60  ? 110 GLN B C   1 
ATOM   1918 O  O   . GLN B 1 114 ? 12.096  7.446  44.618 1.00 19.48  ? 110 GLN B O   1 
ATOM   1919 C  CB  . GLN B 1 114 ? 11.573  6.713  41.717 1.00 21.43  ? 110 GLN B CB  1 
ATOM   1920 C  CG  . GLN B 1 114 ? 11.244  8.103  41.191 1.00 20.30  ? 110 GLN B CG  1 
ATOM   1921 C  CD  . GLN B 1 114 ? 9.911   8.164  40.427 1.00 21.17  ? 110 GLN B CD  1 
ATOM   1922 O  OE1 . GLN B 1 114 ? 9.256   7.149  40.182 1.00 19.47  ? 110 GLN B OE1 1 
ATOM   1923 N  NE2 . GLN B 1 114 ? 9.524   9.370  40.042 1.00 21.44  ? 110 GLN B NE2 1 
ATOM   1924 N  N   . LYS B 1 115 ? 13.735  8.611  43.602 1.00 20.94  ? 111 LYS B N   1 
ATOM   1925 C  CA  . LYS B 1 115 ? 13.810  9.624  44.639 1.00 22.87  ? 111 LYS B CA  1 
ATOM   1926 C  C   . LYS B 1 115 ? 13.046  10.870 44.171 1.00 22.42  ? 111 LYS B C   1 
ATOM   1927 O  O   . LYS B 1 115 ? 13.215  11.289 43.041 1.00 23.00  ? 111 LYS B O   1 
ATOM   1928 C  CB  . LYS B 1 115 ? 15.273  9.990  44.937 1.00 22.85  ? 111 LYS B CB  1 
ATOM   1929 C  CG  . LYS B 1 115 ? 15.397  10.942 46.154 1.00 24.95  ? 111 LYS B CG  1 
ATOM   1930 C  CD  . LYS B 1 115 ? 16.843  11.176 46.622 1.00 26.83  ? 111 LYS B CD  1 
ATOM   1931 C  CE  . LYS B 1 115 ? 17.274  12.630 46.351 1.00 32.88  ? 111 LYS B CE  1 
ATOM   1932 N  NZ  . LYS B 1 115 ? 18.278  13.186 47.347 1.00 36.24  ? 111 LYS B NZ  1 
ATOM   1933 N  N   . VAL B 1 116 ? 12.224  11.463 45.037 1.00 22.25  ? 112 VAL B N   1 
ATOM   1934 C  CA  . VAL B 1 116 ? 11.464  12.668 44.683 1.00 22.07  ? 112 VAL B CA  1 
ATOM   1935 C  C   . VAL B 1 116 ? 11.683  13.739 45.764 1.00 22.37  ? 112 VAL B C   1 
ATOM   1936 O  O   . VAL B 1 116 ? 11.335  13.534 46.925 1.00 21.95  ? 112 VAL B O   1 
ATOM   1937 C  CB  . VAL B 1 116 ? 9.960   12.406 44.568 1.00 22.03  ? 112 VAL B CB  1 
ATOM   1938 C  CG1 . VAL B 1 116 ? 9.226   13.713 44.131 1.00 21.76  ? 112 VAL B CG1 1 
ATOM   1939 C  CG2 . VAL B 1 116 ? 9.672   11.276 43.580 1.00 20.97  ? 112 VAL B CG2 1 
ATOM   1940 N  N   A MET B 1 117 ? 12.320  14.848 45.406 0.50 22.70  ? 113 MET B N   1 
ATOM   1941 N  N   B MET B 1 117 ? 12.207  14.883 45.333 0.50 22.10  ? 113 MET B N   1 
ATOM   1942 C  CA  A MET B 1 117 ? 12.605  15.903 46.384 0.50 23.58  ? 113 MET B CA  1 
ATOM   1943 C  CA  B MET B 1 117 ? 12.455  16.019 46.207 0.50 22.18  ? 113 MET B CA  1 
ATOM   1944 C  C   A MET B 1 117 ? 11.429  16.859 46.460 0.50 22.47  ? 113 MET B C   1 
ATOM   1945 C  C   B MET B 1 117 ? 11.145  16.756 46.363 0.50 21.69  ? 113 MET B C   1 
ATOM   1946 O  O   A MET B 1 117 ? 11.205  17.628 45.537 0.50 22.29  ? 113 MET B O   1 
ATOM   1947 O  O   B MET B 1 117 ? 10.483  17.063 45.363 0.50 21.38  ? 113 MET B O   1 
ATOM   1948 C  CB  A MET B 1 117 ? 13.880  16.652 45.995 0.50 23.48  ? 113 MET B CB  1 
ATOM   1949 C  CB  B MET B 1 117 ? 13.477  16.951 45.572 0.50 22.53  ? 113 MET B CB  1 
ATOM   1950 C  CG  A MET B 1 117 ? 15.073  15.731 45.664 0.50 25.04  ? 113 MET B CG  1 
ATOM   1951 C  CG  B MET B 1 117 ? 14.782  16.257 45.228 0.50 25.21  ? 113 MET B CG  1 
ATOM   1952 S  SD  A MET B 1 117 ? 16.470  16.661 44.972 0.50 28.07  ? 113 MET B SD  1 
ATOM   1953 S  SD  B MET B 1 117 ? 15.724  15.870 46.711 0.50 30.89  ? 113 MET B SD  1 
ATOM   1954 C  CE  A MET B 1 117 ? 16.067  16.638 43.218 0.50 28.50  ? 113 MET B CE  1 
ATOM   1955 C  CE  B MET B 1 117 ? 16.449  17.487 47.027 0.50 28.26  ? 113 MET B CE  1 
ATOM   1956 N  N   A PHE B 1 118 ? 10.664  16.798 47.548 0.50 21.57  ? 114 PHE B N   1 
ATOM   1957 N  N   B PHE B 1 118 ? 10.756  17.009 47.612 0.50 20.85  ? 114 PHE B N   1 
ATOM   1958 C  CA  A PHE B 1 118 ? 9.499   17.664 47.688 0.50 20.25  ? 114 PHE B CA  1 
ATOM   1959 C  CA  B PHE B 1 118 ? 9.516   17.708 47.898 0.50 20.06  ? 114 PHE B CA  1 
ATOM   1960 C  C   A PHE B 1 118 ? 9.940   19.128 47.807 0.50 20.41  ? 114 PHE B C   1 
ATOM   1961 C  C   B PHE B 1 118 ? 9.874   19.160 48.122 0.50 20.32  ? 114 PHE B C   1 
ATOM   1962 O  O   A PHE B 1 118 ? 11.143  19.405 47.964 0.50 20.38  ? 114 PHE B O   1 
ATOM   1963 O  O   B PHE B 1 118 ? 10.959  19.470 48.640 0.50 20.22  ? 114 PHE B O   1 
ATOM   1964 C  CB  A PHE B 1 118 ? 8.623   17.237 48.888 0.50 19.82  ? 114 PHE B CB  1 
ATOM   1965 C  CB  B PHE B 1 118 ? 8.797   17.113 49.110 0.50 19.89  ? 114 PHE B CB  1 
ATOM   1966 C  CG  A PHE B 1 118 ? 7.793   15.967 48.658 0.50 19.85  ? 114 PHE B CG  1 
ATOM   1967 C  CG  B PHE B 1 118 ? 7.863   15.975 48.774 0.50 20.73  ? 114 PHE B CG  1 
ATOM   1968 C  CD1 A PHE B 1 118 ? 7.062   15.416 49.705 0.50 20.17  ? 114 PHE B CD1 1 
ATOM   1969 C  CD1 B PHE B 1 118 ? 6.610   15.898 49.366 0.50 21.41  ? 114 PHE B CD1 1 
ATOM   1970 C  CD2 A PHE B 1 118 ? 7.751   15.331 47.424 0.50 18.09  ? 114 PHE B CD2 1 
ATOM   1971 C  CD2 B PHE B 1 118 ? 8.234   14.991 47.874 0.50 19.59  ? 114 PHE B CD2 1 
ATOM   1972 C  CE1 A PHE B 1 118 ? 6.298   14.272 49.534 0.50 18.87  ? 114 PHE B CE1 1 
ATOM   1973 C  CE1 B PHE B 1 118 ? 5.734   14.864 49.070 0.50 20.87  ? 114 PHE B CE1 1 
ATOM   1974 C  CE2 A PHE B 1 118 ? 6.969   14.166 47.228 0.50 20.52  ? 114 PHE B CE2 1 
ATOM   1975 C  CE2 B PHE B 1 118 ? 7.367   13.941 47.564 0.50 21.89  ? 114 PHE B CE2 1 
ATOM   1976 C  CZ  A PHE B 1 118 ? 6.244   13.643 48.303 0.50 19.38  ? 114 PHE B CZ  1 
ATOM   1977 C  CZ  B PHE B 1 118 ? 6.109   13.878 48.170 0.50 20.80  ? 114 PHE B CZ  1 
ATOM   1978 N  N   . ALA B 1 119 ? 8.985   20.061 47.716 1.00 19.26  ? 115 ALA B N   1 
ATOM   1979 C  CA  . ALA B 1 119 ? 9.289   21.500 47.859 1.00 19.30  ? 115 ALA B CA  1 
ATOM   1980 C  C   . ALA B 1 119 ? 8.216   22.112 48.718 1.00 18.96  ? 115 ALA B C   1 
ATOM   1981 O  O   . ALA B 1 119 ? 7.085   21.612 48.718 1.00 19.22  ? 115 ALA B O   1 
ATOM   1982 C  CB  . ALA B 1 119 ? 9.309   22.179 46.480 1.00 18.40  ? 115 ALA B CB  1 
ATOM   1983 N  N   . PRO B 1 120 ? 8.554   23.170 49.475 1.00 18.87  ? 116 PRO B N   1 
ATOM   1984 C  CA  . PRO B 1 120 ? 7.504   23.832 50.271 1.00 18.42  ? 116 PRO B CA  1 
ATOM   1985 C  C   . PRO B 1 120 ? 6.616   24.708 49.379 1.00 17.74  ? 116 PRO B C   1 
ATOM   1986 O  O   . PRO B 1 120 ? 7.124   25.370 48.483 1.00 15.77  ? 116 PRO B O   1 
ATOM   1987 C  CB  . PRO B 1 120 ? 8.275   24.702 51.253 1.00 18.90  ? 116 PRO B CB  1 
ATOM   1988 C  CG  . PRO B 1 120 ? 9.632   24.962 50.616 1.00 19.92  ? 116 PRO B CG  1 
ATOM   1989 C  CD  . PRO B 1 120 ? 9.904   23.746 49.699 1.00 18.78  ? 116 PRO B CD  1 
ATOM   1990 N  N   . MET B 1 121 ? 5.308   24.712 49.647 1.00 16.88  ? 117 MET B N   1 
ATOM   1991 C  CA  . MET B 1 121 ? 4.372   25.484 48.820 1.00 16.54  ? 117 MET B CA  1 
ATOM   1992 C  C   . MET B 1 121 ? 3.012   25.599 49.453 1.00 16.31  ? 117 MET B C   1 
ATOM   1993 O  O   . MET B 1 121 ? 2.676   24.813 50.352 1.00 17.34  ? 117 MET B O   1 
ATOM   1994 C  CB  . MET B 1 121 ? 4.190   24.761 47.426 1.00 16.14  ? 117 MET B CB  1 
ATOM   1995 C  CG  . MET B 1 121 ? 3.431   23.438 47.519 1.00 19.19  ? 117 MET B CG  1 
ATOM   1996 S  SD  . MET B 1 121 ? 3.423   22.429 46.049 1.00 19.63  ? 117 MET B SD  1 
ATOM   1997 C  CE  . MET B 1 121 ? 5.167   21.981 46.022 1.00 19.64  ? 117 MET B CE  1 
ATOM   1998 N  N   . ASN B 1 122 ? 2.202   26.542 48.955 1.00 15.44  ? 118 ASN B N   1 
ATOM   1999 C  CA  . ASN B 1 122 ? 0.836   26.669 49.406 1.00 16.56  ? 118 ASN B CA  1 
ATOM   2000 C  C   . ASN B 1 122 ? -0.115  26.122 48.342 1.00 16.89  ? 118 ASN B C   1 
ATOM   2001 O  O   . ASN B 1 122 ? 0.110   26.331 47.137 1.00 15.93  ? 118 ASN B O   1 
ATOM   2002 C  CB  . ASN B 1 122 ? 0.411   28.131 49.597 1.00 16.20  ? 118 ASN B CB  1 
ATOM   2003 C  CG  . ASN B 1 122 ? 0.949   28.745 50.861 1.00 16.24  ? 118 ASN B CG  1 
ATOM   2004 O  OD1 . ASN B 1 122 ? 1.518   28.068 51.691 1.00 17.03  ? 118 ASN B OD1 1 
ATOM   2005 N  ND2 . ASN B 1 122 ? 0.767   30.047 51.006 1.00 16.44  ? 118 ASN B ND2 1 
ATOM   2006 N  N   . ALA B 1 123 ? -1.198  25.481 48.795 1.00 18.01  ? 119 ALA B N   1 
ATOM   2007 C  CA  . ALA B 1 123 ? -2.325  25.082 47.942 1.00 17.74  ? 119 ALA B CA  1 
ATOM   2008 C  C   . ALA B 1 123 ? -3.393  25.980 48.561 1.00 18.97  ? 119 ALA B C   1 
ATOM   2009 O  O   . ALA B 1 123 ? -3.086  26.776 49.451 1.00 18.27  ? 119 ALA B O   1 
ATOM   2010 C  CB  . ALA B 1 123 ? -2.743  23.586 48.093 1.00 18.24  ? 119 ALA B CB  1 
ATOM   2011 N  N   . GLY B 1 124 ? -4.649  25.858 48.135 1.00 20.62  ? 120 GLY B N   1 
ATOM   2012 C  CA  . GLY B 1 124 ? -5.725  26.650 48.728 1.00 22.09  ? 120 GLY B CA  1 
ATOM   2013 C  C   . GLY B 1 124 ? -5.925  26.275 50.198 1.00 23.95  ? 120 GLY B C   1 
ATOM   2014 O  O   . GLY B 1 124 ? -6.396  27.086 50.993 1.00 24.28  ? 120 GLY B O   1 
ATOM   2015 N  N   . ASP B 1 125 ? -5.506  25.065 50.579 1.00 25.67  ? 121 ASP B N   1 
ATOM   2016 C  CA  . ASP B 1 125 ? -5.658  24.599 51.973 1.00 26.44  ? 121 ASP B CA  1 
ATOM   2017 C  C   . ASP B 1 125 ? -4.420  24.803 52.852 1.00 25.84  ? 121 ASP B C   1 
ATOM   2018 O  O   . ASP B 1 125 ? -4.320  24.234 53.937 1.00 26.94  ? 121 ASP B O   1 
ATOM   2019 C  CB  . ASP B 1 125 ? -6.189  23.146 52.018 1.00 27.89  ? 121 ASP B CB  1 
ATOM   2020 C  CG  . ASP B 1 125 ? -5.108  22.102 51.658 1.00 32.28  ? 121 ASP B CG  1 
ATOM   2021 O  OD1 . ASP B 1 125 ? -4.019  22.499 51.167 1.00 36.79  ? 121 ASP B OD1 1 
ATOM   2022 O  OD2 . ASP B 1 125 ? -5.334  20.873 51.870 1.00 36.58  ? 121 ASP B OD2 1 
ATOM   2023 N  N   . GLY B 1 126 ? -3.490  25.658 52.415 1.00 24.01  ? 122 GLY B N   1 
ATOM   2024 C  CA  . GLY B 1 126 ? -2.309  25.956 53.198 1.00 22.72  ? 122 GLY B CA  1 
ATOM   2025 C  C   . GLY B 1 126 ? -0.944  25.405 52.807 1.00 21.15  ? 122 GLY B C   1 
ATOM   2026 O  O   . GLY B 1 126 ? -0.812  24.680 51.801 1.00 19.72  ? 122 GLY B O   1 
ATOM   2027 N  N   . PRO B 1 127 ? 0.088   25.755 53.606 1.00 20.68  ? 123 PRO B N   1 
ATOM   2028 C  CA  . PRO B 1 127 ? 1.462   25.340 53.362 1.00 20.15  ? 123 PRO B CA  1 
ATOM   2029 C  C   . PRO B 1 127 ? 1.647   23.858 53.559 1.00 20.31  ? 123 PRO B C   1 
ATOM   2030 O  O   . PRO B 1 127 ? 1.027   23.261 54.450 1.00 18.83  ? 123 PRO B O   1 
ATOM   2031 C  CB  . PRO B 1 127 ? 2.266   26.104 54.427 1.00 19.89  ? 123 PRO B CB  1 
ATOM   2032 C  CG  . PRO B 1 127 ? 1.331   27.317 54.768 1.00 21.55  ? 123 PRO B CG  1 
ATOM   2033 C  CD  . PRO B 1 127 ? 0.003   26.639 54.786 1.00 20.84  ? 123 PRO B CD  1 
ATOM   2034 N  N   . HIS B 1 128 ? 2.531   23.281 52.750 1.00 19.37  ? 124 HIS B N   1 
ATOM   2035 C  CA  . HIS B 1 128 ? 2.845   21.850 52.851 1.00 18.88  ? 124 HIS B CA  1 
ATOM   2036 C  C   . HIS B 1 128 ? 4.090   21.611 52.012 1.00 18.53  ? 124 HIS B C   1 
ATOM   2037 O  O   . HIS B 1 128 ? 4.620   22.555 51.435 1.00 19.01  ? 124 HIS B O   1 
ATOM   2038 C  CB  . HIS B 1 128 ? 1.686   21.001 52.309 1.00 17.47  ? 124 HIS B CB  1 
ATOM   2039 C  CG  . HIS B 1 128 ? 1.343   21.317 50.876 1.00 19.96  ? 124 HIS B CG  1 
ATOM   2040 N  ND1 . HIS B 1 128 ? 0.488   22.345 50.514 1.00 19.69  ? 124 HIS B ND1 1 
ATOM   2041 C  CD2 . HIS B 1 128 ? 1.768   20.757 49.718 1.00 19.13  ? 124 HIS B CD2 1 
ATOM   2042 C  CE1 . HIS B 1 128 ? 0.400   22.394 49.196 1.00 21.52  ? 124 HIS B CE1 1 
ATOM   2043 N  NE2 . HIS B 1 128 ? 1.181   21.451 48.693 1.00 19.43  ? 124 HIS B NE2 1 
ATOM   2044 N  N   . TYR B 1 129 ? 4.542   20.348 51.940 1.00 17.68  ? 125 TYR B N   1 
ATOM   2045 C  CA  . TYR B 1 129 ? 5.693   19.954 51.134 1.00 17.22  ? 125 TYR B CA  1 
ATOM   2046 C  C   . TYR B 1 129 ? 5.081   19.085 50.022 1.00 17.84  ? 125 TYR B C   1 
ATOM   2047 O  O   . TYR B 1 129 ? 4.202   18.259 50.290 1.00 17.61  ? 125 TYR B O   1 
ATOM   2048 C  CB  . TYR B 1 129 ? 6.733   19.146 51.947 1.00 16.27  ? 125 TYR B CB  1 
ATOM   2049 C  CG  . TYR B 1 129 ? 7.276   19.982 53.107 1.00 15.09  ? 125 TYR B CG  1 
ATOM   2050 C  CD1 . TYR B 1 129 ? 6.656   19.973 54.356 1.00 16.48  ? 125 TYR B CD1 1 
ATOM   2051 C  CD2 . TYR B 1 129 ? 8.343   20.810 52.912 1.00 17.82  ? 125 TYR B CD2 1 
ATOM   2052 C  CE1 . TYR B 1 129 ? 7.160   20.777 55.413 1.00 18.13  ? 125 TYR B CE1 1 
ATOM   2053 C  CE2 . TYR B 1 129 ? 8.850   21.624 53.930 1.00 17.70  ? 125 TYR B CE2 1 
ATOM   2054 C  CZ  . TYR B 1 129 ? 8.269   21.605 55.159 1.00 16.67  ? 125 TYR B CZ  1 
ATOM   2055 O  OH  . TYR B 1 129 ? 8.808   22.405 56.115 1.00 17.61  ? 125 TYR B OH  1 
ATOM   2056 N  N   . GLY B 1 130 ? 5.487   19.304 48.784 1.00 18.43  ? 126 GLY B N   1 
ATOM   2057 C  CA  . GLY B 1 130 ? 4.879   18.483 47.724 1.00 18.76  ? 126 GLY B CA  1 
ATOM   2058 C  C   . GLY B 1 130 ? 5.668   18.427 46.457 1.00 18.71  ? 126 GLY B C   1 
ATOM   2059 O  O   . GLY B 1 130 ? 6.684   19.109 46.321 1.00 18.73  ? 126 GLY B O   1 
ATOM   2060 N  N   . ALA B 1 131 ? 5.179   17.612 45.529 1.00 18.15  ? 127 ALA B N   1 
ATOM   2061 C  CA  . ALA B 1 131 ? 5.766   17.493 44.200 1.00 18.58  ? 127 ALA B CA  1 
ATOM   2062 C  C   . ALA B 1 131 ? 4.830   16.810 43.224 1.00 17.89  ? 127 ALA B C   1 
ATOM   2063 O  O   . ALA B 1 131 ? 4.075   15.908 43.603 1.00 17.08  ? 127 ALA B O   1 
ATOM   2064 C  CB  . ALA B 1 131 ? 7.109   16.705 44.225 1.00 18.40  ? 127 ALA B CB  1 
ATOM   2065 N  N   . ASN B 1 132 ? 4.916   17.232 41.961 1.00 17.46  ? 128 ASN B N   1 
ATOM   2066 C  CA  . ASN B 1 132 ? 4.245   16.552 40.857 1.00 17.20  ? 128 ASN B CA  1 
ATOM   2067 C  C   . ASN B 1 132 ? 5.177   15.361 40.661 1.00 17.58  ? 128 ASN B C   1 
ATOM   2068 O  O   . ASN B 1 132 ? 6.413   15.515 40.740 1.00 17.22  ? 128 ASN B O   1 
ATOM   2069 C  CB  . ASN B 1 132 ? 4.266   17.400 39.608 1.00 17.65  ? 128 ASN B CB  1 
ATOM   2070 C  CG  . ASN B 1 132 ? 3.074   18.314 39.526 1.00 19.17  ? 128 ASN B CG  1 
ATOM   2071 O  OD1 . ASN B 1 132 ? 2.212   18.300 40.416 1.00 19.53  ? 128 ASN B OD1 1 
ATOM   2072 N  ND2 . ASN B 1 132 ? 3.006   19.122 38.463 1.00 16.83  ? 128 ASN B ND2 1 
ATOM   2073 N  N   A VAL B 1 133 ? 4.595   14.187 40.440 0.50 16.72  ? 129 VAL B N   1 
ATOM   2074 N  N   B VAL B 1 133 ? 4.624   14.177 40.443 0.50 17.05  ? 129 VAL B N   1 
ATOM   2075 C  CA  A VAL B 1 133 ? 5.348   12.950 40.300 0.50 16.15  ? 129 VAL B CA  1 
ATOM   2076 C  CA  B VAL B 1 133 ? 5.465   13.003 40.256 0.50 16.73  ? 129 VAL B CA  1 
ATOM   2077 C  C   A VAL B 1 133 ? 4.929   12.122 39.092 0.50 16.61  ? 129 VAL B C   1 
ATOM   2078 C  C   B VAL B 1 133 ? 4.964   12.152 39.097 0.50 16.95  ? 129 VAL B C   1 
ATOM   2079 O  O   A VAL B 1 133 ? 3.749   12.063 38.769 0.50 15.86  ? 129 VAL B O   1 
ATOM   2080 O  O   B VAL B 1 133 ? 3.776   12.129 38.801 0.50 16.09  ? 129 VAL B O   1 
ATOM   2081 C  CB  A VAL B 1 133 ? 5.075   12.050 41.539 0.50 16.60  ? 129 VAL B CB  1 
ATOM   2082 C  CB  B VAL B 1 133 ? 5.568   12.110 41.527 0.50 17.70  ? 129 VAL B CB  1 
ATOM   2083 C  CG1 A VAL B 1 133 ? 5.811   10.690 41.439 0.50 15.07  ? 129 VAL B CG1 1 
ATOM   2084 C  CG1 B VAL B 1 133 ? 6.235   12.848 42.707 0.50 16.61  ? 129 VAL B CG1 1 
ATOM   2085 C  CG2 A VAL B 1 133 ? 5.417   12.798 42.869 0.50 15.41  ? 129 VAL B CG2 1 
ATOM   2086 C  CG2 B VAL B 1 133 ? 4.217   11.589 41.955 0.50 16.23  ? 129 VAL B CG2 1 
ATOM   2087 N  N   . LYS B 1 134 ? 5.892   11.444 38.468 1.00 16.33  ? 130 LYS B N   1 
ATOM   2088 C  CA  . LYS B 1 134 ? 5.597   10.535 37.375 1.00 19.59  ? 130 LYS B CA  1 
ATOM   2089 C  C   . LYS B 1 134 ? 6.187   9.231  37.941 1.00 18.37  ? 130 LYS B C   1 
ATOM   2090 O  O   . LYS B 1 134 ? 7.349   9.224  38.337 1.00 18.85  ? 130 LYS B O   1 
ATOM   2091 C  CB  . LYS B 1 134 ? 6.243   10.938 36.041 1.00 20.57  ? 130 LYS B CB  1 
ATOM   2092 C  CG  . LYS B 1 134 ? 5.901   9.989  34.889 1.00 24.01  ? 130 LYS B CG  1 
ATOM   2093 C  CD  . LYS B 1 134 ? 6.374   10.454 33.495 1.00 24.19  ? 130 LYS B CD  1 
ATOM   2094 C  CE  . LYS B 1 134 ? 6.331   9.273  32.498 1.00 28.56  ? 130 LYS B CE  1 
ATOM   2095 N  NZ  . LYS B 1 134 ? 7.045   9.530  31.168 1.00 32.62  ? 130 LYS B NZ  1 
ATOM   2096 N  N   . PHE B 1 135 ? 5.379   8.176  38.068 1.00 18.61  ? 131 PHE B N   1 
ATOM   2097 C  CA  . PHE B 1 135 ? 5.856   6.881  38.589 1.00 18.89  ? 131 PHE B CA  1 
ATOM   2098 C  C   . PHE B 1 135 ? 6.632   6.224  37.468 1.00 18.97  ? 131 PHE B C   1 
ATOM   2099 O  O   . PHE B 1 135 ? 6.064   5.704  36.514 1.00 18.57  ? 131 PHE B O   1 
ATOM   2100 C  CB  . PHE B 1 135 ? 4.709   5.977  39.064 1.00 18.92  ? 131 PHE B CB  1 
ATOM   2101 C  CG  . PHE B 1 135 ? 3.953   6.521  40.260 1.00 20.70  ? 131 PHE B CG  1 
ATOM   2102 C  CD1 . PHE B 1 135 ? 4.377   6.240  41.563 1.00 21.40  ? 131 PHE B CD1 1 
ATOM   2103 C  CD2 . PHE B 1 135 ? 2.820   7.311  40.083 1.00 21.41  ? 131 PHE B CD2 1 
ATOM   2104 C  CE1 . PHE B 1 135 ? 3.685   6.756  42.666 1.00 18.77  ? 131 PHE B CE1 1 
ATOM   2105 C  CE2 . PHE B 1 135 ? 2.126   7.835  41.183 1.00 21.01  ? 131 PHE B CE2 1 
ATOM   2106 C  CZ  . PHE B 1 135 ? 2.570   7.547  42.477 1.00 18.51  ? 131 PHE B CZ  1 
ATOM   2107 N  N   . GLU B 1 136 ? 7.950   6.261  37.578 1.00 19.63  ? 132 GLU B N   1 
ATOM   2108 C  CA  . GLU B 1 136 ? 8.814   5.694  36.561 1.00 21.18  ? 132 GLU B CA  1 
ATOM   2109 C  C   . GLU B 1 136 ? 8.562   4.226  36.278 1.00 20.85  ? 132 GLU B C   1 
ATOM   2110 O  O   . GLU B 1 136 ? 8.597   3.819  35.118 1.00 21.07  ? 132 GLU B O   1 
ATOM   2111 C  CB  . GLU B 1 136 ? 10.275  5.942  36.922 1.00 21.75  ? 132 GLU B CB  1 
ATOM   2112 C  CG  . GLU B 1 136 ? 10.630  7.426  36.884 1.00 23.20  ? 132 GLU B CG  1 
ATOM   2113 C  CD  . GLU B 1 136 ? 12.036  7.727  37.410 1.00 25.71  ? 132 GLU B CD  1 
ATOM   2114 O  OE1 . GLU B 1 136 ? 12.810  6.783  37.709 1.00 33.05  ? 132 GLU B OE1 1 
ATOM   2115 O  OE2 . GLU B 1 136 ? 12.369  8.927  37.542 1.00 31.60  ? 132 GLU B OE2 1 
ATOM   2116 N  N   . GLU B 1 137 ? 8.284   3.425  37.306 1.00 20.53  ? 133 GLU B N   1 
ATOM   2117 C  CA  . GLU B 1 137 ? 8.046   1.981  37.055 1.00 21.03  ? 133 GLU B CA  1 
ATOM   2118 C  C   . GLU B 1 137 ? 6.603   1.650  36.723 1.00 19.90  ? 133 GLU B C   1 
ATOM   2119 O  O   . GLU B 1 137 ? 6.236   0.492  36.508 1.00 21.49  ? 133 GLU B O   1 
ATOM   2120 C  CB  . GLU B 1 137 ? 8.593   1.134  38.211 1.00 22.03  ? 133 GLU B CB  1 
ATOM   2121 C  CG  . GLU B 1 137 ? 10.054  1.412  38.497 1.00 26.26  ? 133 GLU B CG  1 
ATOM   2122 C  CD  . GLU B 1 137 ? 10.919  1.275  37.250 1.00 31.23  ? 133 GLU B CD  1 
ATOM   2123 O  OE1 . GLU B 1 137 ? 10.925  0.185  36.636 1.00 34.84  ? 133 GLU B OE1 1 
ATOM   2124 O  OE2 . GLU B 1 137 ? 11.570  2.279  36.876 1.00 32.35  ? 133 GLU B OE2 1 
ATOM   2125 N  N   . GLY B 1 138 ? 5.761   2.664  36.640 1.00 18.59  ? 134 GLY B N   1 
ATOM   2126 C  CA  . GLY B 1 138 ? 4.371   2.405  36.262 1.00 17.27  ? 134 GLY B CA  1 
ATOM   2127 C  C   . GLY B 1 138 ? 3.362   1.920  37.275 1.00 16.04  ? 134 GLY B C   1 
ATOM   2128 O  O   . GLY B 1 138 ? 3.508   2.146  38.451 1.00 16.14  ? 134 GLY B O   1 
ATOM   2129 N  N   . LEU B 1 139 ? 2.318   1.242  36.799 1.00 15.13  ? 135 LEU B N   1 
ATOM   2130 C  CA  . LEU B 1 139 ? 1.258   0.789  37.683 1.00 13.99  ? 135 LEU B CA  1 
ATOM   2131 C  C   . LEU B 1 139 ? 1.742   -0.275 38.622 1.00 14.25  ? 135 LEU B C   1 
ATOM   2132 O  O   . LEU B 1 139 ? 2.563   -1.089 38.236 1.00 14.21  ? 135 LEU B O   1 
ATOM   2133 C  CB  . LEU B 1 139 ? 0.077   0.228  36.880 1.00 13.04  ? 135 LEU B CB  1 
ATOM   2134 C  CG  . LEU B 1 139 ? -0.592  1.215  35.904 1.00 12.19  ? 135 LEU B CG  1 
ATOM   2135 C  CD1 . LEU B 1 139 ? -1.638  0.442  35.138 1.00 13.60  ? 135 LEU B CD1 1 
ATOM   2136 C  CD2 . LEU B 1 139 ? -1.197  2.401  36.632 1.00 12.15  ? 135 LEU B CD2 1 
ATOM   2137 N  N   . GLY B 1 140 ? 1.187   -0.316 39.829 1.00 14.75  ? 136 GLY B N   1 
ATOM   2138 C  CA  . GLY B 1 140 ? 1.559   -1.375 40.763 1.00 16.78  ? 136 GLY B CA  1 
ATOM   2139 C  C   . GLY B 1 140 ? 1.516   -0.962 42.213 1.00 18.02  ? 136 GLY B C   1 
ATOM   2140 O  O   . GLY B 1 140 ? 1.039   0.106  42.532 1.00 18.88  ? 136 GLY B O   1 
ATOM   2141 N  N   . THR B 1 141 ? 2.010   -1.836 43.090 1.00 17.62  ? 137 THR B N   1 
ATOM   2142 C  CA  . THR B 1 141 ? 2.047   -1.539 44.515 1.00 18.32  ? 137 THR B CA  1 
ATOM   2143 C  C   . THR B 1 141 ? 3.442   -1.043 44.826 1.00 17.86  ? 137 THR B C   1 
ATOM   2144 O  O   . THR B 1 141 ? 4.442   -1.657 44.421 1.00 17.43  ? 137 THR B O   1 
ATOM   2145 C  CB  . THR B 1 141 ? 1.714   -2.790 45.345 1.00 18.88  ? 137 THR B CB  1 
ATOM   2146 O  OG1 . THR B 1 141 ? 0.483   -3.325 44.863 1.00 19.56  ? 137 THR B OG1 1 
ATOM   2147 C  CG2 . THR B 1 141 ? 1.573   -2.451 46.810 1.00 18.58  ? 137 THR B CG2 1 
ATOM   2148 N  N   . TYR B 1 142 ? 3.503   0.043  45.580 1.00 17.78  ? 138 TYR B N   1 
ATOM   2149 C  CA  . TYR B 1 142 ? 4.754   0.640  45.956 1.00 18.49  ? 138 TYR B CA  1 
ATOM   2150 C  C   . TYR B 1 142 ? 4.958   0.787  47.449 1.00 19.19  ? 138 TYR B C   1 
ATOM   2151 O  O   . TYR B 1 142 ? 3.995   0.948  48.207 1.00 18.99  ? 138 TYR B O   1 
ATOM   2152 C  CB  . TYR B 1 142 ? 4.760   2.106  45.442 1.00 18.30  ? 138 TYR B CB  1 
ATOM   2153 C  CG  . TYR B 1 142 ? 5.006   2.246  43.972 1.00 18.14  ? 138 TYR B CG  1 
ATOM   2154 C  CD1 . TYR B 1 142 ? 3.983   2.037  43.048 1.00 17.34  ? 138 TYR B CD1 1 
ATOM   2155 C  CD2 . TYR B 1 142 ? 6.272   2.577  43.500 1.00 18.17  ? 138 TYR B CD2 1 
ATOM   2156 C  CE1 . TYR B 1 142 ? 4.219   2.158  41.683 1.00 19.37  ? 138 TYR B CE1 1 
ATOM   2157 C  CE2 . TYR B 1 142 ? 6.520   2.718  42.154 1.00 18.35  ? 138 TYR B CE2 1 
ATOM   2158 C  CZ  . TYR B 1 142 ? 5.479   2.507  41.243 1.00 18.92  ? 138 TYR B CZ  1 
ATOM   2159 O  OH  . TYR B 1 142 ? 5.727   2.622  39.913 1.00 14.55  ? 138 TYR B OH  1 
ATOM   2160 N  N   . LYS B 1 143 ? 6.234   0.799  47.838 1.00 19.41  ? 139 LYS B N   1 
ATOM   2161 C  CA  . LYS B 1 143 ? 6.636   1.096  49.186 1.00 20.86  ? 139 LYS B CA  1 
ATOM   2162 C  C   . LYS B 1 143 ? 6.913   2.595  49.031 1.00 20.45  ? 139 LYS B C   1 
ATOM   2163 O  O   . LYS B 1 143 ? 7.646   2.975  48.121 1.00 20.89  ? 139 LYS B O   1 
ATOM   2164 C  CB  . LYS B 1 143 ? 7.933   0.391  49.545 1.00 21.03  ? 139 LYS B CB  1 
ATOM   2165 C  CG  . LYS B 1 143 ? 7.834   -1.125 49.433 1.00 25.83  ? 139 LYS B CG  1 
ATOM   2166 C  CD  . LYS B 1 143 ? 8.924   -1.826 50.232 1.00 28.53  ? 139 LYS B CD  1 
ATOM   2167 C  CE  . LYS B 1 143 ? 8.610   -3.323 50.333 1.00 33.35  ? 139 LYS B CE  1 
ATOM   2168 N  NZ  . LYS B 1 143 ? 7.393   -3.568 51.185 1.00 36.08  ? 139 LYS B NZ  1 
ATOM   2169 N  N   . VAL B 1 144 ? 6.332   3.442  49.886 1.00 20.54  ? 140 VAL B N   1 
ATOM   2170 C  CA  . VAL B 1 144 ? 6.536   4.904  49.808 1.00 19.51  ? 140 VAL B CA  1 
ATOM   2171 C  C   . VAL B 1 144 ? 7.162   5.366  51.122 1.00 20.12  ? 140 VAL B C   1 
ATOM   2172 O  O   . VAL B 1 144 ? 6.578   5.156  52.169 1.00 20.45  ? 140 VAL B O   1 
ATOM   2173 C  CB  . VAL B 1 144 ? 5.201   5.670  49.608 1.00 18.78  ? 140 VAL B CB  1 
ATOM   2174 C  CG1 . VAL B 1 144 ? 5.447   7.169  49.526 1.00 18.67  ? 140 VAL B CG1 1 
ATOM   2175 C  CG2 . VAL B 1 144 ? 4.474   5.180  48.390 1.00 20.24  ? 140 VAL B CG2 1 
ATOM   2176 N  N   . ARG B 1 145 ? 8.319   6.018  51.046 1.00 20.20  ? 141 ARG B N   1 
ATOM   2177 C  CA  . ARG B 1 145 ? 9.066   6.465  52.215 1.00 21.09  ? 141 ARG B CA  1 
ATOM   2178 C  C   . ARG B 1 145 ? 9.394   7.956  52.197 1.00 21.53  ? 141 ARG B C   1 
ATOM   2179 O  O   . ARG B 1 145 ? 10.019  8.424  51.247 1.00 22.27  ? 141 ARG B O   1 
ATOM   2180 C  CB  . ARG B 1 145 ? 10.363  5.634  52.252 1.00 20.85  ? 141 ARG B CB  1 
ATOM   2181 C  CG  . ARG B 1 145 ? 11.437  6.007  53.310 1.00 21.22  ? 141 ARG B CG  1 
ATOM   2182 C  CD  . ARG B 1 145 ? 12.718  5.202  53.057 1.00 22.40  ? 141 ARG B CD  1 
ATOM   2183 N  NE  . ARG B 1 145 ? 13.693  5.406  54.127 1.00 25.97  ? 141 ARG B NE  1 
ATOM   2184 C  CZ  . ARG B 1 145 ? 13.928  4.538  55.107 1.00 28.08  ? 141 ARG B CZ  1 
ATOM   2185 N  NH1 . ARG B 1 145 ? 13.281  3.378  55.159 1.00 30.05  ? 141 ARG B NH1 1 
ATOM   2186 N  NH2 . ARG B 1 145 ? 14.833  4.820  56.035 1.00 29.36  ? 141 ARG B NH2 1 
ATOM   2187 N  N   . PHE B 1 146 ? 8.951   8.687  53.227 1.00 20.69  ? 142 PHE B N   1 
ATOM   2188 C  CA  . PHE B 1 146 ? 9.253   10.097 53.353 1.00 20.18  ? 142 PHE B CA  1 
ATOM   2189 C  C   . PHE B 1 146 ? 10.398  10.226 54.328 1.00 20.02  ? 142 PHE B C   1 
ATOM   2190 O  O   . PHE B 1 146 ? 10.311  9.710  55.430 1.00 20.19  ? 142 PHE B O   1 
ATOM   2191 C  CB  . PHE B 1 146 ? 8.084   10.922 53.932 1.00 20.85  ? 142 PHE B CB  1 
ATOM   2192 C  CG  . PHE B 1 146 ? 6.892   11.119 52.990 1.00 21.18  ? 142 PHE B CG  1 
ATOM   2193 C  CD1 . PHE B 1 146 ? 6.908   10.677 51.648 1.00 19.35  ? 142 PHE B CD1 1 
ATOM   2194 C  CD2 . PHE B 1 146 ? 5.729   11.713 53.476 1.00 21.02  ? 142 PHE B CD2 1 
ATOM   2195 C  CE1 . PHE B 1 146 ? 5.808   10.861 50.814 1.00 21.04  ? 142 PHE B CE1 1 
ATOM   2196 C  CE2 . PHE B 1 146 ? 4.605   11.908 52.627 1.00 22.61  ? 142 PHE B CE2 1 
ATOM   2197 C  CZ  . PHE B 1 146 ? 4.655   11.480 51.290 1.00 22.80  ? 142 PHE B CZ  1 
ATOM   2198 N  N   . GLU B 1 147 ? 11.488  10.866 53.932 1.00 19.12  ? 143 GLU B N   1 
ATOM   2199 C  CA  . GLU B 1 147 ? 12.557  11.081 54.875 1.00 18.89  ? 143 GLU B CA  1 
ATOM   2200 C  C   . GLU B 1 147 ? 12.473  12.583 55.122 1.00 18.49  ? 143 GLU B C   1 
ATOM   2201 O  O   . GLU B 1 147 ? 12.418  13.379 54.174 1.00 17.23  ? 143 GLU B O   1 
ATOM   2202 C  CB  . GLU B 1 147 ? 13.910  10.619 54.382 1.00 19.32  ? 143 GLU B CB  1 
ATOM   2203 C  CG  . GLU B 1 147 ? 14.023  9.097  54.383 1.00 20.47  ? 143 GLU B CG  1 
ATOM   2204 C  CD  . GLU B 1 147 ? 15.403  8.615  54.011 1.00 22.37  ? 143 GLU B CD  1 
ATOM   2205 O  OE1 . GLU B 1 147 ? 16.282  9.464  53.830 1.00 24.38  ? 143 GLU B OE1 1 
ATOM   2206 O  OE2 . GLU B 1 147 ? 15.602  7.387  53.881 1.00 21.74  ? 143 GLU B OE2 1 
ATOM   2207 N  N   . ILE B 1 148 ? 12.413  12.945 56.399 1.00 18.41  ? 144 ILE B N   1 
ATOM   2208 C  CA  . ILE B 1 148 ? 12.258  14.345 56.790 1.00 18.00  ? 144 ILE B CA  1 
ATOM   2209 C  C   . ILE B 1 148 ? 13.433  14.821 57.635 1.00 19.21  ? 144 ILE B C   1 
ATOM   2210 O  O   . ILE B 1 148 ? 13.582  14.390 58.790 1.00 19.12  ? 144 ILE B O   1 
ATOM   2211 C  CB  . ILE B 1 148 ? 10.936  14.528 57.562 1.00 17.09  ? 144 ILE B CB  1 
ATOM   2212 C  CG1 . ILE B 1 148 ? 9.768   13.917 56.771 1.00 17.53  ? 144 ILE B CG1 1 
ATOM   2213 C  CG2 . ILE B 1 148 ? 10.711  15.988 57.928 1.00 16.41  ? 144 ILE B CG2 1 
ATOM   2214 C  CD1 . ILE B 1 148 ? 8.709   13.323 57.634 1.00 18.02  ? 144 ILE B CD1 1 
ATOM   2215 N  N   . ALA B 1 149 ? 14.269  15.684 57.053 1.00 19.36  ? 145 ALA B N   1 
ATOM   2216 C  CA  . ALA B 1 149 ? 15.432  16.214 57.770 1.00 19.97  ? 145 ALA B CA  1 
ATOM   2217 C  C   . ALA B 1 149 ? 15.061  17.547 58.403 1.00 20.92  ? 145 ALA B C   1 
ATOM   2218 O  O   . ALA B 1 149 ? 14.235  18.302 57.857 1.00 19.73  ? 145 ALA B O   1 
ATOM   2219 C  CB  . ALA B 1 149 ? 16.604  16.408 56.832 1.00 18.94  ? 145 ALA B CB  1 
ATOM   2220 N  N   . ALA B 1 150 ? 15.662  17.813 59.554 1.00 21.78  ? 146 ALA B N   1 
ATOM   2221 C  CA  . ALA B 1 150 ? 15.450  19.055 60.288 1.00 23.44  ? 146 ALA B CA  1 
ATOM   2222 C  C   . ALA B 1 150 ? 16.051  20.206 59.460 1.00 24.18  ? 146 ALA B C   1 
ATOM   2223 O  O   . ALA B 1 150 ? 16.859  19.952 58.555 1.00 24.79  ? 146 ALA B O   1 
ATOM   2224 C  CB  . ALA B 1 150 ? 16.137  18.958 61.633 1.00 23.18  ? 146 ALA B CB  1 
ATOM   2225 N  N   . PRO B 1 151 ? 15.674  21.459 59.761 1.00 25.53  ? 147 PRO B N   1 
ATOM   2226 C  CA  . PRO B 1 151 ? 16.283  22.598 59.056 1.00 26.66  ? 147 PRO B CA  1 
ATOM   2227 C  C   . PRO B 1 151 ? 17.827  22.586 59.046 1.00 28.54  ? 147 PRO B C   1 
ATOM   2228 O  O   . PRO B 1 151 ? 18.465  21.993 59.931 1.00 28.04  ? 147 PRO B O   1 
ATOM   2229 C  CB  . PRO B 1 151 ? 15.764  23.812 59.844 1.00 25.68  ? 147 PRO B CB  1 
ATOM   2230 C  CG  . PRO B 1 151 ? 14.501  23.379 60.449 1.00 25.68  ? 147 PRO B CG  1 
ATOM   2231 C  CD  . PRO B 1 151 ? 14.674  21.895 60.756 1.00 24.79  ? 147 PRO B CD  1 
ATOM   2232 N  N   . SER B 1 152 ? 18.440  23.183 58.029 1.00 30.18  ? 148 SER B N   1 
ATOM   2233 C  CA  . SER B 1 152 ? 19.886  23.221 58.003 1.00 32.15  ? 148 SER B CA  1 
ATOM   2234 C  C   . SER B 1 152 ? 20.305  24.194 59.115 1.00 32.59  ? 148 SER B C   1 
ATOM   2235 O  O   . SER B 1 152 ? 19.545  25.094 59.468 1.00 32.13  ? 148 SER B O   1 
ATOM   2236 C  CB  . SER B 1 152 ? 20.396  23.703 56.650 1.00 32.84  ? 148 SER B CB  1 
ATOM   2237 O  OG  . SER B 1 152 ? 19.805  22.962 55.574 1.00 35.68  ? 148 SER B OG  1 
ATOM   2238 N  N   . HIS B 1 153 ? 21.502  24.012 59.665 1.00 33.46  ? 149 HIS B N   1 
ATOM   2239 C  CA  . HIS B 1 153 ? 22.006  24.882 60.745 1.00 34.66  ? 149 HIS B CA  1 
ATOM   2240 C  C   . HIS B 1 153 ? 22.019  26.376 60.422 1.00 34.38  ? 149 HIS B C   1 
ATOM   2241 O  O   . HIS B 1 153 ? 21.817  27.235 61.303 1.00 33.80  ? 149 HIS B O   1 
ATOM   2242 C  CB  . HIS B 1 153 ? 23.404  24.419 61.164 1.00 35.97  ? 149 HIS B CB  1 
ATOM   2243 C  CG  . HIS B 1 153 ? 23.427  23.674 62.463 1.00 39.53  ? 149 HIS B CG  1 
ATOM   2244 N  ND1 . HIS B 1 153 ? 24.553  23.605 63.259 1.00 43.12  ? 149 HIS B ND1 1 
ATOM   2245 C  CD2 . HIS B 1 153 ? 22.452  23.007 63.128 1.00 41.97  ? 149 HIS B CD2 1 
ATOM   2246 C  CE1 . HIS B 1 153 ? 24.273  22.916 64.352 1.00 43.82  ? 149 HIS B CE1 1 
ATOM   2247 N  NE2 . HIS B 1 153 ? 23.004  22.546 64.298 1.00 43.11  ? 149 HIS B NE2 1 
ATOM   2248 N  N   . ASP B 1 154 ? 22.239  26.705 59.160 1.00 34.20  ? 150 ASP B N   1 
ATOM   2249 C  CA  . ASP B 1 154 ? 22.251  28.110 58.790 1.00 34.20  ? 150 ASP B CA  1 
ATOM   2250 C  C   . ASP B 1 154 ? 20.863  28.586 58.313 1.00 32.86  ? 150 ASP B C   1 
ATOM   2251 O  O   . ASP B 1 154 ? 20.696  29.746 57.915 1.00 32.63  ? 150 ASP B O   1 
ATOM   2252 C  CB  . ASP B 1 154 ? 23.332  28.371 57.734 1.00 35.17  ? 150 ASP B CB  1 
ATOM   2253 C  CG  . ASP B 1 154 ? 23.055  27.668 56.424 1.00 38.38  ? 150 ASP B CG  1 
ATOM   2254 O  OD1 . ASP B 1 154 ? 22.583  26.492 56.421 1.00 39.55  ? 150 ASP B OD1 1 
ATOM   2255 O  OD2 . ASP B 1 154 ? 23.341  28.305 55.385 1.00 42.71  ? 150 ASP B OD2 1 
ATOM   2256 N  N   . GLU B 1 155 ? 19.868  27.707 58.376 1.00 30.64  ? 151 GLU B N   1 
ATOM   2257 C  CA  . GLU B 1 155 ? 18.517  28.071 57.950 1.00 30.91  ? 151 GLU B CA  1 
ATOM   2258 C  C   . GLU B 1 155 ? 17.540  28.324 59.104 1.00 28.68  ? 151 GLU B C   1 
ATOM   2259 O  O   . GLU B 1 155 ? 16.480  28.929 58.896 1.00 28.70  ? 151 GLU B O   1 
ATOM   2260 C  CB  . GLU B 1 155 ? 17.918  26.990 57.053 1.00 30.81  ? 151 GLU B CB  1 
ATOM   2261 C  CG  . GLU B 1 155 ? 18.588  26.831 55.681 1.00 34.06  ? 151 GLU B CG  1 
ATOM   2262 C  CD  . GLU B 1 155 ? 18.203  25.516 55.007 1.00 36.50  ? 151 GLU B CD  1 
ATOM   2263 O  OE1 . GLU B 1 155 ? 17.226  24.846 55.483 1.00 41.08  ? 151 GLU B OE1 1 
ATOM   2264 O  OE2 . GLU B 1 155 ? 18.882  25.129 54.006 1.00 44.57  ? 151 GLU B OE2 1 
ATOM   2265 N  N   . TYR B 1 156 ? 17.859  27.845 60.300 1.00 25.68  ? 152 TYR B N   1 
ATOM   2266 C  CA  . TYR B 1 156 ? 16.952  28.017 61.444 1.00 23.65  ? 152 TYR B CA  1 
ATOM   2267 C  C   . TYR B 1 156 ? 17.710  27.939 62.766 1.00 22.12  ? 152 TYR B C   1 
ATOM   2268 O  O   . TYR B 1 156 ? 18.815  27.388 62.825 1.00 22.63  ? 152 TYR B O   1 
ATOM   2269 C  CB  . TYR B 1 156 ? 15.855  26.933 61.381 1.00 21.86  ? 152 TYR B CB  1 
ATOM   2270 C  CG  . TYR B 1 156 ? 14.521  27.332 61.935 1.00 21.13  ? 152 TYR B CG  1 
ATOM   2271 C  CD1 . TYR B 1 156 ? 13.646  28.081 61.171 1.00 19.94  ? 152 TYR B CD1 1 
ATOM   2272 C  CD2 . TYR B 1 156 ? 14.113  26.926 63.206 1.00 17.96  ? 152 TYR B CD2 1 
ATOM   2273 C  CE1 . TYR B 1 156 ? 12.414  28.455 61.663 1.00 20.57  ? 152 TYR B CE1 1 
ATOM   2274 C  CE2 . TYR B 1 156 ? 12.866  27.291 63.729 1.00 20.80  ? 152 TYR B CE2 1 
ATOM   2275 C  CZ  . TYR B 1 156 ? 12.004  28.047 62.910 1.00 22.76  ? 152 TYR B CZ  1 
ATOM   2276 O  OH  . TYR B 1 156 ? 10.770  28.474 63.324 1.00 21.60  ? 152 TYR B OH  1 
ATOM   2277 N  N   . SER B 1 157 ? 17.133  28.527 63.810 1.00 20.34  ? 153 SER B N   1 
ATOM   2278 C  CA  . SER B 1 157 ? 17.708  28.543 65.141 1.00 19.90  ? 153 SER B CA  1 
ATOM   2279 C  C   . SER B 1 157 ? 16.648  28.409 66.205 1.00 18.76  ? 153 SER B C   1 
ATOM   2280 O  O   . SER B 1 157 ? 15.426  28.531 65.930 1.00 18.35  ? 153 SER B O   1 
ATOM   2281 C  CB  . SER B 1 157 ? 18.470  29.846 65.447 1.00 20.92  ? 153 SER B CB  1 
ATOM   2282 O  OG  . SER B 1 157 ? 19.625  29.941 64.653 1.00 23.89  ? 153 SER B OG  1 
ATOM   2283 N  N   . LEU B 1 158 ? 17.140  28.147 67.419 1.00 16.54  ? 154 LEU B N   1 
ATOM   2284 C  CA  . LEU B 1 158 ? 16.312  28.035 68.615 1.00 15.92  ? 154 LEU B CA  1 
ATOM   2285 C  C   . LEU B 1 158 ? 16.904  28.903 69.688 1.00 15.69  ? 154 LEU B C   1 
ATOM   2286 O  O   . LEU B 1 158 ? 18.144  28.951 69.874 1.00 17.28  ? 154 LEU B O   1 
ATOM   2287 C  CB  . LEU B 1 158 ? 16.249  26.575 69.137 1.00 15.15  ? 154 LEU B CB  1 
ATOM   2288 C  CG  . LEU B 1 158 ? 15.796  25.472 68.175 1.00 16.06  ? 154 LEU B CG  1 
ATOM   2289 C  CD1 . LEU B 1 158 ? 16.000  24.068 68.813 1.00 15.75  ? 154 LEU B CD1 1 
ATOM   2290 C  CD2 . LEU B 1 158 ? 14.316  25.667 67.728 1.00 16.22  ? 154 LEU B CD2 1 
ATOM   2291 N  N   . HIS B 1 159 ? 16.042  29.565 70.440 1.00 15.61  ? 155 HIS B N   1 
ATOM   2292 C  CA  . HIS B 1 159 ? 16.481  30.323 71.616 1.00 14.38  ? 155 HIS B CA  1 
ATOM   2293 C  C   . HIS B 1 159 ? 16.760  29.144 72.579 1.00 15.87  ? 155 HIS B C   1 
ATOM   2294 O  O   . HIS B 1 159 ? 15.922  28.225 72.685 1.00 15.54  ? 155 HIS B O   1 
ATOM   2295 C  CB  . HIS B 1 159 ? 15.323  31.028 72.254 1.00 13.68  ? 155 HIS B CB  1 
ATOM   2296 C  CG  . HIS B 1 159 ? 14.910  32.308 71.607 1.00 12.68  ? 155 HIS B CG  1 
ATOM   2297 N  ND1 . HIS B 1 159 ? 14.363  33.335 72.348 1.00 14.37  ? 155 HIS B ND1 1 
ATOM   2298 C  CD2 . HIS B 1 159 ? 14.878  32.714 70.315 1.00 11.00  ? 155 HIS B CD2 1 
ATOM   2299 C  CE1 . HIS B 1 159 ? 14.000  34.317 71.529 1.00 10.64  ? 155 HIS B CE1 1 
ATOM   2300 N  NE2 . HIS B 1 159 ? 14.302  33.962 70.296 1.00 9.45   ? 155 HIS B NE2 1 
ATOM   2301 N  N   . ILE B 1 160 ? 17.897  29.168 73.286 1.00 15.71  ? 156 ILE B N   1 
ATOM   2302 C  CA  . ILE B 1 160 ? 18.225  28.080 74.225 1.00 17.87  ? 156 ILE B CA  1 
ATOM   2303 C  C   . ILE B 1 160 ? 18.503  28.586 75.638 1.00 18.04  ? 156 ILE B C   1 
ATOM   2304 O  O   . ILE B 1 160 ? 18.779  27.804 76.559 1.00 18.06  ? 156 ILE B O   1 
ATOM   2305 C  CB  . ILE B 1 160 ? 19.392  27.194 73.725 1.00 16.74  ? 156 ILE B CB  1 
ATOM   2306 C  CG1 . ILE B 1 160 ? 20.677  28.020 73.556 1.00 18.68  ? 156 ILE B CG1 1 
ATOM   2307 C  CG2 . ILE B 1 160 ? 19.008  26.502 72.419 1.00 16.82  ? 156 ILE B CG2 1 
ATOM   2308 C  CD1 . ILE B 1 160 ? 21.960  27.178 73.311 1.00 18.93  ? 156 ILE B CD1 1 
ATOM   2309 N  N   . ASP B 1 161 ? 18.412  29.895 75.827 1.00 19.41  ? 157 ASP B N   1 
ATOM   2310 C  CA  . ASP B 1 161 ? 18.621  30.454 77.162 1.00 22.15  ? 157 ASP B CA  1 
ATOM   2311 C  C   . ASP B 1 161 ? 17.451  29.968 78.035 1.00 23.54  ? 157 ASP B C   1 
ATOM   2312 O  O   . ASP B 1 161 ? 16.383  29.609 77.522 1.00 23.22  ? 157 ASP B O   1 
ATOM   2313 C  CB  . ASP B 1 161 ? 18.668  31.978 77.125 1.00 21.24  ? 157 ASP B CB  1 
ATOM   2314 C  CG  . ASP B 1 161 ? 17.591  32.543 76.262 1.00 23.20  ? 157 ASP B CG  1 
ATOM   2315 O  OD1 . ASP B 1 161 ? 17.684  32.347 75.037 1.00 22.87  ? 157 ASP B OD1 1 
ATOM   2316 O  OD2 . ASP B 1 161 ? 16.645  33.160 76.800 1.00 22.85  ? 157 ASP B OD2 1 
ATOM   2317 N  N   . GLU B 1 162 ? 17.665  29.953 79.346 1.00 25.24  ? 158 GLU B N   1 
ATOM   2318 C  CA  . GLU B 1 162 ? 16.648  29.513 80.294 1.00 27.43  ? 158 GLU B CA  1 
ATOM   2319 C  C   . GLU B 1 162 ? 15.432  30.430 80.286 1.00 27.68  ? 158 GLU B C   1 
ATOM   2320 O  O   . GLU B 1 162 ? 14.294  29.969 80.263 1.00 28.15  ? 158 GLU B O   1 
ATOM   2321 C  CB  . GLU B 1 162 ? 17.226  29.461 81.714 1.00 28.12  ? 158 GLU B CB  1 
ATOM   2322 C  CG  . GLU B 1 162 ? 16.344  28.668 82.670 1.00 32.69  ? 158 GLU B CG  1 
ATOM   2323 C  CD  . GLU B 1 162 ? 16.687  28.894 84.129 1.00 37.50  ? 158 GLU B CD  1 
ATOM   2324 O  OE1 . GLU B 1 162 ? 16.974  30.057 84.520 1.00 39.33  ? 158 GLU B OE1 1 
ATOM   2325 O  OE2 . GLU B 1 162 ? 16.653  27.898 84.889 1.00 39.66  ? 158 GLU B OE2 1 
ATOM   2326 N  N   . GLN B 1 163 ? 15.670  31.733 80.296 1.00 28.47  ? 159 GLN B N   1 
ATOM   2327 C  CA  . GLN B 1 163 ? 14.564  32.672 80.331 1.00 29.11  ? 159 GLN B CA  1 
ATOM   2328 C  C   . GLN B 1 163 ? 13.557  32.590 79.191 1.00 28.17  ? 159 GLN B C   1 
ATOM   2329 O  O   . GLN B 1 163 ? 12.358  32.603 79.468 1.00 28.20  ? 159 GLN B O   1 
ATOM   2330 C  CB  . GLN B 1 163 ? 15.080  34.118 80.519 1.00 30.28  ? 159 GLN B CB  1 
ATOM   2331 C  CG  . GLN B 1 163 ? 14.059  35.245 80.212 1.00 34.26  ? 159 GLN B CG  1 
ATOM   2332 C  CD  . GLN B 1 163 ? 13.377  35.879 81.440 1.00 39.61  ? 159 GLN B CD  1 
ATOM   2333 O  OE1 . GLN B 1 163 ? 13.652  35.508 82.591 1.00 41.53  ? 159 GLN B OE1 1 
ATOM   2334 N  NE2 . GLN B 1 163 ? 12.477  36.860 81.183 1.00 40.82  ? 159 GLN B NE2 1 
ATOM   2335 N  N   . THR B 1 164 ? 13.995  32.390 77.942 1.00 26.75  ? 160 THR B N   1 
ATOM   2336 C  CA  . THR B 1 164 ? 13.136  32.520 76.760 1.00 25.54  ? 160 THR B CA  1 
ATOM   2337 C  C   . THR B 1 164 ? 13.036  31.290 75.838 1.00 25.96  ? 160 THR B C   1 
ATOM   2338 O  O   . THR B 1 164 ? 12.321  31.272 74.888 1.00 25.78  ? 160 THR B O   1 
ATOM   2339 C  CB  . THR B 1 164 ? 13.521  33.739 75.923 1.00 25.20  ? 160 THR B CB  1 
ATOM   2340 O  OG1 . THR B 1 164 ? 14.673  33.460 75.153 1.00 24.06  ? 160 THR B OG1 1 
ATOM   2341 C  CG2 . THR B 1 164 ? 13.788  34.975 76.826 1.00 23.18  ? 160 THR B CG2 1 
ATOM   2342 N  N   . GLY B 1 165 ? 13.805  30.287 76.150 1.00 26.66  ? 161 GLY B N   1 
ATOM   2343 C  CA  . GLY B 1 165 ? 14.278  29.369 75.171 1.00 26.30  ? 161 GLY B CA  1 
ATOM   2344 C  C   . GLY B 1 165 ? 13.556  28.084 75.303 1.00 25.36  ? 161 GLY B C   1 
ATOM   2345 O  O   . GLY B 1 165 ? 12.611  28.003 76.013 1.00 25.99  ? 161 GLY B O   1 
ATOM   2346 N  N   . VAL B 1 166 ? 14.034  27.082 74.612 1.00 24.17  ? 162 VAL B N   1 
ATOM   2347 C  CA  . VAL B 1 166 ? 13.291  25.803 74.556 1.00 23.18  ? 162 VAL B CA  1 
ATOM   2348 C  C   . VAL B 1 166 ? 14.184  24.643 74.984 1.00 22.77  ? 162 VAL B C   1 
ATOM   2349 O  O   . VAL B 1 166 ? 15.406  24.733 74.841 1.00 22.76  ? 162 VAL B O   1 
ATOM   2350 C  CB  . VAL B 1 166 ? 12.712  25.474 73.166 1.00 22.92  ? 162 VAL B CB  1 
ATOM   2351 C  CG1 . VAL B 1 166 ? 11.800  26.599 72.672 1.00 24.16  ? 162 VAL B CG1 1 
ATOM   2352 C  CG2 . VAL B 1 166 ? 13.820  25.152 72.159 1.00 21.38  ? 162 VAL B CG2 1 
ATOM   2353 N  N   . SER B 1 167 ? 13.587  23.551 75.482 1.00 22.37  ? 163 SER B N   1 
ATOM   2354 C  CA  . SER B 1 167 ? 14.383  22.403 75.932 1.00 22.61  ? 163 SER B CA  1 
ATOM   2355 C  C   . SER B 1 167 ? 14.765  21.397 74.847 1.00 22.35  ? 163 SER B C   1 
ATOM   2356 O  O   . SER B 1 167 ? 15.814  20.771 74.936 1.00 21.78  ? 163 SER B O   1 
ATOM   2357 C  CB  . SER B 1 167 ? 13.668  21.648 77.066 1.00 23.29  ? 163 SER B CB  1 
ATOM   2358 O  OG  . SER B 1 167 ? 12.417  21.153 76.618 1.00 25.88  ? 163 SER B OG  1 
ATOM   2359 N  N   . GLY B 1 168 ? 13.911  21.219 73.843 1.00 22.15  ? 164 GLY B N   1 
ATOM   2360 C  CA  . GLY B 1 168 ? 14.193  20.255 72.786 1.00 22.03  ? 164 GLY B CA  1 
ATOM   2361 C  C   . GLY B 1 168 ? 15.243  20.719 71.801 1.00 21.78  ? 164 GLY B C   1 
ATOM   2362 O  O   . GLY B 1 168 ? 15.598  21.894 71.774 1.00 20.06  ? 164 GLY B O   1 
ATOM   2363 N  N   . ARG B 1 169 ? 15.762  19.774 71.014 1.00 21.43  ? 165 ARG B N   1 
ATOM   2364 C  CA  . ARG B 1 169 ? 16.767  20.079 69.998 1.00 22.02  ? 165 ARG B CA  1 
ATOM   2365 C  C   . ARG B 1 169 ? 16.341  19.357 68.724 1.00 22.23  ? 165 ARG B C   1 
ATOM   2366 O  O   . ARG B 1 169 ? 15.623  18.358 68.808 1.00 22.12  ? 165 ARG B O   1 
ATOM   2367 C  CB  . ARG B 1 169 ? 18.162  19.641 70.431 1.00 22.31  ? 165 ARG B CB  1 
ATOM   2368 C  CG  . ARG B 1 169 ? 18.713  20.347 71.663 1.00 22.13  ? 165 ARG B CG  1 
ATOM   2369 C  CD  . ARG B 1 169 ? 18.897  21.860 71.452 1.00 26.17  ? 165 ARG B CD  1 
ATOM   2370 N  NE  . ARG B 1 169 ? 19.451  22.493 72.656 1.00 24.90  ? 165 ARG B NE  1 
ATOM   2371 C  CZ  . ARG B 1 169 ? 18.748  23.164 73.566 1.00 22.91  ? 165 ARG B CZ  1 
ATOM   2372 N  NH1 . ARG B 1 169 ? 17.435  23.304 73.456 1.00 20.70  ? 165 ARG B NH1 1 
ATOM   2373 N  NH2 . ARG B 1 169 ? 19.370  23.694 74.606 1.00 22.67  ? 165 ARG B NH2 1 
ATOM   2374 N  N   . PHE B 1 170 ? 16.763  19.847 67.558 1.00 21.29  ? 166 PHE B N   1 
ATOM   2375 C  CA  . PHE B 1 170 ? 16.371  19.201 66.301 1.00 20.34  ? 166 PHE B CA  1 
ATOM   2376 C  C   . PHE B 1 170 ? 17.027  17.842 66.190 1.00 20.88  ? 166 PHE B C   1 
ATOM   2377 O  O   . PHE B 1 170 ? 18.106  17.619 66.753 1.00 19.26  ? 166 PHE B O   1 
ATOM   2378 C  CB  . PHE B 1 170 ? 16.701  20.059 65.093 1.00 20.01  ? 166 PHE B CB  1 
ATOM   2379 C  CG  . PHE B 1 170 ? 15.719  21.149 64.854 1.00 22.14  ? 166 PHE B CG  1 
ATOM   2380 C  CD1 . PHE B 1 170 ? 14.443  20.869 64.360 1.00 22.02  ? 166 PHE B CD1 1 
ATOM   2381 C  CD2 . PHE B 1 170 ? 16.054  22.469 65.120 1.00 22.28  ? 166 PHE B CD2 1 
ATOM   2382 C  CE1 . PHE B 1 170 ? 13.525  21.899 64.140 1.00 23.31  ? 166 PHE B CE1 1 
ATOM   2383 C  CE2 . PHE B 1 170 ? 15.136  23.497 64.904 1.00 21.65  ? 166 PHE B CE2 1 
ATOM   2384 C  CZ  . PHE B 1 170 ? 13.866  23.208 64.408 1.00 20.85  ? 166 PHE B CZ  1 
ATOM   2385 N  N   . TRP B 1 171 ? 16.345  16.928 65.510 1.00 20.63  ? 167 TRP B N   1 
ATOM   2386 C  CA  . TRP B 1 171 ? 16.822  15.578 65.310 1.00 21.70  ? 167 TRP B CA  1 
ATOM   2387 C  C   . TRP B 1 171 ? 17.952  15.602 64.291 1.00 22.96  ? 167 TRP B C   1 
ATOM   2388 O  O   . TRP B 1 171 ? 17.984  16.479 63.427 1.00 22.88  ? 167 TRP B O   1 
ATOM   2389 C  CB  . TRP B 1 171 ? 15.681  14.690 64.839 1.00 20.57  ? 167 TRP B CB  1 
ATOM   2390 C  CG  . TRP B 1 171 ? 15.015  15.193 63.608 1.00 20.95  ? 167 TRP B CG  1 
ATOM   2391 C  CD1 . TRP B 1 171 ? 15.271  14.805 62.332 1.00 21.38  ? 167 TRP B CD1 1 
ATOM   2392 C  CD2 . TRP B 1 171 ? 13.967  16.162 63.534 1.00 19.53  ? 167 TRP B CD2 1 
ATOM   2393 N  NE1 . TRP B 1 171 ? 14.446  15.461 61.463 1.00 20.54  ? 167 TRP B NE1 1 
ATOM   2394 C  CE2 . TRP B 1 171 ? 13.644  16.318 62.174 1.00 21.32  ? 167 TRP B CE2 1 
ATOM   2395 C  CE3 . TRP B 1 171 ? 13.270  16.925 64.493 1.00 18.84  ? 167 TRP B CE3 1 
ATOM   2396 C  CZ2 . TRP B 1 171 ? 12.649  17.200 61.732 1.00 17.53  ? 167 TRP B CZ2 1 
ATOM   2397 C  CZ3 . TRP B 1 171 ? 12.283  17.813 64.046 1.00 19.95  ? 167 TRP B CZ3 1 
ATOM   2398 C  CH2 . TRP B 1 171 ? 11.987  17.934 62.682 1.00 20.39  ? 167 TRP B CH2 1 
ATOM   2399 N  N   . SER B 1 172 ? 18.878  14.649 64.413 1.00 24.44  ? 168 SER B N   1 
ATOM   2400 C  CA  . SER B 1 172 ? 20.044  14.563 63.538 1.00 26.80  ? 168 SER B CA  1 
ATOM   2401 C  C   . SER B 1 172 ? 19.792  13.689 62.311 1.00 27.87  ? 168 SER B C   1 
ATOM   2402 O  O   . SER B 1 172 ? 19.963  14.152 61.179 1.00 29.43  ? 168 SER B O   1 
ATOM   2403 C  CB  . SER B 1 172 ? 21.269  14.127 64.360 1.00 27.89  ? 168 SER B CB  1 
ATOM   2404 O  OG  . SER B 1 172 ? 22.281  13.562 63.552 1.00 32.01  ? 168 SER B OG  1 
ATOM   2405 N  N   . GLU B 1 173 ? 19.320  12.460 62.511 1.00 27.16  ? 169 GLU B N   1 
ATOM   2406 C  CA  . GLU B 1 173 ? 19.008  11.585 61.384 1.00 27.61  ? 169 GLU B CA  1 
ATOM   2407 C  C   . GLU B 1 173 ? 17.586  11.873 60.898 1.00 26.42  ? 169 GLU B C   1 
ATOM   2408 O  O   . GLU B 1 173 ? 16.665  11.973 61.709 1.00 26.99  ? 169 GLU B O   1 
ATOM   2409 C  CB  . GLU B 1 173 ? 19.133  10.128 61.789 1.00 27.72  ? 169 GLU B CB  1 
ATOM   2410 C  CG  . GLU B 1 173 ? 20.559  9.677  62.009 1.00 33.60  ? 169 GLU B CG  1 
ATOM   2411 C  CD  . GLU B 1 173 ? 21.357  9.461  60.710 1.00 39.34  ? 169 GLU B CD  1 
ATOM   2412 O  OE1 . GLU B 1 173 ? 20.760  9.080  59.666 1.00 40.22  ? 169 GLU B OE1 1 
ATOM   2413 O  OE2 . GLU B 1 173 ? 22.604  9.651  60.764 1.00 42.20  ? 169 GLU B OE2 1 
ATOM   2414 N  N   . PRO B 1 174 ? 17.394  12.024 59.575 1.00 25.42  ? 170 PRO B N   1 
ATOM   2415 C  CA  . PRO B 1 174 ? 16.053  12.287 59.077 1.00 24.49  ? 170 PRO B CA  1 
ATOM   2416 C  C   . PRO B 1 174 ? 14.997  11.362 59.664 1.00 23.30  ? 170 PRO B C   1 
ATOM   2417 O  O   . PRO B 1 174 ? 15.254  10.159 59.839 1.00 22.98  ? 170 PRO B O   1 
ATOM   2418 C  CB  . PRO B 1 174 ? 16.195  12.039 57.575 1.00 25.06  ? 170 PRO B CB  1 
ATOM   2419 C  CG  . PRO B 1 174 ? 17.560  12.508 57.287 1.00 25.22  ? 170 PRO B CG  1 
ATOM   2420 C  CD  . PRO B 1 174 ? 18.369  11.976 58.469 1.00 26.12  ? 170 PRO B CD  1 
ATOM   2421 N  N   . LEU B 1 175 ? 13.834  11.925 59.996 1.00 21.45  ? 171 LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 175 ? 12.723  11.128 60.531 1.00 21.18  ? 171 LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 175 ? 12.010  10.424 59.365 1.00 21.13  ? 171 LEU B C   1 
ATOM   2424 O  O   . LEU B 1 175 ? 11.939  10.966 58.270 1.00 20.28  ? 171 LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 175 ? 11.724  11.991 61.293 1.00 20.40  ? 171 LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 175 ? 12.231  12.688 62.559 1.00 20.93  ? 171 LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 175 ? 11.176  13.615 63.117 1.00 21.81  ? 171 LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 175 ? 12.644  11.645 63.624 1.00 18.76  ? 171 LEU B CD2 1 
ATOM   2429 N  N   . VAL B 1 176 ? 11.485  9.221  59.605 1.00 21.83  ? 172 VAL B N   1 
ATOM   2430 C  CA  . VAL B 1 176 ? 10.819  8.456  58.544 1.00 22.01  ? 172 VAL B CA  1 
ATOM   2431 C  C   . VAL B 1 176 ? 9.318   8.170  58.751 1.00 22.60  ? 172 VAL B C   1 
ATOM   2432 O  O   . VAL B 1 176 ? 8.891   7.720  59.817 1.00 22.57  ? 172 VAL B O   1 
ATOM   2433 C  CB  . VAL B 1 176 ? 11.556  7.086  58.312 1.00 22.60  ? 172 VAL B CB  1 
ATOM   2434 C  CG1 . VAL B 1 176 ? 10.837  6.242  57.231 1.00 21.92  ? 172 VAL B CG1 1 
ATOM   2435 C  CG2 . VAL B 1 176 ? 13.025  7.293  57.944 1.00 22.00  ? 172 VAL B CG2 1 
ATOM   2436 N  N   . ALA B 1 177 ? 8.539   8.415  57.701 1.00 23.21  ? 173 ALA B N   1 
ATOM   2437 C  CA  . ALA B 1 177 ? 7.116   8.120  57.648 1.00 23.83  ? 173 ALA B CA  1 
ATOM   2438 C  C   . ALA B 1 177 ? 7.045   7.226  56.387 1.00 24.87  ? 173 ALA B C   1 
ATOM   2439 O  O   . ALA B 1 177 ? 7.378   7.658  55.266 1.00 25.85  ? 173 ALA B O   1 
ATOM   2440 C  CB  . ALA B 1 177 ? 6.311   9.359  57.530 1.00 23.59  ? 173 ALA B CB  1 
ATOM   2441 N  N   . GLU B 1 178 ? 6.671   5.969  56.583 1.00 25.47  ? 174 GLU B N   1 
ATOM   2442 C  CA  . GLU B 1 178 ? 6.648   4.986  55.517 1.00 26.26  ? 174 GLU B CA  1 
ATOM   2443 C  C   . GLU B 1 178 ? 5.355   4.189  55.385 1.00 25.58  ? 174 GLU B C   1 
ATOM   2444 O  O   . GLU B 1 178 ? 4.763   3.800  56.394 1.00 24.80  ? 174 GLU B O   1 
ATOM   2445 C  CB  . GLU B 1 178 ? 7.783   3.992  55.791 1.00 26.89  ? 174 GLU B CB  1 
ATOM   2446 C  CG  . GLU B 1 178 ? 8.709   3.826  54.604 1.00 29.79  ? 174 GLU B CG  1 
ATOM   2447 C  CD  . GLU B 1 178 ? 9.670   2.649  54.696 1.00 29.39  ? 174 GLU B CD  1 
ATOM   2448 O  OE1 . GLU B 1 178 ? 10.275  2.414  55.776 1.00 34.32  ? 174 GLU B OE1 1 
ATOM   2449 O  OE2 . GLU B 1 178 ? 9.813   1.958  53.655 1.00 35.97  ? 174 GLU B OE2 1 
ATOM   2450 N  N   . TRP B 1 179 ? 4.947   3.929  54.135 1.00 24.24  ? 175 TRP B N   1 
ATOM   2451 C  CA  . TRP B 1 179 ? 3.758   3.133  53.812 1.00 24.43  ? 175 TRP B CA  1 
ATOM   2452 C  C   . TRP B 1 179 ? 4.290   2.101  52.824 1.00 25.12  ? 175 TRP B C   1 
ATOM   2453 O  O   . TRP B 1 179 ? 4.928   2.466  51.857 1.00 25.12  ? 175 TRP B O   1 
ATOM   2454 C  CB  . TRP B 1 179 ? 2.642   3.992  53.198 1.00 23.68  ? 175 TRP B CB  1 
ATOM   2455 C  CG  . TRP B 1 179 ? 2.234   5.114  54.093 1.00 22.33  ? 175 TRP B CG  1 
ATOM   2456 C  CD1 . TRP B 1 179 ? 1.283   5.069  55.053 1.00 21.59  ? 175 TRP B CD1 1 
ATOM   2457 C  CD2 . TRP B 1 179 ? 2.781   6.446  54.122 1.00 21.89  ? 175 TRP B CD2 1 
ATOM   2458 N  NE1 . TRP B 1 179 ? 1.195   6.276  55.696 1.00 24.17  ? 175 TRP B NE1 1 
ATOM   2459 C  CE2 . TRP B 1 179 ? 2.101   7.146  55.146 1.00 22.94  ? 175 TRP B CE2 1 
ATOM   2460 C  CE3 . TRP B 1 179 ? 3.784   7.109  53.395 1.00 23.94  ? 175 TRP B CE3 1 
ATOM   2461 C  CZ2 . TRP B 1 179 ? 2.376   8.493  55.462 1.00 22.63  ? 175 TRP B CZ2 1 
ATOM   2462 C  CZ3 . TRP B 1 179 ? 4.058   8.462  53.701 1.00 21.84  ? 175 TRP B CZ3 1 
ATOM   2463 C  CH2 . TRP B 1 179 ? 3.360   9.128  54.740 1.00 20.90  ? 175 TRP B CH2 1 
ATOM   2464 N  N   . ASP B 1 180 ? 4.102   0.814  53.080 1.00 26.09  ? 176 ASP B N   1 
ATOM   2465 C  CA  . ASP B 1 180 ? 4.679   -0.190 52.164 1.00 27.42  ? 176 ASP B CA  1 
ATOM   2466 C  C   . ASP B 1 180 ? 3.760   -0.921 51.193 1.00 27.01  ? 176 ASP B C   1 
ATOM   2467 O  O   . ASP B 1 180 ? 4.209   -1.834 50.508 1.00 27.48  ? 176 ASP B O   1 
ATOM   2468 C  CB  . ASP B 1 180 ? 5.503   -1.212 52.947 1.00 28.78  ? 176 ASP B CB  1 
ATOM   2469 C  CG  . ASP B 1 180 ? 4.757   -1.761 54.138 1.00 32.87  ? 176 ASP B CG  1 
ATOM   2470 O  OD1 . ASP B 1 180 ? 3.502   -1.795 54.055 1.00 38.37  ? 176 ASP B OD1 1 
ATOM   2471 O  OD2 . ASP B 1 180 ? 5.410   -2.165 55.147 1.00 35.26  ? 176 ASP B OD2 1 
ATOM   2472 N  N   . ASP B 1 181 ? 2.494   -0.521 51.126 1.00 26.13  ? 177 ASP B N   1 
ATOM   2473 C  CA  . ASP B 1 181 ? 1.531   -1.143 50.240 1.00 25.16  ? 177 ASP B CA  1 
ATOM   2474 C  C   . ASP B 1 181 ? 0.667   -0.081 49.557 1.00 24.42  ? 177 ASP B C   1 
ATOM   2475 O  O   . ASP B 1 181 ? -0.560  -0.170 49.552 1.00 24.31  ? 177 ASP B O   1 
ATOM   2476 C  CB  . ASP B 1 181 ? 0.651   -2.115 51.013 1.00 25.82  ? 177 ASP B CB  1 
ATOM   2477 C  CG  . ASP B 1 181 ? 1.377   -3.417 51.365 1.00 27.98  ? 177 ASP B CG  1 
ATOM   2478 O  OD1 . ASP B 1 181 ? 1.495   -4.301 50.486 1.00 28.22  ? 177 ASP B OD1 1 
ATOM   2479 O  OD2 . ASP B 1 181 ? 1.821   -3.554 52.527 1.00 30.18  ? 177 ASP B OD2 1 
ATOM   2480 N  N   . PHE B 1 182 ? 1.313   0.932  48.985 1.00 22.83  ? 178 PHE B N   1 
ATOM   2481 C  CA  . PHE B 1 182 ? 0.583   2.001  48.281 1.00 22.06  ? 178 PHE B CA  1 
ATOM   2482 C  C   . PHE B 1 182 ? 0.276   1.522  46.869 1.00 22.15  ? 178 PHE B C   1 
ATOM   2483 O  O   . PHE B 1 182 ? 1.195   1.201  46.102 1.00 21.29  ? 178 PHE B O   1 
ATOM   2484 C  CB  . PHE B 1 182 ? 1.411   3.277  48.197 1.00 21.59  ? 178 PHE B CB  1 
ATOM   2485 C  CG  . PHE B 1 182 ? 0.817   4.322  47.276 1.00 22.31  ? 178 PHE B CG  1 
ATOM   2486 C  CD1 . PHE B 1 182 ? -0.343  4.994  47.634 1.00 22.23  ? 178 PHE B CD1 1 
ATOM   2487 C  CD2 . PHE B 1 182 ? 1.415   4.621  46.063 1.00 21.25  ? 178 PHE B CD2 1 
ATOM   2488 C  CE1 . PHE B 1 182 ? -0.890  5.963  46.793 1.00 23.99  ? 178 PHE B CE1 1 
ATOM   2489 C  CE2 . PHE B 1 182 ? 0.846   5.565  45.194 1.00 21.80  ? 178 PHE B CE2 1 
ATOM   2490 C  CZ  . PHE B 1 182 ? -0.300  6.236  45.580 1.00 21.34  ? 178 PHE B CZ  1 
ATOM   2491 N  N   . GLU B 1 183 ? -1.009  1.472  46.528 1.00 22.08  ? 179 GLU B N   1 
ATOM   2492 C  CA  . GLU B 1 183 ? -1.412  1.007  45.221 1.00 23.19  ? 179 GLU B CA  1 
ATOM   2493 C  C   . GLU B 1 183 ? -1.682  2.131  44.230 1.00 22.00  ? 179 GLU B C   1 
ATOM   2494 O  O   . GLU B 1 183 ? -2.621  2.940  44.397 1.00 21.73  ? 179 GLU B O   1 
ATOM   2495 C  CB  . GLU B 1 183 ? -2.613  0.045  45.308 1.00 24.16  ? 179 GLU B CB  1 
ATOM   2496 C  CG  . GLU B 1 183 ? -2.276  -1.316 45.878 1.00 25.50  ? 179 GLU B CG  1 
ATOM   2497 C  CD  . GLU B 1 183 ? -3.507  -2.179 46.110 1.00 27.69  ? 179 GLU B CD  1 
ATOM   2498 O  OE1 . GLU B 1 183 ? -4.648  -1.721 45.823 1.00 35.84  ? 179 GLU B OE1 1 
ATOM   2499 O  OE2 . GLU B 1 183 ? -3.334  -3.325 46.567 1.00 30.58  ? 179 GLU B OE2 1 
ATOM   2500 N  N   . TRP B 1 184 ? -0.829  2.177  43.211 1.00 20.47  ? 180 TRP B N   1 
ATOM   2501 C  CA  . TRP B 1 184 ? -0.955  3.150  42.142 1.00 20.08  ? 180 TRP B CA  1 
ATOM   2502 C  C   . TRP B 1 184 ? -1.626  2.420  40.996 1.00 20.34  ? 180 TRP B C   1 
ATOM   2503 O  O   . TRP B 1 184 ? -1.045  1.520  40.401 1.00 18.64  ? 180 TRP B O   1 
ATOM   2504 C  CB  . TRP B 1 184 ? 0.417   3.702  41.732 1.00 20.17  ? 180 TRP B CB  1 
ATOM   2505 C  CG  . TRP B 1 184 ? 0.364   4.496  40.446 1.00 20.35  ? 180 TRP B CG  1 
ATOM   2506 C  CD1 . TRP B 1 184 ? 1.042   4.236  39.305 1.00 18.89  ? 180 TRP B CD1 1 
ATOM   2507 C  CD2 . TRP B 1 184 ? -0.387  5.710  40.205 1.00 20.00  ? 180 TRP B CD2 1 
ATOM   2508 N  NE1 . TRP B 1 184 ? 0.757   5.193  38.362 1.00 19.53  ? 180 TRP B NE1 1 
ATOM   2509 C  CE2 . TRP B 1 184 ? -0.120  6.103  38.885 1.00 19.61  ? 180 TRP B CE2 1 
ATOM   2510 C  CE3 . TRP B 1 184 ? -1.260  6.495  40.985 1.00 21.74  ? 180 TRP B CE3 1 
ATOM   2511 C  CZ2 . TRP B 1 184 ? -0.714  7.240  38.300 1.00 20.88  ? 180 TRP B CZ2 1 
ATOM   2512 C  CZ3 . TRP B 1 184 ? -1.839  7.611  40.425 1.00 21.14  ? 180 TRP B CZ3 1 
ATOM   2513 C  CH2 . TRP B 1 184 ? -1.557  7.991  39.093 1.00 21.69  ? 180 TRP B CH2 1 
ATOM   2514 N  N   . LYS B 1 185 ? -2.855  2.822  40.691 1.00 20.48  ? 181 LYS B N   1 
ATOM   2515 C  CA  . LYS B 1 185 ? -3.640  2.186  39.651 1.00 22.17  ? 181 LYS B CA  1 
ATOM   2516 C  C   . LYS B 1 185 ? -3.998  3.139  38.510 1.00 21.63  ? 181 LYS B C   1 
ATOM   2517 O  O   . LYS B 1 185 ? -4.813  2.831  37.660 1.00 22.80  ? 181 LYS B O   1 
ATOM   2518 C  CB  . LYS B 1 185 ? -4.914  1.670  40.299 1.00 22.65  ? 181 LYS B CB  1 
ATOM   2519 C  CG  . LYS B 1 185 ? -4.995  0.158  40.529 1.00 25.40  ? 181 LYS B CG  1 
ATOM   2520 C  CD  . LYS B 1 185 ? -3.653  -0.539 40.762 1.00 27.36  ? 181 LYS B CD  1 
ATOM   2521 C  CE  . LYS B 1 185 ? -3.784  -2.045 40.471 1.00 30.64  ? 181 LYS B CE  1 
ATOM   2522 N  NZ  . LYS B 1 185 ? -3.113  -2.819 41.553 1.00 32.91  ? 181 LYS B NZ  1 
ATOM   2523 N  N   . GLY B 1 186 ? -3.361  4.297  38.490 1.00 22.64  ? 182 GLY B N   1 
ATOM   2524 C  CA  . GLY B 1 186 ? -3.665  5.286  37.463 1.00 20.78  ? 182 GLY B CA  1 
ATOM   2525 C  C   . GLY B 1 186 ? -4.514  6.373  38.110 1.00 20.14  ? 182 GLY B C   1 
ATOM   2526 O  O   . GLY B 1 186 ? -4.980  6.222  39.233 1.00 18.35  ? 182 GLY B O   1 
ATOM   2527 N  N   . PRO B 1 187 ? -4.731  7.482  37.393 1.00 20.35  ? 183 PRO B N   1 
ATOM   2528 C  CA  . PRO B 1 187 ? -5.586  8.532  37.896 1.00 20.65  ? 183 PRO B CA  1 
ATOM   2529 C  C   . PRO B 1 187 ? -6.976  8.124  38.426 1.00 21.43  ? 183 PRO B C   1 
ATOM   2530 O  O   . PRO B 1 187 ? -7.690  7.310  37.808 1.00 21.18  ? 183 PRO B O   1 
ATOM   2531 C  CB  . PRO B 1 187 ? -5.776  9.422  36.661 1.00 20.50  ? 183 PRO B CB  1 
ATOM   2532 C  CG  . PRO B 1 187 ? -4.546  9.293  35.916 1.00 21.62  ? 183 PRO B CG  1 
ATOM   2533 C  CD  . PRO B 1 187 ? -4.183  7.818  36.070 1.00 20.54  ? 183 PRO B CD  1 
ATOM   2534 N  N   A GLN B 1 188 ? -7.335  8.728  39.559 0.50 21.68  ? 184 GLN B N   1 
ATOM   2535 N  N   B GLN B 1 188 ? -7.366  8.714  39.553 0.50 22.10  ? 184 GLN B N   1 
ATOM   2536 C  CA  A GLN B 1 188 ? -8.619  8.540  40.226 0.50 21.74  ? 184 GLN B CA  1 
ATOM   2537 C  CA  B GLN B 1 188 ? -8.678  8.470  40.145 0.50 22.69  ? 184 GLN B CA  1 
ATOM   2538 C  C   A GLN B 1 188 ? -9.377  9.863  40.071 0.50 22.24  ? 184 GLN B C   1 
ATOM   2539 C  C   B GLN B 1 188 ? -9.453  9.791  40.017 0.50 22.73  ? 184 GLN B C   1 
ATOM   2540 O  O   A GLN B 1 188 ? -10.073 10.304 40.993 0.50 21.95  ? 184 GLN B O   1 
ATOM   2541 O  O   B GLN B 1 188 ? -10.237 10.153 40.902 0.50 22.55  ? 184 GLN B O   1 
ATOM   2542 C  CB  A GLN B 1 188 ? -8.401  8.303  41.723 0.50 21.79  ? 184 GLN B CB  1 
ATOM   2543 C  CB  B GLN B 1 188 ? -8.551  8.070  41.620 0.50 22.73  ? 184 GLN B CB  1 
ATOM   2544 C  CG  A GLN B 1 188 ? -7.666  7.032  42.100 0.50 21.84  ? 184 GLN B CG  1 
ATOM   2545 C  CG  B GLN B 1 188 ? -7.665  6.851  41.887 0.50 24.14  ? 184 GLN B CG  1 
ATOM   2546 C  CD  A GLN B 1 188 ? -8.406  5.796  41.653 0.50 22.26  ? 184 GLN B CD  1 
ATOM   2547 C  CD  B GLN B 1 188 ? -7.860  6.234  43.267 0.50 24.38  ? 184 GLN B CD  1 
ATOM   2548 O  OE1 A GLN B 1 188 ? -7.899  5.029  40.840 0.50 23.19  ? 184 GLN B OE1 1 
ATOM   2549 O  OE1 B GLN B 1 188 ? -8.899  6.401  43.913 0.50 28.19  ? 184 GLN B OE1 1 
ATOM   2550 N  NE2 A GLN B 1 188 ? -9.615  5.599  42.179 0.50 21.32  ? 184 GLN B NE2 1 
ATOM   2551 N  NE2 B GLN B 1 188 ? -6.864  5.485  43.710 0.50 27.91  ? 184 GLN B NE2 1 
ATOM   2552 N  N   . TRP B 1 189 ? -9.194  10.513 38.923 1.00 22.59  ? 185 TRP B N   1 
ATOM   2553 C  CA  . TRP B 1 189 ? -9.816  11.815 38.636 1.00 22.83  ? 185 TRP B CA  1 
ATOM   2554 C  C   . TRP B 1 189 ? -9.936  12.018 37.118 1.00 23.70  ? 185 TRP B C   1 
ATOM   2555 O  O   . TRP B 1 189 ? -10.533 13.017 36.693 1.00 24.57  ? 185 TRP B O   1 
ATOM   2556 C  CB  . TRP B 1 189 ? -8.956  12.951 39.232 1.00 23.00  ? 185 TRP B CB  1 
ATOM   2557 C  CG  . TRP B 1 189 ? -7.498  12.743 38.930 1.00 21.35  ? 185 TRP B CG  1 
ATOM   2558 C  CD1 . TRP B 1 189 ? -6.841  13.072 37.776 1.00 20.98  ? 185 TRP B CD1 1 
ATOM   2559 C  CD2 . TRP B 1 189 ? -6.541  12.096 39.765 1.00 19.73  ? 185 TRP B CD2 1 
ATOM   2560 N  NE1 . TRP B 1 189 ? -5.516  12.682 37.858 1.00 21.63  ? 185 TRP B NE1 1 
ATOM   2561 C  CE2 . TRP B 1 189 ? -5.313  12.070 39.062 1.00 20.88  ? 185 TRP B CE2 1 
ATOM   2562 C  CE3 . TRP B 1 189 ? -6.594  11.534 41.046 1.00 21.30  ? 185 TRP B CE3 1 
ATOM   2563 C  CZ2 . TRP B 1 189 ? -4.143  11.501 39.601 1.00 22.10  ? 185 TRP B CZ2 1 
ATOM   2564 C  CZ3 . TRP B 1 189 ? -5.424  10.947 41.569 1.00 21.33  ? 185 TRP B CZ3 1 
ATOM   2565 C  CH2 . TRP B 1 189 ? -4.224  10.954 40.852 1.00 20.62  ? 185 TRP B CH2 1 
ATOM   2566 O  OXT . TRP B 1 189 ? -9.424  11.244 36.282 1.00 23.47  ? 185 TRP B OXT 1 
HETATM 2567 ZN ZN  . ZN  C 2 .   ? 13.790  35.393 69.018 1.00 23.88  ? 301 ZN  A ZN  1 
HETATM 2568 ZN ZN  . ZN  D 2 .   ? 2.625   35.159 65.491 1.00 102.01 ? 304 ZN  A ZN  1 
HETATM 2569 ZN ZN  . ZN  E 2 .   ? 7.078   36.949 70.730 1.00 130.23 ? 305 ZN  A ZN  1 
HETATM 2570 ZN ZN  . ZN  F 2 .   ? 22.740  21.309 66.704 1.00 103.92 ? 306 ZN  A ZN  1 
HETATM 2571 ZN ZN  . ZN  G 2 .   ? 13.756  63.112 67.333 1.00 118.08 ? 307 ZN  A ZN  1 
HETATM 2572 ZN ZN  . ZN  H 2 .   ? 30.778  39.120 63.448 1.00 130.25 ? 308 ZN  A ZN  1 
HETATM 2573 S  S   . SO4 I 3 .   ? 3.605   44.468 43.892 1.00 28.47  ? 501 SO4 A S   1 
HETATM 2574 O  O1  . SO4 I 3 .   ? 4.961   44.920 43.691 1.00 27.77  ? 501 SO4 A O1  1 
HETATM 2575 O  O2  . SO4 I 3 .   ? 2.856   44.686 42.658 1.00 30.30  ? 501 SO4 A O2  1 
HETATM 2576 O  O3  . SO4 I 3 .   ? 3.617   43.042 44.207 1.00 27.76  ? 501 SO4 A O3  1 
HETATM 2577 O  O4  . SO4 I 3 .   ? 2.952   45.164 44.978 1.00 27.26  ? 501 SO4 A O4  1 
HETATM 2578 CL CL  . CL  J 4 .   ? 14.742  36.382 44.360 1.00 55.08  ? 311 CL  A CL  1 
HETATM 2579 C  C1  . EDO K 5 .   ? 26.562  49.410 74.464 1.00 24.04  ? 401 EDO A C1  1 
HETATM 2580 O  O1  . EDO K 5 .   ? 25.117  49.560 74.558 1.00 18.36  ? 401 EDO A O1  1 
HETATM 2581 C  C2  . EDO K 5 .   ? 26.939  48.961 73.065 1.00 24.40  ? 401 EDO A C2  1 
HETATM 2582 O  O2  . EDO K 5 .   ? 26.133  47.820 72.771 1.00 27.24  ? 401 EDO A O2  1 
HETATM 2583 C  C1  . EDO L 5 .   ? 4.768   55.761 64.460 1.00 32.30  ? 402 EDO A C1  1 
HETATM 2584 O  O1  . EDO L 5 .   ? 5.757   55.764 63.435 1.00 31.65  ? 402 EDO A O1  1 
HETATM 2585 C  C2  . EDO L 5 .   ? 5.388   55.338 65.775 1.00 34.44  ? 402 EDO A C2  1 
HETATM 2586 O  O2  . EDO L 5 .   ? 4.762   54.109 66.146 1.00 34.08  ? 402 EDO A O2  1 
HETATM 2587 ZN ZN  . ZN  M 2 .   ? 0.860   20.767 46.724 1.00 30.28  ? 302 ZN  B ZN  1 
HETATM 2588 ZN ZN  . ZN  N 2 .   ? 7.596   34.419 39.980 1.00 88.33  ? 303 ZN  B ZN  1 
HETATM 2589 S  S   . SO4 O 3 .   ? -0.527  1.743  55.871 1.00 66.30  ? 502 SO4 B S   1 
HETATM 2590 O  O1  . SO4 O 3 .   ? 0.814   1.360  56.328 1.00 66.55  ? 502 SO4 B O1  1 
HETATM 2591 O  O2  . SO4 O 3 .   ? -0.383  2.363  54.560 1.00 67.64  ? 502 SO4 B O2  1 
HETATM 2592 O  O3  . SO4 O 3 .   ? -1.321  0.523  55.746 1.00 68.25  ? 502 SO4 B O3  1 
HETATM 2593 O  O4  . SO4 O 3 .   ? -1.231  2.655  56.777 1.00 65.65  ? 502 SO4 B O4  1 
HETATM 2594 CL CL  . CL  P 4 .   ? 12.391  2.223  49.378 1.00 70.85  ? 312 CL  B CL  1 
HETATM 2595 O  O   . HOH Q 6 .   ? 14.594  50.576 76.268 1.00 13.41  ? 502 HOH A O   1 
HETATM 2596 O  O   . HOH Q 6 .   ? 3.769   34.648 43.634 1.00 17.98  ? 503 HOH A O   1 
HETATM 2597 O  O   . HOH Q 6 .   ? 9.290   53.568 72.234 1.00 18.18  ? 504 HOH A O   1 
HETATM 2598 O  O   . HOH Q 6 .   ? -2.450  32.991 41.624 1.00 17.10  ? 505 HOH A O   1 
HETATM 2599 O  O   . HOH Q 6 .   ? 23.136  51.292 73.109 1.00 13.28  ? 506 HOH A O   1 
HETATM 2600 O  O   . HOH Q 6 .   ? 8.705   50.994 73.357 1.00 16.68  ? 507 HOH A O   1 
HETATM 2601 O  O   . HOH Q 6 .   ? 10.975  51.239 74.618 1.00 18.27  ? 508 HOH A O   1 
HETATM 2602 O  O   . HOH Q 6 .   ? 9.290   40.639 47.986 1.00 22.05  ? 509 HOH A O   1 
HETATM 2603 O  O   . HOH Q 6 .   ? 14.444  36.607 57.544 1.00 20.43  ? 510 HOH A O   1 
HETATM 2604 O  O   . HOH Q 6 .   ? 4.041   45.778 67.210 1.00 18.48  ? 511 HOH A O   1 
HETATM 2605 O  O   . HOH Q 6 .   ? 7.675   53.275 69.409 1.00 27.56  ? 512 HOH A O   1 
HETATM 2606 O  O   . HOH Q 6 .   ? 22.789  58.963 73.554 1.00 26.51  ? 513 HOH A O   1 
HETATM 2607 O  O   . HOH Q 6 .   ? 5.501   30.783 53.216 1.00 16.55  ? 514 HOH A O   1 
HETATM 2608 O  O   . HOH Q 6 .   ? 23.534  44.825 65.808 1.00 17.39  ? 515 HOH A O   1 
HETATM 2609 O  O   . HOH Q 6 .   ? 25.323  34.219 72.591 1.00 21.23  ? 516 HOH A O   1 
HETATM 2610 O  O   . HOH Q 6 .   ? 22.371  42.250 64.877 1.00 25.02  ? 517 HOH A O   1 
HETATM 2611 O  O   . HOH Q 6 .   ? 22.048  55.612 63.948 1.00 16.04  ? 518 HOH A O   1 
HETATM 2612 O  O   . HOH Q 6 .   ? 4.474   50.936 59.146 1.00 19.95  ? 519 HOH A O   1 
HETATM 2613 O  O   . HOH Q 6 .   ? 3.398   52.904 67.746 1.00 25.32  ? 520 HOH A O   1 
HETATM 2614 O  O   . HOH Q 6 .   ? -1.329  47.696 52.633 1.00 35.00  ? 521 HOH A O   1 
HETATM 2615 O  O   . HOH Q 6 .   ? 16.474  57.069 75.715 1.00 19.83  ? 522 HOH A O   1 
HETATM 2616 O  O   . HOH Q 6 .   ? 13.352  32.755 51.136 1.00 26.26  ? 523 HOH A O   1 
HETATM 2617 O  O   . HOH Q 6 .   ? 4.381   44.785 70.279 1.00 18.46  ? 524 HOH A O   1 
HETATM 2618 O  O   . HOH Q 6 .   ? 10.309  58.132 71.774 1.00 22.46  ? 525 HOH A O   1 
HETATM 2619 O  O   . HOH Q 6 .   ? 4.977   53.732 70.307 1.00 26.21  ? 526 HOH A O   1 
HETATM 2620 O  O   . HOH Q 6 .   ? -3.170  37.689 42.229 1.00 25.53  ? 527 HOH A O   1 
HETATM 2621 O  O   . HOH Q 6 .   ? -0.814  50.321 63.057 1.00 24.27  ? 528 HOH A O   1 
HETATM 2622 O  O   . HOH Q 6 .   ? 24.749  48.018 59.439 1.00 22.85  ? 529 HOH A O   1 
HETATM 2623 O  O   . HOH Q 6 .   ? 13.838  42.524 52.918 1.00 23.77  ? 530 HOH A O   1 
HETATM 2624 O  O   . HOH Q 6 .   ? 18.130  35.374 77.685 1.00 23.65  ? 531 HOH A O   1 
HETATM 2625 O  O   . HOH Q 6 .   ? 4.873   48.501 52.352 1.00 15.03  ? 532 HOH A O   1 
HETATM 2626 O  O   . HOH Q 6 .   ? 17.928  30.957 61.645 1.00 25.74  ? 533 HOH A O   1 
HETATM 2627 O  O   . HOH Q 6 .   ? 23.309  33.464 70.472 1.00 26.40  ? 534 HOH A O   1 
HETATM 2628 O  O   . HOH Q 6 .   ? 5.915   35.138 64.374 1.00 25.77  ? 535 HOH A O   1 
HETATM 2629 O  O   . HOH Q 6 .   ? 17.314  51.404 81.884 1.00 23.94  ? 536 HOH A O   1 
HETATM 2630 O  O   . HOH Q 6 .   ? 1.374   54.384 65.200 1.00 31.29  ? 537 HOH A O   1 
HETATM 2631 O  O   . HOH Q 6 .   ? 11.902  23.835 53.558 1.00 20.31  ? 538 HOH A O   1 
HETATM 2632 O  O   . HOH Q 6 .   ? 22.891  41.017 60.088 1.00 26.21  ? 539 HOH A O   1 
HETATM 2633 O  O   . HOH Q 6 .   ? -7.215  41.103 58.491 1.00 30.01  ? 540 HOH A O   1 
HETATM 2634 O  O   . HOH Q 6 .   ? 21.088  37.137 60.940 1.00 24.49  ? 541 HOH A O   1 
HETATM 2635 O  O   . HOH Q 6 .   ? 15.612  40.850 51.762 1.00 27.05  ? 542 HOH A O   1 
HETATM 2636 O  O   . HOH Q 6 .   ? 2.517   46.902 70.543 1.00 24.34  ? 543 HOH A O   1 
HETATM 2637 O  O   . HOH Q 6 .   ? 6.951   34.419 68.560 1.00 40.34  ? 544 HOH A O   1 
HETATM 2638 O  O   . HOH Q 6 .   ? 26.543  28.048 67.352 1.00 39.99  ? 545 HOH A O   1 
HETATM 2639 O  O   . HOH Q 6 .   ? 13.705  40.869 79.108 1.00 28.21  ? 546 HOH A O   1 
HETATM 2640 O  O   . HOH Q 6 .   ? 14.916  52.697 81.627 1.00 27.12  ? 547 HOH A O   1 
HETATM 2641 O  O   . HOH Q 6 .   ? -1.029  49.410 60.014 1.00 27.30  ? 548 HOH A O   1 
HETATM 2642 O  O   . HOH Q 6 .   ? 10.016  61.036 70.202 1.00 32.98  ? 549 HOH A O   1 
HETATM 2643 O  O   . HOH Q 6 .   ? 24.728  54.389 56.937 1.00 28.86  ? 550 HOH A O   1 
HETATM 2644 O  O   . HOH Q 6 .   ? 23.888  46.287 63.720 1.00 24.71  ? 551 HOH A O   1 
HETATM 2645 O  O   . HOH Q 6 .   ? 8.008   38.218 44.821 1.00 32.04  ? 552 HOH A O   1 
HETATM 2646 O  O   . HOH Q 6 .   ? 18.763  24.535 66.233 1.00 24.72  ? 553 HOH A O   1 
HETATM 2647 O  O   . HOH Q 6 .   ? 25.303  61.219 61.250 1.00 31.18  ? 554 HOH A O   1 
HETATM 2648 O  O   . HOH Q 6 .   ? 2.727   28.454 59.086 1.00 27.09  ? 555 HOH A O   1 
HETATM 2649 O  O   . HOH Q 6 .   ? 24.152  35.365 68.594 1.00 27.91  ? 556 HOH A O   1 
HETATM 2650 O  O   . HOH Q 6 .   ? 23.070  53.284 65.043 1.00 24.40  ? 557 HOH A O   1 
HETATM 2651 O  O   . HOH Q 6 .   ? 29.228  39.009 69.583 1.00 21.30  ? 558 HOH A O   1 
HETATM 2652 O  O   . HOH Q 6 .   ? 16.443  41.134 84.966 1.00 28.19  ? 559 HOH A O   1 
HETATM 2653 O  O   . HOH Q 6 .   ? 20.335  38.451 78.470 1.00 27.51  ? 560 HOH A O   1 
HETATM 2654 O  O   . HOH Q 6 .   ? 4.304   40.821 68.359 1.00 24.89  ? 561 HOH A O   1 
HETATM 2655 O  O   . HOH Q 6 .   ? 4.654   38.336 42.180 1.00 25.43  ? 562 HOH A O   1 
HETATM 2656 O  O   . HOH Q 6 .   ? 3.485   42.317 70.235 1.00 27.53  ? 563 HOH A O   1 
HETATM 2657 O  O   . HOH Q 6 .   ? 15.945  58.463 62.332 1.00 21.99  ? 564 HOH A O   1 
HETATM 2658 O  O   . HOH Q 6 .   ? 17.957  44.655 52.249 1.00 30.49  ? 565 HOH A O   1 
HETATM 2659 O  O   . HOH Q 6 .   ? 1.487   40.031 66.316 1.00 33.05  ? 566 HOH A O   1 
HETATM 2660 O  O   . HOH Q 6 .   ? 15.150  45.010 52.323 1.00 28.78  ? 567 HOH A O   1 
HETATM 2661 O  O   . HOH Q 6 .   ? -2.286  38.668 46.197 1.00 29.77  ? 568 HOH A O   1 
HETATM 2662 O  O   . HOH Q 6 .   ? 21.105  44.058 77.970 1.00 31.35  ? 569 HOH A O   1 
HETATM 2663 O  O   . HOH Q 6 .   ? 0.840   49.520 56.480 1.00 31.69  ? 570 HOH A O   1 
HETATM 2664 O  O   . HOH Q 6 .   ? 7.526   55.162 67.220 1.00 23.04  ? 571 HOH A O   1 
HETATM 2665 O  O   . HOH Q 6 .   ? 9.194   35.414 71.540 1.00 22.53  ? 572 HOH A O   1 
HETATM 2666 O  O   . HOH Q 6 .   ? 15.083  53.145 59.863 1.00 24.35  ? 573 HOH A O   1 
HETATM 2667 O  O   . HOH Q 6 .   ? 25.407  53.081 63.431 1.00 32.52  ? 574 HOH A O   1 
HETATM 2668 O  O   . HOH Q 6 .   ? -1.724  28.671 57.597 1.00 33.96  ? 575 HOH A O   1 
HETATM 2669 O  O   . HOH Q 6 .   ? 16.384  54.199 58.230 1.00 33.58  ? 576 HOH A O   1 
HETATM 2670 O  O   . HOH Q 6 .   ? 17.460  60.754 70.750 1.00 24.25  ? 577 HOH A O   1 
HETATM 2671 O  O   . HOH Q 6 .   ? 20.356  42.013 83.763 1.00 35.70  ? 578 HOH A O   1 
HETATM 2672 O  O   . HOH Q 6 .   ? -7.192  23.400 37.085 1.00 40.80  ? 579 HOH A O   1 
HETATM 2673 O  O   . HOH Q 6 .   ? 17.182  38.818 56.266 1.00 27.29  ? 580 HOH A O   1 
HETATM 2674 O  O   . HOH Q 6 .   ? 8.178   32.309 45.477 1.00 42.32  ? 581 HOH A O   1 
HETATM 2675 O  O   . HOH Q 6 .   ? 4.461   45.391 47.600 1.00 30.78  ? 582 HOH A O   1 
HETATM 2676 O  O   . HOH Q 6 .   ? 6.246   48.378 50.335 1.00 31.20  ? 583 HOH A O   1 
HETATM 2677 O  O   . HOH Q 6 .   ? 8.149   34.905 46.153 1.00 26.19  ? 584 HOH A O   1 
HETATM 2678 O  O   . HOH Q 6 .   ? -7.349  32.048 46.429 1.00 29.13  ? 585 HOH A O   1 
HETATM 2679 O  O   . HOH Q 6 .   ? 12.725  61.926 70.650 1.00 35.22  ? 586 HOH A O   1 
HETATM 2680 O  O   . HOH Q 6 .   ? 8.430   54.447 75.275 1.00 41.39  ? 587 HOH A O   1 
HETATM 2681 O  O   . HOH Q 6 .   ? -5.140  20.379 39.029 1.00 32.88  ? 588 HOH A O   1 
HETATM 2682 O  O   . HOH Q 6 .   ? 23.660  47.024 76.823 1.00 26.47  ? 589 HOH A O   1 
HETATM 2683 O  O   . HOH Q 6 .   ? 1.312   29.626 63.108 1.00 28.91  ? 590 HOH A O   1 
HETATM 2684 O  O   . HOH Q 6 .   ? 26.174  49.453 61.098 1.00 31.56  ? 591 HOH A O   1 
HETATM 2685 O  O   . HOH Q 6 .   ? 15.355  60.593 73.484 1.00 29.54  ? 592 HOH A O   1 
HETATM 2686 O  O   . HOH Q 6 .   ? 24.382  45.315 61.424 1.00 34.53  ? 593 HOH A O   1 
HETATM 2687 O  O   . HOH Q 6 .   ? 15.675  39.207 83.138 1.00 47.79  ? 594 HOH A O   1 
HETATM 2688 O  O   . HOH Q 6 .   ? 0.667   39.743 47.821 1.00 37.33  ? 595 HOH A O   1 
HETATM 2689 O  O   . HOH Q 6 .   ? 4.246   34.030 67.972 1.00 35.11  ? 596 HOH A O   1 
HETATM 2690 O  O   . HOH Q 6 .   ? -6.526  42.302 55.373 1.00 33.36  ? 597 HOH A O   1 
HETATM 2691 O  O   . HOH Q 6 .   ? 21.762  61.929 66.474 1.00 35.06  ? 598 HOH A O   1 
HETATM 2692 O  O   . HOH Q 6 .   ? 28.996  41.358 64.790 1.00 45.19  ? 599 HOH A O   1 
HETATM 2693 O  O   . HOH Q 6 .   ? 1.073   42.215 46.000 1.00 34.40  ? 600 HOH A O   1 
HETATM 2694 O  O   . HOH Q 6 .   ? 0.891   43.965 48.717 1.00 41.37  ? 601 HOH A O   1 
HETATM 2695 O  O   . HOH Q 6 .   ? 2.547   48.286 44.928 1.00 38.27  ? 602 HOH A O   1 
HETATM 2696 O  O   . HOH Q 6 .   ? -6.223  23.213 47.699 1.00 34.68  ? 603 HOH A O   1 
HETATM 2697 O  O   . HOH Q 6 .   ? 22.112  31.266 77.829 1.00 36.39  ? 604 HOH A O   1 
HETATM 2698 O  O   . HOH Q 6 .   ? 25.371  26.699 68.973 1.00 51.05  ? 605 HOH A O   1 
HETATM 2699 O  O   . HOH Q 6 .   ? -4.819  41.293 60.872 1.00 38.26  ? 606 HOH A O   1 
HETATM 2700 O  O   . HOH Q 6 .   ? 21.028  35.344 59.280 1.00 38.20  ? 607 HOH A O   1 
HETATM 2701 O  O   . HOH Q 6 .   ? -3.956  37.693 61.586 1.00 44.11  ? 608 HOH A O   1 
HETATM 2702 O  O   . HOH Q 6 .   ? 17.273  60.485 61.566 1.00 45.54  ? 609 HOH A O   1 
HETATM 2703 O  O   . HOH Q 6 .   ? 1.855   39.511 64.068 1.00 32.91  ? 610 HOH A O   1 
HETATM 2704 O  O   . HOH Q 6 .   ? 10.766  48.989 82.780 1.00 34.98  ? 611 HOH A O   1 
HETATM 2705 O  O   . HOH Q 6 .   ? -1.632  41.469 67.273 1.00 52.57  ? 612 HOH A O   1 
HETATM 2706 O  O   . HOH Q 6 .   ? 26.238  44.361 66.203 1.00 32.78  ? 613 HOH A O   1 
HETATM 2707 O  O   . HOH Q 6 .   ? 18.190  59.103 75.806 1.00 38.35  ? 614 HOH A O   1 
HETATM 2708 O  O   . HOH Q 6 .   ? 12.623  26.708 50.646 1.00 34.76  ? 615 HOH A O   1 
HETATM 2709 O  O   . HOH Q 6 .   ? -10.749 38.047 60.019 1.00 37.99  ? 616 HOH A O   1 
HETATM 2710 O  O   . HOH Q 6 .   ? -2.719  54.365 65.722 1.00 35.64  ? 617 HOH A O   1 
HETATM 2711 O  O   . HOH Q 6 .   ? 17.104  57.291 78.180 1.00 32.42  ? 618 HOH A O   1 
HETATM 2712 O  O   . HOH Q 6 .   ? 10.124  48.202 49.849 1.00 42.19  ? 619 HOH A O   1 
HETATM 2713 O  O   . HOH Q 6 .   ? 11.853  29.414 38.035 1.00 51.61  ? 620 HOH A O   1 
HETATM 2714 O  O   . HOH Q 6 .   ? 15.977  34.798 56.199 1.00 41.78  ? 621 HOH A O   1 
HETATM 2715 O  O   . HOH Q 6 .   ? 19.579  41.856 52.076 1.00 44.29  ? 622 HOH A O   1 
HETATM 2716 O  O   . HOH Q 6 .   ? 23.830  41.614 62.600 1.00 36.15  ? 623 HOH A O   1 
HETATM 2717 O  O   . HOH Q 6 .   ? 17.520  39.456 53.299 1.00 32.90  ? 624 HOH A O   1 
HETATM 2718 O  O   . HOH Q 6 .   ? 10.272  46.194 43.920 1.00 46.09  ? 625 HOH A O   1 
HETATM 2719 O  O   . HOH Q 6 .   ? 3.280   49.271 57.535 1.00 35.59  ? 626 HOH A O   1 
HETATM 2720 O  O   . HOH R 6 .   ? 1.911   5.845  35.771 1.00 20.70  ? 503 HOH B O   1 
HETATM 2721 O  O   . HOH R 6 .   ? 5.337   32.067 43.706 1.00 24.88  ? 504 HOH B O   1 
HETATM 2722 O  O   . HOH R 6 .   ? 8.930   25.600 46.274 1.00 30.10  ? 505 HOH B O   1 
HETATM 2723 O  O   . HOH R 6 .   ? 4.244   23.204 37.456 1.00 22.15  ? 506 HOH B O   1 
HETATM 2724 O  O   . HOH R 6 .   ? -4.515  4.998  41.502 1.00 26.37  ? 507 HOH B O   1 
HETATM 2725 O  O   . HOH R 6 .   ? 2.999   22.723 34.987 1.00 24.70  ? 508 HOH B O   1 
HETATM 2726 O  O   . HOH R 6 .   ? 11.560  11.370 40.628 1.00 30.82  ? 509 HOH B O   1 
HETATM 2727 O  O   . HOH R 6 .   ? 5.990   21.368 37.952 1.00 20.68  ? 510 HOH B O   1 
HETATM 2728 O  O   . HOH R 6 .   ? 11.397  19.919 51.423 1.00 24.59  ? 511 HOH B O   1 
HETATM 2729 O  O   . HOH R 6 .   ? -3.165  12.583 36.004 1.00 20.73  ? 512 HOH B O   1 
HETATM 2730 O  O   . HOH R 6 .   ? 10.602  25.220 61.706 1.00 23.33  ? 513 HOH B O   1 
HETATM 2731 O  O   . HOH R 6 .   ? 18.630  22.017 67.674 1.00 24.49  ? 514 HOH B O   1 
HETATM 2732 O  O   . HOH R 6 .   ? 11.566  19.518 43.784 1.00 39.97  ? 515 HOH B O   1 
HETATM 2733 O  O   . HOH R 6 .   ? 15.527  14.223 53.986 1.00 27.32  ? 516 HOH B O   1 
HETATM 2734 O  O   . HOH R 6 .   ? -1.639  9.867  55.773 1.00 25.26  ? 517 HOH B O   1 
HETATM 2735 O  O   . HOH R 6 .   ? 8.600   12.120 38.871 1.00 25.90  ? 518 HOH B O   1 
HETATM 2736 O  O   . HOH R 6 .   ? 15.201  8.826  41.110 1.00 31.74  ? 519 HOH B O   1 
HETATM 2737 O  O   . HOH R 6 .   ? 7.715   28.671 36.328 1.00 46.78  ? 520 HOH B O   1 
HETATM 2738 O  O   . HOH R 6 .   ? 5.761   5.015  59.391 1.00 28.09  ? 521 HOH B O   1 
HETATM 2739 O  O   . HOH R 6 .   ? 12.060  8.002  62.151 1.00 27.10  ? 522 HOH B O   1 
HETATM 2740 O  O   . HOH R 6 .   ? 1.726   21.370 31.646 1.00 30.80  ? 523 HOH B O   1 
HETATM 2741 O  O   . HOH R 6 .   ? 9.135   14.897 40.979 1.00 29.36  ? 524 HOH B O   1 
HETATM 2742 O  O   . HOH R 6 .   ? 3.224   -4.246 42.034 1.00 25.36  ? 525 HOH B O   1 
HETATM 2743 O  O   . HOH R 6 .   ? 18.855  24.421 62.797 1.00 31.35  ? 526 HOH B O   1 
HETATM 2744 O  O   . HOH R 6 .   ? 10.654  0.780  41.823 1.00 35.04  ? 527 HOH B O   1 
HETATM 2745 O  O   . HOH R 6 .   ? -0.724  14.805 33.373 1.00 34.18  ? 528 HOH B O   1 
HETATM 2746 O  O   . HOH R 6 .   ? 8.545   4.495  39.957 1.00 36.11  ? 529 HOH B O   1 
HETATM 2747 O  O   . HOH R 6 .   ? 12.991  32.710 55.928 1.00 13.73  ? 530 HOH B O   1 
HETATM 2748 O  O   . HOH R 6 .   ? 8.441   8.773  67.562 1.00 39.02  ? 531 HOH B O   1 
HETATM 2749 O  O   . HOH R 6 .   ? 1.292   20.790 55.694 1.00 28.84  ? 532 HOH B O   1 
HETATM 2750 O  O   . HOH R 6 .   ? 4.273   27.426 61.695 1.00 27.70  ? 533 HOH B O   1 
HETATM 2751 O  O   . HOH R 6 .   ? 0.100   5.227  61.771 1.00 44.62  ? 534 HOH B O   1 
HETATM 2752 O  O   . HOH R 6 .   ? 12.714  21.971 50.847 1.00 31.86  ? 535 HOH B O   1 
HETATM 2753 O  O   . HOH R 6 .   ? 13.744  17.948 49.064 1.00 35.88  ? 536 HOH B O   1 
HETATM 2754 O  O   . HOH R 6 .   ? -8.796  14.470 42.703 1.00 38.21  ? 537 HOH B O   1 
HETATM 2755 O  O   . HOH R 6 .   ? 0.550   26.703 60.884 1.00 32.48  ? 538 HOH B O   1 
HETATM 2756 O  O   . HOH R 6 .   ? -3.441  20.424 49.278 1.00 29.83  ? 539 HOH B O   1 
HETATM 2757 O  O   . HOH R 6 .   ? 14.283  17.115 72.206 1.00 45.04  ? 540 HOH B O   1 
HETATM 2758 O  O   . HOH R 6 .   ? 17.671  15.882 60.355 1.00 26.29  ? 541 HOH B O   1 
HETATM 2759 O  O   . HOH R 6 .   ? 16.638  12.011 53.048 1.00 32.74  ? 542 HOH B O   1 
HETATM 2760 O  O   . HOH R 6 .   ? 16.305  30.140 56.574 1.00 28.19  ? 543 HOH B O   1 
HETATM 2761 O  O   . HOH R 6 .   ? 10.630  3.272  41.655 1.00 32.12  ? 544 HOH B O   1 
HETATM 2762 O  O   . HOH R 6 .   ? 1.017   0.890  52.516 1.00 41.05  ? 545 HOH B O   1 
HETATM 2763 O  O   . HOH R 6 .   ? 2.674   6.375  63.674 1.00 34.69  ? 546 HOH B O   1 
HETATM 2764 O  O   . HOH R 6 .   ? 2.652   -6.639 47.052 1.00 43.07  ? 547 HOH B O   1 
HETATM 2765 O  O   . HOH R 6 .   ? 20.569  30.234 80.099 1.00 45.90  ? 548 HOH B O   1 
HETATM 2766 O  O   . HOH R 6 .   ? 3.066   28.696 67.673 1.00 36.18  ? 549 HOH B O   1 
HETATM 2767 O  O   . HOH R 6 .   ? -3.210  24.879 35.175 1.00 31.98  ? 550 HOH B O   1 
HETATM 2768 O  O   . HOH R 6 .   ? 1.855   11.660 32.165 1.00 49.79  ? 551 HOH B O   1 
HETATM 2769 O  O   . HOH R 6 .   ? -11.248 10.078 48.189 1.00 47.75  ? 552 HOH B O   1 
HETATM 2770 O  O   . HOH R 6 .   ? 7.026   -2.580 35.525 1.00 55.19  ? 553 HOH B O   1 
HETATM 2771 O  O   . HOH R 6 .   ? -4.913  2.972  34.651 1.00 31.88  ? 554 HOH B O   1 
HETATM 2772 O  O   . HOH R 6 .   ? -0.565  16.329 59.333 1.00 47.43  ? 555 HOH B O   1 
HETATM 2773 O  O   . HOH R 6 .   ? 19.255  32.086 59.523 1.00 33.60  ? 556 HOH B O   1 
HETATM 2774 O  O   . HOH R 6 .   ? 5.233   6.693  34.122 1.00 42.53  ? 557 HOH B O   1 
HETATM 2775 O  O   . HOH R 6 .   ? 18.311  33.034 80.759 1.00 39.66  ? 558 HOH B O   1 
HETATM 2776 O  O   . HOH R 6 .   ? -6.773  0.763  46.117 1.00 36.43  ? 559 HOH B O   1 
HETATM 2777 O  O   . HOH R 6 .   ? -7.739  18.253 44.928 1.00 36.46  ? 560 HOH B O   1 
HETATM 2778 O  O   . HOH R 6 .   ? 12.794  15.746 42.515 1.00 44.23  ? 561 HOH B O   1 
HETATM 2779 O  O   . HOH R 6 .   ? 10.109  3.168  49.672 1.00 40.15  ? 562 HOH B O   1 
HETATM 2780 O  O   . HOH R 6 .   ? 3.659   28.753 63.733 1.00 30.49  ? 563 HOH B O   1 
HETATM 2781 O  O   . HOH R 6 .   ? -1.419  25.646 64.794 1.00 37.07  ? 564 HOH B O   1 
HETATM 2782 O  O   . HOH R 6 .   ? -1.470  15.854 65.402 1.00 45.62  ? 565 HOH B O   1 
HETATM 2783 O  O   . HOH R 6 .   ? 8.903   21.608 37.784 1.00 33.15  ? 566 HOH B O   1 
HETATM 2784 O  O   . HOH R 6 .   ? 19.462  11.742 65.949 1.00 50.13  ? 567 HOH B O   1 
HETATM 2785 O  O   . HOH R 6 .   ? 3.189   8.436  32.933 1.00 40.75  ? 568 HOH B O   1 
HETATM 2786 O  O   . HOH R 6 .   ? 14.753  -4.407 39.482 1.00 41.81  ? 569 HOH B O   1 
HETATM 2787 O  O   . HOH R 6 .   ? 10.963  23.595 76.116 1.00 36.27  ? 570 HOH B O   1 
HETATM 2788 O  O   . HOH R 6 .   ? 4.773   19.686 29.856 1.00 42.87  ? 571 HOH B O   1 
HETATM 2789 O  O   . HOH R 6 .   ? -0.432  23.735 71.607 1.00 42.68  ? 572 HOH B O   1 
HETATM 2790 O  O   . HOH R 6 .   ? -0.249  13.748 66.974 1.00 40.87  ? 573 HOH B O   1 
HETATM 2791 O  O   . HOH R 6 .   ? -3.918  -5.293 39.683 1.00 44.99  ? 574 HOH B O   1 
HETATM 2792 O  O   . HOH R 6 .   ? -2.307  18.535 51.745 1.00 47.05  ? 575 HOH B O   1 
HETATM 2793 O  O   . HOH R 6 .   ? 14.913  24.761 39.009 1.00 42.80  ? 576 HOH B O   1 
HETATM 2794 O  O   . HOH R 6 .   ? 0.009   14.415 69.811 1.00 50.63  ? 577 HOH B O   1 
HETATM 2795 O  O   . HOH R 6 .   ? 4.134   24.924 72.519 1.00 46.98  ? 578 HOH B O   1 
HETATM 2796 O  O   . HOH R 6 .   ? -2.692  21.900 54.893 1.00 41.20  ? 579 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   ALA 2   -2  ?   ?   ?   A . n 
A 1 3   MET 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   GLY 6   2   ?   ?   ?   A . n 
A 1 7   GLY 7   3   ?   ?   ?   A . n 
A 1 8   GLY 8   4   ?   ?   ?   A . n 
A 1 9   GLY 9   5   ?   ?   ?   A . n 
A 1 10  GLU 10  6   ?   ?   ?   A . n 
A 1 11  HIS 11  7   ?   ?   ?   A . n 
A 1 12  GLN 12  8   ?   ?   ?   A . n 
A 1 13  HIS 13  9   ?   ?   ?   A . n 
A 1 14  GLY 14  10  ?   ?   ?   A . n 
A 1 15  GLU 15  11  ?   ?   ?   A . n 
A 1 16  GLU 16  12  ?   ?   ?   A . n 
A 1 17  MET 17  13  ?   ?   ?   A . n 
A 1 18  MET 18  14  ?   ?   ?   A . n 
A 1 19  ALA 19  15  ?   ?   ?   A . n 
A 1 20  ALA 20  16  ?   ?   ?   A . n 
A 1 21  VAL 21  17  ?   ?   ?   A . n 
A 1 22  PRO 22  18  ?   ?   ?   A . n 
A 1 23  ALA 23  19  ?   ?   ?   A . n 
A 1 24  PRO 24  20  ?   ?   ?   A . n 
A 1 25  ASP 25  21  ?   ?   ?   A . n 
A 1 26  ALA 26  22  ?   ?   ?   A . n 
A 1 27  GLU 27  23  ?   ?   ?   A . n 
A 1 28  GLY 28  24  ?   ?   ?   A . n 
A 1 29  ALA 29  25  ?   ?   ?   A . n 
A 1 30  ALA 30  26  ?   ?   ?   A . n 
A 1 31  GLY 31  27  ?   ?   ?   A . n 
A 1 32  PHE 32  28  28  PHE PHE A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  PHE 35  31  31  PHE PHE A . n 
A 1 36  PRO 36  32  32  PRO PRO A . n 
A 1 37  ILE 37  33  33  ILE ILE A . n 
A 1 38  GLY 38  34  34  GLY GLY A . n 
A 1 39  GLU 39  35  35  GLU GLU A . n 
A 1 40  ASP 40  36  36  ASP ASP A . n 
A 1 41  ARG 41  37  37  ARG ARG A . n 
A 1 42  ASP 42  38  38  ASP ASP A . n 
A 1 43  VAL 43  39  39  VAL VAL A . n 
A 1 44  GLY 44  40  40  GLY GLY A . n 
A 1 45  PRO 45  41  41  PRO PRO A . n 
A 1 46  LEU 46  42  42  LEU LEU A . n 
A 1 47  HIS 47  43  43  HIS HIS A . n 
A 1 48  VAL 48  44  44  VAL VAL A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  GLY 50  46  46  GLY GLY A . n 
A 1 51  VAL 51  47  47  VAL VAL A . n 
A 1 52  TYR 52  48  48  TYR TYR A . n 
A 1 53  PHE 53  49  49  PHE PHE A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  PRO 55  51  51  PRO PRO A . n 
A 1 56  VAL 56  52  52  VAL VAL A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  MET 58  54  54  MET MET A . n 
A 1 59  HIS 59  55  55  HIS HIS A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  ALA 61  57  57  ALA ALA A . n 
A 1 62  PRO 62  58  58  PRO PRO A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  ALA 64  60  60  ALA ALA A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  PRO 66  62  62  PRO PRO A . n 
A 1 67  SER 67  63  63  SER SER A . n 
A 1 68  LYS 68  64  64  LYS LYS A . n 
A 1 69  GLU 69  65  65  GLU GLU A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  ALA 71  67  67  ALA ALA A . n 
A 1 72  ASP 72  68  68  ASP ASP A . n 
A 1 73  CYS 73  69  69  CYS CYS A . n 
A 1 74  HIS 74  70  70  HIS HIS A . n 
A 1 75  ILE 75  71  71  ILE ILE A . n 
A 1 76  GLU 76  72  72  GLU GLU A . n 
A 1 77  ALA 77  73  73  ALA ALA A . n 
A 1 78  ASP 78  74  74  ASP ASP A . n 
A 1 79  ILE 79  75  75  ILE ILE A . n 
A 1 80  HIS 80  76  76  HIS HIS A . n 
A 1 81  ALA 81  77  77  ALA ALA A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  GLU 83  79  79  GLU GLU A . n 
A 1 84  ALA 84  80  80  ALA ALA A . n 
A 1 85  GLY 85  81  81  GLY GLY A . n 
A 1 86  LYS 86  82  82  LYS LYS A . n 
A 1 87  ASP 87  83  83  ASP ASP A . n 
A 1 88  LEU 88  84  84  LEU LEU A . n 
A 1 89  GLY 89  85  85  GLY GLY A . n 
A 1 90  TYR 90  86  86  TYR TYR A . n 
A 1 91  GLY 91  87  87  GLY GLY A . n 
A 1 92  VAL 92  88  88  VAL VAL A . n 
A 1 93  GLY 93  89  89  GLY GLY A . n 
A 1 94  ASP 94  90  90  ASP ASP A . n 
A 1 95  PHE 95  91  91  PHE PHE A . n 
A 1 96  VAL 96  92  92  VAL VAL A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  TYR 98  94  94  TYR TYR A . n 
A 1 99  LEU 99  95  95  LEU LEU A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 VAL 102 98  98  VAL VAL A . n 
A 1 103 ALA 103 99  99  ALA ALA A . n 
A 1 104 PHE 104 100 100 PHE PHE A . n 
A 1 105 LEU 105 101 101 LEU LEU A . n 
A 1 106 GLN 106 102 102 GLN GLN A . n 
A 1 107 LYS 107 103 103 LYS LYS A . n 
A 1 108 HIS 108 104 104 HIS HIS A . n 
A 1 109 GLY 109 105 105 GLY GLY A . n 
A 1 110 SER 110 106 106 SER SER A . n 
A 1 111 GLU 111 107 107 GLU GLU A . n 
A 1 112 LYS 112 108 108 LYS LYS A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 GLN 114 110 110 GLN GLN A . n 
A 1 115 LYS 115 111 111 LYS LYS A . n 
A 1 116 VAL 116 112 112 VAL VAL A . n 
A 1 117 MET 117 113 113 MET MET A . n 
A 1 118 PHE 118 114 114 PHE PHE A . n 
A 1 119 ALA 119 115 115 ALA ALA A . n 
A 1 120 PRO 120 116 116 PRO PRO A . n 
A 1 121 MET 121 117 117 MET MET A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ALA 123 119 119 ALA ALA A . n 
A 1 124 GLY 124 120 120 GLY GLY A . n 
A 1 125 ASP 125 121 121 ASP ASP A . n 
A 1 126 GLY 126 122 122 GLY GLY A . n 
A 1 127 PRO 127 123 123 PRO PRO A . n 
A 1 128 HIS 128 124 124 HIS HIS A . n 
A 1 129 TYR 129 125 125 TYR TYR A . n 
A 1 130 GLY 130 126 126 GLY GLY A . n 
A 1 131 ALA 131 127 127 ALA ALA A . n 
A 1 132 ASN 132 128 128 ASN ASN A . n 
A 1 133 VAL 133 129 129 VAL VAL A . n 
A 1 134 LYS 134 130 130 LYS LYS A . n 
A 1 135 PHE 135 131 131 PHE PHE A . n 
A 1 136 GLU 136 132 132 GLU GLU A . n 
A 1 137 GLU 137 133 133 GLU GLU A . n 
A 1 138 GLY 138 134 134 GLY GLY A . n 
A 1 139 LEU 139 135 135 LEU LEU A . n 
A 1 140 GLY 140 136 136 GLY GLY A . n 
A 1 141 THR 141 137 137 THR THR A . n 
A 1 142 TYR 142 138 138 TYR TYR A . n 
A 1 143 LYS 143 139 139 LYS LYS A . n 
A 1 144 VAL 144 140 140 VAL VAL A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 PHE 146 142 142 PHE PHE A . n 
A 1 147 GLU 147 143 143 GLU GLU A . n 
A 1 148 ILE 148 144 144 ILE ILE A . n 
A 1 149 ALA 149 145 145 ALA ALA A . n 
A 1 150 ALA 150 146 146 ALA ALA A . n 
A 1 151 PRO 151 147 147 PRO PRO A . n 
A 1 152 SER 152 148 148 SER SER A . n 
A 1 153 HIS 153 149 149 HIS HIS A . n 
A 1 154 ASP 154 150 150 ASP ASP A . n 
A 1 155 GLU 155 151 151 GLU GLU A . n 
A 1 156 TYR 156 152 152 TYR TYR A . n 
A 1 157 SER 157 153 153 SER SER A . n 
A 1 158 LEU 158 154 154 LEU LEU A . n 
A 1 159 HIS 159 155 155 HIS HIS A . n 
A 1 160 ILE 160 156 156 ILE ILE A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 GLU 162 158 158 GLU GLU A . n 
A 1 163 GLN 163 159 159 GLN GLN A . n 
A 1 164 THR 164 160 160 THR THR A . n 
A 1 165 GLY 165 161 161 GLY GLY A . n 
A 1 166 VAL 166 162 162 VAL VAL A . n 
A 1 167 SER 167 163 163 SER SER A . n 
A 1 168 GLY 168 164 164 GLY GLY A . n 
A 1 169 ARG 169 165 165 ARG ARG A . n 
A 1 170 PHE 170 166 166 PHE PHE A . n 
A 1 171 TRP 171 167 167 TRP TRP A . n 
A 1 172 SER 172 168 168 SER SER A . n 
A 1 173 GLU 173 169 169 GLU GLU A . n 
A 1 174 PRO 174 170 170 PRO PRO A . n 
A 1 175 LEU 175 171 171 LEU LEU A . n 
A 1 176 VAL 176 172 172 VAL VAL A . n 
A 1 177 ALA 177 173 173 ALA ALA A . n 
A 1 178 GLU 178 174 174 GLU GLU A . n 
A 1 179 TRP 179 175 175 TRP TRP A . n 
A 1 180 ASP 180 176 176 ASP ASP A . n 
A 1 181 ASP 181 177 177 ASP ASP A . n 
A 1 182 PHE 182 178 178 PHE PHE A . n 
A 1 183 GLU 183 179 179 GLU GLU A . n 
A 1 184 TRP 184 180 180 TRP TRP A . n 
A 1 185 LYS 185 181 181 LYS LYS A . n 
A 1 186 GLY 186 182 182 GLY GLY A . n 
A 1 187 PRO 187 183 183 PRO PRO A . n 
A 1 188 GLN 188 184 184 GLN GLN A . n 
A 1 189 TRP 189 185 185 TRP TRP A . n 
B 1 1   GLY 1   -3  ?   ?   ?   B . n 
B 1 2   ALA 2   -2  ?   ?   ?   B . n 
B 1 3   MET 3   -1  ?   ?   ?   B . n 
B 1 4   GLY 4   0   ?   ?   ?   B . n 
B 1 5   SER 5   1   ?   ?   ?   B . n 
B 1 6   GLY 6   2   ?   ?   ?   B . n 
B 1 7   GLY 7   3   ?   ?   ?   B . n 
B 1 8   GLY 8   4   ?   ?   ?   B . n 
B 1 9   GLY 9   5   ?   ?   ?   B . n 
B 1 10  GLU 10  6   ?   ?   ?   B . n 
B 1 11  HIS 11  7   ?   ?   ?   B . n 
B 1 12  GLN 12  8   ?   ?   ?   B . n 
B 1 13  HIS 13  9   ?   ?   ?   B . n 
B 1 14  GLY 14  10  ?   ?   ?   B . n 
B 1 15  GLU 15  11  ?   ?   ?   B . n 
B 1 16  GLU 16  12  ?   ?   ?   B . n 
B 1 17  MET 17  13  ?   ?   ?   B . n 
B 1 18  MET 18  14  ?   ?   ?   B . n 
B 1 19  ALA 19  15  ?   ?   ?   B . n 
B 1 20  ALA 20  16  ?   ?   ?   B . n 
B 1 21  VAL 21  17  ?   ?   ?   B . n 
B 1 22  PRO 22  18  ?   ?   ?   B . n 
B 1 23  ALA 23  19  ?   ?   ?   B . n 
B 1 24  PRO 24  20  ?   ?   ?   B . n 
B 1 25  ASP 25  21  ?   ?   ?   B . n 
B 1 26  ALA 26  22  ?   ?   ?   B . n 
B 1 27  GLU 27  23  ?   ?   ?   B . n 
B 1 28  GLY 28  24  ?   ?   ?   B . n 
B 1 29  ALA 29  25  ?   ?   ?   B . n 
B 1 30  ALA 30  26  ?   ?   ?   B . n 
B 1 31  GLY 31  27  ?   ?   ?   B . n 
B 1 32  PHE 32  28  ?   ?   ?   B . n 
B 1 33  ASP 33  29  29  ASP ASP B . n 
B 1 34  GLU 34  30  30  GLU GLU B . n 
B 1 35  PHE 35  31  31  PHE PHE B . n 
B 1 36  PRO 36  32  32  PRO PRO B . n 
B 1 37  ILE 37  33  33  ILE ILE B . n 
B 1 38  GLY 38  34  34  GLY GLY B . n 
B 1 39  GLU 39  35  35  GLU GLU B . n 
B 1 40  ASP 40  36  36  ASP ASP B . n 
B 1 41  ARG 41  37  37  ARG ARG B . n 
B 1 42  ASP 42  38  38  ASP ASP B . n 
B 1 43  VAL 43  39  39  VAL VAL B . n 
B 1 44  GLY 44  40  40  GLY GLY B . n 
B 1 45  PRO 45  41  41  PRO PRO B . n 
B 1 46  LEU 46  42  42  LEU LEU B . n 
B 1 47  HIS 47  43  43  HIS HIS B . n 
B 1 48  VAL 48  44  44  VAL VAL B . n 
B 1 49  GLY 49  45  45  GLY GLY B . n 
B 1 50  GLY 50  46  46  GLY GLY B . n 
B 1 51  VAL 51  47  47  VAL VAL B . n 
B 1 52  TYR 52  48  48  TYR TYR B . n 
B 1 53  PHE 53  49  49  PHE PHE B . n 
B 1 54  GLN 54  50  50  GLN GLN B . n 
B 1 55  PRO 55  51  51  PRO PRO B . n 
B 1 56  VAL 56  52  52  VAL VAL B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  MET 58  54  54  MET MET B . n 
B 1 59  HIS 59  55  55  HIS HIS B . n 
B 1 60  PRO 60  56  56  PRO PRO B . n 
B 1 61  ALA 61  57  57  ALA ALA B . n 
B 1 62  PRO 62  58  58  PRO PRO B . n 
B 1 63  GLY 63  59  59  GLY GLY B . n 
B 1 64  ALA 64  60  60  ALA ALA B . n 
B 1 65  GLN 65  61  61  GLN GLN B . n 
B 1 66  PRO 66  62  62  PRO PRO B . n 
B 1 67  SER 67  63  63  SER SER B . n 
B 1 68  LYS 68  64  64  LYS LYS B . n 
B 1 69  GLU 69  65  65  GLU GLU B . n 
B 1 70  GLU 70  66  66  GLU GLU B . n 
B 1 71  ALA 71  67  67  ALA ALA B . n 
B 1 72  ASP 72  68  68  ASP ASP B . n 
B 1 73  CYS 73  69  69  CYS CYS B . n 
B 1 74  HIS 74  70  70  HIS HIS B . n 
B 1 75  ILE 75  71  71  ILE ILE B . n 
B 1 76  GLU 76  72  72  GLU GLU B . n 
B 1 77  ALA 77  73  73  ALA ALA B . n 
B 1 78  ASP 78  74  74  ASP ASP B . n 
B 1 79  ILE 79  75  75  ILE ILE B . n 
B 1 80  HIS 80  76  76  HIS HIS B . n 
B 1 81  ALA 81  77  77  ALA ALA B . n 
B 1 82  ASN 82  78  78  ASN ASN B . n 
B 1 83  GLU 83  79  79  GLU GLU B . n 
B 1 84  ALA 84  80  80  ALA ALA B . n 
B 1 85  GLY 85  81  81  GLY GLY B . n 
B 1 86  LYS 86  82  82  LYS LYS B . n 
B 1 87  ASP 87  83  83  ASP ASP B . n 
B 1 88  LEU 88  84  84  LEU LEU B . n 
B 1 89  GLY 89  85  85  GLY GLY B . n 
B 1 90  TYR 90  86  86  TYR TYR B . n 
B 1 91  GLY 91  87  87  GLY GLY B . n 
B 1 92  VAL 92  88  88  VAL VAL B . n 
B 1 93  GLY 93  89  89  GLY GLY B . n 
B 1 94  ASP 94  90  90  ASP ASP B . n 
B 1 95  PHE 95  91  91  PHE PHE B . n 
B 1 96  VAL 96  92  92  VAL VAL B . n 
B 1 97  PRO 97  93  93  PRO PRO B . n 
B 1 98  TYR 98  94  94  TYR TYR B . n 
B 1 99  LEU 99  95  95  LEU LEU B . n 
B 1 100 ARG 100 96  96  ARG ARG B . n 
B 1 101 VAL 101 97  97  VAL VAL B . n 
B 1 102 VAL 102 98  98  VAL VAL B . n 
B 1 103 ALA 103 99  99  ALA ALA B . n 
B 1 104 PHE 104 100 100 PHE PHE B . n 
B 1 105 LEU 105 101 101 LEU LEU B . n 
B 1 106 GLN 106 102 102 GLN GLN B . n 
B 1 107 LYS 107 103 103 LYS LYS B . n 
B 1 108 HIS 108 104 104 HIS HIS B . n 
B 1 109 GLY 109 105 105 GLY GLY B . n 
B 1 110 SER 110 106 106 SER SER B . n 
B 1 111 GLU 111 107 107 GLU GLU B . n 
B 1 112 LYS 112 108 108 LYS LYS B . n 
B 1 113 VAL 113 109 109 VAL VAL B . n 
B 1 114 GLN 114 110 110 GLN GLN B . n 
B 1 115 LYS 115 111 111 LYS LYS B . n 
B 1 116 VAL 116 112 112 VAL VAL B . n 
B 1 117 MET 117 113 113 MET MET B . n 
B 1 118 PHE 118 114 114 PHE PHE B . n 
B 1 119 ALA 119 115 115 ALA ALA B . n 
B 1 120 PRO 120 116 116 PRO PRO B . n 
B 1 121 MET 121 117 117 MET MET B . n 
B 1 122 ASN 122 118 118 ASN ASN B . n 
B 1 123 ALA 123 119 119 ALA ALA B . n 
B 1 124 GLY 124 120 120 GLY GLY B . n 
B 1 125 ASP 125 121 121 ASP ASP B . n 
B 1 126 GLY 126 122 122 GLY GLY B . n 
B 1 127 PRO 127 123 123 PRO PRO B . n 
B 1 128 HIS 128 124 124 HIS HIS B . n 
B 1 129 TYR 129 125 125 TYR TYR B . n 
B 1 130 GLY 130 126 126 GLY GLY B . n 
B 1 131 ALA 131 127 127 ALA ALA B . n 
B 1 132 ASN 132 128 128 ASN ASN B . n 
B 1 133 VAL 133 129 129 VAL VAL B . n 
B 1 134 LYS 134 130 130 LYS LYS B . n 
B 1 135 PHE 135 131 131 PHE PHE B . n 
B 1 136 GLU 136 132 132 GLU GLU B . n 
B 1 137 GLU 137 133 133 GLU GLU B . n 
B 1 138 GLY 138 134 134 GLY GLY B . n 
B 1 139 LEU 139 135 135 LEU LEU B . n 
B 1 140 GLY 140 136 136 GLY GLY B . n 
B 1 141 THR 141 137 137 THR THR B . n 
B 1 142 TYR 142 138 138 TYR TYR B . n 
B 1 143 LYS 143 139 139 LYS LYS B . n 
B 1 144 VAL 144 140 140 VAL VAL B . n 
B 1 145 ARG 145 141 141 ARG ARG B . n 
B 1 146 PHE 146 142 142 PHE PHE B . n 
B 1 147 GLU 147 143 143 GLU GLU B . n 
B 1 148 ILE 148 144 144 ILE ILE B . n 
B 1 149 ALA 149 145 145 ALA ALA B . n 
B 1 150 ALA 150 146 146 ALA ALA B . n 
B 1 151 PRO 151 147 147 PRO PRO B . n 
B 1 152 SER 152 148 148 SER SER B . n 
B 1 153 HIS 153 149 149 HIS HIS B . n 
B 1 154 ASP 154 150 150 ASP ASP B . n 
B 1 155 GLU 155 151 151 GLU GLU B . n 
B 1 156 TYR 156 152 152 TYR TYR B . n 
B 1 157 SER 157 153 153 SER SER B . n 
B 1 158 LEU 158 154 154 LEU LEU B . n 
B 1 159 HIS 159 155 155 HIS HIS B . n 
B 1 160 ILE 160 156 156 ILE ILE B . n 
B 1 161 ASP 161 157 157 ASP ASP B . n 
B 1 162 GLU 162 158 158 GLU GLU B . n 
B 1 163 GLN 163 159 159 GLN GLN B . n 
B 1 164 THR 164 160 160 THR THR B . n 
B 1 165 GLY 165 161 161 GLY GLY B . n 
B 1 166 VAL 166 162 162 VAL VAL B . n 
B 1 167 SER 167 163 163 SER SER B . n 
B 1 168 GLY 168 164 164 GLY GLY B . n 
B 1 169 ARG 169 165 165 ARG ARG B . n 
B 1 170 PHE 170 166 166 PHE PHE B . n 
B 1 171 TRP 171 167 167 TRP TRP B . n 
B 1 172 SER 172 168 168 SER SER B . n 
B 1 173 GLU 173 169 169 GLU GLU B . n 
B 1 174 PRO 174 170 170 PRO PRO B . n 
B 1 175 LEU 175 171 171 LEU LEU B . n 
B 1 176 VAL 176 172 172 VAL VAL B . n 
B 1 177 ALA 177 173 173 ALA ALA B . n 
B 1 178 GLU 178 174 174 GLU GLU B . n 
B 1 179 TRP 179 175 175 TRP TRP B . n 
B 1 180 ASP 180 176 176 ASP ASP B . n 
B 1 181 ASP 181 177 177 ASP ASP B . n 
B 1 182 PHE 182 178 178 PHE PHE B . n 
B 1 183 GLU 183 179 179 GLU GLU B . n 
B 1 184 TRP 184 180 180 TRP TRP B . n 
B 1 185 LYS 185 181 181 LYS LYS B . n 
B 1 186 GLY 186 182 182 GLY GLY B . n 
B 1 187 PRO 187 183 183 PRO PRO B . n 
B 1 188 GLN 188 184 184 GLN GLN B . n 
B 1 189 TRP 189 185 185 TRP TRP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   301 301 ZN  ZN  A . 
D 2 ZN  1   304 304 ZN  ZN  A . 
E 2 ZN  1   305 305 ZN  ZN  A . 
F 2 ZN  1   306 306 ZN  ZN  A . 
G 2 ZN  1   307 307 ZN  ZN  A . 
H 2 ZN  1   308 308 ZN  ZN  A . 
I 3 SO4 1   501 501 SO4 SO4 A . 
J 4 CL  1   311 311 CL  CL  A . 
K 5 EDO 1   401 401 EDO EDO A . 
L 5 EDO 1   402 402 EDO EDO A . 
M 2 ZN  1   302 302 ZN  ZN  B . 
N 2 ZN  1   303 303 ZN  ZN  B . 
O 3 SO4 1   502 502 SO4 SO4 B . 
P 4 CL  1   312 312 CL  CL  B . 
Q 6 HOH 1   502 1   HOH HOH A . 
Q 6 HOH 2   503 2   HOH HOH A . 
Q 6 HOH 3   504 3   HOH HOH A . 
Q 6 HOH 4   505 4   HOH HOH A . 
Q 6 HOH 5   506 6   HOH HOH A . 
Q 6 HOH 6   507 7   HOH HOH A . 
Q 6 HOH 7   508 8   HOH HOH A . 
Q 6 HOH 8   509 9   HOH HOH A . 
Q 6 HOH 9   510 10  HOH HOH A . 
Q 6 HOH 10  511 11  HOH HOH A . 
Q 6 HOH 11  512 12  HOH HOH A . 
Q 6 HOH 12  513 13  HOH HOH A . 
Q 6 HOH 13  514 14  HOH HOH A . 
Q 6 HOH 14  515 15  HOH HOH A . 
Q 6 HOH 15  516 16  HOH HOH A . 
Q 6 HOH 16  517 17  HOH HOH A . 
Q 6 HOH 17  518 18  HOH HOH A . 
Q 6 HOH 18  519 19  HOH HOH A . 
Q 6 HOH 19  520 20  HOH HOH A . 
Q 6 HOH 20  521 21  HOH HOH A . 
Q 6 HOH 21  522 22  HOH HOH A . 
Q 6 HOH 22  523 23  HOH HOH A . 
Q 6 HOH 23  524 24  HOH HOH A . 
Q 6 HOH 24  525 25  HOH HOH A . 
Q 6 HOH 25  526 27  HOH HOH A . 
Q 6 HOH 26  527 28  HOH HOH A . 
Q 6 HOH 27  528 32  HOH HOH A . 
Q 6 HOH 28  529 33  HOH HOH A . 
Q 6 HOH 29  530 34  HOH HOH A . 
Q 6 HOH 30  531 35  HOH HOH A . 
Q 6 HOH 31  532 37  HOH HOH A . 
Q 6 HOH 32  533 38  HOH HOH A . 
Q 6 HOH 33  534 39  HOH HOH A . 
Q 6 HOH 34  535 40  HOH HOH A . 
Q 6 HOH 35  536 41  HOH HOH A . 
Q 6 HOH 36  537 45  HOH HOH A . 
Q 6 HOH 37  538 48  HOH HOH A . 
Q 6 HOH 38  539 49  HOH HOH A . 
Q 6 HOH 39  540 51  HOH HOH A . 
Q 6 HOH 40  541 52  HOH HOH A . 
Q 6 HOH 41  542 54  HOH HOH A . 
Q 6 HOH 42  543 55  HOH HOH A . 
Q 6 HOH 43  544 57  HOH HOH A . 
Q 6 HOH 44  545 58  HOH HOH A . 
Q 6 HOH 45  546 59  HOH HOH A . 
Q 6 HOH 46  547 60  HOH HOH A . 
Q 6 HOH 47  548 61  HOH HOH A . 
Q 6 HOH 48  549 64  HOH HOH A . 
Q 6 HOH 49  550 67  HOH HOH A . 
Q 6 HOH 50  551 68  HOH HOH A . 
Q 6 HOH 51  552 70  HOH HOH A . 
Q 6 HOH 52  553 71  HOH HOH A . 
Q 6 HOH 53  554 72  HOH HOH A . 
Q 6 HOH 54  555 73  HOH HOH A . 
Q 6 HOH 55  556 74  HOH HOH A . 
Q 6 HOH 56  557 75  HOH HOH A . 
Q 6 HOH 57  558 79  HOH HOH A . 
Q 6 HOH 58  559 80  HOH HOH A . 
Q 6 HOH 59  560 83  HOH HOH A . 
Q 6 HOH 60  561 84  HOH HOH A . 
Q 6 HOH 61  562 86  HOH HOH A . 
Q 6 HOH 62  563 88  HOH HOH A . 
Q 6 HOH 63  564 89  HOH HOH A . 
Q 6 HOH 64  565 91  HOH HOH A . 
Q 6 HOH 65  566 92  HOH HOH A . 
Q 6 HOH 66  567 96  HOH HOH A . 
Q 6 HOH 67  568 97  HOH HOH A . 
Q 6 HOH 68  569 98  HOH HOH A . 
Q 6 HOH 69  570 100 HOH HOH A . 
Q 6 HOH 70  571 103 HOH HOH A . 
Q 6 HOH 71  572 105 HOH HOH A . 
Q 6 HOH 72  573 108 HOH HOH A . 
Q 6 HOH 73  574 109 HOH HOH A . 
Q 6 HOH 74  575 110 HOH HOH A . 
Q 6 HOH 75  576 111 HOH HOH A . 
Q 6 HOH 76  577 112 HOH HOH A . 
Q 6 HOH 77  578 114 HOH HOH A . 
Q 6 HOH 78  579 115 HOH HOH A . 
Q 6 HOH 79  580 116 HOH HOH A . 
Q 6 HOH 80  581 117 HOH HOH A . 
Q 6 HOH 81  582 120 HOH HOH A . 
Q 6 HOH 82  583 122 HOH HOH A . 
Q 6 HOH 83  584 125 HOH HOH A . 
Q 6 HOH 84  585 127 HOH HOH A . 
Q 6 HOH 85  586 128 HOH HOH A . 
Q 6 HOH 86  587 130 HOH HOH A . 
Q 6 HOH 87  588 131 HOH HOH A . 
Q 6 HOH 88  589 134 HOH HOH A . 
Q 6 HOH 89  590 135 HOH HOH A . 
Q 6 HOH 90  591 136 HOH HOH A . 
Q 6 HOH 91  592 138 HOH HOH A . 
Q 6 HOH 92  593 139 HOH HOH A . 
Q 6 HOH 93  594 140 HOH HOH A . 
Q 6 HOH 94  595 145 HOH HOH A . 
Q 6 HOH 95  596 146 HOH HOH A . 
Q 6 HOH 96  597 149 HOH HOH A . 
Q 6 HOH 97  598 151 HOH HOH A . 
Q 6 HOH 98  599 152 HOH HOH A . 
Q 6 HOH 99  600 155 HOH HOH A . 
Q 6 HOH 100 601 156 HOH HOH A . 
Q 6 HOH 101 602 157 HOH HOH A . 
Q 6 HOH 102 603 158 HOH HOH A . 
Q 6 HOH 103 604 159 HOH HOH A . 
Q 6 HOH 104 605 160 HOH HOH A . 
Q 6 HOH 105 606 161 HOH HOH A . 
Q 6 HOH 106 607 162 HOH HOH A . 
Q 6 HOH 107 608 163 HOH HOH A . 
Q 6 HOH 108 609 164 HOH HOH A . 
Q 6 HOH 109 610 166 HOH HOH A . 
Q 6 HOH 110 611 168 HOH HOH A . 
Q 6 HOH 111 612 169 HOH HOH A . 
Q 6 HOH 112 613 170 HOH HOH A . 
Q 6 HOH 113 614 171 HOH HOH A . 
Q 6 HOH 114 615 172 HOH HOH A . 
Q 6 HOH 115 616 175 HOH HOH A . 
Q 6 HOH 116 617 179 HOH HOH A . 
Q 6 HOH 117 618 181 HOH HOH A . 
Q 6 HOH 118 619 190 HOH HOH A . 
Q 6 HOH 119 620 191 HOH HOH A . 
Q 6 HOH 120 621 200 HOH HOH A . 
Q 6 HOH 121 622 201 HOH HOH A . 
Q 6 HOH 122 623 203 HOH HOH A . 
Q 6 HOH 123 624 207 HOH HOH A . 
Q 6 HOH 124 625 211 HOH HOH A . 
Q 6 HOH 125 626 213 HOH HOH A . 
R 6 HOH 1   503 5   HOH HOH B . 
R 6 HOH 2   504 26  HOH HOH B . 
R 6 HOH 3   505 29  HOH HOH B . 
R 6 HOH 4   506 30  HOH HOH B . 
R 6 HOH 5   507 31  HOH HOH B . 
R 6 HOH 6   508 36  HOH HOH B . 
R 6 HOH 7   509 42  HOH HOH B . 
R 6 HOH 8   510 43  HOH HOH B . 
R 6 HOH 9   511 44  HOH HOH B . 
R 6 HOH 10  512 46  HOH HOH B . 
R 6 HOH 11  513 47  HOH HOH B . 
R 6 HOH 12  514 50  HOH HOH B . 
R 6 HOH 13  515 53  HOH HOH B . 
R 6 HOH 14  516 56  HOH HOH B . 
R 6 HOH 15  517 62  HOH HOH B . 
R 6 HOH 16  518 63  HOH HOH B . 
R 6 HOH 17  519 65  HOH HOH B . 
R 6 HOH 18  520 66  HOH HOH B . 
R 6 HOH 19  521 69  HOH HOH B . 
R 6 HOH 20  522 76  HOH HOH B . 
R 6 HOH 21  523 77  HOH HOH B . 
R 6 HOH 22  524 78  HOH HOH B . 
R 6 HOH 23  525 81  HOH HOH B . 
R 6 HOH 24  526 82  HOH HOH B . 
R 6 HOH 25  527 85  HOH HOH B . 
R 6 HOH 26  528 87  HOH HOH B . 
R 6 HOH 27  529 90  HOH HOH B . 
R 6 HOH 28  530 93  HOH HOH B . 
R 6 HOH 29  531 94  HOH HOH B . 
R 6 HOH 30  532 95  HOH HOH B . 
R 6 HOH 31  533 99  HOH HOH B . 
R 6 HOH 32  534 101 HOH HOH B . 
R 6 HOH 33  535 102 HOH HOH B . 
R 6 HOH 34  536 104 HOH HOH B . 
R 6 HOH 35  537 106 HOH HOH B . 
R 6 HOH 36  538 107 HOH HOH B . 
R 6 HOH 37  539 113 HOH HOH B . 
R 6 HOH 38  540 118 HOH HOH B . 
R 6 HOH 39  541 119 HOH HOH B . 
R 6 HOH 40  542 121 HOH HOH B . 
R 6 HOH 41  543 123 HOH HOH B . 
R 6 HOH 42  544 124 HOH HOH B . 
R 6 HOH 43  545 126 HOH HOH B . 
R 6 HOH 44  546 129 HOH HOH B . 
R 6 HOH 45  547 132 HOH HOH B . 
R 6 HOH 46  548 133 HOH HOH B . 
R 6 HOH 47  549 137 HOH HOH B . 
R 6 HOH 48  550 141 HOH HOH B . 
R 6 HOH 49  551 142 HOH HOH B . 
R 6 HOH 50  552 143 HOH HOH B . 
R 6 HOH 51  553 144 HOH HOH B . 
R 6 HOH 52  554 147 HOH HOH B . 
R 6 HOH 53  555 148 HOH HOH B . 
R 6 HOH 54  556 150 HOH HOH B . 
R 6 HOH 55  557 153 HOH HOH B . 
R 6 HOH 56  558 154 HOH HOH B . 
R 6 HOH 57  559 165 HOH HOH B . 
R 6 HOH 58  560 167 HOH HOH B . 
R 6 HOH 59  561 176 HOH HOH B . 
R 6 HOH 60  562 177 HOH HOH B . 
R 6 HOH 61  563 180 HOH HOH B . 
R 6 HOH 62  564 183 HOH HOH B . 
R 6 HOH 63  565 184 HOH HOH B . 
R 6 HOH 64  566 185 HOH HOH B . 
R 6 HOH 65  567 188 HOH HOH B . 
R 6 HOH 66  568 192 HOH HOH B . 
R 6 HOH 67  569 193 HOH HOH B . 
R 6 HOH 68  570 195 HOH HOH B . 
R 6 HOH 69  571 196 HOH HOH B . 
R 6 HOH 70  572 197 HOH HOH B . 
R 6 HOH 71  573 204 HOH HOH B . 
R 6 HOH 72  574 209 HOH HOH B . 
R 6 HOH 73  575 210 HOH HOH B . 
R 6 HOH 74  576 212 HOH HOH B . 
R 6 HOH 75  577 214 HOH HOH B . 
R 6 HOH 76  578 216 HOH HOH B . 
R 6 HOH 77  579 217 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4940  ? 
1 MORE         -304  ? 
1 'SSA (A^2)'  14900 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 34  ? A GLU 30  ? 1_555 ZN ? E ZN . ? A ZN 305 ? 1_555 OD2 ? A ASP 125 ? A ASP 121 ? 1_555 73.3  ? 
2  OE2 ? A GLU 34  ? A GLU 30  ? 1_555 ZN ? E ZN . ? A ZN 305 ? 1_555 O   ? Q HOH .   ? A HOH 572 ? 1_555 66.8  ? 
3  OD2 ? A ASP 125 ? A ASP 121 ? 1_555 ZN ? E ZN . ? A ZN 305 ? 1_555 O   ? Q HOH .   ? A HOH 572 ? 1_555 71.2  ? 
4  NE2 ? A HIS 59  ? A HIS 55  ? 1_555 ZN ? F ZN . ? A ZN 306 ? 1_555 NE2 ? B HIS 153 ? B HIS 149 ? 1_555 94.2  ? 
5  NE2 ? A HIS 74  ? A HIS 70  ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 OE2 ? A GLU 76  ? A GLU 72  ? 1_555 94.9  ? 
6  NE2 ? A HIS 74  ? A HIS 70  ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 143.8 ? 
7  OE2 ? A GLU 76  ? A GLU 72  ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 81.9  ? 
8  NE2 ? A HIS 74  ? A HIS 70  ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? B HIS 159 ? B HIS 155 ? 1_555 104.6 ? 
9  OE2 ? A GLU 76  ? A GLU 72  ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? B HIS 159 ? B HIS 155 ? 1_555 101.6 ? 
10 NE2 ? A HIS 128 ? A HIS 124 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? B HIS 159 ? B HIS 155 ? 1_555 111.4 ? 
11 OD1 B A ASP 78  ? A ASP 74  ? 1_555 ZN ? D ZN . ? A ZN 304 ? 1_555 ND1 ? A HIS 80  ? A HIS 76  ? 1_555 113.1 ? 
12 NE2 ? A HIS 159 ? A HIS 155 ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 NE2 ? B HIS 74  ? B HIS 70  ? 1_555 103.6 ? 
13 NE2 ? A HIS 159 ? A HIS 155 ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 OE2 ? B GLU 76  ? B GLU 72  ? 1_555 101.5 ? 
14 NE2 ? B HIS 74  ? B HIS 70  ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 OE2 ? B GLU 76  ? B GLU 72  ? 1_555 98.9  ? 
15 NE2 ? A HIS 159 ? A HIS 155 ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 NE2 ? B HIS 128 ? B HIS 124 ? 1_555 110.3 ? 
16 NE2 ? B HIS 74  ? B HIS 70  ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 NE2 ? B HIS 128 ? B HIS 124 ? 1_555 143.4 ? 
17 OE2 ? B GLU 76  ? B GLU 72  ? 1_555 ZN ? M ZN . ? B ZN 302 ? 1_555 NE2 ? B HIS 128 ? B HIS 124 ? 1_555 87.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id'  
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id'  
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
21 4 'Structure model' '_pdbx_struct_conn_angle.value'               
22 4 'Structure model' '_struct_conn.pdbx_dist_value'                
23 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id'        
24 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id'        
25 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
32 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
33 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
34 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
35 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
36 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
37 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
38 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
39 4 'Structure model' '_struct_conn.ptnr2_symmetry'                 
40 4 'Structure model' '_struct_ref_seq_dif.details'                 
41 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
42 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
43 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 10.8255 41.2135 61.7259 -0.1315 -0.0509 -0.0513 -0.0005 -0.0036 -0.0304 0.7806 1.4683 2.0638 0.3320 1.1372 1.0233 
-0.0085 0.0111 -0.0025 -0.0254 0.0201  0.0568  -0.1394 -0.0170 -0.0050 'X-RAY DIFFRACTION' 
2 ? refined 6.3783  14.9962 52.5937 0.0548  -0.0701 -0.0238 -0.0050 -0.0739 0.0027  0.8836 2.3786 2.7299 0.9563 1.1824 1.9219 
0.1976  0.0184 -0.2159 -0.0563 -0.1411 -0.0472 0.2145  0.3662  -0.0344 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 32 A 189 ALL A 28 A 185 'X-RAY DIFFRACTION' ? 
2 2 B 33 B 189 ALL B 29 B 185 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0019 ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-3000    .        ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-3000    .        ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
HKL-3000    .        ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .        ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    50 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   A 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    531 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 49 ? ? -161.11 -169.59 
2 1 ASN A 78 ? ? -101.98 -165.92 
3 1 PHE B 49 ? ? -164.43 -168.88 
4 1 ASN B 78 ? ? -105.08 -168.43 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    80 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    81 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            58.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -3 ? A GLY 1  
2  1 Y 1 A ALA -2 ? A ALA 2  
3  1 Y 1 A MET -1 ? A MET 3  
4  1 Y 1 A GLY 0  ? A GLY 4  
5  1 Y 1 A SER 1  ? A SER 5  
6  1 Y 1 A GLY 2  ? A GLY 6  
7  1 Y 1 A GLY 3  ? A GLY 7  
8  1 Y 1 A GLY 4  ? A GLY 8  
9  1 Y 1 A GLY 5  ? A GLY 9  
10 1 Y 1 A GLU 6  ? A GLU 10 
11 1 Y 1 A HIS 7  ? A HIS 11 
12 1 Y 1 A GLN 8  ? A GLN 12 
13 1 Y 1 A HIS 9  ? A HIS 13 
14 1 Y 1 A GLY 10 ? A GLY 14 
15 1 Y 1 A GLU 11 ? A GLU 15 
16 1 Y 1 A GLU 12 ? A GLU 16 
17 1 Y 1 A MET 13 ? A MET 17 
18 1 Y 1 A MET 14 ? A MET 18 
19 1 Y 1 A ALA 15 ? A ALA 19 
20 1 Y 1 A ALA 16 ? A ALA 20 
21 1 Y 1 A VAL 17 ? A VAL 21 
22 1 Y 1 A PRO 18 ? A PRO 22 
23 1 Y 1 A ALA 19 ? A ALA 23 
24 1 Y 1 A PRO 20 ? A PRO 24 
25 1 Y 1 A ASP 21 ? A ASP 25 
26 1 Y 1 A ALA 22 ? A ALA 26 
27 1 Y 1 A GLU 23 ? A GLU 27 
28 1 Y 1 A GLY 24 ? A GLY 28 
29 1 Y 1 A ALA 25 ? A ALA 29 
30 1 Y 1 A ALA 26 ? A ALA 30 
31 1 Y 1 A GLY 27 ? A GLY 31 
32 1 Y 1 B GLY -3 ? B GLY 1  
33 1 Y 1 B ALA -2 ? B ALA 2  
34 1 Y 1 B MET -1 ? B MET 3  
35 1 Y 1 B GLY 0  ? B GLY 4  
36 1 Y 1 B SER 1  ? B SER 5  
37 1 Y 1 B GLY 2  ? B GLY 6  
38 1 Y 1 B GLY 3  ? B GLY 7  
39 1 Y 1 B GLY 4  ? B GLY 8  
40 1 Y 1 B GLY 5  ? B GLY 9  
41 1 Y 1 B GLU 6  ? B GLU 10 
42 1 Y 1 B HIS 7  ? B HIS 11 
43 1 Y 1 B GLN 8  ? B GLN 12 
44 1 Y 1 B HIS 9  ? B HIS 13 
45 1 Y 1 B GLY 10 ? B GLY 14 
46 1 Y 1 B GLU 11 ? B GLU 15 
47 1 Y 1 B GLU 12 ? B GLU 16 
48 1 Y 1 B MET 13 ? B MET 17 
49 1 Y 1 B MET 14 ? B MET 18 
50 1 Y 1 B ALA 15 ? B ALA 19 
51 1 Y 1 B ALA 16 ? B ALA 20 
52 1 Y 1 B VAL 17 ? B VAL 21 
53 1 Y 1 B PRO 18 ? B PRO 22 
54 1 Y 1 B ALA 19 ? B ALA 23 
55 1 Y 1 B PRO 20 ? B PRO 24 
56 1 Y 1 B ASP 21 ? B ASP 25 
57 1 Y 1 B ALA 22 ? B ALA 26 
58 1 Y 1 B GLU 23 ? B GLU 27 
59 1 Y 1 B GLY 24 ? B GLY 28 
60 1 Y 1 B ALA 25 ? B ALA 29 
61 1 Y 1 B ALA 26 ? B ALA 30 
62 1 Y 1 B GLY 27 ? B GLY 31 
63 1 Y 1 B PHE 28 ? B PHE 32 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 'SULFATE ION'  SO4 
4 'CHLORIDE ION' CL  
5 1,2-ETHANEDIOL EDO 
6 water          HOH 
#