data_2O6F
# 
_entry.id   2O6F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.350 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2O6F         pdb_00002o6f 10.2210/pdb2o6f/pdb 
RCSB  RCSB040745   ?            ?                   
WWPDB D_1000040745 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2O6C . unspecified 
PDB 2O6D . unspecified 
PDB 2O6E . unspecified 
# 
_pdbx_database_status.entry_id                        2O6F 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-07 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Machius, M.'     1 
'Brautigam, C.A.' 2 
'Deka, R.K.'      3 
'Tomchick, D.R.'  4 
'Lumpkins, S.B.'  5 
'Norgard, M.V.'   6 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
;
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                5944 
_citation.page_last                 5958 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17192261 
_citation.pdbx_database_id_DOI      10.1074/jbc.M610215200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Deka, R.K.'      1 ? 
primary 'Brautigam, C.A.' 2 ? 
primary 'Tomson, F.L.'    3 ? 
primary 'Lumpkins, S.B.'  4 ? 
primary 'Tomchick, D.R.'  5 ? 
primary 'Machius, M.'     6 ? 
primary 'Norgard, M.V.'   7 ? 
# 
_cell.length_a           34.251 
_cell.length_b           66.034 
_cell.length_c           151.019 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2O6F 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         2O6F 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man '34 kDa membrane antigen' 20443.449 2   ? 'V16G, F17A, S18M, A19G, C20S' ? ? 
2 non-polymer syn 'SULFATE ION'             96.063    2   ? ?                              ? ? 
3 non-polymer syn 'CHLORIDE ION'            35.453    3   ? ?                              ? ? 
4 non-polymer syn 1,2-ETHANEDIOL            62.068    2   ? ?                              ? ? 
5 water       nat water                     18.015    240 ? ?                              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pathogen-specific membrane antigen' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGSGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGSGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   GLY n 
1 8   GLY n 
1 9   GLY n 
1 10  GLU n 
1 11  HIS n 
1 12  GLN n 
1 13  HIS n 
1 14  GLY n 
1 15  GLU n 
1 16  GLU n 
1 17  MET n 
1 18  MET n 
1 19  ALA n 
1 20  ALA n 
1 21  VAL n 
1 22  PRO n 
1 23  ALA n 
1 24  PRO n 
1 25  ASP n 
1 26  ALA n 
1 27  GLU n 
1 28  GLY n 
1 29  ALA n 
1 30  ALA n 
1 31  GLY n 
1 32  PHE n 
1 33  ASP n 
1 34  GLU n 
1 35  PHE n 
1 36  PRO n 
1 37  ILE n 
1 38  GLY n 
1 39  GLU n 
1 40  ASP n 
1 41  ARG n 
1 42  ASP n 
1 43  VAL n 
1 44  GLY n 
1 45  PRO n 
1 46  LEU n 
1 47  HIS n 
1 48  VAL n 
1 49  GLY n 
1 50  GLY n 
1 51  VAL n 
1 52  TYR n 
1 53  PHE n 
1 54  GLN n 
1 55  PRO n 
1 56  VAL n 
1 57  GLU n 
1 58  MET n 
1 59  HIS n 
1 60  PRO n 
1 61  ALA n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  GLN n 
1 66  PRO n 
1 67  SER n 
1 68  LYS n 
1 69  GLU n 
1 70  GLU n 
1 71  ALA n 
1 72  ASP n 
1 73  CYS n 
1 74  HIS n 
1 75  ILE n 
1 76  GLU n 
1 77  ALA n 
1 78  ASP n 
1 79  ILE n 
1 80  HIS n 
1 81  ALA n 
1 82  ASN n 
1 83  GLU n 
1 84  ALA n 
1 85  GLY n 
1 86  LYS n 
1 87  ASP n 
1 88  LEU n 
1 89  GLY n 
1 90  TYR n 
1 91  GLY n 
1 92  VAL n 
1 93  GLY n 
1 94  ASP n 
1 95  PHE n 
1 96  VAL n 
1 97  PRO n 
1 98  TYR n 
1 99  LEU n 
1 100 ARG n 
1 101 VAL n 
1 102 VAL n 
1 103 ALA n 
1 104 PHE n 
1 105 LEU n 
1 106 GLN n 
1 107 LYS n 
1 108 HIS n 
1 109 GLY n 
1 110 SER n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 GLN n 
1 115 LYS n 
1 116 VAL n 
1 117 MET n 
1 118 PHE n 
1 119 ALA n 
1 120 PRO n 
1 121 MET n 
1 122 ASN n 
1 123 ALA n 
1 124 GLY n 
1 125 ASP n 
1 126 GLY n 
1 127 PRO n 
1 128 HIS n 
1 129 TYR n 
1 130 GLY n 
1 131 ALA n 
1 132 ASN n 
1 133 VAL n 
1 134 LYS n 
1 135 PHE n 
1 136 GLU n 
1 137 GLU n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
1 141 THR n 
1 142 TYR n 
1 143 LYS n 
1 144 VAL n 
1 145 ARG n 
1 146 PHE n 
1 147 GLU n 
1 148 ILE n 
1 149 ALA n 
1 150 ALA n 
1 151 PRO n 
1 152 SER n 
1 153 HIS n 
1 154 ASP n 
1 155 GLU n 
1 156 TYR n 
1 157 SER n 
1 158 LEU n 
1 159 HIS n 
1 160 ILE n 
1 161 ASP n 
1 162 GLU n 
1 163 GLN n 
1 164 THR n 
1 165 GLY n 
1 166 VAL n 
1 167 SER n 
1 168 GLY n 
1 169 ARG n 
1 170 PHE n 
1 171 TRP n 
1 172 SER n 
1 173 GLU n 
1 174 PRO n 
1 175 LEU n 
1 176 VAL n 
1 177 ALA n 
1 178 GLU n 
1 179 TRP n 
1 180 ASP n 
1 181 ASP n 
1 182 PHE n 
1 183 GLU n 
1 184 TRP n 
1 185 LYS n 
1 186 GLY n 
1 187 PRO n 
1 188 GLN n 
1 189 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Treponema 
_entity_src_gen.pdbx_gene_src_gene                 tpd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Treponema pallidum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     160 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XL1-Blue 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pProExHTa 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TA34_TREPA 
_struct_ref.pdbx_db_accession          P19478 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;VFSACGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIH
ANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHI
DEQTGVSGRFWSEPLVAEWDDFEWKGPQW
;
_struct_ref.pdbx_align_begin           16 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O6F A 1 ? 189 ? P19478 16 ? 204 ? -3 185 
2 1 2O6F B 1 ? 189 ? P19478 16 ? 204 ? -3 185 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O6F GLY A 1 ? UNP P19478 VAL 16 'engineered mutation' -3 1  
1 2O6F ALA A 2 ? UNP P19478 PHE 17 'engineered mutation' -2 2  
1 2O6F MET A 3 ? UNP P19478 SER 18 'engineered mutation' -1 3  
1 2O6F GLY A 4 ? UNP P19478 ALA 19 'engineered mutation' 0  4  
1 2O6F SER A 5 ? UNP P19478 CYS 20 'engineered mutation' 1  5  
2 2O6F GLY B 1 ? UNP P19478 VAL 16 'engineered mutation' -3 6  
2 2O6F ALA B 2 ? UNP P19478 PHE 17 'engineered mutation' -2 7  
2 2O6F MET B 3 ? UNP P19478 SER 18 'engineered mutation' -1 8  
2 2O6F GLY B 4 ? UNP P19478 ALA 19 'engineered mutation' 0  9  
2 2O6F SER B 5 ? UNP P19478 CYS 20 'engineered mutation' 1  10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2O6F 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.09 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   41.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '2.4 M Ammonium sulfate, 0.1 M Bicine, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2006-07-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    'Double-crystal Si 111' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97899 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97899 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
# 
_reflns.entry_id                     2O6F 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            1.63 
_reflns.d_resolution_low             26.03 
_reflns.number_all                   41967 
_reflns.number_obs                   41967 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.038 
_reflns.pdbx_netI_over_sigmaI        32.0 
_reflns.B_iso_Wilson_estimate        25.0 
_reflns.pdbx_redundancy              4.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.63 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   94.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    2.2 
_reflns_shell.pdbx_Rsym_value        0.487 
_reflns_shell.pdbx_redundancy        3.7 
_reflns_shell.number_unique_all      2016 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2O6F 
_refine.ls_d_res_high                            1.630 
_refine.ls_d_res_low                             26.030 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.110 
_refine.ls_number_reflns_obs                     41892 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.19 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_percent_reflns_R_free                 3.600 
_refine.ls_number_reflns_R_free                  1508 
_refine.B_iso_mean                               25.686 
_refine.aniso_B[1][1]                            1.000 
_refine.aniso_B[2][2]                            -1.050 
_refine.aniso_B[3][3]                            0.050 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.964 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.pdbx_overall_ESU_R                       0.099 
_refine.pdbx_overall_ESU_R_Free                  0.097 
_refine.overall_SU_ML                            0.067 
_refine.overall_SU_B                             3.800 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_starting_model                      'native protein' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2O6F 
_refine_analyze.Luzzati_coordinate_error_obs    .231 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2474 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             240 
_refine_hist.number_atoms_total               2735 
_refine_hist.d_res_high                       1.630 
_refine_hist.d_res_low                        26.030 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2683 0.015  0.021  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3662 1.893  1.937  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   337  4.874  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   142  34.881 25.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   396  13.975 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   8    17.948 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           350  0.137  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2524 0.015  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1142 0.198  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          1756 0.318  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    214  0.146  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   49   0.184  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 18   0.206  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1660 1.081  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2618 1.698  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1172 2.565  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1041 4.121  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.63 
_refine_ls_shell.d_res_low                        1.669 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               91.590 
_refine_ls_shell.number_reflns_R_work             2814 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.R_factor_R_free                  0.344 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             95 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                2909 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O6F 
_struct.title                     'Structure of metal- free rTp34 from Treponema pallidum' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O6F 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN, PROTEIN BINDING' 
_struct_keywords.text            'Ig-fold, syphilis, metal-ion binding, dimer, MEMBRANE PROTEIN, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 5 ? 
K N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 83 ? GLY A 89 ? GLU A 79 GLY A 85 5 ? 7 
HELX_P HELX_P2 2 GLU B 83 ? GLY B 89 ? GLU B 79 GLY B 85 5 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 59 A . ? HIS 55 A PRO 60 A ? PRO 56 A 1 -11.86 
2 HIS 59 B . ? HIS 55 B PRO 60 B ? PRO 56 B 1 -11.36 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 7 ? 
C ? 4 ? 
D ? 3 ? 
E ? 7 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? parallel      
E 6 7 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
A 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
A 3 ARG A 41  ? VAL A 43  ? ARG A 37  VAL A 39  
B 1 PHE A 35  ? PRO A 36  ? PHE A 31  PRO A 32  
B 2 LEU A 46  ? PHE A 53  ? LEU A 42  PHE A 49  
B 3 CYS A 73  ? ALA A 81  ? CYS A 69  ALA A 77  
B 4 GLY A 126 ? VAL A 133 ? GLY A 122 VAL A 129 
B 5 ALA A 119 ? ALA A 123 ? ALA A 115 ALA A 119 
B 6 SER B 157 ? HIS B 159 ? SER B 153 HIS B 155 
B 7 MET A 58  ? HIS A 59  ? MET A 54  HIS A 55  
C 1 GLN A 114 ? MET A 117 ? GLN A 110 MET A 113 
C 2 ARG A 100 ? LYS A 107 ? ARG A 96  LYS A 103 
C 3 GLY A 140 ? ALA A 149 ? GLY A 136 ALA A 145 
C 4 LEU A 175 ? TRP A 184 ? LEU A 171 TRP A 180 
D 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
D 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
D 3 ARG B 41  ? VAL B 43  ? ARG B 37  VAL B 39  
E 1 PHE B 35  ? PRO B 36  ? PHE B 31  PRO B 32  
E 2 LEU B 46  ? PHE B 53  ? LEU B 42  PHE B 49  
E 3 CYS B 73  ? ALA B 81  ? CYS B 69  ALA B 77  
E 4 GLY B 126 ? VAL B 133 ? GLY B 122 VAL B 129 
E 5 ALA B 119 ? ALA B 123 ? ALA B 115 ALA B 119 
E 6 SER A 157 ? HIS A 159 ? SER A 153 HIS A 155 
E 7 MET B 58  ? HIS B 59  ? MET B 54  HIS B 55  
F 1 GLN B 114 ? MET B 117 ? GLN B 110 MET B 113 
F 2 ARG B 100 ? LYS B 107 ? ARG B 96  LYS B 103 
F 3 GLY B 140 ? ALA B 149 ? GLY B 136 ALA B 145 
F 4 LEU B 175 ? TRP B 184 ? LEU B 171 TRP B 180 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
A 2 3 O VAL A 48  ? O VAL A 44  N ARG A 41  ? N ARG A 37  
B 1 2 N PHE A 35  ? N PHE A 31  O TYR A 52  ? O TYR A 48  
B 2 3 N HIS A 47  ? N HIS A 43  O HIS A 80  ? O HIS A 76  
B 3 4 N ALA A 77  ? N ALA A 73  O TYR A 129 ? O TYR A 125 
B 4 5 O GLY A 130 ? O GLY A 126 N ALA A 119 ? N ALA A 115 
B 5 6 N ASN A 122 ? N ASN A 118 O HIS B 159 ? O HIS B 155 
B 6 7 O LEU B 158 ? O LEU B 154 N HIS A 59  ? N HIS A 55  
C 1 2 O VAL A 116 ? O VAL A 112 N ALA A 103 ? N ALA A 99  
C 2 3 N VAL A 102 ? N VAL A 98  O GLU A 147 ? O GLU A 143 
C 3 4 N PHE A 146 ? N PHE A 142 O ALA A 177 ? O ALA A 173 
D 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
D 2 3 O VAL B 48  ? O VAL B 44  N ARG B 41  ? N ARG B 37  
E 1 2 N PHE B 35  ? N PHE B 31  O TYR B 52  ? O TYR B 48  
E 2 3 N HIS B 47  ? N HIS B 43  O HIS B 80  ? O HIS B 76  
E 3 4 N CYS B 73  ? N CYS B 69  O VAL B 133 ? O VAL B 129 
E 4 5 O GLY B 130 ? O GLY B 126 N ALA B 119 ? N ALA B 115 
E 5 6 O ASN B 122 ? O ASN B 118 N HIS A 159 ? N HIS A 155 
E 6 7 N LEU A 158 ? N LEU A 154 O HIS B 59  ? O HIS B 55  
F 1 2 O VAL B 116 ? O VAL B 112 N ALA B 103 ? N ALA B 99  
F 2 3 N VAL B 102 ? N VAL B 98  O GLU B 147 ? O GLU B 143 
F 3 4 N PHE B 146 ? N PHE B 142 O ALA B 177 ? O ALA B 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 9 'BINDING SITE FOR RESIDUE SO4 A 501' 
AC2 Software B SO4 502 ? 6 'BINDING SITE FOR RESIDUE SO4 B 502' 
AC3 Software A CL  302 ? 2 'BINDING SITE FOR RESIDUE CL A 302'  
AC4 Software A CL  303 ? 2 'BINDING SITE FOR RESIDUE CL A 303'  
AC5 Software A EDO 401 ? 7 'BINDING SITE FOR RESIDUE EDO A 401' 
AC6 Software A EDO 402 ? 6 'BINDING SITE FOR RESIDUE EDO A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ARG A 169 ? ARG A 165 . ? 1_555 ? 
2  AC1 9 TRP A 171 ? TRP A 167 . ? 1_555 ? 
3  AC1 9 SER A 172 ? SER A 168 . ? 1_555 ? 
4  AC1 9 GLU A 173 ? GLU A 169 . ? 1_555 ? 
5  AC1 9 HOH J .   ? HOH A 515 . ? 1_555 ? 
6  AC1 9 HOH J .   ? HOH A 535 . ? 1_555 ? 
7  AC1 9 HOH J .   ? HOH A 553 . ? 1_555 ? 
8  AC1 9 HOH J .   ? HOH A 587 . ? 1_555 ? 
9  AC1 9 HOH J .   ? HOH A 620 . ? 1_555 ? 
10 AC2 6 GLY B 38  ? GLY B 34  . ? 1_555 ? 
11 AC2 6 GLU B 39  ? GLU B 35  . ? 1_555 ? 
12 AC2 6 ARG B 41  ? ARG B 37  . ? 1_555 ? 
13 AC2 6 TRP B 179 ? TRP B 175 . ? 1_555 ? 
14 AC2 6 HOH K .   ? HOH B 548 . ? 1_555 ? 
15 AC2 6 HOH K .   ? HOH B 587 . ? 1_555 ? 
16 AC3 2 GLN A 106 ? GLN A 102 . ? 1_555 ? 
17 AC3 2 HOH J .   ? HOH A 647 . ? 1_555 ? 
18 AC4 2 SER A 152 ? SER A 148 . ? 1_555 ? 
19 AC4 2 HIS A 153 ? HIS A 149 . ? 1_555 ? 
20 AC5 7 PHE A 35  ? PHE A 31  . ? 4_566 ? 
21 AC5 7 PRO A 36  ? PRO A 32  . ? 4_566 ? 
22 AC5 7 TYR A 52  ? TYR A 48  . ? 4_566 ? 
23 AC5 7 ASP A 72  ? ASP A 68  . ? 1_555 ? 
24 AC5 7 LYS A 134 ? LYS A 130 . ? 1_555 ? 
25 AC5 7 LYS A 185 ? LYS A 181 . ? 4_566 ? 
26 AC5 7 HOH J .   ? HOH A 502 . ? 1_555 ? 
27 AC6 6 ARG A 41  ? ARG A 37  . ? 1_555 ? 
28 AC6 6 TRP A 179 ? TRP A 175 . ? 1_555 ? 
29 AC6 6 ASP A 180 ? ASP A 176 . ? 1_555 ? 
30 AC6 6 HOH J .   ? HOH A 514 . ? 1_555 ? 
31 AC6 6 HOH J .   ? HOH A 588 . ? 1_555 ? 
32 AC6 6 HOH J .   ? HOH A 645 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2O6F 
_atom_sites.fract_transf_matrix[1][1]   0.029196 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015144 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006622 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASP A 1 33  ? 10.168  38.987 79.614 1.00 28.37 ? 29  ASP A N   1 
ATOM   2    C  CA  . ASP A 1 33  ? 9.289   40.170 79.313 1.00 26.38 ? 29  ASP A CA  1 
ATOM   3    C  C   . ASP A 1 33  ? 9.512   40.754 77.920 1.00 24.86 ? 29  ASP A C   1 
ATOM   4    O  O   . ASP A 1 33  ? 10.686  41.028 77.573 1.00 26.00 ? 29  ASP A O   1 
ATOM   5    C  CB  . ASP A 1 33  ? 9.608   41.261 80.336 1.00 26.45 ? 29  ASP A CB  1 
ATOM   6    C  CG  . ASP A 1 33  ? 9.330   40.827 81.770 1.00 26.82 ? 29  ASP A CG  1 
ATOM   7    O  OD1 . ASP A 1 33  ? 8.594   39.831 81.964 1.00 27.81 ? 29  ASP A OD1 1 
ATOM   8    O  OD2 . ASP A 1 33  ? 9.817   41.529 82.649 1.00 29.23 ? 29  ASP A OD2 1 
ATOM   9    N  N   . GLU A 1 34  ? 8.428   40.965 77.154 1.00 23.55 ? 30  GLU A N   1 
ATOM   10   C  CA  . GLU A 1 34  ? 8.499   41.571 75.791 1.00 22.55 ? 30  GLU A CA  1 
ATOM   11   C  C   . GLU A 1 34  ? 8.067   43.045 75.839 1.00 21.23 ? 30  GLU A C   1 
ATOM   12   O  O   . GLU A 1 34  ? 7.078   43.380 76.501 1.00 21.71 ? 30  GLU A O   1 
ATOM   13   C  CB  . GLU A 1 34  ? 7.525   40.892 74.838 1.00 23.38 ? 30  GLU A CB  1 
ATOM   14   C  CG  . GLU A 1 34  ? 7.861   39.491 74.424 1.00 31.63 ? 30  GLU A CG  1 
ATOM   15   C  CD  . GLU A 1 34  ? 6.885   38.993 73.358 1.00 33.17 ? 30  GLU A CD  1 
ATOM   16   O  OE1 . GLU A 1 34  ? 5.686   39.420 73.354 1.00 39.44 ? 30  GLU A OE1 1 
ATOM   17   O  OE2 . GLU A 1 34  ? 7.298   38.187 72.505 1.00 42.79 ? 30  GLU A OE2 1 
ATOM   18   N  N   . PHE A 1 35  ? 8.767   43.899 75.113 1.00 19.41 ? 31  PHE A N   1 
ATOM   19   C  CA  . PHE A 1 35  ? 8.469   45.328 75.097 1.00 18.30 ? 31  PHE A CA  1 
ATOM   20   C  C   . PHE A 1 35  ? 8.128   45.736 73.700 1.00 19.08 ? 31  PHE A C   1 
ATOM   21   O  O   . PHE A 1 35  ? 8.697   45.223 72.756 1.00 20.14 ? 31  PHE A O   1 
ATOM   22   C  CB  . PHE A 1 35  ? 9.687   46.101 75.642 1.00 19.20 ? 31  PHE A CB  1 
ATOM   23   C  CG  . PHE A 1 35  ? 9.989   45.729 77.059 1.00 16.60 ? 31  PHE A CG  1 
ATOM   24   C  CD1 . PHE A 1 35  ? 10.812  44.635 77.339 1.00 16.32 ? 31  PHE A CD1 1 
ATOM   25   C  CD2 . PHE A 1 35  ? 9.355   46.378 78.109 1.00 17.55 ? 31  PHE A CD2 1 
ATOM   26   C  CE1 . PHE A 1 35  ? 11.067  44.224 78.657 1.00 16.47 ? 31  PHE A CE1 1 
ATOM   27   C  CE2 . PHE A 1 35  ? 9.601   45.960 79.474 1.00 19.06 ? 31  PHE A CE2 1 
ATOM   28   C  CZ  . PHE A 1 35  ? 10.455  44.885 79.720 1.00 17.76 ? 31  PHE A CZ  1 
ATOM   29   N  N   . PRO A 1 36  ? 7.138   46.607 73.539 1.00 18.97 ? 32  PRO A N   1 
ATOM   30   C  CA  . PRO A 1 36  ? 6.760   46.924 72.178 1.00 18.47 ? 32  PRO A CA  1 
ATOM   31   C  C   . PRO A 1 36  ? 7.639   47.887 71.432 1.00 19.31 ? 32  PRO A C   1 
ATOM   32   O  O   . PRO A 1 36  ? 8.252   48.789 72.044 1.00 19.56 ? 32  PRO A O   1 
ATOM   33   C  CB  . PRO A 1 36  ? 5.399   47.627 72.337 1.00 18.57 ? 32  PRO A CB  1 
ATOM   34   C  CG  . PRO A 1 36  ? 5.472   48.246 73.720 1.00 18.45 ? 32  PRO A CG  1 
ATOM   35   C  CD  . PRO A 1 36  ? 6.319   47.304 74.556 1.00 19.17 ? 32  PRO A CD  1 
ATOM   36   N  N   . ILE A 1 37  ? 7.734   47.679 70.109 1.00 19.99 ? 33  ILE A N   1 
ATOM   37   C  CA  A ILE A 1 37  ? 8.492   48.582 69.253 0.50 20.13 ? 33  ILE A CA  1 
ATOM   38   C  CA  B ILE A 1 37  ? 8.510   48.599 69.269 0.50 19.95 ? 33  ILE A CA  1 
ATOM   39   C  C   . ILE A 1 37  ? 7.587   49.755 68.885 1.00 19.64 ? 33  ILE A C   1 
ATOM   40   O  O   . ILE A 1 37  ? 8.010   50.938 68.815 1.00 20.42 ? 33  ILE A O   1 
ATOM   41   C  CB  A ILE A 1 37  ? 8.962   47.876 67.974 0.50 20.66 ? 33  ILE A CB  1 
ATOM   42   C  CB  B ILE A 1 37  ? 9.072   47.961 67.967 0.50 20.36 ? 33  ILE A CB  1 
ATOM   43   C  CG1 A ILE A 1 37  ? 10.084  46.909 68.352 0.50 21.32 ? 33  ILE A CG1 1 
ATOM   44   C  CG1 B ILE A 1 37  ? 10.075  46.844 68.293 0.50 20.54 ? 33  ILE A CG1 1 
ATOM   45   C  CG2 A ILE A 1 37  ? 9.424   48.890 66.936 0.50 21.05 ? 33  ILE A CG2 1 
ATOM   46   C  CG2 B ILE A 1 37  ? 9.738   49.045 67.099 0.50 20.32 ? 33  ILE A CG2 1 
ATOM   47   C  CD1 A ILE A 1 37  ? 10.950  46.479 67.219 0.50 21.30 ? 33  ILE A CD1 1 
ATOM   48   C  CD1 B ILE A 1 37  ? 11.545  47.298 68.469 0.50 17.85 ? 33  ILE A CD1 1 
ATOM   49   N  N   . GLY A 1 38  ? 6.315   49.439 68.695 1.00 18.79 ? 34  GLY A N   1 
ATOM   50   C  CA  . GLY A 1 38  ? 5.288   50.398 68.309 1.00 19.00 ? 34  GLY A CA  1 
ATOM   51   C  C   . GLY A 1 38  ? 4.012   49.655 67.991 1.00 18.46 ? 34  GLY A C   1 
ATOM   52   O  O   . GLY A 1 38  ? 3.926   48.430 68.165 1.00 19.33 ? 34  GLY A O   1 
ATOM   53   N  N   . GLU A 1 39  ? 3.025   50.382 67.463 1.00 18.05 ? 35  GLU A N   1 
ATOM   54   C  CA  . GLU A 1 39  ? 1.759   49.806 67.142 1.00 19.20 ? 35  GLU A CA  1 
ATOM   55   C  C   . GLU A 1 39  ? 1.859   48.738 66.033 1.00 18.60 ? 35  GLU A C   1 
ATOM   56   O  O   . GLU A 1 39  ? 2.584   48.882 65.072 1.00 18.18 ? 35  GLU A O   1 
ATOM   57   C  CB  . GLU A 1 39  ? 0.815   50.917 66.692 1.00 18.93 ? 35  GLU A CB  1 
ATOM   58   C  CG  . GLU A 1 39  ? -0.605  50.450 66.617 1.00 22.28 ? 35  GLU A CG  1 
ATOM   59   C  CD  . GLU A 1 39  ? -1.584  51.555 66.327 1.00 26.17 ? 35  GLU A CD  1 
ATOM   60   O  OE1 . GLU A 1 39  ? -1.188  52.642 65.837 1.00 26.39 ? 35  GLU A OE1 1 
ATOM   61   O  OE2 . GLU A 1 39  ? -2.762  51.301 66.612 1.00 29.65 ? 35  GLU A OE2 1 
ATOM   62   N  N   . ASP A 1 40  ? 1.081   47.671 66.169 1.00 18.02 ? 36  ASP A N   1 
ATOM   63   C  CA  . ASP A 1 40  ? 1.109   46.639 65.132 1.00 18.99 ? 36  ASP A CA  1 
ATOM   64   C  C   . ASP A 1 40  ? 0.661   47.230 63.800 1.00 18.86 ? 36  ASP A C   1 
ATOM   65   O  O   . ASP A 1 40  ? -0.181  48.164 63.756 1.00 19.51 ? 36  ASP A O   1 
ATOM   66   C  CB  . ASP A 1 40  ? 0.148   45.484 65.402 1.00 20.75 ? 36  ASP A CB  1 
ATOM   67   C  CG  . ASP A 1 40  ? 0.527   44.623 66.588 1.00 24.36 ? 36  ASP A CG  1 
ATOM   68   O  OD1 . ASP A 1 40  ? 1.588   44.807 67.203 1.00 27.03 ? 36  ASP A OD1 1 
ATOM   69   O  OD2 . ASP A 1 40  ? -0.311  43.710 66.863 1.00 33.05 ? 36  ASP A OD2 1 
ATOM   70   N  N   . ARG A 1 41  ? 1.194   46.679 62.722 1.00 18.95 ? 37  ARG A N   1 
ATOM   71   C  CA  . ARG A 1 41  ? 0.828   47.129 61.365 1.00 20.00 ? 37  ARG A CA  1 
ATOM   72   C  C   . ARG A 1 41  ? 0.163   46.059 60.519 1.00 20.50 ? 37  ARG A C   1 
ATOM   73   O  O   . ARG A 1 41  ? 0.457   44.887 60.678 1.00 21.83 ? 37  ARG A O   1 
ATOM   74   C  CB  . ARG A 1 41  ? 2.083   47.547 60.573 1.00 19.52 ? 37  ARG A CB  1 
ATOM   75   C  CG  . ARG A 1 41  ? 2.993   48.561 61.233 1.00 21.69 ? 37  ARG A CG  1 
ATOM   76   C  CD  . ARG A 1 41  ? 2.269   49.832 61.517 1.00 21.90 ? 37  ARG A CD  1 
ATOM   77   N  NE  . ARG A 1 41  ? 3.218   50.871 61.895 1.00 23.47 ? 37  ARG A NE  1 
ATOM   78   C  CZ  . ARG A 1 41  ? 2.876   51.903 62.660 1.00 20.94 ? 37  ARG A CZ  1 
ATOM   79   N  NH1 . ARG A 1 41  ? 1.605   52.013 63.112 1.00 22.69 ? 37  ARG A NH1 1 
ATOM   80   N  NH2 . ARG A 1 41  ? 3.758   52.839 62.942 1.00 20.68 ? 37  ARG A NH2 1 
ATOM   81   N  N   . ASP A 1 42  ? -0.699  46.488 59.591 1.00 21.35 ? 38  ASP A N   1 
ATOM   82   C  CA  . ASP A 1 42  ? -1.264  45.568 58.596 1.00 22.39 ? 38  ASP A CA  1 
ATOM   83   C  C   . ASP A 1 42  ? -0.714  46.125 57.283 1.00 22.68 ? 38  ASP A C   1 
ATOM   84   O  O   . ASP A 1 42  ? -0.934  47.301 56.958 1.00 22.66 ? 38  ASP A O   1 
ATOM   85   C  CB  . ASP A 1 42  ? -2.786  45.488 58.586 1.00 24.79 ? 38  ASP A CB  1 
ATOM   86   C  CG  . ASP A 1 42  ? -3.313  44.377 59.503 1.00 29.18 ? 38  ASP A CG  1 
ATOM   87   O  OD1 . ASP A 1 42  ? -3.099  43.169 59.225 1.00 29.58 ? 38  ASP A OD1 1 
ATOM   88   O  OD2 . ASP A 1 42  ? -3.986  44.720 60.495 1.00 38.63 ? 38  ASP A OD2 1 
ATOM   89   N  N   . VAL A 1 43  ? 0.061   45.304 56.564 1.00 20.78 ? 39  VAL A N   1 
ATOM   90   C  CA  . VAL A 1 43  ? 0.660   45.720 55.301 1.00 22.13 ? 39  VAL A CA  1 
ATOM   91   C  C   . VAL A 1 43  ? 0.482   44.601 54.291 1.00 20.12 ? 39  VAL A C   1 
ATOM   92   O  O   . VAL A 1 43  ? 0.961   43.480 54.505 1.00 20.23 ? 39  VAL A O   1 
ATOM   93   C  CB  . VAL A 1 43  ? 2.151   46.198 55.468 1.00 21.95 ? 39  VAL A CB  1 
ATOM   94   C  CG1 . VAL A 1 43  ? 3.081   45.081 55.989 1.00 22.16 ? 39  VAL A CG1 1 
ATOM   95   C  CG2 . VAL A 1 43  ? 2.668   46.768 54.174 1.00 25.64 ? 39  VAL A CG2 1 
ATOM   96   N  N   . GLY A 1 44  ? -0.230  44.873 53.193 1.00 20.89 ? 40  GLY A N   1 
ATOM   97   C  CA  . GLY A 1 44  ? -0.475  43.819 52.215 1.00 20.42 ? 40  GLY A CA  1 
ATOM   98   C  C   . GLY A 1 44  ? -1.201  42.666 52.908 1.00 19.41 ? 40  GLY A C   1 
ATOM   99   O  O   . GLY A 1 44  ? -2.125  42.907 53.710 1.00 21.50 ? 40  GLY A O   1 
ATOM   100  N  N   . PRO A 1 45  ? -0.792  41.414 52.651 1.00 19.40 ? 41  PRO A N   1 
ATOM   101  C  CA  . PRO A 1 45  ? -1.424  40.265 53.274 1.00 19.03 ? 41  PRO A CA  1 
ATOM   102  C  C   . PRO A 1 45  ? -0.837  39.909 54.647 1.00 19.14 ? 41  PRO A C   1 
ATOM   103  O  O   . PRO A 1 45  ? -1.096  38.816 55.151 1.00 20.03 ? 41  PRO A O   1 
ATOM   104  C  CB  . PRO A 1 45  ? -1.085  39.121 52.287 1.00 19.57 ? 41  PRO A CB  1 
ATOM   105  C  CG  . PRO A 1 45  ? 0.284   39.474 51.823 1.00 21.55 ? 41  PRO A CG  1 
ATOM   106  C  CD  . PRO A 1 45  ? 0.293   40.982 51.719 1.00 19.96 ? 41  PRO A CD  1 
ATOM   107  N  N   . LEU A 1 46  ? -0.020  40.799 55.201 1.00 18.69 ? 42  LEU A N   1 
ATOM   108  C  CA  . LEU A 1 46  ? 0.608   40.533 56.485 1.00 17.59 ? 42  LEU A CA  1 
ATOM   109  C  C   . LEU A 1 46  ? 0.194   41.415 57.651 1.00 18.95 ? 42  LEU A C   1 
ATOM   110  O  O   . LEU A 1 46  ? 0.053   42.616 57.496 1.00 20.39 ? 42  LEU A O   1 
ATOM   111  C  CB  . LEU A 1 46  ? 2.166   40.712 56.366 1.00 17.46 ? 42  LEU A CB  1 
ATOM   112  C  CG  . LEU A 1 46  ? 2.847   39.975 55.207 1.00 18.60 ? 42  LEU A CG  1 
ATOM   113  C  CD1 . LEU A 1 46  ? 4.375   40.247 55.124 1.00 17.42 ? 42  LEU A CD1 1 
ATOM   114  C  CD2 . LEU A 1 46  ? 2.579   38.491 55.194 1.00 17.65 ? 42  LEU A CD2 1 
ATOM   115  N  N   . HIS A 1 47  ? 0.095   40.797 58.838 1.00 18.59 ? 43  HIS A N   1 
ATOM   116  C  CA  . HIS A 1 47  ? -0.072  41.506 60.097 1.00 18.29 ? 43  HIS A CA  1 
ATOM   117  C  C   . HIS A 1 47  ? 1.318   41.428 60.700 1.00 19.14 ? 43  HIS A C   1 
ATOM   118  O  O   . HIS A 1 47  ? 1.896   40.340 60.883 1.00 20.00 ? 43  HIS A O   1 
ATOM   119  C  CB  . HIS A 1 47  ? -1.068  40.818 61.019 1.00 19.37 ? 43  HIS A CB  1 
ATOM   120  C  CG  . HIS A 1 47  ? -1.294  41.600 62.270 1.00 20.86 ? 43  HIS A CG  1 
ATOM   121  N  ND1 . HIS A 1 47  ? -0.641  41.322 63.446 1.00 26.93 ? 43  HIS A ND1 1 
ATOM   122  C  CD2 . HIS A 1 47  ? -2.062  42.690 62.505 1.00 23.02 ? 43  HIS A CD2 1 
ATOM   123  C  CE1 . HIS A 1 47  ? -1.027  42.181 64.372 1.00 22.03 ? 43  HIS A CE1 1 
ATOM   124  N  NE2 . HIS A 1 47  ? -1.873  43.028 63.827 1.00 26.38 ? 43  HIS A NE2 1 
ATOM   125  N  N   . VAL A 1 48  ? 1.882   42.598 60.994 1.00 16.91 ? 44  VAL A N   1 
ATOM   126  C  CA  . VAL A 1 48  ? 3.270   42.651 61.507 1.00 17.82 ? 44  VAL A CA  1 
ATOM   127  C  C   . VAL A 1 48  ? 3.339   43.371 62.862 1.00 18.63 ? 44  VAL A C   1 
ATOM   128  O  O   . VAL A 1 48  ? 2.879   44.499 63.000 1.00 20.14 ? 44  VAL A O   1 
ATOM   129  C  CB  . VAL A 1 48  ? 4.131   43.428 60.490 1.00 17.50 ? 44  VAL A CB  1 
ATOM   130  C  CG1 . VAL A 1 48  ? 5.592   43.554 60.932 1.00 19.72 ? 44  VAL A CG1 1 
ATOM   131  C  CG2 . VAL A 1 48  ? 4.109   42.821 59.065 1.00 16.78 ? 44  VAL A CG2 1 
ATOM   132  N  N   . GLY A 1 49  ? 3.901   42.674 63.823 1.00 18.40 ? 45  GLY A N   1 
ATOM   133  C  CA  . GLY A 1 49  ? 4.157   43.184 65.180 1.00 19.18 ? 45  GLY A CA  1 
ATOM   134  C  C   . GLY A 1 49  ? 5.654   43.221 65.399 1.00 19.26 ? 45  GLY A C   1 
ATOM   135  O  O   . GLY A 1 49  ? 6.449   42.461 64.777 1.00 19.91 ? 45  GLY A O   1 
ATOM   136  N  N   . GLY A 1 50  ? 6.076   44.124 66.282 1.00 18.73 ? 46  GLY A N   1 
ATOM   137  C  CA  . GLY A 1 50  ? 7.484   44.261 66.571 1.00 19.16 ? 46  GLY A CA  1 
ATOM   138  C  C   . GLY A 1 50  ? 7.656   44.418 68.077 1.00 20.51 ? 46  GLY A C   1 
ATOM   139  O  O   . GLY A 1 50  ? 6.957   45.234 68.712 1.00 18.30 ? 46  GLY A O   1 
ATOM   140  N  N   . VAL A 1 51  ? 8.517   43.578 68.633 1.00 18.26 ? 47  VAL A N   1 
ATOM   141  C  CA  . VAL A 1 51  ? 8.830   43.646 70.063 1.00 18.56 ? 47  VAL A CA  1 
ATOM   142  C  C   . VAL A 1 51  ? 10.327  43.497 70.248 1.00 18.99 ? 47  VAL A C   1 
ATOM   143  O  O   . VAL A 1 51  ? 11.092  43.102 69.330 1.00 18.47 ? 47  VAL A O   1 
ATOM   144  C  CB  . VAL A 1 51  ? 8.091   42.535 70.926 1.00 17.71 ? 47  VAL A CB  1 
ATOM   145  C  CG1 . VAL A 1 51  ? 6.582   42.605 70.789 1.00 19.38 ? 47  VAL A CG1 1 
ATOM   146  C  CG2 . VAL A 1 51  ? 8.611   41.153 70.587 1.00 20.31 ? 47  VAL A CG2 1 
ATOM   147  N  N   . TYR A 1 52  ? 10.773  43.830 71.457 1.00 17.99 ? 48  TYR A N   1 
ATOM   148  C  CA  . TYR A 1 52  ? 12.192  43.668 71.787 1.00 19.04 ? 48  TYR A CA  1 
ATOM   149  C  C   . TYR A 1 52  ? 12.261  43.205 73.239 1.00 19.93 ? 48  TYR A C   1 
ATOM   150  O  O   . TYR A 1 52  ? 11.344  43.436 74.055 1.00 19.66 ? 48  TYR A O   1 
ATOM   151  C  CB  . TYR A 1 52  ? 13.012  44.927 71.557 1.00 19.29 ? 48  TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 52  ? 12.763  46.071 72.535 1.00 17.82 ? 48  TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 52  ? 11.584  46.859 72.464 1.00 21.78 ? 48  TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 52  ? 13.694  46.334 73.580 1.00 18.35 ? 48  TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 52  ? 11.398  47.905 73.363 1.00 19.63 ? 48  TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 52  ? 13.496  47.383 74.499 1.00 17.68 ? 48  TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 52  ? 12.335  48.150 74.358 1.00 20.66 ? 48  TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 52  ? 12.245  49.133 75.256 1.00 22.87 ? 48  TYR A OH  1 
ATOM   159  N  N   . PHE A 1 53  ? 13.360  42.531 73.557 1.00 19.51 ? 49  PHE A N   1 
ATOM   160  C  CA  . PHE A 1 53  ? 13.542  41.990 74.900 1.00 18.98 ? 49  PHE A CA  1 
ATOM   161  C  C   . PHE A 1 53  ? 15.022  41.692 75.056 1.00 19.14 ? 49  PHE A C   1 
ATOM   162  O  O   . PHE A 1 53  ? 15.852  42.040 74.192 1.00 18.16 ? 49  PHE A O   1 
ATOM   163  C  CB  . PHE A 1 53  ? 12.618  40.765 75.157 1.00 18.86 ? 49  PHE A CB  1 
ATOM   164  C  CG  . PHE A 1 53  ? 12.566  39.767 74.029 1.00 19.74 ? 49  PHE A CG  1 
ATOM   165  C  CD1 . PHE A 1 53  ? 13.572  38.788 73.850 1.00 20.94 ? 49  PHE A CD1 1 
ATOM   166  C  CD2 . PHE A 1 53  ? 11.493  39.768 73.133 1.00 18.11 ? 49  PHE A CD2 1 
ATOM   167  C  CE1 . PHE A 1 53  ? 13.461  37.844 72.822 1.00 21.29 ? 49  PHE A CE1 1 
ATOM   168  C  CE2 . PHE A 1 53  ? 11.361  38.811 72.099 1.00 20.09 ? 49  PHE A CE2 1 
ATOM   169  C  CZ  . PHE A 1 53  ? 12.351  37.845 71.938 1.00 22.54 ? 49  PHE A CZ  1 
ATOM   170  N  N   . GLN A 1 54  ? 15.376  41.154 76.219 1.00 18.99 ? 50  GLN A N   1 
ATOM   171  C  CA  . GLN A 1 54  ? 16.780  40.854 76.490 1.00 21.08 ? 50  GLN A CA  1 
ATOM   172  C  C   . GLN A 1 54  ? 17.412  39.973 75.383 1.00 19.63 ? 50  GLN A C   1 
ATOM   173  O  O   . GLN A 1 54  ? 16.729  39.113 74.787 1.00 19.61 ? 50  GLN A O   1 
ATOM   174  C  CB  . GLN A 1 54  ? 16.911  40.242 77.890 1.00 22.94 ? 50  GLN A CB  1 
ATOM   175  C  CG  . GLN A 1 54  ? 16.322  38.890 78.002 1.00 29.55 ? 50  GLN A CG  1 
ATOM   176  C  CD  . GLN A 1 54  ? 16.684  38.195 79.315 1.00 39.79 ? 50  GLN A CD  1 
ATOM   177  O  OE1 . GLN A 1 54  ? 17.264  38.808 80.232 1.00 43.04 ? 50  GLN A OE1 1 
ATOM   178  N  NE2 . GLN A 1 54  ? 16.338  36.901 79.409 1.00 43.49 ? 50  GLN A NE2 1 
ATOM   179  N  N   . PRO A 1 55  ? 18.695  40.200 75.106 1.00 20.26 ? 51  PRO A N   1 
ATOM   180  C  CA  . PRO A 1 55  ? 19.355  39.372 74.094 1.00 20.70 ? 51  PRO A CA  1 
ATOM   181  C  C   . PRO A 1 55  ? 19.287  37.911 74.470 1.00 21.25 ? 51  PRO A C   1 
ATOM   182  O  O   . PRO A 1 55  ? 19.279  37.554 75.654 1.00 21.51 ? 51  PRO A O   1 
ATOM   183  C  CB  . PRO A 1 55  ? 20.795  39.869 74.112 1.00 20.33 ? 51  PRO A CB  1 
ATOM   184  C  CG  . PRO A 1 55  ? 20.793  41.157 74.825 1.00 22.80 ? 51  PRO A CG  1 
ATOM   185  C  CD  . PRO A 1 55  ? 19.597  41.201 75.722 1.00 19.80 ? 51  PRO A CD  1 
ATOM   186  N  N   . VAL A 1 56  ? 19.260  37.053 73.461 1.00 20.79 ? 52  VAL A N   1 
ATOM   187  C  CA  . VAL A 1 56  ? 19.123  35.635 73.711 1.00 21.47 ? 52  VAL A CA  1 
ATOM   188  C  C   . VAL A 1 56  ? 20.293  34.808 73.174 1.00 22.58 ? 52  VAL A C   1 
ATOM   189  O  O   . VAL A 1 56  ? 21.084  35.272 72.317 1.00 23.33 ? 52  VAL A O   1 
ATOM   190  C  CB  . VAL A 1 56  ? 17.800  35.099 73.086 1.00 21.43 ? 52  VAL A CB  1 
ATOM   191  C  CG1 . VAL A 1 56  ? 16.580  35.770 73.763 1.00 25.29 ? 52  VAL A CG1 1 
ATOM   192  C  CG2 . VAL A 1 56  ? 17.795  35.363 71.608 1.00 24.24 ? 52  VAL A CG2 1 
ATOM   193  N  N   . GLU A 1 57  ? 20.379  33.582 73.666 1.00 23.42 ? 53  GLU A N   1 
ATOM   194  C  CA  . GLU A 1 57  ? 21.397  32.630 73.210 1.00 23.73 ? 53  GLU A CA  1 
ATOM   195  C  C   . GLU A 1 57  ? 20.631  31.788 72.177 1.00 23.21 ? 53  GLU A C   1 
ATOM   196  O  O   . GLU A 1 57  ? 19.607  31.156 72.488 1.00 23.64 ? 53  GLU A O   1 
ATOM   197  C  CB  . GLU A 1 57  ? 21.877  31.721 74.334 1.00 23.38 ? 53  GLU A CB  1 
ATOM   198  C  CG  . GLU A 1 57  ? 22.946  30.748 73.816 1.00 28.83 ? 53  GLU A CG  1 
ATOM   199  C  CD  . GLU A 1 57  ? 23.635  29.993 74.919 1.00 36.72 ? 53  GLU A CD  1 
ATOM   200  O  OE1 . GLU A 1 57  ? 23.065  29.921 76.043 1.00 39.34 ? 53  GLU A OE1 1 
ATOM   201  O  OE2 . GLU A 1 57  ? 24.754  29.488 74.658 1.00 40.42 ? 53  GLU A OE2 1 
ATOM   202  N  N   . MET A 1 58  ? 21.120  31.814 70.946 1.00 23.48 ? 54  MET A N   1 
ATOM   203  C  CA  . MET A 1 58  ? 20.494  31.057 69.850 1.00 23.83 ? 54  MET A CA  1 
ATOM   204  C  C   . MET A 1 58  ? 21.376  29.935 69.328 1.00 24.20 ? 54  MET A C   1 
ATOM   205  O  O   . MET A 1 58  ? 22.596  30.073 69.284 1.00 25.06 ? 54  MET A O   1 
ATOM   206  C  CB  . MET A 1 58  ? 20.187  31.992 68.714 1.00 23.53 ? 54  MET A CB  1 
ATOM   207  C  CG  . MET A 1 58  ? 19.140  33.038 69.104 1.00 23.28 ? 54  MET A CG  1 
ATOM   208  S  SD  . MET A 1 58  ? 19.029  34.372 67.870 1.00 26.82 ? 54  MET A SD  1 
ATOM   209  C  CE  . MET A 1 58  ? 20.488  35.332 68.390 1.00 25.33 ? 54  MET A CE  1 
ATOM   210  N  N   . HIS A 1 59  ? 20.755  28.813 68.943 1.00 24.03 ? 55  HIS A N   1 
ATOM   211  C  CA  . HIS A 1 59  ? 21.516  27.676 68.424 1.00 25.31 ? 55  HIS A CA  1 
ATOM   212  C  C   . HIS A 1 59  ? 20.924  27.123 67.111 1.00 25.48 ? 55  HIS A C   1 
ATOM   213  O  O   . HIS A 1 59  ? 19.731  26.849 67.058 1.00 23.63 ? 55  HIS A O   1 
ATOM   214  C  CB  . HIS A 1 59  ? 21.562  26.547 69.445 1.00 26.14 ? 55  HIS A CB  1 
ATOM   215  C  CG  . HIS A 1 59  ? 22.168  25.291 68.891 1.00 29.88 ? 55  HIS A CG  1 
ATOM   216  N  ND1 . HIS A 1 59  ? 23.512  25.184 68.600 1.00 34.69 ? 55  HIS A ND1 1 
ATOM   217  C  CD2 . HIS A 1 59  ? 21.598  24.132 68.477 1.00 32.77 ? 55  HIS A CD2 1 
ATOM   218  C  CE1 . HIS A 1 59  ? 23.753  23.991 68.077 1.00 35.35 ? 55  HIS A CE1 1 
ATOM   219  N  NE2 . HIS A 1 59  ? 22.608  23.336 67.987 1.00 33.40 ? 55  HIS A NE2 1 
ATOM   220  N  N   . PRO A 1 60  ? 21.725  27.030 66.028 1.00 26.66 ? 56  PRO A N   1 
ATOM   221  C  CA  . PRO A 1 60  ? 23.047  27.606 65.852 1.00 27.73 ? 56  PRO A CA  1 
ATOM   222  C  C   . PRO A 1 60  ? 22.945  29.124 65.963 1.00 28.30 ? 56  PRO A C   1 
ATOM   223  O  O   . PRO A 1 60  ? 21.858  29.666 65.780 1.00 28.84 ? 56  PRO A O   1 
ATOM   224  C  CB  . PRO A 1 60  ? 23.387  27.232 64.403 1.00 28.44 ? 56  PRO A CB  1 
ATOM   225  C  CG  . PRO A 1 60  ? 22.574  26.051 64.094 1.00 29.13 ? 56  PRO A CG  1 
ATOM   226  C  CD  . PRO A 1 60  ? 21.279  26.361 64.794 1.00 26.72 ? 56  PRO A CD  1 
ATOM   227  N  N   . ALA A 1 61  ? 24.046  29.801 66.264 1.00 28.45 ? 57  ALA A N   1 
ATOM   228  C  CA  . ALA A 1 61  ? 24.022  31.260 66.362 1.00 29.57 ? 57  ALA A CA  1 
ATOM   229  C  C   . ALA A 1 61  ? 23.900  31.775 64.926 1.00 29.95 ? 57  ALA A C   1 
ATOM   230  O  O   . ALA A 1 61  ? 24.691  31.386 64.060 1.00 31.12 ? 57  ALA A O   1 
ATOM   231  C  CB  . ALA A 1 61  ? 25.298  31.780 67.050 1.00 30.30 ? 57  ALA A CB  1 
ATOM   232  N  N   . PRO A 1 62  ? 22.862  32.586 64.652 1.00 29.22 ? 58  PRO A N   1 
ATOM   233  C  CA  . PRO A 1 62  ? 22.473  33.013 63.308 1.00 30.29 ? 58  PRO A CA  1 
ATOM   234  C  C   . PRO A 1 62  ? 23.326  34.100 62.673 1.00 31.26 ? 58  PRO A C   1 
ATOM   235  O  O   . PRO A 1 62  ? 23.613  35.121 63.299 1.00 31.21 ? 58  PRO A O   1 
ATOM   236  C  CB  . PRO A 1 62  ? 21.034  33.507 63.513 1.00 29.19 ? 58  PRO A CB  1 
ATOM   237  C  CG  . PRO A 1 62  ? 21.021  33.968 64.898 1.00 28.26 ? 58  PRO A CG  1 
ATOM   238  C  CD  . PRO A 1 62  ? 21.893  33.074 65.664 1.00 28.94 ? 58  PRO A CD  1 
ATOM   239  N  N   . GLY A 1 63  ? 23.718  33.866 61.423 1.00 31.85 ? 59  GLY A N   1 
ATOM   240  C  CA  . GLY A 1 63  ? 24.514  34.819 60.682 1.00 32.11 ? 59  GLY A CA  1 
ATOM   241  C  C   . GLY A 1 63  ? 25.625  35.473 61.491 1.00 31.38 ? 59  GLY A C   1 
ATOM   242  O  O   . GLY A 1 63  ? 26.356  34.816 62.245 1.00 32.15 ? 59  GLY A O   1 
ATOM   243  N  N   . ALA A 1 64  ? 25.703  36.794 61.349 1.00 31.29 ? 60  ALA A N   1 
ATOM   244  C  CA  . ALA A 1 64  ? 26.719  37.614 62.006 1.00 29.47 ? 60  ALA A CA  1 
ATOM   245  C  C   . ALA A 1 64  ? 26.120  38.407 63.166 1.00 28.37 ? 60  ALA A C   1 
ATOM   246  O  O   . ALA A 1 64  ? 26.620  39.463 63.536 1.00 27.60 ? 60  ALA A O   1 
ATOM   247  C  CB  . ALA A 1 64  ? 27.346  38.570 60.980 1.00 30.94 ? 60  ALA A CB  1 
ATOM   248  N  N   . GLN A 1 65  ? 25.026  37.904 63.729 1.00 26.02 ? 61  GLN A N   1 
ATOM   249  C  CA  . GLN A 1 65  ? 24.414  38.617 64.836 1.00 24.05 ? 61  GLN A CA  1 
ATOM   250  C  C   . GLN A 1 65  ? 25.297  38.631 66.085 1.00 23.69 ? 61  GLN A C   1 
ATOM   251  O  O   . GLN A 1 65  ? 25.991  37.636 66.377 1.00 23.66 ? 61  GLN A O   1 
ATOM   252  C  CB  . GLN A 1 65  ? 23.072  38.002 65.194 1.00 23.23 ? 61  GLN A CB  1 
ATOM   253  C  CG  . GLN A 1 65  ? 22.122  37.977 64.055 1.00 23.43 ? 61  GLN A CG  1 
ATOM   254  C  CD  . GLN A 1 65  ? 20.753  37.468 64.471 1.00 21.08 ? 61  GLN A CD  1 
ATOM   255  O  OE1 . GLN A 1 65  ? 20.470  37.333 65.668 1.00 20.93 ? 61  GLN A OE1 1 
ATOM   256  N  NE2 . GLN A 1 65  ? 19.901  37.163 63.477 1.00 23.65 ? 61  GLN A NE2 1 
ATOM   257  N  N   . PRO A 1 66  ? 25.243  39.727 66.856 1.00 23.43 ? 62  PRO A N   1 
ATOM   258  C  CA  . PRO A 1 66  ? 25.998  39.707 68.110 1.00 23.08 ? 62  PRO A CA  1 
ATOM   259  C  C   . PRO A 1 66  ? 25.527  38.641 69.098 1.00 21.97 ? 62  PRO A C   1 
ATOM   260  O  O   . PRO A 1 66  ? 24.332  38.227 69.123 1.00 21.58 ? 62  PRO A O   1 
ATOM   261  C  CB  . PRO A 1 66  ? 25.797  41.128 68.685 1.00 23.76 ? 62  PRO A CB  1 
ATOM   262  C  CG  . PRO A 1 66  ? 24.584  41.645 68.020 1.00 26.08 ? 62  PRO A CG  1 
ATOM   263  C  CD  . PRO A 1 66  ? 24.540  41.005 66.662 1.00 23.78 ? 62  PRO A CD  1 
ATOM   264  N  N   . SER A 1 67  ? 26.475  38.215 69.919 1.00 21.47 ? 63  SER A N   1 
ATOM   265  C  CA  . SER A 1 67  ? 26.224  37.245 70.978 1.00 21.37 ? 63  SER A CA  1 
ATOM   266  C  C   . SER A 1 67  ? 25.285  37.849 72.016 1.00 21.49 ? 63  SER A C   1 
ATOM   267  O  O   . SER A 1 67  ? 25.056  39.070 72.054 1.00 21.16 ? 63  SER A O   1 
ATOM   268  C  CB  . SER A 1 67  ? 27.584  36.905 71.656 1.00 20.62 ? 63  SER A CB  1 
ATOM   269  O  OG  . SER A 1 67  ? 28.063  37.995 72.441 1.00 22.47 ? 63  SER A OG  1 
ATOM   270  N  N   . LYS A 1 68  ? 24.771  37.002 72.895 1.00 22.36 ? 64  LYS A N   1 
ATOM   271  C  CA  . LYS A 1 68  ? 23.897  37.455 73.974 1.00 22.64 ? 64  LYS A CA  1 
ATOM   272  C  C   . LYS A 1 68  ? 24.609  38.545 74.825 1.00 22.19 ? 64  LYS A C   1 
ATOM   273  O  O   . LYS A 1 68  ? 24.016  39.519 75.213 1.00 22.27 ? 64  LYS A O   1 
ATOM   274  C  CB  . LYS A 1 68  ? 23.560  36.234 74.828 1.00 24.83 ? 64  LYS A CB  1 
ATOM   275  C  CG  . LYS A 1 68  ? 22.840  36.529 76.109 1.00 27.29 ? 64  LYS A CG  1 
ATOM   276  C  CD  . LYS A 1 68  ? 22.635  35.222 76.863 1.00 31.80 ? 64  LYS A CD  1 
ATOM   277  C  CE  . LYS A 1 68  ? 21.613  35.390 78.001 1.00 38.56 ? 64  LYS A CE  1 
ATOM   278  N  NZ  . LYS A 1 68  ? 21.129  34.069 78.532 1.00 42.56 ? 64  LYS A NZ  1 
ATOM   279  N  N   . GLU A 1 69  ? 25.910  38.350 75.083 1.00 22.56 ? 65  GLU A N   1 
ATOM   280  C  CA  . GLU A 1 69  ? 26.661  39.324 75.881 1.00 23.09 ? 65  GLU A CA  1 
ATOM   281  C  C   . GLU A 1 69  ? 26.959  40.639 75.140 1.00 23.03 ? 65  GLU A C   1 
ATOM   282  O  O   . GLU A 1 69  ? 26.974  41.683 75.786 1.00 23.86 ? 65  GLU A O   1 
ATOM   283  C  CB  . GLU A 1 69  ? 28.004  38.731 76.302 1.00 22.54 ? 65  GLU A CB  1 
ATOM   284  C  CG  . GLU A 1 69  ? 27.901  37.545 77.203 1.00 24.87 ? 65  GLU A CG  1 
ATOM   285  C  CD  . GLU A 1 69  ? 27.493  36.256 76.497 1.00 29.24 ? 65  GLU A CD  1 
ATOM   286  O  OE1 . GLU A 1 69  ? 27.638  36.132 75.247 1.00 27.68 ? 65  GLU A OE1 1 
ATOM   287  O  OE2 . GLU A 1 69  ? 27.025  35.347 77.228 1.00 33.71 ? 65  GLU A OE2 1 
ATOM   288  N  N   . GLU A 1 70  ? 27.247  40.562 73.841 1.00 22.77 ? 66  GLU A N   1 
ATOM   289  C  CA  . GLU A 1 70  ? 27.587  41.740 73.018 1.00 23.01 ? 66  GLU A CA  1 
ATOM   290  C  C   . GLU A 1 70  ? 26.364  42.574 72.633 1.00 22.30 ? 66  GLU A C   1 
ATOM   291  O  O   . GLU A 1 70  ? 26.422  43.830 72.539 1.00 22.28 ? 66  GLU A O   1 
ATOM   292  C  CB  . GLU A 1 70  ? 28.319  41.287 71.743 1.00 25.42 ? 66  GLU A CB  1 
ATOM   293  C  CG  . GLU A 1 70  ? 28.608  42.369 70.628 1.00 27.75 ? 66  GLU A CG  1 
ATOM   294  C  CD  . GLU A 1 70  ? 30.000  43.009 70.735 1.00 33.95 ? 66  GLU A CD  1 
ATOM   295  O  OE1 . GLU A 1 70  ? 30.872  42.454 71.468 1.00 37.67 ? 66  GLU A OE1 1 
ATOM   296  O  OE2 . GLU A 1 70  ? 30.217  44.057 70.065 1.00 30.44 ? 66  GLU A OE2 1 
ATOM   297  N  N   . ALA A 1 71  ? 25.245  41.881 72.511 1.00 19.56 ? 67  ALA A N   1 
ATOM   298  C  CA  . ALA A 1 71  ? 24.013  42.566 72.086 1.00 19.70 ? 67  ALA A CA  1 
ATOM   299  C  C   . ALA A 1 71  ? 23.380  43.511 73.085 1.00 18.90 ? 67  ALA A C   1 
ATOM   300  O  O   . ALA A 1 71  ? 23.544  43.308 74.270 1.00 19.75 ? 67  ALA A O   1 
ATOM   301  C  CB  . ALA A 1 71  ? 22.962  41.490 71.682 1.00 19.17 ? 67  ALA A CB  1 
ATOM   302  N  N   . ASP A 1 72  ? 22.600  44.487 72.599 1.00 19.32 ? 68  ASP A N   1 
ATOM   303  C  CA  . ASP A 1 72  ? 21.799  45.369 73.444 1.00 18.57 ? 68  ASP A CA  1 
ATOM   304  C  C   . ASP A 1 72  ? 20.459  44.681 73.713 1.00 19.69 ? 68  ASP A C   1 
ATOM   305  O  O   . ASP A 1 72  ? 19.954  44.747 74.826 1.00 19.59 ? 68  ASP A O   1 
ATOM   306  C  CB  . ASP A 1 72  ? 21.547  46.695 72.760 1.00 18.44 ? 68  ASP A CB  1 
ATOM   307  C  CG  . ASP A 1 72  ? 22.732  47.594 72.843 1.00 21.20 ? 68  ASP A CG  1 
ATOM   308  O  OD1 . ASP A 1 72  ? 23.374  47.633 73.932 1.00 20.42 ? 68  ASP A OD1 1 
ATOM   309  O  OD2 . ASP A 1 72  ? 23.107  48.226 71.849 1.00 24.67 ? 68  ASP A OD2 1 
ATOM   310  N  N   . CYS A 1 73  ? 19.857  44.074 72.675 1.00 18.88 ? 69  CYS A N   1 
ATOM   311  C  CA  . CYS A 1 73  ? 18.580  43.403 72.889 1.00 18.05 ? 69  CYS A CA  1 
ATOM   312  C  C   . CYS A 1 73  ? 18.353  42.459 71.709 1.00 19.18 ? 69  CYS A C   1 
ATOM   313  O  O   . CYS A 1 73  ? 19.202  42.365 70.824 1.00 17.89 ? 69  CYS A O   1 
ATOM   314  C  CB  . CYS A 1 73  ? 17.479  44.468 72.888 1.00 17.25 ? 69  CYS A CB  1 
ATOM   315  S  SG  . CYS A 1 73  ? 17.237  45.270 71.244 1.00 21.31 ? 69  CYS A SG  1 
ATOM   316  N  N   . HIS A 1 74  ? 17.231  41.751 71.759 1.00 18.45 ? 70  HIS A N   1 
ATOM   317  C  CA  . HIS A 1 74  ? 16.759  40.908 70.677 1.00 18.25 ? 70  HIS A CA  1 
ATOM   318  C  C   . HIS A 1 74  ? 15.535  41.640 70.139 1.00 19.38 ? 70  HIS A C   1 
ATOM   319  O  O   . HIS A 1 74  ? 14.664  42.096 70.941 1.00 18.35 ? 70  HIS A O   1 
ATOM   320  C  CB  . HIS A 1 74  ? 16.277  39.538 71.170 1.00 18.19 ? 70  HIS A CB  1 
ATOM   321  C  CG  . HIS A 1 74  ? 15.980  38.586 70.067 1.00 18.52 ? 70  HIS A CG  1 
ATOM   322  N  ND1 . HIS A 1 74  ? 16.963  37.924 69.351 1.00 20.61 ? 70  HIS A ND1 1 
ATOM   323  C  CD2 . HIS A 1 74  ? 14.788  38.207 69.529 1.00 19.47 ? 70  HIS A CD2 1 
ATOM   324  C  CE1 . HIS A 1 74  ? 16.383  37.151 68.448 1.00 21.55 ? 70  HIS A CE1 1 
ATOM   325  N  NE2 . HIS A 1 74  ? 15.067  37.301 68.530 1.00 21.50 ? 70  HIS A NE2 1 
ATOM   326  N  N   . ILE A 1 75  ? 15.456  41.792 68.813 1.00 18.71 ? 71  ILE A N   1 
ATOM   327  C  CA  . ILE A 1 75  ? 14.274  42.396 68.178 1.00 19.16 ? 71  ILE A CA  1 
ATOM   328  C  C   . ILE A 1 75  ? 13.573  41.281 67.411 1.00 20.41 ? 71  ILE A C   1 
ATOM   329  O  O   . ILE A 1 75  ? 14.229  40.522 66.690 1.00 19.58 ? 71  ILE A O   1 
ATOM   330  C  CB  . ILE A 1 75  ? 14.530  43.574 67.239 1.00 20.78 ? 71  ILE A CB  1 
ATOM   331  C  CG1 . ILE A 1 75  ? 15.237  44.712 68.008 1.00 21.45 ? 71  ILE A CG1 1 
ATOM   332  C  CG2 . ILE A 1 75  ? 13.209  44.035 66.554 1.00 22.60 ? 71  ILE A CG2 1 
ATOM   333  C  CD1 . ILE A 1 75  ? 15.538  45.908 67.135 1.00 25.92 ? 71  ILE A CD1 1 
ATOM   334  N  N   . GLU A 1 76  ? 12.253  41.209 67.589 1.00 21.17 ? 72  GLU A N   1 
ATOM   335  C  CA  . GLU A 1 76  ? 11.470  40.160 66.957 1.00 21.41 ? 72  GLU A CA  1 
ATOM   336  C  C   . GLU A 1 76  ? 10.345  40.738 66.112 1.00 20.83 ? 72  GLU A C   1 
ATOM   337  O  O   . GLU A 1 76  ? 9.594   41.585 66.577 1.00 21.47 ? 72  GLU A O   1 
ATOM   338  C  CB  . GLU A 1 76  ? 10.934  39.266 68.059 1.00 23.95 ? 72  GLU A CB  1 
ATOM   339  C  CG  . GLU A 1 76  ? 9.682   38.509 67.716 1.00 25.05 ? 72  GLU A CG  1 
ATOM   340  C  CD  . GLU A 1 76  ? 9.245   37.516 68.772 1.00 26.64 ? 72  GLU A CD  1 
ATOM   341  O  OE1 . GLU A 1 76  ? 10.050  37.119 69.633 1.00 31.48 ? 72  GLU A OE1 1 
ATOM   342  O  OE2 . GLU A 1 76  ? 8.080   37.073 68.666 1.00 32.09 ? 72  GLU A OE2 1 
ATOM   343  N  N   . ALA A 1 77  ? 10.237  40.246 64.880 1.00 20.26 ? 73  ALA A N   1 
ATOM   344  C  CA  . ALA A 1 77  ? 9.166   40.640 63.995 1.00 19.99 ? 73  ALA A CA  1 
ATOM   345  C  C   . ALA A 1 77  ? 8.229   39.439 63.988 1.00 20.89 ? 73  ALA A C   1 
ATOM   346  O  O   . ALA A 1 77  ? 8.635   38.293 63.625 1.00 21.29 ? 73  ALA A O   1 
ATOM   347  C  CB  . ALA A 1 77  ? 9.673   40.953 62.578 1.00 20.93 ? 73  ALA A CB  1 
ATOM   348  N  N   A ASP A 1 78  ? 6.988   39.698 64.344 0.50 20.18 ? 74  ASP A N   1 
ATOM   349  N  N   B ASP A 1 78  ? 6.982   39.680 64.398 0.50 20.68 ? 74  ASP A N   1 
ATOM   350  C  CA  A ASP A 1 78  ? 5.979   38.661 64.346 0.50 20.72 ? 74  ASP A CA  1 
ATOM   351  C  CA  B ASP A 1 78  ? 5.886   38.679 64.489 0.50 21.59 ? 74  ASP A CA  1 
ATOM   352  C  C   A ASP A 1 78  ? 5.199   38.919 63.102 0.50 20.40 ? 74  ASP A C   1 
ATOM   353  C  C   B ASP A 1 78  ? 5.056   38.856 63.219 0.50 21.05 ? 74  ASP A C   1 
ATOM   354  O  O   A ASP A 1 78  ? 4.725   40.030 62.850 0.50 21.05 ? 74  ASP A O   1 
ATOM   355  O  O   B ASP A 1 78  ? 4.333   39.872 63.109 0.50 21.56 ? 74  ASP A O   1 
ATOM   356  C  CB  A ASP A 1 78  ? 5.157   38.714 65.623 0.50 21.60 ? 74  ASP A CB  1 
ATOM   357  C  CB  B ASP A 1 78  ? 5.030   38.999 65.740 0.50 22.87 ? 74  ASP A CB  1 
ATOM   358  C  CG  A ASP A 1 78  ? 5.998   38.387 66.807 0.50 22.11 ? 74  ASP A CG  1 
ATOM   359  C  CG  B ASP A 1 78  ? 4.133   37.849 66.177 0.50 25.57 ? 74  ASP A CG  1 
ATOM   360  O  OD1 A ASP A 1 78  ? 6.748   37.407 66.665 0.50 22.78 ? 74  ASP A OD1 1 
ATOM   361  O  OD1 B ASP A 1 78  ? 4.190   36.752 65.594 0.50 30.08 ? 74  ASP A OD1 1 
ATOM   362  O  OD2 A ASP A 1 78  ? 5.957   39.111 67.828 0.50 24.68 ? 74  ASP A OD2 1 
ATOM   363  O  OD2 B ASP A 1 78  ? 3.351   38.035 67.143 0.50 30.36 ? 74  ASP A OD2 1 
ATOM   364  N  N   . ILE A 1 79  ? 5.129   37.892 62.281 1.00 19.99 ? 75  ILE A N   1 
ATOM   365  C  CA  . ILE A 1 79  ? 4.421   38.032 60.996 1.00 20.53 ? 75  ILE A CA  1 
ATOM   366  C  C   . ILE A 1 79  ? 3.440   36.910 60.773 1.00 21.45 ? 75  ILE A C   1 
ATOM   367  O  O   . ILE A 1 79  ? 3.826   35.759 60.670 1.00 21.55 ? 75  ILE A O   1 
ATOM   368  C  CB  . ILE A 1 79  ? 5.459   38.132 59.808 1.00 21.35 ? 75  ILE A CB  1 
ATOM   369  C  CG1 . ILE A 1 79  ? 6.516   39.263 60.035 1.00 20.28 ? 75  ILE A CG1 1 
ATOM   370  C  CG2 . ILE A 1 79  ? 4.738   38.261 58.413 1.00 20.13 ? 75  ILE A CG2 1 
ATOM   371  C  CD1 . ILE A 1 79  ? 7.647   39.309 59.011 1.00 21.23 ? 75  ILE A CD1 1 
ATOM   372  N  N   . HIS A 1 80  ? 2.194   37.295 60.613 1.00 20.50 ? 76  HIS A N   1 
ATOM   373  C  CA  . HIS A 1 80  ? 1.107   36.327 60.385 1.00 21.36 ? 76  HIS A CA  1 
ATOM   374  C  C   . HIS A 1 80  ? 0.255   36.802 59.241 1.00 20.90 ? 76  HIS A C   1 
ATOM   375  O  O   . HIS A 1 80  ? 0.132   37.982 58.959 1.00 21.28 ? 76  HIS A O   1 
ATOM   376  C  CB  . HIS A 1 80  ? 0.284   36.141 61.664 1.00 23.12 ? 76  HIS A CB  1 
ATOM   377  C  CG  . HIS A 1 80  ? 1.125   35.740 62.838 1.00 28.17 ? 76  HIS A CG  1 
ATOM   378  N  ND1 . HIS A 1 80  ? 1.377   34.419 63.151 1.00 36.70 ? 76  HIS A ND1 1 
ATOM   379  C  CD2 . HIS A 1 80  ? 1.808   36.479 63.746 1.00 31.90 ? 76  HIS A CD2 1 
ATOM   380  C  CE1 . HIS A 1 80  ? 2.178   34.362 64.204 1.00 35.10 ? 76  HIS A CE1 1 
ATOM   381  N  NE2 . HIS A 1 80  ? 2.446   35.597 64.589 1.00 38.34 ? 76  HIS A NE2 1 
ATOM   382  N  N   . ALA A 1 81  ? -0.406  35.864 58.569 1.00 19.57 ? 77  ALA A N   1 
ATOM   383  C  CA  . ALA A 1 81  ? -1.250  36.269 57.477 1.00 19.10 ? 77  ALA A CA  1 
ATOM   384  C  C   . ALA A 1 81  ? -2.514  36.953 58.010 1.00 19.56 ? 77  ALA A C   1 
ATOM   385  O  O   . ALA A 1 81  ? -3.110  36.478 58.994 1.00 19.51 ? 77  ALA A O   1 
ATOM   386  C  CB  . ALA A 1 81  ? -1.652  35.003 56.651 1.00 19.63 ? 77  ALA A CB  1 
ATOM   387  N  N   . ASN A 1 82  ? -2.937  38.017 57.339 1.00 19.74 ? 78  ASN A N   1 
ATOM   388  C  CA  . ASN A 1 82  ? -4.188  38.681 57.706 1.00 20.68 ? 78  ASN A CA  1 
ATOM   389  C  C   . ASN A 1 82  ? -5.222  38.159 56.705 1.00 21.30 ? 78  ASN A C   1 
ATOM   390  O  O   . ASN A 1 82  ? -4.961  37.186 55.961 1.00 20.57 ? 78  ASN A O   1 
ATOM   391  C  CB  . ASN A 1 82  ? -4.084  40.219 57.715 1.00 20.66 ? 78  ASN A CB  1 
ATOM   392  C  CG  . ASN A 1 82  ? -3.672  40.800 56.361 1.00 21.46 ? 78  ASN A CG  1 
ATOM   393  O  OD1 . ASN A 1 82  ? -3.917  40.215 55.318 1.00 21.31 ? 78  ASN A OD1 1 
ATOM   394  N  ND2 . ASN A 1 82  ? -2.960  41.927 56.403 1.00 23.11 ? 78  ASN A ND2 1 
ATOM   395  N  N   A GLU A 1 83  ? -6.383  38.796 56.655 0.50 21.73 ? 79  GLU A N   1 
ATOM   396  N  N   B GLU A 1 83  ? -6.406  38.778 56.664 0.50 22.16 ? 79  GLU A N   1 
ATOM   397  C  CA  A GLU A 1 83  ? -7.420  38.352 55.752 0.50 22.34 ? 79  GLU A CA  1 
ATOM   398  C  CA  B GLU A 1 83  ? -7.461  38.334 55.749 0.50 23.17 ? 79  GLU A CA  1 
ATOM   399  C  C   A GLU A 1 83  ? -6.994  38.274 54.287 0.50 22.68 ? 79  GLU A C   1 
ATOM   400  C  C   B GLU A 1 83  ? -7.019  38.282 54.276 0.50 23.19 ? 79  GLU A C   1 
ATOM   401  O  O   A GLU A 1 83  ? -7.320  37.302 53.605 0.50 23.52 ? 79  GLU A O   1 
ATOM   402  O  O   B GLU A 1 83  ? -7.374  37.338 53.566 0.50 24.07 ? 79  GLU A O   1 
ATOM   403  C  CB  A GLU A 1 83  ? -8.666  39.196 55.956 0.50 22.37 ? 79  GLU A CB  1 
ATOM   404  C  CB  B GLU A 1 83  ? -8.745  39.162 55.928 0.50 23.73 ? 79  GLU A CB  1 
ATOM   405  C  CG  A GLU A 1 83  ? -9.493  38.666 57.114 0.50 24.04 ? 79  GLU A CG  1 
ATOM   406  C  CG  B GLU A 1 83  ? -9.908  38.431 56.683 0.50 27.19 ? 79  GLU A CG  1 
ATOM   407  C  CD  A GLU A 1 83  ? -10.163 37.305 56.800 0.50 22.82 ? 79  GLU A CD  1 
ATOM   408  C  CD  B GLU A 1 83  ? -10.060 38.859 58.161 0.50 29.99 ? 79  GLU A CD  1 
ATOM   409  O  OE1 A GLU A 1 83  ? -10.372 36.960 55.612 0.50 24.35 ? 79  GLU A OE1 1 
ATOM   410  O  OE1 B GLU A 1 83  ? -9.554  39.936 58.513 0.50 31.64 ? 79  GLU A OE1 1 
ATOM   411  O  OE2 A GLU A 1 83  ? -10.453 36.576 57.762 0.50 24.21 ? 79  GLU A OE2 1 
ATOM   412  O  OE2 B GLU A 1 83  ? -10.706 38.133 58.969 0.50 29.72 ? 79  GLU A OE2 1 
ATOM   413  N  N   . ALA A 1 84  ? -6.222  39.270 53.841 1.00 22.74 ? 80  ALA A N   1 
ATOM   414  C  CA  . ALA A 1 84  ? -5.720  39.345 52.441 1.00 23.42 ? 80  ALA A CA  1 
ATOM   415  C  C   . ALA A 1 84  ? -4.790  38.174 52.143 1.00 22.72 ? 80  ALA A C   1 
ATOM   416  O  O   . ALA A 1 84  ? -4.671  37.729 50.977 1.00 22.67 ? 80  ALA A O   1 
ATOM   417  C  CB  . ALA A 1 84  ? -5.057  40.681 52.135 1.00 24.32 ? 80  ALA A CB  1 
ATOM   418  N  N   . GLY A 1 85  ? -4.222  37.616 53.202 1.00 22.60 ? 81  GLY A N   1 
ATOM   419  C  CA  . GLY A 1 85  ? -3.361  36.441 53.058 1.00 22.45 ? 81  GLY A CA  1 
ATOM   420  C  C   . GLY A 1 85  ? -4.052  35.174 52.590 1.00 22.69 ? 81  GLY A C   1 
ATOM   421  O  O   . GLY A 1 85  ? -3.412  34.300 52.016 1.00 21.13 ? 81  GLY A O   1 
ATOM   422  N  N   . LYS A 1 86  ? -5.369  35.065 52.813 1.00 22.93 ? 82  LYS A N   1 
ATOM   423  C  CA  . LYS A 1 86  ? -6.118  33.901 52.415 1.00 24.57 ? 82  LYS A CA  1 
ATOM   424  C  C   . LYS A 1 86  ? -5.976  33.679 50.889 1.00 21.77 ? 82  LYS A C   1 
ATOM   425  O  O   . LYS A 1 86  ? -5.930  32.542 50.408 1.00 23.16 ? 82  LYS A O   1 
ATOM   426  C  CB  . LYS A 1 86  ? -7.599  34.045 52.859 1.00 24.91 ? 82  LYS A CB  1 
ATOM   427  C  CG  . LYS A 1 86  ? -8.474  32.851 52.648 1.00 29.36 ? 82  LYS A CG  1 
ATOM   428  C  CD  . LYS A 1 86  ? -9.826  33.051 53.387 1.00 28.98 ? 82  LYS A CD  1 
ATOM   429  C  CE  . LYS A 1 86  ? -10.985 32.288 52.718 1.00 37.61 ? 82  LYS A CE  1 
ATOM   430  N  NZ  . LYS A 1 86  ? -10.929 30.795 52.924 1.00 39.97 ? 82  LYS A NZ  1 
ATOM   431  N  N   . ASP A 1 87  ? -5.874  34.777 50.137 1.00 22.18 ? 83  ASP A N   1 
ATOM   432  C  CA  . ASP A 1 87  ? -5.726  34.714 48.690 1.00 23.48 ? 83  ASP A CA  1 
ATOM   433  C  C   . ASP A 1 87  ? -4.403  34.063 48.236 1.00 21.67 ? 83  ASP A C   1 
ATOM   434  O  O   . ASP A 1 87  ? -4.299  33.602 47.084 1.00 22.17 ? 83  ASP A O   1 
ATOM   435  C  CB  . ASP A 1 87  ? -5.912  36.109 48.116 1.00 25.92 ? 83  ASP A CB  1 
ATOM   436  C  CG  . ASP A 1 87  ? -7.180  36.783 48.661 1.00 29.66 ? 83  ASP A CG  1 
ATOM   437  O  OD1 . ASP A 1 87  ? -8.261  36.424 48.167 1.00 35.81 ? 83  ASP A OD1 1 
ATOM   438  O  OD2 . ASP A 1 87  ? -7.091  37.608 49.628 1.00 35.13 ? 83  ASP A OD2 1 
ATOM   439  N  N   . LEU A 1 88  ? -3.413  34.041 49.134 1.00 21.47 ? 84  LEU A N   1 
ATOM   440  C  CA  . LEU A 1 88  ? -2.093  33.414 48.823 1.00 21.16 ? 84  LEU A CA  1 
ATOM   441  C  C   . LEU A 1 88  ? -2.100  31.983 49.307 1.00 21.39 ? 84  LEU A C   1 
ATOM   442  O  O   . LEU A 1 88  ? -1.119  31.238 49.145 1.00 21.57 ? 84  LEU A O   1 
ATOM   443  C  CB  . LEU A 1 88  ? -0.935  34.174 49.497 1.00 22.09 ? 84  LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 88  ? -0.361  35.246 48.579 1.00 22.59 ? 84  LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 88  ? 0.690   36.090 49.346 1.00 22.74 ? 84  LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 88  ? 0.368   34.521 47.484 1.00 27.28 ? 84  LEU A CD2 1 
ATOM   447  N  N   . GLY A 1 89  ? -3.217  31.573 49.896 1.00 20.55 ? 85  GLY A N   1 
ATOM   448  C  CA  . GLY A 1 89  ? -3.331  30.216 50.406 1.00 21.11 ? 85  GLY A CA  1 
ATOM   449  C  C   . GLY A 1 89  ? -2.914  30.002 51.846 1.00 23.21 ? 85  GLY A C   1 
ATOM   450  O  O   . GLY A 1 89  ? -2.894  28.864 52.309 1.00 25.80 ? 85  GLY A O   1 
ATOM   451  N  N   . TYR A 1 90  ? -2.578  31.071 52.569 1.00 21.01 ? 86  TYR A N   1 
ATOM   452  C  CA  . TYR A 1 90  ? -2.213  30.932 53.956 1.00 21.24 ? 86  TYR A CA  1 
ATOM   453  C  C   . TYR A 1 90  ? -3.438  30.829 54.823 1.00 22.01 ? 86  TYR A C   1 
ATOM   454  O  O   . TYR A 1 90  ? -4.471  31.393 54.499 1.00 22.90 ? 86  TYR A O   1 
ATOM   455  C  CB  . TYR A 1 90  ? -1.473  32.179 54.422 1.00 20.88 ? 86  TYR A CB  1 
ATOM   456  C  CG  . TYR A 1 90  ? -0.128  32.304 53.792 1.00 18.92 ? 86  TYR A CG  1 
ATOM   457  C  CD1 . TYR A 1 90  ? 0.931   31.424 54.146 1.00 20.84 ? 86  TYR A CD1 1 
ATOM   458  C  CD2 . TYR A 1 90  ? 0.113   33.292 52.863 1.00 20.91 ? 86  TYR A CD2 1 
ATOM   459  C  CE1 . TYR A 1 90  ? 2.169   31.509 53.560 1.00 21.21 ? 86  TYR A CE1 1 
ATOM   460  C  CE2 . TYR A 1 90  ? 1.368   33.405 52.264 1.00 20.30 ? 86  TYR A CE2 1 
ATOM   461  C  CZ  . TYR A 1 90  ? 2.391   32.507 52.623 1.00 22.49 ? 86  TYR A CZ  1 
ATOM   462  O  OH  . TYR A 1 90  ? 3.598   32.617 52.022 1.00 24.52 ? 86  TYR A OH  1 
ATOM   463  N  N   . GLY A 1 91  ? -3.295  30.148 55.953 1.00 24.18 ? 87  GLY A N   1 
ATOM   464  C  CA  . GLY A 1 91  ? -4.385  30.084 56.912 1.00 24.91 ? 87  GLY A CA  1 
ATOM   465  C  C   . GLY A 1 91  ? -4.325  31.457 57.560 1.00 24.50 ? 87  GLY A C   1 
ATOM   466  O  O   . GLY A 1 91  ? -3.240  31.915 57.913 1.00 24.41 ? 87  GLY A O   1 
ATOM   467  N  N   . VAL A 1 92  ? -5.478  32.114 57.683 1.00 25.47 ? 88  VAL A N   1 
ATOM   468  C  CA  . VAL A 1 92  ? -5.498  33.452 58.288 1.00 25.24 ? 88  VAL A CA  1 
ATOM   469  C  C   . VAL A 1 92  ? -5.074  33.336 59.748 1.00 24.49 ? 88  VAL A C   1 
ATOM   470  O  O   . VAL A 1 92  ? -5.524  32.431 60.465 1.00 23.41 ? 88  VAL A O   1 
ATOM   471  C  CB  . VAL A 1 92  ? -6.845  34.166 58.128 1.00 26.15 ? 88  VAL A CB  1 
ATOM   472  C  CG1 . VAL A 1 92  ? -6.770  35.554 58.764 1.00 28.10 ? 88  VAL A CG1 1 
ATOM   473  C  CG2 . VAL A 1 92  ? -7.187  34.279 56.637 1.00 26.40 ? 88  VAL A CG2 1 
ATOM   474  N  N   . GLY A 1 93  ? -4.142  34.207 60.136 1.00 23.33 ? 89  GLY A N   1 
ATOM   475  C  CA  . GLY A 1 93  ? -3.588  34.227 61.467 1.00 24.48 ? 89  GLY A CA  1 
ATOM   476  C  C   . GLY A 1 93  ? -2.388  33.337 61.678 1.00 25.08 ? 89  GLY A C   1 
ATOM   477  O  O   . GLY A 1 93  ? -1.816  33.334 62.766 1.00 27.67 ? 89  GLY A O   1 
ATOM   478  N  N   . ASP A 1 94  ? -1.974  32.571 60.669 1.00 24.57 ? 90  ASP A N   1 
ATOM   479  C  CA  . ASP A 1 94  ? -0.804  31.732 60.900 1.00 25.52 ? 90  ASP A CA  1 
ATOM   480  C  C   . ASP A 1 94  ? 0.508   32.410 60.512 1.00 23.03 ? 90  ASP A C   1 
ATOM   481  O  O   . ASP A 1 94  ? 0.538   33.330 59.706 1.00 21.37 ? 90  ASP A O   1 
ATOM   482  C  CB  . ASP A 1 94  ? -0.875  30.418 60.168 1.00 26.76 ? 90  ASP A CB  1 
ATOM   483  C  CG  . ASP A 1 94  ? -2.159  29.637 60.450 1.00 28.61 ? 90  ASP A CG  1 
ATOM   484  O  OD1 . ASP A 1 94  ? -2.727  29.671 61.579 1.00 32.55 ? 90  ASP A OD1 1 
ATOM   485  O  OD2 . ASP A 1 94  ? -2.539  29.006 59.494 1.00 35.61 ? 90  ASP A OD2 1 
ATOM   486  N  N   . PHE A 1 95  ? 1.579   31.883 61.063 1.00 21.97 ? 91  PHE A N   1 
ATOM   487  C  CA  . PHE A 1 95  ? 2.934   32.372 60.771 1.00 21.71 ? 91  PHE A CA  1 
ATOM   488  C  C   . PHE A 1 95  ? 3.177   32.270 59.263 1.00 21.16 ? 91  PHE A C   1 
ATOM   489  O  O   . PHE A 1 95  ? 2.780   31.278 58.621 1.00 22.29 ? 91  PHE A O   1 
ATOM   490  C  CB  . PHE A 1 95  ? 3.980   31.521 61.554 1.00 23.42 ? 91  PHE A CB  1 
ATOM   491  C  CG  . PHE A 1 95  ? 5.411   31.835 61.216 1.00 22.40 ? 91  PHE A CG  1 
ATOM   492  C  CD1 . PHE A 1 95  ? 5.959   33.067 61.550 1.00 23.14 ? 91  PHE A CD1 1 
ATOM   493  C  CD2 . PHE A 1 95  ? 6.240   30.900 60.589 1.00 24.24 ? 91  PHE A CD2 1 
ATOM   494  C  CE1 . PHE A 1 95  ? 7.267   33.399 61.256 1.00 23.62 ? 91  PHE A CE1 1 
ATOM   495  C  CE2 . PHE A 1 95  ? 7.584   31.205 60.256 1.00 24.64 ? 91  PHE A CE2 1 
ATOM   496  C  CZ  . PHE A 1 95  ? 8.124   32.474 60.606 1.00 24.29 ? 91  PHE A CZ  1 
ATOM   497  N  N   . VAL A 1 96  ? 3.873   33.270 58.688 1.00 21.43 ? 92  VAL A N   1 
ATOM   498  C  CA  . VAL A 1 96  ? 4.208   33.206 57.276 1.00 20.29 ? 92  VAL A CA  1 
ATOM   499  C  C   . VAL A 1 96  ? 5.705   32.907 57.124 1.00 20.82 ? 92  VAL A C   1 
ATOM   500  O  O   . VAL A 1 96  ? 6.539   33.815 57.351 1.00 18.98 ? 92  VAL A O   1 
ATOM   501  C  CB  . VAL A 1 96  ? 3.816   34.501 56.496 1.00 20.30 ? 92  VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 96  ? 4.263   34.383 55.022 1.00 20.24 ? 92  VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 96  ? 2.326   34.775 56.620 1.00 22.00 ? 92  VAL A CG2 1 
ATOM   504  N  N   . PRO A 1 97  ? 6.043   31.650 56.781 1.00 20.89 ? 93  PRO A N   1 
ATOM   505  C  CA  . PRO A 1 97  ? 7.442   31.320 56.644 1.00 20.97 ? 93  PRO A CA  1 
ATOM   506  C  C   . PRO A 1 97  ? 8.068   31.671 55.290 1.00 20.08 ? 93  PRO A C   1 
ATOM   507  O  O   . PRO A 1 97  ? 7.380   32.073 54.334 1.00 21.09 ? 93  PRO A O   1 
ATOM   508  C  CB  . PRO A 1 97  ? 7.453   29.795 56.807 1.00 20.64 ? 93  PRO A CB  1 
ATOM   509  C  CG  . PRO A 1 97  ? 6.153   29.343 56.171 1.00 22.71 ? 93  PRO A CG  1 
ATOM   510  C  CD  . PRO A 1 97  ? 5.177   30.467 56.520 1.00 21.43 ? 93  PRO A CD  1 
ATOM   511  N  N   . TYR A 1 98  ? 9.386   31.498 55.254 1.00 19.73 ? 94  TYR A N   1 
ATOM   512  C  CA  . TYR A 1 98  ? 10.207  31.688 54.062 1.00 19.08 ? 94  TYR A CA  1 
ATOM   513  C  C   . TYR A 1 98  ? 10.380  33.122 53.571 1.00 18.67 ? 94  TYR A C   1 
ATOM   514  O  O   . TYR A 1 98  ? 10.941  33.333 52.502 1.00 19.11 ? 94  TYR A O   1 
ATOM   515  C  CB  . TYR A 1 98  ? 9.735   30.798 52.876 1.00 19.40 ? 94  TYR A CB  1 
ATOM   516  C  CG  . TYR A 1 98  ? 9.747   29.328 53.186 1.00 19.62 ? 94  TYR A CG  1 
ATOM   517  C  CD1 . TYR A 1 98  ? 10.904  28.577 53.026 1.00 19.02 ? 94  TYR A CD1 1 
ATOM   518  C  CD2 . TYR A 1 98  ? 8.606   28.718 53.690 1.00 22.57 ? 94  TYR A CD2 1 
ATOM   519  C  CE1 . TYR A 1 98  ? 10.897  27.196 53.331 1.00 19.23 ? 94  TYR A CE1 1 
ATOM   520  C  CE2 . TYR A 1 98  ? 8.594   27.339 53.988 1.00 20.91 ? 94  TYR A CE2 1 
ATOM   521  C  CZ  . TYR A 1 98  ? 9.740   26.611 53.780 1.00 21.54 ? 94  TYR A CZ  1 
ATOM   522  O  OH  . TYR A 1 98  ? 9.708   25.267 54.073 1.00 21.19 ? 94  TYR A OH  1 
ATOM   523  N  N   . LEU A 1 99  ? 9.927   34.100 54.365 1.00 18.73 ? 95  LEU A N   1 
ATOM   524  C  CA  . LEU A 1 99  ? 10.122  35.509 53.966 1.00 18.53 ? 95  LEU A CA  1 
ATOM   525  C  C   . LEU A 1 99  ? 11.558  35.954 54.262 1.00 19.32 ? 95  LEU A C   1 
ATOM   526  O  O   . LEU A 1 99  ? 12.296  35.293 55.022 1.00 20.78 ? 95  LEU A O   1 
ATOM   527  C  CB  . LEU A 1 99  ? 9.169   36.403 54.755 1.00 18.21 ? 95  LEU A CB  1 
ATOM   528  C  CG  . LEU A 1 99  ? 7.695   35.950 54.704 1.00 16.89 ? 95  LEU A CG  1 
ATOM   529  C  CD1 . LEU A 1 99  ? 6.856   36.931 55.515 1.00 18.97 ? 95  LEU A CD1 1 
ATOM   530  C  CD2 . LEU A 1 99  ? 7.212   35.900 53.216 1.00 19.88 ? 95  LEU A CD2 1 
ATOM   531  N  N   . ARG A 1 100 ? 11.948  37.079 53.664 1.00 18.31 ? 96  ARG A N   1 
ATOM   532  C  CA  . ARG A 1 100 ? 13.315  37.627 53.898 1.00 18.79 ? 96  ARG A CA  1 
ATOM   533  C  C   . ARG A 1 100 ? 13.086  38.969 54.550 1.00 19.62 ? 96  ARG A C   1 
ATOM   534  O  O   . ARG A 1 100 ? 12.667  39.940 53.897 1.00 20.46 ? 96  ARG A O   1 
ATOM   535  C  CB  . ARG A 1 100 ? 14.081  37.715 52.592 1.00 20.65 ? 96  ARG A CB  1 
ATOM   536  C  CG  . ARG A 1 100 ? 14.250  36.308 51.956 1.00 22.59 ? 96  ARG A CG  1 
ATOM   537  C  CD  . ARG A 1 100 ? 14.744  36.403 50.539 1.00 26.24 ? 96  ARG A CD  1 
ATOM   538  N  NE  . ARG A 1 100 ? 13.694  36.847 49.611 1.00 24.15 ? 96  ARG A NE  1 
ATOM   539  C  CZ  . ARG A 1 100 ? 13.933  37.218 48.355 1.00 28.17 ? 96  ARG A CZ  1 
ATOM   540  N  NH1 . ARG A 1 100 ? 15.189  37.215 47.870 1.00 28.89 ? 96  ARG A NH1 1 
ATOM   541  N  NH2 . ARG A 1 100 ? 12.936  37.581 47.561 1.00 25.49 ? 96  ARG A NH2 1 
ATOM   542  N  N   . VAL A 1 101 ? 13.332  39.009 55.845 1.00 18.79 ? 97  VAL A N   1 
ATOM   543  C  CA  . VAL A 1 101 ? 13.080  40.211 56.660 1.00 19.04 ? 97  VAL A CA  1 
ATOM   544  C  C   . VAL A 1 101 ? 14.377  40.932 57.039 1.00 19.86 ? 97  VAL A C   1 
ATOM   545  O  O   . VAL A 1 101 ? 15.317  40.309 57.572 1.00 20.65 ? 97  VAL A O   1 
ATOM   546  C  CB  . VAL A 1 101 ? 12.310  39.823 57.917 1.00 20.35 ? 97  VAL A CB  1 
ATOM   547  C  CG1 . VAL A 1 101 ? 11.962  41.079 58.690 1.00 22.16 ? 97  VAL A CG1 1 
ATOM   548  C  CG2 . VAL A 1 101 ? 11.002  39.023 57.572 1.00 19.54 ? 97  VAL A CG2 1 
ATOM   549  N  N   . VAL A 1 102 ? 14.437  42.229 56.752 1.00 19.13 ? 98  VAL A N   1 
ATOM   550  C  CA  . VAL A 1 102 ? 15.623  43.053 57.071 1.00 20.31 ? 98  VAL A CA  1 
ATOM   551  C  C   . VAL A 1 102 ? 15.102  44.264 57.863 1.00 21.21 ? 98  VAL A C   1 
ATOM   552  O  O   . VAL A 1 102 ? 14.073  44.842 57.513 1.00 22.64 ? 98  VAL A O   1 
ATOM   553  C  CB  . VAL A 1 102 ? 16.309  43.491 55.778 1.00 21.31 ? 98  VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 102 ? 17.557  44.334 56.071 1.00 25.03 ? 98  VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 102 ? 16.652  42.253 54.894 1.00 23.08 ? 98  VAL A CG2 1 
ATOM   556  N  N   . ALA A 1 103 ? 15.807  44.636 58.924 1.00 19.52 ? 99  ALA A N   1 
ATOM   557  C  CA  . ALA A 1 103 ? 15.439  45.830 59.699 1.00 18.16 ? 99  ALA A CA  1 
ATOM   558  C  C   . ALA A 1 103 ? 16.456  46.919 59.413 1.00 19.14 ? 99  ALA A C   1 
ATOM   559  O  O   . ALA A 1 103 ? 17.638  46.627 59.283 1.00 19.15 ? 99  ALA A O   1 
ATOM   560  C  CB  . ALA A 1 103 ? 15.356  45.579 61.213 1.00 20.18 ? 99  ALA A CB  1 
ATOM   561  N  N   . PHE A 1 104 ? 15.986  48.168 59.345 1.00 17.29 ? 100 PHE A N   1 
ATOM   562  C  CA  . PHE A 1 104 ? 16.893  49.324 59.188 1.00 18.37 ? 100 PHE A CA  1 
ATOM   563  C  C   . PHE A 1 104 ? 16.652  50.189 60.416 1.00 18.99 ? 100 PHE A C   1 
ATOM   564  O  O   . PHE A 1 104 ? 15.506  50.486 60.750 1.00 19.81 ? 100 PHE A O   1 
ATOM   565  C  CB  . PHE A 1 104 ? 16.613  50.085 57.891 1.00 18.35 ? 100 PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 104 ? 16.885  49.259 56.670 1.00 18.06 ? 100 PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 104 ? 15.876  48.436 56.148 1.00 21.35 ? 100 PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 104 ? 18.168  49.225 56.110 1.00 19.53 ? 100 PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 104 ? 16.107  47.625 55.025 1.00 21.85 ? 100 PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 104 ? 18.394  48.418 54.995 1.00 20.95 ? 100 PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 104 ? 17.363  47.650 54.452 1.00 20.76 ? 100 PHE A CZ  1 
ATOM   572  N  N   . LEU A 1 105 ? 17.733  50.614 61.069 1.00 19.15 ? 101 LEU A N   1 
ATOM   573  C  CA  . LEU A 1 105 ? 17.597  51.433 62.266 1.00 18.60 ? 101 LEU A CA  1 
ATOM   574  C  C   . LEU A 1 105 ? 18.291  52.739 62.005 1.00 18.21 ? 101 LEU A C   1 
ATOM   575  O  O   . LEU A 1 105 ? 19.439  52.746 61.553 1.00 18.54 ? 101 LEU A O   1 
ATOM   576  C  CB  . LEU A 1 105 ? 18.290  50.751 63.467 1.00 19.74 ? 101 LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 105 ? 17.927  49.282 63.685 1.00 20.99 ? 101 LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 105 ? 18.764  48.703 64.877 1.00 25.21 ? 101 LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 105 ? 16.482  49.074 63.896 1.00 22.11 ? 101 LEU A CD2 1 
ATOM   580  N  N   . GLN A 1 106 ? 17.646  53.853 62.300 1.00 17.25 ? 102 GLN A N   1 
ATOM   581  C  CA  . GLN A 1 106 ? 18.317  55.108 62.070 1.00 19.55 ? 102 GLN A CA  1 
ATOM   582  C  C   . GLN A 1 106 ? 18.037  56.075 63.191 1.00 18.67 ? 102 GLN A C   1 
ATOM   583  O  O   . GLN A 1 106 ? 16.890  56.479 63.396 1.00 19.17 ? 102 GLN A O   1 
ATOM   584  C  CB  . GLN A 1 106 ? 17.889  55.700 60.715 1.00 19.71 ? 102 GLN A CB  1 
ATOM   585  C  CG  . GLN A 1 106 ? 18.593  57.011 60.358 1.00 20.39 ? 102 GLN A CG  1 
ATOM   586  C  CD  . GLN A 1 106 ? 18.143  57.542 59.019 1.00 20.62 ? 102 GLN A CD  1 
ATOM   587  O  OE1 . GLN A 1 106 ? 17.215  57.002 58.378 1.00 22.96 ? 102 GLN A OE1 1 
ATOM   588  N  NE2 . GLN A 1 106 ? 18.830  58.574 58.561 1.00 24.71 ? 102 GLN A NE2 1 
ATOM   589  N  N   . LYS A 1 107 ? 19.094  56.467 63.908 1.00 18.73 ? 103 LYS A N   1 
ATOM   590  C  CA  . LYS A 1 107 ? 18.902  57.408 65.018 1.00 19.00 ? 103 LYS A CA  1 
ATOM   591  C  C   . LYS A 1 107 ? 18.427  58.778 64.520 1.00 20.08 ? 103 LYS A C   1 
ATOM   592  O  O   . LYS A 1 107 ? 18.909  59.257 63.505 1.00 19.36 ? 103 LYS A O   1 
ATOM   593  C  CB  . LYS A 1 107 ? 20.211  57.601 65.817 1.00 19.80 ? 103 LYS A CB  1 
ATOM   594  C  CG  . LYS A 1 107 ? 19.970  58.287 67.171 1.00 19.21 ? 103 LYS A CG  1 
ATOM   595  C  CD  . LYS A 1 107 ? 21.221  58.137 68.031 1.00 24.17 ? 103 LYS A CD  1 
ATOM   596  C  CE  . LYS A 1 107 ? 21.160  58.954 69.333 1.00 26.88 ? 103 LYS A CE  1 
ATOM   597  N  NZ  . LYS A 1 107 ? 22.509  58.995 69.965 1.00 28.99 ? 103 LYS A NZ  1 
ATOM   598  N  N   . HIS A 1 108 ? 17.479  59.406 65.215 1.00 21.94 ? 104 HIS A N   1 
ATOM   599  C  CA  . HIS A 1 108 ? 17.016  60.743 64.830 1.00 22.63 ? 104 HIS A CA  1 
ATOM   600  C  C   . HIS A 1 108 ? 18.203  61.681 64.815 1.00 23.35 ? 104 HIS A C   1 
ATOM   601  O  O   . HIS A 1 108 ? 19.040  61.639 65.727 1.00 23.88 ? 104 HIS A O   1 
ATOM   602  C  CB  . HIS A 1 108 ? 15.979  61.239 65.831 1.00 22.33 ? 104 HIS A CB  1 
ATOM   603  C  CG  . HIS A 1 108 ? 14.647  60.616 65.637 1.00 22.91 ? 104 HIS A CG  1 
ATOM   604  N  ND1 . HIS A 1 108 ? 13.475  61.179 66.107 1.00 22.96 ? 104 HIS A ND1 1 
ATOM   605  C  CD2 . HIS A 1 108 ? 14.297  59.465 65.018 1.00 21.98 ? 104 HIS A CD2 1 
ATOM   606  C  CE1 . HIS A 1 108 ? 12.460  60.412 65.749 1.00 22.00 ? 104 HIS A CE1 1 
ATOM   607  N  NE2 . HIS A 1 108 ? 12.928  59.365 65.092 1.00 24.25 ? 104 HIS A NE2 1 
ATOM   608  N  N   . GLY A 1 109 ? 18.286  62.482 63.758 1.00 24.98 ? 105 GLY A N   1 
ATOM   609  C  CA  . GLY A 1 109 ? 19.380  63.447 63.620 1.00 27.17 ? 105 GLY A CA  1 
ATOM   610  C  C   . GLY A 1 109 ? 20.681  62.891 63.053 1.00 27.90 ? 105 GLY A C   1 
ATOM   611  O  O   . GLY A 1 109 ? 21.710  63.612 63.032 1.00 28.61 ? 105 GLY A O   1 
ATOM   612  N  N   . SER A 1 110 ? 20.669  61.616 62.660 1.00 27.43 ? 106 SER A N   1 
ATOM   613  C  CA  . SER A 1 110 ? 21.842  60.948 62.088 1.00 27.18 ? 106 SER A CA  1 
ATOM   614  C  C   . SER A 1 110 ? 21.602  60.500 60.660 1.00 27.14 ? 106 SER A C   1 
ATOM   615  O  O   . SER A 1 110 ? 20.460  60.192 60.279 1.00 26.55 ? 106 SER A O   1 
ATOM   616  C  CB  . SER A 1 110 ? 22.208  59.708 62.916 1.00 27.13 ? 106 SER A CB  1 
ATOM   617  O  OG  . SER A 1 110 ? 23.282  58.985 62.318 1.00 26.76 ? 106 SER A OG  1 
ATOM   618  N  N   . GLU A 1 111 ? 22.679  60.422 59.867 1.00 27.19 ? 107 GLU A N   1 
ATOM   619  C  CA  . GLU A 1 111 ? 22.556  59.929 58.489 1.00 28.10 ? 107 GLU A CA  1 
ATOM   620  C  C   . GLU A 1 111 ? 22.919  58.438 58.428 1.00 26.54 ? 107 GLU A C   1 
ATOM   621  O  O   . GLU A 1 111 ? 22.762  57.795 57.394 1.00 28.14 ? 107 GLU A O   1 
ATOM   622  C  CB  . GLU A 1 111 ? 23.459  60.703 57.522 1.00 28.53 ? 107 GLU A CB  1 
ATOM   623  C  CG  . GLU A 1 111 ? 22.989  62.106 57.250 1.00 33.55 ? 107 GLU A CG  1 
ATOM   624  C  CD  . GLU A 1 111 ? 23.851  62.788 56.215 1.00 38.89 ? 107 GLU A CD  1 
ATOM   625  O  OE1 . GLU A 1 111 ? 23.742  62.415 55.022 1.00 43.15 ? 107 GLU A OE1 1 
ATOM   626  O  OE2 . GLU A 1 111 ? 24.634  63.683 56.596 1.00 41.41 ? 107 GLU A OE2 1 
ATOM   627  N  N   . LYS A 1 112 ? 23.433  57.904 59.537 1.00 24.94 ? 108 LYS A N   1 
ATOM   628  C  CA  . LYS A 1 112 ? 23.845  56.512 59.585 1.00 24.67 ? 108 LYS A CA  1 
ATOM   629  C  C   . LYS A 1 112 ? 22.641  55.583 59.687 1.00 23.53 ? 108 LYS A C   1 
ATOM   630  O  O   . LYS A 1 112 ? 21.770  55.783 60.527 1.00 23.11 ? 108 LYS A O   1 
ATOM   631  C  CB  . LYS A 1 112 ? 24.805  56.255 60.751 1.00 24.80 ? 108 LYS A CB  1 
ATOM   632  C  CG  . LYS A 1 112 ? 26.144  57.018 60.608 1.00 27.89 ? 108 LYS A CG  1 
ATOM   633  C  CD  . LYS A 1 112 ? 27.146  56.596 61.681 1.00 27.95 ? 108 LYS A CD  1 
ATOM   634  C  CE  . LYS A 1 112 ? 28.515  57.274 61.497 1.00 33.12 ? 108 LYS A CE  1 
ATOM   635  N  NZ  . LYS A 1 112 ? 29.610  56.435 62.105 1.00 36.28 ? 108 LYS A NZ  1 
ATOM   636  N  N   . VAL A 1 113 ? 22.628  54.558 58.857 1.00 22.88 ? 109 VAL A N   1 
ATOM   637  C  CA  . VAL A 1 113 ? 21.525  53.613 58.905 1.00 22.08 ? 109 VAL A CA  1 
ATOM   638  C  C   . VAL A 1 113 ? 22.112  52.240 59.136 1.00 23.20 ? 109 VAL A C   1 
ATOM   639  O  O   . VAL A 1 113 ? 22.987  51.823 58.377 1.00 23.45 ? 109 VAL A O   1 
ATOM   640  C  CB  . VAL A 1 113 ? 20.716  53.590 57.553 1.00 23.26 ? 109 VAL A CB  1 
ATOM   641  C  CG1 . VAL A 1 113 ? 19.697  52.440 57.553 1.00 22.87 ? 109 VAL A CG1 1 
ATOM   642  C  CG2 . VAL A 1 113 ? 20.040  54.939 57.299 1.00 24.61 ? 109 VAL A CG2 1 
ATOM   643  N  N   . GLN A 1 114 ? 21.658  51.532 60.174 1.00 21.26 ? 110 GLN A N   1 
ATOM   644  C  CA  . GLN A 1 114 ? 22.121  50.163 60.432 1.00 22.04 ? 110 GLN A CA  1 
ATOM   645  C  C   . GLN A 1 114 ? 21.216  49.200 59.710 1.00 23.02 ? 110 GLN A C   1 
ATOM   646  O  O   . GLN A 1 114 ? 19.990  49.313 59.812 1.00 23.42 ? 110 GLN A O   1 
ATOM   647  C  CB  . GLN A 1 114 ? 21.916  49.783 61.890 1.00 23.27 ? 110 GLN A CB  1 
ATOM   648  C  CG  . GLN A 1 114 ? 22.995  50.082 62.755 1.00 25.90 ? 110 GLN A CG  1 
ATOM   649  C  CD  . GLN A 1 114 ? 22.659  49.728 64.187 1.00 23.90 ? 110 GLN A CD  1 
ATOM   650  O  OE1 . GLN A 1 114 ? 22.391  50.628 64.998 1.00 24.15 ? 110 GLN A OE1 1 
ATOM   651  N  NE2 . GLN A 1 114 ? 22.661  48.426 64.498 1.00 22.77 ? 110 GLN A NE2 1 
ATOM   652  N  N   . LYS A 1 115 ? 21.806  48.213 59.064 1.00 22.37 ? 111 LYS A N   1 
ATOM   653  C  CA  . LYS A 1 115 ? 21.026  47.201 58.368 1.00 25.48 ? 111 LYS A CA  1 
ATOM   654  C  C   . LYS A 1 115 ? 21.145  45.923 59.186 1.00 26.28 ? 111 LYS A C   1 
ATOM   655  O  O   . LYS A 1 115 ? 22.270  45.481 59.517 1.00 28.88 ? 111 LYS A O   1 
ATOM   656  C  CB  . LYS A 1 115 ? 21.574  47.012 56.959 1.00 24.42 ? 111 LYS A CB  1 
ATOM   657  C  CG  . LYS A 1 115 ? 20.801  45.964 56.148 1.00 27.21 ? 111 LYS A CG  1 
ATOM   658  C  CD  . LYS A 1 115 ? 21.349  45.789 54.732 1.00 28.46 ? 111 LYS A CD  1 
ATOM   659  C  CE  . LYS A 1 115 ? 20.727  44.548 54.082 1.00 34.09 ? 111 LYS A CE  1 
ATOM   660  N  NZ  . LYS A 1 115 ? 21.177  44.379 52.687 1.00 38.99 ? 111 LYS A NZ  1 
ATOM   661  N  N   . VAL A 1 116 ? 20.021  45.318 59.532 1.00 24.46 ? 112 VAL A N   1 
ATOM   662  C  CA  . VAL A 1 116 ? 20.062  44.101 60.326 1.00 24.86 ? 112 VAL A CA  1 
ATOM   663  C  C   . VAL A 1 116 ? 19.273  42.998 59.621 1.00 24.38 ? 112 VAL A C   1 
ATOM   664  O  O   . VAL A 1 116 ? 18.085  43.153 59.392 1.00 23.90 ? 112 VAL A O   1 
ATOM   665  C  CB  . VAL A 1 116 ? 19.463  44.362 61.699 1.00 26.06 ? 112 VAL A CB  1 
ATOM   666  C  CG1 . VAL A 1 116 ? 19.412  43.081 62.527 1.00 29.73 ? 112 VAL A CG1 1 
ATOM   667  C  CG2 . VAL A 1 116 ? 20.260  45.452 62.419 1.00 28.10 ? 112 VAL A CG2 1 
ATOM   668  N  N   A MET A 1 117 ? 19.947  41.909 59.270 0.50 24.12 ? 113 MET A N   1 
ATOM   669  N  N   B MET A 1 117 ? 19.931  41.895 59.255 0.50 23.81 ? 113 MET A N   1 
ATOM   670  C  CA  A MET A 1 117 ? 19.219  40.819 58.652 0.50 24.02 ? 113 MET A CA  1 
ATOM   671  C  CA  B MET A 1 117 ? 19.213  40.786 58.575 0.50 23.12 ? 113 MET A CA  1 
ATOM   672  C  C   A MET A 1 117 ? 18.588  40.013 59.792 0.50 22.53 ? 113 MET A C   1 
ATOM   673  C  C   B MET A 1 117 ? 18.618  39.784 59.584 0.50 22.25 ? 113 MET A C   1 
ATOM   674  O  O   A MET A 1 117 ? 19.261  39.657 60.780 0.50 21.37 ? 113 MET A O   1 
ATOM   675  O  O   B MET A 1 117 ? 19.336  39.025 60.244 0.50 21.26 ? 113 MET A O   1 
ATOM   676  C  CB  A MET A 1 117 ? 20.121  39.886 57.833 0.50 24.52 ? 113 MET A CB  1 
ATOM   677  C  CB  B MET A 1 117 ? 20.103  40.083 57.559 0.50 23.69 ? 113 MET A CB  1 
ATOM   678  C  CG  A MET A 1 117 ? 20.359  40.290 56.377 0.50 25.23 ? 113 MET A CG  1 
ATOM   679  C  CG  B MET A 1 117 ? 20.829  41.058 56.634 0.50 24.42 ? 113 MET A CG  1 
ATOM   680  S  SD  A MET A 1 117 ? 21.308  39.006 55.511 0.50 30.33 ? 113 MET A SD  1 
ATOM   681  S  SD  B MET A 1 117 ? 21.875  40.137 55.541 0.50 27.04 ? 113 MET A SD  1 
ATOM   682  C  CE  A MET A 1 117 ? 21.922  39.915 54.089 0.50 27.18 ? 113 MET A CE  1 
ATOM   683  C  CE  B MET A 1 117 ? 20.639  39.426 54.437 0.50 29.96 ? 113 MET A CE  1 
ATOM   684  N  N   . PHE A 1 118 ? 17.295  39.758 59.664 1.00 20.79 ? 114 PHE A N   1 
ATOM   685  C  CA  . PHE A 1 118 ? 16.594  38.923 60.624 1.00 19.97 ? 114 PHE A CA  1 
ATOM   686  C  C   . PHE A 1 118 ? 16.727  37.463 60.143 1.00 19.63 ? 114 PHE A C   1 
ATOM   687  O  O   . PHE A 1 118 ? 16.948  37.204 58.959 1.00 21.46 ? 114 PHE A O   1 
ATOM   688  C  CB  . PHE A 1 118 ? 15.117  39.328 60.767 1.00 20.41 ? 114 PHE A CB  1 
ATOM   689  C  CG  . PHE A 1 118 ? 14.919  40.558 61.658 1.00 19.16 ? 114 PHE A CG  1 
ATOM   690  C  CD1 . PHE A 1 118 ? 16.048  41.363 61.990 1.00 21.07 ? 114 PHE A CD1 1 
ATOM   691  C  CD2 . PHE A 1 118 ? 13.666  40.915 62.156 1.00 27.43 ? 114 PHE A CD2 1 
ATOM   692  C  CE1 . PHE A 1 118 ? 15.903  42.507 62.864 1.00 21.88 ? 114 PHE A CE1 1 
ATOM   693  C  CE2 . PHE A 1 118 ? 13.505  42.081 62.997 1.00 24.51 ? 114 PHE A CE2 1 
ATOM   694  C  CZ  . PHE A 1 118 ? 14.623  42.838 63.349 1.00 25.24 ? 114 PHE A CZ  1 
ATOM   695  N  N   . ALA A 1 119 ? 16.569  36.528 61.072 1.00 19.48 ? 115 ALA A N   1 
ATOM   696  C  CA  . ALA A 1 119 ? 16.630  35.108 60.698 1.00 19.77 ? 115 ALA A CA  1 
ATOM   697  C  C   . ALA A 1 119 ? 15.412  34.427 61.302 1.00 19.75 ? 115 ALA A C   1 
ATOM   698  O  O   . ALA A 1 119 ? 14.919  34.846 62.347 1.00 19.28 ? 115 ALA A O   1 
ATOM   699  C  CB  . ALA A 1 119 ? 17.901  34.463 61.235 1.00 20.32 ? 115 ALA A CB  1 
ATOM   700  N  N   . PRO A 1 120 ? 14.926  33.354 60.647 1.00 19.64 ? 116 PRO A N   1 
ATOM   701  C  CA  . PRO A 1 120 ? 13.773  32.608 61.208 1.00 20.06 ? 116 PRO A CA  1 
ATOM   702  C  C   . PRO A 1 120 ? 14.258  31.748 62.369 1.00 20.19 ? 116 PRO A C   1 
ATOM   703  O  O   . PRO A 1 120 ? 15.384  31.213 62.352 1.00 20.69 ? 116 PRO A O   1 
ATOM   704  C  CB  . PRO A 1 120 ? 13.297  31.723 60.043 1.00 20.60 ? 116 PRO A CB  1 
ATOM   705  C  CG  . PRO A 1 120 ? 14.443  31.618 59.159 1.00 20.73 ? 116 PRO A CG  1 
ATOM   706  C  CD  . PRO A 1 120 ? 15.408  32.762 59.380 1.00 21.25 ? 116 PRO A CD  1 
ATOM   707  N  N   . MET A 1 121 ? 13.451  31.710 63.423 1.00 19.89 ? 117 MET A N   1 
ATOM   708  C  CA  . MET A 1 121 ? 13.852  30.974 64.625 1.00 21.74 ? 117 MET A CA  1 
ATOM   709  C  C   . MET A 1 121 ? 12.637  30.699 65.505 1.00 21.86 ? 117 MET A C   1 
ATOM   710  O  O   . MET A 1 121 ? 11.562  31.306 65.346 1.00 22.64 ? 117 MET A O   1 
ATOM   711  C  CB  . MET A 1 121 ? 14.872  31.800 65.426 1.00 21.01 ? 117 MET A CB  1 
ATOM   712  C  CG  . MET A 1 121 ? 14.389  33.228 65.623 1.00 22.00 ? 117 MET A CG  1 
ATOM   713  S  SD  . MET A 1 121 ? 15.759  34.108 66.480 1.00 26.31 ? 117 MET A SD  1 
ATOM   714  C  CE  . MET A 1 121 ? 17.033  34.217 65.208 1.00 23.31 ? 117 MET A CE  1 
ATOM   715  N  N   . ASN A 1 122 ? 12.802  29.745 66.414 1.00 22.04 ? 118 ASN A N   1 
ATOM   716  C  CA  . ASN A 1 122 ? 11.716  29.426 67.344 1.00 23.14 ? 118 ASN A CA  1 
ATOM   717  C  C   . ASN A 1 122 ? 12.129  29.837 68.743 1.00 23.14 ? 118 ASN A C   1 
ATOM   718  O  O   . ASN A 1 122 ? 13.262  29.606 69.174 1.00 20.60 ? 118 ASN A O   1 
ATOM   719  C  CB  . ASN A 1 122 ? 11.470  27.917 67.480 1.00 23.67 ? 118 ASN A CB  1 
ATOM   720  C  CG  . ASN A 1 122 ? 10.534  27.355 66.443 1.00 26.70 ? 118 ASN A CG  1 
ATOM   721  O  OD1 . ASN A 1 122 ? 9.982   28.085 65.589 1.00 27.63 ? 118 ASN A OD1 1 
ATOM   722  N  ND2 . ASN A 1 122 ? 10.322  26.029 66.518 1.00 27.93 ? 118 ASN A ND2 1 
ATOM   723  N  N   . ALA A 1 123 ? 11.153  30.369 69.477 1.00 23.87 ? 119 ALA A N   1 
ATOM   724  C  CA  . ALA A 1 123 ? 11.307  30.695 70.891 1.00 26.39 ? 119 ALA A CA  1 
ATOM   725  C  C   . ALA A 1 123 ? 10.190  29.799 71.492 1.00 27.92 ? 119 ALA A C   1 
ATOM   726  O  O   . ALA A 1 123 ? 9.529   29.043 70.752 1.00 28.01 ? 119 ALA A O   1 
ATOM   727  C  CB  . ALA A 1 123 ? 11.021  32.144 71.137 1.00 26.84 ? 119 ALA A CB  1 
ATOM   728  N  N   . GLY A 1 124 ? 9.971   29.888 72.800 1.00 29.73 ? 120 GLY A N   1 
ATOM   729  C  CA  . GLY A 1 124 ? 8.929   29.077 73.454 1.00 31.73 ? 120 GLY A CA  1 
ATOM   730  C  C   . GLY A 1 124 ? 7.529   29.334 72.927 1.00 32.10 ? 120 GLY A C   1 
ATOM   731  O  O   . GLY A 1 124 ? 6.674   28.434 72.960 1.00 33.18 ? 120 GLY A O   1 
ATOM   732  N  N   . ASP A 1 125 ? 7.300   30.539 72.409 1.00 32.52 ? 121 ASP A N   1 
ATOM   733  C  CA  . ASP A 1 125 ? 6.003   30.931 71.844 1.00 32.01 ? 121 ASP A CA  1 
ATOM   734  C  C   . ASP A 1 125 ? 5.902   30.816 70.319 1.00 31.01 ? 121 ASP A C   1 
ATOM   735  O  O   . ASP A 1 125 ? 5.004   31.393 69.686 1.00 32.33 ? 121 ASP A O   1 
ATOM   736  C  CB  . ASP A 1 125 ? 5.609   32.340 72.327 1.00 32.98 ? 121 ASP A CB  1 
ATOM   737  C  CG  . ASP A 1 125 ? 6.527   33.426 71.777 1.00 35.33 ? 121 ASP A CG  1 
ATOM   738  O  OD1 . ASP A 1 125 ? 7.726   33.141 71.542 1.00 36.29 ? 121 ASP A OD1 1 
ATOM   739  O  OD2 . ASP A 1 125 ? 6.035   34.569 71.586 1.00 38.74 ? 121 ASP A OD2 1 
ATOM   740  N  N   . GLY A 1 126 ? 6.803   30.041 69.727 1.00 29.08 ? 122 GLY A N   1 
ATOM   741  C  CA  . GLY A 1 126 ? 6.759   29.774 68.328 1.00 26.80 ? 122 GLY A CA  1 
ATOM   742  C  C   . GLY A 1 126 ? 7.724   30.510 67.430 1.00 25.34 ? 122 GLY A C   1 
ATOM   743  O  O   . GLY A 1 126 ? 8.673   31.206 67.913 1.00 24.67 ? 122 GLY A O   1 
ATOM   744  N  N   . PRO A 1 127 ? 7.540   30.306 66.115 1.00 25.05 ? 123 PRO A N   1 
ATOM   745  C  CA  . PRO A 1 127 ? 8.434   30.906 65.139 1.00 24.21 ? 123 PRO A CA  1 
ATOM   746  C  C   . PRO A 1 127 ? 8.259   32.410 64.978 1.00 23.41 ? 123 PRO A C   1 
ATOM   747  O  O   . PRO A 1 127 ? 7.126   32.964 65.067 1.00 24.03 ? 123 PRO A O   1 
ATOM   748  C  CB  . PRO A 1 127 ? 8.033   30.209 63.819 1.00 24.13 ? 123 PRO A CB  1 
ATOM   749  C  CG  . PRO A 1 127 ? 6.656   29.738 64.035 1.00 27.90 ? 123 PRO A CG  1 
ATOM   750  C  CD  . PRO A 1 127 ? 6.459   29.516 65.492 1.00 25.97 ? 123 PRO A CD  1 
ATOM   751  N  N   . HIS A 1 128 ? 9.373   33.084 64.738 1.00 21.69 ? 124 HIS A N   1 
ATOM   752  C  CA  . HIS A 1 128 ? 9.337   34.500 64.427 1.00 22.11 ? 124 HIS A CA  1 
ATOM   753  C  C   . HIS A 1 128 ? 10.548  34.794 63.566 1.00 20.80 ? 124 HIS A C   1 
ATOM   754  O  O   . HIS A 1 128 ? 11.403  33.897 63.351 1.00 21.18 ? 124 HIS A O   1 
ATOM   755  C  CB  . HIS A 1 128 ? 9.328   35.389 65.682 1.00 22.43 ? 124 HIS A CB  1 
ATOM   756  C  CG  . HIS A 1 128 ? 10.619  35.407 66.468 1.00 24.21 ? 124 HIS A CG  1 
ATOM   757  N  ND1 . HIS A 1 128 ? 10.826  34.628 67.593 1.00 29.05 ? 124 HIS A ND1 1 
ATOM   758  C  CD2 . HIS A 1 128 ? 11.739  36.178 66.347 1.00 29.32 ? 124 HIS A CD2 1 
ATOM   759  C  CE1 . HIS A 1 128 ? 12.019  34.901 68.115 1.00 31.05 ? 124 HIS A CE1 1 
ATOM   760  N  NE2 . HIS A 1 128 ? 12.588  35.848 67.395 1.00 30.49 ? 124 HIS A NE2 1 
ATOM   761  N  N   . TYR A 1 129 ? 10.678  36.039 63.128 1.00 19.88 ? 125 TYR A N   1 
ATOM   762  C  CA  . TYR A 1 129 ? 11.896  36.468 62.420 1.00 18.89 ? 125 TYR A CA  1 
ATOM   763  C  C   . TYR A 1 129 ? 12.585  37.373 63.441 1.00 19.98 ? 125 TYR A C   1 
ATOM   764  O  O   . TYR A 1 129 ? 11.946  38.280 63.970 1.00 20.61 ? 125 TYR A O   1 
ATOM   765  C  CB  . TYR A 1 129 ? 11.581  37.292 61.175 1.00 18.94 ? 125 TYR A CB  1 
ATOM   766  C  CG  . TYR A 1 129 ? 10.934  36.426 60.135 1.00 17.41 ? 125 TYR A CG  1 
ATOM   767  C  CD1 . TYR A 1 129 ? 11.714  35.649 59.249 1.00 18.96 ? 125 TYR A CD1 1 
ATOM   768  C  CD2 . TYR A 1 129 ? 9.545   36.360 60.044 1.00 17.44 ? 125 TYR A CD2 1 
ATOM   769  C  CE1 . TYR A 1 129 ? 11.073  34.831 58.268 1.00 18.53 ? 125 TYR A CE1 1 
ATOM   770  C  CE2 . TYR A 1 129 ? 8.901   35.565 59.080 1.00 17.60 ? 125 TYR A CE2 1 
ATOM   771  C  CZ  . TYR A 1 129 ? 9.679   34.798 58.213 1.00 17.97 ? 125 TYR A CZ  1 
ATOM   772  O  OH  . TYR A 1 129 ? 9.092   34.028 57.256 1.00 20.06 ? 125 TYR A OH  1 
ATOM   773  N  N   . GLY A 1 130 ? 13.866  37.174 63.701 1.00 18.68 ? 126 GLY A N   1 
ATOM   774  C  CA  . GLY A 1 130 ? 14.410  38.082 64.704 1.00 20.23 ? 126 GLY A CA  1 
ATOM   775  C  C   . GLY A 1 130 ? 15.922  38.161 64.657 1.00 18.55 ? 126 GLY A C   1 
ATOM   776  O  O   . GLY A 1 130 ? 16.605  37.504 63.853 1.00 18.59 ? 126 GLY A O   1 
ATOM   777  N  N   . ALA A 1 131 ? 16.450  39.012 65.535 1.00 19.89 ? 127 ALA A N   1 
ATOM   778  C  CA  . ALA A 1 131 ? 17.893  39.144 65.622 1.00 18.87 ? 127 ALA A CA  1 
ATOM   779  C  C   . ALA A 1 131 ? 18.325  39.774 66.915 1.00 19.07 ? 127 ALA A C   1 
ATOM   780  O  O   . ALA A 1 131 ? 17.626  40.645 67.418 1.00 19.96 ? 127 ALA A O   1 
ATOM   781  C  CB  . ALA A 1 131 ? 18.445  40.071 64.515 1.00 20.65 ? 127 ALA A CB  1 
ATOM   782  N  N   . ASN A 1 132 ? 19.479  39.356 67.399 1.00 17.57 ? 128 ASN A N   1 
ATOM   783  C  CA  . ASN A 1 132 ? 20.097  40.090 68.499 1.00 17.95 ? 128 ASN A CA  1 
ATOM   784  C  C   . ASN A 1 132 ? 20.691  41.318 67.773 1.00 18.06 ? 128 ASN A C   1 
ATOM   785  O  O   . ASN A 1 132 ? 21.246  41.213 66.678 1.00 18.60 ? 128 ASN A O   1 
ATOM   786  C  CB  . ASN A 1 132 ? 21.245  39.311 69.112 1.00 18.54 ? 128 ASN A CB  1 
ATOM   787  C  CG  . ASN A 1 132 ? 20.789  38.338 70.180 1.00 19.59 ? 128 ASN A CG  1 
ATOM   788  O  OD1 . ASN A 1 132 ? 19.575  38.241 70.557 1.00 18.65 ? 128 ASN A OD1 1 
ATOM   789  N  ND2 . ASN A 1 132 ? 21.770  37.627 70.712 1.00 19.35 ? 128 ASN A ND2 1 
ATOM   790  N  N   A VAL A 1 133 ? 20.542  42.484 68.402 0.50 19.09 ? 129 VAL A N   1 
ATOM   791  N  N   B VAL A 1 133 ? 20.634  42.482 68.405 0.50 18.68 ? 129 VAL A N   1 
ATOM   792  C  CA  A VAL A 1 133 ? 20.960  43.748 67.828 0.50 19.35 ? 129 VAL A CA  1 
ATOM   793  C  CA  B VAL A 1 133 ? 21.197  43.657 67.776 0.50 18.68 ? 129 VAL A CA  1 
ATOM   794  C  C   A VAL A 1 133 ? 21.658  44.704 68.811 0.50 19.71 ? 129 VAL A C   1 
ATOM   795  C  C   B VAL A 1 133 ? 21.897  44.523 68.818 0.50 19.14 ? 129 VAL A C   1 
ATOM   796  O  O   A VAL A 1 133 ? 21.313  44.719 69.999 0.50 18.91 ? 129 VAL A O   1 
ATOM   797  O  O   B VAL A 1 133 ? 21.808  44.287 70.027 0.50 18.07 ? 129 VAL A O   1 
ATOM   798  C  CB  A VAL A 1 133 ? 19.670  44.512 67.352 0.50 20.54 ? 129 VAL A CB  1 
ATOM   799  C  CB  B VAL A 1 133 ? 20.121  44.515 67.015 0.50 19.36 ? 129 VAL A CB  1 
ATOM   800  C  CG1 A VAL A 1 133 ? 20.021  45.829 66.751 0.50 21.12 ? 129 VAL A CG1 1 
ATOM   801  C  CG1 B VAL A 1 133 ? 19.334  43.675 65.991 0.50 20.32 ? 129 VAL A CG1 1 
ATOM   802  C  CG2 A VAL A 1 133 ? 18.784  43.662 66.401 0.50 19.89 ? 129 VAL A CG2 1 
ATOM   803  C  CG2 B VAL A 1 133 ? 19.142  45.187 68.022 0.50 17.88 ? 129 VAL A CG2 1 
ATOM   804  N  N   . LYS A 1 134 ? 22.594  45.509 68.290 1.00 18.73 ? 130 LYS A N   1 
ATOM   805  C  CA  . LYS A 1 134 ? 23.261  46.553 69.070 1.00 19.17 ? 130 LYS A CA  1 
ATOM   806  C  C   . LYS A 1 134 ? 22.664  47.854 68.489 1.00 20.77 ? 130 LYS A C   1 
ATOM   807  O  O   . LYS A 1 134 ? 22.558  48.008 67.242 1.00 22.75 ? 130 LYS A O   1 
ATOM   808  C  CB  . LYS A 1 134 ? 24.780  46.592 68.862 1.00 22.01 ? 130 LYS A CB  1 
ATOM   809  C  CG  . LYS A 1 134 ? 25.479  45.460 69.526 1.00 24.00 ? 130 LYS A CG  1 
ATOM   810  C  CD  . LYS A 1 134 ? 26.943  45.755 69.802 1.00 30.73 ? 130 LYS A CD  1 
ATOM   811  C  CE  . LYS A 1 134 ? 27.675  46.297 68.607 1.00 32.88 ? 130 LYS A CE  1 
ATOM   812  N  NZ  . LYS A 1 134 ? 29.125  46.505 68.933 1.00 29.20 ? 130 LYS A NZ  1 
ATOM   813  N  N   . PHE A 1 135 ? 22.270  48.799 69.336 1.00 17.68 ? 131 PHE A N   1 
ATOM   814  C  CA  . PHE A 1 135 ? 21.865  50.116 68.808 1.00 19.27 ? 131 PHE A CA  1 
ATOM   815  C  C   . PHE A 1 135 ? 23.169  50.929 68.721 1.00 20.02 ? 131 PHE A C   1 
ATOM   816  O  O   . PHE A 1 135 ? 23.698  51.453 69.737 1.00 19.54 ? 131 PHE A O   1 
ATOM   817  C  CB  . PHE A 1 135 ? 20.832  50.784 69.703 1.00 18.84 ? 131 PHE A CB  1 
ATOM   818  C  CG  . PHE A 1 135 ? 19.496  50.236 69.541 1.00 19.40 ? 131 PHE A CG  1 
ATOM   819  C  CD1 . PHE A 1 135 ? 18.691  50.717 68.526 1.00 21.69 ? 131 PHE A CD1 1 
ATOM   820  C  CD2 . PHE A 1 135 ? 19.039  49.234 70.405 1.00 20.93 ? 131 PHE A CD2 1 
ATOM   821  C  CE1 . PHE A 1 135 ? 17.413  50.205 68.330 1.00 19.77 ? 131 PHE A CE1 1 
ATOM   822  C  CE2 . PHE A 1 135 ? 17.739  48.717 70.245 1.00 22.53 ? 131 PHE A CE2 1 
ATOM   823  C  CZ  . PHE A 1 135 ? 16.946  49.179 69.202 1.00 21.73 ? 131 PHE A CZ  1 
ATOM   824  N  N   . GLU A 1 136 ? 23.767  50.927 67.519 1.00 20.43 ? 132 GLU A N   1 
ATOM   825  C  CA  . GLU A 1 136 ? 25.095  51.507 67.298 1.00 20.48 ? 132 GLU A CA  1 
ATOM   826  C  C   . GLU A 1 136 ? 25.355  52.945 67.679 1.00 20.00 ? 132 GLU A C   1 
ATOM   827  O  O   . GLU A 1 136 ? 26.522  53.285 67.974 1.00 20.17 ? 132 GLU A O   1 
ATOM   828  C  CB  . GLU A 1 136 ? 25.597  51.182 65.882 1.00 21.15 ? 132 GLU A CB  1 
ATOM   829  C  CG  . GLU A 1 136 ? 25.824  49.686 65.729 1.00 23.56 ? 132 GLU A CG  1 
ATOM   830  C  CD  . GLU A 1 136 ? 26.128  49.252 64.298 1.00 28.35 ? 132 GLU A CD  1 
ATOM   831  O  OE1 . GLU A 1 136 ? 26.250  50.139 63.426 1.00 31.41 ? 132 GLU A OE1 1 
ATOM   832  O  OE2 . GLU A 1 136 ? 26.197  48.014 64.047 1.00 32.78 ? 132 GLU A OE2 1 
ATOM   833  N  N   . GLU A 1 137 ? 24.307  53.764 67.664 1.00 20.02 ? 133 GLU A N   1 
ATOM   834  C  CA  . GLU A 1 137 ? 24.484  55.160 68.034 1.00 21.21 ? 133 GLU A CA  1 
ATOM   835  C  C   . GLU A 1 137 ? 23.966  55.477 69.425 1.00 20.13 ? 133 GLU A C   1 
ATOM   836  O  O   . GLU A 1 137 ? 23.806  56.640 69.754 1.00 21.28 ? 133 GLU A O   1 
ATOM   837  C  CB  . GLU A 1 137 ? 23.998  56.136 66.963 1.00 21.32 ? 133 GLU A CB  1 
ATOM   838  C  CG  . GLU A 1 137 ? 24.883  56.055 65.738 1.00 25.08 ? 133 GLU A CG  1 
ATOM   839  C  CD  . GLU A 1 137 ? 24.694  57.204 64.780 1.00 28.35 ? 133 GLU A CD  1 
ATOM   840  O  OE1 . GLU A 1 137 ? 23.619  57.278 64.169 1.00 28.63 ? 133 GLU A OE1 1 
ATOM   841  O  OE2 . GLU A 1 137 ? 25.647  58.008 64.618 1.00 33.77 ? 133 GLU A OE2 1 
ATOM   842  N  N   . GLY A 1 138 ? 23.812  54.449 70.266 1.00 19.46 ? 134 GLY A N   1 
ATOM   843  C  CA  . GLY A 1 138 ? 23.457  54.629 71.661 1.00 18.93 ? 134 GLY A CA  1 
ATOM   844  C  C   . GLY A 1 138 ? 22.008  54.988 71.932 1.00 18.63 ? 134 GLY A C   1 
ATOM   845  O  O   . GLY A 1 138 ? 21.122  54.874 71.063 1.00 17.08 ? 134 GLY A O   1 
ATOM   846  N  N   . LEU A 1 139 ? 21.790  55.390 73.170 1.00 18.43 ? 135 LEU A N   1 
ATOM   847  C  CA  . LEU A 1 139 ? 20.443  55.727 73.615 1.00 19.21 ? 135 LEU A CA  1 
ATOM   848  C  C   . LEU A 1 139 ? 19.849  56.872 72.822 1.00 19.11 ? 135 LEU A C   1 
ATOM   849  O  O   . LEU A 1 139 ? 20.542  57.847 72.474 1.00 18.56 ? 135 LEU A O   1 
ATOM   850  C  CB  . LEU A 1 139 ? 20.510  56.150 75.098 1.00 19.66 ? 135 LEU A CB  1 
ATOM   851  C  CG  . LEU A 1 139 ? 21.113  55.102 76.031 1.00 21.69 ? 135 LEU A CG  1 
ATOM   852  C  CD1 . LEU A 1 139 ? 21.321  55.797 77.396 1.00 24.48 ? 135 LEU A CD1 1 
ATOM   853  C  CD2 . LEU A 1 139 ? 20.163  53.942 76.180 1.00 22.65 ? 135 LEU A CD2 1 
ATOM   854  N  N   . GLY A 1 140 ? 18.545  56.785 72.592 1.00 18.07 ? 136 GLY A N   1 
ATOM   855  C  CA  . GLY A 1 140 ? 17.872  57.860 71.873 1.00 19.06 ? 136 GLY A CA  1 
ATOM   856  C  C   . GLY A 1 140 ? 16.694  57.341 71.092 1.00 19.11 ? 136 GLY A C   1 
ATOM   857  O  O   . GLY A 1 140 ? 16.296  56.155 71.219 1.00 19.37 ? 136 GLY A O   1 
ATOM   858  N  N   . THR A 1 141 ? 16.154  58.228 70.254 1.00 18.36 ? 137 THR A N   1 
ATOM   859  C  CA  . THR A 1 141 ? 15.008  57.904 69.422 1.00 18.05 ? 137 THR A CA  1 
ATOM   860  C  C   . THR A 1 141 ? 15.485  57.441 68.043 1.00 18.15 ? 137 THR A C   1 
ATOM   861  O  O   . THR A 1 141 ? 16.404  58.036 67.466 1.00 17.43 ? 137 THR A O   1 
ATOM   862  C  CB  . THR A 1 141 ? 14.099  59.139 69.249 1.00 19.09 ? 137 THR A CB  1 
ATOM   863  O  OG1 . THR A 1 141 ? 13.987  59.826 70.519 1.00 18.43 ? 137 THR A OG1 1 
ATOM   864  C  CG2 . THR A 1 141 ? 12.757  58.685 68.692 1.00 19.34 ? 137 THR A CG2 1 
ATOM   865  N  N   . TYR A 1 142 ? 14.940  56.327 67.587 1.00 18.06 ? 138 TYR A N   1 
ATOM   866  C  CA  . TYR A 1 142 ? 15.296  55.755 66.297 1.00 17.67 ? 138 TYR A CA  1 
ATOM   867  C  C   . TYR A 1 142 ? 14.077  55.532 65.414 1.00 18.56 ? 138 TYR A C   1 
ATOM   868  O  O   . TYR A 1 142 ? 12.990  55.244 65.893 1.00 19.15 ? 138 TYR A O   1 
ATOM   869  C  CB  . TYR A 1 142 ? 15.892  54.332 66.499 1.00 18.84 ? 138 TYR A CB  1 
ATOM   870  C  CG  . TYR A 1 142 ? 17.309  54.338 66.992 1.00 17.71 ? 138 TYR A CG  1 
ATOM   871  C  CD1 . TYR A 1 142 ? 17.584  54.611 68.349 1.00 15.79 ? 138 TYR A CD1 1 
ATOM   872  C  CD2 . TYR A 1 142 ? 18.382  54.001 66.140 1.00 17.33 ? 138 TYR A CD2 1 
ATOM   873  C  CE1 . TYR A 1 142 ? 18.904  54.581 68.848 1.00 17.57 ? 138 TYR A CE1 1 
ATOM   874  C  CE2 . TYR A 1 142 ? 19.709  53.980 66.618 1.00 17.04 ? 138 TYR A CE2 1 
ATOM   875  C  CZ  . TYR A 1 142 ? 19.953  54.278 67.977 1.00 18.77 ? 138 TYR A CZ  1 
ATOM   876  O  OH  . TYR A 1 142 ? 21.265  54.277 68.418 1.00 18.86 ? 138 TYR A OH  1 
ATOM   877  N  N   . LYS A 1 143 ? 14.284  55.649 64.115 1.00 17.76 ? 139 LYS A N   1 
ATOM   878  C  CA  . LYS A 1 143 ? 13.262  55.227 63.155 1.00 19.99 ? 139 LYS A CA  1 
ATOM   879  C  C   . LYS A 1 143 ? 13.631  53.747 62.982 1.00 19.28 ? 139 LYS A C   1 
ATOM   880  O  O   . LYS A 1 143 ? 14.822  53.391 62.866 1.00 18.89 ? 139 LYS A O   1 
ATOM   881  C  CB  . LYS A 1 143 ? 13.378  55.947 61.805 1.00 20.24 ? 139 LYS A CB  1 
ATOM   882  C  CG  . LYS A 1 143 ? 12.334  55.458 60.750 1.00 26.24 ? 139 LYS A CG  1 
ATOM   883  C  CD  . LYS A 1 143 ? 12.524  56.223 59.450 1.00 26.01 ? 139 LYS A CD  1 
ATOM   884  C  CE  . LYS A 1 143 ? 11.497  55.809 58.369 1.00 30.05 ? 139 LYS A CE  1 
ATOM   885  N  NZ  . LYS A 1 143 ? 10.381  56.845 58.238 1.00 36.30 ? 139 LYS A NZ  1 
ATOM   886  N  N   . VAL A 1 144 ? 12.630  52.868 63.038 1.00 18.62 ? 140 VAL A N   1 
ATOM   887  C  CA  . VAL A 1 144 ? 12.818  51.416 62.883 1.00 19.28 ? 140 VAL A CA  1 
ATOM   888  C  C   . VAL A 1 144 ? 11.942  50.961 61.718 1.00 19.77 ? 140 VAL A C   1 
ATOM   889  O  O   . VAL A 1 144 ? 10.722  51.202 61.701 1.00 18.92 ? 140 VAL A O   1 
ATOM   890  C  CB  . VAL A 1 144 ? 12.450  50.608 64.171 1.00 19.72 ? 140 VAL A CB  1 
ATOM   891  C  CG1 . VAL A 1 144 ? 12.500  49.111 63.913 1.00 19.09 ? 140 VAL A CG1 1 
ATOM   892  C  CG2 . VAL A 1 144 ? 13.382  50.970 65.358 1.00 21.26 ? 140 VAL A CG2 1 
ATOM   893  N  N   . ARG A 1 145 ? 12.570  50.349 60.721 1.00 19.09 ? 141 ARG A N   1 
ATOM   894  C  CA  . ARG A 1 145 ? 11.824  49.929 59.516 1.00 20.66 ? 141 ARG A CA  1 
ATOM   895  C  C   . ARG A 1 145 ? 12.068  48.473 59.253 1.00 19.82 ? 141 ARG A C   1 
ATOM   896  O  O   . ARG A 1 145 ? 13.245  48.049 59.182 1.00 21.38 ? 141 ARG A O   1 
ATOM   897  C  CB  . ARG A 1 145 ? 12.345  50.784 58.331 1.00 20.60 ? 141 ARG A CB  1 
ATOM   898  C  CG  . ARG A 1 145 ? 11.908  50.372 56.934 1.00 24.26 ? 141 ARG A CG  1 
ATOM   899  C  CD  . ARG A 1 145 ? 12.458  51.415 55.950 1.00 24.41 ? 141 ARG A CD  1 
ATOM   900  N  NE  . ARG A 1 145 ? 12.191  51.168 54.544 1.00 29.59 ? 141 ARG A NE  1 
ATOM   901  C  CZ  . ARG A 1 145 ? 11.350  51.910 53.820 1.00 29.54 ? 141 ARG A CZ  1 
ATOM   902  N  NH1 . ARG A 1 145 ? 10.734  52.953 54.380 1.00 32.56 ? 141 ARG A NH1 1 
ATOM   903  N  NH2 . ARG A 1 145 ? 11.149  51.642 52.540 1.00 31.07 ? 141 ARG A NH2 1 
ATOM   904  N  N   . PHE A 1 146 ? 11.002  47.691 59.068 1.00 18.84 ? 142 PHE A N   1 
ATOM   905  C  CA  . PHE A 1 146 ? 11.200  46.305 58.711 1.00 18.38 ? 142 PHE A CA  1 
ATOM   906  C  C   . PHE A 1 146 ? 10.811  46.254 57.219 1.00 19.32 ? 142 PHE A C   1 
ATOM   907  O  O   . PHE A 1 146 ? 9.714   46.734 56.839 1.00 19.06 ? 142 PHE A O   1 
ATOM   908  C  CB  . PHE A 1 146 ? 10.200  45.402 59.433 1.00 18.37 ? 142 PHE A CB  1 
ATOM   909  C  CG  . PHE A 1 146 ? 10.436  45.230 60.917 1.00 18.62 ? 142 PHE A CG  1 
ATOM   910  C  CD1 . PHE A 1 146 ? 11.584  45.705 61.561 1.00 21.36 ? 142 PHE A CD1 1 
ATOM   911  C  CD2 . PHE A 1 146 ? 9.456   44.591 61.698 1.00 19.30 ? 142 PHE A CD2 1 
ATOM   912  C  CE1 . PHE A 1 146 ? 11.752  45.485 62.958 1.00 20.62 ? 142 PHE A CE1 1 
ATOM   913  C  CE2 . PHE A 1 146 ? 9.631   44.375 63.043 1.00 21.06 ? 142 PHE A CE2 1 
ATOM   914  C  CZ  . PHE A 1 146 ? 10.761  44.830 63.685 1.00 21.12 ? 142 PHE A CZ  1 
ATOM   915  N  N   . GLU A 1 147 ? 11.676  45.671 56.403 1.00 18.10 ? 143 GLU A N   1 
ATOM   916  C  CA  . GLU A 1 147 ? 11.368  45.487 54.965 1.00 19.04 ? 143 GLU A CA  1 
ATOM   917  C  C   . GLU A 1 147 ? 11.225  43.994 54.818 1.00 19.36 ? 143 GLU A C   1 
ATOM   918  O  O   . GLU A 1 147 ? 12.127  43.245 55.216 1.00 18.29 ? 143 GLU A O   1 
ATOM   919  C  CB  . GLU A 1 147 ? 12.453  46.031 54.044 1.00 19.29 ? 143 GLU A CB  1 
ATOM   920  C  CG  . GLU A 1 147 ? 12.552  47.539 54.089 1.00 22.23 ? 143 GLU A CG  1 
ATOM   921  C  CD  . GLU A 1 147 ? 13.371  48.124 52.947 1.00 26.13 ? 143 GLU A CD  1 
ATOM   922  O  OE1 . GLU A 1 147 ? 13.972  47.370 52.112 1.00 27.46 ? 143 GLU A OE1 1 
ATOM   923  O  OE2 . GLU A 1 147 ? 13.416  49.363 52.924 1.00 26.05 ? 143 GLU A OE2 1 
ATOM   924  N  N   . ILE A 1 148 ? 10.072  43.568 54.293 1.00 18.22 ? 144 ILE A N   1 
ATOM   925  C  CA  . ILE A 1 148 ? 9.738   42.179 54.225 1.00 18.18 ? 144 ILE A CA  1 
ATOM   926  C  C   . ILE A 1 148 ? 9.570   41.709 52.790 1.00 19.26 ? 144 ILE A C   1 
ATOM   927  O  O   . ILE A 1 148 ? 8.594   42.092 52.101 1.00 18.59 ? 144 ILE A O   1 
ATOM   928  C  CB  . ILE A 1 148 ? 8.400   41.970 54.983 1.00 17.64 ? 144 ILE A CB  1 
ATOM   929  C  CG1 . ILE A 1 148 ? 8.532   42.427 56.440 1.00 18.86 ? 144 ILE A CG1 1 
ATOM   930  C  CG2 . ILE A 1 148 ? 8.012   40.515 54.960 1.00 17.74 ? 144 ILE A CG2 1 
ATOM   931  C  CD1 . ILE A 1 148 ? 7.199   42.757 57.063 1.00 19.53 ? 144 ILE A CD1 1 
ATOM   932  N  N   . ALA A 1 149 ? 10.546  40.943 52.329 1.00 18.21 ? 145 ALA A N   1 
ATOM   933  C  CA  . ALA A 1 149 ? 10.477  40.435 50.968 1.00 18.09 ? 145 ALA A CA  1 
ATOM   934  C  C   . ALA A 1 149 ? 9.837   39.065 50.942 1.00 17.50 ? 145 ALA A C   1 
ATOM   935  O  O   . ALA A 1 149 ? 9.937   38.261 51.905 1.00 17.66 ? 145 ALA A O   1 
ATOM   936  C  CB  . ALA A 1 149 ? 11.900  40.386 50.357 1.00 19.65 ? 145 ALA A CB  1 
ATOM   937  N  N   . ALA A 1 150 ? 9.178   38.777 49.817 1.00 17.67 ? 146 ALA A N   1 
ATOM   938  C  CA  . ALA A 1 150 ? 8.559   37.476 49.599 1.00 18.12 ? 146 ALA A CA  1 
ATOM   939  C  C   . ALA A 1 150 ? 9.684   36.428 49.502 1.00 18.62 ? 146 ALA A C   1 
ATOM   940  O  O   . ALA A 1 150 ? 10.865  36.774 49.320 1.00 18.65 ? 146 ALA A O   1 
ATOM   941  C  CB  . ALA A 1 150 ? 7.764   37.474 48.303 1.00 18.82 ? 146 ALA A CB  1 
ATOM   942  N  N   . PRO A 1 151 ? 9.307   35.139 49.523 1.00 20.39 ? 147 PRO A N   1 
ATOM   943  C  CA  . PRO A 1 151 ? 10.340  34.097 49.398 1.00 21.16 ? 147 PRO A CA  1 
ATOM   944  C  C   . PRO A 1 151 ? 11.100  34.214 48.097 1.00 22.73 ? 147 PRO A C   1 
ATOM   945  O  O   . PRO A 1 151 ? 10.544  34.699 47.072 1.00 22.46 ? 147 PRO A O   1 
ATOM   946  C  CB  . PRO A 1 151 ? 9.524   32.787 49.414 1.00 20.63 ? 147 PRO A CB  1 
ATOM   947  C  CG  . PRO A 1 151 ? 8.263   33.148 50.174 1.00 20.83 ? 147 PRO A CG  1 
ATOM   948  C  CD  . PRO A 1 151 ? 7.963   34.562 49.668 1.00 19.46 ? 147 PRO A CD  1 
ATOM   949  N  N   A SER A 1 152 ? 12.366  33.807 48.120 0.50 23.46 ? 148 SER A N   1 
ATOM   950  N  N   B SER A 1 152 ? 12.358  33.772 48.117 0.50 23.26 ? 148 SER A N   1 
ATOM   951  C  CA  A SER A 1 152 ? 13.163  33.832 46.907 0.50 25.04 ? 148 SER A CA  1 
ATOM   952  C  CA  B SER A 1 152 ? 13.179  33.762 46.914 0.50 24.48 ? 148 SER A CA  1 
ATOM   953  C  C   A SER A 1 152 ? 12.489  32.895 45.890 0.50 25.27 ? 148 SER A C   1 
ATOM   954  C  C   B SER A 1 152 ? 12.478  32.875 45.882 0.50 24.96 ? 148 SER A C   1 
ATOM   955  O  O   A SER A 1 152 ? 11.761  31.959 46.256 0.50 25.27 ? 148 SER A O   1 
ATOM   956  O  O   B SER A 1 152 ? 11.728  31.947 46.229 0.50 24.89 ? 148 SER A O   1 
ATOM   957  C  CB  A SER A 1 152 ? 14.595  33.405 47.186 0.50 25.38 ? 148 SER A CB  1 
ATOM   958  C  CB  B SER A 1 152 ? 14.555  33.173 47.209 0.50 24.77 ? 148 SER A CB  1 
ATOM   959  O  OG  A SER A 1 152 ? 15.369  33.548 46.014 0.50 28.37 ? 148 SER A OG  1 
ATOM   960  O  OG  B SER A 1 152 ? 15.258  33.952 48.150 0.50 25.31 ? 148 SER A OG  1 
ATOM   961  N  N   . HIS A 1 153 ? 12.709  33.186 44.615 1.00 25.93 ? 149 HIS A N   1 
ATOM   962  C  CA  . HIS A 1 153 ? 12.113  32.452 43.500 1.00 27.78 ? 149 HIS A CA  1 
ATOM   963  C  C   . HIS A 1 153 ? 12.154  30.922 43.614 1.00 27.67 ? 149 HIS A C   1 
ATOM   964  O  O   . HIS A 1 153 ? 11.161  30.233 43.314 1.00 28.16 ? 149 HIS A O   1 
ATOM   965  C  CB  . HIS A 1 153 ? 12.779  32.948 42.192 1.00 28.44 ? 149 HIS A CB  1 
ATOM   966  C  CG  . HIS A 1 153 ? 12.136  32.451 40.937 1.00 33.08 ? 149 HIS A CG  1 
ATOM   967  N  ND1 . HIS A 1 153 ? 12.582  31.331 40.270 1.00 35.16 ? 149 HIS A ND1 1 
ATOM   968  C  CD2 . HIS A 1 153 ? 11.109  32.941 40.199 1.00 36.10 ? 149 HIS A CD2 1 
ATOM   969  C  CE1 . HIS A 1 153 ? 11.848  31.137 39.186 1.00 35.82 ? 149 HIS A CE1 1 
ATOM   970  N  NE2 . HIS A 1 153 ? 10.947  32.102 39.118 1.00 37.71 ? 149 HIS A NE2 1 
ATOM   971  N  N   . ASP A 1 154 ? 13.300  30.389 44.042 1.00 28.08 ? 150 ASP A N   1 
ATOM   972  C  CA  . ASP A 1 154 ? 13.459  28.938 44.133 1.00 29.05 ? 150 ASP A CA  1 
ATOM   973  C  C   . ASP A 1 154 ? 13.096  28.359 45.484 1.00 27.83 ? 150 ASP A C   1 
ATOM   974  O  O   . ASP A 1 154 ? 13.259  27.169 45.689 1.00 29.19 ? 150 ASP A O   1 
ATOM   975  C  CB  . ASP A 1 154 ? 14.906  28.519 43.801 1.00 29.74 ? 150 ASP A CB  1 
ATOM   976  C  CG  . ASP A 1 154 ? 15.394  29.032 42.430 1.00 34.28 ? 150 ASP A CG  1 
ATOM   977  O  OD1 . ASP A 1 154 ? 14.581  29.174 41.481 1.00 38.22 ? 150 ASP A OD1 1 
ATOM   978  O  OD2 . ASP A 1 154 ? 16.616  29.290 42.306 1.00 38.96 ? 150 ASP A OD2 1 
ATOM   979  N  N   . GLU A 1 155 ? 12.585  29.171 46.396 1.00 25.50 ? 151 GLU A N   1 
ATOM   980  C  CA  . GLU A 1 155 ? 12.278  28.671 47.746 1.00 24.94 ? 151 GLU A CA  1 
ATOM   981  C  C   . GLU A 1 155 ? 10.813  28.405 48.112 1.00 23.54 ? 151 GLU A C   1 
ATOM   982  O  O   . GLU A 1 155 ? 10.514  27.866 49.196 1.00 23.83 ? 151 GLU A O   1 
ATOM   983  C  CB  . GLU A 1 155 ? 12.850  29.662 48.779 1.00 25.53 ? 151 GLU A CB  1 
ATOM   984  C  CG  . GLU A 1 155 ? 14.383  29.899 48.671 1.00 33.66 ? 151 GLU A CG  1 
ATOM   985  C  CD  . GLU A 1 155 ? 15.212  28.663 48.952 1.00 42.02 ? 151 GLU A CD  1 
ATOM   986  O  OE1 . GLU A 1 155 ? 14.911  27.948 49.938 1.00 46.81 ? 151 GLU A OE1 1 
ATOM   987  O  OE2 . GLU A 1 155 ? 16.182  28.412 48.197 1.00 45.93 ? 151 GLU A OE2 1 
ATOM   988  N  N   . TYR A 1 156 ? 9.894   28.821 47.248 1.00 20.97 ? 152 TYR A N   1 
ATOM   989  C  CA  . TYR A 1 156 ? 8.495   28.618 47.550 1.00 20.10 ? 152 TYR A CA  1 
ATOM   990  C  C   . TYR A 1 156 ? 7.706   28.702 46.267 1.00 19.78 ? 152 TYR A C   1 
ATOM   991  O  O   . TYR A 1 156 ? 8.129   29.380 45.321 1.00 21.23 ? 152 TYR A O   1 
ATOM   992  C  CB  . TYR A 1 156 ? 7.992   29.697 48.517 1.00 19.88 ? 152 TYR A CB  1 
ATOM   993  C  CG  . TYR A 1 156 ? 6.917   29.181 49.421 1.00 18.49 ? 152 TYR A CG  1 
ATOM   994  C  CD1 . TYR A 1 156 ? 7.255   28.384 50.504 1.00 18.52 ? 152 TYR A CD1 1 
ATOM   995  C  CD2 . TYR A 1 156 ? 5.556   29.420 49.172 1.00 18.33 ? 152 TYR A CD2 1 
ATOM   996  C  CE1 . TYR A 1 156 ? 6.288   27.881 51.371 1.00 21.18 ? 152 TYR A CE1 1 
ATOM   997  C  CE2 . TYR A 1 156 ? 4.563   28.921 50.022 1.00 19.70 ? 152 TYR A CE2 1 
ATOM   998  C  CZ  . TYR A 1 156 ? 4.952   28.140 51.134 1.00 19.80 ? 152 TYR A CZ  1 
ATOM   999  O  OH  . TYR A 1 156 ? 4.032   27.590 52.006 1.00 21.66 ? 152 TYR A OH  1 
ATOM   1000 N  N   . SER A 1 157 ? 6.566   28.014 46.231 1.00 18.08 ? 153 SER A N   1 
ATOM   1001 C  CA  . SER A 1 157 ? 5.706   28.054 45.045 1.00 17.86 ? 153 SER A CA  1 
ATOM   1002 C  C   . SER A 1 157 ? 4.277   28.112 45.479 1.00 17.82 ? 153 SER A C   1 
ATOM   1003 O  O   . SER A 1 157 ? 3.952   27.899 46.661 1.00 18.05 ? 153 SER A O   1 
ATOM   1004 C  CB  . SER A 1 157 ? 5.899   26.809 44.160 1.00 19.39 ? 153 SER A CB  1 
ATOM   1005 O  OG  . SER A 1 157 ? 7.241   26.735 43.707 1.00 21.11 ? 153 SER A OG  1 
ATOM   1006 N  N   . LEU A 1 158 ? 3.424   28.460 44.521 1.00 17.63 ? 154 LEU A N   1 
ATOM   1007 C  CA  . LEU A 1 158 ? 1.992   28.496 44.715 1.00 17.41 ? 154 LEU A CA  1 
ATOM   1008 C  C   . LEU A 1 158 ? 1.336   27.600 43.675 1.00 18.06 ? 154 LEU A C   1 
ATOM   1009 O  O   . LEU A 1 158 ? 1.705   27.643 42.474 1.00 17.86 ? 154 LEU A O   1 
ATOM   1010 C  CB  . LEU A 1 158 ? 1.443   29.921 44.443 1.00 17.29 ? 154 LEU A CB  1 
ATOM   1011 C  CG  . LEU A 1 158 ? 1.942   31.020 45.394 1.00 17.28 ? 154 LEU A CG  1 
ATOM   1012 C  CD1 . LEU A 1 158 ? 1.410   32.401 44.891 1.00 19.09 ? 154 LEU A CD1 1 
ATOM   1013 C  CD2 . LEU A 1 158 ? 1.557   30.717 46.843 1.00 18.73 ? 154 LEU A CD2 1 
ATOM   1014 N  N   . HIS A 1 159 ? 0.290   26.868 44.070 1.00 17.83 ? 155 HIS A N   1 
ATOM   1015 C  CA  . HIS A 1 159 ? -0.508  26.139 43.089 1.00 17.30 ? 155 HIS A CA  1 
ATOM   1016 C  C   . HIS A 1 159 ? -1.313  27.257 42.370 1.00 17.90 ? 155 HIS A C   1 
ATOM   1017 O  O   . HIS A 1 159 ? -1.920  28.133 43.010 1.00 18.38 ? 155 HIS A O   1 
ATOM   1018 C  CB  . HIS A 1 159 ? -1.537  25.226 43.727 1.00 17.93 ? 155 HIS A CB  1 
ATOM   1019 C  CG  . HIS A 1 159 ? -0.966  24.020 44.402 1.00 18.93 ? 155 HIS A CG  1 
ATOM   1020 N  ND1 . HIS A 1 159 ? -1.671  22.831 44.451 1.00 21.25 ? 155 HIS A ND1 1 
ATOM   1021 C  CD2 . HIS A 1 159 ? 0.210   23.797 45.026 1.00 21.52 ? 155 HIS A CD2 1 
ATOM   1022 C  CE1 . HIS A 1 159 ? -0.962  21.943 45.133 1.00 19.02 ? 155 HIS A CE1 1 
ATOM   1023 N  NE2 . HIS A 1 159 ? 0.185   22.496 45.480 1.00 20.14 ? 155 HIS A NE2 1 
ATOM   1024 N  N   . ILE A 1 160 ? -1.302  27.214 41.045 1.00 18.48 ? 156 ILE A N   1 
ATOM   1025 C  CA  . ILE A 1 160 ? -2.046  28.218 40.260 1.00 19.51 ? 156 ILE A CA  1 
ATOM   1026 C  C   . ILE A 1 160 ? -3.106  27.647 39.314 1.00 21.64 ? 156 ILE A C   1 
ATOM   1027 O  O   . ILE A 1 160 ? -3.782  28.409 38.617 1.00 21.48 ? 156 ILE A O   1 
ATOM   1028 C  CB  . ILE A 1 160 ? -1.101  29.169 39.524 1.00 19.65 ? 156 ILE A CB  1 
ATOM   1029 C  CG1 . ILE A 1 160 ? -0.262  28.405 38.484 1.00 21.66 ? 156 ILE A CG1 1 
ATOM   1030 C  CG2 . ILE A 1 160 ? -0.239  29.990 40.525 1.00 19.67 ? 156 ILE A CG2 1 
ATOM   1031 C  CD1 . ILE A 1 160 ? 0.389   29.336 37.449 1.00 23.78 ? 156 ILE A CD1 1 
ATOM   1032 N  N   . ASP A 1 161 ? -3.273  26.325 39.305 1.00 21.55 ? 157 ASP A N   1 
ATOM   1033 C  CA  . ASP A 1 161 ? -4.289  25.673 38.472 1.00 24.16 ? 157 ASP A CA  1 
ATOM   1034 C  C   . ASP A 1 161 ? -5.646  26.007 39.067 1.00 25.09 ? 157 ASP A C   1 
ATOM   1035 O  O   . ASP A 1 161 ? -5.778  26.319 40.254 1.00 26.01 ? 157 ASP A O   1 
ATOM   1036 C  CB  . ASP A 1 161 ? -4.082  24.148 38.456 1.00 23.95 ? 157 ASP A CB  1 
ATOM   1037 C  CG  . ASP A 1 161 ? -3.851  23.584 39.828 1.00 23.15 ? 157 ASP A CG  1 
ATOM   1038 O  OD1 . ASP A 1 161 ? -2.787  23.875 40.385 1.00 22.49 ? 157 ASP A OD1 1 
ATOM   1039 O  OD2 . ASP A 1 161 ? -4.728  22.866 40.356 1.00 25.24 ? 157 ASP A OD2 1 
ATOM   1040 N  N   . GLU A 1 162 ? -6.662  25.949 38.223 1.00 28.21 ? 158 GLU A N   1 
ATOM   1041 C  CA  . GLU A 1 162 ? -8.014  26.242 38.633 1.00 29.44 ? 158 GLU A CA  1 
ATOM   1042 C  C   . GLU A 1 162 ? -8.544  25.444 39.811 1.00 29.51 ? 158 GLU A C   1 
ATOM   1043 O  O   . GLU A 1 162 ? -9.085  26.014 40.757 1.00 29.78 ? 158 GLU A O   1 
ATOM   1044 C  CB  . GLU A 1 162 ? -8.955  26.061 37.435 1.00 30.94 ? 158 GLU A CB  1 
ATOM   1045 C  CG  . GLU A 1 162 ? -9.507  27.372 36.971 1.00 35.28 ? 158 GLU A CG  1 
ATOM   1046 C  CD  . GLU A 1 162 ? -10.350 28.015 38.036 1.00 40.54 ? 158 GLU A CD  1 
ATOM   1047 O  OE1 . GLU A 1 162 ? -11.340 27.377 38.472 1.00 44.04 ? 158 GLU A OE1 1 
ATOM   1048 O  OE2 . GLU A 1 162 ? -10.012 29.151 38.442 1.00 43.61 ? 158 GLU A OE2 1 
ATOM   1049 N  N   . GLN A 1 163 ? -8.385  24.125 39.757 1.00 29.05 ? 159 GLN A N   1 
ATOM   1050 C  CA  . GLN A 1 163 ? -8.932  23.237 40.775 1.00 28.90 ? 159 GLN A CA  1 
ATOM   1051 C  C   . GLN A 1 163 ? -8.367  23.334 42.188 1.00 28.07 ? 159 GLN A C   1 
ATOM   1052 O  O   . GLN A 1 163 ? -9.121  23.298 43.151 1.00 29.10 ? 159 GLN A O   1 
ATOM   1053 C  CB  . GLN A 1 163 ? -8.903  21.775 40.288 1.00 29.65 ? 159 GLN A CB  1 
ATOM   1054 C  CG  . GLN A 1 163 ? -9.920  21.470 39.189 1.00 35.62 ? 159 GLN A CG  1 
ATOM   1055 C  CD  . GLN A 1 163 ? -11.329 21.244 39.723 1.00 41.55 ? 159 GLN A CD  1 
ATOM   1056 O  OE1 . GLN A 1 163 ? -11.513 20.804 40.866 1.00 45.61 ? 159 GLN A OE1 1 
ATOM   1057 N  NE2 . GLN A 1 163 ? -12.335 21.524 38.886 1.00 42.97 ? 159 GLN A NE2 1 
ATOM   1058 N  N   . THR A 1 164 ? -7.047  23.442 42.316 1.00 25.01 ? 160 THR A N   1 
ATOM   1059 C  CA  . THR A 1 164 ? -6.429  23.457 43.632 1.00 24.73 ? 160 THR A CA  1 
ATOM   1060 C  C   . THR A 1 164 ? -5.693  24.754 43.950 1.00 23.88 ? 160 THR A C   1 
ATOM   1061 O  O   . THR A 1 164 ? -5.166  24.924 45.055 1.00 25.89 ? 160 THR A O   1 
ATOM   1062 C  CB  . THR A 1 164 ? -5.367  22.314 43.729 1.00 24.72 ? 160 THR A CB  1 
ATOM   1063 O  OG1 . THR A 1 164 ? -4.168  22.675 43.018 1.00 23.59 ? 160 THR A OG1 1 
ATOM   1064 C  CG2 . THR A 1 164 ? -5.918  20.982 43.154 1.00 24.69 ? 160 THR A CG2 1 
ATOM   1065 N  N   . GLY A 1 165 ? -5.612  25.639 42.961 1.00 23.25 ? 161 GLY A N   1 
ATOM   1066 C  CA  . GLY A 1 165 ? -4.818  26.861 43.115 1.00 21.72 ? 161 GLY A CA  1 
ATOM   1067 C  C   . GLY A 1 165 ? -5.364  28.048 43.864 1.00 21.13 ? 161 GLY A C   1 
ATOM   1068 O  O   . GLY A 1 165 ? -6.512  28.034 44.318 1.00 22.40 ? 161 GLY A O   1 
ATOM   1069 N  N   . VAL A 1 166 ? -4.538  29.087 43.927 1.00 19.07 ? 162 VAL A N   1 
ATOM   1070 C  CA  . VAL A 1 166 ? -4.906  30.328 44.595 1.00 19.47 ? 162 VAL A CA  1 
ATOM   1071 C  C   . VAL A 1 166 ? -4.954  31.426 43.540 1.00 20.02 ? 162 VAL A C   1 
ATOM   1072 O  O   . VAL A 1 166 ? -4.415  31.245 42.437 1.00 19.51 ? 162 VAL A O   1 
ATOM   1073 C  CB  . VAL A 1 166 ? -3.878  30.678 45.686 1.00 20.05 ? 162 VAL A CB  1 
ATOM   1074 C  CG1 . VAL A 1 166 ? -3.667  29.500 46.662 1.00 23.10 ? 162 VAL A CG1 1 
ATOM   1075 C  CG2 . VAL A 1 166 ? -2.531  31.074 45.067 1.00 20.03 ? 162 VAL A CG2 1 
ATOM   1076 N  N   . SER A 1 167 ? -5.667  32.514 43.838 1.00 20.33 ? 163 SER A N   1 
ATOM   1077 C  CA  . SER A 1 167 ? -5.808  33.622 42.887 1.00 21.14 ? 163 SER A CA  1 
ATOM   1078 C  C   . SER A 1 167 ? -4.861  34.759 43.252 1.00 20.51 ? 163 SER A C   1 
ATOM   1079 O  O   . SER A 1 167 ? -4.773  35.745 42.516 1.00 20.54 ? 163 SER A O   1 
ATOM   1080 C  CB  . SER A 1 167 ? -7.246  34.170 42.864 1.00 22.31 ? 163 SER A CB  1 
ATOM   1081 O  OG  . SER A 1 167 ? -7.598  34.596 44.161 1.00 25.51 ? 163 SER A OG  1 
ATOM   1082 N  N   . GLY A 1 168 ? -4.196  34.657 44.399 1.00 19.57 ? 164 GLY A N   1 
ATOM   1083 C  CA  . GLY A 1 168 ? -3.262  35.676 44.801 1.00 19.19 ? 164 GLY A CA  1 
ATOM   1084 C  C   . GLY A 1 168 ? -1.862  35.402 44.269 1.00 17.91 ? 164 GLY A C   1 
ATOM   1085 O  O   . GLY A 1 168 ? -1.600  34.444 43.521 1.00 18.93 ? 164 GLY A O   1 
ATOM   1086 N  N   . ARG A 1 169 ? -0.952  36.274 44.648 1.00 18.36 ? 165 ARG A N   1 
ATOM   1087 C  CA  . ARG A 1 169 ? 0.425   36.120 44.219 1.00 17.16 ? 165 ARG A CA  1 
ATOM   1088 C  C   . ARG A 1 169 ? 1.329   36.834 45.237 1.00 17.21 ? 165 ARG A C   1 
ATOM   1089 O  O   . ARG A 1 169 ? 0.877   37.710 45.982 1.00 17.80 ? 165 ARG A O   1 
ATOM   1090 C  CB  . ARG A 1 169 ? 0.644   36.741 42.838 1.00 18.58 ? 165 ARG A CB  1 
ATOM   1091 C  CG  . ARG A 1 169 ? 0.483   38.254 42.758 1.00 18.04 ? 165 ARG A CG  1 
ATOM   1092 C  CD  . ARG A 1 169 ? 1.068   38.819 41.436 1.00 18.20 ? 165 ARG A CD  1 
ATOM   1093 N  NE  . ARG A 1 169 ? 0.733   40.230 41.300 1.00 17.15 ? 165 ARG A NE  1 
ATOM   1094 C  CZ  . ARG A 1 169 ? 1.435   41.222 41.864 1.00 17.18 ? 165 ARG A CZ  1 
ATOM   1095 N  NH1 . ARG A 1 169 ? 2.527   40.929 42.578 1.00 18.96 ? 165 ARG A NH1 1 
ATOM   1096 N  NH2 . ARG A 1 169 ? 1.059   42.503 41.714 1.00 16.63 ? 165 ARG A NH2 1 
ATOM   1097 N  N   . PHE A 1 170 ? 2.609   36.465 45.239 1.00 17.38 ? 166 PHE A N   1 
ATOM   1098 C  CA  . PHE A 1 170 ? 3.545   37.150 46.129 1.00 16.71 ? 166 PHE A CA  1 
ATOM   1099 C  C   . PHE A 1 170 ? 3.799   38.560 45.633 1.00 17.88 ? 166 PHE A C   1 
ATOM   1100 O  O   . PHE A 1 170 ? 3.704   38.845 44.439 1.00 17.69 ? 166 PHE A O   1 
ATOM   1101 C  CB  . PHE A 1 170 ? 4.857   36.393 46.229 1.00 18.06 ? 166 PHE A CB  1 
ATOM   1102 C  CG  . PHE A 1 170 ? 4.790   35.242 47.162 1.00 17.46 ? 166 PHE A CG  1 
ATOM   1103 C  CD1 . PHE A 1 170 ? 4.632   35.463 48.531 1.00 18.95 ? 166 PHE A CD1 1 
ATOM   1104 C  CD2 . PHE A 1 170 ? 4.842   33.951 46.684 1.00 19.02 ? 166 PHE A CD2 1 
ATOM   1105 C  CE1 . PHE A 1 170 ? 4.536   34.358 49.415 1.00 19.96 ? 166 PHE A CE1 1 
ATOM   1106 C  CE2 . PHE A 1 170 ? 4.728   32.849 47.531 1.00 18.19 ? 166 PHE A CE2 1 
ATOM   1107 C  CZ  . PHE A 1 170 ? 4.567   33.055 48.896 1.00 18.38 ? 166 PHE A CZ  1 
ATOM   1108 N  N   . TRP A 1 171 ? 4.121   39.443 46.571 1.00 18.11 ? 167 TRP A N   1 
ATOM   1109 C  CA  . TRP A 1 171 ? 4.402   40.845 46.289 1.00 18.69 ? 167 TRP A CA  1 
ATOM   1110 C  C   . TRP A 1 171 ? 5.817   40.975 45.718 1.00 20.73 ? 167 TRP A C   1 
ATOM   1111 O  O   . TRP A 1 171 ? 6.734   40.197 46.060 1.00 22.15 ? 167 TRP A O   1 
ATOM   1112 C  CB  . TRP A 1 171 ? 4.212   41.702 47.546 1.00 18.88 ? 167 TRP A CB  1 
ATOM   1113 C  CG  . TRP A 1 171 ? 5.059   41.194 48.725 1.00 17.15 ? 167 TRP A CG  1 
ATOM   1114 C  CD1 . TRP A 1 171 ? 6.315   41.648 49.125 1.00 17.65 ? 167 TRP A CD1 1 
ATOM   1115 C  CD2 . TRP A 1 171 ? 4.718   40.131 49.630 1.00 17.45 ? 167 TRP A CD2 1 
ATOM   1116 N  NE1 . TRP A 1 171 ? 6.746   40.921 50.221 1.00 17.12 ? 167 TRP A NE1 1 
ATOM   1117 C  CE2 . TRP A 1 171 ? 5.794   39.989 50.546 1.00 17.78 ? 167 TRP A CE2 1 
ATOM   1118 C  CE3 . TRP A 1 171 ? 3.609   39.280 49.752 1.00 19.11 ? 167 TRP A CE3 1 
ATOM   1119 C  CZ2 . TRP A 1 171 ? 5.784   39.015 51.559 1.00 18.77 ? 167 TRP A CZ2 1 
ATOM   1120 C  CZ3 . TRP A 1 171 ? 3.604   38.292 50.780 1.00 18.48 ? 167 TRP A CZ3 1 
ATOM   1121 C  CH2 . TRP A 1 171 ? 4.696   38.177 51.650 1.00 17.73 ? 167 TRP A CH2 1 
ATOM   1122 N  N   . SER A 1 172 ? 5.999   41.932 44.824 1.00 21.11 ? 168 SER A N   1 
ATOM   1123 C  CA  . SER A 1 172 ? 7.288   42.096 44.214 1.00 22.71 ? 168 SER A CA  1 
ATOM   1124 C  C   . SER A 1 172 ? 8.113   43.089 45.013 1.00 24.31 ? 168 SER A C   1 
ATOM   1125 O  O   . SER A 1 172 ? 9.186   42.759 45.453 1.00 27.41 ? 168 SER A O   1 
ATOM   1126 C  CB  . SER A 1 172 ? 7.147   42.506 42.741 1.00 23.34 ? 168 SER A CB  1 
ATOM   1127 O  OG  . SER A 1 172 ? 8.421   42.851 42.281 1.00 25.83 ? 168 SER A OG  1 
ATOM   1128 N  N   . GLU A 1 173 ? 7.595   44.285 45.236 1.00 24.49 ? 169 GLU A N   1 
ATOM   1129 C  CA  . GLU A 1 173 ? 8.285   45.296 46.042 1.00 25.71 ? 169 GLU A CA  1 
ATOM   1130 C  C   . GLU A 1 173 ? 8.152   44.849 47.519 1.00 25.05 ? 169 GLU A C   1 
ATOM   1131 O  O   . GLU A 1 173 ? 7.049   44.499 47.939 1.00 23.60 ? 169 GLU A O   1 
ATOM   1132 C  CB  . GLU A 1 173 ? 7.581   46.611 45.815 1.00 26.84 ? 169 GLU A CB  1 
ATOM   1133 C  CG  . GLU A 1 173 ? 8.170   47.773 46.555 1.00 32.23 ? 169 GLU A CG  1 
ATOM   1134 C  CD  . GLU A 1 173 ? 7.451   49.087 46.261 1.00 39.43 ? 169 GLU A CD  1 
ATOM   1135 O  OE1 . GLU A 1 173 ? 6.566   49.116 45.369 1.00 42.70 ? 169 GLU A OE1 1 
ATOM   1136 O  OE2 . GLU A 1 173 ? 7.770   50.088 46.943 1.00 42.38 ? 169 GLU A OE2 1 
ATOM   1137 N  N   . PRO A 1 174 ? 9.263   44.851 48.290 1.00 25.29 ? 170 PRO A N   1 
ATOM   1138 C  CA  . PRO A 1 174 ? 9.135   44.475 49.711 1.00 24.51 ? 170 PRO A CA  1 
ATOM   1139 C  C   . PRO A 1 174 ? 8.103   45.308 50.472 1.00 23.14 ? 170 PRO A C   1 
ATOM   1140 O  O   . PRO A 1 174 ? 7.930   46.508 50.214 1.00 22.68 ? 170 PRO A O   1 
ATOM   1141 C  CB  . PRO A 1 174 ? 10.539  44.705 50.285 1.00 25.92 ? 170 PRO A CB  1 
ATOM   1142 C  CG  . PRO A 1 174 ? 11.459  44.551 49.051 1.00 26.00 ? 170 PRO A CG  1 
ATOM   1143 C  CD  . PRO A 1 174 ? 10.673  45.103 47.911 1.00 26.31 ? 170 PRO A CD  1 
ATOM   1144 N  N   . LEU A 1 175 ? 7.409   44.651 51.400 1.00 20.36 ? 171 LEU A N   1 
ATOM   1145 C  CA  . LEU A 1 175 ? 6.404   45.322 52.235 1.00 19.00 ? 171 LEU A CA  1 
ATOM   1146 C  C   . LEU A 1 175 ? 7.167   46.021 53.349 1.00 18.78 ? 171 LEU A C   1 
ATOM   1147 O  O   . LEU A 1 175 ? 8.222   45.526 53.782 1.00 21.04 ? 171 LEU A O   1 
ATOM   1148 C  CB  . LEU A 1 175 ? 5.437   44.303 52.789 1.00 18.16 ? 171 LEU A CB  1 
ATOM   1149 C  CG  . LEU A 1 175 ? 4.585   43.575 51.714 1.00 19.56 ? 171 LEU A CG  1 
ATOM   1150 C  CD1 . LEU A 1 175 ? 3.731   42.483 52.352 1.00 21.15 ? 171 LEU A CD1 1 
ATOM   1151 C  CD2 . LEU A 1 175 ? 3.758   44.616 50.941 1.00 20.94 ? 171 LEU A CD2 1 
ATOM   1152 N  N   . VAL A 1 176 ? 6.627   47.134 53.818 1.00 18.65 ? 172 VAL A N   1 
ATOM   1153 C  CA  . VAL A 1 176 ? 7.288   47.932 54.869 1.00 19.37 ? 172 VAL A CA  1 
ATOM   1154 C  C   . VAL A 1 176 ? 6.414   48.132 56.067 1.00 20.03 ? 172 VAL A C   1 
ATOM   1155 O  O   . VAL A 1 176 ? 5.246   48.526 55.906 1.00 20.32 ? 172 VAL A O   1 
ATOM   1156 C  CB  . VAL A 1 176 ? 7.644   49.341 54.286 1.00 21.02 ? 172 VAL A CB  1 
ATOM   1157 C  CG1 . VAL A 1 176 ? 8.138   50.296 55.379 1.00 20.26 ? 172 VAL A CG1 1 
ATOM   1158 C  CG2 . VAL A 1 176 ? 8.692   49.219 53.171 1.00 23.13 ? 172 VAL A CG2 1 
ATOM   1159 N  N   . ALA A 1 177 ? 6.965   47.838 57.251 1.00 18.49 ? 173 ALA A N   1 
ATOM   1160 C  CA  . ALA A 1 177 ? 6.262   48.114 58.529 1.00 19.01 ? 173 ALA A CA  1 
ATOM   1161 C  C   . ALA A 1 177 ? 7.272   49.026 59.204 1.00 20.55 ? 173 ALA A C   1 
ATOM   1162 O  O   . ALA A 1 177 ? 8.445   48.621 59.389 1.00 21.48 ? 173 ALA A O   1 
ATOM   1163 C  CB  . ALA A 1 177 ? 6.035   46.880 59.357 1.00 21.66 ? 173 ALA A CB  1 
ATOM   1164 N  N   . GLU A 1 178 ? 6.855   50.228 59.575 1.00 19.98 ? 174 GLU A N   1 
ATOM   1165 C  CA  . GLU A 1 178 ? 7.838   51.108 60.214 1.00 20.74 ? 174 GLU A CA  1 
ATOM   1166 C  C   . GLU A 1 178 ? 7.283   51.941 61.325 1.00 19.87 ? 174 GLU A C   1 
ATOM   1167 O  O   . GLU A 1 178 ? 6.067   52.203 61.387 1.00 19.25 ? 174 GLU A O   1 
ATOM   1168 C  CB  . GLU A 1 178 ? 8.570   51.947 59.200 1.00 22.54 ? 174 GLU A CB  1 
ATOM   1169 C  CG  . GLU A 1 178 ? 7.772   52.956 58.534 1.00 27.83 ? 174 GLU A CG  1 
ATOM   1170 C  CD  . GLU A 1 178 ? 8.506   53.587 57.350 1.00 34.21 ? 174 GLU A CD  1 
ATOM   1171 O  OE1 . GLU A 1 178 ? 9.783   53.624 57.332 1.00 35.13 ? 174 GLU A OE1 1 
ATOM   1172 O  OE2 . GLU A 1 178 ? 7.773   54.020 56.432 1.00 38.24 ? 174 GLU A OE2 1 
ATOM   1173 N  N   . TRP A 1 179 ? 8.198   52.330 62.208 1.00 16.72 ? 175 TRP A N   1 
ATOM   1174 C  CA  . TRP A 1 179 ? 7.881   53.127 63.399 1.00 18.27 ? 175 TRP A CA  1 
ATOM   1175 C  C   . TRP A 1 179 ? 8.880   54.273 63.425 1.00 19.40 ? 175 TRP A C   1 
ATOM   1176 O  O   . TRP A 1 179 ? 10.064  54.013 63.471 1.00 20.39 ? 175 TRP A O   1 
ATOM   1177 C  CB  . TRP A 1 179 ? 8.061   52.246 64.628 1.00 17.96 ? 175 TRP A CB  1 
ATOM   1178 C  CG  . TRP A 1 179 ? 7.063   51.100 64.566 1.00 17.70 ? 175 TRP A CG  1 
ATOM   1179 C  CD1 . TRP A 1 179 ? 5.746   51.135 64.950 1.00 20.48 ? 175 TRP A CD1 1 
ATOM   1180 C  CD2 . TRP A 1 179 ? 7.311   49.781 64.081 1.00 17.71 ? 175 TRP A CD2 1 
ATOM   1181 N  NE1 . TRP A 1 179 ? 5.169   49.916 64.768 1.00 19.82 ? 175 TRP A NE1 1 
ATOM   1182 C  CE2 . TRP A 1 179 ? 6.098   49.058 64.227 1.00 18.54 ? 175 TRP A CE2 1 
ATOM   1183 C  CE3 . TRP A 1 179 ? 8.441   49.122 63.553 1.00 18.26 ? 175 TRP A CE3 1 
ATOM   1184 C  CZ2 . TRP A 1 179 ? 5.963   47.714 63.829 1.00 19.32 ? 175 TRP A CZ2 1 
ATOM   1185 C  CZ3 . TRP A 1 179 ? 8.317   47.763 63.175 1.00 18.67 ? 175 TRP A CZ3 1 
ATOM   1186 C  CH2 . TRP A 1 179 ? 7.075   47.072 63.310 1.00 20.24 ? 175 TRP A CH2 1 
ATOM   1187 N  N   . ASP A 1 180 ? 8.385   55.509 63.375 1.00 20.37 ? 176 ASP A N   1 
ATOM   1188 C  CA  . ASP A 1 180 ? 9.276   56.653 63.300 1.00 22.31 ? 176 ASP A CA  1 
ATOM   1189 C  C   . ASP A 1 180 ? 9.890   57.106 64.590 1.00 22.24 ? 176 ASP A C   1 
ATOM   1190 O  O   . ASP A 1 180 ? 10.811  57.913 64.547 1.00 22.58 ? 176 ASP A O   1 
ATOM   1191 C  CB  . ASP A 1 180 ? 8.534   57.881 62.734 1.00 23.35 ? 176 ASP A CB  1 
ATOM   1192 C  CG  . ASP A 1 180 ? 7.991   57.666 61.318 1.00 26.88 ? 176 ASP A CG  1 
ATOM   1193 O  OD1 . ASP A 1 180 ? 8.494   56.805 60.582 1.00 31.87 ? 176 ASP A OD1 1 
ATOM   1194 O  OD2 . ASP A 1 180 ? 7.036   58.407 60.957 1.00 33.13 ? 176 ASP A OD2 1 
ATOM   1195 N  N   . ASP A 1 181 ? 9.317   56.699 65.721 1.00 22.36 ? 177 ASP A N   1 
ATOM   1196 C  CA  . ASP A 1 181 ? 9.742   57.204 66.999 1.00 21.91 ? 177 ASP A CA  1 
ATOM   1197 C  C   . ASP A 1 181 ? 10.027  56.169 68.081 1.00 22.12 ? 177 ASP A C   1 
ATOM   1198 O  O   . ASP A 1 181 ? 9.598   56.320 69.247 1.00 22.97 ? 177 ASP A O   1 
ATOM   1199 C  CB  . ASP A 1 181 ? 8.706   58.248 67.478 1.00 24.03 ? 177 ASP A CB  1 
ATOM   1200 C  CG  . ASP A 1 181 ? 8.802   59.554 66.687 1.00 27.71 ? 177 ASP A CG  1 
ATOM   1201 O  OD1 . ASP A 1 181 ? 9.643   60.422 67.047 1.00 31.28 ? 177 ASP A OD1 1 
ATOM   1202 O  OD2 . ASP A 1 181 ? 8.039   59.725 65.721 1.00 31.94 ? 177 ASP A OD2 1 
ATOM   1203 N  N   . PHE A 1 182 ? 10.774  55.131 67.720 1.00 18.62 ? 178 PHE A N   1 
ATOM   1204 C  CA  . PHE A 1 182 ? 11.070  54.128 68.738 1.00 18.24 ? 178 PHE A CA  1 
ATOM   1205 C  C   . PHE A 1 182 ? 12.078  54.660 69.738 1.00 18.61 ? 178 PHE A C   1 
ATOM   1206 O  O   . PHE A 1 182 ? 13.143  55.155 69.355 1.00 18.62 ? 178 PHE A O   1 
ATOM   1207 C  CB  . PHE A 1 182 ? 11.591  52.850 68.082 1.00 17.11 ? 178 PHE A CB  1 
ATOM   1208 C  CG  . PHE A 1 182 ? 12.116  51.847 69.081 1.00 17.60 ? 178 PHE A CG  1 
ATOM   1209 C  CD1 . PHE A 1 182 ? 11.226  51.150 69.913 1.00 18.69 ? 178 PHE A CD1 1 
ATOM   1210 C  CD2 . PHE A 1 182 ? 13.480  51.673 69.255 1.00 18.83 ? 178 PHE A CD2 1 
ATOM   1211 C  CE1 . PHE A 1 182 ? 11.715  50.269 70.887 1.00 19.79 ? 178 PHE A CE1 1 
ATOM   1212 C  CE2 . PHE A 1 182 ? 13.954  50.805 70.231 1.00 19.34 ? 178 PHE A CE2 1 
ATOM   1213 C  CZ  . PHE A 1 182 ? 13.044  50.093 71.049 1.00 18.09 ? 178 PHE A CZ  1 
ATOM   1214 N  N   . GLU A 1 183 ? 11.795  54.514 71.049 1.00 18.13 ? 179 GLU A N   1 
ATOM   1215 C  CA  . GLU A 1 183 ? 12.730  54.998 72.049 1.00 18.05 ? 179 GLU A CA  1 
ATOM   1216 C  C   . GLU A 1 183 ? 13.596  53.909 72.637 1.00 19.86 ? 179 GLU A C   1 
ATOM   1217 O  O   . GLU A 1 183 ? 13.098  52.998 73.315 1.00 19.49 ? 179 GLU A O   1 
ATOM   1218 C  CB  . GLU A 1 183 ? 11.978  55.741 73.196 1.00 19.29 ? 179 GLU A CB  1 
ATOM   1219 C  CG  . GLU A 1 183 ? 12.941  56.542 74.009 1.00 19.69 ? 179 GLU A CG  1 
ATOM   1220 C  CD  . GLU A 1 183 ? 13.473  57.790 73.303 1.00 18.73 ? 179 GLU A CD  1 
ATOM   1221 O  OE1 . GLU A 1 183 ? 12.891  58.210 72.266 1.00 20.62 ? 179 GLU A OE1 1 
ATOM   1222 O  OE2 . GLU A 1 183 ? 14.457  58.339 73.811 1.00 22.79 ? 179 GLU A OE2 1 
ATOM   1223 N  N   . TRP A 1 184 ? 14.880  53.953 72.286 1.00 17.60 ? 180 TRP A N   1 
ATOM   1224 C  CA  . TRP A 1 184 ? 15.855  53.028 72.890 1.00 18.89 ? 180 TRP A CA  1 
ATOM   1225 C  C   . TRP A 1 184 ? 16.295  53.728 74.183 1.00 19.09 ? 180 TRP A C   1 
ATOM   1226 O  O   . TRP A 1 184 ? 17.116  54.657 74.146 1.00 18.31 ? 180 TRP A O   1 
ATOM   1227 C  CB  . TRP A 1 184 ? 17.041  52.719 71.960 1.00 19.52 ? 180 TRP A CB  1 
ATOM   1228 C  CG  . TRP A 1 184 ? 18.181  52.016 72.617 1.00 19.84 ? 180 TRP A CG  1 
ATOM   1229 C  CD1 . TRP A 1 184 ? 19.536  52.355 72.494 1.00 17.47 ? 180 TRP A CD1 1 
ATOM   1230 C  CD2 . TRP A 1 184 ? 18.160  50.797 73.413 1.00 20.50 ? 180 TRP A CD2 1 
ATOM   1231 N  NE1 . TRP A 1 184 ? 20.315  51.467 73.195 1.00 19.64 ? 180 TRP A NE1 1 
ATOM   1232 C  CE2 . TRP A 1 184 ? 19.510  50.510 73.760 1.00 19.72 ? 180 TRP A CE2 1 
ATOM   1233 C  CE3 . TRP A 1 184 ? 17.146  49.917 73.848 1.00 21.11 ? 180 TRP A CE3 1 
ATOM   1234 C  CZ2 . TRP A 1 184 ? 19.872  49.395 74.522 1.00 20.08 ? 180 TRP A CZ2 1 
ATOM   1235 C  CZ3 . TRP A 1 184 ? 17.516  48.807 74.666 1.00 20.18 ? 180 TRP A CZ3 1 
ATOM   1236 C  CH2 . TRP A 1 184 ? 18.877  48.550 74.957 1.00 18.36 ? 180 TRP A CH2 1 
ATOM   1237 N  N   A LYS A 1 185 ? 15.737  53.360 75.337 0.50 19.81 ? 181 LYS A N   1 
ATOM   1238 N  N   B LYS A 1 185 ? 15.672  53.241 75.267 0.50 20.58 ? 181 LYS A N   1 
ATOM   1239 C  CA  A LYS A 1 185 ? 16.178  54.025 76.568 0.50 19.04 ? 181 LYS A CA  1 
ATOM   1240 C  CA  B LYS A 1 185 ? 15.819  53.686 76.648 0.50 20.59 ? 181 LYS A CA  1 
ATOM   1241 C  C   A LYS A 1 185 ? 17.087  53.114 77.403 0.50 19.20 ? 181 LYS A C   1 
ATOM   1242 C  C   B LYS A 1 185 ? 16.797  52.862 77.473 0.50 20.26 ? 181 LYS A C   1 
ATOM   1243 O  O   A LYS A 1 185 ? 17.414  53.458 78.553 0.50 18.27 ? 181 LYS A O   1 
ATOM   1244 O  O   B LYS A 1 185 ? 16.884  53.005 78.702 0.50 20.32 ? 181 LYS A O   1 
ATOM   1245 C  CB  A LYS A 1 185 ? 15.014  54.680 77.384 0.50 18.94 ? 181 LYS A CB  1 
ATOM   1246 C  CB  B LYS A 1 185 ? 14.452  53.508 77.363 0.50 21.09 ? 181 LYS A CB  1 
ATOM   1247 C  CG  A LYS A 1 185 ? 13.947  53.691 77.835 0.50 20.54 ? 181 LYS A CG  1 
ATOM   1248 C  CG  B LYS A 1 185 ? 13.210  53.947 76.605 0.50 22.69 ? 181 LYS A CG  1 
ATOM   1249 C  CD  A LYS A 1 185 ? 12.632  53.886 77.124 0.50 20.30 ? 181 LYS A CD  1 
ATOM   1250 C  CD  B LYS A 1 185 ? 11.960  53.426 77.298 0.50 21.20 ? 181 LYS A CD  1 
ATOM   1251 C  CE  A LYS A 1 185 ? 11.739  52.723 77.443 0.50 17.79 ? 181 LYS A CE  1 
ATOM   1252 C  CE  B LYS A 1 185 ? 10.726  53.551 76.414 0.50 23.06 ? 181 LYS A CE  1 
ATOM   1253 N  NZ  A LYS A 1 185 ? 10.372  52.937 76.973 0.50 15.82 ? 181 LYS A NZ  1 
ATOM   1254 N  NZ  B LYS A 1 185 ? 9.536   53.197 77.207 0.50 26.84 ? 181 LYS A NZ  1 
ATOM   1255 N  N   . GLY A 1 186 ? 17.514  51.975 76.815 1.00 19.56 ? 182 GLY A N   1 
ATOM   1256 C  CA  . GLY A 1 186 ? 18.425  51.063 77.507 1.00 19.94 ? 182 GLY A CA  1 
ATOM   1257 C  C   . GLY A 1 186 ? 17.673  49.793 77.933 1.00 20.52 ? 182 GLY A C   1 
ATOM   1258 O  O   . GLY A 1 186 ? 16.431  49.681 77.749 1.00 21.38 ? 182 GLY A O   1 
ATOM   1259 N  N   . PRO A 1 187 ? 18.391  48.842 78.516 1.00 19.86 ? 183 PRO A N   1 
ATOM   1260 C  CA  . PRO A 1 187 ? 17.727  47.594 78.891 1.00 20.14 ? 183 PRO A CA  1 
ATOM   1261 C  C   . PRO A 1 187 ? 16.632  47.803 79.929 1.00 19.19 ? 183 PRO A C   1 
ATOM   1262 O  O   . PRO A 1 187 ? 16.801  48.611 80.866 1.00 19.84 ? 183 PRO A O   1 
ATOM   1263 C  CB  . PRO A 1 187 ? 18.824  46.787 79.582 1.00 19.75 ? 183 PRO A CB  1 
ATOM   1264 C  CG  . PRO A 1 187 ? 19.934  47.770 79.906 1.00 21.37 ? 183 PRO A CG  1 
ATOM   1265 C  CD  . PRO A 1 187 ? 19.827  48.894 78.889 1.00 20.70 ? 183 PRO A CD  1 
ATOM   1266 N  N   . GLN A 1 188 ? 15.537  47.060 79.759 1.00 19.28 ? 184 GLN A N   1 
ATOM   1267 C  CA  . GLN A 1 188 ? 14.409  47.093 80.704 1.00 20.04 ? 184 GLN A CA  1 
ATOM   1268 C  C   . GLN A 1 188 ? 14.431  45.769 81.485 1.00 22.05 ? 184 GLN A C   1 
ATOM   1269 O  O   . GLN A 1 188 ? 13.378  45.208 81.830 1.00 23.86 ? 184 GLN A O   1 
ATOM   1270 C  CB  . GLN A 1 188 ? 13.083  47.274 79.944 1.00 20.32 ? 184 GLN A CB  1 
ATOM   1271 C  CG  . GLN A 1 188 ? 13.055  48.512 79.080 1.00 20.65 ? 184 GLN A CG  1 
ATOM   1272 C  CD  . GLN A 1 188 ? 13.220  49.807 79.882 1.00 23.36 ? 184 GLN A CD  1 
ATOM   1273 O  OE1 . GLN A 1 188 ? 12.375  50.175 80.705 1.00 23.99 ? 184 GLN A OE1 1 
ATOM   1274 N  NE2 . GLN A 1 188 ? 14.297  50.507 79.626 1.00 21.88 ? 184 GLN A NE2 1 
ATOM   1275 N  N   . TRP A 1 189 ? 15.635  45.290 81.778 1.00 20.76 ? 185 TRP A N   1 
ATOM   1276 C  CA  . TRP A 1 189 ? 15.906  44.017 82.442 1.00 22.28 ? 185 TRP A CA  1 
ATOM   1277 C  C   . TRP A 1 189 ? 17.317  44.100 82.984 1.00 22.70 ? 185 TRP A C   1 
ATOM   1278 O  O   . TRP A 1 189 ? 17.707  43.251 83.784 1.00 24.88 ? 185 TRP A O   1 
ATOM   1279 C  CB  . TRP A 1 189 ? 15.809  42.857 81.417 1.00 21.73 ? 185 TRP A CB  1 
ATOM   1280 C  CG  . TRP A 1 189 ? 16.627  43.170 80.202 1.00 21.56 ? 185 TRP A CG  1 
ATOM   1281 C  CD1 . TRP A 1 189 ? 17.983  42.982 80.050 1.00 20.91 ? 185 TRP A CD1 1 
ATOM   1282 C  CD2 . TRP A 1 189 ? 16.167  43.776 78.982 1.00 22.49 ? 185 TRP A CD2 1 
ATOM   1283 N  NE1 . TRP A 1 189 ? 18.397  43.450 78.809 1.00 21.03 ? 185 TRP A NE1 1 
ATOM   1284 C  CE2 . TRP A 1 189 ? 17.312  43.955 78.141 1.00 21.20 ? 185 TRP A CE2 1 
ATOM   1285 C  CE3 . TRP A 1 189 ? 14.901  44.217 78.526 1.00 23.03 ? 185 TRP A CE3 1 
ATOM   1286 C  CZ2 . TRP A 1 189 ? 17.224  44.528 76.856 1.00 20.29 ? 185 TRP A CZ2 1 
ATOM   1287 C  CZ3 . TRP A 1 189 ? 14.805  44.809 77.220 1.00 21.68 ? 185 TRP A CZ3 1 
ATOM   1288 C  CH2 . TRP A 1 189 ? 15.980  44.945 76.418 1.00 21.10 ? 185 TRP A CH2 1 
ATOM   1289 O  OXT . TRP A 1 189 ? 18.098  45.020 82.664 1.00 23.18 ? 185 TRP A OXT 1 
ATOM   1290 N  N   . ASP B 1 33  ? -11.129 15.965 45.439 1.00 42.22 ? 29  ASP B N   1 
ATOM   1291 C  CA  . ASP B 1 33  ? -10.843 14.498 45.587 1.00 41.62 ? 29  ASP B CA  1 
ATOM   1292 C  C   . ASP B 1 33  ? -9.380  14.180 45.911 1.00 40.45 ? 29  ASP B C   1 
ATOM   1293 O  O   . ASP B 1 33  ? -8.508  14.284 45.047 1.00 40.70 ? 29  ASP B O   1 
ATOM   1294 C  CB  . ASP B 1 33  ? -11.271 13.731 44.338 1.00 42.66 ? 29  ASP B CB  1 
ATOM   1295 C  CG  . ASP B 1 33  ? -12.647 13.092 44.484 1.00 44.58 ? 29  ASP B CG  1 
ATOM   1296 O  OD1 . ASP B 1 33  ? -13.289 13.291 45.544 1.00 47.52 ? 29  ASP B OD1 1 
ATOM   1297 O  OD2 . ASP B 1 33  ? -13.085 12.395 43.536 1.00 46.36 ? 29  ASP B OD2 1 
ATOM   1298 N  N   . GLU B 1 34  ? -9.139  13.782 47.157 1.00 38.71 ? 30  GLU B N   1 
ATOM   1299 C  CA  . GLU B 1 34  ? -7.810  13.423 47.657 1.00 36.95 ? 30  GLU B CA  1 
ATOM   1300 C  C   . GLU B 1 34  ? -7.816  11.958 48.070 1.00 34.97 ? 30  GLU B C   1 
ATOM   1301 O  O   . GLU B 1 34  ? -8.814  11.464 48.605 1.00 34.82 ? 30  GLU B O   1 
ATOM   1302 C  CB  . GLU B 1 34  ? -7.449  14.270 48.865 1.00 37.88 ? 30  GLU B CB  1 
ATOM   1303 C  CG  . GLU B 1 34  ? -6.836  15.598 48.516 1.00 40.59 ? 30  GLU B CG  1 
ATOM   1304 C  CD  . GLU B 1 34  ? -6.592  16.464 49.722 1.00 43.78 ? 30  GLU B CD  1 
ATOM   1305 O  OE1 . GLU B 1 34  ? -6.250  15.945 50.821 1.00 45.06 ? 30  GLU B OE1 1 
ATOM   1306 O  OE2 . GLU B 1 34  ? -6.740  17.687 49.557 1.00 47.39 ? 30  GLU B OE2 1 
ATOM   1307 N  N   . PHE B 1 35  ? -6.700  11.278 47.817 1.00 32.18 ? 31  PHE B N   1 
ATOM   1308 C  CA  . PHE B 1 35  ? -6.546  9.863  48.136 1.00 30.03 ? 31  PHE B CA  1 
ATOM   1309 C  C   . PHE B 1 35  ? -5.321  9.667  49.008 1.00 29.61 ? 31  PHE B C   1 
ATOM   1310 O  O   . PHE B 1 35  ? -4.269  10.237 48.730 1.00 28.20 ? 31  PHE B O   1 
ATOM   1311 C  CB  . PHE B 1 35  ? -6.432  9.053  46.850 1.00 29.94 ? 31  PHE B CB  1 
ATOM   1312 C  CG  . PHE B 1 35  ? -7.550  9.335  45.880 1.00 29.30 ? 31  PHE B CG  1 
ATOM   1313 C  CD1 . PHE B 1 35  ? -7.452  10.404 44.991 1.00 29.68 ? 31  PHE B CD1 1 
ATOM   1314 C  CD2 . PHE B 1 35  ? -8.717  8.586  45.907 1.00 31.56 ? 31  PHE B CD2 1 
ATOM   1315 C  CE1 . PHE B 1 35  ? -8.489  10.710 44.115 1.00 28.91 ? 31  PHE B CE1 1 
ATOM   1316 C  CE2 . PHE B 1 35  ? -9.771  8.877  45.013 1.00 29.65 ? 31  PHE B CE2 1 
ATOM   1317 C  CZ  . PHE B 1 35  ? -9.649  9.940  44.118 1.00 29.82 ? 31  PHE B CZ  1 
ATOM   1318 N  N   . PRO B 1 36  ? -5.459  8.850  50.067 1.00 28.81 ? 32  PRO B N   1 
ATOM   1319 C  CA  . PRO B 1 36  ? -4.330  8.643  50.956 1.00 27.78 ? 32  PRO B CA  1 
ATOM   1320 C  C   . PRO B 1 36  ? -3.261  7.714  50.395 1.00 27.26 ? 32  PRO B C   1 
ATOM   1321 O  O   . PRO B 1 36  ? -3.556  6.767  49.642 1.00 26.59 ? 32  PRO B O   1 
ATOM   1322 C  CB  . PRO B 1 36  ? -4.976  7.958  52.169 1.00 28.58 ? 32  PRO B CB  1 
ATOM   1323 C  CG  . PRO B 1 36  ? -6.119  7.198  51.594 1.00 28.58 ? 32  PRO B CG  1 
ATOM   1324 C  CD  . PRO B 1 36  ? -6.641  8.062  50.476 1.00 29.41 ? 32  PRO B CD  1 
ATOM   1325 N  N   . ILE B 1 37  ? -2.022  7.980  50.782 1.00 26.36 ? 33  ILE B N   1 
ATOM   1326 C  CA  . ILE B 1 37  ? -0.904  7.132  50.424 1.00 27.21 ? 33  ILE B CA  1 
ATOM   1327 C  C   . ILE B 1 37  ? -0.982  5.963  51.422 1.00 26.74 ? 33  ILE B C   1 
ATOM   1328 O  O   . ILE B 1 37  ? -0.621  4.813  51.119 1.00 27.09 ? 33  ILE B O   1 
ATOM   1329 C  CB  . ILE B 1 37  ? 0.425   7.878  50.574 1.00 27.53 ? 33  ILE B CB  1 
ATOM   1330 C  CG1 . ILE B 1 37  ? 0.588   8.871  49.415 1.00 27.75 ? 33  ILE B CG1 1 
ATOM   1331 C  CG2 . ILE B 1 37  ? 1.611   6.913  50.575 1.00 26.84 ? 33  ILE B CG2 1 
ATOM   1332 C  CD1 . ILE B 1 37  ? 1.792   9.738  49.583 1.00 34.66 ? 33  ILE B CD1 1 
ATOM   1333 N  N   . GLY B 1 38  ? -1.481  6.272  52.617 1.00 26.69 ? 34  GLY B N   1 
ATOM   1334 C  CA  . GLY B 1 38  ? -1.650  5.311  53.696 1.00 25.96 ? 34  GLY B CA  1 
ATOM   1335 C  C   . GLY B 1 38  ? -2.029  6.028  54.979 1.00 26.62 ? 34  GLY B C   1 
ATOM   1336 O  O   . GLY B 1 38  ? -2.397  7.201  54.964 1.00 26.34 ? 34  GLY B O   1 
ATOM   1337 N  N   . GLU B 1 39  ? -1.941  5.321  56.099 1.00 26.58 ? 35  GLU B N   1 
ATOM   1338 C  CA  . GLU B 1 39  ? -2.300  5.915  57.377 1.00 27.75 ? 35  GLU B CA  1 
ATOM   1339 C  C   . GLU B 1 39  ? -1.284  6.960  57.816 1.00 27.10 ? 35  GLU B C   1 
ATOM   1340 O  O   . GLU B 1 39  ? -0.098  6.801  57.562 1.00 26.45 ? 35  GLU B O   1 
ATOM   1341 C  CB  . GLU B 1 39  ? -2.423  4.823  58.440 1.00 29.50 ? 35  GLU B CB  1 
ATOM   1342 C  CG  . GLU B 1 39  ? -3.684  4.944  59.312 1.00 35.22 ? 35  GLU B CG  1 
ATOM   1343 C  CD  . GLU B 1 39  ? -4.971  4.948  58.485 1.00 39.71 ? 35  GLU B CD  1 
ATOM   1344 O  OE1 . GLU B 1 39  ? -5.166  4.017  57.668 1.00 41.75 ? 35  GLU B OE1 1 
ATOM   1345 O  OE2 . GLU B 1 39  ? -5.779  5.896  58.651 1.00 43.05 ? 35  GLU B OE2 1 
ATOM   1346 N  N   . ASP B 1 40  ? -1.761  8.010  58.485 1.00 27.00 ? 36  ASP B N   1 
ATOM   1347 C  CA  . ASP B 1 40  ? -0.888  9.065  59.011 1.00 27.20 ? 36  ASP B CA  1 
ATOM   1348 C  C   . ASP B 1 40  ? 0.114   8.451  59.998 1.00 27.74 ? 36  ASP B C   1 
ATOM   1349 O  O   . ASP B 1 40  ? -0.193  7.455  60.675 1.00 27.90 ? 36  ASP B O   1 
ATOM   1350 C  CB  . ASP B 1 40  ? -1.700  10.138 59.748 1.00 28.25 ? 36  ASP B CB  1 
ATOM   1351 C  CG  . ASP B 1 40  ? -2.499  11.041 58.815 1.00 30.82 ? 36  ASP B CG  1 
ATOM   1352 O  OD1 . ASP B 1 40  ? -2.447  10.867 57.574 1.00 30.65 ? 36  ASP B OD1 1 
ATOM   1353 O  OD2 . ASP B 1 40  ? -3.190  11.932 59.351 1.00 32.95 ? 36  ASP B OD2 1 
ATOM   1354 N  N   . ARG B 1 41  ? 1.291   9.052  60.088 1.00 27.09 ? 37  ARG B N   1 
ATOM   1355 C  CA  . ARG B 1 41  ? 2.340   8.576  60.986 1.00 27.39 ? 37  ARG B CA  1 
ATOM   1356 C  C   . ARG B 1 41  ? 2.757   9.638  61.989 1.00 27.49 ? 37  ARG B C   1 
ATOM   1357 O  O   . ARG B 1 41  ? 2.710   10.827 61.691 1.00 27.46 ? 37  ARG B O   1 
ATOM   1358 C  CB  . ARG B 1 41  ? 3.587   8.217  60.176 1.00 27.33 ? 37  ARG B CB  1 
ATOM   1359 C  CG  . ARG B 1 41  ? 3.368   7.185  59.059 1.00 28.20 ? 37  ARG B CG  1 
ATOM   1360 C  CD  . ARG B 1 41  ? 3.062   5.820  59.665 1.00 28.36 ? 37  ARG B CD  1 
ATOM   1361 N  NE  . ARG B 1 41  ? 3.203   4.747  58.685 1.00 31.43 ? 37  ARG B NE  1 
ATOM   1362 C  CZ  . ARG B 1 41  ? 2.216   3.939  58.321 1.00 33.04 ? 37  ARG B CZ  1 
ATOM   1363 N  NH1 . ARG B 1 41  ? 1.007   4.074  58.859 1.00 34.66 ? 37  ARG B NH1 1 
ATOM   1364 N  NH2 . ARG B 1 41  ? 2.449   2.979  57.436 1.00 29.04 ? 37  ARG B NH2 1 
ATOM   1365 N  N   . ASP B 1 42  ? 3.185   9.197  63.172 1.00 27.61 ? 38  ASP B N   1 
ATOM   1366 C  CA  . ASP B 1 42  ? 3.716   10.104 64.181 1.00 28.15 ? 38  ASP B CA  1 
ATOM   1367 C  C   . ASP B 1 42  ? 5.160   9.641  64.321 1.00 26.85 ? 38  ASP B C   1 
ATOM   1368 O  O   . ASP B 1 42  ? 5.422   8.476  64.635 1.00 26.60 ? 38  ASP B O   1 
ATOM   1369 C  CB  . ASP B 1 42  ? 2.945   10.082 65.511 1.00 29.59 ? 38  ASP B CB  1 
ATOM   1370 C  CG  . ASP B 1 42  ? 1.728   11.005 65.486 1.00 32.76 ? 38  ASP B CG  1 
ATOM   1371 O  OD1 . ASP B 1 42  ? 1.891   12.248 65.555 1.00 36.58 ? 38  ASP B OD1 1 
ATOM   1372 O  OD2 . ASP B 1 42  ? 0.602   10.479 65.354 1.00 34.90 ? 38  ASP B OD2 1 
ATOM   1373 N  N   . VAL B 1 43  ? 6.085   10.536 64.001 1.00 25.81 ? 39  VAL B N   1 
ATOM   1374 C  CA  . VAL B 1 43  ? 7.499   10.229 64.075 1.00 25.92 ? 39  VAL B CA  1 
ATOM   1375 C  C   . VAL B 1 43  ? 8.214   11.402 64.742 1.00 25.02 ? 39  VAL B C   1 
ATOM   1376 O  O   . VAL B 1 43  ? 8.251   12.522 64.215 1.00 23.94 ? 39  VAL B O   1 
ATOM   1377 C  CB  . VAL B 1 43  ? 8.121   9.839  62.710 1.00 26.31 ? 39  VAL B CB  1 
ATOM   1378 C  CG1 . VAL B 1 43  ? 8.151   11.006 61.727 1.00 27.04 ? 39  VAL B CG1 1 
ATOM   1379 C  CG2 . VAL B 1 43  ? 9.505   9.183  62.921 1.00 26.16 ? 39  VAL B CG2 1 
ATOM   1380 N  N   . GLY B 1 44  ? 8.751   11.147 65.925 1.00 24.95 ? 40  GLY B N   1 
ATOM   1381 C  CA  . GLY B 1 44  ? 9.417   12.222 66.654 1.00 25.00 ? 40  GLY B CA  1 
ATOM   1382 C  C   . GLY B 1 44  ? 8.384   13.313 66.915 1.00 24.35 ? 40  GLY B C   1 
ATOM   1383 O  O   . GLY B 1 44  ? 7.246   12.999 67.287 1.00 25.38 ? 40  GLY B O   1 
ATOM   1384 N  N   . PRO B 1 45  ? 8.743   14.585 66.677 1.00 24.71 ? 41  PRO B N   1 
ATOM   1385 C  CA  . PRO B 1 45  ? 7.823   15.677 66.959 1.00 24.24 ? 41  PRO B CA  1 
ATOM   1386 C  C   . PRO B 1 45  ? 6.869   15.992 65.787 1.00 24.31 ? 41  PRO B C   1 
ATOM   1387 O  O   . PRO B 1 45  ? 6.201   17.025 65.793 1.00 23.83 ? 41  PRO B O   1 
ATOM   1388 C  CB  . PRO B 1 45  ? 8.778   16.851 67.190 1.00 25.43 ? 41  PRO B CB  1 
ATOM   1389 C  CG  . PRO B 1 45  ? 9.886   16.605 66.235 1.00 25.11 ? 41  PRO B CG  1 
ATOM   1390 C  CD  . PRO B 1 45  ? 10.022  15.094 66.140 1.00 24.26 ? 41  PRO B CD  1 
ATOM   1391 N  N   . LEU B 1 46  ? 6.805   15.091 64.809 1.00 23.53 ? 42  LEU B N   1 
ATOM   1392 C  CA  . LEU B 1 46  ? 5.988   15.320 63.630 1.00 23.77 ? 42  LEU B CA  1 
ATOM   1393 C  C   . LEU B 1 46  ? 4.818   14.403 63.401 1.00 23.70 ? 42  LEU B C   1 
ATOM   1394 O  O   . LEU B 1 46  ? 4.926   13.203 63.583 1.00 24.84 ? 42  LEU B O   1 
ATOM   1395 C  CB  . LEU B 1 46  ? 6.886   15.234 62.368 1.00 23.82 ? 42  LEU B CB  1 
ATOM   1396 C  CG  . LEU B 1 46  ? 8.180   16.071 62.390 1.00 24.20 ? 42  LEU B CG  1 
ATOM   1397 C  CD1 . LEU B 1 46  ? 9.035   15.825 61.118 1.00 24.71 ? 42  LEU B CD1 1 
ATOM   1398 C  CD2 . LEU B 1 46  ? 7.805   17.513 62.563 1.00 22.95 ? 42  LEU B CD2 1 
ATOM   1399 N  N   . HIS B 1 47  ? 3.717   14.999 62.959 1.00 23.67 ? 43  HIS B N   1 
ATOM   1400 C  CA  . HIS B 1 47  ? 2.533   14.263 62.531 1.00 23.54 ? 43  HIS B CA  1 
ATOM   1401 C  C   . HIS B 1 47  ? 2.675   14.364 61.010 1.00 23.45 ? 43  HIS B C   1 
ATOM   1402 O  O   . HIS B 1 47  ? 2.676   15.480 60.462 1.00 22.15 ? 43  HIS B O   1 
ATOM   1403 C  CB  . HIS B 1 47  ? 1.227   14.911 62.946 1.00 24.44 ? 43  HIS B CB  1 
ATOM   1404 C  CG  . HIS B 1 47  ? 0.034   14.116 62.527 1.00 26.68 ? 43  HIS B CG  1 
ATOM   1405 N  ND1 . HIS B 1 47  ? -0.394  13.004 63.220 1.00 29.70 ? 43  HIS B ND1 1 
ATOM   1406 C  CD2 . HIS B 1 47  ? -0.784  14.231 61.456 1.00 28.63 ? 43  HIS B CD2 1 
ATOM   1407 C  CE1 . HIS B 1 47  ? -1.437  12.481 62.604 1.00 30.16 ? 43  HIS B CE1 1 
ATOM   1408 N  NE2 . HIS B 1 47  ? -1.701  13.212 61.537 1.00 31.55 ? 43  HIS B NE2 1 
ATOM   1409 N  N   . VAL B 1 48  ? 2.825   13.213 60.343 1.00 22.20 ? 44  VAL B N   1 
ATOM   1410 C  CA  . VAL B 1 48  ? 3.042   13.164 58.893 1.00 22.97 ? 44  VAL B CA  1 
ATOM   1411 C  C   . VAL B 1 48  ? 1.919   12.425 58.158 1.00 23.86 ? 44  VAL B C   1 
ATOM   1412 O  O   . VAL B 1 48  ? 1.612   11.260 58.464 1.00 23.68 ? 44  VAL B O   1 
ATOM   1413 C  CB  . VAL B 1 48  ? 4.409   12.446 58.570 1.00 23.54 ? 44  VAL B CB  1 
ATOM   1414 C  CG1 . VAL B 1 48  ? 4.728   12.526 57.081 1.00 22.98 ? 44  VAL B CG1 1 
ATOM   1415 C  CG2 . VAL B 1 48  ? 5.577   13.047 59.382 1.00 23.63 ? 44  VAL B CG2 1 
ATOM   1416 N  N   . GLY B 1 49  ? 1.326   13.101 57.175 1.00 23.67 ? 45  GLY B N   1 
ATOM   1417 C  CA  . GLY B 1 49  ? 0.262   12.521 56.353 1.00 24.20 ? 45  GLY B CA  1 
ATOM   1418 C  C   . GLY B 1 49  ? 0.685   12.578 54.897 1.00 23.86 ? 45  GLY B C   1 
ATOM   1419 O  O   . GLY B 1 49  ? 1.408   13.506 54.489 1.00 24.27 ? 45  GLY B O   1 
ATOM   1420 N  N   . GLY B 1 50  ? 0.256   11.590 54.109 1.00 23.43 ? 46  GLY B N   1 
ATOM   1421 C  CA  . GLY B 1 50  ? 0.583   11.568 52.685 1.00 23.33 ? 46  GLY B CA  1 
ATOM   1422 C  C   . GLY B 1 50  ? -0.692  11.352 51.883 1.00 23.64 ? 46  GLY B C   1 
ATOM   1423 O  O   . GLY B 1 50  ? -1.490  10.487 52.237 1.00 23.58 ? 46  GLY B O   1 
ATOM   1424 N  N   . VAL B 1 51  ? -0.909  12.176 50.856 1.00 23.68 ? 47  VAL B N   1 
ATOM   1425 C  CA  . VAL B 1 51  ? -2.087  12.052 49.964 1.00 23.71 ? 47  VAL B CA  1 
ATOM   1426 C  C   . VAL B 1 51  ? -1.620  12.325 48.520 1.00 23.51 ? 47  VAL B C   1 
ATOM   1427 O  O   . VAL B 1 51  ? -0.568  12.906 48.290 1.00 22.71 ? 47  VAL B O   1 
ATOM   1428 C  CB  . VAL B 1 51  ? -3.233  13.091 50.286 1.00 24.43 ? 47  VAL B CB  1 
ATOM   1429 C  CG1 . VAL B 1 51  ? -3.670  13.061 51.763 1.00 25.95 ? 47  VAL B CG1 1 
ATOM   1430 C  CG2 . VAL B 1 51  ? -2.779  14.527 49.932 1.00 25.85 ? 47  VAL B CG2 1 
ATOM   1431 N  N   . TYR B 1 52  ? -2.407  11.868 47.562 1.00 22.71 ? 48  TYR B N   1 
ATOM   1432 C  CA  . TYR B 1 52  ? -2.118  12.121 46.158 1.00 22.47 ? 48  TYR B CA  1 
ATOM   1433 C  C   . TYR B 1 52  ? -3.424  12.490 45.495 1.00 22.28 ? 48  TYR B C   1 
ATOM   1434 O  O   . TYR B 1 52  ? -4.522  12.169 45.992 1.00 23.46 ? 48  TYR B O   1 
ATOM   1435 C  CB  . TYR B 1 52  ? -1.424  10.963 45.473 1.00 23.47 ? 48  TYR B CB  1 
ATOM   1436 C  CG  . TYR B 1 52  ? -2.312  9.781  45.146 1.00 23.31 ? 48  TYR B CG  1 
ATOM   1437 C  CD1 . TYR B 1 52  ? -2.549  8.789  46.101 1.00 26.19 ? 48  TYR B CD1 1 
ATOM   1438 C  CD2 . TYR B 1 52  ? -2.853  9.624  43.857 1.00 23.58 ? 48  TYR B CD2 1 
ATOM   1439 C  CE1 . TYR B 1 52  ? -3.343  7.648  45.770 1.00 26.34 ? 48  TYR B CE1 1 
ATOM   1440 C  CE2 . TYR B 1 52  ? -3.634  8.510  43.522 1.00 23.95 ? 48  TYR B CE2 1 
ATOM   1441 C  CZ  . TYR B 1 52  ? -3.887  7.538  44.485 1.00 26.10 ? 48  TYR B CZ  1 
ATOM   1442 O  OH  . TYR B 1 52  ? -4.661  6.422  44.135 1.00 25.94 ? 48  TYR B OH  1 
ATOM   1443 N  N   . PHE B 1 53  ? -3.307  13.187 44.377 1.00 21.13 ? 49  PHE B N   1 
ATOM   1444 C  CA  . PHE B 1 53  ? -4.471  13.611 43.606 1.00 21.16 ? 49  PHE B CA  1 
ATOM   1445 C  C   . PHE B 1 53  ? -3.954  14.053 42.250 1.00 21.17 ? 49  PHE B C   1 
ATOM   1446 O  O   . PHE B 1 53  ? -2.782  13.803 41.919 1.00 21.40 ? 49  PHE B O   1 
ATOM   1447 C  CB  . PHE B 1 53  ? -5.264  14.683 44.359 1.00 21.31 ? 49  PHE B CB  1 
ATOM   1448 C  CG  . PHE B 1 53  ? -4.415  15.777 44.930 1.00 21.23 ? 49  PHE B CG  1 
ATOM   1449 C  CD1 . PHE B 1 53  ? -4.068  16.865 44.136 1.00 23.25 ? 49  PHE B CD1 1 
ATOM   1450 C  CD2 . PHE B 1 53  ? -4.029  15.773 46.277 1.00 23.04 ? 49  PHE B CD2 1 
ATOM   1451 C  CE1 . PHE B 1 53  ? -3.304  17.914 44.666 1.00 24.61 ? 49  PHE B CE1 1 
ATOM   1452 C  CE2 . PHE B 1 53  ? -3.269  16.833 46.828 1.00 24.54 ? 49  PHE B CE2 1 
ATOM   1453 C  CZ  . PHE B 1 53  ? -2.909  17.906 46.016 1.00 23.44 ? 49  PHE B CZ  1 
ATOM   1454 N  N   . GLN B 1 54  ? -4.811  14.688 41.449 1.00 21.17 ? 50  GLN B N   1 
ATOM   1455 C  CA  A GLN B 1 54  ? -4.435  15.130 40.114 0.50 21.30 ? 50  GLN B CA  1 
ATOM   1456 C  CA  B GLN B 1 54  ? -4.396  15.085 40.118 0.50 20.89 ? 50  GLN B CA  1 
ATOM   1457 C  C   . GLN B 1 54  ? -3.204  16.050 40.119 1.00 20.67 ? 50  GLN B C   1 
ATOM   1458 O  O   . GLN B 1 54  ? -2.975  16.773 41.107 1.00 19.39 ? 50  GLN B O   1 
ATOM   1459 C  CB  A GLN B 1 54  ? -5.635  15.824 39.440 0.50 21.75 ? 50  GLN B CB  1 
ATOM   1460 C  CB  B GLN B 1 54  ? -5.592  15.617 39.304 0.50 21.20 ? 50  GLN B CB  1 
ATOM   1461 C  CG  A GLN B 1 54  ? -5.937  17.185 40.008 0.50 23.19 ? 50  GLN B CG  1 
ATOM   1462 C  CG  B GLN B 1 54  ? -5.992  17.021 39.644 0.50 20.73 ? 50  GLN B CG  1 
ATOM   1463 C  CD  A GLN B 1 54  ? -7.355  17.647 39.755 0.50 27.87 ? 50  GLN B CD  1 
ATOM   1464 C  CD  B GLN B 1 54  ? -6.686  17.158 40.990 0.50 24.17 ? 50  GLN B CD  1 
ATOM   1465 O  OE1 A GLN B 1 54  ? -8.315  17.011 40.189 0.50 29.67 ? 50  GLN B OE1 1 
ATOM   1466 O  OE1 B GLN B 1 54  ? -6.690  18.242 41.569 0.50 28.26 ? 50  GLN B OE1 1 
ATOM   1467 N  NE2 A GLN B 1 54  ? -7.493  18.764 39.064 0.50 27.44 ? 50  GLN B NE2 1 
ATOM   1468 N  NE2 B GLN B 1 54  ? -7.277  16.075 41.491 0.50 21.71 ? 50  GLN B NE2 1 
ATOM   1469 N  N   . PRO B 1 55  ? -2.404  16.019 39.030 1.00 20.90 ? 51  PRO B N   1 
ATOM   1470 C  CA  . PRO B 1 55  ? -1.310  16.955 38.893 1.00 21.43 ? 51  PRO B CA  1 
ATOM   1471 C  C   . PRO B 1 55  ? -1.794  18.414 39.005 1.00 20.90 ? 51  PRO B C   1 
ATOM   1472 O  O   . PRO B 1 55  ? -2.954  18.759 38.667 1.00 21.22 ? 51  PRO B O   1 
ATOM   1473 C  CB  . PRO B 1 55  ? -0.765  16.663 37.480 1.00 22.15 ? 51  PRO B CB  1 
ATOM   1474 C  CG  . PRO B 1 55  ? -1.102  15.207 37.245 1.00 21.27 ? 51  PRO B CG  1 
ATOM   1475 C  CD  . PRO B 1 55  ? -2.487  15.121 37.845 1.00 20.88 ? 51  PRO B CD  1 
ATOM   1476 N  N   . VAL B 1 56  ? -0.893  19.262 39.472 1.00 21.44 ? 52  VAL B N   1 
ATOM   1477 C  CA  . VAL B 1 56  ? -1.221  20.674 39.618 1.00 20.44 ? 52  VAL B CA  1 
ATOM   1478 C  C   . VAL B 1 56  ? -0.204  21.528 38.829 1.00 21.48 ? 52  VAL B C   1 
ATOM   1479 O  O   . VAL B 1 56  ? 0.836   21.021 38.368 1.00 21.46 ? 52  VAL B O   1 
ATOM   1480 C  CB  . VAL B 1 56  ? -1.243  21.126 41.102 1.00 21.65 ? 52  VAL B CB  1 
ATOM   1481 C  CG1 . VAL B 1 56  ? -2.139  20.225 41.966 1.00 21.79 ? 52  VAL B CG1 1 
ATOM   1482 C  CG2 . VAL B 1 56  ? 0.144   21.134 41.680 1.00 19.33 ? 52  VAL B CG2 1 
ATOM   1483 N  N   . GLU B 1 57  ? -0.515  22.808 38.694 1.00 20.87 ? 53  GLU B N   1 
ATOM   1484 C  CA  . GLU B 1 57  ? 0.371   23.755 38.039 1.00 20.86 ? 53  GLU B CA  1 
ATOM   1485 C  C   . GLU B 1 57  ? 0.945   24.604 39.169 1.00 21.19 ? 53  GLU B C   1 
ATOM   1486 O  O   . GLU B 1 57  ? 0.207   25.203 39.964 1.00 20.60 ? 53  GLU B O   1 
ATOM   1487 C  CB  . GLU B 1 57  ? -0.354  24.672 37.033 1.00 19.81 ? 53  GLU B CB  1 
ATOM   1488 C  CG  . GLU B 1 57  ? 0.648   25.591 36.337 1.00 24.49 ? 53  GLU B CG  1 
ATOM   1489 C  CD  . GLU B 1 57  ? 0.014   26.449 35.262 1.00 27.80 ? 53  GLU B CD  1 
ATOM   1490 O  OE1 . GLU B 1 57  ? -1.240  26.531 35.198 1.00 30.77 ? 53  GLU B OE1 1 
ATOM   1491 O  OE2 . GLU B 1 57  ? 0.781   27.025 34.467 1.00 30.99 ? 53  GLU B OE2 1 
ATOM   1492 N  N   . MET B 1 58  ? 2.266   24.622 39.267 1.00 20.23 ? 54  MET B N   1 
ATOM   1493 C  CA  . MET B 1 58  ? 2.933   25.391 40.315 1.00 21.29 ? 54  MET B CA  1 
ATOM   1494 C  C   . MET B 1 58  ? 3.768   26.527 39.750 1.00 20.80 ? 54  MET B C   1 
ATOM   1495 O  O   . MET B 1 58  ? 4.366   26.395 38.677 1.00 22.18 ? 54  MET B O   1 
ATOM   1496 C  CB  . MET B 1 58  ? 3.859   24.473 41.121 1.00 20.27 ? 54  MET B CB  1 
ATOM   1497 C  CG  . MET B 1 58  ? 3.157   23.322 41.877 1.00 22.36 ? 54  MET B CG  1 
ATOM   1498 S  SD  . MET B 1 58  ? 4.229   21.929 42.272 1.00 23.80 ? 54  MET B SD  1 
ATOM   1499 C  CE  . MET B 1 58  ? 4.364   21.205 40.633 1.00 23.33 ? 54  MET B CE  1 
ATOM   1500 N  N   . HIS B 1 59  ? 3.757   27.659 40.440 1.00 18.57 ? 55  HIS B N   1 
ATOM   1501 C  CA  . HIS B 1 59  ? 4.561   28.795 40.027 1.00 18.75 ? 55  HIS B CA  1 
ATOM   1502 C  C   . HIS B 1 59  ? 5.369   29.347 41.221 1.00 19.88 ? 55  HIS B C   1 
ATOM   1503 O  O   . HIS B 1 59  ? 4.802   29.686 42.255 1.00 18.50 ? 55  HIS B O   1 
ATOM   1504 C  CB  . HIS B 1 59  ? 3.766   29.944 39.442 1.00 19.77 ? 55  HIS B CB  1 
ATOM   1505 C  CG  . HIS B 1 59  ? 4.659   31.087 39.050 1.00 21.56 ? 55  HIS B CG  1 
ATOM   1506 N  ND1 . HIS B 1 59  ? 5.427   31.059 37.900 1.00 26.02 ? 55  HIS B ND1 1 
ATOM   1507 C  CD2 . HIS B 1 59  ? 4.990   32.227 39.701 1.00 25.70 ? 55  HIS B CD2 1 
ATOM   1508 C  CE1 . HIS B 1 59  ? 6.151   32.171 37.838 1.00 24.30 ? 55  HIS B CE1 1 
ATOM   1509 N  NE2 . HIS B 1 59  ? 5.907   32.893 38.922 1.00 25.56 ? 55  HIS B NE2 1 
ATOM   1510 N  N   . PRO B 1 60  ? 6.702   29.462 41.069 1.00 21.24 ? 56  PRO B N   1 
ATOM   1511 C  CA  . PRO B 1 60  ? 7.483   28.890 39.956 1.00 22.45 ? 56  PRO B CA  1 
ATOM   1512 C  C   . PRO B 1 60  ? 7.405   27.357 39.957 1.00 22.86 ? 56  PRO B C   1 
ATOM   1513 O  O   . PRO B 1 60  ? 7.016   26.728 40.973 1.00 22.19 ? 56  PRO B O   1 
ATOM   1514 C  CB  . PRO B 1 60  ? 8.919   29.331 40.301 1.00 22.84 ? 56  PRO B CB  1 
ATOM   1515 C  CG  . PRO B 1 60  ? 8.742   30.612 41.156 1.00 23.43 ? 56  PRO B CG  1 
ATOM   1516 C  CD  . PRO B 1 60  ? 7.579   30.178 42.024 1.00 21.85 ? 56  PRO B CD  1 
ATOM   1517 N  N   . ALA B 1 61  ? 7.762   26.738 38.829 1.00 23.97 ? 57  ALA B N   1 
ATOM   1518 C  CA  . ALA B 1 61  ? 7.744   25.282 38.751 1.00 26.13 ? 57  ALA B CA  1 
ATOM   1519 C  C   . ALA B 1 61  ? 8.966   24.760 39.534 1.00 27.78 ? 57  ALA B C   1 
ATOM   1520 O  O   . ALA B 1 61  ? 10.091  25.168 39.257 1.00 28.28 ? 57  ALA B O   1 
ATOM   1521 C  CB  . ALA B 1 61  ? 7.764   24.823 37.313 1.00 27.18 ? 57  ALA B CB  1 
ATOM   1522 N  N   . PRO B 1 62  ? 8.743   23.900 40.547 1.00 29.14 ? 58  PRO B N   1 
ATOM   1523 C  CA  . PRO B 1 62  ? 9.887   23.506 41.399 1.00 30.39 ? 58  PRO B CA  1 
ATOM   1524 C  C   . PRO B 1 62  ? 10.873  22.559 40.737 1.00 31.75 ? 58  PRO B C   1 
ATOM   1525 O  O   . PRO B 1 62  ? 10.466  21.690 39.963 1.00 32.80 ? 58  PRO B O   1 
ATOM   1526 C  CB  . PRO B 1 62  ? 9.234   22.775 42.576 1.00 30.96 ? 58  PRO B CB  1 
ATOM   1527 C  CG  . PRO B 1 62  ? 7.801   22.824 42.376 1.00 30.21 ? 58  PRO B CG  1 
ATOM   1528 C  CD  . PRO B 1 62  ? 7.484   23.280 40.999 1.00 30.05 ? 58  PRO B CD  1 
ATOM   1529 N  N   . GLY B 1 63  ? 12.151  22.715 41.086 1.00 32.48 ? 59  GLY B N   1 
ATOM   1530 C  CA  . GLY B 1 63  ? 13.253  21.867 40.604 1.00 33.34 ? 59  GLY B CA  1 
ATOM   1531 C  C   . GLY B 1 63  ? 13.082  21.156 39.283 1.00 33.72 ? 59  GLY B C   1 
ATOM   1532 O  O   . GLY B 1 63  ? 12.966  21.808 38.241 1.00 34.56 ? 59  GLY B O   1 
ATOM   1533 N  N   . ALA B 1 64  ? 13.067  19.826 39.313 1.00 33.09 ? 60  ALA B N   1 
ATOM   1534 C  CA  . ALA B 1 64  ? 12.912  19.043 38.097 1.00 33.00 ? 60  ALA B CA  1 
ATOM   1535 C  C   . ALA B 1 64  ? 11.592  18.265 38.060 1.00 32.35 ? 60  ALA B C   1 
ATOM   1536 O  O   . ALA B 1 64  ? 11.498  17.216 37.409 1.00 33.42 ? 60  ALA B O   1 
ATOM   1537 C  CB  . ALA B 1 64  ? 14.098  18.066 37.929 1.00 34.18 ? 60  ALA B CB  1 
ATOM   1538 N  N   . GLN B 1 65  ? 10.582  18.765 38.762 1.00 30.13 ? 61  GLN B N   1 
ATOM   1539 C  CA  . GLN B 1 65  ? 9.290   18.076 38.799 1.00 27.79 ? 61  GLN B CA  1 
ATOM   1540 C  C   . GLN B 1 65  ? 8.585   18.191 37.451 1.00 26.47 ? 61  GLN B C   1 
ATOM   1541 O  O   . GLN B 1 65  ? 8.705   19.214 36.772 1.00 27.12 ? 61  GLN B O   1 
ATOM   1542 C  CB  . GLN B 1 65  ? 8.395   18.668 39.890 1.00 27.57 ? 61  GLN B CB  1 
ATOM   1543 C  CG  . GLN B 1 65  ? 8.923   18.547 41.314 1.00 26.34 ? 61  GLN B CG  1 
ATOM   1544 C  CD  . GLN B 1 65  ? 7.921   19.103 42.307 1.00 26.15 ? 61  GLN B CD  1 
ATOM   1545 O  OE1 . GLN B 1 65  ? 6.745   19.318 41.983 1.00 23.02 ? 61  GLN B OE1 1 
ATOM   1546 N  NE2 . GLN B 1 65  ? 8.382   19.359 43.517 1.00 25.71 ? 61  GLN B NE2 1 
ATOM   1547 N  N   . PRO B 1 66  ? 7.849   17.132 37.042 1.00 24.97 ? 62  PRO B N   1 
ATOM   1548 C  CA  . PRO B 1 66  ? 7.113   17.172 35.768 1.00 23.82 ? 62  PRO B CA  1 
ATOM   1549 C  C   . PRO B 1 66  ? 6.011   18.225 35.817 1.00 22.99 ? 62  PRO B C   1 
ATOM   1550 O  O   . PRO B 1 66  ? 5.507   18.540 36.906 1.00 22.29 ? 62  PRO B O   1 
ATOM   1551 C  CB  . PRO B 1 66  ? 6.465   15.772 35.670 1.00 24.10 ? 62  PRO B CB  1 
ATOM   1552 C  CG  . PRO B 1 66  ? 6.436   15.259 37.092 1.00 24.50 ? 62  PRO B CG  1 
ATOM   1553 C  CD  . PRO B 1 66  ? 7.676   15.851 37.750 1.00 24.68 ? 62  PRO B CD  1 
ATOM   1554 N  N   . SER B 1 67  ? 5.663   18.753 34.638 1.00 22.45 ? 63  SER B N   1 
ATOM   1555 C  CA  . SER B 1 67  ? 4.599   19.727 34.486 1.00 23.38 ? 63  SER B CA  1 
ATOM   1556 C  C   . SER B 1 67  ? 3.282   19.033 34.804 1.00 22.85 ? 63  SER B C   1 
ATOM   1557 O  O   . SER B 1 67  ? 3.228   17.781 34.917 1.00 22.77 ? 63  SER B O   1 
ATOM   1558 C  CB  . SER B 1 67  ? 4.530   20.239 33.018 1.00 23.18 ? 63  SER B CB  1 
ATOM   1559 O  OG  . SER B 1 67  ? 4.129   19.193 32.154 1.00 24.80 ? 63  SER B OG  1 
ATOM   1560 N  N   . LYS B 1 68  ? 2.218   19.836 34.933 1.00 22.61 ? 64  LYS B N   1 
ATOM   1561 C  CA  . LYS B 1 68  ? 0.885   19.330 35.170 1.00 24.26 ? 64  LYS B CA  1 
ATOM   1562 C  C   . LYS B 1 68  ? 0.521   18.299 34.066 1.00 24.57 ? 64  LYS B C   1 
ATOM   1563 O  O   . LYS B 1 68  ? -0.057  17.258 34.342 1.00 24.24 ? 64  LYS B O   1 
ATOM   1564 C  CB  . LYS B 1 68  ? -0.132  20.482 35.146 1.00 23.55 ? 64  LYS B CB  1 
ATOM   1565 C  CG  . LYS B 1 68  ? -1.569  20.048 35.426 1.00 24.38 ? 64  LYS B CG  1 
ATOM   1566 C  CD  . LYS B 1 68  ? -2.522  21.246 35.455 1.00 25.94 ? 64  LYS B CD  1 
ATOM   1567 C  CE  . LYS B 1 68  ? -3.960  20.791 35.316 1.00 34.06 ? 64  LYS B CE  1 
ATOM   1568 N  NZ  . LYS B 1 68  ? -4.892  21.731 36.019 1.00 37.87 ? 64  LYS B NZ  1 
ATOM   1569 N  N   . GLU B 1 69  ? 0.885   18.624 32.823 1.00 25.66 ? 65  GLU B N   1 
ATOM   1570 C  CA  . GLU B 1 69  ? 0.610   17.763 31.679 1.00 26.86 ? 65  GLU B CA  1 
ATOM   1571 C  C   . GLU B 1 69  ? 1.409   16.452 31.654 1.00 26.48 ? 65  GLU B C   1 
ATOM   1572 O  O   . GLU B 1 69  ? 0.864   15.407 31.273 1.00 28.53 ? 65  GLU B O   1 
ATOM   1573 C  CB  . GLU B 1 69  ? 0.812   18.562 30.380 1.00 27.56 ? 65  GLU B CB  1 
ATOM   1574 C  CG  . GLU B 1 69  ? -0.355  19.493 30.098 1.00 33.57 ? 65  GLU B CG  1 
ATOM   1575 C  CD  . GLU B 1 69  ? -1.731  18.785 30.085 1.00 40.32 ? 65  GLU B CD  1 
ATOM   1576 O  OE1 . GLU B 1 69  ? -1.853  17.670 29.489 1.00 42.76 ? 65  GLU B OE1 1 
ATOM   1577 O  OE2 . GLU B 1 69  ? -2.690  19.352 30.678 1.00 42.83 ? 65  GLU B OE2 1 
ATOM   1578 N  N   . GLU B 1 70  ? 2.694   16.520 32.012 1.00 25.84 ? 66  GLU B N   1 
ATOM   1579 C  CA  . GLU B 1 70  ? 3.601   15.360 32.027 1.00 27.52 ? 66  GLU B CA  1 
ATOM   1580 C  C   . GLU B 1 70  ? 3.392   14.393 33.209 1.00 25.25 ? 66  GLU B C   1 
ATOM   1581 O  O   . GLU B 1 70  ? 3.652   13.182 33.112 1.00 26.41 ? 66  GLU B O   1 
ATOM   1582 C  CB  . GLU B 1 70  ? 5.072   15.815 32.141 1.00 27.64 ? 66  GLU B CB  1 
ATOM   1583 C  CG  . GLU B 1 70  ? 5.654   16.559 30.936 1.00 31.92 ? 66  GLU B CG  1 
ATOM   1584 C  CD  . GLU B 1 70  ? 7.008   17.259 31.221 1.00 31.43 ? 66  GLU B CD  1 
ATOM   1585 O  OE1 . GLU B 1 70  ? 7.322   17.722 32.371 1.00 39.02 ? 66  GLU B OE1 1 
ATOM   1586 O  OE2 . GLU B 1 70  ? 7.781   17.352 30.238 1.00 31.50 ? 66  GLU B OE2 1 
ATOM   1587 N  N   . ALA B 1 71  ? 2.993   14.949 34.341 1.00 23.64 ? 67  ALA B N   1 
ATOM   1588 C  CA  . ALA B 1 71  ? 2.857   14.196 35.580 1.00 21.66 ? 67  ALA B CA  1 
ATOM   1589 C  C   . ALA B 1 71  ? 1.713   13.183 35.631 1.00 21.68 ? 67  ALA B C   1 
ATOM   1590 O  O   . ALA B 1 71  ? 0.685   13.356 34.974 1.00 22.69 ? 67  ALA B O   1 
ATOM   1591 C  CB  . ALA B 1 71  ? 2.674   15.212 36.755 1.00 20.65 ? 67  ALA B CB  1 
ATOM   1592 N  N   . ASP B 1 72  ? 1.880   12.182 36.488 1.00 20.97 ? 68  ASP B N   1 
ATOM   1593 C  CA  . ASP B 1 72  ? 0.859   11.202 36.771 1.00 20.20 ? 68  ASP B CA  1 
ATOM   1594 C  C   . ASP B 1 72  ? -0.048  11.758 37.859 1.00 21.24 ? 68  ASP B C   1 
ATOM   1595 O  O   . ASP B 1 72  ? -1.274  11.615 37.801 1.00 20.93 ? 68  ASP B O   1 
ATOM   1596 C  CB  . ASP B 1 72  ? 1.453   9.886  37.276 1.00 19.87 ? 68  ASP B CB  1 
ATOM   1597 C  CG  . ASP B 1 72  ? 1.992   9.020  36.164 1.00 21.22 ? 68  ASP B CG  1 
ATOM   1598 O  OD1 . ASP B 1 72  ? 1.474   9.041  35.030 1.00 21.07 ? 68  ASP B OD1 1 
ATOM   1599 O  OD2 . ASP B 1 72  ? 2.920   8.275  36.456 1.00 21.47 ? 68  ASP B OD2 1 
ATOM   1600 N  N   . CYS B 1 73  ? 0.550   12.362 38.891 1.00 20.97 ? 69  CYS B N   1 
ATOM   1601 C  CA  . CYS B 1 73  ? -0.249  12.907 39.972 1.00 19.89 ? 69  CYS B CA  1 
ATOM   1602 C  C   . CYS B 1 73  ? 0.586   13.934 40.728 1.00 19.71 ? 69  CYS B C   1 
ATOM   1603 O  O   . CYS B 1 73  ? 1.726   14.197 40.374 1.00 19.63 ? 69  CYS B O   1 
ATOM   1604 C  CB  . CYS B 1 73  ? -0.611  11.792 40.948 1.00 20.61 ? 69  CYS B CB  1 
ATOM   1605 S  SG  . CYS B 1 73  ? 0.858   11.100 41.855 1.00 22.11 ? 69  CYS B SG  1 
ATOM   1606 N  N   . HIS B 1 74  ? -0.020  14.474 41.775 1.00 19.92 ? 70  HIS B N   1 
ATOM   1607 C  CA  . HIS B 1 74  ? 0.622   15.389 42.724 1.00 20.10 ? 70  HIS B CA  1 
ATOM   1608 C  C   . HIS B 1 74  ? 0.580   14.617 44.054 1.00 21.50 ? 70  HIS B C   1 
ATOM   1609 O  O   . HIS B 1 74  ? -0.455  14.062 44.423 1.00 20.57 ? 70  HIS B O   1 
ATOM   1610 C  CB  . HIS B 1 74  ? -0.154  16.677 42.925 1.00 20.65 ? 70  HIS B CB  1 
ATOM   1611 C  CG  . HIS B 1 74  ? 0.615   17.713 43.688 1.00 20.81 ? 70  HIS B CG  1 
ATOM   1612 N  ND1 . HIS B 1 74  ? 1.728   18.346 43.168 1.00 20.35 ? 70  HIS B ND1 1 
ATOM   1613 C  CD2 . HIS B 1 74  ? 0.461   18.186 44.954 1.00 22.55 ? 70  HIS B CD2 1 
ATOM   1614 C  CE1 . HIS B 1 74  ? 2.191   19.211 44.063 1.00 23.30 ? 70  HIS B CE1 1 
ATOM   1615 N  NE2 . HIS B 1 74  ? 1.457   19.123 45.161 1.00 22.56 ? 70  HIS B NE2 1 
ATOM   1616 N  N   . ILE B 1 75  ? 1.701   14.581 44.756 1.00 21.21 ? 71  ILE B N   1 
ATOM   1617 C  CA  . ILE B 1 75  ? 1.745   13.945 46.084 1.00 21.94 ? 71  ILE B CA  1 
ATOM   1618 C  C   . ILE B 1 75  ? 2.049   15.080 47.093 1.00 23.28 ? 71  ILE B C   1 
ATOM   1619 O  O   . ILE B 1 75  ? 2.906   15.925 46.821 1.00 22.83 ? 71  ILE B O   1 
ATOM   1620 C  CB  . ILE B 1 75  ? 2.800   12.837 46.207 1.00 22.30 ? 71  ILE B CB  1 
ATOM   1621 C  CG1 . ILE B 1 75  ? 2.536   11.737 45.165 1.00 23.06 ? 71  ILE B CG1 1 
ATOM   1622 C  CG2 . ILE B 1 75  ? 2.864   12.297 47.657 1.00 21.58 ? 71  ILE B CG2 1 
ATOM   1623 C  CD1 . ILE B 1 75  ? 3.522   10.593 45.281 1.00 24.37 ? 71  ILE B CD1 1 
ATOM   1624 N  N   . GLU B 1 76  ? 1.323   15.096 48.214 1.00 23.79 ? 72  GLU B N   1 
ATOM   1625 C  CA  . GLU B 1 76  ? 1.524   16.083 49.293 1.00 25.10 ? 72  GLU B CA  1 
ATOM   1626 C  C   . GLU B 1 76  ? 1.923   15.365 50.576 1.00 24.76 ? 72  GLU B C   1 
ATOM   1627 O  O   . GLU B 1 76  ? 1.312   14.355 50.959 1.00 24.01 ? 72  GLU B O   1 
ATOM   1628 C  CB  . GLU B 1 76  ? 0.277   16.902 49.608 1.00 26.20 ? 72  GLU B CB  1 
ATOM   1629 C  CG  . GLU B 1 76  ? -0.027  17.977 48.582 1.00 28.25 ? 72  GLU B CG  1 
ATOM   1630 C  CD  . GLU B 1 76  ? -1.300  18.787 48.852 1.00 28.47 ? 72  GLU B CD  1 
ATOM   1631 O  OE1 . GLU B 1 76  ? -2.172  18.390 49.677 1.00 33.17 ? 72  GLU B OE1 1 
ATOM   1632 O  OE2 . GLU B 1 76  ? -1.458  19.837 48.181 1.00 29.44 ? 72  GLU B OE2 1 
ATOM   1633 N  N   . ALA B 1 77  ? 2.957   15.896 51.224 1.00 23.65 ? 73  ALA B N   1 
ATOM   1634 C  CA  . ALA B 1 77  ? 3.422   15.399 52.494 1.00 24.62 ? 73  ALA B CA  1 
ATOM   1635 C  C   . ALA B 1 77  ? 3.005   16.541 53.391 1.00 24.37 ? 73  ALA B C   1 
ATOM   1636 O  O   . ALA B 1 77  ? 3.534   17.687 53.265 1.00 23.41 ? 73  ALA B O   1 
ATOM   1637 C  CB  . ALA B 1 77  ? 4.942   15.240 52.501 1.00 24.13 ? 73  ALA B CB  1 
ATOM   1638 N  N   A ASP B 1 78  ? 2.081   16.259 54.296 0.50 24.52 ? 74  ASP B N   1 
ATOM   1639 N  N   B ASP B 1 78  ? 2.036   16.297 54.278 0.50 24.39 ? 74  ASP B N   1 
ATOM   1640 C  CA  A ASP B 1 78  ? 1.653   17.271 55.234 0.50 25.07 ? 74  ASP B CA  1 
ATOM   1641 C  CA  B ASP B 1 78  ? 1.563   17.334 55.224 0.50 24.85 ? 74  ASP B CA  1 
ATOM   1642 C  C   A ASP B 1 78  ? 2.349   16.984 56.537 0.50 25.01 ? 74  ASP B C   1 
ATOM   1643 C  C   B ASP B 1 78  ? 2.190   17.074 56.594 0.50 24.88 ? 74  ASP B C   1 
ATOM   1644 O  O   A ASP B 1 78  ? 2.279   15.865 57.055 0.50 25.23 ? 74  ASP B O   1 
ATOM   1645 O  O   B ASP B 1 78  ? 1.898   16.055 57.223 0.50 25.06 ? 74  ASP B O   1 
ATOM   1646 C  CB  A ASP B 1 78  ? 0.148   17.259 55.402 0.50 25.67 ? 74  ASP B CB  1 
ATOM   1647 C  CB  B ASP B 1 78  ? 0.029   17.370 55.308 0.50 25.29 ? 74  ASP B CB  1 
ATOM   1648 C  CG  A ASP B 1 78  ? -0.540  17.820 54.204 0.50 27.51 ? 74  ASP B CG  1 
ATOM   1649 C  CG  B ASP B 1 78  ? -0.592  18.182 54.178 0.50 26.75 ? 74  ASP B CG  1 
ATOM   1650 O  OD1 A ASP B 1 78  ? -0.023  18.823 53.642 0.50 27.68 ? 74  ASP B OD1 1 
ATOM   1651 O  OD1 B ASP B 1 78  ? 0.080   18.317 53.124 0.50 26.78 ? 74  ASP B OD1 1 
ATOM   1652 O  OD2 A ASP B 1 78  ? -1.565  17.238 53.808 0.50 31.31 ? 74  ASP B OD2 1 
ATOM   1653 O  OD2 B ASP B 1 78  ? -1.732  18.697 54.339 0.50 26.85 ? 74  ASP B OD2 1 
ATOM   1654 N  N   . ILE B 1 79  ? 3.058   17.990 57.025 1.00 24.15 ? 75  ILE B N   1 
ATOM   1655 C  CA  . ILE B 1 79  ? 3.800   17.866 58.262 1.00 24.32 ? 75  ILE B CA  1 
ATOM   1656 C  C   . ILE B 1 79  ? 3.395   18.927 59.269 1.00 24.87 ? 75  ILE B C   1 
ATOM   1657 O  O   . ILE B 1 79  ? 3.591   20.130 59.039 1.00 23.79 ? 75  ILE B O   1 
ATOM   1658 C  CB  . ILE B 1 79  ? 5.327   17.900 57.974 1.00 24.18 ? 75  ILE B CB  1 
ATOM   1659 C  CG1 . ILE B 1 79  ? 5.694   16.782 56.971 1.00 25.67 ? 75  ILE B CG1 1 
ATOM   1660 C  CG2 . ILE B 1 79  ? 6.103   17.785 59.301 1.00 23.00 ? 75  ILE B CG2 1 
ATOM   1661 C  CD1 . ILE B 1 79  ? 7.098   16.834 56.391 1.00 24.28 ? 75  ILE B CD1 1 
ATOM   1662 N  N   . HIS B 1 80  ? 2.859   18.459 60.394 1.00 25.20 ? 76  HIS B N   1 
ATOM   1663 C  CA  . HIS B 1 80  ? 2.409   19.320 61.483 1.00 26.36 ? 76  HIS B CA  1 
ATOM   1664 C  C   . HIS B 1 80  ? 3.043   18.848 62.768 1.00 26.64 ? 76  HIS B C   1 
ATOM   1665 O  O   . HIS B 1 80  ? 3.300   17.654 62.950 1.00 26.51 ? 76  HIS B O   1 
ATOM   1666 C  CB  . HIS B 1 80  ? 0.888   19.275 61.606 1.00 27.41 ? 76  HIS B CB  1 
ATOM   1667 C  CG  . HIS B 1 80  ? 0.192   19.793 60.394 1.00 29.97 ? 76  HIS B CG  1 
ATOM   1668 N  ND1 . HIS B 1 80  ? -0.255  18.967 59.382 1.00 33.12 ? 76  HIS B ND1 1 
ATOM   1669 C  CD2 . HIS B 1 80  ? -0.081  21.059 60.000 1.00 32.97 ? 76  HIS B CD2 1 
ATOM   1670 C  CE1 . HIS B 1 80  ? -0.797  19.703 58.428 1.00 34.35 ? 76  HIS B CE1 1 
ATOM   1671 N  NE2 . HIS B 1 80  ? -0.708  20.975 58.780 1.00 35.14 ? 76  HIS B NE2 1 
ATOM   1672 N  N   . ALA B 1 81  ? 3.290   19.791 63.669 1.00 26.23 ? 77  ALA B N   1 
ATOM   1673 C  CA  . ALA B 1 81  ? 3.869   19.448 64.951 1.00 26.34 ? 77  ALA B CA  1 
ATOM   1674 C  C   . ALA B 1 81  ? 2.874   18.644 65.797 1.00 27.06 ? 77  ALA B C   1 
ATOM   1675 O  O   . ALA B 1 81  ? 1.676   18.958 65.837 1.00 27.72 ? 77  ALA B O   1 
ATOM   1676 C  CB  . ALA B 1 81  ? 4.256   20.736 65.687 1.00 25.67 ? 77  ALA B CB  1 
ATOM   1677 N  N   . ASN B 1 82  ? 3.370   17.613 66.468 1.00 27.39 ? 78  ASN B N   1 
ATOM   1678 C  CA  . ASN B 1 82  ? 2.530   16.841 67.376 1.00 28.24 ? 78  ASN B CA  1 
ATOM   1679 C  C   . ASN B 1 82  ? 2.830   17.345 68.803 1.00 28.89 ? 78  ASN B C   1 
ATOM   1680 O  O   . ASN B 1 82  ? 3.504   18.383 68.977 1.00 29.23 ? 78  ASN B O   1 
ATOM   1681 C  CB  . ASN B 1 82  ? 2.695   15.323 67.193 1.00 28.49 ? 78  ASN B CB  1 
ATOM   1682 C  CG  . ASN B 1 82  ? 4.117   14.845 67.394 1.00 28.53 ? 78  ASN B CG  1 
ATOM   1683 O  OD1 . ASN B 1 82  ? 4.898   15.448 68.118 1.00 29.37 ? 78  ASN B OD1 1 
ATOM   1684 N  ND2 . ASN B 1 82  ? 4.453   13.738 66.758 1.00 29.22 ? 78  ASN B ND2 1 
ATOM   1685 N  N   . GLU B 1 83  ? 2.359   16.640 69.829 1.00 29.49 ? 79  GLU B N   1 
ATOM   1686 C  CA  . GLU B 1 83  ? 2.616   17.065 71.202 1.00 30.12 ? 79  GLU B CA  1 
ATOM   1687 C  C   . GLU B 1 83  ? 4.113   17.242 71.512 1.00 29.69 ? 79  GLU B C   1 
ATOM   1688 O  O   . GLU B 1 83  ? 4.494   18.146 72.250 1.00 30.49 ? 79  GLU B O   1 
ATOM   1689 C  CB  . GLU B 1 83  ? 1.954   16.093 72.192 1.00 31.08 ? 79  GLU B CB  1 
ATOM   1690 C  CG  . GLU B 1 83  ? 0.442   16.290 72.324 1.00 34.53 ? 79  GLU B CG  1 
ATOM   1691 C  CD  . GLU B 1 83  ? 0.080   17.587 73.060 1.00 39.30 ? 79  GLU B CD  1 
ATOM   1692 O  OE1 . GLU B 1 83  ? 0.835   18.001 73.964 1.00 40.86 ? 79  GLU B OE1 1 
ATOM   1693 O  OE2 . GLU B 1 83  ? -0.966  18.189 72.725 1.00 41.95 ? 79  GLU B OE2 1 
ATOM   1694 N  N   . ALA B 1 84  ? 4.956   16.411 70.902 1.00 29.79 ? 80  ALA B N   1 
ATOM   1695 C  CA  . ALA B 1 84  ? 6.419   16.457 71.107 1.00 30.41 ? 80  ALA B CA  1 
ATOM   1696 C  C   . ALA B 1 84  ? 7.399   17.487 70.426 1.00 30.83 ? 80  ALA B C   1 
ATOM   1697 O  O   . ALA B 1 84  ? 8.408   17.801 71.050 1.00 31.50 ? 80  ALA B O   1 
ATOM   1698 C  CB  . ALA B 1 84  ? 6.986   15.038 70.908 1.00 29.63 ? 80  ALA B CB  1 
ATOM   1699 N  N   . GLY B 1 85  ? 7.150   18.138 69.280 1.00 32.07 ? 81  GLY B N   1 
ATOM   1700 C  CA  . GLY B 1 85  ? 6.091   19.089 69.017 1.00 31.93 ? 81  GLY B CA  1 
ATOM   1701 C  C   . GLY B 1 85  ? 6.464   20.378 69.762 1.00 31.39 ? 81  GLY B C   1 
ATOM   1702 O  O   . GLY B 1 85  ? 7.310   21.208 69.344 1.00 31.49 ? 81  GLY B O   1 
ATOM   1703 N  N   . LYS B 1 86  ? 5.835   20.520 70.912 1.00 30.81 ? 82  LYS B N   1 
ATOM   1704 C  CA  . LYS B 1 86  ? 6.025   21.666 71.790 1.00 30.85 ? 82  LYS B CA  1 
ATOM   1705 C  C   . LYS B 1 86  ? 7.456   21.912 72.301 1.00 29.99 ? 82  LYS B C   1 
ATOM   1706 O  O   . LYS B 1 86  ? 7.809   23.063 72.580 1.00 30.48 ? 82  LYS B O   1 
ATOM   1707 C  CB  . LYS B 1 86  ? 5.057   21.542 72.965 1.00 31.22 ? 82  LYS B CB  1 
ATOM   1708 C  CG  . LYS B 1 86  ? 3.583   21.536 72.566 1.00 32.73 ? 82  LYS B CG  1 
ATOM   1709 C  CD  . LYS B 1 86  ? 2.730   21.378 73.829 1.00 36.85 ? 82  LYS B CD  1 
ATOM   1710 C  CE  . LYS B 1 86  ? 1.240   21.428 73.529 1.00 39.48 ? 82  LYS B CE  1 
ATOM   1711 N  NZ  . LYS B 1 86  ? 0.442   21.228 74.785 1.00 40.23 ? 82  LYS B NZ  1 
ATOM   1712 N  N   . ASP B 1 87  ? 8.262   20.855 72.467 1.00 29.87 ? 83  ASP B N   1 
ATOM   1713 C  CA  . ASP B 1 87  ? 9.649   21.009 72.981 1.00 29.49 ? 83  ASP B CA  1 
ATOM   1714 C  C   . ASP B 1 87  ? 10.548  21.837 72.060 1.00 28.72 ? 83  ASP B C   1 
ATOM   1715 O  O   . ASP B 1 87  ? 11.553  22.389 72.503 1.00 28.51 ? 83  ASP B O   1 
ATOM   1716 C  CB  . ASP B 1 87  ? 10.318  19.654 73.276 1.00 30.67 ? 83  ASP B CB  1 
ATOM   1717 C  CG  . ASP B 1 87  ? 9.610   18.858 74.381 1.00 33.15 ? 83  ASP B CG  1 
ATOM   1718 O  OD1 . ASP B 1 87  ? 9.124   19.459 75.374 1.00 37.98 ? 83  ASP B OD1 1 
ATOM   1719 O  OD2 . ASP B 1 87  ? 9.568   17.611 74.267 1.00 36.74 ? 83  ASP B OD2 1 
ATOM   1720 N  N   . LEU B 1 88  ? 10.167  21.934 70.785 1.00 26.96 ? 84  LEU B N   1 
ATOM   1721 C  CA  . LEU B 1 88  ? 10.918  22.721 69.802 1.00 26.99 ? 84  LEU B CA  1 
ATOM   1722 C  C   . LEU B 1 88  ? 10.308  24.114 69.669 1.00 27.08 ? 84  LEU B C   1 
ATOM   1723 O  O   . LEU B 1 88  ? 10.822  24.980 68.930 1.00 26.93 ? 84  LEU B O   1 
ATOM   1724 C  CB  . LEU B 1 88  ? 10.941  22.019 68.430 1.00 26.21 ? 84  LEU B CB  1 
ATOM   1725 C  CG  . LEU B 1 88  ? 11.826  20.769 68.380 1.00 27.42 ? 84  LEU B CG  1 
ATOM   1726 C  CD1 . LEU B 1 88  ? 11.623  20.018 67.086 1.00 26.48 ? 84  LEU B CD1 1 
ATOM   1727 C  CD2 . LEU B 1 88  ? 13.285  21.125 68.539 1.00 28.43 ? 84  LEU B CD2 1 
ATOM   1728 N  N   . GLY B 1 89  ? 9.209   24.330 70.381 1.00 26.72 ? 85  GLY B N   1 
ATOM   1729 C  CA  . GLY B 1 89  ? 8.543   25.613 70.370 1.00 26.84 ? 85  GLY B CA  1 
ATOM   1730 C  C   . GLY B 1 89  ? 7.314   25.733 69.511 1.00 27.24 ? 85  GLY B C   1 
ATOM   1731 O  O   . GLY B 1 89  ? 6.668   26.772 69.515 1.00 26.42 ? 85  GLY B O   1 
ATOM   1732 N  N   . TYR B 1 90  ? 6.976   24.683 68.759 1.00 27.76 ? 86  TYR B N   1 
ATOM   1733 C  CA  . TYR B 1 90  ? 5.794   24.754 67.907 1.00 28.47 ? 86  TYR B CA  1 
ATOM   1734 C  C   . TYR B 1 90  ? 4.530   24.490 68.698 1.00 29.28 ? 86  TYR B C   1 
ATOM   1735 O  O   . TYR B 1 90  ? 4.561   23.872 69.760 1.00 29.15 ? 86  TYR B O   1 
ATOM   1736 C  CB  . TYR B 1 90  ? 5.832   23.714 66.779 1.00 27.86 ? 86  TYR B CB  1 
ATOM   1737 C  CG  . TYR B 1 90  ? 7.054   23.723 65.910 1.00 26.60 ? 86  TYR B CG  1 
ATOM   1738 C  CD1 . TYR B 1 90  ? 7.186   24.641 64.867 1.00 24.25 ? 86  TYR B CD1 1 
ATOM   1739 C  CD2 . TYR B 1 90  ? 8.071   22.781 66.103 1.00 25.71 ? 86  TYR B CD2 1 
ATOM   1740 C  CE1 . TYR B 1 90  ? 8.320   24.655 64.075 1.00 26.63 ? 86  TYR B CE1 1 
ATOM   1741 C  CE2 . TYR B 1 90  ? 9.221   22.783 65.298 1.00 26.86 ? 86  TYR B CE2 1 
ATOM   1742 C  CZ  . TYR B 1 90  ? 9.330   23.728 64.284 1.00 25.32 ? 86  TYR B CZ  1 
ATOM   1743 O  OH  . TYR B 1 90  ? 10.454  23.739 63.476 1.00 27.88 ? 86  TYR B OH  1 
ATOM   1744 N  N   . GLY B 1 91  ? 3.408   24.943 68.149 1.00 30.23 ? 87  GLY B N   1 
ATOM   1745 C  CA  . GLY B 1 91  ? 2.115   24.697 68.747 1.00 31.14 ? 87  GLY B CA  1 
ATOM   1746 C  C   . GLY B 1 91  ? 1.633   23.432 68.048 1.00 31.81 ? 87  GLY B C   1 
ATOM   1747 O  O   . GLY B 1 91  ? 1.967   23.211 66.872 1.00 30.89 ? 87  GLY B O   1 
ATOM   1748 N  N   . VAL B 1 92  ? 0.894   22.583 68.766 1.00 32.86 ? 88  VAL B N   1 
ATOM   1749 C  CA  . VAL B 1 92  ? 0.368   21.347 68.185 1.00 34.01 ? 88  VAL B CA  1 
ATOM   1750 C  C   . VAL B 1 92  ? -0.486  21.714 66.960 1.00 34.35 ? 88  VAL B C   1 
ATOM   1751 O  O   . VAL B 1 92  ? -1.233  22.698 66.995 1.00 35.27 ? 88  VAL B O   1 
ATOM   1752 C  CB  . VAL B 1 92  ? -0.461  20.511 69.213 1.00 34.67 ? 88  VAL B CB  1 
ATOM   1753 C  CG1 . VAL B 1 92  ? -1.130  19.312 68.542 1.00 34.74 ? 88  VAL B CG1 1 
ATOM   1754 C  CG2 . VAL B 1 92  ? 0.423   20.060 70.348 1.00 34.94 ? 88  VAL B CG2 1 
ATOM   1755 N  N   . GLY B 1 93  ? -0.349  20.952 65.871 1.00 33.89 ? 89  GLY B N   1 
ATOM   1756 C  CA  . GLY B 1 93  ? -1.107  21.211 64.652 1.00 32.97 ? 89  GLY B CA  1 
ATOM   1757 C  C   . GLY B 1 93  ? -0.517  22.243 63.714 1.00 32.26 ? 89  GLY B C   1 
ATOM   1758 O  O   . GLY B 1 93  ? -0.982  22.386 62.583 1.00 33.82 ? 89  GLY B O   1 
ATOM   1759 N  N   . ASP B 1 94  ? 0.510   22.970 64.156 1.00 31.20 ? 90  ASP B N   1 
ATOM   1760 C  CA  . ASP B 1 94  ? 1.130   23.973 63.298 1.00 30.25 ? 90  ASP B CA  1 
ATOM   1761 C  C   . ASP B 1 94  ? 1.912   23.294 62.188 1.00 29.05 ? 90  ASP B C   1 
ATOM   1762 O  O   . ASP B 1 94  ? 2.592   22.304 62.429 1.00 28.13 ? 90  ASP B O   1 
ATOM   1763 C  CB  . ASP B 1 94  ? 2.181   24.790 64.051 1.00 30.33 ? 90  ASP B CB  1 
ATOM   1764 C  CG  . ASP B 1 94  ? 1.600   25.723 65.101 1.00 32.07 ? 90  ASP B CG  1 
ATOM   1765 O  OD1 . ASP B 1 94  ? 0.362   25.839 65.253 1.00 34.32 ? 90  ASP B OD1 1 
ATOM   1766 O  OD2 . ASP B 1 94  ? 2.439   26.353 65.771 1.00 34.66 ? 90  ASP B OD2 1 
ATOM   1767 N  N   . PHE B 1 95  ? 1.892   23.885 61.002 1.00 28.45 ? 91  PHE B N   1 
ATOM   1768 C  CA  . PHE B 1 95  ? 2.703   23.406 59.892 1.00 27.30 ? 91  PHE B CA  1 
ATOM   1769 C  C   . PHE B 1 95  ? 4.150   23.652 60.345 1.00 26.24 ? 91  PHE B C   1 
ATOM   1770 O  O   . PHE B 1 95  ? 4.440   24.661 60.999 1.00 25.84 ? 91  PHE B O   1 
ATOM   1771 C  CB  . PHE B 1 95  ? 2.413   24.261 58.639 1.00 28.65 ? 91  PHE B CB  1 
ATOM   1772 C  CG  . PHE B 1 95  ? 3.428   24.085 57.484 1.00 29.12 ? 91  PHE B CG  1 
ATOM   1773 C  CD1 . PHE B 1 95  ? 3.489   22.895 56.814 1.00 27.65 ? 91  PHE B CD1 1 
ATOM   1774 C  CD2 . PHE B 1 95  ? 4.289   25.133 57.068 1.00 30.79 ? 91  PHE B CD2 1 
ATOM   1775 C  CE1 . PHE B 1 95  ? 4.361   22.687 55.730 1.00 26.81 ? 91  PHE B CE1 1 
ATOM   1776 C  CE2 . PHE B 1 95  ? 5.201   24.943 55.975 1.00 30.69 ? 91  PHE B CE2 1 
ATOM   1777 C  CZ  . PHE B 1 95  ? 5.212   23.694 55.306 1.00 29.95 ? 91  PHE B CZ  1 
ATOM   1778 N  N   . VAL B 1 96  ? 5.051   22.730 60.012 1.00 24.51 ? 92  VAL B N   1 
ATOM   1779 C  CA  . VAL B 1 96  ? 6.460   22.850 60.343 1.00 23.32 ? 92  VAL B CA  1 
ATOM   1780 C  C   . VAL B 1 96  ? 7.226   23.187 59.067 1.00 23.36 ? 92  VAL B C   1 
ATOM   1781 O  O   . VAL B 1 96  ? 7.481   22.309 58.236 1.00 22.41 ? 92  VAL B O   1 
ATOM   1782 C  CB  . VAL B 1 96  ? 7.006   21.550 61.054 1.00 23.75 ? 92  VAL B CB  1 
ATOM   1783 C  CG1 . VAL B 1 96  ? 8.498   21.684 61.455 1.00 23.35 ? 92  VAL B CG1 1 
ATOM   1784 C  CG2 . VAL B 1 96  ? 6.169   21.199 62.301 1.00 24.40 ? 92  VAL B CG2 1 
ATOM   1785 N  N   . PRO B 1 97  ? 7.563   24.480 58.887 1.00 22.96 ? 93  PRO B N   1 
ATOM   1786 C  CA  . PRO B 1 97  ? 8.290   24.939 57.715 1.00 22.82 ? 93  PRO B CA  1 
ATOM   1787 C  C   . PRO B 1 97  ? 9.798   24.665 57.830 1.00 21.67 ? 93  PRO B C   1 
ATOM   1788 O  O   . PRO B 1 97  ? 10.306  24.270 58.920 1.00 23.78 ? 93  PRO B O   1 
ATOM   1789 C  CB  . PRO B 1 97  ? 8.053   26.475 57.753 1.00 22.10 ? 93  PRO B CB  1 
ATOM   1790 C  CG  . PRO B 1 97  ? 8.015   26.757 59.224 1.00 24.73 ? 93  PRO B CG  1 
ATOM   1791 C  CD  . PRO B 1 97  ? 7.330   25.576 59.863 1.00 24.52 ? 93  PRO B CD  1 
ATOM   1792 N  N   . TYR B 1 98  ? 10.510  24.901 56.743 1.00 21.73 ? 94  TYR B N   1 
ATOM   1793 C  CA  . TYR B 1 98  ? 11.979  24.794 56.591 1.00 20.93 ? 94  TYR B CA  1 
ATOM   1794 C  C   . TYR B 1 98  ? 12.569  23.388 56.609 1.00 22.07 ? 94  TYR B C   1 
ATOM   1795 O  O   . TYR B 1 98  ? 13.797  23.249 56.639 1.00 22.73 ? 94  TYR B O   1 
ATOM   1796 C  CB  . TYR B 1 98  ? 12.738  25.703 57.623 1.00 20.35 ? 94  TYR B CB  1 
ATOM   1797 C  CG  . TYR B 1 98  ? 12.359  27.171 57.502 1.00 19.55 ? 94  TYR B CG  1 
ATOM   1798 C  CD1 . TYR B 1 98  ? 12.982  27.991 56.569 1.00 21.65 ? 94  TYR B CD1 1 
ATOM   1799 C  CD2 . TYR B 1 98  ? 11.393  27.723 58.344 1.00 19.74 ? 94  TYR B CD2 1 
ATOM   1800 C  CE1 . TYR B 1 98  ? 12.618  29.346 56.467 1.00 20.20 ? 94  TYR B CE1 1 
ATOM   1801 C  CE2 . TYR B 1 98  ? 10.998  29.062 58.239 1.00 21.28 ? 94  TYR B CE2 1 
ATOM   1802 C  CZ  . TYR B 1 98  ? 11.642  29.880 57.332 1.00 20.76 ? 94  TYR B CZ  1 
ATOM   1803 O  OH  . TYR B 1 98  ? 11.340  31.220 57.216 1.00 19.99 ? 94  TYR B OH  1 
ATOM   1804 N  N   . LEU B 1 99  ? 11.708  22.363 56.542 1.00 21.87 ? 95  LEU B N   1 
ATOM   1805 C  CA  . LEU B 1 99  ? 12.189  20.972 56.515 1.00 22.33 ? 95  LEU B CA  1 
ATOM   1806 C  C   . LEU B 1 99  ? 12.576  20.607 55.095 1.00 23.23 ? 95  LEU B C   1 
ATOM   1807 O  O   . LEU B 1 99  ? 12.145  21.274 54.146 1.00 22.56 ? 95  LEU B O   1 
ATOM   1808 C  CB  . LEU B 1 99  ? 11.090  20.033 57.021 1.00 21.61 ? 95  LEU B CB  1 
ATOM   1809 C  CG  . LEU B 1 99  ? 10.505  20.342 58.395 1.00 20.94 ? 95  LEU B CG  1 
ATOM   1810 C  CD1 . LEU B 1 99  ? 9.465   19.331 58.801 1.00 23.26 ? 95  LEU B CD1 1 
ATOM   1811 C  CD2 . LEU B 1 99  ? 11.607  20.474 59.538 1.00 21.35 ? 95  LEU B CD2 1 
ATOM   1812 N  N   . ARG B 1 100 ? 13.395  19.570 54.933 1.00 23.49 ? 96  ARG B N   1 
ATOM   1813 C  CA  . ARG B 1 100 ? 13.808  19.127 53.608 1.00 24.95 ? 96  ARG B CA  1 
ATOM   1814 C  C   . ARG B 1 100 ? 13.230  17.708 53.461 1.00 23.82 ? 96  ARG B C   1 
ATOM   1815 O  O   . ARG B 1 100 ? 13.637  16.772 54.153 1.00 23.16 ? 96  ARG B O   1 
ATOM   1816 C  CB  . ARG B 1 100 ? 15.328  19.234 53.471 1.00 25.55 ? 96  ARG B CB  1 
ATOM   1817 C  CG  . ARG B 1 100 ? 15.822  20.699 53.703 1.00 28.06 ? 96  ARG B CG  1 
ATOM   1818 C  CD  . ARG B 1 100 ? 17.343  20.854 53.963 1.00 29.40 ? 96  ARG B CD  1 
ATOM   1819 N  NE  . ARG B 1 100 ? 17.740  20.346 55.278 1.00 32.85 ? 96  ARG B NE  1 
ATOM   1820 C  CZ  . ARG B 1 100 ? 18.985  20.026 55.620 1.00 37.29 ? 96  ARG B CZ  1 
ATOM   1821 N  NH1 . ARG B 1 100 ? 19.975  20.180 54.749 1.00 40.43 ? 96  ARG B NH1 1 
ATOM   1822 N  NH2 . ARG B 1 100 ? 19.250  19.572 56.843 1.00 37.82 ? 96  ARG B NH2 1 
ATOM   1823 N  N   . VAL B 1 101 ? 12.201  17.604 52.616 1.00 23.48 ? 97  VAL B N   1 
ATOM   1824 C  CA  . VAL B 1 101 ? 11.468  16.361 52.456 1.00 23.00 ? 97  VAL B CA  1 
ATOM   1825 C  C   . VAL B 1 101 ? 11.715  15.680 51.115 1.00 23.40 ? 97  VAL B C   1 
ATOM   1826 O  O   . VAL B 1 101 ? 11.570  16.305 50.054 1.00 23.91 ? 97  VAL B O   1 
ATOM   1827 C  CB  . VAL B 1 101 ? 9.955   16.656 52.662 1.00 23.96 ? 97  VAL B CB  1 
ATOM   1828 C  CG1 . VAL B 1 101 ? 9.159   15.367 52.765 1.00 25.27 ? 97  VAL B CG1 1 
ATOM   1829 C  CG2 . VAL B 1 101 ? 9.748   17.475 53.947 1.00 24.21 ? 97  VAL B CG2 1 
ATOM   1830 N  N   . VAL B 1 102 ? 12.077  14.404 51.167 1.00 22.56 ? 98  VAL B N   1 
ATOM   1831 C  CA  . VAL B 1 102 ? 12.312  13.611 49.955 1.00 23.72 ? 98  VAL B CA  1 
ATOM   1832 C  C   . VAL B 1 102 ? 11.514  12.331 50.089 1.00 23.74 ? 98  VAL B C   1 
ATOM   1833 O  O   . VAL B 1 102 ? 11.259  11.860 51.205 1.00 23.78 ? 98  VAL B O   1 
ATOM   1834 C  CB  . VAL B 1 102 ? 13.839  13.309 49.718 1.00 24.13 ? 98  VAL B CB  1 
ATOM   1835 C  CG1 . VAL B 1 102 ? 14.066  12.606 48.391 1.00 26.68 ? 98  VAL B CG1 1 
ATOM   1836 C  CG2 . VAL B 1 102 ? 14.617  14.594 49.698 1.00 25.52 ? 98  VAL B CG2 1 
ATOM   1837 N  N   . ALA B 1 103 ? 11.067  11.815 48.949 1.00 23.54 ? 99  ALA B N   1 
ATOM   1838 C  CA  . ALA B 1 103 ? 10.334  10.567 48.916 1.00 22.52 ? 99  ALA B CA  1 
ATOM   1839 C  C   . ALA B 1 103 ? 11.113  9.596  48.071 1.00 22.85 ? 99  ALA B C   1 
ATOM   1840 O  O   . ALA B 1 103 ? 11.715  9.968  47.049 1.00 22.59 ? 99  ALA B O   1 
ATOM   1841 C  CB  . ALA B 1 103 ? 8.905   10.743 48.337 1.00 23.90 ? 99  ALA B CB  1 
ATOM   1842 N  N   . PHE B 1 104 ? 11.079  8.337  48.488 1.00 21.78 ? 100 PHE B N   1 
ATOM   1843 C  CA  . PHE B 1 104 ? 11.706  7.248  47.716 1.00 21.57 ? 100 PHE B CA  1 
ATOM   1844 C  C   . PHE B 1 104 ? 10.581  6.305  47.370 1.00 21.83 ? 100 PHE B C   1 
ATOM   1845 O  O   . PHE B 1 104 ? 9.813   5.899  48.260 1.00 21.68 ? 100 PHE B O   1 
ATOM   1846 C  CB  . PHE B 1 104 ? 12.827  6.527  48.458 1.00 22.35 ? 100 PHE B CB  1 
ATOM   1847 C  CG  . PHE B 1 104 ? 13.985  7.429  48.783 1.00 22.41 ? 100 PHE B CG  1 
ATOM   1848 C  CD1 . PHE B 1 104 ? 14.008  8.141  49.973 1.00 25.63 ? 100 PHE B CD1 1 
ATOM   1849 C  CD2 . PHE B 1 104 ? 15.023  7.602  47.876 1.00 24.46 ? 100 PHE B CD2 1 
ATOM   1850 C  CE1 . PHE B 1 104 ? 15.062  9.007  50.282 1.00 25.57 ? 100 PHE B CE1 1 
ATOM   1851 C  CE2 . PHE B 1 104 ? 16.084  8.483  48.183 1.00 26.68 ? 100 PHE B CE2 1 
ATOM   1852 C  CZ  . PHE B 1 104 ? 16.093  9.171  49.374 1.00 25.49 ? 100 PHE B CZ  1 
ATOM   1853 N  N   . LEU B 1 105 ? 10.485  5.963  46.079 1.00 19.51 ? 101 LEU B N   1 
ATOM   1854 C  CA  . LEU B 1 105 ? 9.442   5.061  45.601 1.00 20.43 ? 101 LEU B CA  1 
ATOM   1855 C  C   . LEU B 1 105 ? 10.068  3.788  45.047 1.00 20.92 ? 101 LEU B C   1 
ATOM   1856 O  O   . LEU B 1 105 ? 10.926  3.867  44.167 1.00 21.80 ? 101 LEU B O   1 
ATOM   1857 C  CB  . LEU B 1 105 ? 8.666   5.750  44.470 1.00 20.19 ? 101 LEU B CB  1 
ATOM   1858 C  CG  . LEU B 1 105 ? 8.162   7.169  44.697 1.00 22.92 ? 101 LEU B CG  1 
ATOM   1859 C  CD1 . LEU B 1 105 ? 7.431   7.664  43.413 1.00 22.19 ? 101 LEU B CD1 1 
ATOM   1860 C  CD2 . LEU B 1 105 ? 7.264   7.228  45.905 1.00 25.91 ? 101 LEU B CD2 1 
ATOM   1861 N  N   . GLN B 1 106 ? 9.612   2.621  45.501 1.00 20.96 ? 102 GLN B N   1 
ATOM   1862 C  CA  . GLN B 1 106 ? 10.140  1.346  44.989 1.00 21.41 ? 102 GLN B CA  1 
ATOM   1863 C  C   . GLN B 1 106 ? 8.979   0.383  44.712 1.00 22.03 ? 102 GLN B C   1 
ATOM   1864 O  O   . GLN B 1 106 ? 8.242   0.005  45.633 1.00 22.59 ? 102 GLN B O   1 
ATOM   1865 C  CB  . GLN B 1 106 ? 11.166  0.716  45.958 1.00 22.68 ? 102 GLN B CB  1 
ATOM   1866 C  CG  . GLN B 1 106 ? 11.800  -0.509 45.345 1.00 24.08 ? 102 GLN B CG  1 
ATOM   1867 C  CD  . GLN B 1 106 ? 12.926  -1.065 46.183 1.00 24.63 ? 102 GLN B CD  1 
ATOM   1868 O  OE1 . GLN B 1 106 ? 13.238  -0.534 47.236 1.00 29.44 ? 102 GLN B OE1 1 
ATOM   1869 N  NE2 . GLN B 1 106 ? 13.525  -2.172 45.718 1.00 30.47 ? 102 GLN B NE2 1 
ATOM   1870 N  N   . LYS B 1 107 ? 8.812   0.040  43.436 1.00 20.76 ? 103 LYS B N   1 
ATOM   1871 C  CA  . LYS B 1 107 ? 7.747   -0.855 42.983 1.00 22.39 ? 103 LYS B CA  1 
ATOM   1872 C  C   . LYS B 1 107 ? 8.095   -2.269 43.434 1.00 23.11 ? 103 LYS B C   1 
ATOM   1873 O  O   . LYS B 1 107 ? 9.246   -2.715 43.308 1.00 23.68 ? 103 LYS B O   1 
ATOM   1874 C  CB  . LYS B 1 107 ? 7.622   -0.813 41.461 1.00 21.87 ? 103 LYS B CB  1 
ATOM   1875 C  CG  . LYS B 1 107 ? 6.461   -1.650 40.866 1.00 21.84 ? 103 LYS B CG  1 
ATOM   1876 C  CD  . LYS B 1 107 ? 6.344   -1.383 39.359 1.00 23.59 ? 103 LYS B CD  1 
ATOM   1877 C  CE  . LYS B 1 107 ? 5.554   -2.511 38.648 1.00 26.78 ? 103 LYS B CE  1 
ATOM   1878 N  NZ  . LYS B 1 107 ? 5.067   -2.120 37.279 1.00 28.35 ? 103 LYS B NZ  1 
ATOM   1879 N  N   . HIS B 1 108 ? 7.093   -2.952 43.979 1.00 24.76 ? 104 HIS B N   1 
ATOM   1880 C  CA  . HIS B 1 108 ? 7.242   -4.335 44.436 1.00 26.04 ? 104 HIS B CA  1 
ATOM   1881 C  C   . HIS B 1 108 ? 7.643   -5.186 43.240 1.00 26.64 ? 104 HIS B C   1 
ATOM   1882 O  O   . HIS B 1 108 ? 6.978   -5.151 42.187 1.00 27.38 ? 104 HIS B O   1 
ATOM   1883 C  CB  . HIS B 1 108 ? 5.910   -4.836 44.969 1.00 25.86 ? 104 HIS B CB  1 
ATOM   1884 C  CG  . HIS B 1 108 ? 5.538   -4.252 46.289 1.00 27.36 ? 104 HIS B CG  1 
ATOM   1885 N  ND1 . HIS B 1 108 ? 4.497   -4.736 47.047 1.00 27.56 ? 104 HIS B ND1 1 
ATOM   1886 C  CD2 . HIS B 1 108 ? 6.072   -3.227 46.992 1.00 27.09 ? 104 HIS B CD2 1 
ATOM   1887 C  CE1 . HIS B 1 108 ? 4.397   -4.025 48.155 1.00 28.32 ? 104 HIS B CE1 1 
ATOM   1888 N  NE2 . HIS B 1 108 ? 5.350   -3.114 48.154 1.00 28.30 ? 104 HIS B NE2 1 
ATOM   1889 N  N   . GLY B 1 109 ? 8.750   -5.900 43.401 1.00 28.62 ? 105 GLY B N   1 
ATOM   1890 C  CA  . GLY B 1 109 ? 9.288   -6.760 42.351 1.00 29.72 ? 105 GLY B CA  1 
ATOM   1891 C  C   . GLY B 1 109 ? 10.447  -6.113 41.616 1.00 30.62 ? 105 GLY B C   1 
ATOM   1892 O  O   . GLY B 1 109 ? 11.071  -6.746 40.766 1.00 30.86 ? 105 GLY B O   1 
ATOM   1893 N  N   . SER B 1 110 ? 10.727  -4.845 41.929 1.00 31.14 ? 106 SER B N   1 
ATOM   1894 C  CA  . SER B 1 110 ? 11.813  -4.120 41.283 1.00 31.88 ? 106 SER B CA  1 
ATOM   1895 C  C   . SER B 1 110 ? 12.900  -3.728 42.280 1.00 32.77 ? 106 SER B C   1 
ATOM   1896 O  O   . SER B 1 110 ? 12.620  -3.550 43.466 1.00 32.97 ? 106 SER B O   1 
ATOM   1897 C  CB  . SER B 1 110 ? 11.271  -2.871 40.568 1.00 32.30 ? 106 SER B CB  1 
ATOM   1898 O  OG  . SER B 1 110 ? 12.331  -2.056 40.091 1.00 31.92 ? 106 SER B OG  1 
ATOM   1899 N  N   . GLU B 1 111 ? 14.130  -3.593 41.776 1.00 33.53 ? 107 GLU B N   1 
ATOM   1900 C  CA  . GLU B 1 111 ? 15.283  -3.163 42.569 1.00 34.17 ? 107 GLU B CA  1 
ATOM   1901 C  C   . GLU B 1 111 ? 15.500  -1.662 42.390 1.00 33.63 ? 107 GLU B C   1 
ATOM   1902 O  O   . GLU B 1 111 ? 16.332  -1.072 43.074 1.00 33.20 ? 107 GLU B O   1 
ATOM   1903 C  CB  . GLU B 1 111 ? 16.573  -3.873 42.138 1.00 35.22 ? 107 GLU B CB  1 
ATOM   1904 C  CG  . GLU B 1 111 ? 16.564  -5.400 42.321 1.00 39.36 ? 107 GLU B CG  1 
ATOM   1905 C  CD  . GLU B 1 111 ? 15.932  -5.832 43.645 1.00 43.26 ? 107 GLU B CD  1 
ATOM   1906 O  OE1 . GLU B 1 111 ? 16.249  -5.214 44.696 1.00 44.60 ? 107 GLU B OE1 1 
ATOM   1907 O  OE2 . GLU B 1 111 ? 15.110  -6.785 43.617 1.00 46.00 ? 107 GLU B OE2 1 
ATOM   1908 N  N   . LYS B 1 112 ? 14.780  -1.066 41.440 1.00 32.65 ? 108 LYS B N   1 
ATOM   1909 C  CA  . LYS B 1 112 ? 14.920  0.360  41.152 1.00 32.26 ? 108 LYS B CA  1 
ATOM   1910 C  C   . LYS B 1 112 ? 14.218  1.219  42.181 1.00 30.71 ? 108 LYS B C   1 
ATOM   1911 O  O   . LYS B 1 112 ? 13.128  0.867  42.654 1.00 30.80 ? 108 LYS B O   1 
ATOM   1912 C  CB  . LYS B 1 112 ? 14.365  0.699  39.763 1.00 31.96 ? 108 LYS B CB  1 
ATOM   1913 C  CG  . LYS B 1 112 ? 15.036  -0.051 38.614 1.00 32.48 ? 108 LYS B CG  1 
ATOM   1914 C  CD  . LYS B 1 112 ? 14.596  0.499  37.261 1.00 33.97 ? 108 LYS B CD  1 
ATOM   1915 C  CE  . LYS B 1 112 ? 15.322  -0.202 36.101 1.00 37.31 ? 108 LYS B CE  1 
ATOM   1916 N  NZ  . LYS B 1 112 ? 14.857  -1.609 35.870 1.00 39.46 ? 108 LYS B NZ  1 
ATOM   1917 N  N   . VAL B 1 113 ? 14.841  2.355  42.501 1.00 29.29 ? 109 VAL B N   1 
ATOM   1918 C  CA  . VAL B 1 113 ? 14.272  3.307  43.440 1.00 27.61 ? 109 VAL B CA  1 
ATOM   1919 C  C   . VAL B 1 113 ? 14.222  4.700  42.794 1.00 27.13 ? 109 VAL B C   1 
ATOM   1920 O  O   . VAL B 1 113 ? 15.224  5.202  42.266 1.00 28.36 ? 109 VAL B O   1 
ATOM   1921 C  CB  . VAL B 1 113 ? 15.039  3.372  44.794 1.00 27.64 ? 109 VAL B CB  1 
ATOM   1922 C  CG1 . VAL B 1 113 ? 14.450  4.472  45.692 1.00 27.37 ? 109 VAL B CG1 1 
ATOM   1923 C  CG2 . VAL B 1 113 ? 14.981  2.025  45.509 1.00 29.30 ? 109 VAL B CG2 1 
ATOM   1924 N  N   . GLN B 1 114 ? 13.050  5.320  42.839 1.00 24.38 ? 110 GLN B N   1 
ATOM   1925 C  CA  . GLN B 1 114 ? 12.871  6.644  42.288 1.00 23.47 ? 110 GLN B CA  1 
ATOM   1926 C  C   . GLN B 1 114 ? 12.867  7.624  43.451 1.00 23.09 ? 110 GLN B C   1 
ATOM   1927 O  O   . GLN B 1 114 ? 12.189  7.397  44.446 1.00 22.11 ? 110 GLN B O   1 
ATOM   1928 C  CB  . GLN B 1 114 ? 11.527  6.730  41.556 1.00 22.82 ? 110 GLN B CB  1 
ATOM   1929 C  CG  . GLN B 1 114 ? 11.276  8.066  40.950 1.00 22.69 ? 110 GLN B CG  1 
ATOM   1930 C  CD  . GLN B 1 114 ? 9.943   8.131  40.192 1.00 22.64 ? 110 GLN B CD  1 
ATOM   1931 O  OE1 . GLN B 1 114 ? 9.343   7.103  39.839 1.00 22.00 ? 110 GLN B OE1 1 
ATOM   1932 N  NE2 . GLN B 1 114 ? 9.494   9.344  39.940 1.00 24.42 ? 110 GLN B NE2 1 
ATOM   1933 N  N   . LYS B 1 115 ? 13.637  8.701  43.327 1.00 23.32 ? 111 LYS B N   1 
ATOM   1934 C  CA  . LYS B 1 115 ? 13.703  9.717  44.368 1.00 25.10 ? 111 LYS B CA  1 
ATOM   1935 C  C   . LYS B 1 115 ? 12.892  10.942 43.917 1.00 24.49 ? 111 LYS B C   1 
ATOM   1936 O  O   . LYS B 1 115 ? 13.021  11.378 42.759 1.00 25.28 ? 111 LYS B O   1 
ATOM   1937 C  CB  . LYS B 1 115 ? 15.162  10.096 44.638 1.00 24.68 ? 111 LYS B CB  1 
ATOM   1938 C  CG  . LYS B 1 115 ? 15.327  11.082 45.772 1.00 27.62 ? 111 LYS B CG  1 
ATOM   1939 C  CD  . LYS B 1 115 ? 16.804  11.497 45.969 1.00 29.79 ? 111 LYS B CD  1 
ATOM   1940 C  CE  . LYS B 1 115 ? 17.218  12.503 44.882 1.00 36.58 ? 111 LYS B CE  1 
ATOM   1941 N  NZ  . LYS B 1 115 ? 18.413  13.305 45.271 1.00 38.96 ? 111 LYS B NZ  1 
ATOM   1942 N  N   . VAL B 1 116 ? 12.032  11.443 44.810 1.00 24.32 ? 112 VAL B N   1 
ATOM   1943 C  CA  . VAL B 1 116 ? 11.153  12.612 44.588 1.00 24.48 ? 112 VAL B CA  1 
ATOM   1944 C  C   . VAL B 1 116 ? 11.488  13.705 45.634 1.00 24.98 ? 112 VAL B C   1 
ATOM   1945 O  O   . VAL B 1 116 ? 11.361  13.498 46.851 1.00 24.51 ? 112 VAL B O   1 
ATOM   1946 C  CB  . VAL B 1 116 ? 9.659   12.248 44.726 1.00 24.41 ? 112 VAL B CB  1 
ATOM   1947 C  CG1 . VAL B 1 116 ? 8.788   13.513 44.596 1.00 26.32 ? 112 VAL B CG1 1 
ATOM   1948 C  CG2 . VAL B 1 116 ? 9.220   11.127 43.707 1.00 23.82 ? 112 VAL B CG2 1 
ATOM   1949 N  N   A MET B 1 117 ? 11.919  14.864 45.157 0.50 25.86 ? 113 MET B N   1 
ATOM   1950 N  N   B MET B 1 117 ? 11.894  14.860 45.115 0.50 24.85 ? 113 MET B N   1 
ATOM   1951 C  CA  A MET B 1 117 ? 12.280  15.959 46.050 0.50 27.16 ? 113 MET B CA  1 
ATOM   1952 C  CA  B MET B 1 117 ? 12.252  16.024 45.913 0.50 24.73 ? 113 MET B CA  1 
ATOM   1953 C  C   A MET B 1 117 ? 11.101  16.913 46.176 0.50 25.22 ? 113 MET B C   1 
ATOM   1954 C  C   B MET B 1 117 ? 10.982  16.840 46.106 0.50 23.71 ? 113 MET B C   1 
ATOM   1955 O  O   A MET B 1 117 ? 10.802  17.651 45.241 0.50 25.27 ? 113 MET B O   1 
ATOM   1956 O  O   B MET B 1 117 ? 10.404  17.308 45.129 0.50 23.34 ? 113 MET B O   1 
ATOM   1957 C  CB  A MET B 1 117 ? 13.519  16.686 45.528 0.50 27.50 ? 113 MET B CB  1 
ATOM   1958 C  CB  B MET B 1 117 ? 13.297  16.867 45.177 0.50 25.87 ? 113 MET B CB  1 
ATOM   1959 C  CG  A MET B 1 117 ? 14.684  15.756 45.175 0.50 30.41 ? 113 MET B CG  1 
ATOM   1960 C  CG  B MET B 1 117 ? 14.649  16.181 44.965 0.50 30.29 ? 113 MET B CG  1 
ATOM   1961 S  SD  A MET B 1 117 ? 16.166  16.725 44.865 0.50 33.59 ? 113 MET B SD  1 
ATOM   1962 S  SD  B MET B 1 117 ? 15.472  15.639 46.484 0.50 36.78 ? 113 MET B SD  1 
ATOM   1963 C  CE  A MET B 1 117 ? 16.802  16.905 46.524 0.50 33.64 ? 113 MET B CE  1 
ATOM   1964 C  CE  B MET B 1 117 ? 15.597  17.181 47.406 0.50 35.03 ? 113 MET B CE  1 
ATOM   1965 N  N   A PHE B 1 118 ? 10.412  16.882 47.312 0.50 23.80 ? 114 PHE B N   1 
ATOM   1966 N  N   B PHE B 1 118 ? 10.532  16.979 47.350 0.50 22.65 ? 114 PHE B N   1 
ATOM   1967 C  CA  A PHE B 1 118 ? 9.270   17.753 47.484 0.50 22.64 ? 114 PHE B CA  1 
ATOM   1968 C  CA  B PHE B 1 118 ? 9.322   17.732 47.643 0.50 22.40 ? 114 PHE B CA  1 
ATOM   1969 C  C   A PHE B 1 118 ? 9.778   19.185 47.588 0.50 22.43 ? 114 PHE B C   1 
ATOM   1970 C  C   B PHE B 1 118 ? 9.725   19.185 47.853 0.50 22.16 ? 114 PHE B C   1 
ATOM   1971 O  O   A PHE B 1 118 ? 10.986  19.425 47.737 0.50 21.30 ? 114 PHE B O   1 
ATOM   1972 O  O   B PHE B 1 118 ? 10.837  19.442 48.300 0.50 21.23 ? 114 PHE B O   1 
ATOM   1973 C  CB  A PHE B 1 118 ? 8.483   17.416 48.760 0.50 23.16 ? 114 PHE B CB  1 
ATOM   1974 C  CB  B PHE B 1 118 ? 8.633   17.165 48.884 0.50 23.38 ? 114 PHE B CB  1 
ATOM   1975 C  CG  A PHE B 1 118 ? 7.738   16.102 48.716 0.50 23.28 ? 114 PHE B CG  1 
ATOM   1976 C  CG  B PHE B 1 118 ? 7.719   16.001 48.593 0.50 23.91 ? 114 PHE B CG  1 
ATOM   1977 C  CD1 A PHE B 1 118 ? 8.186   15.020 49.455 0.50 25.06 ? 114 PHE B CD1 1 
ATOM   1978 C  CD1 B PHE B 1 118 ? 6.428   15.979 49.105 0.50 27.40 ? 114 PHE B CD1 1 
ATOM   1979 C  CD2 A PHE B 1 118 ? 6.555   15.971 47.977 0.50 24.83 ? 114 PHE B CD2 1 
ATOM   1980 C  CD2 B PHE B 1 118 ? 8.123   14.961 47.772 0.50 25.24 ? 114 PHE B CD2 1 
ATOM   1981 C  CE1 A PHE B 1 118 ? 7.496   13.813 49.441 0.50 24.17 ? 114 PHE B CE1 1 
ATOM   1982 C  CE1 B PHE B 1 118 ? 5.565   14.925 48.832 0.50 27.41 ? 114 PHE B CE1 1 
ATOM   1983 C  CE2 A PHE B 1 118 ? 5.854   14.763 47.947 0.50 25.96 ? 114 PHE B CE2 1 
ATOM   1984 C  CE2 B PHE B 1 118 ? 7.258   13.871 47.482 0.50 27.24 ? 114 PHE B CE2 1 
ATOM   1985 C  CZ  A PHE B 1 118 ? 6.335   13.675 48.692 0.50 25.01 ? 114 PHE B CZ  1 
ATOM   1986 C  CZ  B PHE B 1 118 ? 5.981   13.862 48.008 0.50 26.74 ? 114 PHE B CZ  1 
ATOM   1987 N  N   . ALA B 1 119 ? 8.836   20.114 47.502 1.00 21.10 ? 115 ALA B N   1 
ATOM   1988 C  CA  . ALA B 1 119 ? 9.132   21.547 47.631 1.00 20.91 ? 115 ALA B CA  1 
ATOM   1989 C  C   . ALA B 1 119 ? 8.010   22.186 48.453 1.00 21.46 ? 115 ALA B C   1 
ATOM   1990 O  O   . ALA B 1 119 ? 6.866   21.721 48.446 1.00 21.36 ? 115 ALA B O   1 
ATOM   1991 C  CB  . ALA B 1 119 ? 9.241   22.191 46.265 1.00 22.31 ? 115 ALA B CB  1 
ATOM   1992 N  N   . PRO B 1 120 ? 8.342   23.232 49.206 1.00 20.61 ? 116 PRO B N   1 
ATOM   1993 C  CA  . PRO B 1 120 ? 7.325   23.893 50.004 1.00 20.60 ? 116 PRO B CA  1 
ATOM   1994 C  C   . PRO B 1 120 ? 6.440   24.754 49.100 1.00 19.97 ? 116 PRO B C   1 
ATOM   1995 O  O   . PRO B 1 120 ? 6.939   25.462 48.216 1.00 20.38 ? 116 PRO B O   1 
ATOM   1996 C  CB  . PRO B 1 120 ? 8.141   24.781 50.967 1.00 21.29 ? 116 PRO B CB  1 
ATOM   1997 C  CG  . PRO B 1 120 ? 9.465   24.907 50.364 1.00 22.11 ? 116 PRO B CG  1 
ATOM   1998 C  CD  . PRO B 1 120 ? 9.682   23.854 49.350 1.00 21.58 ? 116 PRO B CD  1 
ATOM   1999 N  N   . MET B 1 121 ? 5.133   24.679 49.322 1.00 19.80 ? 117 MET B N   1 
ATOM   2000 C  CA  . MET B 1 121 ? 4.198   25.484 48.486 1.00 20.23 ? 117 MET B CA  1 
ATOM   2001 C  C   . MET B 1 121 ? 2.832   25.655 49.130 1.00 19.78 ? 117 MET B C   1 
ATOM   2002 O  O   . MET B 1 121 ? 2.455   24.862 50.010 1.00 20.54 ? 117 MET B O   1 
ATOM   2003 C  CB  . MET B 1 121 ? 3.985   24.788 47.137 1.00 20.20 ? 117 MET B CB  1 
ATOM   2004 C  CG  . MET B 1 121 ? 3.481   23.353 47.227 1.00 19.47 ? 117 MET B CG  1 
ATOM   2005 S  SD  . MET B 1 121 ? 3.595   22.505 45.637 1.00 21.55 ? 117 MET B SD  1 
ATOM   2006 C  CE  . MET B 1 121 ? 5.394   22.325 45.434 1.00 21.33 ? 117 MET B CE  1 
ATOM   2007 N  N   . ASN B 1 122 ? 2.078   26.663 48.677 1.00 17.95 ? 118 ASN B N   1 
ATOM   2008 C  CA  . ASN B 1 122 ? 0.710   26.810 49.141 1.00 18.84 ? 118 ASN B CA  1 
ATOM   2009 C  C   . ASN B 1 122 ? -0.257  26.405 48.039 1.00 19.94 ? 118 ASN B C   1 
ATOM   2010 O  O   . ASN B 1 122 ? -0.042  26.749 46.880 1.00 19.74 ? 118 ASN B O   1 
ATOM   2011 C  CB  . ASN B 1 122 ? 0.343   28.261 49.383 1.00 19.02 ? 118 ASN B CB  1 
ATOM   2012 C  CG  . ASN B 1 122 ? 0.865   28.781 50.705 1.00 19.31 ? 118 ASN B CG  1 
ATOM   2013 O  OD1 . ASN B 1 122 ? 1.458   28.048 51.523 1.00 19.71 ? 118 ASN B OD1 1 
ATOM   2014 N  ND2 . ASN B 1 122 ? 0.686   30.076 50.903 1.00 20.49 ? 118 ASN B ND2 1 
ATOM   2015 N  N   . ALA B 1 123 ? -1.353  25.761 48.439 1.00 20.70 ? 119 ALA B N   1 
ATOM   2016 C  CA  . ALA B 1 123 ? -2.453  25.453 47.552 1.00 22.13 ? 119 ALA B CA  1 
ATOM   2017 C  C   . ALA B 1 123 ? -3.627  26.265 48.158 1.00 22.54 ? 119 ALA B C   1 
ATOM   2018 O  O   . ALA B 1 123 ? -3.418  27.037 49.134 1.00 22.37 ? 119 ALA B O   1 
ATOM   2019 C  CB  . ALA B 1 123 ? -2.729  23.946 47.565 1.00 22.98 ? 119 ALA B CB  1 
ATOM   2020 N  N   . GLY B 1 124 ? -4.834  26.136 47.604 1.00 23.59 ? 120 GLY B N   1 
ATOM   2021 C  CA  . GLY B 1 124 ? -5.986  26.872 48.156 1.00 25.03 ? 120 GLY B CA  1 
ATOM   2022 C  C   . GLY B 1 124 ? -6.280  26.459 49.596 1.00 26.15 ? 120 GLY B C   1 
ATOM   2023 O  O   . GLY B 1 124 ? -6.869  27.226 50.386 1.00 27.68 ? 120 GLY B O   1 
ATOM   2024 N  N   . ASP B 1 125 ? -5.889  25.243 49.949 1.00 27.03 ? 121 ASP B N   1 
ATOM   2025 C  CA  . ASP B 1 125 ? -6.149  24.745 51.292 1.00 28.19 ? 121 ASP B CA  1 
ATOM   2026 C  C   . ASP B 1 125 ? -4.967  24.879 52.244 1.00 28.17 ? 121 ASP B C   1 
ATOM   2027 O  O   . ASP B 1 125 ? -4.947  24.242 53.293 1.00 30.86 ? 121 ASP B O   1 
ATOM   2028 C  CB  . ASP B 1 125 ? -6.669  23.303 51.257 1.00 28.58 ? 121 ASP B CB  1 
ATOM   2029 C  CG  . ASP B 1 125 ? -5.602  22.316 50.814 1.00 31.77 ? 121 ASP B CG  1 
ATOM   2030 O  OD1 . ASP B 1 125 ? -4.586  22.783 50.252 1.00 27.79 ? 121 ASP B OD1 1 
ATOM   2031 O  OD2 . ASP B 1 125 ? -5.789  21.087 51.006 1.00 36.41 ? 121 ASP B OD2 1 
ATOM   2032 N  N   . GLY B 1 126 ? -3.984  25.705 51.896 1.00 27.49 ? 122 GLY B N   1 
ATOM   2033 C  CA  . GLY B 1 126 ? -2.833  25.951 52.771 1.00 25.96 ? 122 GLY B CA  1 
ATOM   2034 C  C   . GLY B 1 126 ? -1.467  25.416 52.350 1.00 26.80 ? 122 GLY B C   1 
ATOM   2035 O  O   . GLY B 1 126 ? -1.317  24.891 51.224 1.00 26.19 ? 122 GLY B O   1 
ATOM   2036 N  N   . PRO B 1 127 ? -0.456  25.540 53.234 1.00 25.57 ? 123 PRO B N   1 
ATOM   2037 C  CA  . PRO B 1 127 ? 0.898   25.074 52.932 1.00 25.08 ? 123 PRO B CA  1 
ATOM   2038 C  C   . PRO B 1 127 ? 1.045   23.551 52.935 1.00 25.23 ? 123 PRO B C   1 
ATOM   2039 O  O   . PRO B 1 127 ? 0.349   22.843 53.700 1.00 25.96 ? 123 PRO B O   1 
ATOM   2040 C  CB  . PRO B 1 127 ? 1.738   25.649 54.096 1.00 25.94 ? 123 PRO B CB  1 
ATOM   2041 C  CG  . PRO B 1 127 ? 0.752   25.688 55.274 1.00 27.60 ? 123 PRO B CG  1 
ATOM   2042 C  CD  . PRO B 1 127 ? -0.524  26.173 54.581 1.00 25.49 ? 123 PRO B CD  1 
ATOM   2043 N  N   . HIS B 1 128 ? 1.958   23.052 52.103 1.00 24.00 ? 124 HIS B N   1 
ATOM   2044 C  CA  . HIS B 1 128 ? 2.272   21.621 52.046 1.00 24.00 ? 124 HIS B CA  1 
ATOM   2045 C  C   . HIS B 1 128 ? 3.721   21.486 51.589 1.00 22.20 ? 124 HIS B C   1 
ATOM   2046 O  O   . HIS B 1 128 ? 4.306   22.443 51.080 1.00 22.43 ? 124 HIS B O   1 
ATOM   2047 C  CB  . HIS B 1 128 ? 1.410   20.905 50.951 1.00 25.70 ? 124 HIS B CB  1 
ATOM   2048 C  CG  . HIS B 1 128 ? -0.059  21.202 51.037 1.00 27.09 ? 124 HIS B CG  1 
ATOM   2049 N  ND1 . HIS B 1 128 ? -0.903  20.511 51.882 1.00 30.26 ? 124 HIS B ND1 1 
ATOM   2050 C  CD2 . HIS B 1 128 ? -0.828  22.120 50.408 1.00 29.30 ? 124 HIS B CD2 1 
ATOM   2051 C  CE1 . HIS B 1 128 ? -2.133  20.978 51.754 1.00 30.60 ? 124 HIS B CE1 1 
ATOM   2052 N  NE2 . HIS B 1 128 ? -2.112  21.965 50.876 1.00 29.13 ? 124 HIS B NE2 1 
ATOM   2053 N  N   . TYR B 1 129 ? 4.262   20.266 51.672 1.00 21.75 ? 125 TYR B N   1 
ATOM   2054 C  CA  . TYR B 1 129 ? 5.509   19.908 51.007 1.00 20.03 ? 125 TYR B CA  1 
ATOM   2055 C  C   . TYR B 1 129 ? 4.904   19.068 49.863 1.00 22.33 ? 125 TYR B C   1 
ATOM   2056 O  O   . TYR B 1 129 ? 4.144   18.129 50.106 1.00 22.59 ? 125 TYR B O   1 
ATOM   2057 C  CB  . TYR B 1 129 ? 6.458   19.073 51.852 1.00 20.37 ? 125 TYR B CB  1 
ATOM   2058 C  CG  . TYR B 1 129 ? 7.068   19.918 52.941 1.00 19.18 ? 125 TYR B CG  1 
ATOM   2059 C  CD1 . TYR B 1 129 ? 8.142   20.758 52.670 1.00 19.83 ? 125 TYR B CD1 1 
ATOM   2060 C  CD2 . TYR B 1 129 ? 6.555   19.869 54.232 1.00 20.80 ? 125 TYR B CD2 1 
ATOM   2061 C  CE1 . TYR B 1 129 ? 8.687   21.562 53.664 1.00 19.01 ? 125 TYR B CE1 1 
ATOM   2062 C  CE2 . TYR B 1 129 ? 7.086   20.666 55.263 1.00 19.80 ? 125 TYR B CE2 1 
ATOM   2063 C  CZ  . TYR B 1 129 ? 8.167   21.486 54.967 1.00 19.07 ? 125 TYR B CZ  1 
ATOM   2064 O  OH  . TYR B 1 129 ? 8.715   22.266 55.943 1.00 20.70 ? 125 TYR B OH  1 
ATOM   2065 N  N   . GLY B 1 130 ? 5.149   19.455 48.627 1.00 21.83 ? 126 GLY B N   1 
ATOM   2066 C  CA  . GLY B 1 130 ? 4.516   18.735 47.531 1.00 22.31 ? 126 GLY B CA  1 
ATOM   2067 C  C   . GLY B 1 130 ? 5.357   18.538 46.308 1.00 21.63 ? 126 GLY B C   1 
ATOM   2068 O  O   . GLY B 1 130 ? 6.403   19.147 46.132 1.00 21.26 ? 126 GLY B O   1 
ATOM   2069 N  N   . ALA B 1 131 ? 4.877   17.648 45.446 1.00 21.07 ? 127 ALA B N   1 
ATOM   2070 C  CA  . ALA B 1 131 ? 5.556   17.392 44.214 1.00 20.62 ? 127 ALA B CA  1 
ATOM   2071 C  C   . ALA B 1 131 ? 4.647   16.754 43.201 1.00 20.11 ? 127 ALA B C   1 
ATOM   2072 O  O   . ALA B 1 131 ? 3.856   15.857 43.539 1.00 19.83 ? 127 ALA B O   1 
ATOM   2073 C  CB  . ALA B 1 131 ? 6.756   16.430 44.416 1.00 21.52 ? 127 ALA B CB  1 
ATOM   2074 N  N   . ASN B 1 132 ? 4.793   17.229 41.968 1.00 19.29 ? 128 ASN B N   1 
ATOM   2075 C  CA  . ASN B 1 132 ? 4.160   16.548 40.839 1.00 19.14 ? 128 ASN B CA  1 
ATOM   2076 C  C   . ASN B 1 132 ? 5.070   15.326 40.631 1.00 20.25 ? 128 ASN B C   1 
ATOM   2077 O  O   . ASN B 1 132 ? 6.320   15.424 40.748 1.00 20.80 ? 128 ASN B O   1 
ATOM   2078 C  CB  . ASN B 1 132 ? 4.139   17.409 39.579 1.00 19.25 ? 128 ASN B CB  1 
ATOM   2079 C  CG  . ASN B 1 132 ? 2.897   18.225 39.467 1.00 20.42 ? 128 ASN B CG  1 
ATOM   2080 O  OD1 . ASN B 1 132 ? 2.008   18.195 40.341 1.00 21.27 ? 128 ASN B OD1 1 
ATOM   2081 N  ND2 . ASN B 1 132 ? 2.817   18.985 38.377 1.00 19.70 ? 128 ASN B ND2 1 
ATOM   2082 N  N   A VAL B 1 133 ? 4.464   14.164 40.355 0.50 19.23 ? 129 VAL B N   1 
ATOM   2083 N  N   B VAL B 1 133 ? 4.481   14.190 40.281 0.50 19.97 ? 129 VAL B N   1 
ATOM   2084 C  CA  A VAL B 1 133 ? 5.224   12.904 40.211 0.50 19.43 ? 129 VAL B CA  1 
ATOM   2085 C  CA  B VAL B 1 133 ? 5.298   13.003 40.084 0.50 21.22 ? 129 VAL B CA  1 
ATOM   2086 C  C   A VAL B 1 133 ? 4.793   12.049 39.036 0.50 20.06 ? 129 VAL B C   1 
ATOM   2087 C  C   B VAL B 1 133 ? 4.826   12.184 38.913 0.50 21.03 ? 129 VAL B C   1 
ATOM   2088 O  O   A VAL B 1 133 ? 3.587   11.865 38.836 0.50 18.90 ? 129 VAL B O   1 
ATOM   2089 O  O   B VAL B 1 133 ? 3.646   12.188 38.567 0.50 20.77 ? 129 VAL B O   1 
ATOM   2090 C  CB  A VAL B 1 133 ? 5.004   11.984 41.459 0.50 19.86 ? 129 VAL B CB  1 
ATOM   2091 C  CB  B VAL B 1 133 ? 5.328   12.076 41.339 0.50 21.72 ? 129 VAL B CB  1 
ATOM   2092 C  CG1 A VAL B 1 133 ? 5.768   10.661 41.323 0.50 16.85 ? 129 VAL B CG1 1 
ATOM   2093 C  CG1 B VAL B 1 133 ? 5.953   12.764 42.552 0.50 22.30 ? 129 VAL B CG1 1 
ATOM   2094 C  CG2 A VAL B 1 133 ? 5.375   12.677 42.777 0.50 18.99 ? 129 VAL B CG2 1 
ATOM   2095 C  CG2 B VAL B 1 133 ? 3.953   11.596 41.707 0.50 22.86 ? 129 VAL B CG2 1 
ATOM   2096 N  N   . LYS B 1 134 ? 5.775   11.463 38.337 1.00 21.39 ? 130 LYS B N   1 
ATOM   2097 C  CA  . LYS B 1 134 ? 5.506   10.529 37.215 1.00 21.30 ? 130 LYS B CA  1 
ATOM   2098 C  C   . LYS B 1 134 ? 6.120   9.239  37.733 1.00 21.95 ? 130 LYS B C   1 
ATOM   2099 O  O   . LYS B 1 134 ? 7.311   9.205  38.034 1.00 22.29 ? 130 LYS B O   1 
ATOM   2100 C  CB  . LYS B 1 134 ? 6.157   10.924 35.890 1.00 22.83 ? 130 LYS B CB  1 
ATOM   2101 C  CG  . LYS B 1 134 ? 5.863   9.967  34.728 1.00 26.04 ? 130 LYS B CG  1 
ATOM   2102 C  CD  . LYS B 1 134 ? 6.177   10.697 33.405 1.00 35.90 ? 130 LYS B CD  1 
ATOM   2103 C  CE  . LYS B 1 134 ? 5.983   9.801  32.199 1.00 40.00 ? 130 LYS B CE  1 
ATOM   2104 N  NZ  . LYS B 1 134 ? 6.211   10.551 30.921 1.00 44.43 ? 130 LYS B NZ  1 
ATOM   2105 N  N   . PHE B 1 135 ? 5.317   8.193  37.893 1.00 20.38 ? 131 PHE B N   1 
ATOM   2106 C  CA  . PHE B 1 135 ? 5.857   6.900  38.407 1.00 21.88 ? 131 PHE B CA  1 
ATOM   2107 C  C   . PHE B 1 135 ? 6.637   6.247  37.266 1.00 21.77 ? 131 PHE B C   1 
ATOM   2108 O  O   . PHE B 1 135 ? 6.050   5.727  36.332 1.00 22.13 ? 131 PHE B O   1 
ATOM   2109 C  CB  . PHE B 1 135 ? 4.752   5.993  38.905 1.00 20.94 ? 131 PHE B CB  1 
ATOM   2110 C  CG  . PHE B 1 135 ? 4.020   6.516  40.087 1.00 22.27 ? 131 PHE B CG  1 
ATOM   2111 C  CD1 . PHE B 1 135 ? 4.450   6.218  41.382 1.00 21.86 ? 131 PHE B CD1 1 
ATOM   2112 C  CD2 . PHE B 1 135 ? 2.878   7.315  39.907 1.00 21.46 ? 131 PHE B CD2 1 
ATOM   2113 C  CE1 . PHE B 1 135 ? 3.766   6.725  42.492 1.00 24.02 ? 131 PHE B CE1 1 
ATOM   2114 C  CE2 . PHE B 1 135 ? 2.182   7.799  41.018 1.00 22.94 ? 131 PHE B CE2 1 
ATOM   2115 C  CZ  . PHE B 1 135 ? 2.635   7.498  42.312 1.00 22.27 ? 131 PHE B CZ  1 
ATOM   2116 N  N   . GLU B 1 136 ? 7.974   6.293  37.354 1.00 23.04 ? 132 GLU B N   1 
ATOM   2117 C  CA  A GLU B 1 136 ? 8.844   5.731  36.312 0.50 23.69 ? 132 GLU B CA  1 
ATOM   2118 C  CA  B GLU B 1 136 ? 8.792   5.737  36.282 0.50 22.96 ? 132 GLU B CA  1 
ATOM   2119 C  C   . GLU B 1 136 ? 8.533   4.276  35.977 1.00 22.37 ? 132 GLU B C   1 
ATOM   2120 O  O   . GLU B 1 136 ? 8.527   3.899  34.815 1.00 23.84 ? 132 GLU B O   1 
ATOM   2121 C  CB  A GLU B 1 136 ? 10.342  5.900  36.648 0.50 23.81 ? 132 GLU B CB  1 
ATOM   2122 C  CB  B GLU B 1 136 ? 10.269  6.010  36.502 0.50 23.32 ? 132 GLU B CB  1 
ATOM   2123 C  CG  A GLU B 1 136 ? 10.806  5.186  37.922 0.50 25.74 ? 132 GLU B CG  1 
ATOM   2124 C  CG  B GLU B 1 136 ? 10.591  7.488  36.400 0.50 24.15 ? 132 GLU B CG  1 
ATOM   2125 C  CD  A GLU B 1 136 ? 12.303  5.326  38.239 0.50 26.20 ? 132 GLU B CD  1 
ATOM   2126 C  CD  B GLU B 1 136 ? 11.977  7.813  36.903 0.50 26.85 ? 132 GLU B CD  1 
ATOM   2127 O  OE1 A GLU B 1 136 ? 12.834  6.463  38.263 0.50 28.37 ? 132 GLU B OE1 1 
ATOM   2128 O  OE1 B GLU B 1 136 ? 12.773  6.870  37.107 0.50 29.66 ? 132 GLU B OE1 1 
ATOM   2129 O  OE2 A GLU B 1 136 ? 12.938  4.283  38.514 0.50 28.36 ? 132 GLU B OE2 1 
ATOM   2130 O  OE2 B GLU B 1 136 ? 12.280  9.012  37.079 0.50 27.12 ? 132 GLU B OE2 1 
ATOM   2131 N  N   . GLU B 1 137 ? 8.266   3.486  37.013 1.00 22.65 ? 133 GLU B N   1 
ATOM   2132 C  CA  . GLU B 1 137 ? 7.989   2.057  36.816 1.00 22.28 ? 133 GLU B CA  1 
ATOM   2133 C  C   . GLU B 1 137 ? 6.543   1.719  36.527 1.00 22.24 ? 133 GLU B C   1 
ATOM   2134 O  O   . GLU B 1 137 ? 6.202   0.555  36.384 1.00 22.40 ? 133 GLU B O   1 
ATOM   2135 C  CB  . GLU B 1 137 ? 8.511   1.237  38.010 1.00 23.30 ? 133 GLU B CB  1 
ATOM   2136 C  CG  . GLU B 1 137 ? 9.993   1.425  38.279 1.00 29.38 ? 133 GLU B CG  1 
ATOM   2137 C  CD  . GLU B 1 137 ? 10.866  1.181  37.041 1.00 35.41 ? 133 GLU B CD  1 
ATOM   2138 O  OE1 . GLU B 1 137 ? 10.709  0.133  36.372 1.00 40.77 ? 133 GLU B OE1 1 
ATOM   2139 O  OE2 . GLU B 1 137 ? 11.707  2.065  36.750 1.00 40.00 ? 133 GLU B OE2 1 
ATOM   2140 N  N   . GLY B 1 138 ? 5.693   2.737  36.452 1.00 21.02 ? 134 GLY B N   1 
ATOM   2141 C  CA  . GLY B 1 138 ? 4.284   2.456  36.097 1.00 20.80 ? 134 GLY B CA  1 
ATOM   2142 C  C   . GLY B 1 138 ? 3.349   1.959  37.176 1.00 19.39 ? 134 GLY B C   1 
ATOM   2143 O  O   . GLY B 1 138 ? 3.544   2.203  38.372 1.00 19.25 ? 134 GLY B O   1 
ATOM   2144 N  N   . LEU B 1 139 ? 2.318   1.264  36.718 1.00 19.36 ? 135 LEU B N   1 
ATOM   2145 C  CA  . LEU B 1 139 ? 1.276   0.766  37.581 1.00 18.84 ? 135 LEU B CA  1 
ATOM   2146 C  C   . LEU B 1 139 ? 1.818   -0.323 38.481 1.00 18.84 ? 135 LEU B C   1 
ATOM   2147 O  O   . LEU B 1 139 ? 2.669   -1.127 38.066 1.00 19.11 ? 135 LEU B O   1 
ATOM   2148 C  CB  . LEU B 1 139 ? 0.148   0.160  36.741 1.00 17.60 ? 135 LEU B CB  1 
ATOM   2149 C  CG  . LEU B 1 139 ? -0.497  1.152  35.737 1.00 18.80 ? 135 LEU B CG  1 
ATOM   2150 C  CD1 . LEU B 1 139 ? -1.432  0.413  34.763 1.00 20.30 ? 135 LEU B CD1 1 
ATOM   2151 C  CD2 . LEU B 1 139 ? -1.162  2.357  36.442 1.00 21.69 ? 135 LEU B CD2 1 
ATOM   2152 N  N   . GLY B 1 140 ? 1.284   -0.387 39.690 1.00 19.13 ? 136 GLY B N   1 
ATOM   2153 C  CA  . GLY B 1 140 ? 1.726   -1.456 40.603 1.00 19.54 ? 136 GLY B CA  1 
ATOM   2154 C  C   . GLY B 1 140 ? 1.703   -0.995 42.036 1.00 19.43 ? 136 GLY B C   1 
ATOM   2155 O  O   . GLY B 1 140 ? 1.263   0.121  42.333 1.00 20.97 ? 136 GLY B O   1 
ATOM   2156 N  N   . THR B 1 141 ? 2.173   -1.879 42.907 1.00 18.96 ? 137 THR B N   1 
ATOM   2157 C  CA  . THR B 1 141 ? 2.240   -1.603 44.335 1.00 19.36 ? 137 THR B CA  1 
ATOM   2158 C  C   . THR B 1 141 ? 3.637   -1.100 44.643 1.00 19.63 ? 137 THR B C   1 
ATOM   2159 O  O   . THR B 1 141 ? 4.637   -1.667 44.174 1.00 20.00 ? 137 THR B O   1 
ATOM   2160 C  CB  . THR B 1 141 ? 1.860   -2.868 45.155 1.00 19.08 ? 137 THR B CB  1 
ATOM   2161 O  OG1 . THR B 1 141 ? 0.602   -3.398 44.693 1.00 21.53 ? 137 THR B OG1 1 
ATOM   2162 C  CG2 . THR B 1 141 ? 1.818   -2.552 46.683 1.00 22.14 ? 137 THR B CG2 1 
ATOM   2163 N  N   . TYR B 1 142 ? 3.703   -0.056 45.457 1.00 20.03 ? 138 TYR B N   1 
ATOM   2164 C  CA  . TYR B 1 142 ? 4.982   0.543  45.849 1.00 19.76 ? 138 TYR B CA  1 
ATOM   2165 C  C   . TYR B 1 142 ? 5.239   0.634  47.333 1.00 21.20 ? 138 TYR B C   1 
ATOM   2166 O  O   . TYR B 1 142 ? 4.310   0.774  48.119 1.00 22.00 ? 138 TYR B O   1 
ATOM   2167 C  CB  . TYR B 1 142 ? 5.040   2.021  45.370 1.00 20.04 ? 138 TYR B CB  1 
ATOM   2168 C  CG  . TYR B 1 142 ? 5.205   2.188  43.881 1.00 20.21 ? 138 TYR B CG  1 
ATOM   2169 C  CD1 . TYR B 1 142 ? 4.142   1.944  43.010 1.00 19.23 ? 138 TYR B CD1 1 
ATOM   2170 C  CD2 . TYR B 1 142 ? 6.433   2.538  43.344 1.00 19.80 ? 138 TYR B CD2 1 
ATOM   2171 C  CE1 . TYR B 1 142 ? 4.295   2.081  41.609 1.00 19.88 ? 138 TYR B CE1 1 
ATOM   2172 C  CE2 . TYR B 1 142 ? 6.608   2.677  41.966 1.00 20.52 ? 138 TYR B CE2 1 
ATOM   2173 C  CZ  . TYR B 1 142 ? 5.534   2.459  41.101 1.00 21.94 ? 138 TYR B CZ  1 
ATOM   2174 O  OH  . TYR B 1 142 ? 5.742   2.586  39.750 1.00 19.43 ? 138 TYR B OH  1 
ATOM   2175 N  N   . LYS B 1 143 ? 6.531   0.644  47.675 1.00 21.22 ? 139 LYS B N   1 
ATOM   2176 C  CA  . LYS B 1 143 ? 6.977   0.947  49.025 1.00 21.97 ? 139 LYS B CA  1 
ATOM   2177 C  C   . LYS B 1 143 ? 7.182   2.476  48.845 1.00 22.46 ? 139 LYS B C   1 
ATOM   2178 O  O   . LYS B 1 143 ? 7.834   2.909  47.880 1.00 21.75 ? 139 LYS B O   1 
ATOM   2179 C  CB  . LYS B 1 143 ? 8.288   0.257  49.384 1.00 21.29 ? 139 LYS B CB  1 
ATOM   2180 C  CG  . LYS B 1 143 ? 8.192   -1.243 49.299 1.00 27.73 ? 139 LYS B CG  1 
ATOM   2181 C  CD  . LYS B 1 143 ? 8.898   -1.937 50.438 1.00 32.22 ? 139 LYS B CD  1 
ATOM   2182 C  CE  . LYS B 1 143 ? 8.372   -3.376 50.603 1.00 34.77 ? 139 LYS B CE  1 
ATOM   2183 N  NZ  . LYS B 1 143 ? 8.940   -3.920 51.895 1.00 38.29 ? 139 LYS B NZ  1 
ATOM   2184 N  N   . VAL B 1 144 ? 6.621   3.284  49.746 1.00 22.43 ? 140 VAL B N   1 
ATOM   2185 C  CA  . VAL B 1 144 ? 6.757   4.753  49.671 1.00 22.63 ? 140 VAL B CA  1 
ATOM   2186 C  C   . VAL B 1 144 ? 7.369   5.189  51.006 1.00 23.02 ? 140 VAL B C   1 
ATOM   2187 O  O   . VAL B 1 144 ? 6.795   4.930  52.054 1.00 23.97 ? 140 VAL B O   1 
ATOM   2188 C  CB  . VAL B 1 144 ? 5.409   5.448  49.460 1.00 23.31 ? 140 VAL B CB  1 
ATOM   2189 C  CG1 . VAL B 1 144 ? 5.565   6.985  49.521 1.00 24.17 ? 140 VAL B CG1 1 
ATOM   2190 C  CG2 . VAL B 1 144 ? 4.809   5.031  48.107 1.00 23.19 ? 140 VAL B CG2 1 
ATOM   2191 N  N   . ARG B 1 145 ? 8.527   5.827  50.924 1.00 22.68 ? 141 ARG B N   1 
ATOM   2192 C  CA  . ARG B 1 145 ? 9.285   6.271  52.117 1.00 24.30 ? 141 ARG B CA  1 
ATOM   2193 C  C   . ARG B 1 145 ? 9.556   7.761  52.061 1.00 23.76 ? 141 ARG B C   1 
ATOM   2194 O  O   . ARG B 1 145 ? 10.202  8.221  51.123 1.00 23.94 ? 141 ARG B O   1 
ATOM   2195 C  CB  . ARG B 1 145 ? 10.639  5.537  52.159 1.00 24.08 ? 141 ARG B CB  1 
ATOM   2196 C  CG  . ARG B 1 145 ? 11.627  5.943  53.274 1.00 27.49 ? 141 ARG B CG  1 
ATOM   2197 C  CD  . ARG B 1 145 ? 12.979  5.244  53.049 1.00 27.22 ? 141 ARG B CD  1 
ATOM   2198 N  NE  . ARG B 1 145 ? 13.969  5.505  54.103 1.00 32.01 ? 141 ARG B NE  1 
ATOM   2199 C  CZ  . ARG B 1 145 ? 14.246  4.669  55.107 1.00 32.50 ? 141 ARG B CZ  1 
ATOM   2200 N  NH1 . ARG B 1 145 ? 13.605  3.502  55.222 1.00 34.43 ? 141 ARG B NH1 1 
ATOM   2201 N  NH2 . ARG B 1 145 ? 15.169  4.992  56.011 1.00 34.86 ? 141 ARG B NH2 1 
ATOM   2202 N  N   . PHE B 1 146 ? 9.089   8.502  53.073 1.00 23.86 ? 142 PHE B N   1 
ATOM   2203 C  CA  . PHE B 1 146 ? 9.394   9.928  53.176 1.00 22.45 ? 142 PHE B CA  1 
ATOM   2204 C  C   . PHE B 1 146 ? 10.556  10.080 54.152 1.00 22.62 ? 142 PHE B C   1 
ATOM   2205 O  O   . PHE B 1 146 ? 10.521  9.520  55.247 1.00 22.22 ? 142 PHE B O   1 
ATOM   2206 C  CB  . PHE B 1 146 ? 8.236   10.781 53.751 1.00 23.08 ? 142 PHE B CB  1 
ATOM   2207 C  CG  . PHE B 1 146 ? 7.025   10.930 52.829 1.00 23.35 ? 142 PHE B CG  1 
ATOM   2208 C  CD1 . PHE B 1 146 ? 7.007   10.404 51.536 1.00 22.43 ? 142 PHE B CD1 1 
ATOM   2209 C  CD2 . PHE B 1 146 ? 5.885   11.564 53.309 1.00 22.63 ? 142 PHE B CD2 1 
ATOM   2210 C  CE1 . PHE B 1 146 ? 5.876   10.568 50.706 1.00 24.07 ? 142 PHE B CE1 1 
ATOM   2211 C  CE2 . PHE B 1 146 ? 4.751   11.732 52.500 1.00 23.53 ? 142 PHE B CE2 1 
ATOM   2212 C  CZ  . PHE B 1 146 ? 4.749   11.215 51.197 1.00 23.24 ? 142 PHE B CZ  1 
ATOM   2213 N  N   . GLU B 1 147 ? 11.572  10.845 53.751 1.00 22.47 ? 143 GLU B N   1 
ATOM   2214 C  CA  . GLU B 1 147 ? 12.714  11.157 54.623 1.00 22.46 ? 143 GLU B CA  1 
ATOM   2215 C  C   . GLU B 1 147 ? 12.592  12.647 54.877 1.00 21.73 ? 143 GLU B C   1 
ATOM   2216 O  O   . GLU B 1 147 ? 12.504  13.438 53.940 1.00 20.88 ? 143 GLU B O   1 
ATOM   2217 C  CB  . GLU B 1 147 ? 14.075  10.724 54.055 1.00 23.01 ? 143 GLU B CB  1 
ATOM   2218 C  CG  . GLU B 1 147 ? 14.192  9.192  54.040 1.00 25.13 ? 143 GLU B CG  1 
ATOM   2219 C  CD  . GLU B 1 147 ? 15.579  8.664  53.704 1.00 24.91 ? 143 GLU B CD  1 
ATOM   2220 O  OE1 . GLU B 1 147 ? 16.531  9.462  53.579 1.00 29.17 ? 143 GLU B OE1 1 
ATOM   2221 O  OE2 . GLU B 1 147 ? 15.711  7.421  53.562 1.00 28.90 ? 143 GLU B OE2 1 
ATOM   2222 N  N   . ILE B 1 148 ? 12.549  12.994 56.164 1.00 21.83 ? 144 ILE B N   1 
ATOM   2223 C  CA  . ILE B 1 148 ? 12.346  14.372 56.568 1.00 21.55 ? 144 ILE B CA  1 
ATOM   2224 C  C   . ILE B 1 148 ? 13.535  14.871 57.381 1.00 22.62 ? 144 ILE B C   1 
ATOM   2225 O  O   . ILE B 1 148 ? 13.743  14.425 58.521 1.00 21.54 ? 144 ILE B O   1 
ATOM   2226 C  CB  . ILE B 1 148 ? 11.030  14.469 57.375 1.00 21.32 ? 144 ILE B CB  1 
ATOM   2227 C  CG1 . ILE B 1 148 ? 9.835   13.886 56.581 1.00 21.80 ? 144 ILE B CG1 1 
ATOM   2228 C  CG2 . ILE B 1 148 ? 10.751  15.907 57.771 1.00 20.91 ? 144 ILE B CG2 1 
ATOM   2229 C  CD1 . ILE B 1 148 ? 8.758   13.385 57.491 1.00 21.55 ? 144 ILE B CD1 1 
ATOM   2230 N  N   . ALA B 1 149 ? 14.318  15.759 56.761 1.00 21.62 ? 145 ALA B N   1 
ATOM   2231 C  CA  . ALA B 1 149 ? 15.498  16.345 57.404 1.00 22.43 ? 145 ALA B CA  1 
ATOM   2232 C  C   . ALA B 1 149 ? 15.108  17.645 58.057 1.00 22.19 ? 145 ALA B C   1 
ATOM   2233 O  O   . ALA B 1 149 ? 14.252  18.390 57.561 1.00 21.84 ? 145 ALA B O   1 
ATOM   2234 C  CB  . ALA B 1 149 ? 16.641  16.586 56.387 1.00 21.58 ? 145 ALA B CB  1 
ATOM   2235 N  N   . ALA B 1 150 ? 15.784  17.925 59.166 1.00 22.32 ? 146 ALA B N   1 
ATOM   2236 C  CA  . ALA B 1 150 ? 15.574  19.149 59.898 1.00 21.63 ? 146 ALA B CA  1 
ATOM   2237 C  C   . ALA B 1 150 ? 16.104  20.312 59.059 1.00 22.72 ? 146 ALA B C   1 
ATOM   2238 O  O   . ALA B 1 150 ? 16.832  20.093 58.065 1.00 21.91 ? 146 ALA B O   1 
ATOM   2239 C  CB  . ALA B 1 150 ? 16.328  19.077 61.251 1.00 22.22 ? 146 ALA B CB  1 
ATOM   2240 N  N   . PRO B 1 151 ? 15.756  21.550 59.443 1.00 23.48 ? 147 PRO B N   1 
ATOM   2241 C  CA  . PRO B 1 151 ? 16.340  22.665 58.693 1.00 24.56 ? 147 PRO B CA  1 
ATOM   2242 C  C   . PRO B 1 151 ? 17.889  22.625 58.642 1.00 25.56 ? 147 PRO B C   1 
ATOM   2243 O  O   . PRO B 1 151 ? 18.545  22.089 59.555 1.00 25.46 ? 147 PRO B O   1 
ATOM   2244 C  CB  . PRO B 1 151 ? 15.843  23.907 59.462 1.00 24.59 ? 147 PRO B CB  1 
ATOM   2245 C  CG  . PRO B 1 151 ? 14.589  23.444 60.159 1.00 24.65 ? 147 PRO B CG  1 
ATOM   2246 C  CD  . PRO B 1 151 ? 14.877  22.009 60.545 1.00 22.66 ? 147 PRO B CD  1 
ATOM   2247 N  N   . SER B 1 152 ? 18.470  23.176 57.574 1.00 27.71 ? 148 SER B N   1 
ATOM   2248 C  CA  . SER B 1 152 ? 19.925  23.244 57.463 1.00 28.99 ? 148 SER B CA  1 
ATOM   2249 C  C   . SER B 1 152 ? 20.429  24.141 58.609 1.00 29.04 ? 148 SER B C   1 
ATOM   2250 O  O   . SER B 1 152 ? 19.697  25.015 59.084 1.00 27.74 ? 148 SER B O   1 
ATOM   2251 C  CB  . SER B 1 152 ? 20.337  23.840 56.117 1.00 29.55 ? 148 SER B CB  1 
ATOM   2252 O  OG  . SER B 1 152 ? 19.694  23.151 55.041 1.00 33.48 ? 148 SER B OG  1 
ATOM   2253 N  N   . HIS B 1 153 ? 21.659  23.917 59.058 1.00 30.21 ? 149 HIS B N   1 
ATOM   2254 C  CA  . HIS B 1 153 ? 22.223  24.706 60.159 1.00 32.29 ? 149 HIS B CA  1 
ATOM   2255 C  C   . HIS B 1 153 ? 22.153  26.219 59.985 1.00 31.85 ? 149 HIS B C   1 
ATOM   2256 O  O   . HIS B 1 153 ? 21.961  26.951 60.959 1.00 32.09 ? 149 HIS B O   1 
ATOM   2257 C  CB  . HIS B 1 153 ? 23.668  24.267 60.437 1.00 33.51 ? 149 HIS B CB  1 
ATOM   2258 C  CG  . HIS B 1 153 ? 23.850  23.593 61.764 1.00 37.02 ? 149 HIS B CG  1 
ATOM   2259 N  ND1 . HIS B 1 153 ? 24.830  23.969 62.662 1.00 39.61 ? 149 HIS B ND1 1 
ATOM   2260 C  CD2 . HIS B 1 153 ? 23.163  22.582 62.353 1.00 38.68 ? 149 HIS B CD2 1 
ATOM   2261 C  CE1 . HIS B 1 153 ? 24.742  23.216 63.746 1.00 41.53 ? 149 HIS B CE1 1 
ATOM   2262 N  NE2 . HIS B 1 153 ? 23.739  22.367 63.583 1.00 41.07 ? 149 HIS B NE2 1 
ATOM   2263 N  N   . ASP B 1 154 ? 22.316  26.693 58.756 1.00 31.17 ? 150 ASP B N   1 
ATOM   2264 C  CA  . ASP B 1 154 ? 22.305  28.144 58.499 1.00 32.34 ? 150 ASP B CA  1 
ATOM   2265 C  C   . ASP B 1 154 ? 20.925  28.707 58.151 1.00 31.15 ? 150 ASP B C   1 
ATOM   2266 O  O   . ASP B 1 154 ? 20.805  29.895 57.823 1.00 32.09 ? 150 ASP B O   1 
ATOM   2267 C  CB  . ASP B 1 154 ? 23.305  28.494 57.365 1.00 32.47 ? 150 ASP B CB  1 
ATOM   2268 C  CG  . ASP B 1 154 ? 22.995  27.782 56.029 1.00 36.96 ? 150 ASP B CG  1 
ATOM   2269 O  OD1 . ASP B 1 154 ? 22.163  26.825 55.983 1.00 37.92 ? 150 ASP B OD1 1 
ATOM   2270 O  OD2 . ASP B 1 154 ? 23.619  28.180 55.005 1.00 38.57 ? 150 ASP B OD2 1 
ATOM   2271 N  N   . GLU B 1 155 ? 19.902  27.867 58.249 1.00 29.52 ? 151 GLU B N   1 
ATOM   2272 C  CA  . GLU B 1 155 ? 18.540  28.250 57.864 1.00 30.01 ? 151 GLU B CA  1 
ATOM   2273 C  C   . GLU B 1 155 ? 17.527  28.430 58.989 1.00 28.45 ? 151 GLU B C   1 
ATOM   2274 O  O   . GLU B 1 155 ? 16.412  28.921 58.748 1.00 29.67 ? 151 GLU B O   1 
ATOM   2275 C  CB  . GLU B 1 155 ? 17.986  27.255 56.851 1.00 31.25 ? 151 GLU B CB  1 
ATOM   2276 C  CG  . GLU B 1 155 ? 18.635  27.366 55.464 1.00 36.50 ? 151 GLU B CG  1 
ATOM   2277 C  CD  . GLU B 1 155 ? 18.365  26.152 54.584 1.00 44.18 ? 151 GLU B CD  1 
ATOM   2278 O  OE1 . GLU B 1 155 ? 17.919  25.096 55.115 1.00 46.66 ? 151 GLU B OE1 1 
ATOM   2279 O  OE2 . GLU B 1 155 ? 18.610  26.240 53.354 1.00 48.21 ? 151 GLU B OE2 1 
ATOM   2280 N  N   . TYR B 1 156 ? 17.887  28.025 60.197 1.00 26.34 ? 152 TYR B N   1 
ATOM   2281 C  CA  . TYR B 1 156 ? 16.949  28.146 61.315 1.00 23.83 ? 152 TYR B CA  1 
ATOM   2282 C  C   . TYR B 1 156 ? 17.679  28.082 62.654 1.00 23.20 ? 152 TYR B C   1 
ATOM   2283 O  O   . TYR B 1 156 ? 18.744  27.494 62.746 1.00 22.69 ? 152 TYR B O   1 
ATOM   2284 C  CB  . TYR B 1 156 ? 15.921  27.012 61.223 1.00 23.89 ? 152 TYR B CB  1 
ATOM   2285 C  CG  . TYR B 1 156 ? 14.561  27.369 61.737 1.00 21.79 ? 152 TYR B CG  1 
ATOM   2286 C  CD1 . TYR B 1 156 ? 13.669  28.063 60.939 1.00 24.27 ? 152 TYR B CD1 1 
ATOM   2287 C  CD2 . TYR B 1 156 ? 14.162  26.998 63.031 1.00 23.14 ? 152 TYR B CD2 1 
ATOM   2288 C  CE1 . TYR B 1 156 ? 12.434  28.415 61.407 1.00 24.83 ? 152 TYR B CE1 1 
ATOM   2289 C  CE2 . TYR B 1 156 ? 12.871  27.330 63.523 1.00 23.10 ? 152 TYR B CE2 1 
ATOM   2290 C  CZ  . TYR B 1 156 ? 12.024  28.042 62.675 1.00 25.86 ? 152 TYR B CZ  1 
ATOM   2291 O  OH  . TYR B 1 156 ? 10.764  28.408 63.037 1.00 25.15 ? 152 TYR B OH  1 
ATOM   2292 N  N   . SER B 1 157 ? 17.115  28.679 63.699 1.00 21.67 ? 153 SER B N   1 
ATOM   2293 C  CA  . SER B 1 157 ? 17.741  28.630 64.994 1.00 20.97 ? 153 SER B CA  1 
ATOM   2294 C  C   . SER B 1 157 ? 16.686  28.448 66.076 1.00 21.29 ? 153 SER B C   1 
ATOM   2295 O  O   . SER B 1 157 ? 15.468  28.614 65.833 1.00 20.84 ? 153 SER B O   1 
ATOM   2296 C  CB  . SER B 1 157 ? 18.547  29.906 65.296 1.00 20.93 ? 153 SER B CB  1 
ATOM   2297 O  OG  . SER B 1 157 ? 19.561  30.138 64.323 1.00 23.44 ? 153 SER B OG  1 
ATOM   2298 N  N   . LEU B 1 158 ? 17.163  28.062 67.243 1.00 19.57 ? 154 LEU B N   1 
ATOM   2299 C  CA  . LEU B 1 158 ? 16.304  27.898 68.418 1.00 20.22 ? 154 LEU B CA  1 
ATOM   2300 C  C   . LEU B 1 158 ? 16.842  28.762 69.525 1.00 19.54 ? 154 LEU B C   1 
ATOM   2301 O  O   . LEU B 1 158 ? 18.066  28.827 69.729 1.00 18.69 ? 154 LEU B O   1 
ATOM   2302 C  CB  . LEU B 1 158 ? 16.290  26.448 68.911 1.00 20.21 ? 154 LEU B CB  1 
ATOM   2303 C  CG  . LEU B 1 158 ? 15.775  25.399 67.916 1.00 19.89 ? 154 LEU B CG  1 
ATOM   2304 C  CD1 . LEU B 1 158 ? 15.974  23.960 68.502 1.00 21.96 ? 154 LEU B CD1 1 
ATOM   2305 C  CD2 . LEU B 1 158 ? 14.321  25.653 67.534 1.00 21.99 ? 154 LEU B CD2 1 
ATOM   2306 N  N   . HIS B 1 159 ? 15.952  29.409 70.282 1.00 19.54 ? 155 HIS B N   1 
ATOM   2307 C  CA  . HIS B 1 159 ? 16.354  30.184 71.467 1.00 21.40 ? 155 HIS B CA  1 
ATOM   2308 C  C   . HIS B 1 159 ? 16.616  29.087 72.495 1.00 22.50 ? 155 HIS B C   1 
ATOM   2309 O  O   . HIS B 1 159 ? 15.745  28.247 72.744 1.00 22.64 ? 155 HIS B O   1 
ATOM   2310 C  CB  . HIS B 1 159 ? 15.200  31.047 71.961 1.00 21.81 ? 155 HIS B CB  1 
ATOM   2311 C  CG  . HIS B 1 159 ? 14.941  32.252 71.127 1.00 23.04 ? 155 HIS B CG  1 
ATOM   2312 N  ND1 . HIS B 1 159 ? 14.324  33.383 71.631 1.00 25.17 ? 155 HIS B ND1 1 
ATOM   2313 C  CD2 . HIS B 1 159 ? 15.227  32.520 69.829 1.00 24.65 ? 155 HIS B CD2 1 
ATOM   2314 C  CE1 . HIS B 1 159 ? 14.210  34.278 70.665 1.00 24.78 ? 155 HIS B CE1 1 
ATOM   2315 N  NE2 . HIS B 1 159 ? 14.766  33.789 69.570 1.00 26.73 ? 155 HIS B NE2 1 
ATOM   2316 N  N   . ILE B 1 160 ? 17.805  29.098 73.104 1.00 22.90 ? 156 ILE B N   1 
ATOM   2317 C  CA  . ILE B 1 160 ? 18.166  28.047 74.069 1.00 26.39 ? 156 ILE B CA  1 
ATOM   2318 C  C   . ILE B 1 160 ? 18.546  28.504 75.481 1.00 26.61 ? 156 ILE B C   1 
ATOM   2319 O  O   . ILE B 1 160 ? 19.145  27.737 76.257 1.00 26.60 ? 156 ILE B O   1 
ATOM   2320 C  CB  . ILE B 1 160 ? 19.256  27.077 73.487 1.00 26.06 ? 156 ILE B CB  1 
ATOM   2321 C  CG1 . ILE B 1 160 ? 20.593  27.811 73.311 1.00 27.25 ? 156 ILE B CG1 1 
ATOM   2322 C  CG2 . ILE B 1 160 ? 18.786  26.435 72.173 1.00 27.75 ? 156 ILE B CG2 1 
ATOM   2323 C  CD1 . ILE B 1 160 ? 21.815  26.892 73.207 1.00 27.18 ? 156 ILE B CD1 1 
ATOM   2324 N  N   . ASP B 1 161 ? 18.198  29.740 75.836 1.00 27.95 ? 157 ASP B N   1 
ATOM   2325 C  CA  . ASP B 1 161 ? 18.491  30.229 77.196 1.00 30.64 ? 157 ASP B CA  1 
ATOM   2326 C  C   . ASP B 1 161 ? 17.834  29.299 78.209 1.00 32.65 ? 157 ASP B C   1 
ATOM   2327 O  O   . ASP B 1 161 ? 16.747  28.750 77.955 1.00 32.21 ? 157 ASP B O   1 
ATOM   2328 C  CB  . ASP B 1 161 ? 17.964  31.643 77.404 1.00 30.32 ? 157 ASP B CB  1 
ATOM   2329 C  CG  . ASP B 1 161 ? 18.484  32.587 76.384 1.00 29.88 ? 157 ASP B CG  1 
ATOM   2330 O  OD1 . ASP B 1 161 ? 17.858  32.683 75.309 1.00 31.24 ? 157 ASP B OD1 1 
ATOM   2331 O  OD2 . ASP B 1 161 ? 19.547  33.165 76.627 1.00 32.53 ? 157 ASP B OD2 1 
ATOM   2332 N  N   . GLU B 1 162 ? 18.508  29.120 79.348 1.00 35.17 ? 158 GLU B N   1 
ATOM   2333 C  CA  . GLU B 1 162 ? 18.016  28.261 80.425 1.00 38.17 ? 158 GLU B CA  1 
ATOM   2334 C  C   . GLU B 1 162 ? 16.685  28.792 80.935 1.00 38.60 ? 158 GLU B C   1 
ATOM   2335 O  O   . GLU B 1 162 ? 16.532  30.002 81.138 1.00 39.03 ? 158 GLU B O   1 
ATOM   2336 C  CB  . GLU B 1 162 ? 19.015  28.242 81.592 1.00 38.14 ? 158 GLU B CB  1 
ATOM   2337 C  CG  . GLU B 1 162 ? 20.295  27.478 81.312 1.00 40.30 ? 158 GLU B CG  1 
ATOM   2338 C  CD  . GLU B 1 162 ? 21.231  27.433 82.523 1.00 40.96 ? 158 GLU B CD  1 
ATOM   2339 O  OE1 . GLU B 1 162 ? 21.135  28.315 83.414 1.00 44.64 ? 158 GLU B OE1 1 
ATOM   2340 O  OE2 . GLU B 1 162 ? 22.073  26.506 82.581 1.00 45.34 ? 158 GLU B OE2 1 
ATOM   2341 N  N   . GLN B 1 163 ? 15.728  27.882 81.129 1.00 39.58 ? 159 GLN B N   1 
ATOM   2342 C  CA  . GLN B 1 163 ? 14.380  28.214 81.647 1.00 40.01 ? 159 GLN B CA  1 
ATOM   2343 C  C   . GLN B 1 163 ? 13.477  28.933 80.661 1.00 39.07 ? 159 GLN B C   1 
ATOM   2344 O  O   . GLN B 1 163 ? 12.326  28.517 80.479 1.00 39.85 ? 159 GLN B O   1 
ATOM   2345 C  CB  . GLN B 1 163 ? 14.439  29.029 82.946 1.00 40.40 ? 159 GLN B CB  1 
ATOM   2346 C  CG  . GLN B 1 163 ? 15.094  28.326 84.113 1.00 43.45 ? 159 GLN B CG  1 
ATOM   2347 C  CD  . GLN B 1 163 ? 15.931  29.286 84.919 1.00 47.37 ? 159 GLN B CD  1 
ATOM   2348 O  OE1 . GLN B 1 163 ? 17.126  29.456 84.651 1.00 49.93 ? 159 GLN B OE1 1 
ATOM   2349 N  NE2 . GLN B 1 163 ? 15.307  29.952 85.896 1.00 49.00 ? 159 GLN B NE2 1 
ATOM   2350 N  N   . THR B 1 164 ? 13.988  29.998 80.029 1.00 37.45 ? 160 THR B N   1 
ATOM   2351 C  CA  . THR B 1 164 ? 13.199  30.775 79.059 1.00 35.35 ? 160 THR B CA  1 
ATOM   2352 C  C   . THR B 1 164 ? 13.165  30.226 77.607 1.00 34.21 ? 160 THR B C   1 
ATOM   2353 O  O   . THR B 1 164 ? 12.188  30.459 76.895 1.00 34.06 ? 160 THR B O   1 
ATOM   2354 C  CB  . THR B 1 164 ? 13.632  32.256 79.018 1.00 35.41 ? 160 THR B CB  1 
ATOM   2355 O  OG1 . THR B 1 164 ? 14.985  32.333 78.556 1.00 36.52 ? 160 THR B OG1 1 
ATOM   2356 C  CG2 . THR B 1 164 ? 13.538  32.906 80.412 1.00 35.75 ? 160 THR B CG2 1 
ATOM   2357 N  N   . GLY B 1 165 ? 14.215  29.522 77.172 1.00 32.34 ? 161 GLY B N   1 
ATOM   2358 C  CA  . GLY B 1 165 ? 14.267  28.982 75.802 1.00 30.92 ? 161 GLY B CA  1 
ATOM   2359 C  C   . GLY B 1 165 ? 13.635  27.606 75.685 1.00 30.39 ? 161 GLY B C   1 
ATOM   2360 O  O   . GLY B 1 165 ? 13.060  27.108 76.652 1.00 30.08 ? 161 GLY B O   1 
ATOM   2361 N  N   . VAL B 1 166 ? 13.756  26.988 74.509 1.00 28.36 ? 162 VAL B N   1 
ATOM   2362 C  CA  . VAL B 1 166 ? 13.195  25.646 74.279 1.00 29.13 ? 162 VAL B CA  1 
ATOM   2363 C  C   . VAL B 1 166 ? 14.167  24.559 74.749 1.00 28.48 ? 162 VAL B C   1 
ATOM   2364 O  O   . VAL B 1 166 ? 15.384  24.767 74.748 1.00 29.15 ? 162 VAL B O   1 
ATOM   2365 C  CB  . VAL B 1 166 ? 12.768  25.402 72.802 1.00 28.94 ? 162 VAL B CB  1 
ATOM   2366 C  CG1 . VAL B 1 166 ? 11.841  26.529 72.292 1.00 29.66 ? 162 VAL B CG1 1 
ATOM   2367 C  CG2 . VAL B 1 166 ? 13.990  25.212 71.878 1.00 29.43 ? 162 VAL B CG2 1 
ATOM   2368 N  N   . SER B 1 167 ? 13.633  23.404 75.154 1.00 29.07 ? 163 SER B N   1 
ATOM   2369 C  CA  . SER B 1 167 ? 14.484  22.306 75.649 1.00 28.74 ? 163 SER B CA  1 
ATOM   2370 C  C   . SER B 1 167 ? 14.858  21.313 74.563 1.00 28.25 ? 163 SER B C   1 
ATOM   2371 O  O   . SER B 1 167 ? 15.923  20.699 74.625 1.00 27.68 ? 163 SER B O   1 
ATOM   2372 C  CB  . SER B 1 167 ? 13.818  21.567 76.820 1.00 29.43 ? 163 SER B CB  1 
ATOM   2373 O  OG  . SER B 1 167 ? 12.574  21.010 76.437 1.00 30.02 ? 163 SER B OG  1 
ATOM   2374 N  N   . GLY B 1 168 ? 13.992  21.186 73.561 1.00 27.44 ? 164 GLY B N   1 
ATOM   2375 C  CA  . GLY B 1 168 ? 14.219  20.255 72.458 1.00 26.75 ? 164 GLY B CA  1 
ATOM   2376 C  C   . GLY B 1 168 ? 15.263  20.760 71.471 1.00 25.96 ? 164 GLY B C   1 
ATOM   2377 O  O   . GLY B 1 168 ? 15.611  21.951 71.447 1.00 24.96 ? 164 GLY B O   1 
ATOM   2378 N  N   . ARG B 1 169 ? 15.774  19.834 70.670 1.00 25.14 ? 165 ARG B N   1 
ATOM   2379 C  CA  . ARG B 1 169 ? 16.756  20.161 69.652 1.00 24.70 ? 165 ARG B CA  1 
ATOM   2380 C  C   . ARG B 1 169 ? 16.317  19.442 68.384 1.00 24.22 ? 165 ARG B C   1 
ATOM   2381 O  O   . ARG B 1 169 ? 15.575  18.436 68.436 1.00 24.09 ? 165 ARG B O   1 
ATOM   2382 C  CB  . ARG B 1 169 ? 18.166  19.707 70.053 1.00 24.68 ? 165 ARG B CB  1 
ATOM   2383 C  CG  . ARG B 1 169 ? 18.718  20.341 71.323 1.00 25.23 ? 165 ARG B CG  1 
ATOM   2384 C  CD  . ARG B 1 169 ? 18.989  21.832 71.147 1.00 27.00 ? 165 ARG B CD  1 
ATOM   2385 N  NE  . ARG B 1 169 ? 19.558  22.439 72.368 1.00 25.93 ? 165 ARG B NE  1 
ATOM   2386 C  CZ  . ARG B 1 169 ? 18.846  23.042 73.318 1.00 26.78 ? 165 ARG B CZ  1 
ATOM   2387 N  NH1 . ARG B 1 169 ? 17.522  23.134 73.223 1.00 25.43 ? 165 ARG B NH1 1 
ATOM   2388 N  NH2 . ARG B 1 169 ? 19.461  23.570 74.369 1.00 29.82 ? 165 ARG B NH2 1 
ATOM   2389 N  N   . PHE B 1 170 ? 16.733  19.962 67.234 1.00 23.28 ? 166 PHE B N   1 
ATOM   2390 C  CA  . PHE B 1 170 ? 16.347  19.299 65.989 1.00 22.64 ? 166 PHE B CA  1 
ATOM   2391 C  C   . PHE B 1 170 ? 17.048  17.956 65.884 1.00 22.80 ? 166 PHE B C   1 
ATOM   2392 O  O   . PHE B 1 170 ? 18.129  17.746 66.420 1.00 21.69 ? 166 PHE B O   1 
ATOM   2393 C  CB  . PHE B 1 170 ? 16.661  20.151 64.784 1.00 22.86 ? 166 PHE B CB  1 
ATOM   2394 C  CG  . PHE B 1 170 ? 15.671  21.236 64.557 1.00 24.31 ? 166 PHE B CG  1 
ATOM   2395 C  CD1 . PHE B 1 170 ? 14.391  20.948 64.071 1.00 25.05 ? 166 PHE B CD1 1 
ATOM   2396 C  CD2 . PHE B 1 170 ? 16.008  22.550 64.846 1.00 25.21 ? 166 PHE B CD2 1 
ATOM   2397 C  CE1 . PHE B 1 170 ? 13.460  21.985 63.861 1.00 25.53 ? 166 PHE B CE1 1 
ATOM   2398 C  CE2 . PHE B 1 170 ? 15.097  23.579 64.649 1.00 24.71 ? 166 PHE B CE2 1 
ATOM   2399 C  CZ  . PHE B 1 170 ? 13.827  23.299 64.168 1.00 22.80 ? 166 PHE B CZ  1 
ATOM   2400 N  N   . TRP B 1 171 ? 16.378  17.033 65.216 1.00 21.97 ? 167 TRP B N   1 
ATOM   2401 C  CA  . TRP B 1 171 ? 16.887  15.703 64.986 1.00 23.12 ? 167 TRP B CA  1 
ATOM   2402 C  C   . TRP B 1 171 ? 18.038  15.736 63.990 1.00 24.78 ? 167 TRP B C   1 
ATOM   2403 O  O   . TRP B 1 171 ? 18.042  16.548 63.043 1.00 25.52 ? 167 TRP B O   1 
ATOM   2404 C  CB  . TRP B 1 171 ? 15.770  14.787 64.470 1.00 21.41 ? 167 TRP B CB  1 
ATOM   2405 C  CG  . TRP B 1 171 ? 15.069  15.297 63.248 1.00 22.30 ? 167 TRP B CG  1 
ATOM   2406 C  CD1 . TRP B 1 171 ? 15.319  14.949 61.964 1.00 20.30 ? 167 TRP B CD1 1 
ATOM   2407 C  CD2 . TRP B 1 171 ? 14.005  16.261 63.214 1.00 22.16 ? 167 TRP B CD2 1 
ATOM   2408 N  NE1 . TRP B 1 171 ? 14.458  15.630 61.110 1.00 21.81 ? 167 TRP B NE1 1 
ATOM   2409 C  CE2 . TRP B 1 171 ? 13.652  16.444 61.860 1.00 21.51 ? 167 TRP B CE2 1 
ATOM   2410 C  CE3 . TRP B 1 171 ? 13.323  16.995 64.201 1.00 22.73 ? 167 TRP B CE3 1 
ATOM   2411 C  CZ2 . TRP B 1 171 ? 12.638  17.339 61.463 1.00 21.82 ? 167 TRP B CZ2 1 
ATOM   2412 C  CZ3 . TRP B 1 171 ? 12.308  17.862 63.807 1.00 22.54 ? 167 TRP B CZ3 1 
ATOM   2413 C  CH2 . TRP B 1 171 ? 11.982  18.028 62.442 1.00 21.35 ? 167 TRP B CH2 1 
ATOM   2414 N  N   . SER B 1 172 ? 18.993  14.827 64.197 1.00 26.30 ? 168 SER B N   1 
ATOM   2415 C  CA  . SER B 1 172 ? 20.186  14.741 63.369 1.00 29.01 ? 168 SER B CA  1 
ATOM   2416 C  C   . SER B 1 172 ? 20.070  13.948 62.109 1.00 29.72 ? 168 SER B C   1 
ATOM   2417 O  O   . SER B 1 172 ? 20.506  14.409 61.048 1.00 32.79 ? 168 SER B O   1 
ATOM   2418 C  CB  . SER B 1 172 ? 21.360  14.196 64.173 1.00 29.80 ? 168 SER B CB  1 
ATOM   2419 O  OG  . SER B 1 172 ? 22.546  14.682 63.582 1.00 34.16 ? 168 SER B OG  1 
ATOM   2420 N  N   . GLU B 1 173 ? 19.505  12.750 62.209 1.00 29.38 ? 169 GLU B N   1 
ATOM   2421 C  CA  . GLU B 1 173 ? 19.316  11.942 61.021 1.00 29.03 ? 169 GLU B CA  1 
ATOM   2422 C  C   . GLU B 1 173 ? 17.862  12.129 60.609 1.00 27.37 ? 169 GLU B C   1 
ATOM   2423 O  O   . GLU B 1 173 ? 16.989  12.287 61.453 1.00 26.12 ? 169 GLU B O   1 
ATOM   2424 C  CB  . GLU B 1 173 ? 19.640  10.470 61.270 1.00 30.44 ? 169 GLU B CB  1 
ATOM   2425 C  CG  . GLU B 1 173 ? 21.133  10.213 61.493 1.00 34.31 ? 169 GLU B CG  1 
ATOM   2426 C  CD  . GLU B 1 173 ? 21.648  9.049  60.655 1.00 39.68 ? 169 GLU B CD  1 
ATOM   2427 O  OE1 . GLU B 1 173 ? 21.198  8.907  59.487 1.00 42.70 ? 169 GLU B OE1 1 
ATOM   2428 O  OE2 . GLU B 1 173 ? 22.507  8.279  61.162 1.00 43.19 ? 169 GLU B OE2 1 
ATOM   2429 N  N   . PRO B 1 174 ? 17.599  12.143 59.302 1.00 26.97 ? 170 PRO B N   1 
ATOM   2430 C  CA  . PRO B 1 174 ? 16.205  12.341 58.864 1.00 25.66 ? 170 PRO B CA  1 
ATOM   2431 C  C   . PRO B 1 174 ? 15.185  11.378 59.477 1.00 25.24 ? 170 PRO B C   1 
ATOM   2432 O  O   . PRO B 1 174 ? 15.487  10.185 59.683 1.00 25.43 ? 170 PRO B O   1 
ATOM   2433 C  CB  . PRO B 1 174 ? 16.288  12.150 57.343 1.00 26.64 ? 170 PRO B CB  1 
ATOM   2434 C  CG  . PRO B 1 174 ? 17.689  12.629 57.027 1.00 27.97 ? 170 PRO B CG  1 
ATOM   2435 C  CD  . PRO B 1 174 ? 18.526  12.054 58.164 1.00 27.01 ? 170 PRO B CD  1 
ATOM   2436 N  N   . LEU B 1 175 ? 14.005  11.913 59.795 1.00 23.65 ? 171 LEU B N   1 
ATOM   2437 C  CA  . LEU B 1 175 ? 12.902  11.135 60.328 1.00 22.87 ? 171 LEU B CA  1 
ATOM   2438 C  C   . LEU B 1 175 ? 12.280  10.399 59.145 1.00 22.85 ? 171 LEU B C   1 
ATOM   2439 O  O   . LEU B 1 175 ? 12.328  10.871 58.023 1.00 23.81 ? 171 LEU B O   1 
ATOM   2440 C  CB  . LEU B 1 175 ? 11.870  12.019 61.020 1.00 22.25 ? 171 LEU B CB  1 
ATOM   2441 C  CG  . LEU B 1 175 ? 12.388  12.713 62.295 1.00 24.38 ? 171 LEU B CG  1 
ATOM   2442 C  CD1 . LEU B 1 175 ? 11.349  13.662 62.856 1.00 23.89 ? 171 LEU B CD1 1 
ATOM   2443 C  CD2 . LEU B 1 175 ? 12.752  11.679 63.323 1.00 24.12 ? 171 LEU B CD2 1 
ATOM   2444 N  N   . VAL B 1 176 ? 11.723  9.230  59.416 1.00 23.81 ? 172 VAL B N   1 
ATOM   2445 C  CA  . VAL B 1 176 ? 11.141  8.398  58.345 1.00 24.22 ? 172 VAL B CA  1 
ATOM   2446 C  C   . VAL B 1 176 ? 9.678   8.051  58.552 1.00 24.26 ? 172 VAL B C   1 
ATOM   2447 O  O   . VAL B 1 176 ? 9.270   7.647  59.635 1.00 24.48 ? 172 VAL B O   1 
ATOM   2448 C  CB  . VAL B 1 176 ? 11.948  7.079  58.187 1.00 25.06 ? 172 VAL B CB  1 
ATOM   2449 C  CG1 . VAL B 1 176 ? 11.281  6.131  57.155 1.00 25.20 ? 172 VAL B CG1 1 
ATOM   2450 C  CG2 . VAL B 1 176 ? 13.395  7.356  57.812 1.00 26.68 ? 172 VAL B CG2 1 
ATOM   2451 N  N   . ALA B 1 177 ? 8.895   8.187  57.483 1.00 24.45 ? 173 ALA B N   1 
ATOM   2452 C  CA  . ALA B 1 177 ? 7.489   7.809  57.493 1.00 25.01 ? 173 ALA B CA  1 
ATOM   2453 C  C   . ALA B 1 177 ? 7.432   6.925  56.252 1.00 24.82 ? 173 ALA B C   1 
ATOM   2454 O  O   . ALA B 1 177 ? 7.790   7.355  55.153 1.00 25.74 ? 173 ALA B O   1 
ATOM   2455 C  CB  . ALA B 1 177 ? 6.565   9.006  57.396 1.00 25.27 ? 173 ALA B CB  1 
ATOM   2456 N  N   . GLU B 1 178 ? 7.025   5.680  56.444 1.00 25.34 ? 174 GLU B N   1 
ATOM   2457 C  CA  . GLU B 1 178 ? 7.007   4.705  55.358 1.00 26.74 ? 174 GLU B CA  1 
ATOM   2458 C  C   . GLU B 1 178 ? 5.673   3.984  55.230 1.00 26.29 ? 174 GLU B C   1 
ATOM   2459 O  O   . GLU B 1 178 ? 5.009   3.713  56.223 1.00 26.58 ? 174 GLU B O   1 
ATOM   2460 C  CB  . GLU B 1 178 ? 8.123   3.698  55.682 1.00 27.90 ? 174 GLU B CB  1 
ATOM   2461 C  CG  . GLU B 1 178 ? 8.588   2.809  54.543 1.00 33.68 ? 174 GLU B CG  1 
ATOM   2462 C  CD  . GLU B 1 178 ? 10.047  2.376  54.686 1.00 37.83 ? 174 GLU B CD  1 
ATOM   2463 O  OE1 . GLU B 1 178 ? 10.523  2.183  55.831 1.00 40.24 ? 174 GLU B OE1 1 
ATOM   2464 O  OE2 . GLU B 1 178 ? 10.715  2.220  53.634 1.00 40.48 ? 174 GLU B OE2 1 
ATOM   2465 N  N   . TRP B 1 179 ? 5.301   3.667  53.986 1.00 26.05 ? 175 TRP B N   1 
ATOM   2466 C  CA  . TRP B 1 179 ? 4.081   2.919  53.666 1.00 26.77 ? 175 TRP B CA  1 
ATOM   2467 C  C   . TRP B 1 179 ? 4.595   1.820  52.749 1.00 27.03 ? 175 TRP B C   1 
ATOM   2468 O  O   . TRP B 1 179 ? 5.244   2.100  51.746 1.00 26.88 ? 175 TRP B O   1 
ATOM   2469 C  CB  . TRP B 1 179 ? 3.029   3.798  52.958 1.00 26.66 ? 175 TRP B CB  1 
ATOM   2470 C  CG  . TRP B 1 179 ? 2.528   4.895  53.855 1.00 26.56 ? 175 TRP B CG  1 
ATOM   2471 C  CD1 . TRP B 1 179 ? 1.520   4.807  54.768 1.00 27.65 ? 175 TRP B CD1 1 
ATOM   2472 C  CD2 . TRP B 1 179 ? 3.050   6.227  53.960 1.00 27.54 ? 175 TRP B CD2 1 
ATOM   2473 N  NE1 . TRP B 1 179 ? 1.357   6.001  55.423 1.00 28.99 ? 175 TRP B NE1 1 
ATOM   2474 C  CE2 . TRP B 1 179 ? 2.292   6.891  54.962 1.00 27.80 ? 175 TRP B CE2 1 
ATOM   2475 C  CE3 . TRP B 1 179 ? 4.077   6.926  53.306 1.00 27.99 ? 175 TRP B CE3 1 
ATOM   2476 C  CZ2 . TRP B 1 179 ? 2.525   8.229  55.325 1.00 28.36 ? 175 TRP B CZ2 1 
ATOM   2477 C  CZ3 . TRP B 1 179 ? 4.325   8.263  53.681 1.00 27.21 ? 175 TRP B CZ3 1 
ATOM   2478 C  CH2 . TRP B 1 179 ? 3.534   8.899  54.664 1.00 27.14 ? 175 TRP B CH2 1 
ATOM   2479 N  N   . ASP B 1 180 ? 4.357   0.567  53.105 1.00 27.49 ? 176 ASP B N   1 
ATOM   2480 C  CA  . ASP B 1 180 ? 4.885   -0.516 52.269 1.00 28.77 ? 176 ASP B CA  1 
ATOM   2481 C  C   . ASP B 1 180 ? 3.998   -1.056 51.167 1.00 28.01 ? 176 ASP B C   1 
ATOM   2482 O  O   . ASP B 1 180 ? 4.498   -1.808 50.335 1.00 28.41 ? 176 ASP B O   1 
ATOM   2483 C  CB  . ASP B 1 180 ? 5.457   -1.678 53.113 1.00 30.02 ? 176 ASP B CB  1 
ATOM   2484 C  CG  . ASP B 1 180 ? 4.546   -2.100 54.253 1.00 35.15 ? 176 ASP B CG  1 
ATOM   2485 O  OD1 . ASP B 1 180 ? 3.300   -2.156 54.047 1.00 38.94 ? 176 ASP B OD1 1 
ATOM   2486 O  OD2 . ASP B 1 180 ? 5.091   -2.409 55.360 1.00 37.13 ? 176 ASP B OD2 1 
ATOM   2487 N  N   . ASP B 1 181 ? 2.710   -0.713 51.163 1.00 26.91 ? 177 ASP B N   1 
ATOM   2488 C  CA  . ASP B 1 181 ? 1.789   -1.246 50.148 1.00 26.85 ? 177 ASP B CA  1 
ATOM   2489 C  C   . ASP B 1 181 ? 0.927   -0.195 49.440 1.00 26.41 ? 177 ASP B C   1 
ATOM   2490 O  O   . ASP B 1 181 ? -0.308  -0.328 49.360 1.00 27.00 ? 177 ASP B O   1 
ATOM   2491 C  CB  . ASP B 1 181 ? 0.898   -2.351 50.744 1.00 27.98 ? 177 ASP B CB  1 
ATOM   2492 C  CG  . ASP B 1 181 ? 1.694   -3.589 51.178 1.00 30.91 ? 177 ASP B CG  1 
ATOM   2493 O  OD1 . ASP B 1 181 ? 2.070   -4.422 50.311 1.00 34.56 ? 177 ASP B OD1 1 
ATOM   2494 O  OD2 . ASP B 1 181 ? 1.921   -3.737 52.393 1.00 35.13 ? 177 ASP B OD2 1 
ATOM   2495 N  N   . PHE B 1 182 ? 1.581   0.830  48.915 1.00 24.06 ? 178 PHE B N   1 
ATOM   2496 C  CA  . PHE B 1 182 ? 0.881   1.879  48.177 1.00 22.92 ? 178 PHE B CA  1 
ATOM   2497 C  C   . PHE B 1 182 ? 0.514   1.404  46.760 1.00 23.71 ? 178 PHE B C   1 
ATOM   2498 O  O   . PHE B 1 182 ? 1.383   1.054  45.963 1.00 23.54 ? 178 PHE B O   1 
ATOM   2499 C  CB  . PHE B 1 182 ? 1.706   3.165  48.073 1.00 23.13 ? 178 PHE B CB  1 
ATOM   2500 C  CG  . PHE B 1 182 ? 1.076   4.182  47.181 1.00 22.07 ? 178 PHE B CG  1 
ATOM   2501 C  CD1 . PHE B 1 182 ? -0.104  4.813  47.560 1.00 22.63 ? 178 PHE B CD1 1 
ATOM   2502 C  CD2 . PHE B 1 182 ? 1.640   4.488  45.947 1.00 24.66 ? 178 PHE B CD2 1 
ATOM   2503 C  CE1 . PHE B 1 182 ? -0.702  5.756  46.728 1.00 22.44 ? 178 PHE B CE1 1 
ATOM   2504 C  CE2 . PHE B 1 182 ? 1.032   5.424  45.096 1.00 24.40 ? 178 PHE B CE2 1 
ATOM   2505 C  CZ  . PHE B 1 182 ? -0.138  6.052  45.492 1.00 23.73 ? 178 PHE B CZ  1 
ATOM   2506 N  N   . GLU B 1 183 ? -0.766  1.459  46.445 1.00 23.56 ? 179 GLU B N   1 
ATOM   2507 C  CA  . GLU B 1 183 ? -1.222  1.018  45.135 1.00 23.58 ? 179 GLU B CA  1 
ATOM   2508 C  C   . GLU B 1 183 ? -1.487  2.146  44.138 1.00 23.67 ? 179 GLU B C   1 
ATOM   2509 O  O   . GLU B 1 183 ? -2.387  2.966  44.333 1.00 24.16 ? 179 GLU B O   1 
ATOM   2510 C  CB  . GLU B 1 183 ? -2.468  0.173  45.302 1.00 25.73 ? 179 GLU B CB  1 
ATOM   2511 C  CG  . GLU B 1 183 ? -2.161  -1.225 45.857 1.00 29.41 ? 179 GLU B CG  1 
ATOM   2512 C  CD  . GLU B 1 183 ? -3.394  -2.100 45.933 1.00 36.27 ? 179 GLU B CD  1 
ATOM   2513 O  OE1 . GLU B 1 183 ? -4.485  -1.640 45.505 1.00 40.71 ? 179 GLU B OE1 1 
ATOM   2514 O  OE2 . GLU B 1 183 ? -3.268  -3.240 46.419 1.00 38.71 ? 179 GLU B OE2 1 
ATOM   2515 N  N   . TRP B 1 184 ? -0.686  2.170  43.077 1.00 21.96 ? 180 TRP B N   1 
ATOM   2516 C  CA  . TRP B 1 184 ? -0.828  3.151  42.019 1.00 22.13 ? 180 TRP B CA  1 
ATOM   2517 C  C   . TRP B 1 184 ? -1.486  2.402  40.871 1.00 22.41 ? 180 TRP B C   1 
ATOM   2518 O  O   . TRP B 1 184 ? -0.874  1.497  40.288 1.00 21.30 ? 180 TRP B O   1 
ATOM   2519 C  CB  . TRP B 1 184 ? 0.526   3.722  41.600 1.00 21.96 ? 180 TRP B CB  1 
ATOM   2520 C  CG  . TRP B 1 184 ? 0.428   4.517  40.326 1.00 21.59 ? 180 TRP B CG  1 
ATOM   2521 C  CD1 . TRP B 1 184 ? 1.084   4.253  39.163 1.00 20.84 ? 180 TRP B CD1 1 
ATOM   2522 C  CD2 . TRP B 1 184 ? -0.373  5.699  40.090 1.00 22.45 ? 180 TRP B CD2 1 
ATOM   2523 N  NE1 . TRP B 1 184 ? 0.753   5.197  38.217 1.00 21.52 ? 180 TRP B NE1 1 
ATOM   2524 C  CE2 . TRP B 1 184 ? -0.141  6.090  38.753 1.00 21.63 ? 180 TRP B CE2 1 
ATOM   2525 C  CE3 . TRP B 1 184 ? -1.257  6.473  40.884 1.00 21.31 ? 180 TRP B CE3 1 
ATOM   2526 C  CZ2 . TRP B 1 184 ? -0.763  7.202  38.173 1.00 22.07 ? 180 TRP B CZ2 1 
ATOM   2527 C  CZ3 . TRP B 1 184 ? -1.872  7.604  40.292 1.00 22.38 ? 180 TRP B CZ3 1 
ATOM   2528 C  CH2 . TRP B 1 184 ? -1.615  7.945  38.955 1.00 21.74 ? 180 TRP B CH2 1 
ATOM   2529 N  N   . LYS B 1 185 ? -2.745  2.753  40.616 1.00 23.46 ? 181 LYS B N   1 
ATOM   2530 C  CA  . LYS B 1 185 ? -3.582  2.130  39.580 1.00 23.77 ? 181 LYS B CA  1 
ATOM   2531 C  C   . LYS B 1 185 ? -3.919  3.077  38.401 1.00 23.65 ? 181 LYS B C   1 
ATOM   2532 O  O   . LYS B 1 185 ? -4.699  2.730  37.489 1.00 24.40 ? 181 LYS B O   1 
ATOM   2533 C  CB  . LYS B 1 185 ? -4.917  1.679  40.207 1.00 24.52 ? 181 LYS B CB  1 
ATOM   2534 C  CG  . LYS B 1 185 ? -4.973  0.322  40.866 1.00 29.69 ? 181 LYS B CG  1 
ATOM   2535 C  CD  . LYS B 1 185 ? -3.654  -0.173 41.321 1.00 31.24 ? 181 LYS B CD  1 
ATOM   2536 C  CE  . LYS B 1 185 ? -3.023  -1.166 40.331 1.00 32.59 ? 181 LYS B CE  1 
ATOM   2537 N  NZ  . LYS B 1 185 ? -1.777  -1.693 40.992 1.00 32.56 ? 181 LYS B NZ  1 
ATOM   2538 N  N   . GLY B 1 186 ? -3.296  4.240  38.411 1.00 23.15 ? 182 GLY B N   1 
ATOM   2539 C  CA  . GLY B 1 186 ? -3.553  5.259  37.391 1.00 23.29 ? 182 GLY B CA  1 
ATOM   2540 C  C   . GLY B 1 186 ? -4.458  6.327  37.992 1.00 23.52 ? 182 GLY B C   1 
ATOM   2541 O  O   . GLY B 1 186 ? -4.894  6.206  39.155 1.00 21.80 ? 182 GLY B O   1 
ATOM   2542 N  N   . PRO B 1 187 ? -4.731  7.390  37.217 1.00 23.42 ? 183 PRO B N   1 
ATOM   2543 C  CA  . PRO B 1 187 ? -5.590  8.466  37.685 1.00 23.67 ? 183 PRO B CA  1 
ATOM   2544 C  C   . PRO B 1 187 ? -6.959  7.997  38.191 1.00 24.49 ? 183 PRO B C   1 
ATOM   2545 O  O   . PRO B 1 187 ? -7.602  7.114  37.590 1.00 24.07 ? 183 PRO B O   1 
ATOM   2546 C  CB  . PRO B 1 187 ? -5.752  9.349  36.441 1.00 24.38 ? 183 PRO B CB  1 
ATOM   2547 C  CG  . PRO B 1 187 ? -4.496  9.127  35.679 1.00 24.62 ? 183 PRO B CG  1 
ATOM   2548 C  CD  . PRO B 1 187 ? -4.215  7.660  35.864 1.00 23.98 ? 183 PRO B CD  1 
ATOM   2549 N  N   . GLN B 1 188 ? -7.384  8.624  39.286 1.00 26.10 ? 184 GLN B N   1 
ATOM   2550 C  CA  . GLN B 1 188 ? -8.668  8.386  39.925 1.00 27.78 ? 184 GLN B CA  1 
ATOM   2551 C  C   . GLN B 1 188 ? -9.468  9.688  39.793 1.00 28.49 ? 184 GLN B C   1 
ATOM   2552 O  O   . GLN B 1 188 ? -10.226 10.049 40.694 1.00 29.46 ? 184 GLN B O   1 
ATOM   2553 C  CB  . GLN B 1 188 ? -8.463  8.073  41.406 1.00 28.45 ? 184 GLN B CB  1 
ATOM   2554 C  CG  . GLN B 1 188 ? -7.599  6.842  41.716 1.00 30.72 ? 184 GLN B CG  1 
ATOM   2555 C  CD  . GLN B 1 188 ? -8.138  5.575  41.081 1.00 36.04 ? 184 GLN B CD  1 
ATOM   2556 O  OE1 . GLN B 1 188 ? -7.422  4.869  40.370 1.00 39.59 ? 184 GLN B OE1 1 
ATOM   2557 N  NE2 . GLN B 1 188 ? -9.419  5.294  41.309 1.00 38.21 ? 184 GLN B NE2 1 
ATOM   2558 N  N   . TRP B 1 189 ? -9.269  10.407 38.680 1.00 29.69 ? 185 TRP B N   1 
ATOM   2559 C  CA  . TRP B 1 189 ? -9.919  11.700 38.426 1.00 29.72 ? 185 TRP B CA  1 
ATOM   2560 C  C   . TRP B 1 189 ? -10.054 11.903 36.941 1.00 30.80 ? 185 TRP B C   1 
ATOM   2561 O  O   . TRP B 1 189 ? -10.643 12.920 36.531 1.00 31.83 ? 185 TRP B O   1 
ATOM   2562 C  CB  . TRP B 1 189 ? -9.061  12.866 38.969 1.00 28.33 ? 185 TRP B CB  1 
ATOM   2563 C  CG  . TRP B 1 189 ? -7.592  12.682 38.662 1.00 27.73 ? 185 TRP B CG  1 
ATOM   2564 C  CD1 . TRP B 1 189 ? -6.930  13.020 37.517 1.00 26.57 ? 185 TRP B CD1 1 
ATOM   2565 C  CD2 . TRP B 1 189 ? -6.625  12.044 39.510 1.00 24.13 ? 185 TRP B CD2 1 
ATOM   2566 N  NE1 . TRP B 1 189 ? -5.599  12.659 37.610 1.00 25.70 ? 185 TRP B NE1 1 
ATOM   2567 C  CE2 . TRP B 1 189 ? -5.391  12.044 38.816 1.00 24.41 ? 185 TRP B CE2 1 
ATOM   2568 C  CE3 . TRP B 1 189 ? -6.691  11.460 40.784 1.00 24.71 ? 185 TRP B CE3 1 
ATOM   2569 C  CZ2 . TRP B 1 189 ? -4.221  11.472 39.356 1.00 25.13 ? 185 TRP B CZ2 1 
ATOM   2570 C  CZ3 . TRP B 1 189 ? -5.508  10.907 41.339 1.00 25.28 ? 185 TRP B CZ3 1 
ATOM   2571 C  CH2 . TRP B 1 189 ? -4.298  10.922 40.614 1.00 25.94 ? 185 TRP B CH2 1 
ATOM   2572 O  OXT . TRP B 1 189 ? -9.559  11.088 36.142 1.00 31.59 ? 185 TRP B OXT 1 
HETATM 2573 S  S   . SO4 C 2 .   ? 3.596   44.502 43.683 1.00 26.08 ? 501 SO4 A S   1 
HETATM 2574 O  O1  . SO4 C 2 .   ? 4.970   44.890 43.514 1.00 28.64 ? 501 SO4 A O1  1 
HETATM 2575 O  O2  . SO4 C 2 .   ? 2.885   44.723 42.424 1.00 27.90 ? 501 SO4 A O2  1 
HETATM 2576 O  O3  . SO4 C 2 .   ? 3.558   43.107 44.031 1.00 25.72 ? 501 SO4 A O3  1 
HETATM 2577 O  O4  . SO4 C 2 .   ? 3.019   45.318 44.716 1.00 29.13 ? 501 SO4 A O4  1 
HETATM 2578 CL CL  . CL  D 3 .   ? 15.460  54.118 57.572 1.00 77.04 ? 302 CL  A CL  1 
HETATM 2579 CL CL  . CL  E 3 .   ? 14.500  36.045 44.117 1.00 56.79 ? 303 CL  A CL  1 
HETATM 2580 C  C1  . EDO F 4 .   ? 26.413  49.361 74.249 1.00 31.56 ? 401 EDO A C1  1 
HETATM 2581 O  O1  . EDO F 4 .   ? 25.020  49.728 74.260 1.00 25.71 ? 401 EDO A O1  1 
HETATM 2582 C  C2  . EDO F 4 .   ? 26.749  49.081 72.800 1.00 30.42 ? 401 EDO A C2  1 
HETATM 2583 O  O2  . EDO F 4 .   ? 26.024  47.925 72.426 1.00 28.75 ? 401 EDO A O2  1 
HETATM 2584 C  C1  . EDO G 4 .   ? 4.557   55.862 64.398 1.00 26.20 ? 402 EDO A C1  1 
HETATM 2585 O  O1  . EDO G 4 .   ? 5.546   55.825 63.386 1.00 29.11 ? 402 EDO A O1  1 
HETATM 2586 C  C2  . EDO G 4 .   ? 5.155   55.472 65.700 1.00 29.80 ? 402 EDO A C2  1 
HETATM 2587 O  O2  . EDO G 4 .   ? 4.769   54.117 65.768 1.00 33.91 ? 402 EDO A O2  1 
HETATM 2588 S  S   . SO4 H 2 .   ? -0.427  1.587  56.081 1.00 66.10 ? 502 SO4 B S   1 
HETATM 2589 O  O1  . SO4 H 2 .   ? 0.010   1.635  57.480 1.00 66.47 ? 502 SO4 B O1  1 
HETATM 2590 O  O2  . SO4 H 2 .   ? 0.749   1.549  55.207 1.00 65.43 ? 502 SO4 B O2  1 
HETATM 2591 O  O3  . SO4 H 2 .   ? -1.215  0.369  55.863 1.00 67.33 ? 502 SO4 B O3  1 
HETATM 2592 O  O4  . SO4 H 2 .   ? -1.287  2.731  55.809 1.00 64.31 ? 502 SO4 B O4  1 
HETATM 2593 CL CL  . CL  I 3 .   ? 12.353  2.574  49.142 1.00 63.07 ? 301 CL  B CL  1 
HETATM 2594 O  O   . HOH J 5 .   ? 23.139  51.287 72.638 1.00 15.90 ? 502 HOH A O   1 
HETATM 2595 O  O   . HOH J 5 .   ? 14.600  50.718 75.859 1.00 18.32 ? 503 HOH A O   1 
HETATM 2596 O  O   . HOH J 5 .   ? 11.030  51.435 74.375 1.00 18.66 ? 504 HOH A O   1 
HETATM 2597 O  O   . HOH J 5 .   ? 9.109   53.708 71.792 1.00 21.38 ? 505 HOH A O   1 
HETATM 2598 O  O   . HOH J 5 .   ? 3.778   34.752 43.290 1.00 18.69 ? 506 HOH A O   1 
HETATM 2599 O  O   . HOH J 5 .   ? 5.430   30.879 52.811 1.00 21.81 ? 507 HOH A O   1 
HETATM 2600 O  O   . HOH J 5 .   ? 14.607  36.708 57.227 1.00 24.74 ? 508 HOH A O   1 
HETATM 2601 O  O   . HOH J 5 .   ? 8.628   51.226 73.063 1.00 20.84 ? 509 HOH A O   1 
HETATM 2602 O  O   . HOH J 5 .   ? -2.557  33.107 41.352 1.00 21.12 ? 510 HOH A O   1 
HETATM 2603 O  O   . HOH J 5 .   ? 16.526  57.156 75.332 1.00 21.69 ? 511 HOH A O   1 
HETATM 2604 O  O   . HOH J 5 .   ? 13.254  41.028 78.366 1.00 20.99 ? 512 HOH A O   1 
HETATM 2605 O  O   . HOH J 5 .   ? 22.255  42.276 64.390 1.00 23.64 ? 513 HOH A O   1 
HETATM 2606 O  O   . HOH J 5 .   ? 3.354   53.232 67.459 1.00 21.33 ? 514 HOH A O   1 
HETATM 2607 O  O   . HOH J 5 .   ? 3.192   45.464 39.699 1.00 23.78 ? 515 HOH A O   1 
HETATM 2608 O  O   . HOH J 5 .   ? 22.927  58.989 72.942 1.00 22.86 ? 516 HOH A O   1 
HETATM 2609 O  O   . HOH J 5 .   ? 25.173  34.256 72.485 1.00 24.91 ? 517 HOH A O   1 
HETATM 2610 O  O   . HOH J 5 .   ? 7.484   53.552 69.026 1.00 22.96 ? 518 HOH A O   1 
HETATM 2611 O  O   . HOH J 5 .   ? 9.161   40.786 47.799 1.00 23.88 ? 519 HOH A O   1 
HETATM 2612 O  O   . HOH J 5 .   ? 13.166  32.896 50.784 1.00 27.47 ? 520 HOH A O   1 
HETATM 2613 O  O   . HOH J 5 .   ? 4.639   48.482 51.991 1.00 23.93 ? 521 HOH A O   1 
HETATM 2614 O  O   . HOH J 5 .   ? -1.231  47.735 52.519 1.00 38.17 ? 522 HOH A O   1 
HETATM 2615 O  O   . HOH J 5 .   ? 1.696   39.366 63.801 1.00 25.05 ? 523 HOH A O   1 
HETATM 2616 O  O   . HOH J 5 .   ? 17.504  60.824 70.296 1.00 25.99 ? 524 HOH A O   1 
HETATM 2617 O  O   . HOH J 5 .   ? 4.287   51.127 58.784 1.00 23.34 ? 525 HOH A O   1 
HETATM 2618 O  O   . HOH J 5 .   ? 4.378   45.055 70.146 1.00 19.66 ? 526 HOH A O   1 
HETATM 2619 O  O   . HOH J 5 .   ? 3.964   45.925 66.988 1.00 19.69 ? 527 HOH A O   1 
HETATM 2620 O  O   . HOH J 5 .   ? 24.671  48.177 58.959 1.00 28.58 ? 528 HOH A O   1 
HETATM 2621 O  O   . HOH J 5 .   ? 32.135  46.202 69.695 1.00 26.04 ? 529 HOH A O   1 
HETATM 2622 O  O   . HOH J 5 .   ? 8.772   54.524 74.921 1.00 27.73 ? 530 HOH A O   1 
HETATM 2623 O  O   . HOH J 5 .   ? -3.009  37.774 42.076 1.00 26.51 ? 531 HOH A O   1 
HETATM 2624 O  O   . HOH J 5 .   ? 17.159  38.888 55.934 1.00 29.55 ? 532 HOH A O   1 
HETATM 2625 O  O   . HOH J 5 .   ? 23.434  44.890 65.445 1.00 25.26 ? 533 HOH A O   1 
HETATM 2626 O  O   . HOH J 5 .   ? 21.785  55.557 63.379 1.00 23.12 ? 534 HOH A O   1 
HETATM 2627 O  O   . HOH J 5 .   ? 4.372   45.252 47.334 1.00 26.21 ? 535 HOH A O   1 
HETATM 2628 O  O   . HOH J 5 .   ? -0.898  50.474 62.416 1.00 28.42 ? 536 HOH A O   1 
HETATM 2629 O  O   . HOH J 5 .   ? 11.752  23.797 53.332 1.00 24.44 ? 537 HOH A O   1 
HETATM 2630 O  O   . HOH J 5 .   ? 10.386  58.358 71.327 1.00 24.91 ? 538 HOH A O   1 
HETATM 2631 O  O   . HOH J 5 .   ? 5.882   35.325 64.040 1.00 28.75 ? 539 HOH A O   1 
HETATM 2632 O  O   . HOH J 5 .   ? 13.866  42.606 52.669 1.00 25.40 ? 540 HOH A O   1 
HETATM 2633 O  O   . HOH J 5 .   ? 2.545   47.136 70.175 1.00 29.58 ? 541 HOH A O   1 
HETATM 2634 O  O   . HOH J 5 .   ? -5.180  20.403 39.148 1.00 31.13 ? 542 HOH A O   1 
HETATM 2635 O  O   . HOH J 5 .   ? 17.223  51.377 81.626 1.00 33.18 ? 543 HOH A O   1 
HETATM 2636 O  O   . HOH J 5 .   ? 23.978  35.430 68.414 1.00 25.56 ? 544 HOH A O   1 
HETATM 2637 O  O   . HOH J 5 .   ? 8.110   34.146 68.691 1.00 35.17 ? 545 HOH A O   1 
HETATM 2638 O  O   . HOH J 5 .   ? 21.116  37.262 60.704 1.00 28.84 ? 546 HOH A O   1 
HETATM 2639 O  O   . HOH J 5 .   ? 24.424  54.473 56.609 1.00 30.86 ? 547 HOH A O   1 
HETATM 2640 O  O   . HOH J 5 .   ? 10.109  27.650 43.720 1.00 28.51 ? 548 HOH A O   1 
HETATM 2641 O  O   . HOH J 5 .   ? 23.778  46.785 76.407 1.00 27.68 ? 549 HOH A O   1 
HETATM 2642 O  O   . HOH J 5 .   ? 4.104   41.152 68.030 1.00 33.01 ? 550 HOH A O   1 
HETATM 2643 O  O   . HOH J 5 .   ? 18.685  24.505 66.003 1.00 28.64 ? 551 HOH A O   1 
HETATM 2644 O  O   . HOH J 5 .   ? 29.207  39.117 69.374 1.00 25.44 ? 552 HOH A O   1 
HETATM 2645 O  O   . HOH J 5 .   ? 2.656   47.989 44.739 1.00 38.54 ? 553 HOH A O   1 
HETATM 2646 O  O   . HOH J 5 .   ? 18.185  31.289 61.923 1.00 31.55 ? 554 HOH A O   1 
HETATM 2647 O  O   . HOH J 5 .   ? 12.412  42.597 82.372 1.00 31.42 ? 555 HOH A O   1 
HETATM 2648 O  O   . HOH J 5 .   ? 15.158  60.944 73.093 1.00 30.86 ? 556 HOH A O   1 
HETATM 2649 O  O   . HOH J 5 .   ? 7.926   38.163 44.679 1.00 31.46 ? 557 HOH A O   1 
HETATM 2650 O  O   . HOH J 5 .   ? -7.141  41.073 58.217 1.00 31.56 ? 558 HOH A O   1 
HETATM 2651 O  O   . HOH J 5 .   ? 23.010  53.233 64.577 1.00 27.84 ? 559 HOH A O   1 
HETATM 2652 O  O   . HOH J 5 .   ? 1.241   29.695 63.011 1.00 30.65 ? 560 HOH A O   1 
HETATM 2653 O  O   . HOH J 5 .   ? 15.968  58.898 61.748 1.00 40.10 ? 561 HOH A O   1 
HETATM 2654 O  O   . HOH J 5 .   ? 25.221  61.369 60.667 1.00 34.64 ? 562 HOH A O   1 
HETATM 2655 O  O   . HOH J 5 .   ? 18.264  44.736 86.201 1.00 33.43 ? 563 HOH A O   1 
HETATM 2656 O  O   . HOH J 5 .   ? 26.110  28.146 67.332 1.00 41.24 ? 564 HOH A O   1 
HETATM 2657 O  O   . HOH J 5 .   ? 23.053  33.907 70.467 1.00 27.05 ? 565 HOH A O   1 
HETATM 2658 O  O   . HOH J 5 .   ? 8.078   35.095 45.893 1.00 29.11 ? 566 HOH A O   1 
HETATM 2659 O  O   . HOH J 5 .   ? -6.845  30.285 53.824 1.00 40.40 ? 567 HOH A O   1 
HETATM 2660 O  O   . HOH J 5 .   ? 1.923   40.290 66.407 1.00 32.55 ? 568 HOH A O   1 
HETATM 2661 O  O   . HOH J 5 .   ? -11.584 41.448 59.571 1.00 33.48 ? 569 HOH A O   1 
HETATM 2662 O  O   . HOH J 5 .   ? 0.552   39.548 47.908 1.00 34.16 ? 570 HOH A O   1 
HETATM 2663 O  O   . HOH J 5 .   ? -7.302  32.236 46.061 1.00 29.57 ? 571 HOH A O   1 
HETATM 2664 O  O   . HOH J 5 .   ? 7.819   32.592 44.775 1.00 47.87 ? 572 HOH A O   1 
HETATM 2665 O  O   . HOH J 5 .   ? 23.547  46.204 62.730 1.00 33.93 ? 573 HOH A O   1 
HETATM 2666 O  O   . HOH J 5 .   ? 13.318  40.210 80.884 1.00 32.04 ? 574 HOH A O   1 
HETATM 2667 O  O   . HOH J 5 .   ? 25.111  35.106 65.781 1.00 30.63 ? 575 HOH A O   1 
HETATM 2668 O  O   . HOH J 5 .   ? 15.035  44.997 52.069 1.00 35.40 ? 576 HOH A O   1 
HETATM 2669 O  O   . HOH J 5 .   ? -4.865  41.557 60.670 1.00 35.77 ? 577 HOH A O   1 
HETATM 2670 O  O   . HOH J 5 .   ? 12.616  26.589 50.223 1.00 34.68 ? 578 HOH A O   1 
HETATM 2671 O  O   . HOH J 5 .   ? 4.615   38.231 41.963 1.00 28.51 ? 579 HOH A O   1 
HETATM 2672 O  O   . HOH J 5 .   ? -1.262  49.493 59.751 1.00 33.56 ? 580 HOH A O   1 
HETATM 2673 O  O   . HOH J 5 .   ? 20.093  42.074 83.377 1.00 35.50 ? 581 HOH A O   1 
HETATM 2674 O  O   . HOH J 5 .   ? -7.862  30.858 57.060 1.00 37.97 ? 582 HOH A O   1 
HETATM 2675 O  O   . HOH J 5 .   ? 3.010   49.180 57.517 1.00 28.30 ? 583 HOH A O   1 
HETATM 2676 O  O   . HOH J 5 .   ? 20.473  38.569 77.995 1.00 34.22 ? 584 HOH A O   1 
HETATM 2677 O  O   . HOH J 5 .   ? 25.327  53.019 62.912 1.00 32.57 ? 585 HOH A O   1 
HETATM 2678 O  O   . HOH J 5 .   ? 16.224  41.452 84.820 1.00 34.58 ? 586 HOH A O   1 
HETATM 2679 O  O   . HOH J 5 .   ? 1.152   42.172 45.628 1.00 41.24 ? 587 HOH A O   1 
HETATM 2680 O  O   . HOH J 5 .   ? 7.247   55.316 66.794 1.00 28.99 ? 588 HOH A O   1 
HETATM 2681 O  O   . HOH J 5 .   ? 8.569   53.326 51.495 1.00 50.92 ? 589 HOH A O   1 
HETATM 2682 O  O   . HOH J 5 .   ? 11.262  25.234 45.934 1.00 37.23 ? 590 HOH A O   1 
HETATM 2683 O  O   . HOH J 5 .   ? 21.246  45.903 77.153 1.00 35.34 ? 591 HOH A O   1 
HETATM 2684 O  O   . HOH J 5 .   ? -6.485  41.960 55.310 1.00 35.03 ? 592 HOH A O   1 
HETATM 2685 O  O   . HOH J 5 .   ? 21.044  43.474 78.007 1.00 40.28 ? 593 HOH A O   1 
HETATM 2686 O  O   . HOH J 5 .   ? 6.816   56.070 58.805 1.00 36.37 ? 594 HOH A O   1 
HETATM 2687 O  O   . HOH J 5 .   ? 3.190   28.478 59.225 1.00 54.77 ? 595 HOH A O   1 
HETATM 2688 O  O   . HOH J 5 .   ? 8.234   56.440 72.351 1.00 28.79 ? 596 HOH A O   1 
HETATM 2689 O  O   . HOH J 5 .   ? 13.695  63.356 67.930 1.00 38.34 ? 597 HOH A O   1 
HETATM 2690 O  O   . HOH J 5 .   ? 0.666   49.616 56.471 1.00 34.36 ? 598 HOH A O   1 
HETATM 2691 O  O   . HOH J 5 .   ? 9.324   37.785 77.919 1.00 36.20 ? 599 HOH A O   1 
HETATM 2692 O  O   . HOH J 5 .   ? 15.414  34.655 56.085 1.00 34.65 ? 600 HOH A O   1 
HETATM 2693 O  O   . HOH J 5 .   ? 17.894  55.968 79.700 1.00 37.75 ? 601 HOH A O   1 
HETATM 2694 O  O   . HOH J 5 .   ? 30.221  37.140 73.739 1.00 37.53 ? 602 HOH A O   1 
HETATM 2695 O  O   . HOH J 5 .   ? 21.418  57.979 54.960 1.00 38.37 ? 603 HOH A O   1 
HETATM 2696 O  O   . HOH J 5 .   ? 23.634  41.940 76.831 1.00 33.61 ? 604 HOH A O   1 
HETATM 2697 O  O   . HOH J 5 .   ? 9.906   48.383 49.427 1.00 38.75 ? 605 HOH A O   1 
HETATM 2698 O  O   . HOH J 5 .   ? -2.993  54.473 65.216 1.00 37.42 ? 606 HOH A O   1 
HETATM 2699 O  O   . HOH J 5 .   ? 17.916  37.228 48.947 1.00 45.61 ? 607 HOH A O   1 
HETATM 2700 O  O   . HOH J 5 .   ? 17.059  57.501 77.695 1.00 34.93 ? 608 HOH A O   1 
HETATM 2701 O  O   . HOH J 5 .   ? 26.089  49.512 60.847 1.00 42.48 ? 609 HOH A O   1 
HETATM 2702 O  O   . HOH J 5 .   ? 18.408  59.328 75.281 1.00 33.89 ? 610 HOH A O   1 
HETATM 2703 O  O   . HOH J 5 .   ? 19.110  61.049 72.742 1.00 45.87 ? 611 HOH A O   1 
HETATM 2704 O  O   . HOH J 5 .   ? 4.901   53.828 69.969 1.00 25.18 ? 612 HOH A O   1 
HETATM 2705 O  O   . HOH J 5 .   ? 9.889   60.932 70.030 1.00 31.26 ? 613 HOH A O   1 
HETATM 2706 O  O   . HOH J 5 .   ? 12.507  62.231 70.314 1.00 30.10 ? 614 HOH A O   1 
HETATM 2707 O  O   . HOH J 5 .   ? 11.491  36.563 78.639 1.00 39.22 ? 615 HOH A O   1 
HETATM 2708 O  O   . HOH J 5 .   ? 17.816  44.753 52.049 1.00 36.12 ? 616 HOH A O   1 
HETATM 2709 O  O   . HOH J 5 .   ? 21.936  50.421 55.407 1.00 42.96 ? 617 HOH A O   1 
HETATM 2710 O  O   . HOH J 5 .   ? 22.056  61.897 65.930 1.00 44.88 ? 618 HOH A O   1 
HETATM 2711 O  O   . HOH J 5 .   ? -2.422  38.636 45.924 1.00 37.59 ? 619 HOH A O   1 
HETATM 2712 O  O   . HOH J 5 .   ? 6.210   46.058 41.306 1.00 41.29 ? 620 HOH A O   1 
HETATM 2713 O  O   . HOH J 5 .   ? -3.148  48.150 64.165 1.00 46.47 ? 621 HOH A O   1 
HETATM 2714 O  O   . HOH J 5 .   ? 4.561   32.458 65.239 1.00 40.82 ? 622 HOH A O   1 
HETATM 2715 O  O   . HOH J 5 .   ? 10.647  49.100 82.205 1.00 35.82 ? 623 HOH A O   1 
HETATM 2716 O  O   . HOH J 5 .   ? 20.737  52.175 53.908 1.00 52.46 ? 624 HOH A O   1 
HETATM 2717 O  O   . HOH J 5 .   ? 18.668  61.919 68.159 1.00 49.34 ? 625 HOH A O   1 
HETATM 2718 O  O   . HOH J 5 .   ? 13.971  36.627 77.798 1.00 51.31 ? 626 HOH A O   1 
HETATM 2719 O  O   . HOH J 5 .   ? -13.327 35.432 58.859 1.00 45.40 ? 627 HOH A O   1 
HETATM 2720 O  O   . HOH J 5 .   ? 17.431  60.868 61.033 1.00 45.72 ? 628 HOH A O   1 
HETATM 2721 O  O   . HOH J 5 .   ? 17.468  39.488 53.206 1.00 32.25 ? 629 HOH A O   1 
HETATM 2722 O  O   . HOH J 5 .   ? 15.536  41.041 51.693 1.00 38.08 ? 630 HOH A O   1 
HETATM 2723 O  O   . HOH J 5 .   ? 0.934   43.923 48.418 1.00 43.28 ? 631 HOH A O   1 
HETATM 2724 O  O   . HOH J 5 .   ? -3.622  38.101 61.330 1.00 43.83 ? 632 HOH A O   1 
HETATM 2725 O  O   . HOH J 5 .   ? 25.996  45.175 65.640 1.00 44.72 ? 633 HOH A O   1 
HETATM 2726 O  O   . HOH J 5 .   ? 27.386  33.747 70.089 1.00 41.14 ? 634 HOH A O   1 
HETATM 2727 O  O   . HOH J 5 .   ? 16.026  31.420 44.368 1.00 47.22 ? 635 HOH A O   1 
HETATM 2728 O  O   . HOH J 5 .   ? 10.087  30.590 36.921 1.00 47.33 ? 636 HOH A O   1 
HETATM 2729 O  O   . HOH J 5 .   ? 3.172   42.599 70.083 1.00 38.72 ? 637 HOH A O   1 
HETATM 2730 O  O   . HOH J 5 .   ? -6.002  27.997 53.897 1.00 53.32 ? 638 HOH A O   1 
HETATM 2731 O  O   . HOH J 5 .   ? 1.931   47.809 50.882 1.00 38.36 ? 639 HOH A O   1 
HETATM 2732 O  O   . HOH J 5 .   ? 12.866  24.337 48.141 1.00 39.47 ? 640 HOH A O   1 
HETATM 2733 O  O   . HOH J 5 .   ? 7.710   61.999 71.518 1.00 39.79 ? 641 HOH A O   1 
HETATM 2734 O  O   . HOH J 5 .   ? 9.622   35.118 79.498 1.00 40.44 ? 642 HOH A O   1 
HETATM 2735 O  O   . HOH J 5 .   ? 5.582   58.978 65.449 1.00 37.50 ? 643 HOH A O   1 
HETATM 2736 O  O   . HOH J 5 .   ? 21.693  40.735 61.907 1.00 35.74 ? 644 HOH A O   1 
HETATM 2737 O  O   . HOH J 5 .   ? 4.932   55.328 60.852 1.00 43.86 ? 645 HOH A O   1 
HETATM 2738 O  O   . HOH J 5 .   ? -6.715  23.443 47.329 1.00 44.52 ? 646 HOH A O   1 
HETATM 2739 O  O   . HOH J 5 .   ? 14.773  53.187 59.688 1.00 34.24 ? 647 HOH A O   1 
HETATM 2740 O  O   . HOH J 5 .   ? 28.585  51.864 67.765 1.00 35.80 ? 648 HOH A O   1 
HETATM 2741 O  O   . HOH J 5 .   ? 7.145   39.174 84.272 1.00 44.72 ? 649 HOH A O   1 
HETATM 2742 O  O   . HOH J 5 .   ? 8.666   45.103 41.422 1.00 43.10 ? 650 HOH A O   1 
HETATM 2743 O  O   . HOH J 5 .   ? 6.036   48.439 49.894 1.00 46.60 ? 651 HOH A O   1 
HETATM 2744 O  O   . HOH K 5 .   ? 12.949  32.725 55.688 1.00 20.87 ? 503 HOH B O   1 
HETATM 2745 O  O   . HOH K 5 .   ? 1.813   5.895  35.670 1.00 21.06 ? 504 HOH B O   1 
HETATM 2746 O  O   . HOH K 5 .   ? 8.685   25.531 45.930 1.00 23.46 ? 505 HOH B O   1 
HETATM 2747 O  O   . HOH K 5 .   ? 2.782   22.673 34.934 1.00 25.96 ? 506 HOH B O   1 
HETATM 2748 O  O   . HOH K 5 .   ? 4.978   32.256 43.578 1.00 20.58 ? 507 HOH B O   1 
HETATM 2749 O  O   . HOH K 5 .   ? -4.319  4.953  41.568 1.00 25.24 ? 508 HOH B O   1 
HETATM 2750 O  O   . HOH K 5 .   ? 5.980   21.327 37.628 1.00 25.89 ? 509 HOH B O   1 
HETATM 2751 O  O   . HOH K 5 .   ? 4.003   23.265 37.424 1.00 25.23 ? 510 HOH B O   1 
HETATM 2752 O  O   . HOH K 5 .   ? 11.281  19.837 51.067 1.00 28.96 ? 511 HOH B O   1 
HETATM 2753 O  O   . HOH K 5 .   ? -4.461  17.644 36.438 1.00 28.80 ? 512 HOH B O   1 
HETATM 2754 O  O   . HOH K 5 .   ? -1.025  9.621  55.535 1.00 26.64 ? 513 HOH B O   1 
HETATM 2755 O  O   . HOH K 5 .   ? 8.500   12.340 38.731 1.00 29.49 ? 514 HOH B O   1 
HETATM 2756 O  O   . HOH K 5 .   ? 10.366  25.327 61.492 1.00 29.18 ? 515 HOH B O   1 
HETATM 2757 O  O   . HOH K 5 .   ? 18.602  21.961 67.331 1.00 27.13 ? 516 HOH B O   1 
HETATM 2758 O  O   . HOH K 5 .   ? 17.851  16.111 59.971 1.00 29.34 ? 517 HOH B O   1 
HETATM 2759 O  O   . HOH K 5 .   ? 11.459  11.609 40.387 1.00 29.85 ? 518 HOH B O   1 
HETATM 2760 O  O   . HOH K 5 .   ? 8.271   28.488 36.510 1.00 34.81 ? 519 HOH B O   1 
HETATM 2761 O  O   . HOH K 5 .   ? -0.109  16.210 59.255 1.00 29.75 ? 520 HOH B O   1 
HETATM 2762 O  O   . HOH K 5 .   ? 18.388  21.627 62.215 1.00 39.33 ? 521 HOH B O   1 
HETATM 2763 O  O   . HOH K 5 .   ? 15.211  9.135  40.823 1.00 32.90 ? 522 HOH B O   1 
HETATM 2764 O  O   . HOH K 5 .   ? 10.761  0.717  41.415 1.00 31.53 ? 523 HOH B O   1 
HETATM 2765 O  O   . HOH K 5 .   ? 6.140   4.847  59.236 1.00 32.84 ? 524 HOH B O   1 
HETATM 2766 O  O   . HOH K 5 .   ? -2.653  2.221  48.514 1.00 28.21 ? 525 HOH B O   1 
HETATM 2767 O  O   . HOH K 5 .   ? -1.331  14.569 33.330 1.00 32.67 ? 526 HOH B O   1 
HETATM 2768 O  O   . HOH K 5 .   ? 12.748  8.013  61.802 1.00 35.72 ? 527 HOH B O   1 
HETATM 2769 O  O   . HOH K 5 .   ? 11.545  19.475 43.471 1.00 34.61 ? 528 HOH B O   1 
HETATM 2770 O  O   . HOH K 5 .   ? 14.859  16.973 71.565 1.00 39.19 ? 529 HOH B O   1 
HETATM 2771 O  O   . HOH K 5 .   ? 15.546  14.467 53.819 1.00 36.96 ? 530 HOH B O   1 
HETATM 2772 O  O   . HOH K 5 .   ? 8.765   4.358  39.828 1.00 36.16 ? 531 HOH B O   1 
HETATM 2773 O  O   . HOH K 5 .   ? 3.618   -4.162 41.942 1.00 35.11 ? 532 HOH B O   1 
HETATM 2774 O  O   . HOH K 5 .   ? -3.569  15.774 34.565 1.00 37.40 ? 533 HOH B O   1 
HETATM 2775 O  O   . HOH K 5 .   ? -4.704  2.849  34.644 1.00 33.67 ? 534 HOH B O   1 
HETATM 2776 O  O   . HOH K 5 .   ? 1.237   21.332 31.666 1.00 39.71 ? 535 HOH B O   1 
HETATM 2777 O  O   . HOH K 5 .   ? 8.684   8.625  67.122 1.00 43.79 ? 536 HOH B O   1 
HETATM 2778 O  O   . HOH K 5 .   ? 11.641  26.876 41.620 1.00 37.57 ? 537 HOH B O   1 
HETATM 2779 O  O   . HOH K 5 .   ? 19.111  24.702 62.400 1.00 43.17 ? 538 HOH B O   1 
HETATM 2780 O  O   . HOH K 5 .   ? 16.215  30.112 56.452 1.00 37.60 ? 539 HOH B O   1 
HETATM 2781 O  O   . HOH K 5 .   ? 8.963   14.633 40.958 1.00 31.99 ? 540 HOH B O   1 
HETATM 2782 O  O   . HOH K 5 .   ? 11.489  15.546 42.258 1.00 40.38 ? 541 HOH B O   1 
HETATM 2783 O  O   . HOH K 5 .   ? 3.087   6.281  63.526 1.00 39.01 ? 542 HOH B O   1 
HETATM 2784 O  O   . HOH K 5 .   ? 10.726  3.214  41.207 1.00 36.43 ? 543 HOH B O   1 
HETATM 2785 O  O   . HOH K 5 .   ? 8.880   21.608 37.771 1.00 33.09 ? 544 HOH B O   1 
HETATM 2786 O  O   . HOH K 5 .   ? -3.320  24.857 35.142 1.00 33.27 ? 545 HOH B O   1 
HETATM 2787 O  O   . HOH K 5 .   ? 15.369  32.293 75.373 1.00 32.55 ? 546 HOH B O   1 
HETATM 2788 O  O   . HOH K 5 .   ? 3.951   27.328 36.103 1.00 40.90 ? 547 HOH B O   1 
HETATM 2789 O  O   . HOH K 5 .   ? 0.770   0.921  52.544 1.00 43.57 ? 548 HOH B O   1 
HETATM 2790 O  O   . HOH K 5 .   ? -4.379  4.166  45.779 1.00 32.14 ? 549 HOH B O   1 
HETATM 2791 O  O   . HOH K 5 .   ? 14.588  3.305  58.706 1.00 46.62 ? 550 HOH B O   1 
HETATM 2792 O  O   . HOH K 5 .   ? 5.412   29.132 35.910 1.00 40.63 ? 551 HOH B O   1 
HETATM 2793 O  O   . HOH K 5 .   ? 4.201   27.413 61.485 1.00 39.26 ? 552 HOH B O   1 
HETATM 2794 O  O   . HOH K 5 .   ? 0.675   26.618 60.679 1.00 41.55 ? 553 HOH B O   1 
HETATM 2795 O  O   . HOH K 5 .   ? 18.836  12.569 66.253 1.00 53.63 ? 554 HOH B O   1 
HETATM 2796 O  O   . HOH K 5 .   ? 0.448   4.965  61.817 1.00 44.62 ? 555 HOH B O   1 
HETATM 2797 O  O   . HOH K 5 .   ? 2.990   8.411  32.853 1.00 43.88 ? 556 HOH B O   1 
HETATM 2798 O  O   . HOH K 5 .   ? -7.252  23.021 37.033 1.00 46.65 ? 557 HOH B O   1 
HETATM 2799 O  O   . HOH K 5 .   ? 10.736  23.410 75.831 1.00 35.20 ? 558 HOH B O   1 
HETATM 2800 O  O   . HOH K 5 .   ? 13.340  33.574 74.080 1.00 34.80 ? 559 HOH B O   1 
HETATM 2801 O  O   . HOH K 5 .   ? 5.144   6.908  34.051 1.00 37.41 ? 560 HOH B O   1 
HETATM 2802 O  O   . HOH K 5 .   ? -2.816  17.323 51.959 1.00 30.39 ? 561 HOH B O   1 
HETATM 2803 O  O   . HOH K 5 .   ? 0.980   20.756 47.478 1.00 21.61 ? 562 HOH B O   1 
HETATM 2804 O  O   . HOH K 5 .   ? 19.829  18.807 62.811 1.00 39.28 ? 563 HOH B O   1 
HETATM 2805 O  O   . HOH K 5 .   ? 12.010  31.137 74.330 1.00 39.66 ? 564 HOH B O   1 
HETATM 2806 O  O   . HOH K 5 .   ? -4.004  4.423  48.448 1.00 40.95 ? 565 HOH B O   1 
HETATM 2807 O  O   . HOH K 5 .   ? -2.400  14.445 55.178 1.00 35.71 ? 566 HOH B O   1 
HETATM 2808 O  O   . HOH K 5 .   ? 7.079   6.170  63.503 1.00 41.55 ? 567 HOH B O   1 
HETATM 2809 O  O   . HOH K 5 .   ? 13.665  16.638 67.523 1.00 41.01 ? 568 HOH B O   1 
HETATM 2810 O  O   . HOH K 5 .   ? -7.942  18.239 44.651 1.00 45.61 ? 569 HOH B O   1 
HETATM 2811 O  O   . HOH K 5 .   ? -0.651  17.089 64.894 1.00 45.61 ? 570 HOH B O   1 
HETATM 2812 O  O   . HOH K 5 .   ? 15.763  24.544 55.792 1.00 46.69 ? 571 HOH B O   1 
HETATM 2813 O  O   . HOH K 5 .   ? -1.551  2.314  51.482 1.00 35.33 ? 572 HOH B O   1 
HETATM 2814 O  O   . HOH K 5 .   ? -2.956  28.297 35.809 1.00 36.80 ? 573 HOH B O   1 
HETATM 2815 O  O   . HOH K 5 .   ? 3.931   28.056 64.056 1.00 39.27 ? 574 HOH B O   1 
HETATM 2816 O  O   . HOH K 5 .   ? 21.031  29.268 61.740 1.00 39.78 ? 575 HOH B O   1 
HETATM 2817 O  O   . HOH K 5 .   ? 4.512   19.806 29.655 1.00 42.20 ? 576 HOH B O   1 
HETATM 2818 O  O   . HOH K 5 .   ? -8.634  14.233 42.370 1.00 43.86 ? 577 HOH B O   1 
HETATM 2819 O  O   . HOH K 5 .   ? -3.466  11.885 55.044 1.00 47.83 ? 578 HOH B O   1 
HETATM 2820 O  O   . HOH K 5 .   ? 1.057   20.553 55.349 1.00 37.38 ? 579 HOH B O   1 
HETATM 2821 O  O   . HOH K 5 .   ? 7.981   14.882 74.253 1.00 54.99 ? 580 HOH B O   1 
HETATM 2822 O  O   . HOH K 5 .   ? 24.098  15.454 66.337 1.00 54.48 ? 581 HOH B O   1 
HETATM 2823 O  O   . HOH K 5 .   ? -3.881  20.928 47.672 1.00 39.42 ? 582 HOH B O   1 
HETATM 2824 O  O   . HOH K 5 .   ? -1.160  15.234 53.015 1.00 36.03 ? 583 HOH B O   1 
HETATM 2825 O  O   . HOH K 5 .   ? 21.004  30.173 79.547 1.00 45.00 ? 584 HOH B O   1 
HETATM 2826 O  O   . HOH K 5 .   ? 16.918  32.755 80.501 1.00 42.13 ? 585 HOH B O   1 
HETATM 2827 O  O   . HOH K 5 .   ? 0.299   14.308 69.507 1.00 46.99 ? 586 HOH B O   1 
HETATM 2828 O  O   . HOH K 5 .   ? 2.900   0.133  55.725 1.00 47.25 ? 587 HOH B O   1 
HETATM 2829 O  O   . HOH K 5 .   ? 25.459  26.369 58.961 1.00 48.98 ? 588 HOH B O   1 
HETATM 2830 O  O   . HOH K 5 .   ? -2.792  4.151  62.138 1.00 48.33 ? 589 HOH B O   1 
HETATM 2831 O  O   . HOH K 5 .   ? 22.793  21.292 56.077 1.00 54.00 ? 590 HOH B O   1 
HETATM 2832 O  O   . HOH K 5 .   ? -4.579  8.282  58.819 1.00 45.23 ? 591 HOH B O   1 
HETATM 2833 O  O   . HOH K 5 .   ? 2.123   11.056 32.588 1.00 44.33 ? 592 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -3  ?   ?   ?   A . n 
A 1 2   ALA 2   -2  ?   ?   ?   A . n 
A 1 3   MET 3   -1  ?   ?   ?   A . n 
A 1 4   GLY 4   0   ?   ?   ?   A . n 
A 1 5   SER 5   1   ?   ?   ?   A . n 
A 1 6   GLY 6   2   ?   ?   ?   A . n 
A 1 7   GLY 7   3   ?   ?   ?   A . n 
A 1 8   GLY 8   4   ?   ?   ?   A . n 
A 1 9   GLY 9   5   ?   ?   ?   A . n 
A 1 10  GLU 10  6   ?   ?   ?   A . n 
A 1 11  HIS 11  7   ?   ?   ?   A . n 
A 1 12  GLN 12  8   ?   ?   ?   A . n 
A 1 13  HIS 13  9   ?   ?   ?   A . n 
A 1 14  GLY 14  10  ?   ?   ?   A . n 
A 1 15  GLU 15  11  ?   ?   ?   A . n 
A 1 16  GLU 16  12  ?   ?   ?   A . n 
A 1 17  MET 17  13  ?   ?   ?   A . n 
A 1 18  MET 18  14  ?   ?   ?   A . n 
A 1 19  ALA 19  15  ?   ?   ?   A . n 
A 1 20  ALA 20  16  ?   ?   ?   A . n 
A 1 21  VAL 21  17  ?   ?   ?   A . n 
A 1 22  PRO 22  18  ?   ?   ?   A . n 
A 1 23  ALA 23  19  ?   ?   ?   A . n 
A 1 24  PRO 24  20  ?   ?   ?   A . n 
A 1 25  ASP 25  21  ?   ?   ?   A . n 
A 1 26  ALA 26  22  ?   ?   ?   A . n 
A 1 27  GLU 27  23  ?   ?   ?   A . n 
A 1 28  GLY 28  24  ?   ?   ?   A . n 
A 1 29  ALA 29  25  ?   ?   ?   A . n 
A 1 30  ALA 30  26  ?   ?   ?   A . n 
A 1 31  GLY 31  27  ?   ?   ?   A . n 
A 1 32  PHE 32  28  ?   ?   ?   A . n 
A 1 33  ASP 33  29  29  ASP ASP A . n 
A 1 34  GLU 34  30  30  GLU GLU A . n 
A 1 35  PHE 35  31  31  PHE PHE A . n 
A 1 36  PRO 36  32  32  PRO PRO A . n 
A 1 37  ILE 37  33  33  ILE ILE A . n 
A 1 38  GLY 38  34  34  GLY GLY A . n 
A 1 39  GLU 39  35  35  GLU GLU A . n 
A 1 40  ASP 40  36  36  ASP ASP A . n 
A 1 41  ARG 41  37  37  ARG ARG A . n 
A 1 42  ASP 42  38  38  ASP ASP A . n 
A 1 43  VAL 43  39  39  VAL VAL A . n 
A 1 44  GLY 44  40  40  GLY GLY A . n 
A 1 45  PRO 45  41  41  PRO PRO A . n 
A 1 46  LEU 46  42  42  LEU LEU A . n 
A 1 47  HIS 47  43  43  HIS HIS A . n 
A 1 48  VAL 48  44  44  VAL VAL A . n 
A 1 49  GLY 49  45  45  GLY GLY A . n 
A 1 50  GLY 50  46  46  GLY GLY A . n 
A 1 51  VAL 51  47  47  VAL VAL A . n 
A 1 52  TYR 52  48  48  TYR TYR A . n 
A 1 53  PHE 53  49  49  PHE PHE A . n 
A 1 54  GLN 54  50  50  GLN GLN A . n 
A 1 55  PRO 55  51  51  PRO PRO A . n 
A 1 56  VAL 56  52  52  VAL VAL A . n 
A 1 57  GLU 57  53  53  GLU GLU A . n 
A 1 58  MET 58  54  54  MET MET A . n 
A 1 59  HIS 59  55  55  HIS HIS A . n 
A 1 60  PRO 60  56  56  PRO PRO A . n 
A 1 61  ALA 61  57  57  ALA ALA A . n 
A 1 62  PRO 62  58  58  PRO PRO A . n 
A 1 63  GLY 63  59  59  GLY GLY A . n 
A 1 64  ALA 64  60  60  ALA ALA A . n 
A 1 65  GLN 65  61  61  GLN GLN A . n 
A 1 66  PRO 66  62  62  PRO PRO A . n 
A 1 67  SER 67  63  63  SER SER A . n 
A 1 68  LYS 68  64  64  LYS LYS A . n 
A 1 69  GLU 69  65  65  GLU GLU A . n 
A 1 70  GLU 70  66  66  GLU GLU A . n 
A 1 71  ALA 71  67  67  ALA ALA A . n 
A 1 72  ASP 72  68  68  ASP ASP A . n 
A 1 73  CYS 73  69  69  CYS CYS A . n 
A 1 74  HIS 74  70  70  HIS HIS A . n 
A 1 75  ILE 75  71  71  ILE ILE A . n 
A 1 76  GLU 76  72  72  GLU GLU A . n 
A 1 77  ALA 77  73  73  ALA ALA A . n 
A 1 78  ASP 78  74  74  ASP ASP A . n 
A 1 79  ILE 79  75  75  ILE ILE A . n 
A 1 80  HIS 80  76  76  HIS HIS A . n 
A 1 81  ALA 81  77  77  ALA ALA A . n 
A 1 82  ASN 82  78  78  ASN ASN A . n 
A 1 83  GLU 83  79  79  GLU GLU A . n 
A 1 84  ALA 84  80  80  ALA ALA A . n 
A 1 85  GLY 85  81  81  GLY GLY A . n 
A 1 86  LYS 86  82  82  LYS LYS A . n 
A 1 87  ASP 87  83  83  ASP ASP A . n 
A 1 88  LEU 88  84  84  LEU LEU A . n 
A 1 89  GLY 89  85  85  GLY GLY A . n 
A 1 90  TYR 90  86  86  TYR TYR A . n 
A 1 91  GLY 91  87  87  GLY GLY A . n 
A 1 92  VAL 92  88  88  VAL VAL A . n 
A 1 93  GLY 93  89  89  GLY GLY A . n 
A 1 94  ASP 94  90  90  ASP ASP A . n 
A 1 95  PHE 95  91  91  PHE PHE A . n 
A 1 96  VAL 96  92  92  VAL VAL A . n 
A 1 97  PRO 97  93  93  PRO PRO A . n 
A 1 98  TYR 98  94  94  TYR TYR A . n 
A 1 99  LEU 99  95  95  LEU LEU A . n 
A 1 100 ARG 100 96  96  ARG ARG A . n 
A 1 101 VAL 101 97  97  VAL VAL A . n 
A 1 102 VAL 102 98  98  VAL VAL A . n 
A 1 103 ALA 103 99  99  ALA ALA A . n 
A 1 104 PHE 104 100 100 PHE PHE A . n 
A 1 105 LEU 105 101 101 LEU LEU A . n 
A 1 106 GLN 106 102 102 GLN GLN A . n 
A 1 107 LYS 107 103 103 LYS LYS A . n 
A 1 108 HIS 108 104 104 HIS HIS A . n 
A 1 109 GLY 109 105 105 GLY GLY A . n 
A 1 110 SER 110 106 106 SER SER A . n 
A 1 111 GLU 111 107 107 GLU GLU A . n 
A 1 112 LYS 112 108 108 LYS LYS A . n 
A 1 113 VAL 113 109 109 VAL VAL A . n 
A 1 114 GLN 114 110 110 GLN GLN A . n 
A 1 115 LYS 115 111 111 LYS LYS A . n 
A 1 116 VAL 116 112 112 VAL VAL A . n 
A 1 117 MET 117 113 113 MET MET A . n 
A 1 118 PHE 118 114 114 PHE PHE A . n 
A 1 119 ALA 119 115 115 ALA ALA A . n 
A 1 120 PRO 120 116 116 PRO PRO A . n 
A 1 121 MET 121 117 117 MET MET A . n 
A 1 122 ASN 122 118 118 ASN ASN A . n 
A 1 123 ALA 123 119 119 ALA ALA A . n 
A 1 124 GLY 124 120 120 GLY GLY A . n 
A 1 125 ASP 125 121 121 ASP ASP A . n 
A 1 126 GLY 126 122 122 GLY GLY A . n 
A 1 127 PRO 127 123 123 PRO PRO A . n 
A 1 128 HIS 128 124 124 HIS HIS A . n 
A 1 129 TYR 129 125 125 TYR TYR A . n 
A 1 130 GLY 130 126 126 GLY GLY A . n 
A 1 131 ALA 131 127 127 ALA ALA A . n 
A 1 132 ASN 132 128 128 ASN ASN A . n 
A 1 133 VAL 133 129 129 VAL VAL A . n 
A 1 134 LYS 134 130 130 LYS LYS A . n 
A 1 135 PHE 135 131 131 PHE PHE A . n 
A 1 136 GLU 136 132 132 GLU GLU A . n 
A 1 137 GLU 137 133 133 GLU GLU A . n 
A 1 138 GLY 138 134 134 GLY GLY A . n 
A 1 139 LEU 139 135 135 LEU LEU A . n 
A 1 140 GLY 140 136 136 GLY GLY A . n 
A 1 141 THR 141 137 137 THR THR A . n 
A 1 142 TYR 142 138 138 TYR TYR A . n 
A 1 143 LYS 143 139 139 LYS LYS A . n 
A 1 144 VAL 144 140 140 VAL VAL A . n 
A 1 145 ARG 145 141 141 ARG ARG A . n 
A 1 146 PHE 146 142 142 PHE PHE A . n 
A 1 147 GLU 147 143 143 GLU GLU A . n 
A 1 148 ILE 148 144 144 ILE ILE A . n 
A 1 149 ALA 149 145 145 ALA ALA A . n 
A 1 150 ALA 150 146 146 ALA ALA A . n 
A 1 151 PRO 151 147 147 PRO PRO A . n 
A 1 152 SER 152 148 148 SER SER A . n 
A 1 153 HIS 153 149 149 HIS HIS A . n 
A 1 154 ASP 154 150 150 ASP ASP A . n 
A 1 155 GLU 155 151 151 GLU GLU A . n 
A 1 156 TYR 156 152 152 TYR TYR A . n 
A 1 157 SER 157 153 153 SER SER A . n 
A 1 158 LEU 158 154 154 LEU LEU A . n 
A 1 159 HIS 159 155 155 HIS HIS A . n 
A 1 160 ILE 160 156 156 ILE ILE A . n 
A 1 161 ASP 161 157 157 ASP ASP A . n 
A 1 162 GLU 162 158 158 GLU GLU A . n 
A 1 163 GLN 163 159 159 GLN GLN A . n 
A 1 164 THR 164 160 160 THR THR A . n 
A 1 165 GLY 165 161 161 GLY GLY A . n 
A 1 166 VAL 166 162 162 VAL VAL A . n 
A 1 167 SER 167 163 163 SER SER A . n 
A 1 168 GLY 168 164 164 GLY GLY A . n 
A 1 169 ARG 169 165 165 ARG ARG A . n 
A 1 170 PHE 170 166 166 PHE PHE A . n 
A 1 171 TRP 171 167 167 TRP TRP A . n 
A 1 172 SER 172 168 168 SER SER A . n 
A 1 173 GLU 173 169 169 GLU GLU A . n 
A 1 174 PRO 174 170 170 PRO PRO A . n 
A 1 175 LEU 175 171 171 LEU LEU A . n 
A 1 176 VAL 176 172 172 VAL VAL A . n 
A 1 177 ALA 177 173 173 ALA ALA A . n 
A 1 178 GLU 178 174 174 GLU GLU A . n 
A 1 179 TRP 179 175 175 TRP TRP A . n 
A 1 180 ASP 180 176 176 ASP ASP A . n 
A 1 181 ASP 181 177 177 ASP ASP A . n 
A 1 182 PHE 182 178 178 PHE PHE A . n 
A 1 183 GLU 183 179 179 GLU GLU A . n 
A 1 184 TRP 184 180 180 TRP TRP A . n 
A 1 185 LYS 185 181 181 LYS LYS A . n 
A 1 186 GLY 186 182 182 GLY GLY A . n 
A 1 187 PRO 187 183 183 PRO PRO A . n 
A 1 188 GLN 188 184 184 GLN GLN A . n 
A 1 189 TRP 189 185 185 TRP TRP A . n 
B 1 1   GLY 1   -3  ?   ?   ?   B . n 
B 1 2   ALA 2   -2  ?   ?   ?   B . n 
B 1 3   MET 3   -1  ?   ?   ?   B . n 
B 1 4   GLY 4   0   ?   ?   ?   B . n 
B 1 5   SER 5   1   ?   ?   ?   B . n 
B 1 6   GLY 6   2   ?   ?   ?   B . n 
B 1 7   GLY 7   3   ?   ?   ?   B . n 
B 1 8   GLY 8   4   ?   ?   ?   B . n 
B 1 9   GLY 9   5   ?   ?   ?   B . n 
B 1 10  GLU 10  6   ?   ?   ?   B . n 
B 1 11  HIS 11  7   ?   ?   ?   B . n 
B 1 12  GLN 12  8   ?   ?   ?   B . n 
B 1 13  HIS 13  9   ?   ?   ?   B . n 
B 1 14  GLY 14  10  ?   ?   ?   B . n 
B 1 15  GLU 15  11  ?   ?   ?   B . n 
B 1 16  GLU 16  12  ?   ?   ?   B . n 
B 1 17  MET 17  13  ?   ?   ?   B . n 
B 1 18  MET 18  14  ?   ?   ?   B . n 
B 1 19  ALA 19  15  ?   ?   ?   B . n 
B 1 20  ALA 20  16  ?   ?   ?   B . n 
B 1 21  VAL 21  17  ?   ?   ?   B . n 
B 1 22  PRO 22  18  ?   ?   ?   B . n 
B 1 23  ALA 23  19  ?   ?   ?   B . n 
B 1 24  PRO 24  20  ?   ?   ?   B . n 
B 1 25  ASP 25  21  ?   ?   ?   B . n 
B 1 26  ALA 26  22  ?   ?   ?   B . n 
B 1 27  GLU 27  23  ?   ?   ?   B . n 
B 1 28  GLY 28  24  ?   ?   ?   B . n 
B 1 29  ALA 29  25  ?   ?   ?   B . n 
B 1 30  ALA 30  26  ?   ?   ?   B . n 
B 1 31  GLY 31  27  ?   ?   ?   B . n 
B 1 32  PHE 32  28  ?   ?   ?   B . n 
B 1 33  ASP 33  29  29  ASP ASP B . n 
B 1 34  GLU 34  30  30  GLU GLU B . n 
B 1 35  PHE 35  31  31  PHE PHE B . n 
B 1 36  PRO 36  32  32  PRO PRO B . n 
B 1 37  ILE 37  33  33  ILE ILE B . n 
B 1 38  GLY 38  34  34  GLY GLY B . n 
B 1 39  GLU 39  35  35  GLU GLU B . n 
B 1 40  ASP 40  36  36  ASP ASP B . n 
B 1 41  ARG 41  37  37  ARG ARG B . n 
B 1 42  ASP 42  38  38  ASP ASP B . n 
B 1 43  VAL 43  39  39  VAL VAL B . n 
B 1 44  GLY 44  40  40  GLY GLY B . n 
B 1 45  PRO 45  41  41  PRO PRO B . n 
B 1 46  LEU 46  42  42  LEU LEU B . n 
B 1 47  HIS 47  43  43  HIS HIS B . n 
B 1 48  VAL 48  44  44  VAL VAL B . n 
B 1 49  GLY 49  45  45  GLY GLY B . n 
B 1 50  GLY 50  46  46  GLY GLY B . n 
B 1 51  VAL 51  47  47  VAL VAL B . n 
B 1 52  TYR 52  48  48  TYR TYR B . n 
B 1 53  PHE 53  49  49  PHE PHE B . n 
B 1 54  GLN 54  50  50  GLN GLN B . n 
B 1 55  PRO 55  51  51  PRO PRO B . n 
B 1 56  VAL 56  52  52  VAL VAL B . n 
B 1 57  GLU 57  53  53  GLU GLU B . n 
B 1 58  MET 58  54  54  MET MET B . n 
B 1 59  HIS 59  55  55  HIS HIS B . n 
B 1 60  PRO 60  56  56  PRO PRO B . n 
B 1 61  ALA 61  57  57  ALA ALA B . n 
B 1 62  PRO 62  58  58  PRO PRO B . n 
B 1 63  GLY 63  59  59  GLY GLY B . n 
B 1 64  ALA 64  60  60  ALA ALA B . n 
B 1 65  GLN 65  61  61  GLN GLN B . n 
B 1 66  PRO 66  62  62  PRO PRO B . n 
B 1 67  SER 67  63  63  SER SER B . n 
B 1 68  LYS 68  64  64  LYS LYS B . n 
B 1 69  GLU 69  65  65  GLU GLU B . n 
B 1 70  GLU 70  66  66  GLU GLU B . n 
B 1 71  ALA 71  67  67  ALA ALA B . n 
B 1 72  ASP 72  68  68  ASP ASP B . n 
B 1 73  CYS 73  69  69  CYS CYS B . n 
B 1 74  HIS 74  70  70  HIS HIS B . n 
B 1 75  ILE 75  71  71  ILE ILE B . n 
B 1 76  GLU 76  72  72  GLU GLU B . n 
B 1 77  ALA 77  73  73  ALA ALA B . n 
B 1 78  ASP 78  74  74  ASP ASP B . n 
B 1 79  ILE 79  75  75  ILE ILE B . n 
B 1 80  HIS 80  76  76  HIS HIS B . n 
B 1 81  ALA 81  77  77  ALA ALA B . n 
B 1 82  ASN 82  78  78  ASN ASN B . n 
B 1 83  GLU 83  79  79  GLU GLU B . n 
B 1 84  ALA 84  80  80  ALA ALA B . n 
B 1 85  GLY 85  81  81  GLY GLY B . n 
B 1 86  LYS 86  82  82  LYS LYS B . n 
B 1 87  ASP 87  83  83  ASP ASP B . n 
B 1 88  LEU 88  84  84  LEU LEU B . n 
B 1 89  GLY 89  85  85  GLY GLY B . n 
B 1 90  TYR 90  86  86  TYR TYR B . n 
B 1 91  GLY 91  87  87  GLY GLY B . n 
B 1 92  VAL 92  88  88  VAL VAL B . n 
B 1 93  GLY 93  89  89  GLY GLY B . n 
B 1 94  ASP 94  90  90  ASP ASP B . n 
B 1 95  PHE 95  91  91  PHE PHE B . n 
B 1 96  VAL 96  92  92  VAL VAL B . n 
B 1 97  PRO 97  93  93  PRO PRO B . n 
B 1 98  TYR 98  94  94  TYR TYR B . n 
B 1 99  LEU 99  95  95  LEU LEU B . n 
B 1 100 ARG 100 96  96  ARG ARG B . n 
B 1 101 VAL 101 97  97  VAL VAL B . n 
B 1 102 VAL 102 98  98  VAL VAL B . n 
B 1 103 ALA 103 99  99  ALA ALA B . n 
B 1 104 PHE 104 100 100 PHE PHE B . n 
B 1 105 LEU 105 101 101 LEU LEU B . n 
B 1 106 GLN 106 102 102 GLN GLN B . n 
B 1 107 LYS 107 103 103 LYS LYS B . n 
B 1 108 HIS 108 104 104 HIS HIS B . n 
B 1 109 GLY 109 105 105 GLY GLY B . n 
B 1 110 SER 110 106 106 SER SER B . n 
B 1 111 GLU 111 107 107 GLU GLU B . n 
B 1 112 LYS 112 108 108 LYS LYS B . n 
B 1 113 VAL 113 109 109 VAL VAL B . n 
B 1 114 GLN 114 110 110 GLN GLN B . n 
B 1 115 LYS 115 111 111 LYS LYS B . n 
B 1 116 VAL 116 112 112 VAL VAL B . n 
B 1 117 MET 117 113 113 MET MET B . n 
B 1 118 PHE 118 114 114 PHE PHE B . n 
B 1 119 ALA 119 115 115 ALA ALA B . n 
B 1 120 PRO 120 116 116 PRO PRO B . n 
B 1 121 MET 121 117 117 MET MET B . n 
B 1 122 ASN 122 118 118 ASN ASN B . n 
B 1 123 ALA 123 119 119 ALA ALA B . n 
B 1 124 GLY 124 120 120 GLY GLY B . n 
B 1 125 ASP 125 121 121 ASP ASP B . n 
B 1 126 GLY 126 122 122 GLY GLY B . n 
B 1 127 PRO 127 123 123 PRO PRO B . n 
B 1 128 HIS 128 124 124 HIS HIS B . n 
B 1 129 TYR 129 125 125 TYR TYR B . n 
B 1 130 GLY 130 126 126 GLY GLY B . n 
B 1 131 ALA 131 127 127 ALA ALA B . n 
B 1 132 ASN 132 128 128 ASN ASN B . n 
B 1 133 VAL 133 129 129 VAL VAL B . n 
B 1 134 LYS 134 130 130 LYS LYS B . n 
B 1 135 PHE 135 131 131 PHE PHE B . n 
B 1 136 GLU 136 132 132 GLU GLU B . n 
B 1 137 GLU 137 133 133 GLU GLU B . n 
B 1 138 GLY 138 134 134 GLY GLY B . n 
B 1 139 LEU 139 135 135 LEU LEU B . n 
B 1 140 GLY 140 136 136 GLY GLY B . n 
B 1 141 THR 141 137 137 THR THR B . n 
B 1 142 TYR 142 138 138 TYR TYR B . n 
B 1 143 LYS 143 139 139 LYS LYS B . n 
B 1 144 VAL 144 140 140 VAL VAL B . n 
B 1 145 ARG 145 141 141 ARG ARG B . n 
B 1 146 PHE 146 142 142 PHE PHE B . n 
B 1 147 GLU 147 143 143 GLU GLU B . n 
B 1 148 ILE 148 144 144 ILE ILE B . n 
B 1 149 ALA 149 145 145 ALA ALA B . n 
B 1 150 ALA 150 146 146 ALA ALA B . n 
B 1 151 PRO 151 147 147 PRO PRO B . n 
B 1 152 SER 152 148 148 SER SER B . n 
B 1 153 HIS 153 149 149 HIS HIS B . n 
B 1 154 ASP 154 150 150 ASP ASP B . n 
B 1 155 GLU 155 151 151 GLU GLU B . n 
B 1 156 TYR 156 152 152 TYR TYR B . n 
B 1 157 SER 157 153 153 SER SER B . n 
B 1 158 LEU 158 154 154 LEU LEU B . n 
B 1 159 HIS 159 155 155 HIS HIS B . n 
B 1 160 ILE 160 156 156 ILE ILE B . n 
B 1 161 ASP 161 157 157 ASP ASP B . n 
B 1 162 GLU 162 158 158 GLU GLU B . n 
B 1 163 GLN 163 159 159 GLN GLN B . n 
B 1 164 THR 164 160 160 THR THR B . n 
B 1 165 GLY 165 161 161 GLY GLY B . n 
B 1 166 VAL 166 162 162 VAL VAL B . n 
B 1 167 SER 167 163 163 SER SER B . n 
B 1 168 GLY 168 164 164 GLY GLY B . n 
B 1 169 ARG 169 165 165 ARG ARG B . n 
B 1 170 PHE 170 166 166 PHE PHE B . n 
B 1 171 TRP 171 167 167 TRP TRP B . n 
B 1 172 SER 172 168 168 SER SER B . n 
B 1 173 GLU 173 169 169 GLU GLU B . n 
B 1 174 PRO 174 170 170 PRO PRO B . n 
B 1 175 LEU 175 171 171 LEU LEU B . n 
B 1 176 VAL 176 172 172 VAL VAL B . n 
B 1 177 ALA 177 173 173 ALA ALA B . n 
B 1 178 GLU 178 174 174 GLU GLU B . n 
B 1 179 TRP 179 175 175 TRP TRP B . n 
B 1 180 ASP 180 176 176 ASP ASP B . n 
B 1 181 ASP 181 177 177 ASP ASP B . n 
B 1 182 PHE 182 178 178 PHE PHE B . n 
B 1 183 GLU 183 179 179 GLU GLU B . n 
B 1 184 TRP 184 180 180 TRP TRP B . n 
B 1 185 LYS 185 181 181 LYS LYS B . n 
B 1 186 GLY 186 182 182 GLY GLY B . n 
B 1 187 PRO 187 183 183 PRO PRO B . n 
B 1 188 GLN 188 184 184 GLN GLN B . n 
B 1 189 TRP 189 185 185 TRP TRP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 SO4 1   501 501 SO4 SO4 A . 
D 3 CL  1   302 302 CL  CL  A . 
E 3 CL  1   303 303 CL  CL  A . 
F 4 EDO 1   401 401 EDO EDO A . 
G 4 EDO 1   402 402 EDO EDO A . 
H 2 SO4 1   502 502 SO4 SO4 B . 
I 3 CL  1   301 301 CL  CL  B . 
J 5 HOH 1   502 1   HOH HOH A . 
J 5 HOH 2   503 2   HOH HOH A . 
J 5 HOH 3   504 3   HOH HOH A . 
J 5 HOH 4   505 4   HOH HOH A . 
J 5 HOH 5   506 5   HOH HOH A . 
J 5 HOH 6   507 8   HOH HOH A . 
J 5 HOH 7   508 9   HOH HOH A . 
J 5 HOH 8   509 10  HOH HOH A . 
J 5 HOH 9   510 11  HOH HOH A . 
J 5 HOH 10  511 12  HOH HOH A . 
J 5 HOH 11  512 13  HOH HOH A . 
J 5 HOH 12  513 14  HOH HOH A . 
J 5 HOH 13  514 15  HOH HOH A . 
J 5 HOH 14  515 18  HOH HOH A . 
J 5 HOH 15  516 19  HOH HOH A . 
J 5 HOH 16  517 20  HOH HOH A . 
J 5 HOH 17  518 22  HOH HOH A . 
J 5 HOH 18  519 24  HOH HOH A . 
J 5 HOH 19  520 25  HOH HOH A . 
J 5 HOH 20  521 26  HOH HOH A . 
J 5 HOH 21  522 27  HOH HOH A . 
J 5 HOH 22  523 28  HOH HOH A . 
J 5 HOH 23  524 29  HOH HOH A . 
J 5 HOH 24  525 30  HOH HOH A . 
J 5 HOH 25  526 31  HOH HOH A . 
J 5 HOH 26  527 32  HOH HOH A . 
J 5 HOH 27  528 33  HOH HOH A . 
J 5 HOH 28  529 34  HOH HOH A . 
J 5 HOH 29  530 35  HOH HOH A . 
J 5 HOH 30  531 36  HOH HOH A . 
J 5 HOH 31  532 37  HOH HOH A . 
J 5 HOH 32  533 38  HOH HOH A . 
J 5 HOH 33  534 39  HOH HOH A . 
J 5 HOH 34  535 40  HOH HOH A . 
J 5 HOH 35  536 42  HOH HOH A . 
J 5 HOH 36  537 43  HOH HOH A . 
J 5 HOH 37  538 44  HOH HOH A . 
J 5 HOH 38  539 49  HOH HOH A . 
J 5 HOH 39  540 50  HOH HOH A . 
J 5 HOH 40  541 51  HOH HOH A . 
J 5 HOH 41  542 54  HOH HOH A . 
J 5 HOH 42  543 55  HOH HOH A . 
J 5 HOH 43  544 56  HOH HOH A . 
J 5 HOH 44  545 57  HOH HOH A . 
J 5 HOH 45  546 58  HOH HOH A . 
J 5 HOH 46  547 59  HOH HOH A . 
J 5 HOH 47  548 61  HOH HOH A . 
J 5 HOH 48  549 62  HOH HOH A . 
J 5 HOH 49  550 63  HOH HOH A . 
J 5 HOH 50  551 65  HOH HOH A . 
J 5 HOH 51  552 67  HOH HOH A . 
J 5 HOH 52  553 69  HOH HOH A . 
J 5 HOH 53  554 71  HOH HOH A . 
J 5 HOH 54  555 72  HOH HOH A . 
J 5 HOH 55  556 73  HOH HOH A . 
J 5 HOH 56  557 74  HOH HOH A . 
J 5 HOH 57  558 75  HOH HOH A . 
J 5 HOH 58  559 76  HOH HOH A . 
J 5 HOH 59  560 77  HOH HOH A . 
J 5 HOH 60  561 81  HOH HOH A . 
J 5 HOH 61  562 83  HOH HOH A . 
J 5 HOH 62  563 85  HOH HOH A . 
J 5 HOH 63  564 86  HOH HOH A . 
J 5 HOH 64  565 88  HOH HOH A . 
J 5 HOH 65  566 91  HOH HOH A . 
J 5 HOH 66  567 92  HOH HOH A . 
J 5 HOH 67  568 93  HOH HOH A . 
J 5 HOH 68  569 94  HOH HOH A . 
J 5 HOH 69  570 100 HOH HOH A . 
J 5 HOH 70  571 101 HOH HOH A . 
J 5 HOH 71  572 102 HOH HOH A . 
J 5 HOH 72  573 104 HOH HOH A . 
J 5 HOH 73  574 106 HOH HOH A . 
J 5 HOH 74  575 107 HOH HOH A . 
J 5 HOH 75  576 108 HOH HOH A . 
J 5 HOH 76  577 109 HOH HOH A . 
J 5 HOH 77  578 110 HOH HOH A . 
J 5 HOH 78  579 114 HOH HOH A . 
J 5 HOH 79  580 117 HOH HOH A . 
J 5 HOH 80  581 120 HOH HOH A . 
J 5 HOH 81  582 121 HOH HOH A . 
J 5 HOH 82  583 122 HOH HOH A . 
J 5 HOH 83  584 126 HOH HOH A . 
J 5 HOH 84  585 127 HOH HOH A . 
J 5 HOH 85  586 128 HOH HOH A . 
J 5 HOH 86  587 131 HOH HOH A . 
J 5 HOH 87  588 133 HOH HOH A . 
J 5 HOH 88  589 135 HOH HOH A . 
J 5 HOH 89  590 136 HOH HOH A . 
J 5 HOH 90  591 138 HOH HOH A . 
J 5 HOH 91  592 141 HOH HOH A . 
J 5 HOH 92  593 142 HOH HOH A . 
J 5 HOH 93  594 144 HOH HOH A . 
J 5 HOH 94  595 146 HOH HOH A . 
J 5 HOH 95  596 150 HOH HOH A . 
J 5 HOH 96  597 152 HOH HOH A . 
J 5 HOH 97  598 155 HOH HOH A . 
J 5 HOH 98  599 158 HOH HOH A . 
J 5 HOH 99  600 159 HOH HOH A . 
J 5 HOH 100 601 161 HOH HOH A . 
J 5 HOH 101 602 164 HOH HOH A . 
J 5 HOH 102 603 165 HOH HOH A . 
J 5 HOH 103 604 167 HOH HOH A . 
J 5 HOH 104 605 169 HOH HOH A . 
J 5 HOH 105 606 170 HOH HOH A . 
J 5 HOH 106 607 171 HOH HOH A . 
J 5 HOH 107 608 172 HOH HOH A . 
J 5 HOH 108 609 173 HOH HOH A . 
J 5 HOH 109 610 175 HOH HOH A . 
J 5 HOH 110 611 176 HOH HOH A . 
J 5 HOH 111 612 177 HOH HOH A . 
J 5 HOH 112 613 178 HOH HOH A . 
J 5 HOH 113 614 179 HOH HOH A . 
J 5 HOH 114 615 180 HOH HOH A . 
J 5 HOH 115 616 181 HOH HOH A . 
J 5 HOH 116 617 183 HOH HOH A . 
J 5 HOH 117 618 185 HOH HOH A . 
J 5 HOH 118 619 186 HOH HOH A . 
J 5 HOH 119 620 187 HOH HOH A . 
J 5 HOH 120 621 189 HOH HOH A . 
J 5 HOH 121 622 192 HOH HOH A . 
J 5 HOH 122 623 194 HOH HOH A . 
J 5 HOH 123 624 195 HOH HOH A . 
J 5 HOH 124 625 200 HOH HOH A . 
J 5 HOH 125 626 203 HOH HOH A . 
J 5 HOH 126 627 205 HOH HOH A . 
J 5 HOH 127 628 206 HOH HOH A . 
J 5 HOH 128 629 207 HOH HOH A . 
J 5 HOH 129 630 208 HOH HOH A . 
J 5 HOH 130 631 209 HOH HOH A . 
J 5 HOH 131 632 210 HOH HOH A . 
J 5 HOH 132 633 214 HOH HOH A . 
J 5 HOH 133 634 216 HOH HOH A . 
J 5 HOH 134 635 217 HOH HOH A . 
J 5 HOH 135 636 223 HOH HOH A . 
J 5 HOH 136 637 224 HOH HOH A . 
J 5 HOH 137 638 225 HOH HOH A . 
J 5 HOH 138 639 228 HOH HOH A . 
J 5 HOH 139 640 229 HOH HOH A . 
J 5 HOH 140 641 233 HOH HOH A . 
J 5 HOH 141 642 236 HOH HOH A . 
J 5 HOH 142 643 237 HOH HOH A . 
J 5 HOH 143 644 241 HOH HOH A . 
J 5 HOH 144 645 244 HOH HOH A . 
J 5 HOH 145 646 245 HOH HOH A . 
J 5 HOH 146 647 246 HOH HOH A . 
J 5 HOH 147 648 252 HOH HOH A . 
J 5 HOH 148 649 255 HOH HOH A . 
J 5 HOH 149 650 258 HOH HOH A . 
J 5 HOH 150 651 259 HOH HOH A . 
K 5 HOH 1   503 6   HOH HOH B . 
K 5 HOH 2   504 7   HOH HOH B . 
K 5 HOH 3   505 16  HOH HOH B . 
K 5 HOH 4   506 17  HOH HOH B . 
K 5 HOH 5   507 21  HOH HOH B . 
K 5 HOH 6   508 23  HOH HOH B . 
K 5 HOH 7   509 41  HOH HOH B . 
K 5 HOH 8   510 45  HOH HOH B . 
K 5 HOH 9   511 46  HOH HOH B . 
K 5 HOH 10  512 47  HOH HOH B . 
K 5 HOH 11  513 48  HOH HOH B . 
K 5 HOH 12  514 52  HOH HOH B . 
K 5 HOH 13  515 53  HOH HOH B . 
K 5 HOH 14  516 60  HOH HOH B . 
K 5 HOH 15  517 64  HOH HOH B . 
K 5 HOH 16  518 66  HOH HOH B . 
K 5 HOH 17  519 68  HOH HOH B . 
K 5 HOH 18  520 70  HOH HOH B . 
K 5 HOH 19  521 78  HOH HOH B . 
K 5 HOH 20  522 79  HOH HOH B . 
K 5 HOH 21  523 80  HOH HOH B . 
K 5 HOH 22  524 82  HOH HOH B . 
K 5 HOH 23  525 84  HOH HOH B . 
K 5 HOH 24  526 87  HOH HOH B . 
K 5 HOH 25  527 89  HOH HOH B . 
K 5 HOH 26  528 90  HOH HOH B . 
K 5 HOH 27  529 95  HOH HOH B . 
K 5 HOH 28  530 96  HOH HOH B . 
K 5 HOH 29  531 97  HOH HOH B . 
K 5 HOH 30  532 98  HOH HOH B . 
K 5 HOH 31  533 99  HOH HOH B . 
K 5 HOH 32  534 103 HOH HOH B . 
K 5 HOH 33  535 105 HOH HOH B . 
K 5 HOH 34  536 111 HOH HOH B . 
K 5 HOH 35  537 112 HOH HOH B . 
K 5 HOH 36  538 113 HOH HOH B . 
K 5 HOH 37  539 115 HOH HOH B . 
K 5 HOH 38  540 116 HOH HOH B . 
K 5 HOH 39  541 118 HOH HOH B . 
K 5 HOH 40  542 119 HOH HOH B . 
K 5 HOH 41  543 123 HOH HOH B . 
K 5 HOH 42  544 124 HOH HOH B . 
K 5 HOH 43  545 125 HOH HOH B . 
K 5 HOH 44  546 129 HOH HOH B . 
K 5 HOH 45  547 130 HOH HOH B . 
K 5 HOH 46  548 132 HOH HOH B . 
K 5 HOH 47  549 134 HOH HOH B . 
K 5 HOH 48  550 137 HOH HOH B . 
K 5 HOH 49  551 139 HOH HOH B . 
K 5 HOH 50  552 140 HOH HOH B . 
K 5 HOH 51  553 143 HOH HOH B . 
K 5 HOH 52  554 145 HOH HOH B . 
K 5 HOH 53  555 147 HOH HOH B . 
K 5 HOH 54  556 148 HOH HOH B . 
K 5 HOH 55  557 149 HOH HOH B . 
K 5 HOH 56  558 151 HOH HOH B . 
K 5 HOH 57  559 153 HOH HOH B . 
K 5 HOH 58  560 154 HOH HOH B . 
K 5 HOH 59  561 156 HOH HOH B . 
K 5 HOH 60  562 157 HOH HOH B . 
K 5 HOH 61  563 160 HOH HOH B . 
K 5 HOH 62  564 162 HOH HOH B . 
K 5 HOH 63  565 163 HOH HOH B . 
K 5 HOH 64  566 166 HOH HOH B . 
K 5 HOH 65  567 168 HOH HOH B . 
K 5 HOH 66  568 174 HOH HOH B . 
K 5 HOH 67  569 182 HOH HOH B . 
K 5 HOH 68  570 184 HOH HOH B . 
K 5 HOH 69  571 188 HOH HOH B . 
K 5 HOH 70  572 190 HOH HOH B . 
K 5 HOH 71  573 191 HOH HOH B . 
K 5 HOH 72  574 193 HOH HOH B . 
K 5 HOH 73  575 196 HOH HOH B . 
K 5 HOH 74  576 197 HOH HOH B . 
K 5 HOH 75  577 198 HOH HOH B . 
K 5 HOH 76  578 199 HOH HOH B . 
K 5 HOH 77  579 201 HOH HOH B . 
K 5 HOH 78  580 202 HOH HOH B . 
K 5 HOH 79  581 204 HOH HOH B . 
K 5 HOH 80  582 211 HOH HOH B . 
K 5 HOH 81  583 213 HOH HOH B . 
K 5 HOH 82  584 218 HOH HOH B . 
K 5 HOH 83  585 219 HOH HOH B . 
K 5 HOH 84  586 230 HOH HOH B . 
K 5 HOH 85  587 240 HOH HOH B . 
K 5 HOH 86  588 242 HOH HOH B . 
K 5 HOH 87  589 249 HOH HOH B . 
K 5 HOH 88  590 254 HOH HOH B . 
K 5 HOH 89  591 256 HOH HOH B . 
K 5 HOH 90  592 260 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4070  ? 
1 MORE         -66   ? 
1 'SSA (A^2)'  15130 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-12-26 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 10.7720 41.3374 61.2894 -0.1039 -0.0129 -0.0309 -0.0076 -0.0131 -0.0321 0.3988 1.0475 1.4054 0.2681 0.7280 0.7401 
-0.0040 0.0353  -0.0313 -0.0344 0.0029  0.0057  -0.1360 -0.0461 -0.0126 'X-RAY DIFFRACTION' 
2 ? refined 6.4253  14.8674 52.4198 0.0981  -0.0510 -0.0249 -0.0291 -0.1038 0.0041  0.6199 1.5299 1.3796 0.6558 0.6146 1.3508 
0.1993  -0.0254 -0.1739 -0.0902 -0.1113 -0.1233 0.2530  0.2978  -0.0492 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 33 A 189 ALL A 29 A 185 'X-RAY DIFFRACTION' ? 
2 2 B 33 B 189 ALL B 29 B 185 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.2.0005 ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000    'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-3000    .        ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
HKL-3000    .        ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
HKL-3000    .        ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .        ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OD2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    74 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   A 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    583 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              90 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              90 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              90 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                112.67 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            -5.63 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE B 49  ? ? -165.78 -169.31 
2 1 GLN B 159 ? ? 72.96   -49.41  
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   ALA 
_pdbx_validate_peptide_omega.auth_asym_id_1   B 
_pdbx_validate_peptide_omega.auth_seq_id_1    80 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_2   B 
_pdbx_validate_peptide_omega.auth_seq_id_2    81 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            63.02 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -3 ? A GLY 1  
2  1 Y 1 A ALA -2 ? A ALA 2  
3  1 Y 1 A MET -1 ? A MET 3  
4  1 Y 1 A GLY 0  ? A GLY 4  
5  1 Y 1 A SER 1  ? A SER 5  
6  1 Y 1 A GLY 2  ? A GLY 6  
7  1 Y 1 A GLY 3  ? A GLY 7  
8  1 Y 1 A GLY 4  ? A GLY 8  
9  1 Y 1 A GLY 5  ? A GLY 9  
10 1 Y 1 A GLU 6  ? A GLU 10 
11 1 Y 1 A HIS 7  ? A HIS 11 
12 1 Y 1 A GLN 8  ? A GLN 12 
13 1 Y 1 A HIS 9  ? A HIS 13 
14 1 Y 1 A GLY 10 ? A GLY 14 
15 1 Y 1 A GLU 11 ? A GLU 15 
16 1 Y 1 A GLU 12 ? A GLU 16 
17 1 Y 1 A MET 13 ? A MET 17 
18 1 Y 1 A MET 14 ? A MET 18 
19 1 Y 1 A ALA 15 ? A ALA 19 
20 1 Y 1 A ALA 16 ? A ALA 20 
21 1 Y 1 A VAL 17 ? A VAL 21 
22 1 Y 1 A PRO 18 ? A PRO 22 
23 1 Y 1 A ALA 19 ? A ALA 23 
24 1 Y 1 A PRO 20 ? A PRO 24 
25 1 Y 1 A ASP 21 ? A ASP 25 
26 1 Y 1 A ALA 22 ? A ALA 26 
27 1 Y 1 A GLU 23 ? A GLU 27 
28 1 Y 1 A GLY 24 ? A GLY 28 
29 1 Y 1 A ALA 25 ? A ALA 29 
30 1 Y 1 A ALA 26 ? A ALA 30 
31 1 Y 1 A GLY 27 ? A GLY 31 
32 1 Y 1 A PHE 28 ? A PHE 32 
33 1 Y 1 B GLY -3 ? B GLY 1  
34 1 Y 1 B ALA -2 ? B ALA 2  
35 1 Y 1 B MET -1 ? B MET 3  
36 1 Y 1 B GLY 0  ? B GLY 4  
37 1 Y 1 B SER 1  ? B SER 5  
38 1 Y 1 B GLY 2  ? B GLY 6  
39 1 Y 1 B GLY 3  ? B GLY 7  
40 1 Y 1 B GLY 4  ? B GLY 8  
41 1 Y 1 B GLY 5  ? B GLY 9  
42 1 Y 1 B GLU 6  ? B GLU 10 
43 1 Y 1 B HIS 7  ? B HIS 11 
44 1 Y 1 B GLN 8  ? B GLN 12 
45 1 Y 1 B HIS 9  ? B HIS 13 
46 1 Y 1 B GLY 10 ? B GLY 14 
47 1 Y 1 B GLU 11 ? B GLU 15 
48 1 Y 1 B GLU 12 ? B GLU 16 
49 1 Y 1 B MET 13 ? B MET 17 
50 1 Y 1 B MET 14 ? B MET 18 
51 1 Y 1 B ALA 15 ? B ALA 19 
52 1 Y 1 B ALA 16 ? B ALA 20 
53 1 Y 1 B VAL 17 ? B VAL 21 
54 1 Y 1 B PRO 18 ? B PRO 22 
55 1 Y 1 B ALA 19 ? B ALA 23 
56 1 Y 1 B PRO 20 ? B PRO 24 
57 1 Y 1 B ASP 21 ? B ASP 25 
58 1 Y 1 B ALA 22 ? B ALA 26 
59 1 Y 1 B GLU 23 ? B GLU 27 
60 1 Y 1 B GLY 24 ? B GLY 28 
61 1 Y 1 B ALA 25 ? B ALA 29 
62 1 Y 1 B ALA 26 ? B ALA 30 
63 1 Y 1 B GLY 27 ? B GLY 31 
64 1 Y 1 B PHE 28 ? B PHE 32 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'  SO4 
3 'CHLORIDE ION' CL  
4 1,2-ETHANEDIOL EDO 
5 water          HOH 
#