data_2O93
# 
_entry.id   2O93 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2O93         
NDB   PD0957       
RCSB  RCSB040841   
WWPDB D_1000040841 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1P7H 
_pdbx_database_related.details        'NFAT bound to single kappaB element' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2O93 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bates, D.L.' 1 
'Chen, L.'    2 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            16 
_citation.page_first                684 
_citation.page_last                 694 
_citation.year                      2008 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18462673 
_citation.pdbx_database_id_DOI      10.1016/j.str.2008.01.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bates, D.L.'   1 
primary 'Barthel, K.K.' 2 
primary 'Wu, Y.'        3 
primary 'Kalhor, R.'    4 
primary 'Stroud, J.C.'  5 
primary 'Giffin, M.J.'  6 
primary 'Chen, L.'      7 
# 
_cell.entry_id           2O93 
_cell.length_a           93.691 
_cell.length_b           95.299 
_cell.length_c           159.227 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2O93 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'kappaB enhancer element, DNA 25-mer'       7681.932  1 ? ? ?            ? 
2 polymer syn 'kappaB enhancer element, DNA 25-mer'       7677.964  1 ? ? ?            ? 
3 polymer man 'actor of activated T-cells, cytoplasmic 2' 34226.887 3 ? ? 'RHR domain' ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'T cell transcription factor NFAT1; NFAT pre-existing subunit; NF-ATp' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DG)(DG)(DG)(DA)(DC)(DT)(DT)(DT)(DC)(DC)(DG)(DC)(DT)(DG)(DG)(DG)(DG)(DA)(DC)
(DT)(DT)(DT)(DC)(DC)
;
AGGGACTTTCCGCTGGGGACTTTCC A     ? 
2 polydeoxyribonucleotide no no 
;(DT)(DG)(DG)(DA)(DA)(DA)(DG)(DT)(DC)(DC)(DC)(DC)(DA)(DG)(DC)(DG)(DG)(DA)(DA)(DA)
(DG)(DT)(DC)(DC)(DC)
;
TGGAAAGTCCCCAGCGGAAAGTCCC B     ? 
3 'polypeptide(L)'        no no 
;MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQ
IFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGR
KNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
;
;MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQ
IFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGR
KNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
;
L,M,O ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DG  n 
1 3   DG  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DT  n 
1 8   DT  n 
1 9   DT  n 
1 10  DC  n 
1 11  DC  n 
1 12  DG  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DG  n 
1 17  DG  n 
1 18  DG  n 
1 19  DA  n 
1 20  DC  n 
1 21  DT  n 
1 22  DT  n 
1 23  DT  n 
1 24  DC  n 
1 25  DC  n 
2 1   DT  n 
2 2   DG  n 
2 3   DG  n 
2 4   DA  n 
2 5   DA  n 
2 6   DA  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DC  n 
2 12  DC  n 
2 13  DA  n 
2 14  DG  n 
2 15  DC  n 
2 16  DG  n 
2 17  DG  n 
2 18  DA  n 
2 19  DA  n 
2 20  DA  n 
2 21  DG  n 
2 22  DT  n 
2 23  DC  n 
2 24  DC  n 
2 25  DC  n 
3 1   MET n 
3 2   ARG n 
3 3   GLY n 
3 4   SER n 
3 5   HIS n 
3 6   HIS n 
3 7   HIS n 
3 8   HIS n 
3 9   HIS n 
3 10  HIS n 
3 11  THR n 
3 12  ALA n 
3 13  PRO n 
3 14  HIS n 
3 15  ALA n 
3 16  SER n 
3 17  SER n 
3 18  VAL n 
3 19  PRO n 
3 20  LEU n 
3 21  GLU n 
3 22  TRP n 
3 23  PRO n 
3 24  LEU n 
3 25  SER n 
3 26  SER n 
3 27  GLN n 
3 28  SER n 
3 29  GLY n 
3 30  SER n 
3 31  TYR n 
3 32  GLU n 
3 33  LEU n 
3 34  ARG n 
3 35  ILE n 
3 36  GLU n 
3 37  VAL n 
3 38  GLN n 
3 39  PRO n 
3 40  LYS n 
3 41  PRO n 
3 42  HIS n 
3 43  HIS n 
3 44  ARG n 
3 45  ALA n 
3 46  HIS n 
3 47  TYR n 
3 48  GLU n 
3 49  THR n 
3 50  GLU n 
3 51  GLY n 
3 52  SER n 
3 53  ARG n 
3 54  GLY n 
3 55  ALA n 
3 56  VAL n 
3 57  LYS n 
3 58  ALA n 
3 59  PRO n 
3 60  THR n 
3 61  GLY n 
3 62  GLY n 
3 63  HIS n 
3 64  PRO n 
3 65  VAL n 
3 66  VAL n 
3 67  GLN n 
3 68  LEU n 
3 69  HIS n 
3 70  GLY n 
3 71  TYR n 
3 72  MET n 
3 73  GLU n 
3 74  ASN n 
3 75  LYS n 
3 76  PRO n 
3 77  LEU n 
3 78  GLY n 
3 79  LEU n 
3 80  GLN n 
3 81  ILE n 
3 82  PHE n 
3 83  ILE n 
3 84  GLY n 
3 85  THR n 
3 86  ALA n 
3 87  ASP n 
3 88  GLU n 
3 89  ARG n 
3 90  ILE n 
3 91  LEU n 
3 92  LYS n 
3 93  PRO n 
3 94  HIS n 
3 95  ALA n 
3 96  PHE n 
3 97  TYR n 
3 98  GLN n 
3 99  VAL n 
3 100 HIS n 
3 101 ARG n 
3 102 ILE n 
3 103 THR n 
3 104 GLY n 
3 105 LYS n 
3 106 THR n 
3 107 VAL n 
3 108 THR n 
3 109 THR n 
3 110 THR n 
3 111 SER n 
3 112 TYR n 
3 113 GLU n 
3 114 LYS n 
3 115 ILE n 
3 116 VAL n 
3 117 GLY n 
3 118 ASN n 
3 119 THR n 
3 120 LYS n 
3 121 VAL n 
3 122 LEU n 
3 123 GLU n 
3 124 ILE n 
3 125 PRO n 
3 126 LEU n 
3 127 GLU n 
3 128 PRO n 
3 129 LYS n 
3 130 ASN n 
3 131 ASN n 
3 132 MET n 
3 133 ARG n 
3 134 ALA n 
3 135 THR n 
3 136 ILE n 
3 137 ASP n 
3 138 CYS n 
3 139 ALA n 
3 140 GLY n 
3 141 ILE n 
3 142 LEU n 
3 143 LYS n 
3 144 LEU n 
3 145 ARG n 
3 146 ASN n 
3 147 ALA n 
3 148 ASP n 
3 149 ILE n 
3 150 GLU n 
3 151 LEU n 
3 152 ARG n 
3 153 LYS n 
3 154 GLY n 
3 155 GLU n 
3 156 THR n 
3 157 ASP n 
3 158 ILE n 
3 159 GLY n 
3 160 ARG n 
3 161 LYS n 
3 162 ASN n 
3 163 THR n 
3 164 ARG n 
3 165 VAL n 
3 166 ARG n 
3 167 LEU n 
3 168 VAL n 
3 169 PHE n 
3 170 ARG n 
3 171 VAL n 
3 172 HIS n 
3 173 ILE n 
3 174 PRO n 
3 175 GLU n 
3 176 SER n 
3 177 SER n 
3 178 GLY n 
3 179 ARG n 
3 180 ILE n 
3 181 VAL n 
3 182 SER n 
3 183 LEU n 
3 184 GLN n 
3 185 THR n 
3 186 ALA n 
3 187 SER n 
3 188 ASN n 
3 189 PRO n 
3 190 ILE n 
3 191 GLU n 
3 192 CYS n 
3 193 SER n 
3 194 GLN n 
3 195 ARG n 
3 196 SER n 
3 197 ALA n 
3 198 HIS n 
3 199 GLU n 
3 200 LEU n 
3 201 PRO n 
3 202 MET n 
3 203 VAL n 
3 204 GLU n 
3 205 ARG n 
3 206 GLN n 
3 207 ASP n 
3 208 THR n 
3 209 ASP n 
3 210 SER n 
3 211 CYS n 
3 212 LEU n 
3 213 VAL n 
3 214 TYR n 
3 215 GLY n 
3 216 GLY n 
3 217 GLN n 
3 218 GLN n 
3 219 MET n 
3 220 ILE n 
3 221 LEU n 
3 222 THR n 
3 223 GLY n 
3 224 GLN n 
3 225 ASN n 
3 226 PHE n 
3 227 THR n 
3 228 SER n 
3 229 GLU n 
3 230 SER n 
3 231 LYS n 
3 232 VAL n 
3 233 VAL n 
3 234 PHE n 
3 235 THR n 
3 236 GLU n 
3 237 LYS n 
3 238 THR n 
3 239 THR n 
3 240 ASP n 
3 241 GLY n 
3 242 GLN n 
3 243 GLN n 
3 244 ILE n 
3 245 TRP n 
3 246 GLU n 
3 247 MET n 
3 248 GLU n 
3 249 ALA n 
3 250 THR n 
3 251 VAL n 
3 252 ASP n 
3 253 LYS n 
3 254 ASP n 
3 255 LYS n 
3 256 SER n 
3 257 GLN n 
3 258 PRO n 
3 259 ASN n 
3 260 MET n 
3 261 LEU n 
3 262 PHE n 
3 263 VAL n 
3 264 GLU n 
3 265 ILE n 
3 266 PRO n 
3 267 GLU n 
3 268 TYR n 
3 269 ARG n 
3 270 ASN n 
3 271 LYS n 
3 272 HIS n 
3 273 ILE n 
3 274 ARG n 
3 275 THR n 
3 276 PRO n 
3 277 VAL n 
3 278 LYS n 
3 279 VAL n 
3 280 ASN n 
3 281 PHE n 
3 282 TYR n 
3 283 VAL n 
3 284 ILE n 
3 285 ASN n 
3 286 GLY n 
3 287 LYS n 
3 288 ARG n 
3 289 LYS n 
3 290 ARG n 
3 291 SER n 
3 292 GLN n 
3 293 PRO n 
3 294 GLN n 
3 295 HIS n 
3 296 PHE n 
3 297 THR n 
3 298 TYR n 
3 299 HIS n 
3 300 PRO n 
3 301 VAL n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'NFATC2, NFAT1, NFATP' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQE-30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 3 UNP NFAC2_HUMAN Q13469 392 
;ASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPH
AFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIP
ESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKD
KSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV
;
? 
2 1 PDB 2O93        2O93   ?   ? ? 
3 2 PDB 2O93        2O93   ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2O93 L 15 ? 301 ? Q13469 392 ? 678 ? 392 678 
2 1 2O93 M 15 ? 301 ? Q13469 392 ? 678 ? 392 678 
3 1 2O93 O 15 ? 301 ? Q13469 392 ? 678 ? 392 678 
4 2 2O93 A 1  ? 25  ? 2O93   1   ? 25  ? 1   25  
5 3 2O93 B 1  ? 25  ? 2O93   1   ? 25  ? 1   25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2O93 MET L 1  ? UNP Q13469 ?   ?   'INITIATING METHIONINE' 378 1  
1 2O93 ARG L 2  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        379 2  
1 2O93 GLY L 3  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        380 3  
1 2O93 SER L 4  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        381 4  
1 2O93 HIS L 5  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        382 5  
1 2O93 HIS L 6  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        383 6  
1 2O93 HIS L 7  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        384 7  
1 2O93 HIS L 8  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        385 8  
1 2O93 HIS L 9  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        386 9  
1 2O93 HIS L 10 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        387 10 
1 2O93 THR L 11 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        388 11 
1 2O93 ALA L 12 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        389 12 
1 2O93 PRO L 13 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        390 13 
1 2O93 HIS L 14 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        391 14 
1 2O93 SER L 17 ? UNP Q13469 LEU 394 'CLONING ARTIFACT'      394 15 
1 2O93 VAL L 18 ? UNP Q13469 PRO 395 'CLONING ARTIFACT'      395 16 
2 2O93 MET M 1  ? UNP Q13469 ?   ?   'INITIATING METHIONINE' 378 17 
2 2O93 ARG M 2  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        379 18 
2 2O93 GLY M 3  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        380 19 
2 2O93 SER M 4  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        381 20 
2 2O93 HIS M 5  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        382 21 
2 2O93 HIS M 6  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        383 22 
2 2O93 HIS M 7  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        384 23 
2 2O93 HIS M 8  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        385 24 
2 2O93 HIS M 9  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        386 25 
2 2O93 HIS M 10 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        387 26 
2 2O93 THR M 11 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        388 27 
2 2O93 ALA M 12 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        389 28 
2 2O93 PRO M 13 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        390 29 
2 2O93 HIS M 14 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        391 30 
2 2O93 SER M 17 ? UNP Q13469 LEU 394 'CLONING ARTIFACT'      394 31 
2 2O93 VAL M 18 ? UNP Q13469 PRO 395 'CLONING ARTIFACT'      395 32 
3 2O93 MET O 1  ? UNP Q13469 ?   ?   'INITIATING METHIONINE' 378 33 
3 2O93 ARG O 2  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        379 34 
3 2O93 GLY O 3  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        380 35 
3 2O93 SER O 4  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        381 36 
3 2O93 HIS O 5  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        382 37 
3 2O93 HIS O 6  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        383 38 
3 2O93 HIS O 7  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        384 39 
3 2O93 HIS O 8  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        385 40 
3 2O93 HIS O 9  ? UNP Q13469 ?   ?   'EXPRESSION TAG'        386 41 
3 2O93 HIS O 10 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        387 42 
3 2O93 THR O 11 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        388 43 
3 2O93 ALA O 12 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        389 44 
3 2O93 PRO O 13 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        390 45 
3 2O93 HIS O 14 ? UNP Q13469 ?   ?   'EXPRESSION TAG'        391 46 
3 2O93 SER O 17 ? UNP Q13469 LEU 394 'CLONING ARTIFACT'      394 47 
3 2O93 VAL O 18 ? UNP Q13469 PRO 395 'CLONING ARTIFACT'      395 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2O93 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.00 
_exptl_crystal.density_percent_sol   58.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'50mM Hepes pH 7.0, 15mM Magnesium Acetate, 250mM Ammonium Acetate, 7.5% PEG 4000, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 'PEG 4000'          ? ? ? 
1 2 1 'Ammonium Acetate'  ? ? ? 
1 3 1 'Magnesium Acetate' ? ? ? 
1 4 1 Hepes               ? ? ? 
1 5 2 'PEG 4000'          ? ? ? 
1 6 2 'Ammonium Acetate'  ? ? ? 
1 7 2 'Magnesium Acetate' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2002-07-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     2O93 
_reflns.d_resolution_high            3.050 
_reflns.d_resolution_low             30.000 
_reflns.number_obs                   26944 
_reflns.pdbx_Rmerge_I_obs            0.129 
_reflns.pdbx_netI_over_sigmaI        11.000 
_reflns.pdbx_chi_squared             2.034 
_reflns.percent_possible_obs         97.900 
_reflns.number_all                   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
3.05 3.16  ? ? ? 0.538 ? ? 1.892 ? ? 2269 83.50  ? 1  
3.16 3.29  ? ? ? 0.287 ? ? 1.882 ? ? 2579 96.10  ? 2  
3.29 3.43  ? ? ? 0.306 ? ? 2.104 ? ? 2705 99.20  ? 3  
3.43 3.62  ? ? ? 0.313 ? ? 2.057 ? ? 2704 99.90  ? 4  
3.62 3.84  ? ? ? 0.224 ? ? 2.191 ? ? 2724 100.00 ? 5  
3.84 4.14  ? ? ? 0.181 ? ? 2.209 ? ? 2739 100.00 ? 6  
4.14 4.55  ? ? ? 0.128 ? ? 2.218 ? ? 2726 100.00 ? 7  
4.55 5.21  ? ? ? 0.098 ? ? 2.030 ? ? 2764 100.00 ? 8  
5.21 6.55  ? ? ? 0.09  ? ? 1.918 ? ? 2800 100.00 ? 9  
6.55 30.00 ? ? ? 0.05  ? ? 1.719 ? ? 2934 99.80  ? 10 
# 
_refine.entry_id                                 2O93 
_refine.ls_number_reflns_obs                     25518 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            3.05 
_refine.ls_percent_reflns_obs                    91.8 
_refine.ls_R_factor_obs                          0.225 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.283 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.200 
_refine.ls_number_reflns_R_free                  2548 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               77.72 
_refine.aniso_B[1][1]                            -17.37000 
_refine.aniso_B[2][2]                            13.38700 
_refine.aniso_B[3][3]                            3.98300 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 35.38 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1P7H' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6847 
_refine_hist.pdbx_number_atoms_nucleic_acid   1019 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               7866 
_refine_hist.d_res_high                       3.05 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.007 ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.30  ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.585 1.500 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            6.214 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             4.428 2.000 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            7.575 2.500 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.050  3.070  50 . 283 . 0.401 0.513 . 42 . . 325 . 'X-RAY DIFFRACTION' 
3.070  3.090  50 . 324 . 0.374 0.363 . 36 . . 360 . 'X-RAY DIFFRACTION' 
3.090  3.110  50 . 335 . 0.372 0.48  . 42 . . 377 . 'X-RAY DIFFRACTION' 
3.110  3.140  50 . 349 . 0.35  0.391 . 41 . . 390 . 'X-RAY DIFFRACTION' 
3.140  3.160  50 . 381 . 0.363 0.431 . 32 . . 413 . 'X-RAY DIFFRACTION' 
3.160  3.180  50 . 389 . 0.339 0.383 . 37 . . 426 . 'X-RAY DIFFRACTION' 
3.180  3.210  50 . 376 . 0.301 0.397 . 38 . . 414 . 'X-RAY DIFFRACTION' 
3.210  3.230  50 . 394 . 0.3   0.326 . 57 . . 451 . 'X-RAY DIFFRACTION' 
3.230  3.260  50 . 413 . 0.267 0.36  . 59 . . 472 . 'X-RAY DIFFRACTION' 
3.260  3.290  50 . 427 . 0.301 0.249 . 49 . . 476 . 'X-RAY DIFFRACTION' 
3.290  3.310  50 . 417 . 0.259 0.317 . 45 . . 462 . 'X-RAY DIFFRACTION' 
3.310  3.340  50 . 445 . 0.262 0.395 . 35 . . 480 . 'X-RAY DIFFRACTION' 
3.340  3.370  50 . 462 . 0.271 0.388 . 39 . . 501 . 'X-RAY DIFFRACTION' 
3.370  3.400  50 . 445 . 0.289 0.332 . 47 . . 492 . 'X-RAY DIFFRACTION' 
3.400  3.430  50 . 447 . 0.27  0.342 . 39 . . 486 . 'X-RAY DIFFRACTION' 
3.430  3.470  50 . 467 . 0.284 0.297 . 53 . . 520 . 'X-RAY DIFFRACTION' 
3.470  3.500  50 . 457 . 0.297 0.333 . 40 . . 497 . 'X-RAY DIFFRACTION' 
3.500  3.540  50 . 484 . 0.285 0.353 . 44 . . 528 . 'X-RAY DIFFRACTION' 
3.540  3.580  50 . 452 . 0.257 0.336 . 58 . . 510 . 'X-RAY DIFFRACTION' 
3.580  3.620  50 . 469 . 0.244 0.286 . 54 . . 523 . 'X-RAY DIFFRACTION' 
3.620  3.660  50 . 479 . 0.258 0.288 . 50 . . 529 . 'X-RAY DIFFRACTION' 
3.660  3.700  50 . 474 . 0.256 0.292 . 54 . . 528 . 'X-RAY DIFFRACTION' 
3.700  3.740  50 . 454 . 0.281 0.391 . 64 . . 518 . 'X-RAY DIFFRACTION' 
3.740  3.790  50 . 487 . 0.265 0.337 . 58 . . 545 . 'X-RAY DIFFRACTION' 
3.790  3.840  50 . 464 . 0.251 0.32  . 59 . . 523 . 'X-RAY DIFFRACTION' 
3.840  3.890  50 . 461 . 0.248 0.299 . 49 . . 510 . 'X-RAY DIFFRACTION' 
3.890  3.950  50 . 471 . 0.24  0.272 . 58 . . 529 . 'X-RAY DIFFRACTION' 
3.950  4.010  50 . 468 . 0.248 0.303 . 47 . . 515 . 'X-RAY DIFFRACTION' 
4.010  4.070  50 . 490 . 0.218 0.258 . 54 . . 544 . 'X-RAY DIFFRACTION' 
4.070  4.140  50 . 473 . 0.227 0.28  . 48 . . 521 . 'X-RAY DIFFRACTION' 
4.140  4.210  50 . 502 . 0.212 0.341 . 52 . . 554 . 'X-RAY DIFFRACTION' 
4.210  4.280  50 . 475 . 0.22  0.255 . 47 . . 522 . 'X-RAY DIFFRACTION' 
4.280  4.370  50 . 486 . 0.189 0.24  . 51 . . 537 . 'X-RAY DIFFRACTION' 
4.370  4.460  50 . 499 . 0.192 0.281 . 62 . . 561 . 'X-RAY DIFFRACTION' 
4.460  4.550  50 . 491 . 0.214 0.275 . 54 . . 545 . 'X-RAY DIFFRACTION' 
4.550  4.660  50 . 474 . 0.193 0.256 . 50 . . 524 . 'X-RAY DIFFRACTION' 
4.660  4.770  50 . 520 . 0.188 0.244 . 48 . . 568 . 'X-RAY DIFFRACTION' 
4.770  4.900  50 . 477 . 0.192 0.273 . 52 . . 529 . 'X-RAY DIFFRACTION' 
4.900  5.050  50 . 506 . 0.173 0.204 . 50 . . 556 . 'X-RAY DIFFRACTION' 
5.050  5.210  50 . 480 . 0.191 0.246 . 69 . . 549 . 'X-RAY DIFFRACTION' 
5.210  5.390  50 . 492 . 0.189 0.29  . 56 . . 548 . 'X-RAY DIFFRACTION' 
5.390  5.610  50 . 502 . 0.186 0.241 . 62 . . 564 . 'X-RAY DIFFRACTION' 
5.610  5.860  50 . 498 . 0.204 0.262 . 63 . . 561 . 'X-RAY DIFFRACTION' 
5.860  6.170  50 . 499 . 0.209 0.27  . 56 . . 555 . 'X-RAY DIFFRACTION' 
6.170  6.550  50 . 491 . 0.227 0.289 . 54 . . 545 . 'X-RAY DIFFRACTION' 
6.550  7.050  50 . 516 . 0.195 0.262 . 56 . . 572 . 'X-RAY DIFFRACTION' 
7.050  7.750  50 . 513 . 0.192 0.254 . 58 . . 571 . 'X-RAY DIFFRACTION' 
7.750  8.840  50 . 528 . 0.195 0.246 . 56 . . 584 . 'X-RAY DIFFRACTION' 
8.840  11.050 50 . 528 . 0.17  0.246 . 56 . . 584 . 'X-RAY DIFFRACTION' 
11.050 30.000 50 . 556 . 0.199 0.215 . 68 . . 624 . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:PROTEIN_REP.PARAM ? 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:DNA-RNA_REP.PARAM ? 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:ION.PARAM         ? 'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:WATER_REP.PARAM   ? 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2O93 
_struct.title                     'Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element' 
_struct.pdbx_descriptor           'actor of activated T-cells, cytoplasmic 2/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2O93 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'IG domain; Protein-DNA complex; double helix, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU C 127 ? ASN C 131 ? GLU L 504 ASN L 508 5 ? 5 
HELX_P HELX_P2 2 ARG C 145 ? ARG C 152 ? ARG L 522 ARG L 529 1 ? 8 
HELX_P HELX_P3 3 GLU D 127 ? ASN D 131 ? GLU M 504 ASN M 508 5 ? 5 
HELX_P HELX_P4 4 ARG D 145 ? LEU D 151 ? ARG M 522 LEU M 528 1 ? 7 
HELX_P HELX_P5 5 GLU E 127 ? ASN E 131 ? GLU O 504 ASN O 508 5 ? 5 
HELX_P HELX_P6 6 ARG E 145 ? GLU E 150 ? ARG O 522 GLU O 527 1 ? 6 
HELX_P HELX_P7 7 SER E 193 ? GLU E 199 ? SER O 570 GLU O 576 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 25 N3 ? ? A DG 2  B DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 25 O2 ? ? A DG 2  B DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 25 N4 ? ? A DG 2  B DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC 24 N3 ? ? A DG 3  B DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC 24 O2 ? ? A DG 3  B DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC 24 N4 ? ? A DG 3  B DC 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 23 N3 ? ? A DG 4  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 23 O2 ? ? A DG 4  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 23 N4 ? ? A DG 4  B DC 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 22 N3 ? ? A DA 5  B DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 22 O4 ? ? A DA 5  B DT 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 21 N1 ? ? A DC 6  B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 21 O6 ? ? A DC 6  B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 21 N2 ? ? A DC 6  B DG 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 20 N1 ? ? A DT 7  B DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 20 N6 ? ? A DT 7  B DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 19 N1 ? ? A DT 8  B DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 19 N6 ? ? A DT 8  B DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 18 N1 ? ? A DT 9  B DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DT 9  O4 ? ? ? 1_555 B DA 18 N6 ? ? A DT 9  B DA 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 17 N1 ? ? A DC 10 B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 17 O6 ? ? A DC 10 B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 17 N2 ? ? A DC 10 B DG 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 16 N1 ? ? A DC 11 B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 16 O6 ? ? A DC 11 B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 16 N2 ? ? A DC 11 B DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 12 N1 ? ? ? 1_555 B DC 15 N3 ? ? A DG 12 B DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 12 N2 ? ? ? 1_555 B DC 15 O2 ? ? A DG 12 B DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 12 O6 ? ? ? 1_555 B DC 15 N4 ? ? A DG 12 B DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG 14 N1 ? ? A DC 13 B DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG 14 O6 ? ? A DC 13 B DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG 14 N2 ? ? A DC 13 B DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 13 N1 ? ? A DT 14 B DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 13 N6 ? ? A DT 14 B DA 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 12 N3 ? ? A DG 15 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 12 O2 ? ? A DG 15 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 12 N4 ? ? A DG 15 B DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DG 16 N1 ? ? ? 1_555 B DC 11 N3 ? ? A DG 16 B DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? A DG 16 N2 ? ? ? 1_555 B DC 11 O2 ? ? A DG 16 B DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? A DG 16 O6 ? ? ? 1_555 B DC 11 N4 ? ? A DG 16 B DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? A DG 17 N1 ? ? ? 1_555 B DC 10 N3 ? ? A DG 17 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? A DG 17 N2 ? ? ? 1_555 B DC 10 O2 ? ? A DG 17 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? A DG 17 O6 ? ? ? 1_555 B DC 10 N4 ? ? A DG 17 B DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? A DG 18 N1 ? ? ? 1_555 B DC 9  N3 ? ? A DG 18 B DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? A DG 18 N2 ? ? ? 1_555 B DC 9  O2 ? ? A DG 18 B DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? A DG 18 O6 ? ? ? 1_555 B DC 9  N4 ? ? A DG 18 B DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 8  N3 ? ? A DA 19 B DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? A DA 19 N6 ? ? ? 1_555 B DT 8  O4 ? ? A DA 19 B DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? A DC 20 N3 ? ? ? 1_555 B DG 7  N1 ? ? A DC 20 B DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? A DC 20 N4 ? ? ? 1_555 B DG 7  O6 ? ? A DC 20 B DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? A DC 20 O2 ? ? ? 1_555 B DG 7  N2 ? ? A DC 20 B DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? A DT 21 N3 ? ? ? 1_555 B DA 6  N1 ? ? A DT 21 B DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? A DT 21 O4 ? ? ? 1_555 B DA 6  N6 ? ? A DT 21 B DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? A DT 22 N3 ? ? ? 1_555 B DA 5  N1 ? ? A DT 22 B DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? A DT 22 O4 ? ? ? 1_555 B DA 5  N6 ? ? A DT 22 B DA 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? A DT 23 N3 ? ? ? 1_555 B DA 4  N1 ? ? A DT 23 B DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? A DT 23 O4 ? ? ? 1_555 B DA 4  N6 ? ? A DT 23 B DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? A DC 24 N3 ? ? ? 1_555 B DG 3  N1 ? ? A DC 24 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? A DC 24 N4 ? ? ? 1_555 B DG 3  O6 ? ? A DC 24 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? A DC 24 O2 ? ? ? 1_555 B DG 3  N2 ? ? A DC 24 B DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? A DC 25 N3 ? ? ? 1_555 B DG 2  N1 ? ? A DC 25 B DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? A DC 25 N4 ? ? ? 1_555 B DG 2  O6 ? ? A DC 25 B DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? A DC 25 O2 ? ? ? 1_555 B DG 2  N2 ? ? A DC 25 B DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 5 ? 
D ? 2 ? 
E ? 8 ? 
F ? 4 ? 
G ? 3 ? 
H ? 5 ? 
I ? 5 ? 
J ? 8 ? 
K ? 2 ? 
L ? 5 ? 
M ? 5 ? 
N ? 2 ? 
O ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
E 7 8 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
J 6 7 ? anti-parallel 
J 7 8 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
O 6 7 ? anti-parallel 
O 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU C 32  ? VAL C 37  ? GLU L 409 VAL L 414 
A 2 VAL C 65  ? HIS C 69  ? VAL L 442 HIS L 446 
A 3 ARG C 133 ? THR C 135 ? ARG L 510 THR L 512 
B 1 TYR C 112 ? VAL C 116 ? TYR L 489 VAL L 493 
B 2 THR C 119 ? LEU C 126 ? THR L 496 LEU L 503 
B 3 LEU C 77  ? THR C 85  ? LEU L 454 THR L 462 
B 4 ARG C 164 ? PRO C 174 ? ARG L 541 PRO L 551 
B 5 ILE C 180 ? LEU C 183 ? ILE L 557 LEU L 560 
C 1 TYR C 112 ? VAL C 116 ? TYR L 489 VAL L 493 
C 2 THR C 119 ? LEU C 126 ? THR L 496 LEU L 503 
C 3 LEU C 77  ? THR C 85  ? LEU L 454 THR L 462 
C 4 ARG C 164 ? PRO C 174 ? ARG L 541 PRO L 551 
C 5 ILE C 190 ? GLU C 191 ? ILE L 567 GLU L 568 
D 1 TYR C 97  ? ARG C 101 ? TYR L 474 ARG L 478 
D 2 ALA C 139 ? LYS C 143 ? ALA L 516 LYS L 520 
E 1 MET C 202 ? GLN C 206 ? MET L 579 GLN L 583 
E 2 GLN C 218 ? GLN C 224 ? GLN L 595 GLN L 601 
E 3 MET C 260 ? GLU C 264 ? MET L 637 GLU L 641 
E 4 GLN C 243 ? VAL C 251 ? GLN L 620 VAL L 628 
E 5 SER C 230 ? LYS C 237 ? SER L 607 LYS L 614 
E 6 VAL C 277 ? ASN C 285 ? VAL L 654 ASN L 662 
E 7 GLN C 294 ? HIS C 299 ? GLN L 671 HIS L 676 
E 8 SER C 210 ? LEU C 212 ? SER L 587 LEU L 589 
F 1 GLN D 27  ? SER D 28  ? GLN M 404 SER M 405 
F 2 TYR D 31  ? VAL D 37  ? TYR M 408 VAL M 414 
F 3 VAL D 65  ? HIS D 69  ? VAL M 442 HIS M 446 
F 4 ARG D 133 ? ALA D 134 ? ARG M 510 ALA M 511 
G 1 HIS D 46  ? TYR D 47  ? HIS M 423 TYR M 424 
G 2 ALA D 139 ? LYS D 143 ? ALA M 516 LYS M 520 
G 3 TYR D 97  ? ARG D 101 ? TYR M 474 ARG M 478 
H 1 TYR D 112 ? VAL D 116 ? TYR M 489 VAL M 493 
H 2 THR D 119 ? LEU D 126 ? THR M 496 LEU M 503 
H 3 LEU D 77  ? GLY D 84  ? LEU M 454 GLY M 461 
H 4 ARG D 164 ? PRO D 174 ? ARG M 541 PRO M 551 
H 5 ILE D 180 ? LEU D 183 ? ILE M 557 LEU M 560 
I 1 TYR D 112 ? VAL D 116 ? TYR M 489 VAL M 493 
I 2 THR D 119 ? LEU D 126 ? THR M 496 LEU M 503 
I 3 LEU D 77  ? GLY D 84  ? LEU M 454 GLY M 461 
I 4 ARG D 164 ? PRO D 174 ? ARG M 541 PRO M 551 
I 5 ILE D 190 ? GLU D 191 ? ILE M 567 GLU M 568 
J 1 MET D 202 ? GLN D 206 ? MET M 579 GLN M 583 
J 2 GLN D 218 ? GLN D 224 ? GLN M 595 GLN M 601 
J 3 MET D 260 ? GLU D 264 ? MET M 637 GLU M 641 
J 4 GLN D 243 ? VAL D 251 ? GLN M 620 VAL M 628 
J 5 LYS D 231 ? LYS D 237 ? LYS M 608 LYS M 614 
J 6 VAL D 277 ? ILE D 284 ? VAL M 654 ILE M 661 
J 7 GLN D 294 ? HIS D 299 ? GLN M 671 HIS M 676 
J 8 SER D 210 ? LEU D 212 ? SER M 587 LEU M 589 
K 1 GLU E 32  ? VAL E 37  ? GLU O 409 VAL O 414 
K 2 VAL E 65  ? HIS E 69  ? VAL O 442 HIS O 446 
L 1 TYR E 112 ? VAL E 116 ? TYR O 489 VAL O 493 
L 2 THR E 119 ? LEU E 126 ? THR O 496 LEU O 503 
L 3 LEU E 77  ? THR E 85  ? LEU O 454 THR O 462 
L 4 ARG E 164 ? PRO E 174 ? ARG O 541 PRO O 551 
L 5 ILE E 180 ? LEU E 183 ? ILE O 557 LEU O 560 
M 1 TYR E 112 ? VAL E 116 ? TYR O 489 VAL O 493 
M 2 THR E 119 ? LEU E 126 ? THR O 496 LEU O 503 
M 3 LEU E 77  ? THR E 85  ? LEU O 454 THR O 462 
M 4 ARG E 164 ? PRO E 174 ? ARG O 541 PRO O 551 
M 5 ILE E 190 ? GLU E 191 ? ILE O 567 GLU O 568 
N 1 TYR E 97  ? ARG E 101 ? TYR O 474 ARG O 478 
N 2 ALA E 139 ? LYS E 143 ? ALA O 516 LYS O 520 
O 1 MET E 202 ? GLN E 206 ? MET O 579 GLN O 583 
O 2 GLN E 218 ? GLN E 224 ? GLN O 595 GLN O 601 
O 3 MET E 260 ? GLU E 264 ? MET O 637 GLU O 641 
O 4 GLN E 243 ? GLN E 257 ? GLN O 620 GLN O 634 
O 5 VAL E 232 ? LYS E 237 ? VAL O 609 LYS O 614 
O 6 VAL E 277 ? VAL E 283 ? VAL O 654 VAL O 660 
O 7 GLN E 294 ? HIS E 299 ? GLN O 671 HIS O 676 
O 8 SER E 210 ? LEU E 212 ? SER O 587 LEU O 589 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 32  ? N GLU L 409 O HIS C 69  ? O HIS L 446 
A 2 3 N VAL C 66  ? N VAL L 443 O ALA C 134 ? O ALA L 511 
B 1 2 N TYR C 112 ? N TYR L 489 O GLU C 123 ? O GLU L 500 
B 2 3 O LEU C 126 ? O LEU L 503 N LEU C 77  ? N LEU L 454 
B 3 4 N GLY C 84  ? N GLY L 461 O ARG C 166 ? O ARG L 543 
B 4 5 N VAL C 171 ? N VAL L 548 O LEU C 183 ? O LEU L 560 
C 1 2 N TYR C 112 ? N TYR L 489 O GLU C 123 ? O GLU L 500 
C 2 3 O LEU C 126 ? O LEU L 503 N LEU C 77  ? N LEU L 454 
C 3 4 N GLY C 84  ? N GLY L 461 O ARG C 166 ? O ARG L 543 
C 4 5 N VAL C 165 ? N VAL L 542 O ILE C 190 ? O ILE L 567 
D 1 2 N HIS C 100 ? N HIS L 477 O GLY C 140 ? O GLY L 517 
E 1 2 N GLU C 204 ? N GLU L 581 O THR C 222 ? O THR L 599 
E 2 3 N MET C 219 ? N MET L 596 O VAL C 263 ? O VAL L 640 
E 3 4 O GLU C 264 ? O GLU L 641 N THR C 250 ? N THR L 627 
E 4 5 O MET C 247 ? O MET L 624 N PHE C 234 ? N PHE L 611 
E 5 6 N VAL C 233 ? N VAL L 610 O TYR C 282 ? O TYR L 659 
E 6 7 N VAL C 279 ? N VAL L 656 O PHE C 296 ? O PHE L 673 
E 7 8 O HIS C 299 ? O HIS L 676 N CYS C 211 ? N CYS L 588 
F 1 2 N SER D 28  ? N SER M 405 O TYR D 31  ? O TYR M 408 
F 2 3 N GLU D 32  ? N GLU M 409 O HIS D 69  ? O HIS M 446 
F 3 4 N VAL D 66  ? N VAL M 443 O ALA D 134 ? O ALA M 511 
G 1 2 N HIS D 46  ? N HIS M 423 O ILE D 141 ? O ILE M 518 
G 2 3 O GLY D 140 ? O GLY M 517 N HIS D 100 ? N HIS M 477 
H 1 2 N LYS D 114 ? N LYS M 491 O VAL D 121 ? O VAL M 498 
H 2 3 O ILE D 124 ? O ILE M 501 N LEU D 79  ? N LEU M 456 
H 3 4 N GLN D 80  ? N GLN M 457 O ARG D 170 ? O ARG M 547 
H 4 5 N ILE D 173 ? N ILE M 550 O VAL D 181 ? O VAL M 558 
I 1 2 N LYS D 114 ? N LYS M 491 O VAL D 121 ? O VAL M 498 
I 2 3 O ILE D 124 ? O ILE M 501 N LEU D 79  ? N LEU M 456 
I 3 4 N GLN D 80  ? N GLN M 457 O ARG D 170 ? O ARG M 547 
I 4 5 N VAL D 165 ? N VAL M 542 O ILE D 190 ? O ILE M 567 
J 1 2 N ARG D 205 ? N ARG M 582 O THR D 222 ? O THR M 599 
J 2 3 N MET D 219 ? N MET M 596 O VAL D 263 ? O VAL M 640 
J 3 4 O GLU D 264 ? O GLU M 641 N THR D 250 ? N THR M 627 
J 4 5 O MET D 247 ? O MET M 624 N PHE D 234 ? N PHE M 611 
J 5 6 N THR D 235 ? N THR M 612 O ASN D 280 ? O ASN M 657 
J 6 7 N VAL D 277 ? N VAL M 654 O TYR D 298 ? O TYR M 675 
J 7 8 O HIS D 299 ? O HIS M 676 N CYS D 211 ? N CYS M 588 
K 1 2 N GLU E 32  ? N GLU O 409 O HIS E 69  ? O HIS O 446 
L 1 2 N LYS E 114 ? N LYS O 491 O VAL E 121 ? O VAL O 498 
L 2 3 O LEU E 126 ? O LEU O 503 N LEU E 77  ? N LEU O 454 
L 3 4 N GLY E 84  ? N GLY O 461 O ARG E 166 ? O ARG O 543 
L 4 5 N VAL E 171 ? N VAL O 548 O LEU E 183 ? O LEU O 560 
M 1 2 N LYS E 114 ? N LYS O 491 O VAL E 121 ? O VAL O 498 
M 2 3 O LEU E 126 ? O LEU O 503 N LEU E 77  ? N LEU O 454 
M 3 4 N GLY E 84  ? N GLY O 461 O ARG E 166 ? O ARG O 543 
M 4 5 N VAL E 165 ? N VAL O 542 O ILE E 190 ? O ILE O 567 
N 1 2 N GLN E 98  ? N GLN O 475 O LEU E 142 ? O LEU O 519 
O 1 2 N ARG E 205 ? N ARG O 582 O THR E 222 ? O THR O 599 
O 2 3 N MET E 219 ? N MET O 596 O VAL E 263 ? O VAL O 640 
O 3 4 O MET E 260 ? O MET O 637 N GLN E 257 ? N GLN O 634 
O 4 5 O MET E 247 ? O MET O 624 N PHE E 234 ? N PHE O 611 
O 5 6 N THR E 235 ? N THR O 612 O ASN E 280 ? O ASN O 657 
O 6 7 N PHE E 281 ? N PHE O 658 O GLN E 294 ? O GLN O 671 
O 7 8 O HIS E 299 ? O HIS O 676 N CYS E 211 ? N CYS O 588 
# 
_atom_sites.entry_id                    2O93 
_atom_sites.fract_transf_matrix[1][1]   0.010673 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006280 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    O "O5'" . DA  A 1 1   ? 28.473  58.267 62.186  1.00 57.97  ? 1   DA  A "O5'" 1 
ATOM 2    C "C5'" . DA  A 1 1   ? 29.267  59.050 63.074  1.00 59.84  ? 1   DA  A "C5'" 1 
ATOM 3    C "C4'" . DA  A 1 1   ? 30.651  58.496 63.338  1.00 60.26  ? 1   DA  A "C4'" 1 
ATOM 4    O "O4'" . DA  A 1 1   ? 30.521  57.166 63.918  1.00 55.74  ? 1   DA  A "O4'" 1 
ATOM 5    C "C3'" . DA  A 1 1   ? 31.455  58.292 62.065  1.00 63.10  ? 1   DA  A "C3'" 1 
ATOM 6    O "O3'" . DA  A 1 1   ? 32.851  58.555 62.191  1.00 69.04  ? 1   DA  A "O3'" 1 
ATOM 7    C "C2'" . DA  A 1 1   ? 31.120  56.869 61.659  1.00 59.22  ? 1   DA  A "C2'" 1 
ATOM 8    C "C1'" . DA  A 1 1   ? 30.877  56.151 62.982  1.00 48.21  ? 1   DA  A "C1'" 1 
ATOM 9    N N9    . DA  A 1 1   ? 29.733  55.240 62.866  1.00 38.43  ? 1   DA  A N9    1 
ATOM 10   C C8    . DA  A 1 1   ? 28.429  55.587 62.579  1.00 35.91  ? 1   DA  A C8    1 
ATOM 11   N N7    . DA  A 1 1   ? 27.608  54.565 62.501  1.00 28.89  ? 1   DA  A N7    1 
ATOM 12   C C5    . DA  A 1 1   ? 28.417  53.482 62.766  1.00 27.91  ? 1   DA  A C5    1 
ATOM 13   C C6    . DA  A 1 1   ? 28.137  52.132 62.850  1.00 27.91  ? 1   DA  A C6    1 
ATOM 14   N N6    . DA  A 1 1   ? 26.918  51.636 62.662  1.00 29.52  ? 1   DA  A N6    1 
ATOM 15   N N1    . DA  A 1 1   ? 29.154  51.292 63.139  1.00 27.68  ? 1   DA  A N1    1 
ATOM 16   C C2    . DA  A 1 1   ? 30.379  51.812 63.323  1.00 28.78  ? 1   DA  A C2    1 
ATOM 17   N N3    . DA  A 1 1   ? 30.769  53.084 63.270  1.00 29.98  ? 1   DA  A N3    1 
ATOM 18   C C4    . DA  A 1 1   ? 29.728  53.877 62.990  1.00 31.04  ? 1   DA  A C4    1 
ATOM 19   P P     . DG  A 1 2   ? 33.728  58.722 60.852  1.00 72.10  ? 2   DG  A P     1 
ATOM 20   O OP1   . DG  A 1 2   ? 34.707  59.806 61.067  1.00 74.26  ? 2   DG  A OP1   1 
ATOM 21   O OP2   . DG  A 1 2   ? 32.813  58.792 59.686  1.00 72.43  ? 2   DG  A OP2   1 
ATOM 22   O "O5'" . DG  A 1 2   ? 34.527  57.354 60.784  1.00 76.18  ? 2   DG  A "O5'" 1 
ATOM 23   C "C5'" . DG  A 1 2   ? 35.353  56.979 61.873  1.00 82.56  ? 2   DG  A "C5'" 1 
ATOM 24   C "C4'" . DG  A 1 2   ? 36.134  55.730 61.547  1.00 79.08  ? 2   DG  A "C4'" 1 
ATOM 25   O "O4'" . DG  A 1 2   ? 35.255  54.588 61.502  1.00 76.00  ? 2   DG  A "O4'" 1 
ATOM 26   C "C3'" . DG  A 1 2   ? 36.814  55.758 60.186  1.00 75.87  ? 2   DG  A "C3'" 1 
ATOM 27   O "O3'" . DG  A 1 2   ? 37.952  54.903 60.290  1.00 67.13  ? 2   DG  A "O3'" 1 
ATOM 28   C "C2'" . DG  A 1 2   ? 35.738  55.194 59.271  1.00 73.10  ? 2   DG  A "C2'" 1 
ATOM 29   C "C1'" . DG  A 1 2   ? 35.101  54.142 60.166  1.00 64.44  ? 2   DG  A "C1'" 1 
ATOM 30   N N9    . DG  A 1 2   ? 33.690  53.852 59.962  1.00 51.81  ? 2   DG  A N9    1 
ATOM 31   C C8    . DG  A 1 2   ? 32.685  54.726 59.627  1.00 44.44  ? 2   DG  A C8    1 
ATOM 32   N N7    . DG  A 1 2   ? 31.514  54.146 59.536  1.00 37.56  ? 2   DG  A N7    1 
ATOM 33   C C5    . DG  A 1 2   ? 31.770  52.811 59.826  1.00 36.08  ? 2   DG  A C5    1 
ATOM 34   C C6    . DG  A 1 2   ? 30.893  51.689 59.879  1.00 33.57  ? 2   DG  A C6    1 
ATOM 35   O O6    . DG  A 1 2   ? 29.672  51.653 59.673  1.00 34.31  ? 2   DG  A O6    1 
ATOM 36   N N1    . DG  A 1 2   ? 31.572  50.522 60.207  1.00 30.54  ? 2   DG  A N1    1 
ATOM 37   C C2    . DG  A 1 2   ? 32.916  50.439 60.450  1.00 34.47  ? 2   DG  A C2    1 
ATOM 38   N N2    . DG  A 1 2   ? 33.392  49.223 60.743  1.00 33.90  ? 2   DG  A N2    1 
ATOM 39   N N3    . DG  A 1 2   ? 33.742  51.473 60.409  1.00 36.81  ? 2   DG  A N3    1 
ATOM 40   C C4    . DG  A 1 2   ? 33.106  52.616 60.090  1.00 40.97  ? 2   DG  A C4    1 
ATOM 41   P P     . DG  A 1 3   ? 39.071  54.900 59.148  1.00 59.79  ? 3   DG  A P     1 
ATOM 42   O OP1   . DG  A 1 3   ? 40.375  54.948 59.848  1.00 60.72  ? 3   DG  A OP1   1 
ATOM 43   O OP2   . DG  A 1 3   ? 38.745  55.879 58.079  1.00 57.31  ? 3   DG  A OP2   1 
ATOM 44   O "O5'" . DG  A 1 3   ? 38.933  53.448 58.554  1.00 56.33  ? 3   DG  A "O5'" 1 
ATOM 45   C "C5'" . DG  A 1 3   ? 37.735  52.759 58.753  1.00 48.07  ? 3   DG  A "C5'" 1 
ATOM 46   C "C4'" . DG  A 1 3   ? 37.883  51.337 58.307  1.00 43.51  ? 3   DG  A "C4'" 1 
ATOM 47   O "O4'" . DG  A 1 3   ? 36.556  50.783 58.316  1.00 43.70  ? 3   DG  A "O4'" 1 
ATOM 48   C "C3'" . DG  A 1 3   ? 38.351  51.257 56.869  1.00 43.09  ? 3   DG  A "C3'" 1 
ATOM 49   O "O3'" . DG  A 1 3   ? 38.954  49.999 56.658  1.00 48.87  ? 3   DG  A "O3'" 1 
ATOM 50   C "C2'" . DG  A 1 3   ? 37.064  51.350 56.088  1.00 41.40  ? 3   DG  A "C2'" 1 
ATOM 51   C "C1'" . DG  A 1 3   ? 36.079  50.635 56.994  1.00 38.53  ? 3   DG  A "C1'" 1 
ATOM 52   N N9    . DG  A 1 3   ? 34.749  51.220 56.931  1.00 32.18  ? 3   DG  A N9    1 
ATOM 53   C C8    . DG  A 1 3   ? 34.432  52.534 56.665  1.00 31.53  ? 3   DG  A C8    1 
ATOM 54   N N7    . DG  A 1 3   ? 33.149  52.730 56.525  1.00 29.51  ? 3   DG  A N7    1 
ATOM 55   C C5    . DG  A 1 3   ? 32.588  51.476 56.751  1.00 27.01  ? 3   DG  A C5    1 
ATOM 56   C C6    . DG  A 1 3   ? 31.235  51.061 56.722  1.00 25.43  ? 3   DG  A C6    1 
ATOM 57   O O6    . DG  A 1 3   ? 30.226  51.743 56.477  1.00 23.29  ? 3   DG  A O6    1 
ATOM 58   N N1    . DG  A 1 3   ? 31.113  49.705 57.015  1.00 22.42  ? 3   DG  A N1    1 
ATOM 59   C C2    . DG  A 1 3   ? 32.159  48.866 57.308  1.00 25.00  ? 3   DG  A C2    1 
ATOM 60   N N2    . DG  A 1 3   ? 31.839  47.586 57.583  1.00 25.82  ? 3   DG  A N2    1 
ATOM 61   N N3    . DG  A 1 3   ? 33.427  49.245 57.334  1.00 24.31  ? 3   DG  A N3    1 
ATOM 62   C C4    . DG  A 1 3   ? 33.564  50.548 57.041  1.00 26.78  ? 3   DG  A C4    1 
ATOM 63   P P     . DG  A 1 4   ? 40.040  49.841 55.510  1.00 53.04  ? 4   DG  A P     1 
ATOM 64   O OP1   . DG  A 1 4   ? 41.384  49.883 56.149  1.00 55.35  ? 4   DG  A OP1   1 
ATOM 65   O OP2   . DG  A 1 4   ? 39.696  50.805 54.427  1.00 56.29  ? 4   DG  A OP2   1 
ATOM 66   O "O5'" . DG  A 1 4   ? 39.752  48.395 54.944  1.00 48.84  ? 4   DG  A "O5'" 1 
ATOM 67   C "C5'" . DG  A 1 4   ? 38.624  48.191 54.116  1.00 44.88  ? 4   DG  A "C5'" 1 
ATOM 68   C "C4'" . DG  A 1 4   ? 37.616  47.340 54.844  1.00 43.66  ? 4   DG  A "C4'" 1 
ATOM 69   O "O4'" . DG  A 1 4   ? 36.473  48.165 55.172  1.00 40.93  ? 4   DG  A "O4'" 1 
ATOM 70   C "C3'" . DG  A 1 4   ? 37.072  46.252 53.927  1.00 44.79  ? 4   DG  A "C3'" 1 
ATOM 71   O "O3'" . DG  A 1 4   ? 36.724  45.103 54.674  1.00 53.33  ? 4   DG  A "O3'" 1 
ATOM 72   C "C2'" . DG  A 1 4   ? 35.878  46.908 53.266  1.00 41.20  ? 4   DG  A "C2'" 1 
ATOM 73   C "C1'" . DG  A 1 4   ? 35.353  47.772 54.392  1.00 40.52  ? 4   DG  A "C1'" 1 
ATOM 74   N N9    . DG  A 1 4   ? 34.625  48.969 53.993  1.00 39.82  ? 4   DG  A N9    1 
ATOM 75   C C8    . DG  A 1 4   ? 35.136  50.204 53.681  1.00 39.30  ? 4   DG  A C8    1 
ATOM 76   N N7    . DG  A 1 4   ? 34.212  51.071 53.364  1.00 40.58  ? 4   DG  A N7    1 
ATOM 77   C C5    . DG  A 1 4   ? 33.023  50.363 53.476  1.00 41.33  ? 4   DG  A C5    1 
ATOM 78   C C6    . DG  A 1 4   ? 31.684  50.773 53.269  1.00 42.02  ? 4   DG  A C6    1 
ATOM 79   O O6    . DG  A 1 4   ? 31.267  51.884 52.924  1.00 41.97  ? 4   DG  A O6    1 
ATOM 80   N N1    . DG  A 1 4   ? 30.786  49.733 53.507  1.00 41.17  ? 4   DG  A N1    1 
ATOM 81   C C2    . DG  A 1 4   ? 31.134  48.466 53.892  1.00 41.67  ? 4   DG  A C2    1 
ATOM 82   N N2    . DG  A 1 4   ? 30.138  47.605 54.075  1.00 43.35  ? 4   DG  A N2    1 
ATOM 83   N N3    . DG  A 1 4   ? 32.374  48.071 54.085  1.00 41.67  ? 4   DG  A N3    1 
ATOM 84   C C4    . DG  A 1 4   ? 33.262  49.065 53.863  1.00 41.28  ? 4   DG  A C4    1 
ATOM 85   P P     . DA  A 1 5   ? 36.782  43.676 53.964  1.00 62.00  ? 5   DA  A P     1 
ATOM 86   O OP1   . DA  A 1 5   ? 37.089  42.702 55.040  1.00 63.81  ? 5   DA  A OP1   1 
ATOM 87   O OP2   . DA  A 1 5   ? 37.671  43.773 52.774  1.00 62.58  ? 5   DA  A OP2   1 
ATOM 88   O "O5'" . DA  A 1 5   ? 35.290  43.447 53.453  1.00 63.11  ? 5   DA  A "O5'" 1 
ATOM 89   C "C5'" . DA  A 1 5   ? 34.287  43.060 54.370  1.00 63.63  ? 5   DA  A "C5'" 1 
ATOM 90   C "C4'" . DA  A 1 5   ? 33.060  42.546 53.656  1.00 61.43  ? 5   DA  A "C4'" 1 
ATOM 91   O "O4'" . DA  A 1 5   ? 32.319  43.638 53.078  1.00 60.43  ? 5   DA  A "O4'" 1 
ATOM 92   C "C3'" . DA  A 1 5   ? 33.323  41.604 52.487  1.00 59.54  ? 5   DA  A "C3'" 1 
ATOM 93   O "O3'" . DA  A 1 5   ? 32.170  40.761 52.391  1.00 56.75  ? 5   DA  A "O3'" 1 
ATOM 94   C "C2'" . DA  A 1 5   ? 33.439  42.559 51.311  1.00 56.47  ? 5   DA  A "C2'" 1 
ATOM 95   C "C1'" . DA  A 1 5   ? 32.384  43.590 51.662  1.00 51.77  ? 5   DA  A "C1'" 1 
ATOM 96   N N9    . DA  A 1 5   ? 32.547  44.962 51.193  1.00 43.73  ? 5   DA  A N9    1 
ATOM 97   C C8    . DA  A 1 5   ? 33.683  45.687 50.958  1.00 38.93  ? 5   DA  A C8    1 
ATOM 98   N N7    . DA  A 1 5   ? 33.452  46.934 50.623  1.00 35.37  ? 5   DA  A N7    1 
ATOM 99   C C5    . DA  A 1 5   ? 32.067  47.029 50.619  1.00 33.93  ? 5   DA  A C5    1 
ATOM 100  C C6    . DA  A 1 5   ? 31.182  48.101 50.348  1.00 31.75  ? 5   DA  A C6    1 
ATOM 101  N N6    . DA  A 1 5   ? 31.576  49.330 50.027  1.00 28.98  ? 5   DA  A N6    1 
ATOM 102  N N1    . DA  A 1 5   ? 29.861  47.857 50.425  1.00 31.02  ? 5   DA  A N1    1 
ATOM 103  C C2    . DA  A 1 5   ? 29.456  46.620 50.765  1.00 34.60  ? 5   DA  A C2    1 
ATOM 104  N N3    . DA  A 1 5   ? 30.184  45.537 51.049  1.00 35.82  ? 5   DA  A N3    1 
ATOM 105  C C4    . DA  A 1 5   ? 31.498  45.816 50.954  1.00 37.67  ? 5   DA  A C4    1 
ATOM 106  P P     . DC  A 1 6   ? 32.017  39.725 51.179  1.00 55.89  ? 6   DC  A P     1 
ATOM 107  O OP1   . DC  A 1 6   ? 31.596  38.432 51.803  1.00 53.37  ? 6   DC  A OP1   1 
ATOM 108  O OP2   . DC  A 1 6   ? 33.233  39.778 50.324  1.00 55.76  ? 6   DC  A OP2   1 
ATOM 109  O "O5'" . DC  A 1 6   ? 30.751  40.289 50.393  1.00 50.85  ? 6   DC  A "O5'" 1 
ATOM 110  C "C5'" . DC  A 1 6   ? 29.511  40.295 51.068  1.00 43.35  ? 6   DC  A "C5'" 1 
ATOM 111  C "C4'" . DC  A 1 6   ? 28.410  40.948 50.269  1.00 40.31  ? 6   DC  A "C4'" 1 
ATOM 112  O "O4'" . DC  A 1 6   ? 28.718  42.333 49.951  1.00 42.39  ? 6   DC  A "O4'" 1 
ATOM 113  C "C3'" . DC  A 1 6   ? 28.199  40.286 48.914  1.00 38.31  ? 6   DC  A "C3'" 1 
ATOM 114  O "O3'" . DC  A 1 6   ? 26.822  40.435 48.601  1.00 38.67  ? 6   DC  A "O3'" 1 
ATOM 115  C "C2'" . DC  A 1 6   ? 29.081  41.101 47.986  1.00 38.16  ? 6   DC  A "C2'" 1 
ATOM 116  C "C1'" . DC  A 1 6   ? 28.830  42.483 48.546  1.00 38.60  ? 6   DC  A "C1'" 1 
ATOM 117  N N1    . DC  A 1 6   ? 29.734  43.606 48.231  1.00 38.24  ? 6   DC  A N1    1 
ATOM 118  C C2    . DC  A 1 6   ? 29.177  44.894 48.036  1.00 39.63  ? 6   DC  A C2    1 
ATOM 119  O O2    . DC  A 1 6   ? 27.956  45.049 48.146  1.00 41.20  ? 6   DC  A O2    1 
ATOM 120  N N3    . DC  A 1 6   ? 29.990  45.928 47.729  1.00 38.55  ? 6   DC  A N3    1 
ATOM 121  C C4    . DC  A 1 6   ? 31.298  45.724 47.603  1.00 39.08  ? 6   DC  A C4    1 
ATOM 122  N N4    . DC  A 1 6   ? 32.058  46.761 47.280  1.00 38.82  ? 6   DC  A N4    1 
ATOM 123  C C5    . DC  A 1 6   ? 31.887  44.442 47.800  1.00 39.77  ? 6   DC  A C5    1 
ATOM 124  C C6    . DC  A 1 6   ? 31.076  43.420 48.114  1.00 38.66  ? 6   DC  A C6    1 
ATOM 125  P P     . DT  A 1 7   ? 26.265  39.915 47.214  1.00 38.54  ? 7   DT  A P     1 
ATOM 126  O OP1   . DT  A 1 7   ? 25.083  39.098 47.515  1.00 40.84  ? 7   DT  A OP1   1 
ATOM 127  O OP2   . DT  A 1 7   ? 27.394  39.317 46.474  1.00 41.90  ? 7   DT  A OP2   1 
ATOM 128  O "O5'" . DT  A 1 7   ? 25.787  41.272 46.525  1.00 43.44  ? 7   DT  A "O5'" 1 
ATOM 129  C "C5'" . DT  A 1 7   ? 25.077  42.238 47.300  1.00 42.60  ? 7   DT  A "C5'" 1 
ATOM 130  C "C4'" . DT  A 1 7   ? 24.459  43.332 46.447  1.00 42.41  ? 7   DT  A "C4'" 1 
ATOM 131  O "O4'" . DT  A 1 7   ? 25.448  44.323 46.078  1.00 38.02  ? 7   DT  A "O4'" 1 
ATOM 132  C "C3'" . DT  A 1 7   ? 23.845  42.876 45.123  1.00 41.95  ? 7   DT  A "C3'" 1 
ATOM 133  O "O3'" . DT  A 1 7   ? 22.803  43.801 44.759  1.00 42.75  ? 7   DT  A "O3'" 1 
ATOM 134  C "C2'" . DT  A 1 7   ? 25.024  42.994 44.171  1.00 40.70  ? 7   DT  A "C2'" 1 
ATOM 135  C "C1'" . DT  A 1 7   ? 25.685  44.265 44.684  1.00 35.42  ? 7   DT  A "C1'" 1 
ATOM 136  N N1    . DT  A 1 7   ? 27.113  44.503 44.457  1.00 29.74  ? 7   DT  A N1    1 
ATOM 137  C C2    . DT  A 1 7   ? 27.459  45.776 44.059  1.00 31.74  ? 7   DT  A C2    1 
ATOM 138  O O2    . DT  A 1 7   ? 26.627  46.655 43.807  1.00 31.95  ? 7   DT  A O2    1 
ATOM 139  N N3    . DT  A 1 7   ? 28.815  45.996 43.961  1.00 30.17  ? 7   DT  A N3    1 
ATOM 140  C C4    . DT  A 1 7   ? 29.823  45.087 44.206  1.00 27.36  ? 7   DT  A C4    1 
ATOM 141  O O4    . DT  A 1 7   ? 31.004  45.430 44.112  1.00 26.23  ? 7   DT  A O4    1 
ATOM 142  C C5    . DT  A 1 7   ? 29.380  43.768 44.576  1.00 25.48  ? 7   DT  A C5    1 
ATOM 143  C C7    . DT  A 1 7   ? 30.415  42.725 44.851  1.00 27.43  ? 7   DT  A C7    1 
ATOM 144  C C6    . DT  A 1 7   ? 28.062  43.539 44.670  1.00 25.85  ? 7   DT  A C6    1 
ATOM 145  P P     . DT  A 1 8   ? 21.645  43.354 43.741  1.00 41.94  ? 8   DT  A P     1 
ATOM 146  O OP1   . DT  A 1 8   ? 20.318  43.629 44.352  1.00 43.28  ? 8   DT  A OP1   1 
ATOM 147  O OP2   . DT  A 1 8   ? 21.974  41.996 43.256  1.00 43.26  ? 8   DT  A OP2   1 
ATOM 148  O "O5'" . DT  A 1 8   ? 21.805  44.376 42.544  1.00 43.84  ? 8   DT  A "O5'" 1 
ATOM 149  C "C5'" . DT  A 1 8   ? 23.035  45.035 42.358  1.00 41.84  ? 8   DT  A "C5'" 1 
ATOM 150  C "C4'" . DT  A 1 8   ? 22.816  46.381 41.720  1.00 40.14  ? 8   DT  A "C4'" 1 
ATOM 151  O "O4'" . DT  A 1 8   ? 24.097  47.047 41.742  1.00 36.98  ? 8   DT  A "O4'" 1 
ATOM 152  C "C3'" . DT  A 1 8   ? 22.393  46.352 40.254  1.00 41.13  ? 8   DT  A "C3'" 1 
ATOM 153  O "O3'" . DT  A 1 8   ? 21.576  47.489 39.941  1.00 45.35  ? 8   DT  A "O3'" 1 
ATOM 154  C "C2'" . DT  A 1 8   ? 23.723  46.302 39.523  1.00 38.00  ? 8   DT  A "C2'" 1 
ATOM 155  C "C1'" . DT  A 1 8   ? 24.685  47.056 40.446  1.00 32.66  ? 8   DT  A "C1'" 1 
ATOM 156  N N1    . DT  A 1 8   ? 25.981  46.364 40.574  1.00 25.02  ? 8   DT  A N1    1 
ATOM 157  C C2    . DT  A 1 8   ? 27.151  47.095 40.501  1.00 23.75  ? 8   DT  A C2    1 
ATOM 158  O O2    . DT  A 1 8   ? 27.171  48.306 40.335  1.00 24.79  ? 8   DT  A O2    1 
ATOM 159  N N3    . DT  A 1 8   ? 28.300  46.351 40.627  1.00 20.80  ? 8   DT  A N3    1 
ATOM 160  C C4    . DT  A 1 8   ? 28.382  44.971 40.804  1.00 21.81  ? 8   DT  A C4    1 
ATOM 161  O O4    . DT  A 1 8   ? 29.483  44.414 40.882  1.00 20.46  ? 8   DT  A O4    1 
ATOM 162  C C5    . DT  A 1 8   ? 27.115  44.282 40.877  1.00 19.63  ? 8   DT  A C5    1 
ATOM 163  C C7    . DT  A 1 8   ? 27.115  42.803 41.076  1.00 17.72  ? 8   DT  A C7    1 
ATOM 164  C C6    . DT  A 1 8   ? 25.996  45.001 40.762  1.00 19.62  ? 8   DT  A C6    1 
ATOM 165  P P     . DT  A 1 9   ? 21.246  47.854 38.413  1.00 44.09  ? 9   DT  A P     1 
ATOM 166  O OP1   . DT  A 1 9   ? 20.177  48.876 38.485  1.00 45.77  ? 9   DT  A OP1   1 
ATOM 167  O OP2   . DT  A 1 9   ? 21.007  46.597 37.664  1.00 46.72  ? 9   DT  A OP2   1 
ATOM 168  O "O5'" . DT  A 1 9   ? 22.584  48.572 37.919  1.00 45.50  ? 9   DT  A "O5'" 1 
ATOM 169  C "C5'" . DT  A 1 9   ? 23.188  49.559 38.756  1.00 45.26  ? 9   DT  A "C5'" 1 
ATOM 170  C "C4'" . DT  A 1 9   ? 24.114  50.488 37.997  1.00 44.88  ? 9   DT  A "C4'" 1 
ATOM 171  O "O4'" . DT  A 1 9   ? 25.474  49.989 38.047  1.00 43.00  ? 9   DT  A "O4'" 1 
ATOM 172  C "C3'" . DT  A 1 9   ? 23.827  50.706 36.515  1.00 46.09  ? 9   DT  A "C3'" 1 
ATOM 173  O "O3'" . DT  A 1 9   ? 24.236  52.032 36.138  1.00 51.53  ? 9   DT  A "O3'" 1 
ATOM 174  C "C2'" . DT  A 1 9   ? 24.660  49.617 35.858  1.00 42.86  ? 9   DT  A "C2'" 1 
ATOM 175  C "C1'" . DT  A 1 9   ? 25.891  49.548 36.762  1.00 36.46  ? 9   DT  A "C1'" 1 
ATOM 176  N N1    . DT  A 1 9   ? 26.490  48.207 36.917  1.00 32.05  ? 9   DT  A N1    1 
ATOM 177  C C2    . DT  A 1 9   ? 27.859  48.106 37.084  1.00 28.89  ? 9   DT  A C2    1 
ATOM 178  O O2    . DT  A 1 9   ? 28.600  49.075 37.131  1.00 28.45  ? 9   DT  A O2    1 
ATOM 179  N N3    . DT  A 1 9   ? 28.326  46.816 37.196  1.00 24.88  ? 9   DT  A N3    1 
ATOM 180  C C4    . DT  A 1 9   ? 27.571  45.650 37.162  1.00 25.58  ? 9   DT  A C4    1 
ATOM 181  O O4    . DT  A 1 9   ? 28.119  44.553 37.269  1.00 26.99  ? 9   DT  A O4    1 
ATOM 182  C C5    . DT  A 1 9   ? 26.152  45.836 36.994  1.00 24.97  ? 9   DT  A C5    1 
ATOM 183  C C7    . DT  A 1 9   ? 25.266  44.631 36.945  1.00 23.38  ? 9   DT  A C7    1 
ATOM 184  C C6    . DT  A 1 9   ? 25.688  47.084 36.884  1.00 28.05  ? 9   DT  A C6    1 
ATOM 185  P P     . DC  A 1 10  ? 24.116  52.522 34.604  1.00 54.97  ? 10  DC  A P     1 
ATOM 186  O OP1   . DC  A 1 10  ? 23.768  53.964 34.712  1.00 52.28  ? 10  DC  A OP1   1 
ATOM 187  O OP2   . DC  A 1 10  ? 23.262  51.605 33.791  1.00 54.08  ? 10  DC  A OP2   1 
ATOM 188  O "O5'" . DC  A 1 10  ? 25.615  52.420 34.096  1.00 54.04  ? 10  DC  A "O5'" 1 
ATOM 189  C "C5'" . DC  A 1 10  ? 26.613  53.070 34.844  1.00 54.75  ? 10  DC  A "C5'" 1 
ATOM 190  C "C4'" . DC  A 1 10  ? 27.973  52.906 34.216  1.00 54.95  ? 10  DC  A "C4'" 1 
ATOM 191  O "O4'" . DC  A 1 10  ? 28.539  51.600 34.508  1.00 51.67  ? 10  DC  A "O4'" 1 
ATOM 192  C "C3'" . DC  A 1 10  ? 27.894  52.969 32.690  1.00 55.19  ? 10  DC  A "C3'" 1 
ATOM 193  O "O3'" . DC  A 1 10  ? 29.160  53.454 32.244  1.00 57.55  ? 10  DC  A "O3'" 1 
ATOM 194  C "C2'" . DC  A 1 10  ? 27.715  51.508 32.310  1.00 51.22  ? 10  DC  A "C2'" 1 
ATOM 195  C "C1'" . DC  A 1 10  ? 28.670  50.887 33.302  1.00 43.91  ? 10  DC  A "C1'" 1 
ATOM 196  N N1    . DC  A 1 10  ? 28.640  49.446 33.561  1.00 36.40  ? 10  DC  A N1    1 
ATOM 197  C C2    . DC  A 1 10  ? 29.867  48.779 33.778  1.00 31.65  ? 10  DC  A C2    1 
ATOM 198  O O2    . DC  A 1 10  ? 30.919  49.443 33.822  1.00 26.95  ? 10  DC  A O2    1 
ATOM 199  N N3    . DC  A 1 10  ? 29.870  47.432 33.930  1.00 27.36  ? 10  DC  A N3    1 
ATOM 200  C C4    . DC  A 1 10  ? 28.722  46.755 33.879  1.00 26.75  ? 10  DC  A C4    1 
ATOM 201  N N4    . DC  A 1 10  ? 28.774  45.433 34.000  1.00 24.35  ? 10  DC  A N4    1 
ATOM 202  C C5    . DC  A 1 10  ? 27.463  47.407 33.696  1.00 28.71  ? 10  DC  A C5    1 
ATOM 203  C C6    . DC  A 1 10  ? 27.468  48.745 33.550  1.00 33.38  ? 10  DC  A C6    1 
ATOM 204  P P     . DC  A 1 11  ? 29.346  54.038 30.767  1.00 58.11  ? 11  DC  A P     1 
ATOM 205  O OP1   . DC  A 1 11  ? 29.611  55.474 30.974  1.00 58.58  ? 11  DC  A OP1   1 
ATOM 206  O OP2   . DC  A 1 11  ? 28.262  53.609 29.844  1.00 60.96  ? 11  DC  A OP2   1 
ATOM 207  O "O5'" . DC  A 1 11  ? 30.704  53.330 30.355  1.00 57.42  ? 11  DC  A "O5'" 1 
ATOM 208  C "C5'" . DC  A 1 11  ? 31.635  53.011 31.380  1.00 55.50  ? 11  DC  A "C5'" 1 
ATOM 209  C "C4'" . DC  A 1 11  ? 32.933  52.510 30.799  1.00 55.23  ? 11  DC  A "C4'" 1 
ATOM 210  O "O4'" . DC  A 1 11  ? 33.060  51.085 31.023  1.00 52.18  ? 11  DC  A "O4'" 1 
ATOM 211  C "C3'" . DC  A 1 11  ? 33.052  52.689 29.292  1.00 57.35  ? 11  DC  A "C3'" 1 
ATOM 212  O "O3'" . DC  A 1 11  ? 34.449  52.859 28.997  1.00 66.26  ? 11  DC  A "O3'" 1 
ATOM 213  C "C2'" . DC  A 1 11  ? 32.458  51.391 28.761  1.00 52.37  ? 11  DC  A "C2'" 1 
ATOM 214  C "C1'" . DC  A 1 11  ? 32.930  50.374 29.799  1.00 47.44  ? 11  DC  A "C1'" 1 
ATOM 215  N N1    . DC  A 1 11  ? 32.071  49.197 30.046  1.00 41.44  ? 11  DC  A N1    1 
ATOM 216  C C2    . DC  A 1 11  ? 32.681  47.950 30.308  1.00 39.18  ? 11  DC  A C2    1 
ATOM 217  O O2    . DC  A 1 11  ? 33.930  47.865 30.302  1.00 37.22  ? 11  DC  A O2    1 
ATOM 218  N N3    . DC  A 1 11  ? 31.893  46.876 30.558  1.00 36.70  ? 11  DC  A N3    1 
ATOM 219  C C4    . DC  A 1 11  ? 30.564  47.006 30.550  1.00 34.92  ? 11  DC  A C4    1 
ATOM 220  N N4    . DC  A 1 11  ? 29.831  45.930 30.806  1.00 33.06  ? 11  DC  A N4    1 
ATOM 221  C C5    . DC  A 1 11  ? 29.928  48.248 30.281  1.00 34.64  ? 11  DC  A C5    1 
ATOM 222  C C6    . DC  A 1 11  ? 30.709  49.307 30.035  1.00 38.27  ? 11  DC  A C6    1 
ATOM 223  P P     . DG  A 1 12  ? 34.932  53.249 27.516  1.00 71.46  ? 12  DG  A P     1 
ATOM 224  O OP1   . DG  A 1 12  ? 35.735  54.498 27.622  1.00 72.83  ? 12  DG  A OP1   1 
ATOM 225  O OP2   . DG  A 1 12  ? 33.768  53.190 26.584  1.00 71.89  ? 12  DG  A OP2   1 
ATOM 226  O "O5'" . DG  A 1 12  ? 35.914  52.049 27.185  1.00 72.67  ? 12  DG  A "O5'" 1 
ATOM 227  C "C5'" . DG  A 1 12  ? 35.648  50.770 27.729  1.00 74.66  ? 12  DG  A "C5'" 1 
ATOM 228  C "C4'" . DG  A 1 12  ? 36.614  49.756 27.179  1.00 73.64  ? 12  DG  A "C4'" 1 
ATOM 229  O "O4'" . DG  A 1 12  ? 36.098  48.447 27.503  1.00 71.05  ? 12  DG  A "O4'" 1 
ATOM 230  C "C3'" . DG  A 1 12  ? 36.713  49.778 25.663  1.00 74.77  ? 12  DG  A "C3'" 1 
ATOM 231  O "O3'" . DG  A 1 12  ? 38.002  49.302 25.282  1.00 76.79  ? 12  DG  A "O3'" 1 
ATOM 232  C "C2'" . DG  A 1 12  ? 35.591  48.854 25.235  1.00 70.04  ? 12  DG  A "C2'" 1 
ATOM 233  C "C1'" . DG  A 1 12  ? 35.553  47.822 26.348  1.00 62.77  ? 12  DG  A "C1'" 1 
ATOM 234  N N9    . DG  A 1 12  ? 34.188  47.430 26.674  1.00 54.51  ? 12  DG  A N9    1 
ATOM 235  C C8    . DG  A 1 12  ? 33.084  48.253 26.741  1.00 50.23  ? 12  DG  A C8    1 
ATOM 236  N N7    . DG  A 1 12  ? 31.986  47.612 27.028  1.00 45.50  ? 12  DG  A N7    1 
ATOM 237  C C5    . DG  A 1 12  ? 32.392  46.292 27.164  1.00 45.03  ? 12  DG  A C5    1 
ATOM 238  C C6    . DG  A 1 12  ? 31.641  45.136 27.462  1.00 44.27  ? 12  DG  A C6    1 
ATOM 239  O O6    . DG  A 1 12  ? 30.423  45.048 27.676  1.00 44.93  ? 12  DG  A O6    1 
ATOM 240  N N1    . DG  A 1 12  ? 32.444  43.999 27.499  1.00 41.78  ? 12  DG  A N1    1 
ATOM 241  C C2    . DG  A 1 12  ? 33.799  43.988 27.280  1.00 43.55  ? 12  DG  A C2    1 
ATOM 242  N N2    . DG  A 1 12  ? 34.410  42.795 27.365  1.00 42.42  ? 12  DG  A N2    1 
ATOM 243  N N3    . DG  A 1 12  ? 34.510  45.068 26.997  1.00 43.47  ? 12  DG  A N3    1 
ATOM 244  C C4    . DG  A 1 12  ? 33.749  46.170 26.956  1.00 46.32  ? 12  DG  A C4    1 
ATOM 245  P P     . DC  A 1 13  ? 38.309  48.951 23.749  1.00 76.69  ? 13  DC  A P     1 
ATOM 246  O OP1   . DC  A 1 13  ? 39.762  49.221 23.633  1.00 77.12  ? 13  DC  A OP1   1 
ATOM 247  O OP2   . DC  A 1 13  ? 37.343  49.652 22.852  1.00 76.21  ? 13  DC  A OP2   1 
ATOM 248  O "O5'" . DC  A 1 13  ? 38.089  47.374 23.671  1.00 73.93  ? 13  DC  A "O5'" 1 
ATOM 249  C "C5'" . DC  A 1 13  ? 38.773  46.532 24.592  1.00 74.34  ? 13  DC  A "C5'" 1 
ATOM 250  C "C4'" . DC  A 1 13  ? 38.750  45.091 24.142  1.00 69.97  ? 13  DC  A "C4'" 1 
ATOM 251  O "O4'" . DC  A 1 13  ? 37.470  44.484 24.456  1.00 65.30  ? 13  DC  A "O4'" 1 
ATOM 252  C "C3'" . DC  A 1 13  ? 38.901  44.945 22.634  1.00 69.09  ? 13  DC  A "C3'" 1 
ATOM 253  O "O3'" . DC  A 1 13  ? 39.537  43.700 22.347  1.00 71.80  ? 13  DC  A "O3'" 1 
ATOM 254  C "C2'" . DC  A 1 13  ? 37.464  44.979 22.151  1.00 63.70  ? 13  DC  A "C2'" 1 
ATOM 255  C "C1'" . DC  A 1 13  ? 36.744  44.232 23.261  1.00 54.12  ? 13  DC  A "C1'" 1 
ATOM 256  N N1    . DC  A 1 13  ? 35.344  44.621 23.477  1.00 40.73  ? 13  DC  A N1    1 
ATOM 257  C C2    . DC  A 1 13  ? 34.389  43.613 23.714  1.00 33.41  ? 13  DC  A C2    1 
ATOM 258  O O2    . DC  A 1 13  ? 34.766  42.424 23.751  1.00 26.68  ? 13  DC  A O2    1 
ATOM 259  N N3    . DC  A 1 13  ? 33.085  43.969 23.893  1.00 28.05  ? 13  DC  A N3    1 
ATOM 260  C C4    . DC  A 1 13  ? 32.734  45.264 23.841  1.00 27.08  ? 13  DC  A C4    1 
ATOM 261  N N4    . DC  A 1 13  ? 31.449  45.578 24.012  1.00 25.33  ? 13  DC  A N4    1 
ATOM 262  C C5    . DC  A 1 13  ? 33.688  46.297 23.608  1.00 27.28  ? 13  DC  A C5    1 
ATOM 263  C C6    . DC  A 1 13  ? 34.968  45.934 23.438  1.00 33.99  ? 13  DC  A C6    1 
ATOM 264  P P     . DT  A 1 14  ? 39.735  43.229 20.825  1.00 73.81  ? 14  DT  A P     1 
ATOM 265  O OP1   . DT  A 1 14  ? 41.024  42.486 20.797  1.00 72.45  ? 14  DT  A OP1   1 
ATOM 266  O OP2   . DT  A 1 14  ? 39.524  44.378 19.901  1.00 72.68  ? 14  DT  A OP2   1 
ATOM 267  O "O5'" . DT  A 1 14  ? 38.553  42.191 20.613  1.00 72.96  ? 14  DT  A "O5'" 1 
ATOM 268  C "C5'" . DT  A 1 14  ? 38.527  40.988 21.359  1.00 76.15  ? 14  DT  A "C5'" 1 
ATOM 269  C "C4'" . DT  A 1 14  ? 37.656  39.971 20.668  1.00 74.14  ? 14  DT  A "C4'" 1 
ATOM 270  O "O4'" . DT  A 1 14  ? 36.265  40.310 20.862  1.00 72.24  ? 14  DT  A "O4'" 1 
ATOM 271  C "C3'" . DT  A 1 14  ? 37.863  39.997 19.161  1.00 72.99  ? 14  DT  A "C3'" 1 
ATOM 272  O "O3'" . DT  A 1 14  ? 37.525  38.713 18.659  1.00 71.62  ? 14  DT  A "O3'" 1 
ATOM 273  C "C2'" . DT  A 1 14  ? 36.856  41.037 18.702  1.00 70.00  ? 14  DT  A "C2'" 1 
ATOM 274  C "C1'" . DT  A 1 14  ? 35.699  40.752 19.641  1.00 62.15  ? 14  DT  A "C1'" 1 
ATOM 275  N N1    . DT  A 1 14  ? 34.727  41.829 19.934  1.00 49.95  ? 14  DT  A N1    1 
ATOM 276  C C2    . DT  A 1 14  ? 33.444  41.420 20.182  1.00 43.30  ? 14  DT  A C2    1 
ATOM 277  O O2    . DT  A 1 14  ? 33.122  40.249 20.188  1.00 42.29  ? 14  DT  A O2    1 
ATOM 278  N N3    . DT  A 1 14  ? 32.549  42.418 20.428  1.00 37.58  ? 14  DT  A N3    1 
ATOM 279  C C4    . DT  A 1 14  ? 32.802  43.764 20.460  1.00 39.25  ? 14  DT  A C4    1 
ATOM 280  O O4    . DT  A 1 14  ? 31.883  44.553 20.708  1.00 37.61  ? 14  DT  A O4    1 
ATOM 281  C C5    . DT  A 1 14  ? 34.183  44.138 20.196  1.00 40.53  ? 14  DT  A C5    1 
ATOM 282  C C7    . DT  A 1 14  ? 34.553  45.590 20.206  1.00 38.92  ? 14  DT  A C7    1 
ATOM 283  C C6    . DT  A 1 14  ? 35.067  43.159 19.952  1.00 43.11  ? 14  DT  A C6    1 
ATOM 284  P P     . DG  A 1 15  ? 38.069  38.245 17.228  1.00 72.19  ? 15  DG  A P     1 
ATOM 285  O OP1   . DG  A 1 15  ? 39.233  37.343 17.457  1.00 68.55  ? 15  DG  A OP1   1 
ATOM 286  O OP2   . DG  A 1 15  ? 38.212  39.440 16.340  1.00 67.46  ? 15  DG  A OP2   1 
ATOM 287  O "O5'" . DG  A 1 15  ? 36.877  37.340 16.704  1.00 72.27  ? 15  DG  A "O5'" 1 
ATOM 288  C "C5'" . DG  A 1 15  ? 36.312  36.365 17.558  1.00 77.11  ? 15  DG  A "C5'" 1 
ATOM 289  C "C4'" . DG  A 1 15  ? 34.914  36.033 17.106  1.00 77.05  ? 15  DG  A "C4'" 1 
ATOM 290  O "O4'" . DG  A 1 15  ? 34.028  37.151 17.356  1.00 74.43  ? 15  DG  A "O4'" 1 
ATOM 291  C "C3'" . DG  A 1 15  ? 34.885  35.837 15.599  1.00 78.05  ? 15  DG  A "C3'" 1 
ATOM 292  O "O3'" . DG  A 1 15  ? 33.803  34.983 15.292  1.00 81.41  ? 15  DG  A "O3'" 1 
ATOM 293  C "C2'" . DG  A 1 15  ? 34.609  37.234 15.080  1.00 73.44  ? 15  DG  A "C2'" 1 
ATOM 294  C "C1'" . DG  A 1 15  ? 33.639  37.741 16.125  1.00 65.32  ? 15  DG  A "C1'" 1 
ATOM 295  N N9    . DG  A 1 15  ? 33.575  39.187 16.303  1.00 53.76  ? 15  DG  A N9    1 
ATOM 296  C C8    . DG  A 1 15  ? 34.574  40.098 16.065  1.00 48.57  ? 15  DG  A C8    1 
ATOM 297  N N7    . DG  A 1 15  ? 34.215  41.328 16.320  1.00 43.86  ? 15  DG  A N7    1 
ATOM 298  C C5    . DG  A 1 15  ? 32.899  41.221 16.755  1.00 41.31  ? 15  DG  A C5    1 
ATOM 299  C C6    . DG  A 1 15  ? 31.994  42.224 17.190  1.00 40.20  ? 15  DG  A C6    1 
ATOM 300  O O6    . DG  A 1 15  ? 32.189  43.439 17.282  1.00 40.02  ? 15  DG  A O6    1 
ATOM 301  N N1    . DG  A 1 15  ? 30.760  41.688 17.548  1.00 37.50  ? 15  DG  A N1    1 
ATOM 302  C C2    . DG  A 1 15  ? 30.440  40.354 17.502  1.00 38.66  ? 15  DG  A C2    1 
ATOM 303  N N2    . DG  A 1 15  ? 29.189  40.031 17.900  1.00 35.87  ? 15  DG  A N2    1 
ATOM 304  N N3    . DG  A 1 15  ? 31.282  39.403 17.099  1.00 39.41  ? 15  DG  A N3    1 
ATOM 305  C C4    . DG  A 1 15  ? 32.485  39.909 16.745  1.00 43.98  ? 15  DG  A C4    1 
ATOM 306  P P     . DG  A 1 16  ? 33.967  33.872 14.160  1.00 82.66  ? 16  DG  A P     1 
ATOM 307  O OP1   . DG  A 1 16  ? 34.415  32.624 14.833  1.00 81.19  ? 16  DG  A OP1   1 
ATOM 308  O OP2   . DG  A 1 16  ? 34.758  34.438 13.036  1.00 84.67  ? 16  DG  A OP2   1 
ATOM 309  O "O5'" . DG  A 1 16  ? 32.464  33.678 13.697  1.00 82.76  ? 16  DG  A "O5'" 1 
ATOM 310  C "C5'" . DG  A 1 16  ? 31.487  33.391 14.675  1.00 81.79  ? 16  DG  A "C5'" 1 
ATOM 311  C "C4'" . DG  A 1 16  ? 30.219  34.170 14.428  1.00 79.28  ? 16  DG  A "C4'" 1 
ATOM 312  O "O4'" . DG  A 1 16  ? 30.413  35.600 14.600  1.00 73.96  ? 16  DG  A "O4'" 1 
ATOM 313  C "C3'" . DG  A 1 16  ? 29.784  34.012 12.975  1.00 80.52  ? 16  DG  A "C3'" 1 
ATOM 314  O "O3'" . DG  A 1 16  ? 28.387  34.228 12.964  1.00 87.40  ? 16  DG  A "O3'" 1 
ATOM 315  C "C2'" . DG  A 1 16  ? 30.464  35.179 12.285  1.00 73.45  ? 16  DG  A "C2'" 1 
ATOM 316  C "C1'" . DG  A 1 16  ? 30.242  36.231 13.346  1.00 65.89  ? 16  DG  A "C1'" 1 
ATOM 317  N N9    . DG  A 1 16  ? 30.991  37.480 13.307  1.00 55.85  ? 16  DG  A N9    1 
ATOM 318  C C8    . DG  A 1 16  ? 32.285  37.678 12.899  1.00 52.25  ? 16  DG  A C8    1 
ATOM 319  N N7    . DG  A 1 16  ? 32.652  38.936 12.948  1.00 48.34  ? 16  DG  A N7    1 
ATOM 320  C C5    . DG  A 1 16  ? 31.534  39.606 13.426  1.00 44.11  ? 16  DG  A C5    1 
ATOM 321  C C6    . DG  A 1 16  ? 31.335  40.990 13.698  1.00 40.76  ? 16  DG  A C6    1 
ATOM 322  O O6    . DG  A 1 16  ? 32.145  41.929 13.577  1.00 36.89  ? 16  DG  A O6    1 
ATOM 323  N N1    . DG  A 1 16  ? 30.045  41.237 14.166  1.00 39.34  ? 16  DG  A N1    1 
ATOM 324  C C2    . DG  A 1 16  ? 29.073  40.274 14.362  1.00 40.89  ? 16  DG  A C2    1 
ATOM 325  N N2    . DG  A 1 16  ? 27.878  40.707 14.833  1.00 39.66  ? 16  DG  A N2    1 
ATOM 326  N N3    . DG  A 1 16  ? 29.255  38.980 14.120  1.00 41.85  ? 16  DG  A N3    1 
ATOM 327  C C4    . DG  A 1 16  ? 30.498  38.722 13.657  1.00 47.50  ? 16  DG  A C4    1 
ATOM 328  P P     . DG  A 1 17  ? 27.464  33.431 11.943  1.00 91.67  ? 17  DG  A P     1 
ATOM 329  O OP1   . DG  A 1 17  ? 27.260  32.067 12.500  1.00 88.63  ? 17  DG  A OP1   1 
ATOM 330  O OP2   . DG  A 1 17  ? 28.057  33.598 10.589  1.00 90.76  ? 17  DG  A OP2   1 
ATOM 331  O "O5'" . DG  A 1 17  ? 26.107  34.250 12.067  1.00 97.88  ? 17  DG  A "O5'" 1 
ATOM 332  C "C5'" . DG  A 1 17  ? 25.604  34.568 13.358  1.00 108.49 ? 17  DG  A "C5'" 1 
ATOM 333  C "C4'" . DG  A 1 17  ? 24.668  35.753 13.308  1.00 105.58 ? 17  DG  A "C4'" 1 
ATOM 334  O "O4'" . DG  A 1 17  ? 25.409  36.993 13.189  1.00 101.44 ? 17  DG  A "O4'" 1 
ATOM 335  C "C3'" . DG  A 1 17  ? 23.747  35.724 12.095  1.00 102.86 ? 17  DG  A "C3'" 1 
ATOM 336  O "O3'" . DG  A 1 17  ? 22.527  36.377 12.441  1.00 94.64  ? 17  DG  A "O3'" 1 
ATOM 337  C "C2'" . DG  A 1 17  ? 24.539  36.495 11.052  1.00 98.61  ? 17  DG  A "C2'" 1 
ATOM 338  C "C1'" . DG  A 1 17  ? 25.199  37.571 11.905  1.00 85.89  ? 17  DG  A "C1'" 1 
ATOM 339  N N9    . DG  A 1 17  ? 26.472  38.118 11.441  1.00 66.31  ? 17  DG  A N9    1 
ATOM 340  C C8    . DG  A 1 17  ? 27.538  37.420 10.922  1.00 55.90  ? 17  DG  A C8    1 
ATOM 341  N N7    . DG  A 1 17  ? 28.567  38.181 10.647  1.00 45.95  ? 17  DG  A N7    1 
ATOM 342  C C5    . DG  A 1 17  ? 28.155  39.462 10.999  1.00 43.18  ? 17  DG  A C5    1 
ATOM 343  C C6    . DG  A 1 17  ? 28.857  40.703 10.939  1.00 39.14  ? 17  DG  A C6    1 
ATOM 344  O O6    . DG  A 1 17  ? 30.018  40.913 10.560  1.00 34.79  ? 17  DG  A O6    1 
ATOM 345  N N1    . DG  A 1 17  ? 28.066  41.764 11.381  1.00 36.89  ? 17  DG  A N1    1 
ATOM 346  C C2    . DG  A 1 17  ? 26.768  41.644 11.827  1.00 38.50  ? 17  DG  A C2    1 
ATOM 347  N N2    . DG  A 1 17  ? 26.171  42.795 12.192  1.00 36.10  ? 17  DG  A N2    1 
ATOM 348  N N3    . DG  A 1 17  ? 26.104  40.486 11.902  1.00 39.74  ? 17  DG  A N3    1 
ATOM 349  C C4    . DG  A 1 17  ? 26.856  39.447 11.473  1.00 49.17  ? 17  DG  A C4    1 
ATOM 350  P P     . DG  A 1 18  ? 21.134  35.841 11.851  1.00 90.32  ? 18  DG  A P     1 
ATOM 351  O OP1   . DG  A 1 18  ? 20.215  35.662 13.007  1.00 87.08  ? 18  DG  A OP1   1 
ATOM 352  O OP2   . DG  A 1 18  ? 21.377  34.715 10.905  1.00 84.64  ? 18  DG  A OP2   1 
ATOM 353  O "O5'" . DG  A 1 18  ? 20.632  37.087 11.013  1.00 87.80  ? 18  DG  A "O5'" 1 
ATOM 354  C "C5'" . DG  A 1 18  ? 21.594  37.963 10.473  1.00 86.89  ? 18  DG  A "C5'" 1 
ATOM 355  C "C4'" . DG  A 1 18  ? 21.356  39.368 10.958  1.00 82.14  ? 18  DG  A "C4'" 1 
ATOM 356  O "O4'" . DG  A 1 18  ? 22.634  40.019 11.014  1.00 79.99  ? 18  DG  A "O4'" 1 
ATOM 357  C "C3'" . DG  A 1 18  ? 20.507  40.202 10.018  1.00 79.46  ? 18  DG  A "C3'" 1 
ATOM 358  O "O3'" . DG  A 1 18  ? 19.854  41.250 10.727  1.00 74.34  ? 18  DG  A "O3'" 1 
ATOM 359  C "C2'" . DG  A 1 18  ? 21.541  40.736 9.051   1.00 78.42  ? 18  DG  A "C2'" 1 
ATOM 360  C "C1'" . DG  A 1 18  ? 22.782  40.898 9.915   1.00 72.25  ? 18  DG  A "C1'" 1 
ATOM 361  N N9    . DG  A 1 18  ? 24.001  40.484 9.232   1.00 62.68  ? 18  DG  A N9    1 
ATOM 362  C C8    . DG  A 1 18  ? 24.341  39.210 8.842   1.00 55.41  ? 18  DG  A C8    1 
ATOM 363  N N7    . DG  A 1 18  ? 25.527  39.140 8.306   1.00 49.86  ? 18  DG  A N7    1 
ATOM 364  C C5    . DG  A 1 18  ? 25.989  40.449 8.331   1.00 50.88  ? 18  DG  A C5    1 
ATOM 365  C C6    . DG  A 1 18  ? 27.218  40.998 7.886   1.00 50.25  ? 18  DG  A C6    1 
ATOM 366  O O6    . DG  A 1 18  ? 28.178  40.409 7.360   1.00 50.91  ? 18  DG  A O6    1 
ATOM 367  N N1    . DG  A 1 18  ? 27.273  42.377 8.102   1.00 48.35  ? 18  DG  A N1    1 
ATOM 368  C C2    . DG  A 1 18  ? 26.264  43.126 8.672   1.00 51.00  ? 18  DG  A C2    1 
ATOM 369  N N2    . DG  A 1 18  ? 26.486  44.444 8.804   1.00 53.18  ? 18  DG  A N2    1 
ATOM 370  N N3    . DG  A 1 18  ? 25.116  42.622 9.087   1.00 52.04  ? 18  DG  A N3    1 
ATOM 371  C C4    . DG  A 1 18  ? 25.049  41.289 8.889   1.00 54.85  ? 18  DG  A C4    1 
ATOM 372  P P     . DA  A 1 19  ? 18.907  42.268 9.930   1.00 70.13  ? 19  DA  A P     1 
ATOM 373  O OP1   . DA  A 1 19  ? 17.850  42.739 10.849  1.00 69.93  ? 19  DA  A OP1   1 
ATOM 374  O OP2   . DA  A 1 19  ? 18.526  41.610 8.659   1.00 69.08  ? 19  DA  A OP2   1 
ATOM 375  O "O5'" . DA  A 1 19  ? 19.851  43.508 9.616   1.00 67.87  ? 19  DA  A "O5'" 1 
ATOM 376  C "C5'" . DA  A 1 19  ? 20.324  44.338 10.670  1.00 64.14  ? 19  DA  A "C5'" 1 
ATOM 377  C "C4'" . DA  A 1 19  ? 20.860  45.638 10.117  1.00 62.31  ? 19  DA  A "C4'" 1 
ATOM 378  O "O4'" . DA  A 1 19  ? 22.033  45.364 9.317   1.00 58.84  ? 19  DA  A "O4'" 1 
ATOM 379  C "C3'" . DA  A 1 19  ? 19.896  46.355 9.176   1.00 61.80  ? 19  DA  A "C3'" 1 
ATOM 380  O "O3'" . DA  A 1 19  ? 20.182  47.762 9.213   1.00 65.46  ? 19  DA  A "O3'" 1 
ATOM 381  C "C2'" . DA  A 1 19  ? 20.235  45.735 7.833   1.00 57.30  ? 19  DA  A "C2'" 1 
ATOM 382  C "C1'" . DA  A 1 19  ? 21.744  45.541 7.937   1.00 51.31  ? 19  DA  A "C1'" 1 
ATOM 383  N N9    . DA  A 1 19  ? 22.299  44.387 7.230   1.00 42.79  ? 19  DA  A N9    1 
ATOM 384  C C8    . DA  A 1 19  ? 21.736  43.150 7.067   1.00 37.82  ? 19  DA  A C8    1 
ATOM 385  N N7    . DA  A 1 19  ? 22.521  42.288 6.465   1.00 34.64  ? 19  DA  A N7    1 
ATOM 386  C C5    . DA  A 1 19  ? 23.672  43.014 6.195   1.00 31.76  ? 19  DA  A C5    1 
ATOM 387  C C6    . DA  A 1 19  ? 24.885  42.668 5.581   1.00 28.33  ? 19  DA  A C6    1 
ATOM 388  N N6    . DA  A 1 19  ? 25.161  41.443 5.129   1.00 25.84  ? 19  DA  A N6    1 
ATOM 389  N N1    . DA  A 1 19  ? 25.823  43.632 5.452   1.00 27.64  ? 19  DA  A N1    1 
ATOM 390  C C2    . DA  A 1 19  ? 25.553  44.856 5.918   1.00 29.74  ? 19  DA  A C2    1 
ATOM 391  N N3    . DA  A 1 19  ? 24.455  45.300 6.523   1.00 34.18  ? 19  DA  A N3    1 
ATOM 392  C C4    . DA  A 1 19  ? 23.541  44.316 6.635   1.00 36.03  ? 19  DA  A C4    1 
ATOM 393  P P     . DC  A 1 20  ? 19.122  48.818 8.628   1.00 67.31  ? 20  DC  A P     1 
ATOM 394  O OP1   . DC  A 1 20  ? 19.078  50.007 9.513   1.00 67.36  ? 20  DC  A OP1   1 
ATOM 395  O OP2   . DC  A 1 20  ? 17.862  48.098 8.290   1.00 66.82  ? 20  DC  A OP2   1 
ATOM 396  O "O5'" . DC  A 1 20  ? 19.829  49.293 7.290   1.00 72.31  ? 20  DC  A "O5'" 1 
ATOM 397  C "C5'" . DC  A 1 20  ? 20.688  48.401 6.608   1.00 75.10  ? 20  DC  A "C5'" 1 
ATOM 398  C "C4'" . DC  A 1 20  ? 21.837  49.135 5.968   1.00 71.45  ? 20  DC  A "C4'" 1 
ATOM 399  O "O4'" . DC  A 1 20  ? 22.782  48.119 5.581   1.00 68.50  ? 20  DC  A "O4'" 1 
ATOM 400  C "C3'" . DC  A 1 20  ? 21.455  49.860 4.679   1.00 69.15  ? 20  DC  A "C3'" 1 
ATOM 401  O "O3'" . DC  A 1 20  ? 22.356  50.947 4.397   1.00 64.21  ? 20  DC  A "O3'" 1 
ATOM 402  C "C2'" . DC  A 1 20  ? 21.593  48.765 3.644   1.00 67.18  ? 20  DC  A "C2'" 1 
ATOM 403  C "C1'" . DC  A 1 20  ? 22.763  47.951 4.176   1.00 61.02  ? 20  DC  A "C1'" 1 
ATOM 404  N N1    . DC  A 1 20  ? 22.665  46.512 3.897   1.00 52.85  ? 20  DC  A N1    1 
ATOM 405  C C2    . DC  A 1 20  ? 23.768  45.873 3.316   1.00 49.24  ? 20  DC  A C2    1 
ATOM 406  O O2    . DC  A 1 20  ? 24.801  46.544 3.092   1.00 48.83  ? 20  DC  A O2    1 
ATOM 407  N N3    . DC  A 1 20  ? 23.688  44.553 3.015   1.00 43.79  ? 20  DC  A N3    1 
ATOM 408  C C4    . DC  A 1 20  ? 22.571  43.878 3.282   1.00 40.97  ? 20  DC  A C4    1 
ATOM 409  N N4    . DC  A 1 20  ? 22.542  42.581 2.962   1.00 39.83  ? 20  DC  A N4    1 
ATOM 410  C C5    . DC  A 1 20  ? 21.436  44.502 3.887   1.00 40.28  ? 20  DC  A C5    1 
ATOM 411  C C6    . DC  A 1 20  ? 21.528  45.808 4.177   1.00 44.91  ? 20  DC  A C6    1 
ATOM 412  P P     . DT  A 1 21  ? 22.309  51.666 2.954   1.00 61.28  ? 21  DT  A P     1 
ATOM 413  O OP1   . DT  A 1 21  ? 22.841  53.040 3.056   1.00 58.98  ? 21  DT  A OP1   1 
ATOM 414  O OP2   . DT  A 1 21  ? 20.928  51.444 2.452   1.00 59.51  ? 21  DT  A OP2   1 
ATOM 415  O "O5'" . DT  A 1 21  ? 23.373  50.866 2.076   1.00 60.79  ? 21  DT  A "O5'" 1 
ATOM 416  C "C5'" . DT  A 1 21  ? 24.669  50.627 2.606   1.00 61.45  ? 21  DT  A "C5'" 1 
ATOM 417  C "C4'" . DT  A 1 21  ? 25.679  50.320 1.523   1.00 60.24  ? 21  DT  A "C4'" 1 
ATOM 418  O "O4'" . DT  A 1 21  ? 25.599  48.935 1.111   1.00 58.19  ? 21  DT  A "O4'" 1 
ATOM 419  C "C3'" . DT  A 1 21  ? 25.537  51.118 0.231   1.00 60.01  ? 21  DT  A "C3'" 1 
ATOM 420  O "O3'" . DT  A 1 21  ? 26.862  51.235 -0.314  1.00 60.39  ? 21  DT  A "O3'" 1 
ATOM 421  C "C2'" . DT  A 1 21  ? 24.615  50.234 -0.598  1.00 56.84  ? 21  DT  A "C2'" 1 
ATOM 422  C "C1'" . DT  A 1 21  ? 25.097  48.841 -0.217  1.00 50.70  ? 21  DT  A "C1'" 1 
ATOM 423  N N1    . DT  A 1 21  ? 24.150  47.705 -0.265  1.00 42.27  ? 21  DT  A N1    1 
ATOM 424  C C2    . DT  A 1 21  ? 24.634  46.504 -0.770  1.00 38.46  ? 21  DT  A C2    1 
ATOM 425  O O2    . DT  A 1 21  ? 25.770  46.379 -1.212  1.00 36.38  ? 21  DT  A O2    1 
ATOM 426  N N3    . DT  A 1 21  ? 23.740  45.451 -0.726  1.00 32.39  ? 21  DT  A N3    1 
ATOM 427  C C4    . DT  A 1 21  ? 22.447  45.483 -0.234  1.00 32.35  ? 21  DT  A C4    1 
ATOM 428  O O4    . DT  A 1 21  ? 21.770  44.456 -0.219  1.00 30.66  ? 21  DT  A O4    1 
ATOM 429  C C5    . DT  A 1 21  ? 21.995  46.780 0.253   1.00 31.83  ? 21  DT  A C5    1 
ATOM 430  C C7    . DT  A 1 21  ? 20.602  46.903 0.782   1.00 28.94  ? 21  DT  A C7    1 
ATOM 431  C C6    . DT  A 1 21  ? 22.855  47.814 0.206   1.00 35.28  ? 21  DT  A C6    1 
ATOM 432  P P     . DT  A 1 22  ? 27.110  51.927 -1.739  1.00 58.96  ? 22  DT  A P     1 
ATOM 433  O OP1   . DT  A 1 22  ? 28.444  52.587 -1.636  1.00 55.65  ? 22  DT  A OP1   1 
ATOM 434  O OP2   . DT  A 1 22  ? 25.925  52.732 -2.115  1.00 55.99  ? 22  DT  A OP2   1 
ATOM 435  O "O5'" . DT  A 1 22  ? 27.257  50.670 -2.712  1.00 61.95  ? 22  DT  A "O5'" 1 
ATOM 436  C "C5'" . DT  A 1 22  ? 28.228  49.682 -2.407  1.00 66.71  ? 22  DT  A "C5'" 1 
ATOM 437  C "C4'" . DT  A 1 22  ? 28.470  48.736 -3.563  1.00 65.83  ? 22  DT  A "C4'" 1 
ATOM 438  O "O4'" . DT  A 1 22  ? 27.497  47.663 -3.553  1.00 63.82  ? 22  DT  A "O4'" 1 
ATOM 439  C "C3'" . DT  A 1 22  ? 28.374  49.343 -4.966  1.00 64.04  ? 22  DT  A "C3'" 1 
ATOM 440  O "O3'" . DT  A 1 22  ? 29.275  48.588 -5.806  1.00 61.44  ? 22  DT  A "O3'" 1 
ATOM 441  C "C2'" . DT  A 1 22  ? 26.909  49.124 -5.307  1.00 62.25  ? 22  DT  A "C2'" 1 
ATOM 442  C "C1'" . DT  A 1 22  ? 26.659  47.760 -4.687  1.00 54.50  ? 22  DT  A "C1'" 1 
ATOM 443  N N1    . DT  A 1 22  ? 25.289  47.370 -4.304  1.00 45.65  ? 22  DT  A N1    1 
ATOM 444  C C2    . DT  A 1 22  ? 24.995  46.017 -4.344  1.00 43.35  ? 22  DT  A C2    1 
ATOM 445  O O2    . DT  A 1 22  ? 25.822  45.159 -4.659  1.00 43.26  ? 22  DT  A O2    1 
ATOM 446  N N3    . DT  A 1 22  ? 23.692  45.698 -4.003  1.00 38.02  ? 22  DT  A N3    1 
ATOM 447  C C4    . DT  A 1 22  ? 22.688  46.580 -3.645  1.00 35.75  ? 22  DT  A C4    1 
ATOM 448  O O4    . DT  A 1 22  ? 21.564  46.161 -3.375  1.00 33.06  ? 22  DT  A O4    1 
ATOM 449  C C5    . DT  A 1 22  ? 23.070  47.976 -3.625  1.00 34.79  ? 22  DT  A C5    1 
ATOM 450  C C7    . DT  A 1 22  ? 22.033  48.994 -3.264  1.00 32.32  ? 22  DT  A C7    1 
ATOM 451  C C6    . DT  A 1 22  ? 24.337  48.296 -3.940  1.00 38.23  ? 22  DT  A C6    1 
ATOM 452  P P     . DT  A 1 23  ? 29.351  48.829 -7.403  1.00 57.06  ? 23  DT  A P     1 
ATOM 453  O OP1   . DT  A 1 23  ? 30.729  49.315 -7.663  1.00 52.27  ? 23  DT  A OP1   1 
ATOM 454  O OP2   . DT  A 1 23  ? 28.193  49.634 -7.880  1.00 55.42  ? 23  DT  A OP2   1 
ATOM 455  O "O5'" . DT  A 1 23  ? 29.224  47.333 -7.940  1.00 52.97  ? 23  DT  A "O5'" 1 
ATOM 456  C "C5'" . DT  A 1 23  ? 29.749  46.282 -7.145  1.00 56.97  ? 23  DT  A "C5'" 1 
ATOM 457  C "C4'" . DT  A 1 23  ? 29.278  44.914 -7.592  1.00 59.46  ? 23  DT  A "C4'" 1 
ATOM 458  O "O4'" . DT  A 1 23  ? 27.899  44.666 -7.199  1.00 57.12  ? 23  DT  A "O4'" 1 
ATOM 459  C "C3'" . DT  A 1 23  ? 29.294  44.718 -9.109  1.00 61.97  ? 23  DT  A "C3'" 1 
ATOM 460  O "O3'" . DT  A 1 23  ? 29.590  43.347 -9.418  1.00 62.94  ? 23  DT  A "O3'" 1 
ATOM 461  C "C2'" . DT  A 1 23  ? 27.883  45.113 -9.519  1.00 60.98  ? 23  DT  A "C2'" 1 
ATOM 462  C "C1'" . DT  A 1 23  ? 27.069  44.567 -8.354  1.00 53.67  ? 23  DT  A "C1'" 1 
ATOM 463  N N1    . DT  A 1 23  ? 25.775  45.206 -8.063  1.00 47.12  ? 23  DT  A N1    1 
ATOM 464  C C2    . DT  A 1 23  ? 24.676  44.394 -7.884  1.00 43.22  ? 23  DT  A C2    1 
ATOM 465  O O2    . DT  A 1 23  ? 24.715  43.181 -7.992  1.00 38.77  ? 23  DT  A O2    1 
ATOM 466  N N3    . DT  A 1 23  ? 23.518  45.064 -7.576  1.00 40.08  ? 23  DT  A N3    1 
ATOM 467  C C4    . DT  A 1 23  ? 23.355  46.430 -7.453  1.00 39.16  ? 23  DT  A C4    1 
ATOM 468  O O4    . DT  A 1 23  ? 22.260  46.896 -7.173  1.00 38.31  ? 23  DT  A O4    1 
ATOM 469  C C5    . DT  A 1 23  ? 24.539  47.214 -7.674  1.00 39.85  ? 23  DT  A C5    1 
ATOM 470  C C7    . DT  A 1 23  ? 24.446  48.702 -7.570  1.00 40.09  ? 23  DT  A C7    1 
ATOM 471  C C6    . DT  A 1 23  ? 25.675  46.574 -7.963  1.00 43.35  ? 23  DT  A C6    1 
ATOM 472  P P     . DC  A 1 24  ? 30.099  42.944 -10.888 1.00 59.37  ? 24  DC  A P     1 
ATOM 473  O OP1   . DC  A 1 24  ? 31.336  42.135 -10.745 1.00 62.16  ? 24  DC  A OP1   1 
ATOM 474  O OP2   . DC  A 1 24  ? 30.121  44.188 -11.698 1.00 61.12  ? 24  DC  A OP2   1 
ATOM 475  O "O5'" . DC  A 1 24  ? 28.940  41.990 -11.406 1.00 55.84  ? 24  DC  A "O5'" 1 
ATOM 476  C "C5'" . DC  A 1 24  ? 27.621  42.218 -10.968 1.00 50.75  ? 24  DC  A "C5'" 1 
ATOM 477  C "C4'" . DC  A 1 24  ? 26.843  40.933 -10.986 1.00 48.96  ? 24  DC  A "C4'" 1 
ATOM 478  O "O4'" . DC  A 1 24  ? 25.566  41.206 -10.361 1.00 49.29  ? 24  DC  A "O4'" 1 
ATOM 479  C "C3'" . DC  A 1 24  ? 26.519  40.478 -12.398 1.00 50.63  ? 24  DC  A "C3'" 1 
ATOM 480  O "O3'" . DC  A 1 24  ? 26.427  39.057 -12.458 1.00 53.15  ? 24  DC  A "O3'" 1 
ATOM 481  C "C2'" . DC  A 1 24  ? 25.207  41.191 -12.690 1.00 49.55  ? 24  DC  A "C2'" 1 
ATOM 482  C "C1'" . DC  A 1 24  ? 24.522  41.242 -11.326 1.00 46.39  ? 24  DC  A "C1'" 1 
ATOM 483  N N1    . DC  A 1 24  ? 23.724  42.469 -11.083 1.00 41.34  ? 24  DC  A N1    1 
ATOM 484  C C2    . DC  A 1 24  ? 22.378  42.345 -10.696 1.00 39.10  ? 24  DC  A C2    1 
ATOM 485  O O2    . DC  A 1 24  ? 21.901  41.213 -10.548 1.00 39.69  ? 24  DC  A O2    1 
ATOM 486  N N3    . DC  A 1 24  ? 21.640  43.457 -10.494 1.00 35.55  ? 24  DC  A N3    1 
ATOM 487  C C4    . DC  A 1 24  ? 22.191  44.660 -10.657 1.00 37.16  ? 24  DC  A C4    1 
ATOM 488  N N4    . DC  A 1 24  ? 21.421  45.741 -10.443 1.00 34.64  ? 24  DC  A N4    1 
ATOM 489  C C5    . DC  A 1 24  ? 23.557  44.817 -11.043 1.00 37.12  ? 24  DC  A C5    1 
ATOM 490  C C6    . DC  A 1 24  ? 24.279  43.706 -11.240 1.00 38.07  ? 24  DC  A C6    1 
ATOM 491  P P     . DC  A 1 25  ? 26.251  38.330 -13.877 1.00 53.32  ? 25  DC  A P     1 
ATOM 492  O OP1   . DC  A 1 25  ? 27.333  37.326 -13.997 1.00 57.47  ? 25  DC  A OP1   1 
ATOM 493  O OP2   . DC  A 1 25  ? 26.067  39.355 -14.937 1.00 55.62  ? 25  DC  A OP2   1 
ATOM 494  O "O5'" . DC  A 1 25  ? 24.874  37.571 -13.700 1.00 55.36  ? 25  DC  A "O5'" 1 
ATOM 495  C "C5'" . DC  A 1 25  ? 23.813  38.235 -13.051 1.00 56.87  ? 25  DC  A "C5'" 1 
ATOM 496  C "C4'" . DC  A 1 25  ? 22.508  37.540 -13.331 1.00 55.69  ? 25  DC  A "C4'" 1 
ATOM 497  O "O4'" . DC  A 1 25  ? 21.478  38.496 -12.989 1.00 54.61  ? 25  DC  A "O4'" 1 
ATOM 498  C "C3'" . DC  A 1 25  ? 22.285  37.215 -14.804 1.00 54.80  ? 25  DC  A "C3'" 1 
ATOM 499  O "O3'" . DC  A 1 25  ? 21.246  36.242 -14.921 1.00 53.56  ? 25  DC  A "O3'" 1 
ATOM 500  C "C2'" . DC  A 1 25  ? 21.705  38.510 -15.336 1.00 52.04  ? 25  DC  A "C2'" 1 
ATOM 501  C "C1'" . DC  A 1 25  ? 20.877  39.011 -14.164 1.00 46.77  ? 25  DC  A "C1'" 1 
ATOM 502  N N1    . DC  A 1 25  ? 20.850  40.469 -14.038 1.00 38.22  ? 25  DC  A N1    1 
ATOM 503  C C2    . DC  A 1 25  ? 19.638  41.089 -13.742 1.00 34.16  ? 25  DC  A C2    1 
ATOM 504  O O2    . DC  A 1 25  ? 18.628  40.380 -13.584 1.00 31.10  ? 25  DC  A O2    1 
ATOM 505  N N3    . DC  A 1 25  ? 19.594  42.439 -13.639 1.00 31.69  ? 25  DC  A N3    1 
ATOM 506  C C4    . DC  A 1 25  ? 20.707  43.158 -13.829 1.00 31.83  ? 25  DC  A C4    1 
ATOM 507  N N4    . DC  A 1 25  ? 20.619  44.488 -13.740 1.00 30.02  ? 25  DC  A N4    1 
ATOM 508  C C5    . DC  A 1 25  ? 21.959  42.545 -14.124 1.00 30.82  ? 25  DC  A C5    1 
ATOM 509  C C6    . DC  A 1 25  ? 21.984  41.209 -14.216 1.00 33.12  ? 25  DC  A C6    1 
ATOM 510  O "O5'" . DT  B 2 1   ? 15.352  51.671 -14.511 1.00 46.88  ? 1   DT  B "O5'" 1 
ATOM 511  C "C5'" . DT  B 2 1   ? 14.210  51.774 -15.363 1.00 48.87  ? 1   DT  B "C5'" 1 
ATOM 512  C "C4'" . DT  B 2 1   ? 13.234  50.632 -15.203 1.00 49.05  ? 1   DT  B "C4'" 1 
ATOM 513  O "O4'" . DT  B 2 1   ? 13.772  49.476 -15.901 1.00 46.41  ? 1   DT  B "O4'" 1 
ATOM 514  C "C3'" . DT  B 2 1   ? 13.148  50.210 -13.741 1.00 51.27  ? 1   DT  B "C3'" 1 
ATOM 515  O "O3'" . DT  B 2 1   ? 11.896  49.681 -13.328 1.00 57.56  ? 1   DT  B "O3'" 1 
ATOM 516  C "C2'" . DT  B 2 1   ? 14.216  49.154 -13.619 1.00 49.00  ? 1   DT  B "C2'" 1 
ATOM 517  C "C1'" . DT  B 2 1   ? 14.186  48.479 -14.974 1.00 40.59  ? 1   DT  B "C1'" 1 
ATOM 518  N N1    . DT  B 2 1   ? 15.543  48.029 -15.322 1.00 32.50  ? 1   DT  B N1    1 
ATOM 519  C C2    . DT  B 2 1   ? 15.754  46.711 -15.639 1.00 30.68  ? 1   DT  B C2    1 
ATOM 520  O O2    . DT  B 2 1   ? 14.848  45.896 -15.771 1.00 32.03  ? 1   DT  B O2    1 
ATOM 521  N N3    . DT  B 2 1   ? 17.076  46.371 -15.792 1.00 28.35  ? 1   DT  B N3    1 
ATOM 522  C C4    . DT  B 2 1   ? 18.177  47.205 -15.673 1.00 27.35  ? 1   DT  B C4    1 
ATOM 523  O O4    . DT  B 2 1   ? 19.328  46.754 -15.807 1.00 24.90  ? 1   DT  B O4    1 
ATOM 524  C C5    . DT  B 2 1   ? 17.865  48.577 -15.386 1.00 27.00  ? 1   DT  B C5    1 
ATOM 525  C C7    . DT  B 2 1   ? 18.986  49.557 -15.243 1.00 28.49  ? 1   DT  B C7    1 
ATOM 526  C C6    . DT  B 2 1   ? 16.583  48.918 -15.248 1.00 27.99  ? 1   DT  B C6    1 
ATOM 527  P P     . DG  B 2 2   ? 11.598  49.546 -11.752 1.00 60.61  ? 2   DG  B P     1 
ATOM 528  O OP1   . DG  B 2 2   ? 10.304  50.234 -11.511 1.00 61.56  ? 2   DG  B OP1   1 
ATOM 529  O OP2   . DG  B 2 2   ? 12.822  49.990 -11.019 1.00 59.74  ? 2   DG  B OP2   1 
ATOM 530  O "O5'" . DG  B 2 2   ? 11.383  47.987 -11.524 1.00 56.56  ? 2   DG  B "O5'" 1 
ATOM 531  C "C5'" . DG  B 2 2   ? 10.319  47.328 -12.183 1.00 55.72  ? 2   DG  B "C5'" 1 
ATOM 532  C "C4'" . DG  B 2 2   ? 10.371  45.842 -11.928 1.00 55.05  ? 2   DG  B "C4'" 1 
ATOM 533  O "O4'" . DG  B 2 2   ? 11.639  45.307 -12.388 1.00 53.00  ? 2   DG  B "O4'" 1 
ATOM 534  C "C3'" . DG  B 2 2   ? 10.298  45.462 -10.456 1.00 54.42  ? 2   DG  B "C3'" 1 
ATOM 535  O "O3'" . DG  B 2 2   ? 9.678   44.170 -10.383 1.00 59.15  ? 2   DG  B "O3'" 1 
ATOM 536  C "C2'" . DG  B 2 2   ? 11.763  45.467 -10.041 1.00 50.81  ? 2   DG  B "C2'" 1 
ATOM 537  C "C1'" . DG  B 2 2   ? 12.461  44.939 -11.287 1.00 46.45  ? 2   DG  B "C1'" 1 
ATOM 538  N N9    . DG  B 2 2   ? 13.805  45.447 -11.560 1.00 41.70  ? 2   DG  B N9    1 
ATOM 539  C C8    . DG  B 2 2   ? 14.232  46.753 -11.522 1.00 40.20  ? 2   DG  B C8    1 
ATOM 540  N N7    . DG  B 2 2   ? 15.483  46.896 -11.882 1.00 35.97  ? 2   DG  B N7    1 
ATOM 541  C C5    . DG  B 2 2   ? 15.908  45.608 -12.159 1.00 35.55  ? 2   DG  B C5    1 
ATOM 542  C C6    . DG  B 2 2   ? 17.171  45.130 -12.600 1.00 34.77  ? 2   DG  B C6    1 
ATOM 543  O O6    . DG  B 2 2   ? 18.196  45.770 -12.830 1.00 34.18  ? 2   DG  B O6    1 
ATOM 544  N N1    . DG  B 2 2   ? 17.167  43.752 -12.765 1.00 33.17  ? 2   DG  B N1    1 
ATOM 545  C C2    . DG  B 2 2   ? 16.086  42.935 -12.529 1.00 35.00  ? 2   DG  B C2    1 
ATOM 546  N N2    . DG  B 2 2   ? 16.265  41.623 -12.748 1.00 34.49  ? 2   DG  B N2    1 
ATOM 547  N N3    . DG  B 2 2   ? 14.906  43.368 -12.111 1.00 35.89  ? 2   DG  B N3    1 
ATOM 548  C C4    . DG  B 2 2   ? 14.887  44.701 -11.952 1.00 37.17  ? 2   DG  B C4    1 
ATOM 549  P P     . DG  B 2 3   ? 9.038   43.650 -9.002  1.00 62.25  ? 3   DG  B P     1 
ATOM 550  O OP1   . DG  B 2 3   ? 7.825   42.845 -9.308  1.00 62.57  ? 3   DG  B OP1   1 
ATOM 551  O OP2   . DG  B 2 3   ? 8.939   44.804 -8.055  1.00 60.39  ? 3   DG  B OP2   1 
ATOM 552  O "O5'" . DG  B 2 3   ? 10.139  42.611 -8.524  1.00 62.82  ? 3   DG  B "O5'" 1 
ATOM 553  C "C5'" . DG  B 2 3   ? 11.384  42.600 -9.180  1.00 64.70  ? 3   DG  B "C5'" 1 
ATOM 554  C "C4'" . DG  B 2 3   ? 12.054  41.261 -9.043  1.00 62.30  ? 3   DG  B "C4'" 1 
ATOM 555  O "O4'" . DG  B 2 3   ? 13.376  41.445 -9.587  1.00 61.16  ? 3   DG  B "O4'" 1 
ATOM 556  C "C3'" . DG  B 2 3   ? 12.264  40.841 -7.597  1.00 61.92  ? 3   DG  B "C3'" 1 
ATOM 557  O "O3'" . DG  B 2 3   ? 12.382  39.411 -7.529  1.00 61.98  ? 3   DG  B "O3'" 1 
ATOM 558  C "C2'" . DG  B 2 3   ? 13.570  41.529 -7.248  1.00 58.45  ? 3   DG  B "C2'" 1 
ATOM 559  C "C1'" . DG  B 2 3   ? 14.341  41.479 -8.550  1.00 51.75  ? 3   DG  B "C1'" 1 
ATOM 560  N N9    . DG  B 2 3   ? 15.185  42.649 -8.763  1.00 42.35  ? 3   DG  B N9    1 
ATOM 561  C C8    . DG  B 2 3   ? 14.851  43.965 -8.534  1.00 40.46  ? 3   DG  B C8    1 
ATOM 562  N N7    . DG  B 2 3   ? 15.838  44.796 -8.761  1.00 34.60  ? 3   DG  B N7    1 
ATOM 563  C C5    . DG  B 2 3   ? 16.877  43.981 -9.179  1.00 31.58  ? 3   DG  B C5    1 
ATOM 564  C C6    . DG  B 2 3   ? 18.192  44.312 -9.547  1.00 29.17  ? 3   DG  B C6    1 
ATOM 565  O O6    . DG  B 2 3   ? 18.721  45.428 -9.570  1.00 28.70  ? 3   DG  B O6    1 
ATOM 566  N N1    . DG  B 2 3   ? 18.922  43.182 -9.905  1.00 25.78  ? 3   DG  B N1    1 
ATOM 567  C C2    . DG  B 2 3   ? 18.438  41.898 -9.892  1.00 27.05  ? 3   DG  B C2    1 
ATOM 568  N N2    . DG  B 2 3   ? 19.292  40.943 -10.266 1.00 28.28  ? 3   DG  B N2    1 
ATOM 569  N N3    . DG  B 2 3   ? 17.205  41.572 -9.540  1.00 27.18  ? 3   DG  B N3    1 
ATOM 570  C C4    . DG  B 2 3   ? 16.485  42.653 -9.200  1.00 33.95  ? 3   DG  B C4    1 
ATOM 571  P P     . DA  B 2 4   ? 12.743  38.700 -6.128  1.00 62.00  ? 4   DA  B P     1 
ATOM 572  O OP1   . DA  B 2 4   ? 13.490  37.438 -6.393  1.00 57.36  ? 4   DA  B OP1   1 
ATOM 573  O OP2   . DA  B 2 4   ? 11.526  38.681 -5.268  1.00 57.85  ? 4   DA  B OP2   1 
ATOM 574  O "O5'" . DA  B 2 4   ? 13.823  39.665 -5.478  1.00 63.60  ? 4   DA  B "O5'" 1 
ATOM 575  C "C5'" . DA  B 2 4   ? 14.917  39.123 -4.759  1.00 67.55  ? 4   DA  B "C5'" 1 
ATOM 576  C "C4'" . DA  B 2 4   ? 15.906  38.479 -5.701  1.00 62.70  ? 4   DA  B "C4'" 1 
ATOM 577  O "O4'" . DA  B 2 4   ? 16.475  39.516 -6.537  1.00 59.10  ? 4   DA  B "O4'" 1 
ATOM 578  C "C3'" . DA  B 2 4   ? 17.080  37.923 -4.911  1.00 63.84  ? 4   DA  B "C3'" 1 
ATOM 579  O "O3'" . DA  B 2 4   ? 17.656  36.774 -5.519  1.00 66.48  ? 4   DA  B "O3'" 1 
ATOM 580  C "C2'" . DA  B 2 4   ? 18.038  39.094 -4.840  1.00 58.84  ? 4   DA  B "C2'" 1 
ATOM 581  C "C1'" . DA  B 2 4   ? 17.828  39.772 -6.176  1.00 48.85  ? 4   DA  B "C1'" 1 
ATOM 582  N N9    . DA  B 2 4   ? 18.045  41.226 -6.157  1.00 37.24  ? 4   DA  B N9    1 
ATOM 583  C C8    . DA  B 2 4   ? 17.186  42.212 -5.740  1.00 31.57  ? 4   DA  B C8    1 
ATOM 584  N N7    . DA  B 2 4   ? 17.692  43.427 -5.814  1.00 25.30  ? 4   DA  B N7    1 
ATOM 585  C C5    . DA  B 2 4   ? 18.968  43.226 -6.322  1.00 23.93  ? 4   DA  B C5    1 
ATOM 586  C C6    . DA  B 2 4   ? 20.026  44.115 -6.630  1.00 21.23  ? 4   DA  B C6    1 
ATOM 587  N N6    . DA  B 2 4   ? 19.964  45.437 -6.467  1.00 18.30  ? 4   DA  B N6    1 
ATOM 588  N N1    . DA  B 2 4   ? 21.169  43.588 -7.120  1.00 20.44  ? 4   DA  B N1    1 
ATOM 589  C C2    . DA  B 2 4   ? 21.241  42.265 -7.287  1.00 22.10  ? 4   DA  B C2    1 
ATOM 590  N N3    . DA  B 2 4   ? 20.324  41.329 -7.033  1.00 26.24  ? 4   DA  B N3    1 
ATOM 591  C C4    . DA  B 2 4   ? 19.197  41.879 -6.546  1.00 28.39  ? 4   DA  B C4    1 
ATOM 592  P P     . DA  B 2 5   ? 18.488  35.742 -4.604  1.00 68.82  ? 5   DA  B P     1 
ATOM 593  O OP1   . DA  B 2 5   ? 18.148  34.373 -5.060  1.00 67.07  ? 5   DA  B OP1   1 
ATOM 594  O OP2   . DA  B 2 5   ? 18.258  36.121 -3.186  1.00 68.17  ? 5   DA  B OP2   1 
ATOM 595  O "O5'" . DA  B 2 5   ? 20.015  36.025 -4.966  1.00 67.42  ? 5   DA  B "O5'" 1 
ATOM 596  C "C5'" . DA  B 2 5   ? 20.487  35.751 -6.270  1.00 67.70  ? 5   DA  B "C5'" 1 
ATOM 597  C "C4'" . DA  B 2 5   ? 21.939  36.135 -6.420  1.00 65.49  ? 5   DA  B "C4'" 1 
ATOM 598  O "O4'" . DA  B 2 5   ? 22.090  37.574 -6.335  1.00 61.93  ? 5   DA  B "O4'" 1 
ATOM 599  C "C3'" . DA  B 2 5   ? 22.840  35.584 -5.323  1.00 65.58  ? 5   DA  B "C3'" 1 
ATOM 600  O "O3'" . DA  B 2 5   ? 24.142  35.381 -5.884  1.00 66.92  ? 5   DA  B "O3'" 1 
ATOM 601  C "C2'" . DA  B 2 5   ? 22.807  36.686 -4.275  1.00 61.90  ? 5   DA  B "C2'" 1 
ATOM 602  C "C1'" . DA  B 2 5   ? 22.771  37.935 -5.140  1.00 53.99  ? 5   DA  B "C1'" 1 
ATOM 603  N N9    . DA  B 2 5   ? 22.113  39.119 -4.589  1.00 43.93  ? 5   DA  B N9    1 
ATOM 604  C C8    . DA  B 2 5   ? 20.906  39.182 -3.939  1.00 37.91  ? 5   DA  B C8    1 
ATOM 605  N N7    . DA  B 2 5   ? 20.545  40.400 -3.614  1.00 31.37  ? 5   DA  B N7    1 
ATOM 606  C C5    . DA  B 2 5   ? 21.594  41.187 -4.058  1.00 29.35  ? 5   DA  B C5    1 
ATOM 607  C C6    . DA  B 2 5   ? 21.811  42.560 -4.002  1.00 28.00  ? 5   DA  B C6    1 
ATOM 608  N N6    . DA  B 2 5   ? 20.930  43.404 -3.474  1.00 25.54  ? 5   DA  B N6    1 
ATOM 609  N N1    . DA  B 2 5   ? 22.966  43.046 -4.518  1.00 27.24  ? 5   DA  B N1    1 
ATOM 610  C C2    . DA  B 2 5   ? 23.825  42.180 -5.067  1.00 27.88  ? 5   DA  B C2    1 
ATOM 611  N N3    . DA  B 2 5   ? 23.723  40.855 -5.188  1.00 29.70  ? 5   DA  B N3    1 
ATOM 612  C C4    . DA  B 2 5   ? 22.571  40.417 -4.653  1.00 33.76  ? 5   DA  B C4    1 
ATOM 613  P P     . DA  B 2 6   ? 25.364  34.930 -4.945  1.00 69.02  ? 6   DA  B P     1 
ATOM 614  O OP1   . DA  B 2 6   ? 26.154  33.944 -5.724  1.00 68.39  ? 6   DA  B OP1   1 
ATOM 615  O OP2   . DA  B 2 6   ? 24.827  34.550 -3.607  1.00 68.50  ? 6   DA  B OP2   1 
ATOM 616  O "O5'" . DA  B 2 6   ? 26.255  36.247 -4.833  1.00 66.71  ? 6   DA  B "O5'" 1 
ATOM 617  C "C5'" . DA  B 2 6   ? 26.725  36.864 -6.018  1.00 69.75  ? 6   DA  B "C5'" 1 
ATOM 618  C "C4'" . DA  B 2 6   ? 27.733  37.949 -5.718  1.00 69.57  ? 6   DA  B "C4'" 1 
ATOM 619  O "O4'" . DA  B 2 6   ? 27.080  39.107 -5.141  1.00 68.88  ? 6   DA  B "O4'" 1 
ATOM 620  C "C3'" . DA  B 2 6   ? 28.805  37.562 -4.710  1.00 68.39  ? 6   DA  B "C3'" 1 
ATOM 621  O "O3'" . DA  B 2 6   ? 29.994  38.291 -5.039  1.00 68.12  ? 6   DA  B "O3'" 1 
ATOM 622  C "C2'" . DA  B 2 6   ? 28.181  37.977 -3.387  1.00 66.70  ? 6   DA  B "C2'" 1 
ATOM 623  C "C1'" . DA  B 2 6   ? 27.431  39.245 -3.765  1.00 62.68  ? 6   DA  B "C1'" 1 
ATOM 624  N N9    . DA  B 2 6   ? 26.206  39.555 -3.022  1.00 57.24  ? 6   DA  B N9    1 
ATOM 625  C C8    . DA  B 2 6   ? 25.162  38.721 -2.694  1.00 53.80  ? 6   DA  B C8    1 
ATOM 626  N N7    . DA  B 2 6   ? 24.169  39.331 -2.091  1.00 50.99  ? 6   DA  B N7    1 
ATOM 627  C C5    . DA  B 2 6   ? 24.595  40.649 -1.996  1.00 51.04  ? 6   DA  B C5    1 
ATOM 628  C C6    . DA  B 2 6   ? 23.991  41.807 -1.462  1.00 51.20  ? 6   DA  B C6    1 
ATOM 629  N N6    . DA  B 2 6   ? 22.786  41.815 -0.891  1.00 50.52  ? 6   DA  B N6    1 
ATOM 630  N N1    . DA  B 2 6   ? 24.680  42.971 -1.535  1.00 51.02  ? 6   DA  B N1    1 
ATOM 631  C C2    . DA  B 2 6   ? 25.890  42.960 -2.103  1.00 52.18  ? 6   DA  B C2    1 
ATOM 632  N N3    . DA  B 2 6   ? 26.564  41.938 -2.639  1.00 53.37  ? 6   DA  B N3    1 
ATOM 633  C C4    . DA  B 2 6   ? 25.852  40.799 -2.552  1.00 53.16  ? 6   DA  B C4    1 
ATOM 634  P P     . DG  B 2 7   ? 31.197  38.398 -3.983  1.00 68.78  ? 7   DG  B P     1 
ATOM 635  O OP1   . DG  B 2 7   ? 32.446  38.656 -4.755  1.00 64.91  ? 7   DG  B OP1   1 
ATOM 636  O OP2   . DG  B 2 7   ? 31.124  37.222 -3.070  1.00 68.70  ? 7   DG  B OP2   1 
ATOM 637  O "O5'" . DG  B 2 7   ? 30.836  39.708 -3.155  1.00 70.03  ? 7   DG  B "O5'" 1 
ATOM 638  C "C5'" . DG  B 2 7   ? 30.456  40.887 -3.835  1.00 78.28  ? 7   DG  B "C5'" 1 
ATOM 639  C "C4'" . DG  B 2 7   ? 30.920  42.107 -3.079  1.00 79.04  ? 7   DG  B "C4'" 1 
ATOM 640  O "O4'" . DG  B 2 7   ? 29.855  42.602 -2.236  1.00 77.46  ? 7   DG  B "O4'" 1 
ATOM 641  C "C3'" . DG  B 2 7   ? 32.096  41.864 -2.138  1.00 79.03  ? 7   DG  B "C3'" 1 
ATOM 642  O "O3'" . DG  B 2 7   ? 32.849  43.086 -2.070  1.00 76.86  ? 7   DG  B "O3'" 1 
ATOM 643  C "C2'" . DG  B 2 7   ? 31.395  41.479 -0.844  1.00 76.40  ? 7   DG  B "C2'" 1 
ATOM 644  C "C1'" . DG  B 2 7   ? 30.152  42.361 -0.872  1.00 67.80  ? 7   DG  B "C1'" 1 
ATOM 645  N N9    . DG  B 2 7   ? 28.949  41.818 -0.252  1.00 56.42  ? 7   DG  B N9    1 
ATOM 646  C C8    . DG  B 2 7   ? 28.540  40.504 -0.201  1.00 51.17  ? 7   DG  B C8    1 
ATOM 647  N N7    . DG  B 2 7   ? 27.401  40.343 0.421   1.00 44.32  ? 7   DG  B N7    1 
ATOM 648  C C5    . DG  B 2 7   ? 27.043  41.625 0.804   1.00 45.58  ? 7   DG  B C5    1 
ATOM 649  C C6    . DG  B 2 7   ? 25.905  42.087 1.519   1.00 44.10  ? 7   DG  B C6    1 
ATOM 650  O O6    . DG  B 2 7   ? 24.951  41.430 1.955   1.00 41.25  ? 7   DG  B O6    1 
ATOM 651  N N1    . DG  B 2 7   ? 25.944  43.466 1.703   1.00 44.14  ? 7   DG  B N1    1 
ATOM 652  C C2    . DG  B 2 7   ? 26.947  44.296 1.247   1.00 47.37  ? 7   DG  B C2    1 
ATOM 653  N N2    . DG  B 2 7   ? 26.809  45.603 1.519   1.00 47.54  ? 7   DG  B N2    1 
ATOM 654  N N3    . DG  B 2 7   ? 28.009  43.877 0.573   1.00 47.28  ? 7   DG  B N3    1 
ATOM 655  C C4    . DG  B 2 7   ? 27.992  42.544 0.394   1.00 48.63  ? 7   DG  B C4    1 
ATOM 656  P P     . DT  B 2 8   ? 33.877  43.361 -0.862  1.00 75.38  ? 8   DT  B P     1 
ATOM 657  O OP1   . DT  B 2 8   ? 35.224  43.536 -1.464  1.00 73.48  ? 8   DT  B OP1   1 
ATOM 658  O OP2   . DT  B 2 8   ? 33.680  42.368 0.237   1.00 71.18  ? 8   DT  B OP2   1 
ATOM 659  O "O5'" . DT  B 2 8   ? 33.411  44.786 -0.332  1.00 73.00  ? 8   DT  B "O5'" 1 
ATOM 660  C "C5'" . DT  B 2 8   ? 32.091  44.954 0.158   1.00 77.70  ? 8   DT  B "C5'" 1 
ATOM 661  C "C4'" . DT  B 2 8   ? 32.040  46.096 1.139   1.00 76.27  ? 8   DT  B "C4'" 1 
ATOM 662  O "O4'" . DT  B 2 8   ? 30.827  45.942 1.911   1.00 72.32  ? 8   DT  B "O4'" 1 
ATOM 663  C "C3'" . DT  B 2 8   ? 33.166  46.072 2.162   1.00 77.31  ? 8   DT  B "C3'" 1 
ATOM 664  O "O3'" . DT  B 2 8   ? 33.483  47.412 2.561   1.00 80.25  ? 8   DT  B "O3'" 1 
ATOM 665  C "C2'" . DT  B 2 8   ? 32.608  45.190 3.263   1.00 71.14  ? 8   DT  B "C2'" 1 
ATOM 666  C "C1'" . DT  B 2 8   ? 31.117  45.488 3.228   1.00 60.53  ? 8   DT  B "C1'" 1 
ATOM 667  N N1    . DT  B 2 8   ? 30.267  44.301 3.478   1.00 46.78  ? 8   DT  B N1    1 
ATOM 668  C C2    . DT  B 2 8   ? 29.039  44.489 4.088   1.00 40.23  ? 8   DT  B C2    1 
ATOM 669  O O2    . DT  B 2 8   ? 28.630  45.586 4.451   1.00 39.68  ? 8   DT  B O2    1 
ATOM 670  N N3    . DT  B 2 8   ? 28.300  43.343 4.260   1.00 30.81  ? 8   DT  B N3    1 
ATOM 671  C C4    . DT  B 2 8   ? 28.657  42.065 3.898   1.00 29.80  ? 8   DT  B C4    1 
ATOM 672  O O4    . DT  B 2 8   ? 27.889  41.129 4.112   1.00 29.14  ? 8   DT  B O4    1 
ATOM 673  C C5    . DT  B 2 8   ? 29.952  41.936 3.277   1.00 29.89  ? 8   DT  B C5    1 
ATOM 674  C C7    . DT  B 2 8   ? 30.410  40.574 2.861   1.00 27.47  ? 8   DT  B C7    1 
ATOM 675  C C6    . DT  B 2 8   ? 30.686  43.044 3.100   1.00 35.63  ? 8   DT  B C6    1 
ATOM 676  P P     . DC  B 2 9   ? 34.187  47.682 3.977   1.00 83.25  ? 9   DC  B P     1 
ATOM 677  O OP1   . DC  B 2 9   ? 34.754  49.060 3.954   1.00 79.38  ? 9   DC  B OP1   1 
ATOM 678  O OP2   . DC  B 2 9   ? 35.064  46.527 4.324   1.00 80.22  ? 9   DC  B OP2   1 
ATOM 679  O "O5'" . DC  B 2 9   ? 32.943  47.702 4.961   1.00 90.88  ? 9   DC  B "O5'" 1 
ATOM 680  C "C5'" . DC  B 2 9   ? 31.854  48.575 4.703   1.00 106.57 ? 9   DC  B "C5'" 1 
ATOM 681  C "C4'" . DC  B 2 9   ? 31.087  48.818 5.976   1.00 105.65 ? 9   DC  B "C4'" 1 
ATOM 682  O "O4'" . DC  B 2 9   ? 30.366  47.622 6.325   1.00 100.34 ? 9   DC  B "O4'" 1 
ATOM 683  C "C3'" . DC  B 2 9   ? 32.013  49.083 7.157   1.00 104.96 ? 9   DC  B "C3'" 1 
ATOM 684  O "O3'" . DC  B 2 9   ? 31.271  49.846 8.108   1.00 98.76  ? 9   DC  B "O3'" 1 
ATOM 685  C "C2'" . DC  B 2 9   ? 32.305  47.684 7.667   1.00 98.67  ? 9   DC  B "C2'" 1 
ATOM 686  C "C1'" . DC  B 2 9   ? 30.965  47.013 7.456   1.00 83.10  ? 9   DC  B "C1'" 1 
ATOM 687  N N1    . DC  B 2 9   ? 30.969  45.570 7.228   1.00 60.98  ? 9   DC  B N1    1 
ATOM 688  C C2    . DC  B 2 9   ? 29.779  44.884 7.472   1.00 46.88  ? 9   DC  B C2    1 
ATOM 689  O O2    . DC  B 2 9   ? 28.794  45.552 7.882   1.00 39.60  ? 9   DC  B O2    1 
ATOM 690  N N3    . DC  B 2 9   ? 29.722  43.537 7.254   1.00 34.29  ? 9   DC  B N3    1 
ATOM 691  C C4    . DC  B 2 9   ? 30.808  42.898 6.793   1.00 33.58  ? 9   DC  B C4    1 
ATOM 692  N N4    . DC  B 2 9   ? 30.721  41.577 6.558   1.00 29.12  ? 9   DC  B N4    1 
ATOM 693  C C5    . DC  B 2 9   ? 32.042  43.585 6.543   1.00 34.96  ? 9   DC  B C5    1 
ATOM 694  C C6    . DC  B 2 9   ? 32.076  44.907 6.779   1.00 46.79  ? 9   DC  B C6    1 
ATOM 695  P P     . DC  B 2 10  ? 31.800  50.008 9.611   1.00 93.57  ? 10  DC  B P     1 
ATOM 696  O OP1   . DC  B 2 10  ? 32.523  51.306 9.657   1.00 90.72  ? 10  DC  B OP1   1 
ATOM 697  O OP2   . DC  B 2 10  ? 32.491  48.766 10.033  1.00 90.73  ? 10  DC  B OP2   1 
ATOM 698  O "O5'" . DC  B 2 10  ? 30.439  50.137 10.419  1.00 89.43  ? 10  DC  B "O5'" 1 
ATOM 699  C "C5'" . DC  B 2 10  ? 29.281  50.589 9.743   1.00 87.73  ? 10  DC  B "C5'" 1 
ATOM 700  C "C4'" . DC  B 2 10  ? 28.025  50.077 10.405  1.00 84.14  ? 10  DC  B "C4'" 1 
ATOM 701  O "O4'" . DC  B 2 10  ? 27.929  48.630 10.307  1.00 79.24  ? 10  DC  B "O4'" 1 
ATOM 702  C "C3'" . DC  B 2 10  ? 27.988  50.366 11.897  1.00 84.08  ? 10  DC  B "C3'" 1 
ATOM 703  O "O3'" . DC  B 2 10  ? 26.622  50.553 12.249  1.00 86.42  ? 10  DC  B "O3'" 1 
ATOM 704  C "C2'" . DC  B 2 10  ? 28.624  49.123 12.505  1.00 79.08  ? 10  DC  B "C2'" 1 
ATOM 705  C "C1'" . DC  B 2 10  ? 28.108  48.023 11.588  1.00 69.52  ? 10  DC  B "C1'" 1 
ATOM 706  N N1    . DC  B 2 10  ? 28.962  46.827 11.414  1.00 57.71  ? 10  DC  B N1    1 
ATOM 707  C C2    . DC  B 2 10  ? 28.368  45.527 11.473  1.00 50.83  ? 10  DC  B C2    1 
ATOM 708  O O2    . DC  B 2 10  ? 27.156  45.419 11.755  1.00 46.65  ? 10  DC  B O2    1 
ATOM 709  N N3    . DC  B 2 10  ? 29.143  44.433 11.216  1.00 42.94  ? 10  DC  B N3    1 
ATOM 710  C C4    . DC  B 2 10  ? 30.442  44.592 10.925  1.00 42.19  ? 10  DC  B C4    1 
ATOM 711  N N4    . DC  B 2 10  ? 31.157  43.505 10.635  1.00 37.80  ? 10  DC  B N4    1 
ATOM 712  C C5    . DC  B 2 10  ? 31.066  45.883 10.907  1.00 43.48  ? 10  DC  B C5    1 
ATOM 713  C C6    . DC  B 2 10  ? 30.298  46.959 11.160  1.00 49.73  ? 10  DC  B C6    1 
ATOM 714  P P     . DC  B 2 11  ? 26.207  50.766 13.776  1.00 88.23  ? 11  DC  B P     1 
ATOM 715  O OP1   . DC  B 2 11  ? 25.476  52.055 13.874  1.00 85.37  ? 11  DC  B OP1   1 
ATOM 716  O OP2   . DC  B 2 11  ? 27.397  50.513 14.636  1.00 86.09  ? 11  DC  B OP2   1 
ATOM 717  O "O5'" . DC  B 2 11  ? 25.170  49.588 13.995  1.00 92.95  ? 11  DC  B "O5'" 1 
ATOM 718  C "C5'" . DC  B 2 11  ? 25.512  48.278 13.579  1.00 103.55 ? 11  DC  B "C5'" 1 
ATOM 719  C "C4'" . DC  B 2 11  ? 24.853  47.274 14.484  1.00 101.50 ? 11  DC  B "C4'" 1 
ATOM 720  O "O4'" . DC  B 2 11  ? 25.668  46.083 14.511  1.00 98.93  ? 11  DC  B "O4'" 1 
ATOM 721  C "C3'" . DC  B 2 11  ? 24.799  47.746 15.926  1.00 98.80  ? 11  DC  B "C3'" 1 
ATOM 722  O "O3'" . DC  B 2 11  ? 23.692  47.104 16.539  1.00 89.92  ? 11  DC  B "O3'" 1 
ATOM 723  C "C2'" . DC  B 2 11  ? 26.130  47.285 16.489  1.00 95.02  ? 11  DC  B "C2'" 1 
ATOM 724  C "C1'" . DC  B 2 11  ? 26.359  45.977 15.749  1.00 83.68  ? 11  DC  B "C1'" 1 
ATOM 725  N N1    . DC  B 2 11  ? 27.758  45.695 15.424  1.00 65.06  ? 11  DC  B N1    1 
ATOM 726  C C2    . DC  B 2 11  ? 28.142  44.351 15.251  1.00 53.53  ? 11  DC  B C2    1 
ATOM 727  O O2    . DC  B 2 11  ? 27.293  43.456 15.438  1.00 45.10  ? 11  DC  B O2    1 
ATOM 728  N N3    . DC  B 2 11  ? 29.420  44.068 14.886  1.00 45.07  ? 11  DC  B N3    1 
ATOM 729  C C4    . DC  B 2 11  ? 30.300  45.069 14.705  1.00 44.12  ? 11  DC  B C4    1 
ATOM 730  N N4    . DC  B 2 11  ? 31.551  44.747 14.322  1.00 38.87  ? 11  DC  B N4    1 
ATOM 731  C C5    . DC  B 2 11  ? 29.936  46.446 14.902  1.00 44.97  ? 11  DC  B C5    1 
ATOM 732  C C6    . DC  B 2 11  ? 28.667  46.707 15.260  1.00 53.50  ? 11  DC  B C6    1 
ATOM 733  P P     . DC  B 2 12  ? 23.342  47.416 18.061  1.00 85.25  ? 12  DC  B P     1 
ATOM 734  O OP1   . DC  B 2 12  ? 21.902  47.787 18.090  1.00 81.97  ? 12  DC  B OP1   1 
ATOM 735  O OP2   . DC  B 2 12  ? 24.363  48.342 18.620  1.00 80.61  ? 12  DC  B OP2   1 
ATOM 736  O "O5'" . DC  B 2 12  ? 23.512  46.005 18.777  1.00 82.71  ? 12  DC  B "O5'" 1 
ATOM 737  C "C5'" . DC  B 2 12  ? 22.725  44.893 18.373  1.00 77.73  ? 12  DC  B "C5'" 1 
ATOM 738  C "C4'" . DC  B 2 12  ? 23.241  43.626 19.014  1.00 71.93  ? 12  DC  B "C4'" 1 
ATOM 739  O "O4'" . DC  B 2 12  ? 24.619  43.408 18.624  1.00 66.81  ? 12  DC  B "O4'" 1 
ATOM 740  C "C3'" . DC  B 2 12  ? 23.284  43.747 20.537  1.00 68.51  ? 12  DC  B "C3'" 1 
ATOM 741  O "O3'" . DC  B 2 12  ? 23.255  42.432 21.074  1.00 65.68  ? 12  DC  B "O3'" 1 
ATOM 742  C "C2'" . DC  B 2 12  ? 24.660  44.325 20.792  1.00 64.64  ? 12  DC  B "C2'" 1 
ATOM 743  C "C1'" . DC  B 2 12  ? 25.452  43.565 19.754  1.00 56.68  ? 12  DC  B "C1'" 1 
ATOM 744  N N1    . DC  B 2 12  ? 26.742  44.096 19.329  1.00 43.78  ? 12  DC  B N1    1 
ATOM 745  C C2    . DC  B 2 12  ? 27.733  43.185 18.952  1.00 38.69  ? 12  DC  B C2    1 
ATOM 746  O O2    . DC  B 2 12  ? 27.462  41.967 18.965  1.00 35.89  ? 12  DC  B O2    1 
ATOM 747  N N3    . DC  B 2 12  ? 28.950  43.638 18.588  1.00 32.37  ? 12  DC  B N3    1 
ATOM 748  C C4    . DC  B 2 12  ? 29.191  44.947 18.589  1.00 32.93  ? 12  DC  B C4    1 
ATOM 749  N N4    . DC  B 2 12  ? 30.408  45.357 18.224  1.00 31.44  ? 12  DC  B N4    1 
ATOM 750  C C5    . DC  B 2 12  ? 28.193  45.900 18.962  1.00 34.13  ? 12  DC  B C5    1 
ATOM 751  C C6    . DC  B 2 12  ? 26.992  45.433 19.315  1.00 37.62  ? 12  DC  B C6    1 
ATOM 752  P P     . DA  B 2 13  ? 22.296  42.096 22.304  1.00 64.32  ? 13  DA  B P     1 
ATOM 753  O OP1   . DA  B 2 13  ? 20.900  42.086 21.780  1.00 62.29  ? 13  DA  B OP1   1 
ATOM 754  O OP2   . DA  B 2 13  ? 22.660  42.983 23.449  1.00 64.88  ? 13  DA  B OP2   1 
ATOM 755  O "O5'" . DA  B 2 13  ? 22.679  40.595 22.665  1.00 60.10  ? 13  DA  B "O5'" 1 
ATOM 756  C "C5'" . DA  B 2 13  ? 22.318  39.552 21.784  1.00 53.07  ? 13  DA  B "C5'" 1 
ATOM 757  C "C4'" . DA  B 2 13  ? 23.391  38.490 21.735  1.00 50.60  ? 13  DA  B "C4'" 1 
ATOM 758  O "O4'" . DA  B 2 13  ? 24.680  39.069 21.389  1.00 49.56  ? 13  DA  B "O4'" 1 
ATOM 759  C "C3'" . DA  B 2 13  ? 23.633  37.788 23.062  1.00 46.41  ? 13  DA  B "C3'" 1 
ATOM 760  O "O3'" . DA  B 2 13  ? 24.078  36.477 22.737  1.00 46.12  ? 13  DA  B "O3'" 1 
ATOM 761  C "C2'" . DA  B 2 13  ? 24.716  38.639 23.707  1.00 45.32  ? 13  DA  B "C2'" 1 
ATOM 762  C "C1'" . DA  B 2 13  ? 25.568  39.035 22.506  1.00 43.58  ? 13  DA  B "C1'" 1 
ATOM 763  N N9    . DA  B 2 13  ? 26.277  40.322 22.545  1.00 39.39  ? 13  DA  B N9    1 
ATOM 764  C C8    . DA  B 2 13  ? 25.795  41.559 22.920  1.00 37.96  ? 13  DA  B C8    1 
ATOM 765  N N7    . DA  B 2 13  ? 26.648  42.540 22.736  1.00 33.87  ? 13  DA  B N7    1 
ATOM 766  C C5    . DA  B 2 13  ? 27.776  41.911 22.231  1.00 32.43  ? 13  DA  B C5    1 
ATOM 767  C C6    . DA  B 2 13  ? 29.029  42.405 21.818  1.00 30.70  ? 13  DA  B C6    1 
ATOM 768  N N6    . DA  B 2 13  ? 29.366  43.694 21.839  1.00 27.61  ? 13  DA  B N6    1 
ATOM 769  N N1    . DA  B 2 13  ? 29.934  41.516 21.371  1.00 31.45  ? 13  DA  B N1    1 
ATOM 770  C C2    . DA  B 2 13  ? 29.596  40.214 21.344  1.00 32.70  ? 13  DA  B C2    1 
ATOM 771  N N3    . DA  B 2 13  ? 28.451  39.626 21.700  1.00 33.17  ? 13  DA  B N3    1 
ATOM 772  C C4    . DA  B 2 13  ? 27.572  40.540 22.136  1.00 35.00  ? 13  DA  B C4    1 
ATOM 773  P P     . DG  B 2 14  ? 23.964  35.310 23.814  1.00 46.75  ? 14  DG  B P     1 
ATOM 774  O OP1   . DG  B 2 14  ? 23.577  34.036 23.159  1.00 45.97  ? 14  DG  B OP1   1 
ATOM 775  O OP2   . DG  B 2 14  ? 23.143  35.861 24.926  1.00 45.05  ? 14  DG  B OP2   1 
ATOM 776  O "O5'" . DG  B 2 14  ? 25.474  35.144 24.259  1.00 46.92  ? 14  DG  B "O5'" 1 
ATOM 777  C "C5'" . DG  B 2 14  ? 26.355  36.206 24.013  1.00 48.33  ? 14  DG  B "C5'" 1 
ATOM 778  C "C4'" . DG  B 2 14  ? 27.774  35.819 24.323  1.00 47.01  ? 14  DG  B "C4'" 1 
ATOM 779  O "O4'" . DG  B 2 14  ? 28.549  37.020 24.169  1.00 46.47  ? 14  DG  B "O4'" 1 
ATOM 780  C "C3'" . DG  B 2 14  ? 27.980  35.390 25.760  1.00 46.04  ? 14  DG  B "C3'" 1 
ATOM 781  O "O3'" . DG  B 2 14  ? 29.232  34.707 25.778  1.00 50.11  ? 14  DG  B "O3'" 1 
ATOM 782  C "C2'" . DG  B 2 14  ? 28.142  36.727 26.453  1.00 45.02  ? 14  DG  B "C2'" 1 
ATOM 783  C "C1'" . DG  B 2 14  ? 28.935  37.498 25.428  1.00 39.17  ? 14  DG  B "C1'" 1 
ATOM 784  N N9    . DG  B 2 14  ? 28.774  38.941 25.419  1.00 32.97  ? 14  DG  B N9    1 
ATOM 785  C C8    . DG  B 2 14  ? 27.681  39.688 25.783  1.00 30.33  ? 14  DG  B C8    1 
ATOM 786  N N7    . DG  B 2 14  ? 27.898  40.978 25.712  1.00 27.34  ? 14  DG  B N7    1 
ATOM 787  C C5    . DG  B 2 14  ? 29.204  41.073 25.259  1.00 26.17  ? 14  DG  B C5    1 
ATOM 788  C C6    . DG  B 2 14  ? 29.991  42.202 25.001  1.00 25.01  ? 14  DG  B C6    1 
ATOM 789  O O6    . DG  B 2 14  ? 29.688  43.387 25.143  1.00 24.82  ? 14  DG  B O6    1 
ATOM 790  N N1    . DG  B 2 14  ? 31.258  41.848 24.543  1.00 24.80  ? 14  DG  B N1    1 
ATOM 791  C C2    . DG  B 2 14  ? 31.703  40.548 24.376  1.00 28.01  ? 14  DG  B C2    1 
ATOM 792  N N2    . DG  B 2 14  ? 32.958  40.384 23.942  1.00 29.76  ? 14  DG  B N2    1 
ATOM 793  N N3    . DG  B 2 14  ? 30.972  39.485 24.624  1.00 25.60  ? 14  DG  B N3    1 
ATOM 794  C C4    . DG  B 2 14  ? 29.745  39.820 25.059  1.00 28.54  ? 14  DG  B C4    1 
ATOM 795  P P     . DC  B 2 15  ? 29.482  33.498 26.797  1.00 56.78  ? 15  DC  B P     1 
ATOM 796  O OP1   . DC  B 2 15  ? 30.784  32.882 26.412  1.00 57.84  ? 15  DC  B OP1   1 
ATOM 797  O OP2   . DC  B 2 15  ? 28.251  32.661 26.823  1.00 60.19  ? 15  DC  B OP2   1 
ATOM 798  O "O5'" . DC  B 2 15  ? 29.664  34.203 28.216  1.00 55.13  ? 15  DC  B "O5'" 1 
ATOM 799  C "C5'" . DC  B 2 15  ? 29.963  35.586 28.293  1.00 50.67  ? 15  DC  B "C5'" 1 
ATOM 800  C "C4'" . DC  B 2 15  ? 31.447  35.802 28.148  1.00 48.32  ? 15  DC  B "C4'" 1 
ATOM 801  O "O4'" . DC  B 2 15  ? 31.606  37.076 27.474  1.00 46.50  ? 15  DC  B "O4'" 1 
ATOM 802  C "C3'" . DC  B 2 15  ? 32.081  35.985 29.520  1.00 50.18  ? 15  DC  B "C3'" 1 
ATOM 803  O "O3'" . DC  B 2 15  ? 33.408  35.509 29.717  1.00 52.29  ? 15  DC  B "O3'" 1 
ATOM 804  C "C2'" . DC  B 2 15  ? 31.999  37.475 29.748  1.00 48.32  ? 15  DC  B "C2'" 1 
ATOM 805  C "C1'" . DC  B 2 15  ? 32.127  38.054 28.351  1.00 41.90  ? 15  DC  B "C1'" 1 
ATOM 806  N N1    . DC  B 2 15  ? 31.294  39.257 28.268  1.00 35.97  ? 15  DC  B N1    1 
ATOM 807  C C2    . DC  B 2 15  ? 31.902  40.479 27.988  1.00 33.79  ? 15  DC  B C2    1 
ATOM 808  O O2    . DC  B 2 15  ? 33.096  40.479 27.643  1.00 33.31  ? 15  DC  B O2    1 
ATOM 809  N N3    . DC  B 2 15  ? 31.178  41.620 28.111  1.00 27.99  ? 15  DC  B N3    1 
ATOM 810  C C4    . DC  B 2 15  ? 29.898  41.555 28.477  1.00 28.16  ? 15  DC  B C4    1 
ATOM 811  N N4    . DC  B 2 15  ? 29.230  42.689 28.633  1.00 27.79  ? 15  DC  B N4    1 
ATOM 812  C C5    . DC  B 2 15  ? 29.243  40.316 28.702  1.00 29.66  ? 15  DC  B C5    1 
ATOM 813  C C6    . DC  B 2 15  ? 29.963  39.201 28.564  1.00 32.56  ? 15  DC  B C6    1 
ATOM 814  P P     . DG  B 2 16  ? 34.068  35.692 31.179  1.00 53.95  ? 16  DG  B P     1 
ATOM 815  O OP1   . DG  B 2 16  ? 34.959  34.538 31.452  1.00 54.20  ? 16  DG  B OP1   1 
ATOM 816  O OP2   . DG  B 2 16  ? 32.972  36.021 32.133  1.00 52.49  ? 16  DG  B OP2   1 
ATOM 817  O "O5'" . DG  B 2 16  ? 34.953  37.012 31.048  1.00 52.74  ? 16  DG  B "O5'" 1 
ATOM 818  C "C5'" . DG  B 2 16  ? 36.133  36.985 30.270  1.00 51.83  ? 16  DG  B "C5'" 1 
ATOM 819  C "C4'" . DG  B 2 16  ? 37.017  38.165 30.585  1.00 49.18  ? 16  DG  B "C4'" 1 
ATOM 820  O "O4'" . DG  B 2 16  ? 36.323  39.384 30.232  1.00 47.54  ? 16  DG  B "O4'" 1 
ATOM 821  C "C3'" . DG  B 2 16  ? 37.310  38.296 32.072  1.00 50.16  ? 16  DG  B "C3'" 1 
ATOM 822  O "O3'" . DG  B 2 16  ? 38.566  38.945 32.229  1.00 55.91  ? 16  DG  B "O3'" 1 
ATOM 823  C "C2'" . DG  B 2 16  ? 36.177  39.174 32.563  1.00 46.76  ? 16  DG  B "C2'" 1 
ATOM 824  C "C1'" . DG  B 2 16  ? 36.000  40.120 31.393  1.00 40.65  ? 16  DG  B "C1'" 1 
ATOM 825  N N9    . DG  B 2 16  ? 34.658  40.668 31.245  1.00 33.19  ? 16  DG  B N9    1 
ATOM 826  C C8    . DG  B 2 16  ? 33.482  39.987 31.406  1.00 30.45  ? 16  DG  B C8    1 
ATOM 827  N N7    . DG  B 2 16  ? 32.431  40.762 31.361  1.00 26.78  ? 16  DG  B N7    1 
ATOM 828  C C5    . DG  B 2 16  ? 32.941  42.025 31.111  1.00 24.22  ? 16  DG  B C5    1 
ATOM 829  C C6    . DG  B 2 16  ? 32.276  43.257 30.976  1.00 22.28  ? 16  DG  B C6    1 
ATOM 830  O O6    . DG  B 2 16  ? 31.077  43.485 31.065  1.00 23.71  ? 16  DG  B O6    1 
ATOM 831  N N1    . DG  B 2 16  ? 33.155  44.295 30.728  1.00 19.99  ? 16  DG  B N1    1 
ATOM 832  C C2    . DG  B 2 16  ? 34.510  44.166 30.625  1.00 22.51  ? 16  DG  B C2    1 
ATOM 833  N N2    . DG  B 2 16  ? 35.171  45.310 30.380  1.00 23.16  ? 16  DG  B N2    1 
ATOM 834  N N3    . DG  B 2 16  ? 35.162  43.009 30.756  1.00 23.27  ? 16  DG  B N3    1 
ATOM 835  C C4    . DG  B 2 16  ? 34.313  41.986 31.002  1.00 27.30  ? 16  DG  B C4    1 
ATOM 836  P P     . DG  B 2 17  ? 39.278  38.981 33.666  1.00 58.63  ? 17  DG  B P     1 
ATOM 837  O OP1   . DG  B 2 17  ? 40.680  38.515 33.472  1.00 61.38  ? 17  DG  B OP1   1 
ATOM 838  O OP2   . DG  B 2 17  ? 38.406  38.343 34.702  1.00 58.07  ? 17  DG  B OP2   1 
ATOM 839  O "O5'" . DG  B 2 17  ? 39.353  40.535 33.948  1.00 57.53  ? 17  DG  B "O5'" 1 
ATOM 840  C "C5'" . DG  B 2 17  ? 38.363  41.365 33.412  1.00 52.92  ? 17  DG  B "C5'" 1 
ATOM 841  C "C4'" . DG  B 2 17  ? 38.802  42.799 33.463  1.00 50.73  ? 17  DG  B "C4'" 1 
ATOM 842  O "O4'" . DG  B 2 17  ? 37.646  43.543 33.065  1.00 50.99  ? 17  DG  B "O4'" 1 
ATOM 843  C "C3'" . DG  B 2 17  ? 39.146  43.299 34.855  1.00 51.70  ? 17  DG  B "C3'" 1 
ATOM 844  O "O3'" . DG  B 2 17  ? 40.044  44.409 34.762  1.00 56.05  ? 17  DG  B "O3'" 1 
ATOM 845  C "C2'" . DG  B 2 17  ? 37.797  43.702 35.408  1.00 49.15  ? 17  DG  B "C2'" 1 
ATOM 846  C "C1'" . DG  B 2 17  ? 37.055  44.186 34.176  1.00 46.34  ? 17  DG  B "C1'" 1 
ATOM 847  N N9    . DG  B 2 17  ? 35.647  43.813 34.178  1.00 41.42  ? 17  DG  B N9    1 
ATOM 848  C C8    . DG  B 2 17  ? 35.127  42.555 34.357  1.00 40.04  ? 17  DG  B C8    1 
ATOM 849  N N7    . DG  B 2 17  ? 33.824  42.541 34.377  1.00 37.57  ? 17  DG  B N7    1 
ATOM 850  C C5    . DG  B 2 17  ? 33.468  43.866 34.181  1.00 36.83  ? 17  DG  B C5    1 
ATOM 851  C C6    . DG  B 2 17  ? 32.195  44.468 34.115  1.00 36.76  ? 17  DG  B C6    1 
ATOM 852  O O6    . DG  B 2 17  ? 31.085  43.934 34.225  1.00 36.82  ? 17  DG  B O6    1 
ATOM 853  N N1    . DG  B 2 17  ? 32.290  45.835 33.898  1.00 35.07  ? 17  DG  B N1    1 
ATOM 854  C C2    . DG  B 2 17  ? 33.461  46.530 33.762  1.00 34.89  ? 17  DG  B C2    1 
ATOM 855  N N2    . DG  B 2 17  ? 33.340  47.848 33.561  1.00 36.43  ? 17  DG  B N2    1 
ATOM 856  N N3    . DG  B 2 17  ? 34.657  45.979 33.821  1.00 32.80  ? 17  DG  B N3    1 
ATOM 857  C C4    . DG  B 2 17  ? 34.585  44.657 34.036  1.00 36.59  ? 17  DG  B C4    1 
ATOM 858  P P     . DA  B 2 18  ? 40.618  45.081 36.104  1.00 57.82  ? 18  DA  B P     1 
ATOM 859  O OP1   . DA  B 2 18  ? 41.801  45.885 35.709  1.00 57.68  ? 18  DA  B OP1   1 
ATOM 860  O OP2   . DA  B 2 18  ? 40.761  44.009 37.119  1.00 58.38  ? 18  DA  B OP2   1 
ATOM 861  O "O5'" . DA  B 2 18  ? 39.452  46.083 36.533  1.00 55.80  ? 18  DA  B "O5'" 1 
ATOM 862  C "C5'" . DA  B 2 18  ? 38.998  47.037 35.593  1.00 52.77  ? 18  DA  B "C5'" 1 
ATOM 863  C "C4'" . DA  B 2 18  ? 38.038  48.036 36.197  1.00 50.41  ? 18  DA  B "C4'" 1 
ATOM 864  O "O4'" . DA  B 2 18  ? 36.672  47.553 36.140  1.00 49.65  ? 18  DA  B "O4'" 1 
ATOM 865  C "C3'" . DA  B 2 18  ? 38.284  48.334 37.677  1.00 49.30  ? 18  DA  B "C3'" 1 
ATOM 866  O "O3'" . DA  B 2 18  ? 37.709  49.618 37.934  1.00 50.97  ? 18  DA  B "O3'" 1 
ATOM 867  C "C2'" . DA  B 2 18  ? 37.403  47.304 38.362  1.00 47.09  ? 18  DA  B "C2'" 1 
ATOM 868  C "C1'" . DA  B 2 18  ? 36.193  47.380 37.456  1.00 43.12  ? 18  DA  B "C1'" 1 
ATOM 869  N N9    . DA  B 2 18  ? 35.151  46.356 37.482  1.00 36.26  ? 18  DA  B N9    1 
ATOM 870  C C8    . DA  B 2 18  ? 35.260  45.015 37.713  1.00 36.46  ? 18  DA  B C8    1 
ATOM 871  N N7    . DA  B 2 18  ? 34.107  44.388 37.736  1.00 33.33  ? 18  DA  B N7    1 
ATOM 872  C C5    . DA  B 2 18  ? 33.180  45.386 37.493  1.00 29.60  ? 18  DA  B C5    1 
ATOM 873  C C6    . DA  B 2 18  ? 31.783  45.366 37.404  1.00 28.25  ? 18  DA  B C6    1 
ATOM 874  N N6    . DA  B 2 18  ? 31.055  44.268 37.590  1.00 26.93  ? 18  DA  B N6    1 
ATOM 875  N N1    . DA  B 2 18  ? 31.149  46.524 37.126  1.00 27.52  ? 18  DA  B N1    1 
ATOM 876  C C2    . DA  B 2 18  ? 31.889  47.625 36.969  1.00 31.64  ? 18  DA  B C2    1 
ATOM 877  N N3    . DA  B 2 18  ? 33.219  47.774 37.046  1.00 32.11  ? 18  DA  B N3    1 
ATOM 878  C C4    . DA  B 2 18  ? 33.809  46.599 37.313  1.00 31.68  ? 18  DA  B C4    1 
ATOM 879  P P     . DA  B 2 19  ? 38.397  50.638 38.957  1.00 51.67  ? 19  DA  B P     1 
ATOM 880  O OP1   . DA  B 2 19  ? 39.642  51.124 38.320  1.00 51.91  ? 19  DA  B OP1   1 
ATOM 881  O OP2   . DA  B 2 19  ? 38.441  50.063 40.327  1.00 53.43  ? 19  DA  B OP2   1 
ATOM 882  O "O5'" . DA  B 2 19  ? 37.337  51.815 38.937  1.00 49.07  ? 19  DA  B "O5'" 1 
ATOM 883  C "C5'" . DA  B 2 19  ? 36.837  52.261 37.689  1.00 44.35  ? 19  DA  B "C5'" 1 
ATOM 884  C "C4'" . DA  B 2 19  ? 35.440  52.826 37.817  1.00 43.21  ? 19  DA  B "C4'" 1 
ATOM 885  O "O4'" . DA  B 2 19  ? 34.466  51.762 37.964  1.00 42.58  ? 19  DA  B "O4'" 1 
ATOM 886  C "C3'" . DA  B 2 19  ? 35.244  53.702 39.053  1.00 41.15  ? 19  DA  B "C3'" 1 
ATOM 887  O "O3'" . DA  B 2 19  ? 34.246  54.673 38.769  1.00 41.35  ? 19  DA  B "O3'" 1 
ATOM 888  C "C2'" . DA  B 2 19  ? 34.766  52.714 40.100  1.00 38.93  ? 19  DA  B "C2'" 1 
ATOM 889  C "C1'" . DA  B 2 19  ? 33.894  51.797 39.270  1.00 36.72  ? 19  DA  B "C1'" 1 
ATOM 890  N N9    . DA  B 2 19  ? 33.744  50.422 39.736  1.00 32.39  ? 19  DA  B N9    1 
ATOM 891  C C8    . DA  B 2 19  ? 34.720  49.571 40.163  1.00 30.53  ? 19  DA  B C8    1 
ATOM 892  N N7    . DA  B 2 19  ? 34.272  48.384 40.498  1.00 31.49  ? 19  DA  B N7    1 
ATOM 893  C C5    . DA  B 2 19  ? 32.905  48.465 40.281  1.00 29.39  ? 19  DA  B C5    1 
ATOM 894  C C6    . DA  B 2 19  ? 31.859  47.530 40.446  1.00 29.94  ? 19  DA  B C6    1 
ATOM 895  N N6    . DA  B 2 19  ? 32.049  46.284 40.891  1.00 27.18  ? 19  DA  B N6    1 
ATOM 896  N N1    . DA  B 2 19  ? 30.601  47.925 40.133  1.00 28.56  ? 19  DA  B N1    1 
ATOM 897  C C2    . DA  B 2 19  ? 30.424  49.174 39.680  1.00 28.44  ? 19  DA  B C2    1 
ATOM 898  N N3    . DA  B 2 19  ? 31.327  50.139 39.482  1.00 29.25  ? 19  DA  B N3    1 
ATOM 899  C C4    . DA  B 2 19  ? 32.563  49.715 39.810  1.00 30.20  ? 19  DA  B C4    1 
ATOM 900  P P     . DA  B 2 20  ? 33.788  55.686 39.908  1.00 46.29  ? 20  DA  B P     1 
ATOM 901  O OP1   . DA  B 2 20  ? 33.595  57.009 39.253  1.00 43.82  ? 20  DA  B OP1   1 
ATOM 902  O OP2   . DA  B 2 20  ? 34.731  55.552 41.059  1.00 44.78  ? 20  DA  B OP2   1 
ATOM 903  O "O5'" . DA  B 2 20  ? 32.344  55.152 40.329  1.00 46.89  ? 20  DA  B "O5'" 1 
ATOM 904  C "C5'" . DA  B 2 20  ? 31.266  55.274 39.414  1.00 46.56  ? 20  DA  B "C5'" 1 
ATOM 905  C "C4'" . DA  B 2 20  ? 29.925  55.022 40.068  1.00 45.38  ? 20  DA  B "C4'" 1 
ATOM 906  O "O4'" . DA  B 2 20  ? 29.804  53.629 40.457  1.00 44.72  ? 20  DA  B "O4'" 1 
ATOM 907  C "C3'" . DA  B 2 20  ? 29.659  55.810 41.348  1.00 44.06  ? 20  DA  B "C3'" 1 
ATOM 908  O "O3'" . DA  B 2 20  ? 28.251  56.100 41.413  1.00 45.62  ? 20  DA  B "O3'" 1 
ATOM 909  C "C2'" . DA  B 2 20  ? 30.166  54.870 42.428  1.00 43.31  ? 20  DA  B "C2'" 1 
ATOM 910  C "C1'" . DA  B 2 20  ? 29.774  53.509 41.875  1.00 38.94  ? 20  DA  B "C1'" 1 
ATOM 911  N N9    . DA  B 2 20  ? 30.574  52.342 42.277  1.00 34.44  ? 20  DA  B N9    1 
ATOM 912  C C8    . DA  B 2 20  ? 31.928  52.257 42.506  1.00 31.87  ? 20  DA  B C8    1 
ATOM 913  N N7    . DA  B 2 20  ? 32.326  51.065 42.892  1.00 26.65  ? 20  DA  B N7    1 
ATOM 914  C C5    . DA  B 2 20  ? 31.163  50.316 42.914  1.00 27.17  ? 20  DA  B C5    1 
ATOM 915  C C6    . DA  B 2 20  ? 30.914  48.979 43.244  1.00 28.19  ? 20  DA  B C6    1 
ATOM 916  N N6    . DA  B 2 20  ? 31.858  48.134 43.642  1.00 29.61  ? 20  DA  B N6    1 
ATOM 917  N N1    . DA  B 2 20  ? 29.645  48.530 43.152  1.00 27.74  ? 20  DA  B N1    1 
ATOM 918  C C2    . DA  B 2 20  ? 28.699  49.380 42.757  1.00 30.55  ? 20  DA  B C2    1 
ATOM 919  N N3    . DA  B 2 20  ? 28.806  50.668 42.424  1.00 31.01  ? 20  DA  B N3    1 
ATOM 920  C C4    . DA  B 2 20  ? 30.079  51.081 42.527  1.00 30.41  ? 20  DA  B C4    1 
ATOM 921  P P     . DG  B 2 21  ? 27.553  56.484 42.805  1.00 46.03  ? 21  DG  B P     1 
ATOM 922  O OP1   . DG  B 2 21  ? 26.367  57.319 42.524  1.00 47.01  ? 21  DG  B OP1   1 
ATOM 923  O OP2   . DG  B 2 21  ? 28.583  56.979 43.747  1.00 49.06  ? 21  DG  B OP2   1 
ATOM 924  O "O5'" . DG  B 2 21  ? 26.968  55.085 43.302  1.00 47.12  ? 21  DG  B "O5'" 1 
ATOM 925  C "C5'" . DG  B 2 21  ? 26.145  54.320 42.427  1.00 41.90  ? 21  DG  B "C5'" 1 
ATOM 926  C "C4'" . DG  B 2 21  ? 25.220  53.396 43.188  1.00 41.18  ? 21  DG  B "C4'" 1 
ATOM 927  O "O4'" . DG  B 2 21  ? 25.932  52.232 43.678  1.00 41.08  ? 21  DG  B "O4'" 1 
ATOM 928  C "C3'" . DG  B 2 21  ? 24.581  54.016 44.427  1.00 39.74  ? 21  DG  B "C3'" 1 
ATOM 929  O "O3'" . DG  B 2 21  ? 23.359  53.316 44.656  1.00 39.05  ? 21  DG  B "O3'" 1 
ATOM 930  C "C2'" . DG  B 2 21  ? 25.591  53.686 45.513  1.00 40.20  ? 21  DG  B "C2'" 1 
ATOM 931  C "C1'" . DG  B 2 21  ? 26.033  52.284 45.094  1.00 40.42  ? 21  DG  B "C1'" 1 
ATOM 932  N N9    . DG  B 2 21  ? 27.377  51.869 45.476  1.00 38.76  ? 21  DG  B N9    1 
ATOM 933  C C8    . DG  B 2 21  ? 28.508  52.635 45.460  1.00 39.82  ? 21  DG  B C8    1 
ATOM 934  N N7    . DG  B 2 21  ? 29.570  51.986 45.852  1.00 39.60  ? 21  DG  B N7    1 
ATOM 935  C C5    . DG  B 2 21  ? 29.108  50.718 46.144  1.00 38.95  ? 21  DG  B C5    1 
ATOM 936  C C6    . DG  B 2 21  ? 29.806  49.586 46.612  1.00 40.82  ? 21  DG  B C6    1 
ATOM 937  O O6    . DG  B 2 21  ? 31.002  49.482 46.871  1.00 41.38  ? 21  DG  B O6    1 
ATOM 938  N N1    . DG  B 2 21  ? 28.964  48.494 46.778  1.00 41.47  ? 21  DG  B N1    1 
ATOM 939  C C2    . DG  B 2 21  ? 27.618  48.504 46.527  1.00 42.59  ? 21  DG  B C2    1 
ATOM 940  N N2    . DG  B 2 21  ? 26.975  47.348 46.759  1.00 43.73  ? 21  DG  B N2    1 
ATOM 941  N N3    . DG  B 2 21  ? 26.952  49.566 46.085  1.00 40.49  ? 21  DG  B N3    1 
ATOM 942  C C4    . DG  B 2 21  ? 27.756  50.627 45.919  1.00 38.67  ? 21  DG  B C4    1 
ATOM 943  P P     . DT  B 2 22  ? 22.280  53.886 45.687  1.00 35.55  ? 22  DT  B P     1 
ATOM 944  O OP1   . DT  B 2 22  ? 20.994  54.020 44.958  1.00 41.57  ? 22  DT  B OP1   1 
ATOM 945  O OP2   . DT  B 2 22  ? 22.860  55.042 46.394  1.00 35.99  ? 22  DT  B OP2   1 
ATOM 946  O "O5'" . DT  B 2 22  ? 22.085  52.684 46.689  1.00 36.02  ? 22  DT  B "O5'" 1 
ATOM 947  C "C5'" . DT  B 2 22  ? 23.183  51.890 46.997  1.00 34.75  ? 22  DT  B "C5'" 1 
ATOM 948  C "C4'" . DT  B 2 22  ? 22.762  50.673 47.769  1.00 35.11  ? 22  DT  B "C4'" 1 
ATOM 949  O "O4'" . DT  B 2 22  ? 23.998  49.970 47.998  1.00 36.26  ? 22  DT  B "O4'" 1 
ATOM 950  C "C3'" . DT  B 2 22  ? 22.174  50.935 49.154  1.00 38.26  ? 22  DT  B "C3'" 1 
ATOM 951  O "O3'" . DT  B 2 22  ? 21.268  49.855 49.504  1.00 44.30  ? 22  DT  B "O3'" 1 
ATOM 952  C "C2'" . DT  B 2 22  ? 23.419  51.037 50.025  1.00 34.59  ? 22  DT  B "C2'" 1 
ATOM 953  C "C1'" . DT  B 2 22  ? 24.396  50.079 49.348  1.00 32.65  ? 22  DT  B "C1'" 1 
ATOM 954  N N1    . DT  B 2 22  ? 25.819  50.480 49.361  1.00 28.06  ? 22  DT  B N1    1 
ATOM 955  C C2    . DT  B 2 22  ? 26.718  49.522 49.768  1.00 28.55  ? 22  DT  B C2    1 
ATOM 956  O O2    . DT  B 2 22  ? 26.381  48.378 50.042  1.00 30.82  ? 22  DT  B O2    1 
ATOM 957  N N3    . DT  B 2 22  ? 28.024  49.947 49.842  1.00 26.50  ? 22  DT  B N3    1 
ATOM 958  C C4    . DT  B 2 22  ? 28.505  51.208 49.544  1.00 25.98  ? 22  DT  B C4    1 
ATOM 959  O O4    . DT  B 2 22  ? 29.708  51.454 49.671  1.00 24.04  ? 22  DT  B O4    1 
ATOM 960  C C5    . DT  B 2 22  ? 27.503  52.158 49.094  1.00 24.53  ? 22  DT  B C5    1 
ATOM 961  C C7    . DT  B 2 22  ? 27.936  53.544 48.745  1.00 23.11  ? 22  DT  B C7    1 
ATOM 962  C C6    . DT  B 2 22  ? 26.228  51.748 49.017  1.00 24.57  ? 22  DT  B C6    1 
ATOM 963  P P     . DC  B 2 23  ? 20.580  49.789 50.966  1.00 45.28  ? 23  DC  B P     1 
ATOM 964  O OP1   . DC  B 2 23  ? 19.434  48.861 50.822  1.00 43.57  ? 23  DC  B OP1   1 
ATOM 965  O OP2   . DC  B 2 23  ? 20.344  51.153 51.503  1.00 44.74  ? 23  DC  B OP2   1 
ATOM 966  O "O5'" . DC  B 2 23  ? 21.697  49.068 51.844  1.00 45.51  ? 23  DC  B "O5'" 1 
ATOM 967  C "C5'" . DC  B 2 23  ? 22.197  47.796 51.450  1.00 44.54  ? 23  DC  B "C5'" 1 
ATOM 968  C "C4'" . DC  B 2 23  ? 23.051  47.187 52.536  1.00 45.31  ? 23  DC  B "C4'" 1 
ATOM 969  O "O4'" . DC  B 2 23  ? 24.408  47.679 52.451  1.00 43.65  ? 23  DC  B "O4'" 1 
ATOM 970  C "C3'" . DC  B 2 23  ? 22.567  47.603 53.929  1.00 48.42  ? 23  DC  B "C3'" 1 
ATOM 971  O "O3'" . DC  B 2 23  ? 23.091  46.672 54.865  1.00 53.48  ? 23  DC  B "O3'" 1 
ATOM 972  C "C2'" . DC  B 2 23  ? 23.341  48.879 54.183  1.00 45.91  ? 23  DC  B "C2'" 1 
ATOM 973  C "C1'" . DC  B 2 23  ? 24.676  48.466 53.600  1.00 42.47  ? 23  DC  B "C1'" 1 
ATOM 974  N N1    . DC  B 2 23  ? 25.663  49.503 53.283  1.00 37.59  ? 23  DC  B N1    1 
ATOM 975  C C2    . DC  B 2 23  ? 27.025  49.178 53.376  1.00 35.83  ? 23  DC  B C2    1 
ATOM 976  O O2    . DC  B 2 23  ? 27.350  48.010 53.649  1.00 35.16  ? 23  DC  B O2    1 
ATOM 977  N N3    . DC  B 2 23  ? 27.947  50.134 53.165  1.00 33.05  ? 23  DC  B N3    1 
ATOM 978  C C4    . DC  B 2 23  ? 27.562  51.366 52.851  1.00 35.41  ? 23  DC  B C4    1 
ATOM 979  N N4    . DC  B 2 23  ? 28.511  52.282 52.642  1.00 35.06  ? 23  DC  B N4    1 
ATOM 980  C C5    . DC  B 2 23  ? 26.184  51.720 52.729  1.00 36.31  ? 23  DC  B C5    1 
ATOM 981  C C6    . DC  B 2 23  ? 25.278  50.763 52.945  1.00 35.79  ? 23  DC  B C6    1 
ATOM 982  P P     . DC  B 2 24  ? 22.117  45.864 55.842  1.00 57.01  ? 24  DC  B P     1 
ATOM 983  O OP1   . DC  B 2 24  ? 20.828  45.568 55.157  1.00 57.64  ? 24  DC  B OP1   1 
ATOM 984  O OP2   . DC  B 2 24  ? 22.116  46.571 57.159  1.00 55.06  ? 24  DC  B OP2   1 
ATOM 985  O "O5'" . DC  B 2 24  ? 22.914  44.504 56.007  1.00 54.56  ? 24  DC  B "O5'" 1 
ATOM 986  C "C5'" . DC  B 2 24  ? 23.757  44.337 57.119  1.00 55.75  ? 24  DC  B "C5'" 1 
ATOM 987  C "C4'" . DC  B 2 24  ? 25.081  43.751 56.707  1.00 51.48  ? 24  DC  B "C4'" 1 
ATOM 988  O "O4'" . DC  B 2 24  ? 25.912  44.781 56.127  1.00 48.82  ? 24  DC  B "O4'" 1 
ATOM 989  C "C3'" . DC  B 2 24  ? 25.806  43.351 57.974  1.00 51.80  ? 24  DC  B "C3'" 1 
ATOM 990  O "O3'" . DC  B 2 24  ? 26.604  42.216 57.765  1.00 50.31  ? 24  DC  B "O3'" 1 
ATOM 991  C "C2'" . DC  B 2 24  ? 26.587  44.585 58.364  1.00 49.55  ? 24  DC  B "C2'" 1 
ATOM 992  C "C1'" . DC  B 2 24  ? 26.968  45.133 57.021  1.00 44.27  ? 24  DC  B "C1'" 1 
ATOM 993  N N1    . DC  B 2 24  ? 27.118  46.594 56.996  1.00 38.68  ? 24  DC  B N1    1 
ATOM 994  C C2    . DC  B 2 24  ? 28.382  47.149 57.191  1.00 33.46  ? 24  DC  B C2    1 
ATOM 995  O O2    . DC  B 2 24  ? 29.327  46.411 57.460  1.00 32.83  ? 24  DC  B O2    1 
ATOM 996  N N3    . DC  B 2 24  ? 28.542  48.475 57.085  1.00 28.84  ? 24  DC  B N3    1 
ATOM 997  C C4    . DC  B 2 24  ? 27.501  49.248 56.817  1.00 30.52  ? 24  DC  B C4    1 
ATOM 998  N N4    . DC  B 2 24  ? 27.715  50.559 56.702  1.00 31.75  ? 24  DC  B N4    1 
ATOM 999  C C5    . DC  B 2 24  ? 26.191  48.717 56.649  1.00 31.78  ? 24  DC  B C5    1 
ATOM 1000 C C6    . DC  B 2 24  ? 26.045  47.397 56.751  1.00 35.81  ? 24  DC  B C6    1 
ATOM 1001 P P     . DC  B 2 25  ? 26.703  41.150 58.934  1.00 49.95  ? 25  DC  B P     1 
ATOM 1002 O OP1   . DC  B 2 25  ? 26.599  39.787 58.351  1.00 50.34  ? 25  DC  B OP1   1 
ATOM 1003 O OP2   . DC  B 2 25  ? 25.695  41.610 59.931  1.00 49.77  ? 25  DC  B OP2   1 
ATOM 1004 O "O5'" . DC  B 2 25  ? 28.160  41.413 59.504  1.00 45.27  ? 25  DC  B "O5'" 1 
ATOM 1005 C "C5'" . DC  B 2 25  ? 28.712  42.698 59.391  1.00 40.78  ? 25  DC  B "C5'" 1 
ATOM 1006 C "C4'" . DC  B 2 25  ? 30.138  42.702 59.866  1.00 41.12  ? 25  DC  B "C4'" 1 
ATOM 1007 O "O4'" . DC  B 2 25  ? 30.611  44.056 59.719  1.00 42.75  ? 25  DC  B "O4'" 1 
ATOM 1008 C "C3'" . DC  B 2 25  ? 30.319  42.367 61.339  1.00 40.80  ? 25  DC  B "C3'" 1 
ATOM 1009 O "O3'" . DC  B 2 25  ? 31.688  41.959 61.538  1.00 39.22  ? 25  DC  B "O3'" 1 
ATOM 1010 C "C2'" . DC  B 2 25  ? 30.108  43.719 61.999  1.00 40.27  ? 25  DC  B "C2'" 1 
ATOM 1011 C "C1'" . DC  B 2 25  ? 30.691  44.695 60.984  1.00 38.02  ? 25  DC  B "C1'" 1 
ATOM 1012 N N1    . DC  B 2 25  ? 29.957  45.964 60.865  1.00 33.39  ? 25  DC  B N1    1 
ATOM 1013 C C2    . DC  B 2 25  ? 30.665  47.164 60.964  1.00 33.23  ? 25  DC  B C2    1 
ATOM 1014 O O2    . DC  B 2 25  ? 31.885  47.123 61.185  1.00 34.88  ? 25  DC  B O2    1 
ATOM 1015 N N3    . DC  B 2 25  ? 30.008  48.332 60.822  1.00 30.37  ? 25  DC  B N3    1 
ATOM 1016 C C4    . DC  B 2 25  ? 28.696  48.330 60.597  1.00 30.53  ? 25  DC  B C4    1 
ATOM 1017 N N4    . DC  B 2 25  ? 28.084  49.514 60.457  1.00 28.31  ? 25  DC  B N4    1 
ATOM 1018 C C5    . DC  B 2 25  ? 27.949  47.118 60.503  1.00 28.95  ? 25  DC  B C5    1 
ATOM 1019 C C6    . DC  B 2 25  ? 28.613  45.973 60.644  1.00 28.18  ? 25  DC  B C6    1 
ATOM 1020 N N     . ALA C 3 15  ? 0.174   80.037 56.013  1.00 117.35 ? 392 ALA L N     1 
ATOM 1021 C CA    . ALA C 3 15  ? 0.037   80.504 54.602  1.00 117.46 ? 392 ALA L CA    1 
ATOM 1022 C C     . ALA C 3 15  ? 1.394   80.553 53.897  1.00 117.09 ? 392 ALA L C     1 
ATOM 1023 O O     . ALA C 3 15  ? 1.468   80.515 52.665  1.00 117.46 ? 392 ALA L O     1 
ATOM 1024 C CB    . ALA C 3 15  ? -0.623  81.890 54.572  1.00 117.69 ? 392 ALA L CB    1 
ATOM 1025 N N     . SER C 3 16  ? 2.460   80.627 54.693  1.00 115.84 ? 393 SER L N     1 
ATOM 1026 C CA    . SER C 3 16  ? 3.834   80.703 54.192  1.00 113.93 ? 393 SER L CA    1 
ATOM 1027 C C     . SER C 3 16  ? 4.259   79.533 53.304  1.00 111.84 ? 393 SER L C     1 
ATOM 1028 O O     . SER C 3 16  ? 5.240   78.845 53.604  1.00 111.89 ? 393 SER L O     1 
ATOM 1029 C CB    . SER C 3 16  ? 4.804   80.810 55.373  1.00 114.99 ? 393 SER L CB    1 
ATOM 1030 O OG    . SER C 3 16  ? 4.688   79.688 56.234  1.00 116.16 ? 393 SER L OG    1 
ATOM 1031 N N     . SER C 3 17  ? 3.539   79.321 52.205  1.00 108.44 ? 394 SER L N     1 
ATOM 1032 C CA    . SER C 3 17  ? 3.858   78.225 51.301  1.00 104.49 ? 394 SER L CA    1 
ATOM 1033 C C     . SER C 3 17  ? 4.292   78.711 49.917  1.00 100.25 ? 394 SER L C     1 
ATOM 1034 O O     . SER C 3 17  ? 3.463   78.945 49.033  1.00 99.87  ? 394 SER L O     1 
ATOM 1035 C CB    . SER C 3 17  ? 2.655   77.285 51.178  1.00 105.93 ? 394 SER L CB    1 
ATOM 1036 O OG    . SER C 3 17  ? 3.018   76.064 50.555  1.00 108.36 ? 394 SER L OG    1 
ATOM 1037 N N     . VAL C 3 18  ? 5.602   78.864 49.746  1.00 94.64  ? 395 VAL L N     1 
ATOM 1038 C CA    . VAL C 3 18  ? 6.176   79.307 48.482  1.00 88.59  ? 395 VAL L CA    1 
ATOM 1039 C C     . VAL C 3 18  ? 7.033   78.171 47.945  1.00 83.73  ? 395 VAL L C     1 
ATOM 1040 O O     . VAL C 3 18  ? 7.976   77.733 48.600  1.00 82.54  ? 395 VAL L O     1 
ATOM 1041 C CB    . VAL C 3 18  ? 7.061   80.534 48.680  1.00 89.38  ? 395 VAL L CB    1 
ATOM 1042 C CG1   . VAL C 3 18  ? 7.441   81.122 47.332  1.00 89.48  ? 395 VAL L CG1   1 
ATOM 1043 C CG2   . VAL C 3 18  ? 6.337   81.549 49.536  1.00 90.13  ? 395 VAL L CG2   1 
ATOM 1044 N N     . PRO C 3 19  ? 6.724   77.690 46.732  1.00 79.53  ? 396 PRO L N     1 
ATOM 1045 C CA    . PRO C 3 19  ? 7.479   76.592 46.131  1.00 76.64  ? 396 PRO L CA    1 
ATOM 1046 C C     . PRO C 3 19  ? 8.960   76.633 46.445  1.00 74.31  ? 396 PRO L C     1 
ATOM 1047 O O     . PRO C 3 19  ? 9.556   77.706 46.575  1.00 74.07  ? 396 PRO L O     1 
ATOM 1048 C CB    . PRO C 3 19  ? 7.188   76.753 44.646  1.00 75.96  ? 396 PRO L CB    1 
ATOM 1049 C CG    . PRO C 3 19  ? 5.790   77.228 44.655  1.00 76.34  ? 396 PRO L CG    1 
ATOM 1050 C CD    . PRO C 3 19  ? 5.821   78.291 45.737  1.00 77.82  ? 396 PRO L CD    1 
ATOM 1051 N N     . LEU C 3 20  ? 9.541   75.448 46.580  1.00 71.85  ? 397 LEU L N     1 
ATOM 1052 C CA    . LEU C 3 20  ? 10.954  75.321 46.873  1.00 69.94  ? 397 LEU L CA    1 
ATOM 1053 C C     . LEU C 3 20  ? 11.750  75.471 45.586  1.00 70.72  ? 397 LEU L C     1 
ATOM 1054 O O     . LEU C 3 20  ? 12.967  75.559 45.614  1.00 70.00  ? 397 LEU L O     1 
ATOM 1055 C CB    . LEU C 3 20  ? 11.213  73.968 47.531  1.00 66.33  ? 397 LEU L CB    1 
ATOM 1056 C CG    . LEU C 3 20  ? 10.596  73.857 48.932  1.00 63.87  ? 397 LEU L CG    1 
ATOM 1057 C CD1   . LEU C 3 20  ? 10.327  72.413 49.298  1.00 61.85  ? 397 LEU L CD1   1 
ATOM 1058 C CD2   . LEU C 3 20  ? 11.533  74.511 49.934  1.00 62.04  ? 397 LEU L CD2   1 
ATOM 1059 N N     . GLU C 3 21  ? 11.044  75.515 44.460  1.00 73.15  ? 398 GLU L N     1 
ATOM 1060 C CA    . GLU C 3 21  ? 11.665  75.669 43.148  1.00 76.31  ? 398 GLU L CA    1 
ATOM 1061 C C     . GLU C 3 21  ? 11.701  77.138 42.813  1.00 79.60  ? 398 GLU L C     1 
ATOM 1062 O O     . GLU C 3 21  ? 12.346  77.550 41.862  1.00 79.01  ? 398 GLU L O     1 
ATOM 1063 C CB    . GLU C 3 21  ? 10.860  74.942 42.080  1.00 75.33  ? 398 GLU L CB    1 
ATOM 1064 C CG    . GLU C 3 21  ? 10.781  73.460 42.297  1.00 76.25  ? 398 GLU L CG    1 
ATOM 1065 C CD    . GLU C 3 21  ? 10.424  73.114 43.727  1.00 77.11  ? 398 GLU L CD    1 
ATOM 1066 O OE1   . GLU C 3 21  ? 9.386   73.610 44.215  1.00 77.47  ? 398 GLU L OE1   1 
ATOM 1067 O OE2   . GLU C 3 21  ? 11.183  72.352 44.365  1.00 78.09  ? 398 GLU L OE2   1 
ATOM 1068 N N     . TRP C 3 22  ? 10.983  77.928 43.597  1.00 85.26  ? 399 TRP L N     1 
ATOM 1069 C CA    . TRP C 3 22  ? 10.951  79.362 43.388  1.00 90.38  ? 399 TRP L CA    1 
ATOM 1070 C C     . TRP C 3 22  ? 12.296  79.942 43.753  1.00 88.97  ? 399 TRP L C     1 
ATOM 1071 O O     . TRP C 3 22  ? 12.893  79.564 44.761  1.00 88.89  ? 399 TRP L O     1 
ATOM 1072 C CB    . TRP C 3 22  ? 9.884   80.008 44.259  1.00 99.12  ? 399 TRP L CB    1 
ATOM 1073 C CG    . TRP C 3 22  ? 8.626   80.294 43.533  1.00 109.10 ? 399 TRP L CG    1 
ATOM 1074 C CD1   . TRP C 3 22  ? 7.814   79.394 42.911  1.00 111.60 ? 399 TRP L CD1   1 
ATOM 1075 C CD2   . TRP C 3 22  ? 8.000   81.571 43.388  1.00 114.42 ? 399 TRP L CD2   1 
ATOM 1076 N NE1   . TRP C 3 22  ? 6.713   80.029 42.390  1.00 115.15 ? 399 TRP L NE1   1 
ATOM 1077 C CE2   . TRP C 3 22  ? 6.801   81.368 42.669  1.00 116.39 ? 399 TRP L CE2   1 
ATOM 1078 C CE3   . TRP C 3 22  ? 8.334   82.870 43.798  1.00 117.81 ? 399 TRP L CE3   1 
ATOM 1079 C CZ2   . TRP C 3 22  ? 5.927   82.418 42.352  1.00 118.78 ? 399 TRP L CZ2   1 
ATOM 1080 C CZ3   . TRP C 3 22  ? 7.464   83.918 43.482  1.00 120.46 ? 399 TRP L CZ3   1 
ATOM 1081 C CH2   . TRP C 3 22  ? 6.274   83.682 42.765  1.00 120.40 ? 399 TRP L CH2   1 
ATOM 1082 N N     . PRO C 3 23  ? 12.795  80.871 42.934  1.00 87.49  ? 400 PRO L N     1 
ATOM 1083 C CA    . PRO C 3 23  ? 14.090  81.488 43.207  1.00 86.74  ? 400 PRO L CA    1 
ATOM 1084 C C     . PRO C 3 23  ? 13.901  82.639 44.170  1.00 85.83  ? 400 PRO L C     1 
ATOM 1085 O O     . PRO C 3 23  ? 13.006  83.458 43.997  1.00 86.36  ? 400 PRO L O     1 
ATOM 1086 C CB    . PRO C 3 23  ? 14.548  81.981 41.833  1.00 87.00  ? 400 PRO L CB    1 
ATOM 1087 C CG    . PRO C 3 23  ? 13.634  81.274 40.848  1.00 87.72  ? 400 PRO L CG    1 
ATOM 1088 C CD    . PRO C 3 23  ? 12.335  81.220 41.586  1.00 87.28  ? 400 PRO L CD    1 
ATOM 1089 N N     . LEU C 3 24  ? 14.727  82.688 45.197  1.00 84.85  ? 401 LEU L N     1 
ATOM 1090 C CA    . LEU C 3 24  ? 14.643  83.772 46.150  1.00 85.44  ? 401 LEU L CA    1 
ATOM 1091 C C     . LEU C 3 24  ? 16.061  84.275 46.301  1.00 87.85  ? 401 LEU L C     1 
ATOM 1092 O O     . LEU C 3 24  ? 16.994  83.639 45.807  1.00 88.90  ? 401 LEU L O     1 
ATOM 1093 C CB    . LEU C 3 24  ? 14.092  83.276 47.482  1.00 82.93  ? 401 LEU L CB    1 
ATOM 1094 C CG    . LEU C 3 24  ? 12.710  82.626 47.399  1.00 80.66  ? 401 LEU L CG    1 
ATOM 1095 C CD1   . LEU C 3 24  ? 12.207  82.264 48.793  1.00 78.72  ? 401 LEU L CD1   1 
ATOM 1096 C CD2   . LEU C 3 24  ? 11.750  83.578 46.722  1.00 79.65  ? 401 LEU L CD2   1 
ATOM 1097 N N     . SER C 3 25  ? 16.235  85.416 46.958  1.00 90.33  ? 402 SER L N     1 
ATOM 1098 C CA    . SER C 3 25  ? 17.571  85.966 47.130  1.00 92.09  ? 402 SER L CA    1 
ATOM 1099 C C     . SER C 3 25  ? 17.975  86.064 48.584  1.00 93.69  ? 402 SER L C     1 
ATOM 1100 O O     . SER C 3 25  ? 17.140  86.034 49.489  1.00 92.44  ? 402 SER L O     1 
ATOM 1101 C CB    . SER C 3 25  ? 17.681  87.351 46.482  1.00 92.31  ? 402 SER L CB    1 
ATOM 1102 O OG    . SER C 3 25  ? 19.015  87.841 46.550  1.00 91.65  ? 402 SER L OG    1 
ATOM 1103 N N     . SER C 3 26  ? 19.279  86.185 48.788  1.00 97.12  ? 403 SER L N     1 
ATOM 1104 C CA    . SER C 3 26  ? 19.845  86.295 50.119  1.00 101.17 ? 403 SER L CA    1 
ATOM 1105 C C     . SER C 3 26  ? 19.468  87.611 50.800  1.00 103.77 ? 403 SER L C     1 
ATOM 1106 O O     . SER C 3 26  ? 19.221  87.629 52.008  1.00 103.81 ? 403 SER L O     1 
ATOM 1107 C CB    . SER C 3 26  ? 21.372  86.147 50.046  1.00 100.80 ? 403 SER L CB    1 
ATOM 1108 O OG    . SER C 3 26  ? 21.921  86.927 48.994  1.00 100.11 ? 403 SER L OG    1 
ATOM 1109 N N     . GLN C 3 27  ? 19.406  88.702 50.033  1.00 107.07 ? 404 GLN L N     1 
ATOM 1110 C CA    . GLN C 3 27  ? 19.071  90.008 50.605  1.00 110.66 ? 404 GLN L CA    1 
ATOM 1111 C C     . GLN C 3 27  ? 17.963  90.792 49.891  1.00 111.17 ? 404 GLN L C     1 
ATOM 1112 O O     . GLN C 3 27  ? 17.887  90.798 48.661  1.00 110.98 ? 404 GLN L O     1 
ATOM 1113 C CB    . GLN C 3 27  ? 20.325  90.882 50.670  1.00 112.99 ? 404 GLN L CB    1 
ATOM 1114 C CG    . GLN C 3 27  ? 20.893  91.248 49.313  1.00 117.63 ? 404 GLN L CG    1 
ATOM 1115 C CD    . GLN C 3 27  ? 22.030  92.250 49.413  1.00 120.34 ? 404 GLN L CD    1 
ATOM 1116 O OE1   . GLN C 3 27  ? 23.087  91.957 49.977  1.00 122.56 ? 404 GLN L OE1   1 
ATOM 1117 N NE2   . GLN C 3 27  ? 21.815  93.443 48.870  1.00 121.27 ? 404 GLN L NE2   1 
ATOM 1118 N N     . SER C 3 28  ? 17.122  91.461 50.683  1.00 112.07 ? 405 SER L N     1 
ATOM 1119 C CA    . SER C 3 28  ? 16.013  92.277 50.176  1.00 112.92 ? 405 SER L CA    1 
ATOM 1120 C C     . SER C 3 28  ? 15.806  93.542 51.004  1.00 113.67 ? 405 SER L C     1 
ATOM 1121 O O     . SER C 3 28  ? 15.182  93.500 52.066  1.00 113.38 ? 405 SER L O     1 
ATOM 1122 C CB    . SER C 3 28  ? 14.706  91.488 50.186  1.00 112.96 ? 405 SER L CB    1 
ATOM 1123 O OG    . SER C 3 28  ? 13.609  92.355 49.936  1.00 112.47 ? 405 SER L OG    1 
ATOM 1124 N N     . GLY C 3 29  ? 16.311  94.665 50.508  1.00 114.41 ? 406 GLY L N     1 
ATOM 1125 C CA    . GLY C 3 29  ? 16.166  95.911 51.236  1.00 116.10 ? 406 GLY L CA    1 
ATOM 1126 C C     . GLY C 3 29  ? 16.993  95.923 52.510  1.00 117.14 ? 406 GLY L C     1 
ATOM 1127 O O     . GLY C 3 29  ? 18.220  95.815 52.464  1.00 117.02 ? 406 GLY L O     1 
ATOM 1128 N N     . SER C 3 30  ? 16.324  96.062 53.651  1.00 118.22 ? 407 SER L N     1 
ATOM 1129 C CA    . SER C 3 30  ? 17.012  96.079 54.939  1.00 119.47 ? 407 SER L CA    1 
ATOM 1130 C C     . SER C 3 30  ? 16.998  94.677 55.546  1.00 119.98 ? 407 SER L C     1 
ATOM 1131 O O     . SER C 3 30  ? 16.895  94.511 56.765  1.00 119.98 ? 407 SER L O     1 
ATOM 1132 C CB    . SER C 3 30  ? 16.336  97.068 55.897  1.00 119.85 ? 407 SER L CB    1 
ATOM 1133 O OG    . SER C 3 30  ? 15.036  96.634 56.261  1.00 120.44 ? 407 SER L OG    1 
ATOM 1134 N N     . TYR C 3 31  ? 17.103  93.673 54.679  1.00 120.15 ? 408 TYR L N     1 
ATOM 1135 C CA    . TYR C 3 31  ? 17.099  92.277 55.100  1.00 119.83 ? 408 TYR L CA    1 
ATOM 1136 C C     . TYR C 3 31  ? 18.188  91.471 54.390  1.00 119.97 ? 408 TYR L C     1 
ATOM 1137 O O     . TYR C 3 31  ? 18.455  91.676 53.205  1.00 119.74 ? 408 TYR L O     1 
ATOM 1138 C CB    . TYR C 3 31  ? 15.725  91.655 54.820  1.00 118.63 ? 408 TYR L CB    1 
ATOM 1139 C CG    . TYR C 3 31  ? 14.629  92.108 55.763  1.00 116.88 ? 408 TYR L CG    1 
ATOM 1140 C CD1   . TYR C 3 31  ? 13.309  92.208 55.327  1.00 116.60 ? 408 TYR L CD1   1 
ATOM 1141 C CD2   . TYR C 3 31  ? 14.906  92.416 57.095  1.00 116.20 ? 408 TYR L CD2   1 
ATOM 1142 C CE1   . TYR C 3 31  ? 12.288  92.606 56.194  1.00 115.72 ? 408 TYR L CE1   1 
ATOM 1143 C CE2   . TYR C 3 31  ? 13.893  92.812 57.970  1.00 115.52 ? 408 TYR L CE2   1 
ATOM 1144 C CZ    . TYR C 3 31  ? 12.589  92.906 57.513  1.00 115.50 ? 408 TYR L CZ    1 
ATOM 1145 O OH    . TYR C 3 31  ? 11.589  93.306 58.369  1.00 114.59 ? 408 TYR L OH    1 
ATOM 1146 N N     . GLU C 3 32  ? 18.815  90.560 55.132  1.00 120.05 ? 409 GLU L N     1 
ATOM 1147 C CA    . GLU C 3 32  ? 19.867  89.704 54.593  1.00 119.45 ? 409 GLU L CA    1 
ATOM 1148 C C     . GLU C 3 32  ? 20.036  88.438 55.428  1.00 115.53 ? 409 GLU L C     1 
ATOM 1149 O O     . GLU C 3 32  ? 20.173  88.495 56.652  1.00 115.31 ? 409 GLU L O     1 
ATOM 1150 C CB    . GLU C 3 32  ? 21.197  90.463 54.523  1.00 124.59 ? 409 GLU L CB    1 
ATOM 1151 C CG    . GLU C 3 32  ? 22.355  89.642 53.966  1.00 132.41 ? 409 GLU L CG    1 
ATOM 1152 C CD    . GLU C 3 32  ? 23.557  90.496 53.590  1.00 137.16 ? 409 GLU L CD    1 
ATOM 1153 O OE1   . GLU C 3 32  ? 24.590  89.929 53.173  1.00 139.72 ? 409 GLU L OE1   1 
ATOM 1154 O OE2   . GLU C 3 32  ? 23.468  91.737 53.705  1.00 140.51 ? 409 GLU L OE2   1 
ATOM 1155 N N     . LEU C 3 33  ? 20.013  87.295 54.751  1.00 110.58 ? 410 LEU L N     1 
ATOM 1156 C CA    . LEU C 3 33  ? 20.172  86.000 55.398  1.00 105.23 ? 410 LEU L CA    1 
ATOM 1157 C C     . LEU C 3 33  ? 21.516  85.411 54.980  1.00 104.24 ? 410 LEU L C     1 
ATOM 1158 O O     . LEU C 3 33  ? 21.619  84.740 53.957  1.00 103.65 ? 410 LEU L O     1 
ATOM 1159 C CB    . LEU C 3 33  ? 19.032  85.065 54.982  1.00 100.32 ? 410 LEU L CB    1 
ATOM 1160 C CG    . LEU C 3 33  ? 18.957  83.682 55.634  1.00 96.23  ? 410 LEU L CG    1 
ATOM 1161 C CD1   . LEU C 3 33  ? 18.967  83.840 57.141  1.00 94.39  ? 410 LEU L CD1   1 
ATOM 1162 C CD2   . LEU C 3 33  ? 17.693  82.949 55.179  1.00 92.79  ? 410 LEU L CD2   1 
ATOM 1163 N N     . ARG C 3 34  ? 22.551  85.684 55.764  1.00 103.77 ? 411 ARG L N     1 
ATOM 1164 C CA    . ARG C 3 34  ? 23.878  85.172 55.455  1.00 103.27 ? 411 ARG L CA    1 
ATOM 1165 C C     . ARG C 3 34  ? 24.138  83.851 56.144  1.00 101.17 ? 411 ARG L C     1 
ATOM 1166 O O     . ARG C 3 34  ? 23.543  83.542 57.178  1.00 100.66 ? 411 ARG L O     1 
ATOM 1167 C CB    . ARG C 3 34  ? 24.969  86.146 55.905  1.00 106.31 ? 411 ARG L CB    1 
ATOM 1168 C CG    . ARG C 3 34  ? 25.260  87.303 54.974  1.00 111.21 ? 411 ARG L CG    1 
ATOM 1169 C CD    . ARG C 3 34  ? 26.645  87.882 55.284  1.00 115.60 ? 411 ARG L CD    1 
ATOM 1170 N NE    . ARG C 3 34  ? 26.752  88.422 56.641  1.00 120.45 ? 411 ARG L NE    1 
ATOM 1171 C CZ    . ARG C 3 34  ? 26.338  89.635 57.004  1.00 122.84 ? 411 ARG L CZ    1 
ATOM 1172 N NH1   . ARG C 3 34  ? 25.786  90.448 56.112  1.00 124.42 ? 411 ARG L NH1   1 
ATOM 1173 N NH2   . ARG C 3 34  ? 26.480  90.040 58.260  1.00 123.61 ? 411 ARG L NH2   1 
ATOM 1174 N N     . ILE C 3 35  ? 25.040  83.077 55.556  1.00 98.96  ? 412 ILE L N     1 
ATOM 1175 C CA    . ILE C 3 35  ? 25.437  81.803 56.123  1.00 97.37  ? 412 ILE L CA    1 
ATOM 1176 C C     . ILE C 3 35  ? 26.681  82.126 56.935  1.00 97.12  ? 412 ILE L C     1 
ATOM 1177 O O     . ILE C 3 35  ? 27.777  82.264 56.390  1.00 96.32  ? 412 ILE L O     1 
ATOM 1178 C CB    . ILE C 3 35  ? 25.781  80.776 55.024  1.00 96.48  ? 412 ILE L CB    1 
ATOM 1179 C CG1   . ILE C 3 35  ? 24.502  80.338 54.301  1.00 95.37  ? 412 ILE L CG1   1 
ATOM 1180 C CG2   . ILE C 3 35  ? 26.483  79.575 55.632  1.00 95.39  ? 412 ILE L CG2   1 
ATOM 1181 C CD1   . ILE C 3 35  ? 23.496  79.633 55.197  1.00 93.18  ? 412 ILE L CD1   1 
ATOM 1182 N N     . GLU C 3 36  ? 26.492  82.269 58.241  1.00 97.44  ? 413 GLU L N     1 
ATOM 1183 C CA    . GLU C 3 36  ? 27.577  82.601 59.155  1.00 97.90  ? 413 GLU L CA    1 
ATOM 1184 C C     . GLU C 3 36  ? 28.733  81.607 59.139  1.00 95.16  ? 413 GLU L C     1 
ATOM 1185 O O     . GLU C 3 36  ? 29.887  81.985 58.911  1.00 94.39  ? 413 GLU L O     1 
ATOM 1186 C CB    . GLU C 3 36  ? 27.030  82.713 60.578  1.00 102.46 ? 413 GLU L CB    1 
ATOM 1187 C CG    . GLU C 3 36  ? 25.995  83.813 60.763  1.00 108.54 ? 413 GLU L CG    1 
ATOM 1188 C CD    . GLU C 3 36  ? 26.567  85.212 60.564  1.00 111.94 ? 413 GLU L CD    1 
ATOM 1189 O OE1   . GLU C 3 36  ? 25.837  86.191 60.844  1.00 113.49 ? 413 GLU L OE1   1 
ATOM 1190 O OE2   . GLU C 3 36  ? 27.737  85.335 60.128  1.00 113.65 ? 413 GLU L OE2   1 
ATOM 1191 N N     . VAL C 3 37  ? 28.415  80.340 59.389  1.00 91.69  ? 414 VAL L N     1 
ATOM 1192 C CA    . VAL C 3 37  ? 29.425  79.289 59.416  1.00 87.85  ? 414 VAL L CA    1 
ATOM 1193 C C     . VAL C 3 37  ? 29.094  78.175 58.422  1.00 86.19  ? 414 VAL L C     1 
ATOM 1194 O O     . VAL C 3 37  ? 28.261  77.313 58.700  1.00 84.43  ? 414 VAL L O     1 
ATOM 1195 C CB    . VAL C 3 37  ? 29.527  78.686 60.825  1.00 87.29  ? 414 VAL L CB    1 
ATOM 1196 C CG1   . VAL C 3 37  ? 30.792  77.856 60.946  1.00 85.88  ? 414 VAL L CG1   1 
ATOM 1197 C CG2   . VAL C 3 37  ? 29.502  79.794 61.858  1.00 84.94  ? 414 VAL L CG2   1 
ATOM 1198 N N     . GLN C 3 38  ? 29.753  78.198 57.265  1.00 85.09  ? 415 GLN L N     1 
ATOM 1199 C CA    . GLN C 3 38  ? 29.529  77.194 56.223  1.00 84.87  ? 415 GLN L CA    1 
ATOM 1200 C C     . GLN C 3 38  ? 29.895  75.792 56.705  1.00 84.15  ? 415 GLN L C     1 
ATOM 1201 O O     . GLN C 3 38  ? 30.772  75.634 57.551  1.00 84.48  ? 415 GLN L O     1 
ATOM 1202 C CB    . GLN C 3 38  ? 30.364  77.521 54.979  1.00 85.30  ? 415 GLN L CB    1 
ATOM 1203 C CG    . GLN C 3 38  ? 29.918  78.751 54.194  1.00 87.30  ? 415 GLN L CG    1 
ATOM 1204 C CD    . GLN C 3 38  ? 28.618  78.537 53.439  1.00 88.63  ? 415 GLN L CD    1 
ATOM 1205 O OE1   . GLN C 3 38  ? 28.169  79.405 52.689  1.00 88.79  ? 415 GLN L OE1   1 
ATOM 1206 N NE2   . GLN C 3 38  ? 28.005  77.377 53.634  1.00 90.42  ? 415 GLN L NE2   1 
ATOM 1207 N N     . PRO C 3 39  ? 29.219  74.753 56.178  1.00 83.37  ? 416 PRO L N     1 
ATOM 1208 C CA    . PRO C 3 39  ? 29.525  73.378 56.589  1.00 81.90  ? 416 PRO L CA    1 
ATOM 1209 C C     . PRO C 3 39  ? 30.812  72.854 55.943  1.00 80.01  ? 416 PRO L C     1 
ATOM 1210 O O     . PRO C 3 39  ? 31.496  73.575 55.217  1.00 79.02  ? 416 PRO L O     1 
ATOM 1211 C CB    . PRO C 3 39  ? 28.283  72.605 56.149  1.00 81.59  ? 416 PRO L CB    1 
ATOM 1212 C CG    . PRO C 3 39  ? 27.862  73.336 54.932  1.00 81.82  ? 416 PRO L CG    1 
ATOM 1213 C CD    . PRO C 3 39  ? 28.006  74.786 55.342  1.00 82.56  ? 416 PRO L CD    1 
ATOM 1214 N N     . LYS C 3 40  ? 31.144  71.601 56.220  1.00 78.97  ? 417 LYS L N     1 
ATOM 1215 C CA    . LYS C 3 40  ? 32.351  70.999 55.668  1.00 78.60  ? 417 LYS L CA    1 
ATOM 1216 C C     . LYS C 3 40  ? 32.179  70.597 54.199  1.00 76.20  ? 417 LYS L C     1 
ATOM 1217 O O     . LYS C 3 40  ? 31.086  70.264 53.750  1.00 75.33  ? 417 LYS L O     1 
ATOM 1218 C CB    . LYS C 3 40  ? 32.750  69.781 56.511  1.00 81.13  ? 417 LYS L CB    1 
ATOM 1219 C CG    . LYS C 3 40  ? 32.979  70.104 57.985  1.00 84.05  ? 417 LYS L CG    1 
ATOM 1220 C CD    . LYS C 3 40  ? 33.184  68.850 58.825  1.00 87.83  ? 417 LYS L CD    1 
ATOM 1221 C CE    . LYS C 3 40  ? 34.356  68.026 58.312  1.00 90.58  ? 417 LYS L CE    1 
ATOM 1222 N NZ    . LYS C 3 40  ? 34.623  66.824 59.146  1.00 92.29  ? 417 LYS L NZ    1 
ATOM 1223 N N     . PRO C 3 41  ? 33.270  70.617 53.433  1.00 74.36  ? 418 PRO L N     1 
ATOM 1224 C CA    . PRO C 3 41  ? 33.209  70.253 52.019  1.00 73.60  ? 418 PRO L CA    1 
ATOM 1225 C C     . PRO C 3 41  ? 32.574  68.886 51.834  1.00 72.77  ? 418 PRO L C     1 
ATOM 1226 O O     . PRO C 3 41  ? 31.776  68.686 50.921  1.00 73.84  ? 418 PRO L O     1 
ATOM 1227 C CB    . PRO C 3 41  ? 34.677  70.247 51.594  1.00 73.89  ? 418 PRO L CB    1 
ATOM 1228 C CG    . PRO C 3 41  ? 35.316  71.174 52.546  1.00 75.11  ? 418 PRO L CG    1 
ATOM 1229 C CD    . PRO C 3 41  ? 34.660  70.828 53.851  1.00 74.99  ? 418 PRO L CD    1 
ATOM 1230 N N     . HIS C 3 42  ? 32.946  67.949 52.702  1.00 70.57  ? 419 HIS L N     1 
ATOM 1231 C CA    . HIS C 3 42  ? 32.437  66.586 52.644  1.00 67.76  ? 419 HIS L CA    1 
ATOM 1232 C C     . HIS C 3 42  ? 31.630  66.221 53.873  1.00 65.44  ? 419 HIS L C     1 
ATOM 1233 O O     . HIS C 3 42  ? 31.885  66.728 54.963  1.00 66.41  ? 419 HIS L O     1 
ATOM 1234 C CB    . HIS C 3 42  ? 33.588  65.589 52.525  1.00 69.40  ? 419 HIS L CB    1 
ATOM 1235 C CG    . HIS C 3 42  ? 33.205  64.183 52.889  1.00 72.09  ? 419 HIS L CG    1 
ATOM 1236 N ND1   . HIS C 3 42  ? 32.309  63.437 52.150  1.00 72.73  ? 419 HIS L ND1   1 
ATOM 1237 C CD2   . HIS C 3 42  ? 33.581  63.397 53.925  1.00 72.74  ? 419 HIS L CD2   1 
ATOM 1238 C CE1   . HIS C 3 42  ? 32.152  62.253 52.714  1.00 72.49  ? 419 HIS L CE1   1 
ATOM 1239 N NE2   . HIS C 3 42  ? 32.912  62.204 53.793  1.00 73.87  ? 419 HIS L NE2   1 
ATOM 1240 N N     . HIS C 3 43  ? 30.674  65.319 53.685  1.00 61.83  ? 420 HIS L N     1 
ATOM 1241 C CA    . HIS C 3 43  ? 29.831  64.830 54.765  1.00 58.80  ? 420 HIS L CA    1 
ATOM 1242 C C     . HIS C 3 43  ? 29.244  63.484 54.363  1.00 56.82  ? 420 HIS L C     1 
ATOM 1243 O O     . HIS C 3 43  ? 28.350  63.424 53.521  1.00 58.19  ? 420 HIS L O     1 
ATOM 1244 C CB    . HIS C 3 43  ? 28.687  65.799 55.044  1.00 59.03  ? 420 HIS L CB    1 
ATOM 1245 C CG    . HIS C 3 43  ? 27.612  65.212 55.903  1.00 60.50  ? 420 HIS L CG    1 
ATOM 1246 N ND1   . HIS C 3 43  ? 27.757  65.041 57.262  1.00 61.39  ? 420 HIS L ND1   1 
ATOM 1247 C CD2   . HIS C 3 43  ? 26.401  64.695 55.586  1.00 61.29  ? 420 HIS L CD2   1 
ATOM 1248 C CE1   . HIS C 3 43  ? 26.682  64.443 57.744  1.00 61.39  ? 420 HIS L CE1   1 
ATOM 1249 N NE2   . HIS C 3 43  ? 25.844  64.222 56.748  1.00 60.79  ? 420 HIS L NE2   1 
ATOM 1250 N N     . ARG C 3 44  ? 29.727  62.394 54.940  1.00 52.84  ? 421 ARG L N     1 
ATOM 1251 C CA    . ARG C 3 44  ? 29.161  61.113 54.553  1.00 50.85  ? 421 ARG L CA    1 
ATOM 1252 C C     . ARG C 3 44  ? 27.666  61.099 54.869  1.00 51.79  ? 421 ARG L C     1 
ATOM 1253 O O     . ARG C 3 44  ? 27.269  61.317 56.008  1.00 51.86  ? 421 ARG L O     1 
ATOM 1254 C CB    . ARG C 3 44  ? 29.868  59.967 55.279  1.00 46.54  ? 421 ARG L CB    1 
ATOM 1255 C CG    . ARG C 3 44  ? 29.242  58.586 55.049  1.00 40.82  ? 421 ARG L CG    1 
ATOM 1256 C CD    . ARG C 3 44  ? 30.204  57.481 55.466  1.00 34.88  ? 421 ARG L CD    1 
ATOM 1257 N NE    . ARG C 3 44  ? 29.660  56.133 55.305  1.00 30.38  ? 421 ARG L NE    1 
ATOM 1258 C CZ    . ARG C 3 44  ? 30.351  55.021 55.563  1.00 30.93  ? 421 ARG L CZ    1 
ATOM 1259 N NH1   . ARG C 3 44  ? 31.612  55.095 55.986  1.00 28.54  ? 421 ARG L NH1   1 
ATOM 1260 N NH2   . ARG C 3 44  ? 29.783  53.831 55.432  1.00 28.46  ? 421 ARG L NH2   1 
ATOM 1261 N N     . ALA C 3 45  ? 26.835  60.872 53.854  1.00 52.68  ? 422 ALA L N     1 
ATOM 1262 C CA    . ALA C 3 45  ? 25.389  60.816 54.062  1.00 52.30  ? 422 ALA L CA    1 
ATOM 1263 C C     . ALA C 3 45  ? 25.058  59.366 54.370  1.00 52.13  ? 422 ALA L C     1 
ATOM 1264 O O     . ALA C 3 45  ? 25.813  58.472 53.987  1.00 52.25  ? 422 ALA L O     1 
ATOM 1265 C CB    . ALA C 3 45  ? 24.662  61.261 52.815  1.00 52.78  ? 422 ALA L CB    1 
ATOM 1266 N N     . HIS C 3 46  ? 23.938  59.127 55.046  1.00 51.17  ? 423 HIS L N     1 
ATOM 1267 C CA    . HIS C 3 46  ? 23.553  57.764 55.407  1.00 51.29  ? 423 HIS L CA    1 
ATOM 1268 C C     . HIS C 3 46  ? 22.320  57.265 54.678  1.00 51.08  ? 423 HIS L C     1 
ATOM 1269 O O     . HIS C 3 46  ? 21.469  58.053 54.281  1.00 50.39  ? 423 HIS L O     1 
ATOM 1270 C CB    . HIS C 3 46  ? 23.273  57.680 56.905  1.00 52.19  ? 423 HIS L CB    1 
ATOM 1271 C CG    . HIS C 3 46  ? 22.093  58.497 57.340  1.00 52.67  ? 423 HIS L CG    1 
ATOM 1272 N ND1   . HIS C 3 46  ? 22.203  59.813 57.742  1.00 51.69  ? 423 HIS L ND1   1 
ATOM 1273 C CD2   . HIS C 3 46  ? 20.772  58.198 57.385  1.00 51.68  ? 423 HIS L CD2   1 
ATOM 1274 C CE1   . HIS C 3 46  ? 21.000  60.287 58.013  1.00 51.66  ? 423 HIS L CE1   1 
ATOM 1275 N NE2   . HIS C 3 46  ? 20.115  59.328 57.804  1.00 50.55  ? 423 HIS L NE2   1 
ATOM 1276 N N     . TYR C 3 47  ? 22.221  55.949 54.520  1.00 52.41  ? 424 TYR L N     1 
ATOM 1277 C CA    . TYR C 3 47  ? 21.059  55.340 53.875  1.00 55.60  ? 424 TYR L CA    1 
ATOM 1278 C C     . TYR C 3 47  ? 20.011  55.076 54.942  1.00 60.14  ? 424 TYR L C     1 
ATOM 1279 O O     . TYR C 3 47  ? 20.291  55.240 56.127  1.00 60.40  ? 424 TYR L O     1 
ATOM 1280 C CB    . TYR C 3 47  ? 21.437  54.023 53.209  1.00 50.42  ? 424 TYR L CB    1 
ATOM 1281 C CG    . TYR C 3 47  ? 22.193  54.219 51.923  1.00 46.29  ? 424 TYR L CG    1 
ATOM 1282 C CD1   . TYR C 3 47  ? 23.517  54.627 51.932  1.00 42.89  ? 424 TYR L CD1   1 
ATOM 1283 C CD2   . TYR C 3 47  ? 21.555  54.076 50.688  1.00 43.22  ? 424 TYR L CD2   1 
ATOM 1284 C CE1   . TYR C 3 47  ? 24.182  54.895 50.750  1.00 39.48  ? 424 TYR L CE1   1 
ATOM 1285 C CE2   . TYR C 3 47  ? 22.215  54.345 49.509  1.00 38.77  ? 424 TYR L CE2   1 
ATOM 1286 C CZ    . TYR C 3 47  ? 23.525  54.754 49.548  1.00 37.86  ? 424 TYR L CZ    1 
ATOM 1287 O OH    . TYR C 3 47  ? 24.193  55.026 48.383  1.00 39.22  ? 424 TYR L OH    1 
ATOM 1288 N N     . GLU C 3 48  ? 18.805  54.682 54.548  1.00 64.57  ? 425 GLU L N     1 
ATOM 1289 C CA    . GLU C 3 48  ? 17.799  54.410 55.564  1.00 68.38  ? 425 GLU L CA    1 
ATOM 1290 C C     . GLU C 3 48  ? 18.165  53.116 56.256  1.00 65.21  ? 425 GLU L C     1 
ATOM 1291 O O     . GLU C 3 48  ? 17.967  52.983 57.451  1.00 65.83  ? 425 GLU L O     1 
ATOM 1292 C CB    . GLU C 3 48  ? 16.392  54.337 54.957  1.00 77.51  ? 425 GLU L CB    1 
ATOM 1293 C CG    . GLU C 3 48  ? 15.773  55.725 54.737  1.00 92.49  ? 425 GLU L CG    1 
ATOM 1294 C CD    . GLU C 3 48  ? 14.566  55.741 53.790  1.00 100.13 ? 425 GLU L CD    1 
ATOM 1295 O OE1   . GLU C 3 48  ? 14.684  55.226 52.654  1.00 104.52 ? 425 GLU L OE1   1 
ATOM 1296 O OE2   . GLU C 3 48  ? 13.504  56.288 54.172  1.00 104.11 ? 425 GLU L OE2   1 
ATOM 1297 N N     . THR C 3 49  ? 18.731  52.171 55.514  1.00 62.38  ? 426 THR L N     1 
ATOM 1298 C CA    . THR C 3 49  ? 19.124  50.897 56.099  1.00 59.18  ? 426 THR L CA    1 
ATOM 1299 C C     . THR C 3 49  ? 20.163  51.126 57.180  1.00 58.42  ? 426 THR L C     1 
ATOM 1300 O O     . THR C 3 49  ? 20.469  50.235 57.959  1.00 58.34  ? 426 THR L O     1 
ATOM 1301 C CB    . THR C 3 49  ? 19.717  49.941 55.059  1.00 58.15  ? 426 THR L CB    1 
ATOM 1302 O OG1   . THR C 3 49  ? 20.831  50.561 54.411  1.00 56.78  ? 426 THR L OG1   1 
ATOM 1303 C CG2   . THR C 3 49  ? 18.679  49.577 54.038  1.00 59.16  ? 426 THR L CG2   1 
ATOM 1304 N N     . GLU C 3 50  ? 20.731  52.319 57.208  1.00 57.53  ? 427 GLU L N     1 
ATOM 1305 C CA    . GLU C 3 50  ? 21.704  52.649 58.238  1.00 57.20  ? 427 GLU L CA    1 
ATOM 1306 C C     . GLU C 3 50  ? 20.933  53.518 59.231  1.00 59.35  ? 427 GLU L C     1 
ATOM 1307 O O     . GLU C 3 50  ? 19.801  53.927 58.957  1.00 60.12  ? 427 GLU L O     1 
ATOM 1308 C CB    . GLU C 3 50  ? 22.876  53.436 57.646  1.00 54.69  ? 427 GLU L CB    1 
ATOM 1309 C CG    . GLU C 3 50  ? 23.645  52.721 56.538  1.00 47.87  ? 427 GLU L CG    1 
ATOM 1310 C CD    . GLU C 3 50  ? 24.928  53.444 56.185  1.00 43.86  ? 427 GLU L CD    1 
ATOM 1311 O OE1   . GLU C 3 50  ? 24.858  54.577 55.671  1.00 43.45  ? 427 GLU L OE1   1 
ATOM 1312 O OE2   . GLU C 3 50  ? 26.012  52.887 56.433  1.00 41.46  ? 427 GLU L OE2   1 
ATOM 1313 N N     . GLY C 3 51  ? 21.513  53.806 60.384  1.00 60.57  ? 428 GLY L N     1 
ATOM 1314 C CA    . GLY C 3 51  ? 20.776  54.625 61.326  1.00 62.63  ? 428 GLY L CA    1 
ATOM 1315 C C     . GLY C 3 51  ? 20.758  56.086 60.917  1.00 62.95  ? 428 GLY L C     1 
ATOM 1316 O O     . GLY C 3 51  ? 19.805  56.601 60.338  1.00 61.75  ? 428 GLY L O     1 
ATOM 1317 N N     . SER C 3 52  ? 21.850  56.750 61.248  1.00 64.18  ? 429 SER L N     1 
ATOM 1318 C CA    . SER C 3 52  ? 22.053  58.150 60.958  1.00 64.15  ? 429 SER L CA    1 
ATOM 1319 C C     . SER C 3 52  ? 23.552  58.310 61.072  1.00 63.42  ? 429 SER L C     1 
ATOM 1320 O O     . SER C 3 52  ? 24.224  57.469 61.646  1.00 63.90  ? 429 SER L O     1 
ATOM 1321 C CB    . SER C 3 52  ? 21.352  59.010 62.005  1.00 65.35  ? 429 SER L CB    1 
ATOM 1322 O OG    . SER C 3 52  ? 21.989  60.270 62.136  1.00 67.46  ? 429 SER L OG    1 
ATOM 1323 N N     . ARG C 3 53  ? 24.096  59.372 60.521  1.00 62.61  ? 430 ARG L N     1 
ATOM 1324 C CA    . ARG C 3 53  ? 25.518  59.538 60.631  1.00 62.79  ? 430 ARG L CA    1 
ATOM 1325 C C     . ARG C 3 53  ? 25.815  60.955 61.040  1.00 62.89  ? 430 ARG L C     1 
ATOM 1326 O O     . ARG C 3 53  ? 26.671  61.627 60.470  1.00 62.97  ? 430 ARG L O     1 
ATOM 1327 C CB    . ARG C 3 53  ? 26.202  59.151 59.317  1.00 63.61  ? 430 ARG L CB    1 
ATOM 1328 C CG    . ARG C 3 53  ? 26.266  57.627 59.103  1.00 62.28  ? 430 ARG L CG    1 
ATOM 1329 C CD    . ARG C 3 53  ? 26.797  57.238 57.721  1.00 61.32  ? 430 ARG L CD    1 
ATOM 1330 N NE    . ARG C 3 53  ? 27.071  55.809 57.621  1.00 57.02  ? 430 ARG L NE    1 
ATOM 1331 C CZ    . ARG C 3 53  ? 28.070  55.202 58.251  1.00 56.44  ? 430 ARG L CZ    1 
ATOM 1332 N NH1   . ARG C 3 53  ? 28.896  55.896 59.019  1.00 54.15  ? 430 ARG L NH1   1 
ATOM 1333 N NH2   . ARG C 3 53  ? 28.238  53.898 58.125  1.00 57.09  ? 430 ARG L NH2   1 
ATOM 1334 N N     . GLY C 3 54  ? 25.074  61.394 62.050  1.00 63.12  ? 431 GLY L N     1 
ATOM 1335 C CA    . GLY C 3 54  ? 25.247  62.726 62.599  1.00 64.42  ? 431 GLY L CA    1 
ATOM 1336 C C     . GLY C 3 54  ? 24.630  63.849 61.800  1.00 64.30  ? 431 GLY L C     1 
ATOM 1337 O O     . GLY C 3 54  ? 23.958  63.627 60.797  1.00 65.08  ? 431 GLY L O     1 
ATOM 1338 N N     . ALA C 3 55  ? 24.843  65.068 62.268  1.00 64.01  ? 432 ALA L N     1 
ATOM 1339 C CA    . ALA C 3 55  ? 24.332  66.229 61.575  1.00 64.54  ? 432 ALA L CA    1 
ATOM 1340 C C     . ALA C 3 55  ? 25.539  66.754 60.853  1.00 65.43  ? 432 ALA L C     1 
ATOM 1341 O O     . ALA C 3 55  ? 26.653  66.302 61.103  1.00 64.43  ? 432 ALA L O     1 
ATOM 1342 C CB    . ALA C 3 55  ? 23.830  67.255 62.555  1.00 65.59  ? 432 ALA L CB    1 
ATOM 1343 N N     . VAL C 3 56  ? 25.334  67.700 59.954  1.00 67.21  ? 433 VAL L N     1 
ATOM 1344 C CA    . VAL C 3 56  ? 26.461  68.242 59.231  1.00 69.09  ? 433 VAL L CA    1 
ATOM 1345 C C     . VAL C 3 56  ? 27.262  69.059 60.234  1.00 71.03  ? 433 VAL L C     1 
ATOM 1346 O O     . VAL C 3 56  ? 26.706  69.580 61.194  1.00 70.96  ? 433 VAL L O     1 
ATOM 1347 C CB    . VAL C 3 56  ? 25.990  69.123 58.072  1.00 68.18  ? 433 VAL L CB    1 
ATOM 1348 C CG1   . VAL C 3 56  ? 27.146  69.390 57.124  1.00 67.61  ? 433 VAL L CG1   1 
ATOM 1349 C CG2   . VAL C 3 56  ? 24.834  68.442 57.353  1.00 66.82  ? 433 VAL L CG2   1 
ATOM 1350 N N     . LYS C 3 57  ? 28.568  69.150 60.018  1.00 73.81  ? 434 LYS L N     1 
ATOM 1351 C CA    . LYS C 3 57  ? 29.441  69.891 60.916  1.00 77.27  ? 434 LYS L CA    1 
ATOM 1352 C C     . LYS C 3 57  ? 30.291  70.912 60.163  1.00 78.42  ? 434 LYS L C     1 
ATOM 1353 O O     . LYS C 3 57  ? 30.513  70.786 58.959  1.00 78.00  ? 434 LYS L O     1 
ATOM 1354 C CB    . LYS C 3 57  ? 30.372  68.924 61.667  1.00 80.39  ? 434 LYS L CB    1 
ATOM 1355 C CG    . LYS C 3 57  ? 29.680  67.911 62.594  1.00 83.58  ? 434 LYS L CG    1 
ATOM 1356 C CD    . LYS C 3 57  ? 30.716  67.125 63.411  1.00 85.40  ? 434 LYS L CD    1 
ATOM 1357 C CE    . LYS C 3 57  ? 30.085  66.109 64.369  1.00 86.67  ? 434 LYS L CE    1 
ATOM 1358 N NZ    . LYS C 3 57  ? 29.584  64.874 63.698  1.00 87.43  ? 434 LYS L NZ    1 
ATOM 1359 N N     . ALA C 3 58  ? 30.766  71.923 60.884  1.00 79.76  ? 435 ALA L N     1 
ATOM 1360 C CA    . ALA C 3 58  ? 31.610  72.953 60.289  1.00 80.96  ? 435 ALA L CA    1 
ATOM 1361 C C     . ALA C 3 58  ? 33.060  72.542 60.518  1.00 82.02  ? 435 ALA L C     1 
ATOM 1362 O O     . ALA C 3 58  ? 33.334  71.713 61.378  1.00 82.56  ? 435 ALA L O     1 
ATOM 1363 C CB    . ALA C 3 58  ? 31.329  74.292 60.942  1.00 81.34  ? 435 ALA L CB    1 
ATOM 1364 N N     . PRO C 3 59  ? 34.010  73.114 59.760  1.00 83.33  ? 436 PRO L N     1 
ATOM 1365 C CA    . PRO C 3 59  ? 35.415  72.740 59.952  1.00 85.80  ? 436 PRO L CA    1 
ATOM 1366 C C     . PRO C 3 59  ? 35.842  72.937 61.409  1.00 88.39  ? 436 PRO L C     1 
ATOM 1367 O O     . PRO C 3 59  ? 36.751  72.273 61.904  1.00 89.10  ? 436 PRO L O     1 
ATOM 1368 C CB    . PRO C 3 59  ? 36.158  73.675 58.997  1.00 84.51  ? 436 PRO L CB    1 
ATOM 1369 C CG    . PRO C 3 59  ? 35.157  73.961 57.952  1.00 83.91  ? 436 PRO L CG    1 
ATOM 1370 C CD    . PRO C 3 59  ? 33.901  74.181 58.758  1.00 83.40  ? 436 PRO L CD    1 
ATOM 1371 N N     . THR C 3 60  ? 35.177  73.867 62.084  1.00 90.43  ? 437 THR L N     1 
ATOM 1372 C CA    . THR C 3 60  ? 35.458  74.151 63.480  1.00 91.99  ? 437 THR L CA    1 
ATOM 1373 C C     . THR C 3 60  ? 35.478  72.830 64.232  1.00 93.44  ? 437 THR L C     1 
ATOM 1374 O O     . THR C 3 60  ? 36.318  72.595 65.097  1.00 93.68  ? 437 THR L O     1 
ATOM 1375 C CB    . THR C 3 60  ? 34.348  75.013 64.090  1.00 92.53  ? 437 THR L CB    1 
ATOM 1376 O OG1   . THR C 3 60  ? 33.131  74.248 64.148  1.00 91.63  ? 437 THR L OG1   1 
ATOM 1377 C CG2   . THR C 3 60  ? 34.129  76.271 63.247  1.00 91.90  ? 437 THR L CG2   1 
ATOM 1378 N N     . GLY C 3 61  ? 34.541  71.965 63.875  1.00 95.06  ? 438 GLY L N     1 
ATOM 1379 C CA    . GLY C 3 61  ? 34.424  70.679 64.527  1.00 97.70  ? 438 GLY L CA    1 
ATOM 1380 C C     . GLY C 3 61  ? 33.069  70.693 65.201  1.00 100.03 ? 438 GLY L C     1 
ATOM 1381 O O     . GLY C 3 61  ? 32.637  69.703 65.796  1.00 99.64  ? 438 GLY L O     1 
ATOM 1382 N N     . GLY C 3 62  ? 32.396  71.837 65.089  1.00 101.93 ? 439 GLY L N     1 
ATOM 1383 C CA    . GLY C 3 62  ? 31.087  71.998 65.689  1.00 103.95 ? 439 GLY L CA    1 
ATOM 1384 C C     . GLY C 3 62  ? 29.930  71.863 64.717  1.00 105.17 ? 439 GLY L C     1 
ATOM 1385 O O     . GLY C 3 62  ? 29.510  70.753 64.389  1.00 104.89 ? 439 GLY L O     1 
ATOM 1386 N N     . HIS C 3 63  ? 29.412  72.995 64.255  1.00 106.70 ? 440 HIS L N     1 
ATOM 1387 C CA    . HIS C 3 63  ? 28.282  72.995 63.335  1.00 108.18 ? 440 HIS L CA    1 
ATOM 1388 C C     . HIS C 3 63  ? 28.244  74.264 62.504  1.00 108.68 ? 440 HIS L C     1 
ATOM 1389 O O     . HIS C 3 63  ? 28.984  75.211 62.762  1.00 109.09 ? 440 HIS L O     1 
ATOM 1390 C CB    . HIS C 3 63  ? 26.972  72.896 64.114  1.00 109.06 ? 440 HIS L CB    1 
ATOM 1391 C CG    . HIS C 3 63  ? 26.867  71.673 64.965  1.00 110.71 ? 440 HIS L CG    1 
ATOM 1392 N ND1   . HIS C 3 63  ? 26.850  70.401 64.438  1.00 111.78 ? 440 HIS L ND1   1 
ATOM 1393 C CD2   . HIS C 3 63  ? 26.793  71.526 66.308  1.00 111.71 ? 440 HIS L CD2   1 
ATOM 1394 C CE1   . HIS C 3 63  ? 26.770  69.521 65.419  1.00 112.30 ? 440 HIS L CE1   1 
ATOM 1395 N NE2   . HIS C 3 63  ? 26.734  70.178 66.565  1.00 112.26 ? 440 HIS L NE2   1 
ATOM 1396 N N     . PRO C 3 64  ? 27.377  74.295 61.480  1.00 109.03 ? 441 PRO L N     1 
ATOM 1397 C CA    . PRO C 3 64  ? 27.266  75.484 60.630  1.00 108.91 ? 441 PRO L CA    1 
ATOM 1398 C C     . PRO C 3 64  ? 26.281  76.474 61.266  1.00 108.55 ? 441 PRO L C     1 
ATOM 1399 O O     . PRO C 3 64  ? 25.408  76.073 62.046  1.00 107.76 ? 441 PRO L O     1 
ATOM 1400 C CB    . PRO C 3 64  ? 26.765  74.904 59.311  1.00 108.31 ? 441 PRO L CB    1 
ATOM 1401 C CG    . PRO C 3 64  ? 25.866  73.811 59.773  1.00 108.29 ? 441 PRO L CG    1 
ATOM 1402 C CD    . PRO C 3 64  ? 26.662  73.153 60.879  1.00 108.54 ? 441 PRO L CD    1 
ATOM 1403 N N     . VAL C 3 65  ? 26.421  77.759 60.951  1.00 108.32 ? 442 VAL L N     1 
ATOM 1404 C CA    . VAL C 3 65  ? 25.524  78.750 61.532  1.00 108.99 ? 442 VAL L CA    1 
ATOM 1405 C C     . VAL C 3 65  ? 24.870  79.713 60.545  1.00 109.83 ? 442 VAL L C     1 
ATOM 1406 O O     . VAL C 3 65  ? 25.522  80.279 59.663  1.00 108.99 ? 442 VAL L O     1 
ATOM 1407 C CB    . VAL C 3 65  ? 26.237  79.561 62.618  1.00 108.82 ? 442 VAL L CB    1 
ATOM 1408 C CG1   . VAL C 3 65  ? 25.262  80.529 63.267  1.00 108.42 ? 442 VAL L CG1   1 
ATOM 1409 C CG2   . VAL C 3 65  ? 26.810  78.620 63.660  1.00 108.71 ? 442 VAL L CG2   1 
ATOM 1410 N N     . VAL C 3 66  ? 23.564  79.889 60.731  1.00 110.93 ? 443 VAL L N     1 
ATOM 1411 C CA    . VAL C 3 66  ? 22.737  80.753 59.900  1.00 112.08 ? 443 VAL L CA    1 
ATOM 1412 C C     . VAL C 3 66  ? 22.186  81.904 60.729  1.00 113.75 ? 443 VAL L C     1 
ATOM 1413 O O     . VAL C 3 66  ? 21.905  81.731 61.914  1.00 113.88 ? 443 VAL L O     1 
ATOM 1414 C CB    . VAL C 3 66  ? 21.535  79.981 59.357  1.00 111.01 ? 443 VAL L CB    1 
ATOM 1415 C CG1   . VAL C 3 66  ? 20.754  80.850 58.396  1.00 111.51 ? 443 VAL L CG1   1 
ATOM 1416 C CG2   . VAL C 3 66  ? 21.999  78.707 58.701  1.00 111.28 ? 443 VAL L CG2   1 
ATOM 1417 N N     . GLN C 3 67  ? 22.023  83.072 60.111  1.00 115.69 ? 444 GLN L N     1 
ATOM 1418 C CA    . GLN C 3 67  ? 21.470  84.222 60.825  1.00 117.61 ? 444 GLN L CA    1 
ATOM 1419 C C     . GLN C 3 67  ? 20.798  85.259 59.926  1.00 118.67 ? 444 GLN L C     1 
ATOM 1420 O O     . GLN C 3 67  ? 21.260  85.537 58.814  1.00 118.59 ? 444 GLN L O     1 
ATOM 1421 C CB    . GLN C 3 67  ? 22.545  84.919 61.663  1.00 118.09 ? 444 GLN L CB    1 
ATOM 1422 C CG    . GLN C 3 67  ? 22.007  86.122 62.423  1.00 118.55 ? 444 GLN L CG    1 
ATOM 1423 C CD    . GLN C 3 67  ? 23.073  86.858 63.191  1.00 119.03 ? 444 GLN L CD    1 
ATOM 1424 O OE1   . GLN C 3 67  ? 24.084  87.280 62.628  1.00 118.84 ? 444 GLN L OE1   1 
ATOM 1425 N NE2   . GLN C 3 67  ? 22.852  87.024 64.488  1.00 119.72 ? 444 GLN L NE2   1 
ATOM 1426 N N     . LEU C 3 68  ? 19.703  85.824 60.436  1.00 119.66 ? 445 LEU L N     1 
ATOM 1427 C CA    . LEU C 3 68  ? 18.926  86.844 59.736  1.00 120.46 ? 445 LEU L CA    1 
ATOM 1428 C C     . LEU C 3 68  ? 19.269  88.216 60.300  1.00 122.11 ? 445 LEU L C     1 
ATOM 1429 O O     . LEU C 3 68  ? 18.934  88.533 61.445  1.00 122.36 ? 445 LEU L O     1 
ATOM 1430 C CB    . LEU C 3 68  ? 17.431  86.585 59.913  1.00 118.51 ? 445 LEU L CB    1 
ATOM 1431 C CG    . LEU C 3 68  ? 16.498  87.603 59.257  1.00 116.91 ? 445 LEU L CG    1 
ATOM 1432 C CD1   . LEU C 3 68  ? 16.754  87.640 57.754  1.00 115.71 ? 445 LEU L CD1   1 
ATOM 1433 C CD2   . LEU C 3 68  ? 15.053  87.233 59.555  1.00 115.83 ? 445 LEU L CD2   1 
ATOM 1434 N N     . HIS C 3 69  ? 19.924  89.030 59.482  1.00 123.70 ? 446 HIS L N     1 
ATOM 1435 C CA    . HIS C 3 69  ? 20.334  90.360 59.900  1.00 125.18 ? 446 HIS L CA    1 
ATOM 1436 C C     . HIS C 3 69  ? 19.369  91.419 59.388  1.00 124.38 ? 446 HIS L C     1 
ATOM 1437 O O     . HIS C 3 69  ? 18.734  91.244 58.350  1.00 125.47 ? 446 HIS L O     1 
ATOM 1438 C CB    . HIS C 3 69  ? 21.741  90.654 59.379  1.00 128.35 ? 446 HIS L CB    1 
ATOM 1439 C CG    . HIS C 3 69  ? 22.675  89.488 59.467  1.00 131.67 ? 446 HIS L CG    1 
ATOM 1440 N ND1   . HIS C 3 69  ? 24.040  89.638 59.579  1.00 133.18 ? 446 HIS L ND1   1 
ATOM 1441 C CD2   . HIS C 3 69  ? 22.445  88.154 59.435  1.00 133.06 ? 446 HIS L CD2   1 
ATOM 1442 C CE1   . HIS C 3 69  ? 24.609  88.446 59.616  1.00 134.49 ? 446 HIS L CE1   1 
ATOM 1443 N NE2   . HIS C 3 69  ? 23.663  87.529 59.530  1.00 134.21 ? 446 HIS L NE2   1 
ATOM 1444 N N     . GLY C 3 70  ? 19.263  92.522 60.120  1.00 122.41 ? 447 GLY L N     1 
ATOM 1445 C CA    . GLY C 3 70  ? 18.376  93.592 59.711  1.00 119.06 ? 447 GLY L CA    1 
ATOM 1446 C C     . GLY C 3 70  ? 16.943  93.379 60.155  1.00 116.80 ? 447 GLY L C     1 
ATOM 1447 O O     . GLY C 3 70  ? 16.024  93.956 59.577  1.00 117.46 ? 447 GLY L O     1 
ATOM 1448 N N     . TYR C 3 71  ? 16.747  92.553 61.179  1.00 113.86 ? 448 TYR L N     1 
ATOM 1449 C CA    . TYR C 3 71  ? 15.407  92.282 61.693  1.00 111.36 ? 448 TYR L CA    1 
ATOM 1450 C C     . TYR C 3 71  ? 15.132  93.079 62.968  1.00 114.69 ? 448 TYR L C     1 
ATOM 1451 O O     . TYR C 3 71  ? 15.580  92.704 64.057  1.00 115.09 ? 448 TYR L O     1 
ATOM 1452 C CB    . TYR C 3 71  ? 15.241  90.799 61.992  1.00 102.93 ? 448 TYR L CB    1 
ATOM 1453 C CG    . TYR C 3 71  ? 13.830  90.428 62.365  1.00 93.72  ? 448 TYR L CG    1 
ATOM 1454 C CD1   . TYR C 3 71  ? 12.804  90.488 61.424  1.00 89.72  ? 448 TYR L CD1   1 
ATOM 1455 C CD2   . TYR C 3 71  ? 13.523  89.993 63.648  1.00 89.82  ? 448 TYR L CD2   1 
ATOM 1456 C CE1   . TYR C 3 71  ? 11.505  90.116 61.751  1.00 86.25  ? 448 TYR L CE1   1 
ATOM 1457 C CE2   . TYR C 3 71  ? 12.228  89.617 63.990  1.00 86.94  ? 448 TYR L CE2   1 
ATOM 1458 C CZ    . TYR C 3 71  ? 11.220  89.676 63.037  1.00 86.06  ? 448 TYR L CZ    1 
ATOM 1459 O OH    . TYR C 3 71  ? 9.938   89.273 63.366  1.00 84.01  ? 448 TYR L OH    1 
ATOM 1460 N N     . MET C 3 72  ? 14.377  94.166 62.825  1.00 118.28 ? 449 MET L N     1 
ATOM 1461 C CA    . MET C 3 72  ? 14.047  95.044 63.943  1.00 121.48 ? 449 MET L CA    1 
ATOM 1462 C C     . MET C 3 72  ? 12.948  94.515 64.858  1.00 123.69 ? 449 MET L C     1 
ATOM 1463 O O     . MET C 3 72  ? 12.999  94.719 66.067  1.00 124.07 ? 449 MET L O     1 
ATOM 1464 C CB    . MET C 3 72  ? 13.651  96.420 63.414  1.00 121.69 ? 449 MET L CB    1 
ATOM 1465 C CG    . MET C 3 72  ? 14.627  96.981 62.403  1.00 123.18 ? 449 MET L CG    1 
ATOM 1466 S SD    . MET C 3 72  ? 16.294  97.121 63.072  1.00 123.78 ? 449 MET L SD    1 
ATOM 1467 C CE    . MET C 3 72  ? 16.372  98.889 63.436  1.00 124.14 ? 449 MET L CE    1 
ATOM 1468 N N     . GLU C 3 73  ? 11.952  93.844 64.291  1.00 126.79 ? 450 GLU L N     1 
ATOM 1469 C CA    . GLU C 3 73  ? 10.861  93.313 65.100  1.00 129.83 ? 450 GLU L CA    1 
ATOM 1470 C C     . GLU C 3 73  ? 11.352  92.371 66.182  1.00 130.53 ? 450 GLU L C     1 
ATOM 1471 O O     . GLU C 3 73  ? 12.496  91.915 66.157  1.00 130.47 ? 450 GLU L O     1 
ATOM 1472 C CB    . GLU C 3 73  ? 9.840   92.580 64.232  1.00 131.80 ? 450 GLU L CB    1 
ATOM 1473 C CG    . GLU C 3 73  ? 8.824   93.482 63.577  1.00 135.81 ? 450 GLU L CG    1 
ATOM 1474 C CD    . GLU C 3 73  ? 7.709   92.703 62.922  1.00 137.83 ? 450 GLU L CD    1 
ATOM 1475 O OE1   . GLU C 3 73  ? 6.770   93.331 62.389  1.00 139.37 ? 450 GLU L OE1   1 
ATOM 1476 O OE2   . GLU C 3 73  ? 7.771   91.457 62.942  1.00 138.84 ? 450 GLU L OE2   1 
ATOM 1477 N N     . ASN C 3 74  ? 10.470  92.083 67.133  1.00 131.41 ? 451 ASN L N     1 
ATOM 1478 C CA    . ASN C 3 74  ? 10.799  91.190 68.232  1.00 132.12 ? 451 ASN L CA    1 
ATOM 1479 C C     . ASN C 3 74  ? 9.801   90.045 68.292  1.00 132.56 ? 451 ASN L C     1 
ATOM 1480 O O     . ASN C 3 74  ? 9.055   89.899 69.263  1.00 132.57 ? 451 ASN L O     1 
ATOM 1481 C CB    . ASN C 3 74  ? 10.787  91.945 69.559  1.00 132.14 ? 451 ASN L CB    1 
ATOM 1482 C CG    . ASN C 3 74  ? 11.300  91.102 70.703  1.00 132.02 ? 451 ASN L CG    1 
ATOM 1483 O OD1   . ASN C 3 74  ? 12.482  90.753 70.746  1.00 131.45 ? 451 ASN L OD1   1 
ATOM 1484 N ND2   . ASN C 3 74  ? 10.412  90.760 71.635  1.00 131.90 ? 451 ASN L ND2   1 
ATOM 1485 N N     . LYS C 3 75  ? 9.788   89.241 67.238  1.00 132.96 ? 452 LYS L N     1 
ATOM 1486 C CA    . LYS C 3 75  ? 8.897   88.099 67.164  1.00 133.21 ? 452 LYS L CA    1 
ATOM 1487 C C     . LYS C 3 75  ? 9.741   86.894 66.794  1.00 133.11 ? 452 LYS L C     1 
ATOM 1488 O O     . LYS C 3 75  ? 10.783  87.027 66.150  1.00 132.91 ? 452 LYS L O     1 
ATOM 1489 C CB    . LYS C 3 75  ? 7.821   88.321 66.098  1.00 133.70 ? 452 LYS L CB    1 
ATOM 1490 C CG    . LYS C 3 75  ? 7.154   89.693 66.153  1.00 134.73 ? 452 LYS L CG    1 
ATOM 1491 C CD    . LYS C 3 75  ? 6.450   89.951 67.480  1.00 134.53 ? 452 LYS L CD    1 
ATOM 1492 C CE    . LYS C 3 75  ? 5.925   91.385 67.562  1.00 133.88 ? 452 LYS L CE    1 
ATOM 1493 N NZ    . LYS C 3 75  ? 4.926   91.704 66.502  1.00 133.00 ? 452 LYS L NZ    1 
ATOM 1494 N N     . PRO C 3 76  ? 9.311   85.699 67.221  1.00 133.05 ? 453 PRO L N     1 
ATOM 1495 C CA    . PRO C 3 76  ? 10.017  84.444 66.938  1.00 132.03 ? 453 PRO L CA    1 
ATOM 1496 C C     . PRO C 3 76  ? 9.713   83.917 65.524  1.00 129.97 ? 453 PRO L C     1 
ATOM 1497 O O     . PRO C 3 76  ? 8.597   83.467 65.245  1.00 129.83 ? 453 PRO L O     1 
ATOM 1498 C CB    . PRO C 3 76  ? 9.501   83.516 68.033  1.00 133.00 ? 453 PRO L CB    1 
ATOM 1499 C CG    . PRO C 3 76  ? 8.079   83.972 68.190  1.00 133.47 ? 453 PRO L CG    1 
ATOM 1500 C CD    . PRO C 3 76  ? 8.209   85.480 68.178  1.00 133.39 ? 453 PRO L CD    1 
ATOM 1501 N N     . LEU C 3 77  ? 10.708  83.975 64.639  1.00 126.26 ? 454 LEU L N     1 
ATOM 1502 C CA    . LEU C 3 77  ? 10.537  83.512 63.264  1.00 121.47 ? 454 LEU L CA    1 
ATOM 1503 C C     . LEU C 3 77  ? 10.875  82.036 63.104  1.00 117.46 ? 454 LEU L C     1 
ATOM 1504 O O     . LEU C 3 77  ? 11.485  81.431 63.984  1.00 117.49 ? 454 LEU L O     1 
ATOM 1505 C CB    . LEU C 3 77  ? 11.410  84.333 62.316  1.00 122.35 ? 454 LEU L CB    1 
ATOM 1506 C CG    . LEU C 3 77  ? 11.150  85.839 62.260  1.00 122.69 ? 454 LEU L CG    1 
ATOM 1507 C CD1   . LEU C 3 77  ? 12.067  86.471 61.220  1.00 122.78 ? 454 LEU L CD1   1 
ATOM 1508 C CD2   . LEU C 3 77  ? 9.691   86.099 61.919  1.00 122.93 ? 454 LEU L CD2   1 
ATOM 1509 N N     . GLY C 3 78  ? 10.478  81.467 61.969  1.00 112.55 ? 455 GLY L N     1 
ATOM 1510 C CA    . GLY C 3 78  ? 10.743  80.064 61.704  1.00 106.19 ? 455 GLY L CA    1 
ATOM 1511 C C     . GLY C 3 78  ? 11.662  79.829 60.519  1.00 101.21 ? 455 GLY L C     1 
ATOM 1512 O O     . GLY C 3 78  ? 11.293  80.085 59.374  1.00 101.19 ? 455 GLY L O     1 
ATOM 1513 N N     . LEU C 3 79  ? 12.867  79.342 60.797  1.00 95.87  ? 456 LEU L N     1 
ATOM 1514 C CA    . LEU C 3 79  ? 13.837  79.066 59.746  1.00 89.73  ? 456 LEU L CA    1 
ATOM 1515 C C     . LEU C 3 79  ? 13.549  77.708 59.115  1.00 87.14  ? 456 LEU L C     1 
ATOM 1516 O O     . LEU C 3 79  ? 13.200  76.750 59.812  1.00 86.49  ? 456 LEU L O     1 
ATOM 1517 C CB    . LEU C 3 79  ? 15.259  79.070 60.314  1.00 86.70  ? 456 LEU L CB    1 
ATOM 1518 C CG    . LEU C 3 79  ? 16.363  78.920 59.268  1.00 83.50  ? 456 LEU L CG    1 
ATOM 1519 C CD1   . LEU C 3 79  ? 16.193  79.996 58.214  1.00 83.48  ? 456 LEU L CD1   1 
ATOM 1520 C CD2   . LEU C 3 79  ? 17.725  79.036 59.913  1.00 82.17  ? 456 LEU L CD2   1 
ATOM 1521 N N     . GLN C 3 80  ? 13.688  77.637 57.792  1.00 83.43  ? 457 GLN L N     1 
ATOM 1522 C CA    . GLN C 3 80  ? 13.454  76.396 57.063  1.00 78.95  ? 457 GLN L CA    1 
ATOM 1523 C C     . GLN C 3 80  ? 14.739  75.861 56.457  1.00 76.59  ? 457 GLN L C     1 
ATOM 1524 O O     . GLN C 3 80  ? 15.612  76.633 56.034  1.00 75.83  ? 457 GLN L O     1 
ATOM 1525 C CB    . GLN C 3 80  ? 12.423  76.601 55.964  1.00 77.43  ? 457 GLN L CB    1 
ATOM 1526 C CG    . GLN C 3 80  ? 11.047  76.834 56.492  1.00 77.26  ? 457 GLN L CG    1 
ATOM 1527 C CD    . GLN C 3 80  ? 10.021  76.792 55.398  1.00 78.51  ? 457 GLN L CD    1 
ATOM 1528 O OE1   . GLN C 3 80  ? 10.151  77.478 54.386  1.00 79.29  ? 457 GLN L OE1   1 
ATOM 1529 N NE2   . GLN C 3 80  ? 8.988   75.985 55.589  1.00 80.02  ? 457 GLN L NE2   1 
ATOM 1530 N N     . ILE C 3 81  ? 14.832  74.531 56.405  1.00 72.88  ? 458 ILE L N     1 
ATOM 1531 C CA    . ILE C 3 81  ? 16.010  73.855 55.883  1.00 68.59  ? 458 ILE L CA    1 
ATOM 1532 C C     . ILE C 3 81  ? 15.660  72.731 54.926  1.00 66.09  ? 458 ILE L C     1 
ATOM 1533 O O     . ILE C 3 81  ? 14.616  72.103 55.057  1.00 65.82  ? 458 ILE L O     1 
ATOM 1534 C CB    . ILE C 3 81  ? 16.816  73.242 57.025  1.00 67.56  ? 458 ILE L CB    1 
ATOM 1535 C CG1   . ILE C 3 81  ? 16.815  74.192 58.217  1.00 66.37  ? 458 ILE L CG1   1 
ATOM 1536 C CG2   . ILE C 3 81  ? 18.239  72.972 56.572  1.00 67.42  ? 458 ILE L CG2   1 
ATOM 1537 C CD1   . ILE C 3 81  ? 17.353  73.575 59.464  1.00 67.49  ? 458 ILE L CD1   1 
ATOM 1538 N N     . PHE C 3 82  ? 16.537  72.496 53.956  1.00 63.88  ? 459 PHE L N     1 
ATOM 1539 C CA    . PHE C 3 82  ? 16.371  71.410 52.993  1.00 62.22  ? 459 PHE L CA    1 
ATOM 1540 C C     . PHE C 3 82  ? 17.612  71.237 52.111  1.00 59.60  ? 459 PHE L C     1 
ATOM 1541 O O     . PHE C 3 82  ? 18.442  72.145 52.001  1.00 58.31  ? 459 PHE L O     1 
ATOM 1542 C CB    . PHE C 3 82  ? 15.096  71.583 52.134  1.00 64.53  ? 459 PHE L CB    1 
ATOM 1543 C CG    . PHE C 3 82  ? 15.165  72.683 51.107  1.00 66.77  ? 459 PHE L CG    1 
ATOM 1544 C CD1   . PHE C 3 82  ? 15.089  74.018 51.480  1.00 68.04  ? 459 PHE L CD1   1 
ATOM 1545 C CD2   . PHE C 3 82  ? 15.260  72.376 49.753  1.00 68.12  ? 459 PHE L CD2   1 
ATOM 1546 C CE1   . PHE C 3 82  ? 15.103  75.030 50.519  1.00 68.52  ? 459 PHE L CE1   1 
ATOM 1547 C CE2   . PHE C 3 82  ? 15.276  73.386 48.786  1.00 69.36  ? 459 PHE L CE2   1 
ATOM 1548 C CZ    . PHE C 3 82  ? 15.196  74.712 49.172  1.00 68.47  ? 459 PHE L CZ    1 
ATOM 1549 N N     . ILE C 3 83  ? 17.747  70.054 51.512  1.00 56.91  ? 460 ILE L N     1 
ATOM 1550 C CA    . ILE C 3 83  ? 18.892  69.754 50.654  1.00 53.77  ? 460 ILE L CA    1 
ATOM 1551 C C     . ILE C 3 83  ? 18.644  70.094 49.183  1.00 52.36  ? 460 ILE L C     1 
ATOM 1552 O O     . ILE C 3 83  ? 17.701  69.583 48.552  1.00 50.47  ? 460 ILE L O     1 
ATOM 1553 C CB    . ILE C 3 83  ? 19.287  68.274 50.778  1.00 52.83  ? 460 ILE L CB    1 
ATOM 1554 C CG1   . ILE C 3 83  ? 19.418  67.912 52.253  1.00 51.07  ? 460 ILE L CG1   1 
ATOM 1555 C CG2   . ILE C 3 83  ? 20.639  68.033 50.120  1.00 52.38  ? 460 ILE L CG2   1 
ATOM 1556 C CD1   . ILE C 3 83  ? 20.437  68.754 52.985  1.00 48.29  ? 460 ILE L CD1   1 
ATOM 1557 N N     . GLY C 3 84  ? 19.510  70.961 48.655  1.00 50.47  ? 461 GLY L N     1 
ATOM 1558 C CA    . GLY C 3 84  ? 19.402  71.406 47.278  1.00 50.10  ? 461 GLY L CA    1 
ATOM 1559 C C     . GLY C 3 84  ? 20.452  70.833 46.346  1.00 50.16  ? 461 GLY L C     1 
ATOM 1560 O O     . GLY C 3 84  ? 21.374  70.139 46.777  1.00 48.55  ? 461 GLY L O     1 
ATOM 1561 N N     . THR C 3 85  ? 20.308  71.137 45.060  1.00 50.66  ? 462 THR L N     1 
ATOM 1562 C CA    . THR C 3 85  ? 21.222  70.637 44.049  1.00 52.04  ? 462 THR L CA    1 
ATOM 1563 C C     . THR C 3 85  ? 22.352  71.595 43.736  1.00 54.86  ? 462 THR L C     1 
ATOM 1564 O O     . THR C 3 85  ? 22.122  72.743 43.374  1.00 55.62  ? 462 THR L O     1 
ATOM 1565 C CB    . THR C 3 85  ? 20.497  70.344 42.733  1.00 49.36  ? 462 THR L CB    1 
ATOM 1566 O OG1   . THR C 3 85  ? 19.848  71.530 42.276  1.00 50.20  ? 462 THR L OG1   1 
ATOM 1567 C CG2   . THR C 3 85  ? 19.475  69.263 42.917  1.00 49.56  ? 462 THR L CG2   1 
ATOM 1568 N N     . ALA C 3 86  ? 23.577  71.102 43.859  1.00 58.03  ? 463 ALA L N     1 
ATOM 1569 C CA    . ALA C 3 86  ? 24.756  71.896 43.570  1.00 61.88  ? 463 ALA L CA    1 
ATOM 1570 C C     . ALA C 3 86  ? 25.279  71.514 42.185  1.00 64.98  ? 463 ALA L C     1 
ATOM 1571 O O     . ALA C 3 86  ? 26.384  70.982 42.044  1.00 64.60  ? 463 ALA L O     1 
ATOM 1572 C CB    . ALA C 3 86  ? 25.822  71.649 44.628  1.00 61.93  ? 463 ALA L CB    1 
ATOM 1573 N N     . ASP C 3 87  ? 24.472  71.794 41.165  1.00 68.78  ? 464 ASP L N     1 
ATOM 1574 C CA    . ASP C 3 87  ? 24.827  71.481 39.786  1.00 72.46  ? 464 ASP L CA    1 
ATOM 1575 C C     . ASP C 3 87  ? 24.904  72.730 38.912  1.00 74.52  ? 464 ASP L C     1 
ATOM 1576 O O     . ASP C 3 87  ? 24.684  73.847 39.384  1.00 75.17  ? 464 ASP L O     1 
ATOM 1577 C CB    . ASP C 3 87  ? 23.816  70.490 39.202  1.00 73.39  ? 464 ASP L CB    1 
ATOM 1578 C CG    . ASP C 3 87  ? 22.378  70.927 39.417  1.00 76.42  ? 464 ASP L CG    1 
ATOM 1579 O OD1   . ASP C 3 87  ? 21.463  70.141 39.083  1.00 75.13  ? 464 ASP L OD1   1 
ATOM 1580 O OD2   . ASP C 3 87  ? 22.162  72.056 39.922  1.00 79.49  ? 464 ASP L OD2   1 
ATOM 1581 N N     . GLU C 3 88  ? 25.212  72.527 37.634  1.00 76.84  ? 465 GLU L N     1 
ATOM 1582 C CA    . GLU C 3 88  ? 25.348  73.621 36.680  1.00 78.98  ? 465 GLU L CA    1 
ATOM 1583 C C     . GLU C 3 88  ? 24.033  74.301 36.348  1.00 78.69  ? 465 GLU L C     1 
ATOM 1584 O O     . GLU C 3 88  ? 24.013  75.301 35.635  1.00 78.46  ? 465 GLU L O     1 
ATOM 1585 C CB    . GLU C 3 88  ? 25.982  73.122 35.383  1.00 81.01  ? 465 GLU L CB    1 
ATOM 1586 C CG    . GLU C 3 88  ? 25.047  72.288 34.533  1.00 83.92  ? 465 GLU L CG    1 
ATOM 1587 C CD    . GLU C 3 88  ? 24.706  70.967 35.174  1.00 85.40  ? 465 GLU L CD    1 
ATOM 1588 O OE1   . GLU C 3 88  ? 23.730  70.326 34.729  1.00 86.81  ? 465 GLU L OE1   1 
ATOM 1589 O OE2   . GLU C 3 88  ? 25.423  70.566 36.115  1.00 86.59  ? 465 GLU L OE2   1 
ATOM 1590 N N     . ARG C 3 89  ? 22.933  73.748 36.836  1.00 78.29  ? 466 ARG L N     1 
ATOM 1591 C CA    . ARG C 3 89  ? 21.641  74.352 36.585  1.00 79.32  ? 466 ARG L CA    1 
ATOM 1592 C C     . ARG C 3 89  ? 21.321  75.242 37.775  1.00 78.39  ? 466 ARG L C     1 
ATOM 1593 O O     . ARG C 3 89  ? 22.199  75.528 38.590  1.00 79.22  ? 466 ARG L O     1 
ATOM 1594 C CB    . ARG C 3 89  ? 20.571  73.278 36.421  1.00 82.54  ? 466 ARG L CB    1 
ATOM 1595 C CG    . ARG C 3 89  ? 20.681  72.468 35.138  1.00 87.06  ? 466 ARG L CG    1 
ATOM 1596 C CD    . ARG C 3 89  ? 19.756  71.258 35.183  1.00 91.68  ? 466 ARG L CD    1 
ATOM 1597 N NE    . ARG C 3 89  ? 20.214  70.254 36.143  1.00 95.93  ? 466 ARG L NE    1 
ATOM 1598 C CZ    . ARG C 3 89  ? 19.423  69.375 36.757  1.00 98.30  ? 466 ARG L CZ    1 
ATOM 1599 N NH1   . ARG C 3 89  ? 18.118  69.365 36.521  1.00 100.67 ? 466 ARG L NH1   1 
ATOM 1600 N NH2   . ARG C 3 89  ? 19.937  68.501 37.611  1.00 99.01  ? 466 ARG L NH2   1 
ATOM 1601 N N     . ILE C 3 90  ? 20.073  75.689 37.867  1.00 76.68  ? 467 ILE L N     1 
ATOM 1602 C CA    . ILE C 3 90  ? 19.643  76.544 38.970  1.00 73.43  ? 467 ILE L CA    1 
ATOM 1603 C C     . ILE C 3 90  ? 19.390  75.690 40.209  1.00 70.94  ? 467 ILE L C     1 
ATOM 1604 O O     . ILE C 3 90  ? 19.129  74.489 40.111  1.00 70.00  ? 467 ILE L O     1 
ATOM 1605 C CB    . ILE C 3 90  ? 18.345  77.304 38.621  1.00 73.46  ? 467 ILE L CB    1 
ATOM 1606 C CG1   . ILE C 3 90  ? 17.919  78.197 39.791  1.00 74.72  ? 467 ILE L CG1   1 
ATOM 1607 C CG2   . ILE C 3 90  ? 17.227  76.311 38.330  1.00 73.87  ? 467 ILE L CG2   1 
ATOM 1608 C CD1   . ILE C 3 90  ? 18.920  79.259 40.184  1.00 74.18  ? 467 ILE L CD1   1 
ATOM 1609 N N     . LEU C 3 91  ? 19.473  76.315 41.375  1.00 67.81  ? 468 LEU L N     1 
ATOM 1610 C CA    . LEU C 3 91  ? 19.255  75.599 42.614  1.00 64.50  ? 468 LEU L CA    1 
ATOM 1611 C C     . LEU C 3 91  ? 17.844  75.032 42.617  1.00 62.42  ? 468 LEU L C     1 
ATOM 1612 O O     . LEU C 3 91  ? 16.944  75.569 41.979  1.00 61.89  ? 468 LEU L O     1 
ATOM 1613 C CB    . LEU C 3 91  ? 19.479  76.536 43.797  1.00 64.70  ? 468 LEU L CB    1 
ATOM 1614 C CG    . LEU C 3 91  ? 19.557  75.947 45.207  1.00 65.04  ? 468 LEU L CG    1 
ATOM 1615 C CD1   . LEU C 3 91  ? 18.170  75.595 45.674  1.00 66.88  ? 468 LEU L CD1   1 
ATOM 1616 C CD2   . LEU C 3 91  ? 20.469  74.733 45.232  1.00 65.59  ? 468 LEU L CD2   1 
ATOM 1617 N N     . LYS C 3 92  ? 17.668  73.936 43.342  1.00 60.78  ? 469 LYS L N     1 
ATOM 1618 C CA    . LYS C 3 92  ? 16.391  73.246 43.433  1.00 58.97  ? 469 LYS L CA    1 
ATOM 1619 C C     . LYS C 3 92  ? 16.559  72.059 44.387  1.00 57.98  ? 469 LYS L C     1 
ATOM 1620 O O     . LYS C 3 92  ? 17.674  71.599 44.617  1.00 58.32  ? 469 LYS L O     1 
ATOM 1621 C CB    . LYS C 3 92  ? 16.001  72.763 42.040  1.00 59.24  ? 469 LYS L CB    1 
ATOM 1622 C CG    . LYS C 3 92  ? 15.184  71.502 41.999  1.00 60.02  ? 469 LYS L CG    1 
ATOM 1623 C CD    . LYS C 3 92  ? 15.220  70.879 40.608  1.00 62.42  ? 469 LYS L CD    1 
ATOM 1624 C CE    . LYS C 3 92  ? 16.631  70.456 40.200  1.00 61.27  ? 469 LYS L CE    1 
ATOM 1625 N NZ    . LYS C 3 92  ? 16.628  69.678 38.927  1.00 60.77  ? 469 LYS L NZ    1 
ATOM 1626 N N     . PRO C 3 93  ? 15.460  71.556 44.969  1.00 57.04  ? 470 PRO L N     1 
ATOM 1627 C CA    . PRO C 3 93  ? 15.587  70.417 45.885  1.00 56.15  ? 470 PRO L CA    1 
ATOM 1628 C C     . PRO C 3 93  ? 16.172  69.173 45.207  1.00 55.24  ? 470 PRO L C     1 
ATOM 1629 O O     . PRO C 3 93  ? 15.678  68.714 44.172  1.00 53.89  ? 470 PRO L O     1 
ATOM 1630 C CB    . PRO C 3 93  ? 14.151  70.190 46.353  1.00 56.38  ? 470 PRO L CB    1 
ATOM 1631 C CG    . PRO C 3 93  ? 13.551  71.553 46.284  1.00 55.23  ? 470 PRO L CG    1 
ATOM 1632 C CD    . PRO C 3 93  ? 14.081  72.076 44.976  1.00 57.22  ? 470 PRO L CD    1 
ATOM 1633 N N     . HIS C 3 94  ? 17.233  68.637 45.799  1.00 54.80  ? 471 HIS L N     1 
ATOM 1634 C CA    . HIS C 3 94  ? 17.888  67.440 45.285  1.00 53.49  ? 471 HIS L CA    1 
ATOM 1635 C C     . HIS C 3 94  ? 16.887  66.297 45.469  1.00 52.93  ? 471 HIS L C     1 
ATOM 1636 O O     . HIS C 3 94  ? 16.246  66.191 46.508  1.00 54.88  ? 471 HIS L O     1 
ATOM 1637 C CB    . HIS C 3 94  ? 19.158  67.189 46.088  1.00 52.97  ? 471 HIS L CB    1 
ATOM 1638 C CG    . HIS C 3 94  ? 20.160  66.342 45.381  1.00 53.18  ? 471 HIS L CG    1 
ATOM 1639 N ND1   . HIS C 3 94  ? 19.907  65.037 45.019  1.00 53.71  ? 471 HIS L ND1   1 
ATOM 1640 C CD2   . HIS C 3 94  ? 21.421  66.612 44.971  1.00 53.11  ? 471 HIS L CD2   1 
ATOM 1641 C CE1   . HIS C 3 94  ? 20.972  64.539 44.417  1.00 53.77  ? 471 HIS L CE1   1 
ATOM 1642 N NE2   . HIS C 3 94  ? 21.904  65.475 44.374  1.00 53.52  ? 471 HIS L NE2   1 
ATOM 1643 N N     . ALA C 3 95  ? 16.742  65.434 44.480  1.00 52.22  ? 472 ALA L N     1 
ATOM 1644 C CA    . ALA C 3 95  ? 15.754  64.374 44.602  1.00 52.22  ? 472 ALA L CA    1 
ATOM 1645 C C     . ALA C 3 95  ? 16.204  63.098 45.286  1.00 52.23  ? 472 ALA L C     1 
ATOM 1646 O O     . ALA C 3 95  ? 15.368  62.286 45.688  1.00 52.46  ? 472 ALA L O     1 
ATOM 1647 C CB    . ALA C 3 95  ? 15.199  64.047 43.244  1.00 52.93  ? 472 ALA L CB    1 
ATOM 1648 N N     . PHE C 3 96  ? 17.511  62.925 45.433  1.00 51.45  ? 473 PHE L N     1 
ATOM 1649 C CA    . PHE C 3 96  ? 18.045  61.716 46.044  1.00 51.29  ? 473 PHE L CA    1 
ATOM 1650 C C     . PHE C 3 96  ? 18.518  61.935 47.463  1.00 51.40  ? 473 PHE L C     1 
ATOM 1651 O O     . PHE C 3 96  ? 19.003  61.013 48.112  1.00 50.39  ? 473 PHE L O     1 
ATOM 1652 C CB    . PHE C 3 96  ? 19.207  61.208 45.211  1.00 51.76  ? 473 PHE L CB    1 
ATOM 1653 C CG    . PHE C 3 96  ? 18.896  61.113 43.762  1.00 51.98  ? 473 PHE L CG    1 
ATOM 1654 C CD1   . PHE C 3 96  ? 18.637  59.881 43.175  1.00 52.99  ? 473 PHE L CD1   1 
ATOM 1655 C CD2   . PHE C 3 96  ? 18.807  62.266 42.985  1.00 50.18  ? 473 PHE L CD2   1 
ATOM 1656 C CE1   . PHE C 3 96  ? 18.287  59.801 41.828  1.00 52.63  ? 473 PHE L CE1   1 
ATOM 1657 C CE2   . PHE C 3 96  ? 18.463  62.195 41.657  1.00 48.73  ? 473 PHE L CE2   1 
ATOM 1658 C CZ    . PHE C 3 96  ? 18.201  60.964 41.073  1.00 50.32  ? 473 PHE L CZ    1 
ATOM 1659 N N     . TYR C 3 97  ? 18.362  63.157 47.943  1.00 51.61  ? 474 TYR L N     1 
ATOM 1660 C CA    . TYR C 3 97  ? 18.805  63.501 49.271  1.00 52.69  ? 474 TYR L CA    1 
ATOM 1661 C C     . TYR C 3 97  ? 17.753  64.296 50.022  1.00 55.29  ? 474 TYR L C     1 
ATOM 1662 O O     . TYR C 3 97  ? 17.053  65.120 49.436  1.00 56.32  ? 474 TYR L O     1 
ATOM 1663 C CB    . TYR C 3 97  ? 20.077  64.318 49.162  1.00 52.02  ? 474 TYR L CB    1 
ATOM 1664 C CG    . TYR C 3 97  ? 21.290  63.535 48.732  1.00 49.99  ? 474 TYR L CG    1 
ATOM 1665 C CD1   . TYR C 3 97  ? 21.926  62.672 49.610  1.00 50.95  ? 474 TYR L CD1   1 
ATOM 1666 C CD2   . TYR C 3 97  ? 21.837  63.699 47.470  1.00 48.79  ? 474 TYR L CD2   1 
ATOM 1667 C CE1   . TYR C 3 97  ? 23.082  62.001 49.242  1.00 49.61  ? 474 TYR L CE1   1 
ATOM 1668 C CE2   . TYR C 3 97  ? 22.997  63.028 47.096  1.00 47.44  ? 474 TYR L CE2   1 
ATOM 1669 C CZ    . TYR C 3 97  ? 23.612  62.185 47.988  1.00 46.28  ? 474 TYR L CZ    1 
ATOM 1670 O OH    . TYR C 3 97  ? 24.767  61.530 47.647  1.00 44.46  ? 474 TYR L OH    1 
ATOM 1671 N N     . GLN C 3 98  ? 17.672  64.064 51.330  1.00 57.37  ? 475 GLN L N     1 
ATOM 1672 C CA    . GLN C 3 98  ? 16.702  64.734 52.193  1.00 59.24  ? 475 GLN L CA    1 
ATOM 1673 C C     . GLN C 3 98  ? 17.365  65.156 53.490  1.00 60.05  ? 475 GLN L C     1 
ATOM 1674 O O     . GLN C 3 98  ? 18.329  64.530 53.924  1.00 61.16  ? 475 GLN L O     1 
ATOM 1675 C CB    . GLN C 3 98  ? 15.561  63.772 52.535  1.00 60.79  ? 475 GLN L CB    1 
ATOM 1676 C CG    . GLN C 3 98  ? 14.834  63.206 51.336  1.00 62.83  ? 475 GLN L CG    1 
ATOM 1677 C CD    . GLN C 3 98  ? 13.871  64.204 50.728  1.00 64.62  ? 475 GLN L CD    1 
ATOM 1678 O OE1   . GLN C 3 98  ? 14.225  65.356 50.474  1.00 65.88  ? 475 GLN L OE1   1 
ATOM 1679 N NE2   . GLN C 3 98  ? 12.644  63.765 50.487  1.00 65.85  ? 475 GLN L NE2   1 
ATOM 1680 N N     . VAL C 3 99  ? 16.860  66.212 54.117  1.00 61.41  ? 476 VAL L N     1 
ATOM 1681 C CA    . VAL C 3 99  ? 17.430  66.628 55.394  1.00 62.86  ? 476 VAL L CA    1 
ATOM 1682 C C     . VAL C 3 99  ? 17.041  65.521 56.342  1.00 65.09  ? 476 VAL L C     1 
ATOM 1683 O O     . VAL C 3 99  ? 16.110  64.761 56.060  1.00 65.96  ? 476 VAL L O     1 
ATOM 1684 C CB    . VAL C 3 99  ? 16.794  67.906 55.945  1.00 61.25  ? 476 VAL L CB    1 
ATOM 1685 C CG1   . VAL C 3 99  ? 17.131  69.070 55.072  1.00 62.89  ? 476 VAL L CG1   1 
ATOM 1686 C CG2   . VAL C 3 99  ? 15.295  67.732 56.032  1.00 59.84  ? 476 VAL L CG2   1 
ATOM 1687 N N     . HIS C 3 100 ? 17.734  65.426 57.468  1.00 66.90  ? 477 HIS L N     1 
ATOM 1688 C CA    . HIS C 3 100 ? 17.398  64.404 58.439  1.00 68.97  ? 477 HIS L CA    1 
ATOM 1689 C C     . HIS C 3 100 ? 17.300  65.061 59.802  1.00 71.99  ? 477 HIS L C     1 
ATOM 1690 O O     . HIS C 3 100 ? 18.252  65.714 60.249  1.00 71.28  ? 477 HIS L O     1 
ATOM 1691 C CB    . HIS C 3 100 ? 18.454  63.301 58.449  1.00 67.14  ? 477 HIS L CB    1 
ATOM 1692 C CG    . HIS C 3 100 ? 18.014  62.064 59.164  1.00 66.78  ? 477 HIS L CG    1 
ATOM 1693 N ND1   . HIS C 3 100 ? 18.348  61.801 60.474  1.00 67.08  ? 477 HIS L ND1   1 
ATOM 1694 C CD2   . HIS C 3 100 ? 17.222  61.042 58.765  1.00 66.69  ? 477 HIS L CD2   1 
ATOM 1695 C CE1   . HIS C 3 100 ? 17.782  60.669 60.853  1.00 67.80  ? 477 HIS L CE1   1 
ATOM 1696 N NE2   . HIS C 3 100 ? 17.092  60.188 59.834  1.00 67.27  ? 477 HIS L NE2   1 
ATOM 1697 N N     . ARG C 3 101 ? 16.142  64.903 60.449  1.00 75.70  ? 478 ARG L N     1 
ATOM 1698 C CA    . ARG C 3 101 ? 15.924  65.489 61.766  1.00 79.74  ? 478 ARG L CA    1 
ATOM 1699 C C     . ARG C 3 101 ? 16.648  64.752 62.878  1.00 81.54  ? 478 ARG L C     1 
ATOM 1700 O O     . ARG C 3 101 ? 16.401  63.573 63.123  1.00 81.37  ? 478 ARG L O     1 
ATOM 1701 C CB    . ARG C 3 101 ? 14.439  65.545 62.112  1.00 81.62  ? 478 ARG L CB    1 
ATOM 1702 C CG    . ARG C 3 101 ? 14.212  66.220 63.456  1.00 85.59  ? 478 ARG L CG    1 
ATOM 1703 C CD    . ARG C 3 101 ? 12.763  66.553 63.720  1.00 89.24  ? 478 ARG L CD    1 
ATOM 1704 N NE    . ARG C 3 101 ? 12.641  67.448 64.870  1.00 93.88  ? 478 ARG L NE    1 
ATOM 1705 C CZ    . ARG C 3 101 ? 12.893  67.100 66.130  1.00 96.18  ? 478 ARG L CZ    1 
ATOM 1706 N NH1   . ARG C 3 101 ? 13.281  65.863 66.416  1.00 97.64  ? 478 ARG L NH1   1 
ATOM 1707 N NH2   . ARG C 3 101 ? 12.767  67.993 67.106  1.00 96.69  ? 478 ARG L NH2   1 
ATOM 1708 N N     . ILE C 3 102 ? 17.534  65.470 63.556  1.00 84.37  ? 479 ILE L N     1 
ATOM 1709 C CA    . ILE C 3 102 ? 18.298  64.914 64.660  1.00 87.93  ? 479 ILE L CA    1 
ATOM 1710 C C     . ILE C 3 102 ? 17.738  65.402 66.003  1.00 92.07  ? 479 ILE L C     1 
ATOM 1711 O O     . ILE C 3 102 ? 17.533  66.601 66.207  1.00 92.38  ? 479 ILE L O     1 
ATOM 1712 C CB    . ILE C 3 102 ? 19.773  65.297 64.524  1.00 85.61  ? 479 ILE L CB    1 
ATOM 1713 C CG1   . ILE C 3 102 ? 20.358  64.573 63.316  1.00 84.26  ? 479 ILE L CG1   1 
ATOM 1714 C CG2   . ILE C 3 102 ? 20.526  64.966 65.796  1.00 85.54  ? 479 ILE L CG2   1 
ATOM 1715 C CD1   . ILE C 3 102 ? 21.827  64.771 63.143  1.00 83.41  ? 479 ILE L CD1   1 
ATOM 1716 N N     . THR C 3 103 ? 17.502  64.464 66.916  1.00 96.74  ? 480 THR L N     1 
ATOM 1717 C CA    . THR C 3 103 ? 16.931  64.779 68.223  1.00 100.90 ? 480 THR L CA    1 
ATOM 1718 C C     . THR C 3 103 ? 17.756  64.365 69.455  1.00 103.46 ? 480 THR L C     1 
ATOM 1719 O O     . THR C 3 103 ? 18.562  63.430 69.394  1.00 104.13 ? 480 THR L O     1 
ATOM 1720 C CB    . THR C 3 103 ? 15.544  64.126 68.351  1.00 101.10 ? 480 THR L CB    1 
ATOM 1721 O OG1   . THR C 3 103 ? 15.019  64.376 69.658  1.00 102.67 ? 480 THR L OG1   1 
ATOM 1722 C CG2   . THR C 3 103 ? 15.641  62.616 68.125  1.00 101.11 ? 480 THR L CG2   1 
ATOM 1723 N N     . GLY C 3 104 ? 17.549  65.082 70.566  1.00 105.76 ? 481 GLY L N     1 
ATOM 1724 C CA    . GLY C 3 104 ? 18.219  64.761 71.823  1.00 107.70 ? 481 GLY L CA    1 
ATOM 1725 C C     . GLY C 3 104 ? 19.349  65.598 72.415  1.00 108.84 ? 481 GLY L C     1 
ATOM 1726 O O     . GLY C 3 104 ? 19.546  66.767 72.085  1.00 108.54 ? 481 GLY L O     1 
ATOM 1727 N N     . LYS C 3 105 ? 20.072  64.949 73.327  1.00 110.12 ? 482 LYS L N     1 
ATOM 1728 C CA    . LYS C 3 105 ? 21.226  65.483 74.050  1.00 110.97 ? 482 LYS L CA    1 
ATOM 1729 C C     . LYS C 3 105 ? 21.855  66.753 73.484  1.00 110.86 ? 482 LYS L C     1 
ATOM 1730 O O     . LYS C 3 105 ? 21.210  67.795 73.406  1.00 110.82 ? 482 LYS L O     1 
ATOM 1731 C CB    . LYS C 3 105 ? 22.301  64.388 74.157  1.00 111.72 ? 482 LYS L CB    1 
ATOM 1732 C CG    . LYS C 3 105 ? 22.896  63.928 72.813  1.00 111.95 ? 482 LYS L CG    1 
ATOM 1733 C CD    . LYS C 3 105 ? 21.838  63.375 71.857  1.00 112.43 ? 482 LYS L CD    1 
ATOM 1734 C CE    . LYS C 3 105 ? 22.370  63.231 70.434  1.00 112.37 ? 482 LYS L CE    1 
ATOM 1735 N NZ    . LYS C 3 105 ? 21.312  62.831 69.458  1.00 111.03 ? 482 LYS L NZ    1 
ATOM 1736 N N     . THR C 3 106 ? 23.127  66.654 73.106  1.00 110.99 ? 483 THR L N     1 
ATOM 1737 C CA    . THR C 3 106 ? 23.883  67.776 72.556  1.00 110.96 ? 483 THR L CA    1 
ATOM 1738 C C     . THR C 3 106 ? 23.171  68.511 71.425  1.00 110.33 ? 483 THR L C     1 
ATOM 1739 O O     . THR C 3 106 ? 23.650  69.541 70.946  1.00 109.79 ? 483 THR L O     1 
ATOM 1740 C CB    . THR C 3 106 ? 25.274  67.321 72.048  1.00 111.16 ? 483 THR L CB    1 
ATOM 1741 O OG1   . THR C 3 106 ? 25.121  66.193 71.179  1.00 111.13 ? 483 THR L OG1   1 
ATOM 1742 C CG2   . THR C 3 106 ? 26.177  66.946 73.216  1.00 110.94 ? 483 THR L CG2   1 
ATOM 1743 N N     . VAL C 3 107 ? 22.034  67.983 70.989  1.00 109.68 ? 484 VAL L N     1 
ATOM 1744 C CA    . VAL C 3 107 ? 21.278  68.640 69.932  1.00 109.17 ? 484 VAL L CA    1 
ATOM 1745 C C     . VAL C 3 107 ? 20.680  69.892 70.573  1.00 107.27 ? 484 VAL L C     1 
ATOM 1746 O O     . VAL C 3 107 ? 19.607  69.835 71.182  1.00 107.42 ? 484 VAL L O     1 
ATOM 1747 C CB    . VAL C 3 107 ? 20.138  67.734 69.403  1.00 110.50 ? 484 VAL L CB    1 
ATOM 1748 C CG1   . VAL C 3 107 ? 19.554  68.325 68.123  1.00 111.72 ? 484 VAL L CG1   1 
ATOM 1749 C CG2   . VAL C 3 107 ? 20.660  66.320 69.162  1.00 111.67 ? 484 VAL L CG2   1 
ATOM 1750 N N     . THR C 3 108 ? 21.382  71.017 70.451  1.00 104.40 ? 485 THR L N     1 
ATOM 1751 C CA    . THR C 3 108 ? 20.920  72.270 71.043  1.00 101.56 ? 485 THR L CA    1 
ATOM 1752 C C     . THR C 3 108 ? 19.618  72.780 70.421  1.00 99.44  ? 485 THR L C     1 
ATOM 1753 O O     . THR C 3 108 ? 18.532  72.505 70.930  1.00 99.33  ? 485 THR L O     1 
ATOM 1754 C CB    . THR C 3 108 ? 22.006  73.377 70.943  1.00 101.70 ? 485 THR L CB    1 
ATOM 1755 O OG1   . THR C 3 108 ? 22.217  73.734 69.573  1.00 103.34 ? 485 THR L OG1   1 
ATOM 1756 C CG2   . THR C 3 108 ? 23.323  72.885 71.530  1.00 101.52 ? 485 THR L CG2   1 
ATOM 1757 N N     . THR C 3 109 ? 19.730  73.514 69.320  1.00 96.85  ? 486 THR L N     1 
ATOM 1758 C CA    . THR C 3 109 ? 18.570  74.076 68.635  1.00 93.97  ? 486 THR L CA    1 
ATOM 1759 C C     . THR C 3 109 ? 17.459  73.046 68.400  1.00 93.06  ? 486 THR L C     1 
ATOM 1760 O O     . THR C 3 109 ? 17.726  71.902 68.045  1.00 92.18  ? 486 THR L O     1 
ATOM 1761 C CB    . THR C 3 109 ? 18.993  74.696 67.284  1.00 92.85  ? 486 THR L CB    1 
ATOM 1762 O OG1   . THR C 3 109 ? 19.581  73.685 66.463  1.00 92.87  ? 486 THR L OG1   1 
ATOM 1763 C CG2   . THR C 3 109 ? 20.026  75.806 67.494  1.00 90.95  ? 486 THR L CG2   1 
ATOM 1764 N N     . THR C 3 110 ? 16.212  73.459 68.614  1.00 93.04  ? 487 THR L N     1 
ATOM 1765 C CA    . THR C 3 110 ? 15.063  72.573 68.422  1.00 94.11  ? 487 THR L CA    1 
ATOM 1766 C C     . THR C 3 110 ? 14.710  72.467 66.941  1.00 96.52  ? 487 THR L C     1 
ATOM 1767 O O     . THR C 3 110 ? 15.161  73.281 66.133  1.00 95.67  ? 487 THR L O     1 
ATOM 1768 C CB    . THR C 3 110 ? 13.824  73.066 69.239  1.00 93.11  ? 487 THR L CB    1 
ATOM 1769 O OG1   . THR C 3 110 ? 12.627  72.440 68.749  1.00 89.75  ? 487 THR L OG1   1 
ATOM 1770 C CG2   . THR C 3 110 ? 13.698  74.579 69.161  1.00 91.44  ? 487 THR L CG2   1 
ATOM 1771 N N     . SER C 3 111 ? 13.898  71.471 66.587  1.00 99.88  ? 488 SER L N     1 
ATOM 1772 C CA    . SER C 3 111 ? 13.541  71.263 65.188  1.00 103.71 ? 488 SER L CA    1 
ATOM 1773 C C     . SER C 3 111 ? 12.165  70.653 64.915  1.00 107.09 ? 488 SER L C     1 
ATOM 1774 O O     . SER C 3 111 ? 11.670  69.839 65.689  1.00 106.91 ? 488 SER L O     1 
ATOM 1775 C CB    . SER C 3 111 ? 14.612  70.385 64.529  1.00 103.86 ? 488 SER L CB    1 
ATOM 1776 O OG    . SER C 3 111 ? 14.823  69.182 65.260  1.00 101.68 ? 488 SER L OG    1 
ATOM 1777 N N     . TYR C 3 112 ? 11.568  71.053 63.794  1.00 112.31 ? 489 TYR L N     1 
ATOM 1778 C CA    . TYR C 3 112 ? 10.262  70.552 63.360  1.00 117.48 ? 489 TYR L CA    1 
ATOM 1779 C C     . TYR C 3 112 ? 10.390  70.018 61.932  1.00 113.33 ? 489 TYR L C     1 
ATOM 1780 O O     . TYR C 3 112 ? 10.941  70.684 61.057  1.00 113.45 ? 489 TYR L O     1 
ATOM 1781 C CB    . TYR C 3 112 ? 9.209   71.664 63.390  1.00 131.26 ? 489 TYR L CB    1 
ATOM 1782 C CG    . TYR C 3 112 ? 8.929   72.222 64.769  1.00 147.04 ? 489 TYR L CG    1 
ATOM 1783 C CD1   . TYR C 3 112 ? 9.868   73.023 65.427  1.00 153.79 ? 489 TYR L CD1   1 
ATOM 1784 C CD2   . TYR C 3 112 ? 7.728   71.938 65.425  1.00 153.80 ? 489 TYR L CD2   1 
ATOM 1785 C CE1   . TYR C 3 112 ? 9.617   73.528 66.707  1.00 160.31 ? 489 TYR L CE1   1 
ATOM 1786 C CE2   . TYR C 3 112 ? 7.468   72.437 66.704  1.00 160.44 ? 489 TYR L CE2   1 
ATOM 1787 C CZ    . TYR C 3 112 ? 8.416   73.229 67.337  1.00 162.12 ? 489 TYR L CZ    1 
ATOM 1788 O OH    . TYR C 3 112 ? 8.164   73.716 68.597  1.00 166.74 ? 489 TYR L OH    1 
ATOM 1789 N N     . GLU C 3 113 ? 9.868   68.821 61.697  1.00 107.64 ? 490 GLU L N     1 
ATOM 1790 C CA    . GLU C 3 113 ? 9.945   68.196 60.380  1.00 101.46 ? 490 GLU L CA    1 
ATOM 1791 C C     . GLU C 3 113 ? 8.617   68.276 59.631  1.00 96.31  ? 490 GLU L C     1 
ATOM 1792 O O     . GLU C 3 113 ? 7.559   68.350 60.246  1.00 95.82  ? 490 GLU L O     1 
ATOM 1793 C CB    . GLU C 3 113 ? 10.374  66.737 60.551  1.00 102.29 ? 490 GLU L CB    1 
ATOM 1794 C CG    . GLU C 3 113 ? 10.516  65.943 59.274  1.00 103.44 ? 490 GLU L CG    1 
ATOM 1795 C CD    . GLU C 3 113 ? 11.138  64.581 59.522  1.00 104.51 ? 490 GLU L CD    1 
ATOM 1796 O OE1   . GLU C 3 113 ? 12.297  64.536 59.992  1.00 105.28 ? 490 GLU L OE1   1 
ATOM 1797 O OE2   . GLU C 3 113 ? 10.472  63.557 59.253  1.00 104.92 ? 490 GLU L OE2   1 
ATOM 1798 N N     . LYS C 3 114 ? 8.678   68.277 58.303  1.00 90.78  ? 491 LYS L N     1 
ATOM 1799 C CA    . LYS C 3 114 ? 7.472   68.333 57.476  1.00 85.40  ? 491 LYS L CA    1 
ATOM 1800 C C     . LYS C 3 114 ? 7.785   68.121 56.004  1.00 82.70  ? 491 LYS L C     1 
ATOM 1801 O O     . LYS C 3 114 ? 8.795   68.600 55.501  1.00 81.75  ? 491 LYS L O     1 
ATOM 1802 C CB    . LYS C 3 114 ? 6.753   69.669 57.648  1.00 83.85  ? 491 LYS L CB    1 
ATOM 1803 C CG    . LYS C 3 114 ? 7.532   70.884 57.185  1.00 80.46  ? 491 LYS L CG    1 
ATOM 1804 C CD    . LYS C 3 114 ? 6.687   72.135 57.359  1.00 78.44  ? 491 LYS L CD    1 
ATOM 1805 C CE    . LYS C 3 114 ? 7.462   73.398 57.025  1.00 77.38  ? 491 LYS L CE    1 
ATOM 1806 N NZ    . LYS C 3 114 ? 6.638   74.616 57.272  1.00 76.17  ? 491 LYS L NZ    1 
ATOM 1807 N N     . ILE C 3 115 ? 6.903   67.405 55.318  1.00 80.53  ? 492 ILE L N     1 
ATOM 1808 C CA    . ILE C 3 115 ? 7.084   67.104 53.902  1.00 78.61  ? 492 ILE L CA    1 
ATOM 1809 C C     . ILE C 3 115 ? 6.437   68.142 53.001  1.00 77.09  ? 492 ILE L C     1 
ATOM 1810 O O     . ILE C 3 115 ? 5.434   68.748 53.358  1.00 78.42  ? 492 ILE L O     1 
ATOM 1811 C CB    . ILE C 3 115 ? 6.494   65.724 53.557  1.00 78.95  ? 492 ILE L CB    1 
ATOM 1812 C CG1   . ILE C 3 115 ? 7.179   64.651 54.406  1.00 79.94  ? 492 ILE L CG1   1 
ATOM 1813 C CG2   . ILE C 3 115 ? 6.669   65.429 52.075  1.00 76.98  ? 492 ILE L CG2   1 
ATOM 1814 C CD1   . ILE C 3 115 ? 6.507   63.298 54.335  1.00 81.90  ? 492 ILE L CD1   1 
ATOM 1815 N N     . VAL C 3 116 ? 7.027   68.341 51.832  1.00 74.59  ? 493 VAL L N     1 
ATOM 1816 C CA    . VAL C 3 116 ? 6.526   69.292 50.851  1.00 71.89  ? 493 VAL L CA    1 
ATOM 1817 C C     . VAL C 3 116 ? 6.845   68.646 49.512  1.00 71.46  ? 493 VAL L C     1 
ATOM 1818 O O     . VAL C 3 116 ? 8.008   68.487 49.159  1.00 71.88  ? 493 VAL L O     1 
ATOM 1819 C CB    . VAL C 3 116 ? 7.261   70.643 50.953  1.00 70.60  ? 493 VAL L CB    1 
ATOM 1820 C CG1   . VAL C 3 116 ? 6.556   71.670 50.111  1.00 69.62  ? 493 VAL L CG1   1 
ATOM 1821 C CG2   . VAL C 3 116 ? 7.336   71.095 52.398  1.00 68.45  ? 493 VAL L CG2   1 
ATOM 1822 N N     . GLY C 3 117 ? 5.825   68.264 48.762  1.00 71.19  ? 494 GLY L N     1 
ATOM 1823 C CA    . GLY C 3 117 ? 6.099   67.606 47.504  1.00 71.77  ? 494 GLY L CA    1 
ATOM 1824 C C     . GLY C 3 117 ? 6.782   66.325 47.923  1.00 72.45  ? 494 GLY L C     1 
ATOM 1825 O O     . GLY C 3 117 ? 6.213   65.560 48.690  1.00 74.03  ? 494 GLY L O     1 
ATOM 1826 N N     . ASN C 3 118 ? 7.999   66.085 47.454  1.00 72.92  ? 495 ASN L N     1 
ATOM 1827 C CA    . ASN C 3 118 ? 8.714   64.873 47.841  1.00 73.06  ? 495 ASN L CA    1 
ATOM 1828 C C     . ASN C 3 118 ? 9.942   65.293 48.610  1.00 72.88  ? 495 ASN L C     1 
ATOM 1829 O O     . ASN C 3 118 ? 10.867  64.508 48.806  1.00 73.43  ? 495 ASN L O     1 
ATOM 1830 C CB    . ASN C 3 118 ? 9.150   64.086 46.614  1.00 74.43  ? 495 ASN L CB    1 
ATOM 1831 C CG    . ASN C 3 118 ? 8.046   63.933 45.610  1.00 75.87  ? 495 ASN L CG    1 
ATOM 1832 O OD1   . ASN C 3 118 ? 7.539   64.925 45.079  1.00 76.95  ? 495 ASN L OD1   1 
ATOM 1833 N ND2   . ASN C 3 118 ? 7.658   62.688 45.338  1.00 76.15  ? 495 ASN L ND2   1 
ATOM 1834 N N     . THR C 3 119 ? 9.939   66.546 49.040  1.00 71.87  ? 496 THR L N     1 
ATOM 1835 C CA    . THR C 3 119 ? 11.052  67.111 49.771  1.00 71.73  ? 496 THR L CA    1 
ATOM 1836 C C     . THR C 3 119 ? 10.754  67.268 51.247  1.00 72.84  ? 496 THR L C     1 
ATOM 1837 O O     . THR C 3 119 ? 9.841   67.986 51.634  1.00 73.73  ? 496 THR L O     1 
ATOM 1838 C CB    . THR C 3 119 ? 11.422  68.475 49.188  1.00 70.64  ? 496 THR L CB    1 
ATOM 1839 O OG1   . THR C 3 119 ? 12.085  68.283 47.935  1.00 71.24  ? 496 THR L OG1   1 
ATOM 1840 C CG2   . THR C 3 119 ? 12.322  69.240 50.128  1.00 70.60  ? 496 THR L CG2   1 
ATOM 1841 N N     . LYS C 3 120 ? 11.532  66.590 52.075  1.00 73.96  ? 497 LYS L N     1 
ATOM 1842 C CA    . LYS C 3 120 ? 11.343  66.686 53.506  1.00 75.74  ? 497 LYS L CA    1 
ATOM 1843 C C     . LYS C 3 120 ? 11.985  67.995 53.955  1.00 74.84  ? 497 LYS L C     1 
ATOM 1844 O O     . LYS C 3 120 ? 13.172  68.208 53.735  1.00 74.25  ? 497 LYS L O     1 
ATOM 1845 C CB    . LYS C 3 120 ? 12.005  65.489 54.196  1.00 79.71  ? 497 LYS L CB    1 
ATOM 1846 C CG    . LYS C 3 120 ? 11.741  65.403 55.695  1.00 84.63  ? 497 LYS L CG    1 
ATOM 1847 C CD    . LYS C 3 120 ? 12.363  64.162 56.316  1.00 87.74  ? 497 LYS L CD    1 
ATOM 1848 C CE    . LYS C 3 120 ? 11.712  62.892 55.799  1.00 90.06  ? 497 LYS L CE    1 
ATOM 1849 N NZ    . LYS C 3 120 ? 12.324  61.693 56.425  1.00 91.21  ? 497 LYS L NZ    1 
ATOM 1850 N N     . VAL C 3 121 ? 11.195  68.876 54.565  1.00 75.22  ? 498 VAL L N     1 
ATOM 1851 C CA    . VAL C 3 121 ? 11.701  70.162 55.042  1.00 76.14  ? 498 VAL L CA    1 
ATOM 1852 C C     . VAL C 3 121 ? 11.750  70.234 56.559  1.00 78.78  ? 498 VAL L C     1 
ATOM 1853 O O     . VAL C 3 121 ? 10.785  69.904 57.245  1.00 78.63  ? 498 VAL L O     1 
ATOM 1854 C CB    . VAL C 3 121 ? 10.838  71.342 54.563  1.00 74.84  ? 498 VAL L CB    1 
ATOM 1855 C CG1   . VAL C 3 121 ? 11.460  72.654 55.021  1.00 73.05  ? 498 VAL L CG1   1 
ATOM 1856 C CG2   . VAL C 3 121 ? 10.709  71.316 53.055  1.00 75.17  ? 498 VAL L CG2   1 
ATOM 1857 N N     . LEU C 3 122 ? 12.887  70.685 57.071  1.00 82.36  ? 499 LEU L N     1 
ATOM 1858 C CA    . LEU C 3 122 ? 13.099  70.817 58.503  1.00 86.11  ? 499 LEU L CA    1 
ATOM 1859 C C     . LEU C 3 122 ? 12.838  72.266 58.861  1.00 89.72  ? 499 LEU L C     1 
ATOM 1860 O O     . LEU C 3 122 ? 13.168  73.164 58.085  1.00 90.13  ? 499 LEU L O     1 
ATOM 1861 C CB    . LEU C 3 122 ? 14.546  70.464 58.851  1.00 85.04  ? 499 LEU L CB    1 
ATOM 1862 C CG    . LEU C 3 122 ? 14.851  70.032 60.285  1.00 83.87  ? 499 LEU L CG    1 
ATOM 1863 C CD1   . LEU C 3 122 ? 14.162  68.702 60.552  1.00 83.26  ? 499 LEU L CD1   1 
ATOM 1864 C CD2   . LEU C 3 122 ? 16.352  69.901 60.482  1.00 82.15  ? 499 LEU L CD2   1 
ATOM 1865 N N     . GLU C 3 123 ? 12.253  72.495 60.033  1.00 94.31  ? 500 GLU L N     1 
ATOM 1866 C CA    . GLU C 3 123 ? 11.956  73.851 60.476  1.00 98.72  ? 500 GLU L CA    1 
ATOM 1867 C C     . GLU C 3 123 ? 12.407  74.139 61.904  1.00 99.71  ? 500 GLU L C     1 
ATOM 1868 O O     . GLU C 3 123 ? 11.856  73.606 62.868  1.00 99.06  ? 500 GLU L O     1 
ATOM 1869 C CB    . GLU C 3 123 ? 10.460  74.128 60.348  1.00 101.53 ? 500 GLU L CB    1 
ATOM 1870 C CG    . GLU C 3 123 ? 10.088  75.572 60.601  1.00 106.27 ? 500 GLU L CG    1 
ATOM 1871 C CD    . GLU C 3 123 ? 8.664   75.871 60.194  1.00 108.98 ? 500 GLU L CD    1 
ATOM 1872 O OE1   . GLU C 3 123 ? 8.347   75.714 58.995  1.00 110.09 ? 500 GLU L OE1   1 
ATOM 1873 O OE2   . GLU C 3 123 ? 7.862   76.260 61.070  1.00 110.99 ? 500 GLU L OE2   1 
ATOM 1874 N N     . ILE C 3 124 ? 13.419  74.988 62.028  1.00 101.79 ? 501 ILE L N     1 
ATOM 1875 C CA    . ILE C 3 124 ? 13.943  75.363 63.331  1.00 104.78 ? 501 ILE L CA    1 
ATOM 1876 C C     . ILE C 3 124 ? 13.463  76.774 63.646  1.00 107.80 ? 501 ILE L C     1 
ATOM 1877 O O     . ILE C 3 124 ? 13.040  77.504 62.747  1.00 107.93 ? 501 ILE L O     1 
ATOM 1878 C CB    . ILE C 3 124 ? 15.484  75.372 63.349  1.00 104.00 ? 501 ILE L CB    1 
ATOM 1879 C CG1   . ILE C 3 124 ? 16.008  76.486 62.437  1.00 103.24 ? 501 ILE L CG1   1 
ATOM 1880 C CG2   . ILE C 3 124 ? 16.012  74.015 62.924  1.00 103.72 ? 501 ILE L CG2   1 
ATOM 1881 C CD1   . ILE C 3 124 ? 17.465  76.823 62.659  1.00 102.94 ? 501 ILE L CD1   1 
ATOM 1882 N N     . PRO C 3 125 ? 13.519  77.173 64.929  1.00 110.42 ? 502 PRO L N     1 
ATOM 1883 C CA    . PRO C 3 125 ? 13.093  78.503 65.368  1.00 112.49 ? 502 PRO L CA    1 
ATOM 1884 C C     . PRO C 3 125 ? 14.193  79.567 65.345  1.00 115.01 ? 502 PRO L C     1 
ATOM 1885 O O     . PRO C 3 125 ? 15.337  79.310 65.728  1.00 114.62 ? 502 PRO L O     1 
ATOM 1886 C CB    . PRO C 3 125 ? 12.593  78.239 66.776  1.00 111.70 ? 502 PRO L CB    1 
ATOM 1887 C CG    . PRO C 3 125 ? 13.579  77.243 67.257  1.00 111.33 ? 502 PRO L CG    1 
ATOM 1888 C CD    . PRO C 3 125 ? 13.664  76.278 66.091  1.00 110.76 ? 502 PRO L CD    1 
ATOM 1889 N N     . LEU C 3 126 ? 13.823  80.760 64.884  1.00 118.42 ? 503 LEU L N     1 
ATOM 1890 C CA    . LEU C 3 126 ? 14.725  81.908 64.819  1.00 121.63 ? 503 LEU L CA    1 
ATOM 1891 C C     . LEU C 3 126 ? 14.195  82.940 65.800  1.00 123.51 ? 503 LEU L C     1 
ATOM 1892 O O     . LEU C 3 126 ? 13.282  83.704 65.479  1.00 123.78 ? 503 LEU L O     1 
ATOM 1893 C CB    . LEU C 3 126 ? 14.741  82.518 63.416  1.00 122.25 ? 503 LEU L CB    1 
ATOM 1894 C CG    . LEU C 3 126 ? 15.924  82.159 62.521  1.00 123.34 ? 503 LEU L CG    1 
ATOM 1895 C CD1   . LEU C 3 126 ? 15.852  82.976 61.240  1.00 123.77 ? 503 LEU L CD1   1 
ATOM 1896 C CD2   . LEU C 3 126 ? 17.224  82.440 63.258  1.00 123.68 ? 503 LEU L CD2   1 
ATOM 1897 N N     . GLU C 3 127 ? 14.769  82.962 66.996  1.00 125.32 ? 504 GLU L N     1 
ATOM 1898 C CA    . GLU C 3 127 ? 14.316  83.891 68.015  1.00 126.82 ? 504 GLU L CA    1 
ATOM 1899 C C     . GLU C 3 127 ? 15.204  85.105 68.241  1.00 127.21 ? 504 GLU L C     1 
ATOM 1900 O O     . GLU C 3 127 ? 16.431  85.037 68.104  1.00 126.67 ? 504 GLU L O     1 
ATOM 1901 C CB    . GLU C 3 127 ? 14.107  83.146 69.327  1.00 127.31 ? 504 GLU L CB    1 
ATOM 1902 C CG    . GLU C 3 127 ? 12.959  82.176 69.261  1.00 128.91 ? 504 GLU L CG    1 
ATOM 1903 C CD    . GLU C 3 127 ? 12.757  81.449 70.560  1.00 130.65 ? 504 GLU L CD    1 
ATOM 1904 O OE1   . GLU C 3 127 ? 13.668  80.696 70.961  1.00 132.19 ? 504 GLU L OE1   1 
ATOM 1905 O OE2   . GLU C 3 127 ? 11.691  81.634 71.182  1.00 131.54 ? 504 GLU L OE2   1 
ATOM 1906 N N     . PRO C 3 128 ? 14.574  86.246 68.580  1.00 127.36 ? 505 PRO L N     1 
ATOM 1907 C CA    . PRO C 3 128 ? 15.219  87.534 68.848  1.00 126.37 ? 505 PRO L CA    1 
ATOM 1908 C C     . PRO C 3 128 ? 16.204  87.460 70.012  1.00 124.86 ? 505 PRO L C     1 
ATOM 1909 O O     . PRO C 3 128 ? 17.299  88.025 69.948  1.00 124.55 ? 505 PRO L O     1 
ATOM 1910 C CB    . PRO C 3 128 ? 14.036  88.452 69.149  1.00 126.97 ? 505 PRO L CB    1 
ATOM 1911 C CG    . PRO C 3 128 ? 12.955  87.882 68.284  1.00 127.77 ? 505 PRO L CG    1 
ATOM 1912 C CD    . PRO C 3 128 ? 13.107  86.405 68.547  1.00 127.69 ? 505 PRO L CD    1 
ATOM 1913 N N     . LYS C 3 129 ? 15.812  86.761 71.073  1.00 122.81 ? 506 LYS L N     1 
ATOM 1914 C CA    . LYS C 3 129 ? 16.674  86.627 72.237  1.00 121.24 ? 506 LYS L CA    1 
ATOM 1915 C C     . LYS C 3 129 ? 18.075  86.160 71.835  1.00 123.05 ? 506 LYS L C     1 
ATOM 1916 O O     . LYS C 3 129 ? 19.043  86.398 72.556  1.00 122.99 ? 506 LYS L O     1 
ATOM 1917 C CB    . LYS C 3 129 ? 16.055  85.657 73.250  1.00 116.40 ? 506 LYS L CB    1 
ATOM 1918 C CG    . LYS C 3 129 ? 15.770  84.267 72.714  1.00 109.66 ? 506 LYS L CG    1 
ATOM 1919 C CD    . LYS C 3 129 ? 15.160  83.372 73.790  1.00 103.93 ? 506 LYS L CD    1 
ATOM 1920 C CE    . LYS C 3 129 ? 14.973  81.944 73.282  1.00 100.58 ? 506 LYS L CE    1 
ATOM 1921 N NZ    . LYS C 3 129 ? 14.379  81.014 74.290  1.00 97.35  ? 506 LYS L NZ    1 
ATOM 1922 N N     . ASN C 3 130 ? 18.178  85.508 70.677  1.00 125.67 ? 507 ASN L N     1 
ATOM 1923 C CA    . ASN C 3 130 ? 19.464  85.016 70.181  1.00 127.60 ? 507 ASN L CA    1 
ATOM 1924 C C     . ASN C 3 130 ? 19.968  85.778 68.955  1.00 128.14 ? 507 ASN L C     1 
ATOM 1925 O O     . ASN C 3 130 ? 20.975  85.394 68.361  1.00 128.57 ? 507 ASN L O     1 
ATOM 1926 C CB    . ASN C 3 130 ? 19.380  83.522 69.839  1.00 128.68 ? 507 ASN L CB    1 
ATOM 1927 C CG    . ASN C 3 130 ? 19.197  82.643 71.069  1.00 129.73 ? 507 ASN L CG    1 
ATOM 1928 O OD1   . ASN C 3 130 ? 18.142  82.652 71.707  1.00 130.15 ? 507 ASN L OD1   1 
ATOM 1929 N ND2   . ASN C 3 130 ? 20.230  81.877 71.406  1.00 129.95 ? 507 ASN L ND2   1 
ATOM 1930 N N     . ASN C 3 131 ? 19.264  86.847 68.583  1.00 128.50 ? 508 ASN L N     1 
ATOM 1931 C CA    . ASN C 3 131 ? 19.635  87.683 67.437  1.00 128.35 ? 508 ASN L CA    1 
ATOM 1932 C C     . ASN C 3 131 ? 19.270  87.070 66.090  1.00 126.82 ? 508 ASN L C     1 
ATOM 1933 O O     . ASN C 3 131 ? 20.032  87.194 65.126  1.00 127.02 ? 508 ASN L O     1 
ATOM 1934 C CB    . ASN C 3 131 ? 21.141  87.971 67.447  1.00 130.98 ? 508 ASN L CB    1 
ATOM 1935 C CG    . ASN C 3 131 ? 21.589  88.708 68.687  1.00 133.67 ? 508 ASN L CG    1 
ATOM 1936 O OD1   . ASN C 3 131 ? 22.787  88.856 68.930  1.00 135.01 ? 508 ASN L OD1   1 
ATOM 1937 N ND2   . ASN C 3 131 ? 20.630  89.181 69.481  1.00 135.16 ? 508 ASN L ND2   1 
ATOM 1938 N N     . MET C 3 132 ? 18.112  86.419 66.012  1.00 124.20 ? 509 MET L N     1 
ATOM 1939 C CA    . MET C 3 132 ? 17.688  85.792 64.762  1.00 121.45 ? 509 MET L CA    1 
ATOM 1940 C C     . MET C 3 132 ? 18.833  84.960 64.189  1.00 119.60 ? 509 MET L C     1 
ATOM 1941 O O     . MET C 3 132 ? 19.013  84.867 62.971  1.00 119.13 ? 509 MET L O     1 
ATOM 1942 C CB    . MET C 3 132 ? 17.259  86.863 63.758  1.00 120.83 ? 509 MET L CB    1 
ATOM 1943 C CG    . MET C 3 132 ? 16.089  87.673 64.251  1.00 120.69 ? 509 MET L CG    1 
ATOM 1944 S SD    . MET C 3 132 ? 14.897  86.586 65.066  1.00 120.54 ? 509 MET L SD    1 
ATOM 1945 C CE    . MET C 3 132 ? 14.159  85.818 63.665  1.00 121.18 ? 509 MET L CE    1 
ATOM 1946 N N     . ARG C 3 133 ? 19.597  84.355 65.097  1.00 117.20 ? 510 ARG L N     1 
ATOM 1947 C CA    . ARG C 3 133 ? 20.752  83.527 64.766  1.00 114.06 ? 510 ARG L CA    1 
ATOM 1948 C C     . ARG C 3 133 ? 20.502  82.110 65.271  1.00 113.32 ? 510 ARG L C     1 
ATOM 1949 O O     . ARG C 3 133 ? 19.802  81.911 66.264  1.00 111.85 ? 510 ARG L O     1 
ATOM 1950 C CB    . ARG C 3 133 ? 21.999  84.103 65.441  1.00 112.08 ? 510 ARG L CB    1 
ATOM 1951 C CG    . ARG C 3 133 ? 23.317  83.447 65.077  1.00 108.39 ? 510 ARG L CG    1 
ATOM 1952 C CD    . ARG C 3 133 ? 24.374  83.838 66.101  1.00 106.09 ? 510 ARG L CD    1 
ATOM 1953 N NE    . ARG C 3 133 ? 25.740  83.612 65.640  1.00 103.46 ? 510 ARG L NE    1 
ATOM 1954 C CZ    . ARG C 3 133 ? 26.297  84.254 64.617  1.00 102.12 ? 510 ARG L CZ    1 
ATOM 1955 N NH1   . ARG C 3 133 ? 25.603  85.162 63.943  1.00 101.05 ? 510 ARG L NH1   1 
ATOM 1956 N NH2   . ARG C 3 133 ? 27.555  84.000 64.279  1.00 100.90 ? 510 ARG L NH2   1 
ATOM 1957 N N     . ALA C 3 134 ? 21.078  81.129 64.584  1.00 113.47 ? 511 ALA L N     1 
ATOM 1958 C CA    . ALA C 3 134 ? 20.904  79.735 64.969  1.00 113.45 ? 511 ALA L CA    1 
ATOM 1959 C C     . ALA C 3 134 ? 22.080  78.849 64.564  1.00 113.14 ? 511 ALA L C     1 
ATOM 1960 O O     . ALA C 3 134 ? 22.801  79.130 63.601  1.00 112.13 ? 511 ALA L O     1 
ATOM 1961 C CB    . ALA C 3 134 ? 19.607  79.187 64.373  1.00 113.23 ? 511 ALA L CB    1 
ATOM 1962 N N     . THR C 3 135 ? 22.269  77.779 65.328  1.00 113.11 ? 512 THR L N     1 
ATOM 1963 C CA    . THR C 3 135 ? 23.329  76.826 65.069  1.00 112.65 ? 512 THR L CA    1 
ATOM 1964 C C     . THR C 3 135 ? 22.673  75.554 64.592  1.00 111.55 ? 512 THR L C     1 
ATOM 1965 O O     . THR C 3 135 ? 21.802  74.999 65.265  1.00 111.43 ? 512 THR L O     1 
ATOM 1966 C CB    . THR C 3 135 ? 24.159  76.538 66.333  1.00 113.46 ? 512 THR L CB    1 
ATOM 1967 O OG1   . THR C 3 135 ? 25.249  77.466 66.401  1.00 114.28 ? 512 THR L OG1   1 
ATOM 1968 C CG2   . THR C 3 135 ? 24.703  75.120 66.313  1.00 114.22 ? 512 THR L CG2   1 
ATOM 1969 N N     . ILE C 3 136 ? 23.100  75.111 63.417  1.00 110.23 ? 513 ILE L N     1 
ATOM 1970 C CA    . ILE C 3 136 ? 22.571  73.911 62.790  1.00 108.13 ? 513 ILE L CA    1 
ATOM 1971 C C     . ILE C 3 136 ? 23.166  72.660 63.421  1.00 104.63 ? 513 ILE L C     1 
ATOM 1972 O O     . ILE C 3 136 ? 24.354  72.378 63.245  1.00 104.69 ? 513 ILE L O     1 
ATOM 1973 C CB    . ILE C 3 136 ? 22.903  73.904 61.281  1.00 110.12 ? 513 ILE L CB    1 
ATOM 1974 C CG1   . ILE C 3 136 ? 22.451  75.217 60.635  1.00 111.17 ? 513 ILE L CG1   1 
ATOM 1975 C CG2   . ILE C 3 136 ? 22.224  72.726 60.607  1.00 111.58 ? 513 ILE L CG2   1 
ATOM 1976 C CD1   . ILE C 3 136 ? 20.955  75.455 60.703  1.00 112.81 ? 513 ILE L CD1   1 
ATOM 1977 N N     . ASP C 3 137 ? 22.353  71.909 64.158  1.00 99.74  ? 514 ASP L N     1 
ATOM 1978 C CA    . ASP C 3 137 ? 22.862  70.692 64.773  1.00 95.70  ? 514 ASP L CA    1 
ATOM 1979 C C     . ASP C 3 137 ? 21.794  69.637 64.987  1.00 92.49  ? 514 ASP L C     1 
ATOM 1980 O O     . ASP C 3 137 ? 21.960  68.716 65.786  1.00 92.69  ? 514 ASP L O     1 
ATOM 1981 C CB    . ASP C 3 137 ? 23.599  71.004 66.091  1.00 96.80  ? 514 ASP L CB    1 
ATOM 1982 C CG    . ASP C 3 137 ? 22.674  71.461 67.219  1.00 96.41  ? 514 ASP L CG    1 
ATOM 1983 O OD1   . ASP C 3 137 ? 23.209  71.917 68.253  1.00 95.75  ? 514 ASP L OD1   1 
ATOM 1984 O OD2   . ASP C 3 137 ? 21.435  71.360 67.092  1.00 96.41  ? 514 ASP L OD2   1 
ATOM 1985 N N     . CYS C 3 138 ? 20.692  69.774 64.261  1.00 88.14  ? 515 CYS L N     1 
ATOM 1986 C CA    . CYS C 3 138 ? 19.604  68.805 64.340  1.00 84.41  ? 515 CYS L CA    1 
ATOM 1987 C C     . CYS C 3 138 ? 19.285  68.387 62.906  1.00 80.99  ? 515 CYS L C     1 
ATOM 1988 O O     . CYS C 3 138 ? 18.259  67.753 62.634  1.00 79.45  ? 515 CYS L O     1 
ATOM 1989 C CB    . CYS C 3 138 ? 18.372  69.439 64.996  1.00 85.13  ? 515 CYS L CB    1 
ATOM 1990 S SG    . CYS C 3 138 ? 17.834  70.985 64.226  1.00 84.57  ? 515 CYS L SG    1 
ATOM 1991 N N     . ALA C 3 139 ? 20.202  68.743 62.005  1.00 77.37  ? 516 ALA L N     1 
ATOM 1992 C CA    . ALA C 3 139 ? 20.067  68.476 60.579  1.00 73.75  ? 516 ALA L CA    1 
ATOM 1993 C C     . ALA C 3 139 ? 21.093  67.516 59.978  1.00 71.09  ? 516 ALA L C     1 
ATOM 1994 O O     . ALA C 3 139 ? 22.300  67.785 59.979  1.00 70.32  ? 516 ALA L O     1 
ATOM 1995 C CB    . ALA C 3 139 ? 20.103  69.794 59.822  1.00 73.03  ? 516 ALA L CB    1 
ATOM 1996 N N     . GLY C 3 140 ? 20.589  66.408 59.443  1.00 67.56  ? 517 GLY L N     1 
ATOM 1997 C CA    . GLY C 3 140 ? 21.447  65.420 58.817  1.00 65.19  ? 517 GLY L CA    1 
ATOM 1998 C C     . GLY C 3 140 ? 21.046  65.241 57.361  1.00 63.66  ? 517 GLY L C     1 
ATOM 1999 O O     . GLY C 3 140 ? 20.038  65.812 56.919  1.00 64.99  ? 517 GLY L O     1 
ATOM 2000 N N     . ILE C 3 141 ? 21.812  64.446 56.611  1.00 59.51  ? 518 ILE L N     1 
ATOM 2001 C CA    . ILE C 3 141 ? 21.521  64.221 55.196  1.00 52.89  ? 518 ILE L CA    1 
ATOM 2002 C C     . ILE C 3 141 ? 21.285  62.758 54.837  1.00 50.33  ? 518 ILE L C     1 
ATOM 2003 O O     . ILE C 3 141 ? 22.230  61.974 54.724  1.00 49.15  ? 518 ILE L O     1 
ATOM 2004 C CB    . ILE C 3 141 ? 22.664  64.723 54.321  1.00 51.90  ? 518 ILE L CB    1 
ATOM 2005 C CG1   . ILE C 3 141 ? 23.112  66.104 54.786  1.00 50.27  ? 518 ILE L CG1   1 
ATOM 2006 C CG2   . ILE C 3 141 ? 22.208  64.785 52.881  1.00 52.19  ? 518 ILE L CG2   1 
ATOM 2007 C CD1   . ILE C 3 141 ? 24.294  66.639 54.023  1.00 48.23  ? 518 ILE L CD1   1 
ATOM 2008 N N     . LEU C 3 142 ? 20.023  62.397 54.646  1.00 47.60  ? 519 LEU L N     1 
ATOM 2009 C CA    . LEU C 3 142 ? 19.677  61.034 54.285  1.00 46.77  ? 519 LEU L CA    1 
ATOM 2010 C C     . LEU C 3 142 ? 19.769  60.826 52.772  1.00 47.83  ? 519 LEU L C     1 
ATOM 2011 O O     . LEU C 3 142 ? 19.293  61.647 51.988  1.00 48.56  ? 519 LEU L O     1 
ATOM 2012 C CB    . LEU C 3 142 ? 18.269  60.709 54.769  1.00 45.03  ? 519 LEU L CB    1 
ATOM 2013 C CG    . LEU C 3 142 ? 17.661  59.417 54.227  1.00 44.59  ? 519 LEU L CG    1 
ATOM 2014 C CD1   . LEU C 3 142 ? 16.695  58.835 55.224  1.00 46.16  ? 519 LEU L CD1   1 
ATOM 2015 C CD2   . LEU C 3 142 ? 16.958  59.700 52.931  1.00 45.32  ? 519 LEU L CD2   1 
ATOM 2016 N N     . LYS C 3 143 ? 20.393  59.727 52.366  1.00 47.38  ? 520 LYS L N     1 
ATOM 2017 C CA    . LYS C 3 143 ? 20.534  59.410 50.952  1.00 46.34  ? 520 LYS L CA    1 
ATOM 2018 C C     . LYS C 3 143 ? 19.448  58.430 50.513  1.00 47.46  ? 520 LYS L C     1 
ATOM 2019 O O     . LYS C 3 143 ? 19.382  57.296 50.992  1.00 46.47  ? 520 LYS L O     1 
ATOM 2020 C CB    . LYS C 3 143 ? 21.913  58.807 50.677  1.00 44.22  ? 520 LYS L CB    1 
ATOM 2021 C CG    . LYS C 3 143 ? 22.057  58.124 49.324  1.00 40.81  ? 520 LYS L CG    1 
ATOM 2022 C CD    . LYS C 3 143 ? 21.897  59.117 48.188  1.00 39.49  ? 520 LYS L CD    1 
ATOM 2023 C CE    . LYS C 3 143 ? 22.345  58.537 46.857  1.00 39.30  ? 520 LYS L CE    1 
ATOM 2024 N NZ    . LYS C 3 143 ? 21.517  57.391 46.387  1.00 38.92  ? 520 LYS L NZ    1 
ATOM 2025 N N     . LEU C 3 144 ? 18.587  58.885 49.612  1.00 48.31  ? 521 LEU L N     1 
ATOM 2026 C CA    . LEU C 3 144 ? 17.523  58.048 49.110  1.00 50.04  ? 521 LEU L CA    1 
ATOM 2027 C C     . LEU C 3 144 ? 18.156  57.122 48.093  1.00 52.21  ? 521 LEU L C     1 
ATOM 2028 O O     . LEU C 3 144 ? 19.241  57.398 47.599  1.00 52.93  ? 521 LEU L O     1 
ATOM 2029 C CB    . LEU C 3 144 ? 16.454  58.914 48.472  1.00 50.25  ? 521 LEU L CB    1 
ATOM 2030 C CG    . LEU C 3 144 ? 15.764  59.835 49.478  1.00 50.92  ? 521 LEU L CG    1 
ATOM 2031 C CD1   . LEU C 3 144 ? 14.957  60.918 48.779  1.00 51.86  ? 521 LEU L CD1   1 
ATOM 2032 C CD2   . LEU C 3 144 ? 14.876  58.997 50.347  1.00 51.24  ? 521 LEU L CD2   1 
ATOM 2033 N N     . ARG C 3 145 ? 17.482  56.025 47.777  1.00 54.68  ? 522 ARG L N     1 
ATOM 2034 C CA    . ARG C 3 145 ? 18.027  55.063 46.839  1.00 56.52  ? 522 ARG L CA    1 
ATOM 2035 C C     . ARG C 3 145 ? 17.709  55.317 45.378  1.00 57.01  ? 522 ARG L C     1 
ATOM 2036 O O     . ARG C 3 145 ? 16.544  55.423 44.986  1.00 54.90  ? 522 ARG L O     1 
ATOM 2037 C CB    . ARG C 3 145 ? 17.579  53.660 47.228  1.00 59.83  ? 522 ARG L CB    1 
ATOM 2038 C CG    . ARG C 3 145 ? 18.120  53.231 48.575  1.00 63.99  ? 522 ARG L CG    1 
ATOM 2039 C CD    . ARG C 3 145 ? 17.861  51.767 48.847  1.00 67.19  ? 522 ARG L CD    1 
ATOM 2040 N NE    . ARG C 3 145 ? 16.444  51.454 48.750  1.00 71.66  ? 522 ARG L NE    1 
ATOM 2041 C CZ    . ARG C 3 145 ? 15.927  50.287 49.106  1.00 73.70  ? 522 ARG L CZ    1 
ATOM 2042 N NH1   . ARG C 3 145 ? 16.726  49.343 49.577  1.00 76.02  ? 522 ARG L NH1   1 
ATOM 2043 N NH2   . ARG C 3 145 ? 14.623  50.069 48.999  1.00 74.66  ? 522 ARG L NH2   1 
ATOM 2044 N N     . ASN C 3 146 ? 18.778  55.396 44.582  1.00 58.93  ? 523 ASN L N     1 
ATOM 2045 C CA    . ASN C 3 146 ? 18.697  55.629 43.146  1.00 59.49  ? 523 ASN L CA    1 
ATOM 2046 C C     . ASN C 3 146 ? 17.651  54.715 42.554  1.00 61.27  ? 523 ASN L C     1 
ATOM 2047 O O     . ASN C 3 146 ? 16.922  55.102 41.654  1.00 62.17  ? 523 ASN L O     1 
ATOM 2048 C CB    . ASN C 3 146 ? 20.043  55.353 42.470  1.00 57.19  ? 523 ASN L CB    1 
ATOM 2049 C CG    . ASN C 3 146 ? 21.139  56.290 42.936  1.00 57.20  ? 523 ASN L CG    1 
ATOM 2050 O OD1   . ASN C 3 146 ? 20.872  57.411 43.358  1.00 57.95  ? 523 ASN L OD1   1 
ATOM 2051 N ND2   . ASN C 3 146 ? 22.386  55.838 42.846  1.00 57.02  ? 523 ASN L ND2   1 
ATOM 2052 N N     . ALA C 3 147 ? 17.576  53.496 43.069  1.00 63.86  ? 524 ALA L N     1 
ATOM 2053 C CA    . ALA C 3 147 ? 16.606  52.525 42.582  1.00 66.29  ? 524 ALA L CA    1 
ATOM 2054 C C     . ALA C 3 147 ? 15.187  52.991 42.844  1.00 68.15  ? 524 ALA L C     1 
ATOM 2055 O O     . ALA C 3 147 ? 14.319  52.847 41.991  1.00 68.95  ? 524 ALA L O     1 
ATOM 2056 C CB    . ALA C 3 147 ? 16.830  51.180 43.251  1.00 66.78  ? 524 ALA L CB    1 
ATOM 2057 N N     . ASP C 3 148 ? 14.955  53.556 44.024  1.00 70.20  ? 525 ASP L N     1 
ATOM 2058 C CA    . ASP C 3 148 ? 13.628  54.021 44.383  1.00 72.20  ? 525 ASP L CA    1 
ATOM 2059 C C     . ASP C 3 148 ? 13.205  55.260 43.607  1.00 74.10  ? 525 ASP L C     1 
ATOM 2060 O O     . ASP C 3 148 ? 12.179  55.248 42.928  1.00 74.58  ? 525 ASP L O     1 
ATOM 2061 C CB    . ASP C 3 148 ? 13.551  54.309 45.884  1.00 72.29  ? 525 ASP L CB    1 
ATOM 2062 C CG    . ASP C 3 148 ? 13.854  53.089 46.732  1.00 72.13  ? 525 ASP L CG    1 
ATOM 2063 O OD1   . ASP C 3 148 ? 13.485  51.973 46.313  1.00 72.94  ? 525 ASP L OD1   1 
ATOM 2064 O OD2   . ASP C 3 148 ? 14.445  53.246 47.823  1.00 70.94  ? 525 ASP L OD2   1 
ATOM 2065 N N     . ILE C 3 149 ? 14.002  56.321 43.704  1.00 76.08  ? 526 ILE L N     1 
ATOM 2066 C CA    . ILE C 3 149 ? 13.706  57.589 43.035  1.00 78.83  ? 526 ILE L CA    1 
ATOM 2067 C C     . ILE C 3 149 ? 13.458  57.506 41.530  1.00 83.35  ? 526 ILE L C     1 
ATOM 2068 O O     . ILE C 3 149 ? 12.419  57.950 41.048  1.00 83.65  ? 526 ILE L O     1 
ATOM 2069 C CB    . ILE C 3 149 ? 14.832  58.629 43.278  1.00 76.21  ? 526 ILE L CB    1 
ATOM 2070 C CG1   . ILE C 3 149 ? 14.666  59.279 44.648  1.00 74.98  ? 526 ILE L CG1   1 
ATOM 2071 C CG2   . ILE C 3 149 ? 14.781  59.715 42.226  1.00 75.21  ? 526 ILE L CG2   1 
ATOM 2072 C CD1   . ILE C 3 149 ? 14.748  58.322 45.793  1.00 74.59  ? 526 ILE L CD1   1 
ATOM 2073 N N     . GLU C 3 150 ? 14.415  56.959 40.788  1.00 89.21  ? 527 GLU L N     1 
ATOM 2074 C CA    . GLU C 3 150 ? 14.295  56.849 39.335  1.00 94.86  ? 527 GLU L CA    1 
ATOM 2075 C C     . GLU C 3 150 ? 12.997  56.162 38.887  1.00 99.02  ? 527 GLU L C     1 
ATOM 2076 O O     . GLU C 3 150 ? 12.461  56.470 37.817  1.00 98.76  ? 527 GLU L O     1 
ATOM 2077 C CB    . GLU C 3 150 ? 15.526  56.120 38.768  1.00 95.37  ? 527 GLU L CB    1 
ATOM 2078 C CG    . GLU C 3 150 ? 16.856  56.880 38.969  1.00 96.32  ? 527 GLU L CG    1 
ATOM 2079 C CD    . GLU C 3 150 ? 18.086  56.108 38.476  1.00 96.44  ? 527 GLU L CD    1 
ATOM 2080 O OE1   . GLU C 3 150 ? 19.213  56.646 38.578  1.00 95.94  ? 527 GLU L OE1   1 
ATOM 2081 O OE2   . GLU C 3 150 ? 17.929  54.966 37.990  1.00 96.27  ? 527 GLU L OE2   1 
ATOM 2082 N N     . LEU C 3 151 ? 12.492  55.245 39.712  1.00 103.98 ? 528 LEU L N     1 
ATOM 2083 C CA    . LEU C 3 151 ? 11.251  54.525 39.419  1.00 109.60 ? 528 LEU L CA    1 
ATOM 2084 C C     . LEU C 3 151 ? 10.021  55.440 39.450  1.00 113.73 ? 528 LEU L C     1 
ATOM 2085 O O     . LEU C 3 151 ? 8.981   55.119 38.871  1.00 114.27 ? 528 LEU L O     1 
ATOM 2086 C CB    . LEU C 3 151 ? 11.069  53.379 40.424  1.00 109.86 ? 528 LEU L CB    1 
ATOM 2087 C CG    . LEU C 3 151 ? 9.675   53.073 40.990  1.00 110.04 ? 528 LEU L CG    1 
ATOM 2088 C CD1   . LEU C 3 151 ? 9.645   51.646 41.512  1.00 109.70 ? 528 LEU L CD1   1 
ATOM 2089 C CD2   . LEU C 3 151 ? 9.323   54.065 42.095  1.00 108.79 ? 528 LEU L CD2   1 
ATOM 2090 N N     . ARG C 3 152 ? 10.153  56.573 40.135  1.00 118.41 ? 529 ARG L N     1 
ATOM 2091 C CA    . ARG C 3 152 ? 9.077   57.551 40.271  1.00 122.22 ? 529 ARG L CA    1 
ATOM 2092 C C     . ARG C 3 152 ? 8.684   58.162 38.936  1.00 123.58 ? 529 ARG L C     1 
ATOM 2093 O O     . ARG C 3 152 ? 9.519   58.731 38.226  1.00 123.01 ? 529 ARG L O     1 
ATOM 2094 C CB    . ARG C 3 152 ? 9.507   58.667 41.227  1.00 124.51 ? 529 ARG L CB    1 
ATOM 2095 C CG    . ARG C 3 152 ? 8.526   59.822 41.362  1.00 127.24 ? 529 ARG L CG    1 
ATOM 2096 C CD    . ARG C 3 152 ? 9.226   61.040 41.958  1.00 129.48 ? 529 ARG L CD    1 
ATOM 2097 N NE    . ARG C 3 152 ? 9.769   60.784 43.292  1.00 131.44 ? 529 ARG L NE    1 
ATOM 2098 C CZ    . ARG C 3 152 ? 10.705  61.530 43.875  1.00 132.34 ? 529 ARG L CZ    1 
ATOM 2099 N NH1   . ARG C 3 152 ? 11.210  62.580 43.241  1.00 132.70 ? 529 ARG L NH1   1 
ATOM 2100 N NH2   . ARG C 3 152 ? 11.137  61.231 45.093  1.00 132.67 ? 529 ARG L NH2   1 
ATOM 2101 N N     . LYS C 3 153 ? 7.403   58.039 38.607  1.00 125.40 ? 530 LYS L N     1 
ATOM 2102 C CA    . LYS C 3 153 ? 6.872   58.581 37.366  1.00 126.35 ? 530 LYS L CA    1 
ATOM 2103 C C     . LYS C 3 153 ? 6.991   60.096 37.402  1.00 126.64 ? 530 LYS L C     1 
ATOM 2104 O O     . LYS C 3 153 ? 6.087   60.794 37.861  1.00 127.18 ? 530 LYS L O     1 
ATOM 2105 C CB    . LYS C 3 153 ? 5.401   58.190 37.191  1.00 126.42 ? 530 LYS L CB    1 
ATOM 2106 C CG    . LYS C 3 153 ? 5.141   56.695 37.027  1.00 125.23 ? 530 LYS L CG    1 
ATOM 2107 C CD    . LYS C 3 153 ? 3.651   56.433 36.867  1.00 123.77 ? 530 LYS L CD    1 
ATOM 2108 C CE    . LYS C 3 153 ? 3.339   54.957 36.722  1.00 122.60 ? 530 LYS L CE    1 
ATOM 2109 N NZ    . LYS C 3 153 ? 1.869   54.741 36.590  1.00 121.19 ? 530 LYS L NZ    1 
ATOM 2110 N N     . GLY C 3 154 ? 8.116   60.605 36.923  1.00 126.31 ? 531 GLY L N     1 
ATOM 2111 C CA    . GLY C 3 154 ? 8.307   62.038 36.920  1.00 125.74 ? 531 GLY L CA    1 
ATOM 2112 C C     . GLY C 3 154 ? 9.766   62.423 36.832  1.00 124.87 ? 531 GLY L C     1 
ATOM 2113 O O     . GLY C 3 154 ? 10.244  62.835 35.769  1.00 125.63 ? 531 GLY L O     1 
ATOM 2114 N N     . GLU C 3 155 ? 10.478  62.286 37.947  1.00 122.74 ? 532 GLU L N     1 
ATOM 2115 C CA    . GLU C 3 155 ? 11.891  62.638 37.987  1.00 119.55 ? 532 GLU L CA    1 
ATOM 2116 C C     . GLU C 3 155 ? 12.636  62.072 36.790  1.00 116.83 ? 532 GLU L C     1 
ATOM 2117 O O     . GLU C 3 155 ? 12.694  60.860 36.592  1.00 116.88 ? 532 GLU L O     1 
ATOM 2118 C CB    . GLU C 3 155 ? 12.533  62.151 39.291  1.00 119.46 ? 532 GLU L CB    1 
ATOM 2119 C CG    . GLU C 3 155 ? 12.938  63.287 40.223  1.00 118.05 ? 532 GLU L CG    1 
ATOM 2120 C CD    . GLU C 3 155 ? 14.043  64.154 39.641  1.00 116.84 ? 532 GLU L CD    1 
ATOM 2121 O OE1   . GLU C 3 155 ? 14.335  65.225 40.217  1.00 115.25 ? 532 GLU L OE1   1 
ATOM 2122 O OE2   . GLU C 3 155 ? 14.624  63.757 38.610  1.00 115.27 ? 532 GLU L OE2   1 
ATOM 2123 N N     . THR C 3 156 ? 13.188  62.973 35.986  1.00 113.05 ? 533 THR L N     1 
ATOM 2124 C CA    . THR C 3 156 ? 13.935  62.598 34.798  1.00 108.52 ? 533 THR L CA    1 
ATOM 2125 C C     . THR C 3 156 ? 15.442  62.631 35.086  1.00 105.07 ? 533 THR L C     1 
ATOM 2126 O O     . THR C 3 156 ? 16.254  62.246 34.237  1.00 104.91 ? 533 THR L O     1 
ATOM 2127 C CB    . THR C 3 156 ? 13.593  63.548 33.614  1.00 108.55 ? 533 THR L CB    1 
ATOM 2128 O OG1   . THR C 3 156 ? 13.846  64.907 33.991  1.00 107.78 ? 533 THR L OG1   1 
ATOM 2129 C CG2   . THR C 3 156 ? 12.124  63.414 33.231  1.00 108.44 ? 533 THR L CG2   1 
ATOM 2130 N N     . ASP C 3 157 ? 15.807  63.077 36.291  1.00 100.05 ? 534 ASP L N     1 
ATOM 2131 C CA    . ASP C 3 157 ? 17.212  63.162 36.685  1.00 94.46  ? 534 ASP L CA    1 
ATOM 2132 C C     . ASP C 3 157 ? 17.832  61.794 36.933  1.00 91.75  ? 534 ASP L C     1 
ATOM 2133 O O     . ASP C 3 157 ? 17.138  60.783 37.041  1.00 90.38  ? 534 ASP L O     1 
ATOM 2134 C CB    . ASP C 3 157 ? 17.387  64.033 37.935  1.00 92.47  ? 534 ASP L CB    1 
ATOM 2135 C CG    . ASP C 3 157 ? 17.043  65.498 37.689  1.00 91.74  ? 534 ASP L CG    1 
ATOM 2136 O OD1   . ASP C 3 157 ? 15.840  65.824 37.625  1.00 91.27  ? 534 ASP L OD1   1 
ATOM 2137 O OD2   . ASP C 3 157 ? 17.975  66.325 37.553  1.00 89.87  ? 534 ASP L OD2   1 
ATOM 2138 N N     . ILE C 3 158 ? 19.153  61.774 37.032  1.00 89.43  ? 535 ILE L N     1 
ATOM 2139 C CA    . ILE C 3 158 ? 19.878  60.532 37.239  1.00 87.58  ? 535 ILE L CA    1 
ATOM 2140 C C     . ILE C 3 158 ? 20.646  60.573 38.554  1.00 87.19  ? 535 ILE L C     1 
ATOM 2141 O O     . ILE C 3 158 ? 21.029  61.643 39.034  1.00 86.37  ? 535 ILE L O     1 
ATOM 2142 C CB    . ILE C 3 158 ? 20.866  60.292 36.080  1.00 86.80  ? 535 ILE L CB    1 
ATOM 2143 C CG1   . ILE C 3 158 ? 20.239  60.778 34.769  1.00 85.72  ? 535 ILE L CG1   1 
ATOM 2144 C CG2   . ILE C 3 158 ? 21.193  58.809 35.969  1.00 84.90  ? 535 ILE L CG2   1 
ATOM 2145 C CD1   . ILE C 3 158 ? 21.205  60.868 33.618  1.00 85.26  ? 535 ILE L CD1   1 
ATOM 2146 N N     . GLY C 3 159 ? 20.862  59.399 39.135  1.00 87.25  ? 536 GLY L N     1 
ATOM 2147 C CA    . GLY C 3 159 ? 21.580  59.324 40.388  1.00 87.89  ? 536 GLY L CA    1 
ATOM 2148 C C     . GLY C 3 159 ? 23.036  59.015 40.150  1.00 88.88  ? 536 GLY L C     1 
ATOM 2149 O O     . GLY C 3 159 ? 23.901  59.532 40.851  1.00 89.20  ? 536 GLY L O     1 
ATOM 2150 N N     . ARG C 3 160 ? 23.294  58.180 39.146  1.00 90.25  ? 537 ARG L N     1 
ATOM 2151 C CA    . ARG C 3 160 ? 24.641  57.749 38.766  1.00 91.09  ? 537 ARG L CA    1 
ATOM 2152 C C     . ARG C 3 160 ? 25.820  58.410 39.464  1.00 89.61  ? 537 ARG L C     1 
ATOM 2153 O O     . ARG C 3 160 ? 26.565  57.737 40.171  1.00 90.73  ? 537 ARG L O     1 
ATOM 2154 C CB    . ARG C 3 160 ? 24.846  57.889 37.260  1.00 94.83  ? 537 ARG L CB    1 
ATOM 2155 C CG    . ARG C 3 160 ? 26.187  57.339 36.796  1.00 98.95  ? 537 ARG L CG    1 
ATOM 2156 C CD    . ARG C 3 160 ? 26.375  55.912 37.289  1.00 101.94 ? 537 ARG L CD    1 
ATOM 2157 N NE    . ARG C 3 160 ? 27.669  55.357 36.911  1.00 104.33 ? 537 ARG L NE    1 
ATOM 2158 C CZ    . ARG C 3 160 ? 28.088  54.147 37.266  1.00 106.18 ? 537 ARG L CZ    1 
ATOM 2159 N NH1   . ARG C 3 160 ? 27.315  53.362 38.007  1.00 105.93 ? 537 ARG L NH1   1 
ATOM 2160 N NH2   . ARG C 3 160 ? 29.279  53.717 36.876  1.00 106.69 ? 537 ARG L NH2   1 
ATOM 2161 N N     . LYS C 3 161 ? 26.014  59.711 39.253  1.00 86.74  ? 538 LYS L N     1 
ATOM 2162 C CA    . LYS C 3 161 ? 27.131  60.416 39.888  1.00 83.33  ? 538 LYS L CA    1 
ATOM 2163 C C     . LYS C 3 161 ? 26.717  61.708 40.597  1.00 79.44  ? 538 LYS L C     1 
ATOM 2164 O O     . LYS C 3 161 ? 27.569  62.466 41.054  1.00 79.08  ? 538 LYS L O     1 
ATOM 2165 C CB    . LYS C 3 161 ? 28.213  60.746 38.853  1.00 85.64  ? 538 LYS L CB    1 
ATOM 2166 C CG    . LYS C 3 161 ? 28.928  59.552 38.235  1.00 87.77  ? 538 LYS L CG    1 
ATOM 2167 C CD    . LYS C 3 161 ? 29.807  58.836 39.242  1.00 90.58  ? 538 LYS L CD    1 
ATOM 2168 C CE    . LYS C 3 161 ? 31.182  58.558 38.658  1.00 92.40  ? 538 LYS L CE    1 
ATOM 2169 N NZ    . LYS C 3 161 ? 31.106  57.905 37.321  1.00 94.49  ? 538 LYS L NZ    1 
ATOM 2170 N N     . ASN C 3 162 ? 25.416  61.954 40.693  1.00 74.51  ? 539 ASN L N     1 
ATOM 2171 C CA    . ASN C 3 162 ? 24.915  63.157 41.342  1.00 69.86  ? 539 ASN L CA    1 
ATOM 2172 C C     . ASN C 3 162 ? 25.024  63.021 42.855  1.00 65.26  ? 539 ASN L C     1 
ATOM 2173 O O     . ASN C 3 162 ? 24.058  62.657 43.516  1.00 64.02  ? 539 ASN L O     1 
ATOM 2174 C CB    . ASN C 3 162 ? 23.456  63.385 40.942  1.00 72.10  ? 539 ASN L CB    1 
ATOM 2175 C CG    . ASN C 3 162 ? 22.979  64.793 41.250  1.00 74.79  ? 539 ASN L CG    1 
ATOM 2176 O OD1   . ASN C 3 162 ? 23.735  65.623 41.785  1.00 76.17  ? 539 ASN L OD1   1 
ATOM 2177 N ND2   . ASN C 3 162 ? 21.720  65.076 40.913  1.00 74.63  ? 539 ASN L ND2   1 
ATOM 2178 N N     . THR C 3 163 ? 26.196  63.318 43.403  1.00 60.79  ? 540 THR L N     1 
ATOM 2179 C CA    . THR C 3 163 ? 26.404  63.196 44.839  1.00 56.88  ? 540 THR L CA    1 
ATOM 2180 C C     . THR C 3 163 ? 26.844  64.473 45.536  1.00 55.42  ? 540 THR L C     1 
ATOM 2181 O O     . THR C 3 163 ? 27.431  64.426 46.611  1.00 54.80  ? 540 THR L O     1 
ATOM 2182 C CB    . THR C 3 163 ? 27.432  62.090 45.179  1.00 55.20  ? 540 THR L CB    1 
ATOM 2183 O OG1   . THR C 3 163 ? 28.685  62.388 44.559  1.00 56.10  ? 540 THR L OG1   1 
ATOM 2184 C CG2   . THR C 3 163 ? 26.952  60.753 44.699  1.00 52.69  ? 540 THR L CG2   1 
ATOM 2185 N N     . ARG C 3 164 ? 26.580  65.612 44.918  1.00 55.44  ? 541 ARG L N     1 
ATOM 2186 C CA    . ARG C 3 164 ? 26.908  66.899 45.526  1.00 55.84  ? 541 ARG L CA    1 
ATOM 2187 C C     . ARG C 3 164 ? 25.559  67.488 45.928  1.00 55.44  ? 541 ARG L C     1 
ATOM 2188 O O     . ARG C 3 164 ? 24.563  67.328 45.211  1.00 55.61  ? 541 ARG L O     1 
ATOM 2189 C CB    . ARG C 3 164 ? 27.558  67.852 44.528  1.00 58.11  ? 541 ARG L CB    1 
ATOM 2190 C CG    . ARG C 3 164 ? 28.857  67.403 43.920  1.00 62.78  ? 541 ARG L CG    1 
ATOM 2191 C CD    . ARG C 3 164 ? 29.140  68.225 42.651  1.00 67.27  ? 541 ARG L CD    1 
ATOM 2192 N NE    . ARG C 3 164 ? 28.994  69.667 42.861  1.00 68.61  ? 541 ARG L NE    1 
ATOM 2193 C CZ    . ARG C 3 164 ? 29.779  70.397 43.650  1.00 70.58  ? 541 ARG L CZ    1 
ATOM 2194 N NH1   . ARG C 3 164 ? 30.778  69.831 44.312  1.00 70.98  ? 541 ARG L NH1   1 
ATOM 2195 N NH2   . ARG C 3 164 ? 29.560  71.697 43.781  1.00 71.79  ? 541 ARG L NH2   1 
ATOM 2196 N N     . VAL C 3 165 ? 25.514  68.168 47.063  1.00 54.90  ? 542 VAL L N     1 
ATOM 2197 C CA    . VAL C 3 165 ? 24.269  68.760 47.517  1.00 54.19  ? 542 VAL L CA    1 
ATOM 2198 C C     . VAL C 3 165 ? 24.593  70.117 48.084  1.00 55.95  ? 542 VAL L C     1 
ATOM 2199 O O     . VAL C 3 165 ? 25.748  70.534 48.100  1.00 54.91  ? 542 VAL L O     1 
ATOM 2200 C CB    . VAL C 3 165 ? 23.596  67.930 48.644  1.00 52.40  ? 542 VAL L CB    1 
ATOM 2201 C CG1   . VAL C 3 165 ? 23.448  66.486 48.232  1.00 49.80  ? 542 VAL L CG1   1 
ATOM 2202 C CG2   . VAL C 3 165 ? 24.406  68.032 49.916  1.00 50.95  ? 542 VAL L CG2   1 
ATOM 2203 N N     . ARG C 3 166 ? 23.551  70.798 48.543  1.00 59.09  ? 543 ARG L N     1 
ATOM 2204 C CA    . ARG C 3 166 ? 23.672  72.104 49.171  1.00 61.12  ? 543 ARG L CA    1 
ATOM 2205 C C     . ARG C 3 166 ? 22.608  72.226 50.259  1.00 61.76  ? 543 ARG L C     1 
ATOM 2206 O O     . ARG C 3 166 ? 21.512  71.658 50.161  1.00 60.49  ? 543 ARG L O     1 
ATOM 2207 C CB    . ARG C 3 166 ? 23.520  73.238 48.148  1.00 62.36  ? 543 ARG L CB    1 
ATOM 2208 C CG    . ARG C 3 166 ? 24.808  73.572 47.420  1.00 64.50  ? 543 ARG L CG    1 
ATOM 2209 C CD    . ARG C 3 166 ? 24.739  74.920 46.707  1.00 67.51  ? 543 ARG L CD    1 
ATOM 2210 N NE    . ARG C 3 166 ? 23.977  74.884 45.457  1.00 69.56  ? 543 ARG L NE    1 
ATOM 2211 C CZ    . ARG C 3 166 ? 23.858  75.916 44.623  1.00 68.89  ? 543 ARG L CZ    1 
ATOM 2212 N NH1   . ARG C 3 166 ? 24.448  77.064 44.907  1.00 69.42  ? 543 ARG L NH1   1 
ATOM 2213 N NH2   . ARG C 3 166 ? 23.162  75.802 43.500  1.00 69.65  ? 543 ARG L NH2   1 
ATOM 2214 N N     . LEU C 3 167 ? 22.964  72.943 51.316  1.00 63.48  ? 544 LEU L N     1 
ATOM 2215 C CA    . LEU C 3 167 ? 22.065  73.173 52.428  1.00 64.04  ? 544 LEU L CA    1 
ATOM 2216 C C     . LEU C 3 167 ? 21.329  74.457 52.151  1.00 64.61  ? 544 LEU L C     1 
ATOM 2217 O O     . LEU C 3 167 ? 21.895  75.541 52.268  1.00 65.28  ? 544 LEU L O     1 
ATOM 2218 C CB    . LEU C 3 167 ? 22.854  73.323 53.713  1.00 64.59  ? 544 LEU L CB    1 
ATOM 2219 C CG    . LEU C 3 167 ? 23.098  72.020 54.440  1.00 65.71  ? 544 LEU L CG    1 
ATOM 2220 C CD1   . LEU C 3 167 ? 23.941  72.302 55.666  1.00 68.29  ? 544 LEU L CD1   1 
ATOM 2221 C CD2   . LEU C 3 167 ? 21.763  71.409 54.826  1.00 65.39  ? 544 LEU L CD2   1 
ATOM 2222 N N     . VAL C 3 168 ? 20.069  74.346 51.770  1.00 64.85  ? 545 VAL L N     1 
ATOM 2223 C CA    . VAL C 3 168 ? 19.311  75.540 51.485  1.00 65.27  ? 545 VAL L CA    1 
ATOM 2224 C C     . VAL C 3 168 ? 18.601  75.960 52.749  1.00 66.47  ? 545 VAL L C     1 
ATOM 2225 O O     . VAL C 3 168 ? 18.079  75.129 53.488  1.00 65.04  ? 545 VAL L O     1 
ATOM 2226 C CB    . VAL C 3 168 ? 18.267  75.313 50.367  1.00 63.93  ? 545 VAL L CB    1 
ATOM 2227 C CG1   . VAL C 3 168 ? 17.686  76.641 49.938  1.00 63.87  ? 545 VAL L CG1   1 
ATOM 2228 C CG2   . VAL C 3 168 ? 18.901  74.622 49.181  1.00 63.21  ? 545 VAL L CG2   1 
ATOM 2229 N N     . PHE C 3 169 ? 18.614  77.259 53.003  1.00 69.45  ? 546 PHE L N     1 
ATOM 2230 C CA    . PHE C 3 169 ? 17.950  77.825 54.163  1.00 72.37  ? 546 PHE L CA    1 
ATOM 2231 C C     . PHE C 3 169 ? 17.100  78.948 53.629  1.00 74.61  ? 546 PHE L C     1 
ATOM 2232 O O     . PHE C 3 169 ? 17.546  79.712 52.771  1.00 74.00  ? 546 PHE L O     1 
ATOM 2233 C CB    . PHE C 3 169 ? 18.952  78.430 55.143  1.00 72.62  ? 546 PHE L CB    1 
ATOM 2234 C CG    . PHE C 3 169 ? 19.877  77.439 55.762  1.00 73.19  ? 546 PHE L CG    1 
ATOM 2235 C CD1   . PHE C 3 169 ? 19.406  76.519 56.696  1.00 73.24  ? 546 PHE L CD1   1 
ATOM 2236 C CD2   . PHE C 3 169 ? 21.228  77.428 55.416  1.00 73.24  ? 546 PHE L CD2   1 
ATOM 2237 C CE1   . PHE C 3 169 ? 20.271  75.598 57.282  1.00 74.56  ? 546 PHE L CE1   1 
ATOM 2238 C CE2   . PHE C 3 169 ? 22.106  76.516 55.990  1.00 73.46  ? 546 PHE L CE2   1 
ATOM 2239 C CZ    . PHE C 3 169 ? 21.630  75.596 56.927  1.00 74.87  ? 546 PHE L CZ    1 
ATOM 2240 N N     . ARG C 3 170 ? 15.874  79.043 54.120  1.00 77.63  ? 547 ARG L N     1 
ATOM 2241 C CA    . ARG C 3 170 ? 14.998  80.124 53.706  1.00 81.12  ? 547 ARG L CA    1 
ATOM 2242 C C     . ARG C 3 170 ? 14.062  80.443 54.868  1.00 83.42  ? 547 ARG L C     1 
ATOM 2243 O O     . ARG C 3 170 ? 13.814  79.592 55.731  1.00 82.31  ? 547 ARG L O     1 
ATOM 2244 C CB    . ARG C 3 170 ? 14.207  79.756 52.436  1.00 79.76  ? 547 ARG L CB    1 
ATOM 2245 C CG    . ARG C 3 170 ? 13.166  78.672 52.621  1.00 80.45  ? 547 ARG L CG    1 
ATOM 2246 C CD    . ARG C 3 170 ? 12.022  78.809 51.620  1.00 78.93  ? 547 ARG L CD    1 
ATOM 2247 N NE    . ARG C 3 170 ? 12.457  78.619 50.243  1.00 78.58  ? 547 ARG L NE    1 
ATOM 2248 C CZ    . ARG C 3 170 ? 11.652  78.718 49.192  1.00 78.96  ? 547 ARG L CZ    1 
ATOM 2249 N NH1   . ARG C 3 170 ? 10.371  79.007 49.365  1.00 78.91  ? 547 ARG L NH1   1 
ATOM 2250 N NH2   . ARG C 3 170 ? 12.125  78.525 47.967  1.00 79.94  ? 547 ARG L NH2   1 
ATOM 2251 N N     . VAL C 3 171 ? 13.570  81.681 54.893  1.00 87.06  ? 548 VAL L N     1 
ATOM 2252 C CA    . VAL C 3 171 ? 12.667  82.140 55.942  1.00 89.77  ? 548 VAL L CA    1 
ATOM 2253 C C     . VAL C 3 171 ? 11.675  83.170 55.410  1.00 90.51  ? 548 VAL L C     1 
ATOM 2254 O O     . VAL C 3 171 ? 12.029  84.036 54.613  1.00 89.09  ? 548 VAL L O     1 
ATOM 2255 C CB    . VAL C 3 171 ? 13.463  82.753 57.125  1.00 90.66  ? 548 VAL L CB    1 
ATOM 2256 C CG1   . VAL C 3 171 ? 14.220  83.998 56.668  1.00 90.43  ? 548 VAL L CG1   1 
ATOM 2257 C CG2   . VAL C 3 171 ? 12.522  83.069 58.270  1.00 90.94  ? 548 VAL L CG2   1 
ATOM 2258 N N     . HIS C 3 172 ? 10.432  83.059 55.866  1.00 93.12  ? 549 HIS L N     1 
ATOM 2259 C CA    . HIS C 3 172 ? 9.354   83.962 55.462  1.00 96.80  ? 549 HIS L CA    1 
ATOM 2260 C C     . HIS C 3 172 ? 9.048   85.052 56.512  1.00 99.45  ? 549 HIS L C     1 
ATOM 2261 O O     . HIS C 3 172 ? 8.428   84.771 57.545  1.00 99.22  ? 549 HIS L O     1 
ATOM 2262 C CB    . HIS C 3 172 ? 8.077   83.157 55.211  1.00 96.04  ? 549 HIS L CB    1 
ATOM 2263 C CG    . HIS C 3 172 ? 8.213   82.113 54.151  1.00 96.22  ? 549 HIS L CG    1 
ATOM 2264 N ND1   . HIS C 3 172 ? 8.445   82.421 52.829  1.00 96.97  ? 549 HIS L ND1   1 
ATOM 2265 C CD2   . HIS C 3 172 ? 8.114   80.764 54.212  1.00 97.11  ? 549 HIS L CD2   1 
ATOM 2266 C CE1   . HIS C 3 172 ? 8.481   81.307 52.119  1.00 97.51  ? 549 HIS L CE1   1 
ATOM 2267 N NE2   . HIS C 3 172 ? 8.282   80.287 52.935  1.00 97.76  ? 549 HIS L NE2   1 
ATOM 2268 N N     . ILE C 3 173 ? 9.467   86.290 56.237  1.00 102.01 ? 550 ILE L N     1 
ATOM 2269 C CA    . ILE C 3 173 ? 9.235   87.418 57.148  1.00 103.85 ? 550 ILE L CA    1 
ATOM 2270 C C     . ILE C 3 173 ? 7.920   88.130 56.832  1.00 107.82 ? 550 ILE L C     1 
ATOM 2271 O O     . ILE C 3 173 ? 7.678   88.533 55.693  1.00 108.04 ? 550 ILE L O     1 
ATOM 2272 C CB    . ILE C 3 173 ? 10.352  88.473 57.049  1.00 101.30 ? 550 ILE L CB    1 
ATOM 2273 C CG1   . ILE C 3 173 ? 11.710  87.829 57.302  1.00 100.18 ? 550 ILE L CG1   1 
ATOM 2274 C CG2   . ILE C 3 173 ? 10.102  89.582 58.050  1.00 99.80  ? 550 ILE L CG2   1 
ATOM 2275 C CD1   . ILE C 3 173 ? 12.866  88.772 57.078  1.00 99.97  ? 550 ILE L CD1   1 
ATOM 2276 N N     . PRO C 3 174 ? 7.046   88.284 57.838  1.00 111.40 ? 551 PRO L N     1 
ATOM 2277 C CA    . PRO C 3 174 ? 5.758   88.957 57.643  1.00 113.84 ? 551 PRO L CA    1 
ATOM 2278 C C     . PRO C 3 174 ? 5.821   90.420 58.087  1.00 116.15 ? 551 PRO L C     1 
ATOM 2279 O O     . PRO C 3 174 ? 5.945   90.710 59.275  1.00 117.04 ? 551 PRO L O     1 
ATOM 2280 C CB    . PRO C 3 174 ? 4.823   88.138 58.514  1.00 113.81 ? 551 PRO L CB    1 
ATOM 2281 C CG    . PRO C 3 174 ? 5.690   87.858 59.709  1.00 113.37 ? 551 PRO L CG    1 
ATOM 2282 C CD    . PRO C 3 174 ? 7.042   87.506 59.093  1.00 112.38 ? 551 PRO L CD    1 
ATOM 2283 N N     . GLU C 3 175 ? 5.742   91.340 57.135  1.00 118.48 ? 552 GLU L N     1 
ATOM 2284 C CA    . GLU C 3 175 ? 5.792   92.759 57.466  1.00 120.65 ? 552 GLU L CA    1 
ATOM 2285 C C     . GLU C 3 175 ? 4.416   93.297 57.829  1.00 121.80 ? 552 GLU L C     1 
ATOM 2286 O O     . GLU C 3 175 ? 3.394   92.679 57.527  1.00 121.70 ? 552 GLU L O     1 
ATOM 2287 C CB    . GLU C 3 175 ? 6.373   93.563 56.296  1.00 121.07 ? 552 GLU L CB    1 
ATOM 2288 C CG    . GLU C 3 175 ? 7.893   93.513 56.209  1.00 121.91 ? 552 GLU L CG    1 
ATOM 2289 C CD    . GLU C 3 175 ? 8.438   94.239 54.998  1.00 121.95 ? 552 GLU L CD    1 
ATOM 2290 O OE1   . GLU C 3 175 ? 9.665   94.471 54.952  1.00 121.58 ? 552 GLU L OE1   1 
ATOM 2291 O OE2   . GLU C 3 175 ? 7.642   94.570 54.092  1.00 122.58 ? 552 GLU L OE2   1 
ATOM 2292 N N     . SER C 3 176 ? 4.401   94.450 58.489  1.00 123.40 ? 553 SER L N     1 
ATOM 2293 C CA    . SER C 3 176 ? 3.158   95.095 58.891  1.00 125.27 ? 553 SER L CA    1 
ATOM 2294 C C     . SER C 3 176 ? 2.427   95.585 57.647  1.00 126.25 ? 553 SER L C     1 
ATOM 2295 O O     . SER C 3 176 ? 1.195   95.643 57.610  1.00 126.29 ? 553 SER L O     1 
ATOM 2296 C CB    . SER C 3 176 ? 3.462   96.277 59.808  1.00 125.50 ? 553 SER L CB    1 
ATOM 2297 O OG    . SER C 3 176 ? 4.416   97.133 59.207  1.00 125.95 ? 553 SER L OG    1 
ATOM 2298 N N     . SER C 3 177 ? 3.206   95.935 56.628  1.00 127.37 ? 554 SER L N     1 
ATOM 2299 C CA    . SER C 3 177 ? 2.668   96.415 55.365  1.00 128.73 ? 554 SER L CA    1 
ATOM 2300 C C     . SER C 3 177 ? 1.832   95.328 54.691  1.00 130.47 ? 554 SER L C     1 
ATOM 2301 O O     . SER C 3 177 ? 1.355   95.503 53.567  1.00 130.98 ? 554 SER L O     1 
ATOM 2302 C CB    . SER C 3 177 ? 3.818   96.835 54.448  1.00 127.85 ? 554 SER L CB    1 
ATOM 2303 O OG    . SER C 3 177 ? 4.764   95.789 54.313  1.00 126.40 ? 554 SER L OG    1 
ATOM 2304 N N     . GLY C 3 178 ? 1.652   94.209 55.390  1.00 132.01 ? 555 GLY L N     1 
ATOM 2305 C CA    . GLY C 3 178 ? 0.883   93.103 54.847  1.00 133.45 ? 555 GLY L CA    1 
ATOM 2306 C C     . GLY C 3 178 ? 1.750   92.248 53.944  1.00 134.09 ? 555 GLY L C     1 
ATOM 2307 O O     . GLY C 3 178 ? 1.462   91.071 53.715  1.00 134.55 ? 555 GLY L O     1 
ATOM 2308 N N     . ARG C 3 179 ? 2.821   92.852 53.432  1.00 134.44 ? 556 ARG L N     1 
ATOM 2309 C CA    . ARG C 3 179 ? 3.753   92.162 52.547  1.00 134.12 ? 556 ARG L CA    1 
ATOM 2310 C C     . ARG C 3 179 ? 4.575   91.130 53.302  1.00 130.73 ? 556 ARG L C     1 
ATOM 2311 O O     . ARG C 3 179 ? 4.952   91.342 54.455  1.00 130.84 ? 556 ARG L O     1 
ATOM 2312 C CB    . ARG C 3 179 ? 4.713   93.156 51.880  1.00 138.51 ? 556 ARG L CB    1 
ATOM 2313 C CG    . ARG C 3 179 ? 5.835   92.470 51.099  1.00 144.60 ? 556 ARG L CG    1 
ATOM 2314 C CD    . ARG C 3 179 ? 6.828   93.452 50.489  1.00 149.42 ? 556 ARG L CD    1 
ATOM 2315 N NE    . ARG C 3 179 ? 7.902   92.766 49.764  1.00 153.74 ? 556 ARG L NE    1 
ATOM 2316 C CZ    . ARG C 3 179 ? 7.731   92.041 48.659  1.00 155.61 ? 556 ARG L CZ    1 
ATOM 2317 N NH1   . ARG C 3 179 ? 6.523   91.897 48.130  1.00 156.74 ? 556 ARG L NH1   1 
ATOM 2318 N NH2   . ARG C 3 179 ? 8.770   91.452 48.082  1.00 156.35 ? 556 ARG L NH2   1 
ATOM 2319 N N     . ILE C 3 180 ? 4.852   90.014 52.637  1.00 125.99 ? 557 ILE L N     1 
ATOM 2320 C CA    . ILE C 3 180 ? 5.649   88.949 53.224  1.00 120.42 ? 557 ILE L CA    1 
ATOM 2321 C C     . ILE C 3 180 ? 6.919   88.797 52.402  1.00 117.06 ? 557 ILE L C     1 
ATOM 2322 O O     . ILE C 3 180 ? 6.886   88.239 51.310  1.00 116.86 ? 557 ILE L O     1 
ATOM 2323 C CB    . ILE C 3 180 ? 4.894   87.603 53.213  1.00 119.49 ? 557 ILE L CB    1 
ATOM 2324 C CG1   . ILE C 3 180 ? 3.627   87.707 54.062  1.00 118.45 ? 557 ILE L CG1   1 
ATOM 2325 C CG2   . ILE C 3 180 ? 5.799   86.499 53.735  1.00 119.09 ? 557 ILE L CG2   1 
ATOM 2326 C CD1   . ILE C 3 180 ? 2.800   86.442 54.078  1.00 117.31 ? 557 ILE L CD1   1 
ATOM 2327 N N     . VAL C 3 181 ? 8.029   89.312 52.918  1.00 113.06 ? 558 VAL L N     1 
ATOM 2328 C CA    . VAL C 3 181 ? 9.306   89.208 52.221  1.00 109.52 ? 558 VAL L CA    1 
ATOM 2329 C C     . VAL C 3 181 ? 9.815   87.772 52.344  1.00 106.44 ? 558 VAL L C     1 
ATOM 2330 O O     . VAL C 3 181 ? 9.538   87.093 53.333  1.00 105.62 ? 558 VAL L O     1 
ATOM 2331 C CB    . VAL C 3 181 ? 10.348  90.168 52.824  1.00 109.90 ? 558 VAL L CB    1 
ATOM 2332 C CG1   . VAL C 3 181 ? 11.647  90.087 52.041  1.00 110.66 ? 558 VAL L CG1   1 
ATOM 2333 C CG2   . VAL C 3 181 ? 9.807   91.583 52.817  1.00 110.32 ? 558 VAL L CG2   1 
ATOM 2334 N N     . SER C 3 182 ? 10.549  87.305 51.341  1.00 102.52 ? 559 SER L N     1 
ATOM 2335 C CA    . SER C 3 182 ? 11.062  85.946 51.377  1.00 98.74  ? 559 SER L CA    1 
ATOM 2336 C C     . SER C 3 182 ? 12.537  85.892 51.044  1.00 96.09  ? 559 SER L C     1 
ATOM 2337 O O     . SER C 3 182 ? 12.941  86.205 49.924  1.00 95.86  ? 559 SER L O     1 
ATOM 2338 C CB    . SER C 3 182 ? 10.288  85.057 50.403  1.00 99.36  ? 559 SER L CB    1 
ATOM 2339 O OG    . SER C 3 182 ? 8.945   84.885 50.818  1.00 100.12 ? 559 SER L OG    1 
ATOM 2340 N N     . LEU C 3 183 ? 13.339  85.490 52.027  1.00 92.83  ? 560 LEU L N     1 
ATOM 2341 C CA    . LEU C 3 183 ? 14.780  85.382 51.846  1.00 89.09  ? 560 LEU L CA    1 
ATOM 2342 C C     . LEU C 3 183 ? 15.252  83.937 51.830  1.00 86.30  ? 560 LEU L C     1 
ATOM 2343 O O     . LEU C 3 183 ? 14.865  83.139 52.682  1.00 86.51  ? 560 LEU L O     1 
ATOM 2344 C CB    . LEU C 3 183 ? 15.518  86.130 52.954  1.00 88.73  ? 560 LEU L CB    1 
ATOM 2345 C CG    . LEU C 3 183 ? 15.521  87.655 52.887  1.00 88.96  ? 560 LEU L CG    1 
ATOM 2346 C CD1   . LEU C 3 183 ? 16.502  88.180 53.932  1.00 88.57  ? 560 LEU L CD1   1 
ATOM 2347 C CD2   . LEU C 3 183 ? 15.924  88.127 51.483  1.00 88.39  ? 560 LEU L CD2   1 
ATOM 2348 N N     . GLN C 3 184 ? 16.093  83.606 50.859  1.00 82.33  ? 561 GLN L N     1 
ATOM 2349 C CA    . GLN C 3 184 ? 16.613  82.256 50.756  1.00 79.05  ? 561 GLN L CA    1 
ATOM 2350 C C     . GLN C 3 184 ? 18.114  82.240 50.588  1.00 76.04  ? 561 GLN L C     1 
ATOM 2351 O O     . GLN C 3 184 ? 18.712  83.159 50.021  1.00 76.70  ? 561 GLN L O     1 
ATOM 2352 C CB    . GLN C 3 184 ? 15.976  81.507 49.591  1.00 77.73  ? 561 GLN L CB    1 
ATOM 2353 C CG    . GLN C 3 184 ? 16.637  80.172 49.306  1.00 74.72  ? 561 GLN L CG    1 
ATOM 2354 C CD    . GLN C 3 184 ? 15.868  79.348 48.312  1.00 73.77  ? 561 GLN L CD    1 
ATOM 2355 O OE1   . GLN C 3 184 ? 14.773  78.872 48.600  1.00 72.69  ? 561 GLN L OE1   1 
ATOM 2356 N NE2   . GLN C 3 184 ? 16.432  79.178 47.127  1.00 74.60  ? 561 GLN L NE2   1 
ATOM 2357 N N     . THR C 3 185 ? 18.722  81.165 51.066  1.00 71.98  ? 562 THR L N     1 
ATOM 2358 C CA    . THR C 3 185 ? 20.155  81.058 50.972  1.00 66.51  ? 562 THR L CA    1 
ATOM 2359 C C     . THR C 3 185 ? 20.694  79.632 51.066  1.00 68.61  ? 562 THR L C     1 
ATOM 2360 O O     . THR C 3 185 ? 20.323  78.859 51.953  1.00 69.31  ? 562 THR L O     1 
ATOM 2361 C CB    . THR C 3 185 ? 20.779  81.949 52.036  1.00 55.93  ? 562 THR L CB    1 
ATOM 2362 O OG1   . THR C 3 185 ? 21.863  82.677 51.447  1.00 53.35  ? 562 THR L OG1   1 
ATOM 2363 C CG2   . THR C 3 185 ? 21.245  81.122 53.252  1.00 48.42  ? 562 THR L CG2   1 
ATOM 2364 N N     . ALA C 3 186 ? 21.577  79.302 50.131  1.00 71.11  ? 563 ALA L N     1 
ATOM 2365 C CA    . ALA C 3 186 ? 22.160  77.976 50.071  1.00 74.39  ? 563 ALA L CA    1 
ATOM 2366 C C     . ALA C 3 186 ? 23.655  77.998 50.356  1.00 75.33  ? 563 ALA L C     1 
ATOM 2367 O O     . ALA C 3 186 ? 24.392  78.831 49.823  1.00 75.82  ? 563 ALA L O     1 
ATOM 2368 C CB    . ALA C 3 186 ? 21.893  77.349 48.704  1.00 73.25  ? 563 ALA L CB    1 
ATOM 2369 N N     . SER C 3 187 ? 24.084  77.062 51.199  1.00 75.12  ? 564 SER L N     1 
ATOM 2370 C CA    . SER C 3 187 ? 25.474  76.921 51.594  1.00 74.56  ? 564 SER L CA    1 
ATOM 2371 C C     . SER C 3 187 ? 26.363  76.651 50.396  1.00 74.51  ? 564 SER L C     1 
ATOM 2372 O O     . SER C 3 187 ? 25.940  76.752 49.254  1.00 74.58  ? 564 SER L O     1 
ATOM 2373 C CB    . SER C 3 187 ? 25.602  75.757 52.568  1.00 74.69  ? 564 SER L CB    1 
ATOM 2374 O OG    . SER C 3 187 ? 25.251  74.541 51.928  1.00 73.48  ? 564 SER L OG    1 
ATOM 2375 N N     . ASN C 3 188 ? 27.609  76.308 50.667  1.00 75.40  ? 565 ASN L N     1 
ATOM 2376 C CA    . ASN C 3 188 ? 28.528  75.992 49.601  1.00 77.54  ? 565 ASN L CA    1 
ATOM 2377 C C     . ASN C 3 188 ? 28.274  74.529 49.308  1.00 76.14  ? 565 ASN L C     1 
ATOM 2378 O O     . ASN C 3 188 ? 27.485  73.890 50.004  1.00 77.55  ? 565 ASN L O     1 
ATOM 2379 C CB    . ASN C 3 188 ? 29.965  76.203 50.062  1.00 83.85  ? 565 ASN L CB    1 
ATOM 2380 C CG    . ASN C 3 188 ? 30.224  77.629 50.511  1.00 89.33  ? 565 ASN L CG    1 
ATOM 2381 O OD1   . ASN C 3 188 ? 29.685  78.580 49.931  1.00 92.52  ? 565 ASN L OD1   1 
ATOM 2382 N ND2   . ASN C 3 188 ? 31.059  77.789 51.538  1.00 91.20  ? 565 ASN L ND2   1 
ATOM 2383 N N     . PRO C 3 189 ? 28.925  73.976 48.275  1.00 73.50  ? 566 PRO L N     1 
ATOM 2384 C CA    . PRO C 3 189 ? 28.739  72.566 47.917  1.00 70.75  ? 566 PRO L CA    1 
ATOM 2385 C C     . PRO C 3 189 ? 29.296  71.588 48.944  1.00 67.45  ? 566 PRO L C     1 
ATOM 2386 O O     . PRO C 3 189 ? 30.345  71.821 49.529  1.00 66.51  ? 566 PRO L O     1 
ATOM 2387 C CB    . PRO C 3 189 ? 29.463  72.449 46.577  1.00 71.50  ? 566 PRO L CB    1 
ATOM 2388 C CG    . PRO C 3 189 ? 29.364  73.809 46.016  1.00 72.86  ? 566 PRO L CG    1 
ATOM 2389 C CD    . PRO C 3 189 ? 29.663  74.675 47.214  1.00 73.37  ? 566 PRO L CD    1 
ATOM 2390 N N     . ILE C 3 190 ? 28.579  70.486 49.140  1.00 64.97  ? 567 ILE L N     1 
ATOM 2391 C CA    . ILE C 3 190 ? 28.974  69.436 50.075  1.00 61.70  ? 567 ILE L CA    1 
ATOM 2392 C C     . ILE C 3 190 ? 28.984  68.091 49.343  1.00 61.37  ? 567 ILE L C     1 
ATOM 2393 O O     . ILE C 3 190 ? 27.974  67.703 48.766  1.00 60.82  ? 567 ILE L O     1 
ATOM 2394 C CB    . ILE C 3 190 ? 27.974  69.325 51.255  1.00 58.88  ? 567 ILE L CB    1 
ATOM 2395 C CG1   . ILE C 3 190 ? 27.864  70.657 51.984  1.00 56.76  ? 567 ILE L CG1   1 
ATOM 2396 C CG2   . ILE C 3 190 ? 28.429  68.264 52.229  1.00 57.54  ? 567 ILE L CG2   1 
ATOM 2397 C CD1   . ILE C 3 190 ? 26.903  70.615 53.144  1.00 55.58  ? 567 ILE L CD1   1 
ATOM 2398 N N     . GLU C 3 191 ? 30.120  67.393 49.350  1.00 61.54  ? 568 GLU L N     1 
ATOM 2399 C CA    . GLU C 3 191 ? 30.214  66.083 48.707  1.00 61.93  ? 568 GLU L CA    1 
ATOM 2400 C C     . GLU C 3 191 ? 29.597  65.061 49.650  1.00 62.42  ? 568 GLU L C     1 
ATOM 2401 O O     . GLU C 3 191 ? 29.909  65.045 50.840  1.00 61.62  ? 568 GLU L O     1 
ATOM 2402 C CB    . GLU C 3 191 ? 31.667  65.711 48.432  1.00 61.40  ? 568 GLU L CB    1 
ATOM 2403 C CG    . GLU C 3 191 ? 31.829  64.316 47.861  1.00 64.09  ? 568 GLU L CG    1 
ATOM 2404 C CD    . GLU C 3 191 ? 30.997  64.089 46.598  1.00 66.17  ? 568 GLU L CD    1 
ATOM 2405 O OE1   . GLU C 3 191 ? 31.201  64.811 45.588  1.00 66.67  ? 568 GLU L OE1   1 
ATOM 2406 O OE2   . GLU C 3 191 ? 30.137  63.182 46.618  1.00 66.09  ? 568 GLU L OE2   1 
ATOM 2407 N N     . CYS C 3 192 ? 28.730  64.204 49.121  1.00 63.80  ? 569 CYS L N     1 
ATOM 2408 C CA    . CYS C 3 192 ? 28.049  63.216 49.954  1.00 66.41  ? 569 CYS L CA    1 
ATOM 2409 C C     . CYS C 3 192 ? 28.417  61.742 49.765  1.00 67.94  ? 569 CYS L C     1 
ATOM 2410 O O     . CYS C 3 192 ? 27.666  60.850 50.167  1.00 66.35  ? 569 CYS L O     1 
ATOM 2411 C CB    . CYS C 3 192 ? 26.536  63.387 49.803  1.00 65.98  ? 569 CYS L CB    1 
ATOM 2412 S SG    . CYS C 3 192 ? 25.902  64.910 50.534  1.00 63.77  ? 569 CYS L SG    1 
ATOM 2413 N N     . SER C 3 193 ? 29.573  61.482 49.170  1.00 70.43  ? 570 SER L N     1 
ATOM 2414 C CA    . SER C 3 193 ? 30.000  60.109 48.964  1.00 73.63  ? 570 SER L CA    1 
ATOM 2415 C C     . SER C 3 193 ? 31.316  59.833 49.657  1.00 77.63  ? 570 SER L C     1 
ATOM 2416 O O     . SER C 3 193 ? 32.356  60.361 49.271  1.00 78.11  ? 570 SER L O     1 
ATOM 2417 C CB    . SER C 3 193 ? 30.141  59.814 47.480  1.00 72.10  ? 570 SER L CB    1 
ATOM 2418 O OG    . SER C 3 193 ? 30.987  60.765 46.870  1.00 71.68  ? 570 SER L OG    1 
ATOM 2419 N N     . GLN C 3 194 ? 31.249  59.014 50.700  1.00 82.83  ? 571 GLN L N     1 
ATOM 2420 C CA    . GLN C 3 194 ? 32.421  58.621 51.461  1.00 87.52  ? 571 GLN L CA    1 
ATOM 2421 C C     . GLN C 3 194 ? 33.599  58.586 50.500  1.00 92.19  ? 571 GLN L C     1 
ATOM 2422 O O     . GLN C 3 194 ? 33.453  58.186 49.346  1.00 92.20  ? 571 GLN L O     1 
ATOM 2423 C CB    . GLN C 3 194 ? 32.204  57.222 52.059  1.00 86.44  ? 571 GLN L CB    1 
ATOM 2424 C CG    . GLN C 3 194 ? 33.468  56.578 52.635  1.00 85.03  ? 571 GLN L CG    1 
ATOM 2425 C CD    . GLN C 3 194 ? 33.343  55.069 52.844  1.00 83.83  ? 571 GLN L CD    1 
ATOM 2426 O OE1   . GLN C 3 194 ? 34.312  54.404 53.241  1.00 82.51  ? 571 GLN L OE1   1 
ATOM 2427 N NE2   . GLN C 3 194 ? 32.154  54.524 52.576  1.00 81.74  ? 571 GLN L NE2   1 
ATOM 2428 N N     . ARG C 3 195 ? 34.763  59.014 50.964  1.00 98.07  ? 572 ARG L N     1 
ATOM 2429 C CA    . ARG C 3 195 ? 35.936  58.993 50.108  1.00 103.45 ? 572 ARG L CA    1 
ATOM 2430 C C     . ARG C 3 195 ? 36.272  57.544 49.751  1.00 101.81 ? 572 ARG L C     1 
ATOM 2431 O O     . ARG C 3 195 ? 35.412  56.662 49.720  1.00 100.33 ? 572 ARG L O     1 
ATOM 2432 C CB    . ARG C 3 195 ? 37.142  59.639 50.813  1.00 111.24 ? 572 ARG L CB    1 
ATOM 2433 C CG    . ARG C 3 195 ? 36.986  61.117 51.159  1.00 121.38 ? 572 ARG L CG    1 
ATOM 2434 C CD    . ARG C 3 195 ? 36.396  61.329 52.549  1.00 131.52 ? 572 ARG L CD    1 
ATOM 2435 N NE    . ARG C 3 195 ? 37.309  60.918 53.618  1.00 140.65 ? 572 ARG L NE    1 
ATOM 2436 C CZ    . ARG C 3 195 ? 37.078  61.104 54.918  1.00 144.88 ? 572 ARG L CZ    1 
ATOM 2437 N NH1   . ARG C 3 195 ? 35.961  61.697 55.322  1.00 147.63 ? 572 ARG L NH1   1 
ATOM 2438 N NH2   . ARG C 3 195 ? 37.967  60.699 55.817  1.00 147.38 ? 572 ARG L NH2   1 
ATOM 2439 N N     . SER C 3 196 ? 37.544  57.316 49.481  1.00 100.40 ? 573 SER L N     1 
ATOM 2440 C CA    . SER C 3 196 ? 38.027  55.995 49.141  1.00 98.87  ? 573 SER L CA    1 
ATOM 2441 C C     . SER C 3 196 ? 38.777  55.426 50.349  1.00 96.56  ? 573 SER L C     1 
ATOM 2442 O O     . SER C 3 196 ? 39.720  56.054 50.849  1.00 97.23  ? 573 SER L O     1 
ATOM 2443 C CB    . SER C 3 196 ? 38.950  56.105 47.927  1.00 100.40 ? 573 SER L CB    1 
ATOM 2444 O OG    . SER C 3 196 ? 39.564  57.386 47.885  1.00 100.86 ? 573 SER L OG    1 
ATOM 2445 N N     . ALA C 3 197 ? 38.349  54.254 50.828  1.00 92.26  ? 574 ALA L N     1 
ATOM 2446 C CA    . ALA C 3 197 ? 38.999  53.615 51.975  1.00 86.04  ? 574 ALA L CA    1 
ATOM 2447 C C     . ALA C 3 197 ? 40.516  53.674 51.800  1.00 81.80  ? 574 ALA L C     1 
ATOM 2448 O O     . ALA C 3 197 ? 41.034  53.914 50.705  1.00 80.91  ? 574 ALA L O     1 
ATOM 2449 C CB    . ALA C 3 197 ? 38.534  52.167 52.126  1.00 85.14  ? 574 ALA L CB    1 
ATOM 2450 N N     . HIS C 3 198 ? 41.225  53.438 52.888  1.00 76.66  ? 575 HIS L N     1 
ATOM 2451 C CA    . HIS C 3 198 ? 42.671  53.524 52.878  1.00 72.42  ? 575 HIS L CA    1 
ATOM 2452 C C     . HIS C 3 198 ? 43.454  52.502 52.062  1.00 69.89  ? 575 HIS L C     1 
ATOM 2453 O O     . HIS C 3 198 ? 43.073  51.336 51.955  1.00 69.08  ? 575 HIS L O     1 
ATOM 2454 C CB    . HIS C 3 198 ? 43.166  53.523 54.323  1.00 72.00  ? 575 HIS L CB    1 
ATOM 2455 C CG    . HIS C 3 198 ? 42.625  54.657 55.134  1.00 69.95  ? 575 HIS L CG    1 
ATOM 2456 N ND1   . HIS C 3 198 ? 43.102  55.945 55.020  1.00 69.23  ? 575 HIS L ND1   1 
ATOM 2457 C CD2   . HIS C 3 198 ? 41.601  54.710 56.017  1.00 68.87  ? 575 HIS L CD2   1 
ATOM 2458 C CE1   . HIS C 3 198 ? 42.391  56.743 55.796  1.00 69.43  ? 575 HIS L CE1   1 
ATOM 2459 N NE2   . HIS C 3 198 ? 41.473  56.018 56.411  1.00 68.00  ? 575 HIS L NE2   1 
ATOM 2460 N N     . GLU C 3 199 ? 44.556  52.983 51.486  1.00 66.74  ? 576 GLU L N     1 
ATOM 2461 C CA    . GLU C 3 199 ? 45.476  52.179 50.693  1.00 62.75  ? 576 GLU L CA    1 
ATOM 2462 C C     . GLU C 3 199 ? 46.527  51.700 51.666  1.00 59.30  ? 576 GLU L C     1 
ATOM 2463 O O     . GLU C 3 199 ? 46.929  52.430 52.566  1.00 57.69  ? 576 GLU L O     1 
ATOM 2464 C CB    . GLU C 3 199 ? 46.151  53.025 49.615  1.00 64.80  ? 576 GLU L CB    1 
ATOM 2465 C CG    . GLU C 3 199 ? 45.259  53.406 48.467  1.00 68.16  ? 576 GLU L CG    1 
ATOM 2466 C CD    . GLU C 3 199 ? 44.993  52.233 47.541  1.00 71.60  ? 576 GLU L CD    1 
ATOM 2467 O OE1   . GLU C 3 199 ? 44.593  51.156 48.041  1.00 73.08  ? 576 GLU L OE1   1 
ATOM 2468 O OE2   . GLU C 3 199 ? 45.182  52.391 46.311  1.00 73.53  ? 576 GLU L OE2   1 
ATOM 2469 N N     . LEU C 3 200 ? 46.981  50.474 51.473  1.00 57.53  ? 577 LEU L N     1 
ATOM 2470 C CA    . LEU C 3 200 ? 47.977  49.880 52.349  1.00 55.64  ? 577 LEU L CA    1 
ATOM 2471 C C     . LEU C 3 200 ? 49.329  50.601 52.272  1.00 53.38  ? 577 LEU L C     1 
ATOM 2472 O O     . LEU C 3 200 ? 50.008  50.584 51.241  1.00 53.38  ? 577 LEU L O     1 
ATOM 2473 C CB    . LEU C 3 200 ? 48.130  48.403 51.987  1.00 56.72  ? 577 LEU L CB    1 
ATOM 2474 C CG    . LEU C 3 200 ? 48.857  47.525 52.996  1.00 59.65  ? 577 LEU L CG    1 
ATOM 2475 C CD1   . LEU C 3 200 ? 48.253  47.748 54.379  1.00 61.85  ? 577 LEU L CD1   1 
ATOM 2476 C CD2   . LEU C 3 200 ? 48.740  46.061 52.578  1.00 60.93  ? 577 LEU L CD2   1 
ATOM 2477 N N     . PRO C 3 201 ? 49.740  51.253 53.368  1.00 50.88  ? 578 PRO L N     1 
ATOM 2478 C CA    . PRO C 3 201 ? 51.032  51.940 53.291  1.00 48.65  ? 578 PRO L CA    1 
ATOM 2479 C C     . PRO C 3 201 ? 52.142  50.937 52.982  1.00 47.48  ? 578 PRO L C     1 
ATOM 2480 O O     . PRO C 3 201 ? 52.018  49.759 53.313  1.00 46.75  ? 578 PRO L O     1 
ATOM 2481 C CB    . PRO C 3 201 ? 51.160  52.579 54.675  1.00 47.42  ? 578 PRO L CB    1 
ATOM 2482 C CG    . PRO C 3 201 ? 50.394  51.636 55.558  1.00 47.02  ? 578 PRO L CG    1 
ATOM 2483 C CD    . PRO C 3 201 ? 49.191  51.275 54.737  1.00 47.92  ? 578 PRO L CD    1 
ATOM 2484 N N     . MET C 3 202 ? 53.208  51.388 52.324  1.00 46.61  ? 579 MET L N     1 
ATOM 2485 C CA    . MET C 3 202 ? 54.325  50.496 51.997  1.00 46.33  ? 579 MET L CA    1 
ATOM 2486 C C     . MET C 3 202 ? 55.680  51.158 52.213  1.00 45.81  ? 579 MET L C     1 
ATOM 2487 O O     . MET C 3 202 ? 55.984  52.164 51.576  1.00 45.85  ? 579 MET L O     1 
ATOM 2488 C CB    . MET C 3 202 ? 54.234  50.022 50.548  1.00 45.74  ? 579 MET L CB    1 
ATOM 2489 C CG    . MET C 3 202 ? 52.940  49.313 50.217  1.00 48.80  ? 579 MET L CG    1 
ATOM 2490 S SD    . MET C 3 202 ? 52.943  48.527 48.577  1.00 51.38  ? 579 MET L SD    1 
ATOM 2491 C CE    . MET C 3 202 ? 52.887  49.977 47.490  1.00 50.65  ? 579 MET L CE    1 
ATOM 2492 N N     . VAL C 3 203 ? 56.491  50.594 53.110  1.00 45.15  ? 580 VAL L N     1 
ATOM 2493 C CA    . VAL C 3 203 ? 57.821  51.141 53.381  1.00 45.38  ? 580 VAL L CA    1 
ATOM 2494 C C     . VAL C 3 203 ? 58.898  50.318 52.691  1.00 44.92  ? 580 VAL L C     1 
ATOM 2495 O O     . VAL C 3 203 ? 58.995  49.111 52.909  1.00 44.45  ? 580 VAL L O     1 
ATOM 2496 C CB    . VAL C 3 203 ? 58.135  51.175 54.896  1.00 46.98  ? 580 VAL L CB    1 
ATOM 2497 C CG1   . VAL C 3 203 ? 59.576  51.631 55.113  1.00 48.44  ? 580 VAL L CG1   1 
ATOM 2498 C CG2   . VAL C 3 203 ? 57.187  52.139 55.611  1.00 47.01  ? 580 VAL L CG2   1 
ATOM 2499 N N     . GLU C 3 204 ? 59.705  50.977 51.859  1.00 45.31  ? 581 GLU L N     1 
ATOM 2500 C CA    . GLU C 3 204 ? 60.767  50.296 51.125  1.00 46.19  ? 581 GLU L CA    1 
ATOM 2501 C C     . GLU C 3 204 ? 62.144  50.647 51.677  1.00 48.08  ? 581 GLU L C     1 
ATOM 2502 O O     . GLU C 3 204 ? 63.108  49.923 51.445  1.00 48.40  ? 581 GLU L O     1 
ATOM 2503 C CB    . GLU C 3 204 ? 60.738  50.666 49.639  1.00 43.08  ? 581 GLU L CB    1 
ATOM 2504 C CG    . GLU C 3 204 ? 59.370  50.709 48.994  1.00 44.71  ? 581 GLU L CG    1 
ATOM 2505 C CD    . GLU C 3 204 ? 59.441  50.855 47.465  1.00 47.44  ? 581 GLU L CD    1 
ATOM 2506 O OE1   . GLU C 3 204 ? 58.459  51.355 46.848  1.00 45.02  ? 581 GLU L OE1   1 
ATOM 2507 O OE2   . GLU C 3 204 ? 60.479  50.451 46.880  1.00 47.59  ? 581 GLU L OE2   1 
ATOM 2508 N N     . ARG C 3 205 ? 62.249  51.745 52.416  1.00 49.72  ? 582 ARG L N     1 
ATOM 2509 C CA    . ARG C 3 205 ? 63.551  52.125 52.931  1.00 51.90  ? 582 ARG L CA    1 
ATOM 2510 C C     . ARG C 3 205 ? 63.456  53.130 54.076  1.00 52.26  ? 582 ARG L C     1 
ATOM 2511 O O     . ARG C 3 205 ? 62.440  53.811 54.233  1.00 51.75  ? 582 ARG L O     1 
ATOM 2512 C CB    . ARG C 3 205 ? 64.365  52.700 51.782  1.00 55.73  ? 582 ARG L CB    1 
ATOM 2513 C CG    . ARG C 3 205 ? 65.862  52.703 51.969  1.00 62.45  ? 582 ARG L CG    1 
ATOM 2514 C CD    . ARG C 3 205 ? 66.500  53.320 50.726  1.00 67.51  ? 582 ARG L CD    1 
ATOM 2515 N NE    . ARG C 3 205 ? 67.949  53.454 50.825  1.00 74.53  ? 582 ARG L NE    1 
ATOM 2516 C CZ    . ARG C 3 205 ? 68.672  54.241 50.034  1.00 78.74  ? 582 ARG L CZ    1 
ATOM 2517 N NH1   . ARG C 3 205 ? 68.076  54.960 49.088  1.00 80.97  ? 582 ARG L NH1   1 
ATOM 2518 N NH2   . ARG C 3 205 ? 69.990  54.321 50.191  1.00 81.25  ? 582 ARG L NH2   1 
ATOM 2519 N N     . GLN C 3 206 ? 64.525  53.205 54.872  1.00 53.01  ? 583 GLN L N     1 
ATOM 2520 C CA    . GLN C 3 206 ? 64.631  54.104 56.031  1.00 52.91  ? 583 GLN L CA    1 
ATOM 2521 C C     . GLN C 3 206 ? 66.074  54.581 56.127  1.00 53.58  ? 583 GLN L C     1 
ATOM 2522 O O     . GLN C 3 206 ? 66.997  53.802 55.924  1.00 53.50  ? 583 GLN L O     1 
ATOM 2523 C CB    . GLN C 3 206 ? 64.241  53.360 57.307  1.00 51.65  ? 583 GLN L CB    1 
ATOM 2524 C CG    . GLN C 3 206 ? 64.744  51.928 57.350  1.00 52.47  ? 583 GLN L CG    1 
ATOM 2525 C CD    . GLN C 3 206 ? 64.222  51.156 58.540  1.00 54.21  ? 583 GLN L CD    1 
ATOM 2526 O OE1   . GLN C 3 206 ? 64.705  51.315 59.658  1.00 56.39  ? 583 GLN L OE1   1 
ATOM 2527 N NE2   . GLN C 3 206 ? 63.223  50.319 58.309  1.00 54.91  ? 583 GLN L NE2   1 
ATOM 2528 N N     . ASP C 3 207 ? 66.272  55.857 56.433  1.00 55.44  ? 584 ASP L N     1 
ATOM 2529 C CA    . ASP C 3 207 ? 67.622  56.418 56.515  1.00 58.25  ? 584 ASP L CA    1 
ATOM 2530 C C     . ASP C 3 207 ? 68.341  56.169 57.838  1.00 60.51  ? 584 ASP L C     1 
ATOM 2531 O O     . ASP C 3 207 ? 69.499  56.563 58.004  1.00 59.60  ? 584 ASP L O     1 
ATOM 2532 C CB    . ASP C 3 207 ? 67.578  57.923 56.247  1.00 57.45  ? 584 ASP L CB    1 
ATOM 2533 C CG    . ASP C 3 207 ? 66.718  58.665 57.242  1.00 58.74  ? 584 ASP L CG    1 
ATOM 2534 O OD1   . ASP C 3 207 ? 66.521  59.884 57.068  1.00 61.54  ? 584 ASP L OD1   1 
ATOM 2535 O OD2   . ASP C 3 207 ? 66.238  58.034 58.204  1.00 59.83  ? 584 ASP L OD2   1 
ATOM 2536 N N     . THR C 3 208 ? 67.649  55.521 58.774  1.00 62.91  ? 585 THR L N     1 
ATOM 2537 C CA    . THR C 3 208 ? 68.212  55.225 60.087  1.00 63.57  ? 585 THR L CA    1 
ATOM 2538 C C     . THR C 3 208 ? 67.869  53.818 60.515  1.00 64.01  ? 585 THR L C     1 
ATOM 2539 O O     . THR C 3 208 ? 66.737  53.370 60.340  1.00 63.41  ? 585 THR L O     1 
ATOM 2540 C CB    . THR C 3 208 ? 67.668  56.159 61.163  1.00 63.78  ? 585 THR L CB    1 
ATOM 2541 O OG1   . THR C 3 208 ? 67.788  57.519 60.733  1.00 64.18  ? 585 THR L OG1   1 
ATOM 2542 C CG2   . THR C 3 208 ? 68.449  55.967 62.446  1.00 64.18  ? 585 THR L CG2   1 
ATOM 2543 N N     . ASP C 3 209 ? 68.840  53.139 61.108  1.00 65.00  ? 586 ASP L N     1 
ATOM 2544 C CA    . ASP C 3 209 ? 68.632  51.777 61.548  1.00 67.30  ? 586 ASP L CA    1 
ATOM 2545 C C     . ASP C 3 209 ? 68.736  51.590 63.045  1.00 69.57  ? 586 ASP L C     1 
ATOM 2546 O O     . ASP C 3 209 ? 68.360  50.540 63.568  1.00 70.62  ? 586 ASP L O     1 
ATOM 2547 C CB    . ASP C 3 209 ? 69.614  50.875 60.833  1.00 67.36  ? 586 ASP L CB    1 
ATOM 2548 C CG    . ASP C 3 209 ? 69.313  50.778 59.369  1.00 68.97  ? 586 ASP L CG    1 
ATOM 2549 O OD1   . ASP C 3 209 ? 68.459  49.945 58.995  1.00 69.83  ? 586 ASP L OD1   1 
ATOM 2550 O OD2   . ASP C 3 209 ? 69.905  51.557 58.594  1.00 70.73  ? 586 ASP L OD2   1 
ATOM 2551 N N     . SER C 3 210 ? 69.230  52.608 63.740  1.00 71.13  ? 587 SER L N     1 
ATOM 2552 C CA    . SER C 3 210 ? 69.362  52.522 65.189  1.00 72.87  ? 587 SER L CA    1 
ATOM 2553 C C     . SER C 3 210 ? 69.701  53.880 65.756  1.00 74.49  ? 587 SER L C     1 
ATOM 2554 O O     . SER C 3 210 ? 70.018  54.802 65.013  1.00 75.12  ? 587 SER L O     1 
ATOM 2555 C CB    . SER C 3 210 ? 70.474  51.554 65.564  1.00 72.64  ? 587 SER L CB    1 
ATOM 2556 O OG    . SER C 3 210 ? 71.728  52.100 65.197  1.00 72.80  ? 587 SER L OG    1 
ATOM 2557 N N     . CYS C 3 211 ? 69.640  53.997 67.077  1.00 76.81  ? 588 CYS L N     1 
ATOM 2558 C CA    . CYS C 3 211 ? 69.963  55.253 67.739  1.00 79.14  ? 588 CYS L CA    1 
ATOM 2559 C C     . CYS C 3 211 ? 69.867  55.090 69.243  1.00 80.99  ? 588 CYS L C     1 
ATOM 2560 O O     . CYS C 3 211 ? 69.202  54.179 69.735  1.00 81.09  ? 588 CYS L O     1 
ATOM 2561 C CB    . CYS C 3 211 ? 69.011  56.364 67.289  1.00 78.22  ? 588 CYS L CB    1 
ATOM 2562 S SG    . CYS C 3 211 ? 67.342  56.206 67.939  1.00 75.88  ? 588 CYS L SG    1 
ATOM 2563 N N     . LEU C 3 212 ? 70.533  55.983 69.965  1.00 83.84  ? 589 LEU L N     1 
ATOM 2564 C CA    . LEU C 3 212 ? 70.529  55.955 71.423  1.00 86.72  ? 589 LEU L CA    1 
ATOM 2565 C C     . LEU C 3 212 ? 69.108  55.928 71.980  1.00 88.36  ? 589 LEU L C     1 
ATOM 2566 O O     . LEU C 3 212 ? 68.191  56.511 71.407  1.00 89.23  ? 589 LEU L O     1 
ATOM 2567 C CB    . LEU C 3 212 ? 71.285  57.168 71.973  1.00 86.65  ? 589 LEU L CB    1 
ATOM 2568 C CG    . LEU C 3 212 ? 72.815  57.138 71.879  1.00 86.32  ? 589 LEU L CG    1 
ATOM 2569 C CD1   . LEU C 3 212 ? 73.272  56.855 70.453  1.00 86.50  ? 589 LEU L CD1   1 
ATOM 2570 C CD2   . LEU C 3 212 ? 73.352  58.469 72.365  1.00 86.53  ? 589 LEU L CD2   1 
ATOM 2571 N N     . VAL C 3 213 ? 68.940  55.249 73.106  1.00 90.07  ? 590 VAL L N     1 
ATOM 2572 C CA    . VAL C 3 213 ? 67.641  55.114 73.751  1.00 92.30  ? 590 VAL L CA    1 
ATOM 2573 C C     . VAL C 3 213 ? 66.947  56.428 74.107  1.00 92.37  ? 590 VAL L C     1 
ATOM 2574 O O     . VAL C 3 213 ? 65.751  56.440 74.414  1.00 92.28  ? 590 VAL L O     1 
ATOM 2575 C CB    . VAL C 3 213 ? 67.768  54.263 75.019  1.00 93.61  ? 590 VAL L CB    1 
ATOM 2576 C CG1   . VAL C 3 213 ? 68.205  52.848 74.646  1.00 94.63  ? 590 VAL L CG1   1 
ATOM 2577 C CG2   . VAL C 3 213 ? 68.780  54.898 75.965  1.00 94.84  ? 590 VAL L CG2   1 
ATOM 2578 N N     . TYR C 3 214 ? 67.688  57.530 74.077  1.00 92.52  ? 591 TYR L N     1 
ATOM 2579 C CA    . TYR C 3 214 ? 67.090  58.822 74.381  1.00 93.19  ? 591 TYR L CA    1 
ATOM 2580 C C     . TYR C 3 214 ? 66.169  59.187 73.213  1.00 91.58  ? 591 TYR L C     1 
ATOM 2581 O O     . TYR C 3 214 ? 65.257  60.002 73.363  1.00 91.91  ? 591 TYR L O     1 
ATOM 2582 C CB    . TYR C 3 214 ? 68.166  59.908 74.532  1.00 97.79  ? 591 TYR L CB    1 
ATOM 2583 C CG    . TYR C 3 214 ? 69.318  59.563 75.460  1.00 101.81 ? 591 TYR L CG    1 
ATOM 2584 C CD1   . TYR C 3 214 ? 69.110  59.337 76.823  1.00 103.09 ? 591 TYR L CD1   1 
ATOM 2585 C CD2   . TYR C 3 214 ? 70.618  59.446 74.964  1.00 103.51 ? 591 TYR L CD2   1 
ATOM 2586 C CE1   . TYR C 3 214 ? 70.171  58.994 77.668  1.00 104.96 ? 591 TYR L CE1   1 
ATOM 2587 C CE2   . TYR C 3 214 ? 71.682  59.104 75.798  1.00 105.85 ? 591 TYR L CE2   1 
ATOM 2588 C CZ    . TYR C 3 214 ? 71.456  58.875 77.147  1.00 105.91 ? 591 TYR L CZ    1 
ATOM 2589 O OH    . TYR C 3 214 ? 72.511  58.495 77.953  1.00 105.97 ? 591 TYR L OH    1 
ATOM 2590 N N     . GLY C 3 215 ? 66.424  58.579 72.052  1.00 89.00  ? 592 GLY L N     1 
ATOM 2591 C CA    . GLY C 3 215 ? 65.626  58.831 70.859  1.00 84.93  ? 592 GLY L CA    1 
ATOM 2592 C C     . GLY C 3 215 ? 65.679  60.279 70.420  1.00 82.22  ? 592 GLY L C     1 
ATOM 2593 O O     . GLY C 3 215 ? 66.734  60.899 70.454  1.00 81.97  ? 592 GLY L O     1 
ATOM 2594 N N     . GLY C 3 216 ? 64.545  60.813 69.987  1.00 80.42  ? 593 GLY L N     1 
ATOM 2595 C CA    . GLY C 3 216 ? 64.493  62.206 69.582  1.00 79.55  ? 593 GLY L CA    1 
ATOM 2596 C C     . GLY C 3 216 ? 64.963  62.605 68.193  1.00 79.07  ? 593 GLY L C     1 
ATOM 2597 O O     . GLY C 3 216 ? 64.688  63.729 67.765  1.00 79.08  ? 593 GLY L O     1 
ATOM 2598 N N     . GLN C 3 217 ? 65.669  61.721 67.488  1.00 78.49  ? 594 GLN L N     1 
ATOM 2599 C CA    . GLN C 3 217 ? 66.155  62.030 66.137  1.00 77.26  ? 594 GLN L CA    1 
ATOM 2600 C C     . GLN C 3 217 ? 65.060  61.858 65.072  1.00 73.88  ? 594 GLN L C     1 
ATOM 2601 O O     . GLN C 3 217 ? 64.045  61.189 65.305  1.00 73.17  ? 594 GLN L O     1 
ATOM 2602 C CB    . GLN C 3 217 ? 67.336  61.133 65.785  1.00 80.97  ? 594 GLN L CB    1 
ATOM 2603 C CG    . GLN C 3 217 ? 68.520  61.284 66.700  1.00 88.65  ? 594 GLN L CG    1 
ATOM 2604 C CD    . GLN C 3 217 ? 69.364  60.024 66.737  1.00 94.41  ? 594 GLN L CD    1 
ATOM 2605 O OE1   . GLN C 3 217 ? 69.909  59.594 65.715  1.00 96.73  ? 594 GLN L OE1   1 
ATOM 2606 N NE2   . GLN C 3 217 ? 69.468  59.414 67.921  1.00 97.65  ? 594 GLN L NE2   1 
ATOM 2607 N N     . GLN C 3 218 ? 65.278  62.459 63.902  1.00 68.87  ? 595 GLN L N     1 
ATOM 2608 C CA    . GLN C 3 218 ? 64.325  62.385 62.798  1.00 63.15  ? 595 GLN L CA    1 
ATOM 2609 C C     . GLN C 3 218 ? 64.656  61.261 61.830  1.00 59.23  ? 595 GLN L C     1 
ATOM 2610 O O     . GLN C 3 218 ? 65.778  61.158 61.350  1.00 58.90  ? 595 GLN L O     1 
ATOM 2611 C CB    . GLN C 3 218 ? 64.313  63.695 62.014  1.00 63.68  ? 595 GLN L CB    1 
ATOM 2612 C CG    . GLN C 3 218 ? 63.316  63.699 60.854  1.00 64.24  ? 595 GLN L CG    1 
ATOM 2613 C CD    . GLN C 3 218 ? 63.697  64.657 59.735  1.00 63.36  ? 595 GLN L CD    1 
ATOM 2614 O OE1   . GLN C 3 218 ? 64.715  64.466 59.056  1.00 62.82  ? 595 GLN L OE1   1 
ATOM 2615 N NE2   . GLN C 3 218 ? 62.878  65.693 59.535  1.00 61.64  ? 595 GLN L NE2   1 
ATOM 2616 N N     . MET C 3 219 ? 63.674  60.426 61.528  1.00 54.73  ? 596 MET L N     1 
ATOM 2617 C CA    . MET C 3 219 ? 63.899  59.339 60.591  1.00 52.10  ? 596 MET L CA    1 
ATOM 2618 C C     . MET C 3 219 ? 63.072  59.461 59.296  1.00 50.33  ? 596 MET L C     1 
ATOM 2619 O O     . MET C 3 219 ? 61.872  59.751 59.324  1.00 50.83  ? 596 MET L O     1 
ATOM 2620 C CB    . MET C 3 219 ? 63.593  58.006 61.246  1.00 50.76  ? 596 MET L CB    1 
ATOM 2621 C CG    . MET C 3 219 ? 63.777  56.861 60.299  1.00 52.97  ? 596 MET L CG    1 
ATOM 2622 S SD    . MET C 3 219 ? 63.209  55.325 61.003  1.00 61.36  ? 596 MET L SD    1 
ATOM 2623 C CE    . MET C 3 219 ? 61.434  55.710 61.169  1.00 57.97  ? 596 MET L CE    1 
ATOM 2624 N N     . ILE C 3 220 ? 63.718  59.234 58.160  1.00 46.05  ? 597 ILE L N     1 
ATOM 2625 C CA    . ILE C 3 220 ? 63.032  59.304 56.889  1.00 41.13  ? 597 ILE L CA    1 
ATOM 2626 C C     . ILE C 3 220 ? 62.753  57.931 56.304  1.00 42.61  ? 597 ILE L C     1 
ATOM 2627 O O     . ILE C 3 220 ? 63.655  57.104 56.180  1.00 45.07  ? 597 ILE L O     1 
ATOM 2628 C CB    . ILE C 3 220 ? 63.839  60.105 55.897  1.00 36.99  ? 597 ILE L CB    1 
ATOM 2629 C CG1   . ILE C 3 220 ? 63.885  61.555 56.379  1.00 36.15  ? 597 ILE L CG1   1 
ATOM 2630 C CG2   . ILE C 3 220 ? 63.260  59.944 54.504  1.00 35.12  ? 597 ILE L CG2   1 
ATOM 2631 C CD1   . ILE C 3 220 ? 64.376  62.538 55.373  1.00 32.68  ? 597 ILE L CD1   1 
ATOM 2632 N N     . LEU C 3 221 ? 61.492  57.687 55.959  1.00 42.25  ? 598 LEU L N     1 
ATOM 2633 C CA    . LEU C 3 221 ? 61.081  56.420 55.361  1.00 40.21  ? 598 LEU L CA    1 
ATOM 2634 C C     . LEU C 3 221 ? 60.725  56.661 53.898  1.00 39.07  ? 598 LEU L C     1 
ATOM 2635 O O     . LEU C 3 221 ? 60.221  57.717 53.534  1.00 38.66  ? 598 LEU L O     1 
ATOM 2636 C CB    . LEU C 3 221 ? 59.862  55.862 56.081  1.00 41.30  ? 598 LEU L CB    1 
ATOM 2637 C CG    . LEU C 3 221 ? 59.991  55.675 57.585  1.00 41.25  ? 598 LEU L CG    1 
ATOM 2638 C CD1   . LEU C 3 221 ? 58.706  55.077 58.155  1.00 39.54  ? 598 LEU L CD1   1 
ATOM 2639 C CD2   . LEU C 3 221 ? 61.174  54.767 57.846  1.00 43.39  ? 598 LEU L CD2   1 
ATOM 2640 N N     . THR C 3 222 ? 60.979  55.672 53.062  1.00 37.91  ? 599 THR L N     1 
ATOM 2641 C CA    . THR C 3 222 ? 60.698  55.798 51.655  1.00 36.84  ? 599 THR L CA    1 
ATOM 2642 C C     . THR C 3 222 ? 59.820  54.648 51.230  1.00 38.37  ? 599 THR L C     1 
ATOM 2643 O O     . THR C 3 222 ? 60.188  53.482 51.379  1.00 38.63  ? 599 THR L O     1 
ATOM 2644 C CB    . THR C 3 222 ? 61.985  55.766 50.888  1.00 35.18  ? 599 THR L CB    1 
ATOM 2645 O OG1   . THR C 3 222 ? 62.854  56.753 51.433  1.00 37.67  ? 599 THR L OG1   1 
ATOM 2646 C CG2   . THR C 3 222 ? 61.756  56.084 49.449  1.00 38.55  ? 599 THR L CG2   1 
ATOM 2647 N N     . GLY C 3 223 ? 58.646  54.978 50.712  1.00 39.75  ? 600 GLY L N     1 
ATOM 2648 C CA    . GLY C 3 223 ? 57.736  53.944 50.277  1.00 41.69  ? 600 GLY L CA    1 
ATOM 2649 C C     . GLY C 3 223 ? 56.626  54.534 49.448  1.00 43.84  ? 600 GLY L C     1 
ATOM 2650 O O     . GLY C 3 223 ? 56.828  55.537 48.772  1.00 43.56  ? 600 GLY L O     1 
ATOM 2651 N N     . GLN C 3 224 ? 55.452  53.914 49.510  1.00 46.86  ? 601 GLN L N     1 
ATOM 2652 C CA    . GLN C 3 224 ? 54.291  54.366 48.757  1.00 50.44  ? 601 GLN L CA    1 
ATOM 2653 C C     . GLN C 3 224 ? 53.063  54.413 49.636  1.00 51.17  ? 601 GLN L C     1 
ATOM 2654 O O     . GLN C 3 224 ? 53.000  53.755 50.670  1.00 52.43  ? 601 GLN L O     1 
ATOM 2655 C CB    . GLN C 3 224 ? 53.979  53.403 47.614  1.00 52.84  ? 601 GLN L CB    1 
ATOM 2656 C CG    . GLN C 3 224 ? 54.964  53.370 46.474  1.00 58.00  ? 601 GLN L CG    1 
ATOM 2657 C CD    . GLN C 3 224 ? 55.072  51.984 45.871  1.00 61.26  ? 601 GLN L CD    1 
ATOM 2658 O OE1   . GLN C 3 224 ? 55.893  51.168 46.304  1.00 62.65  ? 601 GLN L OE1   1 
ATOM 2659 N NE2   . GLN C 3 224 ? 54.229  51.699 44.883  1.00 63.30  ? 601 GLN L NE2   1 
ATOM 2660 N N     . ASN C 3 225 ? 52.086  55.195 49.201  1.00 51.84  ? 602 ASN L N     1 
ATOM 2661 C CA    . ASN C 3 225 ? 50.814  55.298 49.882  1.00 52.15  ? 602 ASN L CA    1 
ATOM 2662 C C     . ASN C 3 225 ? 50.821  55.955 51.238  1.00 53.42  ? 602 ASN L C     1 
ATOM 2663 O O     . ASN C 3 225 ? 49.972  55.645 52.075  1.00 53.45  ? 602 ASN L O     1 
ATOM 2664 C CB    . ASN C 3 225 ? 50.213  53.909 49.992  1.00 52.16  ? 602 ASN L CB    1 
ATOM 2665 C CG    . ASN C 3 225 ? 50.202  53.188 48.666  1.00 52.07  ? 602 ASN L CG    1 
ATOM 2666 O OD1   . ASN C 3 225 ? 50.147  51.960 48.614  1.00 54.78  ? 602 ASN L OD1   1 
ATOM 2667 N ND2   . ASN C 3 225 ? 50.249  53.948 47.581  1.00 51.62  ? 602 ASN L ND2   1 
ATOM 2668 N N     . PHE C 3 226 ? 51.775  56.852 51.465  1.00 55.72  ? 603 PHE L N     1 
ATOM 2669 C CA    . PHE C 3 226 ? 51.840  57.574 52.738  1.00 58.53  ? 603 PHE L CA    1 
ATOM 2670 C C     . PHE C 3 226 ? 50.980  58.832 52.610  1.00 62.23  ? 603 PHE L C     1 
ATOM 2671 O O     . PHE C 3 226 ? 51.105  59.595 51.649  1.00 62.66  ? 603 PHE L O     1 
ATOM 2672 C CB    . PHE C 3 226 ? 53.269  58.012 53.064  1.00 55.26  ? 603 PHE L CB    1 
ATOM 2673 C CG    . PHE C 3 226 ? 54.228  56.891 53.256  1.00 52.72  ? 603 PHE L CG    1 
ATOM 2674 C CD1   . PHE C 3 226 ? 55.588  57.151 53.344  1.00 52.78  ? 603 PHE L CD1   1 
ATOM 2675 C CD2   . PHE C 3 226 ? 53.787  55.579 53.342  1.00 52.35  ? 603 PHE L CD2   1 
ATOM 2676 C CE1   . PHE C 3 226 ? 56.502  56.114 53.513  1.00 53.26  ? 603 PHE L CE1   1 
ATOM 2677 C CE2   . PHE C 3 226 ? 54.690  54.529 53.511  1.00 52.06  ? 603 PHE L CE2   1 
ATOM 2678 C CZ    . PHE C 3 226 ? 56.051  54.796 53.596  1.00 52.41  ? 603 PHE L CZ    1 
ATOM 2679 N N     . THR C 3 227 ? 50.105  59.051 53.578  1.00 66.60  ? 604 THR L N     1 
ATOM 2680 C CA    . THR C 3 227 ? 49.253  60.229 53.555  1.00 70.62  ? 604 THR L CA    1 
ATOM 2681 C C     . THR C 3 227 ? 49.552  61.022 54.820  1.00 73.84  ? 604 THR L C     1 
ATOM 2682 O O     . THR C 3 227 ? 49.897  60.446 55.846  1.00 74.64  ? 604 THR L O     1 
ATOM 2683 C CB    . THR C 3 227 ? 47.763  59.821 53.502  1.00 69.75  ? 604 THR L CB    1 
ATOM 2684 O OG1   . THR C 3 227 ? 47.382  59.179 54.726  1.00 70.26  ? 604 THR L OG1   1 
ATOM 2685 C CG2   . THR C 3 227 ? 47.541  58.843 52.356  1.00 69.37  ? 604 THR L CG2   1 
ATOM 2686 N N     . SER C 3 228 ? 49.460  62.342 54.754  1.00 78.18  ? 605 SER L N     1 
ATOM 2687 C CA    . SER C 3 228 ? 49.730  63.135 55.940  1.00 82.52  ? 605 SER L CA    1 
ATOM 2688 C C     . SER C 3 228 ? 48.948  62.500 57.091  1.00 84.98  ? 605 SER L C     1 
ATOM 2689 O O     . SER C 3 228 ? 49.362  62.560 58.253  1.00 85.95  ? 605 SER L O     1 
ATOM 2690 C CB    . SER C 3 228 ? 49.301  64.590 55.716  1.00 83.26  ? 605 SER L CB    1 
ATOM 2691 O OG    . SER C 3 228 ? 47.977  64.669 55.214  1.00 85.97  ? 605 SER L OG    1 
ATOM 2692 N N     . GLU C 3 229 ? 47.829  61.862 56.752  1.00 86.30  ? 606 GLU L N     1 
ATOM 2693 C CA    . GLU C 3 229 ? 46.987  61.201 57.743  1.00 87.26  ? 606 GLU L CA    1 
ATOM 2694 C C     . GLU C 3 229 ? 47.551  59.836 58.132  1.00 82.31  ? 606 GLU L C     1 
ATOM 2695 O O     . GLU C 3 229 ? 46.813  58.941 58.552  1.00 82.13  ? 606 GLU L O     1 
ATOM 2696 C CB    . GLU C 3 229 ? 45.562  61.040 57.201  1.00 95.68  ? 606 GLU L CB    1 
ATOM 2697 C CG    . GLU C 3 229 ? 44.902  62.362 56.834  1.00 108.02 ? 606 GLU L CG    1 
ATOM 2698 C CD    . GLU C 3 229 ? 44.773  63.303 58.027  1.00 115.14 ? 606 GLU L CD    1 
ATOM 2699 O OE1   . GLU C 3 229 ? 43.973  63.002 58.941  1.00 119.76 ? 606 GLU L OE1   1 
ATOM 2700 O OE2   . GLU C 3 229 ? 45.475  64.340 58.053  1.00 118.48 ? 606 GLU L OE2   1 
ATOM 2701 N N     . SER C 3 230 ? 48.864  59.683 57.987  1.00 76.23  ? 607 SER L N     1 
ATOM 2702 C CA    . SER C 3 230 ? 49.534  58.437 58.333  1.00 69.76  ? 607 SER L CA    1 
ATOM 2703 C C     . SER C 3 230 ? 50.158  58.589 59.701  1.00 66.73  ? 607 SER L C     1 
ATOM 2704 O O     . SER C 3 230 ? 50.497  59.699 60.119  1.00 65.10  ? 607 SER L O     1 
ATOM 2705 C CB    . SER C 3 230 ? 50.645  58.106 57.332  1.00 68.68  ? 607 SER L CB    1 
ATOM 2706 O OG    . SER C 3 230 ? 50.137  57.811 56.046  1.00 66.52  ? 607 SER L OG    1 
ATOM 2707 N N     . LYS C 3 231 ? 50.305  57.466 60.393  1.00 63.51  ? 608 LYS L N     1 
ATOM 2708 C CA    . LYS C 3 231 ? 50.912  57.448 61.713  1.00 61.16  ? 608 LYS L CA    1 
ATOM 2709 C C     . LYS C 3 231 ? 51.951  56.348 61.760  1.00 59.77  ? 608 LYS L C     1 
ATOM 2710 O O     . LYS C 3 231 ? 51.927  55.417 60.955  1.00 59.45  ? 608 LYS L O     1 
ATOM 2711 C CB    . LYS C 3 231 ? 49.861  57.205 62.783  1.00 60.50  ? 608 LYS L CB    1 
ATOM 2712 C CG    . LYS C 3 231 ? 48.803  58.276 62.826  1.00 61.85  ? 608 LYS L CG    1 
ATOM 2713 C CD    . LYS C 3 231 ? 47.847  58.023 63.962  1.00 63.39  ? 608 LYS L CD    1 
ATOM 2714 C CE    . LYS C 3 231 ? 46.612  58.879 63.825  1.00 65.52  ? 608 LYS L CE    1 
ATOM 2715 N NZ    . LYS C 3 231 ? 45.590  58.465 64.825  1.00 68.05  ? 608 LYS L NZ    1 
ATOM 2716 N N     . VAL C 3 232 ? 52.876  56.455 62.699  1.00 58.51  ? 609 VAL L N     1 
ATOM 2717 C CA    . VAL C 3 232 ? 53.914  55.448 62.816  1.00 57.03  ? 609 VAL L CA    1 
ATOM 2718 C C     . VAL C 3 232 ? 53.888  54.908 64.237  1.00 58.28  ? 609 VAL L C     1 
ATOM 2719 O O     . VAL C 3 232 ? 53.906  55.678 65.203  1.00 58.70  ? 609 VAL L O     1 
ATOM 2720 C CB    . VAL C 3 232 ? 55.294  56.054 62.520  1.00 55.05  ? 609 VAL L CB    1 
ATOM 2721 C CG1   . VAL C 3 232 ? 56.351  54.960 62.499  1.00 53.02  ? 609 VAL L CG1   1 
ATOM 2722 C CG2   . VAL C 3 232 ? 55.246  56.820 61.213  1.00 52.08  ? 609 VAL L CG2   1 
ATOM 2723 N N     . VAL C 3 233 ? 53.835  53.588 64.362  1.00 58.85  ? 610 VAL L N     1 
ATOM 2724 C CA    . VAL C 3 233 ? 53.794  52.955 65.670  1.00 60.65  ? 610 VAL L CA    1 
ATOM 2725 C C     . VAL C 3 233 ? 54.963  51.993 65.873  1.00 62.92  ? 610 VAL L C     1 
ATOM 2726 O O     . VAL C 3 233 ? 55.258  51.169 65.005  1.00 62.16  ? 610 VAL L O     1 
ATOM 2727 C CB    . VAL C 3 233 ? 52.458  52.180 65.865  1.00 59.20  ? 610 VAL L CB    1 
ATOM 2728 C CG1   . VAL C 3 233 ? 52.453  51.454 67.194  1.00 59.02  ? 610 VAL L CG1   1 
ATOM 2729 C CG2   . VAL C 3 233 ? 51.302  53.133 65.821  1.00 57.64  ? 610 VAL L CG2   1 
ATOM 2730 N N     . PHE C 3 234 ? 55.624  52.116 67.023  1.00 66.51  ? 611 PHE L N     1 
ATOM 2731 C CA    . PHE C 3 234 ? 56.744  51.245 67.398  1.00 70.49  ? 611 PHE L CA    1 
ATOM 2732 C C     . PHE C 3 234 ? 56.262  50.161 68.373  1.00 73.73  ? 611 PHE L C     1 
ATOM 2733 O O     . PHE C 3 234 ? 55.402  50.413 69.213  1.00 73.99  ? 611 PHE L O     1 
ATOM 2734 C CB    . PHE C 3 234 ? 57.861  52.050 68.081  1.00 69.34  ? 611 PHE L CB    1 
ATOM 2735 C CG    . PHE C 3 234 ? 58.813  52.722 67.125  1.00 68.84  ? 611 PHE L CG    1 
ATOM 2736 C CD1   . PHE C 3 234 ? 58.490  53.933 66.529  1.00 68.89  ? 611 PHE L CD1   1 
ATOM 2737 C CD2   . PHE C 3 234 ? 60.040  52.140 66.828  1.00 68.07  ? 611 PHE L CD2   1 
ATOM 2738 C CE1   . PHE C 3 234 ? 59.375  54.550 65.655  1.00 68.17  ? 611 PHE L CE1   1 
ATOM 2739 C CE2   . PHE C 3 234 ? 60.928  52.748 65.956  1.00 67.17  ? 611 PHE L CE2   1 
ATOM 2740 C CZ    . PHE C 3 234 ? 60.596  53.953 65.370  1.00 68.08  ? 611 PHE L CZ    1 
ATOM 2741 N N     . THR C 3 235 ? 56.812  48.959 68.265  1.00 77.73  ? 612 THR L N     1 
ATOM 2742 C CA    . THR C 3 235 ? 56.421  47.887 69.165  1.00 83.19  ? 612 THR L CA    1 
ATOM 2743 C C     . THR C 3 235 ? 57.631  47.072 69.604  1.00 88.18  ? 612 THR L C     1 
ATOM 2744 O O     . THR C 3 235 ? 58.775  47.427 69.318  1.00 88.97  ? 612 THR L O     1 
ATOM 2745 C CB    . THR C 3 235 ? 55.410  46.929 68.509  1.00 82.42  ? 612 THR L CB    1 
ATOM 2746 O OG1   . THR C 3 235 ? 56.064  46.153 67.498  1.00 82.19  ? 612 THR L OG1   1 
ATOM 2747 C CG2   . THR C 3 235 ? 54.269  47.709 67.894  1.00 82.37  ? 612 THR L CG2   1 
ATOM 2748 N N     . GLU C 3 236 ? 57.359  45.978 70.309  1.00 93.38  ? 613 GLU L N     1 
ATOM 2749 C CA    . GLU C 3 236 ? 58.386  45.066 70.804  1.00 97.48  ? 613 GLU L CA    1 
ATOM 2750 C C     . GLU C 3 236 ? 57.670  43.918 71.475  1.00 98.86  ? 613 GLU L C     1 
ATOM 2751 O O     . GLU C 3 236 ? 56.877  44.128 72.384  1.00 99.28  ? 613 GLU L O     1 
ATOM 2752 C CB    . GLU C 3 236 ? 59.295  45.746 71.826  1.00 99.33  ? 613 GLU L CB    1 
ATOM 2753 C CG    . GLU C 3 236 ? 60.283  44.790 72.475  1.00 102.44 ? 613 GLU L CG    1 
ATOM 2754 C CD    . GLU C 3 236 ? 61.099  45.446 73.575  1.00 104.58 ? 613 GLU L CD    1 
ATOM 2755 O OE1   . GLU C 3 236 ? 61.917  44.744 74.208  1.00 105.43 ? 613 GLU L OE1   1 
ATOM 2756 O OE2   . GLU C 3 236 ? 60.923  46.661 73.809  1.00 105.28 ? 613 GLU L OE2   1 
ATOM 2757 N N     . LYS C 3 237 ? 57.942  42.707 71.019  1.00 100.69 ? 614 LYS L N     1 
ATOM 2758 C CA    . LYS C 3 237 ? 57.304  41.542 71.595  1.00 102.96 ? 614 LYS L CA    1 
ATOM 2759 C C     . LYS C 3 237 ? 58.340  40.526 72.030  1.00 104.80 ? 614 LYS L C     1 
ATOM 2760 O O     . LYS C 3 237 ? 59.525  40.668 71.720  1.00 104.97 ? 614 LYS L O     1 
ATOM 2761 C CB    . LYS C 3 237 ? 56.338  40.911 70.591  1.00 103.36 ? 614 LYS L CB    1 
ATOM 2762 C CG    . LYS C 3 237 ? 56.694  41.132 69.128  1.00 103.78 ? 614 LYS L CG    1 
ATOM 2763 C CD    . LYS C 3 237 ? 56.283  42.525 68.657  1.00 104.42 ? 614 LYS L CD    1 
ATOM 2764 C CE    . LYS C 3 237 ? 54.784  42.756 68.819  1.00 104.65 ? 614 LYS L CE    1 
ATOM 2765 N NZ    . LYS C 3 237 ? 53.960  41.730 68.109  1.00 104.49 ? 614 LYS L NZ    1 
ATOM 2766 N N     . THR C 3 238 ? 57.885  39.516 72.768  1.00 106.88 ? 615 THR L N     1 
ATOM 2767 C CA    . THR C 3 238 ? 58.754  38.449 73.257  1.00 108.12 ? 615 THR L CA    1 
ATOM 2768 C C     . THR C 3 238 ? 58.669  37.313 72.257  1.00 110.02 ? 615 THR L C     1 
ATOM 2769 O O     . THR C 3 238 ? 57.808  37.318 71.383  1.00 109.67 ? 615 THR L O     1 
ATOM 2770 C CB    . THR C 3 238 ? 58.288  37.921 74.618  1.00 107.04 ? 615 THR L CB    1 
ATOM 2771 O OG1   . THR C 3 238 ? 57.040  37.235 74.461  1.00 106.52 ? 615 THR L OG1   1 
ATOM 2772 C CG2   . THR C 3 238 ? 58.103  39.066 75.591  1.00 106.29 ? 615 THR L CG2   1 
ATOM 2773 N N     . THR C 3 239 ? 59.552  36.335 72.383  1.00 112.62 ? 616 THR L N     1 
ATOM 2774 C CA    . THR C 3 239 ? 59.534  35.216 71.457  1.00 116.33 ? 616 THR L CA    1 
ATOM 2775 C C     . THR C 3 239 ? 58.113  34.705 71.246  1.00 118.90 ? 616 THR L C     1 
ATOM 2776 O O     . THR C 3 239 ? 57.804  34.129 70.204  1.00 119.26 ? 616 THR L O     1 
ATOM 2777 C CB    . THR C 3 239 ? 60.402  34.065 71.969  1.00 116.36 ? 616 THR L CB    1 
ATOM 2778 O OG1   . THR C 3 239 ? 61.735  34.542 72.189  1.00 116.68 ? 616 THR L OG1   1 
ATOM 2779 C CG2   . THR C 3 239 ? 60.433  32.932 70.953  1.00 116.09 ? 616 THR L CG2   1 
ATOM 2780 N N     . ASP C 3 240 ? 57.250  34.928 72.234  1.00 122.07 ? 617 ASP L N     1 
ATOM 2781 C CA    . ASP C 3 240 ? 55.858  34.488 72.154  1.00 125.21 ? 617 ASP L CA    1 
ATOM 2782 C C     . ASP C 3 240 ? 55.009  35.354 71.223  1.00 124.67 ? 617 ASP L C     1 
ATOM 2783 O O     . ASP C 3 240 ? 53.998  34.897 70.686  1.00 125.34 ? 617 ASP L O     1 
ATOM 2784 C CB    . ASP C 3 240 ? 55.213  34.477 73.549  1.00 129.61 ? 617 ASP L CB    1 
ATOM 2785 C CG    . ASP C 3 240 ? 55.688  33.317 74.410  1.00 133.17 ? 617 ASP L CG    1 
ATOM 2786 O OD1   . ASP C 3 240 ? 55.097  33.099 75.492  1.00 135.48 ? 617 ASP L OD1   1 
ATOM 2787 O OD2   . ASP C 3 240 ? 56.649  32.626 74.010  1.00 135.09 ? 617 ASP L OD2   1 
ATOM 2788 N N     . GLY C 3 241 ? 55.420  36.603 71.036  1.00 123.24 ? 618 GLY L N     1 
ATOM 2789 C CA    . GLY C 3 241 ? 54.669  37.505 70.182  1.00 121.30 ? 618 GLY L CA    1 
ATOM 2790 C C     . GLY C 3 241 ? 53.917  38.516 71.026  1.00 119.83 ? 618 GLY L C     1 
ATOM 2791 O O     . GLY C 3 241 ? 53.176  39.358 70.511  1.00 120.28 ? 618 GLY L O     1 
ATOM 2792 N N     . GLN C 3 242 ? 54.111  38.427 72.337  1.00 117.35 ? 619 GLN L N     1 
ATOM 2793 C CA    . GLN C 3 242 ? 53.459  39.335 73.263  1.00 114.41 ? 619 GLN L CA    1 
ATOM 2794 C C     . GLN C 3 242 ? 54.053  40.727 73.129  1.00 111.48 ? 619 GLN L C     1 
ATOM 2795 O O     . GLN C 3 242 ? 55.175  40.973 73.568  1.00 111.49 ? 619 GLN L O     1 
ATOM 2796 C CB    . GLN C 3 242 ? 53.638  38.851 74.703  1.00 115.46 ? 619 GLN L CB    1 
ATOM 2797 C CG    . GLN C 3 242 ? 53.030  37.490 74.999  1.00 116.28 ? 619 GLN L CG    1 
ATOM 2798 C CD    . GLN C 3 242 ? 53.082  37.153 76.480  1.00 116.62 ? 619 GLN L CD    1 
ATOM 2799 O OE1   . GLN C 3 242 ? 52.467  37.833 77.305  1.00 116.29 ? 619 GLN L OE1   1 
ATOM 2800 N NE2   . GLN C 3 242 ? 53.825  36.103 76.825  1.00 116.40 ? 619 GLN L NE2   1 
ATOM 2801 N N     . GLN C 3 243 ? 53.300  41.634 72.518  1.00 107.67 ? 620 GLN L N     1 
ATOM 2802 C CA    . GLN C 3 243 ? 53.762  43.002 72.348  1.00 103.89 ? 620 GLN L CA    1 
ATOM 2803 C C     . GLN C 3 243 ? 53.913  43.613 73.734  1.00 101.90 ? 620 GLN L C     1 
ATOM 2804 O O     . GLN C 3 243 ? 52.926  43.968 74.373  1.00 101.74 ? 620 GLN L O     1 
ATOM 2805 C CB    . GLN C 3 243 ? 52.749  43.797 71.522  1.00 103.53 ? 620 GLN L CB    1 
ATOM 2806 C CG    . GLN C 3 243 ? 53.216  45.192 71.124  1.00 101.81 ? 620 GLN L CG    1 
ATOM 2807 C CD    . GLN C 3 243 ? 52.262  45.882 70.159  1.00 100.68 ? 620 GLN L CD    1 
ATOM 2808 O OE1   . GLN C 3 243 ? 52.078  45.442 69.018  1.00 98.35  ? 620 GLN L OE1   1 
ATOM 2809 N NE2   . GLN C 3 243 ? 51.648  46.968 70.616  1.00 100.19 ? 620 GLN L NE2   1 
ATOM 2810 N N     . ILE C 3 244 ? 55.153  43.722 74.198  1.00 99.95  ? 621 ILE L N     1 
ATOM 2811 C CA    . ILE C 3 244 ? 55.436  44.276 75.518  1.00 97.61  ? 621 ILE L CA    1 
ATOM 2812 C C     . ILE C 3 244 ? 55.783  45.765 75.485  1.00 95.27  ? 621 ILE L C     1 
ATOM 2813 O O     . ILE C 3 244 ? 56.455  46.279 76.377  1.00 95.80  ? 621 ILE L O     1 
ATOM 2814 C CB    . ILE C 3 244 ? 56.591  43.507 76.203  1.00 98.82  ? 621 ILE L CB    1 
ATOM 2815 C CG1   . ILE C 3 244 ? 57.928  43.824 75.523  1.00 99.31  ? 621 ILE L CG1   1 
ATOM 2816 C CG2   . ILE C 3 244 ? 56.316  42.010 76.134  1.00 98.95  ? 621 ILE L CG2   1 
ATOM 2817 C CD1   . ILE C 3 244 ? 59.140  43.228 76.235  1.00 99.73  ? 621 ILE L CD1   1 
ATOM 2818 N N     . TRP C 3 245 ? 55.326  46.449 74.444  1.00 91.96  ? 622 TRP L N     1 
ATOM 2819 C CA    . TRP C 3 245 ? 55.556  47.878 74.298  1.00 87.74  ? 622 TRP L CA    1 
ATOM 2820 C C     . TRP C 3 245 ? 54.840  48.376 73.064  1.00 86.49  ? 622 TRP L C     1 
ATOM 2821 O O     . TRP C 3 245 ? 54.611  47.619 72.125  1.00 86.23  ? 622 TRP L O     1 
ATOM 2822 C CB    . TRP C 3 245 ? 57.035  48.187 74.170  1.00 85.14  ? 622 TRP L CB    1 
ATOM 2823 C CG    . TRP C 3 245 ? 57.309  49.657 74.160  1.00 83.11  ? 622 TRP L CG    1 
ATOM 2824 C CD1   . TRP C 3 245 ? 56.828  50.587 75.041  1.00 82.09  ? 622 TRP L CD1   1 
ATOM 2825 C CD2   . TRP C 3 245 ? 58.195  50.359 73.279  1.00 82.13  ? 622 TRP L CD2   1 
ATOM 2826 N NE1   . TRP C 3 245 ? 57.368  51.824 74.768  1.00 81.15  ? 622 TRP L NE1   1 
ATOM 2827 C CE2   . TRP C 3 245 ? 58.210  51.713 73.693  1.00 81.14  ? 622 TRP L CE2   1 
ATOM 2828 C CE3   . TRP C 3 245 ? 58.982  49.976 72.183  1.00 80.98  ? 622 TRP L CE3   1 
ATOM 2829 C CZ2   . TRP C 3 245 ? 58.983  52.683 73.051  1.00 80.68  ? 622 TRP L CZ2   1 
ATOM 2830 C CZ3   . TRP C 3 245 ? 59.748  50.940 71.545  1.00 81.01  ? 622 TRP L CZ3   1 
ATOM 2831 C CH2   . TRP C 3 245 ? 59.743  52.280 71.984  1.00 81.45  ? 622 TRP L CH2   1 
ATOM 2832 N N     . GLU C 3 246 ? 54.486  49.653 73.063  1.00 84.59  ? 623 GLU L N     1 
ATOM 2833 C CA    . GLU C 3 246 ? 53.781  50.214 71.930  1.00 83.20  ? 623 GLU L CA    1 
ATOM 2834 C C     . GLU C 3 246 ? 53.727  51.727 72.009  1.00 82.33  ? 623 GLU L C     1 
ATOM 2835 O O     . GLU C 3 246 ? 52.838  52.291 72.643  1.00 82.28  ? 623 GLU L O     1 
ATOM 2836 C CB    . GLU C 3 246 ? 52.362  49.661 71.881  1.00 82.96  ? 623 GLU L CB    1 
ATOM 2837 C CG    . GLU C 3 246 ? 51.597  50.075 70.652  1.00 83.49  ? 623 GLU L CG    1 
ATOM 2838 C CD    . GLU C 3 246 ? 50.109  50.012 70.864  1.00 83.53  ? 623 GLU L CD    1 
ATOM 2839 O OE1   . GLU C 3 246 ? 49.608  50.804 71.685  1.00 85.01  ? 623 GLU L OE1   1 
ATOM 2840 O OE2   . GLU C 3 246 ? 49.444  49.175 70.222  1.00 82.60  ? 623 GLU L OE2   1 
ATOM 2841 N N     . MET C 3 247 ? 54.675  52.379 71.349  1.00 81.49  ? 624 MET L N     1 
ATOM 2842 C CA    . MET C 3 247 ? 54.741  53.832 71.342  1.00 80.68  ? 624 MET L CA    1 
ATOM 2843 C C     . MET C 3 247 ? 54.453  54.395 69.950  1.00 79.99  ? 624 MET L C     1 
ATOM 2844 O O     . MET C 3 247 ? 54.891  53.834 68.944  1.00 80.42  ? 624 MET L O     1 
ATOM 2845 C CB    . MET C 3 247 ? 56.131  54.278 71.784  1.00 81.27  ? 624 MET L CB    1 
ATOM 2846 C CG    . MET C 3 247 ? 56.266  55.772 71.978  1.00 82.46  ? 624 MET L CG    1 
ATOM 2847 S SD    . MET C 3 247 ? 55.177  56.329 73.287  1.00 83.66  ? 624 MET L SD    1 
ATOM 2848 C CE    . MET C 3 247 ? 56.079  55.734 74.733  1.00 83.12  ? 624 MET L CE    1 
ATOM 2849 N N     . GLU C 3 248 ? 53.708  55.494 69.885  1.00 78.19  ? 625 GLU L N     1 
ATOM 2850 C CA    . GLU C 3 248 ? 53.428  56.107 68.593  1.00 76.67  ? 625 GLU L CA    1 
ATOM 2851 C C     . GLU C 3 248 ? 54.435  57.228 68.384  1.00 75.47  ? 625 GLU L C     1 
ATOM 2852 O O     . GLU C 3 248 ? 54.650  58.046 69.278  1.00 75.55  ? 625 GLU L O     1 
ATOM 2853 C CB    . GLU C 3 248 ? 52.018  56.686 68.534  1.00 76.78  ? 625 GLU L CB    1 
ATOM 2854 C CG    . GLU C 3 248 ? 51.768  57.455 67.252  1.00 78.36  ? 625 GLU L CG    1 
ATOM 2855 C CD    . GLU C 3 248 ? 50.386  58.055 67.180  1.00 80.58  ? 625 GLU L CD    1 
ATOM 2856 O OE1   . GLU C 3 248 ? 50.112  58.815 66.225  1.00 82.93  ? 625 GLU L OE1   1 
ATOM 2857 O OE2   . GLU C 3 248 ? 49.567  57.767 68.073  1.00 82.65  ? 625 GLU L OE2   1 
ATOM 2858 N N     . ALA C 3 249 ? 55.058  57.259 67.207  1.00 73.27  ? 626 ALA L N     1 
ATOM 2859 C CA    . ALA C 3 249 ? 56.043  58.286 66.897  1.00 69.01  ? 626 ALA L CA    1 
ATOM 2860 C C     . ALA C 3 249 ? 55.382  59.478 66.238  1.00 65.74  ? 626 ALA L C     1 
ATOM 2861 O O     . ALA C 3 249 ? 54.351  59.349 65.594  1.00 65.27  ? 626 ALA L O     1 
ATOM 2862 C CB    . ALA C 3 249 ? 57.114  57.720 65.987  1.00 69.32  ? 626 ALA L CB    1 
ATOM 2863 N N     . THR C 3 250 ? 55.983  60.642 66.416  1.00 63.33  ? 627 THR L N     1 
ATOM 2864 C CA    . THR C 3 250 ? 55.470  61.866 65.829  1.00 62.46  ? 627 THR L CA    1 
ATOM 2865 C C     . THR C 3 250 ? 55.923  62.010 64.379  1.00 62.25  ? 627 THR L C     1 
ATOM 2866 O O     . THR C 3 250 ? 57.100  61.823 64.062  1.00 60.39  ? 627 THR L O     1 
ATOM 2867 C CB    . THR C 3 250 ? 55.953  63.095 66.616  1.00 62.20  ? 627 THR L CB    1 
ATOM 2868 O OG1   . THR C 3 250 ? 55.251  63.163 67.861  1.00 63.11  ? 627 THR L OG1   1 
ATOM 2869 C CG2   . THR C 3 250 ? 55.731  64.373 65.818  1.00 59.48  ? 627 THR L CG2   1 
ATOM 2870 N N     . VAL C 3 251 ? 54.973  62.353 63.512  1.00 61.70  ? 628 VAL L N     1 
ATOM 2871 C CA    . VAL C 3 251 ? 55.239  62.532 62.090  1.00 61.03  ? 628 VAL L CA    1 
ATOM 2872 C C     . VAL C 3 251 ? 55.281  64.015 61.725  1.00 61.79  ? 628 VAL L C     1 
ATOM 2873 O O     . VAL C 3 251 ? 54.509  64.808 62.256  1.00 62.71  ? 628 VAL L O     1 
ATOM 2874 C CB    . VAL C 3 251 ? 54.155  61.828 61.244  1.00 59.14  ? 628 VAL L CB    1 
ATOM 2875 C CG1   . VAL C 3 251 ? 54.251  62.259 59.803  1.00 58.30  ? 628 VAL L CG1   1 
ATOM 2876 C CG2   . VAL C 3 251 ? 54.331  60.330 61.336  1.00 58.58  ? 628 VAL L CG2   1 
ATOM 2877 N N     . ASP C 3 252 ? 56.190  64.392 60.831  1.00 62.29  ? 629 ASP L N     1 
ATOM 2878 C CA    . ASP C 3 252 ? 56.285  65.781 60.413  1.00 64.64  ? 629 ASP L CA    1 
ATOM 2879 C C     . ASP C 3 252 ? 55.304  65.999 59.269  1.00 67.08  ? 629 ASP L C     1 
ATOM 2880 O O     . ASP C 3 252 ? 55.672  65.929 58.100  1.00 67.62  ? 629 ASP L O     1 
ATOM 2881 C CB    . ASP C 3 252 ? 57.692  66.110 59.937  1.00 64.52  ? 629 ASP L CB    1 
ATOM 2882 C CG    . ASP C 3 252 ? 57.894  67.597 59.704  1.00 64.82  ? 629 ASP L CG    1 
ATOM 2883 O OD1   . ASP C 3 252 ? 56.927  68.288 59.319  1.00 64.18  ? 629 ASP L OD1   1 
ATOM 2884 O OD2   . ASP C 3 252 ? 59.030  68.077 59.895  1.00 65.52  ? 629 ASP L OD2   1 
ATOM 2885 N N     . LYS C 3 253 ? 54.051  66.260 59.622  1.00 69.74  ? 630 LYS L N     1 
ATOM 2886 C CA    . LYS C 3 253 ? 52.976  66.479 58.660  1.00 70.80  ? 630 LYS L CA    1 
ATOM 2887 C C     . LYS C 3 253 ? 53.374  67.312 57.445  1.00 70.38  ? 630 LYS L C     1 
ATOM 2888 O O     . LYS C 3 253 ? 52.973  67.002 56.331  1.00 71.47  ? 630 LYS L O     1 
ATOM 2889 C CB    . LYS C 3 253 ? 51.797  67.149 59.365  1.00 73.65  ? 630 LYS L CB    1 
ATOM 2890 C CG    . LYS C 3 253 ? 51.394  66.476 60.661  1.00 76.97  ? 630 LYS L CG    1 
ATOM 2891 C CD    . LYS C 3 253 ? 50.819  65.105 60.393  1.00 81.54  ? 630 LYS L CD    1 
ATOM 2892 C CE    . LYS C 3 253 ? 49.583  65.209 59.518  1.00 84.52  ? 630 LYS L CE    1 
ATOM 2893 N NZ    . LYS C 3 253 ? 48.561  66.110 60.126  1.00 86.82  ? 630 LYS L NZ    1 
ATOM 2894 N N     . ASP C 3 254 ? 54.159  68.363 57.656  1.00 69.85  ? 631 ASP L N     1 
ATOM 2895 C CA    . ASP C 3 254 ? 54.576  69.239 56.565  1.00 69.56  ? 631 ASP L CA    1 
ATOM 2896 C C     . ASP C 3 254 ? 55.482  68.551 55.554  1.00 67.10  ? 631 ASP L C     1 
ATOM 2897 O O     . ASP C 3 254 ? 55.098  68.337 54.404  1.00 67.80  ? 631 ASP L O     1 
ATOM 2898 C CB    . ASP C 3 254 ? 55.291  70.465 57.120  1.00 74.35  ? 631 ASP L CB    1 
ATOM 2899 C CG    . ASP C 3 254 ? 54.605  71.032 58.343  1.00 78.99  ? 631 ASP L CG    1 
ATOM 2900 O OD1   . ASP C 3 254 ? 54.932  70.597 59.470  1.00 82.68  ? 631 ASP L OD1   1 
ATOM 2901 O OD2   . ASP C 3 254 ? 53.730  71.906 58.176  1.00 80.76  ? 631 ASP L OD2   1 
ATOM 2902 N N     . LYS C 3 255 ? 56.690  68.212 55.989  1.00 62.44  ? 632 LYS L N     1 
ATOM 2903 C CA    . LYS C 3 255 ? 57.665  67.550 55.132  1.00 57.38  ? 632 LYS L CA    1 
ATOM 2904 C C     . LYS C 3 255 ? 57.179  66.261 54.466  1.00 55.41  ? 632 LYS L C     1 
ATOM 2905 O O     . LYS C 3 255 ? 57.557  65.963 53.337  1.00 55.27  ? 632 LYS L O     1 
ATOM 2906 C CB    . LYS C 3 255 ? 58.935  67.258 55.931  1.00 54.60  ? 632 LYS L CB    1 
ATOM 2907 C CG    . LYS C 3 255 ? 59.707  68.505 56.298  1.00 52.60  ? 632 LYS L CG    1 
ATOM 2908 C CD    . LYS C 3 255 ? 60.966  68.181 57.087  1.00 52.09  ? 632 LYS L CD    1 
ATOM 2909 C CE    . LYS C 3 255 ? 61.823  69.425 57.318  1.00 50.01  ? 632 LYS L CE    1 
ATOM 2910 N NZ    . LYS C 3 255 ? 61.036  70.532 57.927  1.00 49.83  ? 632 LYS L NZ    1 
ATOM 2911 N N     . SER C 3 256 ? 56.343  65.501 55.157  1.00 53.64  ? 633 SER L N     1 
ATOM 2912 C CA    . SER C 3 256 ? 55.852  64.245 54.620  1.00 52.96  ? 633 SER L CA    1 
ATOM 2913 C C     . SER C 3 256 ? 55.128  64.363 53.285  1.00 53.39  ? 633 SER L C     1 
ATOM 2914 O O     . SER C 3 256 ? 54.520  65.386 52.982  1.00 52.59  ? 633 SER L O     1 
ATOM 2915 C CB    . SER C 3 256 ? 54.959  63.562 55.645  1.00 51.60  ? 633 SER L CB    1 
ATOM 2916 O OG    . SER C 3 256 ? 55.730  63.177 56.765  1.00 50.98  ? 633 SER L OG    1 
ATOM 2917 N N     . GLN C 3 257 ? 55.207  63.289 52.501  1.00 53.45  ? 634 GLN L N     1 
ATOM 2918 C CA    . GLN C 3 257 ? 54.613  63.203 51.178  1.00 54.29  ? 634 GLN L CA    1 
ATOM 2919 C C     . GLN C 3 257 ? 54.283  61.746 50.836  1.00 53.89  ? 634 GLN L C     1 
ATOM 2920 O O     . GLN C 3 257 ? 54.715  60.830 51.532  1.00 53.97  ? 634 GLN L O     1 
ATOM 2921 C CB    . GLN C 3 257 ? 55.601  63.762 50.168  1.00 57.56  ? 634 GLN L CB    1 
ATOM 2922 C CG    . GLN C 3 257 ? 55.923  65.201 50.437  1.00 65.30  ? 634 GLN L CG    1 
ATOM 2923 C CD    . GLN C 3 257 ? 57.124  65.686 49.674  1.00 70.36  ? 634 GLN L CD    1 
ATOM 2924 O OE1   . GLN C 3 257 ? 57.490  66.857 49.765  1.00 73.56  ? 634 GLN L OE1   1 
ATOM 2925 N NE2   . GLN C 3 257 ? 57.755  64.790 48.918  1.00 73.95  ? 634 GLN L NE2   1 
ATOM 2926 N N     . PRO C 3 258 ? 53.529  61.513 49.743  1.00 53.18  ? 635 PRO L N     1 
ATOM 2927 C CA    . PRO C 3 258 ? 53.131  60.178 49.297  1.00 51.78  ? 635 PRO L CA    1 
ATOM 2928 C C     . PRO C 3 258 ? 54.175  59.077 49.437  1.00 51.86  ? 635 PRO L C     1 
ATOM 2929 O O     . PRO C 3 258 ? 53.854  57.970 49.871  1.00 51.85  ? 635 PRO L O     1 
ATOM 2930 C CB    . PRO C 3 258 ? 52.750  60.418 47.849  1.00 51.25  ? 635 PRO L CB    1 
ATOM 2931 C CG    . PRO C 3 258 ? 52.122  61.738 47.917  1.00 50.80  ? 635 PRO L CG    1 
ATOM 2932 C CD    . PRO C 3 258 ? 53.097  62.516 48.754  1.00 52.22  ? 635 PRO L CD    1 
ATOM 2933 N N     . ASN C 3 259 ? 55.418  59.385 49.072  1.00 52.35  ? 636 ASN L N     1 
ATOM 2934 C CA    . ASN C 3 259 ? 56.506  58.412 49.130  1.00 52.50  ? 636 ASN L CA    1 
ATOM 2935 C C     . ASN C 3 259 ? 57.571  58.660 50.192  1.00 51.23  ? 636 ASN L C     1 
ATOM 2936 O O     . ASN C 3 259 ? 58.474  57.847 50.364  1.00 50.10  ? 636 ASN L O     1 
ATOM 2937 C CB    . ASN C 3 259 ? 57.173  58.300 47.756  1.00 55.07  ? 636 ASN L CB    1 
ATOM 2938 C CG    . ASN C 3 259 ? 57.607  59.647 47.197  1.00 57.96  ? 636 ASN L CG    1 
ATOM 2939 O OD1   . ASN C 3 259 ? 58.228  59.709 46.135  1.00 58.96  ? 636 ASN L OD1   1 
ATOM 2940 N ND2   . ASN C 3 259 ? 57.283  60.732 47.905  1.00 59.16  ? 636 ASN L ND2   1 
ATOM 2941 N N     . MET C 3 260 ? 57.463  59.774 50.904  1.00 51.01  ? 637 MET L N     1 
ATOM 2942 C CA    . MET C 3 260 ? 58.418  60.107 51.954  1.00 51.49  ? 637 MET L CA    1 
ATOM 2943 C C     . MET C 3 260 ? 57.761  60.505 53.276  1.00 52.63  ? 637 MET L C     1 
ATOM 2944 O O     . MET C 3 260 ? 57.120  61.551 53.380  1.00 53.81  ? 637 MET L O     1 
ATOM 2945 C CB    . MET C 3 260 ? 59.322  61.242 51.505  1.00 50.15  ? 637 MET L CB    1 
ATOM 2946 C CG    . MET C 3 260 ? 60.297  60.870 50.440  1.00 50.59  ? 637 MET L CG    1 
ATOM 2947 S SD    . MET C 3 260 ? 61.424  62.236 50.175  1.00 52.29  ? 637 MET L SD    1 
ATOM 2948 C CE    . MET C 3 260 ? 62.406  62.181 51.634  1.00 53.75  ? 637 MET L CE    1 
ATOM 2949 N N     . LEU C 3 261 ? 57.943  59.675 54.296  1.00 52.73  ? 638 LEU L N     1 
ATOM 2950 C CA    . LEU C 3 261 ? 57.371  59.941 55.609  1.00 50.96  ? 638 LEU L CA    1 
ATOM 2951 C C     . LEU C 3 261 ? 58.466  60.318 56.618  1.00 51.41  ? 638 LEU L C     1 
ATOM 2952 O O     . LEU C 3 261 ? 59.381  59.540 56.867  1.00 50.76  ? 638 LEU L O     1 
ATOM 2953 C CB    . LEU C 3 261 ? 56.615  58.698 56.084  1.00 47.58  ? 638 LEU L CB    1 
ATOM 2954 C CG    . LEU C 3 261 ? 55.606  58.896 57.205  1.00 45.19  ? 638 LEU L CG    1 
ATOM 2955 C CD1   . LEU C 3 261 ? 54.666  60.004 56.828  1.00 45.53  ? 638 LEU L CD1   1 
ATOM 2956 C CD2   . LEU C 3 261 ? 54.839  57.629 57.434  1.00 43.77  ? 638 LEU L CD2   1 
ATOM 2957 N N     . PHE C 3 262 ? 58.380  61.517 57.185  1.00 52.97  ? 639 PHE L N     1 
ATOM 2958 C CA    . PHE C 3 262 ? 59.358  61.964 58.180  1.00 55.58  ? 639 PHE L CA    1 
ATOM 2959 C C     . PHE C 3 262 ? 58.858  61.608 59.579  1.00 56.59  ? 639 PHE L C     1 
ATOM 2960 O O     . PHE C 3 262 ? 57.724  61.911 59.928  1.00 56.34  ? 639 PHE L O     1 
ATOM 2961 C CB    . PHE C 3 262 ? 59.565  63.472 58.077  1.00 55.45  ? 639 PHE L CB    1 
ATOM 2962 C CG    . PHE C 3 262 ? 60.229  63.895 56.816  1.00 56.59  ? 639 PHE L CG    1 
ATOM 2963 C CD1   . PHE C 3 262 ? 59.629  63.662 55.590  1.00 58.78  ? 639 PHE L CD1   1 
ATOM 2964 C CD2   . PHE C 3 262 ? 61.469  64.509 56.846  1.00 57.53  ? 639 PHE L CD2   1 
ATOM 2965 C CE1   . PHE C 3 262 ? 60.261  64.037 54.407  1.00 59.21  ? 639 PHE L CE1   1 
ATOM 2966 C CE2   . PHE C 3 262 ? 62.106  64.886 55.673  1.00 57.02  ? 639 PHE L CE2   1 
ATOM 2967 C CZ    . PHE C 3 262 ? 61.505  64.651 54.453  1.00 57.72  ? 639 PHE L CZ    1 
ATOM 2968 N N     . VAL C 3 263 ? 59.700  60.981 60.386  1.00 58.61  ? 640 VAL L N     1 
ATOM 2969 C CA    . VAL C 3 263 ? 59.264  60.582 61.714  1.00 63.10  ? 640 VAL L CA    1 
ATOM 2970 C C     . VAL C 3 263 ? 60.224  60.920 62.854  1.00 66.58  ? 640 VAL L C     1 
ATOM 2971 O O     . VAL C 3 263 ? 61.446  60.932 62.679  1.00 66.98  ? 640 VAL L O     1 
ATOM 2972 C CB    . VAL C 3 263 ? 58.981  59.064 61.752  1.00 62.23  ? 640 VAL L CB    1 
ATOM 2973 C CG1   . VAL C 3 263 ? 58.417  58.672 63.097  1.00 63.22  ? 640 VAL L CG1   1 
ATOM 2974 C CG2   . VAL C 3 263 ? 58.016  58.693 60.661  1.00 61.82  ? 640 VAL L CG2   1 
ATOM 2975 N N     . GLU C 3 264 ? 59.652  61.196 64.025  1.00 69.94  ? 641 GLU L N     1 
ATOM 2976 C CA    . GLU C 3 264 ? 60.433  61.509 65.212  1.00 72.71  ? 641 GLU L CA    1 
ATOM 2977 C C     . GLU C 3 264 ? 60.531  60.257 66.054  1.00 73.34  ? 641 GLU L C     1 
ATOM 2978 O O     . GLU C 3 264 ? 59.552  59.855 66.682  1.00 73.69  ? 641 GLU L O     1 
ATOM 2979 C CB    . GLU C 3 264 ? 59.760  62.594 66.043  1.00 75.65  ? 641 GLU L CB    1 
ATOM 2980 C CG    . GLU C 3 264 ? 60.405  62.769 67.409  1.00 80.67  ? 641 GLU L CG    1 
ATOM 2981 C CD    . GLU C 3 264 ? 59.647  63.728 68.310  1.00 84.35  ? 641 GLU L CD    1 
ATOM 2982 O OE1   . GLU C 3 264 ? 58.446  63.479 68.578  1.00 85.37  ? 641 GLU L OE1   1 
ATOM 2983 O OE2   . GLU C 3 264 ? 60.259  64.727 68.755  1.00 85.90  ? 641 GLU L OE2   1 
ATOM 2984 N N     . ILE C 3 265 ? 61.711  59.645 66.072  1.00 74.23  ? 642 ILE L N     1 
ATOM 2985 C CA    . ILE C 3 265 ? 61.924  58.424 66.846  1.00 74.53  ? 642 ILE L CA    1 
ATOM 2986 C C     . ILE C 3 265 ? 61.581  58.640 68.319  1.00 76.38  ? 642 ILE L C     1 
ATOM 2987 O O     . ILE C 3 265 ? 62.264  59.382 69.030  1.00 76.28  ? 642 ILE L O     1 
ATOM 2988 C CB    . ILE C 3 265 ? 63.376  57.950 66.749  1.00 72.65  ? 642 ILE L CB    1 
ATOM 2989 C CG1   . ILE C 3 265 ? 63.793  57.866 65.284  1.00 72.13  ? 642 ILE L CG1   1 
ATOM 2990 C CG2   . ILE C 3 265 ? 63.512  56.597 67.419  1.00 71.70  ? 642 ILE L CG2   1 
ATOM 2991 C CD1   . ILE C 3 265 ? 65.214  57.406 65.069  1.00 72.77  ? 642 ILE L CD1   1 
ATOM 2992 N N     . PRO C 3 266 ? 60.516  57.986 68.798  1.00 77.71  ? 643 PRO L N     1 
ATOM 2993 C CA    . PRO C 3 266 ? 60.123  58.145 70.194  1.00 79.80  ? 643 PRO L CA    1 
ATOM 2994 C C     . PRO C 3 266 ? 61.209  57.616 71.120  1.00 82.80  ? 643 PRO L C     1 
ATOM 2995 O O     . PRO C 3 266 ? 62.020  56.785 70.714  1.00 83.23  ? 643 PRO L O     1 
ATOM 2996 C CB    . PRO C 3 266 ? 58.833  57.341 70.272  1.00 78.06  ? 643 PRO L CB    1 
ATOM 2997 C CG    . PRO C 3 266 ? 59.112  56.228 69.350  1.00 77.68  ? 643 PRO L CG    1 
ATOM 2998 C CD    . PRO C 3 266 ? 59.733  56.918 68.159  1.00 77.60  ? 643 PRO L CD    1 
ATOM 2999 N N     . GLU C 3 267 ? 61.233  58.116 72.353  1.00 86.27  ? 644 GLU L N     1 
ATOM 3000 C CA    . GLU C 3 267 ? 62.213  57.682 73.340  1.00 89.79  ? 644 GLU L CA    1 
ATOM 3001 C C     . GLU C 3 267 ? 61.886  56.247 73.730  1.00 89.49  ? 644 GLU L C     1 
ATOM 3002 O O     . GLU C 3 267 ? 60.730  55.831 73.665  1.00 89.20  ? 644 GLU L O     1 
ATOM 3003 C CB    . GLU C 3 267 ? 62.147  58.577 74.576  1.00 94.27  ? 644 GLU L CB    1 
ATOM 3004 C CG    . GLU C 3 267 ? 63.142  58.213 75.664  1.00 101.63 ? 644 GLU L CG    1 
ATOM 3005 C CD    . GLU C 3 267 ? 62.839  58.904 76.987  1.00 106.07 ? 644 GLU L CD    1 
ATOM 3006 O OE1   . GLU C 3 267 ? 62.850  60.155 77.027  1.00 108.05 ? 644 GLU L OE1   1 
ATOM 3007 O OE2   . GLU C 3 267 ? 62.587  58.189 77.985  1.00 108.78 ? 644 GLU L OE2   1 
ATOM 3008 N N     . TYR C 3 268 ? 62.894  55.486 74.130  1.00 89.29  ? 645 TYR L N     1 
ATOM 3009 C CA    . TYR C 3 268 ? 62.643  54.107 74.509  1.00 90.54  ? 645 TYR L CA    1 
ATOM 3010 C C     . TYR C 3 268 ? 62.070  54.035 75.919  1.00 93.21  ? 645 TYR L C     1 
ATOM 3011 O O     . TYR C 3 268 ? 62.216  54.969 76.712  1.00 92.90  ? 645 TYR L O     1 
ATOM 3012 C CB    . TYR C 3 268 ? 63.930  53.287 74.408  1.00 88.06  ? 645 TYR L CB    1 
ATOM 3013 C CG    . TYR C 3 268 ? 63.731  51.801 74.628  1.00 85.84  ? 645 TYR L CG    1 
ATOM 3014 C CD1   . TYR C 3 268 ? 62.576  51.160 74.183  1.00 84.45  ? 645 TYR L CD1   1 
ATOM 3015 C CD2   . TYR C 3 268 ? 64.716  51.027 75.250  1.00 85.62  ? 645 TYR L CD2   1 
ATOM 3016 C CE1   . TYR C 3 268 ? 62.404  49.782 74.349  1.00 84.64  ? 645 TYR L CE1   1 
ATOM 3017 C CE2   . TYR C 3 268 ? 64.555  49.643 75.420  1.00 85.26  ? 645 TYR L CE2   1 
ATOM 3018 C CZ    . TYR C 3 268 ? 63.395  49.030 74.965  1.00 84.50  ? 645 TYR L CZ    1 
ATOM 3019 O OH    . TYR C 3 268 ? 63.228  47.672 75.110  1.00 83.54  ? 645 TYR L OH    1 
ATOM 3020 N N     . ARG C 3 269 ? 61.409  52.923 76.222  1.00 96.80  ? 646 ARG L N     1 
ATOM 3021 C CA    . ARG C 3 269 ? 60.806  52.729 77.532  1.00 100.11 ? 646 ARG L CA    1 
ATOM 3022 C C     . ARG C 3 269 ? 61.842  52.619 78.649  1.00 101.38 ? 646 ARG L C     1 
ATOM 3023 O O     . ARG C 3 269 ? 61.749  53.335 79.647  1.00 100.61 ? 646 ARG L O     1 
ATOM 3024 C CB    . ARG C 3 269 ? 59.899  51.495 77.510  1.00 102.44 ? 646 ARG L CB    1 
ATOM 3025 C CG    . ARG C 3 269 ? 60.561  50.203 77.060  1.00 105.71 ? 646 ARG L CG    1 
ATOM 3026 C CD    . ARG C 3 269 ? 59.506  49.124 76.832  1.00 109.74 ? 646 ARG L CD    1 
ATOM 3027 N NE    . ARG C 3 269 ? 60.087  47.816 76.536  1.00 114.42 ? 646 ARG L NE    1 
ATOM 3028 C CZ    . ARG C 3 269 ? 60.623  47.011 77.447  1.00 116.79 ? 646 ARG L CZ    1 
ATOM 3029 N NH1   . ARG C 3 269 ? 60.654  47.375 78.721  1.00 118.81 ? 646 ARG L NH1   1 
ATOM 3030 N NH2   . ARG C 3 269 ? 61.131  45.841 77.086  1.00 118.43 ? 646 ARG L NH2   1 
ATOM 3031 N N     . ASN C 3 270 ? 62.827  51.733 78.482  1.00 103.47 ? 647 ASN L N     1 
ATOM 3032 C CA    . ASN C 3 270 ? 63.876  51.563 79.491  1.00 105.82 ? 647 ASN L CA    1 
ATOM 3033 C C     . ASN C 3 270 ? 65.120  52.381 79.179  1.00 106.87 ? 647 ASN L C     1 
ATOM 3034 O O     . ASN C 3 270 ? 65.960  51.980 78.375  1.00 106.66 ? 647 ASN L O     1 
ATOM 3035 C CB    . ASN C 3 270 ? 64.288  50.098 79.635  1.00 106.75 ? 647 ASN L CB    1 
ATOM 3036 C CG    . ASN C 3 270 ? 65.430  49.915 80.627  1.00 107.28 ? 647 ASN L CG    1 
ATOM 3037 O OD1   . ASN C 3 270 ? 66.527  50.429 80.427  1.00 107.49 ? 647 ASN L OD1   1 
ATOM 3038 N ND2   . ASN C 3 270 ? 65.170  49.189 81.705  1.00 108.10 ? 647 ASN L ND2   1 
ATOM 3039 N N     . LYS C 3 271 ? 65.233  53.520 79.846  1.00 108.41 ? 648 LYS L N     1 
ATOM 3040 C CA    . LYS C 3 271 ? 66.350  54.430 79.666  1.00 109.72 ? 648 LYS L CA    1 
ATOM 3041 C C     . LYS C 3 271 ? 67.713  53.751 79.756  1.00 109.63 ? 648 LYS L C     1 
ATOM 3042 O O     . LYS C 3 271 ? 68.535  53.873 78.852  1.00 109.25 ? 648 LYS L O     1 
ATOM 3043 C CB    . LYS C 3 271 ? 66.257  55.538 80.713  1.00 112.09 ? 648 LYS L CB    1 
ATOM 3044 C CG    . LYS C 3 271 ? 64.957  56.327 80.651  1.00 115.17 ? 648 LYS L CG    1 
ATOM 3045 C CD    . LYS C 3 271 ? 65.174  57.688 80.018  1.00 117.50 ? 648 LYS L CD    1 
ATOM 3046 C CE    . LYS C 3 271 ? 65.866  57.571 78.674  1.00 118.69 ? 648 LYS L CE    1 
ATOM 3047 N NZ    . LYS C 3 271 ? 66.277  58.903 78.161  1.00 120.33 ? 648 LYS L NZ    1 
ATOM 3048 N N     . HIS C 3 272 ? 67.948  53.028 80.845  1.00 110.08 ? 649 HIS L N     1 
ATOM 3049 C CA    . HIS C 3 272 ? 69.233  52.367 81.050  1.00 110.21 ? 649 HIS L CA    1 
ATOM 3050 C C     . HIS C 3 272 ? 69.276  50.865 80.813  1.00 109.90 ? 649 HIS L C     1 
ATOM 3051 O O     . HIS C 3 272 ? 68.826  50.072 81.643  1.00 109.59 ? 649 HIS L O     1 
ATOM 3052 C CB    . HIS C 3 272 ? 69.758  52.672 82.458  1.00 110.26 ? 649 HIS L CB    1 
ATOM 3053 C CG    . HIS C 3 272 ? 68.725  53.258 83.365  1.00 110.99 ? 649 HIS L CG    1 
ATOM 3054 N ND1   . HIS C 3 272 ? 67.602  52.563 83.758  1.00 111.35 ? 649 HIS L ND1   1 
ATOM 3055 C CD2   . HIS C 3 272 ? 68.619  54.491 83.915  1.00 111.74 ? 649 HIS L CD2   1 
ATOM 3056 C CE1   . HIS C 3 272 ? 66.846  53.344 84.510  1.00 112.40 ? 649 HIS L CE1   1 
ATOM 3057 N NE2   . HIS C 3 272 ? 67.440  54.519 84.620  1.00 112.60 ? 649 HIS L NE2   1 
ATOM 3058 N N     . ILE C 3 273 ? 69.826  50.495 79.663  1.00 109.77 ? 650 ILE L N     1 
ATOM 3059 C CA    . ILE C 3 273 ? 69.999  49.102 79.275  1.00 110.02 ? 650 ILE L CA    1 
ATOM 3060 C C     . ILE C 3 273 ? 71.488  48.999 78.984  1.00 110.07 ? 650 ILE L C     1 
ATOM 3061 O O     . ILE C 3 273 ? 72.156  50.022 78.823  1.00 110.22 ? 650 ILE L O     1 
ATOM 3062 C CB    . ILE C 3 273 ? 69.211  48.748 77.980  1.00 110.26 ? 650 ILE L CB    1 
ATOM 3063 C CG1   . ILE C 3 273 ? 69.582  49.727 76.861  1.00 110.56 ? 650 ILE L CG1   1 
ATOM 3064 C CG2   . ILE C 3 273 ? 67.709  48.772 78.244  1.00 109.59 ? 650 ILE L CG2   1 
ATOM 3065 C CD1   . ILE C 3 273 ? 68.914  49.433 75.533  1.00 110.41 ? 650 ILE L CD1   1 
ATOM 3066 N N     . ARG C 3 274 ? 72.016  47.782 78.925  1.00 110.20 ? 651 ARG L N     1 
ATOM 3067 C CA    . ARG C 3 274 ? 73.435  47.606 78.635  1.00 110.70 ? 651 ARG L CA    1 
ATOM 3068 C C     . ARG C 3 274 ? 73.606  47.028 77.236  1.00 108.24 ? 651 ARG L C     1 
ATOM 3069 O O     . ARG C 3 274 ? 74.547  47.374 76.524  1.00 107.91 ? 651 ARG L O     1 
ATOM 3070 C CB    . ARG C 3 274 ? 74.097  46.689 79.677  1.00 115.08 ? 651 ARG L CB    1 
ATOM 3071 C CG    . ARG C 3 274 ? 74.092  47.245 81.100  1.00 120.43 ? 651 ARG L CG    1 
ATOM 3072 C CD    . ARG C 3 274 ? 74.836  48.569 81.180  1.00 126.59 ? 651 ARG L CD    1 
ATOM 3073 N NE    . ARG C 3 274 ? 74.479  49.336 82.372  1.00 133.19 ? 651 ARG L NE    1 
ATOM 3074 C CZ    . ARG C 3 274 ? 74.934  50.558 82.644  1.00 136.65 ? 651 ARG L CZ    1 
ATOM 3075 N NH1   . ARG C 3 274 ? 75.771  51.161 81.809  1.00 139.02 ? 651 ARG L NH1   1 
ATOM 3076 N NH2   . ARG C 3 274 ? 74.547  51.182 83.749  1.00 138.94 ? 651 ARG L NH2   1 
ATOM 3077 N N     . THR C 3 275 ? 72.678  46.157 76.846  1.00 105.80 ? 652 THR L N     1 
ATOM 3078 C CA    . THR C 3 275 ? 72.707  45.519 75.529  1.00 103.29 ? 652 THR L CA    1 
ATOM 3079 C C     . THR C 3 275 ? 71.745  46.170 74.530  1.00 102.01 ? 652 THR L C     1 
ATOM 3080 O O     . THR C 3 275 ? 70.744  46.784 74.921  1.00 102.42 ? 652 THR L O     1 
ATOM 3081 C CB    . THR C 3 275 ? 72.346  44.018 75.623  1.00 102.76 ? 652 THR L CB    1 
ATOM 3082 O OG1   . THR C 3 275 ? 71.398  43.821 76.679  1.00 101.94 ? 652 THR L OG1   1 
ATOM 3083 C CG2   . THR C 3 275 ? 73.586  43.176 75.873  1.00 101.84 ? 652 THR L CG2   1 
ATOM 3084 N N     . PRO C 3 276 ? 72.040  46.042 73.221  1.00 99.80  ? 653 PRO L N     1 
ATOM 3085 C CA    . PRO C 3 276 ? 71.181  46.626 72.190  1.00 97.79  ? 653 PRO L CA    1 
ATOM 3086 C C     . PRO C 3 276 ? 69.824  45.919 72.153  1.00 96.17  ? 653 PRO L C     1 
ATOM 3087 O O     . PRO C 3 276 ? 69.750  44.689 72.221  1.00 95.37  ? 653 PRO L O     1 
ATOM 3088 C CB    . PRO C 3 276 ? 71.984  46.404 70.907  1.00 97.76  ? 653 PRO L CB    1 
ATOM 3089 C CG    . PRO C 3 276 ? 73.398  46.367 71.383  1.00 97.35  ? 653 PRO L CG    1 
ATOM 3090 C CD    . PRO C 3 276 ? 73.278  45.519 72.617  1.00 98.90  ? 653 PRO L CD    1 
ATOM 3091 N N     . VAL C 3 277 ? 68.756  46.703 72.053  1.00 94.43  ? 654 VAL L N     1 
ATOM 3092 C CA    . VAL C 3 277 ? 67.410  46.152 71.995  1.00 92.72  ? 654 VAL L CA    1 
ATOM 3093 C C     . VAL C 3 277 ? 66.863  46.248 70.571  1.00 91.81  ? 654 VAL L C     1 
ATOM 3094 O O     . VAL C 3 277 ? 66.895  47.311 69.940  1.00 91.77  ? 654 VAL L O     1 
ATOM 3095 C CB    . VAL C 3 277 ? 66.452  46.904 72.950  1.00 92.56  ? 654 VAL L CB    1 
ATOM 3096 C CG1   . VAL C 3 277 ? 65.078  46.255 72.931  1.00 91.85  ? 654 VAL L CG1   1 
ATOM 3097 C CG2   . VAL C 3 277 ? 67.013  46.902 74.358  1.00 92.85  ? 654 VAL L CG2   1 
ATOM 3098 N N     . LYS C 3 278 ? 66.371  45.123 70.066  1.00 90.46  ? 655 LYS L N     1 
ATOM 3099 C CA    . LYS C 3 278 ? 65.801  45.065 68.726  1.00 88.42  ? 655 LYS L CA    1 
ATOM 3100 C C     . LYS C 3 278 ? 64.283  45.273 68.839  1.00 84.67  ? 655 LYS L C     1 
ATOM 3101 O O     . LYS C 3 278 ? 63.573  44.487 69.470  1.00 83.39  ? 655 LYS L O     1 
ATOM 3102 C CB    . LYS C 3 278 ? 66.147  43.709 68.066  1.00 91.54  ? 655 LYS L CB    1 
ATOM 3103 C CG    . LYS C 3 278 ? 65.429  43.385 66.742  1.00 96.94  ? 655 LYS L CG    1 
ATOM 3104 C CD    . LYS C 3 278 ? 65.688  44.408 65.624  1.00 100.76 ? 655 LYS L CD    1 
ATOM 3105 C CE    . LYS C 3 278 ? 67.097  44.310 65.048  1.00 102.55 ? 655 LYS L CE    1 
ATOM 3106 N NZ    . LYS C 3 278 ? 67.335  45.352 64.000  1.00 102.38 ? 655 LYS L NZ    1 
ATOM 3107 N N     . VAL C 3 279 ? 63.804  46.361 68.246  1.00 80.90  ? 656 VAL L N     1 
ATOM 3108 C CA    . VAL C 3 279 ? 62.385  46.689 68.259  1.00 77.04  ? 656 VAL L CA    1 
ATOM 3109 C C     . VAL C 3 279 ? 61.845  46.738 66.827  1.00 75.32  ? 656 VAL L C     1 
ATOM 3110 O O     . VAL C 3 279 ? 62.597  46.563 65.860  1.00 74.00  ? 656 VAL L O     1 
ATOM 3111 C CB    . VAL C 3 279 ? 62.135  48.059 68.925  1.00 76.10  ? 656 VAL L CB    1 
ATOM 3112 C CG1   . VAL C 3 279 ? 62.592  48.031 70.361  1.00 76.27  ? 656 VAL L CG1   1 
ATOM 3113 C CG2   . VAL C 3 279 ? 62.874  49.150 68.167  1.00 75.68  ? 656 VAL L CG2   1 
ATOM 3114 N N     . ASN C 3 280 ? 60.537  46.969 66.709  1.00 73.02  ? 657 ASN L N     1 
ATOM 3115 C CA    . ASN C 3 280 ? 59.858  47.064 65.418  1.00 70.67  ? 657 ASN L CA    1 
ATOM 3116 C C     . ASN C 3 280 ? 59.021  48.341 65.328  1.00 68.22  ? 657 ASN L C     1 
ATOM 3117 O O     . ASN C 3 280 ? 58.823  49.041 66.326  1.00 67.97  ? 657 ASN L O     1 
ATOM 3118 C CB    . ASN C 3 280 ? 58.928  45.863 65.207  1.00 72.31  ? 657 ASN L CB    1 
ATOM 3119 C CG    . ASN C 3 280 ? 59.675  44.596 64.866  1.00 75.08  ? 657 ASN L CG    1 
ATOM 3120 O OD1   . ASN C 3 280 ? 59.085  43.624 64.390  1.00 76.50  ? 657 ASN L OD1   1 
ATOM 3121 N ND2   . ASN C 3 280 ? 60.980  44.592 65.111  1.00 77.38  ? 657 ASN L ND2   1 
ATOM 3122 N N     . PHE C 3 281 ? 58.533  48.642 64.126  1.00 64.01  ? 658 PHE L N     1 
ATOM 3123 C CA    . PHE C 3 281 ? 57.680  49.804 63.911  1.00 60.11  ? 658 PHE L CA    1 
ATOM 3124 C C     . PHE C 3 281 ? 56.935  49.602 62.598  1.00 56.70  ? 658 PHE L C     1 
ATOM 3125 O O     . PHE C 3 281 ? 57.441  48.955 61.686  1.00 57.29  ? 658 PHE L O     1 
ATOM 3126 C CB    . PHE C 3 281 ? 58.514  51.096 63.881  1.00 61.17  ? 658 PHE L CB    1 
ATOM 3127 C CG    . PHE C 3 281 ? 59.293  51.294 62.616  1.00 63.47  ? 658 PHE L CG    1 
ATOM 3128 C CD1   . PHE C 3 281 ? 58.731  51.966 61.533  1.00 63.98  ? 658 PHE L CD1   1 
ATOM 3129 C CD2   . PHE C 3 281 ? 60.585  50.787 62.490  1.00 64.75  ? 658 PHE L CD2   1 
ATOM 3130 C CE1   . PHE C 3 281 ? 59.444  52.129 60.343  1.00 64.10  ? 658 PHE L CE1   1 
ATOM 3131 C CE2   . PHE C 3 281 ? 61.310  50.946 61.296  1.00 64.75  ? 658 PHE L CE2   1 
ATOM 3132 C CZ    . PHE C 3 281 ? 60.737  51.617 60.225  1.00 64.04  ? 658 PHE L CZ    1 
ATOM 3133 N N     . TYR C 3 282 ? 55.723  50.126 62.509  1.00 52.83  ? 659 TYR L N     1 
ATOM 3134 C CA    . TYR C 3 282 ? 54.951  49.989 61.290  1.00 49.93  ? 659 TYR L CA    1 
ATOM 3135 C C     . TYR C 3 282 ? 54.249  51.305 60.951  1.00 48.46  ? 659 TYR L C     1 
ATOM 3136 O O     . TYR C 3 282 ? 54.138  52.202 61.789  1.00 49.43  ? 659 TYR L O     1 
ATOM 3137 C CB    . TYR C 3 282 ? 53.935  48.852 61.445  1.00 51.33  ? 659 TYR L CB    1 
ATOM 3138 C CG    . TYR C 3 282 ? 52.882  49.071 62.523  1.00 53.65  ? 659 TYR L CG    1 
ATOM 3139 C CD1   . TYR C 3 282 ? 51.781  49.903 62.305  1.00 54.94  ? 659 TYR L CD1   1 
ATOM 3140 C CD2   . TYR C 3 282 ? 52.991  48.447 63.764  1.00 55.11  ? 659 TYR L CD2   1 
ATOM 3141 C CE1   . TYR C 3 282 ? 50.818  50.107 63.296  1.00 56.11  ? 659 TYR L CE1   1 
ATOM 3142 C CE2   . TYR C 3 282 ? 52.034  48.643 64.764  1.00 55.71  ? 659 TYR L CE2   1 
ATOM 3143 C CZ    . TYR C 3 282 ? 50.950  49.471 64.529  1.00 56.60  ? 659 TYR L CZ    1 
ATOM 3144 O OH    . TYR C 3 282 ? 50.004  49.659 65.524  1.00 55.15  ? 659 TYR L OH    1 
ATOM 3145 N N     . VAL C 3 283 ? 53.793  51.435 59.713  1.00 46.35  ? 660 VAL L N     1 
ATOM 3146 C CA    . VAL C 3 283 ? 53.092  52.641 59.295  1.00 44.86  ? 660 VAL L CA    1 
ATOM 3147 C C     . VAL C 3 283 ? 51.620  52.267 59.213  1.00 44.75  ? 660 VAL L C     1 
ATOM 3148 O O     . VAL C 3 283 ? 51.285  51.111 58.977  1.00 42.61  ? 660 VAL L O     1 
ATOM 3149 C CB    . VAL C 3 283 ? 53.582  53.114 57.913  1.00 44.56  ? 660 VAL L CB    1 
ATOM 3150 C CG1   . VAL C 3 283 ? 52.957  54.454 57.561  1.00 42.46  ? 660 VAL L CG1   1 
ATOM 3151 C CG2   . VAL C 3 283 ? 55.099  53.198 57.906  1.00 42.14  ? 660 VAL L CG2   1 
ATOM 3152 N N     . ILE C 3 284 ? 50.730  53.229 59.408  1.00 46.30  ? 661 ILE L N     1 
ATOM 3153 C CA    . ILE C 3 284 ? 49.316  52.898 59.353  1.00 49.01  ? 661 ILE L CA    1 
ATOM 3154 C C     . ILE C 3 284 ? 48.426  54.005 58.804  1.00 50.45  ? 661 ILE L C     1 
ATOM 3155 O O     . ILE C 3 284 ? 48.601  55.190 59.111  1.00 50.76  ? 661 ILE L O     1 
ATOM 3156 C CB    . ILE C 3 284 ? 48.797  52.460 60.758  1.00 49.87  ? 661 ILE L CB    1 
ATOM 3157 C CG1   . ILE C 3 284 ? 47.397  51.866 60.628  1.00 50.08  ? 661 ILE L CG1   1 
ATOM 3158 C CG2   . ILE C 3 284 ? 48.790  53.647 61.726  1.00 47.69  ? 661 ILE L CG2   1 
ATOM 3159 C CD1   . ILE C 3 284 ? 46.935  51.187 61.874  1.00 50.96  ? 661 ILE L CD1   1 
ATOM 3160 N N     . ASN C 3 285 ? 47.481  53.598 57.964  1.00 51.83  ? 662 ASN L N     1 
ATOM 3161 C CA    . ASN C 3 285 ? 46.531  54.522 57.370  1.00 54.41  ? 662 ASN L CA    1 
ATOM 3162 C C     . ASN C 3 285 ? 45.160  54.097 57.857  1.00 57.26  ? 662 ASN L C     1 
ATOM 3163 O O     . ASN C 3 285 ? 44.722  52.978 57.592  1.00 58.09  ? 662 ASN L O     1 
ATOM 3164 C CB    . ASN C 3 285 ? 46.600  54.460 55.848  1.00 52.40  ? 662 ASN L CB    1 
ATOM 3165 C CG    . ASN C 3 285 ? 47.939  54.909 55.319  1.00 51.72  ? 662 ASN L CG    1 
ATOM 3166 O OD1   . ASN C 3 285 ? 48.466  55.926 55.757  1.00 52.76  ? 662 ASN L OD1   1 
ATOM 3167 N ND2   . ASN C 3 285 ? 48.495  54.162 54.369  1.00 50.62  ? 662 ASN L ND2   1 
ATOM 3168 N N     . GLY C 3 286 ? 44.486  54.981 58.582  1.00 60.08  ? 663 GLY L N     1 
ATOM 3169 C CA    . GLY C 3 286 ? 43.181  54.626 59.101  1.00 65.83  ? 663 GLY L CA    1 
ATOM 3170 C C     . GLY C 3 286 ? 43.338  53.637 60.242  1.00 69.72  ? 663 GLY L C     1 
ATOM 3171 O O     . GLY C 3 286 ? 44.454  53.415 60.722  1.00 70.65  ? 663 GLY L O     1 
ATOM 3172 N N     . LYS C 3 287 ? 42.238  53.031 60.679  1.00 72.57  ? 664 LYS L N     1 
ATOM 3173 C CA    . LYS C 3 287 ? 42.308  52.079 61.780  1.00 76.76  ? 664 LYS L CA    1 
ATOM 3174 C C     . LYS C 3 287 ? 42.875  50.708 61.397  1.00 79.06  ? 664 LYS L C     1 
ATOM 3175 O O     . LYS C 3 287 ? 43.515  50.048 62.215  1.00 79.18  ? 664 LYS L O     1 
ATOM 3176 C CB    . LYS C 3 287 ? 40.925  51.885 62.392  1.00 77.14  ? 664 LYS L CB    1 
ATOM 3177 C CG    . LYS C 3 287 ? 40.280  53.143 62.912  1.00 78.95  ? 664 LYS L CG    1 
ATOM 3178 C CD    . LYS C 3 287 ? 38.930  52.803 63.532  1.00 81.24  ? 664 LYS L CD    1 
ATOM 3179 C CE    . LYS C 3 287 ? 38.292  53.986 64.248  1.00 80.93  ? 664 LYS L CE    1 
ATOM 3180 N NZ    . LYS C 3 287 ? 38.044  55.118 63.328  1.00 80.40  ? 664 LYS L NZ    1 
ATOM 3181 N N     . ARG C 3 288 ? 42.646  50.286 60.158  1.00 81.80  ? 665 ARG L N     1 
ATOM 3182 C CA    . ARG C 3 288 ? 43.103  48.979 59.714  1.00 84.78  ? 665 ARG L CA    1 
ATOM 3183 C C     . ARG C 3 288 ? 44.426  48.981 58.954  1.00 82.75  ? 665 ARG L C     1 
ATOM 3184 O O     . ARG C 3 288 ? 45.481  48.768 59.540  1.00 83.99  ? 665 ARG L O     1 
ATOM 3185 C CB    . ARG C 3 288 ? 42.024  48.327 58.850  1.00 92.85  ? 665 ARG L CB    1 
ATOM 3186 C CG    . ARG C 3 288 ? 40.651  48.228 59.504  1.00 104.49 ? 665 ARG L CG    1 
ATOM 3187 C CD    . ARG C 3 288 ? 39.616  47.746 58.494  1.00 116.42 ? 665 ARG L CD    1 
ATOM 3188 N NE    . ARG C 3 288 ? 38.243  47.824 58.992  1.00 127.71 ? 665 ARG L NE    1 
ATOM 3189 C CZ    . ARG C 3 288 ? 37.727  47.012 59.909  1.00 133.82 ? 665 ARG L CZ    1 
ATOM 3190 N NH1   . ARG C 3 288 ? 38.472  46.049 60.435  1.00 138.05 ? 665 ARG L NH1   1 
ATOM 3191 N NH2   . ARG C 3 288 ? 36.463  47.158 60.294  1.00 137.47 ? 665 ARG L NH2   1 
ATOM 3192 N N     . LYS C 3 289 ? 44.358  49.219 57.647  1.00 79.55  ? 666 LYS L N     1 
ATOM 3193 C CA    . LYS C 3 289 ? 45.530  49.225 56.765  1.00 75.31  ? 666 LYS L CA    1 
ATOM 3194 C C     . LYS C 3 289 ? 46.879  49.633 57.382  1.00 73.22  ? 666 LYS L C     1 
ATOM 3195 O O     . LYS C 3 289 ? 47.167  50.817 57.590  1.00 72.72  ? 666 LYS L O     1 
ATOM 3196 C CB    . LYS C 3 289 ? 45.252  50.110 55.548  1.00 74.20  ? 666 LYS L CB    1 
ATOM 3197 C CG    . LYS C 3 289 ? 43.981  49.770 54.798  1.00 72.68  ? 666 LYS L CG    1 
ATOM 3198 C CD    . LYS C 3 289 ? 44.032  48.378 54.216  1.00 71.64  ? 666 LYS L CD    1 
ATOM 3199 C CE    . LYS C 3 289 ? 42.738  48.031 53.493  1.00 71.29  ? 666 LYS L CE    1 
ATOM 3200 N NZ    . LYS C 3 289 ? 42.498  48.889 52.305  1.00 70.33  ? 666 LYS L NZ    1 
ATOM 3201 N N     . ARG C 3 290 ? 47.714  48.642 57.665  1.00 69.61  ? 667 ARG L N     1 
ATOM 3202 C CA    . ARG C 3 290 ? 49.021  48.925 58.225  1.00 67.19  ? 667 ARG L CA    1 
ATOM 3203 C C     . ARG C 3 290 ? 50.068  48.105 57.472  1.00 65.35  ? 667 ARG L C     1 
ATOM 3204 O O     . ARG C 3 290 ? 49.788  47.003 57.005  1.00 65.27  ? 667 ARG L O     1 
ATOM 3205 C CB    . ARG C 3 290 ? 49.057  48.568 59.708  1.00 67.52  ? 667 ARG L CB    1 
ATOM 3206 C CG    . ARG C 3 290 ? 49.219  47.088 59.951  1.00 69.21  ? 667 ARG L CG    1 
ATOM 3207 C CD    . ARG C 3 290 ? 49.503  46.791 61.404  1.00 72.00  ? 667 ARG L CD    1 
ATOM 3208 N NE    . ARG C 3 290 ? 48.392  47.180 62.262  1.00 73.76  ? 667 ARG L NE    1 
ATOM 3209 C CZ    . ARG C 3 290 ? 48.315  46.888 63.555  1.00 75.04  ? 667 ARG L CZ    1 
ATOM 3210 N NH1   . ARG C 3 290 ? 49.286  46.200 64.145  1.00 74.87  ? 667 ARG L NH1   1 
ATOM 3211 N NH2   . ARG C 3 290 ? 47.265  47.289 64.259  1.00 76.94  ? 667 ARG L NH2   1 
ATOM 3212 N N     . SER C 3 291 ? 51.272  48.655 57.357  1.00 62.93  ? 668 SER L N     1 
ATOM 3213 C CA    . SER C 3 291 ? 52.373  47.996 56.667  1.00 59.98  ? 668 SER L CA    1 
ATOM 3214 C C     . SER C 3 291 ? 52.866  46.866 57.532  1.00 59.11  ? 668 SER L C     1 
ATOM 3215 O O     . SER C 3 291 ? 52.432  46.714 58.670  1.00 58.74  ? 668 SER L O     1 
ATOM 3216 C CB    . SER C 3 291 ? 53.532  48.959 56.479  1.00 60.22  ? 668 SER L CB    1 
ATOM 3217 O OG    . SER C 3 291 ? 54.218  49.118 57.712  1.00 58.78  ? 668 SER L OG    1 
ATOM 3218 N N     . GLN C 3 292 ? 53.793  46.079 57.003  1.00 59.05  ? 669 GLN L N     1 
ATOM 3219 C CA    . GLN C 3 292 ? 54.331  44.987 57.786  1.00 58.89  ? 669 GLN L CA    1 
ATOM 3220 C C     . GLN C 3 292 ? 55.386  45.548 58.728  1.00 59.67  ? 669 GLN L C     1 
ATOM 3221 O O     . GLN C 3 292 ? 55.965  46.611 58.471  1.00 59.51  ? 669 GLN L O     1 
ATOM 3222 C CB    . GLN C 3 292 ? 54.920  43.896 56.888  1.00 56.96  ? 669 GLN L CB    1 
ATOM 3223 C CG    . GLN C 3 292 ? 56.063  44.302 56.010  1.00 57.94  ? 669 GLN L CG    1 
ATOM 3224 C CD    . GLN C 3 292 ? 56.462  43.176 55.070  1.00 60.23  ? 669 GLN L CD    1 
ATOM 3225 O OE1   . GLN C 3 292 ? 56.915  42.121 55.502  1.00 64.28  ? 669 GLN L OE1   1 
ATOM 3226 N NE2   . GLN C 3 292 ? 56.279  43.390 53.780  1.00 61.73  ? 669 GLN L NE2   1 
ATOM 3227 N N     . PRO C 3 293 ? 55.628  44.851 59.853  1.00 59.55  ? 670 PRO L N     1 
ATOM 3228 C CA    . PRO C 3 293 ? 56.614  45.282 60.843  1.00 58.16  ? 670 PRO L CA    1 
ATOM 3229 C C     . PRO C 3 293 ? 57.959  45.562 60.199  1.00 57.48  ? 670 PRO L C     1 
ATOM 3230 O O     . PRO C 3 293 ? 58.431  44.793 59.365  1.00 56.67  ? 670 PRO L O     1 
ATOM 3231 C CB    . PRO C 3 293 ? 56.690  44.091 61.792  1.00 58.72  ? 670 PRO L CB    1 
ATOM 3232 C CG    . PRO C 3 293 ? 55.326  43.487 61.701  1.00 59.12  ? 670 PRO L CG    1 
ATOM 3233 C CD    . PRO C 3 293 ? 55.047  43.548 60.227  1.00 59.23  ? 670 PRO L CD    1 
ATOM 3234 N N     . GLN C 3 294 ? 58.568  46.675 60.573  1.00 57.28  ? 671 GLN L N     1 
ATOM 3235 C CA    . GLN C 3 294 ? 59.878  47.014 60.051  1.00 58.17  ? 671 GLN L CA    1 
ATOM 3236 C C     . GLN C 3 294 ? 60.842  46.812 61.219  1.00 59.39  ? 671 GLN L C     1 
ATOM 3237 O O     . GLN C 3 294 ? 60.406  46.549 62.339  1.00 58.95  ? 671 GLN L O     1 
ATOM 3238 C CB    . GLN C 3 294 ? 59.890  48.457 59.545  1.00 56.30  ? 671 GLN L CB    1 
ATOM 3239 C CG    . GLN C 3 294 ? 59.027  48.662 58.305  1.00 56.23  ? 671 GLN L CG    1 
ATOM 3240 C CD    . GLN C 3 294 ? 59.442  47.768 57.134  1.00 56.70  ? 671 GLN L CD    1 
ATOM 3241 O OE1   . GLN C 3 294 ? 58.668  46.927 56.677  1.00 56.66  ? 671 GLN L OE1   1 
ATOM 3242 N NE2   . GLN C 3 294 ? 60.669  47.951 56.647  1.00 55.96  ? 671 GLN L NE2   1 
ATOM 3243 N N     . HIS C 3 295 ? 62.143  46.929 60.974  1.00 61.30  ? 672 HIS L N     1 
ATOM 3244 C CA    . HIS C 3 295 ? 63.116  46.716 62.038  1.00 61.61  ? 672 HIS L CA    1 
ATOM 3245 C C     . HIS C 3 295 ? 63.951  47.924 62.437  1.00 62.22  ? 672 HIS L C     1 
ATOM 3246 O O     . HIS C 3 295 ? 64.419  48.686 61.596  1.00 62.70  ? 672 HIS L O     1 
ATOM 3247 C CB    . HIS C 3 295 ? 64.035  45.561 61.648  1.00 62.37  ? 672 HIS L CB    1 
ATOM 3248 C CG    . HIS C 3 295 ? 63.299  44.319 61.249  1.00 63.29  ? 672 HIS L CG    1 
ATOM 3249 N ND1   . HIS C 3 295 ? 62.322  43.747 62.036  1.00 64.05  ? 672 HIS L ND1   1 
ATOM 3250 C CD2   . HIS C 3 295 ? 63.393  43.543 60.144  1.00 63.66  ? 672 HIS L CD2   1 
ATOM 3251 C CE1   . HIS C 3 295 ? 61.845  42.673 61.432  1.00 64.29  ? 672 HIS L CE1   1 
ATOM 3252 N NE2   . HIS C 3 295 ? 62.478  42.527 60.282  1.00 64.26  ? 672 HIS L NE2   1 
ATOM 3253 N N     . PHE C 3 296 ? 64.146  48.073 63.740  1.00 64.13  ? 673 PHE L N     1 
ATOM 3254 C CA    . PHE C 3 296 ? 64.925  49.172 64.289  1.00 65.66  ? 673 PHE L CA    1 
ATOM 3255 C C     . PHE C 3 296 ? 65.627  48.719 65.573  1.00 67.68  ? 673 PHE L C     1 
ATOM 3256 O O     . PHE C 3 296 ? 65.191  47.760 66.220  1.00 66.62  ? 673 PHE L O     1 
ATOM 3257 C CB    . PHE C 3 296 ? 64.003  50.339 64.589  1.00 64.93  ? 673 PHE L CB    1 
ATOM 3258 C CG    . PHE C 3 296 ? 64.719  51.603 64.905  1.00 65.23  ? 673 PHE L CG    1 
ATOM 3259 C CD1   . PHE C 3 296 ? 65.584  52.171 63.981  1.00 66.00  ? 673 PHE L CD1   1 
ATOM 3260 C CD2   . PHE C 3 296 ? 64.498  52.257 66.109  1.00 65.86  ? 673 PHE L CD2   1 
ATOM 3261 C CE1   . PHE C 3 296 ? 66.222  53.388 64.250  1.00 66.92  ? 673 PHE L CE1   1 
ATOM 3262 C CE2   . PHE C 3 296 ? 65.128  53.473 66.393  1.00 66.43  ? 673 PHE L CE2   1 
ATOM 3263 C CZ    . PHE C 3 296 ? 65.992  54.041 65.459  1.00 66.78  ? 673 PHE L CZ    1 
ATOM 3264 N N     . THR C 3 297 ? 66.710  49.405 65.939  1.00 69.96  ? 674 THR L N     1 
ATOM 3265 C CA    . THR C 3 297 ? 67.463  49.053 67.146  1.00 72.26  ? 674 THR L CA    1 
ATOM 3266 C C     . THR C 3 297 ? 67.867  50.237 68.012  1.00 74.83  ? 674 THR L C     1 
ATOM 3267 O O     . THR C 3 297 ? 68.417  51.228 67.532  1.00 74.50  ? 674 THR L O     1 
ATOM 3268 C CB    . THR C 3 297 ? 68.753  48.254 66.804  1.00 71.43  ? 674 THR L CB    1 
ATOM 3269 O OG1   . THR C 3 297 ? 68.409  46.898 66.508  1.00 71.55  ? 674 THR L OG1   1 
ATOM 3270 C CG2   . THR C 3 297 ? 69.734  48.270 67.968  1.00 69.42  ? 674 THR L CG2   1 
ATOM 3271 N N     . TYR C 3 298 ? 67.584  50.112 69.301  1.00 78.04  ? 675 TYR L N     1 
ATOM 3272 C CA    . TYR C 3 298 ? 67.930  51.130 70.272  1.00 82.55  ? 675 TYR L CA    1 
ATOM 3273 C C     . TYR C 3 298 ? 69.261  50.740 70.911  1.00 87.51  ? 675 TYR L C     1 
ATOM 3274 O O     . TYR C 3 298 ? 69.495  49.565 71.204  1.00 87.40  ? 675 TYR L O     1 
ATOM 3275 C CB    . TYR C 3 298 ? 66.854  51.200 71.342  1.00 80.35  ? 675 TYR L CB    1 
ATOM 3276 C CG    . TYR C 3 298 ? 65.658  52.031 70.967  1.00 78.17  ? 675 TYR L CG    1 
ATOM 3277 C CD1   . TYR C 3 298 ? 65.726  53.422 70.994  1.00 76.66  ? 675 TYR L CD1   1 
ATOM 3278 C CD2   . TYR C 3 298 ? 64.442  51.433 70.628  1.00 77.51  ? 675 TYR L CD2   1 
ATOM 3279 C CE1   . TYR C 3 298 ? 64.615  54.203 70.702  1.00 74.99  ? 675 TYR L CE1   1 
ATOM 3280 C CE2   . TYR C 3 298 ? 63.321  52.207 70.331  1.00 75.58  ? 675 TYR L CE2   1 
ATOM 3281 C CZ    . TYR C 3 298 ? 63.421  53.592 70.376  1.00 75.10  ? 675 TYR L CZ    1 
ATOM 3282 O OH    . TYR C 3 298 ? 62.324  54.374 70.118  1.00 74.93  ? 675 TYR L OH    1 
ATOM 3283 N N     . HIS C 3 299 ? 70.131  51.722 71.129  1.00 93.53  ? 676 HIS L N     1 
ATOM 3284 C CA    . HIS C 3 299 ? 71.433  51.451 71.734  1.00 99.47  ? 676 HIS L CA    1 
ATOM 3285 C C     . HIS C 3 299 ? 71.562  51.949 73.176  1.00 103.58 ? 676 HIS L C     1 
ATOM 3286 O O     . HIS C 3 299 ? 71.123  53.053 73.502  1.00 103.44 ? 676 HIS L O     1 
ATOM 3287 C CB    . HIS C 3 299 ? 72.549  52.047 70.874  1.00 99.47  ? 676 HIS L CB    1 
ATOM 3288 C CG    . HIS C 3 299 ? 72.761  51.320 69.583  1.00 100.35 ? 676 HIS L CG    1 
ATOM 3289 N ND1   . HIS C 3 299 ? 72.682  49.947 69.485  1.00 100.54 ? 676 HIS L ND1   1 
ATOM 3290 C CD2   . HIS C 3 299 ? 73.082  51.768 68.347  1.00 100.98 ? 676 HIS L CD2   1 
ATOM 3291 C CE1   . HIS C 3 299 ? 72.945  49.580 68.244  1.00 100.92 ? 676 HIS L CE1   1 
ATOM 3292 N NE2   . HIS C 3 299 ? 73.192  50.666 67.533  1.00 101.28 ? 676 HIS L NE2   1 
ATOM 3293 N N     . PRO C 3 300 ? 72.177  51.131 74.057  1.00 107.57 ? 677 PRO L N     1 
ATOM 3294 C CA    . PRO C 3 300 ? 72.361  51.492 75.466  1.00 109.91 ? 677 PRO L CA    1 
ATOM 3295 C C     . PRO C 3 300 ? 73.019  52.852 75.580  1.00 112.08 ? 677 PRO L C     1 
ATOM 3296 O O     . PRO C 3 300 ? 73.823  53.222 74.726  1.00 112.20 ? 677 PRO L O     1 
ATOM 3297 C CB    . PRO C 3 300 ? 73.248  50.369 75.997  1.00 109.94 ? 677 PRO L CB    1 
ATOM 3298 C CG    . PRO C 3 300 ? 74.040  49.969 74.790  1.00 109.21 ? 677 PRO L CG    1 
ATOM 3299 C CD    . PRO C 3 300 ? 72.978  49.937 73.725  1.00 108.53 ? 677 PRO L CD    1 
ATOM 3300 N N     . VAL C 3 301 ? 72.678  53.594 76.628  1.00 114.58 ? 678 VAL L N     1 
ATOM 3301 C CA    . VAL C 3 301 ? 73.244  54.923 76.825  1.00 117.52 ? 678 VAL L CA    1 
ATOM 3302 C C     . VAL C 3 301 ? 74.757  54.927 76.614  1.00 119.17 ? 678 VAL L C     1 
ATOM 3303 O O     . VAL C 3 301 ? 75.368  53.833 76.674  1.00 119.96 ? 678 VAL L O     1 
ATOM 3304 C CB    . VAL C 3 301 ? 72.951  55.451 78.240  1.00 117.67 ? 678 VAL L CB    1 
ATOM 3305 C CG1   . VAL C 3 301 ? 71.457  55.607 78.432  1.00 118.42 ? 678 VAL L CG1   1 
ATOM 3306 C CG2   . VAL C 3 301 ? 73.525  54.498 79.275  1.00 118.05 ? 678 VAL L CG2   1 
ATOM 3307 O OXT   . VAL C 3 301 ? 75.312  56.031 76.402  1.00 120.87 ? 678 VAL L OXT   1 
ATOM 3308 N N     . VAL D 3 18  ? 2.537   19.254 40.971  1.00 50.73  ? 395 VAL M N     1 
ATOM 3309 C CA    . VAL D 3 18  ? 2.434   20.407 40.053  1.00 53.73  ? 395 VAL M CA    1 
ATOM 3310 C C     . VAL D 3 18  ? 3.116   21.659 40.619  1.00 56.81  ? 395 VAL M C     1 
ATOM 3311 O O     . VAL D 3 18  ? 3.904   22.294 39.929  1.00 57.51  ? 395 VAL M O     1 
ATOM 3312 C CB    . VAL D 3 18  ? 0.931   20.717 39.673  1.00 53.31  ? 395 VAL M CB    1 
ATOM 3313 C CG1   . VAL D 3 18  ? 0.834   22.010 38.838  1.00 52.21  ? 395 VAL M CG1   1 
ATOM 3314 C CG2   . VAL D 3 18  ? 0.346   19.569 38.844  1.00 51.32  ? 395 VAL M CG2   1 
ATOM 3315 N N     . PRO D 3 19  ? 2.850   22.028 41.881  1.00 60.21  ? 396 PRO M N     1 
ATOM 3316 C CA    . PRO D 3 19  ? 3.533   23.239 42.355  1.00 63.81  ? 396 PRO M CA    1 
ATOM 3317 C C     . PRO D 3 19  ? 5.052   23.124 42.399  1.00 67.59  ? 396 PRO M C     1 
ATOM 3318 O O     . PRO D 3 19  ? 5.597   22.098 42.807  1.00 68.62  ? 396 PRO M O     1 
ATOM 3319 C CB    . PRO D 3 19  ? 2.910   23.483 43.731  1.00 61.01  ? 396 PRO M CB    1 
ATOM 3320 C CG    . PRO D 3 19  ? 2.570   22.137 44.185  1.00 61.44  ? 396 PRO M CG    1 
ATOM 3321 C CD    . PRO D 3 19  ? 2.006   21.461 42.943  1.00 61.26  ? 396 PRO M CD    1 
ATOM 3322 N N     . LEU D 3 20  ? 5.725   24.188 41.961  1.00 71.52  ? 397 LEU M N     1 
ATOM 3323 C CA    . LEU D 3 20  ? 7.182   24.237 41.927  1.00 73.70  ? 397 LEU M CA    1 
ATOM 3324 C C     . LEU D 3 20  ? 7.783   23.678 43.200  1.00 71.89  ? 397 LEU M C     1 
ATOM 3325 O O     . LEU D 3 20  ? 8.382   22.612 43.178  1.00 72.11  ? 397 LEU M O     1 
ATOM 3326 C CB    . LEU D 3 20  ? 7.653   25.671 41.711  1.00 79.43  ? 397 LEU M CB    1 
ATOM 3327 C CG    . LEU D 3 20  ? 7.196   26.314 40.403  1.00 82.95  ? 397 LEU M CG    1 
ATOM 3328 C CD1   . LEU D 3 20  ? 7.695   27.744 40.338  1.00 87.11  ? 397 LEU M CD1   1 
ATOM 3329 C CD2   . LEU D 3 20  ? 7.722   25.518 39.239  1.00 85.10  ? 397 LEU M CD2   1 
ATOM 3330 N N     . GLU D 3 21  ? 7.625   24.389 44.309  1.00 69.85  ? 398 GLU M N     1 
ATOM 3331 C CA    . GLU D 3 21  ? 8.153   23.904 45.578  1.00 68.63  ? 398 GLU M CA    1 
ATOM 3332 C C     . GLU D 3 21  ? 7.338   22.725 46.082  1.00 68.67  ? 398 GLU M C     1 
ATOM 3333 O O     . GLU D 3 21  ? 6.256   22.897 46.624  1.00 69.41  ? 398 GLU M O     1 
ATOM 3334 C CB    . GLU D 3 21  ? 8.128   25.001 46.629  1.00 67.06  ? 398 GLU M CB    1 
ATOM 3335 C CG    . GLU D 3 21  ? 8.351   24.490 48.036  1.00 64.37  ? 398 GLU M CG    1 
ATOM 3336 C CD    . GLU D 3 21  ? 8.729   25.602 49.002  1.00 65.36  ? 398 GLU M CD    1 
ATOM 3337 O OE1   . GLU D 3 21  ? 8.173   26.718 48.876  1.00 64.93  ? 398 GLU M OE1   1 
ATOM 3338 O OE2   . GLU D 3 21  ? 9.577   25.362 49.895  1.00 65.18  ? 398 GLU M OE2   1 
ATOM 3339 N N     . TRP D 3 22  ? 7.866   21.525 45.901  1.00 68.46  ? 399 TRP M N     1 
ATOM 3340 C CA    . TRP D 3 22  ? 7.180   20.326 46.330  1.00 67.83  ? 399 TRP M CA    1 
ATOM 3341 C C     . TRP D 3 22  ? 8.198   19.208 46.227  1.00 64.83  ? 399 TRP M C     1 
ATOM 3342 O O     . TRP D 3 22  ? 8.980   19.170 45.286  1.00 65.02  ? 399 TRP M O     1 
ATOM 3343 C CB    . TRP D 3 22  ? 6.000   20.047 45.408  1.00 73.69  ? 399 TRP M CB    1 
ATOM 3344 C CG    . TRP D 3 22  ? 4.817   19.464 46.111  1.00 81.78  ? 399 TRP M CG    1 
ATOM 3345 C CD1   . TRP D 3 22  ? 3.901   20.128 46.891  1.00 84.11  ? 399 TRP M CD1   1 
ATOM 3346 C CD2   . TRP D 3 22  ? 4.429   18.095 46.120  1.00 85.16  ? 399 TRP M CD2   1 
ATOM 3347 N NE1   . TRP D 3 22  ? 2.966   19.248 47.383  1.00 84.20  ? 399 TRP M NE1   1 
ATOM 3348 C CE2   . TRP D 3 22  ? 3.269   17.992 46.924  1.00 86.85  ? 399 TRP M CE2   1 
ATOM 3349 C CE3   . TRP D 3 22  ? 4.949   16.938 45.527  1.00 88.01  ? 399 TRP M CE3   1 
ATOM 3350 C CZ2   . TRP D 3 22  ? 2.621   16.778 47.147  1.00 90.05  ? 399 TRP M CZ2   1 
ATOM 3351 C CZ3   . TRP D 3 22  ? 4.304   15.725 45.748  1.00 91.10  ? 399 TRP M CZ3   1 
ATOM 3352 C CH2   . TRP D 3 22  ? 3.152   15.655 46.551  1.00 92.11  ? 399 TRP M CH2   1 
ATOM 3353 N N     . PRO D 3 23  ? 8.211   18.288 47.200  1.00 61.99  ? 400 PRO M N     1 
ATOM 3354 C CA    . PRO D 3 23  ? 9.134   17.147 47.257  1.00 60.36  ? 400 PRO M CA    1 
ATOM 3355 C C     . PRO D 3 23  ? 8.997   16.187 46.092  1.00 58.82  ? 400 PRO M C     1 
ATOM 3356 O O     . PRO D 3 23  ? 7.950   15.583 45.910  1.00 58.57  ? 400 PRO M O     1 
ATOM 3357 C CB    . PRO D 3 23  ? 8.765   16.463 48.565  1.00 59.34  ? 400 PRO M CB    1 
ATOM 3358 C CG    . PRO D 3 23  ? 8.206   17.571 49.381  1.00 60.70  ? 400 PRO M CG    1 
ATOM 3359 C CD    . PRO D 3 23  ? 7.356   18.312 48.393  1.00 61.22  ? 400 PRO M CD    1 
ATOM 3360 N N     . LEU D 3 24  ? 10.054  16.032 45.309  1.00 57.38  ? 401 LEU M N     1 
ATOM 3361 C CA    . LEU D 3 24  ? 9.992   15.117 44.184  1.00 57.00  ? 401 LEU M CA    1 
ATOM 3362 C C     . LEU D 3 24  ? 11.292  14.360 43.993  1.00 58.18  ? 401 LEU M C     1 
ATOM 3363 O O     . LEU D 3 24  ? 12.373  14.917 44.142  1.00 58.36  ? 401 LEU M O     1 
ATOM 3364 C CB    . LEU D 3 24  ? 9.630   15.875 42.907  1.00 54.69  ? 401 LEU M CB    1 
ATOM 3365 C CG    . LEU D 3 24  ? 8.207   16.436 42.854  1.00 51.87  ? 401 LEU M CG    1 
ATOM 3366 C CD1   . LEU D 3 24  ? 7.983   17.183 41.547  1.00 51.54  ? 401 LEU M CD1   1 
ATOM 3367 C CD2   . LEU D 3 24  ? 7.220   15.303 42.978  1.00 49.87  ? 401 LEU M CD2   1 
ATOM 3368 N N     . SER D 3 25  ? 11.184  13.076 43.681  1.00 59.70  ? 402 SER M N     1 
ATOM 3369 C CA    . SER D 3 25  ? 12.371  12.272 43.467  1.00 62.86  ? 402 SER M CA    1 
ATOM 3370 C C     . SER D 3 25  ? 12.697  12.342 41.992  1.00 65.69  ? 402 SER M C     1 
ATOM 3371 O O     . SER D 3 25  ? 11.857  12.747 41.190  1.00 66.41  ? 402 SER M O     1 
ATOM 3372 C CB    . SER D 3 25  ? 12.121  10.820 43.863  1.00 61.40  ? 402 SER M CB    1 
ATOM 3373 O OG    . SER D 3 25  ? 13.155  9.986  43.359  1.00 62.03  ? 402 SER M OG    1 
ATOM 3374 N N     . SER D 3 26  ? 13.911  11.949 41.632  1.00 69.04  ? 403 SER M N     1 
ATOM 3375 C CA    . SER D 3 26  ? 14.310  11.967 40.237  1.00 72.94  ? 403 SER M CA    1 
ATOM 3376 C C     . SER D 3 26  ? 13.924  10.659 39.568  1.00 75.95  ? 403 SER M C     1 
ATOM 3377 O O     . SER D 3 26  ? 14.009  10.535 38.351  1.00 76.31  ? 403 SER M O     1 
ATOM 3378 C CB    . SER D 3 26  ? 15.819  12.180 40.114  1.00 73.44  ? 403 SER M CB    1 
ATOM 3379 O OG    . SER D 3 26  ? 16.542  11.084 40.643  1.00 75.69  ? 403 SER M OG    1 
ATOM 3380 N N     . GLN D 3 27  ? 13.499  9.679  40.358  1.00 80.15  ? 404 GLN M N     1 
ATOM 3381 C CA    . GLN D 3 27  ? 13.117  8.397  39.785  1.00 84.61  ? 404 GLN M CA    1 
ATOM 3382 C C     . GLN D 3 27  ? 11.951  7.728  40.510  1.00 83.46  ? 404 GLN M C     1 
ATOM 3383 O O     . GLN D 3 27  ? 11.827  7.818  41.732  1.00 83.68  ? 404 GLN M O     1 
ATOM 3384 C CB    . GLN D 3 27  ? 14.317  7.458  39.778  1.00 91.30  ? 404 GLN M CB    1 
ATOM 3385 C CG    . GLN D 3 27  ? 14.661  6.905  41.145  1.00 102.90 ? 404 GLN M CG    1 
ATOM 3386 C CD    . GLN D 3 27  ? 15.963  6.122  41.149  1.00 109.79 ? 404 GLN M CD    1 
ATOM 3387 O OE1   . GLN D 3 27  ? 17.053  6.705  41.175  1.00 113.33 ? 404 GLN M OE1   1 
ATOM 3388 N NE2   . GLN D 3 27  ? 15.858  4.794  41.113  1.00 113.03 ? 404 GLN M NE2   1 
ATOM 3389 N N     . SER D 3 28  ? 11.102  7.059  39.733  1.00 81.55  ? 405 SER M N     1 
ATOM 3390 C CA    . SER D 3 28  ? 9.934   6.339  40.236  1.00 79.65  ? 405 SER M CA    1 
ATOM 3391 C C     . SER D 3 28  ? 9.691   5.146  39.324  1.00 78.42  ? 405 SER M C     1 
ATOM 3392 O O     . SER D 3 28  ? 9.815   5.265  38.109  1.00 79.18  ? 405 SER M O     1 
ATOM 3393 C CB    . SER D 3 28  ? 8.697   7.232  40.219  1.00 79.59  ? 405 SER M CB    1 
ATOM 3394 O OG    . SER D 3 28  ? 7.519   6.454  40.340  1.00 79.31  ? 405 SER M OG    1 
ATOM 3395 N N     . GLY D 3 29  ? 9.340   4.001  39.896  1.00 76.67  ? 406 GLY M N     1 
ATOM 3396 C CA    . GLY D 3 29  ? 9.112   2.834  39.066  1.00 73.51  ? 406 GLY M CA    1 
ATOM 3397 C C     . GLY D 3 29  ? 10.284  2.668  38.119  1.00 71.40  ? 406 GLY M C     1 
ATOM 3398 O O     . GLY D 3 29  ? 11.435  2.717  38.541  1.00 70.59  ? 406 GLY M O     1 
ATOM 3399 N N     . SER D 3 30  ? 9.993   2.487  36.837  1.00 70.09  ? 407 SER M N     1 
ATOM 3400 C CA    . SER D 3 30  ? 11.030  2.311  35.824  1.00 69.23  ? 407 SER M CA    1 
ATOM 3401 C C     . SER D 3 30  ? 11.306  3.625  35.107  1.00 68.14  ? 407 SER M C     1 
ATOM 3402 O O     . SER D 3 30  ? 11.650  3.653  33.925  1.00 68.02  ? 407 SER M O     1 
ATOM 3403 C CB    . SER D 3 30  ? 10.601  1.233  34.812  1.00 70.47  ? 407 SER M CB    1 
ATOM 3404 O OG    . SER D 3 30  ? 9.261   1.416  34.374  1.00 70.24  ? 407 SER M OG    1 
ATOM 3405 N N     . TYR D 3 31  ? 11.150  4.713  35.845  1.00 67.03  ? 408 TYR M N     1 
ATOM 3406 C CA    . TYR D 3 31  ? 11.355  6.050  35.315  1.00 66.49  ? 408 TYR M CA    1 
ATOM 3407 C C     . TYR D 3 31  ? 12.438  6.757  36.101  1.00 65.61  ? 408 TYR M C     1 
ATOM 3408 O O     . TYR D 3 31  ? 12.362  6.855  37.322  1.00 65.75  ? 408 TYR M O     1 
ATOM 3409 C CB    . TYR D 3 31  ? 10.076  6.875  35.437  1.00 66.90  ? 408 TYR M CB    1 
ATOM 3410 C CG    . TYR D 3 31  ? 8.916   6.426  34.587  1.00 67.39  ? 408 TYR M CG    1 
ATOM 3411 C CD1   . TYR D 3 31  ? 7.675   6.160  35.162  1.00 67.76  ? 408 TYR M CD1   1 
ATOM 3412 C CD2   . TYR D 3 31  ? 9.022   6.370  33.203  1.00 68.73  ? 408 TYR M CD2   1 
ATOM 3413 C CE1   . TYR D 3 31  ? 6.561   5.863  34.377  1.00 68.63  ? 408 TYR M CE1   1 
ATOM 3414 C CE2   . TYR D 3 31  ? 7.913   6.075  32.407  1.00 69.74  ? 408 TYR M CE2   1 
ATOM 3415 C CZ    . TYR D 3 31  ? 6.686   5.828  33.000  1.00 68.99  ? 408 TYR M CZ    1 
ATOM 3416 O OH    . TYR D 3 31  ? 5.583   5.590  32.212  1.00 69.23  ? 408 TYR M OH    1 
ATOM 3417 N N     . GLU D 3 32  ? 13.441  7.269  35.407  1.00 65.11  ? 409 GLU M N     1 
ATOM 3418 C CA    . GLU D 3 32  ? 14.505  7.982  36.092  1.00 64.42  ? 409 GLU M CA    1 
ATOM 3419 C C     . GLU D 3 32  ? 15.000  9.148  35.252  1.00 61.23  ? 409 GLU M C     1 
ATOM 3420 O O     . GLU D 3 32  ? 15.310  8.995  34.067  1.00 61.87  ? 409 GLU M O     1 
ATOM 3421 C CB    . GLU D 3 32  ? 15.651  7.032  36.412  1.00 67.91  ? 409 GLU M CB    1 
ATOM 3422 C CG    . GLU D 3 32  ? 16.808  7.679  37.127  1.00 73.33  ? 409 GLU M CG    1 
ATOM 3423 C CD    . GLU D 3 32  ? 17.864  6.666  37.496  1.00 77.26  ? 409 GLU M CD    1 
ATOM 3424 O OE1   . GLU D 3 32  ? 18.993  7.078  37.840  1.00 79.59  ? 409 GLU M OE1   1 
ATOM 3425 O OE2   . GLU D 3 32  ? 17.557  5.452  37.447  1.00 79.61  ? 409 GLU M OE2   1 
ATOM 3426 N N     . LEU D 3 33  ? 15.054  10.316 35.885  1.00 56.61  ? 410 LEU M N     1 
ATOM 3427 C CA    . LEU D 3 33  ? 15.490  11.547 35.245  1.00 51.34  ? 410 LEU M CA    1 
ATOM 3428 C C     . LEU D 3 33  ? 16.898  11.851 35.707  1.00 50.70  ? 410 LEU M C     1 
ATOM 3429 O O     . LEU D 3 33  ? 17.137  12.062 36.898  1.00 49.45  ? 410 LEU M O     1 
ATOM 3430 C CB    . LEU D 3 33  ? 14.566  12.693 35.641  1.00 47.01  ? 410 LEU M CB    1 
ATOM 3431 C CG    . LEU D 3 33  ? 14.857  14.035 34.992  1.00 43.63  ? 410 LEU M CG    1 
ATOM 3432 C CD1   . LEU D 3 33  ? 14.606  13.916 33.499  1.00 41.99  ? 410 LEU M CD1   1 
ATOM 3433 C CD2   . LEU D 3 33  ? 13.989  15.113 35.621  1.00 40.98  ? 410 LEU M CD2   1 
ATOM 3434 N N     . ARG D 3 34  ? 17.832  11.870 34.762  1.00 50.31  ? 411 ARG M N     1 
ATOM 3435 C CA    . ARG D 3 34  ? 19.220  12.138 35.098  1.00 49.40  ? 411 ARG M CA    1 
ATOM 3436 C C     . ARG D 3 34  ? 19.832  13.349 34.433  1.00 47.95  ? 411 ARG M C     1 
ATOM 3437 O O     . ARG D 3 34  ? 19.401  13.778 33.364  1.00 48.99  ? 411 ARG M O     1 
ATOM 3438 C CB    . ARG D 3 34  ? 20.088  10.928 34.775  1.00 49.56  ? 411 ARG M CB    1 
ATOM 3439 C CG    . ARG D 3 34  ? 19.856  9.773  35.699  1.00 53.18  ? 411 ARG M CG    1 
ATOM 3440 C CD    . ARG D 3 34  ? 21.107  8.940  35.823  1.00 56.69  ? 411 ARG M CD    1 
ATOM 3441 N NE    . ARG D 3 34  ? 21.436  8.237  34.592  1.00 56.84  ? 411 ARG M NE    1 
ATOM 3442 C CZ    . ARG D 3 34  ? 21.131  6.967  34.360  1.00 58.06  ? 411 ARG M CZ    1 
ATOM 3443 N NH1   . ARG D 3 34  ? 20.487  6.250  35.273  1.00 54.94  ? 411 ARG M NH1   1 
ATOM 3444 N NH2   . ARG D 3 34  ? 21.487  6.413  33.210  1.00 61.31  ? 411 ARG M NH2   1 
ATOM 3445 N N     . ILE D 3 35  ? 20.832  13.902 35.104  1.00 45.82  ? 412 ILE M N     1 
ATOM 3446 C CA    . ILE D 3 35  ? 21.590  15.023 34.598  1.00 43.95  ? 412 ILE M CA    1 
ATOM 3447 C C     . ILE D 3 35  ? 22.800  14.312 34.000  1.00 44.47  ? 412 ILE M C     1 
ATOM 3448 O O     . ILE D 3 35  ? 23.831  14.199 34.658  1.00 46.71  ? 412 ILE M O     1 
ATOM 3449 C CB    . ILE D 3 35  ? 22.122  15.912 35.725  1.00 43.35  ? 412 ILE M CB    1 
ATOM 3450 C CG1   . ILE D 3 35  ? 20.977  16.523 36.521  1.00 43.07  ? 412 ILE M CG1   1 
ATOM 3451 C CG2   . ILE D 3 35  ? 23.022  16.976 35.150  1.00 43.02  ? 412 ILE M CG2   1 
ATOM 3452 C CD1   . ILE D 3 35  ? 20.184  17.527 35.786  1.00 43.36  ? 412 ILE M CD1   1 
ATOM 3453 N N     . GLU D 3 36  ? 22.673  13.798 32.781  1.00 43.21  ? 413 GLU M N     1 
ATOM 3454 C CA    . GLU D 3 36  ? 23.785  13.113 32.141  1.00 41.59  ? 413 GLU M CA    1 
ATOM 3455 C C     . GLU D 3 36  ? 25.044  13.988 32.100  1.00 38.18  ? 413 GLU M C     1 
ATOM 3456 O O     . GLU D 3 36  ? 26.155  13.467 32.160  1.00 36.53  ? 413 GLU M O     1 
ATOM 3457 C CB    . GLU D 3 36  ? 23.379  12.664 30.733  1.00 45.51  ? 413 GLU M CB    1 
ATOM 3458 C CG    . GLU D 3 36  ? 22.343  11.535 30.743  1.00 49.67  ? 413 GLU M CG    1 
ATOM 3459 C CD    . GLU D 3 36  ? 22.898  10.239 31.324  1.00 53.89  ? 413 GLU M CD    1 
ATOM 3460 O OE1   . GLU D 3 36  ? 22.104  9.411  31.830  1.00 54.77  ? 413 GLU M OE1   1 
ATOM 3461 O OE2   . GLU D 3 36  ? 24.135  10.043 31.266  1.00 54.61  ? 413 GLU M OE2   1 
ATOM 3462 N N     . VAL D 3 37  ? 24.866  15.308 32.016  1.00 34.72  ? 414 VAL M N     1 
ATOM 3463 C CA    . VAL D 3 37  ? 25.996  16.249 31.993  1.00 32.92  ? 414 VAL M CA    1 
ATOM 3464 C C     . VAL D 3 37  ? 25.793  17.502 32.855  1.00 33.33  ? 414 VAL M C     1 
ATOM 3465 O O     . VAL D 3 37  ? 25.099  18.428 32.471  1.00 33.22  ? 414 VAL M O     1 
ATOM 3466 C CB    . VAL D 3 37  ? 26.348  16.701 30.553  1.00 30.60  ? 414 VAL M CB    1 
ATOM 3467 C CG1   . VAL D 3 37  ? 27.278  17.883 30.595  1.00 28.33  ? 414 VAL M CG1   1 
ATOM 3468 C CG2   . VAL D 3 37  ? 27.023  15.580 29.812  1.00 27.03  ? 414 VAL M CG2   1 
ATOM 3469 N N     . GLN D 3 38  ? 26.440  17.524 34.016  1.00 34.16  ? 415 GLN M N     1 
ATOM 3470 C CA    . GLN D 3 38  ? 26.345  18.630 34.960  1.00 33.86  ? 415 GLN M CA    1 
ATOM 3471 C C     . GLN D 3 38  ? 27.003  19.885 34.442  1.00 34.48  ? 415 GLN M C     1 
ATOM 3472 O O     . GLN D 3 38  ? 27.967  19.827 33.679  1.00 35.09  ? 415 GLN M O     1 
ATOM 3473 C CB    . GLN D 3 38  ? 27.015  18.255 36.280  1.00 33.38  ? 415 GLN M CB    1 
ATOM 3474 C CG    . GLN D 3 38  ? 26.329  17.158 37.033  1.00 35.59  ? 415 GLN M CG    1 
ATOM 3475 C CD    . GLN D 3 38  ? 25.169  17.670 37.840  1.00 38.79  ? 415 GLN M CD    1 
ATOM 3476 O OE1   . GLN D 3 38  ? 24.347  16.894 38.314  1.00 41.21  ? 415 GLN M OE1   1 
ATOM 3477 N NE2   . GLN D 3 38  ? 25.098  18.986 38.015  1.00 38.62  ? 415 GLN M NE2   1 
ATOM 3478 N N     . PRO D 3 39  ? 26.489  21.045 34.858  1.00 35.04  ? 416 PRO M N     1 
ATOM 3479 C CA    . PRO D 3 39  ? 27.033  22.333 34.445  1.00 36.40  ? 416 PRO M CA    1 
ATOM 3480 C C     . PRO D 3 39  ? 28.310  22.646 35.206  1.00 38.21  ? 416 PRO M C     1 
ATOM 3481 O O     . PRO D 3 39  ? 28.731  21.889 36.071  1.00 39.42  ? 416 PRO M O     1 
ATOM 3482 C CB    . PRO D 3 39  ? 25.904  23.303 34.779  1.00 35.50  ? 416 PRO M CB    1 
ATOM 3483 C CG    . PRO D 3 39  ? 25.264  22.680 35.947  1.00 34.62  ? 416 PRO M CG    1 
ATOM 3484 C CD    . PRO D 3 39  ? 25.206  21.229 35.557  1.00 34.90  ? 416 PRO M CD    1 
ATOM 3485 N N     . LYS D 3 40  ? 28.932  23.762 34.873  1.00 40.85  ? 417 LYS M N     1 
ATOM 3486 C CA    . LYS D 3 40  ? 30.145  24.159 35.544  1.00 43.62  ? 417 LYS M CA    1 
ATOM 3487 C C     . LYS D 3 40  ? 29.771  24.623 36.929  1.00 45.11  ? 417 LYS M C     1 
ATOM 3488 O O     . LYS D 3 40  ? 28.610  24.887 37.209  1.00 46.50  ? 417 LYS M O     1 
ATOM 3489 C CB    . LYS D 3 40  ? 30.790  25.301 34.795  1.00 46.59  ? 417 LYS M CB    1 
ATOM 3490 C CG    . LYS D 3 40  ? 31.086  24.975 33.350  1.00 51.17  ? 417 LYS M CG    1 
ATOM 3491 C CD    . LYS D 3 40  ? 31.376  26.240 32.584  1.00 55.32  ? 417 LYS M CD    1 
ATOM 3492 C CE    . LYS D 3 40  ? 32.405  27.088 33.304  1.00 59.38  ? 417 LYS M CE    1 
ATOM 3493 N NZ    . LYS D 3 40  ? 32.523  28.408 32.641  1.00 64.56  ? 417 LYS M NZ    1 
ATOM 3494 N N     . PRO D 3 41  ? 30.752  24.703 37.826  1.00 45.77  ? 418 PRO M N     1 
ATOM 3495 C CA    . PRO D 3 41  ? 30.522  25.145 39.199  1.00 46.35  ? 418 PRO M CA    1 
ATOM 3496 C C     . PRO D 3 41  ? 30.146  26.614 39.284  1.00 47.44  ? 418 PRO M C     1 
ATOM 3497 O O     . PRO D 3 41  ? 29.315  27.003 40.104  1.00 49.37  ? 418 PRO M O     1 
ATOM 3498 C CB    . PRO D 3 41  ? 31.851  24.854 39.871  1.00 45.44  ? 418 PRO M CB    1 
ATOM 3499 C CG    . PRO D 3 41  ? 32.289  23.630 39.181  1.00 44.78  ? 418 PRO M CG    1 
ATOM 3500 C CD    . PRO D 3 41  ? 32.017  23.962 37.736  1.00 45.93  ? 418 PRO M CD    1 
ATOM 3501 N N     . HIS D 3 42  ? 30.759  27.433 38.441  1.00 47.49  ? 419 HIS M N     1 
ATOM 3502 C CA    . HIS D 3 42  ? 30.469  28.853 38.457  1.00 48.09  ? 419 HIS M CA    1 
ATOM 3503 C C     . HIS D 3 42  ? 29.821  29.312 37.156  1.00 45.22  ? 419 HIS M C     1 
ATOM 3504 O O     . HIS D 3 42  ? 29.967  28.672 36.124  1.00 46.51  ? 419 HIS M O     1 
ATOM 3505 C CB    . HIS D 3 42  ? 31.752  29.639 38.708  1.00 54.86  ? 419 HIS M CB    1 
ATOM 3506 C CG    . HIS D 3 42  ? 31.628  31.102 38.410  1.00 63.67  ? 419 HIS M CG    1 
ATOM 3507 N ND1   . HIS D 3 42  ? 30.769  31.934 39.098  1.00 66.76  ? 419 HIS M ND1   1 
ATOM 3508 C CD2   . HIS D 3 42  ? 32.242  31.879 37.484  1.00 66.78  ? 419 HIS M CD2   1 
ATOM 3509 C CE1   . HIS D 3 42  ? 30.861  33.159 38.612  1.00 67.76  ? 419 HIS M CE1   1 
ATOM 3510 N NE2   . HIS D 3 42  ? 31.748  33.154 37.632  1.00 69.22  ? 419 HIS M NE2   1 
ATOM 3511 N N     . HIS D 3 43  ? 29.094  30.423 37.227  1.00 41.22  ? 420 HIS M N     1 
ATOM 3512 C CA    . HIS D 3 43  ? 28.414  31.016 36.076  1.00 35.73  ? 420 HIS M CA    1 
ATOM 3513 C C     . HIS D 3 43  ? 27.892  32.416 36.397  1.00 31.29  ? 420 HIS M C     1 
ATOM 3514 O O     . HIS D 3 43  ? 26.747  32.592 36.754  1.00 27.56  ? 420 HIS M O     1 
ATOM 3515 C CB    . HIS D 3 43  ? 27.234  30.158 35.623  1.00 36.08  ? 420 HIS M CB    1 
ATOM 3516 C CG    . HIS D 3 43  ? 26.443  30.790 34.524  1.00 38.34  ? 420 HIS M CG    1 
ATOM 3517 N ND1   . HIS D 3 43  ? 26.670  30.515 33.194  1.00 39.50  ? 420 HIS M ND1   1 
ATOM 3518 C CD2   . HIS D 3 43  ? 25.512  31.775 34.551  1.00 38.92  ? 420 HIS M CD2   1 
ATOM 3519 C CE1   . HIS D 3 43  ? 25.919  31.307 32.449  1.00 40.64  ? 420 HIS M CE1   1 
ATOM 3520 N NE2   . HIS D 3 43  ? 25.209  32.084 33.247  1.00 39.69  ? 420 HIS M NE2   1 
ATOM 3521 N N     . ARG D 3 44  ? 28.731  33.422 36.263  1.00 30.40  ? 421 ARG M N     1 
ATOM 3522 C CA    . ARG D 3 44  ? 28.281  34.774 36.551  1.00 30.89  ? 421 ARG M CA    1 
ATOM 3523 C C     . ARG D 3 44  ? 26.930  35.065 35.891  1.00 31.15  ? 421 ARG M C     1 
ATOM 3524 O O     . ARG D 3 44  ? 26.786  34.955 34.683  1.00 33.10  ? 421 ARG M O     1 
ATOM 3525 C CB    . ARG D 3 44  ? 29.337  35.774 36.079  1.00 28.65  ? 421 ARG M CB    1 
ATOM 3526 C CG    . ARG D 3 44  ? 28.942  37.215 36.210  1.00 26.11  ? 421 ARG M CG    1 
ATOM 3527 C CD    . ARG D 3 44  ? 30.111  38.095 35.880  1.00 27.13  ? 421 ARG M CD    1 
ATOM 3528 N NE    . ARG D 3 44  ? 29.748  39.497 35.954  1.00 30.19  ? 421 ARG M NE    1 
ATOM 3529 C CZ    . ARG D 3 44  ? 30.569  40.501 35.667  1.00 34.25  ? 421 ARG M CZ    1 
ATOM 3530 N NH1   . ARG D 3 44  ? 31.814  40.250 35.285  1.00 34.27  ? 421 ARG M NH1   1 
ATOM 3531 N NH2   . ARG D 3 44  ? 30.136  41.760 35.746  1.00 36.88  ? 421 ARG M NH2   1 
ATOM 3532 N N     . ALA D 3 45  ? 25.940  35.423 36.694  1.00 32.03  ? 422 ALA M N     1 
ATOM 3533 C CA    . ALA D 3 45  ? 24.609  35.725 36.182  1.00 32.47  ? 422 ALA M CA    1 
ATOM 3534 C C     . ALA D 3 45  ? 24.609  37.147 35.686  1.00 32.72  ? 422 ALA M C     1 
ATOM 3535 O O     . ALA D 3 45  ? 25.493  37.919 36.029  1.00 31.08  ? 422 ALA M O     1 
ATOM 3536 C CB    . ALA D 3 45  ? 23.571  35.567 37.282  1.00 33.88  ? 422 ALA M CB    1 
ATOM 3537 N N     . HIS D 3 46  ? 23.614  37.501 34.886  1.00 34.31  ? 423 HIS M N     1 
ATOM 3538 C CA    . HIS D 3 46  ? 23.546  38.857 34.366  1.00 38.31  ? 423 HIS M CA    1 
ATOM 3539 C C     . HIS D 3 46  ? 22.321  39.602 34.869  1.00 40.31  ? 423 HIS M C     1 
ATOM 3540 O O     . HIS D 3 46  ? 21.297  38.993 35.195  1.00 40.82  ? 423 HIS M O     1 
ATOM 3541 C CB    . HIS D 3 46  ? 23.541  38.854 32.825  1.00 39.44  ? 423 HIS M CB    1 
ATOM 3542 C CG    . HIS D 3 46  ? 22.346  38.187 32.210  1.00 39.72  ? 423 HIS M CG    1 
ATOM 3543 N ND1   . HIS D 3 46  ? 22.290  36.832 31.961  1.00 41.25  ? 423 HIS M ND1   1 
ATOM 3544 C CD2   . HIS D 3 46  ? 21.157  38.693 31.801  1.00 39.19  ? 423 HIS M CD2   1 
ATOM 3545 C CE1   . HIS D 3 46  ? 21.120  36.532 31.426  1.00 40.88  ? 423 HIS M CE1   1 
ATOM 3546 N NE2   . HIS D 3 46  ? 20.414  37.645 31.319  1.00 38.49  ? 423 HIS M NE2   1 
ATOM 3547 N N     . TYR D 3 47  ? 22.433  40.923 34.926  1.00 41.55  ? 424 TYR M N     1 
ATOM 3548 C CA    . TYR D 3 47  ? 21.330  41.762 35.354  1.00 45.00  ? 424 TYR M CA    1 
ATOM 3549 C C     . TYR D 3 47  ? 20.475  42.179 34.157  1.00 47.79  ? 424 TYR M C     1 
ATOM 3550 O O     . TYR D 3 47  ? 20.925  42.114 33.022  1.00 48.34  ? 424 TYR M O     1 
ATOM 3551 C CB    . TYR D 3 47  ? 21.878  42.993 36.058  1.00 43.99  ? 424 TYR M CB    1 
ATOM 3552 C CG    . TYR D 3 47  ? 22.388  42.688 37.436  1.00 43.87  ? 424 TYR M CG    1 
ATOM 3553 C CD1   . TYR D 3 47  ? 23.481  41.867 37.619  1.00 43.15  ? 424 TYR M CD1   1 
ATOM 3554 C CD2   . TYR D 3 47  ? 21.758  43.211 38.567  1.00 44.88  ? 424 TYR M CD2   1 
ATOM 3555 C CE1   . TYR D 3 47  ? 23.942  41.569 38.895  1.00 43.59  ? 424 TYR M CE1   1 
ATOM 3556 C CE2   . TYR D 3 47  ? 22.209  42.918 39.842  1.00 44.02  ? 424 TYR M CE2   1 
ATOM 3557 C CZ    . TYR D 3 47  ? 23.305  42.096 39.998  1.00 43.41  ? 424 TYR M CZ    1 
ATOM 3558 O OH    . TYR D 3 47  ? 23.781  41.807 41.251  1.00 43.00  ? 424 TYR M OH    1 
ATOM 3559 N N     . GLU D 3 48  ? 19.241  42.599 34.403  1.00 51.74  ? 425 GLU M N     1 
ATOM 3560 C CA    . GLU D 3 48  ? 18.377  43.018 33.312  1.00 56.42  ? 425 GLU M CA    1 
ATOM 3561 C C     . GLU D 3 48  ? 18.978  44.217 32.622  1.00 55.72  ? 425 GLU M C     1 
ATOM 3562 O O     . GLU D 3 48  ? 18.780  44.409 31.426  1.00 58.13  ? 425 GLU M O     1 
ATOM 3563 C CB    . GLU D 3 48  ? 16.982  43.386 33.819  1.00 63.34  ? 425 GLU M CB    1 
ATOM 3564 C CG    . GLU D 3 48  ? 16.138  42.190 34.250  1.00 75.34  ? 425 GLU M CG    1 
ATOM 3565 C CD    . GLU D 3 48  ? 15.027  42.556 35.238  1.00 80.42  ? 425 GLU M CD    1 
ATOM 3566 O OE1   . GLU D 3 48  ? 15.347  43.041 36.350  1.00 82.14  ? 425 GLU M OE1   1 
ATOM 3567 O OE2   . GLU D 3 48  ? 13.838  42.350 34.901  1.00 83.31  ? 425 GLU M OE2   1 
ATOM 3568 N N     . THR D 3 49  ? 19.724  45.020 33.371  1.00 53.75  ? 426 THR M N     1 
ATOM 3569 C CA    . THR D 3 49  ? 20.331  46.226 32.821  1.00 51.14  ? 426 THR M CA    1 
ATOM 3570 C C     . THR D 3 49  ? 21.592  45.983 32.010  1.00 49.17  ? 426 THR M C     1 
ATOM 3571 O O     . THR D 3 49  ? 22.185  46.914 31.490  1.00 48.28  ? 426 THR M O     1 
ATOM 3572 C CB    . THR D 3 49  ? 20.642  47.226 33.936  1.00 51.48  ? 426 THR M CB    1 
ATOM 3573 O OG1   . THR D 3 49  ? 21.458  46.604 34.932  1.00 52.09  ? 426 THR M OG1   1 
ATOM 3574 C CG2   . THR D 3 49  ? 19.366  47.681 34.582  1.00 52.24  ? 426 THR M CG2   1 
ATOM 3575 N N     . GLU D 3 50  ? 22.009  44.730 31.932  1.00 48.94  ? 427 GLU M N     1 
ATOM 3576 C CA    . GLU D 3 50  ? 23.185  44.346 31.160  1.00 50.11  ? 427 GLU M CA    1 
ATOM 3577 C C     . GLU D 3 50  ? 22.637  43.521 30.018  1.00 51.51  ? 427 GLU M C     1 
ATOM 3578 O O     . GLU D 3 50  ? 21.433  43.249 29.940  1.00 52.74  ? 427 GLU M O     1 
ATOM 3579 C CB    . GLU D 3 50  ? 24.121  43.411 31.932  1.00 49.50  ? 427 GLU M CB    1 
ATOM 3580 C CG    . GLU D 3 50  ? 24.960  43.980 33.031  1.00 47.94  ? 427 GLU M CG    1 
ATOM 3581 C CD    . GLU D 3 50  ? 25.861  42.910 33.608  1.00 49.04  ? 427 GLU M CD    1 
ATOM 3582 O OE1   . GLU D 3 50  ? 25.343  41.811 33.892  1.00 50.12  ? 427 GLU M OE1   1 
ATOM 3583 O OE2   . GLU D 3 50  ? 27.076  43.149 33.779  1.00 49.06  ? 427 GLU M OE2   1 
ATOM 3584 N N     . GLY D 3 51  ? 23.526  43.085 29.142  1.00 51.09  ? 428 GLY M N     1 
ATOM 3585 C CA    . GLY D 3 51  ? 23.070  42.255 28.055  1.00 50.06  ? 428 GLY M CA    1 
ATOM 3586 C C     . GLY D 3 51  ? 22.835  40.924 28.716  1.00 46.83  ? 428 GLY M C     1 
ATOM 3587 O O     . GLY D 3 51  ? 22.558  40.872 29.903  1.00 48.35  ? 428 GLY M O     1 
ATOM 3588 N N     . SER D 3 52  ? 22.929  39.852 27.955  1.00 43.75  ? 429 SER M N     1 
ATOM 3589 C CA    . SER D 3 52  ? 22.764  38.537 28.511  1.00 40.05  ? 429 SER M CA    1 
ATOM 3590 C C     . SER D 3 52  ? 24.190  38.084 28.707  1.00 38.71  ? 429 SER M C     1 
ATOM 3591 O O     . SER D 3 52  ? 25.085  38.596 28.062  1.00 39.76  ? 429 SER M O     1 
ATOM 3592 C CB    . SER D 3 52  ? 22.051  37.636 27.513  1.00 41.06  ? 429 SER M CB    1 
ATOM 3593 O OG    . SER D 3 52  ? 22.696  36.380 27.401  1.00 42.48  ? 429 SER M OG    1 
ATOM 3594 N N     . ARG D 3 53  ? 24.434  37.158 29.613  1.00 37.04  ? 430 ARG M N     1 
ATOM 3595 C CA    . ARG D 3 53  ? 25.793  36.701 29.773  1.00 34.35  ? 430 ARG M CA    1 
ATOM 3596 C C     . ARG D 3 53  ? 25.937  35.283 29.259  1.00 33.96  ? 430 ARG M C     1 
ATOM 3597 O O     . ARG D 3 53  ? 26.911  34.599 29.539  1.00 33.62  ? 430 ARG M O     1 
ATOM 3598 C CB    . ARG D 3 53  ? 26.229  36.843 31.221  1.00 32.20  ? 430 ARG M CB    1 
ATOM 3599 C CG    . ARG D 3 53  ? 26.746  38.230 31.481  1.00 27.39  ? 430 ARG M CG    1 
ATOM 3600 C CD    . ARG D 3 53  ? 26.963  38.533 32.938  1.00 24.61  ? 430 ARG M CD    1 
ATOM 3601 N NE    . ARG D 3 53  ? 27.386  39.919 33.087  1.00 21.88  ? 430 ARG M NE    1 
ATOM 3602 C CZ    . ARG D 3 53  ? 28.607  40.355 32.789  1.00 23.49  ? 430 ARG M CZ    1 
ATOM 3603 N NH1   . ARG D 3 53  ? 29.527  39.497 32.340  1.00 22.96  ? 430 ARG M NH1   1 
ATOM 3604 N NH2   . ARG D 3 53  ? 28.902  41.648 32.914  1.00 20.32  ? 430 ARG M NH2   1 
ATOM 3605 N N     . GLY D 3 54  ? 24.949  34.865 28.475  1.00 33.69  ? 431 GLY M N     1 
ATOM 3606 C CA    . GLY D 3 54  ? 24.973  33.549 27.873  1.00 33.14  ? 431 GLY M CA    1 
ATOM 3607 C C     . GLY D 3 54  ? 24.390  32.419 28.681  1.00 33.48  ? 431 GLY M C     1 
ATOM 3608 O O     . GLY D 3 54  ? 23.922  32.612 29.801  1.00 35.61  ? 431 GLY M O     1 
ATOM 3609 N N     . ALA D 3 55  ? 24.435  31.227 28.104  1.00 32.76  ? 432 ALA M N     1 
ATOM 3610 C CA    . ALA D 3 55  ? 23.906  30.051 28.763  1.00 33.93  ? 432 ALA M CA    1 
ATOM 3611 C C     . ALA D 3 55  ? 24.916  29.344 29.662  1.00 33.86  ? 432 ALA M C     1 
ATOM 3612 O O     . ALA D 3 55  ? 26.137  29.464 29.507  1.00 33.06  ? 432 ALA M O     1 
ATOM 3613 C CB    . ALA D 3 55  ? 23.361  29.065 27.725  1.00 33.75  ? 432 ALA M CB    1 
ATOM 3614 N N     . VAL D 3 56  ? 24.369  28.600 30.608  1.00 33.68  ? 433 VAL M N     1 
ATOM 3615 C CA    . VAL D 3 56  ? 25.152  27.832 31.541  1.00 34.27  ? 433 VAL M CA    1 
ATOM 3616 C C     . VAL D 3 56  ? 25.831  26.755 30.714  1.00 34.20  ? 433 VAL M C     1 
ATOM 3617 O O     . VAL D 3 56  ? 25.160  26.035 29.984  1.00 35.22  ? 433 VAL M O     1 
ATOM 3618 C CB    . VAL D 3 56  ? 24.227  27.158 32.550  1.00 35.10  ? 433 VAL M CB    1 
ATOM 3619 C CG1   . VAL D 3 56  ? 24.956  26.923 33.854  1.00 37.89  ? 433 VAL M CG1   1 
ATOM 3620 C CG2   . VAL D 3 56  ? 22.990  28.003 32.753  1.00 34.73  ? 433 VAL M CG2   1 
ATOM 3621 N N     . LYS D 3 57  ? 27.148  26.643 30.817  1.00 34.24  ? 434 LYS M N     1 
ATOM 3622 C CA    . LYS D 3 57  ? 27.875  25.634 30.062  1.00 36.12  ? 434 LYS M CA    1 
ATOM 3623 C C     . LYS D 3 57  ? 28.445  24.564 30.970  1.00 37.96  ? 434 LYS M C     1 
ATOM 3624 O O     . LYS D 3 57  ? 28.466  24.715 32.181  1.00 39.80  ? 434 LYS M O     1 
ATOM 3625 C CB    . LYS D 3 57  ? 29.035  26.256 29.291  1.00 35.45  ? 434 LYS M CB    1 
ATOM 3626 C CG    . LYS D 3 57  ? 28.667  27.377 28.360  1.00 37.52  ? 434 LYS M CG    1 
ATOM 3627 C CD    . LYS D 3 57  ? 29.878  27.788 27.524  1.00 41.22  ? 434 LYS M CD    1 
ATOM 3628 C CE    . LYS D 3 57  ? 29.601  29.015 26.654  1.00 43.29  ? 434 LYS M CE    1 
ATOM 3629 N NZ    . LYS D 3 57  ? 29.149  30.198 27.456  1.00 46.05  ? 434 LYS M NZ    1 
ATOM 3630 N N     . ALA D 3 58  ? 28.923  23.482 30.368  1.00 40.40  ? 435 ALA M N     1 
ATOM 3631 C CA    . ALA D 3 58  ? 29.527  22.382 31.109  1.00 40.87  ? 435 ALA M CA    1 
ATOM 3632 C C     . ALA D 3 58  ? 31.026  22.613 31.101  1.00 42.55  ? 435 ALA M C     1 
ATOM 3633 O O     . ALA D 3 58  ? 31.539  23.387 30.297  1.00 43.85  ? 435 ALA M O     1 
ATOM 3634 C CB    . ALA D 3 58  ? 29.217  21.078 30.434  1.00 41.49  ? 435 ALA M CB    1 
ATOM 3635 N N     . PRO D 3 59  ? 31.757  21.934 31.980  1.00 42.57  ? 436 PRO M N     1 
ATOM 3636 C CA    . PRO D 3 59  ? 33.206  22.099 32.042  1.00 43.58  ? 436 PRO M CA    1 
ATOM 3637 C C     . PRO D 3 59  ? 33.882  21.926 30.690  1.00 44.97  ? 436 PRO M C     1 
ATOM 3638 O O     . PRO D 3 59  ? 34.784  22.677 30.333  1.00 44.84  ? 436 PRO M O     1 
ATOM 3639 C CB    . PRO D 3 59  ? 33.622  21.016 33.017  1.00 42.89  ? 436 PRO M CB    1 
ATOM 3640 C CG    . PRO D 3 59  ? 32.458  20.943 33.922  1.00 43.96  ? 436 PRO M CG    1 
ATOM 3641 C CD    . PRO D 3 59  ? 31.308  20.946 32.964  1.00 42.95  ? 436 PRO M CD    1 
ATOM 3642 N N     . THR D 3 60  ? 33.428  20.925 29.946  1.00 47.53  ? 437 THR M N     1 
ATOM 3643 C CA    . THR D 3 60  ? 33.974  20.578 28.633  1.00 48.87  ? 437 THR M CA    1 
ATOM 3644 C C     . THR D 3 60  ? 33.981  21.728 27.645  1.00 48.36  ? 437 THR M C     1 
ATOM 3645 O O     . THR D 3 60  ? 34.762  21.742 26.705  1.00 49.92  ? 437 THR M O     1 
ATOM 3646 C CB    . THR D 3 60  ? 33.156  19.453 27.983  1.00 51.01  ? 437 THR M CB    1 
ATOM 3647 O OG1   . THR D 3 60  ? 31.936  20.006 27.470  1.00 53.27  ? 437 THR M OG1   1 
ATOM 3648 C CG2   . THR D 3 60  ? 32.807  18.367 29.008  1.00 52.36  ? 437 THR M CG2   1 
ATOM 3649 N N     . GLY D 3 61  ? 33.110  22.697 27.859  1.00 47.14  ? 438 GLY M N     1 
ATOM 3650 C CA    . GLY D 3 61  ? 33.014  23.802 26.932  1.00 45.31  ? 438 GLY M CA    1 
ATOM 3651 C C     . GLY D 3 61  ? 31.659  23.596 26.286  1.00 45.66  ? 438 GLY M C     1 
ATOM 3652 O O     . GLY D 3 61  ? 31.111  24.488 25.634  1.00 45.16  ? 438 GLY M O     1 
ATOM 3653 N N     . GLY D 3 62  ? 31.111  22.397 26.486  1.00 44.39  ? 439 GLY M N     1 
ATOM 3654 C CA    . GLY D 3 62  ? 29.806  22.079 25.947  1.00 44.04  ? 439 GLY M CA    1 
ATOM 3655 C C     . GLY D 3 62  ? 28.700  22.576 26.864  1.00 44.60  ? 439 GLY M C     1 
ATOM 3656 O O     . GLY D 3 62  ? 28.849  23.579 27.551  1.00 45.39  ? 439 GLY M O     1 
ATOM 3657 N N     . HIS D 3 63  ? 27.580  21.870 26.883  1.00 45.22  ? 440 HIS M N     1 
ATOM 3658 C CA    . HIS D 3 63  ? 26.448  22.261 27.713  1.00 43.10  ? 440 HIS M CA    1 
ATOM 3659 C C     . HIS D 3 63  ? 25.920  21.091 28.513  1.00 41.79  ? 440 HIS M C     1 
ATOM 3660 O O     . HIS D 3 63  ? 26.275  19.928 28.265  1.00 41.85  ? 440 HIS M O     1 
ATOM 3661 C CB    . HIS D 3 63  ? 25.325  22.800 26.841  1.00 44.31  ? 440 HIS M CB    1 
ATOM 3662 C CG    . HIS D 3 63  ? 25.703  24.019 26.075  1.00 44.29  ? 440 HIS M CG    1 
ATOM 3663 N ND1   . HIS D 3 63  ? 25.742  25.270 26.647  1.00 46.67  ? 440 HIS M ND1   1 
ATOM 3664 C CD2   . HIS D 3 63  ? 26.103  24.177 24.795  1.00 45.19  ? 440 HIS M CD2   1 
ATOM 3665 C CE1   . HIS D 3 63  ? 26.149  26.150 25.752  1.00 47.09  ? 440 HIS M CE1   1 
ATOM 3666 N NE2   . HIS D 3 63  ? 26.376  25.512 24.619  1.00 48.50  ? 440 HIS M NE2   1 
ATOM 3667 N N     . PRO D 3 64  ? 25.060  21.381 29.494  1.00 39.33  ? 441 PRO M N     1 
ATOM 3668 C CA    . PRO D 3 64  ? 24.531  20.279 30.278  1.00 37.46  ? 441 PRO M CA    1 
ATOM 3669 C C     . PRO D 3 64  ? 23.557  19.477 29.442  1.00 36.28  ? 441 PRO M C     1 
ATOM 3670 O O     . PRO D 3 64  ? 23.058  19.941 28.418  1.00 34.10  ? 441 PRO M O     1 
ATOM 3671 C CB    . PRO D 3 64  ? 23.879  20.984 31.460  1.00 35.66  ? 441 PRO M CB    1 
ATOM 3672 C CG    . PRO D 3 64  ? 23.444  22.232 30.887  1.00 38.05  ? 441 PRO M CG    1 
ATOM 3673 C CD    . PRO D 3 64  ? 24.626  22.663 30.060  1.00 38.00  ? 441 PRO M CD    1 
ATOM 3674 N N     . VAL D 3 65  ? 23.318  18.257 29.887  1.00 36.21  ? 442 VAL M N     1 
ATOM 3675 C CA    . VAL D 3 65  ? 22.417  17.347 29.217  1.00 36.94  ? 442 VAL M CA    1 
ATOM 3676 C C     . VAL D 3 65  ? 21.561  16.624 30.246  1.00 38.41  ? 442 VAL M C     1 
ATOM 3677 O O     . VAL D 3 65  ? 22.053  16.208 31.295  1.00 37.84  ? 442 VAL M O     1 
ATOM 3678 C CB    . VAL D 3 65  ? 23.210  16.317 28.410  1.00 35.43  ? 442 VAL M CB    1 
ATOM 3679 C CG1   . VAL D 3 65  ? 22.305  15.165 27.973  1.00 32.23  ? 442 VAL M CG1   1 
ATOM 3680 C CG2   . VAL D 3 65  ? 23.846  17.007 27.241  1.00 31.29  ? 442 VAL M CG2   1 
ATOM 3681 N N     . VAL D 3 66  ? 20.278  16.487 29.938  1.00 39.10  ? 443 VAL M N     1 
ATOM 3682 C CA    . VAL D 3 66  ? 19.351  15.802 30.822  1.00 39.66  ? 443 VAL M CA    1 
ATOM 3683 C C     . VAL D 3 66  ? 18.706  14.669 30.033  1.00 41.05  ? 443 VAL M C     1 
ATOM 3684 O O     . VAL D 3 66  ? 18.609  14.735 28.816  1.00 40.55  ? 443 VAL M O     1 
ATOM 3685 C CB    . VAL D 3 66  ? 18.288  16.778 31.351  1.00 38.40  ? 443 VAL M CB    1 
ATOM 3686 C CG1   . VAL D 3 66  ? 17.203  16.026 32.089  1.00 38.67  ? 443 VAL M CG1   1 
ATOM 3687 C CG2   . VAL D 3 66  ? 18.946  17.781 32.275  1.00 36.17  ? 443 VAL M CG2   1 
ATOM 3688 N N     . GLN D 3 67  ? 18.280  13.619 30.716  1.00 43.64  ? 444 GLN M N     1 
ATOM 3689 C CA    . GLN D 3 67  ? 17.679  12.500 30.013  1.00 47.19  ? 444 GLN M CA    1 
ATOM 3690 C C     . GLN D 3 67  ? 16.673  11.738 30.861  1.00 49.49  ? 444 GLN M C     1 
ATOM 3691 O O     . GLN D 3 67  ? 16.814  11.656 32.089  1.00 49.83  ? 444 GLN M O     1 
ATOM 3692 C CB    . GLN D 3 67  ? 18.775  11.556 29.544  1.00 47.74  ? 444 GLN M CB    1 
ATOM 3693 C CG    . GLN D 3 67  ? 18.285  10.374 28.757  1.00 48.96  ? 444 GLN M CG    1 
ATOM 3694 C CD    . GLN D 3 67  ? 19.422  9.655  28.073  1.00 50.30  ? 444 GLN M CD    1 
ATOM 3695 O OE1   . GLN D 3 67  ? 20.189  8.919  28.704  1.00 51.07  ? 444 GLN M OE1   1 
ATOM 3696 N NE2   . GLN D 3 67  ? 19.557  9.884  26.771  1.00 50.70  ? 444 GLN M NE2   1 
ATOM 3697 N N     . LEU D 3 68  ? 15.658  11.188 30.194  1.00 50.58  ? 445 LEU M N     1 
ATOM 3698 C CA    . LEU D 3 68  ? 14.617  10.427 30.863  1.00 52.11  ? 445 LEU M CA    1 
ATOM 3699 C C     . LEU D 3 68  ? 14.665  8.983  30.435  1.00 54.43  ? 445 LEU M C     1 
ATOM 3700 O O     . LEU D 3 68  ? 14.347  8.665  29.295  1.00 55.88  ? 445 LEU M O     1 
ATOM 3701 C CB    . LEU D 3 68  ? 13.245  10.983 30.529  1.00 50.67  ? 445 LEU M CB    1 
ATOM 3702 C CG    . LEU D 3 68  ? 12.142  10.077 31.066  1.00 49.45  ? 445 LEU M CG    1 
ATOM 3703 C CD1   . LEU D 3 68  ? 12.319  9.904  32.550  1.00 48.56  ? 445 LEU M CD1   1 
ATOM 3704 C CD2   . LEU D 3 68  ? 10.791  10.660 30.750  1.00 50.09  ? 445 LEU M CD2   1 
ATOM 3705 N N     . HIS D 3 69  ? 15.044  8.106  31.354  1.00 56.76  ? 446 HIS M N     1 
ATOM 3706 C CA    . HIS D 3 69  ? 15.144  6.689  31.050  1.00 60.34  ? 446 HIS M CA    1 
ATOM 3707 C C     . HIS D 3 69  ? 13.879  5.946  31.459  1.00 63.42  ? 446 HIS M C     1 
ATOM 3708 O O     . HIS D 3 69  ? 13.242  6.313  32.445  1.00 64.26  ? 446 HIS M O     1 
ATOM 3709 C CB    . HIS D 3 69  ? 16.338  6.090  31.792  1.00 60.99  ? 446 HIS M CB    1 
ATOM 3710 C CG    . HIS D 3 69  ? 17.646  6.740  31.468  1.00 61.35  ? 446 HIS M CG    1 
ATOM 3711 N ND1   . HIS D 3 69  ? 18.724  6.036  30.975  1.00 60.91  ? 446 HIS M ND1   1 
ATOM 3712 C CD2   . HIS D 3 69  ? 18.056  8.026  31.580  1.00 61.20  ? 446 HIS M CD2   1 
ATOM 3713 C CE1   . HIS D 3 69  ? 19.740  6.860  30.797  1.00 61.45  ? 446 HIS M CE1   1 
ATOM 3714 N NE2   . HIS D 3 69  ? 19.361  8.073  31.157  1.00 61.25  ? 446 HIS M NE2   1 
ATOM 3715 N N     . GLY D 3 70  ? 13.517  4.908  30.704  1.00 66.06  ? 447 GLY M N     1 
ATOM 3716 C CA    . GLY D 3 70  ? 12.340  4.118  31.039  1.00 69.51  ? 447 GLY M CA    1 
ATOM 3717 C C     . GLY D 3 70  ? 11.080  4.408  30.245  1.00 72.64  ? 447 GLY M C     1 
ATOM 3718 O O     . GLY D 3 70  ? 10.077  3.700  30.383  1.00 71.98  ? 447 GLY M O     1 
ATOM 3719 N N     . TYR D 3 71  ? 11.135  5.445  29.413  1.00 75.98  ? 448 TYR M N     1 
ATOM 3720 C CA    . TYR D 3 71  ? 10.005  5.858  28.581  1.00 79.29  ? 448 TYR M CA    1 
ATOM 3721 C C     . TYR D 3 71  ? 9.762   4.881  27.431  1.00 83.57  ? 448 TYR M C     1 
ATOM 3722 O O     . TYR D 3 71  ? 10.683  4.508  26.704  1.00 83.92  ? 448 TYR M O     1 
ATOM 3723 C CB    . TYR D 3 71  ? 10.266  7.256  28.018  1.00 76.35  ? 448 TYR M CB    1 
ATOM 3724 C CG    . TYR D 3 71  ? 9.045   7.950  27.453  1.00 73.92  ? 448 TYR M CG    1 
ATOM 3725 C CD1   . TYR D 3 71  ? 7.928   8.192  28.252  1.00 72.74  ? 448 TYR M CD1   1 
ATOM 3726 C CD2   . TYR D 3 71  ? 9.019   8.402  26.128  1.00 72.77  ? 448 TYR M CD2   1 
ATOM 3727 C CE1   . TYR D 3 71  ? 6.814   8.867  27.756  1.00 70.97  ? 448 TYR M CE1   1 
ATOM 3728 C CE2   . TYR D 3 71  ? 7.909   9.079  25.620  1.00 71.38  ? 448 TYR M CE2   1 
ATOM 3729 C CZ    . TYR D 3 71  ? 6.810   9.308  26.444  1.00 71.06  ? 448 TYR M CZ    1 
ATOM 3730 O OH    . TYR D 3 71  ? 5.704   9.973  25.966  1.00 69.70  ? 448 TYR M OH    1 
ATOM 3731 N N     . MET D 3 72  ? 8.511   4.479  27.262  1.00 88.76  ? 449 MET M N     1 
ATOM 3732 C CA    . MET D 3 72  ? 8.145   3.539  26.209  1.00 94.34  ? 449 MET M CA    1 
ATOM 3733 C C     . MET D 3 72  ? 7.401   4.239  25.076  1.00 95.52  ? 449 MET M C     1 
ATOM 3734 O O     . MET D 3 72  ? 7.691   4.033  23.896  1.00 94.65  ? 449 MET M O     1 
ATOM 3735 C CB    . MET D 3 72  ? 7.249   2.448  26.794  1.00 98.50  ? 449 MET M CB    1 
ATOM 3736 C CG    . MET D 3 72  ? 7.860   1.705  27.955  1.00 103.20 ? 449 MET M CG    1 
ATOM 3737 S SD    . MET D 3 72  ? 9.320   0.865  27.392  1.00 107.68 ? 449 MET M SD    1 
ATOM 3738 C CE    . MET D 3 72  ? 8.589   -0.554 26.608  1.00 109.41 ? 449 MET M CE    1 
ATOM 3739 N N     . GLU D 3 73  ? 6.435   5.063  25.468  1.00 97.45  ? 450 GLU M N     1 
ATOM 3740 C CA    . GLU D 3 73  ? 5.589   5.818  24.555  1.00 98.90  ? 450 GLU M CA    1 
ATOM 3741 C C     . GLU D 3 73  ? 6.337   6.428  23.390  1.00 98.05  ? 450 GLU M C     1 
ATOM 3742 O O     . GLU D 3 73  ? 7.565   6.364  23.311  1.00 97.73  ? 450 GLU M O     1 
ATOM 3743 C CB    . GLU D 3 73  ? 4.863   6.916  25.326  1.00 101.93 ? 450 GLU M CB    1 
ATOM 3744 C CG    . GLU D 3 73  ? 4.133   6.398  26.552  1.00 106.66 ? 450 GLU M CG    1 
ATOM 3745 C CD    . GLU D 3 73  ? 2.957   5.510  26.193  1.00 109.22 ? 450 GLU M CD    1 
ATOM 3746 O OE1   . GLU D 3 73  ? 2.464   4.782  27.084  1.00 110.93 ? 450 GLU M OE1   1 
ATOM 3747 O OE2   . GLU D 3 73  ? 2.518   5.551  25.021  1.00 110.56 ? 450 GLU M OE2   1 
ATOM 3748 N N     . ASN D 3 74  ? 5.580   7.039  22.489  1.00 97.27  ? 451 ASN M N     1 
ATOM 3749 C CA    . ASN D 3 74  ? 6.166   7.646  21.309  1.00 96.32  ? 451 ASN M CA    1 
ATOM 3750 C C     . ASN D 3 74  ? 5.831   9.124  21.179  1.00 94.04  ? 451 ASN M C     1 
ATOM 3751 O O     . ASN D 3 74  ? 6.158   9.756  20.172  1.00 93.18  ? 451 ASN M O     1 
ATOM 3752 C CB    . ASN D 3 74  ? 5.700   6.896  20.065  1.00 98.75  ? 451 ASN M CB    1 
ATOM 3753 C CG    . ASN D 3 74  ? 6.458   7.308  18.832  1.00 101.38 ? 451 ASN M CG    1 
ATOM 3754 O OD1   . ASN D 3 74  ? 7.691   7.287  18.813  1.00 102.64 ? 451 ASN M OD1   1 
ATOM 3755 N ND2   . ASN D 3 74  ? 5.729   7.686  17.789  1.00 103.22 ? 451 ASN M ND2   1 
ATOM 3756 N N     . LYS D 3 75  ? 5.180   9.673  22.202  1.00 91.53  ? 452 LYS M N     1 
ATOM 3757 C CA    . LYS D 3 75  ? 4.810   11.086 22.196  1.00 88.58  ? 452 LYS M CA    1 
ATOM 3758 C C     . LYS D 3 75  ? 5.853   11.881 22.967  1.00 83.49  ? 452 LYS M C     1 
ATOM 3759 O O     . LYS D 3 75  ? 6.164   11.575 24.119  1.00 82.78  ? 452 LYS M O     1 
ATOM 3760 C CB    . LYS D 3 75  ? 3.437   11.298 22.844  1.00 92.10  ? 452 LYS M CB    1 
ATOM 3761 C CG    . LYS D 3 75  ? 2.421   10.220 22.521  1.00 97.21  ? 452 LYS M CG    1 
ATOM 3762 C CD    . LYS D 3 75  ? 2.137   10.122 21.032  1.00 101.52 ? 452 LYS M CD    1 
ATOM 3763 C CE    . LYS D 3 75  ? 1.825   8.684  20.649  1.00 104.22 ? 452 LYS M CE    1 
ATOM 3764 N NZ    . LYS D 3 75  ? 0.887   8.049  21.620  1.00 106.95 ? 452 LYS M NZ    1 
ATOM 3765 N N     . PRO D 3 76  ? 6.406   12.922 22.339  1.00 78.38  ? 453 PRO M N     1 
ATOM 3766 C CA    . PRO D 3 76  ? 7.414   13.732 23.010  1.00 74.32  ? 453 PRO M CA    1 
ATOM 3767 C C     . PRO D 3 76  ? 6.846   14.335 24.279  1.00 70.30  ? 453 PRO M C     1 
ATOM 3768 O O     . PRO D 3 76  ? 5.640   14.511 24.400  1.00 68.89  ? 453 PRO M O     1 
ATOM 3769 C CB    . PRO D 3 76  ? 7.751   14.782 21.961  1.00 75.54  ? 453 PRO M CB    1 
ATOM 3770 C CG    . PRO D 3 76  ? 6.445   14.976 21.281  1.00 76.03  ? 453 PRO M CG    1 
ATOM 3771 C CD    . PRO D 3 76  ? 5.987   13.557 21.082  1.00 77.50  ? 453 PRO M CD    1 
ATOM 3772 N N     . LEU D 3 77  ? 7.730   14.633 25.223  1.00 67.12  ? 454 LEU M N     1 
ATOM 3773 C CA    . LEU D 3 77  ? 7.351   15.233 26.491  1.00 63.70  ? 454 LEU M CA    1 
ATOM 3774 C C     . LEU D 3 77  ? 7.957   16.609 26.609  1.00 61.58  ? 454 LEU M C     1 
ATOM 3775 O O     . LEU D 3 77  ? 8.702   17.062 25.743  1.00 61.69  ? 454 LEU M O     1 
ATOM 3776 C CB    . LEU D 3 77  ? 7.856   14.406 27.662  1.00 63.88  ? 454 LEU M CB    1 
ATOM 3777 C CG    . LEU D 3 77  ? 7.206   13.067 27.945  1.00 63.32  ? 454 LEU M CG    1 
ATOM 3778 C CD1   . LEU D 3 77  ? 7.894   12.432 29.141  1.00 63.90  ? 454 LEU M CD1   1 
ATOM 3779 C CD2   . LEU D 3 77  ? 5.739   13.280 28.221  1.00 63.81  ? 454 LEU M CD2   1 
ATOM 3780 N N     . GLY D 3 78  ? 7.643   17.269 27.709  1.00 59.76  ? 455 GLY M N     1 
ATOM 3781 C CA    . GLY D 3 78  ? 8.178   18.591 27.925  1.00 58.00  ? 455 GLY M CA    1 
ATOM 3782 C C     . GLY D 3 78  ? 9.063   18.573 29.146  1.00 56.76  ? 455 GLY M C     1 
ATOM 3783 O O     . GLY D 3 78  ? 8.642   18.136 30.221  1.00 56.61  ? 455 GLY M O     1 
ATOM 3784 N N     . LEU D 3 79  ? 10.303  19.012 28.974  1.00 55.01  ? 456 LEU M N     1 
ATOM 3785 C CA    . LEU D 3 79  ? 11.218  19.072 30.085  1.00 53.85  ? 456 LEU M CA    1 
ATOM 3786 C C     . LEU D 3 79  ? 11.086  20.487 30.609  1.00 53.38  ? 456 LEU M C     1 
ATOM 3787 O O     . LEU D 3 79  ? 11.105  21.443 29.838  1.00 52.84  ? 456 LEU M O     1 
ATOM 3788 C CB    . LEU D 3 79  ? 12.651  18.806 29.635  1.00 54.44  ? 456 LEU M CB    1 
ATOM 3789 C CG    . LEU D 3 79  ? 13.676  18.923 30.774  1.00 57.58  ? 456 LEU M CG    1 
ATOM 3790 C CD1   . LEU D 3 79  ? 13.327  17.929 31.880  1.00 56.89  ? 456 LEU M CD1   1 
ATOM 3791 C CD2   . LEU D 3 79  ? 15.091  18.678 30.250  1.00 58.39  ? 456 LEU M CD2   1 
ATOM 3792 N N     . GLN D 3 80  ? 10.919  20.623 31.916  1.00 52.98  ? 457 GLN M N     1 
ATOM 3793 C CA    . GLN D 3 80  ? 10.784  21.942 32.500  1.00 53.34  ? 457 GLN M CA    1 
ATOM 3794 C C     . GLN D 3 80  ? 12.077  22.369 33.155  1.00 51.24  ? 457 GLN M C     1 
ATOM 3795 O O     . GLN D 3 80  ? 12.781  21.550 33.744  1.00 52.12  ? 457 GLN M O     1 
ATOM 3796 C CB    . GLN D 3 80  ? 9.661   21.955 33.520  1.00 57.30  ? 457 GLN M CB    1 
ATOM 3797 C CG    . GLN D 3 80  ? 8.326   21.617 32.922  1.00 63.70  ? 457 GLN M CG    1 
ATOM 3798 C CD    . GLN D 3 80  ? 7.189   22.237 33.692  1.00 67.58  ? 457 GLN M CD    1 
ATOM 3799 O OE1   . GLN D 3 80  ? 6.908   21.872 34.844  1.00 67.51  ? 457 GLN M OE1   1 
ATOM 3800 N NE2   . GLN D 3 80  ? 6.525   23.199 33.061  1.00 70.96  ? 457 GLN M NE2   1 
ATOM 3801 N N     . ILE D 3 81  ? 12.382  23.657 33.064  1.00 47.52  ? 458 ILE M N     1 
ATOM 3802 C CA    . ILE D 3 81  ? 13.615  24.171 33.627  1.00 44.29  ? 458 ILE M CA    1 
ATOM 3803 C C     . ILE D 3 81  ? 13.361  25.425 34.408  1.00 42.67  ? 458 ILE M C     1 
ATOM 3804 O O     . ILE D 3 81  ? 12.597  26.272 33.968  1.00 42.75  ? 458 ILE M O     1 
ATOM 3805 C CB    . ILE D 3 81  ? 14.624  24.539 32.526  1.00 43.59  ? 458 ILE M CB    1 
ATOM 3806 C CG1   . ILE D 3 81  ? 14.842  23.354 31.598  1.00 42.77  ? 458 ILE M CG1   1 
ATOM 3807 C CG2   . ILE D 3 81  ? 15.941  24.940 33.143  1.00 41.76  ? 458 ILE M CG2   1 
ATOM 3808 C CD1   . ILE D 3 81  ? 15.628  23.719 30.377  1.00 45.48  ? 458 ILE M CD1   1 
ATOM 3809 N N     . PHE D 3 82  ? 14.005  25.535 35.566  1.00 41.28  ? 459 PHE M N     1 
ATOM 3810 C CA    . PHE D 3 82  ? 13.898  26.721 36.400  1.00 40.05  ? 459 PHE M CA    1 
ATOM 3811 C C     . PHE D 3 82  ? 15.064  26.774 37.378  1.00 40.10  ? 459 PHE M C     1 
ATOM 3812 O O     . PHE D 3 82  ? 15.649  25.746 37.697  1.00 40.61  ? 459 PHE M O     1 
ATOM 3813 C CB    . PHE D 3 82  ? 12.546  26.775 37.137  1.00 39.18  ? 459 PHE M CB    1 
ATOM 3814 C CG    . PHE D 3 82  ? 12.377  25.743 38.215  1.00 38.79  ? 459 PHE M CG    1 
ATOM 3815 C CD1   . PHE D 3 82  ? 11.887  24.481 37.917  1.00 38.34  ? 459 PHE M CD1   1 
ATOM 3816 C CD2   . PHE D 3 82  ? 12.693  26.049 39.543  1.00 40.14  ? 459 PHE M CD2   1 
ATOM 3817 C CE1   . PHE D 3 82  ? 11.706  23.528 38.921  1.00 38.63  ? 459 PHE M CE1   1 
ATOM 3818 C CE2   . PHE D 3 82  ? 12.519  25.107 40.561  1.00 39.18  ? 459 PHE M CE2   1 
ATOM 3819 C CZ    . PHE D 3 82  ? 12.023  23.842 40.248  1.00 39.35  ? 459 PHE M CZ    1 
ATOM 3820 N N     . ILE D 3 83  ? 15.414  27.977 37.825  1.00 40.76  ? 460 ILE M N     1 
ATOM 3821 C CA    . ILE D 3 83  ? 16.515  28.177 38.769  1.00 41.20  ? 460 ILE M CA    1 
ATOM 3822 C C     . ILE D 3 83  ? 16.037  28.029 40.207  1.00 41.80  ? 460 ILE M C     1 
ATOM 3823 O O     . ILE D 3 83  ? 15.223  28.821 40.682  1.00 41.99  ? 460 ILE M O     1 
ATOM 3824 C CB    . ILE D 3 83  ? 17.126  29.588 38.626  1.00 41.47  ? 460 ILE M CB    1 
ATOM 3825 C CG1   . ILE D 3 83  ? 17.587  29.810 37.185  1.00 40.36  ? 460 ILE M CG1   1 
ATOM 3826 C CG2   . ILE D 3 83  ? 18.273  29.769 39.622  1.00 40.50  ? 460 ILE M CG2   1 
ATOM 3827 C CD1   . ILE D 3 83  ? 18.606  28.816 36.723  1.00 39.47  ? 460 ILE M CD1   1 
ATOM 3828 N N     . GLY D 3 84  ? 16.564  27.027 40.901  1.00 42.82  ? 461 GLY M N     1 
ATOM 3829 C CA    . GLY D 3 84  ? 16.171  26.784 42.279  1.00 44.43  ? 461 GLY M CA    1 
ATOM 3830 C C     . GLY D 3 84  ? 17.243  27.086 43.305  1.00 45.46  ? 461 GLY M C     1 
ATOM 3831 O O     . GLY D 3 84  ? 18.313  27.584 42.969  1.00 46.38  ? 461 GLY M O     1 
ATOM 3832 N N     . THR D 3 85  ? 16.956  26.763 44.560  1.00 47.36  ? 462 THR M N     1 
ATOM 3833 C CA    . THR D 3 85  ? 17.870  27.023 45.666  1.00 50.77  ? 462 THR M CA    1 
ATOM 3834 C C     . THR D 3 85  ? 18.909  25.930 45.869  1.00 56.37  ? 462 THR M C     1 
ATOM 3835 O O     . THR D 3 85  ? 18.705  24.790 45.453  1.00 56.21  ? 462 THR M O     1 
ATOM 3836 C CB    . THR D 3 85  ? 17.084  27.211 46.977  1.00 47.75  ? 462 THR M CB    1 
ATOM 3837 O OG1   . THR D 3 85  ? 16.320  26.028 47.262  1.00 46.81  ? 462 THR M OG1   1 
ATOM 3838 C CG2   . THR D 3 85  ? 16.134  28.384 46.851  1.00 46.40  ? 462 THR M CG2   1 
ATOM 3839 N N     . ALA D 3 86  ? 20.019  26.285 46.517  1.00 63.73  ? 463 ALA M N     1 
ATOM 3840 C CA    . ALA D 3 86  ? 21.109  25.345 46.784  1.00 72.46  ? 463 ALA M CA    1 
ATOM 3841 C C     . ALA D 3 86  ? 21.220  25.051 48.269  1.00 79.91  ? 463 ALA M C     1 
ATOM 3842 O O     . ALA D 3 86  ? 21.700  23.993 48.666  1.00 79.96  ? 463 ALA M O     1 
ATOM 3843 C CB    . ALA D 3 86  ? 22.431  25.913 46.282  1.00 70.08  ? 463 ALA M CB    1 
ATOM 3844 N N     . ASP D 3 87  ? 20.781  26.001 49.085  1.00 89.39  ? 464 ASP M N     1 
ATOM 3845 C CA    . ASP D 3 87  ? 20.832  25.860 50.533  1.00 98.24  ? 464 ASP M CA    1 
ATOM 3846 C C     . ASP D 3 87  ? 20.316  24.493 50.962  1.00 105.10 ? 464 ASP M C     1 
ATOM 3847 O O     . ASP D 3 87  ? 19.759  23.746 50.161  1.00 105.24 ? 464 ASP M O     1 
ATOM 3848 C CB    . ASP D 3 87  ? 19.998  26.966 51.201  1.00 97.62  ? 464 ASP M CB    1 
ATOM 3849 C CG    . ASP D 3 87  ? 18.487  26.758 51.042  1.00 97.06  ? 464 ASP M CG    1 
ATOM 3850 O OD1   . ASP D 3 87  ? 17.725  27.713 51.312  1.00 95.60  ? 464 ASP M OD1   1 
ATOM 3851 O OD2   . ASP D 3 87  ? 18.054  25.646 50.662  1.00 96.55  ? 464 ASP M OD2   1 
ATOM 3852 N N     . GLU D 3 88  ? 20.498  24.183 52.240  1.00 114.20 ? 465 GLU M N     1 
ATOM 3853 C CA    . GLU D 3 88  ? 20.053  22.914 52.806  1.00 122.55 ? 465 GLU M CA    1 
ATOM 3854 C C     . GLU D 3 88  ? 18.569  22.632 52.520  1.00 122.84 ? 465 GLU M C     1 
ATOM 3855 O O     . GLU D 3 88  ? 18.230  21.656 51.847  1.00 123.70 ? 465 GLU M O     1 
ATOM 3856 C CB    . GLU D 3 88  ? 20.317  22.898 54.325  1.00 130.22 ? 465 GLU M CB    1 
ATOM 3857 C CG    . GLU D 3 88  ? 19.738  24.090 55.103  1.00 142.26 ? 465 GLU M CG    1 
ATOM 3858 C CD    . GLU D 3 88  ? 20.611  25.341 55.045  1.00 148.37 ? 465 GLU M CD    1 
ATOM 3859 O OE1   . GLU D 3 88  ? 20.126  26.424 55.448  1.00 152.77 ? 465 GLU M OE1   1 
ATOM 3860 O OE2   . GLU D 3 88  ? 21.780  25.242 54.611  1.00 151.71 ? 465 GLU M OE2   1 
ATOM 3861 N N     . ARG D 3 89  ? 17.694  23.494 53.032  1.00 122.15 ? 466 ARG M N     1 
ATOM 3862 C CA    . ARG D 3 89  ? 16.256  23.354 52.844  1.00 120.01 ? 466 ARG M CA    1 
ATOM 3863 C C     . ARG D 3 89  ? 15.907  22.719 51.506  1.00 115.14 ? 466 ARG M C     1 
ATOM 3864 O O     . ARG D 3 89  ? 16.615  22.894 50.515  1.00 114.24 ? 466 ARG M O     1 
ATOM 3865 C CB    . ARG D 3 89  ? 15.586  24.723 52.956  1.00 125.48 ? 466 ARG M CB    1 
ATOM 3866 C CG    . ARG D 3 89  ? 15.770  25.392 54.313  1.00 131.51 ? 466 ARG M CG    1 
ATOM 3867 C CD    . ARG D 3 89  ? 15.231  26.816 54.308  1.00 136.61 ? 466 ARG M CD    1 
ATOM 3868 N NE    . ARG D 3 89  ? 15.974  27.680 53.393  1.00 140.70 ? 466 ARG M NE    1 
ATOM 3869 C CZ    . ARG D 3 89  ? 15.695  28.962 53.181  1.00 142.40 ? 466 ARG M CZ    1 
ATOM 3870 N NH1   . ARG D 3 89  ? 14.686  29.538 53.820  1.00 144.01 ? 466 ARG M NH1   1 
ATOM 3871 N NH2   . ARG D 3 89  ? 16.422  29.672 52.330  1.00 143.15 ? 466 ARG M NH2   1 
ATOM 3872 N N     . ILE D 3 90  ? 14.801  21.983 51.492  1.00 109.41 ? 467 ILE M N     1 
ATOM 3873 C CA    . ILE D 3 90  ? 14.342  21.300 50.291  1.00 102.85 ? 467 ILE M CA    1 
ATOM 3874 C C     . ILE D 3 90  ? 14.135  22.252 49.100  1.00 97.78  ? 467 ILE M C     1 
ATOM 3875 O O     . ILE D 3 90  ? 13.645  23.376 49.249  1.00 98.08  ? 467 ILE M O     1 
ATOM 3876 C CB    . ILE D 3 90  ? 13.042  20.504 50.582  1.00 102.76 ? 467 ILE M CB    1 
ATOM 3877 C CG1   . ILE D 3 90  ? 13.002  19.263 49.699  1.00 102.93 ? 467 ILE M CG1   1 
ATOM 3878 C CG2   . ILE D 3 90  ? 11.815  21.365 50.348  1.00 102.33 ? 467 ILE M CG2   1 
ATOM 3879 C CD1   . ILE D 3 90  ? 14.215  18.365 49.876  1.00 102.25 ? 467 ILE M CD1   1 
ATOM 3880 N N     . LEU D 3 91  ? 14.524  21.776 47.921  1.00 90.18  ? 468 LEU M N     1 
ATOM 3881 C CA    . LEU D 3 91  ? 14.437  22.530 46.678  1.00 82.34  ? 468 LEU M CA    1 
ATOM 3882 C C     . LEU D 3 91  ? 13.233  23.461 46.569  1.00 77.22  ? 468 LEU M C     1 
ATOM 3883 O O     . LEU D 3 91  ? 12.106  23.079 46.845  1.00 76.59  ? 468 LEU M O     1 
ATOM 3884 C CB    . LEU D 3 91  ? 14.447  21.554 45.499  1.00 82.18  ? 468 LEU M CB    1 
ATOM 3885 C CG    . LEU D 3 91  ? 15.255  21.942 44.259  1.00 80.21  ? 468 LEU M CG    1 
ATOM 3886 C CD1   . LEU D 3 91  ? 14.655  23.169 43.605  1.00 79.92  ? 468 LEU M CD1   1 
ATOM 3887 C CD2   . LEU D 3 91  ? 16.689  22.196 44.659  1.00 78.92  ? 468 LEU M CD2   1 
ATOM 3888 N N     . LYS D 3 92  ? 13.491  24.689 46.147  1.00 71.38  ? 469 LYS M N     1 
ATOM 3889 C CA    . LYS D 3 92  ? 12.454  25.694 45.986  1.00 65.79  ? 469 LYS M CA    1 
ATOM 3890 C C     . LYS D 3 92  ? 12.953  26.737 44.997  1.00 62.31  ? 469 LYS M C     1 
ATOM 3891 O O     . LYS D 3 92  ? 14.147  26.990 44.911  1.00 63.12  ? 469 LYS M O     1 
ATOM 3892 C CB    . LYS D 3 92  ? 12.173  26.354 47.328  1.00 65.85  ? 469 LYS M CB    1 
ATOM 3893 C CG    . LYS D 3 92  ? 11.407  27.659 47.236  1.00 66.61  ? 469 LYS M CG    1 
ATOM 3894 C CD    . LYS D 3 92  ? 11.214  28.294 48.617  1.00 68.01  ? 469 LYS M CD    1 
ATOM 3895 C CE    . LYS D 3 92  ? 12.542  28.602 49.297  1.00 67.72  ? 469 LYS M CE    1 
ATOM 3896 N NZ    . LYS D 3 92  ? 12.364  29.274 50.611  1.00 68.25  ? 469 LYS M NZ    1 
ATOM 3897 N N     . PRO D 3 93  ? 12.050  27.348 44.226  1.00 58.67  ? 470 PRO M N     1 
ATOM 3898 C CA    . PRO D 3 93  ? 12.489  28.361 43.263  1.00 55.84  ? 470 PRO M CA    1 
ATOM 3899 C C     . PRO D 3 93  ? 13.260  29.480 43.956  1.00 53.27  ? 470 PRO M C     1 
ATOM 3900 O O     . PRO D 3 93  ? 12.805  30.031 44.961  1.00 53.16  ? 470 PRO M O     1 
ATOM 3901 C CB    . PRO D 3 93  ? 11.178  28.845 42.660  1.00 56.46  ? 470 PRO M CB    1 
ATOM 3902 C CG    . PRO D 3 93  ? 10.340  27.615 42.685  1.00 57.43  ? 470 PRO M CG    1 
ATOM 3903 C CD    . PRO D 3 93  ? 10.617  27.062 44.066  1.00 58.12  ? 470 PRO M CD    1 
ATOM 3904 N N     . HIS D 3 94  ? 14.427  29.808 43.416  1.00 49.98  ? 471 HIS M N     1 
ATOM 3905 C CA    . HIS D 3 94  ? 15.268  30.849 43.994  1.00 47.77  ? 471 HIS M CA    1 
ATOM 3906 C C     . HIS D 3 94  ? 14.672  32.211 43.687  1.00 48.21  ? 471 HIS M C     1 
ATOM 3907 O O     . HIS D 3 94  ? 14.687  32.670 42.556  1.00 49.79  ? 471 HIS M O     1 
ATOM 3908 C CB    . HIS D 3 94  ? 16.676  30.757 43.419  1.00 44.35  ? 471 HIS M CB    1 
ATOM 3909 C CG    . HIS D 3 94  ? 17.715  31.423 44.260  1.00 40.92  ? 471 HIS M CG    1 
ATOM 3910 N ND1   . HIS D 3 94  ? 17.608  32.732 44.677  1.00 38.84  ? 471 HIS M ND1   1 
ATOM 3911 C CD2   . HIS D 3 94  ? 18.884  30.957 44.764  1.00 38.46  ? 471 HIS M CD2   1 
ATOM 3912 C CE1   . HIS D 3 94  ? 18.668  33.042 45.403  1.00 39.12  ? 471 HIS M CE1   1 
ATOM 3913 N NE2   . HIS D 3 94  ? 19.457  31.983 45.471  1.00 37.59  ? 471 HIS M NE2   1 
ATOM 3914 N N     . ALA D 3 95  ? 14.152  32.868 44.706  1.00 48.97  ? 472 ALA M N     1 
ATOM 3915 C CA    . ALA D 3 95  ? 13.518  34.161 44.508  1.00 48.55  ? 472 ALA M CA    1 
ATOM 3916 C C     . ALA D 3 95  ? 14.378  35.240 43.860  1.00 47.94  ? 472 ALA M C     1 
ATOM 3917 O O     . ALA D 3 95  ? 13.852  36.268 43.428  1.00 48.57  ? 472 ALA M O     1 
ATOM 3918 C CB    . ALA D 3 95  ? 12.988  34.668 45.841  1.00 50.08  ? 472 ALA M CB    1 
ATOM 3919 N N     . PHE D 3 96  ? 15.688  35.018 43.776  1.00 45.77  ? 473 PHE M N     1 
ATOM 3920 C CA    . PHE D 3 96  ? 16.569  36.041 43.218  1.00 43.31  ? 473 PHE M CA    1 
ATOM 3921 C C     . PHE D 3 96  ? 17.199  35.758 41.854  1.00 42.11  ? 473 PHE M C     1 
ATOM 3922 O O     . PHE D 3 96  ? 18.007  36.536 41.355  1.00 40.04  ? 473 PHE M O     1 
ATOM 3923 C CB    . PHE D 3 96  ? 17.635  36.342 44.252  1.00 41.59  ? 473 PHE M CB    1 
ATOM 3924 C CG    . PHE D 3 96  ? 17.084  36.941 45.498  1.00 41.80  ? 473 PHE M CG    1 
ATOM 3925 C CD1   . PHE D 3 96  ? 16.934  38.317 45.618  1.00 42.28  ? 473 PHE M CD1   1 
ATOM 3926 C CD2   . PHE D 3 96  ? 16.682  36.130 46.555  1.00 42.61  ? 473 PHE M CD2   1 
ATOM 3927 C CE1   . PHE D 3 96  ? 16.392  38.880 46.785  1.00 41.76  ? 473 PHE M CE1   1 
ATOM 3928 C CE2   . PHE D 3 96  ? 16.139  36.683 47.723  1.00 40.13  ? 473 PHE M CE2   1 
ATOM 3929 C CZ    . PHE D 3 96  ? 15.997  38.058 47.835  1.00 40.06  ? 473 PHE M CZ    1 
ATOM 3930 N N     . TYR D 3 97  ? 16.802  34.649 41.252  1.00 41.08  ? 474 TYR M N     1 
ATOM 3931 C CA    . TYR D 3 97  ? 17.315  34.258 39.965  1.00 40.09  ? 474 TYR M CA    1 
ATOM 3932 C C     . TYR D 3 97  ? 16.176  33.749 39.113  1.00 41.10  ? 474 TYR M C     1 
ATOM 3933 O O     . TYR D 3 97  ? 15.195  33.217 39.618  1.00 41.46  ? 474 TYR M O     1 
ATOM 3934 C CB    . TYR D 3 97  ? 18.362  33.173 40.152  1.00 40.36  ? 474 TYR M CB    1 
ATOM 3935 C CG    . TYR D 3 97  ? 19.654  33.709 40.712  1.00 42.63  ? 474 TYR M CG    1 
ATOM 3936 C CD1   . TYR D 3 97  ? 20.519  34.471 39.920  1.00 43.76  ? 474 TYR M CD1   1 
ATOM 3937 C CD2   . TYR D 3 97  ? 20.001  33.494 42.041  1.00 43.17  ? 474 TYR M CD2   1 
ATOM 3938 C CE1   . TYR D 3 97  ? 21.702  35.008 40.449  1.00 43.80  ? 474 TYR M CE1   1 
ATOM 3939 C CE2   . TYR D 3 97  ? 21.179  34.031 42.580  1.00 42.81  ? 474 TYR M CE2   1 
ATOM 3940 C CZ    . TYR D 3 97  ? 22.018  34.783 41.783  1.00 42.55  ? 474 TYR M CZ    1 
ATOM 3941 O OH    . TYR D 3 97  ? 23.155  35.325 42.324  1.00 41.00  ? 474 TYR M OH    1 
ATOM 3942 N N     . GLN D 3 98  ? 16.310  33.919 37.809  1.00 41.65  ? 475 GLN M N     1 
ATOM 3943 C CA    . GLN D 3 98  ? 15.298  33.476 36.873  1.00 42.12  ? 475 GLN M CA    1 
ATOM 3944 C C     . GLN D 3 98  ? 16.035  32.886 35.687  1.00 41.83  ? 475 GLN M C     1 
ATOM 3945 O O     . GLN D 3 98  ? 17.086  33.403 35.320  1.00 43.39  ? 475 GLN M O     1 
ATOM 3946 C CB    . GLN D 3 98  ? 14.476  34.679 36.415  1.00 44.42  ? 475 GLN M CB    1 
ATOM 3947 C CG    . GLN D 3 98  ? 13.583  35.284 37.476  1.00 49.28  ? 475 GLN M CG    1 
ATOM 3948 C CD    . GLN D 3 98  ? 12.350  34.439 37.731  1.00 54.23  ? 475 GLN M CD    1 
ATOM 3949 O OE1   . GLN D 3 98  ? 12.159  33.904 38.830  1.00 55.95  ? 475 GLN M OE1   1 
ATOM 3950 N NE2   . GLN D 3 98  ? 11.504  34.305 36.708  1.00 54.99  ? 475 GLN M NE2   1 
ATOM 3951 N N     . VAL D 3 99  ? 15.527  31.803 35.096  1.00 41.50  ? 476 VAL M N     1 
ATOM 3952 C CA    . VAL D 3 99  ? 16.190  31.246 33.911  1.00 40.87  ? 476 VAL M CA    1 
ATOM 3953 C C     . VAL D 3 99  ? 15.955  32.246 32.808  1.00 40.71  ? 476 VAL M C     1 
ATOM 3954 O O     . VAL D 3 99  ? 14.858  32.788 32.680  1.00 39.62  ? 476 VAL M O     1 
ATOM 3955 C CB    . VAL D 3 99  ? 15.595  29.907 33.415  1.00 40.14  ? 476 VAL M CB    1 
ATOM 3956 C CG1   . VAL D 3 99  ? 15.583  28.916 34.529  1.00 44.06  ? 476 VAL M CG1   1 
ATOM 3957 C CG2   . VAL D 3 99  ? 14.200  30.110 32.865  1.00 39.11  ? 476 VAL M CG2   1 
ATOM 3958 N N     . HIS D 3 100 ? 16.990  32.489 32.021  1.00 41.87  ? 477 HIS M N     1 
ATOM 3959 C CA    . HIS D 3 100 ? 16.905  33.419 30.919  1.00 44.72  ? 477 HIS M CA    1 
ATOM 3960 C C     . HIS D 3 100 ? 16.868  32.601 29.658  1.00 47.10  ? 477 HIS M C     1 
ATOM 3961 O O     . HIS D 3 100 ? 17.723  31.750 29.445  1.00 48.43  ? 477 HIS M O     1 
ATOM 3962 C CB    . HIS D 3 100 ? 18.126  34.318 30.929  1.00 45.76  ? 477 HIS M CB    1 
ATOM 3963 C CG    . HIS D 3 100 ? 18.176  35.289 29.796  1.00 48.59  ? 477 HIS M CG    1 
ATOM 3964 N ND1   . HIS D 3 100 ? 18.444  34.904 28.499  1.00 49.86  ? 477 HIS M ND1   1 
ATOM 3965 C CD2   . HIS D 3 100 ? 18.046  36.637 29.770  1.00 49.42  ? 477 HIS M CD2   1 
ATOM 3966 C CE1   . HIS D 3 100 ? 18.483  35.973 27.723  1.00 50.54  ? 477 HIS M CE1   1 
ATOM 3967 N NE2   . HIS D 3 100 ? 18.246  37.037 28.470  1.00 51.22  ? 477 HIS M NE2   1 
ATOM 3968 N N     . ARG D 3 101 ? 15.867  32.834 28.824  1.00 50.93  ? 478 ARG M N     1 
ATOM 3969 C CA    . ARG D 3 101 ? 15.765  32.091 27.577  1.00 55.36  ? 478 ARG M CA    1 
ATOM 3970 C C     . ARG D 3 101 ? 16.772  32.578 26.540  1.00 58.49  ? 478 ARG M C     1 
ATOM 3971 O O     . ARG D 3 101 ? 16.776  33.758 26.169  1.00 56.95  ? 478 ARG M O     1 
ATOM 3972 C CB    . ARG D 3 101 ? 14.358  32.214 27.008  1.00 56.46  ? 478 ARG M CB    1 
ATOM 3973 C CG    . ARG D 3 101 ? 14.193  31.606 25.631  1.00 57.53  ? 478 ARG M CG    1 
ATOM 3974 C CD    . ARG D 3 101 ? 12.728  31.410 25.325  1.00 59.62  ? 478 ARG M CD    1 
ATOM 3975 N NE    . ARG D 3 101 ? 12.504  30.791 24.024  1.00 62.35  ? 478 ARG M NE    1 
ATOM 3976 C CZ    . ARG D 3 101 ? 12.585  31.433 22.865  1.00 63.11  ? 478 ARG M CZ    1 
ATOM 3977 N NH1   . ARG D 3 101 ? 12.890  32.721 22.838  1.00 63.89  ? 478 ARG M NH1   1 
ATOM 3978 N NH2   . ARG D 3 101 ? 12.337  30.790 21.734  1.00 64.51  ? 478 ARG M NH2   1 
ATOM 3979 N N     . ILE D 3 102 ? 17.629  31.664 26.086  1.00 63.16  ? 479 ILE M N     1 
ATOM 3980 C CA    . ILE D 3 102 ? 18.641  31.979 25.086  1.00 67.86  ? 479 ILE M CA    1 
ATOM 3981 C C     . ILE D 3 102 ? 18.066  31.665 23.722  1.00 73.63  ? 479 ILE M C     1 
ATOM 3982 O O     . ILE D 3 102 ? 17.588  30.560 23.472  1.00 72.47  ? 479 ILE M O     1 
ATOM 3983 C CB    . ILE D 3 102 ? 19.929  31.157 25.282  1.00 65.47  ? 479 ILE M CB    1 
ATOM 3984 C CG1   . ILE D 3 102 ? 20.583  31.496 26.621  1.00 63.79  ? 479 ILE M CG1   1 
ATOM 3985 C CG2   . ILE D 3 102 ? 20.917  31.485 24.189  1.00 64.95  ? 479 ILE M CG2   1 
ATOM 3986 C CD1   . ILE D 3 102 ? 21.200  32.871 26.669  1.00 62.02  ? 479 ILE M CD1   1 
ATOM 3987 N N     . THR D 3 103 ? 18.129  32.657 22.844  1.00 82.47  ? 480 THR M N     1 
ATOM 3988 C CA    . THR D 3 103 ? 17.596  32.551 21.495  1.00 90.07  ? 480 THR M CA    1 
ATOM 3989 C C     . THR D 3 103 ? 18.642  32.453 20.383  1.00 93.29  ? 480 THR M C     1 
ATOM 3990 O O     . THR D 3 103 ? 19.708  33.077 20.450  1.00 93.27  ? 480 THR M O     1 
ATOM 3991 C CB    . THR D 3 103 ? 16.700  33.754 21.193  1.00 91.67  ? 480 THR M CB    1 
ATOM 3992 O OG1   . THR D 3 103 ? 16.315  33.730 19.814  1.00 94.92  ? 480 THR M OG1   1 
ATOM 3993 C CG2   . THR D 3 103 ? 17.445  35.051 21.497  1.00 93.02  ? 480 THR M CG2   1 
ATOM 3994 N N     . GLY D 3 104 ? 18.300  31.667 19.363  1.00 96.31  ? 481 GLY M N     1 
ATOM 3995 C CA    . GLY D 3 104 ? 19.144  31.456 18.196  1.00 99.58  ? 481 GLY M CA    1 
ATOM 3996 C C     . GLY D 3 104 ? 20.645  31.624 18.331  1.00 101.67 ? 481 GLY M C     1 
ATOM 3997 O O     . GLY D 3 104 ? 21.250  31.144 19.289  1.00 102.82 ? 481 GLY M O     1 
ATOM 3998 N N     . LYS D 3 105 ? 21.239  32.307 17.352  1.00 102.79 ? 482 LYS M N     1 
ATOM 3999 C CA    . LYS D 3 105 ? 22.682  32.562 17.298  1.00 102.59 ? 482 LYS M CA    1 
ATOM 4000 C C     . LYS D 3 105 ? 23.424  31.235 17.083  1.00 102.21 ? 482 LYS M C     1 
ATOM 4001 O O     . LYS D 3 105 ? 24.283  31.139 16.205  1.00 102.68 ? 482 LYS M O     1 
ATOM 4002 C CB    . LYS D 3 105 ? 23.158  33.253 18.588  1.00 102.53 ? 482 LYS M CB    1 
ATOM 4003 C CG    . LYS D 3 105 ? 24.538  33.919 18.503  1.00 101.07 ? 482 LYS M CG    1 
ATOM 4004 C CD    . LYS D 3 105 ? 24.522  35.210 17.677  1.00 98.48  ? 482 LYS M CD    1 
ATOM 4005 C CE    . LYS D 3 105 ? 25.899  35.889 17.663  1.00 95.42  ? 482 LYS M CE    1 
ATOM 4006 N NZ    . LYS D 3 105 ? 25.932  37.165 16.881  1.00 92.24  ? 482 LYS M NZ    1 
ATOM 4007 N N     . THR D 3 106 ? 23.073  30.223 17.882  1.00 100.30 ? 483 THR M N     1 
ATOM 4008 C CA    . THR D 3 106 ? 23.658  28.878 17.815  1.00 97.03  ? 483 THR M CA    1 
ATOM 4009 C C     . THR D 3 106 ? 22.855  27.898 18.669  1.00 93.52  ? 483 THR M C     1 
ATOM 4010 O O     . THR D 3 106 ? 23.169  26.709 18.707  1.00 93.59  ? 483 THR M O     1 
ATOM 4011 C CB    . THR D 3 106 ? 25.123  28.818 18.345  1.00 98.06  ? 483 THR M CB    1 
ATOM 4012 O OG1   . THR D 3 106 ? 25.202  29.465 19.622  1.00 99.36  ? 483 THR M OG1   1 
ATOM 4013 C CG2   . THR D 3 106 ? 26.089  29.460 17.373  1.00 98.74  ? 483 THR M CG2   1 
ATOM 4014 N N     . VAL D 3 107 ? 21.834  28.396 19.365  1.00 88.18  ? 484 VAL M N     1 
ATOM 4015 C CA    . VAL D 3 107 ? 20.999  27.553 20.226  1.00 82.21  ? 484 VAL M CA    1 
ATOM 4016 C C     . VAL D 3 107 ? 20.370  26.393 19.447  1.00 79.32  ? 484 VAL M C     1 
ATOM 4017 O O     . VAL D 3 107 ? 19.740  26.599 18.407  1.00 79.57  ? 484 VAL M O     1 
ATOM 4018 C CB    . VAL D 3 107 ? 19.854  28.369 20.866  1.00 81.43  ? 484 VAL M CB    1 
ATOM 4019 C CG1   . VAL D 3 107 ? 19.157  27.544 21.932  1.00 81.12  ? 484 VAL M CG1   1 
ATOM 4020 C CG2   . VAL D 3 107 ? 20.388  29.648 21.448  1.00 80.54  ? 484 VAL M CG2   1 
ATOM 4021 N N     . THR D 3 108 ? 20.520  25.174 19.945  1.00 75.20  ? 485 THR M N     1 
ATOM 4022 C CA    . THR D 3 108 ? 19.946  24.052 19.234  1.00 72.75  ? 485 THR M CA    1 
ATOM 4023 C C     . THR D 3 108 ? 18.599  23.625 19.783  1.00 71.32  ? 485 THR M C     1 
ATOM 4024 O O     . THR D 3 108 ? 17.668  23.398 19.013  1.00 72.88  ? 485 THR M O     1 
ATOM 4025 C CB    . THR D 3 108 ? 20.874  22.820 19.227  1.00 72.79  ? 485 THR M CB    1 
ATOM 4026 O OG1   . THR D 3 108 ? 20.879  22.212 20.524  1.00 73.84  ? 485 THR M OG1   1 
ATOM 4027 C CG2   . THR D 3 108 ? 22.285  23.221 18.830  1.00 72.15  ? 485 THR M CG2   1 
ATOM 4028 N N     . THR D 3 109 ? 18.457  23.504 21.096  1.00 68.15  ? 486 THR M N     1 
ATOM 4029 C CA    . THR D 3 109 ? 17.155  23.075 21.578  1.00 65.84  ? 486 THR M CA    1 
ATOM 4030 C C     . THR D 3 109 ? 16.139  24.207 21.576  1.00 66.06  ? 486 THR M C     1 
ATOM 4031 O O     . THR D 3 109 ? 16.387  25.295 22.105  1.00 64.89  ? 486 THR M O     1 
ATOM 4032 C CB    . THR D 3 109 ? 17.215  22.466 22.990  1.00 64.11  ? 486 THR M CB    1 
ATOM 4033 O OG1   . THR D 3 109 ? 17.270  23.510 23.970  1.00 62.85  ? 486 THR M OG1   1 
ATOM 4034 C CG2   . THR D 3 109 ? 18.421  21.554 23.113  1.00 62.50  ? 486 THR M CG2   1 
ATOM 4035 N N     . THR D 3 110 ? 15.001  23.944 20.942  1.00 65.83  ? 487 THR M N     1 
ATOM 4036 C CA    . THR D 3 110 ? 13.909  24.901 20.881  1.00 65.40  ? 487 THR M CA    1 
ATOM 4037 C C     . THR D 3 110 ? 13.420  25.089 22.323  1.00 67.82  ? 487 THR M C     1 
ATOM 4038 O O     . THR D 3 110 ? 13.490  24.157 23.126  1.00 67.40  ? 487 THR M O     1 
ATOM 4039 C CB    . THR D 3 110 ? 12.783  24.339 20.016  1.00 62.63  ? 487 THR M CB    1 
ATOM 4040 O OG1   . THR D 3 110 ? 11.518  24.744 20.552  1.00 62.70  ? 487 THR M OG1   1 
ATOM 4041 C CG2   . THR D 3 110 ? 12.859  22.824 19.981  1.00 59.43  ? 487 THR M CG2   1 
ATOM 4042 N N     . SER D 3 111 ? 12.932  26.279 22.664  1.00 70.77  ? 488 SER M N     1 
ATOM 4043 C CA    . SER D 3 111 ? 12.464  26.514 24.026  1.00 74.07  ? 488 SER M CA    1 
ATOM 4044 C C     . SER D 3 111 ? 11.306  27.493 24.127  1.00 77.36  ? 488 SER M C     1 
ATOM 4045 O O     . SER D 3 111 ? 11.242  28.466 23.390  1.00 76.72  ? 488 SER M O     1 
ATOM 4046 C CB    . SER D 3 111 ? 13.617  27.019 24.893  1.00 73.60  ? 488 SER M CB    1 
ATOM 4047 O OG    . SER D 3 111 ? 14.122  28.249 24.405  1.00 73.84  ? 488 SER M OG    1 
ATOM 4048 N N     . TYR D 3 112 ? 10.390  27.215 25.049  1.00 83.39  ? 489 TYR M N     1 
ATOM 4049 C CA    . TYR D 3 112 ? 9.228   28.065 25.293  1.00 89.60  ? 489 TYR M CA    1 
ATOM 4050 C C     . TYR D 3 112 ? 9.380   28.654 26.690  1.00 86.69  ? 489 TYR M C     1 
ATOM 4051 O O     . TYR D 3 112 ? 9.899   28.002 27.596  1.00 86.93  ? 489 TYR M O     1 
ATOM 4052 C CB    . TYR D 3 112 ? 7.929   27.256 25.201  1.00 102.14 ? 489 TYR M CB    1 
ATOM 4053 C CG    . TYR D 3 112 ? 7.631   26.748 23.805  1.00 117.41 ? 489 TYR M CG    1 
ATOM 4054 C CD1   . TYR D 3 112 ? 8.552   25.943 23.123  1.00 123.70 ? 489 TYR M CD1   1 
ATOM 4055 C CD2   . TYR D 3 112 ? 6.438   27.083 23.151  1.00 123.66 ? 489 TYR M CD2   1 
ATOM 4056 C CE1   . TYR D 3 112 ? 8.298   25.484 21.825  1.00 129.48 ? 489 TYR M CE1   1 
ATOM 4057 C CE2   . TYR D 3 112 ? 6.173   26.628 21.851  1.00 129.78 ? 489 TYR M CE2   1 
ATOM 4058 C CZ    . TYR D 3 112 ? 7.111   25.830 21.198  1.00 131.42 ? 489 TYR M CZ    1 
ATOM 4059 O OH    . TYR D 3 112 ? 6.872   25.373 19.921  1.00 135.33 ? 489 TYR M OH    1 
ATOM 4060 N N     . GLU D 3 113 ? 8.922   29.887 26.860  1.00 82.25  ? 490 GLU M N     1 
ATOM 4061 C CA    . GLU D 3 113 ? 9.040   30.579 28.134  1.00 77.40  ? 490 GLU M CA    1 
ATOM 4062 C C     . GLU D 3 113 ? 7.676   30.886 28.730  1.00 73.68  ? 490 GLU M C     1 
ATOM 4063 O O     . GLU D 3 113 ? 6.768   31.280 28.018  1.00 73.98  ? 490 GLU M O     1 
ATOM 4064 C CB    . GLU D 3 113 ? 9.830   31.865 27.911  1.00 78.21  ? 490 GLU M CB    1 
ATOM 4065 C CG    . GLU D 3 113 ? 9.952   32.763 29.101  1.00 80.98  ? 490 GLU M CG    1 
ATOM 4066 C CD    . GLU D 3 113 ? 10.900  33.915 28.835  1.00 83.77  ? 490 GLU M CD    1 
ATOM 4067 O OE1   . GLU D 3 113 ? 12.133  33.705 28.875  1.00 84.51  ? 490 GLU M OE1   1 
ATOM 4068 O OE2   . GLU D 3 113 ? 10.411  35.034 28.571  1.00 85.78  ? 490 GLU M OE2   1 
ATOM 4069 N N     . LYS D 3 114 ? 7.527   30.693 30.036  1.00 69.80  ? 491 LYS M N     1 
ATOM 4070 C CA    . LYS D 3 114 ? 6.258   30.967 30.714  1.00 64.74  ? 491 LYS M CA    1 
ATOM 4071 C C     . LYS D 3 114 ? 6.497   31.261 32.180  1.00 61.83  ? 491 LYS M C     1 
ATOM 4072 O O     . LYS D 3 114 ? 7.524   30.871 32.743  1.00 61.63  ? 491 LYS M O     1 
ATOM 4073 C CB    . LYS D 3 114 ? 5.309   29.777 30.613  1.00 64.47  ? 491 LYS M CB    1 
ATOM 4074 C CG    . LYS D 3 114 ? 5.766   28.571 31.410  1.00 65.03  ? 491 LYS M CG    1 
ATOM 4075 C CD    . LYS D 3 114 ? 4.748   27.451 31.335  1.00 65.22  ? 491 LYS M CD    1 
ATOM 4076 C CE    . LYS D 3 114 ? 5.302   26.162 31.899  1.00 63.91  ? 491 LYS M CE    1 
ATOM 4077 N NZ    . LYS D 3 114 ? 4.385   25.042 31.610  1.00 62.71  ? 491 LYS M NZ    1 
ATOM 4078 N N     . ILE D 3 115 ? 5.535   31.941 32.797  1.00 58.03  ? 492 ILE M N     1 
ATOM 4079 C CA    . ILE D 3 115 ? 5.639   32.295 34.203  1.00 53.70  ? 492 ILE M CA    1 
ATOM 4080 C C     . ILE D 3 115 ? 4.831   31.345 35.058  1.00 51.58  ? 492 ILE M C     1 
ATOM 4081 O O     . ILE D 3 115 ? 3.907   30.719 34.583  1.00 51.51  ? 492 ILE M O     1 
ATOM 4082 C CB    . ILE D 3 115 ? 5.168   33.738 34.430  1.00 52.11  ? 492 ILE M CB    1 
ATOM 4083 C CG1   . ILE D 3 115 ? 6.056   34.676 33.609  1.00 51.97  ? 492 ILE M CG1   1 
ATOM 4084 C CG2   . ILE D 3 115 ? 5.215   34.085 35.907  1.00 50.83  ? 492 ILE M CG2   1 
ATOM 4085 C CD1   . ILE D 3 115 ? 5.969   36.139 33.987  1.00 51.90  ? 492 ILE M CD1   1 
ATOM 4086 N N     . VAL D 3 116 ? 5.200   31.221 36.321  1.00 51.44  ? 493 VAL M N     1 
ATOM 4087 C CA    . VAL D 3 116 ? 4.495   30.339 37.236  1.00 51.73  ? 493 VAL M CA    1 
ATOM 4088 C C     . VAL D 3 116 ? 4.616   30.936 38.621  1.00 53.29  ? 493 VAL M C     1 
ATOM 4089 O O     . VAL D 3 116 ? 5.506   30.570 39.384  1.00 54.22  ? 493 VAL M O     1 
ATOM 4090 C CB    . VAL D 3 116 ? 5.116   28.939 37.244  1.00 50.23  ? 493 VAL M CB    1 
ATOM 4091 C CG1   . VAL D 3 116 ? 4.458   28.086 38.289  1.00 48.88  ? 493 VAL M CG1   1 
ATOM 4092 C CG2   . VAL D 3 116 ? 4.970   28.304 35.881  1.00 49.68  ? 493 VAL M CG2   1 
ATOM 4093 N N     . GLY D 3 117 ? 3.711   31.852 38.945  1.00 54.34  ? 494 GLY M N     1 
ATOM 4094 C CA    . GLY D 3 117 ? 3.764   32.502 40.237  1.00 57.48  ? 494 GLY M CA    1 
ATOM 4095 C C     . GLY D 3 117 ? 4.660   33.701 40.031  1.00 60.17  ? 494 GLY M C     1 
ATOM 4096 O O     . GLY D 3 117 ? 4.219   34.718 39.498  1.00 61.65  ? 494 GLY M O     1 
ATOM 4097 N N     . ASN D 3 118 ? 5.915   33.593 40.450  1.00 61.65  ? 495 ASN M N     1 
ATOM 4098 C CA    . ASN D 3 118 ? 6.873   34.676 40.262  1.00 63.69  ? 495 ASN M CA    1 
ATOM 4099 C C     . ASN D 3 118 ? 8.086   34.030 39.642  1.00 63.29  ? 495 ASN M C     1 
ATOM 4100 O O     . ASN D 3 118 ? 9.154   34.629 39.560  1.00 64.77  ? 495 ASN M O     1 
ATOM 4101 C CB    . ASN D 3 118 ? 7.296   35.307 41.591  1.00 68.51  ? 495 ASN M CB    1 
ATOM 4102 C CG    . ASN D 3 118 ? 6.137   35.881 42.369  1.00 71.68  ? 495 ASN M CG    1 
ATOM 4103 O OD1   . ASN D 3 118 ? 5.265   35.150 42.829  1.00 74.75  ? 495 ASN M OD1   1 
ATOM 4104 N ND2   . ASN D 3 118 ? 6.125   37.199 42.527  1.00 73.04  ? 495 ASN M ND2   1 
ATOM 4105 N N     . THR D 3 119 ? 7.919   32.789 39.215  1.00 61.85  ? 496 THR M N     1 
ATOM 4106 C CA    . THR D 3 119 ? 9.017   32.053 38.627  1.00 60.45  ? 496 THR M CA    1 
ATOM 4107 C C     . THR D 3 119 ? 8.850   31.874 37.136  1.00 59.48  ? 496 THR M C     1 
ATOM 4108 O O     . THR D 3 119 ? 7.798   31.447 36.672  1.00 59.21  ? 496 THR M O     1 
ATOM 4109 C CB    . THR D 3 119 ? 9.137   30.670 39.261  1.00 61.22  ? 496 THR M CB    1 
ATOM 4110 O OG1   . THR D 3 119 ? 9.291   30.807 40.681  1.00 62.29  ? 496 THR M OG1   1 
ATOM 4111 C CG2   . THR D 3 119 ? 10.327  29.923 38.674  1.00 60.77  ? 496 THR M CG2   1 
ATOM 4112 N N     . LYS D 3 120 ? 9.887   32.215 36.383  1.00 58.58  ? 497 LYS M N     1 
ATOM 4113 C CA    . LYS D 3 120 ? 9.841   32.044 34.946  1.00 57.20  ? 497 LYS M CA    1 
ATOM 4114 C C     . LYS D 3 120 ? 10.321  30.623 34.721  1.00 53.03  ? 497 LYS M C     1 
ATOM 4115 O O     . LYS D 3 120 ? 11.190  30.132 35.433  1.00 51.73  ? 497 LYS M O     1 
ATOM 4116 C CB    . LYS D 3 120 ? 10.762  33.049 34.246  1.00 62.54  ? 497 LYS M CB    1 
ATOM 4117 C CG    . LYS D 3 120 ? 10.660  33.024 32.712  1.00 68.34  ? 497 LYS M CG    1 
ATOM 4118 C CD    . LYS D 3 120 ? 11.250  34.280 32.075  1.00 71.84  ? 497 LYS M CD    1 
ATOM 4119 C CE    . LYS D 3 120 ? 10.432  35.514 32.417  1.00 74.28  ? 497 LYS M CE    1 
ATOM 4120 N NZ    . LYS D 3 120 ? 11.048  36.744 31.856  1.00 78.28  ? 497 LYS M NZ    1 
ATOM 4121 N N     . VAL D 3 121 ? 9.748   29.949 33.742  1.00 49.24  ? 498 VAL M N     1 
ATOM 4122 C CA    . VAL D 3 121 ? 10.142  28.582 33.499  1.00 46.37  ? 498 VAL M CA    1 
ATOM 4123 C C     . VAL D 3 121 ? 10.229  28.247 32.034  1.00 46.16  ? 498 VAL M C     1 
ATOM 4124 O O     . VAL D 3 121 ? 9.276   28.421 31.288  1.00 46.16  ? 498 VAL M O     1 
ATOM 4125 C CB    . VAL D 3 121 ? 9.159   27.616 34.159  1.00 44.42  ? 498 VAL M CB    1 
ATOM 4126 C CG1   . VAL D 3 121 ? 9.550   26.174 33.861  1.00 43.21  ? 498 VAL M CG1   1 
ATOM 4127 C CG2   . VAL D 3 121 ? 9.144   27.858 35.638  1.00 43.08  ? 498 VAL M CG2   1 
ATOM 4128 N N     . LEU D 3 122 ? 11.386  27.754 31.632  1.00 46.34  ? 499 LEU M N     1 
ATOM 4129 C CA    . LEU D 3 122 ? 11.616  27.360 30.257  1.00 48.52  ? 499 LEU M CA    1 
ATOM 4130 C C     . LEU D 3 122 ? 11.144  25.920 30.063  1.00 51.42  ? 499 LEU M C     1 
ATOM 4131 O O     . LEU D 3 122 ? 11.134  25.138 31.014  1.00 52.34  ? 499 LEU M O     1 
ATOM 4132 C CB    . LEU D 3 122 ? 13.106  27.416 29.954  1.00 46.10  ? 499 LEU M CB    1 
ATOM 4133 C CG    . LEU D 3 122 ? 13.637  28.496 29.036  1.00 44.38  ? 499 LEU M CG    1 
ATOM 4134 C CD1   . LEU D 3 122 ? 13.314  29.858 29.601  1.00 44.24  ? 499 LEU M CD1   1 
ATOM 4135 C CD2   . LEU D 3 122 ? 15.137  28.294 28.887  1.00 45.09  ? 499 LEU M CD2   1 
ATOM 4136 N N     . GLU D 3 123 ? 10.762  25.562 28.841  1.00 53.40  ? 500 GLU M N     1 
ATOM 4137 C CA    . GLU D 3 123 ? 10.352  24.196 28.575  1.00 55.80  ? 500 GLU M CA    1 
ATOM 4138 C C     . GLU D 3 123 ? 10.793  23.721 27.202  1.00 54.98  ? 500 GLU M C     1 
ATOM 4139 O O     . GLU D 3 123 ? 10.247  24.145 26.196  1.00 55.09  ? 500 GLU M O     1 
ATOM 4140 C CB    . GLU D 3 123 ? 8.844   24.047 28.695  1.00 59.82  ? 500 GLU M CB    1 
ATOM 4141 C CG    . GLU D 3 123 ? 8.384   22.623 28.428  1.00 67.35  ? 500 GLU M CG    1 
ATOM 4142 C CD    . GLU D 3 123 ? 6.901   22.431 28.657  1.00 71.76  ? 500 GLU M CD    1 
ATOM 4143 O OE1   . GLU D 3 123 ? 6.438   22.650 29.800  1.00 75.15  ? 500 GLU M OE1   1 
ATOM 4144 O OE2   . GLU D 3 123 ? 6.200   22.060 27.693  1.00 73.45  ? 500 GLU M OE2   1 
ATOM 4145 N N     . ILE D 3 124 ? 11.791  22.847 27.163  1.00 54.76  ? 501 ILE M N     1 
ATOM 4146 C CA    . ILE D 3 124 ? 12.274  22.310 25.902  1.00 55.73  ? 501 ILE M CA    1 
ATOM 4147 C C     . ILE D 3 124 ? 11.662  20.927 25.736  1.00 56.26  ? 501 ILE M C     1 
ATOM 4148 O O     . ILE D 3 124 ? 11.191  20.332 26.706  1.00 57.11  ? 501 ILE M O     1 
ATOM 4149 C CB    . ILE D 3 124 ? 13.805  22.202 25.883  1.00 56.81  ? 501 ILE M CB    1 
ATOM 4150 C CG1   . ILE D 3 124 ? 14.277  21.321 27.033  1.00 58.11  ? 501 ILE M CG1   1 
ATOM 4151 C CG2   . ILE D 3 124 ? 14.430  23.576 25.992  1.00 58.03  ? 501 ILE M CG2   1 
ATOM 4152 C CD1   . ILE D 3 124 ? 14.149  19.837 26.755  1.00 60.76  ? 501 ILE M CD1   1 
ATOM 4153 N N     . PRO D 3 125 ? 11.664  20.391 24.506  1.00 56.35  ? 502 PRO M N     1 
ATOM 4154 C CA    . PRO D 3 125 ? 11.089  19.071 24.245  1.00 55.95  ? 502 PRO M CA    1 
ATOM 4155 C C     . PRO D 3 125 ? 12.022  17.888 24.417  1.00 56.56  ? 502 PRO M C     1 
ATOM 4156 O O     . PRO D 3 125 ? 13.208  17.969 24.107  1.00 55.89  ? 502 PRO M O     1 
ATOM 4157 C CB    . PRO D 3 125 ? 10.631  19.198 22.809  1.00 55.46  ? 502 PRO M CB    1 
ATOM 4158 C CG    . PRO D 3 125 ? 11.766  19.967 22.216  1.00 55.17  ? 502 PRO M CG    1 
ATOM 4159 C CD    . PRO D 3 125 ? 11.969  21.075 23.235  1.00 55.26  ? 502 PRO M CD    1 
ATOM 4160 N N     . LEU D 3 126 ? 11.455  16.784 24.890  1.00 57.76  ? 503 LEU M N     1 
ATOM 4161 C CA    . LEU D 3 126 ? 12.186  15.537 25.084  1.00 59.47  ? 503 LEU M CA    1 
ATOM 4162 C C     . LEU D 3 126 ? 11.623  14.523 24.111  1.00 61.32  ? 503 LEU M C     1 
ATOM 4163 O O     . LEU D 3 126 ? 10.799  13.700 24.477  1.00 61.19  ? 503 LEU M O     1 
ATOM 4164 C CB    . LEU D 3 126 ? 12.003  15.018 26.507  1.00 57.57  ? 503 LEU M CB    1 
ATOM 4165 C CG    . LEU D 3 126 ? 13.012  15.492 27.545  1.00 55.45  ? 503 LEU M CG    1 
ATOM 4166 C CD1   . LEU D 3 126 ? 12.510  15.170 28.932  1.00 57.12  ? 503 LEU M CD1   1 
ATOM 4167 C CD2   . LEU D 3 126 ? 14.337  14.818 27.292  1.00 53.92  ? 503 LEU M CD2   1 
ATOM 4168 N N     . GLU D 3 127 ? 12.073  14.584 22.869  1.00 65.21  ? 504 GLU M N     1 
ATOM 4169 C CA    . GLU D 3 127 ? 11.578  13.678 21.848  1.00 68.99  ? 504 GLU M CA    1 
ATOM 4170 C C     . GLU D 3 127 ? 12.223  12.309 21.894  1.00 68.58  ? 504 GLU M C     1 
ATOM 4171 O O     . GLU D 3 127 ? 13.437  12.184 22.042  1.00 69.13  ? 504 GLU M O     1 
ATOM 4172 C CB    . GLU D 3 127 ? 11.775  14.305 20.474  1.00 73.14  ? 504 GLU M CB    1 
ATOM 4173 C CG    . GLU D 3 127 ? 11.102  15.651 20.363  1.00 80.63  ? 504 GLU M CG    1 
ATOM 4174 C CD    . GLU D 3 127 ? 11.411  16.351 19.065  1.00 86.11  ? 504 GLU M CD    1 
ATOM 4175 O OE1   . GLU D 3 127 ? 12.610  16.459 18.716  1.00 88.61  ? 504 GLU M OE1   1 
ATOM 4176 O OE2   . GLU D 3 127 ? 10.452  16.801 18.398  1.00 89.97  ? 504 GLU M OE2   1 
ATOM 4177 N N     . PRO D 3 128 ? 11.406  11.257 21.766  1.00 68.26  ? 505 PRO M N     1 
ATOM 4178 C CA    . PRO D 3 128 ? 11.884  9.876  21.791  1.00 68.62  ? 505 PRO M CA    1 
ATOM 4179 C C     . PRO D 3 128 ? 12.834  9.592  20.643  1.00 69.30  ? 505 PRO M C     1 
ATOM 4180 O O     . PRO D 3 128 ? 13.653  8.678  20.721  1.00 69.87  ? 505 PRO M O     1 
ATOM 4181 C CB    . PRO D 3 128 ? 10.599  9.064  21.694  1.00 68.67  ? 505 PRO M CB    1 
ATOM 4182 C CG    . PRO D 3 128 ? 9.584   9.963  22.328  1.00 68.44  ? 505 PRO M CG    1 
ATOM 4183 C CD    . PRO D 3 128 ? 9.937   11.295 21.724  1.00 68.05  ? 505 PRO M CD    1 
ATOM 4184 N N     . LYS D 3 129 ? 12.730  10.373 19.573  1.00 69.70  ? 506 LYS M N     1 
ATOM 4185 C CA    . LYS D 3 129 ? 13.618  10.170 18.441  1.00 70.93  ? 506 LYS M CA    1 
ATOM 4186 C C     . LYS D 3 129 ? 15.047  10.423 18.908  1.00 70.70  ? 506 LYS M C     1 
ATOM 4187 O O     . LYS D 3 129 ? 16.007  10.188 18.177  1.00 70.21  ? 506 LYS M O     1 
ATOM 4188 C CB    . LYS D 3 129 ? 13.255  11.118 17.297  1.00 72.34  ? 506 LYS M CB    1 
ATOM 4189 C CG    . LYS D 3 129 ? 13.671  12.560 17.498  1.00 75.10  ? 506 LYS M CG    1 
ATOM 4190 C CD    . LYS D 3 129 ? 13.213  13.428 16.325  1.00 76.69  ? 506 LYS M CD    1 
ATOM 4191 C CE    . LYS D 3 129 ? 13.658  14.875 16.480  1.00 77.30  ? 506 LYS M CE    1 
ATOM 4192 N NZ    . LYS D 3 129 ? 12.921  15.782 15.561  1.00 78.31  ? 506 LYS M NZ    1 
ATOM 4193 N N     . ASN D 3 130 ? 15.168  10.893 20.146  1.00 70.71  ? 507 ASN M N     1 
ATOM 4194 C CA    . ASN D 3 130 ? 16.457  11.197 20.749  1.00 70.22  ? 507 ASN M CA    1 
ATOM 4195 C C     . ASN D 3 130 ? 16.612  10.561 22.124  1.00 68.30  ? 507 ASN M C     1 
ATOM 4196 O O     . ASN D 3 130 ? 17.252  11.123 23.003  1.00 67.98  ? 507 ASN M O     1 
ATOM 4197 C CB    . ASN D 3 130 ? 16.619  12.710 20.870  1.00 72.51  ? 507 ASN M CB    1 
ATOM 4198 C CG    . ASN D 3 130 ? 16.792  13.379 19.531  1.00 73.42  ? 507 ASN M CG    1 
ATOM 4199 O OD1   . ASN D 3 130 ? 16.163  14.398 19.247  1.00 73.70  ? 507 ASN M OD1   1 
ATOM 4200 N ND2   . ASN D 3 130 ? 17.659  12.815 18.699  1.00 73.51  ? 507 ASN M ND2   1 
ATOM 4201 N N     . ASN D 3 131 ? 16.025  9.387  22.303  1.00 67.24  ? 508 ASN M N     1 
ATOM 4202 C CA    . ASN D 3 131 ? 16.096  8.682  23.577  1.00 66.36  ? 508 ASN M CA    1 
ATOM 4203 C C     . ASN D 3 131 ? 15.761  9.590  24.735  1.00 64.40  ? 508 ASN M C     1 
ATOM 4204 O O     . ASN D 3 131 ? 16.332  9.456  25.813  1.00 63.53  ? 508 ASN M O     1 
ATOM 4205 C CB    . ASN D 3 131 ? 17.485  8.112  23.796  1.00 68.35  ? 508 ASN M CB    1 
ATOM 4206 C CG    . ASN D 3 131 ? 17.915  7.234  22.670  1.00 70.83  ? 508 ASN M CG    1 
ATOM 4207 O OD1   . ASN D 3 131 ? 19.089  6.882  22.557  1.00 72.68  ? 508 ASN M OD1   1 
ATOM 4208 N ND2   . ASN D 3 131 ? 16.963  6.865  21.814  1.00 71.80  ? 508 ASN M ND2   1 
ATOM 4209 N N     . MET D 3 132 ? 14.842  10.519 24.503  1.00 62.31  ? 509 MET M N     1 
ATOM 4210 C CA    . MET D 3 132 ? 14.424  11.434 25.545  1.00 60.79  ? 509 MET M CA    1 
ATOM 4211 C C     . MET D 3 132 ? 15.637  12.095 26.192  1.00 60.30  ? 509 MET M C     1 
ATOM 4212 O O     . MET D 3 132 ? 15.689  12.256 27.417  1.00 61.57  ? 509 MET M O     1 
ATOM 4213 C CB    . MET D 3 132 ? 13.626  10.679 26.605  1.00 60.62  ? 509 MET M CB    1 
ATOM 4214 C CG    . MET D 3 132 ? 12.438  9.891  26.062  1.00 59.86  ? 509 MET M CG    1 
ATOM 4215 S SD    . MET D 3 132 ? 11.145  10.906 25.320  1.00 57.25  ? 509 MET M SD    1 
ATOM 4216 C CE    . MET D 3 132 ? 10.362  11.617 26.762  1.00 58.09  ? 509 MET M CE    1 
ATOM 4217 N N     . ARG D 3 133 ? 16.613  12.454 25.360  1.00 57.69  ? 510 ARG M N     1 
ATOM 4218 C CA    . ARG D 3 133 ? 17.835  13.118 25.800  1.00 53.56  ? 510 ARG M CA    1 
ATOM 4219 C C     . ARG D 3 133 ? 17.660  14.562 25.346  1.00 53.10  ? 510 ARG M C     1 
ATOM 4220 O O     . ARG D 3 133 ? 17.055  14.807 24.305  1.00 54.17  ? 510 ARG M O     1 
ATOM 4221 C CB    . ARG D 3 133 ? 19.021  12.485 25.101  1.00 51.68  ? 510 ARG M CB    1 
ATOM 4222 C CG    . ARG D 3 133 ? 20.368  12.849 25.648  1.00 52.00  ? 510 ARG M CG    1 
ATOM 4223 C CD    . ARG D 3 133 ? 21.455  12.132 24.841  1.00 52.68  ? 510 ARG M CD    1 
ATOM 4224 N NE    . ARG D 3 133 ? 22.765  12.161 25.478  1.00 50.91  ? 510 ARG M NE    1 
ATOM 4225 C CZ    . ARG D 3 133 ? 23.029  11.603 26.655  1.00 51.27  ? 510 ARG M CZ    1 
ATOM 4226 N NH1   . ARG D 3 133 ? 22.075  10.972 27.331  1.00 51.85  ? 510 ARG M NH1   1 
ATOM 4227 N NH2   . ARG D 3 133 ? 24.247  11.671 27.161  1.00 51.84  ? 510 ARG M NH2   1 
ATOM 4228 N N     . ALA D 3 134 ? 18.161  15.516 26.125  1.00 52.04  ? 511 ALA M N     1 
ATOM 4229 C CA    . ALA D 3 134 ? 18.030  16.938 25.789  1.00 50.57  ? 511 ALA M CA    1 
ATOM 4230 C C     . ALA D 3 134 ? 19.282  17.743 26.133  1.00 50.48  ? 511 ALA M C     1 
ATOM 4231 O O     . ALA D 3 134 ? 19.860  17.597 27.213  1.00 51.22  ? 511 ALA M O     1 
ATOM 4232 C CB    . ALA D 3 134 ? 16.822  17.534 26.500  1.00 48.92  ? 511 ALA M CB    1 
ATOM 4233 N N     . THR D 3 135 ? 19.695  18.603 25.214  1.00 49.20  ? 512 THR M N     1 
ATOM 4234 C CA    . THR D 3 135 ? 20.884  19.403 25.436  1.00 47.57  ? 512 THR M CA    1 
ATOM 4235 C C     . THR D 3 135 ? 20.559  20.829 25.848  1.00 47.20  ? 512 THR M C     1 
ATOM 4236 O O     . THR D 3 135 ? 20.455  21.730 25.025  1.00 47.43  ? 512 THR M O     1 
ATOM 4237 C CB    . THR D 3 135 ? 21.777  19.391 24.181  1.00 46.39  ? 512 THR M CB    1 
ATOM 4238 O OG1   . THR D 3 135 ? 22.438  18.123 24.094  1.00 43.42  ? 512 THR M OG1   1 
ATOM 4239 C CG2   . THR D 3 135 ? 22.804  20.508 24.222  1.00 44.09  ? 512 THR M CG2   1 
ATOM 4240 N N     . ILE D 3 136 ? 20.405  21.019 27.148  1.00 46.67  ? 513 ILE M N     1 
ATOM 4241 C CA    . ILE D 3 136 ? 20.104  22.325 27.698  1.00 45.57  ? 513 ILE M CA    1 
ATOM 4242 C C     . ILE D 3 136 ? 21.214  23.288 27.307  1.00 44.93  ? 513 ILE M C     1 
ATOM 4243 O O     . ILE D 3 136 ? 22.301  23.245 27.878  1.00 44.31  ? 513 ILE M O     1 
ATOM 4244 C CB    . ILE D 3 136 ? 20.024  22.278 29.255  1.00 45.84  ? 513 ILE M CB    1 
ATOM 4245 C CG1   . ILE D 3 136 ? 19.274  21.023 29.721  1.00 44.47  ? 513 ILE M CG1   1 
ATOM 4246 C CG2   . ILE D 3 136 ? 19.325  23.529 29.781  1.00 46.24  ? 513 ILE M CG2   1 
ATOM 4247 C CD1   . ILE D 3 136 ? 17.848  20.926 29.248  1.00 44.21  ? 513 ILE M CD1   1 
ATOM 4248 N N     . ASP D 3 137 ? 20.947  24.140 26.323  1.00 45.33  ? 514 ASP M N     1 
ATOM 4249 C CA    . ASP D 3 137 ? 21.929  25.135 25.886  1.00 46.47  ? 514 ASP M CA    1 
ATOM 4250 C C     . ASP D 3 137 ? 21.238  26.447 25.539  1.00 45.42  ? 514 ASP M C     1 
ATOM 4251 O O     . ASP D 3 137 ? 21.794  27.305 24.846  1.00 44.60  ? 514 ASP M O     1 
ATOM 4252 C CB    . ASP D 3 137 ? 22.723  24.647 24.677  1.00 48.09  ? 514 ASP M CB    1 
ATOM 4253 C CG    . ASP D 3 137 ? 21.873  24.505 23.432  1.00 50.12  ? 514 ASP M CG    1 
ATOM 4254 O OD1   . ASP D 3 137 ? 22.455  24.176 22.377  1.00 51.87  ? 514 ASP M OD1   1 
ATOM 4255 O OD2   . ASP D 3 137 ? 20.641  24.712 23.501  1.00 49.74  ? 514 ASP M OD2   1 
ATOM 4256 N N     . CYS D 3 138 ? 20.019  26.584 26.043  1.00 44.06  ? 515 CYS M N     1 
ATOM 4257 C CA    . CYS D 3 138 ? 19.199  27.761 25.833  1.00 41.33  ? 515 CYS M CA    1 
ATOM 4258 C C     . CYS D 3 138 ? 18.846  28.313 27.205  1.00 40.43  ? 515 CYS M C     1 
ATOM 4259 O O     . CYS D 3 138 ? 17.937  29.138 27.340  1.00 40.22  ? 515 CYS M O     1 
ATOM 4260 C CB    . CYS D 3 138 ? 17.922  27.367 25.112  1.00 41.96  ? 515 CYS M CB    1 
ATOM 4261 S SG    . CYS D 3 138 ? 17.085  25.977 25.917  1.00 44.18  ? 515 CYS M SG    1 
ATOM 4262 N N     . ALA D 3 139 ? 19.563  27.859 28.230  1.00 38.13  ? 516 ALA M N     1 
ATOM 4263 C CA    . ALA D 3 139 ? 19.275  28.325 29.578  1.00 36.21  ? 516 ALA M CA    1 
ATOM 4264 C C     . ALA D 3 139 ? 20.336  29.257 30.142  1.00 34.34  ? 516 ALA M C     1 
ATOM 4265 O O     . ALA D 3 139 ? 21.485  28.865 30.334  1.00 35.18  ? 516 ALA M O     1 
ATOM 4266 C CB    . ALA D 3 139 ? 19.082  27.139 30.493  1.00 36.91  ? 516 ALA M CB    1 
ATOM 4267 N N     . GLY D 3 140 ? 19.945  30.498 30.392  1.00 31.58  ? 517 GLY M N     1 
ATOM 4268 C CA    . GLY D 3 140 ? 20.869  31.459 30.949  1.00 31.60  ? 517 GLY M CA    1 
ATOM 4269 C C     . GLY D 3 140 ? 20.441  31.748 32.370  1.00 31.99  ? 517 GLY M C     1 
ATOM 4270 O O     . GLY D 3 140 ? 19.543  31.087 32.878  1.00 30.74  ? 517 GLY M O     1 
ATOM 4271 N N     . ILE D 3 141 ? 21.057  32.731 33.020  1.00 32.00  ? 518 ILE M N     1 
ATOM 4272 C CA    . ILE D 3 141 ? 20.677  33.030 34.398  1.00 32.89  ? 518 ILE M CA    1 
ATOM 4273 C C     . ILE D 3 141 ? 20.598  34.522 34.707  1.00 33.11  ? 518 ILE M C     1 
ATOM 4274 O O     . ILE D 3 141 ? 21.618  35.205 34.902  1.00 32.32  ? 518 ILE M O     1 
ATOM 4275 C CB    . ILE D 3 141 ? 21.648  32.348 35.425  1.00 33.35  ? 518 ILE M CB    1 
ATOM 4276 C CG1   . ILE D 3 141 ? 21.634  30.835 35.238  1.00 31.14  ? 518 ILE M CG1   1 
ATOM 4277 C CG2   . ILE D 3 141 ? 21.204  32.637 36.854  1.00 31.54  ? 518 ILE M CG2   1 
ATOM 4278 C CD1   . ILE D 3 141 ? 22.634  30.135 36.083  1.00 29.19  ? 518 ILE M CD1   1 
ATOM 4279 N N     . LEU D 3 142 ? 19.371  35.024 34.748  1.00 32.26  ? 519 LEU M N     1 
ATOM 4280 C CA    . LEU D 3 142 ? 19.139  36.422 35.057  1.00 32.08  ? 519 LEU M CA    1 
ATOM 4281 C C     . LEU D 3 142 ? 19.204  36.548 36.577  1.00 34.17  ? 519 LEU M C     1 
ATOM 4282 O O     . LEU D 3 142 ? 18.982  35.574 37.310  1.00 35.52  ? 519 LEU M O     1 
ATOM 4283 C CB    . LEU D 3 142 ? 17.768  36.853 34.536  1.00 29.35  ? 519 LEU M CB    1 
ATOM 4284 C CG    . LEU D 3 142 ? 17.293  38.236 34.969  1.00 27.73  ? 519 LEU M CG    1 
ATOM 4285 C CD1   . LEU D 3 142 ? 18.237  39.308 34.460  1.00 26.42  ? 519 LEU M CD1   1 
ATOM 4286 C CD2   . LEU D 3 142 ? 15.907  38.461 34.449  1.00 26.70  ? 519 LEU M CD2   1 
ATOM 4287 N N     . LYS D 3 143 ? 19.519  37.746 37.045  1.00 34.93  ? 520 LYS M N     1 
ATOM 4288 C CA    . LYS D 3 143 ? 19.638  38.028 38.469  1.00 35.83  ? 520 LYS M CA    1 
ATOM 4289 C C     . LYS D 3 143 ? 18.754  39.215 38.821  1.00 38.05  ? 520 LYS M C     1 
ATOM 4290 O O     . LYS D 3 143 ? 18.997  40.327 38.337  1.00 40.21  ? 520 LYS M O     1 
ATOM 4291 C CB    . LYS D 3 143 ? 21.093  38.357 38.805  1.00 33.54  ? 520 LYS M CB    1 
ATOM 4292 C CG    . LYS D 3 143 ? 21.295  38.982 40.157  1.00 35.12  ? 520 LYS M CG    1 
ATOM 4293 C CD    . LYS D 3 143 ? 20.835  38.040 41.264  1.00 37.81  ? 520 LYS M CD    1 
ATOM 4294 C CE    . LYS D 3 143 ? 21.362  38.458 42.629  1.00 37.44  ? 520 LYS M CE    1 
ATOM 4295 N NZ    . LYS D 3 143 ? 20.774  39.738 43.118  1.00 38.34  ? 520 LYS M NZ    1 
ATOM 4296 N N     . LEU D 3 144 ? 17.736  38.984 39.654  1.00 38.83  ? 521 LEU M N     1 
ATOM 4297 C CA    . LEU D 3 144 ? 16.813  40.045 40.069  1.00 38.88  ? 521 LEU M CA    1 
ATOM 4298 C C     . LEU D 3 144 ? 17.484  40.920 41.098  1.00 39.34  ? 521 LEU M C     1 
ATOM 4299 O O     . LEU D 3 144 ? 18.453  40.512 41.716  1.00 39.38  ? 521 LEU M O     1 
ATOM 4300 C CB    . LEU D 3 144 ? 15.555  39.442 40.664  1.00 38.64  ? 521 LEU M CB    1 
ATOM 4301 C CG    . LEU D 3 144 ? 15.063  38.317 39.765  1.00 39.89  ? 521 LEU M CG    1 
ATOM 4302 C CD1   . LEU D 3 144 ? 13.942  37.522 40.426  1.00 38.70  ? 521 LEU M CD1   1 
ATOM 4303 C CD2   . LEU D 3 144 ? 14.642  38.932 38.445  1.00 38.83  ? 521 LEU M CD2   1 
ATOM 4304 N N     . ARG D 3 145 ? 16.986  42.128 41.282  1.00 41.48  ? 522 ARG M N     1 
ATOM 4305 C CA    . ARG D 3 145 ? 17.598  43.002 42.257  1.00 46.10  ? 522 ARG M CA    1 
ATOM 4306 C C     . ARG D 3 145 ? 16.953  42.803 43.621  1.00 47.69  ? 522 ARG M C     1 
ATOM 4307 O O     . ARG D 3 145 ? 15.757  43.033 43.802  1.00 46.46  ? 522 ARG M O     1 
ATOM 4308 C CB    . ARG D 3 145 ? 17.483  44.459 41.818  1.00 48.44  ? 522 ARG M CB    1 
ATOM 4309 C CG    . ARG D 3 145 ? 18.503  44.878 40.772  1.00 49.98  ? 522 ARG M CG    1 
ATOM 4310 C CD    . ARG D 3 145 ? 18.274  46.325 40.401  1.00 51.65  ? 522 ARG M CD    1 
ATOM 4311 N NE    . ARG D 3 145 ? 16.859  46.548 40.139  1.00 53.47  ? 522 ARG M NE    1 
ATOM 4312 C CZ    . ARG D 3 145 ? 16.340  47.708 39.768  1.00 55.15  ? 522 ARG M CZ    1 
ATOM 4313 N NH1   . ARG D 3 145 ? 17.121  48.766 39.609  1.00 56.13  ? 522 ARG M NH1   1 
ATOM 4314 N NH2   . ARG D 3 145 ? 15.037  47.805 39.565  1.00 57.92  ? 522 ARG M NH2   1 
ATOM 4315 N N     . ASN D 3 146 ? 17.766  42.361 44.573  1.00 49.74  ? 523 ASN M N     1 
ATOM 4316 C CA    . ASN D 3 146 ? 17.304  42.099 45.923  1.00 52.22  ? 523 ASN M CA    1 
ATOM 4317 C C     . ASN D 3 146 ? 16.255  43.100 46.374  1.00 54.70  ? 523 ASN M C     1 
ATOM 4318 O O     . ASN D 3 146 ? 15.136  42.718 46.702  1.00 54.96  ? 523 ASN M O     1 
ATOM 4319 C CB    . ASN D 3 146 ? 18.491  42.093 46.886  1.00 51.45  ? 523 ASN M CB    1 
ATOM 4320 C CG    . ASN D 3 146 ? 19.546  41.074 46.494  1.00 50.82  ? 523 ASN M CG    1 
ATOM 4321 O OD1   . ASN D 3 146 ? 19.235  40.061 45.861  1.00 50.39  ? 523 ASN M OD1   1 
ATOM 4322 N ND2   . ASN D 3 146 ? 20.797  41.329 46.875  1.00 49.37  ? 523 ASN M ND2   1 
ATOM 4323 N N     . ALA D 3 147 ? 16.605  44.382 46.372  1.00 58.22  ? 524 ALA M N     1 
ATOM 4324 C CA    . ALA D 3 147 ? 15.663  45.417 46.787  1.00 61.15  ? 524 ALA M CA    1 
ATOM 4325 C C     . ALA D 3 147 ? 14.288  45.198 46.165  1.00 63.37  ? 524 ALA M C     1 
ATOM 4326 O O     . ALA D 3 147 ? 13.275  45.300 46.847  1.00 63.43  ? 524 ALA M O     1 
ATOM 4327 C CB    . ALA D 3 147 ? 16.195  46.788 46.409  1.00 61.83  ? 524 ALA M CB    1 
ATOM 4328 N N     . ASP D 3 148 ? 14.258  44.887 44.871  1.00 66.61  ? 525 ASP M N     1 
ATOM 4329 C CA    . ASP D 3 148 ? 12.998  44.653 44.169  1.00 69.21  ? 525 ASP M CA    1 
ATOM 4330 C C     . ASP D 3 148 ? 12.212  43.476 44.743  1.00 70.34  ? 525 ASP M C     1 
ATOM 4331 O O     . ASP D 3 148 ? 10.989  43.528 44.846  1.00 70.37  ? 525 ASP M O     1 
ATOM 4332 C CB    . ASP D 3 148 ? 13.236  44.397 42.670  1.00 70.52  ? 525 ASP M CB    1 
ATOM 4333 C CG    . ASP D 3 148 ? 13.592  45.662 41.890  1.00 71.63  ? 525 ASP M CG    1 
ATOM 4334 O OD1   . ASP D 3 148 ? 13.156  46.762 42.289  1.00 72.03  ? 525 ASP M OD1   1 
ATOM 4335 O OD2   . ASP D 3 148 ? 14.291  45.550 40.855  1.00 72.28  ? 525 ASP M OD2   1 
ATOM 4336 N N     . ILE D 3 149 ? 12.914  42.418 45.119  1.00 72.37  ? 526 ILE M N     1 
ATOM 4337 C CA    . ILE D 3 149 ? 12.264  41.228 45.648  1.00 75.26  ? 526 ILE M CA    1 
ATOM 4338 C C     . ILE D 3 149 ? 11.893  41.302 47.126  1.00 78.22  ? 526 ILE M C     1 
ATOM 4339 O O     . ILE D 3 149 ? 10.752  41.042 47.493  1.00 78.73  ? 526 ILE M O     1 
ATOM 4340 C CB    . ILE D 3 149 ? 13.141  39.979 45.414  1.00 74.13  ? 526 ILE M CB    1 
ATOM 4341 C CG1   . ILE D 3 149 ? 13.169  39.637 43.925  1.00 73.59  ? 526 ILE M CG1   1 
ATOM 4342 C CG2   . ILE D 3 149 ? 12.600  38.801 46.197  1.00 73.89  ? 526 ILE M CG2   1 
ATOM 4343 C CD1   . ILE D 3 149 ? 13.739  40.723 43.059  1.00 73.04  ? 526 ILE M CD1   1 
ATOM 4344 N N     . GLU D 3 150 ? 12.854  41.641 47.975  1.00 81.83  ? 527 GLU M N     1 
ATOM 4345 C CA    . GLU D 3 150 ? 12.597  41.736 49.406  1.00 85.34  ? 527 GLU M CA    1 
ATOM 4346 C C     . GLU D 3 150 ? 11.354  42.578 49.667  1.00 89.58  ? 527 GLU M C     1 
ATOM 4347 O O     . GLU D 3 150 ? 10.433  42.148 50.369  1.00 90.38  ? 527 GLU M O     1 
ATOM 4348 C CB    . GLU D 3 150 ? 13.806  42.350 50.109  1.00 82.87  ? 527 GLU M CB    1 
ATOM 4349 C CG    . GLU D 3 150 ? 15.048  41.489 50.008  1.00 82.02  ? 527 GLU M CG    1 
ATOM 4350 C CD    . GLU D 3 150 ? 16.320  42.231 50.369  1.00 82.25  ? 527 GLU M CD    1 
ATOM 4351 O OE1   . GLU D 3 150 ? 17.384  41.578 50.445  1.00 81.99  ? 527 GLU M OE1   1 
ATOM 4352 O OE2   . GLU D 3 150 ? 16.264  43.465 50.567  1.00 83.16  ? 527 GLU M OE2   1 
ATOM 4353 N N     . LEU D 3 151 ? 11.333  43.775 49.085  1.00 94.70  ? 528 LEU M N     1 
ATOM 4354 C CA    . LEU D 3 151 ? 10.217  44.708 49.229  1.00 99.49  ? 528 LEU M CA    1 
ATOM 4355 C C     . LEU D 3 151 ? 8.870   44.070 48.882  1.00 102.65 ? 528 LEU M C     1 
ATOM 4356 O O     . LEU D 3 151 ? 7.814   44.611 49.215  1.00 103.02 ? 528 LEU M O     1 
ATOM 4357 C CB    . LEU D 3 151 ? 10.472  45.949 48.360  1.00 99.81  ? 528 LEU M CB    1 
ATOM 4358 C CG    . LEU D 3 151 ? 9.318   46.881 47.986  1.00 100.22 ? 528 LEU M CG    1 
ATOM 4359 C CD1   . LEU D 3 151 ? 9.824   48.307 47.876  1.00 100.37 ? 528 LEU M CD1   1 
ATOM 4360 C CD2   . LEU D 3 151 ? 8.697   46.418 46.672  1.00 100.26 ? 528 LEU M CD2   1 
ATOM 4361 N N     . ARG D 3 152 ? 8.914   42.915 48.223  1.00 106.37 ? 529 ARG M N     1 
ATOM 4362 C CA    . ARG D 3 152 ? 7.703   42.193 47.844  1.00 109.61 ? 529 ARG M CA    1 
ATOM 4363 C C     . ARG D 3 152 ? 6.953   41.729 49.099  1.00 112.72 ? 529 ARG M C     1 
ATOM 4364 O O     . ARG D 3 152 ? 7.548   41.140 50.015  1.00 113.33 ? 529 ARG M O     1 
ATOM 4365 C CB    . ARG D 3 152 ? 8.073   40.985 46.986  1.00 108.17 ? 529 ARG M CB    1 
ATOM 4366 C CG    . ARG D 3 152 ? 6.905   40.161 46.527  1.00 107.41 ? 529 ARG M CG    1 
ATOM 4367 C CD    . ARG D 3 152 ? 7.363   38.768 46.125  1.00 107.39 ? 529 ARG M CD    1 
ATOM 4368 N NE    . ARG D 3 152 ? 8.270   38.772 44.979  1.00 105.50 ? 529 ARG M NE    1 
ATOM 4369 C CZ    . ARG D 3 152 ? 8.815   37.676 44.452  1.00 104.68 ? 529 ARG M CZ    1 
ATOM 4370 N NH1   . ARG D 3 152 ? 8.547   36.482 44.971  1.00 103.47 ? 529 ARG M NH1   1 
ATOM 4371 N NH2   . ARG D 3 152 ? 9.619   37.772 43.398  1.00 103.38 ? 529 ARG M NH2   1 
ATOM 4372 N N     . LYS D 3 153 ? 5.650   42.005 49.142  1.00 115.16 ? 530 LYS M N     1 
ATOM 4373 C CA    . LYS D 3 153 ? 4.825   41.615 50.282  1.00 117.09 ? 530 LYS M CA    1 
ATOM 4374 C C     . LYS D 3 153 ? 4.605   40.111 50.326  1.00 117.93 ? 530 LYS M C     1 
ATOM 4375 O O     . LYS D 3 153 ? 3.787   39.565 49.586  1.00 118.02 ? 530 LYS M O     1 
ATOM 4376 C CB    . LYS D 3 153 ? 3.471   42.331 50.243  1.00 117.19 ? 530 LYS M CB    1 
ATOM 4377 C CG    . LYS D 3 153 ? 3.546   43.803 50.611  1.00 117.78 ? 530 LYS M CG    1 
ATOM 4378 C CD    . LYS D 3 153 ? 2.165   44.431 50.694  1.00 117.50 ? 530 LYS M CD    1 
ATOM 4379 C CE    . LYS D 3 153 ? 2.259   45.908 51.048  1.00 117.01 ? 530 LYS M CE    1 
ATOM 4380 N NZ    . LYS D 3 153 ? 0.922   46.560 51.076  1.00 116.95 ? 530 LYS M NZ    1 
ATOM 4381 N N     . GLY D 3 154 ? 5.344   39.447 51.206  1.00 118.90 ? 531 GLY M N     1 
ATOM 4382 C CA    . GLY D 3 154 ? 5.222   38.010 51.344  1.00 119.71 ? 531 GLY M CA    1 
ATOM 4383 C C     . GLY D 3 154 ? 6.581   37.388 51.577  1.00 120.38 ? 531 GLY M C     1 
ATOM 4384 O O     . GLY D 3 154 ? 6.794   36.674 52.558  1.00 120.99 ? 531 GLY M O     1 
ATOM 4385 N N     . GLU D 3 155 ? 7.511   37.673 50.674  1.00 120.30 ? 532 GLU M N     1 
ATOM 4386 C CA    . GLU D 3 155 ? 8.854   37.129 50.777  1.00 119.52 ? 532 GLU M CA    1 
ATOM 4387 C C     . GLU D 3 155 ? 9.516   37.498 52.092  1.00 119.54 ? 532 GLU M C     1 
ATOM 4388 O O     . GLU D 3 155 ? 9.495   38.655 52.511  1.00 119.66 ? 532 GLU M O     1 
ATOM 4389 C CB    . GLU D 3 155 ? 9.710   37.610 49.602  1.00 118.00 ? 532 GLU M CB    1 
ATOM 4390 C CG    . GLU D 3 155 ? 10.090  36.500 48.626  1.00 114.79 ? 532 GLU M CG    1 
ATOM 4391 C CD    . GLU D 3 155 ? 11.133  35.553 49.193  1.00 113.00 ? 532 GLU M CD    1 
ATOM 4392 O OE1   . GLU D 3 155 ? 11.440  34.541 48.533  1.00 112.48 ? 532 GLU M OE1   1 
ATOM 4393 O OE2   . GLU D 3 155 ? 11.654  35.821 50.294  1.00 111.56 ? 532 GLU M OE2   1 
ATOM 4394 N N     . THR D 3 156 ? 10.094  36.491 52.736  1.00 119.74 ? 533 THR M N     1 
ATOM 4395 C CA    . THR D 3 156 ? 10.779  36.659 54.009  1.00 119.94 ? 533 THR M CA    1 
ATOM 4396 C C     . THR D 3 156 ? 12.235  36.202 53.893  1.00 118.37 ? 533 THR M C     1 
ATOM 4397 O O     . THR D 3 156 ? 12.919  36.014 54.904  1.00 118.75 ? 533 THR M O     1 
ATOM 4398 C CB    . THR D 3 156 ? 10.088  35.837 55.113  1.00 121.40 ? 533 THR M CB    1 
ATOM 4399 O OG1   . THR D 3 156 ? 9.981   34.471 54.694  1.00 122.91 ? 533 THR M OG1   1 
ATOM 4400 C CG2   . THR D 3 156 ? 8.701   36.382 55.389  1.00 122.70 ? 533 THR M CG2   1 
ATOM 4401 N N     . ASP D 3 157 ? 12.701  36.023 52.656  1.00 115.62 ? 534 ASP M N     1 
ATOM 4402 C CA    . ASP D 3 157 ? 14.075  35.590 52.395  1.00 111.56 ? 534 ASP M CA    1 
ATOM 4403 C C     . ASP D 3 157 ? 15.006  36.777 52.182  1.00 107.61 ? 534 ASP M C     1 
ATOM 4404 O O     . ASP D 3 157 ? 14.570  37.926 52.148  1.00 107.15 ? 534 ASP M O     1 
ATOM 4405 C CB    . ASP D 3 157 ? 14.132  34.689 51.159  1.00 113.09 ? 534 ASP M CB    1 
ATOM 4406 C CG    . ASP D 3 157 ? 13.383  33.390 51.349  1.00 114.63 ? 534 ASP M CG    1 
ATOM 4407 O OD1   . ASP D 3 157 ? 12.147  33.432 51.501  1.00 115.95 ? 534 ASP M OD1   1 
ATOM 4408 O OD2   . ASP D 3 157 ? 14.033  32.323 51.348  1.00 115.64 ? 534 ASP M OD2   1 
ATOM 4409 N N     . ILE D 3 158 ? 16.295  36.491 52.039  1.00 102.47 ? 535 ILE M N     1 
ATOM 4410 C CA    . ILE D 3 158 ? 17.278  37.540 51.822  1.00 96.51  ? 535 ILE M CA    1 
ATOM 4411 C C     . ILE D 3 158 ? 18.161  37.206 50.621  1.00 92.79  ? 535 ILE M C     1 
ATOM 4412 O O     . ILE D 3 158 ? 18.674  36.091 50.501  1.00 91.82  ? 535 ILE M O     1 
ATOM 4413 C CB    . ILE D 3 158 ? 18.170  37.726 53.063  1.00 96.27  ? 535 ILE M CB    1 
ATOM 4414 C CG1   . ILE D 3 158 ? 17.305  37.718 54.319  1.00 96.32  ? 535 ILE M CG1   1 
ATOM 4415 C CG2   . ILE D 3 158 ? 18.923  39.052 52.980  1.00 95.00  ? 535 ILE M CG2   1 
ATOM 4416 C CD1   . ILE D 3 158 ? 18.101  37.791 55.609  1.00 97.54  ? 535 ILE M CD1   1 
ATOM 4417 N N     . GLY D 3 159 ? 18.321  38.179 49.730  1.00 88.43  ? 536 GLY M N     1 
ATOM 4418 C CA    . GLY D 3 159 ? 19.155  37.988 48.561  1.00 83.90  ? 536 GLY M CA    1 
ATOM 4419 C C     . GLY D 3 159 ? 20.613  38.134 48.941  1.00 80.63  ? 536 GLY M C     1 
ATOM 4420 O O     . GLY D 3 159 ? 21.460  37.370 48.480  1.00 79.65  ? 536 GLY M O     1 
ATOM 4421 N N     . ARG D 3 160 ? 20.896  39.126 49.784  1.00 78.27  ? 537 ARG M N     1 
ATOM 4422 C CA    . ARG D 3 160 ? 22.249  39.395 50.267  1.00 76.00  ? 537 ARG M CA    1 
ATOM 4423 C C     . ARG D 3 160 ? 23.007  38.083 50.482  1.00 73.80  ? 537 ARG M C     1 
ATOM 4424 O O     . ARG D 3 160 ? 22.464  37.128 51.031  1.00 75.03  ? 537 ARG M O     1 
ATOM 4425 C CB    . ARG D 3 160 ? 22.169  40.185 51.578  1.00 77.14  ? 537 ARG M CB    1 
ATOM 4426 C CG    . ARG D 3 160 ? 23.457  40.247 52.383  1.00 79.74  ? 537 ARG M CG    1 
ATOM 4427 C CD    . ARG D 3 160 ? 24.412  41.315 51.897  1.00 81.82  ? 537 ARG M CD    1 
ATOM 4428 N NE    . ARG D 3 160 ? 25.601  41.367 52.743  1.00 84.92  ? 537 ARG M NE    1 
ATOM 4429 C CZ    . ARG D 3 160 ? 26.556  42.285 52.643  1.00 87.49  ? 537 ARG M CZ    1 
ATOM 4430 N NH1   . ARG D 3 160 ? 26.465  43.243 51.728  1.00 88.94  ? 537 ARG M NH1   1 
ATOM 4431 N NH2   . ARG D 3 160 ? 27.607  42.243 53.456  1.00 89.12  ? 537 ARG M NH2   1 
ATOM 4432 N N     . LYS D 3 161 ? 24.257  38.044 50.036  1.00 69.99  ? 538 LYS M N     1 
ATOM 4433 C CA    . LYS D 3 161 ? 25.109  36.864 50.158  1.00 67.17  ? 538 LYS M CA    1 
ATOM 4434 C C     . LYS D 3 161 ? 24.530  35.514 49.720  1.00 65.02  ? 538 LYS M C     1 
ATOM 4435 O O     . LYS D 3 161 ? 25.184  34.482 49.862  1.00 64.89  ? 538 LYS M O     1 
ATOM 4436 C CB    . LYS D 3 161 ? 25.674  36.754 51.581  1.00 67.69  ? 538 LYS M CB    1 
ATOM 4437 C CG    . LYS D 3 161 ? 26.850  37.694 51.829  1.00 69.72  ? 538 LYS M CG    1 
ATOM 4438 C CD    . LYS D 3 161 ? 27.909  37.097 52.756  1.00 72.30  ? 538 LYS M CD    1 
ATOM 4439 C CE    . LYS D 3 161 ? 27.523  37.187 54.231  1.00 73.24  ? 538 LYS M CE    1 
ATOM 4440 N NZ    . LYS D 3 161 ? 27.539  38.597 54.744  1.00 73.77  ? 538 LYS M NZ    1 
ATOM 4441 N N     . ASN D 3 162 ? 23.316  35.502 49.186  1.00 63.07  ? 539 ASN M N     1 
ATOM 4442 C CA    . ASN D 3 162 ? 22.742  34.249 48.709  1.00 61.63  ? 539 ASN M CA    1 
ATOM 4443 C C     . ASN D 3 162 ? 22.856  34.249 47.184  1.00 58.47  ? 539 ASN M C     1 
ATOM 4444 O O     . ASN D 3 162 ? 21.952  34.703 46.477  1.00 56.52  ? 539 ASN M O     1 
ATOM 4445 C CB    . ASN D 3 162 ? 21.286  34.124 49.138  1.00 66.02  ? 539 ASN M CB    1 
ATOM 4446 C CG    . ASN D 3 162 ? 20.579  32.968 48.455  1.00 71.64  ? 539 ASN M CG    1 
ATOM 4447 O OD1   . ASN D 3 162 ? 21.217  32.098 47.836  1.00 73.79  ? 539 ASN M OD1   1 
ATOM 4448 N ND2   . ASN D 3 162 ? 19.247  32.943 48.567  1.00 74.82  ? 539 ASN M ND2   1 
ATOM 4449 N N     . THR D 3 163 ? 23.982  33.727 46.696  1.00 54.48  ? 540 THR M N     1 
ATOM 4450 C CA    . THR D 3 163 ? 24.286  33.697 45.275  1.00 49.59  ? 540 THR M CA    1 
ATOM 4451 C C     . THR D 3 163 ? 24.626  32.311 44.705  1.00 49.19  ? 540 THR M C     1 
ATOM 4452 O O     . THR D 3 163 ? 25.485  32.183 43.829  1.00 49.85  ? 540 THR M O     1 
ATOM 4453 C CB    . THR D 3 163 ? 25.457  34.650 44.978  1.00 46.87  ? 540 THR M CB    1 
ATOM 4454 O OG1   . THR D 3 163 ? 26.632  34.185 45.643  1.00 44.80  ? 540 THR M OG1   1 
ATOM 4455 C CG2   . THR D 3 163 ? 25.158  36.023 45.499  1.00 46.44  ? 540 THR M CG2   1 
ATOM 4456 N N     . ARG D 3 164 ? 23.967  31.271 45.199  1.00 46.98  ? 541 ARG M N     1 
ATOM 4457 C CA    . ARG D 3 164 ? 24.204  29.924 44.689  1.00 44.37  ? 541 ARG M CA    1 
ATOM 4458 C C     . ARG D 3 164 ? 22.871  29.390 44.204  1.00 42.77  ? 541 ARG M C     1 
ATOM 4459 O O     . ARG D 3 164 ? 21.823  29.779 44.723  1.00 44.19  ? 541 ARG M O     1 
ATOM 4460 C CB    . ARG D 3 164 ? 24.765  29.028 45.782  1.00 44.35  ? 541 ARG M CB    1 
ATOM 4461 C CG    . ARG D 3 164 ? 26.198  29.342 46.149  1.00 45.57  ? 541 ARG M CG    1 
ATOM 4462 C CD    . ARG D 3 164 ? 26.472  28.976 47.602  1.00 47.90  ? 541 ARG M CD    1 
ATOM 4463 N NE    . ARG D 3 164 ? 25.936  27.663 47.963  1.00 47.95  ? 541 ARG M NE    1 
ATOM 4464 C CZ    . ARG D 3 164 ? 26.355  26.500 47.463  1.00 48.24  ? 541 ARG M CZ    1 
ATOM 4465 N NH1   . ARG D 3 164 ? 27.340  26.461 46.560  1.00 47.53  ? 541 ARG M NH1   1 
ATOM 4466 N NH2   . ARG D 3 164 ? 25.779  25.371 47.867  1.00 46.34  ? 541 ARG M NH2   1 
ATOM 4467 N N     . VAL D 3 165 ? 22.897  28.511 43.211  1.00 39.59  ? 542 VAL M N     1 
ATOM 4468 C CA    . VAL D 3 165 ? 21.656  27.974 42.677  1.00 37.39  ? 542 VAL M CA    1 
ATOM 4469 C C     . VAL D 3 165 ? 21.825  26.582 42.140  1.00 36.71  ? 542 VAL M C     1 
ATOM 4470 O O     . VAL D 3 165 ? 22.897  26.002 42.201  1.00 35.42  ? 542 VAL M O     1 
ATOM 4471 C CB    . VAL D 3 165 ? 21.142  28.819 41.515  1.00 36.48  ? 542 VAL M CB    1 
ATOM 4472 C CG1   . VAL D 3 165 ? 20.738  30.194 41.992  1.00 36.97  ? 542 VAL M CG1   1 
ATOM 4473 C CG2   . VAL D 3 165 ? 22.223  28.928 40.469  1.00 34.90  ? 542 VAL M CG2   1 
ATOM 4474 N N     . ARG D 3 166 ? 20.734  26.056 41.611  1.00 37.69  ? 543 ARG M N     1 
ATOM 4475 C CA    . ARG D 3 166 ? 20.735  24.751 40.992  1.00 42.00  ? 543 ARG M CA    1 
ATOM 4476 C C     . ARG D 3 166 ? 19.748  24.760 39.844  1.00 40.79  ? 543 ARG M C     1 
ATOM 4477 O O     . ARG D 3 166 ? 18.650  25.295 39.964  1.00 40.30  ? 543 ARG M O     1 
ATOM 4478 C CB    . ARG D 3 166 ? 20.365  23.656 41.991  1.00 47.13  ? 543 ARG M CB    1 
ATOM 4479 C CG    . ARG D 3 166 ? 21.571  23.103 42.727  1.00 56.69  ? 543 ARG M CG    1 
ATOM 4480 C CD    . ARG D 3 166 ? 21.199  21.979 43.675  1.00 64.61  ? 543 ARG M CD    1 
ATOM 4481 N NE    . ARG D 3 166 ? 20.315  22.449 44.733  1.00 73.92  ? 543 ARG M NE    1 
ATOM 4482 C CZ    . ARG D 3 166 ? 19.744  21.661 45.635  1.00 79.30  ? 543 ARG M CZ    1 
ATOM 4483 N NH1   . ARG D 3 166 ? 19.965  20.352 45.609  1.00 83.13  ? 543 ARG M NH1   1 
ATOM 4484 N NH2   . ARG D 3 166 ? 18.945  22.180 46.561  1.00 82.90  ? 543 ARG M NH2   1 
ATOM 4485 N N     . LEU D 3 167 ? 20.165  24.210 38.711  1.00 39.27  ? 544 LEU M N     1 
ATOM 4486 C CA    . LEU D 3 167 ? 19.289  24.127 37.560  1.00 37.54  ? 544 LEU M CA    1 
ATOM 4487 C C     . LEU D 3 167 ? 18.321  23.039 37.937  1.00 38.21  ? 544 LEU M C     1 
ATOM 4488 O O     . LEU D 3 167 ? 18.747  21.931 38.249  1.00 39.73  ? 544 LEU M O     1 
ATOM 4489 C CB    . LEU D 3 167 ? 20.040  23.665 36.326  1.00 35.10  ? 544 LEU M CB    1 
ATOM 4490 C CG    . LEU D 3 167 ? 20.961  24.630 35.626  1.00 33.12  ? 544 LEU M CG    1 
ATOM 4491 C CD1   . LEU D 3 167 ? 21.433  23.967 34.366  1.00 34.90  ? 544 LEU M CD1   1 
ATOM 4492 C CD2   . LEU D 3 167 ? 20.226  25.906 35.311  1.00 34.36  ? 544 LEU M CD2   1 
ATOM 4493 N N     . VAL D 3 168 ? 17.029  23.330 37.921  1.00 37.40  ? 545 VAL M N     1 
ATOM 4494 C CA    . VAL D 3 168 ? 16.081  22.298 38.271  1.00 36.86  ? 545 VAL M CA    1 
ATOM 4495 C C     . VAL D 3 168 ? 15.358  21.842 37.020  1.00 38.05  ? 545 VAL M C     1 
ATOM 4496 O O     . VAL D 3 168 ? 14.797  22.650 36.277  1.00 37.45  ? 545 VAL M O     1 
ATOM 4497 C CB    . VAL D 3 168 ? 15.049  22.779 39.309  1.00 35.60  ? 545 VAL M CB    1 
ATOM 4498 C CG1   . VAL D 3 168 ? 14.411  21.569 39.983  1.00 34.51  ? 545 VAL M CG1   1 
ATOM 4499 C CG2   . VAL D 3 168 ? 15.708  23.674 40.333  1.00 33.93  ? 545 VAL M CG2   1 
ATOM 4500 N N     . PHE D 3 169 ? 15.386  20.537 36.792  1.00 38.65  ? 546 PHE M N     1 
ATOM 4501 C CA    . PHE D 3 169 ? 14.735  19.958 35.639  1.00 41.37  ? 546 PHE M CA    1 
ATOM 4502 C C     . PHE D 3 169 ? 13.641  19.032 36.074  1.00 43.38  ? 546 PHE M C     1 
ATOM 4503 O O     . PHE D 3 169 ? 13.834  18.244 36.987  1.00 45.00  ? 546 PHE M O     1 
ATOM 4504 C CB    . PHE D 3 169 ? 15.726  19.127 34.836  1.00 42.28  ? 546 PHE M CB    1 
ATOM 4505 C CG    . PHE D 3 169 ? 16.906  19.886 34.383  1.00 41.24  ? 546 PHE M CG    1 
ATOM 4506 C CD1   . PHE D 3 169 ? 16.804  20.773 33.326  1.00 40.71  ? 546 PHE M CD1   1 
ATOM 4507 C CD2   . PHE D 3 169 ? 18.110  19.761 35.051  1.00 40.77  ? 546 PHE M CD2   1 
ATOM 4508 C CE1   . PHE D 3 169 ? 17.884  21.524 32.945  1.00 41.83  ? 546 PHE M CE1   1 
ATOM 4509 C CE2   . PHE D 3 169 ? 19.203  20.509 34.677  1.00 40.39  ? 546 PHE M CE2   1 
ATOM 4510 C CZ    . PHE D 3 169 ? 19.095  21.396 33.623  1.00 41.32  ? 546 PHE M CZ    1 
ATOM 4511 N N     . ARG D 3 170 ? 12.490  19.106 35.430  1.00 45.68  ? 547 ARG M N     1 
ATOM 4512 C CA    . ARG D 3 170 ? 11.449  18.164 35.770  1.00 48.07  ? 547 ARG M CA    1 
ATOM 4513 C C     . ARG D 3 170 ? 10.552  17.883 34.589  1.00 48.53  ? 547 ARG M C     1 
ATOM 4514 O O     . ARG D 3 170 ? 10.310  18.740 33.739  1.00 45.81  ? 547 ARG M O     1 
ATOM 4515 C CB    . ARG D 3 170 ? 10.641  18.610 36.997  1.00 49.66  ? 547 ARG M CB    1 
ATOM 4516 C CG    . ARG D 3 170 ? 9.801   19.832 36.820  1.00 51.10  ? 547 ARG M CG    1 
ATOM 4517 C CD    . ARG D 3 170 ? 8.657   19.861 37.840  1.00 52.01  ? 547 ARG M CD    1 
ATOM 4518 N NE    . ARG D 3 170 ? 9.082   19.992 39.232  1.00 50.03  ? 547 ARG M NE    1 
ATOM 4519 C CZ    . ARG D 3 170 ? 8.288   20.467 40.186  1.00 49.78  ? 547 ARG M CZ    1 
ATOM 4520 N NH1   . ARG D 3 170 ? 7.056   20.843 39.878  1.00 49.85  ? 547 ARG M NH1   1 
ATOM 4521 N NH2   . ARG D 3 170 ? 8.715   20.581 41.433  1.00 47.81  ? 547 ARG M NH2   1 
ATOM 4522 N N     . VAL D 3 171 ? 10.102  16.638 34.547  1.00 50.80  ? 548 VAL M N     1 
ATOM 4523 C CA    . VAL D 3 171 ? 9.241   16.133 33.502  1.00 54.61  ? 548 VAL M CA    1 
ATOM 4524 C C     . VAL D 3 171 ? 8.020   15.474 34.133  1.00 56.01  ? 548 VAL M C     1 
ATOM 4525 O O     . VAL D 3 171 ? 8.123   14.847 35.187  1.00 56.15  ? 548 VAL M O     1 
ATOM 4526 C CB    . VAL D 3 171 ? 9.973   15.065 32.674  1.00 55.86  ? 548 VAL M CB    1 
ATOM 4527 C CG1   . VAL D 3 171 ? 10.416  13.929 33.583  1.00 57.02  ? 548 VAL M CG1   1 
ATOM 4528 C CG2   . VAL D 3 171 ? 9.061   14.525 31.585  1.00 58.54  ? 548 VAL M CG2   1 
ATOM 4529 N N     . HIS D 3 172 ? 6.868   15.623 33.487  1.00 57.35  ? 549 HIS M N     1 
ATOM 4530 C CA    . HIS D 3 172 ? 5.638   15.011 33.962  1.00 57.85  ? 549 HIS M CA    1 
ATOM 4531 C C     . HIS D 3 172 ? 5.279   13.885 32.994  1.00 59.99  ? 549 HIS M C     1 
ATOM 4532 O O     . HIS D 3 172 ? 5.047   14.125 31.811  1.00 58.58  ? 549 HIS M O     1 
ATOM 4533 C CB    . HIS D 3 172 ? 4.530   16.039 33.994  1.00 55.44  ? 549 HIS M CB    1 
ATOM 4534 C CG    . HIS D 3 172 ? 4.809   17.191 34.897  1.00 52.85  ? 549 HIS M CG    1 
ATOM 4535 N ND1   . HIS D 3 172 ? 4.855   17.064 36.266  1.00 53.62  ? 549 HIS M ND1   1 
ATOM 4536 C CD2   . HIS D 3 172 ? 5.041   18.496 34.630  1.00 53.75  ? 549 HIS M CD2   1 
ATOM 4537 C CE1   . HIS D 3 172 ? 5.100   18.244 36.807  1.00 54.91  ? 549 HIS M CE1   1 
ATOM 4538 N NE2   . HIS D 3 172 ? 5.217   19.131 35.835  1.00 55.32  ? 549 HIS M NE2   1 
ATOM 4539 N N     . ILE D 3 173 ? 5.247   12.657 33.503  1.00 63.77  ? 550 ILE M N     1 
ATOM 4540 C CA    . ILE D 3 173 ? 4.947   11.495 32.679  1.00 66.89  ? 550 ILE M CA    1 
ATOM 4541 C C     . ILE D 3 173 ? 3.512   11.048 32.821  1.00 68.82  ? 550 ILE M C     1 
ATOM 4542 O O     . ILE D 3 173 ? 3.102   10.540 33.867  1.00 68.03  ? 550 ILE M O     1 
ATOM 4543 C CB    . ILE D 3 173 ? 5.851   10.284 33.019  1.00 67.10  ? 550 ILE M CB    1 
ATOM 4544 C CG1   . ILE D 3 173 ? 7.315   10.727 33.095  1.00 68.49  ? 550 ILE M CG1   1 
ATOM 4545 C CG2   . ILE D 3 173 ? 5.698   9.210  31.939  1.00 66.77  ? 550 ILE M CG2   1 
ATOM 4546 C CD1   . ILE D 3 173 ? 8.301   9.614  33.388  1.00 68.50  ? 550 ILE M CD1   1 
ATOM 4547 N N     . PRO D 3 174 ? 2.727   11.235 31.755  1.00 71.40  ? 551 PRO M N     1 
ATOM 4548 C CA    . PRO D 3 174 ? 1.315   10.863 31.697  1.00 73.61  ? 551 PRO M CA    1 
ATOM 4549 C C     . PRO D 3 174 ? 1.175   9.363  31.494  1.00 76.44  ? 551 PRO M C     1 
ATOM 4550 O O     . PRO D 3 174 ? 1.771   8.786  30.579  1.00 75.76  ? 551 PRO M O     1 
ATOM 4551 C CB    . PRO D 3 174 ? 0.816   11.644 30.495  1.00 72.37  ? 551 PRO M CB    1 
ATOM 4552 C CG    . PRO D 3 174 ? 1.998   11.589 29.573  1.00 71.27  ? 551 PRO M CG    1 
ATOM 4553 C CD    . PRO D 3 174 ? 3.139   11.908 30.509  1.00 71.31  ? 551 PRO M CD    1 
ATOM 4554 N N     . GLU D 3 175 ? 0.397   8.729  32.359  1.00 80.04  ? 552 GLU M N     1 
ATOM 4555 C CA    . GLU D 3 175 ? 0.175   7.301  32.242  1.00 84.60  ? 552 GLU M CA    1 
ATOM 4556 C C     . GLU D 3 175 ? -1.197  7.013  31.645  1.00 88.76  ? 552 GLU M C     1 
ATOM 4557 O O     . GLU D 3 175 ? -2.172  7.713  31.929  1.00 89.15  ? 552 GLU M O     1 
ATOM 4558 C CB    . GLU D 3 175 ? 0.316   6.634  33.605  1.00 82.41  ? 552 GLU M CB    1 
ATOM 4559 C CG    . GLU D 3 175 ? 1.681   6.033  33.806  1.00 81.10  ? 552 GLU M CG    1 
ATOM 4560 C CD    . GLU D 3 175 ? 1.915   5.603  35.229  1.00 80.67  ? 552 GLU M CD    1 
ATOM 4561 O OE1   . GLU D 3 175 ? 2.960   4.962  35.480  1.00 80.15  ? 552 GLU M OE1   1 
ATOM 4562 O OE2   . GLU D 3 175 ? 1.060   5.912  36.091  1.00 79.27  ? 552 GLU M OE2   1 
ATOM 4563 N N     . SER D 3 176 ? -1.258  5.987  30.802  1.00 93.18  ? 553 SER M N     1 
ATOM 4564 C CA    . SER D 3 176 ? -2.503  5.589  30.158  1.00 96.78  ? 553 SER M CA    1 
ATOM 4565 C C     . SER D 3 176 ? -3.558  5.237  31.207  1.00 98.05  ? 553 SER M C     1 
ATOM 4566 O O     . SER D 3 176 ? -4.655  4.792  30.866  1.00 99.01  ? 553 SER M O     1 
ATOM 4567 C CB    . SER D 3 176 ? -2.251  4.380  29.255  1.00 98.52  ? 553 SER M CB    1 
ATOM 4568 O OG    . SER D 3 176 ? -1.655  3.319  29.988  1.00 101.50 ? 553 SER M OG    1 
ATOM 4569 N N     . SER D 3 177 ? -3.221  5.446  32.478  1.00 98.47  ? 554 SER M N     1 
ATOM 4570 C CA    . SER D 3 177 ? -4.119  5.145  33.589  1.00 98.18  ? 554 SER M CA    1 
ATOM 4571 C C     . SER D 3 177 ? -4.634  6.409  34.282  1.00 97.38  ? 554 SER M C     1 
ATOM 4572 O O     . SER D 3 177 ? -5.038  6.367  35.448  1.00 96.88  ? 554 SER M O     1 
ATOM 4573 C CB    . SER D 3 177 ? -3.385  4.267  34.597  1.00 98.75  ? 554 SER M CB    1 
ATOM 4574 O OG    . SER D 3 177 ? -2.622  3.286  33.916  1.00 98.83  ? 554 SER M OG    1 
ATOM 4575 N N     . GLY D 3 178 ? -4.613  7.525  33.554  1.00 96.46  ? 555 GLY M N     1 
ATOM 4576 C CA    . GLY D 3 178 ? -5.073  8.798  34.088  1.00 94.20  ? 555 GLY M CA    1 
ATOM 4577 C C     . GLY D 3 178 ? -4.090  9.409  35.068  1.00 92.62  ? 555 GLY M C     1 
ATOM 4578 O O     . GLY D 3 178 ? -4.118  10.614 35.329  1.00 91.18  ? 555 GLY M O     1 
ATOM 4579 N N     . ARG D 3 179 ? -3.214  8.562  35.602  1.00 91.70  ? 556 ARG M N     1 
ATOM 4580 C CA    . ARG D 3 179 ? -2.203  8.963  36.575  1.00 89.93  ? 556 ARG M CA    1 
ATOM 4581 C C     . ARG D 3 179 ? -1.055  9.740  35.944  1.00 86.64  ? 556 ARG M C     1 
ATOM 4582 O O     . ARG D 3 179 ? -0.842  9.697  34.730  1.00 86.24  ? 556 ARG M O     1 
ATOM 4583 C CB    . ARG D 3 179 ? -1.638  7.727  37.274  1.00 93.17  ? 556 ARG M CB    1 
ATOM 4584 C CG    . ARG D 3 179 ? -1.698  7.783  38.782  1.00 98.02  ? 556 ARG M CG    1 
ATOM 4585 C CD    . ARG D 3 179 ? -0.993  6.585  39.393  1.00 103.51 ? 556 ARG M CD    1 
ATOM 4586 N NE    . ARG D 3 179 ? 0.458   6.647  39.224  1.00 108.70 ? 556 ARG M NE    1 
ATOM 4587 C CZ    . ARG D 3 179 ? 1.233   7.598  39.741  1.00 111.52 ? 556 ARG M CZ    1 
ATOM 4588 N NH1   . ARG D 3 179 ? 0.700   8.578  40.463  1.00 113.48 ? 556 ARG M NH1   1 
ATOM 4589 N NH2   . ARG D 3 179 ? 2.545   7.566  39.549  1.00 112.40 ? 556 ARG M NH2   1 
ATOM 4590 N N     . ILE D 3 180 ? -0.306  10.444 36.783  1.00 82.24  ? 557 ILE M N     1 
ATOM 4591 C CA    . ILE D 3 180 ? 0.822   11.219 36.300  1.00 77.52  ? 557 ILE M CA    1 
ATOM 4592 C C     . ILE D 3 180 ? 2.023   11.130 37.235  1.00 75.66  ? 557 ILE M C     1 
ATOM 4593 O O     . ILE D 3 180 ? 1.957   11.519 38.404  1.00 74.95  ? 557 ILE M O     1 
ATOM 4594 C CB    . ILE D 3 180 ? 0.419   12.677 36.105  1.00 75.15  ? 557 ILE M CB    1 
ATOM 4595 C CG1   . ILE D 3 180 ? -0.610  12.759 34.992  1.00 73.33  ? 557 ILE M CG1   1 
ATOM 4596 C CG2   . ILE D 3 180 ? 1.616   13.511 35.743  1.00 75.30  ? 557 ILE M CG2   1 
ATOM 4597 C CD1   . ILE D 3 180 ? -1.051  14.151 34.713  1.00 75.06  ? 557 ILE M CD1   1 
ATOM 4598 N N     . VAL D 3 181 ? 3.119   10.599 36.704  1.00 73.21  ? 558 VAL M N     1 
ATOM 4599 C CA    . VAL D 3 181 ? 4.353   10.446 37.461  1.00 71.19  ? 558 VAL M CA    1 
ATOM 4600 C C     . VAL D 3 181 ? 5.232   11.658 37.208  1.00 68.91  ? 558 VAL M C     1 
ATOM 4601 O O     . VAL D 3 181 ? 5.705   11.858 36.096  1.00 69.12  ? 558 VAL M O     1 
ATOM 4602 C CB    . VAL D 3 181 ? 5.114   9.192  37.016  1.00 71.88  ? 558 VAL M CB    1 
ATOM 4603 C CG1   . VAL D 3 181 ? 6.336   8.986  37.898  1.00 71.82  ? 558 VAL M CG1   1 
ATOM 4604 C CG2   . VAL D 3 181 ? 4.189   7.982  37.067  1.00 72.89  ? 558 VAL M CG2   1 
ATOM 4605 N N     . SER D 3 182 ? 5.457   12.458 38.244  1.00 66.23  ? 559 SER M N     1 
ATOM 4606 C CA    . SER D 3 182 ? 6.262   13.665 38.114  1.00 63.61  ? 559 SER M CA    1 
ATOM 4607 C C     . SER D 3 182 ? 7.634   13.533 38.748  1.00 61.89  ? 559 SER M C     1 
ATOM 4608 O O     . SER D 3 182 ? 7.746   13.381 39.967  1.00 63.37  ? 559 SER M O     1 
ATOM 4609 C CB    . SER D 3 182 ? 5.534   14.839 38.756  1.00 63.71  ? 559 SER M CB    1 
ATOM 4610 O OG    . SER D 3 182 ? 4.213   14.939 38.258  1.00 64.45  ? 559 SER M OG    1 
ATOM 4611 N N     . LEU D 3 183 ? 8.674   13.609 37.921  1.00 58.17  ? 560 LEU M N     1 
ATOM 4612 C CA    . LEU D 3 183 ? 10.046  13.505 38.401  1.00 53.55  ? 560 LEU M CA    1 
ATOM 4613 C C     . LEU D 3 183 ? 10.722  14.856 38.366  1.00 51.88  ? 560 LEU M C     1 
ATOM 4614 O O     . LEU D 3 183 ? 10.408  15.694 37.519  1.00 52.01  ? 560 LEU M O     1 
ATOM 4615 C CB    . LEU D 3 183 ? 10.841  12.551 37.530  1.00 51.40  ? 560 LEU M CB    1 
ATOM 4616 C CG    . LEU D 3 183 ? 10.093  11.255 37.289  1.00 52.61  ? 560 LEU M CG    1 
ATOM 4617 C CD1   . LEU D 3 183 ? 10.895  10.363 36.364  1.00 53.37  ? 560 LEU M CD1   1 
ATOM 4618 C CD2   . LEU D 3 183 ? 9.825   10.580 38.621  1.00 52.39  ? 560 LEU M CD2   1 
ATOM 4619 N N     . GLN D 3 184 ? 11.646  15.062 39.299  1.00 49.62  ? 561 GLN M N     1 
ATOM 4620 C CA    . GLN D 3 184 ? 12.407  16.300 39.372  1.00 47.33  ? 561 GLN M CA    1 
ATOM 4621 C C     . GLN D 3 184 ? 13.893  16.015 39.604  1.00 44.38  ? 561 GLN M C     1 
ATOM 4622 O O     . GLN D 3 184 ? 14.258  15.018 40.227  1.00 45.61  ? 561 GLN M O     1 
ATOM 4623 C CB    . GLN D 3 184 ? 11.870  17.202 40.476  1.00 47.77  ? 561 GLN M CB    1 
ATOM 4624 C CG    . GLN D 3 184 ? 12.658  18.486 40.605  1.00 48.41  ? 561 GLN M CG    1 
ATOM 4625 C CD    . GLN D 3 184 ? 12.021  19.460 41.552  1.00 49.57  ? 561 GLN M CD    1 
ATOM 4626 O OE1   . GLN D 3 184 ? 11.140  20.229 41.166  1.00 51.12  ? 561 GLN M OE1   1 
ATOM 4627 N NE2   . GLN D 3 184 ? 12.448  19.427 42.811  1.00 49.10  ? 561 GLN M NE2   1 
ATOM 4628 N N     . THR D 3 185 ? 14.746  16.904 39.109  1.00 41.15  ? 562 THR M N     1 
ATOM 4629 C CA    . THR D 3 185 ? 16.182  16.735 39.232  1.00 38.68  ? 562 THR M CA    1 
ATOM 4630 C C     . THR D 3 185 ? 16.986  18.022 39.271  1.00 39.81  ? 562 THR M C     1 
ATOM 4631 O O     . THR D 3 185 ? 16.832  18.893 38.406  1.00 42.27  ? 562 THR M O     1 
ATOM 4632 C CB    . THR D 3 185 ? 16.703  15.949 38.070  1.00 36.33  ? 562 THR M CB    1 
ATOM 4633 O OG1   . THR D 3 185 ? 16.453  14.557 38.292  1.00 38.84  ? 562 THR M OG1   1 
ATOM 4634 C CG2   . THR D 3 185 ? 18.188  16.196 37.901  1.00 35.63  ? 562 THR M CG2   1 
ATOM 4635 N N     . ALA D 3 186 ? 17.888  18.119 40.241  1.00 40.22  ? 563 ALA M N     1 
ATOM 4636 C CA    . ALA D 3 186 ? 18.707  19.313 40.369  1.00 41.07  ? 563 ALA M CA    1 
ATOM 4637 C C     . ALA D 3 186 ? 20.147  19.095 39.943  1.00 40.94  ? 563 ALA M C     1 
ATOM 4638 O O     . ALA D 3 186 ? 20.671  17.975 39.957  1.00 41.25  ? 563 ALA M O     1 
ATOM 4639 C CB    . ALA D 3 186 ? 18.656  19.835 41.788  1.00 40.77  ? 563 ALA M CB    1 
ATOM 4640 N N     . SER D 3 187 ? 20.778  20.190 39.551  1.00 40.73  ? 564 SER M N     1 
ATOM 4641 C CA    . SER D 3 187 ? 22.157  20.160 39.107  1.00 41.21  ? 564 SER M CA    1 
ATOM 4642 C C     . SER D 3 187 ? 22.975  20.341 40.358  1.00 40.99  ? 564 SER M C     1 
ATOM 4643 O O     . SER D 3 187 ? 22.415  20.469 41.438  1.00 43.37  ? 564 SER M O     1 
ATOM 4644 C CB    . SER D 3 187 ? 22.408  21.338 38.180  1.00 40.72  ? 564 SER M CB    1 
ATOM 4645 O OG    . SER D 3 187 ? 22.055  22.538 38.844  1.00 37.69  ? 564 SER M OG    1 
ATOM 4646 N N     . ASN D 3 188 ? 24.293  20.339 40.227  1.00 39.37  ? 565 ASN M N     1 
ATOM 4647 C CA    . ASN D 3 188 ? 25.130  20.581 41.382  1.00 37.15  ? 565 ASN M CA    1 
ATOM 4648 C C     . ASN D 3 188 ? 25.032  22.075 41.615  1.00 36.49  ? 565 ASN M C     1 
ATOM 4649 O O     . ASN D 3 188 ? 24.614  22.828 40.743  1.00 35.37  ? 565 ASN M O     1 
ATOM 4650 C CB    . ASN D 3 188 ? 26.577  20.210 41.102  1.00 37.65  ? 565 ASN M CB    1 
ATOM 4651 C CG    . ASN D 3 188 ? 26.736  18.762 40.747  1.00 38.67  ? 565 ASN M CG    1 
ATOM 4652 O OD1   . ASN D 3 188 ? 26.054  17.907 41.298  1.00 40.69  ? 565 ASN M OD1   1 
ATOM 4653 N ND2   . ASN D 3 188 ? 27.649  18.468 39.831  1.00 40.65  ? 565 ASN M ND2   1 
ATOM 4654 N N     . PRO D 3 189 ? 25.403  22.530 42.803  1.00 36.55  ? 566 PRO M N     1 
ATOM 4655 C CA    . PRO D 3 189 ? 25.320  23.965 43.059  1.00 36.44  ? 566 PRO M CA    1 
ATOM 4656 C C     . PRO D 3 189 ? 26.131  24.783 42.047  1.00 34.94  ? 566 PRO M C     1 
ATOM 4657 O O     . PRO D 3 189 ? 27.206  24.365 41.626  1.00 35.86  ? 566 PRO M O     1 
ATOM 4658 C CB    . PRO D 3 189 ? 25.866  24.083 44.483  1.00 36.86  ? 566 PRO M CB    1 
ATOM 4659 C CG    . PRO D 3 189 ? 25.463  22.784 45.096  1.00 37.43  ? 566 PRO M CG    1 
ATOM 4660 C CD    . PRO D 3 189 ? 25.785  21.794 44.018  1.00 37.40  ? 566 PRO M CD    1 
ATOM 4661 N N     . ILE D 3 190 ? 25.609  25.948 41.674  1.00 32.17  ? 567 ILE M N     1 
ATOM 4662 C CA    . ILE D 3 190 ? 26.274  26.835 40.729  1.00 30.90  ? 567 ILE M CA    1 
ATOM 4663 C C     . ILE D 3 190 ? 26.428  28.228 41.346  1.00 31.57  ? 567 ILE M C     1 
ATOM 4664 O O     . ILE D 3 190 ? 25.434  28.873 41.673  1.00 32.80  ? 567 ILE M O     1 
ATOM 4665 C CB    . ILE D 3 190 ? 25.444  26.989 39.435  1.00 29.70  ? 567 ILE M CB    1 
ATOM 4666 C CG1   . ILE D 3 190 ? 25.091  25.614 38.874  1.00 26.48  ? 567 ILE M CG1   1 
ATOM 4667 C CG2   . ILE D 3 190 ? 26.210  27.830 38.417  1.00 28.99  ? 567 ILE M CG2   1 
ATOM 4668 C CD1   . ILE D 3 190 ? 24.287  25.674 37.616  1.00 21.84  ? 567 ILE M CD1   1 
ATOM 4669 N N     . GLU D 3 191 ? 27.666  28.691 41.495  1.00 31.62  ? 568 GLU M N     1 
ATOM 4670 C CA    . GLU D 3 191 ? 27.941  30.008 42.060  1.00 33.18  ? 568 GLU M CA    1 
ATOM 4671 C C     . GLU D 3 191 ? 27.668  31.051 40.993  1.00 33.07  ? 568 GLU M C     1 
ATOM 4672 O O     . GLU D 3 191 ? 28.205  30.942 39.907  1.00 34.55  ? 568 GLU M O     1 
ATOM 4673 C CB    . GLU D 3 191 ? 29.403  30.077 42.479  1.00 35.28  ? 568 GLU M CB    1 
ATOM 4674 C CG    . GLU D 3 191 ? 29.854  31.452 42.914  1.00 41.57  ? 568 GLU M CG    1 
ATOM 4675 C CD    . GLU D 3 191 ? 29.008  32.013 44.032  1.00 44.03  ? 568 GLU M CD    1 
ATOM 4676 O OE1   . GLU D 3 191 ? 28.913  31.351 45.087  1.00 46.67  ? 568 GLU M OE1   1 
ATOM 4677 O OE2   . GLU D 3 191 ? 28.442  33.112 43.853  1.00 45.00  ? 568 GLU M OE2   1 
ATOM 4678 N N     . CYS D 3 192 ? 26.872  32.073 41.288  1.00 32.35  ? 569 CYS M N     1 
ATOM 4679 C CA    . CYS D 3 192 ? 26.552  33.078 40.264  1.00 33.65  ? 569 CYS M CA    1 
ATOM 4680 C C     . CYS D 3 192 ? 27.031  34.502 40.484  1.00 34.35  ? 569 CYS M C     1 
ATOM 4681 O O     . CYS D 3 192 ? 26.381  35.460 40.062  1.00 32.99  ? 569 CYS M O     1 
ATOM 4682 C CB    . CYS D 3 192 ? 25.044  33.134 40.038  1.00 33.91  ? 569 CYS M CB    1 
ATOM 4683 S SG    . CYS D 3 192 ? 24.357  31.579 39.591  1.00 36.84  ? 569 CYS M SG    1 
ATOM 4684 N N     . SER D 3 193 ? 28.153  34.670 41.146  1.00 35.27  ? 570 SER M N     1 
ATOM 4685 C CA    . SER D 3 193 ? 28.615  36.020 41.344  1.00 36.80  ? 570 SER M CA    1 
ATOM 4686 C C     . SER D 3 193 ? 29.972  36.135 40.698  1.00 38.19  ? 570 SER M C     1 
ATOM 4687 O O     . SER D 3 193 ? 30.691  35.153 40.558  1.00 39.15  ? 570 SER M O     1 
ATOM 4688 C CB    . SER D 3 193 ? 28.676  36.358 42.840  1.00 34.63  ? 570 SER M CB    1 
ATOM 4689 O OG    . SER D 3 193 ? 29.523  35.467 43.536  1.00 35.23  ? 570 SER M OG    1 
ATOM 4690 N N     . GLN D 3 194 ? 30.303  37.339 40.272  1.00 39.99  ? 571 GLN M N     1 
ATOM 4691 C CA    . GLN D 3 194 ? 31.577  37.592 39.641  1.00 41.58  ? 571 GLN M CA    1 
ATOM 4692 C C     . GLN D 3 194 ? 32.683  37.201 40.604  1.00 44.45  ? 571 GLN M C     1 
ATOM 4693 O O     . GLN D 3 194 ? 32.516  37.273 41.812  1.00 43.43  ? 571 GLN M O     1 
ATOM 4694 C CB    . GLN D 3 194 ? 31.679  39.076 39.308  1.00 38.92  ? 571 GLN M CB    1 
ATOM 4695 C CG    . GLN D 3 194 ? 32.960  39.484 38.635  1.00 38.54  ? 571 GLN M CG    1 
ATOM 4696 C CD    . GLN D 3 194 ? 33.010  40.971 38.383  1.00 37.84  ? 571 GLN M CD    1 
ATOM 4697 O OE1   . GLN D 3 194 ? 32.088  41.693 38.766  1.00 36.67  ? 571 GLN M OE1   1 
ATOM 4698 N NE2   . GLN D 3 194 ? 34.088  41.445 37.745  1.00 36.10  ? 571 GLN M NE2   1 
ATOM 4699 N N     . ARG D 3 195 ? 33.808  36.758 40.070  1.00 49.87  ? 572 ARG M N     1 
ATOM 4700 C CA    . ARG D 3 195 ? 34.927  36.413 40.919  1.00 56.47  ? 572 ARG M CA    1 
ATOM 4701 C C     . ARG D 3 195 ? 36.188  37.108 40.424  1.00 57.51  ? 572 ARG M C     1 
ATOM 4702 O O     . ARG D 3 195 ? 36.642  36.891 39.303  1.00 58.00  ? 572 ARG M O     1 
ATOM 4703 C CB    . ARG D 3 195 ? 35.117  34.895 40.991  1.00 62.46  ? 572 ARG M CB    1 
ATOM 4704 C CG    . ARG D 3 195 ? 34.983  34.143 39.700  1.00 71.27  ? 572 ARG M CG    1 
ATOM 4705 C CD    . ARG D 3 195 ? 35.187  32.659 39.977  1.00 81.57  ? 572 ARG M CD    1 
ATOM 4706 N NE    . ARG D 3 195 ? 34.881  31.814 38.825  1.00 91.80  ? 572 ARG M NE    1 
ATOM 4707 C CZ    . ARG D 3 195 ? 35.464  31.922 37.633  1.00 96.03  ? 572 ARG M CZ    1 
ATOM 4708 N NH1   . ARG D 3 195 ? 36.396  32.847 37.428  1.00 100.04 ? 572 ARG M NH1   1 
ATOM 4709 N NH2   . ARG D 3 195 ? 35.111  31.109 36.645  1.00 97.82  ? 572 ARG M NH2   1 
ATOM 4710 N N     . SER D 3 196 ? 36.734  37.967 41.276  1.00 58.63  ? 573 SER M N     1 
ATOM 4711 C CA    . SER D 3 196 ? 37.930  38.727 40.952  1.00 59.24  ? 573 SER M CA    1 
ATOM 4712 C C     . SER D 3 196 ? 38.926  37.915 40.156  1.00 58.85  ? 573 SER M C     1 
ATOM 4713 O O     . SER D 3 196 ? 39.187  36.746 40.445  1.00 56.88  ? 573 SER M O     1 
ATOM 4714 C CB    . SER D 3 196 ? 38.585  39.239 42.228  1.00 61.31  ? 573 SER M CB    1 
ATOM 4715 O OG    . SER D 3 196 ? 37.627  39.896 43.047  1.00 65.08  ? 573 SER M OG    1 
ATOM 4716 N N     . ALA D 3 197 ? 39.475  38.565 39.142  1.00 60.87  ? 574 ALA M N     1 
ATOM 4717 C CA    . ALA D 3 197 ? 40.444  37.958 38.245  1.00 62.23  ? 574 ALA M CA    1 
ATOM 4718 C C     . ALA D 3 197 ? 41.765  37.733 38.959  1.00 62.78  ? 574 ALA M C     1 
ATOM 4719 O O     . ALA D 3 197 ? 42.460  36.747 38.701  1.00 61.70  ? 574 ALA M O     1 
ATOM 4720 C CB    . ALA D 3 197 ? 40.651  38.864 37.023  1.00 62.09  ? 574 ALA M CB    1 
ATOM 4721 N N     . HIS D 3 198 ? 42.102  38.651 39.862  1.00 64.14  ? 575 HIS M N     1 
ATOM 4722 C CA    . HIS D 3 198 ? 43.350  38.571 40.610  1.00 65.35  ? 575 HIS M CA    1 
ATOM 4723 C C     . HIS D 3 198 ? 43.208  38.780 42.116  1.00 63.85  ? 575 HIS M C     1 
ATOM 4724 O O     . HIS D 3 198 ? 42.442  39.626 42.582  1.00 63.47  ? 575 HIS M O     1 
ATOM 4725 C CB    . HIS D 3 198 ? 44.345  39.599 40.065  1.00 69.49  ? 575 HIS M CB    1 
ATOM 4726 C CG    . HIS D 3 198 ? 44.821  39.308 38.677  1.00 73.50  ? 575 HIS M CG    1 
ATOM 4727 N ND1   . HIS D 3 198 ? 45.507  38.157 38.351  1.00 75.38  ? 575 HIS M ND1   1 
ATOM 4728 C CD2   . HIS D 3 198 ? 44.735  40.030 37.535  1.00 74.78  ? 575 HIS M CD2   1 
ATOM 4729 C CE1   . HIS D 3 198 ? 45.823  38.183 37.068  1.00 75.96  ? 575 HIS M CE1   1 
ATOM 4730 N NE2   . HIS D 3 198 ? 45.366  39.309 36.550  1.00 76.30  ? 575 HIS M NE2   1 
ATOM 4731 N N     . GLU D 3 199 ? 43.962  38.002 42.879  1.00 62.24  ? 576 GLU M N     1 
ATOM 4732 C CA    . GLU D 3 199 ? 43.948  38.131 44.329  1.00 62.14  ? 576 GLU M CA    1 
ATOM 4733 C C     . GLU D 3 199 ? 45.172  38.931 44.761  1.00 60.74  ? 576 GLU M C     1 
ATOM 4734 O O     . GLU D 3 199 ? 46.114  39.101 43.986  1.00 61.70  ? 576 GLU M O     1 
ATOM 4735 C CB    . GLU D 3 199 ? 43.952  36.750 44.999  1.00 63.82  ? 576 GLU M CB    1 
ATOM 4736 C CG    . GLU D 3 199 ? 42.568  36.145 45.111  1.00 67.51  ? 576 GLU M CG    1 
ATOM 4737 C CD    . GLU D 3 199 ? 41.563  37.132 45.706  1.00 69.93  ? 576 GLU M CD    1 
ATOM 4738 O OE1   . GLU D 3 199 ? 41.768  37.555 46.870  1.00 71.46  ? 576 GLU M OE1   1 
ATOM 4739 O OE2   . GLU D 3 199 ? 40.580  37.491 45.009  1.00 69.07  ? 576 GLU M OE2   1 
ATOM 4740 N N     . LEU D 3 200 ? 45.162  39.433 45.988  1.00 58.43  ? 577 LEU M N     1 
ATOM 4741 C CA    . LEU D 3 200 ? 46.297  40.199 46.474  1.00 56.73  ? 577 LEU M CA    1 
ATOM 4742 C C     . LEU D 3 200 ? 47.360  39.264 47.029  1.00 56.51  ? 577 LEU M C     1 
ATOM 4743 O O     . LEU D 3 200 ? 47.114  38.543 47.989  1.00 54.65  ? 577 LEU M O     1 
ATOM 4744 C CB    . LEU D 3 200 ? 45.861  41.158 47.574  1.00 56.01  ? 577 LEU M CB    1 
ATOM 4745 C CG    . LEU D 3 200 ? 46.992  42.047 48.079  1.00 54.54  ? 577 LEU M CG    1 
ATOM 4746 C CD1   . LEU D 3 200 ? 47.164  43.208 47.115  1.00 54.07  ? 577 LEU M CD1   1 
ATOM 4747 C CD2   . LEU D 3 200 ? 46.680  42.550 49.473  1.00 53.76  ? 577 LEU M CD2   1 
ATOM 4748 N N     . PRO D 3 201 ? 48.557  39.262 46.425  1.00 57.84  ? 578 PRO M N     1 
ATOM 4749 C CA    . PRO D 3 201 ? 49.655  38.404 46.881  1.00 60.41  ? 578 PRO M CA    1 
ATOM 4750 C C     . PRO D 3 201 ? 50.176  38.885 48.231  1.00 64.07  ? 578 PRO M C     1 
ATOM 4751 O O     . PRO D 3 201 ? 50.174  40.088 48.502  1.00 64.23  ? 578 PRO M O     1 
ATOM 4752 C CB    . PRO D 3 201 ? 50.681  38.538 45.760  1.00 58.44  ? 578 PRO M CB    1 
ATOM 4753 C CG    . PRO D 3 201 ? 50.441  39.901 45.246  1.00 58.23  ? 578 PRO M CG    1 
ATOM 4754 C CD    . PRO D 3 201 ? 48.943  40.004 45.214  1.00 57.53  ? 578 PRO M CD    1 
ATOM 4755 N N     . MET D 3 202 ? 50.614  37.951 49.075  1.00 68.68  ? 579 MET M N     1 
ATOM 4756 C CA    . MET D 3 202 ? 51.100  38.303 50.408  1.00 74.12  ? 579 MET M CA    1 
ATOM 4757 C C     . MET D 3 202 ? 52.246  37.432 50.907  1.00 74.35  ? 579 MET M C     1 
ATOM 4758 O O     . MET D 3 202 ? 52.031  36.304 51.348  1.00 74.66  ? 579 MET M O     1 
ATOM 4759 C CB    . MET D 3 202 ? 49.944  38.233 51.401  1.00 79.48  ? 579 MET M CB    1 
ATOM 4760 C CG    . MET D 3 202 ? 48.796  39.155 51.030  1.00 89.31  ? 579 MET M CG    1 
ATOM 4761 S SD    . MET D 3 202 ? 47.307  38.871 51.992  1.00 98.75  ? 579 MET M SD    1 
ATOM 4762 C CE    . MET D 3 202 ? 46.408  37.716 50.926  1.00 100.78 ? 579 MET M CE    1 
ATOM 4763 N N     . VAL D 3 203 ? 53.459  37.974 50.851  1.00 74.33  ? 580 VAL M N     1 
ATOM 4764 C CA    . VAL D 3 203 ? 54.652  37.263 51.289  1.00 74.70  ? 580 VAL M CA    1 
ATOM 4765 C C     . VAL D 3 203 ? 54.767  37.266 52.803  1.00 78.75  ? 580 VAL M C     1 
ATOM 4766 O O     . VAL D 3 203 ? 54.831  38.327 53.423  1.00 79.31  ? 580 VAL M O     1 
ATOM 4767 C CB    . VAL D 3 203 ? 55.902  37.907 50.721  1.00 70.89  ? 580 VAL M CB    1 
ATOM 4768 C CG1   . VAL D 3 203 ? 57.110  37.129 51.145  1.00 69.36  ? 580 VAL M CG1   1 
ATOM 4769 C CG2   . VAL D 3 203 ? 55.813  37.959 49.227  1.00 69.10  ? 580 VAL M CG2   1 
ATOM 4770 N N     . GLU D 3 204 ? 54.812  36.076 53.396  1.00 83.56  ? 581 GLU M N     1 
ATOM 4771 C CA    . GLU D 3 204 ? 54.905  35.955 54.846  1.00 88.20  ? 581 GLU M CA    1 
ATOM 4772 C C     . GLU D 3 204 ? 56.287  35.505 55.299  1.00 87.66  ? 581 GLU M C     1 
ATOM 4773 O O     . GLU D 3 204 ? 56.736  35.851 56.388  1.00 87.37  ? 581 GLU M O     1 
ATOM 4774 C CB    . GLU D 3 204 ? 53.858  34.962 55.358  1.00 94.03  ? 581 GLU M CB    1 
ATOM 4775 C CG    . GLU D 3 204 ? 52.500  35.076 54.675  1.00 103.74 ? 581 GLU M CG    1 
ATOM 4776 C CD    . GLU D 3 204 ? 51.388  34.372 55.439  1.00 109.08 ? 581 GLU M CD    1 
ATOM 4777 O OE1   . GLU D 3 204 ? 50.331  34.081 54.832  1.00 112.12 ? 581 GLU M OE1   1 
ATOM 4778 O OE2   . GLU D 3 204 ? 51.567  34.122 56.651  1.00 112.25 ? 581 GLU M OE2   1 
ATOM 4779 N N     . ARG D 3 205 ? 56.972  34.749 54.455  1.00 87.49  ? 582 ARG M N     1 
ATOM 4780 C CA    . ARG D 3 205 ? 58.283  34.255 54.825  1.00 87.81  ? 582 ARG M CA    1 
ATOM 4781 C C     . ARG D 3 205 ? 59.190  34.040 53.606  1.00 83.62  ? 582 ARG M C     1 
ATOM 4782 O O     . ARG D 3 205 ? 58.724  33.729 52.506  1.00 82.58  ? 582 ARG M O     1 
ATOM 4783 C CB    . ARG D 3 205 ? 58.090  32.954 55.599  1.00 95.50  ? 582 ARG M CB    1 
ATOM 4784 C CG    . ARG D 3 205 ? 59.282  32.466 56.390  1.00 107.37 ? 582 ARG M CG    1 
ATOM 4785 C CD    . ARG D 3 205 ? 58.884  31.218 57.167  1.00 117.61 ? 582 ARG M CD    1 
ATOM 4786 N NE    . ARG D 3 205 ? 59.975  30.679 57.972  1.00 128.91 ? 582 ARG M NE    1 
ATOM 4787 C CZ    . ARG D 3 205 ? 59.880  29.574 58.707  1.00 134.56 ? 582 ARG M CZ    1 
ATOM 4788 N NH1   . ARG D 3 205 ? 58.741  28.894 58.736  1.00 138.44 ? 582 ARG M NH1   1 
ATOM 4789 N NH2   . ARG D 3 205 ? 60.922  29.147 59.410  1.00 138.28 ? 582 ARG M NH2   1 
ATOM 4790 N N     . GLN D 3 206 ? 60.490  34.211 53.812  1.00 78.56  ? 583 GLN M N     1 
ATOM 4791 C CA    . GLN D 3 206 ? 61.473  34.040 52.749  1.00 74.19  ? 583 GLN M CA    1 
ATOM 4792 C C     . GLN D 3 206 ? 62.672  33.247 53.271  1.00 72.86  ? 583 GLN M C     1 
ATOM 4793 O O     . GLN D 3 206 ? 63.246  33.587 54.299  1.00 73.16  ? 583 GLN M O     1 
ATOM 4794 C CB    . GLN D 3 206 ? 61.914  35.415 52.218  1.00 71.85  ? 583 GLN M CB    1 
ATOM 4795 C CG    . GLN D 3 206 ? 62.144  36.478 53.292  1.00 67.28  ? 583 GLN M CG    1 
ATOM 4796 C CD    . GLN D 3 206 ? 62.592  37.817 52.725  1.00 64.85  ? 583 GLN M CD    1 
ATOM 4797 O OE1   . GLN D 3 206 ? 63.622  37.902 52.059  1.00 63.17  ? 583 GLN M OE1   1 
ATOM 4798 N NE2   . GLN D 3 206 ? 61.821  38.872 52.995  1.00 63.69  ? 583 GLN M NE2   1 
ATOM 4799 N N     . ASP D 3 207 ? 63.050  32.189 52.564  1.00 71.13  ? 584 ASP M N     1 
ATOM 4800 C CA    . ASP D 3 207 ? 64.160  31.356 53.004  1.00 70.29  ? 584 ASP M CA    1 
ATOM 4801 C C     . ASP D 3 207 ? 65.512  31.932 52.659  1.00 69.07  ? 584 ASP M C     1 
ATOM 4802 O O     . ASP D 3 207 ? 66.528  31.260 52.813  1.00 69.18  ? 584 ASP M O     1 
ATOM 4803 C CB    . ASP D 3 207 ? 64.048  29.959 52.397  1.00 72.75  ? 584 ASP M CB    1 
ATOM 4804 C CG    . ASP D 3 207 ? 64.101  29.980 50.885  1.00 74.57  ? 584 ASP M CG    1 
ATOM 4805 O OD1   . ASP D 3 207 ? 64.000  28.900 50.261  1.00 74.04  ? 584 ASP M OD1   1 
ATOM 4806 O OD2   . ASP D 3 207 ? 64.246  31.084 50.321  1.00 76.38  ? 584 ASP M OD2   1 
ATOM 4807 N N     . THR D 3 208 ? 65.527  33.171 52.182  1.00 67.71  ? 585 THR M N     1 
ATOM 4808 C CA    . THR D 3 208 ? 66.781  33.827 51.821  1.00 66.58  ? 585 THR M CA    1 
ATOM 4809 C C     . THR D 3 208 ? 66.689  35.322 52.085  1.00 66.59  ? 585 THR M C     1 
ATOM 4810 O O     . THR D 3 208 ? 65.674  35.955 51.785  1.00 66.78  ? 585 THR M O     1 
ATOM 4811 C CB    . THR D 3 208 ? 67.116  33.620 50.339  1.00 65.64  ? 585 THR M CB    1 
ATOM 4812 O OG1   . THR D 3 208 ? 67.071  32.223 50.030  1.00 64.87  ? 585 THR M OG1   1 
ATOM 4813 C CG2   . THR D 3 208 ? 68.500  34.168 50.033  1.00 64.11  ? 585 THR M CG2   1 
ATOM 4814 N N     . ASP D 3 209 ? 67.755  35.894 52.633  1.00 66.06  ? 586 ASP M N     1 
ATOM 4815 C CA    . ASP D 3 209 ? 67.753  37.320 52.937  1.00 65.31  ? 586 ASP M CA    1 
ATOM 4816 C C     . ASP D 3 209 ? 68.968  38.050 52.347  1.00 64.17  ? 586 ASP M C     1 
ATOM 4817 O O     . ASP D 3 209 ? 69.063  39.285 52.382  1.00 62.73  ? 586 ASP M O     1 
ATOM 4818 C CB    . ASP D 3 209 ? 67.666  37.482 54.450  1.00 67.08  ? 586 ASP M CB    1 
ATOM 4819 C CG    . ASP D 3 209 ? 66.438  36.790 55.023  1.00 69.83  ? 586 ASP M CG    1 
ATOM 4820 O OD1   . ASP D 3 209 ? 65.325  37.338 54.865  1.00 72.28  ? 586 ASP M OD1   1 
ATOM 4821 O OD2   . ASP D 3 209 ? 66.574  35.689 55.608  1.00 70.02  ? 586 ASP M OD2   1 
ATOM 4822 N N     . SER D 3 210 ? 69.880  37.272 51.775  1.00 62.76  ? 587 SER M N     1 
ATOM 4823 C CA    . SER D 3 210 ? 71.072  37.822 51.161  1.00 60.75  ? 587 SER M CA    1 
ATOM 4824 C C     . SER D 3 210 ? 71.695  36.795 50.235  1.00 60.63  ? 587 SER M C     1 
ATOM 4825 O O     . SER D 3 210 ? 71.196  35.682 50.115  1.00 60.22  ? 587 SER M O     1 
ATOM 4826 C CB    . SER D 3 210 ? 72.078  38.232 52.239  1.00 60.46  ? 587 SER M CB    1 
ATOM 4827 O OG    . SER D 3 210 ? 72.437  37.143 53.072  1.00 58.17  ? 587 SER M OG    1 
ATOM 4828 N N     . CYS D 3 211 ? 72.783  37.188 49.581  1.00 61.45  ? 588 CYS M N     1 
ATOM 4829 C CA    . CYS D 3 211 ? 73.522  36.325 48.666  1.00 63.39  ? 588 CYS M CA    1 
ATOM 4830 C C     . CYS D 3 211 ? 74.478  37.184 47.839  1.00 63.61  ? 588 CYS M C     1 
ATOM 4831 O O     . CYS D 3 211 ? 74.319  38.403 47.781  1.00 64.08  ? 588 CYS M O     1 
ATOM 4832 C CB    . CYS D 3 211 ? 72.569  35.564 47.736  1.00 64.63  ? 588 CYS M CB    1 
ATOM 4833 S SG    . CYS D 3 211 ? 71.963  36.479 46.308  1.00 66.87  ? 588 CYS M SG    1 
ATOM 4834 N N     . LEU D 3 212 ? 75.468  36.554 47.210  1.00 63.40  ? 589 LEU M N     1 
ATOM 4835 C CA    . LEU D 3 212 ? 76.442  37.280 46.398  1.00 64.28  ? 589 LEU M CA    1 
ATOM 4836 C C     . LEU D 3 212 ? 75.784  38.035 45.248  1.00 64.64  ? 589 LEU M C     1 
ATOM 4837 O O     . LEU D 3 212 ? 74.689  37.684 44.815  1.00 65.04  ? 589 LEU M O     1 
ATOM 4838 C CB    . LEU D 3 212 ? 77.486  36.321 45.835  1.00 65.18  ? 589 LEU M CB    1 
ATOM 4839 C CG    . LEU D 3 212 ? 78.537  35.766 46.790  1.00 66.23  ? 589 LEU M CG    1 
ATOM 4840 C CD1   . LEU D 3 212 ? 77.874  35.067 47.968  1.00 67.61  ? 589 LEU M CD1   1 
ATOM 4841 C CD2   . LEU D 3 212 ? 79.421  34.805 46.016  1.00 66.78  ? 589 LEU M CD2   1 
ATOM 4842 N N     . VAL D 3 213 ? 76.471  39.058 44.746  1.00 65.14  ? 590 VAL M N     1 
ATOM 4843 C CA    . VAL D 3 213 ? 75.952  39.882 43.662  1.00 66.47  ? 590 VAL M CA    1 
ATOM 4844 C C     . VAL D 3 213 ? 75.614  39.147 42.378  1.00 68.93  ? 590 VAL M C     1 
ATOM 4845 O O     . VAL D 3 213 ? 74.782  39.615 41.606  1.00 69.51  ? 590 VAL M O     1 
ATOM 4846 C CB    . VAL D 3 213 ? 76.921  41.017 43.309  1.00 65.38  ? 590 VAL M CB    1 
ATOM 4847 C CG1   . VAL D 3 213 ? 77.009  42.008 44.463  1.00 64.67  ? 590 VAL M CG1   1 
ATOM 4848 C CG2   . VAL D 3 213 ? 78.278  40.445 42.989  1.00 64.15  ? 590 VAL M CG2   1 
ATOM 4849 N N     . TYR D 3 214 ? 76.246  38.005 42.137  1.00 73.01  ? 591 TYR M N     1 
ATOM 4850 C CA    . TYR D 3 214 ? 75.971  37.246 40.917  1.00 77.10  ? 591 TYR M CA    1 
ATOM 4851 C C     . TYR D 3 214 ? 74.593  36.616 41.009  1.00 76.67  ? 591 TYR M C     1 
ATOM 4852 O O     . TYR D 3 214 ? 74.118  36.010 40.054  1.00 75.82  ? 591 TYR M O     1 
ATOM 4853 C CB    . TYR D 3 214 ? 77.012  36.144 40.721  1.00 83.17  ? 591 TYR M CB    1 
ATOM 4854 C CG    . TYR D 3 214 ? 78.428  36.593 40.981  1.00 90.16  ? 591 TYR M CG    1 
ATOM 4855 C CD1   . TYR D 3 214 ? 79.044  37.553 40.172  1.00 92.60  ? 591 TYR M CD1   1 
ATOM 4856 C CD2   . TYR D 3 214 ? 79.144  36.084 42.066  1.00 94.01  ? 591 TYR M CD2   1 
ATOM 4857 C CE1   . TYR D 3 214 ? 80.339  37.996 40.443  1.00 95.75  ? 591 TYR M CE1   1 
ATOM 4858 C CE2   . TYR D 3 214 ? 80.438  36.519 42.347  1.00 97.07  ? 591 TYR M CE2   1 
ATOM 4859 C CZ    . TYR D 3 214 ? 81.028  37.472 41.536  1.00 97.50  ? 591 TYR M CZ    1 
ATOM 4860 O OH    . TYR D 3 214 ? 82.302  37.896 41.830  1.00 99.18  ? 591 TYR M OH    1 
ATOM 4861 N N     . GLY D 3 215 ? 73.961  36.764 42.172  1.00 76.91  ? 592 GLY M N     1 
ATOM 4862 C CA    . GLY D 3 215 ? 72.642  36.199 42.385  1.00 76.64  ? 592 GLY M CA    1 
ATOM 4863 C C     . GLY D 3 215 ? 72.666  34.720 42.061  1.00 77.25  ? 592 GLY M C     1 
ATOM 4864 O O     . GLY D 3 215 ? 73.420  33.963 42.668  1.00 78.32  ? 592 GLY M O     1 
ATOM 4865 N N     . GLY D 3 216 ? 71.843  34.308 41.104  1.00 77.05  ? 593 GLY M N     1 
ATOM 4866 C CA    . GLY D 3 216 ? 71.805  32.913 40.716  1.00 78.12  ? 593 GLY M CA    1 
ATOM 4867 C C     . GLY D 3 216 ? 70.943  32.021 41.585  1.00 79.13  ? 593 GLY M C     1 
ATOM 4868 O O     . GLY D 3 216 ? 69.932  31.503 41.134  1.00 79.98  ? 593 GLY M O     1 
ATOM 4869 N N     . GLN D 3 217 ? 71.348  31.829 42.830  1.00 80.36  ? 594 GLN M N     1 
ATOM 4870 C CA    . GLN D 3 217 ? 70.603  30.984 43.748  1.00 82.41  ? 594 GLN M CA    1 
ATOM 4871 C C     . GLN D 3 217 ? 69.096  31.119 43.593  1.00 80.35  ? 594 GLN M C     1 
ATOM 4872 O O     . GLN D 3 217 ? 68.602  32.090 43.034  1.00 79.52  ? 594 GLN M O     1 
ATOM 4873 C CB    . GLN D 3 217 ? 70.968  31.331 45.180  1.00 88.34  ? 594 GLN M CB    1 
ATOM 4874 C CG    . GLN D 3 217 ? 72.439  31.350 45.460  1.00 95.90  ? 594 GLN M CG    1 
ATOM 4875 C CD    . GLN D 3 217 ? 72.756  32.298 46.587  1.00 100.84 ? 594 GLN M CD    1 
ATOM 4876 O OE1   . GLN D 3 217 ? 72.102  32.273 47.634  1.00 102.59 ? 594 GLN M OE1   1 
ATOM 4877 N NE2   . GLN D 3 217 ? 73.760  33.148 46.384  1.00 103.99 ? 594 GLN M NE2   1 
ATOM 4878 N N     . GLN D 3 218 ? 68.378  30.139 44.129  1.00 79.11  ? 595 GLN M N     1 
ATOM 4879 C CA    . GLN D 3 218 ? 66.923  30.096 44.084  1.00 77.13  ? 595 GLN M CA    1 
ATOM 4880 C C     . GLN D 3 218 ? 66.302  30.420 45.444  1.00 75.25  ? 595 GLN M C     1 
ATOM 4881 O O     . GLN D 3 218 ? 66.613  29.777 46.444  1.00 73.84  ? 595 GLN M O     1 
ATOM 4882 C CB    . GLN D 3 218 ? 66.473  28.704 43.656  1.00 79.25  ? 595 GLN M CB    1 
ATOM 4883 C CG    . GLN D 3 218 ? 64.986  28.466 43.826  1.00 83.05  ? 595 GLN M CG    1 
ATOM 4884 C CD    . GLN D 3 218 ? 64.670  27.074 44.342  1.00 84.17  ? 595 GLN M CD    1 
ATOM 4885 O OE1   . GLN D 3 218 ? 65.037  26.713 45.466  1.00 83.95  ? 595 GLN M OE1   1 
ATOM 4886 N NE2   . GLN D 3 218 ? 63.981  26.284 43.522  1.00 84.56  ? 595 GLN M NE2   1 
ATOM 4887 N N     . MET D 3 219 ? 65.414  31.409 45.477  1.00 74.14  ? 596 MET M N     1 
ATOM 4888 C CA    . MET D 3 219 ? 64.752  31.797 46.724  1.00 72.27  ? 596 MET M CA    1 
ATOM 4889 C C     . MET D 3 219 ? 63.313  31.310 46.757  1.00 71.38  ? 596 MET M C     1 
ATOM 4890 O O     . MET D 3 219 ? 62.608  31.350 45.752  1.00 71.53  ? 596 MET M O     1 
ATOM 4891 C CB    . MET D 3 219 ? 64.776  33.315 46.911  1.00 71.35  ? 596 MET M CB    1 
ATOM 4892 C CG    . MET D 3 219 ? 64.034  33.787 48.157  1.00 69.77  ? 596 MET M CG    1 
ATOM 4893 S SD    . MET D 3 219 ? 64.151  35.568 48.415  1.00 69.26  ? 596 MET M SD    1 
ATOM 4894 C CE    . MET D 3 219 ? 63.307  36.170 46.901  1.00 68.21  ? 596 MET M CE    1 
ATOM 4895 N N     . ILE D 3 220 ? 62.882  30.865 47.930  1.00 70.86  ? 597 ILE M N     1 
ATOM 4896 C CA    . ILE D 3 220 ? 61.540  30.342 48.111  1.00 70.80  ? 597 ILE M CA    1 
ATOM 4897 C C     . ILE D 3 220 ? 60.708  31.212 49.036  1.00 69.53  ? 597 ILE M C     1 
ATOM 4898 O O     . ILE D 3 220 ? 61.023  31.360 50.219  1.00 69.37  ? 597 ILE M O     1 
ATOM 4899 C CB    . ILE D 3 220 ? 61.605  28.906 48.673  1.00 72.70  ? 597 ILE M CB    1 
ATOM 4900 C CG1   . ILE D 3 220 ? 62.286  27.994 47.647  1.00 73.63  ? 597 ILE M CG1   1 
ATOM 4901 C CG2   . ILE D 3 220 ? 60.210  28.407 49.021  1.00 73.79  ? 597 ILE M CG2   1 
ATOM 4902 C CD1   . ILE D 3 220 ? 62.392  26.565 48.074  1.00 74.09  ? 597 ILE M CD1   1 
ATOM 4903 N N     . LEU D 3 221 ? 59.638  31.780 48.488  1.00 68.27  ? 598 LEU M N     1 
ATOM 4904 C CA    . LEU D 3 221 ? 58.749  32.644 49.254  1.00 67.48  ? 598 LEU M CA    1 
ATOM 4905 C C     . LEU D 3 221 ? 57.532  31.849 49.699  1.00 69.08  ? 598 LEU M C     1 
ATOM 4906 O O     . LEU D 3 221 ? 57.071  30.959 48.981  1.00 69.08  ? 598 LEU M O     1 
ATOM 4907 C CB    . LEU D 3 221 ? 58.299  33.826 48.395  1.00 63.48  ? 598 LEU M CB    1 
ATOM 4908 C CG    . LEU D 3 221 ? 59.427  34.594 47.706  1.00 61.50  ? 598 LEU M CG    1 
ATOM 4909 C CD1   . LEU D 3 221 ? 58.857  35.550 46.685  1.00 59.89  ? 598 LEU M CD1   1 
ATOM 4910 C CD2   . LEU D 3 221 ? 60.251  35.328 48.742  1.00 60.07  ? 598 LEU M CD2   1 
ATOM 4911 N N     . THR D 3 222 ? 57.019  32.172 50.884  1.00 71.06  ? 599 THR M N     1 
ATOM 4912 C CA    . THR D 3 222 ? 55.844  31.495 51.427  1.00 73.37  ? 599 THR M CA    1 
ATOM 4913 C C     . THR D 3 222 ? 54.786  32.522 51.795  1.00 75.36  ? 599 THR M C     1 
ATOM 4914 O O     . THR D 3 222 ? 54.993  33.343 52.691  1.00 75.55  ? 599 THR M O     1 
ATOM 4915 C CB    . THR D 3 222 ? 56.177  30.702 52.697  1.00 73.12  ? 599 THR M CB    1 
ATOM 4916 O OG1   . THR D 3 222 ? 57.266  29.808 52.440  1.00 74.27  ? 599 THR M OG1   1 
ATOM 4917 C CG2   . THR D 3 222 ? 54.969  29.904 53.141  1.00 72.25  ? 599 THR M CG2   1 
ATOM 4918 N N     . GLY D 3 223 ? 53.650  32.471 51.108  1.00 77.70  ? 600 GLY M N     1 
ATOM 4919 C CA    . GLY D 3 223 ? 52.587  33.418 51.388  1.00 80.40  ? 600 GLY M CA    1 
ATOM 4920 C C     . GLY D 3 223 ? 51.216  32.953 50.942  1.00 82.12  ? 600 GLY M C     1 
ATOM 4921 O O     . GLY D 3 223 ? 50.836  31.812 51.186  1.00 82.17  ? 600 GLY M O     1 
ATOM 4922 N N     . GLN D 3 224 ? 50.473  33.836 50.284  1.00 84.52  ? 601 GLN M N     1 
ATOM 4923 C CA    . GLN D 3 224 ? 49.134  33.505 49.817  1.00 86.32  ? 601 GLN M CA    1 
ATOM 4924 C C     . GLN D 3 224 ? 48.764  34.148 48.492  1.00 86.09  ? 601 GLN M C     1 
ATOM 4925 O O     . GLN D 3 224 ? 49.240  35.226 48.153  1.00 85.80  ? 601 GLN M O     1 
ATOM 4926 C CB    . GLN D 3 224 ? 48.101  33.922 50.857  1.00 88.37  ? 601 GLN M CB    1 
ATOM 4927 C CG    . GLN D 3 224 ? 48.266  33.259 52.198  1.00 91.68  ? 601 GLN M CG    1 
ATOM 4928 C CD    . GLN D 3 224 ? 47.068  33.491 53.082  1.00 94.18  ? 601 GLN M CD    1 
ATOM 4929 O OE1   . GLN D 3 224 ? 46.703  34.636 53.359  1.00 95.76  ? 601 GLN M OE1   1 
ATOM 4930 N NE2   . GLN D 3 224 ? 46.438  32.406 53.529  1.00 95.49  ? 601 GLN M NE2   1 
ATOM 4931 N N     . ASN D 3 225 ? 47.898  33.470 47.751  1.00 86.57  ? 602 ASN M N     1 
ATOM 4932 C CA    . ASN D 3 225 ? 47.417  33.960 46.469  1.00 87.27  ? 602 ASN M CA    1 
ATOM 4933 C C     . ASN D 3 225 ? 48.479  33.992 45.386  1.00 87.58  ? 602 ASN M C     1 
ATOM 4934 O O     . ASN D 3 225 ? 48.454  34.845 44.498  1.00 86.60  ? 602 ASN M O     1 
ATOM 4935 C CB    . ASN D 3 225 ? 46.811  35.346 46.648  1.00 86.83  ? 602 ASN M CB    1 
ATOM 4936 C CG    . ASN D 3 225 ? 45.777  35.380 47.745  1.00 85.68  ? 602 ASN M CG    1 
ATOM 4937 O OD1   . ASN D 3 225 ? 45.209  36.425 48.045  1.00 86.37  ? 602 ASN M OD1   1 
ATOM 4938 N ND2   . ASN D 3 225 ? 45.528  34.229 48.354  1.00 84.86  ? 602 ASN M ND2   1 
ATOM 4939 N N     . PHE D 3 226 ? 49.411  33.054 45.465  1.00 88.79  ? 603 PHE M N     1 
ATOM 4940 C CA    . PHE D 3 226 ? 50.465  32.956 44.474  1.00 90.50  ? 603 PHE M CA    1 
ATOM 4941 C C     . PHE D 3 226 ? 49.917  32.150 43.310  1.00 92.26  ? 603 PHE M C     1 
ATOM 4942 O O     . PHE D 3 226 ? 49.882  30.926 43.374  1.00 92.80  ? 603 PHE M O     1 
ATOM 4943 C CB    . PHE D 3 226 ? 51.683  32.227 45.047  1.00 89.92  ? 603 PHE M CB    1 
ATOM 4944 C CG    . PHE D 3 226 ? 52.400  32.980 46.130  1.00 90.22  ? 603 PHE M CG    1 
ATOM 4945 C CD1   . PHE D 3 226 ? 53.274  32.318 46.983  1.00 90.14  ? 603 PHE M CD1   1 
ATOM 4946 C CD2   . PHE D 3 226 ? 52.205  34.346 46.303  1.00 90.36  ? 603 PHE M CD2   1 
ATOM 4947 C CE1   . PHE D 3 226 ? 53.941  33.003 47.995  1.00 89.51  ? 603 PHE M CE1   1 
ATOM 4948 C CE2   . PHE D 3 226 ? 52.870  35.040 47.313  1.00 89.72  ? 603 PHE M CE2   1 
ATOM 4949 C CZ    . PHE D 3 226 ? 53.737  34.365 48.159  1.00 89.18  ? 603 PHE M CZ    1 
ATOM 4950 N N     . THR D 3 227 ? 49.462  32.825 42.262  1.00 94.25  ? 604 THR M N     1 
ATOM 4951 C CA    . THR D 3 227 ? 48.955  32.120 41.093  1.00 96.54  ? 604 THR M CA    1 
ATOM 4952 C C     . THR D 3 227 ? 50.176  31.888 40.216  1.00 97.29  ? 604 THR M C     1 
ATOM 4953 O O     . THR D 3 227 ? 51.224  32.479 40.455  1.00 97.93  ? 604 THR M O     1 
ATOM 4954 C CB    . THR D 3 227 ? 47.906  32.956 40.309  1.00 97.56  ? 604 THR M CB    1 
ATOM 4955 O OG1   . THR D 3 227 ? 48.539  34.083 39.689  1.00 97.52  ? 604 THR M OG1   1 
ATOM 4956 C CG2   . THR D 3 227 ? 46.814  33.447 41.245  1.00 99.14  ? 604 THR M CG2   1 
ATOM 4957 N N     . SER D 3 228 ? 50.056  31.026 39.215  1.00 98.26  ? 605 SER M N     1 
ATOM 4958 C CA    . SER D 3 228 ? 51.176  30.746 38.325  1.00 98.21  ? 605 SER M CA    1 
ATOM 4959 C C     . SER D 3 228 ? 51.591  31.988 37.538  1.00 97.25  ? 605 SER M C     1 
ATOM 4960 O O     . SER D 3 228 ? 52.728  32.090 37.076  1.00 97.39  ? 605 SER M O     1 
ATOM 4961 C CB    . SER D 3 228 ? 50.804  29.620 37.359  1.00 99.47  ? 605 SER M CB    1 
ATOM 4962 O OG    . SER D 3 228 ? 49.588  29.907 36.690  1.00 101.24 ? 605 SER M OG    1 
ATOM 4963 N N     . GLU D 3 229 ? 50.668  32.934 37.397  1.00 95.52  ? 606 GLU M N     1 
ATOM 4964 C CA    . GLU D 3 229 ? 50.947  34.158 36.657  1.00 93.56  ? 606 GLU M CA    1 
ATOM 4965 C C     . GLU D 3 229 ? 51.696  35.184 37.485  1.00 90.50  ? 606 GLU M C     1 
ATOM 4966 O O     . GLU D 3 229 ? 52.260  36.129 36.944  1.00 91.54  ? 606 GLU M O     1 
ATOM 4967 C CB    . GLU D 3 229 ? 49.648  34.773 36.118  1.00 95.94  ? 606 GLU M CB    1 
ATOM 4968 C CG    . GLU D 3 229 ? 48.951  33.921 35.055  1.00 98.19  ? 606 GLU M CG    1 
ATOM 4969 C CD    . GLU D 3 229 ? 49.920  33.365 34.013  1.00 99.29  ? 606 GLU M CD    1 
ATOM 4970 O OE1   . GLU D 3 229 ? 50.655  34.158 33.383  1.00 100.12 ? 606 GLU M OE1   1 
ATOM 4971 O OE2   . GLU D 3 229 ? 49.946  32.130 33.824  1.00 99.16  ? 606 GLU M OE2   1 
ATOM 4972 N N     . SER D 3 230 ? 51.700  34.998 38.798  1.00 86.71  ? 607 SER M N     1 
ATOM 4973 C CA    . SER D 3 230 ? 52.401  35.907 39.696  1.00 81.81  ? 607 SER M CA    1 
ATOM 4974 C C     . SER D 3 230 ? 53.787  36.180 39.133  1.00 79.02  ? 607 SER M C     1 
ATOM 4975 O O     . SER D 3 230 ? 54.355  35.338 38.442  1.00 79.68  ? 607 SER M O     1 
ATOM 4976 C CB    . SER D 3 230 ? 52.551  35.278 41.082  1.00 81.01  ? 607 SER M CB    1 
ATOM 4977 O OG    . SER D 3 230 ? 51.298  34.905 41.619  1.00 80.20  ? 607 SER M OG    1 
ATOM 4978 N N     . LYS D 3 231 ? 54.327  37.358 39.423  1.00 74.73  ? 608 LYS M N     1 
ATOM 4979 C CA    . LYS D 3 231 ? 55.659  37.717 38.960  1.00 69.86  ? 608 LYS M CA    1 
ATOM 4980 C C     . LYS D 3 231 ? 56.419  38.363 40.106  1.00 66.42  ? 608 LYS M C     1 
ATOM 4981 O O     . LYS D 3 231 ? 55.813  38.802 41.087  1.00 66.41  ? 608 LYS M O     1 
ATOM 4982 C CB    . LYS D 3 231 ? 55.568  38.658 37.771  1.00 69.83  ? 608 LYS M CB    1 
ATOM 4983 C CG    . LYS D 3 231 ? 54.861  38.027 36.594  1.00 72.52  ? 608 LYS M CG    1 
ATOM 4984 C CD    . LYS D 3 231 ? 54.895  38.934 35.393  1.00 74.98  ? 608 LYS M CD    1 
ATOM 4985 C CE    . LYS D 3 231 ? 54.089  38.358 34.257  1.00 75.72  ? 608 LYS M CE    1 
ATOM 4986 N NZ    . LYS D 3 231 ? 53.942  39.388 33.195  1.00 76.87  ? 608 LYS M NZ    1 
ATOM 4987 N N     . VAL D 3 232 ? 57.742  38.414 39.992  1.00 61.15  ? 609 VAL M N     1 
ATOM 4988 C CA    . VAL D 3 232 ? 58.557  38.984 41.051  1.00 56.27  ? 609 VAL M CA    1 
ATOM 4989 C C     . VAL D 3 232 ? 59.479  40.061 40.531  1.00 55.10  ? 609 VAL M C     1 
ATOM 4990 O O     . VAL D 3 232 ? 60.176  39.853 39.544  1.00 55.20  ? 609 VAL M O     1 
ATOM 4991 C CB    . VAL D 3 232 ? 59.412  37.910 41.718  1.00 54.49  ? 609 VAL M CB    1 
ATOM 4992 C CG1   . VAL D 3 232 ? 60.183  38.518 42.866  1.00 53.55  ? 609 VAL M CG1   1 
ATOM 4993 C CG2   . VAL D 3 232 ? 58.532  36.773 42.199  1.00 53.64  ? 609 VAL M CG2   1 
ATOM 4994 N N     . VAL D 3 233 ? 59.496  41.205 41.212  1.00 53.86  ? 610 VAL M N     1 
ATOM 4995 C CA    . VAL D 3 233 ? 60.342  42.323 40.807  1.00 51.96  ? 610 VAL M CA    1 
ATOM 4996 C C     . VAL D 3 233 ? 61.262  42.858 41.908  1.00 54.05  ? 610 VAL M C     1 
ATOM 4997 O O     . VAL D 3 233 ? 60.818  43.152 43.030  1.00 53.82  ? 610 VAL M O     1 
ATOM 4998 C CB    . VAL D 3 233 ? 59.502  43.493 40.313  1.00 48.65  ? 610 VAL M CB    1 
ATOM 4999 C CG1   . VAL D 3 233 ? 60.408  44.618 39.871  1.00 46.96  ? 610 VAL M CG1   1 
ATOM 5000 C CG2   . VAL D 3 233 ? 58.601  43.037 39.201  1.00 45.68  ? 610 VAL M CG2   1 
ATOM 5001 N N     . PHE D 3 234 ? 62.544  42.986 41.564  1.00 54.66  ? 611 PHE M N     1 
ATOM 5002 C CA    . PHE D 3 234 ? 63.559  43.505 42.478  1.00 54.30  ? 611 PHE M CA    1 
ATOM 5003 C C     . PHE D 3 234 ? 63.788  44.956 42.121  1.00 52.64  ? 611 PHE M C     1 
ATOM 5004 O O     . PHE D 3 234 ? 63.972  45.271 40.951  1.00 52.02  ? 611 PHE M O     1 
ATOM 5005 C CB    . PHE D 3 234 ? 64.883  42.749 42.307  1.00 56.62  ? 611 PHE M CB    1 
ATOM 5006 C CG    . PHE D 3 234 ? 64.976  41.480 43.113  1.00 58.93  ? 611 PHE M CG    1 
ATOM 5007 C CD1   . PHE D 3 234 ? 64.156  40.391 42.829  1.00 58.74  ? 611 PHE M CD1   1 
ATOM 5008 C CD2   . PHE D 3 234 ? 65.884  41.380 44.172  1.00 58.85  ? 611 PHE M CD2   1 
ATOM 5009 C CE1   . PHE D 3 234 ? 64.242  39.228 43.589  1.00 59.21  ? 611 PHE M CE1   1 
ATOM 5010 C CE2   . PHE D 3 234 ? 65.972  40.218 44.935  1.00 57.99  ? 611 PHE M CE2   1 
ATOM 5011 C CZ    . PHE D 3 234 ? 65.154  39.145 44.646  1.00 58.48  ? 611 PHE M CZ    1 
ATOM 5012 N N     . THR D 3 235 ? 63.766  45.841 43.111  1.00 52.03  ? 612 THR M N     1 
ATOM 5013 C CA    . THR D 3 235 ? 64.008  47.260 42.841  1.00 53.54  ? 612 THR M CA    1 
ATOM 5014 C C     . THR D 3 235 ? 64.920  47.878 43.878  1.00 52.40  ? 612 THR M C     1 
ATOM 5015 O O     . THR D 3 235 ? 65.232  47.258 44.896  1.00 53.39  ? 612 THR M O     1 
ATOM 5016 C CB    . THR D 3 235 ? 62.705  48.114 42.819  1.00 54.63  ? 612 THR M CB    1 
ATOM 5017 O OG1   . THR D 3 235 ? 62.132  48.176 44.134  1.00 54.58  ? 612 THR M OG1   1 
ATOM 5018 C CG2   . THR D 3 235 ? 61.701  47.523 41.856  1.00 57.22  ? 612 THR M CG2   1 
ATOM 5019 N N     . GLU D 3 236 ? 65.351  49.102 43.596  1.00 50.65  ? 613 GLU M N     1 
ATOM 5020 C CA    . GLU D 3 236 ? 66.197  49.859 44.499  1.00 49.07  ? 613 GLU M CA    1 
ATOM 5021 C C     . GLU D 3 236 ? 65.962  51.317 44.196  1.00 48.54  ? 613 GLU M C     1 
ATOM 5022 O O     . GLU D 3 236 ? 66.089  51.730 43.052  1.00 50.24  ? 613 GLU M O     1 
ATOM 5023 C CB    . GLU D 3 236 ? 67.673  49.561 44.279  1.00 48.85  ? 613 GLU M CB    1 
ATOM 5024 C CG    . GLU D 3 236 ? 68.557  50.398 45.184  1.00 51.05  ? 613 GLU M CG    1 
ATOM 5025 C CD    . GLU D 3 236 ? 70.036  50.232 44.913  1.00 53.25  ? 613 GLU M CD    1 
ATOM 5026 O OE1   . GLU D 3 236 ? 70.854  50.740 45.713  1.00 54.35  ? 613 GLU M OE1   1 
ATOM 5027 O OE2   . GLU D 3 236 ? 70.384  49.603 43.897  1.00 55.83  ? 613 GLU M OE2   1 
ATOM 5028 N N     . LYS D 3 237 ? 65.600  52.102 45.201  1.00 47.15  ? 614 LYS M N     1 
ATOM 5029 C CA    . LYS D 3 237 ? 65.396  53.519 44.958  1.00 45.04  ? 614 LYS M CA    1 
ATOM 5030 C C     . LYS D 3 237 ? 66.056  54.384 46.023  1.00 44.17  ? 614 LYS M C     1 
ATOM 5031 O O     . LYS D 3 237 ? 66.393  53.907 47.102  1.00 43.26  ? 614 LYS M O     1 
ATOM 5032 C CB    . LYS D 3 237 ? 63.901  53.839 44.824  1.00 43.86  ? 614 LYS M CB    1 
ATOM 5033 C CG    . LYS D 3 237 ? 63.002  53.202 45.844  1.00 44.18  ? 614 LYS M CG    1 
ATOM 5034 C CD    . LYS D 3 237 ? 61.855  52.459 45.156  1.00 44.62  ? 614 LYS M CD    1 
ATOM 5035 C CE    . LYS D 3 237 ? 60.804  53.388 44.560  1.00 44.41  ? 614 LYS M CE    1 
ATOM 5036 N NZ    . LYS D 3 237 ? 59.909  53.959 45.601  1.00 45.31  ? 614 LYS M NZ    1 
ATOM 5037 N N     . THR D 3 238 ? 66.269  55.652 45.684  1.00 43.79  ? 615 THR M N     1 
ATOM 5038 C CA    . THR D 3 238 ? 66.891  56.618 46.580  1.00 42.83  ? 615 THR M CA    1 
ATOM 5039 C C     . THR D 3 238 ? 65.925  57.046 47.674  1.00 44.51  ? 615 THR M C     1 
ATOM 5040 O O     . THR D 3 238 ? 64.739  56.712 47.652  1.00 44.23  ? 615 THR M O     1 
ATOM 5041 C CB    . THR D 3 238 ? 67.312  57.895 45.822  1.00 41.12  ? 615 THR M CB    1 
ATOM 5042 O OG1   . THR D 3 238 ? 66.182  58.426 45.130  1.00 38.54  ? 615 THR M OG1   1 
ATOM 5043 C CG2   . THR D 3 238 ? 68.401  57.604 44.811  1.00 41.40  ? 615 THR M CG2   1 
ATOM 5044 N N     . THR D 3 239 ? 66.439  57.799 48.637  1.00 46.17  ? 616 THR M N     1 
ATOM 5045 C CA    . THR D 3 239 ? 65.604  58.294 49.713  1.00 46.78  ? 616 THR M CA    1 
ATOM 5046 C C     . THR D 3 239 ? 64.534  59.184 49.100  1.00 49.36  ? 616 THR M C     1 
ATOM 5047 O O     . THR D 3 239 ? 63.449  59.316 49.638  1.00 48.69  ? 616 THR M O     1 
ATOM 5048 C CB    . THR D 3 239 ? 66.434  59.075 50.693  1.00 44.85  ? 616 THR M CB    1 
ATOM 5049 O OG1   . THR D 3 239 ? 67.369  58.186 51.316  1.00 42.89  ? 616 THR M OG1   1 
ATOM 5050 C CG2   . THR D 3 239 ? 65.545  59.716 51.731  1.00 45.18  ? 616 THR M CG2   1 
ATOM 5051 N N     . ASP D 3 240 ? 64.878  59.785 47.962  1.00 54.47  ? 617 ASP M N     1 
ATOM 5052 C CA    . ASP D 3 240 ? 64.003  60.644 47.157  1.00 57.84  ? 617 ASP M CA    1 
ATOM 5053 C C     . ASP D 3 240 ? 62.777  59.864 46.730  1.00 59.47  ? 617 ASP M C     1 
ATOM 5054 O O     . ASP D 3 240 ? 61.669  60.391 46.666  1.00 58.69  ? 617 ASP M O     1 
ATOM 5055 C CB    . ASP D 3 240 ? 64.700  61.017 45.862  1.00 60.92  ? 617 ASP M CB    1 
ATOM 5056 C CG    . ASP D 3 240 ? 65.301  62.356 45.895  1.00 63.91  ? 617 ASP M CG    1 
ATOM 5057 O OD1   . ASP D 3 240 ? 66.088  62.635 44.980  1.00 66.49  ? 617 ASP M OD1   1 
ATOM 5058 O OD2   . ASP D 3 240 ? 64.989  63.133 46.812  1.00 69.10  ? 617 ASP M OD2   1 
ATOM 5059 N N     . GLY D 3 241 ? 63.025  58.605 46.384  1.00 60.23  ? 618 GLY M N     1 
ATOM 5060 C CA    . GLY D 3 241 ? 61.985  57.731 45.905  1.00 62.44  ? 618 GLY M CA    1 
ATOM 5061 C C     . GLY D 3 241 ? 62.326  57.364 44.475  1.00 64.68  ? 618 GLY M C     1 
ATOM 5062 O O     . GLY D 3 241 ? 61.771  56.417 43.938  1.00 65.07  ? 618 GLY M O     1 
ATOM 5063 N N     . GLN D 3 242 ? 63.244  58.108 43.859  1.00 67.08  ? 619 GLN M N     1 
ATOM 5064 C CA    . GLN D 3 242 ? 63.648  57.846 42.479  1.00 69.00  ? 619 GLN M CA    1 
ATOM 5065 C C     . GLN D 3 242 ? 64.142  56.421 42.383  1.00 66.80  ? 619 GLN M C     1 
ATOM 5066 O O     . GLN D 3 242 ? 65.079  56.044 43.075  1.00 66.11  ? 619 GLN M O     1 
ATOM 5067 C CB    . GLN D 3 242 ? 64.815  58.728 42.034  1.00 76.04  ? 619 GLN M CB    1 
ATOM 5068 C CG    . GLN D 3 242 ? 64.815  60.183 42.448  1.00 85.33  ? 619 GLN M CG    1 
ATOM 5069 C CD    . GLN D 3 242 ? 66.156  60.855 42.112  1.00 89.96  ? 619 GLN M CD    1 
ATOM 5070 O OE1   . GLN D 3 242 ? 66.464  61.106 40.940  1.00 92.51  ? 619 GLN M OE1   1 
ATOM 5071 N NE2   . GLN D 3 242 ? 66.962  61.128 43.142  1.00 90.92  ? 619 GLN M NE2   1 
ATOM 5072 N N     . GLN D 3 243 ? 63.535  55.643 41.498  1.00 65.32  ? 620 GLN M N     1 
ATOM 5073 C CA    . GLN D 3 243 ? 63.921  54.247 41.305  1.00 63.26  ? 620 GLN M CA    1 
ATOM 5074 C C     . GLN D 3 243 ? 65.176  54.183 40.457  1.00 59.76  ? 620 GLN M C     1 
ATOM 5075 O O     . GLN D 3 243 ? 65.160  54.591 39.305  1.00 60.05  ? 620 GLN M O     1 
ATOM 5076 C CB    . GLN D 3 243 ? 62.787  53.493 40.618  1.00 65.36  ? 620 GLN M CB    1 
ATOM 5077 C CG    . GLN D 3 243 ? 63.018  52.019 40.457  1.00 68.42  ? 620 GLN M CG    1 
ATOM 5078 C CD    . GLN D 3 243 ? 61.741  51.298 40.110  1.00 70.60  ? 620 GLN M CD    1 
ATOM 5079 O OE1   . GLN D 3 243 ? 60.829  51.191 40.931  1.00 72.18  ? 620 GLN M OE1   1 
ATOM 5080 N NE2   . GLN D 3 243 ? 61.659  50.807 38.884  1.00 73.33  ? 620 GLN M NE2   1 
ATOM 5081 N N     . ILE D 3 244 ? 66.259  53.672 41.026  1.00 56.38  ? 621 ILE M N     1 
ATOM 5082 C CA    . ILE D 3 244 ? 67.520  53.589 40.311  1.00 52.94  ? 621 ILE M CA    1 
ATOM 5083 C C     . ILE D 3 244 ? 67.877  52.187 39.853  1.00 53.50  ? 621 ILE M C     1 
ATOM 5084 O O     . ILE D 3 244 ? 68.977  51.962 39.353  1.00 52.89  ? 621 ILE M O     1 
ATOM 5085 C CB    . ILE D 3 244 ? 68.662  54.108 41.169  1.00 51.07  ? 621 ILE M CB    1 
ATOM 5086 C CG1   . ILE D 3 244 ? 68.982  53.112 42.290  1.00 48.56  ? 621 ILE M CG1   1 
ATOM 5087 C CG2   . ILE D 3 244 ? 68.278  55.442 41.744  1.00 50.80  ? 621 ILE M CG2   1 
ATOM 5088 C CD1   . ILE D 3 244 ? 70.151  53.524 43.161  1.00 44.52  ? 621 ILE M CD1   1 
ATOM 5089 N N     . TRP D 3 245 ? 66.958  51.244 40.032  1.00 54.02  ? 622 TRP M N     1 
ATOM 5090 C CA    . TRP D 3 245 ? 67.190  49.867 39.599  1.00 54.40  ? 622 TRP M CA    1 
ATOM 5091 C C     . TRP D 3 245 ? 65.953  48.991 39.680  1.00 54.70  ? 622 TRP M C     1 
ATOM 5092 O O     . TRP D 3 245 ? 65.284  48.924 40.709  1.00 54.13  ? 622 TRP M O     1 
ATOM 5093 C CB    . TRP D 3 245 ? 68.304  49.216 40.408  1.00 53.13  ? 622 TRP M CB    1 
ATOM 5094 C CG    . TRP D 3 245 ? 68.587  47.816 39.960  1.00 52.29  ? 622 TRP M CG    1 
ATOM 5095 C CD1   . TRP D 3 245 ? 68.987  47.414 38.713  1.00 52.42  ? 622 TRP M CD1   1 
ATOM 5096 C CD2   . TRP D 3 245 ? 68.511  46.627 40.758  1.00 51.11  ? 622 TRP M CD2   1 
ATOM 5097 N NE1   . TRP D 3 245 ? 69.167  46.048 38.691  1.00 50.64  ? 622 TRP M NE1   1 
ATOM 5098 C CE2   . TRP D 3 245 ? 68.882  45.542 39.932  1.00 50.21  ? 622 TRP M CE2   1 
ATOM 5099 C CE3   . TRP D 3 245 ? 68.167  46.373 42.094  1.00 49.67  ? 622 TRP M CE3   1 
ATOM 5100 C CZ2   . TRP D 3 245 ? 68.917  44.222 40.401  1.00 50.08  ? 622 TRP M CZ2   1 
ATOM 5101 C CZ3   . TRP D 3 245 ? 68.203  45.055 42.558  1.00 48.21  ? 622 TRP M CZ3   1 
ATOM 5102 C CH2   . TRP D 3 245 ? 68.576  44.002 41.714  1.00 48.22  ? 622 TRP M CH2   1 
ATOM 5103 N N     . GLU D 3 246 ? 65.667  48.314 38.575  1.00 56.35  ? 623 GLU M N     1 
ATOM 5104 C CA    . GLU D 3 246 ? 64.518  47.430 38.487  1.00 58.71  ? 623 GLU M CA    1 
ATOM 5105 C C     . GLU D 3 246 ? 64.870  46.201 37.672  1.00 58.94  ? 623 GLU M C     1 
ATOM 5106 O O     . GLU D 3 246 ? 65.315  46.303 36.533  1.00 58.37  ? 623 GLU M O     1 
ATOM 5107 C CB    . GLU D 3 246 ? 63.339  48.145 37.828  1.00 60.55  ? 623 GLU M CB    1 
ATOM 5108 C CG    . GLU D 3 246 ? 62.097  47.271 37.654  1.00 62.92  ? 623 GLU M CG    1 
ATOM 5109 C CD    . GLU D 3 246 ? 60.980  47.993 36.914  1.00 65.12  ? 623 GLU M CD    1 
ATOM 5110 O OE1   . GLU D 3 246 ? 61.182  48.332 35.727  1.00 66.18  ? 623 GLU M OE1   1 
ATOM 5111 O OE2   . GLU D 3 246 ? 59.907  48.227 37.516  1.00 65.43  ? 623 GLU M OE2   1 
ATOM 5112 N N     . MET D 3 247 ? 64.671  45.034 38.263  1.00 59.88  ? 624 MET M N     1 
ATOM 5113 C CA    . MET D 3 247 ? 64.962  43.798 37.568  1.00 61.06  ? 624 MET M CA    1 
ATOM 5114 C C     . MET D 3 247 ? 63.886  42.772 37.886  1.00 61.62  ? 624 MET M C     1 
ATOM 5115 O O     . MET D 3 247 ? 63.580  42.533 39.058  1.00 62.40  ? 624 MET M O     1 
ATOM 5116 C CB    . MET D 3 247 ? 66.331  43.268 37.988  1.00 61.16  ? 624 MET M CB    1 
ATOM 5117 C CG    . MET D 3 247 ? 66.851  42.143 37.104  1.00 61.53  ? 624 MET M CG    1 
ATOM 5118 S SD    . MET D 3 247 ? 66.974  42.651 35.382  1.00 61.83  ? 624 MET M SD    1 
ATOM 5119 C CE    . MET D 3 247 ? 68.497  43.657 35.452  1.00 63.00  ? 624 MET M CE    1 
ATOM 5120 N N     . GLU D 3 248 ? 63.292  42.188 36.848  1.00 61.27  ? 625 GLU M N     1 
ATOM 5121 C CA    . GLU D 3 248 ? 62.278  41.178 37.064  1.00 62.30  ? 625 GLU M CA    1 
ATOM 5122 C C     . GLU D 3 248 ? 63.041  39.909 37.372  1.00 63.67  ? 625 GLU M C     1 
ATOM 5123 O O     . GLU D 3 248 ? 64.105  39.682 36.815  1.00 65.32  ? 625 GLU M O     1 
ATOM 5124 C CB    . GLU D 3 248 ? 61.416  40.986 35.819  1.00 62.25  ? 625 GLU M CB    1 
ATOM 5125 C CG    . GLU D 3 248 ? 60.444  39.810 35.944  1.00 63.96  ? 625 GLU M CG    1 
ATOM 5126 C CD    . GLU D 3 248 ? 59.348  39.808 34.884  1.00 65.56  ? 625 GLU M CD    1 
ATOM 5127 O OE1   . GLU D 3 248 ? 58.556  38.835 34.840  1.00 65.25  ? 625 GLU M OE1   1 
ATOM 5128 O OE2   . GLU D 3 248 ? 59.276  40.781 34.101  1.00 66.81  ? 625 GLU M OE2   1 
ATOM 5129 N N     . ALA D 3 249 ? 62.525  39.089 38.273  1.00 65.10  ? 626 ALA M N     1 
ATOM 5130 C CA    . ALA D 3 249 ? 63.208  37.852 38.617  1.00 67.22  ? 626 ALA M CA    1 
ATOM 5131 C C     . ALA D 3 249 ? 62.474  36.652 38.024  1.00 68.75  ? 626 ALA M C     1 
ATOM 5132 O O     . ALA D 3 249 ? 61.254  36.666 37.891  1.00 69.20  ? 626 ALA M O     1 
ATOM 5133 C CB    . ALA D 3 249 ? 63.310  37.717 40.131  1.00 67.73  ? 626 ALA M CB    1 
ATOM 5134 N N     . THR D 3 250 ? 63.226  35.616 37.672  1.00 70.94  ? 627 THR M N     1 
ATOM 5135 C CA    . THR D 3 250 ? 62.653  34.411 37.090  1.00 73.53  ? 627 THR M CA    1 
ATOM 5136 C C     . THR D 3 250 ? 61.955  33.517 38.116  1.00 76.55  ? 627 THR M C     1 
ATOM 5137 O O     . THR D 3 250 ? 62.464  33.289 39.211  1.00 76.45  ? 627 THR M O     1 
ATOM 5138 C CB    . THR D 3 250 ? 63.739  33.600 36.396  1.00 72.35  ? 627 THR M CB    1 
ATOM 5139 O OG1   . THR D 3 250 ? 64.276  34.364 35.313  1.00 72.96  ? 627 THR M OG1   1 
ATOM 5140 C CG2   . THR D 3 250 ? 63.175  32.308 35.866  1.00 73.44  ? 627 THR M CG2   1 
ATOM 5141 N N     . VAL D 3 251 ? 60.789  33.000 37.747  1.00 80.69  ? 628 VAL M N     1 
ATOM 5142 C CA    . VAL D 3 251 ? 60.025  32.127 38.634  1.00 84.93  ? 628 VAL M CA    1 
ATOM 5143 C C     . VAL D 3 251 ? 59.929  30.701 38.077  1.00 88.85  ? 628 VAL M C     1 
ATOM 5144 O O     . VAL D 3 251 ? 59.743  30.508 36.872  1.00 89.87  ? 628 VAL M O     1 
ATOM 5145 C CB    . VAL D 3 251 ? 58.598  32.670 38.835  1.00 83.83  ? 628 VAL M CB    1 
ATOM 5146 C CG1   . VAL D 3 251 ? 57.862  31.839 39.875  1.00 83.08  ? 628 VAL M CG1   1 
ATOM 5147 C CG2   . VAL D 3 251 ? 58.658  34.123 39.247  1.00 82.51  ? 628 VAL M CG2   1 
ATOM 5148 N N     . ASP D 3 252 ? 60.058  29.707 38.955  1.00 92.76  ? 629 ASP M N     1 
ATOM 5149 C CA    . ASP D 3 252 ? 59.975  28.307 38.542  1.00 97.55  ? 629 ASP M CA    1 
ATOM 5150 C C     . ASP D 3 252 ? 58.508  27.892 38.417  1.00 101.16 ? 629 ASP M C     1 
ATOM 5151 O O     . ASP D 3 252 ? 57.983  27.163 39.261  1.00 101.54 ? 629 ASP M O     1 
ATOM 5152 C CB    . ASP D 3 252 ? 60.682  27.410 39.565  1.00 97.56  ? 629 ASP M CB    1 
ATOM 5153 C CG    . ASP D 3 252 ? 60.836  25.974 39.081  1.00 97.93  ? 629 ASP M CG    1 
ATOM 5154 O OD1   . ASP D 3 252 ? 59.813  25.332 38.755  1.00 98.21  ? 629 ASP M OD1   1 
ATOM 5155 O OD2   . ASP D 3 252 ? 61.986  25.483 39.031  1.00 97.51  ? 629 ASP M OD2   1 
ATOM 5156 N N     . LYS D 3 253 ? 57.855  28.367 37.361  1.00 104.98 ? 630 LYS M N     1 
ATOM 5157 C CA    . LYS D 3 253 ? 56.452  28.068 37.108  1.00 108.08 ? 630 LYS M CA    1 
ATOM 5158 C C     . LYS D 3 253 ? 56.042  26.701 37.643  1.00 107.71 ? 630 LYS M C     1 
ATOM 5159 O O     . LYS D 3 253 ? 55.112  26.593 38.440  1.00 107.91 ? 630 LYS M O     1 
ATOM 5160 C CB    . LYS D 3 253 ? 56.177  28.134 35.607  1.00 112.37 ? 630 LYS M CB    1 
ATOM 5161 C CG    . LYS D 3 253 ? 56.472  29.490 34.981  1.00 118.94 ? 630 LYS M CG    1 
ATOM 5162 C CD    . LYS D 3 253 ? 55.529  30.577 35.498  1.00 124.09 ? 630 LYS M CD    1 
ATOM 5163 C CE    . LYS D 3 253 ? 54.097  30.376 35.011  1.00 126.74 ? 630 LYS M CE    1 
ATOM 5164 N NZ    . LYS D 3 253 ? 53.979  30.503 33.532  1.00 129.48 ? 630 LYS M NZ    1 
ATOM 5165 N N     . ASP D 3 254 ? 56.752  25.667 37.203  1.00 107.20 ? 631 ASP M N     1 
ATOM 5166 C CA    . ASP D 3 254 ? 56.486  24.286 37.606  1.00 106.38 ? 631 ASP M CA    1 
ATOM 5167 C C     . ASP D 3 254 ? 56.174  24.129 39.090  1.00 105.05 ? 631 ASP M C     1 
ATOM 5168 O O     . ASP D 3 254 ? 55.011  24.007 39.476  1.00 104.77 ? 631 ASP M O     1 
ATOM 5169 C CB    . ASP D 3 254 ? 57.683  23.406 37.251  1.00 107.39 ? 631 ASP M CB    1 
ATOM 5170 C CG    . ASP D 3 254 ? 58.073  23.520 35.795  1.00 108.75 ? 631 ASP M CG    1 
ATOM 5171 O OD1   . ASP D 3 254 ? 58.314  24.653 35.326  1.00 109.65 ? 631 ASP M OD1   1 
ATOM 5172 O OD2   . ASP D 3 254 ? 58.142  22.476 35.115  1.00 109.98 ? 631 ASP M OD2   1 
ATOM 5173 N N     . LYS D 3 255 ? 57.223  24.125 39.912  1.00 103.15 ? 632 LYS M N     1 
ATOM 5174 C CA    . LYS D 3 255 ? 57.095  23.973 41.364  1.00 100.76 ? 632 LYS M CA    1 
ATOM 5175 C C     . LYS D 3 255 ? 56.102  24.950 41.997  1.00 99.93  ? 632 LYS M C     1 
ATOM 5176 O O     . LYS D 3 255 ? 55.402  24.601 42.954  1.00 99.57  ? 632 LYS M O     1 
ATOM 5177 C CB    . LYS D 3 255 ? 58.456  24.161 42.039  1.00 99.28  ? 632 LYS M CB    1 
ATOM 5178 C CG    . LYS D 3 255 ? 59.533  23.185 41.615  1.00 98.55  ? 632 LYS M CG    1 
ATOM 5179 C CD    . LYS D 3 255 ? 60.772  23.388 42.480  1.00 99.49  ? 632 LYS M CD    1 
ATOM 5180 C CE    . LYS D 3 255 ? 61.858  22.357 42.204  1.00 99.46  ? 632 LYS M CE    1 
ATOM 5181 N NZ    . LYS D 3 255 ? 62.475  22.532 40.862  1.00 100.47 ? 632 LYS M NZ    1 
ATOM 5182 N N     . SER D 3 256 ? 56.053  26.170 41.464  1.00 98.75  ? 633 SER M N     1 
ATOM 5183 C CA    . SER D 3 256 ? 55.166  27.213 41.975  1.00 97.73  ? 633 SER M CA    1 
ATOM 5184 C C     . SER D 3 256 ? 53.774  26.733 42.385  1.00 96.98  ? 633 SER M C     1 
ATOM 5185 O O     . SER D 3 256 ? 53.097  26.016 41.651  1.00 96.56  ? 633 SER M O     1 
ATOM 5186 C CB    . SER D 3 256 ? 55.048  28.351 40.957  1.00 97.12  ? 633 SER M CB    1 
ATOM 5187 O OG    . SER D 3 256 ? 56.218  29.152 40.970  1.00 96.26  ? 633 SER M OG    1 
ATOM 5188 N N     . GLN D 3 257 ? 53.363  27.151 43.576  1.00 96.33  ? 634 GLN M N     1 
ATOM 5189 C CA    . GLN D 3 257 ? 52.073  26.785 44.132  1.00 95.94  ? 634 GLN M CA    1 
ATOM 5190 C C     . GLN D 3 257 ? 51.396  27.995 44.757  1.00 94.74  ? 634 GLN M C     1 
ATOM 5191 O O     . GLN D 3 257 ? 51.983  29.067 44.848  1.00 95.18  ? 634 GLN M O     1 
ATOM 5192 C CB    . GLN D 3 257 ? 52.264  25.710 45.191  1.00 97.66  ? 634 GLN M CB    1 
ATOM 5193 C CG    . GLN D 3 257 ? 52.667  24.369 44.644  1.00 99.89  ? 634 GLN M CG    1 
ATOM 5194 C CD    . GLN D 3 257 ? 52.881  23.370 45.749  1.00 101.97 ? 634 GLN M CD    1 
ATOM 5195 O OE1   . GLN D 3 257 ? 52.931  22.162 45.511  1.00 103.69 ? 634 GLN M OE1   1 
ATOM 5196 N NE2   . GLN D 3 257 ? 53.017  23.869 46.977  1.00 102.44 ? 634 GLN M NE2   1 
ATOM 5197 N N     . PRO D 3 258 ? 50.145  27.835 45.204  1.00 93.55  ? 635 PRO M N     1 
ATOM 5198 C CA    . PRO D 3 258 ? 49.395  28.926 45.822  1.00 92.90  ? 635 PRO M CA    1 
ATOM 5199 C C     . PRO D 3 258 ? 50.084  29.570 47.016  1.00 92.20  ? 635 PRO M C     1 
ATOM 5200 O O     . PRO D 3 258 ? 50.053  30.789 47.169  1.00 92.37  ? 635 PRO M O     1 
ATOM 5201 C CB    . PRO D 3 258 ? 48.088  28.253 46.217  1.00 93.25  ? 635 PRO M CB    1 
ATOM 5202 C CG    . PRO D 3 258 ? 47.897  27.269 45.130  1.00 93.36  ? 635 PRO M CG    1 
ATOM 5203 C CD    . PRO D 3 258 ? 49.273  26.666 45.001  1.00 93.84  ? 635 PRO M CD    1 
ATOM 5204 N N     . ASN D 3 259 ? 50.707  28.753 47.858  1.00 91.23  ? 636 ASN M N     1 
ATOM 5205 C CA    . ASN D 3 259 ? 51.366  29.268 49.055  1.00 90.66  ? 636 ASN M CA    1 
ATOM 5206 C C     . ASN D 3 259 ? 52.885  29.378 48.982  1.00 88.71  ? 636 ASN M C     1 
ATOM 5207 O O     . ASN D 3 259 ? 53.517  29.945 49.876  1.00 88.61  ? 636 ASN M O     1 
ATOM 5208 C CB    . ASN D 3 259 ? 50.986  28.412 50.263  1.00 92.48  ? 636 ASN M CB    1 
ATOM 5209 C CG    . ASN D 3 259 ? 51.315  26.948 50.065  1.00 94.47  ? 636 ASN M CG    1 
ATOM 5210 O OD1   . ASN D 3 259 ? 51.268  26.166 51.012  1.00 94.96  ? 636 ASN M OD1   1 
ATOM 5211 N ND2   . ASN D 3 259 ? 51.642  26.564 48.829  1.00 95.16  ? 636 ASN M ND2   1 
ATOM 5212 N N     . MET D 3 260 ? 53.476  28.837 47.927  1.00 86.24  ? 637 MET M N     1 
ATOM 5213 C CA    . MET D 3 260 ? 54.921  28.899 47.785  1.00 83.66  ? 637 MET M CA    1 
ATOM 5214 C C     . MET D 3 260 ? 55.350  29.427 46.432  1.00 80.51  ? 637 MET M C     1 
ATOM 5215 O O     . MET D 3 260 ? 54.661  29.242 45.434  1.00 79.97  ? 637 MET M O     1 
ATOM 5216 C CB    . MET D 3 260 ? 55.532  27.522 48.000  1.00 86.20  ? 637 MET M CB    1 
ATOM 5217 C CG    . MET D 3 260 ? 55.349  26.981 49.394  1.00 88.71  ? 637 MET M CG    1 
ATOM 5218 S SD    . MET D 3 260 ? 56.378  25.534 49.624  1.00 91.77  ? 637 MET M SD    1 
ATOM 5219 C CE    . MET D 3 260 ? 57.868  26.289 50.276  1.00 91.40  ? 637 MET M CE    1 
ATOM 5220 N N     . LEU D 3 261 ? 56.504  30.079 46.401  1.00 76.86  ? 638 LEU M N     1 
ATOM 5221 C CA    . LEU D 3 261 ? 57.008  30.631 45.157  1.00 73.87  ? 638 LEU M CA    1 
ATOM 5222 C C     . LEU D 3 261 ? 58.503  30.374 45.009  1.00 72.58  ? 638 LEU M C     1 
ATOM 5223 O O     . LEU D 3 261 ? 59.269  30.528 45.968  1.00 71.66  ? 638 LEU M O     1 
ATOM 5224 C CB    . LEU D 3 261 ? 56.723  32.129 45.108  1.00 71.40  ? 638 LEU M CB    1 
ATOM 5225 C CG    . LEU D 3 261 ? 56.058  32.608 43.826  1.00 67.89  ? 638 LEU M CG    1 
ATOM 5226 C CD1   . LEU D 3 261 ? 54.771  31.853 43.616  1.00 66.37  ? 638 LEU M CD1   1 
ATOM 5227 C CD2   . LEU D 3 261 ? 55.796  34.090 43.927  1.00 68.04  ? 638 LEU M CD2   1 
ATOM 5228 N N     . PHE D 3 262 ? 58.904  29.978 43.802  1.00 70.50  ? 639 PHE M N     1 
ATOM 5229 C CA    . PHE D 3 262 ? 60.299  29.685 43.520  1.00 68.85  ? 639 PHE M CA    1 
ATOM 5230 C C     . PHE D 3 262 ? 60.856  30.682 42.541  1.00 66.19  ? 639 PHE M C     1 
ATOM 5231 O O     . PHE D 3 262 ? 60.464  30.708 41.382  1.00 66.63  ? 639 PHE M O     1 
ATOM 5232 C CB    . PHE D 3 262 ? 60.443  28.272 42.955  1.00 72.22  ? 639 PHE M CB    1 
ATOM 5233 C CG    . PHE D 3 262 ? 59.967  27.202 43.892  1.00 75.74  ? 639 PHE M CG    1 
ATOM 5234 C CD1   . PHE D 3 262 ? 58.608  26.949 44.047  1.00 77.33  ? 639 PHE M CD1   1 
ATOM 5235 C CD2   . PHE D 3 262 ? 60.874  26.480 44.660  1.00 76.53  ? 639 PHE M CD2   1 
ATOM 5236 C CE1   . PHE D 3 262 ? 58.160  25.994 44.957  1.00 78.05  ? 639 PHE M CE1   1 
ATOM 5237 C CE2   . PHE D 3 262 ? 60.435  25.525 45.570  1.00 77.47  ? 639 PHE M CE2   1 
ATOM 5238 C CZ    . PHE D 3 262 ? 59.076  25.283 45.720  1.00 77.78  ? 639 PHE M CZ    1 
ATOM 5239 N N     . VAL D 3 263 ? 61.790  31.496 43.006  1.00 63.58  ? 640 VAL M N     1 
ATOM 5240 C CA    . VAL D 3 263 ? 62.381  32.510 42.154  1.00 61.70  ? 640 VAL M CA    1 
ATOM 5241 C C     . VAL D 3 263 ? 63.892  32.363 42.047  1.00 60.88  ? 640 VAL M C     1 
ATOM 5242 O O     . VAL D 3 263 ? 64.527  31.689 42.858  1.00 60.06  ? 640 VAL M O     1 
ATOM 5243 C CB    . VAL D 3 263 ? 62.084  33.909 42.701  1.00 61.38  ? 640 VAL M CB    1 
ATOM 5244 C CG1   . VAL D 3 263 ? 62.205  34.941 41.593  1.00 60.86  ? 640 VAL M CG1   1 
ATOM 5245 C CG2   . VAL D 3 263 ? 60.709  33.931 43.336  1.00 61.66  ? 640 VAL M CG2   1 
ATOM 5246 N N     . GLU D 3 264 ? 64.460  32.991 41.026  1.00 59.54  ? 641 GLU M N     1 
ATOM 5247 C CA    . GLU D 3 264 ? 65.892  32.970 40.839  1.00 58.78  ? 641 GLU M CA    1 
ATOM 5248 C C     . GLU D 3 264 ? 66.402  34.392 41.036  1.00 58.09  ? 641 GLU M C     1 
ATOM 5249 O O     . GLU D 3 264 ? 66.288  35.242 40.143  1.00 57.94  ? 641 GLU M O     1 
ATOM 5250 C CB    . GLU D 3 264 ? 66.273  32.488 39.444  1.00 61.27  ? 641 GLU M CB    1 
ATOM 5251 C CG    . GLU D 3 264 ? 67.787  32.519 39.216  1.00 65.32  ? 641 GLU M CG    1 
ATOM 5252 C CD    . GLU D 3 264 ? 68.196  32.423 37.747  1.00 68.03  ? 641 GLU M CD    1 
ATOM 5253 O OE1   . GLU D 3 264 ? 67.607  33.167 36.922  1.00 69.70  ? 641 GLU M OE1   1 
ATOM 5254 O OE2   . GLU D 3 264 ? 69.116  31.624 37.428  1.00 67.77  ? 641 GLU M OE2   1 
ATOM 5255 N N     . ILE D 3 265 ? 66.945  34.631 42.228  1.00 56.66  ? 642 ILE M N     1 
ATOM 5256 C CA    . ILE D 3 265 ? 67.515  35.912 42.616  1.00 54.83  ? 642 ILE M CA    1 
ATOM 5257 C C     . ILE D 3 265 ? 68.362  36.444 41.489  1.00 54.39  ? 642 ILE M C     1 
ATOM 5258 O O     . ILE D 3 265 ? 69.366  35.856 41.124  1.00 53.97  ? 642 ILE M O     1 
ATOM 5259 C CB    . ILE D 3 265 ? 68.419  35.765 43.845  1.00 55.16  ? 642 ILE M CB    1 
ATOM 5260 C CG1   . ILE D 3 265 ? 67.601  35.254 45.034  1.00 56.10  ? 642 ILE M CG1   1 
ATOM 5261 C CG2   . ILE D 3 265 ? 69.076  37.098 44.169  1.00 54.66  ? 642 ILE M CG2   1 
ATOM 5262 C CD1   . ILE D 3 265 ? 68.439  34.916 46.268  1.00 56.94  ? 642 ILE M CD1   1 
ATOM 5263 N N     . PRO D 3 266 ? 67.980  37.584 40.936  1.00 55.62  ? 643 PRO M N     1 
ATOM 5264 C CA    . PRO D 3 266 ? 68.753  38.151 39.838  1.00 58.25  ? 643 PRO M CA    1 
ATOM 5265 C C     . PRO D 3 266 ? 70.155  38.613 40.217  1.00 61.11  ? 643 PRO M C     1 
ATOM 5266 O O     . PRO D 3 266 ? 70.525  38.685 41.388  1.00 61.42  ? 643 PRO M O     1 
ATOM 5267 C CB    . PRO D 3 266 ? 67.879  39.307 39.379  1.00 57.97  ? 643 PRO M CB    1 
ATOM 5268 C CG    . PRO D 3 266 ? 67.298  39.787 40.675  1.00 57.08  ? 643 PRO M CG    1 
ATOM 5269 C CD    . PRO D 3 266 ? 66.902  38.494 41.355  1.00 56.00  ? 643 PRO M CD    1 
ATOM 5270 N N     . GLU D 3 267 ? 70.930  38.916 39.188  1.00 64.62  ? 644 GLU M N     1 
ATOM 5271 C CA    . GLU D 3 267 ? 72.283  39.413 39.331  1.00 68.00  ? 644 GLU M CA    1 
ATOM 5272 C C     . GLU D 3 267 ? 72.071  40.874 39.735  1.00 66.84  ? 644 GLU M C     1 
ATOM 5273 O O     . GLU D 3 267 ? 71.140  41.509 39.248  1.00 67.06  ? 644 GLU M O     1 
ATOM 5274 C CB    . GLU D 3 267 ? 72.957  39.325 37.962  1.00 74.18  ? 644 GLU M CB    1 
ATOM 5275 C CG    . GLU D 3 267 ? 74.382  39.807 37.879  1.00 84.66  ? 644 GLU M CG    1 
ATOM 5276 C CD    . GLU D 3 267 ? 74.830  39.982 36.438  1.00 89.85  ? 644 GLU M CD    1 
ATOM 5277 O OE1   . GLU D 3 267 ? 74.574  39.067 35.628  1.00 92.88  ? 644 GLU M OE1   1 
ATOM 5278 O OE2   . GLU D 3 267 ? 75.437  41.029 36.118  1.00 93.61  ? 644 GLU M OE2   1 
ATOM 5279 N N     . TYR D 3 268 ? 72.896  41.413 40.628  1.00 65.30  ? 645 TYR M N     1 
ATOM 5280 C CA    . TYR D 3 268 ? 72.729  42.813 41.016  1.00 63.50  ? 645 TYR M CA    1 
ATOM 5281 C C     . TYR D 3 268 ? 73.329  43.708 39.933  1.00 64.11  ? 645 TYR M C     1 
ATOM 5282 O O     . TYR D 3 268 ? 74.222  43.285 39.205  1.00 64.23  ? 645 TYR M O     1 
ATOM 5283 C CB    . TYR D 3 268 ? 73.392  43.097 42.360  1.00 60.06  ? 645 TYR M CB    1 
ATOM 5284 C CG    . TYR D 3 268 ? 73.209  44.528 42.783  1.00 57.73  ? 645 TYR M CG    1 
ATOM 5285 C CD1   . TYR D 3 268 ? 71.947  45.038 43.053  1.00 57.15  ? 645 TYR M CD1   1 
ATOM 5286 C CD2   . TYR D 3 268 ? 74.295  45.390 42.872  1.00 57.11  ? 645 TYR M CD2   1 
ATOM 5287 C CE1   . TYR D 3 268 ? 71.772  46.379 43.401  1.00 56.78  ? 645 TYR M CE1   1 
ATOM 5288 C CE2   . TYR D 3 268 ? 74.131  46.725 43.216  1.00 55.00  ? 645 TYR M CE2   1 
ATOM 5289 C CZ    . TYR D 3 268 ? 72.872  47.213 43.480  1.00 55.24  ? 645 TYR M CZ    1 
ATOM 5290 O OH    . TYR D 3 268 ? 72.721  48.534 43.826  1.00 54.91  ? 645 TYR M OH    1 
ATOM 5291 N N     . ARG D 3 269 ? 72.857  44.946 39.827  1.00 65.55  ? 646 ARG M N     1 
ATOM 5292 C CA    . ARG D 3 269 ? 73.342  45.836 38.779  1.00 67.82  ? 646 ARG M CA    1 
ATOM 5293 C C     . ARG D 3 269 ? 74.838  46.151 38.764  1.00 68.62  ? 646 ARG M C     1 
ATOM 5294 O O     . ARG D 3 269 ? 75.403  46.396 37.698  1.00 68.05  ? 646 ARG M O     1 
ATOM 5295 C CB    . ARG D 3 269 ? 72.530  47.132 38.772  1.00 69.93  ? 646 ARG M CB    1 
ATOM 5296 C CG    . ARG D 3 269 ? 72.726  48.026 39.968  1.00 74.03  ? 646 ARG M CG    1 
ATOM 5297 C CD    . ARG D 3 269 ? 71.829  49.245 39.861  1.00 77.31  ? 646 ARG M CD    1 
ATOM 5298 N NE    . ARG D 3 269 ? 72.049  50.179 40.960  1.00 81.01  ? 646 ARG M NE    1 
ATOM 5299 C CZ    . ARG D 3 269 ? 73.121  50.955 41.077  1.00 82.06  ? 646 ARG M CZ    1 
ATOM 5300 N NH1   . ARG D 3 269 ? 74.077  50.910 40.158  1.00 82.92  ? 646 ARG M NH1   1 
ATOM 5301 N NH2   . ARG D 3 269 ? 73.237  51.773 42.113  1.00 83.48  ? 646 ARG M NH2   1 
ATOM 5302 N N     . ASN D 3 270 ? 75.486  46.145 39.923  1.00 70.46  ? 647 ASN M N     1 
ATOM 5303 C CA    . ASN D 3 270 ? 76.922  46.420 39.969  1.00 73.22  ? 647 ASN M CA    1 
ATOM 5304 C C     . ASN D 3 270 ? 77.692  45.229 40.514  1.00 76.28  ? 647 ASN M C     1 
ATOM 5305 O O     . ASN D 3 270 ? 77.749  45.006 41.723  1.00 76.68  ? 647 ASN M O     1 
ATOM 5306 C CB    . ASN D 3 270 ? 77.228  47.639 40.837  1.00 71.93  ? 647 ASN M CB    1 
ATOM 5307 C CG    . ASN D 3 270 ? 78.703  48.009 40.824  1.00 70.66  ? 647 ASN M CG    1 
ATOM 5308 O OD1   . ASN D 3 270 ? 79.568  47.144 40.915  1.00 70.99  ? 647 ASN M OD1   1 
ATOM 5309 N ND2   . ASN D 3 270 ? 78.993  49.298 40.724  1.00 70.07  ? 647 ASN M ND2   1 
ATOM 5310 N N     . LYS D 3 271 ? 78.296  44.476 39.604  1.00 80.38  ? 648 LYS M N     1 
ATOM 5311 C CA    . LYS D 3 271 ? 79.073  43.295 39.950  1.00 83.80  ? 648 LYS M CA    1 
ATOM 5312 C C     . LYS D 3 271 ? 80.055  43.532 41.099  1.00 83.37  ? 648 LYS M C     1 
ATOM 5313 O O     . LYS D 3 271 ? 80.005  42.846 42.119  1.00 83.02  ? 648 LYS M O     1 
ATOM 5314 C CB    . LYS D 3 271 ? 79.843  42.812 38.710  1.00 88.81  ? 648 LYS M CB    1 
ATOM 5315 C CG    . LYS D 3 271 ? 78.972  42.483 37.487  1.00 94.63  ? 648 LYS M CG    1 
ATOM 5316 C CD    . LYS D 3 271 ? 78.373  41.083 37.566  1.00 99.51  ? 648 LYS M CD    1 
ATOM 5317 C CE    . LYS D 3 271 ? 77.485  40.908 38.786  1.00 101.97 ? 648 LYS M CE    1 
ATOM 5318 N NZ    . LYS D 3 271 ? 77.090  39.489 38.961  1.00 105.65 ? 648 LYS M NZ    1 
ATOM 5319 N N     . HIS D 3 272 ? 80.936  44.515 40.932  1.00 83.12  ? 649 HIS M N     1 
ATOM 5320 C CA    . HIS D 3 272 ? 81.955  44.822 41.933  1.00 82.84  ? 649 HIS M CA    1 
ATOM 5321 C C     . HIS D 3 272 ? 81.625  45.858 42.998  1.00 81.47  ? 649 HIS M C     1 
ATOM 5322 O O     . HIS D 3 272 ? 81.845  47.043 42.798  1.00 81.66  ? 649 HIS M O     1 
ATOM 5323 C CB    . HIS D 3 272 ? 83.260  45.228 41.234  1.00 84.30  ? 649 HIS M CB    1 
ATOM 5324 C CG    . HIS D 3 272 ? 83.074  45.743 39.841  1.00 85.85  ? 649 HIS M CG    1 
ATOM 5325 N ND1   . HIS D 3 272 ? 82.297  46.843 39.549  1.00 86.92  ? 649 HIS M ND1   1 
ATOM 5326 C CD2   . HIS D 3 272 ? 83.574  45.312 38.657  1.00 87.01  ? 649 HIS M CD2   1 
ATOM 5327 C CE1   . HIS D 3 272 ? 82.327  47.068 38.247  1.00 87.47  ? 649 HIS M CE1   1 
ATOM 5328 N NE2   . HIS D 3 272 ? 83.096  46.154 37.683  1.00 86.93  ? 649 HIS M NE2   1 
ATOM 5329 N N     . ILE D 3 273 ? 81.121  45.398 44.139  1.00 80.56  ? 650 ILE M N     1 
ATOM 5330 C CA    . ILE D 3 273 ? 80.781  46.280 45.254  1.00 80.10  ? 650 ILE M CA    1 
ATOM 5331 C C     . ILE D 3 273 ? 81.555  45.793 46.471  1.00 81.83  ? 650 ILE M C     1 
ATOM 5332 O O     . ILE D 3 273 ? 81.876  44.614 46.563  1.00 83.11  ? 650 ILE M O     1 
ATOM 5333 C CB    . ILE D 3 273 ? 79.266  46.233 45.590  1.00 77.59  ? 650 ILE M CB    1 
ATOM 5334 C CG1   . ILE D 3 273 ? 78.906  44.887 46.222  1.00 75.37  ? 650 ILE M CG1   1 
ATOM 5335 C CG2   . ILE D 3 273 ? 78.446  46.439 44.331  1.00 76.61  ? 650 ILE M CG2   1 
ATOM 5336 C CD1   . ILE D 3 273 ? 77.448  44.741 46.569  1.00 71.97  ? 650 ILE M CD1   1 
ATOM 5337 N N     . ARG D 3 274 ? 81.850  46.681 47.409  1.00 83.29  ? 651 ARG M N     1 
ATOM 5338 C CA    . ARG D 3 274 ? 82.596  46.275 48.589  1.00 85.69  ? 651 ARG M CA    1 
ATOM 5339 C C     . ARG D 3 274 ? 81.727  46.344 49.831  1.00 84.19  ? 651 ARG M C     1 
ATOM 5340 O O     . ARG D 3 274 ? 82.059  45.770 50.867  1.00 84.04  ? 651 ARG M O     1 
ATOM 5341 C CB    . ARG D 3 274 ? 83.802  47.184 48.777  1.00 92.20  ? 651 ARG M CB    1 
ATOM 5342 C CG    . ARG D 3 274 ? 84.622  47.393 47.527  1.00 101.26 ? 651 ARG M CG    1 
ATOM 5343 C CD    . ARG D 3 274 ? 85.181  46.090 47.022  1.00 109.11 ? 651 ARG M CD    1 
ATOM 5344 N NE    . ARG D 3 274 ? 86.237  46.304 46.043  1.00 116.48 ? 651 ARG M NE    1 
ATOM 5345 C CZ    . ARG D 3 274 ? 86.964  45.325 45.518  1.00 120.96 ? 651 ARG M CZ    1 
ATOM 5346 N NH1   . ARG D 3 274 ? 86.743  44.067 45.877  1.00 123.93 ? 651 ARG M NH1   1 
ATOM 5347 N NH2   . ARG D 3 274 ? 87.919  45.601 44.642  1.00 124.24 ? 651 ARG M NH2   1 
ATOM 5348 N N     . THR D 3 275 ? 80.616  47.062 49.721  1.00 81.84  ? 652 THR M N     1 
ATOM 5349 C CA    . THR D 3 275 ? 79.696  47.231 50.837  1.00 78.97  ? 652 THR M CA    1 
ATOM 5350 C C     . THR D 3 275 ? 78.390  46.521 50.537  1.00 76.15  ? 652 THR M C     1 
ATOM 5351 O O     . THR D 3 275 ? 77.945  46.487 49.396  1.00 76.38  ? 652 THR M O     1 
ATOM 5352 C CB    . THR D 3 275 ? 79.383  48.727 51.076  1.00 79.69  ? 652 THR M CB    1 
ATOM 5353 O OG1   . THR D 3 275 ? 80.604  49.440 51.295  1.00 80.35  ? 652 THR M OG1   1 
ATOM 5354 C CG2   . THR D 3 275 ? 78.466  48.909 52.285  1.00 80.08  ? 652 THR M CG2   1 
ATOM 5355 N N     . PRO D 3 276 ? 77.761  45.932 51.559  1.00 72.86  ? 653 PRO M N     1 
ATOM 5356 C CA    . PRO D 3 276 ? 76.496  45.245 51.320  1.00 70.35  ? 653 PRO M CA    1 
ATOM 5357 C C     . PRO D 3 276 ? 75.492  46.248 50.781  1.00 68.21  ? 653 PRO M C     1 
ATOM 5358 O O     . PRO D 3 276 ? 75.430  47.377 51.254  1.00 67.59  ? 653 PRO M O     1 
ATOM 5359 C CB    . PRO D 3 276 ? 76.106  44.755 52.705  1.00 70.55  ? 653 PRO M CB    1 
ATOM 5360 C CG    . PRO D 3 276 ? 77.415  44.522 53.354  1.00 71.37  ? 653 PRO M CG    1 
ATOM 5361 C CD    . PRO D 3 276 ? 78.204  45.737 52.947  1.00 71.88  ? 653 PRO M CD    1 
ATOM 5362 N N     . VAL D 3 277 ? 74.724  45.839 49.779  1.00 66.29  ? 654 VAL M N     1 
ATOM 5363 C CA    . VAL D 3 277 ? 73.703  46.699 49.197  1.00 63.60  ? 654 VAL M CA    1 
ATOM 5364 C C     . VAL D 3 277 ? 72.330  46.156 49.602  1.00 63.48  ? 654 VAL M C     1 
ATOM 5365 O O     . VAL D 3 277 ? 72.048  44.962 49.476  1.00 62.65  ? 654 VAL M O     1 
ATOM 5366 C CB    . VAL D 3 277 ? 73.820  46.750 47.655  1.00 61.59  ? 654 VAL M CB    1 
ATOM 5367 C CG1   . VAL D 3 277 ? 72.648  47.515 47.059  1.00 61.39  ? 654 VAL M CG1   1 
ATOM 5368 C CG2   . VAL D 3 277 ? 75.124  47.413 47.264  1.00 59.95  ? 654 VAL M CG2   1 
ATOM 5369 N N     . LYS D 3 278 ? 71.484  47.039 50.109  1.00 63.00  ? 655 LYS M N     1 
ATOM 5370 C CA    . LYS D 3 278 ? 70.163  46.639 50.536  1.00 63.35  ? 655 LYS M CA    1 
ATOM 5371 C C     . LYS D 3 278 ? 69.141  46.982 49.443  1.00 59.53  ? 655 LYS M C     1 
ATOM 5372 O O     . LYS D 3 278 ? 68.984  48.135 49.061  1.00 58.38  ? 655 LYS M O     1 
ATOM 5373 C CB    . LYS D 3 278 ? 69.846  47.334 51.864  1.00 68.83  ? 655 LYS M CB    1 
ATOM 5374 C CG    . LYS D 3 278 ? 68.661  46.746 52.615  1.00 80.12  ? 655 LYS M CG    1 
ATOM 5375 C CD    . LYS D 3 278 ? 68.890  46.716 54.139  1.00 87.71  ? 655 LYS M CD    1 
ATOM 5376 C CE    . LYS D 3 278 ? 69.125  48.110 54.733  1.00 92.34  ? 655 LYS M CE    1 
ATOM 5377 N NZ    . LYS D 3 278 ? 69.140  48.122 56.231  1.00 95.80  ? 655 LYS M NZ    1 
ATOM 5378 N N     . VAL D 3 279 ? 68.466  45.968 48.917  1.00 56.43  ? 656 VAL M N     1 
ATOM 5379 C CA    . VAL D 3 279 ? 67.477  46.195 47.871  1.00 52.60  ? 656 VAL M CA    1 
ATOM 5380 C C     . VAL D 3 279 ? 66.094  45.735 48.278  1.00 51.57  ? 656 VAL M C     1 
ATOM 5381 O O     . VAL D 3 279 ? 65.866  45.321 49.415  1.00 51.35  ? 656 VAL M O     1 
ATOM 5382 C CB    . VAL D 3 279 ? 67.863  45.506 46.542  1.00 50.75  ? 656 VAL M CB    1 
ATOM 5383 C CG1   . VAL D 3 279 ? 69.046  46.219 45.920  1.00 49.50  ? 656 VAL M CG1   1 
ATOM 5384 C CG2   . VAL D 3 279 ? 68.193  44.048 46.778  1.00 48.50  ? 656 VAL M CG2   1 
ATOM 5385 N N     . ASN D 3 280 ? 65.174  45.808 47.330  1.00 50.20  ? 657 ASN M N     1 
ATOM 5386 C CA    . ASN D 3 280 ? 63.787  45.454 47.574  1.00 51.53  ? 657 ASN M CA    1 
ATOM 5387 C C     . ASN D 3 280 ? 63.237  44.505 46.525  1.00 52.32  ? 657 ASN M C     1 
ATOM 5388 O O     . ASN D 3 280 ? 63.814  44.344 45.448  1.00 53.12  ? 657 ASN M O     1 
ATOM 5389 C CB    . ASN D 3 280 ? 62.922  46.719 47.534  1.00 52.26  ? 657 ASN M CB    1 
ATOM 5390 C CG    . ASN D 3 280 ? 62.922  47.483 48.827  1.00 51.55  ? 657 ASN M CG    1 
ATOM 5391 O OD1   . ASN D 3 280 ? 62.533  48.649 48.856  1.00 50.44  ? 657 ASN M OD1   1 
ATOM 5392 N ND2   . ASN D 3 280 ? 63.331  46.832 49.909  1.00 52.75  ? 657 ASN M ND2   1 
ATOM 5393 N N     . PHE D 3 281 ? 62.093  43.902 46.838  1.00 52.02  ? 658 PHE M N     1 
ATOM 5394 C CA    . PHE D 3 281 ? 61.420  43.027 45.897  1.00 51.39  ? 658 PHE M CA    1 
ATOM 5395 C C     . PHE D 3 281 ? 59.983  42.808 46.342  1.00 52.07  ? 658 PHE M C     1 
ATOM 5396 O O     . PHE D 3 281 ? 59.667  42.956 47.522  1.00 52.25  ? 658 PHE M O     1 
ATOM 5397 C CB    . PHE D 3 281 ? 62.160  41.696 45.770  1.00 49.95  ? 658 PHE M CB    1 
ATOM 5398 C CG    . PHE D 3 281 ? 61.877  40.725 46.876  1.00 49.64  ? 658 PHE M CG    1 
ATOM 5399 C CD1   . PHE D 3 281 ? 60.653  40.066 46.948  1.00 48.91  ? 658 PHE M CD1   1 
ATOM 5400 C CD2   . PHE D 3 281 ? 62.854  40.429 47.819  1.00 51.48  ? 658 PHE M CD2   1 
ATOM 5401 C CE1   . PHE D 3 281 ? 60.400  39.125 47.934  1.00 49.39  ? 658 PHE M CE1   1 
ATOM 5402 C CE2   . PHE D 3 281 ? 62.621  39.488 48.818  1.00 51.61  ? 658 PHE M CE2   1 
ATOM 5403 C CZ    . PHE D 3 281 ? 61.386  38.831 48.874  1.00 51.83  ? 658 PHE M CZ    1 
ATOM 5404 N N     . TYR D 3 282 ? 59.118  42.477 45.384  1.00 52.82  ? 659 TYR M N     1 
ATOM 5405 C CA    . TYR D 3 282 ? 57.702  42.207 45.653  1.00 51.20  ? 659 TYR M CA    1 
ATOM 5406 C C     . TYR D 3 282 ? 57.095  41.302 44.584  1.00 49.94  ? 659 TYR M C     1 
ATOM 5407 O O     . TYR D 3 282 ? 57.579  41.243 43.460  1.00 47.97  ? 659 TYR M O     1 
ATOM 5408 C CB    . TYR D 3 282 ? 56.916  43.516 45.720  1.00 51.92  ? 659 TYR M CB    1 
ATOM 5409 C CG    . TYR D 3 282 ? 56.895  44.274 44.418  1.00 51.55  ? 659 TYR M CG    1 
ATOM 5410 C CD1   . TYR D 3 282 ? 55.934  44.007 43.451  1.00 51.06  ? 659 TYR M CD1   1 
ATOM 5411 C CD2   . TYR D 3 282 ? 57.858  45.242 44.142  1.00 50.96  ? 659 TYR M CD2   1 
ATOM 5412 C CE1   . TYR D 3 282 ? 55.934  44.686 42.235  1.00 50.95  ? 659 TYR M CE1   1 
ATOM 5413 C CE2   . TYR D 3 282 ? 57.865  45.922 42.935  1.00 50.58  ? 659 TYR M CE2   1 
ATOM 5414 C CZ    . TYR D 3 282 ? 56.904  45.640 41.984  1.00 50.19  ? 659 TYR M CZ    1 
ATOM 5415 O OH    . TYR D 3 282 ? 56.930  46.295 40.772  1.00 50.45  ? 659 TYR M OH    1 
ATOM 5416 N N     . VAL D 3 283 ? 56.042  40.589 44.957  1.00 51.13  ? 660 VAL M N     1 
ATOM 5417 C CA    . VAL D 3 283 ? 55.348  39.691 44.047  1.00 53.03  ? 660 VAL M CA    1 
ATOM 5418 C C     . VAL D 3 283 ? 54.187  40.497 43.487  1.00 54.21  ? 660 VAL M C     1 
ATOM 5419 O O     . VAL D 3 283 ? 53.701  41.409 44.155  1.00 55.13  ? 660 VAL M O     1 
ATOM 5420 C CB    . VAL D 3 283 ? 54.780  38.471 44.788  1.00 53.32  ? 660 VAL M CB    1 
ATOM 5421 C CG1   . VAL D 3 283 ? 54.696  37.295 43.844  1.00 55.24  ? 660 VAL M CG1   1 
ATOM 5422 C CG2   . VAL D 3 283 ? 55.636  38.132 45.982  1.00 52.67  ? 660 VAL M CG2   1 
ATOM 5423 N N     . ILE D 3 284 ? 53.734  40.178 42.279  1.00 54.82  ? 661 ILE M N     1 
ATOM 5424 C CA    . ILE D 3 284 ? 52.633  40.938 41.702  1.00 56.11  ? 661 ILE M CA    1 
ATOM 5425 C C     . ILE D 3 284 ? 51.694  40.128 40.799  1.00 58.47  ? 661 ILE M C     1 
ATOM 5426 O O     . ILE D 3 284 ? 52.133  39.369 39.934  1.00 59.13  ? 661 ILE M O     1 
ATOM 5427 C CB    . ILE D 3 284 ? 53.186  42.176 40.940  1.00 53.60  ? 661 ILE M CB    1 
ATOM 5428 C CG1   . ILE D 3 284 ? 52.041  43.063 40.460  1.00 52.68  ? 661 ILE M CG1   1 
ATOM 5429 C CG2   . ILE D 3 284 ? 54.030  41.739 39.783  1.00 53.53  ? 661 ILE M CG2   1 
ATOM 5430 C CD1   . ILE D 3 284 ? 52.489  44.447 40.045  1.00 50.50  ? 661 ILE M CD1   1 
ATOM 5431 N N     . ASN D 3 285 ? 50.393  40.288 41.019  1.00 60.70  ? 662 ASN M N     1 
ATOM 5432 C CA    . ASN D 3 285 ? 49.395  39.582 40.229  1.00 62.32  ? 662 ASN M CA    1 
ATOM 5433 C C     . ASN D 3 285 ? 48.626  40.546 39.358  1.00 64.24  ? 662 ASN M C     1 
ATOM 5434 O O     . ASN D 3 285 ? 47.792  41.309 39.844  1.00 63.99  ? 662 ASN M O     1 
ATOM 5435 C CB    . ASN D 3 285 ? 48.421  38.842 41.139  1.00 63.19  ? 662 ASN M CB    1 
ATOM 5436 C CG    . ASN D 3 285 ? 49.094  37.747 41.937  1.00 64.32  ? 662 ASN M CG    1 
ATOM 5437 O OD1   . ASN D 3 285 ? 50.096  37.178 41.496  1.00 64.41  ? 662 ASN M OD1   1 
ATOM 5438 N ND2   . ASN D 3 285 ? 48.540  37.429 43.105  1.00 63.22  ? 662 ASN M ND2   1 
ATOM 5439 N N     . GLY D 3 286 ? 48.904  40.509 38.063  1.00 67.23  ? 663 GLY M N     1 
ATOM 5440 C CA    . GLY D 3 286 ? 48.215  41.398 37.151  1.00 71.45  ? 663 GLY M CA    1 
ATOM 5441 C C     . GLY D 3 286 ? 48.978  42.694 37.052  1.00 74.51  ? 663 GLY M C     1 
ATOM 5442 O O     . GLY D 3 286 ? 50.192  42.697 37.220  1.00 74.59  ? 663 GLY M O     1 
ATOM 5443 N N     . LYS D 3 287 ? 48.277  43.792 36.794  1.00 78.47  ? 664 LYS M N     1 
ATOM 5444 C CA    . LYS D 3 287 ? 48.929  45.085 36.667  1.00 82.95  ? 664 LYS M CA    1 
ATOM 5445 C C     . LYS D 3 287 ? 48.868  45.929 37.930  1.00 84.06  ? 664 LYS M C     1 
ATOM 5446 O O     . LYS D 3 287 ? 49.579  46.927 38.037  1.00 84.68  ? 664 LYS M O     1 
ATOM 5447 C CB    . LYS D 3 287 ? 48.319  45.883 35.514  1.00 86.89  ? 664 LYS M CB    1 
ATOM 5448 C CG    . LYS D 3 287 ? 48.605  45.328 34.126  1.00 93.08  ? 664 LYS M CG    1 
ATOM 5449 C CD    . LYS D 3 287 ? 48.163  46.318 33.044  1.00 98.15  ? 664 LYS M CD    1 
ATOM 5450 C CE    . LYS D 3 287 ? 48.369  45.775 31.630  1.00 100.93 ? 664 LYS M CE    1 
ATOM 5451 N NZ    . LYS D 3 287 ? 47.367  44.736 31.255  1.00 103.96 ? 664 LYS M NZ    1 
ATOM 5452 N N     . ARG D 3 288 ? 48.025  45.546 38.883  1.00 85.33  ? 665 ARG M N     1 
ATOM 5453 C CA    . ARG D 3 288 ? 47.912  46.312 40.120  1.00 87.12  ? 665 ARG M CA    1 
ATOM 5454 C C     . ARG D 3 288 ? 48.286  45.503 41.368  1.00 86.17  ? 665 ARG M C     1 
ATOM 5455 O O     . ARG D 3 288 ? 49.286  45.786 42.026  1.00 87.35  ? 665 ARG M O     1 
ATOM 5456 C CB    . ARG D 3 288 ? 46.491  46.853 40.281  1.00 90.80  ? 665 ARG M CB    1 
ATOM 5457 C CG    . ARG D 3 288 ? 45.969  47.644 39.101  1.00 97.79  ? 665 ARG M CG    1 
ATOM 5458 C CD    . ARG D 3 288 ? 44.586  48.211 39.417  1.00 105.06 ? 665 ARG M CD    1 
ATOM 5459 N NE    . ARG D 3 288 ? 43.901  48.756 38.242  1.00 111.82 ? 665 ARG M NE    1 
ATOM 5460 C CZ    . ARG D 3 288 ? 44.377  49.735 37.474  1.00 115.02 ? 665 ARG M CZ    1 
ATOM 5461 N NH1   . ARG D 3 288 ? 45.553  50.293 37.746  1.00 117.01 ? 665 ARG M NH1   1 
ATOM 5462 N NH2   . ARG D 3 288 ? 43.673  50.158 36.430  1.00 116.28 ? 665 ARG M NH2   1 
ATOM 5463 N N     . LYS D 3 289 ? 47.475  44.498 41.684  1.00 83.96  ? 666 LYS M N     1 
ATOM 5464 C CA    . LYS D 3 289 ? 47.673  43.639 42.852  1.00 79.92  ? 666 LYS M CA    1 
ATOM 5465 C C     . LYS D 3 289 ? 49.116  43.228 43.130  1.00 76.10  ? 666 LYS M C     1 
ATOM 5466 O O     . LYS D 3 289 ? 49.566  42.170 42.691  1.00 74.67  ? 666 LYS M O     1 
ATOM 5467 C CB    . LYS D 3 289 ? 46.829  42.382 42.695  1.00 82.61  ? 666 LYS M CB    1 
ATOM 5468 C CG    . LYS D 3 289 ? 45.393  42.650 42.294  1.00 85.28  ? 666 LYS M CG    1 
ATOM 5469 C CD    . LYS D 3 289 ? 44.571  43.081 43.479  1.00 87.39  ? 666 LYS M CD    1 
ATOM 5470 C CE    . LYS D 3 289 ? 43.116  43.191 43.092  1.00 89.71  ? 666 LYS M CE    1 
ATOM 5471 N NZ    . LYS D 3 289 ? 42.252  43.394 44.283  1.00 92.09  ? 666 LYS M NZ    1 
ATOM 5472 N N     . ARG D 3 290 ? 49.842  44.063 43.863  1.00 72.34  ? 667 ARG M N     1 
ATOM 5473 C CA    . ARG D 3 290 ? 51.217  43.739 44.207  1.00 69.25  ? 667 ARG M CA    1 
ATOM 5474 C C     . ARG D 3 290 ? 51.341  43.658 45.721  1.00 68.07  ? 667 ARG M C     1 
ATOM 5475 O O     . ARG D 3 290 ? 50.721  44.431 46.450  1.00 68.45  ? 667 ARG M O     1 
ATOM 5476 C CB    . ARG D 3 290 ? 52.196  44.787 43.661  1.00 67.57  ? 667 ARG M CB    1 
ATOM 5477 C CG    . ARG D 3 290 ? 52.186  46.119 44.372  1.00 66.62  ? 667 ARG M CG    1 
ATOM 5478 C CD    . ARG D 3 290 ? 53.294  47.021 43.842  1.00 67.89  ? 667 ARG M CD    1 
ATOM 5479 N NE    . ARG D 3 290 ? 53.210  47.181 42.388  1.00 69.39  ? 667 ARG M NE    1 
ATOM 5480 C CZ    . ARG D 3 290 ? 53.929  48.047 41.672  1.00 69.10  ? 667 ARG M CZ    1 
ATOM 5481 N NH1   . ARG D 3 290 ? 54.803  48.852 42.267  1.00 68.87  ? 667 ARG M NH1   1 
ATOM 5482 N NH2   . ARG D 3 290 ? 53.766  48.110 40.356  1.00 67.60  ? 667 ARG M NH2   1 
ATOM 5483 N N     . SER D 3 291 ? 52.129  42.704 46.196  1.00 65.79  ? 668 SER M N     1 
ATOM 5484 C CA    . SER D 3 291 ? 52.332  42.545 47.623  1.00 63.76  ? 668 SER M CA    1 
ATOM 5485 C C     . SER D 3 291 ? 53.120  43.762 48.051  1.00 63.73  ? 668 SER M C     1 
ATOM 5486 O O     . SER D 3 291 ? 53.209  44.745 47.312  1.00 64.12  ? 668 SER M O     1 
ATOM 5487 C CB    . SER D 3 291 ? 53.163  41.306 47.896  1.00 62.86  ? 668 SER M CB    1 
ATOM 5488 O OG    . SER D 3 291 ? 54.476  41.496 47.409  1.00 61.65  ? 668 SER M OG    1 
ATOM 5489 N N     . GLN D 3 292 ? 53.718  43.711 49.232  1.00 63.07  ? 669 GLN M N     1 
ATOM 5490 C CA    . GLN D 3 292 ? 54.483  44.864 49.639  1.00 62.50  ? 669 GLN M CA    1 
ATOM 5491 C C     . GLN D 3 292 ? 55.977  44.667 49.722  1.00 59.93  ? 669 GLN M C     1 
ATOM 5492 O O     . GLN D 3 292 ? 56.468  43.551 49.860  1.00 58.50  ? 669 GLN M O     1 
ATOM 5493 C CB    . GLN D 3 292 ? 53.934  45.467 50.936  1.00 64.65  ? 669 GLN M CB    1 
ATOM 5494 C CG    . GLN D 3 292 ? 53.651  44.550 52.075  1.00 66.67  ? 669 GLN M CG    1 
ATOM 5495 C CD    . GLN D 3 292 ? 53.183  45.351 53.267  1.00 68.67  ? 669 GLN M CD    1 
ATOM 5496 O OE1   . GLN D 3 292 ? 52.313  46.207 53.135  1.00 70.01  ? 669 GLN M OE1   1 
ATOM 5497 N NE2   . GLN D 3 292 ? 53.760  45.091 54.431  1.00 70.33  ? 669 GLN M NE2   1 
ATOM 5498 N N     . PRO D 3 293 ? 56.721  45.774 49.620  1.00 58.71  ? 670 PRO M N     1 
ATOM 5499 C CA    . PRO D 3 293 ? 58.173  45.806 49.665  1.00 58.77  ? 670 PRO M CA    1 
ATOM 5500 C C     . PRO D 3 293 ? 58.760  44.805 50.631  1.00 58.85  ? 670 PRO M C     1 
ATOM 5501 O O     . PRO D 3 293 ? 58.457  44.835 51.824  1.00 59.21  ? 670 PRO M O     1 
ATOM 5502 C CB    . PRO D 3 293 ? 58.464  47.237 50.089  1.00 58.79  ? 670 PRO M CB    1 
ATOM 5503 C CG    . PRO D 3 293 ? 57.387  47.986 49.440  1.00 58.68  ? 670 PRO M CG    1 
ATOM 5504 C CD    . PRO D 3 293 ? 56.187  47.142 49.739  1.00 58.75  ? 670 PRO M CD    1 
ATOM 5505 N N     . GLN D 3 294 ? 59.593  43.916 50.099  1.00 58.34  ? 671 GLN M N     1 
ATOM 5506 C CA    . GLN D 3 294 ? 60.277  42.918 50.909  1.00 57.03  ? 671 GLN M CA    1 
ATOM 5507 C C     . GLN D 3 294 ? 61.742  43.298 50.884  1.00 55.68  ? 671 GLN M C     1 
ATOM 5508 O O     . GLN D 3 294 ? 62.213  43.936 49.943  1.00 54.20  ? 671 GLN M O     1 
ATOM 5509 C CB    . GLN D 3 294 ? 60.082  41.512 50.344  1.00 56.91  ? 671 GLN M CB    1 
ATOM 5510 C CG    . GLN D 3 294 ? 58.663  41.001 50.468  1.00 57.42  ? 671 GLN M CG    1 
ATOM 5511 C CD    . GLN D 3 294 ? 58.146  41.076 51.889  1.00 60.00  ? 671 GLN M CD    1 
ATOM 5512 O OE1   . GLN D 3 294 ? 57.928  42.159 52.420  1.00 61.02  ? 671 GLN M OE1   1 
ATOM 5513 N NE2   . GLN D 3 294 ? 57.956  39.923 52.516  1.00 62.01  ? 671 GLN M NE2   1 
ATOM 5514 N N     . HIS D 3 295 ? 62.462  42.912 51.923  1.00 55.52  ? 672 HIS M N     1 
ATOM 5515 C CA    . HIS D 3 295 ? 63.864  43.259 52.000  1.00 55.42  ? 672 HIS M CA    1 
ATOM 5516 C C     . HIS D 3 295 ? 64.795  42.109 51.652  1.00 55.98  ? 672 HIS M C     1 
ATOM 5517 O O     . HIS D 3 295 ? 64.510  40.940 51.925  1.00 55.66  ? 672 HIS M O     1 
ATOM 5518 C CB    . HIS D 3 295 ? 64.175  43.790 53.391  1.00 54.14  ? 672 HIS M CB    1 
ATOM 5519 C CG    . HIS D 3 295 ? 63.277  44.907 53.815  1.00 51.89  ? 672 HIS M CG    1 
ATOM 5520 N ND1   . HIS D 3 295 ? 63.346  46.166 53.263  1.00 53.18  ? 672 HIS M ND1   1 
ATOM 5521 C CD2   . HIS D 3 295 ? 62.269  44.946 54.717  1.00 51.99  ? 672 HIS M CD2   1 
ATOM 5522 C CE1   . HIS D 3 295 ? 62.420  46.934 53.810  1.00 53.36  ? 672 HIS M CE1   1 
ATOM 5523 N NE2   . HIS D 3 295 ? 61.752  46.218 54.695  1.00 52.41  ? 672 HIS M NE2   1 
ATOM 5524 N N     . PHE D 3 296 ? 65.912  42.478 51.040  1.00 56.87  ? 673 PHE M N     1 
ATOM 5525 C CA    . PHE D 3 296 ? 66.935  41.546 50.612  1.00 57.64  ? 673 PHE M CA    1 
ATOM 5526 C C     . PHE D 3 296 ? 68.234  42.330 50.620  1.00 58.70  ? 673 PHE M C     1 
ATOM 5527 O O     . PHE D 3 296 ? 68.220  43.555 50.734  1.00 57.73  ? 673 PHE M O     1 
ATOM 5528 C CB    . PHE D 3 296 ? 66.639  41.074 49.196  1.00 56.83  ? 673 PHE M CB    1 
ATOM 5529 C CG    . PHE D 3 296 ? 67.408  39.861 48.788  1.00 57.39  ? 673 PHE M CG    1 
ATOM 5530 C CD1   . PHE D 3 296 ? 67.097  38.612 49.325  1.00 57.81  ? 673 PHE M CD1   1 
ATOM 5531 C CD2   . PHE D 3 296 ? 68.420  39.954 47.850  1.00 57.70  ? 673 PHE M CD2   1 
ATOM 5532 C CE1   . PHE D 3 296 ? 67.780  37.470 48.928  1.00 57.47  ? 673 PHE M CE1   1 
ATOM 5533 C CE2   . PHE D 3 296 ? 69.112  38.818 47.444  1.00 59.46  ? 673 PHE M CE2   1 
ATOM 5534 C CZ    . PHE D 3 296 ? 68.790  37.573 47.985  1.00 59.10  ? 673 PHE M CZ    1 
ATOM 5535 N N     . THR D 3 297 ? 69.354  41.634 50.494  1.00 60.44  ? 674 THR M N     1 
ATOM 5536 C CA    . THR D 3 297 ? 70.639  42.312 50.495  1.00 62.80  ? 674 THR M CA    1 
ATOM 5537 C C     . THR D 3 297 ? 71.634  41.583 49.624  1.00 65.69  ? 674 THR M C     1 
ATOM 5538 O O     . THR D 3 297 ? 71.618  40.360 49.549  1.00 66.93  ? 674 THR M O     1 
ATOM 5539 C CB    . THR D 3 297 ? 71.226  42.376 51.894  1.00 61.12  ? 674 THR M CB    1 
ATOM 5540 O OG1   . THR D 3 297 ? 70.225  42.834 52.803  1.00 62.30  ? 674 THR M OG1   1 
ATOM 5541 C CG2   . THR D 3 297 ? 72.392  43.326 51.928  1.00 60.48  ? 674 THR M CG2   1 
ATOM 5542 N N     . TYR D 3 298 ? 72.499  42.339 48.961  1.00 68.57  ? 675 TYR M N     1 
ATOM 5543 C CA    . TYR D 3 298 ? 73.526  41.751 48.118  1.00 71.68  ? 675 TYR M CA    1 
ATOM 5544 C C     . TYR D 3 298 ? 74.868  41.970 48.790  1.00 75.72  ? 675 TYR M C     1 
ATOM 5545 O O     . TYR D 3 298 ? 75.202  43.096 49.157  1.00 75.73  ? 675 TYR M O     1 
ATOM 5546 C CB    . TYR D 3 298 ? 73.531  42.410 46.746  1.00 69.33  ? 675 TYR M CB    1 
ATOM 5547 C CG    . TYR D 3 298 ? 72.432  41.930 45.840  1.00 68.44  ? 675 TYR M CG    1 
ATOM 5548 C CD1   . TYR D 3 298 ? 72.322  40.581 45.508  1.00 67.92  ? 675 TYR M CD1   1 
ATOM 5549 C CD2   . TYR D 3 298 ? 71.520  42.818 45.284  1.00 68.04  ? 675 TYR M CD2   1 
ATOM 5550 C CE1   . TYR D 3 298 ? 71.332  40.127 44.637  1.00 66.44  ? 675 TYR M CE1   1 
ATOM 5551 C CE2   . TYR D 3 298 ? 70.523  42.374 44.412  1.00 67.52  ? 675 TYR M CE2   1 
ATOM 5552 C CZ    . TYR D 3 298 ? 70.441  41.027 44.094  1.00 66.43  ? 675 TYR M CZ    1 
ATOM 5553 O OH    . TYR D 3 298 ? 69.480  40.578 43.224  1.00 66.82  ? 675 TYR M OH    1 
ATOM 5554 N N     . HIS D 3 299 ? 75.634  40.899 48.964  1.00 80.25  ? 676 HIS M N     1 
ATOM 5555 C CA    . HIS D 3 299 ? 76.940  41.020 49.591  1.00 85.32  ? 676 HIS M CA    1 
ATOM 5556 C C     . HIS D 3 299 ? 78.085  41.063 48.584  1.00 89.68  ? 676 HIS M C     1 
ATOM 5557 O O     . HIS D 3 299 ? 78.000  40.485 47.499  1.00 90.28  ? 676 HIS M O     1 
ATOM 5558 C CB    . HIS D 3 299 ? 77.144  39.889 50.589  1.00 83.94  ? 676 HIS M CB    1 
ATOM 5559 C CG    . HIS D 3 299 ? 76.287  40.018 51.807  1.00 83.82  ? 676 HIS M CG    1 
ATOM 5560 N ND1   . HIS D 3 299 ? 76.323  41.128 52.623  1.00 82.77  ? 676 HIS M ND1   1 
ATOM 5561 C CD2   . HIS D 3 299 ? 75.357  39.189 52.338  1.00 83.64  ? 676 HIS M CD2   1 
ATOM 5562 C CE1   . HIS D 3 299 ? 75.451  40.978 53.604  1.00 82.66  ? 676 HIS M CE1   1 
ATOM 5563 N NE2   . HIS D 3 299 ? 74.852  39.810 53.455  1.00 82.75  ? 676 HIS M NE2   1 
ATOM 5564 N N     . PRO D 3 300 ? 79.173  41.767 48.933  1.00 93.60  ? 677 PRO M N     1 
ATOM 5565 C CA    . PRO D 3 300 ? 80.338  41.895 48.060  1.00 96.71  ? 677 PRO M CA    1 
ATOM 5566 C C     . PRO D 3 300 ? 80.934  40.553 47.696  1.00 99.92  ? 677 PRO M C     1 
ATOM 5567 O O     . PRO D 3 300 ? 80.824  39.584 48.445  1.00 100.71 ? 677 PRO M O     1 
ATOM 5568 C CB    . PRO D 3 300 ? 81.286  42.754 48.882  1.00 96.51  ? 677 PRO M CB    1 
ATOM 5569 C CG    . PRO D 3 300 ? 80.945  42.379 50.275  1.00 96.09  ? 677 PRO M CG    1 
ATOM 5570 C CD    . PRO D 3 300 ? 79.446  42.372 50.246  1.00 94.69  ? 677 PRO M CD    1 
ATOM 5571 N N     . VAL D 3 301 ? 81.563  40.504 46.531  1.00 103.39 ? 678 VAL M N     1 
ATOM 5572 C CA    . VAL D 3 301 ? 82.176  39.281 46.039  1.00 106.69 ? 678 VAL M CA    1 
ATOM 5573 C C     . VAL D 3 301 ? 83.233  38.765 47.003  1.00 107.29 ? 678 VAL M C     1 
ATOM 5574 O O     . VAL D 3 301 ? 83.551  39.490 47.972  1.00 108.19 ? 678 VAL M O     1 
ATOM 5575 C CB    . VAL D 3 301 ? 82.832  39.523 44.678  1.00 108.21 ? 678 VAL M CB    1 
ATOM 5576 C CG1   . VAL D 3 301 ? 81.785  39.986 43.685  1.00 109.90 ? 678 VAL M CG1   1 
ATOM 5577 C CG2   . VAL D 3 301 ? 83.931  40.573 44.814  1.00 109.81 ? 678 VAL M CG2   1 
ATOM 5578 O OXT   . VAL D 3 301 ? 83.735  37.647 46.767  1.00 106.97 ? 678 VAL M OXT   1 
ATOM 5579 N N     . ALA E 3 15  ? 28.600  83.084 -16.058 1.00 151.40 ? 392 ALA O N     1 
ATOM 5580 C CA    . ALA E 3 15  ? 29.301  82.692 -14.800 1.00 153.58 ? 392 ALA O CA    1 
ATOM 5581 C C     . ALA E 3 15  ? 28.596  83.272 -13.574 1.00 154.74 ? 392 ALA O C     1 
ATOM 5582 O O     . ALA E 3 15  ? 29.188  83.368 -12.498 1.00 160.89 ? 392 ALA O O     1 
ATOM 5583 C CB    . ALA E 3 15  ? 30.756  83.168 -14.844 1.00 147.07 ? 392 ALA O CB    1 
ATOM 5584 N N     . SER E 3 16  ? 27.330  83.650 -13.744 1.00 153.18 ? 393 SER O N     1 
ATOM 5585 C CA    . SER E 3 16  ? 26.535  84.230 -12.659 1.00 150.38 ? 393 SER O CA    1 
ATOM 5586 C C     . SER E 3 16  ? 26.033  83.168 -11.695 1.00 155.11 ? 393 SER O C     1 
ATOM 5587 O O     . SER E 3 16  ? 24.915  83.254 -11.183 1.00 162.15 ? 393 SER O O     1 
ATOM 5588 C CB    . SER E 3 16  ? 25.337  84.992 -13.228 1.00 143.88 ? 393 SER O CB    1 
ATOM 5589 O OG    . SER E 3 16  ? 25.756  86.000 -14.129 1.00 118.42 ? 393 SER O OG    1 
ATOM 5590 N N     . SER E 3 17  ? 26.870  82.168 -11.447 1.00 157.38 ? 394 SER O N     1 
ATOM 5591 C CA    . SER E 3 17  ? 26.508  81.084 -10.551 1.00 153.52 ? 394 SER O CA    1 
ATOM 5592 C C     . SER E 3 17  ? 26.786  81.487 -9.104  1.00 153.59 ? 394 SER O C     1 
ATOM 5593 O O     . SER E 3 17  ? 27.938  81.671 -8.702  1.00 159.66 ? 394 SER O O     1 
ATOM 5594 C CB    . SER E 3 17  ? 27.297  79.824 -10.921 1.00 145.72 ? 394 SER O CB    1 
ATOM 5595 O OG    . SER E 3 17  ? 26.673  78.656 -10.418 1.00 128.12 ? 394 SER O OG    1 
ATOM 5596 N N     . VAL E 3 18  ? 25.716  81.636 -8.331  1.00 145.94 ? 395 VAL O N     1 
ATOM 5597 C CA    . VAL E 3 18  ? 25.817  82.014 -6.927  1.00 139.49 ? 395 VAL O CA    1 
ATOM 5598 C C     . VAL E 3 18  ? 25.848  80.750 -6.067  1.00 137.10 ? 395 VAL O C     1 
ATOM 5599 O O     . VAL E 3 18  ? 24.973  79.890 -6.188  1.00 149.76 ? 395 VAL O O     1 
ATOM 5600 C CB    . VAL E 3 18  ? 24.609  82.880 -6.507  1.00 136.73 ? 395 VAL O CB    1 
ATOM 5601 C CG1   . VAL E 3 18  ? 24.786  83.365 -5.076  1.00 121.41 ? 395 VAL O CG1   1 
ATOM 5602 C CG2   . VAL E 3 18  ? 24.450  84.055 -7.468  1.00 121.52 ? 395 VAL O CG2   1 
ATOM 5603 N N     . PRO E 3 19  ? 26.861  80.622 -5.187  1.00 127.98 ? 396 PRO O N     1 
ATOM 5604 C CA    . PRO E 3 19  ? 27.006  79.458 -4.306  1.00 122.72 ? 396 PRO O CA    1 
ATOM 5605 C C     . PRO E 3 19  ? 25.686  78.771 -3.938  1.00 116.89 ? 396 PRO O C     1 
ATOM 5606 O O     . PRO E 3 19  ? 24.723  79.417 -3.525  1.00 119.16 ? 396 PRO O O     1 
ATOM 5607 C CB    . PRO E 3 19  ? 27.745  80.042 -3.112  1.00 120.41 ? 396 PRO O CB    1 
ATOM 5608 C CG    . PRO E 3 19  ? 28.733  80.952 -3.805  1.00 117.56 ? 396 PRO O CG    1 
ATOM 5609 C CD    . PRO E 3 19  ? 27.875  81.646 -4.864  1.00 126.41 ? 396 PRO O CD    1 
ATOM 5610 N N     . LEU E 3 20  ? 25.667  77.452 -4.102  1.00 109.20 ? 397 LEU O N     1 
ATOM 5611 C CA    . LEU E 3 20  ? 24.494  76.616 -3.844  1.00 99.80  ? 397 LEU O CA    1 
ATOM 5612 C C     . LEU E 3 20  ? 24.019  76.550 -2.390  1.00 97.47  ? 397 LEU O C     1 
ATOM 5613 O O     . LEU E 3 20  ? 22.882  76.136 -2.120  1.00 93.18  ? 397 LEU O O     1 
ATOM 5614 C CB    . LEU E 3 20  ? 24.777  75.192 -4.332  1.00 92.75  ? 397 LEU O CB    1 
ATOM 5615 C CG    . LEU E 3 20  ? 25.217  75.042 -5.790  1.00 88.43  ? 397 LEU O CG    1 
ATOM 5616 C CD1   . LEU E 3 20  ? 25.816  73.659 -6.014  1.00 84.86  ? 397 LEU O CD1   1 
ATOM 5617 C CD2   . LEU E 3 20  ? 24.025  75.295 -6.713  1.00 85.57  ? 397 LEU O CD2   1 
ATOM 5618 N N     . GLU E 3 21  ? 24.885  76.960 -1.465  1.00 95.31  ? 398 GLU O N     1 
ATOM 5619 C CA    . GLU E 3 21  ? 24.592  76.919 -0.034  1.00 96.52  ? 398 GLU O CA    1 
ATOM 5620 C C     . GLU E 3 21  ? 23.782  78.111 0.473   1.00 101.46 ? 398 GLU O C     1 
ATOM 5621 O O     . GLU E 3 21  ? 23.176  78.046 1.541   1.00 98.65  ? 398 GLU O O     1 
ATOM 5622 C CB    . GLU E 3 21  ? 25.900  76.819 0.745   1.00 93.76  ? 398 GLU O CB    1 
ATOM 5623 C CG    . GLU E 3 21  ? 26.849  75.751 0.216   1.00 91.64  ? 398 GLU O CG    1 
ATOM 5624 C CD    . GLU E 3 21  ? 27.297  76.014 -1.215  1.00 90.51  ? 398 GLU O CD    1 
ATOM 5625 O OE1   . GLU E 3 21  ? 27.910  77.073 -1.473  1.00 90.09  ? 398 GLU O OE1   1 
ATOM 5626 O OE2   . GLU E 3 21  ? 27.030  75.162 -2.085  1.00 89.59  ? 398 GLU O OE2   1 
ATOM 5627 N N     . TRP E 3 22  ? 23.781  79.195 -0.295  1.00 114.22 ? 399 TRP O N     1 
ATOM 5628 C CA    . TRP E 3 22  ? 23.040  80.403 0.058   1.00 125.44 ? 399 TRP O CA    1 
ATOM 5629 C C     . TRP E 3 22  ? 21.532  80.176 0.147   1.00 125.62 ? 399 TRP O C     1 
ATOM 5630 O O     . TRP E 3 22  ? 20.862  80.046 -0.878  1.00 121.70 ? 399 TRP O O     1 
ATOM 5631 C CB    . TRP E 3 22  ? 23.297  81.484 -0.988  1.00 139.17 ? 399 TRP O CB    1 
ATOM 5632 C CG    . TRP E 3 22  ? 24.297  82.500 -0.589  1.00 161.14 ? 399 TRP O CG    1 
ATOM 5633 C CD1   . TRP E 3 22  ? 25.599  82.284 -0.246  1.00 168.17 ? 399 TRP O CD1   1 
ATOM 5634 C CD2   . TRP E 3 22  ? 24.086  83.911 -0.512  1.00 172.38 ? 399 TRP O CD2   1 
ATOM 5635 N NE1   . TRP E 3 22  ? 26.215  83.478 0.040   1.00 175.58 ? 399 TRP O NE1   1 
ATOM 5636 C CE2   . TRP E 3 22  ? 25.309  84.494 -0.116  1.00 177.38 ? 399 TRP O CE2   1 
ATOM 5637 C CE3   . TRP E 3 22  ? 22.980  84.742 -0.741  1.00 178.83 ? 399 TRP O CE3   1 
ATOM 5638 C CZ2   . TRP E 3 22  ? 25.459  85.875 0.056   1.00 182.15 ? 399 TRP O CZ2   1 
ATOM 5639 C CZ3   . TRP E 3 22  ? 23.129  86.113 -0.571  1.00 183.13 ? 399 TRP O CZ3   1 
ATOM 5640 C CH2   . TRP E 3 22  ? 24.361  86.666 -0.175  1.00 184.29 ? 399 TRP O CH2   1 
ATOM 5641 N N     . PRO E 3 23  ? 20.972  80.134 1.370   1.00 131.08 ? 400 PRO O N     1 
ATOM 5642 C CA    . PRO E 3 23  ? 19.525  79.924 1.510   1.00 131.41 ? 400 PRO O CA    1 
ATOM 5643 C C     . PRO E 3 23  ? 18.765  81.030 0.779   1.00 126.59 ? 400 PRO O C     1 
ATOM 5644 O O     . PRO E 3 23  ? 19.050  82.210 0.972   1.00 135.24 ? 400 PRO O O     1 
ATOM 5645 C CB    . PRO E 3 23  ? 19.314  79.982 3.022   1.00 139.92 ? 400 PRO O CB    1 
ATOM 5646 C CG    . PRO E 3 23  ? 20.614  79.469 3.562   1.00 141.67 ? 400 PRO O CG    1 
ATOM 5647 C CD    . PRO E 3 23  ? 21.622  80.181 2.690   1.00 136.67 ? 400 PRO O CD    1 
ATOM 5648 N N     . LEU E 3 24  ? 17.802  80.655 -0.057  1.00 119.28 ? 401 LEU O N     1 
ATOM 5649 C CA    . LEU E 3 24  ? 17.046  81.653 -0.805  1.00 103.58 ? 401 LEU O CA    1 
ATOM 5650 C C     . LEU E 3 24  ? 15.548  81.376 -0.841  1.00 98.08  ? 401 LEU O C     1 
ATOM 5651 O O     . LEU E 3 24  ? 15.107  80.238 -1.025  1.00 90.42  ? 401 LEU O O     1 
ATOM 5652 C CB    . LEU E 3 24  ? 17.598  81.751 -2.225  1.00 96.49  ? 401 LEU O CB    1 
ATOM 5653 C CG    . LEU E 3 24  ? 19.118  81.944 -2.249  1.00 92.00  ? 401 LEU O CG    1 
ATOM 5654 C CD1   . LEU E 3 24  ? 19.636  81.844 -3.678  1.00 90.16  ? 401 LEU O CD1   1 
ATOM 5655 C CD2   . LEU E 3 24  ? 19.474  83.285 -1.618  1.00 89.85  ? 401 LEU O CD2   1 
ATOM 5656 N N     . SER E 3 25  ? 14.768  82.436 -0.655  1.00 94.94  ? 402 SER O N     1 
ATOM 5657 C CA    . SER E 3 25  ? 13.319  82.329 -0.649  1.00 95.37  ? 402 SER O CA    1 
ATOM 5658 C C     . SER E 3 25  ? 12.807  81.906 -2.009  1.00 92.23  ? 402 SER O C     1 
ATOM 5659 O O     . SER E 3 25  ? 13.493  82.072 -3.023  1.00 86.51  ? 402 SER O O     1 
ATOM 5660 C CB    . SER E 3 25  ? 12.690  83.671 -0.269  1.00 100.16 ? 402 SER O CB    1 
ATOM 5661 O OG    . SER E 3 25  ? 11.279  83.624 -0.382  1.00 115.15 ? 402 SER O OG    1 
ATOM 5662 N N     . SER E 3 26  ? 11.598  81.353 -2.020  1.00 93.34  ? 403 SER O N     1 
ATOM 5663 C CA    . SER E 3 26  ? 10.962  80.920 -3.257  1.00 96.89  ? 403 SER O CA    1 
ATOM 5664 C C     . SER E 3 26  ? 10.145  82.072 -3.843  1.00 106.36 ? 403 SER O C     1 
ATOM 5665 O O     . SER E 3 26  ? 9.186   81.858 -4.590  1.00 106.57 ? 403 SER O O     1 
ATOM 5666 C CB    . SER E 3 26  ? 10.060  79.709 -2.998  1.00 85.95  ? 403 SER O CB    1 
ATOM 5667 O OG    . SER E 3 26  ? 9.128   79.965 -1.965  1.00 76.24  ? 403 SER O OG    1 
ATOM 5668 N N     . GLN E 3 27  ? 10.541  83.294 -3.493  1.00 116.99 ? 404 GLN O N     1 
ATOM 5669 C CA    . GLN E 3 27  ? 9.873   84.504 -3.961  1.00 131.36 ? 404 GLN O CA    1 
ATOM 5670 C C     . GLN E 3 27  ? 10.553  85.767 -3.428  1.00 136.37 ? 404 GLN O C     1 
ATOM 5671 O O     . GLN E 3 27  ? 11.011  85.806 -2.282  1.00 147.39 ? 404 GLN O O     1 
ATOM 5672 C CB    . GLN E 3 27  ? 8.400   84.482 -3.548  1.00 135.95 ? 404 GLN O CB    1 
ATOM 5673 C CG    . GLN E 3 27  ? 8.165   84.050 -2.114  1.00 131.37 ? 404 GLN O CG    1 
ATOM 5674 C CD    . GLN E 3 27  ? 6.700   83.807 -1.820  1.00 127.97 ? 404 GLN O CD    1 
ATOM 5675 O OE1   . GLN E 3 27  ? 6.032   83.042 -2.522  1.00 125.34 ? 404 GLN O OE1   1 
ATOM 5676 N NE2   . GLN E 3 27  ? 6.190   84.454 -0.775  1.00 125.90 ? 404 GLN O NE2   1 
ATOM 5677 N N     . SER E 3 28  ? 10.610  86.794 -4.272  1.00 136.15 ? 405 SER O N     1 
ATOM 5678 C CA    . SER E 3 28  ? 11.242  88.066 -3.925  1.00 127.92 ? 405 SER O CA    1 
ATOM 5679 C C     . SER E 3 28  ? 10.531  89.214 -4.663  1.00 124.94 ? 405 SER O C     1 
ATOM 5680 O O     . SER E 3 28  ? 11.039  89.757 -5.649  1.00 122.31 ? 405 SER O O     1 
ATOM 5681 C CB    . SER E 3 28  ? 12.726  88.010 -4.308  1.00 125.22 ? 405 SER O CB    1 
ATOM 5682 O OG    . SER E 3 28  ? 13.437  89.133 -3.825  1.00 117.83 ? 405 SER O OG    1 
ATOM 5683 N N     . GLY E 3 29  ? 9.353   89.577 -4.163  1.00 123.66 ? 406 GLY O N     1 
ATOM 5684 C CA    . GLY E 3 29  ? 8.559   90.623 -4.781  1.00 122.68 ? 406 GLY O CA    1 
ATOM 5685 C C     . GLY E 3 29  ? 7.306   89.964 -5.330  1.00 124.56 ? 406 GLY O C     1 
ATOM 5686 O O     . GLY E 3 29  ? 6.656   89.190 -4.628  1.00 120.82 ? 406 GLY O O     1 
ATOM 5687 N N     . SER E 3 30  ? 6.960   90.258 -6.579  1.00 127.58 ? 407 SER O N     1 
ATOM 5688 C CA    . SER E 3 30  ? 5.785   89.648 -7.191  1.00 136.91 ? 407 SER O CA    1 
ATOM 5689 C C     . SER E 3 30  ? 6.202   88.361 -7.910  1.00 144.47 ? 407 SER O C     1 
ATOM 5690 O O     . SER E 3 30  ? 5.499   87.863 -8.791  1.00 149.17 ? 407 SER O O     1 
ATOM 5691 C CB    . SER E 3 30  ? 5.110   90.628 -8.166  1.00 136.43 ? 407 SER O CB    1 
ATOM 5692 O OG    . SER E 3 30  ? 6.023   91.167 -9.111  1.00 130.17 ? 407 SER O OG    1 
ATOM 5693 N N     . TYR E 3 31  ? 7.358   87.832 -7.510  1.00 152.30 ? 408 TYR O N     1 
ATOM 5694 C CA    . TYR E 3 31  ? 7.915   86.603 -8.074  1.00 156.37 ? 408 TYR O CA    1 
ATOM 5695 C C     . TYR E 3 31  ? 7.496   85.395 -7.240  1.00 155.26 ? 408 TYR O C     1 
ATOM 5696 O O     . TYR E 3 31  ? 7.344   85.498 -6.024  1.00 156.89 ? 408 TYR O O     1 
ATOM 5697 C CB    . TYR E 3 31  ? 9.447   86.678 -8.108  1.00 160.75 ? 408 TYR O CB    1 
ATOM 5698 C CG    . TYR E 3 31  ? 10.030  87.604 -9.159  1.00 164.36 ? 408 TYR O CG    1 
ATOM 5699 C CD1   . TYR E 3 31  ? 11.385  87.942 -9.138  1.00 165.81 ? 408 TYR O CD1   1 
ATOM 5700 C CD2   . TYR E 3 31  ? 9.239   88.124 -10.187 1.00 165.83 ? 408 TYR O CD2   1 
ATOM 5701 C CE1   . TYR E 3 31  ? 11.940  88.772 -10.111 1.00 167.99 ? 408 TYR O CE1   1 
ATOM 5702 C CE2   . TYR E 3 31  ? 9.785   88.956 -11.166 1.00 168.02 ? 408 TYR O CE2   1 
ATOM 5703 C CZ    . TYR E 3 31  ? 11.135  89.275 -11.121 1.00 168.75 ? 408 TYR O CZ    1 
ATOM 5704 O OH    . TYR E 3 31  ? 11.679  90.097 -12.083 1.00 170.52 ? 408 TYR O OH    1 
ATOM 5705 N N     . GLU E 3 32  ? 7.323   84.251 -7.894  1.00 151.94 ? 409 GLU O N     1 
ATOM 5706 C CA    . GLU E 3 32  ? 6.910   83.037 -7.199  1.00 148.41 ? 409 GLU O CA    1 
ATOM 5707 C C     . GLU E 3 32  ? 7.321   81.776 -7.960  1.00 145.32 ? 409 GLU O C     1 
ATOM 5708 O O     . GLU E 3 32  ? 6.685   81.399 -8.949  1.00 147.33 ? 409 GLU O O     1 
ATOM 5709 C CB    . GLU E 3 32  ? 5.389   83.045 -7.001  1.00 150.12 ? 409 GLU O CB    1 
ATOM 5710 C CG    . GLU E 3 32  ? 4.857   81.943 -6.092  1.00 147.54 ? 409 GLU O CG    1 
ATOM 5711 C CD    . GLU E 3 32  ? 3.339   81.936 -6.007  1.00 146.71 ? 409 GLU O CD    1 
ATOM 5712 O OE1   . GLU E 3 32  ? 2.793   81.167 -5.189  1.00 147.08 ? 409 GLU O OE1   1 
ATOM 5713 O OE2   . GLU E 3 32  ? 2.691   82.693 -6.760  1.00 146.88 ? 409 GLU O OE2   1 
ATOM 5714 N N     . LEU E 3 33  ? 8.384   81.129 -7.488  1.00 140.69 ? 410 LEU O N     1 
ATOM 5715 C CA    . LEU E 3 33  ? 8.890   79.902 -8.100  1.00 134.58 ? 410 LEU O CA    1 
ATOM 5716 C C     . LEU E 3 33  ? 8.245   78.704 -7.410  1.00 134.26 ? 410 LEU O C     1 
ATOM 5717 O O     . LEU E 3 33  ? 8.650   78.320 -6.315  1.00 135.59 ? 410 LEU O O     1 
ATOM 5718 C CB    . LEU E 3 33  ? 10.411  79.836 -7.946  1.00 126.48 ? 410 LEU O CB    1 
ATOM 5719 C CG    . LEU E 3 33  ? 11.150  78.654 -8.576  1.00 117.58 ? 410 LEU O CG    1 
ATOM 5720 C CD1   . LEU E 3 33  ? 10.895  78.621 -10.077 1.00 112.71 ? 410 LEU O CD1   1 
ATOM 5721 C CD2   . LEU E 3 33  ? 12.641  78.781 -8.289  1.00 112.43 ? 410 LEU O CD2   1 
ATOM 5722 N N     . ARG E 3 34  ? 7.243   78.113 -8.052  1.00 131.76 ? 411 ARG O N     1 
ATOM 5723 C CA    . ARG E 3 34  ? 6.539   76.978 -7.466  1.00 129.90 ? 411 ARG O CA    1 
ATOM 5724 C C     . ARG E 3 34  ? 6.780   75.653 -8.180  1.00 122.98 ? 411 ARG O C     1 
ATOM 5725 O O     . ARG E 3 34  ? 7.363   75.606 -9.262  1.00 126.92 ? 411 ARG O O     1 
ATOM 5726 C CB    . ARG E 3 34  ? 5.034   77.252 -7.450  1.00 138.53 ? 411 ARG O CB    1 
ATOM 5727 C CG    . ARG E 3 34  ? 4.646   78.576 -6.827  1.00 143.76 ? 411 ARG O CG    1 
ATOM 5728 C CD    . ARG E 3 34  ? 3.139   78.749 -6.805  1.00 147.33 ? 411 ARG O CD    1 
ATOM 5729 N NE    . ARG E 3 34  ? 2.550   78.582 -8.130  1.00 150.87 ? 411 ARG O NE    1 
ATOM 5730 C CZ    . ARG E 3 34  ? 1.268   78.795 -8.408  1.00 152.73 ? 411 ARG O CZ    1 
ATOM 5731 N NH1   . ARG E 3 34  ? 0.435   79.186 -7.453  1.00 154.13 ? 411 ARG O NH1   1 
ATOM 5732 N NH2   . ARG E 3 34  ? 0.818   78.613 -9.641  1.00 153.90 ? 411 ARG O NH2   1 
ATOM 5733 N N     . ILE E 3 35  ? 6.322   74.578 -7.547  1.00 112.28 ? 412 ILE O N     1 
ATOM 5734 C CA    . ILE E 3 35  ? 6.432   73.234 -8.099  1.00 95.10  ? 412 ILE O CA    1 
ATOM 5735 C C     . ILE E 3 35  ? 4.994   72.811 -8.373  1.00 94.22  ? 412 ILE O C     1 
ATOM 5736 O O     . ILE E 3 35  ? 4.306   72.301 -7.485  1.00 87.51  ? 412 ILE O O     1 
ATOM 5737 C CB    . ILE E 3 35  ? 7.064   72.232 -7.085  1.00 85.25  ? 412 ILE O CB    1 
ATOM 5738 C CG1   . ILE E 3 35  ? 8.422   72.749 -6.588  1.00 78.25  ? 412 ILE O CG1   1 
ATOM 5739 C CG2   . ILE E 3 35  ? 7.218   70.858 -7.731  1.00 77.18  ? 412 ILE O CG2   1 
ATOM 5740 C CD1   . ILE E 3 35  ? 9.450   72.983 -7.674  1.00 73.34  ? 412 ILE O CD1   1 
ATOM 5741 N N     . GLU E 3 36  ? 4.534   73.042 -9.598  1.00 94.98  ? 413 GLU O N     1 
ATOM 5742 C CA    . GLU E 3 36  ? 3.168   72.696 -9.967  1.00 100.37 ? 413 GLU O CA    1 
ATOM 5743 C C     . GLU E 3 36  ? 2.848   71.256 -9.596  1.00 100.62 ? 413 GLU O C     1 
ATOM 5744 O O     . GLU E 3 36  ? 1.908   70.998 -8.845  1.00 102.34 ? 413 GLU O O     1 
ATOM 5745 C CB    . GLU E 3 36  ? 2.952   72.926 -11.465 1.00 103.68 ? 413 GLU O CB    1 
ATOM 5746 C CG    . GLU E 3 36  ? 3.277   74.350 -11.903 1.00 109.56 ? 413 GLU O CG    1 
ATOM 5747 C CD    . GLU E 3 36  ? 2.492   75.398 -11.133 1.00 112.17 ? 413 GLU O CD    1 
ATOM 5748 O OE1   . GLU E 3 36  ? 3.066   76.469 -10.832 1.00 113.66 ? 413 GLU O OE1   1 
ATOM 5749 O OE2   . GLU E 3 36  ? 1.303   75.155 -10.839 1.00 113.37 ? 413 GLU O OE2   1 
ATOM 5750 N N     . VAL E 3 37  ? 3.636   70.322 -10.113 1.00 100.41 ? 414 VAL O N     1 
ATOM 5751 C CA    . VAL E 3 37  ? 3.421   68.914 -9.810  1.00 101.42 ? 414 VAL O CA    1 
ATOM 5752 C C     . VAL E 3 37  ? 4.629   68.393 -9.045  1.00 101.39 ? 414 VAL O C     1 
ATOM 5753 O O     . VAL E 3 37  ? 5.768   68.690 -9.404  1.00 107.29 ? 414 VAL O O     1 
ATOM 5754 C CB    . VAL E 3 37  ? 3.239   68.093 -11.091 1.00 101.30 ? 414 VAL O CB    1 
ATOM 5755 C CG1   . VAL E 3 37  ? 2.544   66.776 -10.775 1.00 95.51  ? 414 VAL O CG1   1 
ATOM 5756 C CG2   . VAL E 3 37  ? 2.443   68.894 -12.098 1.00 96.37  ? 414 VAL O CG2   1 
ATOM 5757 N N     . GLN E 3 38  ? 4.376   67.621 -7.991  1.00 98.02  ? 415 GLN O N     1 
ATOM 5758 C CA    . GLN E 3 38  ? 5.445   67.073 -7.157  1.00 90.03  ? 415 GLN O CA    1 
ATOM 5759 C C     . GLN E 3 38  ? 5.922   65.686 -7.575  1.00 83.10  ? 415 GLN O C     1 
ATOM 5760 O O     . GLN E 3 38  ? 5.145   64.855 -8.049  1.00 87.10  ? 415 GLN O O     1 
ATOM 5761 C CB    . GLN E 3 38  ? 5.007   67.030 -5.682  1.00 88.44  ? 415 GLN O CB    1 
ATOM 5762 C CG    . GLN E 3 38  ? 5.069   68.372 -4.955  1.00 81.05  ? 415 GLN O CG    1 
ATOM 5763 C CD    . GLN E 3 38  ? 6.490   68.788 -4.602  1.00 77.85  ? 415 GLN O CD    1 
ATOM 5764 O OE1   . GLN E 3 38  ? 6.753   69.953 -4.292  1.00 75.52  ? 415 GLN O OE1   1 
ATOM 5765 N NE2   . GLN E 3 38  ? 7.412   67.833 -4.635  1.00 75.90  ? 415 GLN O NE2   1 
ATOM 5766 N N     . PRO E 3 39  ? 7.226   65.429 -7.412  1.00 74.98  ? 416 PRO O N     1 
ATOM 5767 C CA    . PRO E 3 39  ? 7.848   64.145 -7.754  1.00 72.48  ? 416 PRO O CA    1 
ATOM 5768 C C     . PRO E 3 39  ? 7.330   63.018 -6.867  1.00 73.17  ? 416 PRO O C     1 
ATOM 5769 O O     . PRO E 3 39  ? 6.755   63.266 -5.813  1.00 75.88  ? 416 PRO O O     1 
ATOM 5770 C CB    . PRO E 3 39  ? 9.338   64.415 -7.533  1.00 70.47  ? 416 PRO O CB    1 
ATOM 5771 C CG    . PRO E 3 39  ? 9.341   65.537 -6.500  1.00 65.38  ? 416 PRO O CG    1 
ATOM 5772 C CD    . PRO E 3 39  ? 8.241   66.417 -7.006  1.00 70.18  ? 416 PRO O CD    1 
ATOM 5773 N N     . LYS E 3 40  ? 7.526   61.777 -7.292  1.00 77.99  ? 417 LYS O N     1 
ATOM 5774 C CA    . LYS E 3 40  ? 7.069   60.654 -6.486  1.00 79.57  ? 417 LYS O CA    1 
ATOM 5775 C C     . LYS E 3 40  ? 7.815   60.606 -5.152  1.00 81.45  ? 417 LYS O C     1 
ATOM 5776 O O     . LYS E 3 40  ? 8.852   61.256 -4.983  1.00 81.39  ? 417 LYS O O     1 
ATOM 5777 C CB    . LYS E 3 40  ? 7.243   59.333 -7.251  1.00 75.68  ? 417 LYS O CB    1 
ATOM 5778 C CG    . LYS E 3 40  ? 5.975   58.909 -7.991  1.00 74.17  ? 417 LYS O CG    1 
ATOM 5779 C CD    . LYS E 3 40  ? 6.182   57.716 -8.903  1.00 73.19  ? 417 LYS O CD    1 
ATOM 5780 C CE    . LYS E 3 40  ? 6.660   56.492 -8.145  1.00 74.94  ? 417 LYS O CE    1 
ATOM 5781 N NZ    . LYS E 3 40  ? 6.739   55.294 -9.039  1.00 74.55  ? 417 LYS O NZ    1 
ATOM 5782 N N     . PRO E 3 41  ? 7.276   59.853 -4.175  1.00 86.43  ? 418 PRO O N     1 
ATOM 5783 C CA    . PRO E 3 41  ? 7.893   59.720 -2.849  1.00 89.46  ? 418 PRO O CA    1 
ATOM 5784 C C     . PRO E 3 41  ? 9.200   58.960 -2.988  1.00 91.31  ? 418 PRO O C     1 
ATOM 5785 O O     . PRO E 3 41  ? 10.102  59.078 -2.157  1.00 99.85  ? 418 PRO O O     1 
ATOM 5786 C CB    . PRO E 3 41  ? 6.866   58.907 -2.064  1.00 93.04  ? 418 PRO O CB    1 
ATOM 5787 C CG    . PRO E 3 41  ? 5.577   59.173 -2.781  1.00 90.52  ? 418 PRO O CG    1 
ATOM 5788 C CD    . PRO E 3 41  ? 5.990   59.138 -4.220  1.00 89.21  ? 418 PRO O CD    1 
ATOM 5789 N N     . HIS E 3 42  ? 9.278   58.178 -4.060  1.00 93.36  ? 419 HIS O N     1 
ATOM 5790 C CA    . HIS E 3 42  ? 10.442  57.360 -4.349  1.00 85.65  ? 419 HIS O CA    1 
ATOM 5791 C C     . HIS E 3 42  ? 10.838  57.361 -5.822  1.00 79.94  ? 419 HIS O C     1 
ATOM 5792 O O     . HIS E 3 42  ? 10.004  57.532 -6.717  1.00 75.27  ? 419 HIS O O     1 
ATOM 5793 C CB    . HIS E 3 42  ? 10.171  55.920 -3.902  1.00 85.56  ? 419 HIS O CB    1 
ATOM 5794 C CG    . HIS E 3 42  ? 11.236  54.941 -4.300  1.00 88.28  ? 419 HIS O CG    1 
ATOM 5795 N ND1   . HIS E 3 42  ? 12.551  55.064 -3.902  1.00 89.64  ? 419 HIS O ND1   1 
ATOM 5796 C CD2   . HIS E 3 42  ? 11.173  53.805 -5.038  1.00 89.33  ? 419 HIS O CD2   1 
ATOM 5797 C CE1   . HIS E 3 42  ? 13.251  54.046 -4.376  1.00 90.16  ? 419 HIS O CE1   1 
ATOM 5798 N NE2   . HIS E 3 42  ? 12.439  53.268 -5.068  1.00 89.56  ? 419 HIS O NE2   1 
ATOM 5799 N N     . HIS E 3 43  ? 12.137  57.184 -6.037  1.00 73.56  ? 420 HIS O N     1 
ATOM 5800 C CA    . HIS E 3 43  ? 12.759  57.076 -7.354  1.00 70.19  ? 420 HIS O CA    1 
ATOM 5801 C C     . HIS E 3 43  ? 14.109  56.393 -7.137  1.00 67.12  ? 420 HIS O C     1 
ATOM 5802 O O     . HIS E 3 43  ? 15.093  57.045 -6.784  1.00 69.30  ? 420 HIS O O     1 
ATOM 5803 C CB    . HIS E 3 43  ? 13.007  58.438 -8.015  1.00 70.99  ? 420 HIS O CB    1 
ATOM 5804 C CG    . HIS E 3 43  ? 13.957  58.362 -9.174  1.00 69.11  ? 420 HIS O CG    1 
ATOM 5805 N ND1   . HIS E 3 43  ? 13.661  57.677 -10.333 1.00 68.80  ? 420 HIS O ND1   1 
ATOM 5806 C CD2   . HIS E 3 43  ? 15.239  58.780 -9.305  1.00 67.75  ? 420 HIS O CD2   1 
ATOM 5807 C CE1   . HIS E 3 43  ? 14.721  57.669 -11.123 1.00 67.35  ? 420 HIS O CE1   1 
ATOM 5808 N NE2   . HIS E 3 43  ? 15.692  58.332 -10.522 1.00 67.06  ? 420 HIS O NE2   1 
ATOM 5809 N N     . ARG E 3 44  ? 14.157  55.080 -7.331  1.00 62.00  ? 421 ARG O N     1 
ATOM 5810 C CA    . ARG E 3 44  ? 15.403  54.354 -7.144  1.00 55.30  ? 421 ARG O CA    1 
ATOM 5811 C C     . ARG E 3 44  ? 16.486  54.961 -8.028  1.00 54.94  ? 421 ARG O C     1 
ATOM 5812 O O     . ARG E 3 44  ? 16.314  55.084 -9.242  1.00 55.47  ? 421 ARG O O     1 
ATOM 5813 C CB    . ARG E 3 44  ? 15.193  52.874 -7.477  1.00 48.56  ? 421 ARG O CB    1 
ATOM 5814 C CG    . ARG E 3 44  ? 16.463  52.026 -7.509  1.00 37.74  ? 421 ARG O CG    1 
ATOM 5815 C CD    . ARG E 3 44  ? 16.122  50.566 -7.820  1.00 29.64  ? 421 ARG O CD    1 
ATOM 5816 N NE    . ARG E 3 44  ? 17.316  49.733 -7.895  1.00 23.74  ? 421 ARG O NE    1 
ATOM 5817 C CZ    . ARG E 3 44  ? 17.298  48.420 -8.113  1.00 24.05  ? 421 ARG O CZ    1 
ATOM 5818 N NH1   . ARG E 3 44  ? 16.136  47.782 -8.279  1.00 20.29  ? 421 ARG O NH1   1 
ATOM 5819 N NH2   . ARG E 3 44  ? 18.448  47.739 -8.164  1.00 23.59  ? 421 ARG O NH2   1 
ATOM 5820 N N     . ALA E 3 45  ? 17.588  55.365 -7.411  1.00 53.71  ? 422 ALA O N     1 
ATOM 5821 C CA    . ALA E 3 45  ? 18.687  55.955 -8.155  1.00 54.91  ? 422 ALA O CA    1 
ATOM 5822 C C     . ALA E 3 45  ? 19.566  54.822 -8.654  1.00 55.63  ? 422 ALA O C     1 
ATOM 5823 O O     . ALA E 3 45  ? 19.501  53.712 -8.119  1.00 57.84  ? 422 ALA O O     1 
ATOM 5824 C CB    . ALA E 3 45  ? 19.481  56.874 -7.266  1.00 55.33  ? 422 ALA O CB    1 
ATOM 5825 N N     . HIS E 3 46  ? 20.387  55.105 -9.665  1.00 54.05  ? 423 HIS O N     1 
ATOM 5826 C CA    . HIS E 3 46  ? 21.282  54.107 -10.258 1.00 52.73  ? 423 HIS O CA    1 
ATOM 5827 C C     . HIS E 3 46  ? 22.755  54.381 -9.937  1.00 53.10  ? 423 HIS O C     1 
ATOM 5828 O O     . HIS E 3 46  ? 23.125  55.512 -9.616  1.00 52.44  ? 423 HIS O O     1 
ATOM 5829 C CB    . HIS E 3 46  ? 21.127  54.122 -11.776 1.00 53.70  ? 423 HIS O CB    1 
ATOM 5830 C CG    . HIS E 3 46  ? 21.474  55.443 -12.403 1.00 54.08  ? 423 HIS O CG    1 
ATOM 5831 N ND1   . HIS E 3 46  ? 20.522  56.387 -12.734 1.00 52.39  ? 423 HIS O ND1   1 
ATOM 5832 C CD2   . HIS E 3 46  ? 22.674  55.999 -12.704 1.00 52.66  ? 423 HIS O CD2   1 
ATOM 5833 C CE1   . HIS E 3 46  ? 21.120  57.465 -13.208 1.00 51.50  ? 423 HIS O CE1   1 
ATOM 5834 N NE2   . HIS E 3 46  ? 22.426  57.256 -13.200 1.00 51.79  ? 423 HIS O NE2   1 
ATOM 5835 N N     . TYR E 3 47  ? 23.594  53.352 -10.042 1.00 54.12  ? 424 TYR O N     1 
ATOM 5836 C CA    . TYR E 3 47  ? 25.035  53.510 -9.816  1.00 56.35  ? 424 TYR O CA    1 
ATOM 5837 C C     . TYR E 3 47  ? 25.735  53.701 -11.168 1.00 56.53  ? 424 TYR O C     1 
ATOM 5838 O O     . TYR E 3 47  ? 25.138  53.465 -12.232 1.00 50.57  ? 424 TYR O O     1 
ATOM 5839 C CB    . TYR E 3 47  ? 25.617  52.275 -9.125  1.00 61.80  ? 424 TYR O CB    1 
ATOM 5840 C CG    . TYR E 3 47  ? 25.142  52.100 -7.700  1.00 73.04  ? 424 TYR O CG    1 
ATOM 5841 C CD1   . TYR E 3 47  ? 23.790  51.928 -7.411  1.00 76.60  ? 424 TYR O CD1   1 
ATOM 5842 C CD2   . TYR E 3 47  ? 26.040  52.150 -6.632  1.00 76.94  ? 424 TYR O CD2   1 
ATOM 5843 C CE1   . TYR E 3 47  ? 23.348  51.816 -6.104  1.00 79.04  ? 424 TYR O CE1   1 
ATOM 5844 C CE2   . TYR E 3 47  ? 25.599  52.042 -5.319  1.00 78.73  ? 424 TYR O CE2   1 
ATOM 5845 C CZ    . TYR E 3 47  ? 24.254  51.878 -5.065  1.00 79.13  ? 424 TYR O CZ    1 
ATOM 5846 O OH    . TYR E 3 47  ? 23.804  51.807 -3.770  1.00 80.57  ? 424 TYR O OH    1 
ATOM 5847 N N     . GLU E 3 48  ? 26.997  54.124 -11.135 1.00 58.55  ? 425 GLU O N     1 
ATOM 5848 C CA    . GLU E 3 48  ? 27.749  54.323 -12.375 1.00 62.40  ? 425 GLU O CA    1 
ATOM 5849 C C     . GLU E 3 48  ? 28.191  52.998 -12.973 1.00 57.52  ? 425 GLU O C     1 
ATOM 5850 O O     . GLU E 3 48  ? 28.986  52.978 -13.900 1.00 57.49  ? 425 GLU O O     1 
ATOM 5851 C CB    . GLU E 3 48  ? 28.990  55.189 -12.140 1.00 75.35  ? 425 GLU O CB    1 
ATOM 5852 C CG    . GLU E 3 48  ? 28.711  56.524 -11.472 1.00 98.14  ? 425 GLU O CG    1 
ATOM 5853 C CD    . GLU E 3 48  ? 29.916  57.453 -11.492 1.00 109.03 ? 425 GLU O CD    1 
ATOM 5854 O OE1   . GLU E 3 48  ? 31.030  56.990 -11.160 1.00 115.25 ? 425 GLU O OE1   1 
ATOM 5855 O OE2   . GLU E 3 48  ? 29.744  58.647 -11.832 1.00 114.22 ? 425 GLU O OE2   1 
ATOM 5856 N N     . THR E 3 49  ? 27.694  51.892 -12.436 1.00 54.55  ? 426 THR O N     1 
ATOM 5857 C CA    . THR E 3 49  ? 28.059  50.574 -12.941 1.00 51.57  ? 426 THR O CA    1 
ATOM 5858 C C     . THR E 3 49  ? 26.801  49.924 -13.513 1.00 55.33  ? 426 THR O C     1 
ATOM 5859 O O     . THR E 3 49  ? 26.804  48.763 -13.950 1.00 50.70  ? 426 THR O O     1 
ATOM 5860 C CB    . THR E 3 49  ? 28.634  49.672 -11.826 1.00 48.21  ? 426 THR O CB    1 
ATOM 5861 O OG1   . THR E 3 49  ? 27.568  49.154 -11.013 1.00 47.09  ? 426 THR O OG1   1 
ATOM 5862 C CG2   . THR E 3 49  ? 29.610  50.464 -10.965 1.00 47.00  ? 426 THR O CG2   1 
ATOM 5863 N N     . GLU E 3 50  ? 25.719  50.693 -13.475 1.00 60.82  ? 427 GLU O N     1 
ATOM 5864 C CA    . GLU E 3 50  ? 24.433  50.271 -14.004 1.00 68.60  ? 427 GLU O CA    1 
ATOM 5865 C C     . GLU E 3 50  ? 24.183  51.273 -15.121 1.00 73.44  ? 427 GLU O C     1 
ATOM 5866 O O     . GLU E 3 50  ? 24.893  52.281 -15.219 1.00 75.68  ? 427 GLU O O     1 
ATOM 5867 C CB    . GLU E 3 50  ? 23.322  50.415 -12.954 1.00 69.30  ? 427 GLU O CB    1 
ATOM 5868 C CG    . GLU E 3 50  ? 23.459  49.601 -11.671 1.00 69.01  ? 427 GLU O CG    1 
ATOM 5869 C CD    . GLU E 3 50  ? 22.210  49.718 -10.801 1.00 69.38  ? 427 GLU O CD    1 
ATOM 5870 O OE1   . GLU E 3 50  ? 21.819  50.863 -10.478 1.00 68.36  ? 427 GLU O OE1   1 
ATOM 5871 O OE2   . GLU E 3 50  ? 21.618  48.672 -10.448 1.00 69.02  ? 427 GLU O OE2   1 
ATOM 5872 N N     . GLY E 3 51  ? 23.183  51.016 -15.958 1.00 75.46  ? 428 GLY O N     1 
ATOM 5873 C CA    . GLY E 3 51  ? 22.906  51.955 -17.028 1.00 77.74  ? 428 GLY O CA    1 
ATOM 5874 C C     . GLY E 3 51  ? 22.459  53.285 -16.446 1.00 74.39  ? 428 GLY O C     1 
ATOM 5875 O O     . GLY E 3 51  ? 23.263  54.155 -16.084 1.00 78.30  ? 428 GLY O O     1 
ATOM 5876 N N     . SER E 3 52  ? 21.146  53.423 -16.367 1.00 68.69  ? 429 SER O N     1 
ATOM 5877 C CA    . SER E 3 52  ? 20.488  54.596 -15.825 1.00 56.53  ? 429 SER O CA    1 
ATOM 5878 C C     . SER E 3 52  ? 19.132  54.071 -15.454 1.00 51.26  ? 429 SER O C     1 
ATOM 5879 O O     . SER E 3 52  ? 18.525  53.341 -16.227 1.00 48.84  ? 429 SER O O     1 
ATOM 5880 C CB    . SER E 3 52  ? 20.311  55.675 -16.881 1.00 51.99  ? 429 SER O CB    1 
ATOM 5881 O OG    . SER E 3 52  ? 19.074  56.339 -16.676 1.00 48.26  ? 429 SER O OG    1 
ATOM 5882 N N     . ARG E 3 53  ? 18.638  54.418 -14.283 1.00 45.37  ? 430 ARG O N     1 
ATOM 5883 C CA    . ARG E 3 53  ? 17.334  53.909 -13.932 1.00 43.14  ? 430 ARG O CA    1 
ATOM 5884 C C     . ARG E 3 53  ? 16.185  54.841 -14.335 1.00 43.40  ? 430 ARG O C     1 
ATOM 5885 O O     . ARG E 3 53  ? 15.076  54.761 -13.811 1.00 42.54  ? 430 ARG O O     1 
ATOM 5886 C CB    . ARG E 3 53  ? 17.319  53.538 -12.447 1.00 41.92  ? 430 ARG O CB    1 
ATOM 5887 C CG    . ARG E 3 53  ? 17.731  52.088 -12.260 1.00 38.00  ? 430 ARG O CG    1 
ATOM 5888 C CD    . ARG E 3 53  ? 18.627  51.806 -11.066 1.00 33.54  ? 430 ARG O CD    1 
ATOM 5889 N NE    . ARG E 3 53  ? 19.121  50.431 -11.156 1.00 30.69  ? 430 ARG O NE    1 
ATOM 5890 C CZ    . ARG E 3 53  ? 18.337  49.367 -11.351 1.00 29.56  ? 430 ARG O CZ    1 
ATOM 5891 N NH1   . ARG E 3 53  ? 17.017  49.518 -11.465 1.00 28.64  ? 430 ARG O NH1   1 
ATOM 5892 N NH2   . ARG E 3 53  ? 18.864  48.151 -11.460 1.00 25.01  ? 430 ARG O NH2   1 
ATOM 5893 N N     . GLY E 3 54  ? 16.456  55.721 -15.291 1.00 44.38  ? 431 GLY O N     1 
ATOM 5894 C CA    . GLY E 3 54  ? 15.412  56.602 -15.762 1.00 47.45  ? 431 GLY O CA    1 
ATOM 5895 C C     . GLY E 3 54  ? 15.325  57.966 -15.132 1.00 51.38  ? 431 GLY O C     1 
ATOM 5896 O O     . GLY E 3 54  ? 16.253  58.434 -14.471 1.00 51.26  ? 431 GLY O O     1 
ATOM 5897 N N     . ALA E 3 55  ? 14.182  58.609 -15.349 1.00 52.80  ? 432 ALA O N     1 
ATOM 5898 C CA    . ALA E 3 55  ? 13.937  59.942 -14.829 1.00 57.98  ? 432 ALA O CA    1 
ATOM 5899 C C     . ALA E 3 55  ? 12.876  59.973 -13.743 1.00 61.68  ? 432 ALA O C     1 
ATOM 5900 O O     . ALA E 3 55  ? 12.054  59.064 -13.610 1.00 68.05  ? 432 ALA O O     1 
ATOM 5901 C CB    . ALA E 3 55  ? 13.537  60.863 -15.954 1.00 57.75  ? 432 ALA O CB    1 
ATOM 5902 N N     . VAL E 3 56  ? 12.906  61.046 -12.971 1.00 64.93  ? 433 VAL O N     1 
ATOM 5903 C CA    . VAL E 3 56  ? 11.973  61.245 -11.884 1.00 63.22  ? 433 VAL O CA    1 
ATOM 5904 C C     . VAL E 3 56  ? 10.571  61.446 -12.435 1.00 65.88  ? 433 VAL O C     1 
ATOM 5905 O O     . VAL E 3 56  ? 10.395  62.096 -13.459 1.00 65.15  ? 433 VAL O O     1 
ATOM 5906 C CB    . VAL E 3 56  ? 12.364  62.475 -11.104 1.00 60.17  ? 433 VAL O CB    1 
ATOM 5907 C CG1   . VAL E 3 56  ? 11.648  62.486 -9.767  1.00 58.36  ? 433 VAL O CG1   1 
ATOM 5908 C CG2   . VAL E 3 56  ? 13.870  62.514 -10.954 1.00 54.23  ? 433 VAL O CG2   1 
ATOM 5909 N N     . LYS E 3 57  ? 9.569   60.901 -11.757 1.00 68.05  ? 434 LYS O N     1 
ATOM 5910 C CA    . LYS E 3 57  ? 8.208   61.059 -12.235 1.00 71.67  ? 434 LYS O CA    1 
ATOM 5911 C C     . LYS E 3 57  ? 7.224   61.525 -11.169 1.00 76.68  ? 434 LYS O C     1 
ATOM 5912 O O     . LYS E 3 57  ? 7.488   61.445 -9.967  1.00 77.50  ? 434 LYS O O     1 
ATOM 5913 C CB    . LYS E 3 57  ? 7.713   59.757 -12.852 1.00 68.27  ? 434 LYS O CB    1 
ATOM 5914 C CG    . LYS E 3 57  ? 8.617   59.212 -13.930 1.00 65.95  ? 434 LYS O CG    1 
ATOM 5915 C CD    . LYS E 3 57  ? 7.838   58.306 -14.859 1.00 67.22  ? 434 LYS O CD    1 
ATOM 5916 C CE    . LYS E 3 57  ? 8.714   57.203 -15.434 1.00 68.70  ? 434 LYS O CE    1 
ATOM 5917 N NZ    . LYS E 3 57  ? 9.253   56.273 -14.383 1.00 69.86  ? 434 LYS O NZ    1 
ATOM 5918 N N     . ALA E 3 58  ? 6.090   62.039 -11.630 1.00 81.29  ? 435 ALA O N     1 
ATOM 5919 C CA    . ALA E 3 58  ? 5.049   62.519 -10.743 1.00 85.78  ? 435 ALA O CA    1 
ATOM 5920 C C     . ALA E 3 58  ? 4.157   61.324 -10.517 1.00 88.78  ? 435 ALA O C     1 
ATOM 5921 O O     . ALA E 3 58  ? 4.019   60.485 -11.398 1.00 87.33  ? 435 ALA O O     1 
ATOM 5922 C CB    . ALA E 3 58  ? 4.268   63.636 -11.411 1.00 90.94  ? 435 ALA O CB    1 
ATOM 5923 N N     . PRO E 3 59  ? 3.549   61.217 -9.329  1.00 91.31  ? 436 PRO O N     1 
ATOM 5924 C CA    . PRO E 3 59  ? 2.669   60.072 -9.058  1.00 96.86  ? 436 PRO O CA    1 
ATOM 5925 C C     . PRO E 3 59  ? 1.488   60.038 -10.039 1.00 106.21 ? 436 PRO O C     1 
ATOM 5926 O O     . PRO E 3 59  ? 0.825   59.011 -10.207 1.00 103.12 ? 436 PRO O O     1 
ATOM 5927 C CB    . PRO E 3 59  ? 2.225   60.311 -7.614  1.00 87.97  ? 436 PRO O CB    1 
ATOM 5928 C CG    . PRO E 3 59  ? 3.379   61.076 -7.024  1.00 84.45  ? 436 PRO O CG    1 
ATOM 5929 C CD    . PRO E 3 59  ? 3.719   62.051 -8.128  1.00 84.97  ? 436 PRO O CD    1 
ATOM 5930 N N     . THR E 3 60  ? 1.235   61.176 -10.680 1.00 114.29 ? 437 THR O N     1 
ATOM 5931 C CA    . THR E 3 60  ? 0.151   61.296 -11.647 1.00 131.24 ? 437 THR O CA    1 
ATOM 5932 C C     . THR E 3 60  ? 0.422   60.372 -12.831 1.00 126.80 ? 437 THR O C     1 
ATOM 5933 O O     . THR E 3 60  ? -0.497  59.943 -13.527 1.00 138.06 ? 437 THR O O     1 
ATOM 5934 C CB    . THR E 3 60  ? 0.020   62.756 -12.164 1.00 145.64 ? 437 THR O CB    1 
ATOM 5935 O OG1   . THR E 3 60  ? 1.265   63.182 -12.733 1.00 154.00 ? 437 THR O OG1   1 
ATOM 5936 C CG2   . THR E 3 60  ? -0.353  63.697 -11.027 1.00 153.25 ? 437 THR O CG2   1 
ATOM 5937 N N     . GLY E 3 61  ? 1.696   60.061 -13.038 1.00 123.44 ? 438 GLY O N     1 
ATOM 5938 C CA    . GLY E 3 61  ? 2.091   59.205 -14.138 1.00 104.16 ? 438 GLY O CA    1 
ATOM 5939 C C     . GLY E 3 61  ? 3.093   59.944 -15.005 1.00 93.80  ? 438 GLY O C     1 
ATOM 5940 O O     . GLY E 3 61  ? 4.007   59.342 -15.581 1.00 86.15  ? 438 GLY O O     1 
ATOM 5941 N N     . GLY E 3 62  ? 2.924   61.262 -15.085 1.00 86.11  ? 439 GLY O N     1 
ATOM 5942 C CA    . GLY E 3 62  ? 3.816   62.088 -15.880 1.00 85.52  ? 439 GLY O CA    1 
ATOM 5943 C C     . GLY E 3 62  ? 5.084   62.441 -15.129 1.00 86.90  ? 439 GLY O C     1 
ATOM 5944 O O     . GLY E 3 62  ? 5.625   61.615 -14.398 1.00 86.01  ? 439 GLY O O     1 
ATOM 5945 N N     . HIS E 3 63  ? 5.566   63.668 -15.305 1.00 89.46  ? 440 HIS O N     1 
ATOM 5946 C CA    . HIS E 3 63  ? 6.788   64.103 -14.635 1.00 91.98  ? 440 HIS O CA    1 
ATOM 5947 C C     . HIS E 3 63  ? 6.647   65.426 -13.872 1.00 92.12  ? 440 HIS O C     1 
ATOM 5948 O O     . HIS E 3 63  ? 5.738   66.216 -14.131 1.00 93.83  ? 440 HIS O O     1 
ATOM 5949 C CB    . HIS E 3 63  ? 7.921   64.208 -15.659 1.00 94.63  ? 440 HIS O CB    1 
ATOM 5950 C CG    . HIS E 3 63  ? 8.206   62.922 -16.369 1.00 97.06  ? 440 HIS O CG    1 
ATOM 5951 N ND1   . HIS E 3 63  ? 9.454   62.602 -16.855 1.00 98.25  ? 440 HIS O ND1   1 
ATOM 5952 C CD2   . HIS E 3 63  ? 7.407   61.870 -16.669 1.00 98.27  ? 440 HIS O CD2   1 
ATOM 5953 C CE1   . HIS E 3 63  ? 9.414   61.408 -17.418 1.00 99.59  ? 440 HIS O CE1   1 
ATOM 5954 N NE2   . HIS E 3 63  ? 8.182   60.941 -17.319 1.00 99.49  ? 440 HIS O NE2   1 
ATOM 5955 N N     . PRO E 3 64  ? 7.554   65.679 -12.913 1.00 93.09  ? 441 PRO O N     1 
ATOM 5956 C CA    . PRO E 3 64  ? 7.535   66.905 -12.112 1.00 94.32  ? 441 PRO O CA    1 
ATOM 5957 C C     . PRO E 3 64  ? 7.475   68.176 -12.948 1.00 94.87  ? 441 PRO O C     1 
ATOM 5958 O O     . PRO E 3 64  ? 8.045   68.241 -14.039 1.00 98.98  ? 441 PRO O O     1 
ATOM 5959 C CB    . PRO E 3 64  ? 8.822   66.803 -11.289 1.00 93.30  ? 441 PRO O CB    1 
ATOM 5960 C CG    . PRO E 3 64  ? 9.697   65.915 -12.103 1.00 90.70  ? 441 PRO O CG    1 
ATOM 5961 C CD    . PRO E 3 64  ? 8.729   64.864 -12.568 1.00 92.28  ? 441 PRO O CD    1 
ATOM 5962 N N     . VAL E 3 65  ? 6.779   69.181 -12.417 1.00 91.90  ? 442 VAL O N     1 
ATOM 5963 C CA    . VAL E 3 65  ? 6.608   70.462 -13.096 1.00 90.00  ? 442 VAL O CA    1 
ATOM 5964 C C     . VAL E 3 65  ? 6.999   71.656 -12.230 1.00 89.13  ? 442 VAL O C     1 
ATOM 5965 O O     . VAL E 3 65  ? 6.584   71.756 -11.078 1.00 94.26  ? 442 VAL O O     1 
ATOM 5966 C CB    . VAL E 3 65  ? 5.138   70.659 -13.542 1.00 88.71  ? 442 VAL O CB    1 
ATOM 5967 C CG1   . VAL E 3 65  ? 4.973   72.033 -14.160 1.00 81.13  ? 442 VAL O CG1   1 
ATOM 5968 C CG2   . VAL E 3 65  ? 4.734   69.568 -14.539 1.00 79.88  ? 442 VAL O CG2   1 
ATOM 5969 N N     . VAL E 3 66  ? 7.791   72.560 -12.804 1.00 88.81  ? 443 VAL O N     1 
ATOM 5970 C CA    . VAL E 3 66  ? 8.245   73.772 -12.116 1.00 83.14  ? 443 VAL O CA    1 
ATOM 5971 C C     . VAL E 3 66  ? 7.737   75.000 -12.878 1.00 90.46  ? 443 VAL O C     1 
ATOM 5972 O O     . VAL E 3 66  ? 7.402   74.895 -14.060 1.00 88.97  ? 443 VAL O O     1 
ATOM 5973 C CB    . VAL E 3 66  ? 9.797   73.819 -12.035 1.00 71.95  ? 443 VAL O CB    1 
ATOM 5974 C CG1   . VAL E 3 66  ? 10.275  75.160 -11.456 1.00 59.30  ? 443 VAL O CG1   1 
ATOM 5975 C CG2   . VAL E 3 66  ? 10.294  72.663 -11.172 1.00 60.53  ? 443 VAL O CG2   1 
ATOM 5976 N N     . GLN E 3 67  ? 7.671   76.153 -12.209 1.00 96.13  ? 444 GLN O N     1 
ATOM 5977 C CA    . GLN E 3 67  ? 7.189   77.381 -12.851 1.00 106.84 ? 444 GLN O CA    1 
ATOM 5978 C C     . GLN E 3 67  ? 7.660   78.654 -12.150 1.00 110.19 ? 444 GLN O C     1 
ATOM 5979 O O     . GLN E 3 67  ? 8.042   78.625 -10.981 1.00 117.02 ? 444 GLN O O     1 
ATOM 5980 C CB    . GLN E 3 67  ? 5.659   77.371 -12.911 1.00 113.65 ? 444 GLN O CB    1 
ATOM 5981 C CG    . GLN E 3 67  ? 5.065   78.289 -13.966 1.00 114.93 ? 444 GLN O CG    1 
ATOM 5982 C CD    . GLN E 3 67  ? 3.745   77.764 -14.500 1.00 115.31 ? 444 GLN O CD    1 
ATOM 5983 O OE1   . GLN E 3 67  ? 2.750   77.704 -13.782 1.00 116.10 ? 444 GLN O OE1   1 
ATOM 5984 N NE2   . GLN E 3 67  ? 3.737   77.365 -15.764 1.00 115.74 ? 444 GLN O NE2   1 
ATOM 5985 N N     . LEU E 3 68  ? 7.623   79.770 -12.874 1.00 112.31 ? 445 LEU O N     1 
ATOM 5986 C CA    . LEU E 3 68  ? 8.046   81.059 -12.328 1.00 108.90 ? 445 LEU O CA    1 
ATOM 5987 C C     . LEU E 3 68  ? 6.978   82.124 -12.595 1.00 113.34 ? 445 LEU O C     1 
ATOM 5988 O O     . LEU E 3 68  ? 6.670   82.430 -13.749 1.00 110.41 ? 445 LEU O O     1 
ATOM 5989 C CB    . LEU E 3 68  ? 9.384   81.481 -12.951 1.00 96.13  ? 445 LEU O CB    1 
ATOM 5990 C CG    . LEU E 3 68  ? 10.181  82.564 -12.214 1.00 87.02  ? 445 LEU O CG    1 
ATOM 5991 C CD1   . LEU E 3 68  ? 10.555  82.063 -10.831 1.00 82.86  ? 445 LEU O CD1   1 
ATOM 5992 C CD2   . LEU E 3 68  ? 11.440  82.914 -12.983 1.00 81.62  ? 445 LEU O CD2   1 
ATOM 5993 N N     . HIS E 3 69  ? 6.421   82.683 -11.519 1.00 118.95 ? 446 HIS O N     1 
ATOM 5994 C CA    . HIS E 3 69  ? 5.373   83.702 -11.614 1.00 128.00 ? 446 HIS O CA    1 
ATOM 5995 C C     . HIS E 3 69  ? 5.855   85.097 -11.234 1.00 132.77 ? 446 HIS O C     1 
ATOM 5996 O O     . HIS E 3 69  ? 6.551   85.276 -10.236 1.00 134.98 ? 446 HIS O O     1 
ATOM 5997 C CB    . HIS E 3 69  ? 4.200   83.314 -10.717 1.00 130.47 ? 446 HIS O CB    1 
ATOM 5998 C CG    . HIS E 3 69  ? 3.708   81.924 -10.949 1.00 132.83 ? 446 HIS O CG    1 
ATOM 5999 N ND1   . HIS E 3 69  ? 3.077   81.544 -12.115 1.00 133.39 ? 446 HIS O ND1   1 
ATOM 6000 C CD2   . HIS E 3 69  ? 3.791   80.809 -10.185 1.00 133.58 ? 446 HIS O CD2   1 
ATOM 6001 C CE1   . HIS E 3 69  ? 2.794   80.255 -12.058 1.00 134.11 ? 446 HIS O CE1   1 
ATOM 6002 N NE2   . HIS E 3 69  ? 3.217   79.785 -10.898 1.00 133.99 ? 446 HIS O NE2   1 
ATOM 6003 N N     . GLY E 3 70  ? 5.466   86.086 -12.030 1.00 138.88 ? 447 GLY O N     1 
ATOM 6004 C CA    . GLY E 3 70  ? 5.872   87.452 -11.763 1.00 143.34 ? 447 GLY O CA    1 
ATOM 6005 C C     . GLY E 3 70  ? 6.819   87.979 -12.825 1.00 145.74 ? 447 GLY O C     1 
ATOM 6006 O O     . GLY E 3 70  ? 7.244   89.136 -12.768 1.00 146.57 ? 447 GLY O O     1 
ATOM 6007 N N     . TYR E 3 71  ? 7.148   87.130 -13.797 1.00 144.06 ? 448 TYR O N     1 
ATOM 6008 C CA    . TYR E 3 71  ? 8.051   87.509 -14.882 1.00 144.58 ? 448 TYR O CA    1 
ATOM 6009 C C     . TYR E 3 71  ? 7.236   87.929 -16.099 1.00 147.97 ? 448 TYR O C     1 
ATOM 6010 O O     . TYR E 3 71  ? 6.683   87.091 -16.813 1.00 155.28 ? 448 TYR O O     1 
ATOM 6011 C CB    . TYR E 3 71  ? 8.959   86.335 -15.250 1.00 135.79 ? 448 TYR O CB    1 
ATOM 6012 C CG    . TYR E 3 71  ? 10.170  86.711 -16.080 1.00 120.82 ? 448 TYR O CG    1 
ATOM 6013 C CD1   . TYR E 3 71  ? 11.129  87.599 -15.591 1.00 113.11 ? 448 TYR O CD1   1 
ATOM 6014 C CD2   . TYR E 3 71  ? 10.377  86.147 -17.340 1.00 113.70 ? 448 TYR O CD2   1 
ATOM 6015 C CE1   . TYR E 3 71  ? 12.266  87.912 -16.334 1.00 107.09 ? 448 TYR O CE1   1 
ATOM 6016 C CE2   . TYR E 3 71  ? 11.509  86.453 -18.091 1.00 107.48 ? 448 TYR O CE2   1 
ATOM 6017 C CZ    . TYR E 3 71  ? 12.448  87.335 -17.583 1.00 105.94 ? 448 TYR O CZ    1 
ATOM 6018 O OH    . TYR E 3 71  ? 13.563  87.642 -18.327 1.00 103.14 ? 448 TYR O OH    1 
ATOM 6019 N N     . MET E 3 72  ? 7.171   89.237 -16.324 1.00 148.14 ? 449 MET O N     1 
ATOM 6020 C CA    . MET E 3 72  ? 6.416   89.795 -17.438 1.00 141.40 ? 449 MET O CA    1 
ATOM 6021 C C     . MET E 3 72  ? 7.297   89.869 -18.686 1.00 137.30 ? 449 MET O C     1 
ATOM 6022 O O     . MET E 3 72  ? 6.795   89.901 -19.813 1.00 135.52 ? 449 MET O O     1 
ATOM 6023 C CB    . MET E 3 72  ? 5.911   91.196 -17.063 1.00 141.01 ? 449 MET O CB    1 
ATOM 6024 C CG    . MET E 3 72  ? 5.441   91.341 -15.606 1.00 138.48 ? 449 MET O CG    1 
ATOM 6025 S SD    . MET E 3 72  ? 3.952   90.399 -15.163 1.00 137.09 ? 449 MET O SD    1 
ATOM 6026 C CE    . MET E 3 72  ? 2.758   91.730 -14.908 1.00 137.25 ? 449 MET O CE    1 
ATOM 6027 N N     . GLU E 3 73  ? 8.612   89.890 -18.468 1.00 132.68 ? 450 GLU O N     1 
ATOM 6028 C CA    . GLU E 3 73  ? 9.600   89.966 -19.545 1.00 127.38 ? 450 GLU O CA    1 
ATOM 6029 C C     . GLU E 3 73  ? 9.358   88.944 -20.646 1.00 124.77 ? 450 GLU O C     1 
ATOM 6030 O O     . GLU E 3 73  ? 8.327   88.267 -20.671 1.00 122.38 ? 450 GLU O O     1 
ATOM 6031 C CB    . GLU E 3 73  ? 11.009  89.757 -18.988 1.00 125.11 ? 450 GLU O CB    1 
ATOM 6032 C CG    . GLU E 3 73  ? 11.547  90.890 -18.129 1.00 125.11 ? 450 GLU O CG    1 
ATOM 6033 C CD    . GLU E 3 73  ? 12.085  92.044 -18.952 1.00 125.09 ? 450 GLU O CD    1 
ATOM 6034 O OE1   . GLU E 3 73  ? 12.641  92.988 -18.351 1.00 124.60 ? 450 GLU O OE1   1 
ATOM 6035 O OE2   . GLU E 3 73  ? 11.953  92.006 -20.196 1.00 124.82 ? 450 GLU O OE2   1 
ATOM 6036 N N     . ASN E 3 74  ? 10.327  88.834 -21.552 1.00 120.95 ? 451 ASN O N     1 
ATOM 6037 C CA    . ASN E 3 74  ? 10.227  87.896 -22.664 1.00 121.75 ? 451 ASN O CA    1 
ATOM 6038 C C     . ASN E 3 74  ? 11.485  87.049 -22.860 1.00 125.63 ? 451 ASN O C     1 
ATOM 6039 O O     . ASN E 3 74  ? 11.474  86.072 -23.613 1.00 130.64 ? 451 ASN O O     1 
ATOM 6040 C CB    . ASN E 3 74  ? 9.915   88.645 -23.958 1.00 114.56 ? 451 ASN O CB    1 
ATOM 6041 C CG    . ASN E 3 74  ? 9.797   87.717 -25.141 1.00 104.76 ? 451 ASN O CG    1 
ATOM 6042 O OD1   . ASN E 3 74  ? 8.932   86.843 -25.177 1.00 97.77  ? 451 ASN O OD1   1 
ATOM 6043 N ND2   . ASN E 3 74  ? 10.678  87.892 -26.114 1.00 99.25  ? 451 ASN O ND2   1 
ATOM 6044 N N     . LYS E 3 75  ? 12.566  87.424 -22.184 1.00 130.45 ? 452 LYS O N     1 
ATOM 6045 C CA    . LYS E 3 75  ? 13.826  86.694 -22.282 1.00 129.11 ? 452 LYS O CA    1 
ATOM 6046 C C     . LYS E 3 75  ? 13.694  85.305 -21.653 1.00 124.74 ? 452 LYS O C     1 
ATOM 6047 O O     . LYS E 3 75  ? 13.500  85.183 -20.441 1.00 132.19 ? 452 LYS O O     1 
ATOM 6048 C CB    . LYS E 3 75  ? 14.933  87.453 -21.547 1.00 131.60 ? 452 LYS O CB    1 
ATOM 6049 C CG    . LYS E 3 75  ? 15.144  88.889 -21.987 1.00 129.95 ? 452 LYS O CG    1 
ATOM 6050 C CD    . LYS E 3 75  ? 15.874  88.973 -23.309 1.00 131.52 ? 452 LYS O CD    1 
ATOM 6051 C CE    . LYS E 3 75  ? 16.316  90.401 -23.578 1.00 134.13 ? 452 LYS O CE    1 
ATOM 6052 N NZ    . LYS E 3 75  ? 17.171  90.917 -22.470 1.00 135.85 ? 452 LYS O NZ    1 
ATOM 6053 N N     . PRO E 3 76  ? 13.791  84.236 -22.465 1.00 122.25 ? 453 PRO O N     1 
ATOM 6054 C CA    . PRO E 3 76  ? 13.671  82.907 -21.860 1.00 124.08 ? 453 PRO O CA    1 
ATOM 6055 C C     . PRO E 3 76  ? 14.805  82.695 -20.859 1.00 129.02 ? 453 PRO O C     1 
ATOM 6056 O O     . PRO E 3 76  ? 15.982  82.813 -21.203 1.00 141.62 ? 453 PRO O O     1 
ATOM 6057 C CB    . PRO E 3 76  ? 13.747  81.968 -23.066 1.00 123.39 ? 453 PRO O CB    1 
ATOM 6058 C CG    . PRO E 3 76  ? 14.586  82.733 -24.046 1.00 114.25 ? 453 PRO O CG    1 
ATOM 6059 C CD    . PRO E 3 76  ? 14.043  84.138 -23.914 1.00 121.94 ? 453 PRO O CD    1 
ATOM 6060 N N     . LEU E 3 77  ? 14.441  82.396 -19.617 1.00 138.11 ? 454 LEU O N     1 
ATOM 6061 C CA    . LEU E 3 77  ? 15.424  82.197 -18.556 1.00 132.37 ? 454 LEU O CA    1 
ATOM 6062 C C     . LEU E 3 77  ? 15.834  80.744 -18.339 1.00 124.33 ? 454 LEU O C     1 
ATOM 6063 O O     . LEU E 3 77  ? 15.098  79.820 -18.680 1.00 115.76 ? 454 LEU O O     1 
ATOM 6064 C CB    . LEU E 3 77  ? 14.879  82.762 -17.242 1.00 137.65 ? 454 LEU O CB    1 
ATOM 6065 C CG    . LEU E 3 77  ? 14.635  84.269 -17.185 1.00 146.48 ? 454 LEU O CG    1 
ATOM 6066 C CD1   . LEU E 3 77  ? 13.807  84.607 -15.958 1.00 152.88 ? 454 LEU O CD1   1 
ATOM 6067 C CD2   . LEU E 3 77  ? 15.970  85.000 -17.164 1.00 152.86 ? 454 LEU O CD2   1 
ATOM 6068 N N     . GLY E 3 78  ? 17.017  80.552 -17.764 1.00 115.74 ? 455 GLY O N     1 
ATOM 6069 C CA    . GLY E 3 78  ? 17.492  79.210 -17.486 1.00 113.57 ? 455 GLY O CA    1 
ATOM 6070 C C     . GLY E 3 78  ? 16.991  78.761 -16.125 1.00 111.09 ? 455 GLY O C     1 
ATOM 6071 O O     . GLY E 3 78  ? 16.710  79.588 -15.260 1.00 113.84 ? 455 GLY O O     1 
ATOM 6072 N N     . LEU E 3 79  ? 16.871  77.453 -15.929 1.00 103.71 ? 456 LEU O N     1 
ATOM 6073 C CA    . LEU E 3 79  ? 16.396  76.914 -14.660 1.00 97.71  ? 456 LEU O CA    1 
ATOM 6074 C C     . LEU E 3 79  ? 17.321  75.832 -14.126 1.00 98.36  ? 456 LEU O C     1 
ATOM 6075 O O     . LEU E 3 79  ? 17.142  74.656 -14.422 1.00 102.58 ? 456 LEU O O     1 
ATOM 6076 C CB    . LEU E 3 79  ? 14.985  76.344 -14.821 1.00 88.89  ? 456 LEU O CB    1 
ATOM 6077 C CG    . LEU E 3 79  ? 14.468  75.485 -13.664 1.00 76.72  ? 456 LEU O CG    1 
ATOM 6078 C CD1   . LEU E 3 79  ? 14.682  76.208 -12.332 1.00 69.61  ? 456 LEU O CD1   1 
ATOM 6079 C CD2   . LEU E 3 79  ? 12.993  75.168 -13.890 1.00 69.04  ? 456 LEU O CD2   1 
ATOM 6080 N N     . GLN E 3 80  ? 18.306  76.235 -13.334 1.00 99.07  ? 457 GLN O N     1 
ATOM 6081 C CA    . GLN E 3 80  ? 19.258  75.294 -12.765 1.00 94.84  ? 457 GLN O CA    1 
ATOM 6082 C C     . GLN E 3 80  ? 18.569  74.158 -11.997 1.00 89.98  ? 457 GLN O C     1 
ATOM 6083 O O     . GLN E 3 80  ? 17.423  74.299 -11.544 1.00 86.08  ? 457 GLN O O     1 
ATOM 6084 C CB    . GLN E 3 80  ? 20.212  76.039 -11.839 1.00 96.76  ? 457 GLN O CB    1 
ATOM 6085 C CG    . GLN E 3 80  ? 20.978  77.149 -12.524 1.00 104.55 ? 457 GLN O CG    1 
ATOM 6086 C CD    . GLN E 3 80  ? 21.683  78.053 -11.534 1.00 109.31 ? 457 GLN O CD    1 
ATOM 6087 O OE1   . GLN E 3 80  ? 21.040  78.739 -10.735 1.00 111.66 ? 457 GLN O OE1   1 
ATOM 6088 N NE2   . GLN E 3 80  ? 23.012  78.056 -11.578 1.00 111.75 ? 457 GLN O NE2   1 
ATOM 6089 N N     . ILE E 3 81  ? 19.274  73.032 -11.868 1.00 83.79  ? 458 ILE O N     1 
ATOM 6090 C CA    . ILE E 3 81  ? 18.766  71.858 -11.153 1.00 82.30  ? 458 ILE O CA    1 
ATOM 6091 C C     . ILE E 3 81  ? 19.881  70.966 -10.608 1.00 86.43  ? 458 ILE O C     1 
ATOM 6092 O O     . ILE E 3 81  ? 20.676  70.415 -11.371 1.00 88.64  ? 458 ILE O O     1 
ATOM 6093 C CB    . ILE E 3 81  ? 17.895  70.943 -12.048 1.00 76.09  ? 458 ILE O CB    1 
ATOM 6094 C CG1   . ILE E 3 81  ? 16.682  71.697 -12.580 1.00 70.14  ? 458 ILE O CG1   1 
ATOM 6095 C CG2   . ILE E 3 81  ? 17.418  69.745 -11.239 1.00 70.87  ? 458 ILE O CG2   1 
ATOM 6096 C CD1   . ILE E 3 81  ? 15.785  70.851 -13.478 1.00 62.73  ? 458 ILE O CD1   1 
ATOM 6097 N N     . PHE E 3 82  ? 19.929  70.821 -9.286  1.00 92.19  ? 459 PHE O N     1 
ATOM 6098 C CA    . PHE E 3 82  ? 20.913  69.957 -8.641  1.00 93.71  ? 459 PHE O CA    1 
ATOM 6099 C C     . PHE E 3 82  ? 20.204  69.168 -7.545  1.00 90.92  ? 459 PHE O C     1 
ATOM 6100 O O     . PHE E 3 82  ? 19.087  69.506 -7.147  1.00 88.51  ? 459 PHE O O     1 
ATOM 6101 C CB    . PHE E 3 82  ? 22.074  70.772 -8.058  1.00 98.98  ? 459 PHE O CB    1 
ATOM 6102 C CG    . PHE E 3 82  ? 21.676  71.704 -6.949  1.00 107.29 ? 459 PHE O CG    1 
ATOM 6103 C CD1   . PHE E 3 82  ? 20.817  72.772 -7.191  1.00 110.78 ? 459 PHE O CD1   1 
ATOM 6104 C CD2   . PHE E 3 82  ? 22.176  71.523 -5.661  1.00 111.09 ? 459 PHE O CD2   1 
ATOM 6105 C CE1   . PHE E 3 82  ? 20.464  73.645 -6.168  1.00 113.47 ? 459 PHE O CE1   1 
ATOM 6106 C CE2   . PHE E 3 82  ? 21.829  72.392 -4.627  1.00 113.28 ? 459 PHE O CE2   1 
ATOM 6107 C CZ    . PHE E 3 82  ? 20.972  73.455 -4.880  1.00 114.29 ? 459 PHE O CZ    1 
ATOM 6108 N N     . ILE E 3 83  ? 20.837  68.105 -7.069  1.00 87.04  ? 460 ILE O N     1 
ATOM 6109 C CA    . ILE E 3 83  ? 20.231  67.294 -6.031  1.00 86.85  ? 460 ILE O CA    1 
ATOM 6110 C C     . ILE E 3 83  ? 20.696  67.694 -4.640  1.00 84.31  ? 460 ILE O C     1 
ATOM 6111 O O     . ILE E 3 83  ? 21.899  67.800 -4.376  1.00 86.52  ? 460 ILE O O     1 
ATOM 6112 C CB    . ILE E 3 83  ? 20.527  65.819 -6.262  1.00 88.82  ? 460 ILE O CB    1 
ATOM 6113 C CG1   . ILE E 3 83  ? 19.817  65.363 -7.533  1.00 90.11  ? 460 ILE O CG1   1 
ATOM 6114 C CG2   . ILE E 3 83  ? 20.063  64.997 -5.073  1.00 91.38  ? 460 ILE O CG2   1 
ATOM 6115 C CD1   . ILE E 3 83  ? 18.318  65.615 -7.524  1.00 89.50  ? 460 ILE O CD1   1 
ATOM 6116 N N     . GLY E 3 84  ? 19.730  67.906 -3.751  1.00 82.10  ? 461 GLY O N     1 
ATOM 6117 C CA    . GLY E 3 84  ? 20.056  68.311 -2.400  1.00 75.29  ? 461 GLY O CA    1 
ATOM 6118 C C     . GLY E 3 84  ? 19.586  67.391 -1.289  1.00 72.06  ? 461 GLY O C     1 
ATOM 6119 O O     . GLY E 3 84  ? 18.719  66.533 -1.476  1.00 68.36  ? 461 GLY O O     1 
ATOM 6120 N N     . THR E 3 85  ? 20.178  67.606 -0.117  1.00 70.82  ? 462 THR O N     1 
ATOM 6121 C CA    . THR E 3 85  ? 19.897  66.845 1.095   1.00 70.50  ? 462 THR O CA    1 
ATOM 6122 C C     . THR E 3 85  ? 18.466  67.028 1.569   1.00 70.88  ? 462 THR O C     1 
ATOM 6123 O O     . THR E 3 85  ? 17.801  68.002 1.214   1.00 71.64  ? 462 THR O O     1 
ATOM 6124 C CB    . THR E 3 85  ? 20.798  67.297 2.229   1.00 69.47  ? 462 THR O CB    1 
ATOM 6125 O OG1   . THR E 3 85  ? 20.416  68.620 2.620   1.00 68.01  ? 462 THR O OG1   1 
ATOM 6126 C CG2   . THR E 3 85  ? 22.251  67.313 1.779   1.00 68.41  ? 462 THR O CG2   1 
ATOM 6127 N N     . ALA E 3 86  ? 18.013  66.089 2.393   1.00 69.38  ? 463 ALA O N     1 
ATOM 6128 C CA    . ALA E 3 86  ? 16.660  66.120 2.938   1.00 74.61  ? 463 ALA O CA    1 
ATOM 6129 C C     . ALA E 3 86  ? 16.716  65.866 4.442   1.00 83.44  ? 463 ALA O C     1 
ATOM 6130 O O     . ALA E 3 86  ? 15.928  65.090 4.989   1.00 87.69  ? 463 ALA O O     1 
ATOM 6131 C CB    . ALA E 3 86  ? 15.806  65.059 2.255   1.00 63.40  ? 463 ALA O CB    1 
ATOM 6132 N N     . ASP E 3 87  ? 17.652  66.535 5.105   1.00 97.31  ? 464 ASP O N     1 
ATOM 6133 C CA    . ASP E 3 87  ? 17.848  66.371 6.538   1.00 110.18 ? 464 ASP O CA    1 
ATOM 6134 C C     . ASP E 3 87  ? 17.268  67.510 7.356   1.00 122.77 ? 464 ASP O C     1 
ATOM 6135 O O     . ASP E 3 87  ? 16.753  68.488 6.811   1.00 125.64 ? 464 ASP O O     1 
ATOM 6136 C CB    . ASP E 3 87  ? 19.340  66.260 6.841   1.00 104.77 ? 464 ASP O CB    1 
ATOM 6137 C CG    . ASP E 3 87  ? 20.115  67.476 6.369   1.00 98.56  ? 464 ASP O CG    1 
ATOM 6138 O OD1   . ASP E 3 87  ? 21.360  67.494 6.514   1.00 93.95  ? 464 ASP O OD1   1 
ATOM 6139 O OD2   . ASP E 3 87  ? 19.470  68.414 5.848   1.00 94.89  ? 464 ASP O OD2   1 
ATOM 6140 N N     . GLU E 3 88  ? 17.378  67.369 8.674   1.00 135.87 ? 465 GLU O N     1 
ATOM 6141 C CA    . GLU E 3 88  ? 16.883  68.362 9.619   1.00 148.85 ? 465 GLU O CA    1 
ATOM 6142 C C     . GLU E 3 88  ? 17.536  69.716 9.363   1.00 151.60 ? 465 GLU O C     1 
ATOM 6143 O O     . GLU E 3 88  ? 16.888  70.762 9.455   1.00 156.94 ? 465 GLU O O     1 
ATOM 6144 C CB    . GLU E 3 88  ? 17.180  67.915 11.060  1.00 156.63 ? 465 GLU O CB    1 
ATOM 6145 C CG    . GLU E 3 88  ? 18.667  67.942 11.454  1.00 162.50 ? 465 GLU O CG    1 
ATOM 6146 C CD    . GLU E 3 88  ? 19.443  66.708 11.017  1.00 164.91 ? 465 GLU O CD    1 
ATOM 6147 O OE1   . GLU E 3 88  ? 20.691  66.749 11.059  1.00 166.50 ? 465 GLU O OE1   1 
ATOM 6148 O OE2   . GLU E 3 88  ? 18.810  65.697 10.647  1.00 166.79 ? 465 GLU O OE2   1 
ATOM 6149 N N     . ARG E 3 89  ? 18.826  69.681 9.038   1.00 150.90 ? 466 ARG O N     1 
ATOM 6150 C CA    . ARG E 3 89  ? 19.601  70.887 8.778   1.00 146.68 ? 466 ARG O CA    1 
ATOM 6151 C C     . ARG E 3 89  ? 19.080  71.687 7.584   1.00 145.59 ? 466 ARG O C     1 
ATOM 6152 O O     . ARG E 3 89  ? 18.126  71.289 6.913   1.00 147.64 ? 466 ARG O O     1 
ATOM 6153 C CB    . ARG E 3 89  ? 21.069  70.518 8.545   1.00 143.86 ? 466 ARG O CB    1 
ATOM 6154 C CG    . ARG E 3 89  ? 21.685  69.680 9.652   1.00 135.80 ? 466 ARG O CG    1 
ATOM 6155 C CD    . ARG E 3 89  ? 23.150  69.373 9.364   1.00 131.26 ? 466 ARG O CD    1 
ATOM 6156 N NE    . ARG E 3 89  ? 23.335  68.677 8.089   1.00 128.40 ? 466 ARG O NE    1 
ATOM 6157 C CZ    . ARG E 3 89  ? 24.491  68.169 7.665   1.00 126.89 ? 466 ARG O CZ    1 
ATOM 6158 N NH1   . ARG E 3 89  ? 25.584  68.272 8.412   1.00 125.90 ? 466 ARG O NH1   1 
ATOM 6159 N NH2   . ARG E 3 89  ? 24.554  67.552 6.492   1.00 125.79 ? 466 ARG O NH2   1 
ATOM 6160 N N     . ILE E 3 90  ? 19.718  72.825 7.337   1.00 142.34 ? 467 ILE O N     1 
ATOM 6161 C CA    . ILE E 3 90  ? 19.353  73.701 6.233   1.00 135.24 ? 467 ILE O CA    1 
ATOM 6162 C C     . ILE E 3 90  ? 19.684  72.985 4.929   1.00 125.93 ? 467 ILE O C     1 
ATOM 6163 O O     . ILE E 3 90  ? 20.436  72.012 4.930   1.00 121.00 ? 467 ILE O O     1 
ATOM 6164 C CB    . ILE E 3 90  ? 20.148  75.032 6.311   1.00 141.92 ? 467 ILE O CB    1 
ATOM 6165 C CG1   . ILE E 3 90  ? 19.789  75.944 5.133   1.00 148.45 ? 467 ILE O CG1   1 
ATOM 6166 C CG2   . ILE E 3 90  ? 21.642  74.740 6.337   1.00 146.00 ? 467 ILE O CG2   1 
ATOM 6167 C CD1   . ILE E 3 90  ? 18.338  76.382 5.104   1.00 155.58 ? 467 ILE O CD1   1 
ATOM 6168 N N     . LEU E 3 91  ? 19.126  73.462 3.821   1.00 116.43 ? 468 LEU O N     1 
ATOM 6169 C CA    . LEU E 3 91  ? 19.381  72.841 2.526   1.00 109.96 ? 468 LEU O CA    1 
ATOM 6170 C C     . LEU E 3 91  ? 20.869  72.885 2.186   1.00 112.25 ? 468 LEU O C     1 
ATOM 6171 O O     . LEU E 3 91  ? 21.578  73.839 2.510   1.00 115.92 ? 468 LEU O O     1 
ATOM 6172 C CB    . LEU E 3 91  ? 18.584  73.546 1.424   1.00 95.81  ? 468 LEU O CB    1 
ATOM 6173 C CG    . LEU E 3 91  ? 18.269  72.768 0.138   1.00 82.40  ? 468 LEU O CG    1 
ATOM 6174 C CD1   . LEU E 3 91  ? 19.534  72.189 -0.481  1.00 73.74  ? 468 LEU O CD1   1 
ATOM 6175 C CD2   . LEU E 3 91  ? 17.290  71.661 0.457   1.00 74.62  ? 468 LEU O CD2   1 
ATOM 6176 N N     . LYS E 3 92  ? 21.331  71.831 1.528   1.00 111.05 ? 469 LYS O N     1 
ATOM 6177 C CA    . LYS E 3 92  ? 22.719  71.724 1.126   1.00 111.74 ? 469 LYS O CA    1 
ATOM 6178 C C     . LYS E 3 92  ? 22.798  70.673 0.020   1.00 112.64 ? 469 LYS O C     1 
ATOM 6179 O O     . LYS E 3 92  ? 22.037  69.706 0.013   1.00 116.18 ? 469 LYS O O     1 
ATOM 6180 C CB    . LYS E 3 92  ? 23.575  71.306 2.325   1.00 112.19 ? 469 LYS O CB    1 
ATOM 6181 C CG    . LYS E 3 92  ? 25.065  71.245 2.040   1.00 104.21 ? 469 LYS O CG    1 
ATOM 6182 C CD    . LYS E 3 92  ? 25.838  70.641 3.204   1.00 97.59  ? 469 LYS O CD    1 
ATOM 6183 C CE    . LYS E 3 92  ? 25.431  69.196 3.465   1.00 93.62  ? 469 LYS O CE    1 
ATOM 6184 N NZ    . LYS E 3 92  ? 26.259  68.570 4.538   1.00 90.83  ? 469 LYS O NZ    1 
ATOM 6185 N N     . PRO E 3 93  ? 23.705  70.865 -0.946  1.00 107.03 ? 470 PRO O N     1 
ATOM 6186 C CA    . PRO E 3 93  ? 23.848  69.906 -2.040  1.00 100.25 ? 470 PRO O CA    1 
ATOM 6187 C C     . PRO E 3 93  ? 24.203  68.533 -1.489  1.00 91.49  ? 470 PRO O C     1 
ATOM 6188 O O     . PRO E 3 93  ? 25.216  68.387 -0.807  1.00 83.88  ? 470 PRO O O     1 
ATOM 6189 C CB    . PRO E 3 93  ? 24.995  70.491 -2.862  1.00 99.59  ? 470 PRO O CB    1 
ATOM 6190 C CG    . PRO E 3 93  ? 24.870  71.953 -2.630  1.00 104.47 ? 470 PRO O CG    1 
ATOM 6191 C CD    . PRO E 3 93  ? 24.597  72.020 -1.147  1.00 106.59 ? 470 PRO O CD    1 
ATOM 6192 N N     . HIS E 3 94  ? 23.380  67.528 -1.770  1.00 78.04  ? 471 HIS O N     1 
ATOM 6193 C CA    . HIS E 3 94  ? 23.691  66.189 -1.289  1.00 72.61  ? 471 HIS O CA    1 
ATOM 6194 C C     . HIS E 3 94  ? 24.955  65.770 -2.019  1.00 70.89  ? 471 HIS O C     1 
ATOM 6195 O O     . HIS E 3 94  ? 25.105  66.039 -3.210  1.00 77.21  ? 471 HIS O O     1 
ATOM 6196 C CB    . HIS E 3 94  ? 22.563  65.219 -1.601  1.00 69.02  ? 471 HIS O CB    1 
ATOM 6197 C CG    . HIS E 3 94  ? 22.580  63.995 -0.744  1.00 61.49  ? 471 HIS O CG    1 
ATOM 6198 N ND1   . HIS E 3 94  ? 23.712  63.223 -0.576  1.00 57.21  ? 471 HIS O ND1   1 
ATOM 6199 C CD2   . HIS E 3 94  ? 21.605  63.405 -0.010  1.00 56.13  ? 471 HIS O CD2   1 
ATOM 6200 C CE1   . HIS E 3 94  ? 23.431  62.208 0.224   1.00 53.60  ? 471 HIS O CE1   1 
ATOM 6201 N NE2   . HIS E 3 94  ? 22.160  62.294 0.581   1.00 53.05  ? 471 HIS O NE2   1 
ATOM 6202 N N     . ALA E 3 95  ? 25.864  65.111 -1.317  1.00 68.65  ? 472 ALA O N     1 
ATOM 6203 C CA    . ALA E 3 95  ? 27.127  64.731 -1.930  1.00 61.84  ? 472 ALA O CA    1 
ATOM 6204 C C     . ALA E 3 95  ? 27.217  63.283 -2.379  1.00 60.22  ? 472 ALA O C     1 
ATOM 6205 O O     . ALA E 3 95  ? 28.218  62.872 -2.997  1.00 54.52  ? 472 ALA O O     1 
ATOM 6206 C CB    . ALA E 3 95  ? 28.262  65.045 -0.985  1.00 57.89  ? 472 ALA O CB    1 
ATOM 6207 N N     . PHE E 3 96  ? 26.175  62.512 -2.078  1.00 60.56  ? 473 PHE O N     1 
ATOM 6208 C CA    . PHE E 3 96  ? 26.126  61.096 -2.454  1.00 64.38  ? 473 PHE O CA    1 
ATOM 6209 C C     . PHE E 3 96  ? 25.106  60.869 -3.579  1.00 63.88  ? 473 PHE O C     1 
ATOM 6210 O O     . PHE E 3 96  ? 24.655  59.743 -3.829  1.00 59.91  ? 473 PHE O O     1 
ATOM 6211 C CB    . PHE E 3 96  ? 25.767  60.267 -1.221  1.00 68.91  ? 473 PHE O CB    1 
ATOM 6212 C CG    . PHE E 3 96  ? 26.805  60.319 -0.146  1.00 75.31  ? 473 PHE O CG    1 
ATOM 6213 C CD1   . PHE E 3 96  ? 27.845  59.397 -0.123  1.00 79.64  ? 473 PHE O CD1   1 
ATOM 6214 C CD2   . PHE E 3 96  ? 26.765  61.311 0.824   1.00 78.70  ? 473 PHE O CD2   1 
ATOM 6215 C CE1   . PHE E 3 96  ? 28.837  59.460 0.856   1.00 82.30  ? 473 PHE O CE1   1 
ATOM 6216 C CE2   . PHE E 3 96  ? 27.749  61.385 1.808   1.00 80.98  ? 473 PHE O CE2   1 
ATOM 6217 C CZ    . PHE E 3 96  ? 28.789  60.457 1.824   1.00 81.98  ? 473 PHE O CZ    1 
ATOM 6218 N N     . TYR E 3 97  ? 24.765  61.965 -4.249  1.00 65.42  ? 474 TYR O N     1 
ATOM 6219 C CA    . TYR E 3 97  ? 23.802  61.967 -5.337  1.00 69.57  ? 474 TYR O CA    1 
ATOM 6220 C C     . TYR E 3 97  ? 24.068  63.084 -6.337  1.00 71.25  ? 474 TYR O C     1 
ATOM 6221 O O     . TYR E 3 97  ? 24.349  64.227 -5.961  1.00 73.77  ? 474 TYR O O     1 
ATOM 6222 C CB    . TYR E 3 97  ? 22.391  62.124 -4.775  1.00 71.63  ? 474 TYR O CB    1 
ATOM 6223 C CG    . TYR E 3 97  ? 21.860  60.865 -4.155  1.00 73.30  ? 474 TYR O CG    1 
ATOM 6224 C CD1   . TYR E 3 97  ? 21.357  59.843 -4.948  1.00 74.38  ? 474 TYR O CD1   1 
ATOM 6225 C CD2   . TYR E 3 97  ? 21.892  60.674 -2.780  1.00 73.33  ? 474 TYR O CD2   1 
ATOM 6226 C CE1   . TYR E 3 97  ? 20.895  58.656 -4.382  1.00 74.54  ? 474 TYR O CE1   1 
ATOM 6227 C CE2   . TYR E 3 97  ? 21.435  59.488 -2.205  1.00 73.32  ? 474 TYR O CE2   1 
ATOM 6228 C CZ    . TYR E 3 97  ? 20.940  58.487 -3.012  1.00 72.84  ? 474 TYR O CZ    1 
ATOM 6229 O OH    . TYR E 3 97  ? 20.494  57.312 -2.465  1.00 71.79  ? 474 TYR O OH    1 
ATOM 6230 N N     . GLN E 3 98  ? 23.975  62.740 -7.617  1.00 73.69  ? 475 GLN O N     1 
ATOM 6231 C CA    . GLN E 3 98  ? 24.172  63.699 -8.690  1.00 73.24  ? 475 GLN O CA    1 
ATOM 6232 C C     . GLN E 3 98  ? 22.981  63.616 -9.649  1.00 76.02  ? 475 GLN O C     1 
ATOM 6233 O O     . GLN E 3 98  ? 22.361  62.557 -9.800  1.00 72.53  ? 475 GLN O O     1 
ATOM 6234 C CB    . GLN E 3 98  ? 25.474  63.396 -9.425  1.00 68.08  ? 475 GLN O CB    1 
ATOM 6235 C CG    . GLN E 3 98  ? 26.711  63.536 -8.551  1.00 68.16  ? 475 GLN O CG    1 
ATOM 6236 C CD    . GLN E 3 98  ? 27.130  64.983 -8.320  1.00 69.60  ? 475 GLN O CD    1 
ATOM 6237 O OE1   . GLN E 3 98  ? 26.357  65.802 -7.807  1.00 69.80  ? 475 GLN O OE1   1 
ATOM 6238 N NE2   . GLN E 3 98  ? 28.370  65.302 -8.694  1.00 69.49  ? 475 GLN O NE2   1 
ATOM 6239 N N     . VAL E 3 99  ? 22.629  64.739 -10.265 1.00 79.70  ? 476 VAL O N     1 
ATOM 6240 C CA    . VAL E 3 99  ? 21.523  64.729 -11.206 1.00 87.90  ? 476 VAL O CA    1 
ATOM 6241 C C     . VAL E 3 99  ? 22.060  64.045 -12.447 1.00 88.14  ? 476 VAL O C     1 
ATOM 6242 O O     . VAL E 3 99  ? 23.234  64.207 -12.798 1.00 92.38  ? 476 VAL O O     1 
ATOM 6243 C CB    . VAL E 3 99  ? 21.065  66.147 -11.591 1.00 93.00  ? 476 VAL O CB    1 
ATOM 6244 C CG1   . VAL E 3 99  ? 20.606  66.894 -10.365 1.00 97.52  ? 476 VAL O CG1   1 
ATOM 6245 C CG2   . VAL E 3 99  ? 22.198  66.894 -12.269 1.00 98.00  ? 476 VAL O CG2   1 
ATOM 6246 N N     . HIS E 3 100 ? 21.212  63.263 -13.099 1.00 86.89  ? 477 HIS O N     1 
ATOM 6247 C CA    . HIS E 3 100 ? 21.626  62.571 -14.303 1.00 81.77  ? 477 HIS O CA    1 
ATOM 6248 C C     . HIS E 3 100 ? 20.836  63.179 -15.435 1.00 81.66  ? 477 HIS O C     1 
ATOM 6249 O O     . HIS E 3 100 ? 19.599  63.236 -15.387 1.00 79.63  ? 477 HIS O O     1 
ATOM 6250 C CB    . HIS E 3 100 ? 21.340  61.076 -14.193 1.00 76.37  ? 477 HIS O CB    1 
ATOM 6251 C CG    . HIS E 3 100 ? 21.962  60.257 -15.281 1.00 70.41  ? 477 HIS O CG    1 
ATOM 6252 N ND1   . HIS E 3 100 ? 21.230  59.707 -16.315 1.00 66.95  ? 477 HIS O ND1   1 
ATOM 6253 C CD2   . HIS E 3 100 ? 23.246  59.877 -15.484 1.00 66.25  ? 477 HIS O CD2   1 
ATOM 6254 C CE1   . HIS E 3 100 ? 22.035  59.020 -17.104 1.00 63.88  ? 477 HIS O CE1   1 
ATOM 6255 N NE2   . HIS E 3 100 ? 23.263  59.108 -16.622 1.00 64.99  ? 477 HIS O NE2   1 
ATOM 6256 N N     . ARG E 3 101 ? 21.577  63.657 -16.434 1.00 81.40  ? 478 ARG O N     1 
ATOM 6257 C CA    . ARG E 3 101 ? 21.016  64.290 -17.623 1.00 81.00  ? 478 ARG O CA    1 
ATOM 6258 C C     . ARG E 3 101 ? 20.559  63.227 -18.601 1.00 78.63  ? 478 ARG O C     1 
ATOM 6259 O O     . ARG E 3 101 ? 21.358  62.476 -19.154 1.00 79.74  ? 478 ARG O O     1 
ATOM 6260 C CB    . ARG E 3 101 ? 22.067  65.191 -18.269 1.00 83.87  ? 478 ARG O CB    1 
ATOM 6261 C CG    . ARG E 3 101 ? 21.636  65.874 -19.538 1.00 84.19  ? 478 ARG O CG    1 
ATOM 6262 C CD    . ARG E 3 101 ? 22.701  66.865 -19.959 1.00 85.60  ? 478 ARG O CD    1 
ATOM 6263 N NE    . ARG E 3 101 ? 22.392  67.483 -21.239 1.00 86.56  ? 478 ARG O NE    1 
ATOM 6264 C CZ    . ARG E 3 101 ? 22.401  66.833 -22.395 1.00 87.09  ? 478 ARG O CZ    1 
ATOM 6265 N NH1   . ARG E 3 101 ? 22.710  65.546 -22.426 1.00 87.28  ? 478 ARG O NH1   1 
ATOM 6266 N NH2   . ARG E 3 101 ? 22.089  67.465 -23.516 1.00 88.20  ? 478 ARG O NH2   1 
ATOM 6267 N N     . ILE E 3 102 ? 19.251  63.172 -18.791 1.00 77.09  ? 479 ILE O N     1 
ATOM 6268 C CA    . ILE E 3 102 ? 18.635  62.210 -19.677 1.00 72.58  ? 479 ILE O CA    1 
ATOM 6269 C C     . ILE E 3 102 ? 18.240  62.880 -20.977 1.00 76.75  ? 479 ILE O C     1 
ATOM 6270 O O     . ILE E 3 102 ? 17.688  63.985 -20.992 1.00 75.13  ? 479 ILE O O     1 
ATOM 6271 C CB    . ILE E 3 102 ? 17.414  61.595 -19.003 1.00 65.47  ? 479 ILE O CB    1 
ATOM 6272 C CG1   . ILE E 3 102 ? 17.892  60.682 -17.870 1.00 58.91  ? 479 ILE O CG1   1 
ATOM 6273 C CG2   . ILE E 3 102 ? 16.553  60.885 -20.029 1.00 59.45  ? 479 ILE O CG2   1 
ATOM 6274 C CD1   . ILE E 3 102 ? 16.796  60.124 -17.029 1.00 55.65  ? 479 ILE O CD1   1 
ATOM 6275 N N     . THR E 3 103 ? 18.533  62.194 -22.072 1.00 80.72  ? 480 THR O N     1 
ATOM 6276 C CA    . THR E 3 103 ? 18.253  62.711 -23.396 1.00 88.64  ? 480 THR O CA    1 
ATOM 6277 C C     . THR E 3 103 ? 17.479  61.705 -24.240 1.00 89.46  ? 480 THR O C     1 
ATOM 6278 O O     . THR E 3 103 ? 17.506  60.501 -23.967 1.00 91.51  ? 480 THR O O     1 
ATOM 6279 C CB    . THR E 3 103 ? 19.567  63.051 -24.102 1.00 92.99  ? 480 THR O CB    1 
ATOM 6280 O OG1   . THR E 3 103 ? 19.312  63.320 -25.484 1.00 99.25  ? 480 THR O OG1   1 
ATOM 6281 C CG2   . THR E 3 103 ? 20.547  61.890 -23.981 1.00 96.20  ? 480 THR O CG2   1 
ATOM 6282 N N     . GLY E 3 104 ? 16.780  62.204 -25.260 1.00 94.56  ? 481 GLY O N     1 
ATOM 6283 C CA    . GLY E 3 104 ? 16.034  61.312 -26.128 1.00 95.15  ? 481 GLY O CA    1 
ATOM 6284 C C     . GLY E 3 104 ? 14.875  61.865 -26.936 1.00 97.77  ? 481 GLY O C     1 
ATOM 6285 O O     . GLY E 3 104 ? 14.751  63.064 -27.166 1.00 92.86  ? 481 GLY O O     1 
ATOM 6286 N N     . LYS E 3 105 ? 14.032  60.939 -27.375 1.00 103.32 ? 482 LYS O N     1 
ATOM 6287 C CA    . LYS E 3 105 ? 12.839  61.210 -28.166 1.00 113.90 ? 482 LYS O CA    1 
ATOM 6288 C C     . LYS E 3 105 ? 11.750  61.803 -27.285 1.00 116.52 ? 482 LYS O C     1 
ATOM 6289 O O     . LYS E 3 105 ? 11.458  62.996 -27.357 1.00 122.79 ? 482 LYS O O     1 
ATOM 6290 C CB    . LYS E 3 105 ? 12.332  59.902 -28.790 1.00 119.79 ? 482 LYS O CB    1 
ATOM 6291 C CG    . LYS E 3 105 ? 11.990  58.793 -27.771 1.00 125.93 ? 482 LYS O CG    1 
ATOM 6292 C CD    . LYS E 3 105 ? 13.172  58.481 -26.847 1.00 129.56 ? 482 LYS O CD    1 
ATOM 6293 C CE    . LYS E 3 105 ? 12.807  57.582 -25.678 1.00 130.74 ? 482 LYS O CE    1 
ATOM 6294 N NZ    . LYS E 3 105 ? 13.981  57.391 -24.774 1.00 132.84 ? 482 LYS O NZ    1 
ATOM 6295 N N     . THR E 3 106 ? 11.158  60.952 -26.452 1.00 115.19 ? 483 THR O N     1 
ATOM 6296 C CA    . THR E 3 106 ? 10.092  61.343 -25.545 1.00 111.82 ? 483 THR O CA    1 
ATOM 6297 C C     . THR E 3 106 ? 10.489  62.464 -24.588 1.00 107.32 ? 483 THR O C     1 
ATOM 6298 O O     . THR E 3 106 ? 9.627   63.088 -23.961 1.00 112.42 ? 483 THR O O     1 
ATOM 6299 C CB    . THR E 3 106 ? 9.608   60.129 -24.738 1.00 112.99 ? 483 THR O CB    1 
ATOM 6300 O OG1   . THR E 3 106 ? 10.734  59.323 -24.369 1.00 109.27 ? 483 THR O OG1   1 
ATOM 6301 C CG2   . THR E 3 106 ? 8.643   59.300 -25.564 1.00 109.05 ? 483 THR O CG2   1 
ATOM 6302 N N     . VAL E 3 107 ? 11.789  62.716 -24.465 1.00 100.20 ? 484 VAL O N     1 
ATOM 6303 C CA    . VAL E 3 107 ? 12.261  63.789 -23.600 1.00 89.15  ? 484 VAL O CA    1 
ATOM 6304 C C     . VAL E 3 107 ? 11.819  65.070 -24.287 1.00 89.23  ? 484 VAL O C     1 
ATOM 6305 O O     . VAL E 3 107 ? 12.438  65.495 -25.260 1.00 94.03  ? 484 VAL O O     1 
ATOM 6306 C CB    . VAL E 3 107 ? 13.795  63.802 -23.494 1.00 79.59  ? 484 VAL O CB    1 
ATOM 6307 C CG1   . VAL E 3 107 ? 14.234  64.782 -22.413 1.00 63.24  ? 484 VAL O CG1   1 
ATOM 6308 C CG2   . VAL E 3 107 ? 14.304  62.403 -23.214 1.00 64.78  ? 484 VAL O CG2   1 
ATOM 6309 N N     . THR E 3 108 ? 10.748  65.682 -23.796 1.00 84.53  ? 485 THR O N     1 
ATOM 6310 C CA    . THR E 3 108 ? 10.252  66.896 -24.423 1.00 82.88  ? 485 THR O CA    1 
ATOM 6311 C C     . THR E 3 108 ? 11.174  68.095 -24.212 1.00 87.63  ? 485 THR O C     1 
ATOM 6312 O O     . THR E 3 108 ? 11.428  68.858 -25.140 1.00 96.47  ? 485 THR O O     1 
ATOM 6313 C CB    . THR E 3 108 ? 8.830   67.273 -23.919 1.00 75.49  ? 485 THR O CB    1 
ATOM 6314 O OG1   . THR E 3 108 ? 8.932   67.991 -22.690 1.00 59.29  ? 485 THR O OG1   1 
ATOM 6315 C CG2   . THR E 3 108 ? 7.986   66.028 -23.693 1.00 59.68  ? 485 THR O CG2   1 
ATOM 6316 N N     . THR E 3 109 ? 11.692  68.253 -23.002 1.00 90.33  ? 486 THR O N     1 
ATOM 6317 C CA    . THR E 3 109 ? 12.549  69.392 -22.703 1.00 86.13  ? 486 THR O CA    1 
ATOM 6318 C C     . THR E 3 109 ? 14.044  69.189 -22.934 1.00 83.32  ? 486 THR O C     1 
ATOM 6319 O O     . THR E 3 109 ? 14.597  68.135 -22.624 1.00 80.88  ? 486 THR O O     1 
ATOM 6320 C CB    . THR E 3 109 ? 12.342  69.850 -21.244 1.00 85.38  ? 486 THR O CB    1 
ATOM 6321 O OG1   . THR E 3 109 ? 12.350  68.703 -20.391 1.00 85.17  ? 486 THR O OG1   1 
ATOM 6322 C CG2   . THR E 3 109 ? 11.012  70.581 -21.080 1.00 84.39  ? 486 THR O CG2   1 
ATOM 6323 N N     . THR E 3 110 ? 14.686  70.220 -23.482 1.00 78.61  ? 487 THR O N     1 
ATOM 6324 C CA    . THR E 3 110 ? 16.127  70.229 -23.740 1.00 76.31  ? 487 THR O CA    1 
ATOM 6325 C C     . THR E 3 110 ? 16.846  70.360 -22.386 1.00 75.25  ? 487 THR O C     1 
ATOM 6326 O O     . THR E 3 110 ? 16.181  70.373 -21.352 1.00 74.61  ? 487 THR O O     1 
ATOM 6327 C CB    . THR E 3 110 ? 16.502  71.428 -24.657 1.00 76.83  ? 487 THR O CB    1 
ATOM 6328 O OG1   . THR E 3 110 ? 17.769  71.971 -24.261 1.00 78.37  ? 487 THR O OG1   1 
ATOM 6329 C CG2   . THR E 3 110 ? 15.440  72.522 -24.577 1.00 76.87  ? 487 THR O CG2   1 
ATOM 6330 N N     . SER E 3 111 ? 18.179  70.460 -22.380 1.00 75.25  ? 488 SER O N     1 
ATOM 6331 C CA    . SER E 3 111 ? 18.930  70.593 -21.122 1.00 77.04  ? 488 SER O CA    1 
ATOM 6332 C C     . SER E 3 111 ? 20.450  70.750 -21.270 1.00 82.92  ? 488 SER O C     1 
ATOM 6333 O O     . SER E 3 111 ? 21.055  70.157 -22.158 1.00 81.14  ? 488 SER O O     1 
ATOM 6334 C CB    . SER E 3 111 ? 18.663  69.381 -20.236 1.00 72.64  ? 488 SER O CB    1 
ATOM 6335 O OG    . SER E 3 111 ? 18.993  68.187 -20.927 1.00 70.21  ? 488 SER O OG    1 
ATOM 6336 N N     . TYR E 3 112 ? 21.059  71.532 -20.377 1.00 93.44  ? 489 TYR O N     1 
ATOM 6337 C CA    . TYR E 3 112 ? 22.508  71.770 -20.380 1.00 104.74 ? 489 TYR O CA    1 
ATOM 6338 C C     . TYR E 3 112 ? 23.145  71.348 -19.053 1.00 100.90 ? 489 TYR O C     1 
ATOM 6339 O O     . TYR E 3 112 ? 22.817  71.884 -17.994 1.00 97.64  ? 489 TYR O O     1 
ATOM 6340 C CB    . TYR E 3 112 ? 22.804  73.252 -20.645 1.00 128.11 ? 489 TYR O CB    1 
ATOM 6341 C CG    . TYR E 3 112 ? 22.557  73.670 -22.079 1.00 155.55 ? 489 TYR O CG    1 
ATOM 6342 C CD1   . TYR E 3 112 ? 21.286  73.576 -22.648 1.00 167.54 ? 489 TYR O CD1   1 
ATOM 6343 C CD2   . TYR E 3 112 ? 23.603  74.131 -22.879 1.00 167.75 ? 489 TYR O CD2   1 
ATOM 6344 C CE1   . TYR E 3 112 ? 21.063  73.928 -23.980 1.00 177.88 ? 489 TYR O CE1   1 
ATOM 6345 C CE2   . TYR E 3 112 ? 23.392  74.485 -24.212 1.00 178.02 ? 489 TYR O CE2   1 
ATOM 6346 C CZ    . TYR E 3 112 ? 22.120  74.380 -24.755 1.00 180.71 ? 489 TYR O CZ    1 
ATOM 6347 O OH    . TYR E 3 112 ? 21.906  74.721 -26.072 1.00 185.76 ? 489 TYR O OH    1 
ATOM 6348 N N     . GLU E 3 113 ? 24.071  70.398 -19.119 1.00 98.40  ? 490 GLU O N     1 
ATOM 6349 C CA    . GLU E 3 113 ? 24.730  69.880 -17.923 1.00 96.90  ? 490 GLU O CA    1 
ATOM 6350 C C     . GLU E 3 113 ? 26.116  70.456 -17.606 1.00 97.84  ? 490 GLU O C     1 
ATOM 6351 O O     . GLU E 3 113 ? 27.094  70.175 -18.302 1.00 95.55  ? 490 GLU O O     1 
ATOM 6352 C CB    . GLU E 3 113 ? 24.817  68.360 -18.033 1.00 93.38  ? 490 GLU O CB    1 
ATOM 6353 C CG    . GLU E 3 113 ? 25.704  67.703 -17.014 1.00 94.26  ? 490 GLU O CG    1 
ATOM 6354 C CD    . GLU E 3 113 ? 25.707  66.199 -17.157 1.00 95.35  ? 490 GLU O CD    1 
ATOM 6355 O OE1   . GLU E 3 113 ? 24.657  65.579 -16.885 1.00 95.15  ? 490 GLU O OE1   1 
ATOM 6356 O OE2   . GLU E 3 113 ? 26.754  65.637 -17.549 1.00 95.15  ? 490 GLU O OE2   1 
ATOM 6357 N N     . LYS E 3 114 ? 26.185  71.244 -16.531 1.00 99.88  ? 491 LYS O N     1 
ATOM 6358 C CA    . LYS E 3 114 ? 27.427  71.880 -16.071 1.00 103.76 ? 491 LYS O CA    1 
ATOM 6359 C C     . LYS E 3 114 ? 27.835  71.317 -14.708 1.00 104.60 ? 491 LYS O C     1 
ATOM 6360 O O     . LYS E 3 114 ? 27.093  70.535 -14.112 1.00 107.55 ? 491 LYS O O     1 
ATOM 6361 C CB    . LYS E 3 114 ? 27.225  73.394 -15.957 1.00 104.64 ? 491 LYS O CB    1 
ATOM 6362 C CG    . LYS E 3 114 ? 25.972  73.766 -15.169 1.00 105.07 ? 491 LYS O CG    1 
ATOM 6363 C CD    . LYS E 3 114 ? 25.678  75.261 -15.178 1.00 103.80 ? 491 LYS O CD    1 
ATOM 6364 C CE    . LYS E 3 114 ? 24.368  75.549 -14.450 1.00 102.88 ? 491 LYS O CE    1 
ATOM 6365 N NZ    . LYS E 3 114 ? 24.077  77.000 -14.329 1.00 102.26 ? 491 LYS O NZ    1 
ATOM 6366 N N     . ILE E 3 115 ? 29.004  71.723 -14.214 1.00 105.57 ? 492 ILE O N     1 
ATOM 6367 C CA    . ILE E 3 115 ? 29.493  71.242 -12.921 1.00 104.55 ? 492 ILE O CA    1 
ATOM 6368 C C     . ILE E 3 115 ? 30.106  72.293 -11.995 1.00 109.06 ? 492 ILE O C     1 
ATOM 6369 O O     . ILE E 3 115 ? 31.211  72.779 -12.231 1.00 112.75 ? 492 ILE O O     1 
ATOM 6370 C CB    . ILE E 3 115 ? 30.519  70.104 -13.106 1.00 96.54  ? 492 ILE O CB    1 
ATOM 6371 C CG1   . ILE E 3 115 ? 29.786  68.828 -13.518 1.00 88.20  ? 492 ILE O CG1   1 
ATOM 6372 C CG2   . ILE E 3 115 ? 31.302  69.881 -11.820 1.00 88.41  ? 492 ILE O CG2   1 
ATOM 6373 C CD1   . ILE E 3 115 ? 30.656  67.594 -13.551 1.00 83.10  ? 492 ILE O CD1   1 
ATOM 6374 N N     . VAL E 3 116 ? 29.380  72.614 -10.926 1.00 111.70 ? 493 VAL O N     1 
ATOM 6375 C CA    . VAL E 3 116 ? 29.824  73.590 -9.932  1.00 115.34 ? 493 VAL O CA    1 
ATOM 6376 C C     . VAL E 3 116 ? 30.638  72.882 -8.843  1.00 119.78 ? 493 VAL O C     1 
ATOM 6377 O O     . VAL E 3 116 ? 30.083  72.363 -7.872  1.00 126.94 ? 493 VAL O O     1 
ATOM 6378 C CB    . VAL E 3 116 ? 28.610  74.311 -9.263  1.00 111.74 ? 493 VAL O CB    1 
ATOM 6379 C CG1   . VAL E 3 116 ? 29.097  75.403 -8.320  1.00 101.90 ? 493 VAL O CG1   1 
ATOM 6380 C CG2   . VAL E 3 116 ? 27.696  74.901 -10.326 1.00 102.68 ? 493 VAL O CG2   1 
ATOM 6381 N N     . GLY E 3 117 ? 31.956  72.859 -9.009  1.00 122.13 ? 494 GLY O N     1 
ATOM 6382 C CA    . GLY E 3 117 ? 32.800  72.207 -8.027  1.00 117.84 ? 494 GLY O CA    1 
ATOM 6383 C C     . GLY E 3 117 ? 32.639  70.700 -8.055  1.00 114.79 ? 494 GLY O C     1 
ATOM 6384 O O     . GLY E 3 117 ? 32.772  70.080 -9.110  1.00 113.68 ? 494 GLY O O     1 
ATOM 6385 N N     . ASN E 3 118 ? 32.355  70.106 -6.898  1.00 112.48 ? 495 ASN O N     1 
ATOM 6386 C CA    . ASN E 3 118 ? 32.177  68.660 -6.809  1.00 109.28 ? 495 ASN O CA    1 
ATOM 6387 C C     . ASN E 3 118 ? 30.708  68.300 -6.953  1.00 106.19 ? 495 ASN O C     1 
ATOM 6388 O O     . ASN E 3 118 ? 30.295  67.171 -6.677  1.00 105.10 ? 495 ASN O O     1 
ATOM 6389 C CB    . ASN E 3 118 ? 32.709  68.139 -5.474  1.00 109.75 ? 495 ASN O CB    1 
ATOM 6390 C CG    . ASN E 3 118 ? 34.200  68.352 -5.320  1.00 112.31 ? 495 ASN O CG    1 
ATOM 6391 O OD1   . ASN E 3 118 ? 34.668  69.482 -5.178  1.00 113.80 ? 495 ASN O OD1   1 
ATOM 6392 N ND2   . ASN E 3 118 ? 34.957  67.262 -5.357  1.00 113.87 ? 495 ASN O ND2   1 
ATOM 6393 N N     . THR E 3 119 ? 29.925  69.275 -7.395  1.00 101.31 ? 496 THR O N     1 
ATOM 6394 C CA    . THR E 3 119 ? 28.498  69.089 -7.586  1.00 99.50  ? 496 THR O CA    1 
ATOM 6395 C C     . THR E 3 119 ? 28.173  69.231 -9.070  1.00 96.66  ? 496 THR O C     1 
ATOM 6396 O O     . THR E 3 119 ? 28.554  70.218 -9.698  1.00 99.11  ? 496 THR O O     1 
ATOM 6397 C CB    . THR E 3 119 ? 27.704  70.149 -6.796  1.00 101.50 ? 496 THR O CB    1 
ATOM 6398 O OG1   . THR E 3 119 ? 28.162  70.181 -5.437  1.00 101.14 ? 496 THR O OG1   1 
ATOM 6399 C CG2   . THR E 3 119 ? 26.216  69.829 -6.820  1.00 101.27 ? 496 THR O CG2   1 
ATOM 6400 N N     . LYS E 3 120 ? 27.484  68.244 -9.635  1.00 93.56  ? 497 LYS O N     1 
ATOM 6401 C CA    . LYS E 3 120 ? 27.113  68.295 -11.047 1.00 86.90  ? 497 LYS O CA    1 
ATOM 6402 C C     . LYS E 3 120 ? 25.755  68.971 -11.183 1.00 85.75  ? 497 LYS O C     1 
ATOM 6403 O O     . LYS E 3 120 ? 24.775  68.521 -10.595 1.00 81.39  ? 497 LYS O O     1 
ATOM 6404 C CB    . LYS E 3 120 ? 27.055  66.883 -11.635 1.00 82.57  ? 497 LYS O CB    1 
ATOM 6405 C CG    . LYS E 3 120 ? 26.555  66.844 -13.075 1.00 81.04  ? 497 LYS O CG    1 
ATOM 6406 C CD    . LYS E 3 120 ? 26.539  65.434 -13.650 1.00 78.87  ? 497 LYS O CD    1 
ATOM 6407 C CE    . LYS E 3 120 ? 27.938  64.916 -13.879 1.00 77.61  ? 497 LYS O CE    1 
ATOM 6408 N NZ    . LYS E 3 120 ? 27.904  63.612 -14.581 1.00 76.72  ? 497 LYS O NZ    1 
ATOM 6409 N N     . VAL E 3 121 ? 25.695  70.044 -11.966 1.00 86.26  ? 498 VAL O N     1 
ATOM 6410 C CA    . VAL E 3 121 ? 24.448  70.781 -12.143 1.00 91.86  ? 498 VAL O CA    1 
ATOM 6411 C C     . VAL E 3 121 ? 23.863  70.725 -13.551 1.00 92.25  ? 498 VAL O C     1 
ATOM 6412 O O     . VAL E 3 121 ? 24.591  70.745 -14.542 1.00 94.30  ? 498 VAL O O     1 
ATOM 6413 C CB    . VAL E 3 121 ? 24.631  72.264 -11.758 1.00 94.73  ? 498 VAL O CB    1 
ATOM 6414 C CG1   . VAL E 3 121 ? 23.292  72.990 -11.809 1.00 97.64  ? 498 VAL O CG1   1 
ATOM 6415 C CG2   . VAL E 3 121 ? 25.235  72.364 -10.375 1.00 98.08  ? 498 VAL O CG2   1 
ATOM 6416 N N     . LEU E 3 122 ? 22.534  70.657 -13.615 1.00 93.42  ? 499 LEU O N     1 
ATOM 6417 C CA    . LEU E 3 122 ? 21.792  70.619 -14.872 1.00 92.55  ? 499 LEU O CA    1 
ATOM 6418 C C     . LEU E 3 122 ? 21.098  71.963 -15.052 1.00 94.76  ? 499 LEU O C     1 
ATOM 6419 O O     . LEU E 3 122 ? 20.858  72.672 -14.075 1.00 97.55  ? 499 LEU O O     1 
ATOM 6420 C CB    . LEU E 3 122 ? 20.735  69.519 -14.839 1.00 86.19  ? 499 LEU O CB    1 
ATOM 6421 C CG    . LEU E 3 122 ? 20.885  68.424 -15.894 1.00 80.87  ? 499 LEU O CG    1 
ATOM 6422 C CD1   . LEU E 3 122 ? 22.108  67.573 -15.566 1.00 77.34  ? 499 LEU O CD1   1 
ATOM 6423 C CD2   . LEU E 3 122 ? 19.614  67.571 -15.942 1.00 77.19  ? 499 LEU O CD2   1 
ATOM 6424 N N     . GLU E 3 123 ? 20.766  72.309 -16.293 1.00 94.19  ? 500 GLU O N     1 
ATOM 6425 C CA    . GLU E 3 123 ? 20.111  73.584 -16.569 1.00 95.51  ? 500 GLU O CA    1 
ATOM 6426 C C     . GLU E 3 123 ? 19.280  73.572 -17.848 1.00 98.53  ? 500 GLU O C     1 
ATOM 6427 O O     . GLU E 3 123 ? 19.826  73.594 -18.951 1.00 100.11 ? 500 GLU O O     1 
ATOM 6428 C CB    . GLU E 3 123 ? 21.162  74.691 -16.668 1.00 95.45  ? 500 GLU O CB    1 
ATOM 6429 C CG    . GLU E 3 123 ? 20.587  76.100 -16.708 1.00 89.59  ? 500 GLU O CG    1 
ATOM 6430 C CD    . GLU E 3 123 ? 21.084  76.910 -17.895 1.00 85.94  ? 500 GLU O CD    1 
ATOM 6431 O OE1   . GLU E 3 123 ? 22.319  77.015 -18.091 1.00 83.38  ? 500 GLU O OE1   1 
ATOM 6432 O OE2   . GLU E 3 123 ? 20.227  77.447 -18.628 1.00 83.63  ? 500 GLU O OE2   1 
ATOM 6433 N N     . ILE E 3 124 ? 17.960  73.543 -17.703 1.00 103.98 ? 501 ILE O N     1 
ATOM 6434 C CA    . ILE E 3 124 ? 17.080  73.550 -18.864 1.00 106.42 ? 501 ILE O CA    1 
ATOM 6435 C C     . ILE E 3 124 ? 16.585  74.974 -19.098 1.00 110.64 ? 501 ILE O C     1 
ATOM 6436 O O     . ILE E 3 124 ? 16.906  75.881 -18.328 1.00 99.57  ? 501 ILE O O     1 
ATOM 6437 C CB    . ILE E 3 124 ? 15.852  72.638 -18.659 1.00 106.65 ? 501 ILE O CB    1 
ATOM 6438 C CG1   . ILE E 3 124 ? 14.982  73.175 -17.524 1.00 112.46 ? 501 ILE O CG1   1 
ATOM 6439 C CG2   . ILE E 3 124 ? 16.303  71.222 -18.365 1.00 111.54 ? 501 ILE O CG2   1 
ATOM 6440 C CD1   . ILE E 3 124 ? 13.664  72.442 -17.369 1.00 119.86 ? 501 ILE O CD1   1 
ATOM 6441 N N     . PRO E 3 125 ? 15.814  75.196 -20.179 1.00 117.04 ? 502 PRO O N     1 
ATOM 6442 C CA    . PRO E 3 125 ? 15.299  76.538 -20.463 1.00 120.31 ? 502 PRO O CA    1 
ATOM 6443 C C     . PRO E 3 125 ? 13.881  76.774 -19.929 1.00 122.82 ? 502 PRO O C     1 
ATOM 6444 O O     . PRO E 3 125 ? 13.007  75.907 -20.028 1.00 119.04 ? 502 PRO O O     1 
ATOM 6445 C CB    . PRO E 3 125 ? 15.350  76.599 -21.981 1.00 120.09 ? 502 PRO O CB    1 
ATOM 6446 C CG    . PRO E 3 125 ? 14.925  75.214 -22.350 1.00 123.66 ? 502 PRO O CG    1 
ATOM 6447 C CD    . PRO E 3 125 ? 15.719  74.343 -21.381 1.00 116.34 ? 502 PRO O CD    1 
ATOM 6448 N N     . LEU E 3 126 ? 13.670  77.953 -19.354 1.00 121.82 ? 503 LEU O N     1 
ATOM 6449 C CA    . LEU E 3 126 ? 12.369  78.353 -18.828 1.00 126.63 ? 503 LEU O CA    1 
ATOM 6450 C C     . LEU E 3 126 ? 11.855  79.395 -19.817 1.00 132.99 ? 503 LEU O C     1 
ATOM 6451 O O     . LEU E 3 126 ? 11.952  80.603 -19.585 1.00 142.00 ? 503 LEU O O     1 
ATOM 6452 C CB    . LEU E 3 126 ? 12.527  78.974 -17.441 1.00 119.70 ? 503 LEU O CB    1 
ATOM 6453 C CG    . LEU E 3 126 ? 11.821  78.278 -16.277 1.00 108.48 ? 503 LEU O CG    1 
ATOM 6454 C CD1   . LEU E 3 126 ? 12.139  79.033 -14.995 1.00 100.20 ? 503 LEU O CD1   1 
ATOM 6455 C CD2   . LEU E 3 126 ? 10.316  78.233 -16.520 1.00 98.86  ? 503 LEU O CD2   1 
ATOM 6456 N N     . GLU E 3 127 ? 11.311  78.906 -20.925 1.00 137.88 ? 504 GLU O N     1 
ATOM 6457 C CA    . GLU E 3 127 ? 10.820  79.758 -21.998 1.00 134.11 ? 504 GLU O CA    1 
ATOM 6458 C C     . GLU E 3 127 ? 9.441   80.373 -21.770 1.00 120.79 ? 504 GLU O C     1 
ATOM 6459 O O     . GLU E 3 127 ? 8.493   79.684 -21.389 1.00 117.35 ? 504 GLU O O     1 
ATOM 6460 C CB    . GLU E 3 127 ? 10.865  78.959 -23.307 1.00 147.65 ? 504 GLU O CB    1 
ATOM 6461 C CG    . GLU E 3 127 ? 12.283  78.466 -23.625 1.00 168.17 ? 504 GLU O CG    1 
ATOM 6462 C CD    . GLU E 3 127 ? 12.334  77.377 -24.678 1.00 179.13 ? 504 GLU O CD    1 
ATOM 6463 O OE1   . GLU E 3 127 ? 11.714  76.314 -24.469 1.00 185.83 ? 504 GLU O OE1   1 
ATOM 6464 O OE2   . GLU E 3 127 ? 13.004  77.580 -25.712 1.00 185.93 ? 504 GLU O OE2   1 
ATOM 6465 N N     . PRO E 3 128 ? 9.324   81.697 -22.002 1.00 107.63 ? 505 PRO O N     1 
ATOM 6466 C CA    . PRO E 3 128 ? 8.108   82.506 -21.851 1.00 99.39  ? 505 PRO O CA    1 
ATOM 6467 C C     . PRO E 3 128 ? 6.923   82.019 -22.679 1.00 96.07  ? 505 PRO O C     1 
ATOM 6468 O O     . PRO E 3 128 ? 5.780   82.083 -22.230 1.00 92.28  ? 505 PRO O O     1 
ATOM 6469 C CB    . PRO E 3 128 ? 8.565   83.898 -22.281 1.00 96.78  ? 505 PRO O CB    1 
ATOM 6470 C CG    . PRO E 3 128 ? 10.008  83.909 -21.903 1.00 97.47  ? 505 PRO O CG    1 
ATOM 6471 C CD    . PRO E 3 128 ? 10.462  82.556 -22.377 1.00 102.09 ? 505 PRO O CD    1 
ATOM 6472 N N     . LYS E 3 129 ? 7.200   81.536 -23.885 1.00 97.76  ? 506 LYS O N     1 
ATOM 6473 C CA    . LYS E 3 129 ? 6.146   81.056 -24.769 1.00 100.26 ? 506 LYS O CA    1 
ATOM 6474 C C     . LYS E 3 129 ? 5.411   79.826 -24.249 1.00 103.95 ? 506 LYS O C     1 
ATOM 6475 O O     . LYS E 3 129 ? 4.703   79.163 -25.004 1.00 99.91  ? 506 LYS O O     1 
ATOM 6476 C CB    . LYS E 3 129 ? 6.715   80.763 -26.159 1.00 97.52  ? 506 LYS O CB    1 
ATOM 6477 C CG    . LYS E 3 129 ? 7.874   79.788 -26.168 1.00 100.56 ? 506 LYS O CG    1 
ATOM 6478 C CD    . LYS E 3 129 ? 8.310   79.477 -27.592 1.00 102.08 ? 506 LYS O CD    1 
ATOM 6479 C CE    . LYS E 3 129 ? 9.496   78.526 -27.618 1.00 102.68 ? 506 LYS O CE    1 
ATOM 6480 N NZ    . LYS E 3 129 ? 9.892   78.148 -29.001 1.00 101.27 ? 506 LYS O NZ    1 
ATOM 6481 N N     . ASN E 3 130 ? 5.585   79.524 -22.964 1.00 110.79 ? 507 ASN O N     1 
ATOM 6482 C CA    . ASN E 3 130 ? 4.917   78.384 -22.331 1.00 122.85 ? 507 ASN O CA    1 
ATOM 6483 C C     . ASN E 3 130 ? 4.363   78.847 -20.990 1.00 131.90 ? 507 ASN O C     1 
ATOM 6484 O O     . ASN E 3 130 ? 3.906   78.038 -20.183 1.00 137.23 ? 507 ASN O O     1 
ATOM 6485 C CB    . ASN E 3 130 ? 5.899   77.240 -22.080 1.00 119.94 ? 507 ASN O CB    1 
ATOM 6486 C CG    . ASN E 3 130 ? 6.821   76.995 -23.248 1.00 115.98 ? 507 ASN O CG    1 
ATOM 6487 O OD1   . ASN E 3 130 ? 7.704   77.804 -23.537 1.00 112.35 ? 507 ASN O OD1   1 
ATOM 6488 N ND2   . ASN E 3 130 ? 6.622   75.875 -23.932 1.00 112.53 ? 507 ASN O ND2   1 
ATOM 6489 N N     . ASN E 3 131 ? 4.414   80.159 -20.772 1.00 141.51 ? 508 ASN O N     1 
ATOM 6490 C CA    . ASN E 3 131 ? 3.960   80.781 -19.533 1.00 146.73 ? 508 ASN O CA    1 
ATOM 6491 C C     . ASN E 3 131 ? 4.992   80.473 -18.460 1.00 147.39 ? 508 ASN O C     1 
ATOM 6492 O O     . ASN E 3 131 ? 4.656   80.228 -17.304 1.00 151.61 ? 508 ASN O O     1 
ATOM 6493 C CB    . ASN E 3 131 ? 2.583   80.249 -19.120 1.00 148.53 ? 508 ASN O CB    1 
ATOM 6494 C CG    . ASN E 3 131 ? 1.476   81.275 -19.309 1.00 148.20 ? 508 ASN O CG    1 
ATOM 6495 O OD1   . ASN E 3 131 ? 0.304   80.988 -19.062 1.00 147.40 ? 508 ASN O OD1   1 
ATOM 6496 N ND2   . ASN E 3 131 ? 1.844   82.479 -19.742 1.00 147.30 ? 508 ASN O ND2   1 
ATOM 6497 N N     . MET E 3 132 ? 6.257   80.488 -18.867 1.00 144.01 ? 509 MET O N     1 
ATOM 6498 C CA    . MET E 3 132 ? 7.369   80.209 -17.970 1.00 137.77 ? 509 MET O CA    1 
ATOM 6499 C C     . MET E 3 132 ? 7.164   78.927 -17.165 1.00 134.96 ? 509 MET O C     1 
ATOM 6500 O O     . MET E 3 132 ? 7.385   78.890 -15.954 1.00 139.24 ? 509 MET O O     1 
ATOM 6501 C CB    . MET E 3 132 ? 7.600   81.398 -17.037 1.00 132.68 ? 509 MET O CB    1 
ATOM 6502 C CG    . MET E 3 132 ? 8.100   82.633 -17.764 1.00 121.29 ? 509 MET O CG    1 
ATOM 6503 S SD    . MET E 3 132 ? 9.587   82.286 -18.737 1.00 113.92 ? 509 MET O SD    1 
ATOM 6504 C CE    . MET E 3 132 ? 10.918  82.784 -17.582 1.00 107.39 ? 509 MET O CE    1 
ATOM 6505 N N     . ARG E 3 133 ? 6.739   77.878 -17.860 1.00 126.64 ? 510 ARG O N     1 
ATOM 6506 C CA    . ARG E 3 133 ? 6.511   76.573 -17.256 1.00 115.24 ? 510 ARG O CA    1 
ATOM 6507 C C     . ARG E 3 133 ? 7.742   75.740 -17.599 1.00 110.49 ? 510 ARG O C     1 
ATOM 6508 O O     . ARG E 3 133 ? 8.740   76.271 -18.088 1.00 111.25 ? 510 ARG O O     1 
ATOM 6509 C CB    . ARG E 3 133 ? 5.263   75.931 -17.867 1.00 111.46 ? 510 ARG O CB    1 
ATOM 6510 C CG    . ARG E 3 133 ? 4.674   74.754 -17.101 1.00 102.21 ? 510 ARG O CG    1 
ATOM 6511 C CD    . ARG E 3 133 ? 3.538   74.124 -17.908 1.00 97.25  ? 510 ARG O CD    1 
ATOM 6512 N NE    . ARG E 3 133 ? 2.580   73.395 -17.080 1.00 95.28  ? 510 ARG O NE    1 
ATOM 6513 C CZ    . ARG E 3 133 ? 1.886   73.943 -16.086 1.00 95.59  ? 510 ARG O CZ    1 
ATOM 6514 N NH1   . ARG E 3 133 ? 2.048   75.230 -15.796 1.00 95.23  ? 510 ARG O NH1   1 
ATOM 6515 N NH2   . ARG E 3 133 ? 1.030   73.209 -15.381 1.00 95.21  ? 510 ARG O NH2   1 
ATOM 6516 N N     . ALA E 3 134 ? 7.663   74.438 -17.346 1.00 104.36 ? 511 ALA O N     1 
ATOM 6517 C CA    . ALA E 3 134 ? 8.757   73.514 -17.636 1.00 98.08  ? 511 ALA O CA    1 
ATOM 6518 C C     . ALA E 3 134 ? 8.457   72.158 -17.019 1.00 95.92  ? 511 ALA O C     1 
ATOM 6519 O O     . ALA E 3 134 ? 8.345   72.029 -15.803 1.00 94.80  ? 511 ALA O O     1 
ATOM 6520 C CB    . ALA E 3 134 ? 10.075  74.055 -17.089 1.00 89.33  ? 511 ALA O CB    1 
ATOM 6521 N N     . THR E 3 135 ? 8.298   71.145 -17.858 1.00 95.17  ? 512 THR O N     1 
ATOM 6522 C CA    . THR E 3 135 ? 8.031   69.817 -17.342 1.00 100.23 ? 512 THR O CA    1 
ATOM 6523 C C     . THR E 3 135 ? 9.409   69.194 -17.152 1.00 100.08 ? 512 THR O C     1 
ATOM 6524 O O     . THR E 3 135 ? 10.237  69.231 -18.063 1.00 108.14 ? 512 THR O O     1 
ATOM 6525 C CB    . THR E 3 135 ? 7.212   68.972 -18.338 1.00 102.73 ? 512 THR O CB    1 
ATOM 6526 O OG1   . THR E 3 135 ? 6.400   69.831 -19.148 1.00 99.32  ? 512 THR O OG1   1 
ATOM 6527 C CG2   . THR E 3 135 ? 6.305   68.012 -17.584 1.00 99.00  ? 512 THR O CG2   1 
ATOM 6528 N N     . ILE E 3 136 ? 9.667   68.648 -15.967 1.00 97.67  ? 513 ILE O N     1 
ATOM 6529 C CA    . ILE E 3 136 ? 10.962  68.039 -15.700 1.00 88.04  ? 513 ILE O CA    1 
ATOM 6530 C C     . ILE E 3 136 ? 10.924  66.552 -16.000 1.00 87.42  ? 513 ILE O C     1 
ATOM 6531 O O     . ILE E 3 136 ? 10.830  65.726 -15.096 1.00 86.65  ? 513 ILE O O     1 
ATOM 6532 C CB    . ILE E 3 136 ? 11.393  68.222 -14.233 1.00 80.38  ? 513 ILE O CB    1 
ATOM 6533 C CG1   . ILE E 3 136 ? 11.453  69.709 -13.871 1.00 73.23  ? 513 ILE O CG1   1 
ATOM 6534 C CG2   . ILE E 3 136 ? 12.765  67.599 -14.030 1.00 74.10  ? 513 ILE O CG2   1 
ATOM 6535 C CD1   . ILE E 3 136 ? 12.583  70.482 -14.541 1.00 67.28  ? 513 ILE O CD1   1 
ATOM 6536 N N     . ASP E 3 137 ? 11.004  66.211 -17.276 1.00 83.46  ? 514 ASP O N     1 
ATOM 6537 C CA    . ASP E 3 137 ? 10.971  64.816 -17.663 1.00 81.35  ? 514 ASP O CA    1 
ATOM 6538 C C     . ASP E 3 137 ? 12.335  64.379 -18.161 1.00 76.43  ? 514 ASP O C     1 
ATOM 6539 O O     . ASP E 3 137 ? 12.477  63.309 -18.752 1.00 75.85  ? 514 ASP O O     1 
ATOM 6540 C CB    . ASP E 3 137 ? 9.929   64.601 -18.757 1.00 87.71  ? 514 ASP O CB    1 
ATOM 6541 C CG    . ASP E 3 137 ? 10.276  65.323 -20.040 1.00 93.31  ? 514 ASP O CG    1 
ATOM 6542 O OD1   . ASP E 3 137 ? 9.505   65.186 -21.019 1.00 96.41  ? 514 ASP O OD1   1 
ATOM 6543 O OD2   . ASP E 3 137 ? 11.316  66.024 -20.070 1.00 95.05  ? 514 ASP O OD2   1 
ATOM 6544 N N     . CYS E 3 138 ? 13.346  65.200 -17.908 1.00 71.39  ? 515 CYS O N     1 
ATOM 6545 C CA    . CYS E 3 138 ? 14.685  64.869 -18.366 1.00 63.90  ? 515 CYS O CA    1 
ATOM 6546 C C     . CYS E 3 138 ? 15.704  64.663 -17.260 1.00 60.85  ? 515 CYS O C     1 
ATOM 6547 O O     . CYS E 3 138 ? 16.903  64.758 -17.534 1.00 55.94  ? 515 CYS O O     1 
ATOM 6548 C CB    . CYS E 3 138 ? 15.205  65.987 -19.252 1.00 62.74  ? 515 CYS O CB    1 
ATOM 6549 S SG    . CYS E 3 138 ? 15.662  67.459 -18.305 1.00 64.54  ? 515 CYS O SG    1 
ATOM 6550 N N     . ALA E 3 139 ? 15.265  64.389 -16.028 1.00 58.46  ? 516 ALA O N     1 
ATOM 6551 C CA    . ALA E 3 139 ? 16.220  64.233 -14.926 1.00 59.86  ? 516 ALA O CA    1 
ATOM 6552 C C     . ALA E 3 139 ? 16.256  62.913 -14.177 1.00 62.42  ? 516 ALA O C     1 
ATOM 6553 O O     . ALA E 3 139 ? 15.219  62.331 -13.854 1.00 66.10  ? 516 ALA O O     1 
ATOM 6554 C CB    . ALA E 3 139 ? 16.035  65.355 -13.933 1.00 58.35  ? 516 ALA O CB    1 
ATOM 6555 N N     . GLY E 3 140 ? 17.477  62.467 -13.885 1.00 64.09  ? 517 GLY O N     1 
ATOM 6556 C CA    . GLY E 3 140 ? 17.684  61.225 -13.157 1.00 63.33  ? 517 GLY O CA    1 
ATOM 6557 C C     . GLY E 3 140 ? 18.585  61.454 -11.954 1.00 59.94  ? 517 GLY O C     1 
ATOM 6558 O O     . GLY E 3 140 ? 19.132  62.546 -11.784 1.00 62.39  ? 517 GLY O O     1 
ATOM 6559 N N     . ILE E 3 141 ? 18.759  60.436 -11.120 1.00 54.78  ? 518 ILE O N     1 
ATOM 6560 C CA    . ILE E 3 141 ? 19.590  60.592 -9.932  1.00 47.46  ? 518 ILE O CA    1 
ATOM 6561 C C     . ILE E 3 141 ? 20.675  59.518 -9.867  1.00 45.86  ? 518 ILE O C     1 
ATOM 6562 O O     . ILE E 3 141 ? 20.390  58.317 -9.910  1.00 44.98  ? 518 ILE O O     1 
ATOM 6563 C CB    . ILE E 3 141 ? 18.714  60.529 -8.645  1.00 44.23  ? 518 ILE O CB    1 
ATOM 6564 C CG1   . ILE E 3 141 ? 17.442  61.356 -8.840  1.00 40.46  ? 518 ILE O CG1   1 
ATOM 6565 C CG2   . ILE E 3 141 ? 19.475  61.111 -7.462  1.00 42.02  ? 518 ILE O CG2   1 
ATOM 6566 C CD1   . ILE E 3 141 ? 16.422  61.179 -7.763  1.00 36.86  ? 518 ILE O CD1   1 
ATOM 6567 N N     . LEU E 3 142 ? 21.923  59.945 -9.746  1.00 42.79  ? 519 LEU O N     1 
ATOM 6568 C CA    . LEU E 3 142 ? 23.020  58.990 -9.702  1.00 45.35  ? 519 LEU O CA    1 
ATOM 6569 C C     . LEU E 3 142 ? 23.656  58.785 -8.327  1.00 51.28  ? 519 LEU O C     1 
ATOM 6570 O O     . LEU E 3 142 ? 24.305  59.685 -7.788  1.00 53.71  ? 519 LEU O O     1 
ATOM 6571 C CB    . LEU E 3 142 ? 24.112  59.402 -10.690 1.00 37.88  ? 519 LEU O CB    1 
ATOM 6572 C CG    . LEU E 3 142 ? 25.442  58.666 -10.480 1.00 33.63  ? 519 LEU O CG    1 
ATOM 6573 C CD1   . LEU E 3 142 ? 25.350  57.188 -10.967 1.00 25.03  ? 519 LEU O CD1   1 
ATOM 6574 C CD2   . LEU E 3 142 ? 26.554  59.461 -11.188 1.00 28.84  ? 519 LEU O CD2   1 
ATOM 6575 N N     . LYS E 3 143 ? 23.487  57.586 -7.777  1.00 56.91  ? 520 LYS O N     1 
ATOM 6576 C CA    . LYS E 3 143 ? 24.069  57.246 -6.484  1.00 60.03  ? 520 LYS O CA    1 
ATOM 6577 C C     . LYS E 3 143 ? 25.569  57.069 -6.670  1.00 59.73  ? 520 LYS O C     1 
ATOM 6578 O O     . LYS E 3 143 ? 26.004  56.362 -7.578  1.00 56.13  ? 520 LYS O O     1 
ATOM 6579 C CB    . LYS E 3 143 ? 23.455  55.945 -5.952  1.00 64.22  ? 520 LYS O CB    1 
ATOM 6580 C CG    . LYS E 3 143 ? 24.012  55.459 -4.610  1.00 72.91  ? 520 LYS O CG    1 
ATOM 6581 C CD    . LYS E 3 143 ? 23.775  56.462 -3.481  1.00 78.49  ? 520 LYS O CD    1 
ATOM 6582 C CE    . LYS E 3 143 ? 24.151  55.871 -2.123  1.00 81.58  ? 520 LYS O CE    1 
ATOM 6583 N NZ    . LYS E 3 143 ? 25.567  55.390 -2.045  1.00 82.14  ? 520 LYS O NZ    1 
ATOM 6584 N N     . LEU E 3 144 ? 26.347  57.732 -5.820  1.00 62.11  ? 521 LEU O N     1 
ATOM 6585 C CA    . LEU E 3 144 ? 27.800  57.650 -5.861  1.00 65.72  ? 521 LEU O CA    1 
ATOM 6586 C C     . LEU E 3 144 ? 28.218  56.724 -4.748  1.00 70.46  ? 521 LEU O C     1 
ATOM 6587 O O     . LEU E 3 144 ? 27.551  56.671 -3.719  1.00 70.82  ? 521 LEU O O     1 
ATOM 6588 C CB    . LEU E 3 144 ? 28.402  59.009 -5.606  1.00 63.94  ? 521 LEU O CB    1 
ATOM 6589 C CG    . LEU E 3 144 ? 27.958  60.072 -6.588  1.00 64.74  ? 521 LEU O CG    1 
ATOM 6590 C CD1   . LEU E 3 144 ? 27.366  61.250 -5.820  1.00 65.69  ? 521 LEU O CD1   1 
ATOM 6591 C CD2   . LEU E 3 144 ? 29.156  60.493 -7.433  1.00 65.33  ? 521 LEU O CD2   1 
ATOM 6592 N N     . ARG E 3 145 ? 29.320  56.001 -4.936  1.00 76.68  ? 522 ARG O N     1 
ATOM 6593 C CA    . ARG E 3 145 ? 29.780  55.072 -3.909  1.00 84.28  ? 522 ARG O CA    1 
ATOM 6594 C C     . ARG E 3 145 ? 30.172  55.784 -2.623  1.00 86.71  ? 522 ARG O C     1 
ATOM 6595 O O     . ARG E 3 145 ? 30.959  56.732 -2.639  1.00 89.88  ? 522 ARG O O     1 
ATOM 6596 C CB    . ARG E 3 145 ? 30.945  54.231 -4.432  1.00 87.38  ? 522 ARG O CB    1 
ATOM 6597 C CG    . ARG E 3 145 ? 30.481  53.019 -5.216  1.00 89.87  ? 522 ARG O CG    1 
ATOM 6598 C CD    . ARG E 3 145 ? 31.638  52.206 -5.758  1.00 92.62  ? 522 ARG O CD    1 
ATOM 6599 N NE    . ARG E 3 145 ? 32.417  52.949 -6.742  1.00 95.94  ? 522 ARG O NE    1 
ATOM 6600 C CZ    . ARG E 3 145 ? 33.377  52.412 -7.486  1.00 98.54  ? 522 ARG O CZ    1 
ATOM 6601 N NH1   . ARG E 3 145 ? 33.676  51.126 -7.358  1.00 101.27 ? 522 ARG O NH1   1 
ATOM 6602 N NH2   . ARG E 3 145 ? 34.032  53.154 -8.366  1.00 100.04 ? 522 ARG O NH2   1 
ATOM 6603 N N     . ASN E 3 146 ? 29.605  55.325 -1.509  1.00 87.21  ? 523 ASN O N     1 
ATOM 6604 C CA    . ASN E 3 146 ? 29.876  55.921 -0.210  1.00 85.50  ? 523 ASN O CA    1 
ATOM 6605 C C     . ASN E 3 146 ? 31.366  55.971 0.091   1.00 83.46  ? 523 ASN O C     1 
ATOM 6606 O O     . ASN E 3 146 ? 31.857  56.949 0.652   1.00 86.65  ? 523 ASN O O     1 
ATOM 6607 C CB    . ASN E 3 146 ? 29.145  55.148 0.885   1.00 85.66  ? 523 ASN O CB    1 
ATOM 6608 C CG    . ASN E 3 146 ? 27.641  55.227 0.740   1.00 84.27  ? 523 ASN O CG    1 
ATOM 6609 O OD1   . ASN E 3 146 ? 27.058  56.313 0.734   1.00 82.27  ? 523 ASN O OD1   1 
ATOM 6610 N ND2   . ASN E 3 146 ? 27.002  54.073 0.620   1.00 83.29  ? 523 ASN O ND2   1 
ATOM 6611 N N     . ALA E 3 147 ? 32.086  54.921 -0.294  1.00 78.92  ? 524 ALA O N     1 
ATOM 6612 C CA    . ALA E 3 147 ? 33.529  54.853 -0.066  1.00 73.16  ? 524 ALA O CA    1 
ATOM 6613 C C     . ALA E 3 147 ? 34.312  56.001 -0.712  1.00 73.15  ? 524 ALA O C     1 
ATOM 6614 O O     . ALA E 3 147 ? 35.290  56.489 -0.152  1.00 69.74  ? 524 ALA O O     1 
ATOM 6615 C CB    . ALA E 3 147 ? 34.069  53.521 -0.569  1.00 66.25  ? 524 ALA O CB    1 
ATOM 6616 N N     . ASP E 3 148 ? 33.884  56.433 -1.890  1.00 77.38  ? 525 ASP O N     1 
ATOM 6617 C CA    . ASP E 3 148 ? 34.574  57.506 -2.590  1.00 83.17  ? 525 ASP O CA    1 
ATOM 6618 C C     . ASP E 3 148 ? 34.264  58.903 -2.050  1.00 86.32  ? 525 ASP O C     1 
ATOM 6619 O O     . ASP E 3 148 ? 35.150  59.755 -1.994  1.00 83.84  ? 525 ASP O O     1 
ATOM 6620 C CB    . ASP E 3 148 ? 34.244  57.436 -4.078  1.00 87.33  ? 525 ASP O CB    1 
ATOM 6621 C CG    . ASP E 3 148 ? 34.470  56.057 -4.655  1.00 93.35  ? 525 ASP O CG    1 
ATOM 6622 O OD1   . ASP E 3 148 ? 35.593  55.531 -4.503  1.00 96.58  ? 525 ASP O OD1   1 
ATOM 6623 O OD2   . ASP E 3 148 ? 33.525  55.503 -5.261  1.00 97.60  ? 525 ASP O OD2   1 
ATOM 6624 N N     . ILE E 3 149 ? 33.016  59.146 -1.659  1.00 92.57  ? 526 ILE O N     1 
ATOM 6625 C CA    . ILE E 3 149 ? 32.640  60.455 -1.132  1.00 100.64 ? 526 ILE O CA    1 
ATOM 6626 C C     . ILE E 3 149 ? 33.137  60.623 0.298   1.00 107.27 ? 526 ILE O C     1 
ATOM 6627 O O     . ILE E 3 149 ? 33.271  61.743 0.788   1.00 112.54 ? 526 ILE O O     1 
ATOM 6628 C CB    . ILE E 3 149 ? 31.109  60.669 -1.154  1.00 98.01  ? 526 ILE O CB    1 
ATOM 6629 C CG1   . ILE E 3 149 ? 30.618  60.826 -2.590  1.00 96.90  ? 526 ILE O CG1   1 
ATOM 6630 C CG2   . ILE E 3 149 ? 30.746  61.929 -0.405  1.00 95.83  ? 526 ILE O CG2   1 
ATOM 6631 C CD1   . ILE E 3 149 ? 30.844  59.616 -3.442  1.00 97.78  ? 526 ILE O CD1   1 
ATOM 6632 N N     . GLU E 3 150 ? 33.417  59.508 0.964   1.00 109.21 ? 527 GLU O N     1 
ATOM 6633 C CA    . GLU E 3 150 ? 33.902  59.549 2.338   1.00 112.92 ? 527 GLU O CA    1 
ATOM 6634 C C     . GLU E 3 150 ? 35.426  59.596 2.406   1.00 113.55 ? 527 GLU O C     1 
ATOM 6635 O O     . GLU E 3 150 ? 36.007  59.783 3.474   1.00 122.43 ? 527 GLU O O     1 
ATOM 6636 C CB    . GLU E 3 150 ? 33.368  58.345 3.115   1.00 115.51 ? 527 GLU O CB    1 
ATOM 6637 C CG    . GLU E 3 150 ? 31.893  58.476 3.472   1.00 106.22 ? 527 GLU O CG    1 
ATOM 6638 C CD    . GLU E 3 150 ? 31.315  57.212 4.075   1.00 100.79 ? 527 GLU O CD    1 
ATOM 6639 O OE1   . GLU E 3 150 ? 30.147  57.251 4.520   1.00 97.43  ? 527 GLU O OE1   1 
ATOM 6640 O OE2   . GLU E 3 150 ? 32.025  56.180 4.096   1.00 97.53  ? 527 GLU O OE2   1 
ATOM 6641 N N     . LEU E 3 151 ? 36.066  59.435 1.255   1.00 111.27 ? 528 LEU O N     1 
ATOM 6642 C CA    . LEU E 3 151 ? 37.518  59.474 1.174   1.00 99.53  ? 528 LEU O CA    1 
ATOM 6643 C C     . LEU E 3 151 ? 37.924  60.858 0.673   1.00 98.15  ? 528 LEU O C     1 
ATOM 6644 O O     . LEU E 3 151 ? 39.076  61.101 0.313   1.00 90.26  ? 528 LEU O O     1 
ATOM 6645 C CB    . LEU E 3 151 ? 38.007  58.383 0.220   1.00 89.80  ? 528 LEU O CB    1 
ATOM 6646 C CG    . LEU E 3 151 ? 39.508  58.097 0.125   1.00 85.42  ? 528 LEU O CG    1 
ATOM 6647 C CD1   . LEU E 3 151 ? 39.707  56.629 -0.211  1.00 83.17  ? 528 LEU O CD1   1 
ATOM 6648 C CD2   . LEU E 3 151 ? 40.167  58.990 -0.920  1.00 83.16  ? 528 LEU O CD2   1 
ATOM 6649 N N     . ARG E 3 152 ? 36.959  61.770 0.669   1.00 100.01 ? 529 ARG O N     1 
ATOM 6650 C CA    . ARG E 3 152 ? 37.195  63.130 0.214   1.00 107.96 ? 529 ARG O CA    1 
ATOM 6651 C C     . ARG E 3 152 ? 37.804  63.998 1.304   1.00 115.35 ? 529 ARG O C     1 
ATOM 6652 O O     . ARG E 3 152 ? 37.295  64.052 2.424   1.00 116.77 ? 529 ARG O O     1 
ATOM 6653 C CB    . ARG E 3 152 ? 35.888  63.766 -0.250  1.00 104.45 ? 529 ARG O CB    1 
ATOM 6654 C CG    . ARG E 3 152 ? 36.047  65.198 -0.710  1.00 104.49 ? 529 ARG O CG    1 
ATOM 6655 C CD    . ARG E 3 152 ? 34.705  65.821 -0.992  1.00 104.73 ? 529 ARG O CD    1 
ATOM 6656 N NE    . ARG E 3 152 ? 33.937  65.037 -1.951  1.00 105.46 ? 529 ARG O NE    1 
ATOM 6657 C CZ    . ARG E 3 152 ? 32.746  65.399 -2.415  1.00 106.15 ? 529 ARG O CZ    1 
ATOM 6658 N NH1   . ARG E 3 152 ? 32.193  66.533 -2.002  1.00 105.89 ? 529 ARG O NH1   1 
ATOM 6659 N NH2   . ARG E 3 152 ? 32.108  64.630 -3.289  1.00 106.80 ? 529 ARG O NH2   1 
ATOM 6660 N N     . LYS E 3 153 ? 38.893  64.681 0.963   1.00 122.47 ? 530 LYS O N     1 
ATOM 6661 C CA    . LYS E 3 153 ? 39.573  65.563 1.902   1.00 131.24 ? 530 LYS O CA    1 
ATOM 6662 C C     . LYS E 3 153 ? 38.758  66.830 2.096   1.00 131.11 ? 530 LYS O C     1 
ATOM 6663 O O     . LYS E 3 153 ? 38.926  67.804 1.362   1.00 138.88 ? 530 LYS O O     1 
ATOM 6664 C CB    . LYS E 3 153 ? 40.966  65.929 1.381   1.00 139.33 ? 530 LYS O CB    1 
ATOM 6665 C CG    . LYS E 3 153 ? 41.911  64.748 1.266   1.00 143.12 ? 530 LYS O CG    1 
ATOM 6666 C CD    . LYS E 3 153 ? 43.329  65.188 0.921   1.00 144.20 ? 530 LYS O CD    1 
ATOM 6667 C CE    . LYS E 3 153 ? 44.277  63.992 0.882   1.00 144.66 ? 530 LYS O CE    1 
ATOM 6668 N NZ    . LYS E 3 153 ? 45.693  64.379 0.626   1.00 145.40 ? 530 LYS O NZ    1 
ATOM 6669 N N     . GLY E 3 154 ? 37.869  66.813 3.083   1.00 130.74 ? 531 GLY O N     1 
ATOM 6670 C CA    . GLY E 3 154 ? 37.048  67.979 3.345   1.00 118.67 ? 531 GLY O CA    1 
ATOM 6671 C C     . GLY E 3 154 ? 35.617  67.642 3.712   1.00 113.49 ? 531 GLY O C     1 
ATOM 6672 O O     . GLY E 3 154 ? 34.809  68.538 3.962   1.00 105.91 ? 531 GLY O O     1 
ATOM 6673 N N     . GLU E 3 155 ? 35.293  66.354 3.738   1.00 112.33 ? 532 GLU O N     1 
ATOM 6674 C CA    . GLU E 3 155 ? 33.943  65.948 4.090   1.00 117.68 ? 532 GLU O CA    1 
ATOM 6675 C C     . GLU E 3 155 ? 33.882  65.362 5.489   1.00 120.28 ? 532 GLU O C     1 
ATOM 6676 O O     . GLU E 3 155 ? 34.909  65.024 6.080   1.00 122.01 ? 532 GLU O O     1 
ATOM 6677 C CB    . GLU E 3 155 ? 33.389  64.943 3.077   1.00 117.54 ? 532 GLU O CB    1 
ATOM 6678 C CG    . GLU E 3 155 ? 32.225  65.499 2.266   1.00 120.90 ? 532 GLU O CG    1 
ATOM 6679 C CD    . GLU E 3 155 ? 31.064  65.979 3.135   1.00 123.15 ? 532 GLU O CD    1 
ATOM 6680 O OE1   . GLU E 3 155 ? 30.176  66.687 2.614   1.00 124.34 ? 532 GLU O OE1   1 
ATOM 6681 O OE2   . GLU E 3 155 ? 31.030  65.648 4.338   1.00 124.74 ? 532 GLU O OE2   1 
ATOM 6682 N N     . THR E 3 156 ? 32.665  65.251 6.009   1.00 120.95 ? 533 THR O N     1 
ATOM 6683 C CA    . THR E 3 156 ? 32.435  64.726 7.343   1.00 125.39 ? 533 THR O CA    1 
ATOM 6684 C C     . THR E 3 156 ? 31.078  64.030 7.454   1.00 119.36 ? 533 THR O C     1 
ATOM 6685 O O     . THR E 3 156 ? 30.722  63.531 8.521   1.00 124.73 ? 533 THR O O     1 
ATOM 6686 C CB    . THR E 3 156 ? 32.493  65.859 8.383   1.00 134.12 ? 533 THR O CB    1 
ATOM 6687 O OG1   . THR E 3 156 ? 31.535  66.868 8.042   1.00 138.34 ? 533 THR O OG1   1 
ATOM 6688 C CG2   . THR E 3 156 ? 33.879  66.486 8.413   1.00 137.73 ? 533 THR O CG2   1 
ATOM 6689 N N     . ASP E 3 157 ? 30.320  64.003 6.359   1.00 112.85 ? 534 ASP O N     1 
ATOM 6690 C CA    . ASP E 3 157 ? 29.007  63.358 6.369   1.00 98.18  ? 534 ASP O CA    1 
ATOM 6691 C C     . ASP E 3 157 ? 29.108  61.873 6.066   1.00 91.86  ? 534 ASP O C     1 
ATOM 6692 O O     . ASP E 3 157 ? 29.954  61.437 5.288   1.00 85.15  ? 534 ASP O O     1 
ATOM 6693 C CB    . ASP E 3 157 ? 28.067  64.016 5.364   1.00 92.19  ? 534 ASP O CB    1 
ATOM 6694 C CG    . ASP E 3 157 ? 27.740  65.444 5.728   1.00 90.76  ? 534 ASP O CG    1 
ATOM 6695 O OD1   . ASP E 3 157 ? 28.641  66.307 5.632   1.00 91.02  ? 534 ASP O OD1   1 
ATOM 6696 O OD2   . ASP E 3 157 ? 26.582  65.702 6.119   1.00 90.96  ? 534 ASP O OD2   1 
ATOM 6697 N N     . ILE E 3 158 ? 28.233  61.096 6.685   1.00 85.64  ? 535 ILE O N     1 
ATOM 6698 C CA    . ILE E 3 158 ? 28.248  59.659 6.491   1.00 87.56  ? 535 ILE O CA    1 
ATOM 6699 C C     . ILE E 3 158 ? 27.393  59.235 5.308   1.00 85.23  ? 535 ILE O C     1 
ATOM 6700 O O     . ILE E 3 158 ? 26.340  59.824 5.033   1.00 86.96  ? 535 ILE O O     1 
ATOM 6701 C CB    . ILE E 3 158 ? 27.749  58.939 7.751   1.00 92.87  ? 535 ILE O CB    1 
ATOM 6702 C CG1   . ILE E 3 158 ? 28.456  59.516 8.982   1.00 96.09  ? 535 ILE O CG1   1 
ATOM 6703 C CG2   . ILE E 3 158 ? 28.014  57.438 7.632   1.00 95.25  ? 535 ILE O CG2   1 
ATOM 6704 C CD1   . ILE E 3 158 ? 27.965  58.964 10.299  1.00 98.01  ? 535 ILE O CD1   1 
ATOM 6705 N N     . GLY E 3 159 ? 27.856  58.207 4.605   1.00 84.79  ? 536 GLY O N     1 
ATOM 6706 C CA    . GLY E 3 159 ? 27.121  57.714 3.460   1.00 81.28  ? 536 GLY O CA    1 
ATOM 6707 C C     . GLY E 3 159 ? 25.993  56.828 3.924   1.00 80.51  ? 536 GLY O C     1 
ATOM 6708 O O     . GLY E 3 159 ? 24.814  57.189 3.813   1.00 74.60  ? 536 GLY O O     1 
ATOM 6709 N N     . ARG E 3 160 ? 26.376  55.671 4.462   1.00 80.34  ? 537 ARG O N     1 
ATOM 6710 C CA    . ARG E 3 160 ? 25.436  54.682 4.966   1.00 86.61  ? 537 ARG O CA    1 
ATOM 6711 C C     . ARG E 3 160 ? 24.168  55.345 5.478   1.00 82.46  ? 537 ARG O C     1 
ATOM 6712 O O     . ARG E 3 160 ? 24.212  56.389 6.115   1.00 84.76  ? 537 ARG O O     1 
ATOM 6713 C CB    . ARG E 3 160 ? 26.078  53.872 6.094   1.00 100.95 ? 537 ARG O CB    1 
ATOM 6714 C CG    . ARG E 3 160 ? 25.187  52.770 6.654   1.00 116.30 ? 537 ARG O CG    1 
ATOM 6715 C CD    . ARG E 3 160 ? 25.652  52.329 8.039   1.00 126.92 ? 537 ARG O CD    1 
ATOM 6716 N NE    . ARG E 3 160 ? 24.797  51.300 8.625   1.00 134.38 ? 537 ARG O NE    1 
ATOM 6717 C CZ    . ARG E 3 160 ? 24.733  50.041 8.199   1.00 138.32 ? 537 ARG O CZ    1 
ATOM 6718 N NH1   . ARG E 3 160 ? 25.476  49.642 7.175   1.00 140.52 ? 537 ARG O NH1   1 
ATOM 6719 N NH2   . ARG E 3 160 ? 23.926  49.176 8.802   1.00 140.85 ? 537 ARG O NH2   1 
ATOM 6720 N N     . LYS E 3 161 ? 23.034  54.735 5.176   1.00 80.41  ? 538 LYS O N     1 
ATOM 6721 C CA    . LYS E 3 161 ? 21.744  55.244 5.611   1.00 73.05  ? 538 LYS O CA    1 
ATOM 6722 C C     . LYS E 3 161 ? 21.340  56.625 5.090   1.00 69.09  ? 538 LYS O C     1 
ATOM 6723 O O     . LYS E 3 161 ? 20.141  56.896 4.963   1.00 64.51  ? 538 LYS O O     1 
ATOM 6724 C CB    . LYS E 3 161 ? 21.677  55.238 7.140   1.00 72.71  ? 538 LYS O CB    1 
ATOM 6725 C CG    . LYS E 3 161 ? 21.799  53.852 7.743   1.00 78.23  ? 538 LYS O CG    1 
ATOM 6726 C CD    . LYS E 3 161 ? 20.506  53.072 7.583   1.00 83.60  ? 538 LYS O CD    1 
ATOM 6727 C CE    . LYS E 3 161 ? 19.521  53.451 8.669   1.00 86.89  ? 538 LYS O CE    1 
ATOM 6728 N NZ    . LYS E 3 161 ? 20.056  53.105 10.021  1.00 88.02  ? 538 LYS O NZ    1 
ATOM 6729 N N     . ASN E 3 162 ? 22.296  57.505 4.790   1.00 64.47  ? 539 ASN O N     1 
ATOM 6730 C CA    . ASN E 3 162 ? 21.919  58.835 4.291   1.00 65.92  ? 539 ASN O CA    1 
ATOM 6731 C C     . ASN E 3 162 ? 21.489  58.722 2.845   1.00 64.66  ? 539 ASN O C     1 
ATOM 6732 O O     . ASN E 3 162 ? 22.244  59.052 1.941   1.00 66.72  ? 539 ASN O O     1 
ATOM 6733 C CB    . ASN E 3 162 ? 23.087  59.811 4.395   1.00 71.11  ? 539 ASN O CB    1 
ATOM 6734 C CG    . ASN E 3 162 ? 22.722  61.194 3.895   1.00 75.09  ? 539 ASN O CG    1 
ATOM 6735 O OD1   . ASN E 3 162 ? 21.540  61.566 3.866   1.00 76.03  ? 539 ASN O OD1   1 
ATOM 6736 N ND2   . ASN E 3 162 ? 23.733  61.971 3.510   1.00 76.58  ? 539 ASN O ND2   1 
ATOM 6737 N N     . THR E 3 163 ? 20.260  58.283 2.619   1.00 64.48  ? 540 THR O N     1 
ATOM 6738 C CA    . THR E 3 163 ? 19.807  58.065 1.253   1.00 59.88  ? 540 THR O CA    1 
ATOM 6739 C C     . THR E 3 163 ? 18.478  58.727 0.874   1.00 62.94  ? 540 THR O C     1 
ATOM 6740 O O     . THR E 3 163 ? 17.650  58.150 0.160   1.00 60.14  ? 540 THR O O     1 
ATOM 6741 C CB    . THR E 3 163 ? 19.730  56.548 0.983   1.00 53.83  ? 540 THR O CB    1 
ATOM 6742 O OG1   . THR E 3 163 ? 18.694  55.972 1.791   1.00 50.45  ? 540 THR O OG1   1 
ATOM 6743 C CG2   . THR E 3 163 ? 21.067  55.872 1.330   1.00 46.64  ? 540 THR O CG2   1 
ATOM 6744 N N     . ARG E 3 164 ? 18.287  59.947 1.359   1.00 64.85  ? 541 ARG O N     1 
ATOM 6745 C CA    . ARG E 3 164 ? 17.088  60.727 1.066   1.00 69.49  ? 541 ARG O CA    1 
ATOM 6746 C C     . ARG E 3 164 ? 17.558  61.997 0.370   1.00 69.74  ? 541 ARG O C     1 
ATOM 6747 O O     . ARG E 3 164 ? 18.602  62.555 0.719   1.00 73.07  ? 541 ARG O O     1 
ATOM 6748 C CB    . ARG E 3 164 ? 16.363  61.123 2.355   1.00 76.47  ? 541 ARG O CB    1 
ATOM 6749 C CG    . ARG E 3 164 ? 15.582  60.030 3.072   1.00 78.40  ? 541 ARG O CG    1 
ATOM 6750 C CD    . ARG E 3 164 ? 15.392  60.410 4.549   1.00 81.00  ? 541 ARG O CD    1 
ATOM 6751 N NE    . ARG E 3 164 ? 15.094  61.833 4.756   1.00 81.88  ? 541 ARG O NE    1 
ATOM 6752 C CZ    . ARG E 3 164 ? 13.952  62.432 4.420   1.00 82.93  ? 541 ARG O CZ    1 
ATOM 6753 N NH1   . ARG E 3 164 ? 12.966  61.746 3.852   1.00 83.26  ? 541 ARG O NH1   1 
ATOM 6754 N NH2   . ARG E 3 164 ? 13.793  63.727 4.653   1.00 83.28  ? 541 ARG O NH2   1 
ATOM 6755 N N     . VAL E 3 165 ? 16.805  62.457 -0.618  1.00 69.42  ? 542 VAL O N     1 
ATOM 6756 C CA    . VAL E 3 165 ? 17.200  63.678 -1.297  1.00 64.70  ? 542 VAL O CA    1 
ATOM 6757 C C     . VAL E 3 165 ? 15.983  64.455 -1.734  1.00 66.16  ? 542 VAL O C     1 
ATOM 6758 O O     . VAL E 3 165 ? 14.847  63.987 -1.572  1.00 57.19  ? 542 VAL O O     1 
ATOM 6759 C CB    . VAL E 3 165 ? 18.073  63.405 -2.546  1.00 62.15  ? 542 VAL O CB    1 
ATOM 6760 C CG1   . VAL E 3 165 ? 19.336  62.677 -2.147  1.00 64.35  ? 542 VAL O CG1   1 
ATOM 6761 C CG2   . VAL E 3 165 ? 17.283  62.613 -3.579  1.00 63.54  ? 542 VAL O CG2   1 
ATOM 6762 N N     . ARG E 3 166 ? 16.239  65.647 -2.274  1.00 71.19  ? 543 ARG O N     1 
ATOM 6763 C CA    . ARG E 3 166 ? 15.200  66.536 -2.783  1.00 81.61  ? 543 ARG O CA    1 
ATOM 6764 C C     . ARG E 3 166 ? 15.665  67.241 -4.060  1.00 83.55  ? 543 ARG O C     1 
ATOM 6765 O O     . ARG E 3 166 ? 16.847  67.583 -4.218  1.00 84.24  ? 543 ARG O O     1 
ATOM 6766 C CB    . ARG E 3 166 ? 14.814  67.595 -1.741  1.00 88.78  ? 543 ARG O CB    1 
ATOM 6767 C CG    . ARG E 3 166 ? 13.822  67.133 -0.685  1.00 101.41 ? 543 ARG O CG    1 
ATOM 6768 C CD    . ARG E 3 166 ? 13.587  68.239 0.329   1.00 110.53 ? 543 ARG O CD    1 
ATOM 6769 N NE    . ARG E 3 166 ? 14.830  68.603 1.005   1.00 117.41 ? 543 ARG O NE    1 
ATOM 6770 C CZ    . ARG E 3 166 ? 14.976  69.657 1.804   1.00 119.88 ? 543 ARG O CZ    1 
ATOM 6771 N NH1   . ARG E 3 166 ? 13.950  70.467 2.032   1.00 121.54 ? 543 ARG O NH1   1 
ATOM 6772 N NH2   . ARG E 3 166 ? 16.148  69.897 2.384   1.00 120.36 ? 543 ARG O NH2   1 
ATOM 6773 N N     . LEU E 3 167 ? 14.716  67.439 -4.971  1.00 83.82  ? 544 LEU O N     1 
ATOM 6774 C CA    . LEU E 3 167 ? 14.976  68.112 -6.234  1.00 86.40  ? 544 LEU O CA    1 
ATOM 6775 C C     . LEU E 3 167 ? 15.096  69.592 -5.921  1.00 90.43  ? 544 LEU O C     1 
ATOM 6776 O O     . LEU E 3 167 ? 14.202  70.173 -5.311  1.00 94.58  ? 544 LEU O O     1 
ATOM 6777 C CB    . LEU E 3 167 ? 13.817  67.876 -7.205  1.00 82.99  ? 544 LEU O CB    1 
ATOM 6778 C CG    . LEU E 3 167 ? 13.699  66.480 -7.816  1.00 75.68  ? 544 LEU O CG    1 
ATOM 6779 C CD1   . LEU E 3 167 ? 12.325  66.289 -8.431  1.00 71.17  ? 544 LEU O CD1   1 
ATOM 6780 C CD2   . LEU E 3 167 ? 14.794  66.302 -8.855  1.00 70.21  ? 544 LEU O CD2   1 
ATOM 6781 N N     . VAL E 3 168 ? 16.199  70.203 -6.332  1.00 95.72  ? 545 VAL O N     1 
ATOM 6782 C CA    . VAL E 3 168 ? 16.398  71.614 -6.057  1.00 93.48  ? 545 VAL O CA    1 
ATOM 6783 C C     . VAL E 3 168 ? 16.383  72.483 -7.310  1.00 96.41  ? 545 VAL O C     1 
ATOM 6784 O O     . VAL E 3 168 ? 17.065  72.205 -8.295  1.00 93.04  ? 545 VAL O O     1 
ATOM 6785 C CB    . VAL E 3 168 ? 17.723  71.834 -5.309  1.00 88.19  ? 545 VAL O CB    1 
ATOM 6786 C CG1   . VAL E 3 168 ? 17.738  73.209 -4.679  1.00 86.08  ? 545 VAL O CG1   1 
ATOM 6787 C CG2   . VAL E 3 168 ? 17.899  70.760 -4.251  1.00 86.45  ? 545 VAL O CG2   1 
ATOM 6788 N N     . PHE E 3 169 ? 15.597  73.546 -7.261  1.00 96.86  ? 546 PHE O N     1 
ATOM 6789 C CA    . PHE E 3 169 ? 15.501  74.466 -8.379  1.00 105.16 ? 546 PHE O CA    1 
ATOM 6790 C C     . PHE E 3 169 ? 15.887  75.865 -7.909  1.00 112.89 ? 546 PHE O C     1 
ATOM 6791 O O     . PHE E 3 169 ? 15.807  76.180 -6.721  1.00 118.99 ? 546 PHE O O     1 
ATOM 6792 C CB    . PHE E 3 169 ? 14.074  74.484 -8.915  1.00 103.15 ? 546 PHE O CB    1 
ATOM 6793 C CG    . PHE E 3 169 ? 13.549  73.131 -9.271  1.00 94.54  ? 546 PHE O CG    1 
ATOM 6794 C CD1   . PHE E 3 169 ? 13.832  72.565 -10.506 1.00 90.33  ? 546 PHE O CD1   1 
ATOM 6795 C CD2   . PHE E 3 169 ? 12.761  72.423 -8.370  1.00 90.28  ? 546 PHE O CD2   1 
ATOM 6796 C CE1   . PHE E 3 169 ? 13.336  71.311 -10.846 1.00 87.07  ? 546 PHE O CE1   1 
ATOM 6797 C CE2   . PHE E 3 169 ? 12.257  71.168 -8.694  1.00 87.48  ? 546 PHE O CE2   1 
ATOM 6798 C CZ    . PHE E 3 169 ? 12.544  70.609 -9.937  1.00 87.02  ? 546 PHE O CZ    1 
ATOM 6799 N N     . ARG E 3 170 ? 16.318  76.693 -8.849  1.00 123.84 ? 547 ARG O N     1 
ATOM 6800 C CA    . ARG E 3 170 ? 16.699  78.062 -8.557  1.00 125.52 ? 547 ARG O CA    1 
ATOM 6801 C C     . ARG E 3 170 ? 17.000  78.727 -9.889  1.00 129.47 ? 547 ARG O C     1 
ATOM 6802 O O     . ARG E 3 170 ? 17.877  78.289 -10.638 1.00 128.28 ? 547 ARG O O     1 
ATOM 6803 C CB    . ARG E 3 170 ? 17.923  78.124 -7.631  1.00 113.02 ? 547 ARG O CB    1 
ATOM 6804 C CG    . ARG E 3 170 ? 19.195  77.553 -8.220  1.00 106.69 ? 547 ARG O CG    1 
ATOM 6805 C CD    . ARG E 3 170 ? 20.439  78.064 -7.497  1.00 102.07 ? 547 ARG O CD    1 
ATOM 6806 N NE    . ARG E 3 170 ? 20.472  77.687 -6.087  1.00 98.10  ? 547 ARG O NE    1 
ATOM 6807 C CZ    . ARG E 3 170 ? 21.510  77.892 -5.281  1.00 95.90  ? 547 ARG O CZ    1 
ATOM 6808 N NH1   . ARG E 3 170 ? 22.611  78.474 -5.749  1.00 93.99  ? 547 ARG O NH1   1 
ATOM 6809 N NH2   . ARG E 3 170 ? 21.450  77.512 -4.009  1.00 93.06  ? 547 ARG O NH2   1 
ATOM 6810 N N     . VAL E 3 171 ? 16.244  79.781 -10.181 1.00 128.87 ? 548 VAL O N     1 
ATOM 6811 C CA    . VAL E 3 171 ? 16.386  80.519 -11.426 1.00 139.89 ? 548 VAL O CA    1 
ATOM 6812 C C     . VAL E 3 171 ? 16.861  81.955 -11.221 1.00 144.20 ? 548 VAL O C     1 
ATOM 6813 O O     . VAL E 3 171 ? 16.280  82.708 -10.438 1.00 163.20 ? 548 VAL O O     1 
ATOM 6814 C CB    . VAL E 3 171 ? 15.041  80.542 -12.201 1.00 142.49 ? 548 VAL O CB    1 
ATOM 6815 C CG1   . VAL E 3 171 ? 13.938  81.130 -11.325 1.00 129.85 ? 548 VAL O CG1   1 
ATOM 6816 C CG2   . VAL E 3 171 ? 15.192  81.346 -13.481 1.00 130.39 ? 548 VAL O CG2   1 
ATOM 6817 N N     . HIS E 3 172 ? 17.926  82.323 -11.927 1.00 146.90 ? 549 HIS O N     1 
ATOM 6818 C CA    . HIS E 3 172 ? 18.469  83.673 -11.846 1.00 133.08 ? 549 HIS O CA    1 
ATOM 6819 C C     . HIS E 3 172 ? 17.614  84.612 -12.690 1.00 125.72 ? 549 HIS O C     1 
ATOM 6820 O O     . HIS E 3 172 ? 17.286  84.302 -13.836 1.00 117.87 ? 549 HIS O O     1 
ATOM 6821 C CB    . HIS E 3 172 ? 19.908  83.724 -12.369 1.00 126.09 ? 549 HIS O CB    1 
ATOM 6822 C CG    . HIS E 3 172 ? 20.911  83.066 -11.473 1.00 122.39 ? 549 HIS O CG    1 
ATOM 6823 N ND1   . HIS E 3 172 ? 20.851  83.152 -10.099 1.00 121.34 ? 549 HIS O ND1   1 
ATOM 6824 C CD2   . HIS E 3 172 ? 22.033  82.364 -11.759 1.00 121.50 ? 549 HIS O CD2   1 
ATOM 6825 C CE1   . HIS E 3 172 ? 21.894  82.531 -9.577  1.00 121.80 ? 549 HIS O CE1   1 
ATOM 6826 N NE2   . HIS E 3 172 ? 22.627  82.044 -10.563 1.00 121.37 ? 549 HIS O NE2   1 
ATOM 6827 N N     . ILE E 3 173 ? 17.260  85.761 -12.121 1.00 117.56 ? 550 ILE O N     1 
ATOM 6828 C CA    . ILE E 3 173 ? 16.450  86.749 -12.825 1.00 117.80 ? 550 ILE O CA    1 
ATOM 6829 C C     . ILE E 3 173 ? 17.140  88.118 -12.792 1.00 131.57 ? 550 ILE O C     1 
ATOM 6830 O O     . ILE E 3 173 ? 17.546  88.595 -11.730 1.00 135.74 ? 550 ILE O O     1 
ATOM 6831 C CB    . ILE E 3 173 ? 15.037  86.865 -12.194 1.00 103.10 ? 550 ILE O CB    1 
ATOM 6832 C CG1   . ILE E 3 173 ? 14.385  85.475 -12.125 1.00 89.08  ? 550 ILE O CG1   1 
ATOM 6833 C CG2   . ILE E 3 173 ? 14.174  87.824 -13.017 1.00 90.84  ? 550 ILE O CG2   1 
ATOM 6834 C CD1   . ILE E 3 173 ? 13.033  85.432 -11.425 1.00 75.73  ? 550 ILE O CD1   1 
ATOM 6835 N N     . PRO E 3 174 ? 17.308  88.752 -13.965 1.00 145.26 ? 551 PRO O N     1 
ATOM 6836 C CA    . PRO E 3 174 ? 17.954  90.065 -14.038 1.00 153.18 ? 551 PRO O CA    1 
ATOM 6837 C C     . PRO E 3 174 ? 16.960  91.230 -14.073 1.00 154.60 ? 551 PRO O C     1 
ATOM 6838 O O     . PRO E 3 174 ? 16.234  91.407 -15.053 1.00 159.83 ? 551 PRO O O     1 
ATOM 6839 C CB    . PRO E 3 174 ? 18.760  89.963 -15.324 1.00 157.51 ? 551 PRO O CB    1 
ATOM 6840 C CG    . PRO E 3 174 ? 17.819  89.213 -16.210 1.00 157.25 ? 551 PRO O CG    1 
ATOM 6841 C CD    . PRO E 3 174 ? 17.266  88.121 -15.300 1.00 153.32 ? 551 PRO O CD    1 
ATOM 6842 N N     . GLU E 3 175 ? 16.921  92.016 -12.999 1.00 152.85 ? 552 GLU O N     1 
ATOM 6843 C CA    . GLU E 3 175 ? 16.028  93.168 -12.942 1.00 145.64 ? 552 GLU O CA    1 
ATOM 6844 C C     . GLU E 3 175 ? 16.711  94.334 -13.645 1.00 141.47 ? 552 GLU O C     1 
ATOM 6845 O O     . GLU E 3 175 ? 17.933  94.469 -13.587 1.00 140.95 ? 552 GLU O O     1 
ATOM 6846 C CB    . GLU E 3 175 ? 15.713  93.550 -11.492 1.00 143.80 ? 552 GLU O CB    1 
ATOM 6847 C CG    . GLU E 3 175 ? 14.745  92.613 -10.784 1.00 140.47 ? 552 GLU O CG    1 
ATOM 6848 C CD    . GLU E 3 175 ? 14.197  93.207 -9.496  1.00 139.04 ? 552 GLU O CD    1 
ATOM 6849 O OE1   . GLU E 3 175 ? 13.385  92.538 -8.821  1.00 137.93 ? 552 GLU O OE1   1 
ATOM 6850 O OE2   . GLU E 3 175 ? 14.576  94.349 -9.158  1.00 138.43 ? 552 GLU O OE2   1 
ATOM 6851 N N     . SER E 3 176 ? 15.920  95.172 -14.306 1.00 135.85 ? 553 SER O N     1 
ATOM 6852 C CA    . SER E 3 176 ? 16.447  96.323 -15.033 1.00 130.34 ? 553 SER O CA    1 
ATOM 6853 C C     . SER E 3 176 ? 17.113  97.363 -14.134 1.00 130.16 ? 553 SER O C     1 
ATOM 6854 O O     . SER E 3 176 ? 17.526  98.420 -14.608 1.00 127.97 ? 553 SER O O     1 
ATOM 6855 C CB    . SER E 3 176 ? 15.324  96.986 -15.835 1.00 126.45 ? 553 SER O CB    1 
ATOM 6856 O OG    . SER E 3 176 ? 14.229  97.313 -14.996 1.00 121.26 ? 553 SER O OG    1 
ATOM 6857 N N     . SER E 3 177 ? 17.221  97.062 -12.841 1.00 132.37 ? 554 SER O N     1 
ATOM 6858 C CA    . SER E 3 177 ? 17.832  97.983 -11.883 1.00 137.51 ? 554 SER O CA    1 
ATOM 6859 C C     . SER E 3 177 ? 19.232  97.564 -11.436 1.00 149.03 ? 554 SER O C     1 
ATOM 6860 O O     . SER E 3 177 ? 19.799  98.157 -10.518 1.00 152.44 ? 554 SER O O     1 
ATOM 6861 C CB    . SER E 3 177 ? 16.929  98.146 -10.652 1.00 127.22 ? 554 SER O CB    1 
ATOM 6862 O OG    . SER E 3 177 ? 16.674  96.903 -10.019 1.00 109.25 ? 554 SER O OG    1 
ATOM 6863 N N     . GLY E 3 178 ? 19.782  96.541 -12.082 1.00 158.86 ? 555 GLY O N     1 
ATOM 6864 C CA    . GLY E 3 178 ? 21.116  96.082 -11.740 1.00 169.17 ? 555 GLY O CA    1 
ATOM 6865 C C     . GLY E 3 178 ? 21.168  94.850 -10.858 1.00 171.89 ? 555 GLY O C     1 
ATOM 6866 O O     . GLY E 3 178 ? 22.031  93.991 -11.039 1.00 179.16 ? 555 GLY O O     1 
ATOM 6867 N N     . ARG E 3 179 ? 20.250  94.756 -9.902  1.00 171.21 ? 556 ARG O N     1 
ATOM 6868 C CA    . ARG E 3 179 ? 20.232  93.616 -8.999  1.00 161.38 ? 556 ARG O CA    1 
ATOM 6869 C C     . ARG E 3 179 ? 19.763  92.320 -9.653  1.00 155.74 ? 556 ARG O C     1 
ATOM 6870 O O     . ARG E 3 179 ? 18.948  92.331 -10.577 1.00 153.66 ? 556 ARG O O     1 
ATOM 6871 C CB    . ARG E 3 179 ? 19.363  93.905 -7.769  1.00 156.46 ? 556 ARG O CB    1 
ATOM 6872 C CG    . ARG E 3 179 ? 19.252  92.693 -6.844  1.00 154.12 ? 556 ARG O CG    1 
ATOM 6873 C CD    . ARG E 3 179 ? 18.706  93.013 -5.463  1.00 153.38 ? 556 ARG O CD    1 
ATOM 6874 N NE    . ARG E 3 179 ? 18.624  91.807 -4.635  1.00 154.07 ? 556 ARG O NE    1 
ATOM 6875 C CZ    . ARG E 3 179 ? 19.668  91.064 -4.271  1.00 154.11 ? 556 ARG O CZ    1 
ATOM 6876 N NH1   . ARG E 3 179 ? 20.894  91.395 -4.655  1.00 154.22 ? 556 ARG O NH1   1 
ATOM 6877 N NH2   . ARG E 3 179 ? 19.487  89.982 -3.524  1.00 154.44 ? 556 ARG O NH2   1 
ATOM 6878 N N     . ILE E 3 180 ? 20.295  91.206 -9.152  1.00 147.45 ? 557 ILE O N     1 
ATOM 6879 C CA    . ILE E 3 180 ? 19.962  89.872 -9.638  1.00 143.53 ? 557 ILE O CA    1 
ATOM 6880 C C     . ILE E 3 180 ? 19.210  89.075 -8.575  1.00 147.68 ? 557 ILE O C     1 
ATOM 6881 O O     . ILE E 3 180 ? 19.812  88.547 -7.637  1.00 160.55 ? 557 ILE O O     1 
ATOM 6882 C CB    . ILE E 3 180 ? 21.228  89.068 -10.013 1.00 129.82 ? 557 ILE O CB    1 
ATOM 6883 C CG1   . ILE E 3 180 ? 21.927  89.713 -11.212 1.00 113.94 ? 557 ILE O CG1   1 
ATOM 6884 C CG2   . ILE E 3 180 ? 20.851  87.628 -10.326 1.00 117.18 ? 557 ILE O CG2   1 
ATOM 6885 C CD1   . ILE E 3 180 ? 23.211  89.004 -11.635 1.00 97.09  ? 557 ILE O CD1   1 
ATOM 6886 N N     . VAL E 3 181 ? 17.895  88.990 -8.732  1.00 144.86 ? 558 VAL O N     1 
ATOM 6887 C CA    . VAL E 3 181 ? 17.056  88.242 -7.805  1.00 139.63 ? 558 VAL O CA    1 
ATOM 6888 C C     . VAL E 3 181 ? 17.500  86.779 -7.854  1.00 138.96 ? 558 VAL O C     1 
ATOM 6889 O O     . VAL E 3 181 ? 18.396  86.429 -8.622  1.00 149.40 ? 558 VAL O O     1 
ATOM 6890 C CB    . VAL E 3 181 ? 15.573  88.334 -8.223  1.00 135.80 ? 558 VAL O CB    1 
ATOM 6891 C CG1   . VAL E 3 181 ? 14.673  87.777 -7.127  1.00 118.62 ? 558 VAL O CG1   1 
ATOM 6892 C CG2   . VAL E 3 181 ? 15.219  89.776 -8.535  1.00 119.07 ? 558 VAL O CG2   1 
ATOM 6893 N N     . SER E 3 182 ? 16.877  85.930 -7.040  1.00 135.35 ? 559 SER O N     1 
ATOM 6894 C CA    . SER E 3 182 ? 17.219  84.511 -7.012  1.00 123.25 ? 559 SER O CA    1 
ATOM 6895 C C     . SER E 3 182 ? 16.223  83.674 -6.218  1.00 124.60 ? 559 SER O C     1 
ATOM 6896 O O     . SER E 3 182 ? 16.214  83.701 -4.989  1.00 124.81 ? 559 SER O O     1 
ATOM 6897 C CB    . SER E 3 182 ? 18.622  84.313 -6.429  1.00 106.79 ? 559 SER O CB    1 
ATOM 6898 O OG    . SER E 3 182 ? 19.613  84.879 -7.269  1.00 81.15  ? 559 SER O OG    1 
ATOM 6899 N N     . LEU E 3 183 ? 15.385  82.928 -6.927  1.00 121.86 ? 560 LEU O N     1 
ATOM 6900 C CA    . LEU E 3 183 ? 14.410  82.074 -6.268  1.00 125.90 ? 560 LEU O CA    1 
ATOM 6901 C C     . LEU E 3 183 ? 14.961  80.650 -6.217  1.00 132.45 ? 560 LEU O C     1 
ATOM 6902 O O     . LEU E 3 183 ? 15.847  80.291 -6.991  1.00 145.87 ? 560 LEU O O     1 
ATOM 6903 C CB    . LEU E 3 183 ? 13.072  82.101 -7.020  1.00 114.92 ? 560 LEU O CB    1 
ATOM 6904 C CG    . LEU E 3 183 ? 12.437  83.473 -7.284  1.00 96.60  ? 560 LEU O CG    1 
ATOM 6905 C CD1   . LEU E 3 183 ? 10.939  83.307 -7.574  1.00 81.76  ? 560 LEU O CD1   1 
ATOM 6906 C CD2   . LEU E 3 183 ? 12.643  84.376 -6.076  1.00 82.54  ? 560 LEU O CD2   1 
ATOM 6907 N N     . GLN E 3 184 ? 14.442  79.852 -5.291  1.00 133.56 ? 561 GLN O N     1 
ATOM 6908 C CA    . GLN E 3 184 ? 14.867  78.465 -5.122  1.00 124.00 ? 561 GLN O CA    1 
ATOM 6909 C C     . GLN E 3 184 ? 13.739  77.738 -4.408  1.00 127.36 ? 561 GLN O C     1 
ATOM 6910 O O     . GLN E 3 184 ? 13.246  78.212 -3.386  1.00 120.48 ? 561 GLN O O     1 
ATOM 6911 C CB    . GLN E 3 184 ? 16.157  78.408 -4.300  1.00 111.79 ? 561 GLN O CB    1 
ATOM 6912 C CG    . GLN E 3 184 ? 16.643  77.010 -3.987  1.00 96.57  ? 561 GLN O CG    1 
ATOM 6913 C CD    . GLN E 3 184 ? 18.086  77.000 -3.515  1.00 89.96  ? 561 GLN O CD    1 
ATOM 6914 O OE1   . GLN E 3 184 ? 18.988  77.373 -4.258  1.00 85.28  ? 561 GLN O OE1   1 
ATOM 6915 N NE2   . GLN E 3 184 ? 18.308  76.579 -2.276  1.00 85.49  ? 561 GLN O NE2   1 
ATOM 6916 N N     . THR E 3 185 ? 13.327  76.591 -4.940  1.00 130.68 ? 562 THR O N     1 
ATOM 6917 C CA    . THR E 3 185 ? 12.219  75.849 -4.345  1.00 131.99 ? 562 THR O CA    1 
ATOM 6918 C C     . THR E 3 185 ? 12.342  74.329 -4.445  1.00 121.27 ? 562 THR O C     1 
ATOM 6919 O O     . THR E 3 185 ? 11.759  73.718 -5.343  1.00 115.47 ? 562 THR O O     1 
ATOM 6920 C CB    . THR E 3 185 ? 10.880  76.256 -5.005  1.00 138.68 ? 562 THR O CB    1 
ATOM 6921 O OG1   . THR E 3 185 ? 10.778  77.685 -5.042  1.00 162.95 ? 562 THR O OG1   1 
ATOM 6922 C CG2   . THR E 3 185 ? 9.700   75.687 -4.224  1.00 162.99 ? 562 THR O CG2   1 
ATOM 6923 N N     . ALA E 3 186 ? 13.077  73.720 -3.517  1.00 107.42 ? 563 ALA O N     1 
ATOM 6924 C CA    . ALA E 3 186 ? 13.250  72.269 -3.521  1.00 97.36  ? 563 ALA O CA    1 
ATOM 6925 C C     . ALA E 3 186 ? 11.909  71.539 -3.375  1.00 95.65  ? 563 ALA O C     1 
ATOM 6926 O O     . ALA E 3 186 ? 10.909  72.118 -2.946  1.00 95.59  ? 563 ALA O O     1 
ATOM 6927 C CB    . ALA E 3 186 ? 14.216  71.841 -2.411  1.00 87.19  ? 563 ALA O CB    1 
ATOM 6928 N N     . SER E 3 187 ? 11.901  70.261 -3.739  1.00 96.45  ? 564 SER O N     1 
ATOM 6929 C CA    . SER E 3 187 ? 10.692  69.453 -3.683  1.00 99.81  ? 564 SER O CA    1 
ATOM 6930 C C     . SER E 3 187 ? 10.614  68.655 -2.403  1.00 99.84  ? 564 SER O C     1 
ATOM 6931 O O     . SER E 3 187 ? 11.508  68.721 -1.559  1.00 101.93 ? 564 SER O O     1 
ATOM 6932 C CB    . SER E 3 187 ? 10.666  68.479 -4.856  1.00 105.47 ? 564 SER O CB    1 
ATOM 6933 O OG    . SER E 3 187 ? 11.760  67.580 -4.772  1.00 106.08 ? 564 SER O OG    1 
ATOM 6934 N N     . ASN E 3 188 ? 9.534   67.891 -2.277  1.00 101.58 ? 565 ASN O N     1 
ATOM 6935 C CA    . ASN E 3 188 ? 9.333   67.040 -1.118  1.00 96.61  ? 565 ASN O CA    1 
ATOM 6936 C C     . ASN E 3 188 ? 10.529  66.109 -1.057  1.00 93.56  ? 565 ASN O C     1 
ATOM 6937 O O     . ASN E 3 188 ? 11.381  66.116 -1.953  1.00 90.76  ? 565 ASN O O     1 
ATOM 6938 C CB    . ASN E 3 188 ? 8.068   66.201 -1.274  1.00 94.83  ? 565 ASN O CB    1 
ATOM 6939 C CG    . ASN E 3 188 ? 6.862   67.032 -1.611  1.00 97.63  ? 565 ASN O CG    1 
ATOM 6940 O OD1   . ASN E 3 188 ? 6.585   68.035 -0.954  1.00 100.98 ? 565 ASN O OD1   1 
ATOM 6941 N ND2   . ASN E 3 188 ? 6.125   66.618 -2.635  1.00 100.28 ? 565 ASN O ND2   1 
ATOM 6942 N N     . PRO E 3 189 ? 10.617  65.300 0.007   1.00 95.25  ? 566 PRO O N     1 
ATOM 6943 C CA    . PRO E 3 189 ? 11.737  64.367 0.142   1.00 95.44  ? 566 PRO O CA    1 
ATOM 6944 C C     . PRO E 3 189 ? 11.538  63.176 -0.794  1.00 94.82  ? 566 PRO O C     1 
ATOM 6945 O O     . PRO E 3 189 ? 10.403  62.765 -1.048  1.00 103.71 ? 566 PRO O O     1 
ATOM 6946 C CB    . PRO E 3 189 ? 11.668  63.957 1.612   1.00 101.19 ? 566 PRO O CB    1 
ATOM 6947 C CG    . PRO E 3 189 ? 10.963  65.114 2.268   1.00 99.83  ? 566 PRO O CG    1 
ATOM 6948 C CD    . PRO E 3 189 ? 9.885   65.415 1.277   1.00 98.29  ? 566 PRO O CD    1 
ATOM 6949 N N     . ILE E 3 190 ? 12.636  62.634 -1.313  1.00 94.83  ? 567 ILE O N     1 
ATOM 6950 C CA    . ILE E 3 190 ? 12.565  61.481 -2.204  1.00 84.27  ? 567 ILE O CA    1 
ATOM 6951 C C     . ILE E 3 190 ? 13.568  60.438 -1.759  1.00 79.01  ? 567 ILE O C     1 
ATOM 6952 O O     . ILE E 3 190 ? 14.754  60.746 -1.594  1.00 73.23  ? 567 ILE O O     1 
ATOM 6953 C CB    . ILE E 3 190 ? 12.859  61.869 -3.669  1.00 82.35  ? 567 ILE O CB    1 
ATOM 6954 C CG1   . ILE E 3 190 ? 11.775  62.827 -4.175  1.00 82.65  ? 567 ILE O CG1   1 
ATOM 6955 C CG2   . ILE E 3 190 ? 12.895  60.621 -4.538  1.00 80.64  ? 567 ILE O CG2   1 
ATOM 6956 C CD1   . ILE E 3 190 ? 11.922  63.238 -5.625  1.00 83.86  ? 567 ILE O CD1   1 
ATOM 6957 N N     . GLU E 3 191 ? 13.079  59.213 -1.554  1.00 72.42  ? 568 GLU O N     1 
ATOM 6958 C CA    . GLU E 3 191 ? 13.913  58.093 -1.116  1.00 70.95  ? 568 GLU O CA    1 
ATOM 6959 C C     . GLU E 3 191 ? 14.552  57.400 -2.319  1.00 70.21  ? 568 GLU O C     1 
ATOM 6960 O O     . GLU E 3 191 ? 13.867  57.034 -3.273  1.00 72.09  ? 568 GLU O O     1 
ATOM 6961 C CB    . GLU E 3 191 ? 13.078  57.095 -0.313  1.00 70.75  ? 568 GLU O CB    1 
ATOM 6962 C CG    . GLU E 3 191 ? 13.916  56.028 0.370   1.00 72.07  ? 568 GLU O CG    1 
ATOM 6963 C CD    . GLU E 3 191 ? 14.989  56.604 1.300   1.00 73.17  ? 568 GLU O CD    1 
ATOM 6964 O OE1   . GLU E 3 191 ? 14.632  57.280 2.294   1.00 74.14  ? 568 GLU O OE1   1 
ATOM 6965 O OE2   . GLU E 3 191 ? 16.193  56.378 1.041   1.00 71.79  ? 568 GLU O OE2   1 
ATOM 6966 N N     . CYS E 3 192 ? 15.864  57.201 -2.264  1.00 68.60  ? 569 CYS O N     1 
ATOM 6967 C CA    . CYS E 3 192 ? 16.566  56.603 -3.388  1.00 64.63  ? 569 CYS O CA    1 
ATOM 6968 C C     . CYS E 3 192 ? 17.261  55.266 -3.155  1.00 61.73  ? 569 CYS O C     1 
ATOM 6969 O O     . CYS E 3 192 ? 18.443  55.101 -3.475  1.00 59.06  ? 569 CYS O O     1 
ATOM 6970 C CB    . CYS E 3 192 ? 17.581  57.613 -3.922  1.00 65.06  ? 569 CYS O CB    1 
ATOM 6971 S SG    . CYS E 3 192 ? 16.856  59.204 -4.375  1.00 65.78  ? 569 CYS O SG    1 
ATOM 6972 N N     . SER E 3 193 ? 16.536  54.306 -2.606  1.00 58.19  ? 570 SER O N     1 
ATOM 6973 C CA    . SER E 3 193 ? 17.115  52.990 -2.378  1.00 58.19  ? 570 SER O CA    1 
ATOM 6974 C C     . SER E 3 193 ? 15.979  52.001 -2.354  1.00 56.79  ? 570 SER O C     1 
ATOM 6975 O O     . SER E 3 193 ? 15.081  52.111 -1.523  1.00 58.51  ? 570 SER O O     1 
ATOM 6976 C CB    . SER E 3 193 ? 17.876  52.949 -1.050  1.00 58.61  ? 570 SER O CB    1 
ATOM 6977 O OG    . SER E 3 193 ? 17.028  53.268 0.028   1.00 58.49  ? 570 SER O OG    1 
ATOM 6978 N N     . GLN E 3 194 ? 15.994  51.043 -3.271  1.00 54.76  ? 571 GLN O N     1 
ATOM 6979 C CA    . GLN E 3 194 ? 14.910  50.077 -3.293  1.00 53.09  ? 571 GLN O CA    1 
ATOM 6980 C C     . GLN E 3 194 ? 14.794  49.509 -1.889  1.00 56.85  ? 571 GLN O C     1 
ATOM 6981 O O     . GLN E 3 194 ? 13.706  49.138 -1.430  1.00 56.65  ? 571 GLN O O     1 
ATOM 6982 C CB    . GLN E 3 194 ? 15.171  48.964 -4.323  1.00 45.16  ? 571 GLN O CB    1 
ATOM 6983 C CG    . GLN E 3 194 ? 16.573  48.403 -4.382  1.00 30.41  ? 571 GLN O CG    1 
ATOM 6984 C CD    . GLN E 3 194 ? 16.600  46.975 -4.918  1.00 26.57  ? 571 GLN O CD    1 
ATOM 6985 O OE1   . GLN E 3 194 ? 17.656  46.445 -5.226  1.00 25.71  ? 571 GLN O OE1   1 
ATOM 6986 N NE2   . GLN E 3 194 ? 15.438  46.342 -5.013  1.00 23.21  ? 571 GLN O NE2   1 
ATOM 6987 N N     . ARG E 3 195 ? 15.935  49.486 -1.208  1.00 60.87  ? 572 ARG O N     1 
ATOM 6988 C CA    . ARG E 3 195 ? 16.034  48.982 0.153   1.00 64.35  ? 572 ARG O CA    1 
ATOM 6989 C C     . ARG E 3 195 ? 14.946  49.559 1.047   1.00 60.15  ? 572 ARG O C     1 
ATOM 6990 O O     . ARG E 3 195 ? 13.906  48.934 1.264   1.00 56.74  ? 572 ARG O O     1 
ATOM 6991 C CB    . ARG E 3 195 ? 17.415  49.335 0.714   1.00 74.52  ? 572 ARG O CB    1 
ATOM 6992 C CG    . ARG E 3 195 ? 17.609  49.040 2.185   1.00 89.00  ? 572 ARG O CG    1 
ATOM 6993 C CD    . ARG E 3 195 ? 17.374  47.583 2.516   1.00 99.20  ? 572 ARG O CD    1 
ATOM 6994 N NE    . ARG E 3 195 ? 17.623  47.358 3.933   1.00 107.78 ? 572 ARG O NE    1 
ATOM 6995 C CZ    . ARG E 3 195 ? 17.352  46.230 4.573   1.00 111.30 ? 572 ARG O CZ    1 
ATOM 6996 N NH1   . ARG E 3 195 ? 16.816  45.203 3.923   1.00 113.05 ? 572 ARG O NH1   1 
ATOM 6997 N NH2   . ARG E 3 195 ? 17.611  46.140 5.868   1.00 113.23 ? 572 ARG O NH2   1 
ATOM 6998 N N     . SER E 3 196 ? 15.198  50.763 1.552   1.00 56.60  ? 573 SER O N     1 
ATOM 6999 C CA    . SER E 3 196 ? 14.263  51.441 2.431   1.00 55.07  ? 573 SER O CA    1 
ATOM 7000 C C     . SER E 3 196 ? 12.955  51.702 1.708   1.00 56.82  ? 573 SER O C     1 
ATOM 7001 O O     . SER E 3 196 ? 11.890  51.663 2.317   1.00 55.33  ? 573 SER O O     1 
ATOM 7002 C CB    . SER E 3 196 ? 14.853  52.758 2.918   1.00 52.00  ? 573 SER O CB    1 
ATOM 7003 O OG    . SER E 3 196 ? 14.841  53.705 1.873   1.00 50.60  ? 573 SER O OG    1 
ATOM 7004 N N     . ALA E 3 197 ? 13.030  51.969 0.409   1.00 63.10  ? 574 ALA O N     1 
ATOM 7005 C CA    . ALA E 3 197 ? 11.826  52.213 -0.377  1.00 66.08  ? 574 ALA O CA    1 
ATOM 7006 C C     . ALA E 3 197 ? 10.797  51.126 -0.058  1.00 65.67  ? 574 ALA O C     1 
ATOM 7007 O O     . ALA E 3 197 ? 9.588   51.369 -0.090  1.00 58.61  ? 574 ALA O O     1 
ATOM 7008 C CB    . ALA E 3 197 ? 12.161  52.190 -1.858  1.00 73.61  ? 574 ALA O CB    1 
ATOM 7009 N N     . HIS E 3 198 ? 11.288  49.930 0.266   1.00 65.10  ? 575 HIS O N     1 
ATOM 7010 C CA    . HIS E 3 198 ? 10.414  48.806 0.577   1.00 68.25  ? 575 HIS O CA    1 
ATOM 7011 C C     . HIS E 3 198 ? 10.221  48.565 2.067   1.00 65.86  ? 575 HIS O C     1 
ATOM 7012 O O     . HIS E 3 198 ? 9.194   48.029 2.480   1.00 62.93  ? 575 HIS O O     1 
ATOM 7013 C CB    . HIS E 3 198 ? 10.948  47.528 -0.073  1.00 76.45  ? 575 HIS O CB    1 
ATOM 7014 C CG    . HIS E 3 198 ? 9.980   46.388 -0.030  1.00 89.07  ? 575 HIS O CG    1 
ATOM 7015 N ND1   . HIS E 3 198 ? 8.632   46.551 -0.270  1.00 94.83  ? 575 HIS O ND1   1 
ATOM 7016 C CD2   . HIS E 3 198 ? 10.164  45.067 0.200   1.00 94.75  ? 575 HIS O CD2   1 
ATOM 7017 C CE1   . HIS E 3 198 ? 8.027   45.380 -0.191  1.00 97.86  ? 575 HIS O CE1   1 
ATOM 7018 N NE2   . HIS E 3 198 ? 8.934   44.462 0.093   1.00 98.31  ? 575 HIS O NE2   1 
ATOM 7019 N N     . GLU E 3 199 ? 11.208  48.962 2.865   1.00 66.11  ? 576 GLU O N     1 
ATOM 7020 C CA    . GLU E 3 199 ? 11.164  48.781 4.313   1.00 67.05  ? 576 GLU O CA    1 
ATOM 7021 C C     . GLU E 3 199 ? 10.631  50.015 5.046   1.00 64.14  ? 576 GLU O C     1 
ATOM 7022 O O     . GLU E 3 199 ? 9.449   50.111 5.357   1.00 63.57  ? 576 GLU O O     1 
ATOM 7023 C CB    . GLU E 3 199 ? 12.564  48.461 4.842   1.00 71.98  ? 576 GLU O CB    1 
ATOM 7024 C CG    . GLU E 3 199 ? 13.302  47.344 4.104   1.00 81.67  ? 576 GLU O CG    1 
ATOM 7025 C CD    . GLU E 3 199 ? 12.722  45.956 4.348   1.00 86.40  ? 576 GLU O CD    1 
ATOM 7026 O OE1   . GLU E 3 199 ? 11.572  45.694 3.928   1.00 89.38  ? 576 GLU O OE1   1 
ATOM 7027 O OE2   . GLU E 3 199 ? 13.424  45.122 4.960   1.00 88.23  ? 576 GLU O OE2   1 
ATOM 7028 N N     . LEU E 3 200 ? 11.519  50.960 5.319   1.00 61.34  ? 577 LEU O N     1 
ATOM 7029 C CA    . LEU E 3 200 ? 11.160  52.180 6.034   1.00 59.83  ? 577 LEU O CA    1 
ATOM 7030 C C     . LEU E 3 200 ? 9.802   52.769 5.682   1.00 59.54  ? 577 LEU O C     1 
ATOM 7031 O O     . LEU E 3 200 ? 9.436   52.852 4.511   1.00 57.31  ? 577 LEU O O     1 
ATOM 7032 C CB    . LEU E 3 200 ? 12.234  53.257 5.823   1.00 58.80  ? 577 LEU O CB    1 
ATOM 7033 C CG    . LEU E 3 200 ? 13.659  52.928 6.293   1.00 59.27  ? 577 LEU O CG    1 
ATOM 7034 C CD1   . LEU E 3 200 ? 14.588  54.092 5.947   1.00 60.47  ? 577 LEU O CD1   1 
ATOM 7035 C CD2   . LEU E 3 200 ? 13.675  52.659 7.797   1.00 58.08  ? 577 LEU O CD2   1 
ATOM 7036 N N     . PRO E 3 201 ? 9.024   53.161 6.710   1.00 59.95  ? 578 PRO O N     1 
ATOM 7037 C CA    . PRO E 3 201 ? 7.693   53.762 6.540   1.00 62.54  ? 578 PRO O CA    1 
ATOM 7038 C C     . PRO E 3 201 ? 7.852   55.288 6.384   1.00 67.67  ? 578 PRO O C     1 
ATOM 7039 O O     . PRO E 3 201 ? 8.706   55.895 7.033   1.00 62.68  ? 578 PRO O O     1 
ATOM 7040 C CB    . PRO E 3 201 ? 6.973   53.361 7.828   1.00 59.30  ? 578 PRO O CB    1 
ATOM 7041 C CG    . PRO E 3 201 ? 8.073   53.392 8.847   1.00 58.34  ? 578 PRO O CG    1 
ATOM 7042 C CD    . PRO E 3 201 ? 9.243   52.756 8.117   1.00 58.82  ? 578 PRO O CD    1 
ATOM 7043 N N     . MET E 3 202 ? 7.050   55.906 5.523   1.00 77.88  ? 579 MET O N     1 
ATOM 7044 C CA    . MET E 3 202 ? 7.164   57.345 5.301   1.00 89.56  ? 579 MET O CA    1 
ATOM 7045 C C     . MET E 3 202 ? 5.890   58.116 5.557   1.00 82.55  ? 579 MET O C     1 
ATOM 7046 O O     . MET E 3 202 ? 4.890   57.913 4.874   1.00 76.74  ? 579 MET O O     1 
ATOM 7047 C CB    . MET E 3 202 ? 7.606   57.645 3.863   1.00 113.73 ? 579 MET O CB    1 
ATOM 7048 C CG    . MET E 3 202 ? 9.038   57.273 3.533   1.00 153.12 ? 579 MET O CG    1 
ATOM 7049 S SD    . MET E 3 202 ? 9.530   57.926 1.921   1.00 177.75 ? 579 MET O SD    1 
ATOM 7050 C CE    . MET E 3 202 ? 9.007   56.599 0.825   1.00 192.45 ? 579 MET O CE    1 
ATOM 7051 N N     . VAL E 3 203 ? 5.932   59.017 6.529   1.00 76.39  ? 580 VAL O N     1 
ATOM 7052 C CA    . VAL E 3 203 ? 4.766   59.833 6.830   1.00 76.63  ? 580 VAL O CA    1 
ATOM 7053 C C     . VAL E 3 203 ? 4.715   60.945 5.791   1.00 78.51  ? 580 VAL O C     1 
ATOM 7054 O O     . VAL E 3 203 ? 5.740   61.539 5.458   1.00 76.21  ? 580 VAL O O     1 
ATOM 7055 C CB    . VAL E 3 203 ? 4.858   60.466 8.232   1.00 76.10  ? 580 VAL O CB    1 
ATOM 7056 C CG1   . VAL E 3 203 ? 3.582   61.249 8.527   1.00 77.93  ? 580 VAL O CG1   1 
ATOM 7057 C CG2   . VAL E 3 203 ? 5.079   59.388 9.277   1.00 77.29  ? 580 VAL O CG2   1 
ATOM 7058 N N     . GLU E 3 204 ? 3.527   61.230 5.280   1.00 86.66  ? 581 GLU O N     1 
ATOM 7059 C CA    . GLU E 3 204 ? 3.394   62.264 4.268   1.00 93.61  ? 581 GLU O CA    1 
ATOM 7060 C C     . GLU E 3 204 ? 2.249   63.210 4.570   1.00 90.00  ? 581 GLU O C     1 
ATOM 7061 O O     . GLU E 3 204 ? 2.095   64.230 3.911   1.00 81.62  ? 581 GLU O O     1 
ATOM 7062 C CB    . GLU E 3 204 ? 3.165   61.620 2.899   1.00 108.48 ? 581 GLU O CB    1 
ATOM 7063 C CG    . GLU E 3 204 ? 4.127   60.485 2.574   1.00 140.40 ? 581 GLU O CG    1 
ATOM 7064 C CD    . GLU E 3 204 ? 3.814   59.809 1.249   1.00 157.01 ? 581 GLU O CD    1 
ATOM 7065 O OE1   . GLU E 3 204 ? 4.476   58.800 0.926   1.00 166.33 ? 581 GLU O OE1   1 
ATOM 7066 O OE2   . GLU E 3 204 ? 2.910   60.285 0.529   1.00 166.07 ? 581 GLU O OE2   1 
ATOM 7067 N N     . ARG E 3 205 ? 1.445   62.873 5.569   1.00 92.29  ? 582 ARG O N     1 
ATOM 7068 C CA    . ARG E 3 205 ? 0.303   63.703 5.919   1.00 98.91  ? 582 ARG O CA    1 
ATOM 7069 C C     . ARG E 3 205 ? -0.088  63.514 7.378   1.00 95.47  ? 582 ARG O C     1 
ATOM 7070 O O     . ARG E 3 205 ? -0.142  62.388 7.872   1.00 95.45  ? 582 ARG O O     1 
ATOM 7071 C CB    . ARG E 3 205 ? -0.884  63.340 5.018   1.00 112.46 ? 582 ARG O CB    1 
ATOM 7072 C CG    . ARG E 3 205 ? -2.157  64.138 5.257   1.00 134.21 ? 582 ARG O CG    1 
ATOM 7073 C CD    . ARG E 3 205 ? -2.144  65.450 4.491   1.00 152.38 ? 582 ARG O CD    1 
ATOM 7074 N NE    . ARG E 3 205 ? -3.356  66.234 4.720   1.00 165.82 ? 582 ARG O NE    1 
ATOM 7075 C CZ    . ARG E 3 205 ? -3.658  67.352 4.065   1.00 171.81 ? 582 ARG O CZ    1 
ATOM 7076 N NH1   . ARG E 3 205 ? -2.838  67.819 3.134   1.00 174.77 ? 582 ARG O NH1   1 
ATOM 7077 N NH2   . ARG E 3 205 ? -4.778  68.006 4.343   1.00 175.07 ? 582 ARG O NH2   1 
ATOM 7078 N N     . GLN E 3 206 ? -0.350  64.624 8.062   1.00 90.95  ? 583 GLN O N     1 
ATOM 7079 C CA    . GLN E 3 206 ? -0.778  64.603 9.458   1.00 89.75  ? 583 GLN O CA    1 
ATOM 7080 C C     . GLN E 3 206 ? -1.683  65.801 9.716   1.00 89.30  ? 583 GLN O C     1 
ATOM 7081 O O     . GLN E 3 206 ? -1.234  66.949 9.708   1.00 95.15  ? 583 GLN O O     1 
ATOM 7082 C CB    . GLN E 3 206 ? 0.424   64.634 10.404  1.00 88.50  ? 583 GLN O CB    1 
ATOM 7083 C CG    . GLN E 3 206 ? 1.400   65.760 10.168  1.00 79.31  ? 583 GLN O CG    1 
ATOM 7084 C CD    . GLN E 3 206 ? 2.473   65.817 11.237  1.00 74.43  ? 583 GLN O CD    1 
ATOM 7085 O OE1   . GLN E 3 206 ? 2.191   66.111 12.402  1.00 71.66  ? 583 GLN O OE1   1 
ATOM 7086 N NE2   . GLN E 3 206 ? 3.714   65.530 10.849  1.00 71.56  ? 583 GLN O NE2   1 
ATOM 7087 N N     . ASP E 3 207 ? -2.964  65.520 9.935   1.00 86.89  ? 584 ASP O N     1 
ATOM 7088 C CA    . ASP E 3 207 ? -3.959  66.558 10.176  1.00 80.56  ? 584 ASP O CA    1 
ATOM 7089 C C     . ASP E 3 207 ? -3.726  67.410 11.427  1.00 78.29  ? 584 ASP O C     1 
ATOM 7090 O O     . ASP E 3 207 ? -4.137  68.575 11.471  1.00 76.46  ? 584 ASP O O     1 
ATOM 7091 C CB    . ASP E 3 207 ? -5.353  65.932 10.254  1.00 76.23  ? 584 ASP O CB    1 
ATOM 7092 C CG    . ASP E 3 207 ? -5.460  64.905 11.348  1.00 72.06  ? 584 ASP O CG    1 
ATOM 7093 O OD1   . ASP E 3 207 ? -6.570  64.378 11.585  1.00 70.18  ? 584 ASP O OD1   1 
ATOM 7094 O OD2   . ASP E 3 207 ? -4.422  64.621 11.972  1.00 70.87  ? 584 ASP O OD2   1 
ATOM 7095 N N     . THR E 3 208 ? -3.074  66.841 12.439  1.00 75.60  ? 585 THR O N     1 
ATOM 7096 C CA    . THR E 3 208 ? -2.817  67.571 13.680  1.00 72.94  ? 585 THR O CA    1 
ATOM 7097 C C     . THR E 3 208 ? -1.343  67.948 13.868  1.00 74.10  ? 585 THR O C     1 
ATOM 7098 O O     . THR E 3 208 ? -0.456  67.104 13.750  1.00 70.25  ? 585 THR O O     1 
ATOM 7099 C CB    . THR E 3 208 ? -3.278  66.749 14.906  1.00 71.11  ? 585 THR O CB    1 
ATOM 7100 O OG1   . THR E 3 208 ? -4.590  66.228 14.666  1.00 70.12  ? 585 THR O OG1   1 
ATOM 7101 C CG2   . THR E 3 208 ? -3.322  67.627 16.154  1.00 71.31  ? 585 THR O CG2   1 
ATOM 7102 N N     . ASP E 3 209 ? -1.094  69.224 14.156  1.00 78.30  ? 586 ASP O N     1 
ATOM 7103 C CA    . ASP E 3 209 ? 0.261   69.718 14.372  1.00 82.98  ? 586 ASP O CA    1 
ATOM 7104 C C     . ASP E 3 209 ? 0.484   69.915 15.864  1.00 76.37  ? 586 ASP O C     1 
ATOM 7105 O O     . ASP E 3 209 ? 1.623   69.955 16.332  1.00 73.25  ? 586 ASP O O     1 
ATOM 7106 C CB    . ASP E 3 209 ? 0.472   71.058 13.660  1.00 104.00 ? 586 ASP O CB    1 
ATOM 7107 C CG    . ASP E 3 209 ? 0.122   71.000 12.186  1.00 124.40 ? 586 ASP O CG    1 
ATOM 7108 O OD1   . ASP E 3 209 ? 0.725   70.183 11.458  1.00 138.20 ? 586 ASP O OD1   1 
ATOM 7109 O OD2   . ASP E 3 209 ? -0.756  71.777 11.754  1.00 137.89 ? 586 ASP O OD2   1 
ATOM 7110 N N     . SER E 3 210 ? -0.606  70.034 16.615  1.00 69.40  ? 587 SER O N     1 
ATOM 7111 C CA    . SER E 3 210 ? -0.494  70.240 18.051  1.00 65.84  ? 587 SER O CA    1 
ATOM 7112 C C     . SER E 3 210 ? -1.808  70.037 18.800  1.00 65.53  ? 587 SER O C     1 
ATOM 7113 O O     . SER E 3 210 ? -2.871  69.929 18.189  1.00 64.35  ? 587 SER O O     1 
ATOM 7114 C CB    . SER E 3 210 ? 0.023   71.653 18.322  1.00 62.76  ? 587 SER O CB    1 
ATOM 7115 O OG    . SER E 3 210 ? -0.851  72.617 17.765  1.00 60.01  ? 587 SER O OG    1 
ATOM 7116 N N     . CYS E 3 211 ? -1.707  69.975 20.128  1.00 66.20  ? 588 CYS O N     1 
ATOM 7117 C CA    . CYS E 3 211 ? -2.853  69.815 21.023  1.00 67.16  ? 588 CYS O CA    1 
ATOM 7118 C C     . CYS E 3 211 ? -2.387  70.067 22.460  1.00 65.65  ? 588 CYS O C     1 
ATOM 7119 O O     . CYS E 3 211 ? -1.190  70.225 22.701  1.00 66.65  ? 588 CYS O O     1 
ATOM 7120 C CB    . CYS E 3 211 ? -3.476  68.415 20.885  1.00 69.70  ? 588 CYS O CB    1 
ATOM 7121 S SG    . CYS E 3 211 ? -2.684  67.053 21.772  1.00 70.67  ? 588 CYS O SG    1 
ATOM 7122 N N     . LEU E 3 212 ? -3.321  70.102 23.410  1.00 63.76  ? 589 LEU O N     1 
ATOM 7123 C CA    . LEU E 3 212 ? -2.976  70.375 24.810  1.00 59.44  ? 589 LEU O CA    1 
ATOM 7124 C C     . LEU E 3 212 ? -2.268  69.238 25.536  1.00 56.46  ? 589 LEU O C     1 
ATOM 7125 O O     . LEU E 3 212 ? -2.520  68.064 25.270  1.00 53.83  ? 589 LEU O O     1 
ATOM 7126 C CB    . LEU E 3 212 ? -4.223  70.803 25.598  1.00 60.71  ? 589 LEU O CB    1 
ATOM 7127 C CG    . LEU E 3 212 ? -4.848  72.162 25.244  1.00 62.40  ? 589 LEU O CG    1 
ATOM 7128 C CD1   . LEU E 3 212 ? -5.478  72.098 23.856  1.00 65.17  ? 589 LEU O CD1   1 
ATOM 7129 C CD2   . LEU E 3 212 ? -5.899  72.533 26.273  1.00 62.72  ? 589 LEU O CD2   1 
ATOM 7130 N N     . VAL E 3 213 ? -1.399  69.613 26.474  1.00 54.79  ? 590 VAL O N     1 
ATOM 7131 C CA    . VAL E 3 213 ? -0.584  68.677 27.251  1.00 54.96  ? 590 VAL O CA    1 
ATOM 7132 C C     . VAL E 3 213 ? -1.206  67.370 27.731  1.00 59.53  ? 590 VAL O C     1 
ATOM 7133 O O     . VAL E 3 213 ? -0.466  66.418 27.974  1.00 59.70  ? 590 VAL O O     1 
ATOM 7134 C CB    . VAL E 3 213 ? 0.052   69.366 28.477  1.00 50.84  ? 590 VAL O CB    1 
ATOM 7135 C CG1   . VAL E 3 213 ? 0.544   70.750 28.095  1.00 47.25  ? 590 VAL O CG1   1 
ATOM 7136 C CG2   . VAL E 3 213 ? -0.947  69.447 29.612  1.00 49.23  ? 590 VAL O CG2   1 
ATOM 7137 N N     . TYR E 3 214 ? -2.529  67.296 27.895  1.00 66.59  ? 591 TYR O N     1 
ATOM 7138 C CA    . TYR E 3 214 ? -3.114  66.023 28.334  1.00 73.80  ? 591 TYR O CA    1 
ATOM 7139 C C     . TYR E 3 214 ? -3.160  65.048 27.173  1.00 68.64  ? 591 TYR O C     1 
ATOM 7140 O O     . TYR E 3 214 ? -2.865  63.864 27.332  1.00 69.04  ? 591 TYR O O     1 
ATOM 7141 C CB    . TYR E 3 214 ? -4.529  66.153 28.932  1.00 91.73  ? 591 TYR O CB    1 
ATOM 7142 C CG    . TYR E 3 214 ? -5.266  67.453 28.752  1.00 110.74 ? 591 TYR O CG    1 
ATOM 7143 C CD1   . TYR E 3 214 ? -4.858  68.604 29.413  1.00 120.04 ? 591 TYR O CD1   1 
ATOM 7144 C CD2   . TYR E 3 214 ? -6.439  67.506 28.003  1.00 119.17 ? 591 TYR O CD2   1 
ATOM 7145 C CE1   . TYR E 3 214 ? -5.605  69.772 29.343  1.00 129.76 ? 591 TYR O CE1   1 
ATOM 7146 C CE2   . TYR E 3 214 ? -7.192  68.668 27.926  1.00 128.61 ? 591 TYR O CE2   1 
ATOM 7147 C CZ    . TYR E 3 214 ? -6.772  69.795 28.600  1.00 131.76 ? 591 TYR O CZ    1 
ATOM 7148 O OH    . TYR E 3 214 ? -7.528  70.941 28.546  1.00 138.18 ? 591 TYR O OH    1 
ATOM 7149 N N     . GLY E 3 215 ? -3.538  65.539 26.004  1.00 64.05  ? 592 GLY O N     1 
ATOM 7150 C CA    . GLY E 3 215 ? -3.566  64.662 24.856  1.00 60.43  ? 592 GLY O CA    1 
ATOM 7151 C C     . GLY E 3 215 ? -4.914  64.100 24.457  1.00 59.08  ? 592 GLY O C     1 
ATOM 7152 O O     . GLY E 3 215 ? -5.828  64.857 24.135  1.00 57.27  ? 592 GLY O O     1 
ATOM 7153 N N     . GLY E 3 216 ? -5.033  62.773 24.452  1.00 58.40  ? 593 GLY O N     1 
ATOM 7154 C CA    . GLY E 3 216 ? -6.286  62.148 24.070  1.00 63.12  ? 593 GLY O CA    1 
ATOM 7155 C C     . GLY E 3 216 ? -6.671  62.392 22.620  1.00 67.48  ? 593 GLY O C     1 
ATOM 7156 O O     . GLY E 3 216 ? -6.894  61.441 21.876  1.00 67.43  ? 593 GLY O O     1 
ATOM 7157 N N     . GLN E 3 217 ? -6.758  63.659 22.222  1.00 74.11  ? 594 GLN O N     1 
ATOM 7158 C CA    . GLN E 3 217 ? -7.113  64.021 20.853  1.00 81.28  ? 594 GLN O CA    1 
ATOM 7159 C C     . GLN E 3 217 ? -6.473  63.030 19.895  1.00 75.83  ? 594 GLN O C     1 
ATOM 7160 O O     . GLN E 3 217 ? -5.277  62.742 19.988  1.00 71.76  ? 594 GLN O O     1 
ATOM 7161 C CB    . GLN E 3 217 ? -6.630  65.437 20.540  1.00 98.14  ? 594 GLN O CB    1 
ATOM 7162 C CG    . GLN E 3 217 ? -7.244  66.502 21.433  1.00 126.59 ? 594 GLN O CG    1 
ATOM 7163 C CD    . GLN E 3 217 ? -6.566  67.847 21.282  1.00 140.90 ? 594 GLN O CD    1 
ATOM 7164 O OE1   . GLN E 3 217 ? -6.432  68.363 20.173  1.00 149.10 ? 594 GLN O OE1   1 
ATOM 7165 N NE2   . GLN E 3 217 ? -6.133  68.423 22.400  1.00 147.97 ? 594 GLN O NE2   1 
ATOM 7166 N N     . GLN E 3 218 ? -7.274  62.504 18.977  1.00 72.33  ? 595 GLN O N     1 
ATOM 7167 C CA    . GLN E 3 218 ? -6.783  61.518 18.030  1.00 69.91  ? 595 GLN O CA    1 
ATOM 7168 C C     . GLN E 3 218 ? -6.340  62.133 16.713  1.00 68.17  ? 595 GLN O C     1 
ATOM 7169 O O     . GLN E 3 218 ? -7.054  62.932 16.117  1.00 65.89  ? 595 GLN O O     1 
ATOM 7170 C CB    . GLN E 3 218 ? -7.856  60.466 17.774  1.00 71.44  ? 595 GLN O CB    1 
ATOM 7171 C CG    . GLN E 3 218 ? -7.369  59.313 16.940  1.00 78.87  ? 595 GLN O CG    1 
ATOM 7172 C CD    . GLN E 3 218 ? -8.406  58.854 15.957  1.00 83.16  ? 595 GLN O CD    1 
ATOM 7173 O OE1   . GLN E 3 218 ? -8.824  59.614 15.073  1.00 84.35  ? 595 GLN O OE1   1 
ATOM 7174 N NE2   . GLN E 3 218 ? -8.839  57.604 16.101  1.00 85.86  ? 595 GLN O NE2   1 
ATOM 7175 N N     . MET E 3 219 ? -5.156  61.726 16.264  1.00 68.03  ? 596 MET O N     1 
ATOM 7176 C CA    . MET E 3 219 ? -4.548  62.216 15.033  1.00 71.62  ? 596 MET O CA    1 
ATOM 7177 C C     . MET E 3 219 ? -4.509  61.163 13.927  1.00 76.12  ? 596 MET O C     1 
ATOM 7178 O O     . MET E 3 219 ? -4.395  59.965 14.191  1.00 78.06  ? 596 MET O O     1 
ATOM 7179 C CB    . MET E 3 219 ? -3.133  62.703 15.343  1.00 69.63  ? 596 MET O CB    1 
ATOM 7180 C CG    . MET E 3 219 ? -2.240  62.939 14.151  1.00 64.03  ? 596 MET O CG    1 
ATOM 7181 S SD    . MET E 3 219 ? -0.568  63.339 14.701  1.00 60.94  ? 596 MET O SD    1 
ATOM 7182 C CE    . MET E 3 219 ? -0.057  61.766 15.303  1.00 58.56  ? 596 MET O CE    1 
ATOM 7183 N N     . ILE E 3 220 ? -4.603  61.637 12.688  1.00 81.34  ? 597 ILE O N     1 
ATOM 7184 C CA    . ILE E 3 220 ? -4.588  60.787 11.507  1.00 83.78  ? 597 ILE O CA    1 
ATOM 7185 C C     . ILE E 3 220 ? -3.360  61.052 10.639  1.00 79.49  ? 597 ILE O C     1 
ATOM 7186 O O     . ILE E 3 220 ? -3.133  62.174 10.173  1.00 77.92  ? 597 ILE O O     1 
ATOM 7187 C CB    . ILE E 3 220 ? -5.855  61.013 10.660  1.00 90.60  ? 597 ILE O CB    1 
ATOM 7188 C CG1   . ILE E 3 220 ? -7.066  60.441 11.401  1.00 97.68  ? 597 ILE O CG1   1 
ATOM 7189 C CG2   . ILE E 3 220 ? -5.687  60.392 9.276   1.00 95.66  ? 597 ILE O CG2   1 
ATOM 7190 C CD1   . ILE E 3 220 ? -8.379  60.626 10.676  1.00 103.17 ? 597 ILE O CD1   1 
ATOM 7191 N N     . LEU E 3 221 ? -2.573  60.005 10.424  1.00 74.01  ? 598 LEU O N     1 
ATOM 7192 C CA    . LEU E 3 221 ? -1.374  60.110 9.617   1.00 69.45  ? 598 LEU O CA    1 
ATOM 7193 C C     . LEU E 3 221 ? -1.565  59.405 8.280   1.00 74.76  ? 598 LEU O C     1 
ATOM 7194 O O     . LEU E 3 221 ? -2.086  58.290 8.225   1.00 73.91  ? 598 LEU O O     1 
ATOM 7195 C CB    . LEU E 3 221 ? -0.191  59.491 10.361  1.00 57.20  ? 598 LEU O CB    1 
ATOM 7196 C CG    . LEU E 3 221 ? 0.286   60.189 11.641  1.00 48.69  ? 598 LEU O CG    1 
ATOM 7197 C CD1   . LEU E 3 221 ? 1.436   59.390 12.249  1.00 42.58  ? 598 LEU O CD1   1 
ATOM 7198 C CD2   . LEU E 3 221 ? 0.734   61.619 11.341  1.00 40.99  ? 598 LEU O CD2   1 
ATOM 7199 N N     . THR E 3 222 ? -1.145  60.065 7.204   1.00 82.30  ? 599 THR O N     1 
ATOM 7200 C CA    . THR E 3 222 ? -1.242  59.501 5.860   1.00 90.23  ? 599 THR O CA    1 
ATOM 7201 C C     . THR E 3 222 ? 0.156   59.397 5.246   1.00 86.58  ? 599 THR O C     1 
ATOM 7202 O O     . THR E 3 222 ? 0.818   60.407 5.019   1.00 85.43  ? 599 THR O O     1 
ATOM 7203 C CB    . THR E 3 222 ? -2.120  60.379 4.947   1.00 99.04  ? 599 THR O CB    1 
ATOM 7204 O OG1   . THR E 3 222 ? -3.464  60.397 5.444   1.00 110.28 ? 599 THR O OG1   1 
ATOM 7205 C CG2   . THR E 3 222 ? -2.111  59.842 3.527   1.00 110.18 ? 599 THR O CG2   1 
ATOM 7206 N N     . GLY E 3 223 ? 0.604   58.173 4.985   1.00 83.16  ? 600 GLY O N     1 
ATOM 7207 C CA    . GLY E 3 223 ? 1.924   57.979 4.411   1.00 80.40  ? 600 GLY O CA    1 
ATOM 7208 C C     . GLY E 3 223 ? 2.064   56.661 3.669   1.00 80.39  ? 600 GLY O C     1 
ATOM 7209 O O     . GLY E 3 223 ? 1.122   56.219 3.004   1.00 78.91  ? 600 GLY O O     1 
ATOM 7210 N N     . GLN E 3 224 ? 3.233   56.028 3.779   1.00 82.18  ? 601 GLN O N     1 
ATOM 7211 C CA    . GLN E 3 224 ? 3.477   54.756 3.102   1.00 83.94  ? 601 GLN O CA    1 
ATOM 7212 C C     . GLN E 3 224 ? 4.121   53.691 3.977   1.00 81.23  ? 601 GLN O C     1 
ATOM 7213 O O     . GLN E 3 224 ? 4.803   53.993 4.959   1.00 78.64  ? 601 GLN O O     1 
ATOM 7214 C CB    . GLN E 3 224 ? 4.350   54.961 1.858   1.00 89.52  ? 601 GLN O CB    1 
ATOM 7215 C CG    . GLN E 3 224 ? 3.680   55.755 0.754   1.00 102.89 ? 601 GLN O CG    1 
ATOM 7216 C CD    . GLN E 3 224 ? 4.178   55.369 -0.622  1.00 109.94 ? 601 GLN O CD    1 
ATOM 7217 O OE1   . GLN E 3 224 ? 5.378   55.425 -0.902  1.00 114.66 ? 601 GLN O OE1   1 
ATOM 7218 N NE2   . GLN E 3 224 ? 3.253   54.973 -1.495  1.00 113.72 ? 601 GLN O NE2   1 
ATOM 7219 N N     . ASN E 3 225 ? 3.907   52.437 3.592   1.00 79.26  ? 602 ASN O N     1 
ATOM 7220 C CA    . ASN E 3 225 ? 4.451   51.297 4.314   1.00 79.37  ? 602 ASN O CA    1 
ATOM 7221 C C     . ASN E 3 225 ? 3.996   51.253 5.760   1.00 79.07  ? 602 ASN O C     1 
ATOM 7222 O O     . ASN E 3 225 ? 4.806   51.285 6.682   1.00 81.71  ? 602 ASN O O     1 
ATOM 7223 C CB    . ASN E 3 225 ? 5.979   51.302 4.230   1.00 78.44  ? 602 ASN O CB    1 
ATOM 7224 C CG    . ASN E 3 225 ? 6.482   50.611 2.983   1.00 77.63  ? 602 ASN O CG    1 
ATOM 7225 O OD1   . ASN E 3 225 ? 5.709   50.347 2.065   1.00 77.33  ? 602 ASN O OD1   1 
ATOM 7226 N ND2   . ASN E 3 225 ? 7.776   50.316 2.938   1.00 76.71  ? 602 ASN O ND2   1 
ATOM 7227 N N     . PHE E 3 226 ? 2.684   51.174 5.946   1.00 78.01  ? 603 PHE O N     1 
ATOM 7228 C CA    . PHE E 3 226 ? 2.103   51.119 7.274   1.00 75.73  ? 603 PHE O CA    1 
ATOM 7229 C C     . PHE E 3 226 ? 1.485   49.751 7.521   1.00 76.61  ? 603 PHE O C     1 
ATOM 7230 O O     . PHE E 3 226 ? 0.324   49.516 7.179   1.00 76.72  ? 603 PHE O O     1 
ATOM 7231 C CB    . PHE E 3 226 ? 1.030   52.200 7.425   1.00 72.26  ? 603 PHE O CB    1 
ATOM 7232 C CG    . PHE E 3 226 ? 1.574   53.607 7.470   1.00 69.63  ? 603 PHE O CG    1 
ATOM 7233 C CD1   . PHE E 3 226 ? 0.721   54.700 7.328   1.00 69.23  ? 603 PHE O CD1   1 
ATOM 7234 C CD2   . PHE E 3 226 ? 2.928   53.849 7.669   1.00 69.18  ? 603 PHE O CD2   1 
ATOM 7235 C CE1   . PHE E 3 226 ? 1.208   56.012 7.383   1.00 67.01  ? 603 PHE O CE1   1 
ATOM 7236 C CE2   . PHE E 3 226 ? 3.425   55.159 7.724   1.00 67.37  ? 603 PHE O CE2   1 
ATOM 7237 C CZ    . PHE E 3 226 ? 2.562   56.237 7.581   1.00 66.42  ? 603 PHE O CZ    1 
ATOM 7238 N N     . THR E 3 227 ? 2.266   48.844 8.102   1.00 77.34  ? 604 THR O N     1 
ATOM 7239 C CA    . THR E 3 227 ? 1.764   47.508 8.401   1.00 78.09  ? 604 THR O CA    1 
ATOM 7240 C C     . THR E 3 227 ? 0.981   47.561 9.709   1.00 84.19  ? 604 THR O C     1 
ATOM 7241 O O     . THR E 3 227 ? 1.028   48.553 10.441  1.00 84.13  ? 604 THR O O     1 
ATOM 7242 C CB    . THR E 3 227 ? 2.910   46.459 8.560   1.00 72.23  ? 604 THR O CB    1 
ATOM 7243 O OG1   . THR E 3 227 ? 3.747   46.808 9.669   1.00 66.38  ? 604 THR O OG1   1 
ATOM 7244 C CG2   . THR E 3 227 ? 3.760   46.394 7.304   1.00 68.95  ? 604 THR O CG2   1 
ATOM 7245 N N     . SER E 3 228 ? 0.244   46.495 9.989   1.00 89.43  ? 605 SER O N     1 
ATOM 7246 C CA    . SER E 3 228 ? -0.520  46.414 11.221  1.00 95.97  ? 605 SER O CA    1 
ATOM 7247 C C     . SER E 3 228 ? 0.492   46.475 12.362  1.00 97.11  ? 605 SER O C     1 
ATOM 7248 O O     . SER E 3 228 ? 0.179   46.890 13.477  1.00 98.83  ? 605 SER O O     1 
ATOM 7249 C CB    . SER E 3 228 ? -1.277  45.090 11.266  1.00 101.06 ? 605 SER O CB    1 
ATOM 7250 O OG    . SER E 3 228 ? -0.393  44.005 11.023  1.00 104.55 ? 605 SER O OG    1 
ATOM 7251 N N     . GLU E 3 229 ? 1.714   46.055 12.057  1.00 98.53  ? 606 GLU O N     1 
ATOM 7252 C CA    . GLU E 3 229 ? 2.796   46.044 13.025  1.00 96.06  ? 606 GLU O CA    1 
ATOM 7253 C C     . GLU E 3 229 ? 3.402   47.416 13.252  1.00 89.36  ? 606 GLU O C     1 
ATOM 7254 O O     . GLU E 3 229 ? 4.322   47.566 14.055  1.00 83.15  ? 606 GLU O O     1 
ATOM 7255 C CB    . GLU E 3 229 ? 3.888   45.076 12.575  1.00 105.10 ? 606 GLU O CB    1 
ATOM 7256 C CG    . GLU E 3 229 ? 3.495   43.627 12.721  1.00 123.38 ? 606 GLU O CG    1 
ATOM 7257 C CD    . GLU E 3 229 ? 3.056   43.303 14.135  1.00 133.65 ? 606 GLU O CD    1 
ATOM 7258 O OE1   . GLU E 3 229 ? 3.845   43.543 15.075  1.00 139.27 ? 606 GLU O OE1   1 
ATOM 7259 O OE2   . GLU E 3 229 ? 1.921   42.812 14.308  1.00 139.90 ? 606 GLU O OE2   1 
ATOM 7260 N N     . SER E 3 230 ? 2.900   48.420 12.544  1.00 83.82  ? 607 SER O N     1 
ATOM 7261 C CA    . SER E 3 230 ? 3.420   49.768 12.719  1.00 82.59  ? 607 SER O CA    1 
ATOM 7262 C C     . SER E 3 230 ? 3.140   50.195 14.156  1.00 78.38  ? 607 SER O C     1 
ATOM 7263 O O     . SER E 3 230 ? 2.352   49.560 14.851  1.00 76.86  ? 607 SER O O     1 
ATOM 7264 C CB    . SER E 3 230 ? 2.743   50.741 11.746  1.00 87.01  ? 607 SER O CB    1 
ATOM 7265 O OG    . SER E 3 230 ? 3.075   50.440 10.403  1.00 97.48  ? 607 SER O OG    1 
ATOM 7266 N N     . LYS E 3 231 ? 3.796   51.260 14.600  1.00 74.84  ? 608 LYS O N     1 
ATOM 7267 C CA    . LYS E 3 231 ? 3.617   51.785 15.950  1.00 70.69  ? 608 LYS O CA    1 
ATOM 7268 C C     . LYS E 3 231 ? 4.086   53.221 15.884  1.00 63.33  ? 608 LYS O C     1 
ATOM 7269 O O     . LYS E 3 231 ? 4.964   53.542 15.090  1.00 61.23  ? 608 LYS O O     1 
ATOM 7270 C CB    . LYS E 3 231 ? 4.493   51.026 16.949  1.00 78.73  ? 608 LYS O CB    1 
ATOM 7271 C CG    . LYS E 3 231 ? 4.296   49.530 16.941  1.00 92.02  ? 608 LYS O CG    1 
ATOM 7272 C CD    . LYS E 3 231 ? 5.254   48.843 17.876  1.00 101.12 ? 608 LYS O CD    1 
ATOM 7273 C CE    . LYS E 3 231 ? 5.030   47.350 17.841  1.00 107.01 ? 608 LYS O CE    1 
ATOM 7274 N NZ    . LYS E 3 231 ? 5.924   46.638 18.786  1.00 111.07 ? 608 LYS O NZ    1 
ATOM 7275 N N     . VAL E 3 232 ? 3.511   54.099 16.689  1.00 56.44  ? 609 VAL O N     1 
ATOM 7276 C CA    . VAL E 3 232 ? 3.972   55.475 16.657  1.00 50.17  ? 609 VAL O CA    1 
ATOM 7277 C C     . VAL E 3 232 ? 4.689   55.775 17.959  1.00 46.63  ? 609 VAL O C     1 
ATOM 7278 O O     . VAL E 3 232 ? 4.411   55.164 18.985  1.00 47.04  ? 609 VAL O O     1 
ATOM 7279 C CB    . VAL E 3 232 ? 2.819   56.458 16.443  1.00 48.75  ? 609 VAL O CB    1 
ATOM 7280 C CG1   . VAL E 3 232 ? 3.350   57.881 16.391  1.00 48.54  ? 609 VAL O CG1   1 
ATOM 7281 C CG2   . VAL E 3 232 ? 2.129   56.142 15.144  1.00 48.31  ? 609 VAL O CG2   1 
ATOM 7282 N N     . VAL E 3 233 ? 5.636   56.698 17.916  1.00 41.53  ? 610 VAL O N     1 
ATOM 7283 C CA    . VAL E 3 233 ? 6.372   57.020 19.117  1.00 39.93  ? 610 VAL O CA    1 
ATOM 7284 C C     . VAL E 3 233 ? 6.715   58.481 19.254  1.00 42.80  ? 610 VAL O C     1 
ATOM 7285 O O     . VAL E 3 233 ? 7.394   59.061 18.400  1.00 46.86  ? 610 VAL O O     1 
ATOM 7286 C CB    . VAL E 3 233 ? 7.691   56.233 19.204  1.00 35.29  ? 610 VAL O CB    1 
ATOM 7287 C CG1   . VAL E 3 233 ? 8.559   56.803 20.346  1.00 25.42  ? 610 VAL O CG1   1 
ATOM 7288 C CG2   . VAL E 3 233 ? 7.398   54.745 19.404  1.00 25.44  ? 610 VAL O CG2   1 
ATOM 7289 N N     . PHE E 3 234 ? 6.246   59.073 20.342  1.00 43.68  ? 611 PHE O N     1 
ATOM 7290 C CA    . PHE E 3 234 ? 6.549   60.456 20.599  1.00 43.26  ? 611 PHE O CA    1 
ATOM 7291 C C     . PHE E 3 234 ? 7.805   60.437 21.445  1.00 47.04  ? 611 PHE O C     1 
ATOM 7292 O O     . PHE E 3 234 ? 7.995   59.537 22.261  1.00 46.17  ? 611 PHE O O     1 
ATOM 7293 C CB    . PHE E 3 234 ? 5.392   61.131 21.336  1.00 37.04  ? 611 PHE O CB    1 
ATOM 7294 C CG    . PHE E 3 234 ? 4.289   61.596 20.422  1.00 34.05  ? 611 PHE O CG    1 
ATOM 7295 C CD1   . PHE E 3 234 ? 3.483   60.677 19.749  1.00 31.46  ? 611 PHE O CD1   1 
ATOM 7296 C CD2   . PHE E 3 234 ? 4.066   62.960 20.214  1.00 31.39  ? 611 PHE O CD2   1 
ATOM 7297 C CE1   . PHE E 3 234 ? 2.466   61.104 18.882  1.00 28.61  ? 611 PHE O CE1   1 
ATOM 7298 C CE2   . PHE E 3 234 ? 3.056   63.400 19.352  1.00 28.56  ? 611 PHE O CE2   1 
ATOM 7299 C CZ    . PHE E 3 234 ? 2.252   62.466 18.684  1.00 28.31  ? 611 PHE O CZ    1 
ATOM 7300 N N     . THR E 3 235 ? 8.688   61.398 21.207  1.00 52.43  ? 612 THR O N     1 
ATOM 7301 C CA    . THR E 3 235 ? 9.922   61.514 21.968  1.00 59.23  ? 612 THR O CA    1 
ATOM 7302 C C     . THR E 3 235 ? 10.303  62.979 21.933  1.00 65.80  ? 612 THR O C     1 
ATOM 7303 O O     . THR E 3 235 ? 9.834   63.737 21.081  1.00 64.99  ? 612 THR O O     1 
ATOM 7304 C CB    . THR E 3 235 ? 11.086  60.721 21.344  1.00 57.58  ? 612 THR O CB    1 
ATOM 7305 O OG1   . THR E 3 235 ? 11.625  61.459 20.241  1.00 57.73  ? 612 THR O OG1   1 
ATOM 7306 C CG2   . THR E 3 235 ? 10.610  59.363 20.850  1.00 58.39  ? 612 THR O CG2   1 
ATOM 7307 N N     . GLU E 3 236 ? 11.143  63.382 22.870  1.00 72.73  ? 613 GLU O N     1 
ATOM 7308 C CA    . GLU E 3 236 ? 11.602  64.753 22.914  1.00 82.32  ? 613 GLU O CA    1 
ATOM 7309 C C     . GLU E 3 236 ? 13.058  64.682 23.313  1.00 87.71  ? 613 GLU O C     1 
ATOM 7310 O O     . GLU E 3 236 ? 13.449  63.814 24.091  1.00 86.98  ? 613 GLU O O     1 
ATOM 7311 C CB    . GLU E 3 236 ? 10.825  65.563 23.947  1.00 88.45  ? 613 GLU O CB    1 
ATOM 7312 C CG    . GLU E 3 236 ? 11.039  67.056 23.798  1.00 95.77  ? 613 GLU O CG    1 
ATOM 7313 C CD    . GLU E 3 236 ? 10.725  67.827 25.058  1.00 99.13  ? 613 GLU O CD    1 
ATOM 7314 O OE1   . GLU E 3 236 ? 10.826  69.071 25.025  1.00 101.52 ? 613 GLU O OE1   1 
ATOM 7315 O OE2   . GLU E 3 236 ? 10.389  67.193 26.080  1.00 100.80 ? 613 GLU O OE2   1 
ATOM 7316 N N     . LYS E 3 237 ? 13.868  65.579 22.771  1.00 99.37  ? 614 LYS O N     1 
ATOM 7317 C CA    . LYS E 3 237 ? 15.283  65.580 23.102  1.00 106.62 ? 614 LYS O CA    1 
ATOM 7318 C C     . LYS E 3 237 ? 15.839  66.988 23.123  1.00 109.43 ? 614 LYS O C     1 
ATOM 7319 O O     . LYS E 3 237 ? 15.364  67.865 22.396  1.00 99.10  ? 614 LYS O O     1 
ATOM 7320 C CB    . LYS E 3 237 ? 16.074  64.736 22.097  1.00 109.57 ? 614 LYS O CB    1 
ATOM 7321 C CG    . LYS E 3 237 ? 15.957  65.191 20.642  1.00 127.57 ? 614 LYS O CG    1 
ATOM 7322 C CD    . LYS E 3 237 ? 14.704  64.645 19.973  1.00 140.56 ? 614 LYS O CD    1 
ATOM 7323 C CE    . LYS E 3 237 ? 14.713  63.121 19.959  1.00 147.48 ? 614 LYS O CE    1 
ATOM 7324 N NZ    . LYS E 3 237 ? 15.950  62.570 19.333  1.00 151.27 ? 614 LYS O NZ    1 
ATOM 7325 N N     . THR E 3 238 ? 16.840  67.196 23.972  1.00 115.71 ? 615 THR O N     1 
ATOM 7326 C CA    . THR E 3 238 ? 17.494  68.489 24.094  1.00 133.97 ? 615 THR O CA    1 
ATOM 7327 C C     . THR E 3 238 ? 18.360  68.671 22.858  1.00 138.24 ? 615 THR O C     1 
ATOM 7328 O O     . THR E 3 238 ? 18.737  67.692 22.213  1.00 148.07 ? 615 THR O O     1 
ATOM 7329 C CB    . THR E 3 238 ? 18.381  68.548 25.355  1.00 140.81 ? 615 THR O CB    1 
ATOM 7330 O OG1   . THR E 3 238 ? 19.232  67.396 25.395  1.00 145.00 ? 615 THR O OG1   1 
ATOM 7331 C CG2   . THR E 3 238 ? 17.523  68.584 26.613  1.00 144.97 ? 615 THR O CG2   1 
ATOM 7332 N N     . THR E 3 239 ? 18.670  69.917 22.524  1.00 143.41 ? 616 THR O N     1 
ATOM 7333 C CA    . THR E 3 239 ? 19.489  70.197 21.352  1.00 140.91 ? 616 THR O CA    1 
ATOM 7334 C C     . THR E 3 239 ? 20.734  69.309 21.337  1.00 150.34 ? 616 THR O C     1 
ATOM 7335 O O     . THR E 3 239 ? 21.253  68.968 20.275  1.00 151.01 ? 616 THR O O     1 
ATOM 7336 C CB    . THR E 3 239 ? 19.928  71.672 21.322  1.00 129.19 ? 616 THR O CB    1 
ATOM 7337 O OG1   . THR E 3 239 ? 18.794  72.514 21.575  1.00 114.25 ? 616 THR O OG1   1 
ATOM 7338 C CG2   . THR E 3 239 ? 20.514  72.020 19.957  1.00 115.14 ? 616 THR O CG2   1 
ATOM 7339 N N     . ASP E 3 240 ? 21.196  68.927 22.525  1.00 159.12 ? 617 ASP O N     1 
ATOM 7340 C CA    . ASP E 3 240 ? 22.378  68.082 22.665  1.00 169.75 ? 617 ASP O CA    1 
ATOM 7341 C C     . ASP E 3 240 ? 22.111  66.673 22.147  1.00 172.09 ? 617 ASP O C     1 
ATOM 7342 O O     . ASP E 3 240 ? 22.979  65.802 22.221  1.00 177.99 ? 617 ASP O O     1 
ATOM 7343 C CB    . ASP E 3 240 ? 22.801  68.006 24.134  1.00 176.22 ? 617 ASP O CB    1 
ATOM 7344 C CG    . ASP E 3 240 ? 22.919  69.374 24.781  1.00 178.15 ? 617 ASP O CG    1 
ATOM 7345 O OD1   . ASP E 3 240 ? 23.284  69.437 25.973  1.00 178.89 ? 617 ASP O OD1   1 
ATOM 7346 O OD2   . ASP E 3 240 ? 22.644  70.385 24.101  1.00 179.03 ? 617 ASP O OD2   1 
ATOM 7347 N N     . GLY E 3 241 ? 20.906  66.455 21.631  1.00 172.02 ? 618 GLY O N     1 
ATOM 7348 C CA    . GLY E 3 241 ? 20.542  65.150 21.109  1.00 165.25 ? 618 GLY O CA    1 
ATOM 7349 C C     . GLY E 3 241 ? 20.142  64.167 22.194  1.00 159.73 ? 618 GLY O C     1 
ATOM 7350 O O     . GLY E 3 241 ? 19.975  62.973 21.936  1.00 159.12 ? 618 GLY O O     1 
ATOM 7351 N N     . GLN E 3 242 ? 19.987  64.668 23.415  1.00 153.76 ? 619 GLN O N     1 
ATOM 7352 C CA    . GLN E 3 242 ? 19.607  63.822 24.539  1.00 146.70 ? 619 GLN O CA    1 
ATOM 7353 C C     . GLN E 3 242 ? 18.129  63.458 24.479  1.00 141.17 ? 619 GLN O C     1 
ATOM 7354 O O     . GLN E 3 242 ? 17.284  64.224 24.945  1.00 139.53 ? 619 GLN O O     1 
ATOM 7355 C CB    . GLN E 3 242 ? 19.881  64.539 25.863  1.00 147.79 ? 619 GLN O CB    1 
ATOM 7356 C CG    . GLN E 3 242 ? 21.320  64.967 26.073  1.00 149.92 ? 619 GLN O CG    1 
ATOM 7357 C CD    . GLN E 3 242 ? 21.523  65.669 27.404  1.00 151.26 ? 619 GLN O CD    1 
ATOM 7358 O OE1   . GLN E 3 242 ? 21.289  65.090 28.465  1.00 152.21 ? 619 GLN O OE1   1 
ATOM 7359 N NE2   . GLN E 3 242 ? 21.956  66.924 27.355  1.00 152.11 ? 619 GLN O NE2   1 
ATOM 7360 N N     . GLN E 3 243 ? 17.811  62.302 23.901  1.00 135.79 ? 620 GLN O N     1 
ATOM 7361 C CA    . GLN E 3 243 ? 16.418  61.881 23.844  1.00 131.69 ? 620 GLN O CA    1 
ATOM 7362 C C     . GLN E 3 243 ? 16.018  61.615 25.291  1.00 128.78 ? 620 GLN O C     1 
ATOM 7363 O O     . GLN E 3 243 ? 16.265  60.537 25.843  1.00 134.98 ? 620 GLN O O     1 
ATOM 7364 C CB    . GLN E 3 243 ? 16.241  60.607 23.013  1.00 127.62 ? 620 GLN O CB    1 
ATOM 7365 C CG    . GLN E 3 243 ? 14.772  60.215 22.836  1.00 119.80 ? 620 GLN O CG    1 
ATOM 7366 C CD    . GLN E 3 243 ? 14.579  58.797 22.324  1.00 116.80 ? 620 GLN O CD    1 
ATOM 7367 O OE1   . GLN E 3 243 ? 14.835  58.496 21.158  1.00 116.04 ? 620 GLN O OE1   1 
ATOM 7368 N NE2   . GLN E 3 243 ? 14.124  57.914 23.205  1.00 116.06 ? 620 GLN O NE2   1 
ATOM 7369 N N     . ILE E 3 244 ? 15.406  62.622 25.899  1.00 119.64 ? 621 ILE O N     1 
ATOM 7370 C CA    . ILE E 3 244 ? 14.983  62.556 27.288  1.00 113.99 ? 621 ILE O CA    1 
ATOM 7371 C C     . ILE E 3 244 ? 13.650  61.829 27.488  1.00 109.25 ? 621 ILE O C     1 
ATOM 7372 O O     . ILE E 3 244 ? 13.512  61.010 28.400  1.00 120.80 ? 621 ILE O O     1 
ATOM 7373 C CB    . ILE E 3 244 ? 14.896  63.986 27.866  1.00 112.30 ? 621 ILE O CB    1 
ATOM 7374 C CG1   . ILE E 3 244 ? 13.738  64.751 27.220  1.00 100.65 ? 621 ILE O CG1   1 
ATOM 7375 C CG2   . ILE E 3 244 ? 16.196  64.736 27.566  1.00 102.13 ? 621 ILE O CG2   1 
ATOM 7376 C CD1   . ILE E 3 244 ? 13.608  66.194 27.685  1.00 92.11  ? 621 ILE O CD1   1 
ATOM 7377 N N     . TRP E 3 245 ? 12.681  62.121 26.622  1.00 100.95 ? 622 TRP O N     1 
ATOM 7378 C CA    . TRP E 3 245 ? 11.352  61.520 26.703  1.00 81.73  ? 622 TRP O CA    1 
ATOM 7379 C C     . TRP E 3 245 ? 10.995  60.621 25.511  1.00 74.41  ? 622 TRP O C     1 
ATOM 7380 O O     . TRP E 3 245 ? 11.343  60.900 24.365  1.00 65.45  ? 622 TRP O O     1 
ATOM 7381 C CB    . TRP E 3 245 ? 10.309  62.637 26.866  1.00 72.02  ? 622 TRP O CB    1 
ATOM 7382 C CG    . TRP E 3 245 ? 8.873   62.188 26.834  1.00 63.27  ? 622 TRP O CG    1 
ATOM 7383 C CD1   . TRP E 3 245 ? 8.302   61.197 27.580  1.00 61.01  ? 622 TRP O CD1   1 
ATOM 7384 C CD2   . TRP E 3 245 ? 7.835   62.706 25.991  1.00 59.99  ? 622 TRP O CD2   1 
ATOM 7385 N NE1   . TRP E 3 245 ? 6.974   61.061 27.249  1.00 59.83  ? 622 TRP O NE1   1 
ATOM 7386 C CE2   . TRP E 3 245 ? 6.662   61.975 26.277  1.00 58.88  ? 622 TRP O CE2   1 
ATOM 7387 C CE3   . TRP E 3 245 ? 7.784   63.717 25.021  1.00 57.86  ? 622 TRP O CE3   1 
ATOM 7388 C CZ2   . TRP E 3 245 ? 5.448   62.220 25.626  1.00 57.70  ? 622 TRP O CZ2   1 
ATOM 7389 C CZ3   . TRP E 3 245 ? 6.574   63.962 24.371  1.00 57.49  ? 622 TRP O CZ3   1 
ATOM 7390 C CH2   . TRP E 3 245 ? 5.424   63.215 24.678  1.00 57.07  ? 622 TRP O CH2   1 
ATOM 7391 N N     . GLU E 3 246 ? 10.287  59.538 25.797  1.00 68.18  ? 623 GLU O N     1 
ATOM 7392 C CA    . GLU E 3 246 ? 9.884   58.603 24.763  1.00 68.04  ? 623 GLU O CA    1 
ATOM 7393 C C     . GLU E 3 246 ? 8.586   57.906 25.168  1.00 63.78  ? 623 GLU O C     1 
ATOM 7394 O O     . GLU E 3 246 ? 8.587   57.050 26.047  1.00 61.83  ? 623 GLU O O     1 
ATOM 7395 C CB    . GLU E 3 246 ? 10.986  57.560 24.557  1.00 76.20  ? 623 GLU O CB    1 
ATOM 7396 C CG    . GLU E 3 246 ? 10.663  56.498 23.517  1.00 91.69  ? 623 GLU O CG    1 
ATOM 7397 C CD    . GLU E 3 246 ? 11.603  55.302 23.580  1.00 99.74  ? 623 GLU O CD    1 
ATOM 7398 O OE1   . GLU E 3 246 ? 11.519  54.525 24.557  1.00 104.24 ? 623 GLU O OE1   1 
ATOM 7399 O OE2   . GLU E 3 246 ? 12.428  55.140 22.654  1.00 103.82 ? 623 GLU O OE2   1 
ATOM 7400 N N     . MET E 3 247 ? 7.478   58.271 24.531  1.00 60.87  ? 624 MET O N     1 
ATOM 7401 C CA    . MET E 3 247 ? 6.193   57.650 24.843  1.00 58.09  ? 624 MET O CA    1 
ATOM 7402 C C     . MET E 3 247 ? 5.490   57.105 23.590  1.00 54.88  ? 624 MET O C     1 
ATOM 7403 O O     . MET E 3 247 ? 5.293   57.826 22.615  1.00 50.47  ? 624 MET O O     1 
ATOM 7404 C CB    . MET E 3 247 ? 5.288   58.656 25.564  1.00 60.02  ? 624 MET O CB    1 
ATOM 7405 C CG    . MET E 3 247 ? 3.998   58.042 26.089  1.00 67.72  ? 624 MET O CG    1 
ATOM 7406 S SD    . MET E 3 247 ? 4.300   56.577 27.117  1.00 71.81  ? 624 MET O SD    1 
ATOM 7407 C CE    . MET E 3 247 ? 4.663   57.373 28.685  1.00 74.91  ? 624 MET O CE    1 
ATOM 7408 N N     . GLU E 3 248 ? 5.123   55.827 23.620  1.00 54.96  ? 625 GLU O N     1 
ATOM 7409 C CA    . GLU E 3 248 ? 4.445   55.205 22.484  1.00 57.65  ? 625 GLU O CA    1 
ATOM 7410 C C     . GLU E 3 248 ? 2.953   55.494 22.494  1.00 56.97  ? 625 GLU O C     1 
ATOM 7411 O O     . GLU E 3 248 ? 2.257   55.098 23.417  1.00 58.38  ? 625 GLU O O     1 
ATOM 7412 C CB    . GLU E 3 248 ? 4.644   53.687 22.499  1.00 60.36  ? 625 GLU O CB    1 
ATOM 7413 C CG    . GLU E 3 248 ? 3.788   52.958 21.473  1.00 65.68  ? 625 GLU O CG    1 
ATOM 7414 C CD    . GLU E 3 248 ? 3.882   51.449 21.589  1.00 69.82  ? 625 GLU O CD    1 
ATOM 7415 O OE1   . GLU E 3 248 ? 3.198   50.750 20.809  1.00 71.44  ? 625 GLU O OE1   1 
ATOM 7416 O OE2   . GLU E 3 248 ? 4.636   50.959 22.458  1.00 71.60  ? 625 GLU O OE2   1 
ATOM 7417 N N     . ALA E 3 249 ? 2.458   56.171 21.464  1.00 56.41  ? 626 ALA O N     1 
ATOM 7418 C CA    . ALA E 3 249 ? 1.035   56.493 21.386  1.00 59.38  ? 626 ALA O CA    1 
ATOM 7419 C C     . ALA E 3 249 ? 0.238   55.266 20.968  1.00 63.28  ? 626 ALA O C     1 
ATOM 7420 O O     . ALA E 3 249 ? 0.684   54.493 20.127  1.00 67.43  ? 626 ALA O O     1 
ATOM 7421 C CB    . ALA E 3 249 ? 0.809   57.620 20.384  1.00 53.60  ? 626 ALA O CB    1 
ATOM 7422 N N     . THR E 3 250 ? -0.937  55.077 21.554  1.00 69.26  ? 627 THR O N     1 
ATOM 7423 C CA    . THR E 3 250 ? -1.758  53.930 21.182  1.00 73.95  ? 627 THR O CA    1 
ATOM 7424 C C     . THR E 3 250 ? -2.126  54.097 19.717  1.00 79.50  ? 627 THR O C     1 
ATOM 7425 O O     . THR E 3 250 ? -2.726  55.109 19.342  1.00 81.80  ? 627 THR O O     1 
ATOM 7426 C CB    . THR E 3 250 ? -3.063  53.885 21.978  1.00 71.72  ? 627 THR O CB    1 
ATOM 7427 O OG1   . THR E 3 250 ? -2.772  53.830 23.374  1.00 68.38  ? 627 THR O OG1   1 
ATOM 7428 C CG2   . THR E 3 250 ? -3.876  52.674 21.583  1.00 67.11  ? 627 THR O CG2   1 
ATOM 7429 N N     . VAL E 3 251 ? -1.778  53.121 18.885  1.00 84.08  ? 628 VAL O N     1 
ATOM 7430 C CA    . VAL E 3 251 ? -2.103  53.225 17.465  1.00 89.94  ? 628 VAL O CA    1 
ATOM 7431 C C     . VAL E 3 251 ? -3.332  52.419 17.090  1.00 97.93  ? 628 VAL O C     1 
ATOM 7432 O O     . VAL E 3 251 ? -3.274  51.195 16.987  1.00 94.46  ? 628 VAL O O     1 
ATOM 7433 C CB    . VAL E 3 251 ? -0.930  52.776 16.572  1.00 87.42  ? 628 VAL O CB    1 
ATOM 7434 C CG1   . VAL E 3 251 ? -1.375  52.719 15.120  1.00 84.30  ? 628 VAL O CG1   1 
ATOM 7435 C CG2   . VAL E 3 251 ? 0.230   53.748 16.722  1.00 85.95  ? 628 VAL O CG2   1 
ATOM 7436 N N     . ASP E 3 252 ? -4.439  53.127 16.890  1.00 113.74 ? 629 ASP O N     1 
ATOM 7437 C CA    . ASP E 3 252 ? -5.710  52.519 16.513  1.00 128.49 ? 629 ASP O CA    1 
ATOM 7438 C C     . ASP E 3 252 ? -5.446  51.498 15.409  1.00 133.44 ? 629 ASP O C     1 
ATOM 7439 O O     . ASP E 3 252 ? -5.056  51.865 14.297  1.00 125.59 ? 629 ASP O O     1 
ATOM 7440 C CB    . ASP E 3 252 ? -6.670  53.605 16.007  1.00 140.48 ? 629 ASP O CB    1 
ATOM 7441 C CG    . ASP E 3 252 ? -8.109  53.126 15.904  1.00 159.44 ? 629 ASP O CG    1 
ATOM 7442 O OD1   . ASP E 3 252 ? -8.348  52.074 15.279  1.00 172.20 ? 629 ASP O OD1   1 
ATOM 7443 O OD2   . ASP E 3 252 ? -9.006  53.813 16.442  1.00 171.64 ? 629 ASP O OD2   1 
ATOM 7444 N N     . LYS E 3 253 ? -5.649  50.220 15.728  1.00 141.83 ? 630 LYS O N     1 
ATOM 7445 C CA    . LYS E 3 253 ? -5.433  49.126 14.779  1.00 159.42 ? 630 LYS O CA    1 
ATOM 7446 C C     . LYS E 3 253 ? -6.649  48.929 13.875  1.00 171.37 ? 630 LYS O C     1 
ATOM 7447 O O     . LYS E 3 253 ? -6.564  48.276 12.833  1.00 178.09 ? 630 LYS O O     1 
ATOM 7448 C CB    . LYS E 3 253 ? -5.158  47.822 15.537  1.00 159.67 ? 630 LYS O CB    1 
ATOM 7449 C CG    . LYS E 3 253 ? -3.873  47.807 16.362  1.00 156.79 ? 630 LYS O CG    1 
ATOM 7450 C CD    . LYS E 3 253 ? -2.632  47.656 15.489  1.00 153.37 ? 630 LYS O CD    1 
ATOM 7451 C CE    . LYS E 3 253 ? -2.655  46.349 14.699  1.00 151.17 ? 630 LYS O CE    1 
ATOM 7452 N NZ    . LYS E 3 253 ? -2.762  45.148 15.574  1.00 148.97 ? 630 LYS O NZ    1 
ATOM 7453 N N     . ASP E 3 254 ? -7.775  49.503 14.287  1.00 184.28 ? 631 ASP O N     1 
ATOM 7454 C CA    . ASP E 3 254 ? -9.033  49.394 13.554  1.00 193.11 ? 631 ASP O CA    1 
ATOM 7455 C C     . ASP E 3 254 ? -9.030  50.157 12.232  1.00 193.80 ? 631 ASP O C     1 
ATOM 7456 O O     . ASP E 3 254 ? -8.505  49.683 11.222  1.00 198.50 ? 631 ASP O O     1 
ATOM 7457 C CB    . ASP E 3 254 ? -10.189 49.912 14.418  1.00 197.50 ? 631 ASP O CB    1 
ATOM 7458 C CG    . ASP E 3 254 ? -10.075 49.481 15.866  1.00 199.53 ? 631 ASP O CG    1 
ATOM 7459 O OD1   . ASP E 3 254 ? -9.086  49.864 16.526  1.00 200.00 ? 631 ASP O OD1   1 
ATOM 7460 O OD2   . ASP E 3 254 ? -10.972 48.759 16.345  1.00 200.00 ? 631 ASP O OD2   1 
ATOM 7461 N N     . LYS E 3 255 ? -9.631  51.344 12.262  1.00 190.91 ? 632 LYS O N     1 
ATOM 7462 C CA    . LYS E 3 255 ? -9.747  52.214 11.097  1.00 186.26 ? 632 LYS O CA    1 
ATOM 7463 C C     . LYS E 3 255 ? -8.493  52.228 10.222  1.00 188.84 ? 632 LYS O C     1 
ATOM 7464 O O     . LYS E 3 255 ? -8.584  52.335 8.996   1.00 196.16 ? 632 LYS O O     1 
ATOM 7465 C CB    . LYS E 3 255 ? -10.073 53.644 11.546  1.00 175.08 ? 632 LYS O CB    1 
ATOM 7466 C CG    . LYS E 3 255 ? -11.163 53.750 12.602  1.00 152.30 ? 632 LYS O CG    1 
ATOM 7467 C CD    . LYS E 3 255 ? -11.546 55.199 12.841  1.00 136.20 ? 632 LYS O CD    1 
ATOM 7468 C CE    . LYS E 3 255 ? -12.320 55.340 14.128  1.00 128.20 ? 632 LYS O CE    1 
ATOM 7469 N NZ    . LYS E 3 255 ? -11.486 54.868 15.269  1.00 123.70 ? 632 LYS O NZ    1 
ATOM 7470 N N     . SER E 3 256 ? -7.327  52.124 10.854  1.00 187.25 ? 633 SER O N     1 
ATOM 7471 C CA    . SER E 3 256 ? -6.059  52.134 10.134  1.00 182.45 ? 633 SER O CA    1 
ATOM 7472 C C     . SER E 3 256 ? -6.083  51.266 8.881   1.00 179.85 ? 633 SER O C     1 
ATOM 7473 O O     . SER E 3 256 ? -6.775  50.247 8.823   1.00 188.28 ? 633 SER O O     1 
ATOM 7474 C CB    . SER E 3 256 ? -4.920  51.681 11.056  1.00 182.03 ? 633 SER O CB    1 
ATOM 7475 O OG    . SER E 3 256 ? -4.635  52.669 12.034  1.00 165.81 ? 633 SER O OG    1 
ATOM 7476 N N     . GLN E 3 257 ? -5.323  51.689 7.878   1.00 171.01 ? 634 GLN O N     1 
ATOM 7477 C CA    . GLN E 3 257 ? -5.234  50.978 6.612   1.00 156.01 ? 634 GLN O CA    1 
ATOM 7478 C C     . GLN E 3 257 ? -3.817  51.066 6.059   1.00 148.25 ? 634 GLN O C     1 
ATOM 7479 O O     . GLN E 3 257 ? -2.969  51.759 6.621   1.00 152.59 ? 634 GLN O O     1 
ATOM 7480 C CB    . GLN E 3 257 ? -6.227  51.571 5.614   1.00 149.81 ? 634 GLN O CB    1 
ATOM 7481 C CG    . GLN E 3 257 ? -7.605  50.957 5.692   1.00 132.83 ? 634 GLN O CG    1 
ATOM 7482 C CD    . GLN E 3 257 ? -8.601  51.679 4.818   1.00 124.89 ? 634 GLN O CD    1 
ATOM 7483 O OE1   . GLN E 3 257 ? -9.664  51.147 4.501   1.00 119.88 ? 634 GLN O OE1   1 
ATOM 7484 N NE2   . GLN E 3 257 ? -8.267  52.908 4.431   1.00 120.58 ? 634 GLN O NE2   1 
ATOM 7485 N N     . PRO E 3 258 ? -3.537  50.359 4.951   1.00 136.85 ? 635 PRO O N     1 
ATOM 7486 C CA    . PRO E 3 258 ? -2.194  50.395 4.363   1.00 132.25 ? 635 PRO O CA    1 
ATOM 7487 C C     . PRO E 3 258 ? -1.643  51.813 4.188   1.00 131.34 ? 635 PRO O C     1 
ATOM 7488 O O     . PRO E 3 258 ? -0.438  52.003 4.011   1.00 132.74 ? 635 PRO O O     1 
ATOM 7489 C CB    . PRO E 3 258 ? -2.392  49.683 3.025   1.00 130.89 ? 635 PRO O CB    1 
ATOM 7490 C CG    . PRO E 3 258 ? -3.441  48.663 3.353   1.00 127.58 ? 635 PRO O CG    1 
ATOM 7491 C CD    . PRO E 3 258 ? -4.425  49.469 4.176   1.00 134.62 ? 635 PRO O CD    1 
ATOM 7492 N N     . ASN E 3 259 ? -2.526  52.804 4.260   1.00 136.23 ? 636 ASN O N     1 
ATOM 7493 C CA    . ASN E 3 259 ? -2.129  54.194 4.071   1.00 134.13 ? 636 ASN O CA    1 
ATOM 7494 C C     . ASN E 3 259 ? -2.504  55.175 5.185   1.00 126.64 ? 636 ASN O C     1 
ATOM 7495 O O     . ASN E 3 259 ? -2.057  56.325 5.171   1.00 118.05 ? 636 ASN O O     1 
ATOM 7496 C CB    . ASN E 3 259 ? -2.717  54.696 2.756   1.00 145.77 ? 636 ASN O CB    1 
ATOM 7497 C CG    . ASN E 3 259 ? -4.215  54.468 2.667   1.00 161.60 ? 636 ASN O CG    1 
ATOM 7498 O OD1   . ASN E 3 259 ? -4.840  54.784 1.658   1.00 173.83 ? 636 ASN O OD1   1 
ATOM 7499 N ND2   . ASN E 3 259 ? -4.798  53.917 3.728   1.00 172.89 ? 636 ASN O ND2   1 
ATOM 7500 N N     . MET E 3 260 ? -3.313  54.741 6.147   1.00 117.73 ? 637 MET O N     1 
ATOM 7501 C CA    . MET E 3 260 ? -3.721  55.648 7.215   1.00 117.34 ? 637 MET O CA    1 
ATOM 7502 C C     . MET E 3 260 ? -3.640  55.090 8.621   1.00 110.75 ? 637 MET O C     1 
ATOM 7503 O O     . MET E 3 260 ? -3.958  53.925 8.856   1.00 117.06 ? 637 MET O O     1 
ATOM 7504 C CB    . MET E 3 260 ? -5.149  56.110 6.985   1.00 125.97 ? 637 MET O CB    1 
ATOM 7505 C CG    . MET E 3 260 ? -5.400  56.664 5.621   1.00 131.69 ? 637 MET O CG    1 
ATOM 7506 S SD    . MET E 3 260 ? -7.022  57.376 5.602   1.00 134.30 ? 637 MET O SD    1 
ATOM 7507 C CE    . MET E 3 260 ? -6.631  59.030 6.183   1.00 136.00 ? 637 MET O CE    1 
ATOM 7508 N N     . LEU E 3 261 ? -3.227  55.941 9.557   1.00 99.59  ? 638 LEU O N     1 
ATOM 7509 C CA    . LEU E 3 261 ? -3.129  55.560 10.961  1.00 83.78  ? 638 LEU O CA    1 
ATOM 7510 C C     . LEU E 3 261 ? -3.840  56.566 11.853  1.00 80.52  ? 638 LEU O C     1 
ATOM 7511 O O     . LEU E 3 261 ? -3.791  57.777 11.614  1.00 78.76  ? 638 LEU O O     1 
ATOM 7512 C CB    . LEU E 3 261 ? -1.669  55.428 11.393  1.00 70.77  ? 638 LEU O CB    1 
ATOM 7513 C CG    . LEU E 3 261 ? -1.108  54.024 11.183  1.00 57.31  ? 638 LEU O CG    1 
ATOM 7514 C CD1   . LEU E 3 261 ? -1.148  53.711 9.728   1.00 50.99  ? 638 LEU O CD1   1 
ATOM 7515 C CD2   . LEU E 3 261 ? 0.312   53.911 11.686  1.00 51.50  ? 638 LEU O CD2   1 
ATOM 7516 N N     . PHE E 3 262 ? -4.515  56.047 12.873  1.00 78.39  ? 639 PHE O N     1 
ATOM 7517 C CA    . PHE E 3 262 ? -5.245  56.873 13.826  1.00 75.73  ? 639 PHE O CA    1 
ATOM 7518 C C     . PHE E 3 262 ? -4.521  56.716 15.150  1.00 68.56  ? 639 PHE O C     1 
ATOM 7519 O O     . PHE E 3 262 ? -4.540  55.654 15.768  1.00 66.67  ? 639 PHE O O     1 
ATOM 7520 C CB    . PHE E 3 262 ? -6.694  56.403 13.902  1.00 84.74  ? 639 PHE O CB    1 
ATOM 7521 C CG    . PHE E 3 262 ? -7.355  56.328 12.560  1.00 95.18  ? 639 PHE O CG    1 
ATOM 7522 C CD1   . PHE E 3 262 ? -7.088  55.269 11.699  1.00 100.43 ? 639 PHE O CD1   1 
ATOM 7523 C CD2   . PHE E 3 262 ? -8.168  57.363 12.113  1.00 100.21 ? 639 PHE O CD2   1 
ATOM 7524 C CE1   . PHE E 3 262 ? -7.615  55.246 10.410  1.00 104.25 ? 639 PHE O CE1   1 
ATOM 7525 C CE2   . PHE E 3 262 ? -8.700  57.348 10.828  1.00 103.81 ? 639 PHE O CE2   1 
ATOM 7526 C CZ    . PHE E 3 262 ? -8.420  56.287 9.975   1.00 105.10 ? 639 PHE O CZ    1 
ATOM 7527 N N     . VAL E 3 263 ? -3.865  57.789 15.568  1.00 60.29  ? 640 VAL O N     1 
ATOM 7528 C CA    . VAL E 3 263 ? -3.064  57.771 16.774  1.00 55.56  ? 640 VAL O CA    1 
ATOM 7529 C C     . VAL E 3 263 ? -3.682  58.548 17.924  1.00 57.56  ? 640 VAL O C     1 
ATOM 7530 O O     . VAL E 3 263 ? -4.126  59.676 17.733  1.00 58.32  ? 640 VAL O O     1 
ATOM 7531 C CB    . VAL E 3 263 ? -1.666  58.385 16.476  1.00 50.08  ? 640 VAL O CB    1 
ATOM 7532 C CG1   . VAL E 3 263 ? -0.658  57.984 17.539  1.00 45.51  ? 640 VAL O CG1   1 
ATOM 7533 C CG2   . VAL E 3 263 ? -1.194  57.948 15.130  1.00 43.95  ? 640 VAL O CG2   1 
ATOM 7534 N N     . GLU E 3 264 ? -3.728  57.951 19.113  1.00 59.99  ? 641 GLU O N     1 
ATOM 7535 C CA    . GLU E 3 264 ? -4.236  58.688 20.265  1.00 61.42  ? 641 GLU O CA    1 
ATOM 7536 C C     . GLU E 3 264 ? -3.037  59.434 20.837  1.00 55.01  ? 641 GLU O C     1 
ATOM 7537 O O     . GLU E 3 264 ? -2.178  58.836 21.497  1.00 51.29  ? 641 GLU O O     1 
ATOM 7538 C CB    . GLU E 3 264 ? -4.798  57.759 21.341  1.00 73.51  ? 641 GLU O CB    1 
ATOM 7539 C CG    . GLU E 3 264 ? -5.069  58.483 22.670  1.00 92.95  ? 641 GLU O CG    1 
ATOM 7540 C CD    . GLU E 3 264 ? -5.689  57.588 23.732  1.00 103.17 ? 641 GLU O CD    1 
ATOM 7541 O OE1   . GLU E 3 264 ? -5.151  56.489 23.986  1.00 108.53 ? 641 GLU O OE1   1 
ATOM 7542 O OE2   . GLU E 3 264 ? -6.715  57.992 24.319  1.00 108.83 ? 641 GLU O OE2   1 
ATOM 7543 N N     . ILE E 3 265 ? -2.966  60.733 20.571  1.00 48.67  ? 642 ILE O N     1 
ATOM 7544 C CA    . ILE E 3 265 ? -1.858  61.543 21.068  1.00 45.23  ? 642 ILE O CA    1 
ATOM 7545 C C     . ILE E 3 265 ? -1.612  61.300 22.557  1.00 47.46  ? 642 ILE O C     1 
ATOM 7546 O O     . ILE E 3 265 ? -2.457  61.604 23.397  1.00 44.29  ? 642 ILE O O     1 
ATOM 7547 C CB    . ILE E 3 265 ? -2.133  63.034 20.812  1.00 42.28  ? 642 ILE O CB    1 
ATOM 7548 C CG1   . ILE E 3 265 ? -2.313  63.235 19.299  1.00 43.64  ? 642 ILE O CG1   1 
ATOM 7549 C CG2   . ILE E 3 265 ? -0.994  63.894 21.369  1.00 40.22  ? 642 ILE O CG2   1 
ATOM 7550 C CD1   . ILE E 3 265 ? -2.738  64.611 18.878  1.00 44.88  ? 642 ILE O CD1   1 
ATOM 7551 N N     . PRO E 3 266 ? -0.447  60.737 22.907  1.00 51.81  ? 643 PRO O N     1 
ATOM 7552 C CA    . PRO E 3 266 ? -0.192  60.493 24.326  1.00 52.86  ? 643 PRO O CA    1 
ATOM 7553 C C     . PRO E 3 266 ? -0.195  61.765 25.170  1.00 53.57  ? 643 PRO O C     1 
ATOM 7554 O O     . PRO E 3 266 ? -0.280  62.884 24.665  1.00 52.24  ? 643 PRO O O     1 
ATOM 7555 C CB    . PRO E 3 266 ? 1.170   59.804 24.316  1.00 53.59  ? 643 PRO O CB    1 
ATOM 7556 C CG    . PRO E 3 266 ? 1.850   60.471 23.180  1.00 55.86  ? 643 PRO O CG    1 
ATOM 7557 C CD    . PRO E 3 266 ? 0.765   60.481 22.113  1.00 53.11  ? 643 PRO O CD    1 
ATOM 7558 N N     . GLU E 3 267 ? -0.102  61.566 26.471  1.00 55.36  ? 644 GLU O N     1 
ATOM 7559 C CA    . GLU E 3 267 ? -0.089  62.653 27.428  1.00 58.13  ? 644 GLU O CA    1 
ATOM 7560 C C     . GLU E 3 267 ? 1.359   63.130 27.561  1.00 57.25  ? 644 GLU O C     1 
ATOM 7561 O O     . GLU E 3 267 ? 2.275   62.309 27.644  1.00 55.56  ? 644 GLU O O     1 
ATOM 7562 C CB    . GLU E 3 267 ? -0.612  62.107 28.757  1.00 62.78  ? 644 GLU O CB    1 
ATOM 7563 C CG    . GLU E 3 267 ? -0.666  63.080 29.904  1.00 69.79  ? 644 GLU O CG    1 
ATOM 7564 C CD    . GLU E 3 267 ? -0.665  62.360 31.236  1.00 73.22  ? 644 GLU O CD    1 
ATOM 7565 O OE1   . GLU E 3 267 ? -1.511  61.450 31.428  1.00 73.41  ? 644 GLU O OE1   1 
ATOM 7566 O OE2   . GLU E 3 267 ? 0.188   62.711 32.084  1.00 75.24  ? 644 GLU O OE2   1 
ATOM 7567 N N     . TYR E 3 268 ? 1.582   64.441 27.571  1.00 58.54  ? 645 TYR O N     1 
ATOM 7568 C CA    . TYR E 3 268 ? 2.948   64.928 27.703  1.00 61.72  ? 645 TYR O CA    1 
ATOM 7569 C C     . TYR E 3 268 ? 3.494   64.662 29.095  1.00 63.09  ? 645 TYR O C     1 
ATOM 7570 O O     . TYR E 3 268 ? 2.756   64.722 30.082  1.00 62.48  ? 645 TYR O O     1 
ATOM 7571 C CB    . TYR E 3 268 ? 3.052   66.416 27.419  1.00 64.58  ? 645 TYR O CB    1 
ATOM 7572 C CG    . TYR E 3 268 ? 4.491   66.849 27.430  1.00 71.15  ? 645 TYR O CG    1 
ATOM 7573 C CD1   . TYR E 3 268 ? 5.443   66.162 26.675  1.00 73.76  ? 645 TYR O CD1   1 
ATOM 7574 C CD2   . TYR E 3 268 ? 4.919   67.908 28.224  1.00 75.07  ? 645 TYR O CD2   1 
ATOM 7575 C CE1   . TYR E 3 268 ? 6.788   66.513 26.711  1.00 75.70  ? 645 TYR O CE1   1 
ATOM 7576 C CE2   . TYR E 3 268 ? 6.270   68.272 28.266  1.00 77.34  ? 645 TYR O CE2   1 
ATOM 7577 C CZ    . TYR E 3 268 ? 7.198   67.565 27.509  1.00 76.82  ? 645 TYR O CZ    1 
ATOM 7578 O OH    . TYR E 3 268 ? 8.531   67.896 27.570  1.00 76.52  ? 645 TYR O OH    1 
ATOM 7579 N N     . ARG E 3 269 ? 4.791   64.383 29.176  1.00 65.36  ? 646 ARG O N     1 
ATOM 7580 C CA    . ARG E 3 269 ? 5.435   64.074 30.453  1.00 69.02  ? 646 ARG O CA    1 
ATOM 7581 C C     . ARG E 3 269 ? 5.290   65.153 31.515  1.00 67.69  ? 646 ARG O C     1 
ATOM 7582 O O     . ARG E 3 269 ? 4.969   64.857 32.661  1.00 66.92  ? 646 ARG O O     1 
ATOM 7583 C CB    . ARG E 3 269 ? 6.917   63.778 30.238  1.00 75.19  ? 646 ARG O CB    1 
ATOM 7584 C CG    . ARG E 3 269 ? 7.708   64.956 29.730  1.00 85.05  ? 646 ARG O CG    1 
ATOM 7585 C CD    . ARG E 3 269 ? 9.117   64.547 29.403  1.00 92.77  ? 646 ARG O CD    1 
ATOM 7586 N NE    . ARG E 3 269 ? 9.893   65.686 28.942  1.00 99.66  ? 646 ARG O NE    1 
ATOM 7587 C CZ    . ARG E 3 269 ? 10.389  66.615 29.745  1.00 103.16 ? 646 ARG O CZ    1 
ATOM 7588 N NH1   . ARG E 3 269 ? 10.192  66.531 31.055  1.00 105.21 ? 646 ARG O NH1   1 
ATOM 7589 N NH2   . ARG E 3 269 ? 11.075  67.627 29.235  1.00 105.61 ? 646 ARG O NH2   1 
ATOM 7590 N N     . ASN E 3 270 ? 5.541   66.401 31.145  1.00 68.18  ? 647 ASN O N     1 
ATOM 7591 C CA    . ASN E 3 270 ? 5.413   67.488 32.095  1.00 69.86  ? 647 ASN O CA    1 
ATOM 7592 C C     . ASN E 3 270 ? 4.000   68.037 31.966  1.00 68.19  ? 647 ASN O C     1 
ATOM 7593 O O     . ASN E 3 270 ? 3.598   68.491 30.889  1.00 67.00  ? 647 ASN O O     1 
ATOM 7594 C CB    . ASN E 3 270 ? 6.440   68.577 31.809  1.00 77.93  ? 647 ASN O CB    1 
ATOM 7595 C CG    . ASN E 3 270 ? 6.593   69.541 32.963  1.00 86.79  ? 647 ASN O CG    1 
ATOM 7596 O OD1   . ASN E 3 270 ? 5.700   70.340 33.241  1.00 92.75  ? 647 ASN O OD1   1 
ATOM 7597 N ND2   . ASN E 3 270 ? 7.724   69.461 33.655  1.00 92.82  ? 647 ASN O ND2   1 
ATOM 7598 N N     . LYS E 3 271 ? 3.255   67.983 33.072  1.00 66.07  ? 648 LYS O N     1 
ATOM 7599 C CA    . LYS E 3 271 ? 1.867   68.429 33.114  1.00 63.89  ? 648 LYS O CA    1 
ATOM 7600 C C     . LYS E 3 271 ? 1.666   69.922 33.314  1.00 62.73  ? 648 LYS O C     1 
ATOM 7601 O O     . LYS E 3 271 ? 0.775   70.507 32.702  1.00 61.69  ? 648 LYS O O     1 
ATOM 7602 C CB    . LYS E 3 271 ? 1.125   67.703 34.222  1.00 65.26  ? 648 LYS O CB    1 
ATOM 7603 C CG    . LYS E 3 271 ? 1.508   66.249 34.365  1.00 72.14  ? 648 LYS O CG    1 
ATOM 7604 C CD    . LYS E 3 271 ? 0.644   65.553 35.404  1.00 75.18  ? 648 LYS O CD    1 
ATOM 7605 C CE    . LYS E 3 271 ? -0.773  65.389 34.907  1.00 77.51  ? 648 LYS O CE    1 
ATOM 7606 N NZ    . LYS E 3 271 ? -1.324  66.678 34.397  1.00 79.28  ? 648 LYS O NZ    1 
ATOM 7607 N N     . HIS E 3 272 ? 2.489   70.539 34.160  1.00 62.29  ? 649 HIS O N     1 
ATOM 7608 C CA    . HIS E 3 272 ? 2.342   71.963 34.450  1.00 63.33  ? 649 HIS O CA    1 
ATOM 7609 C C     . HIS E 3 272 ? 3.146   72.916 33.556  1.00 65.08  ? 649 HIS O C     1 
ATOM 7610 O O     . HIS E 3 272 ? 3.421   74.052 33.943  1.00 62.83  ? 649 HIS O O     1 
ATOM 7611 C CB    . HIS E 3 272 ? 2.685   72.231 35.925  1.00 63.52  ? 649 HIS O CB    1 
ATOM 7612 C CG    . HIS E 3 272 ? 2.032   71.284 36.888  1.00 66.22  ? 649 HIS O CG    1 
ATOM 7613 N ND1   . HIS E 3 272 ? 2.633   70.115 37.309  1.00 67.93  ? 649 HIS O ND1   1 
ATOM 7614 C CD2   . HIS E 3 272 ? 0.825   71.324 37.502  1.00 67.12  ? 649 HIS O CD2   1 
ATOM 7615 C CE1   . HIS E 3 272 ? 1.826   69.477 38.139  1.00 67.64  ? 649 HIS O CE1   1 
ATOM 7616 N NE2   . HIS E 3 272 ? 0.722   70.189 38.273  1.00 67.79  ? 649 HIS O NE2   1 
ATOM 7617 N N     . ILE E 3 273 ? 3.503   72.476 32.355  1.00 69.21  ? 650 ILE O N     1 
ATOM 7618 C CA    . ILE E 3 273 ? 4.287   73.316 31.453  1.00 74.48  ? 650 ILE O CA    1 
ATOM 7619 C C     . ILE E 3 273 ? 3.603   74.651 31.159  1.00 81.76  ? 650 ILE O C     1 
ATOM 7620 O O     . ILE E 3 273 ? 2.375   74.740 31.161  1.00 80.85  ? 650 ILE O O     1 
ATOM 7621 C CB    . ILE E 3 273 ? 4.559   72.599 30.107  1.00 71.22  ? 650 ILE O CB    1 
ATOM 7622 C CG1   . ILE E 3 273 ? 3.360   72.748 29.170  1.00 69.13  ? 650 ILE O CG1   1 
ATOM 7623 C CG2   . ILE E 3 273 ? 4.831   71.120 30.352  1.00 69.83  ? 650 ILE O CG2   1 
ATOM 7624 C CD1   . ILE E 3 273 ? 3.609   72.212 27.783  1.00 68.33  ? 650 ILE O CD1   1 
ATOM 7625 N N     . ARG E 3 274 ? 4.407   75.682 30.901  1.00 90.57  ? 651 ARG O N     1 
ATOM 7626 C CA    . ARG E 3 274 ? 3.886   77.011 30.593  1.00 102.23 ? 651 ARG O CA    1 
ATOM 7627 C C     . ARG E 3 274 ? 3.961   77.347 29.115  1.00 109.58 ? 651 ARG O C     1 
ATOM 7628 O O     . ARG E 3 274 ? 2.951   77.645 28.491  1.00 113.06 ? 651 ARG O O     1 
ATOM 7629 C CB    . ARG E 3 274 ? 4.637   78.082 31.383  1.00 104.85 ? 651 ARG O CB    1 
ATOM 7630 C CG    . ARG E 3 274 ? 4.232   78.141 32.830  1.00 106.35 ? 651 ARG O CG    1 
ATOM 7631 C CD    . ARG E 3 274 ? 2.722   78.220 32.927  1.00 108.14 ? 651 ARG O CD    1 
ATOM 7632 N NE    . ARG E 3 274 ? 2.250   78.215 34.306  1.00 111.45 ? 651 ARG O NE    1 
ATOM 7633 C CZ    . ARG E 3 274 ? 0.972   78.101 34.650  1.00 113.52 ? 651 ARG O CZ    1 
ATOM 7634 N NH1   . ARG E 3 274 ? 0.037   77.979 33.713  1.00 114.68 ? 651 ARG O NH1   1 
ATOM 7635 N NH2   . ARG E 3 274 ? 0.628   78.116 35.931  1.00 115.53 ? 651 ARG O NH2   1 
ATOM 7636 N N     . THR E 3 275 ? 5.164   77.317 28.559  1.00 117.44 ? 652 THR O N     1 
ATOM 7637 C CA    . THR E 3 275 ? 5.348   77.622 27.148  1.00 119.39 ? 652 THR O CA    1 
ATOM 7638 C C     . THR E 3 275 ? 5.262   76.352 26.321  1.00 103.89 ? 652 THR O C     1 
ATOM 7639 O O     . THR E 3 275 ? 5.692   75.286 26.761  1.00 104.23 ? 652 THR O O     1 
ATOM 7640 C CB    . THR E 3 275 ? 6.719   78.275 26.894  1.00 134.86 ? 652 THR O CB    1 
ATOM 7641 O OG1   . THR E 3 275 ? 6.754   79.561 27.522  1.00 152.55 ? 652 THR O OG1   1 
ATOM 7642 C CG2   . THR E 3 275 ? 6.979   78.432 25.398  1.00 151.97 ? 652 THR O CG2   1 
ATOM 7643 N N     . PRO E 3 276 ? 4.689   76.446 25.112  1.00 90.52  ? 653 PRO O N     1 
ATOM 7644 C CA    . PRO E 3 276 ? 4.571   75.275 24.246  1.00 82.70  ? 653 PRO O CA    1 
ATOM 7645 C C     . PRO E 3 276 ? 5.897   74.534 24.121  1.00 80.67  ? 653 PRO O C     1 
ATOM 7646 O O     . PRO E 3 276 ? 6.953   75.145 23.938  1.00 85.14  ? 653 PRO O O     1 
ATOM 7647 C CB    . PRO E 3 276 ? 4.116   75.881 22.928  1.00 79.73  ? 653 PRO O CB    1 
ATOM 7648 C CG    . PRO E 3 276 ? 3.196   76.954 23.387  1.00 76.03  ? 653 PRO O CG    1 
ATOM 7649 C CD    . PRO E 3 276 ? 3.977   77.596 24.526  1.00 83.80  ? 653 PRO O CD    1 
ATOM 7650 N N     . VAL E 3 277 ? 5.834   73.214 24.252  1.00 80.06  ? 654 VAL O N     1 
ATOM 7651 C CA    . VAL E 3 277 ? 7.014   72.375 24.134  1.00 75.79  ? 654 VAL O CA    1 
ATOM 7652 C C     . VAL E 3 277 ? 6.881   71.632 22.817  1.00 76.99  ? 654 VAL O C     1 
ATOM 7653 O O     . VAL E 3 277 ? 5.854   71.004 22.550  1.00 77.41  ? 654 VAL O O     1 
ATOM 7654 C CB    . VAL E 3 277 ? 7.101   71.352 25.283  1.00 71.55  ? 654 VAL O CB    1 
ATOM 7655 C CG1   . VAL E 3 277 ? 8.186   70.341 25.002  1.00 65.28  ? 654 VAL O CG1   1 
ATOM 7656 C CG2   . VAL E 3 277 ? 7.397   72.065 26.584  1.00 68.24  ? 654 VAL O CG2   1 
ATOM 7657 N N     . LYS E 3 278 ? 7.917   71.730 21.990  1.00 76.66  ? 655 LYS O N     1 
ATOM 7658 C CA    . LYS E 3 278 ? 7.944   71.075 20.692  1.00 75.72  ? 655 LYS O CA    1 
ATOM 7659 C C     . LYS E 3 278 ? 8.536   69.679 20.885  1.00 73.31  ? 655 LYS O C     1 
ATOM 7660 O O     . LYS E 3 278 ? 9.568   69.516 21.529  1.00 70.16  ? 655 LYS O O     1 
ATOM 7661 C CB    . LYS E 3 278 ? 8.800   71.899 19.728  1.00 84.10  ? 655 LYS O CB    1 
ATOM 7662 C CG    . LYS E 3 278 ? 8.845   71.363 18.307  1.00 95.40  ? 655 LYS O CG    1 
ATOM 7663 C CD    . LYS E 3 278 ? 7.702   71.886 17.448  1.00 104.48 ? 655 LYS O CD    1 
ATOM 7664 C CE    . LYS E 3 278 ? 7.825   73.387 17.206  1.00 110.79 ? 655 LYS O CE    1 
ATOM 7665 N NZ    . LYS E 3 278 ? 6.848   73.871 16.189  1.00 116.07 ? 655 LYS O NZ    1 
ATOM 7666 N N     . VAL E 3 279 ? 7.868   68.671 20.344  1.00 74.50  ? 656 VAL O N     1 
ATOM 7667 C CA    . VAL E 3 279 ? 8.336   67.299 20.467  1.00 73.73  ? 656 VAL O CA    1 
ATOM 7668 C C     . VAL E 3 279 ? 8.310   66.628 19.110  1.00 70.04  ? 656 VAL O C     1 
ATOM 7669 O O     . VAL E 3 279 ? 7.681   67.133 18.177  1.00 62.88  ? 656 VAL O O     1 
ATOM 7670 C CB    . VAL E 3 279 ? 7.451   66.478 21.432  1.00 77.72  ? 656 VAL O CB    1 
ATOM 7671 C CG1   . VAL E 3 279 ? 7.663   66.943 22.855  1.00 89.41  ? 656 VAL O CG1   1 
ATOM 7672 C CG2   . VAL E 3 279 ? 5.987   66.624 21.052  1.00 88.41  ? 656 VAL O CG2   1 
ATOM 7673 N N     . ASN E 3 280 ? 8.987   65.482 19.019  1.00 66.92  ? 657 ASN O N     1 
ATOM 7674 C CA    . ASN E 3 280 ? 9.089   64.694 17.787  1.00 68.84  ? 657 ASN O CA    1 
ATOM 7675 C C     . ASN E 3 280 ? 8.384   63.347 17.932  1.00 67.39  ? 657 ASN O C     1 
ATOM 7676 O O     . ASN E 3 280 ? 8.354   62.769 19.019  1.00 71.65  ? 657 ASN O O     1 
ATOM 7677 C CB    . ASN E 3 280 ? 10.567  64.437 17.452  1.00 74.83  ? 657 ASN O CB    1 
ATOM 7678 C CG    . ASN E 3 280 ? 11.272  65.661 16.895  1.00 78.02  ? 657 ASN O CG    1 
ATOM 7679 O OD1   . ASN E 3 280 ? 12.504  65.718 16.864  1.00 78.56  ? 657 ASN O OD1   1 
ATOM 7680 N ND2   . ASN E 3 280 ? 10.497  66.641 16.436  1.00 79.85  ? 657 ASN O ND2   1 
ATOM 7681 N N     . PHE E 3 281 ? 7.817   62.850 16.835  1.00 65.55  ? 658 PHE O N     1 
ATOM 7682 C CA    . PHE E 3 281 ? 7.142   61.550 16.843  1.00 59.27  ? 658 PHE O CA    1 
ATOM 7683 C C     . PHE E 3 281 ? 7.467   60.825 15.547  1.00 55.17  ? 658 PHE O C     1 
ATOM 7684 O O     . PHE E 3 281 ? 7.892   61.450 14.579  1.00 52.37  ? 658 PHE O O     1 
ATOM 7685 C CB    . PHE E 3 281 ? 5.619   61.716 17.027  1.00 58.15  ? 658 PHE O CB    1 
ATOM 7686 C CG    . PHE E 3 281 ? 4.864   62.133 15.779  1.00 57.45  ? 658 PHE O CG    1 
ATOM 7687 C CD1   . PHE E 3 281 ? 4.476   61.191 14.834  1.00 56.88  ? 658 PHE O CD1   1 
ATOM 7688 C CD2   . PHE E 3 281 ? 4.474   63.459 15.595  1.00 57.58  ? 658 PHE O CD2   1 
ATOM 7689 C CE1   . PHE E 3 281 ? 3.703   61.562 13.730  1.00 57.06  ? 658 PHE O CE1   1 
ATOM 7690 C CE2   . PHE E 3 281 ? 3.704   63.837 14.498  1.00 57.10  ? 658 PHE O CE2   1 
ATOM 7691 C CZ    . PHE E 3 281 ? 3.317   62.886 13.566  1.00 57.63  ? 658 PHE O CZ    1 
ATOM 7692 N N     . TYR E 3 282 ? 7.279   59.514 15.518  1.00 50.56  ? 659 TYR O N     1 
ATOM 7693 C CA    . TYR E 3 282 ? 7.607   58.773 14.312  1.00 49.44  ? 659 TYR O CA    1 
ATOM 7694 C C     . TYR E 3 282 ? 6.963   57.403 14.250  1.00 48.83  ? 659 TYR O C     1 
ATOM 7695 O O     . TYR E 3 282 ? 6.671   56.798 15.284  1.00 50.09  ? 659 TYR O O     1 
ATOM 7696 C CB    . TYR E 3 282 ? 9.122   58.612 14.214  1.00 49.91  ? 659 TYR O CB    1 
ATOM 7697 C CG    . TYR E 3 282 ? 9.733   57.835 15.364  1.00 50.66  ? 659 TYR O CG    1 
ATOM 7698 C CD1   . TYR E 3 282 ? 9.602   56.443 15.445  1.00 51.80  ? 659 TYR O CD1   1 
ATOM 7699 C CD2   . TYR E 3 282 ? 10.436  58.490 16.378  1.00 50.62  ? 659 TYR O CD2   1 
ATOM 7700 C CE1   . TYR E 3 282 ? 10.161  55.718 16.510  1.00 51.74  ? 659 TYR O CE1   1 
ATOM 7701 C CE2   . TYR E 3 282 ? 10.995  57.780 17.448  1.00 50.69  ? 659 TYR O CE2   1 
ATOM 7702 C CZ    . TYR E 3 282 ? 10.854  56.396 17.508  1.00 51.97  ? 659 TYR O CZ    1 
ATOM 7703 O OH    . TYR E 3 282 ? 11.399  55.695 18.564  1.00 52.04  ? 659 TYR O OH    1 
ATOM 7704 N N     . VAL E 3 283 ? 6.745   56.919 13.027  1.00 46.73  ? 660 VAL O N     1 
ATOM 7705 C CA    . VAL E 3 283 ? 6.165   55.599 12.811  1.00 43.20  ? 660 VAL O CA    1 
ATOM 7706 C C     . VAL E 3 283 ? 7.346   54.653 12.788  1.00 44.95  ? 660 VAL O C     1 
ATOM 7707 O O     . VAL E 3 283 ? 8.475   55.066 12.528  1.00 43.22  ? 660 VAL O O     1 
ATOM 7708 C CB    . VAL E 3 283 ? 5.448   55.482 11.450  1.00 40.36  ? 660 VAL O CB    1 
ATOM 7709 C CG1   . VAL E 3 283 ? 4.778   54.112 11.330  1.00 37.36  ? 660 VAL O CG1   1 
ATOM 7710 C CG2   . VAL E 3 283 ? 4.435   56.599 11.294  1.00 38.35  ? 660 VAL O CG2   1 
ATOM 7711 N N     . ILE E 3 284 ? 7.093   53.386 13.067  1.00 48.16  ? 661 ILE O N     1 
ATOM 7712 C CA    . ILE E 3 284 ? 8.162   52.417 13.056  1.00 52.28  ? 661 ILE O CA    1 
ATOM 7713 C C     . ILE E 3 284 ? 7.611   51.021 13.087  1.00 58.25  ? 661 ILE O C     1 
ATOM 7714 O O     . ILE E 3 284 ? 6.761   50.700 13.909  1.00 57.05  ? 661 ILE O O     1 
ATOM 7715 C CB    . ILE E 3 284 ? 9.112   52.600 14.244  1.00 49.15  ? 661 ILE O CB    1 
ATOM 7716 C CG1   . ILE E 3 284 ? 10.028  51.386 14.355  1.00 48.81  ? 661 ILE O CG1   1 
ATOM 7717 C CG2   . ILE E 3 284 ? 8.331   52.787 15.509  1.00 47.01  ? 661 ILE O CG2   1 
ATOM 7718 C CD1   . ILE E 3 284 ? 11.173  51.591 15.292  1.00 50.29  ? 661 ILE O CD1   1 
ATOM 7719 N N     . ASN E 3 285 ? 8.092   50.204 12.157  1.00 66.56  ? 662 ASN O N     1 
ATOM 7720 C CA    . ASN E 3 285 ? 7.684   48.818 12.056  1.00 76.17  ? 662 ASN O CA    1 
ATOM 7721 C C     . ASN E 3 285 ? 8.907   48.067 12.536  1.00 82.09  ? 662 ASN O C     1 
ATOM 7722 O O     . ASN E 3 285 ? 9.998   48.637 12.594  1.00 84.52  ? 662 ASN O O     1 
ATOM 7723 C CB    . ASN E 3 285 ? 7.385   48.448 10.603  1.00 76.39  ? 662 ASN O CB    1 
ATOM 7724 C CG    . ASN E 3 285 ? 6.640   49.540 9.863   1.00 76.96  ? 662 ASN O CG    1 
ATOM 7725 O OD1   . ASN E 3 285 ? 5.525   49.909 10.227  1.00 77.33  ? 662 ASN O OD1   1 
ATOM 7726 N ND2   . ASN E 3 285 ? 7.260   50.069 8.815   1.00 76.44  ? 662 ASN O ND2   1 
ATOM 7727 N N     . GLY E 3 286 ? 8.731   46.800 12.887  1.00 86.98  ? 663 GLY O N     1 
ATOM 7728 C CA    . GLY E 3 286 ? 9.858   46.019 13.353  1.00 91.39  ? 663 GLY O CA    1 
ATOM 7729 C C     . GLY E 3 286 ? 10.727  46.785 14.333  1.00 92.07  ? 663 GLY O C     1 
ATOM 7730 O O     . GLY E 3 286 ? 10.228  47.605 15.104  1.00 95.16  ? 663 GLY O O     1 
ATOM 7731 N N     . LYS E 3 287 ? 12.034  46.541 14.280  1.00 90.99  ? 664 LYS O N     1 
ATOM 7732 C CA    . LYS E 3 287 ? 12.977  47.178 15.192  1.00 85.98  ? 664 LYS O CA    1 
ATOM 7733 C C     . LYS E 3 287 ? 13.875  48.263 14.597  1.00 85.07  ? 664 LYS O C     1 
ATOM 7734 O O     . LYS E 3 287 ? 14.336  49.144 15.318  1.00 81.27  ? 664 LYS O O     1 
ATOM 7735 C CB    . LYS E 3 287 ? 13.834  46.092 15.845  1.00 83.19  ? 664 LYS O CB    1 
ATOM 7736 C CG    . LYS E 3 287 ? 13.003  45.106 16.665  1.00 83.73  ? 664 LYS O CG    1 
ATOM 7737 C CD    . LYS E 3 287 ? 13.790  43.868 17.089  1.00 84.43  ? 664 LYS O CD    1 
ATOM 7738 C CE    . LYS E 3 287 ? 13.213  43.258 18.368  1.00 84.33  ? 664 LYS O CE    1 
ATOM 7739 N NZ    . LYS E 3 287 ? 11.741  43.047 18.291  1.00 84.51  ? 664 LYS O NZ    1 
ATOM 7740 N N     . ARG E 3 288 ? 14.114  48.206 13.289  1.00 87.11  ? 665 ARG O N     1 
ATOM 7741 C CA    . ARG E 3 288 ? 14.976  49.178 12.612  1.00 88.99  ? 665 ARG O CA    1 
ATOM 7742 C C     . ARG E 3 288 ? 14.145  50.087 11.716  1.00 87.18  ? 665 ARG O C     1 
ATOM 7743 O O     . ARG E 3 288 ? 14.352  51.297 11.663  1.00 84.05  ? 665 ARG O O     1 
ATOM 7744 C CB    . ARG E 3 288 ? 16.002  48.438 11.757  1.00 94.73  ? 665 ARG O CB    1 
ATOM 7745 C CG    . ARG E 3 288 ? 16.428  47.106 12.346  1.00 108.27 ? 665 ARG O CG    1 
ATOM 7746 C CD    . ARG E 3 288 ? 17.241  46.282 11.361  1.00 121.51 ? 665 ARG O CD    1 
ATOM 7747 N NE    . ARG E 3 288 ? 17.605  44.973 11.903  1.00 132.81 ? 665 ARG O NE    1 
ATOM 7748 C CZ    . ARG E 3 288 ? 18.399  44.780 12.955  1.00 138.38 ? 665 ARG O CZ    1 
ATOM 7749 N NH1   . ARG E 3 288 ? 18.927  45.815 13.598  1.00 141.88 ? 665 ARG O NH1   1 
ATOM 7750 N NH2   . ARG E 3 288 ? 18.674  43.548 13.364  1.00 141.38 ? 665 ARG O NH2   1 
ATOM 7751 N N     . LYS E 3 289 ? 13.200  49.475 11.014  1.00 85.09  ? 666 LYS O N     1 
ATOM 7752 C CA    . LYS E 3 289 ? 12.316  50.173 10.093  1.00 87.84  ? 666 LYS O CA    1 
ATOM 7753 C C     . LYS E 3 289 ? 11.498  51.270 10.768  1.00 83.58  ? 666 LYS O C     1 
ATOM 7754 O O     . LYS E 3 289 ? 10.433  51.007 11.326  1.00 87.65  ? 666 LYS O O     1 
ATOM 7755 C CB    . LYS E 3 289 ? 11.381  49.157 9.427   1.00 97.17  ? 666 LYS O CB    1 
ATOM 7756 C CG    . LYS E 3 289 ? 12.100  47.923 8.900   1.00 102.15 ? 666 LYS O CG    1 
ATOM 7757 C CD    . LYS E 3 289 ? 13.293  48.328 8.050   1.00 106.64 ? 666 LYS O CD    1 
ATOM 7758 C CE    . LYS E 3 289 ? 14.129  47.131 7.625   1.00 109.20 ? 666 LYS O CE    1 
ATOM 7759 N NZ    . LYS E 3 289 ? 15.313  47.538 6.800   1.00 110.90 ? 666 LYS O NZ    1 
ATOM 7760 N N     . ARG E 3 290 ? 11.996  52.502 10.705  1.00 78.29  ? 667 ARG O N     1 
ATOM 7761 C CA    . ARG E 3 290 ? 11.305  53.637 11.311  1.00 66.64  ? 667 ARG O CA    1 
ATOM 7762 C C     . ARG E 3 290 ? 11.292  54.868 10.400  1.00 59.33  ? 667 ARG O C     1 
ATOM 7763 O O     . ARG E 3 290 ? 12.290  55.208 9.778   1.00 52.81  ? 667 ARG O O     1 
ATOM 7764 C CB    . ARG E 3 290 ? 11.971  54.023 12.625  1.00 65.48  ? 667 ARG O CB    1 
ATOM 7765 C CG    . ARG E 3 290 ? 13.297  54.721 12.428  1.00 70.33  ? 667 ARG O CG    1 
ATOM 7766 C CD    . ARG E 3 290 ? 13.572  55.687 13.557  1.00 75.29  ? 667 ARG O CD    1 
ATOM 7767 N NE    . ARG E 3 290 ? 13.700  55.001 14.837  1.00 79.15  ? 667 ARG O NE    1 
ATOM 7768 C CZ    . ARG E 3 290 ? 14.079  55.596 15.961  1.00 80.86  ? 667 ARG O CZ    1 
ATOM 7769 N NH1   . ARG E 3 290 ? 14.362  56.895 15.958  1.00 81.10  ? 667 ARG O NH1   1 
ATOM 7770 N NH2   . ARG E 3 290 ? 14.192  54.891 17.081  1.00 81.47  ? 667 ARG O NH2   1 
ATOM 7771 N N     . SER E 3 291 ? 10.158  55.551 10.346  1.00 53.32  ? 668 SER O N     1 
ATOM 7772 C CA    . SER E 3 291 ? 10.031  56.737 9.515   1.00 51.90  ? 668 SER O CA    1 
ATOM 7773 C C     . SER E 3 291 ? 11.051  57.782 9.918   1.00 53.98  ? 668 SER O C     1 
ATOM 7774 O O     . SER E 3 291 ? 12.041  57.487 10.581  1.00 53.43  ? 668 SER O O     1 
ATOM 7775 C CB    . SER E 3 291 ? 8.649   57.353 9.668   1.00 49.98  ? 668 SER O CB    1 
ATOM 7776 O OG    . SER E 3 291 ? 8.589   58.099 10.871  1.00 47.53  ? 668 SER O OG    1 
ATOM 7777 N N     . GLN E 3 292 ? 10.771  59.018 9.528   1.00 60.07  ? 669 GLN O N     1 
ATOM 7778 C CA    . GLN E 3 292 ? 11.644  60.141 9.812   1.00 67.14  ? 669 GLN O CA    1 
ATOM 7779 C C     . GLN E 3 292 ? 10.972  61.002 10.873  1.00 65.64  ? 669 GLN O C     1 
ATOM 7780 O O     . GLN E 3 292 ? 9.747   61.045 10.953  1.00 62.83  ? 669 GLN O O     1 
ATOM 7781 C CB    . GLN E 3 292 ? 11.843  60.952 8.529   1.00 79.05  ? 669 GLN O CB    1 
ATOM 7782 C CG    . GLN E 3 292 ? 13.027  61.903 8.523   1.00 101.42 ? 669 GLN O CG    1 
ATOM 7783 C CD    . GLN E 3 292 ? 14.349  61.174 8.611   1.00 113.71 ? 669 GLN O CD    1 
ATOM 7784 O OE1   . GLN E 3 292 ? 14.564  60.170 7.932   1.00 121.71 ? 669 GLN O OE1   1 
ATOM 7785 N NE2   . GLN E 3 292 ? 15.248  61.682 9.443   1.00 122.52 ? 669 GLN O NE2   1 
ATOM 7786 N N     . PRO E 3 293 ? 11.764  61.688 11.709  1.00 66.71  ? 670 PRO O N     1 
ATOM 7787 C CA    . PRO E 3 293 ? 11.287  62.568 12.780  1.00 66.64  ? 670 PRO O CA    1 
ATOM 7788 C C     . PRO E 3 293 ? 10.177  63.542 12.368  1.00 67.40  ? 670 PRO O C     1 
ATOM 7789 O O     . PRO E 3 293 ? 10.406  64.466 11.587  1.00 66.20  ? 670 PRO O O     1 
ATOM 7790 C CB    . PRO E 3 293 ? 12.552  63.306 13.186  1.00 66.89  ? 670 PRO O CB    1 
ATOM 7791 C CG    . PRO E 3 293 ? 13.579  62.257 13.058  1.00 69.41  ? 670 PRO O CG    1 
ATOM 7792 C CD    . PRO E 3 293 ? 13.232  61.568 11.758  1.00 66.82  ? 670 PRO O CD    1 
ATOM 7793 N N     . GLN E 3 294 ? 8.977   63.340 12.900  1.00 68.87  ? 671 GLN O N     1 
ATOM 7794 C CA    . GLN E 3 294 ? 7.862   64.229 12.601  1.00 71.54  ? 671 GLN O CA    1 
ATOM 7795 C C     . GLN E 3 294 ? 7.771   65.312 13.669  1.00 73.70  ? 671 GLN O C     1 
ATOM 7796 O O     . GLN E 3 294 ? 8.417   65.219 14.717  1.00 73.01  ? 671 GLN O O     1 
ATOM 7797 C CB    . GLN E 3 294 ? 6.552   63.450 12.538  1.00 72.08  ? 671 GLN O CB    1 
ATOM 7798 C CG    . GLN E 3 294 ? 6.437   62.556 11.321  1.00 74.53  ? 671 GLN O CG    1 
ATOM 7799 C CD    . GLN E 3 294 ? 6.729   63.300 10.039  1.00 76.12  ? 671 GLN O CD    1 
ATOM 7800 O OE1   . GLN E 3 294 ? 7.872   63.674 9.774   1.00 76.99  ? 671 GLN O OE1   1 
ATOM 7801 N NE2   . GLN E 3 294 ? 5.695   63.532 9.239   1.00 76.46  ? 671 GLN O NE2   1 
ATOM 7802 N N     . HIS E 3 295 ? 6.961   66.335 13.414  1.00 77.45  ? 672 HIS O N     1 
ATOM 7803 C CA    . HIS E 3 295 ? 6.838   67.428 14.366  1.00 81.24  ? 672 HIS O CA    1 
ATOM 7804 C C     . HIS E 3 295 ? 5.457   67.605 14.961  1.00 79.49  ? 672 HIS O C     1 
ATOM 7805 O O     . HIS E 3 295 ? 4.441   67.465 14.278  1.00 77.73  ? 672 HIS O O     1 
ATOM 7806 C CB    . HIS E 3 295 ? 7.297   68.720 13.707  1.00 90.06  ? 672 HIS O CB    1 
ATOM 7807 C CG    . HIS E 3 295 ? 8.664   68.621 13.118  1.00 100.86 ? 672 HIS O CG    1 
ATOM 7808 N ND1   . HIS E 3 295 ? 9.776   68.325 13.875  1.00 105.80 ? 672 HIS O ND1   1 
ATOM 7809 C CD2   . HIS E 3 295 ? 9.094   68.717 11.838  1.00 105.81 ? 672 HIS O CD2   1 
ATOM 7810 C CE1   . HIS E 3 295 ? 10.833  68.240 13.087  1.00 108.92 ? 672 HIS O CE1   1 
ATOM 7811 N NE2   . HIS E 3 295 ? 10.445  68.473 11.846  1.00 109.54 ? 672 HIS O NE2   1 
ATOM 7812 N N     . PHE E 3 296 ? 5.443   67.919 16.250  1.00 78.83  ? 673 PHE O N     1 
ATOM 7813 C CA    . PHE E 3 296 ? 4.216   68.120 16.997  1.00 79.08  ? 673 PHE O CA    1 
ATOM 7814 C C     . PHE E 3 296 ? 4.576   69.080 18.110  1.00 80.40  ? 673 PHE O C     1 
ATOM 7815 O O     . PHE E 3 296 ? 5.738   69.170 18.499  1.00 79.17  ? 673 PHE O O     1 
ATOM 7816 C CB    . PHE E 3 296 ? 3.755   66.796 17.604  1.00 78.58  ? 673 PHE O CB    1 
ATOM 7817 C CG    . PHE E 3 296 ? 2.309   66.776 18.009  1.00 79.97  ? 673 PHE O CG    1 
ATOM 7818 C CD1   . PHE E 3 296 ? 1.308   66.611 17.057  1.00 80.63  ? 673 PHE O CD1   1 
ATOM 7819 C CD2   . PHE E 3 296 ? 1.944   66.910 19.345  1.00 81.22  ? 673 PHE O CD2   1 
ATOM 7820 C CE1   . PHE E 3 296 ? -0.034  66.577 17.427  1.00 80.18  ? 673 PHE O CE1   1 
ATOM 7821 C CE2   . PHE E 3 296 ? 0.599   66.877 19.726  1.00 81.12  ? 673 PHE O CE2   1 
ATOM 7822 C CZ    . PHE E 3 296 ? -0.387  66.710 18.764  1.00 80.50  ? 673 PHE O CZ    1 
ATOM 7823 N N     . THR E 3 297 ? 3.584   69.800 18.621  1.00 82.81  ? 674 THR O N     1 
ATOM 7824 C CA    . THR E 3 297 ? 3.817   70.739 19.710  1.00 85.38  ? 674 THR O CA    1 
ATOM 7825 C C     . THR E 3 297 ? 2.698   70.727 20.727  1.00 81.71  ? 674 THR O C     1 
ATOM 7826 O O     . THR E 3 297 ? 1.541   70.965 20.395  1.00 81.79  ? 674 THR O O     1 
ATOM 7827 C CB    . THR E 3 297 ? 3.972   72.173 19.206  1.00 90.33  ? 674 THR O CB    1 
ATOM 7828 O OG1   . THR E 3 297 ? 5.230   72.306 18.540  1.00 97.24  ? 674 THR O OG1   1 
ATOM 7829 C CG2   . THR E 3 297 ? 3.918   73.150 20.368  1.00 94.77  ? 674 THR O CG2   1 
ATOM 7830 N N     . TYR E 3 298 ? 3.061   70.456 21.973  1.00 78.08  ? 675 TYR O N     1 
ATOM 7831 C CA    . TYR E 3 298 ? 2.101   70.419 23.065  1.00 73.69  ? 675 TYR O CA    1 
ATOM 7832 C C     . TYR E 3 298 ? 1.852   71.803 23.675  1.00 75.81  ? 675 TYR O C     1 
ATOM 7833 O O     . TYR E 3 298 ? 2.787   72.562 23.959  1.00 72.88  ? 675 TYR O O     1 
ATOM 7834 C CB    . TYR E 3 298 ? 2.586   69.464 24.153  1.00 66.28  ? 675 TYR O CB    1 
ATOM 7835 C CG    . TYR E 3 298 ? 2.359   67.997 23.859  1.00 59.10  ? 675 TYR O CG    1 
ATOM 7836 C CD1   . TYR E 3 298 ? 1.083   67.515 23.581  1.00 55.81  ? 675 TYR O CD1   1 
ATOM 7837 C CD2   . TYR E 3 298 ? 3.410   67.077 23.933  1.00 56.06  ? 675 TYR O CD2   1 
ATOM 7838 C CE1   . TYR E 3 298 ? 0.853   66.148 23.391  1.00 53.40  ? 675 TYR O CE1   1 
ATOM 7839 C CE2   . TYR E 3 298 ? 3.190   65.707 23.748  1.00 53.30  ? 675 TYR O CE2   1 
ATOM 7840 C CZ    . TYR E 3 298 ? 1.907   65.251 23.479  1.00 51.90  ? 675 TYR O CZ    1 
ATOM 7841 O OH    . TYR E 3 298 ? 1.672   63.905 23.318  1.00 48.48  ? 675 TYR O OH    1 
ATOM 7842 N N     . HIS E 3 299 ? 0.575   72.115 23.872  1.00 80.85  ? 676 HIS O N     1 
ATOM 7843 C CA    . HIS E 3 299 ? 0.171   73.384 24.453  1.00 89.44  ? 676 HIS O CA    1 
ATOM 7844 C C     . HIS E 3 299 ? -0.208  73.287 25.920  1.00 100.24 ? 676 HIS O C     1 
ATOM 7845 O O     . HIS E 3 299 ? -0.994  72.426 26.332  1.00 91.53  ? 676 HIS O O     1 
ATOM 7846 C CB    . HIS E 3 299 ? -0.993  73.968 23.677  1.00 87.46  ? 676 HIS O CB    1 
ATOM 7847 C CG    . HIS E 3 299 ? -0.604  74.477 22.333  1.00 90.68  ? 676 HIS O CG    1 
ATOM 7848 N ND1   . HIS E 3 299 ? 0.419   75.381 22.157  1.00 91.73  ? 676 HIS O ND1   1 
ATOM 7849 C CD2   . HIS E 3 299 ? -1.092  74.208 21.100  1.00 92.45  ? 676 HIS O CD2   1 
ATOM 7850 C CE1   . HIS E 3 299 ? 0.545   75.650 20.871  1.00 93.66  ? 676 HIS O CE1   1 
ATOM 7851 N NE2   . HIS E 3 299 ? -0.360  74.951 20.208  1.00 93.90  ? 676 HIS O NE2   1 
ATOM 7852 N N     . PRO E 3 300 ? 0.344   74.194 26.730  1.00 111.79 ? 677 PRO O N     1 
ATOM 7853 C CA    . PRO E 3 300 ? 0.094   74.252 28.167  1.00 116.61 ? 677 PRO O CA    1 
ATOM 7854 C C     . PRO E 3 300 ? -1.372  74.539 28.446  1.00 113.18 ? 677 PRO O C     1 
ATOM 7855 O O     . PRO E 3 300 ? -2.128  74.887 27.537  1.00 110.47 ? 677 PRO O O     1 
ATOM 7856 C CB    . PRO E 3 300 ? 0.994   75.393 28.614  1.00 118.11 ? 677 PRO O CB    1 
ATOM 7857 C CG    . PRO E 3 300 ? 0.920   76.318 27.435  1.00 123.60 ? 677 PRO O CG    1 
ATOM 7858 C CD    . PRO E 3 300 ? 1.119   75.368 26.289  1.00 114.47 ? 677 PRO O CD    1 
ATOM 7859 N N     . VAL E 3 301 ? -1.765  74.382 29.707  1.00 103.52 ? 678 VAL O N     1 
ATOM 7860 C CA    . VAL E 3 301 ? -3.135  74.647 30.130  1.00 102.96 ? 678 VAL O CA    1 
ATOM 7861 C C     . VAL E 3 301 ? -3.123  75.474 31.414  1.00 107.88 ? 678 VAL O C     1 
ATOM 7862 O O     . VAL E 3 301 ? -2.017  75.826 31.884  1.00 123.08 ? 678 VAL O O     1 
ATOM 7863 C CB    . VAL E 3 301 ? -3.939  73.332 30.366  1.00 101.43 ? 678 VAL O CB    1 
ATOM 7864 C CG1   . VAL E 3 301 ? -3.995  72.538 29.090  1.00 82.41  ? 678 VAL O CG1   1 
ATOM 7865 C CG2   . VAL E 3 301 ? -3.314  72.501 31.472  1.00 81.74  ? 678 VAL O CG2   1 
ATOM 7866 O OXT   . VAL E 3 301 ? -4.222  75.768 31.926  1.00 120.61 ? 678 VAL O OXT   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   A . n 
A 1 2   DG  2   2   2   DG  G   A . n 
A 1 3   DG  3   3   3   DG  G   A . n 
A 1 4   DG  4   4   4   DG  G   A . n 
A 1 5   DA  5   5   5   DA  A   A . n 
A 1 6   DC  6   6   6   DC  C   A . n 
A 1 7   DT  7   7   7   DT  T   A . n 
A 1 8   DT  8   8   8   DT  T   A . n 
A 1 9   DT  9   9   9   DT  T   A . n 
A 1 10  DC  10  10  10  DC  C   A . n 
A 1 11  DC  11  11  11  DC  C   A . n 
A 1 12  DG  12  12  12  DG  G   A . n 
A 1 13  DC  13  13  13  DC  C   A . n 
A 1 14  DT  14  14  14  DT  T   A . n 
A 1 15  DG  15  15  15  DG  G   A . n 
A 1 16  DG  16  16  16  DG  G   A . n 
A 1 17  DG  17  17  17  DG  G   A . n 
A 1 18  DG  18  18  18  DG  G   A . n 
A 1 19  DA  19  19  19  DA  A   A . n 
A 1 20  DC  20  20  20  DC  C   A . n 
A 1 21  DT  21  21  21  DT  T   A . n 
A 1 22  DT  22  22  22  DT  T   A . n 
A 1 23  DT  23  23  23  DT  T   A . n 
A 1 24  DC  24  24  24  DC  C   A . n 
A 1 25  DC  25  25  25  DC  C   A . n 
B 2 1   DT  1   1   1   DT  T   B . n 
B 2 2   DG  2   2   2   DG  G   B . n 
B 2 3   DG  3   3   3   DG  G   B . n 
B 2 4   DA  4   4   4   DA  A   B . n 
B 2 5   DA  5   5   5   DA  A   B . n 
B 2 6   DA  6   6   6   DA  A   B . n 
B 2 7   DG  7   7   7   DG  G   B . n 
B 2 8   DT  8   8   8   DT  T   B . n 
B 2 9   DC  9   9   9   DC  C   B . n 
B 2 10  DC  10  10  10  DC  C   B . n 
B 2 11  DC  11  11  11  DC  C   B . n 
B 2 12  DC  12  12  12  DC  C   B . n 
B 2 13  DA  13  13  13  DA  A   B . n 
B 2 14  DG  14  14  14  DG  G   B . n 
B 2 15  DC  15  15  15  DC  C   B . n 
B 2 16  DG  16  16  16  DG  G   B . n 
B 2 17  DG  17  17  17  DG  G   B . n 
B 2 18  DA  18  18  18  DA  A   B . n 
B 2 19  DA  19  19  19  DA  A   B . n 
B 2 20  DA  20  20  20  DA  A   B . n 
B 2 21  DG  21  21  21  DG  G   B . n 
B 2 22  DT  22  22  22  DT  T   B . n 
B 2 23  DC  23  23  23  DC  C   B . n 
B 2 24  DC  24  24  24  DC  C   B . n 
B 2 25  DC  25  25  25  DC  C   B . n 
C 3 1   MET 1   378 ?   ?   ?   L . n 
C 3 2   ARG 2   379 ?   ?   ?   L . n 
C 3 3   GLY 3   380 ?   ?   ?   L . n 
C 3 4   SER 4   381 ?   ?   ?   L . n 
C 3 5   HIS 5   382 ?   ?   ?   L . n 
C 3 6   HIS 6   383 ?   ?   ?   L . n 
C 3 7   HIS 7   384 ?   ?   ?   L . n 
C 3 8   HIS 8   385 ?   ?   ?   L . n 
C 3 9   HIS 9   386 ?   ?   ?   L . n 
C 3 10  HIS 10  387 ?   ?   ?   L . n 
C 3 11  THR 11  388 ?   ?   ?   L . n 
C 3 12  ALA 12  389 ?   ?   ?   L . n 
C 3 13  PRO 13  390 ?   ?   ?   L . n 
C 3 14  HIS 14  391 ?   ?   ?   L . n 
C 3 15  ALA 15  392 392 ALA ALA L . n 
C 3 16  SER 16  393 393 SER SER L . n 
C 3 17  SER 17  394 394 SER SER L . n 
C 3 18  VAL 18  395 395 VAL VAL L . n 
C 3 19  PRO 19  396 396 PRO PRO L . n 
C 3 20  LEU 20  397 397 LEU LEU L . n 
C 3 21  GLU 21  398 398 GLU GLU L . n 
C 3 22  TRP 22  399 399 TRP TRP L . n 
C 3 23  PRO 23  400 400 PRO PRO L . n 
C 3 24  LEU 24  401 401 LEU LEU L . n 
C 3 25  SER 25  402 402 SER SER L . n 
C 3 26  SER 26  403 403 SER SER L . n 
C 3 27  GLN 27  404 404 GLN GLN L . n 
C 3 28  SER 28  405 405 SER SER L . n 
C 3 29  GLY 29  406 406 GLY GLY L . n 
C 3 30  SER 30  407 407 SER SER L . n 
C 3 31  TYR 31  408 408 TYR TYR L . n 
C 3 32  GLU 32  409 409 GLU GLU L . n 
C 3 33  LEU 33  410 410 LEU LEU L . n 
C 3 34  ARG 34  411 411 ARG ARG L . n 
C 3 35  ILE 35  412 412 ILE ILE L . n 
C 3 36  GLU 36  413 413 GLU GLU L . n 
C 3 37  VAL 37  414 414 VAL VAL L . n 
C 3 38  GLN 38  415 415 GLN GLN L . n 
C 3 39  PRO 39  416 416 PRO PRO L . n 
C 3 40  LYS 40  417 417 LYS LYS L . n 
C 3 41  PRO 41  418 418 PRO PRO L . n 
C 3 42  HIS 42  419 419 HIS HIS L . n 
C 3 43  HIS 43  420 420 HIS HIS L . n 
C 3 44  ARG 44  421 421 ARG ARG L . n 
C 3 45  ALA 45  422 422 ALA ALA L . n 
C 3 46  HIS 46  423 423 HIS HIS L . n 
C 3 47  TYR 47  424 424 TYR TYR L . n 
C 3 48  GLU 48  425 425 GLU GLU L . n 
C 3 49  THR 49  426 426 THR THR L . n 
C 3 50  GLU 50  427 427 GLU GLU L . n 
C 3 51  GLY 51  428 428 GLY GLY L . n 
C 3 52  SER 52  429 429 SER SER L . n 
C 3 53  ARG 53  430 430 ARG ARG L . n 
C 3 54  GLY 54  431 431 GLY GLY L . n 
C 3 55  ALA 55  432 432 ALA ALA L . n 
C 3 56  VAL 56  433 433 VAL VAL L . n 
C 3 57  LYS 57  434 434 LYS LYS L . n 
C 3 58  ALA 58  435 435 ALA ALA L . n 
C 3 59  PRO 59  436 436 PRO PRO L . n 
C 3 60  THR 60  437 437 THR THR L . n 
C 3 61  GLY 61  438 438 GLY GLY L . n 
C 3 62  GLY 62  439 439 GLY GLY L . n 
C 3 63  HIS 63  440 440 HIS HIS L . n 
C 3 64  PRO 64  441 441 PRO PRO L . n 
C 3 65  VAL 65  442 442 VAL VAL L . n 
C 3 66  VAL 66  443 443 VAL VAL L . n 
C 3 67  GLN 67  444 444 GLN GLN L . n 
C 3 68  LEU 68  445 445 LEU LEU L . n 
C 3 69  HIS 69  446 446 HIS HIS L . n 
C 3 70  GLY 70  447 447 GLY GLY L . n 
C 3 71  TYR 71  448 448 TYR TYR L . n 
C 3 72  MET 72  449 449 MET MET L . n 
C 3 73  GLU 73  450 450 GLU GLU L . n 
C 3 74  ASN 74  451 451 ASN ASN L . n 
C 3 75  LYS 75  452 452 LYS LYS L . n 
C 3 76  PRO 76  453 453 PRO PRO L . n 
C 3 77  LEU 77  454 454 LEU LEU L . n 
C 3 78  GLY 78  455 455 GLY GLY L . n 
C 3 79  LEU 79  456 456 LEU LEU L . n 
C 3 80  GLN 80  457 457 GLN GLN L . n 
C 3 81  ILE 81  458 458 ILE ILE L . n 
C 3 82  PHE 82  459 459 PHE PHE L . n 
C 3 83  ILE 83  460 460 ILE ILE L . n 
C 3 84  GLY 84  461 461 GLY GLY L . n 
C 3 85  THR 85  462 462 THR THR L . n 
C 3 86  ALA 86  463 463 ALA ALA L . n 
C 3 87  ASP 87  464 464 ASP ASP L . n 
C 3 88  GLU 88  465 465 GLU GLU L . n 
C 3 89  ARG 89  466 466 ARG ARG L . n 
C 3 90  ILE 90  467 467 ILE ILE L . n 
C 3 91  LEU 91  468 468 LEU LEU L . n 
C 3 92  LYS 92  469 469 LYS LYS L . n 
C 3 93  PRO 93  470 470 PRO PRO L . n 
C 3 94  HIS 94  471 471 HIS HIS L . n 
C 3 95  ALA 95  472 472 ALA ALA L . n 
C 3 96  PHE 96  473 473 PHE PHE L . n 
C 3 97  TYR 97  474 474 TYR TYR L . n 
C 3 98  GLN 98  475 475 GLN GLN L . n 
C 3 99  VAL 99  476 476 VAL VAL L . n 
C 3 100 HIS 100 477 477 HIS HIS L . n 
C 3 101 ARG 101 478 478 ARG ARG L . n 
C 3 102 ILE 102 479 479 ILE ILE L . n 
C 3 103 THR 103 480 480 THR THR L . n 
C 3 104 GLY 104 481 481 GLY GLY L . n 
C 3 105 LYS 105 482 482 LYS LYS L . n 
C 3 106 THR 106 483 483 THR THR L . n 
C 3 107 VAL 107 484 484 VAL VAL L . n 
C 3 108 THR 108 485 485 THR THR L . n 
C 3 109 THR 109 486 486 THR THR L . n 
C 3 110 THR 110 487 487 THR THR L . n 
C 3 111 SER 111 488 488 SER SER L . n 
C 3 112 TYR 112 489 489 TYR TYR L . n 
C 3 113 GLU 113 490 490 GLU GLU L . n 
C 3 114 LYS 114 491 491 LYS LYS L . n 
C 3 115 ILE 115 492 492 ILE ILE L . n 
C 3 116 VAL 116 493 493 VAL VAL L . n 
C 3 117 GLY 117 494 494 GLY GLY L . n 
C 3 118 ASN 118 495 495 ASN ASN L . n 
C 3 119 THR 119 496 496 THR THR L . n 
C 3 120 LYS 120 497 497 LYS LYS L . n 
C 3 121 VAL 121 498 498 VAL VAL L . n 
C 3 122 LEU 122 499 499 LEU LEU L . n 
C 3 123 GLU 123 500 500 GLU GLU L . n 
C 3 124 ILE 124 501 501 ILE ILE L . n 
C 3 125 PRO 125 502 502 PRO PRO L . n 
C 3 126 LEU 126 503 503 LEU LEU L . n 
C 3 127 GLU 127 504 504 GLU GLU L . n 
C 3 128 PRO 128 505 505 PRO PRO L . n 
C 3 129 LYS 129 506 506 LYS LYS L . n 
C 3 130 ASN 130 507 507 ASN ASN L . n 
C 3 131 ASN 131 508 508 ASN ASN L . n 
C 3 132 MET 132 509 509 MET MET L . n 
C 3 133 ARG 133 510 510 ARG ARG L . n 
C 3 134 ALA 134 511 511 ALA ALA L . n 
C 3 135 THR 135 512 512 THR THR L . n 
C 3 136 ILE 136 513 513 ILE ILE L . n 
C 3 137 ASP 137 514 514 ASP ASP L . n 
C 3 138 CYS 138 515 515 CYS CYS L . n 
C 3 139 ALA 139 516 516 ALA ALA L . n 
C 3 140 GLY 140 517 517 GLY GLY L . n 
C 3 141 ILE 141 518 518 ILE ILE L . n 
C 3 142 LEU 142 519 519 LEU LEU L . n 
C 3 143 LYS 143 520 520 LYS LYS L . n 
C 3 144 LEU 144 521 521 LEU LEU L . n 
C 3 145 ARG 145 522 522 ARG ARG L . n 
C 3 146 ASN 146 523 523 ASN ASN L . n 
C 3 147 ALA 147 524 524 ALA ALA L . n 
C 3 148 ASP 148 525 525 ASP ASP L . n 
C 3 149 ILE 149 526 526 ILE ILE L . n 
C 3 150 GLU 150 527 527 GLU GLU L . n 
C 3 151 LEU 151 528 528 LEU LEU L . n 
C 3 152 ARG 152 529 529 ARG ARG L . n 
C 3 153 LYS 153 530 530 LYS LYS L . n 
C 3 154 GLY 154 531 531 GLY GLY L . n 
C 3 155 GLU 155 532 532 GLU GLU L . n 
C 3 156 THR 156 533 533 THR THR L . n 
C 3 157 ASP 157 534 534 ASP ASP L . n 
C 3 158 ILE 158 535 535 ILE ILE L . n 
C 3 159 GLY 159 536 536 GLY GLY L . n 
C 3 160 ARG 160 537 537 ARG ARG L . n 
C 3 161 LYS 161 538 538 LYS LYS L . n 
C 3 162 ASN 162 539 539 ASN ASN L . n 
C 3 163 THR 163 540 540 THR THR L . n 
C 3 164 ARG 164 541 541 ARG ARG L . n 
C 3 165 VAL 165 542 542 VAL VAL L . n 
C 3 166 ARG 166 543 543 ARG ARG L . n 
C 3 167 LEU 167 544 544 LEU LEU L . n 
C 3 168 VAL 168 545 545 VAL VAL L . n 
C 3 169 PHE 169 546 546 PHE PHE L . n 
C 3 170 ARG 170 547 547 ARG ARG L . n 
C 3 171 VAL 171 548 548 VAL VAL L . n 
C 3 172 HIS 172 549 549 HIS HIS L . n 
C 3 173 ILE 173 550 550 ILE ILE L . n 
C 3 174 PRO 174 551 551 PRO PRO L . n 
C 3 175 GLU 175 552 552 GLU GLU L . n 
C 3 176 SER 176 553 553 SER SER L . n 
C 3 177 SER 177 554 554 SER SER L . n 
C 3 178 GLY 178 555 555 GLY GLY L . n 
C 3 179 ARG 179 556 556 ARG ARG L . n 
C 3 180 ILE 180 557 557 ILE ILE L . n 
C 3 181 VAL 181 558 558 VAL VAL L . n 
C 3 182 SER 182 559 559 SER SER L . n 
C 3 183 LEU 183 560 560 LEU LEU L . n 
C 3 184 GLN 184 561 561 GLN GLN L . n 
C 3 185 THR 185 562 562 THR THR L . n 
C 3 186 ALA 186 563 563 ALA ALA L . n 
C 3 187 SER 187 564 564 SER SER L . n 
C 3 188 ASN 188 565 565 ASN ASN L . n 
C 3 189 PRO 189 566 566 PRO PRO L . n 
C 3 190 ILE 190 567 567 ILE ILE L . n 
C 3 191 GLU 191 568 568 GLU GLU L . n 
C 3 192 CYS 192 569 569 CYS CYS L . n 
C 3 193 SER 193 570 570 SER SER L . n 
C 3 194 GLN 194 571 571 GLN GLN L . n 
C 3 195 ARG 195 572 572 ARG ARG L . n 
C 3 196 SER 196 573 573 SER SER L . n 
C 3 197 ALA 197 574 574 ALA ALA L . n 
C 3 198 HIS 198 575 575 HIS HIS L . n 
C 3 199 GLU 199 576 576 GLU GLU L . n 
C 3 200 LEU 200 577 577 LEU LEU L . n 
C 3 201 PRO 201 578 578 PRO PRO L . n 
C 3 202 MET 202 579 579 MET MET L . n 
C 3 203 VAL 203 580 580 VAL VAL L . n 
C 3 204 GLU 204 581 581 GLU GLU L . n 
C 3 205 ARG 205 582 582 ARG ARG L . n 
C 3 206 GLN 206 583 583 GLN GLN L . n 
C 3 207 ASP 207 584 584 ASP ASP L . n 
C 3 208 THR 208 585 585 THR THR L . n 
C 3 209 ASP 209 586 586 ASP ASP L . n 
C 3 210 SER 210 587 587 SER SER L . n 
C 3 211 CYS 211 588 588 CYS CYS L . n 
C 3 212 LEU 212 589 589 LEU LEU L . n 
C 3 213 VAL 213 590 590 VAL VAL L . n 
C 3 214 TYR 214 591 591 TYR TYR L . n 
C 3 215 GLY 215 592 592 GLY GLY L . n 
C 3 216 GLY 216 593 593 GLY GLY L . n 
C 3 217 GLN 217 594 594 GLN GLN L . n 
C 3 218 GLN 218 595 595 GLN GLN L . n 
C 3 219 MET 219 596 596 MET MET L . n 
C 3 220 ILE 220 597 597 ILE ILE L . n 
C 3 221 LEU 221 598 598 LEU LEU L . n 
C 3 222 THR 222 599 599 THR THR L . n 
C 3 223 GLY 223 600 600 GLY GLY L . n 
C 3 224 GLN 224 601 601 GLN GLN L . n 
C 3 225 ASN 225 602 602 ASN ASN L . n 
C 3 226 PHE 226 603 603 PHE PHE L . n 
C 3 227 THR 227 604 604 THR THR L . n 
C 3 228 SER 228 605 605 SER SER L . n 
C 3 229 GLU 229 606 606 GLU GLU L . n 
C 3 230 SER 230 607 607 SER SER L . n 
C 3 231 LYS 231 608 608 LYS LYS L . n 
C 3 232 VAL 232 609 609 VAL VAL L . n 
C 3 233 VAL 233 610 610 VAL VAL L . n 
C 3 234 PHE 234 611 611 PHE PHE L . n 
C 3 235 THR 235 612 612 THR THR L . n 
C 3 236 GLU 236 613 613 GLU GLU L . n 
C 3 237 LYS 237 614 614 LYS LYS L . n 
C 3 238 THR 238 615 615 THR THR L . n 
C 3 239 THR 239 616 616 THR THR L . n 
C 3 240 ASP 240 617 617 ASP ASP L . n 
C 3 241 GLY 241 618 618 GLY GLY L . n 
C 3 242 GLN 242 619 619 GLN GLN L . n 
C 3 243 GLN 243 620 620 GLN GLN L . n 
C 3 244 ILE 244 621 621 ILE ILE L . n 
C 3 245 TRP 245 622 622 TRP TRP L . n 
C 3 246 GLU 246 623 623 GLU GLU L . n 
C 3 247 MET 247 624 624 MET MET L . n 
C 3 248 GLU 248 625 625 GLU GLU L . n 
C 3 249 ALA 249 626 626 ALA ALA L . n 
C 3 250 THR 250 627 627 THR THR L . n 
C 3 251 VAL 251 628 628 VAL VAL L . n 
C 3 252 ASP 252 629 629 ASP ASP L . n 
C 3 253 LYS 253 630 630 LYS LYS L . n 
C 3 254 ASP 254 631 631 ASP ASP L . n 
C 3 255 LYS 255 632 632 LYS LYS L . n 
C 3 256 SER 256 633 633 SER SER L . n 
C 3 257 GLN 257 634 634 GLN GLN L . n 
C 3 258 PRO 258 635 635 PRO PRO L . n 
C 3 259 ASN 259 636 636 ASN ASN L . n 
C 3 260 MET 260 637 637 MET MET L . n 
C 3 261 LEU 261 638 638 LEU LEU L . n 
C 3 262 PHE 262 639 639 PHE PHE L . n 
C 3 263 VAL 263 640 640 VAL VAL L . n 
C 3 264 GLU 264 641 641 GLU GLU L . n 
C 3 265 ILE 265 642 642 ILE ILE L . n 
C 3 266 PRO 266 643 643 PRO PRO L . n 
C 3 267 GLU 267 644 644 GLU GLU L . n 
C 3 268 TYR 268 645 645 TYR TYR L . n 
C 3 269 ARG 269 646 646 ARG ARG L . n 
C 3 270 ASN 270 647 647 ASN ASN L . n 
C 3 271 LYS 271 648 648 LYS LYS L . n 
C 3 272 HIS 272 649 649 HIS HIS L . n 
C 3 273 ILE 273 650 650 ILE ILE L . n 
C 3 274 ARG 274 651 651 ARG ARG L . n 
C 3 275 THR 275 652 652 THR THR L . n 
C 3 276 PRO 276 653 653 PRO PRO L . n 
C 3 277 VAL 277 654 654 VAL VAL L . n 
C 3 278 LYS 278 655 655 LYS LYS L . n 
C 3 279 VAL 279 656 656 VAL VAL L . n 
C 3 280 ASN 280 657 657 ASN ASN L . n 
C 3 281 PHE 281 658 658 PHE PHE L . n 
C 3 282 TYR 282 659 659 TYR TYR L . n 
C 3 283 VAL 283 660 660 VAL VAL L . n 
C 3 284 ILE 284 661 661 ILE ILE L . n 
C 3 285 ASN 285 662 662 ASN ASN L . n 
C 3 286 GLY 286 663 663 GLY GLY L . n 
C 3 287 LYS 287 664 664 LYS LYS L . n 
C 3 288 ARG 288 665 665 ARG ARG L . n 
C 3 289 LYS 289 666 666 LYS LYS L . n 
C 3 290 ARG 290 667 667 ARG ARG L . n 
C 3 291 SER 291 668 668 SER SER L . n 
C 3 292 GLN 292 669 669 GLN GLN L . n 
C 3 293 PRO 293 670 670 PRO PRO L . n 
C 3 294 GLN 294 671 671 GLN GLN L . n 
C 3 295 HIS 295 672 672 HIS HIS L . n 
C 3 296 PHE 296 673 673 PHE PHE L . n 
C 3 297 THR 297 674 674 THR THR L . n 
C 3 298 TYR 298 675 675 TYR TYR L . n 
C 3 299 HIS 299 676 676 HIS HIS L . n 
C 3 300 PRO 300 677 677 PRO PRO L . n 
C 3 301 VAL 301 678 678 VAL VAL L . n 
D 3 1   MET 1   378 ?   ?   ?   M . n 
D 3 2   ARG 2   379 ?   ?   ?   M . n 
D 3 3   GLY 3   380 ?   ?   ?   M . n 
D 3 4   SER 4   381 ?   ?   ?   M . n 
D 3 5   HIS 5   382 ?   ?   ?   M . n 
D 3 6   HIS 6   383 ?   ?   ?   M . n 
D 3 7   HIS 7   384 ?   ?   ?   M . n 
D 3 8   HIS 8   385 ?   ?   ?   M . n 
D 3 9   HIS 9   386 ?   ?   ?   M . n 
D 3 10  HIS 10  387 ?   ?   ?   M . n 
D 3 11  THR 11  388 ?   ?   ?   M . n 
D 3 12  ALA 12  389 ?   ?   ?   M . n 
D 3 13  PRO 13  390 ?   ?   ?   M . n 
D 3 14  HIS 14  391 ?   ?   ?   M . n 
D 3 15  ALA 15  392 ?   ?   ?   M . n 
D 3 16  SER 16  393 ?   ?   ?   M . n 
D 3 17  SER 17  394 ?   ?   ?   M . n 
D 3 18  VAL 18  395 395 VAL VAL M . n 
D 3 19  PRO 19  396 396 PRO PRO M . n 
D 3 20  LEU 20  397 397 LEU LEU M . n 
D 3 21  GLU 21  398 398 GLU GLU M . n 
D 3 22  TRP 22  399 399 TRP TRP M . n 
D 3 23  PRO 23  400 400 PRO PRO M . n 
D 3 24  LEU 24  401 401 LEU LEU M . n 
D 3 25  SER 25  402 402 SER SER M . n 
D 3 26  SER 26  403 403 SER SER M . n 
D 3 27  GLN 27  404 404 GLN GLN M . n 
D 3 28  SER 28  405 405 SER SER M . n 
D 3 29  GLY 29  406 406 GLY GLY M . n 
D 3 30  SER 30  407 407 SER SER M . n 
D 3 31  TYR 31  408 408 TYR TYR M . n 
D 3 32  GLU 32  409 409 GLU GLU M . n 
D 3 33  LEU 33  410 410 LEU LEU M . n 
D 3 34  ARG 34  411 411 ARG ARG M . n 
D 3 35  ILE 35  412 412 ILE ILE M . n 
D 3 36  GLU 36  413 413 GLU GLU M . n 
D 3 37  VAL 37  414 414 VAL VAL M . n 
D 3 38  GLN 38  415 415 GLN GLN M . n 
D 3 39  PRO 39  416 416 PRO PRO M . n 
D 3 40  LYS 40  417 417 LYS LYS M . n 
D 3 41  PRO 41  418 418 PRO PRO M . n 
D 3 42  HIS 42  419 419 HIS HIS M . n 
D 3 43  HIS 43  420 420 HIS HIS M . n 
D 3 44  ARG 44  421 421 ARG ARG M . n 
D 3 45  ALA 45  422 422 ALA ALA M . n 
D 3 46  HIS 46  423 423 HIS HIS M . n 
D 3 47  TYR 47  424 424 TYR TYR M . n 
D 3 48  GLU 48  425 425 GLU GLU M . n 
D 3 49  THR 49  426 426 THR THR M . n 
D 3 50  GLU 50  427 427 GLU GLU M . n 
D 3 51  GLY 51  428 428 GLY GLY M . n 
D 3 52  SER 52  429 429 SER SER M . n 
D 3 53  ARG 53  430 430 ARG ARG M . n 
D 3 54  GLY 54  431 431 GLY GLY M . n 
D 3 55  ALA 55  432 432 ALA ALA M . n 
D 3 56  VAL 56  433 433 VAL VAL M . n 
D 3 57  LYS 57  434 434 LYS LYS M . n 
D 3 58  ALA 58  435 435 ALA ALA M . n 
D 3 59  PRO 59  436 436 PRO PRO M . n 
D 3 60  THR 60  437 437 THR THR M . n 
D 3 61  GLY 61  438 438 GLY GLY M . n 
D 3 62  GLY 62  439 439 GLY GLY M . n 
D 3 63  HIS 63  440 440 HIS HIS M . n 
D 3 64  PRO 64  441 441 PRO PRO M . n 
D 3 65  VAL 65  442 442 VAL VAL M . n 
D 3 66  VAL 66  443 443 VAL VAL M . n 
D 3 67  GLN 67  444 444 GLN GLN M . n 
D 3 68  LEU 68  445 445 LEU LEU M . n 
D 3 69  HIS 69  446 446 HIS HIS M . n 
D 3 70  GLY 70  447 447 GLY GLY M . n 
D 3 71  TYR 71  448 448 TYR TYR M . n 
D 3 72  MET 72  449 449 MET MET M . n 
D 3 73  GLU 73  450 450 GLU GLU M . n 
D 3 74  ASN 74  451 451 ASN ASN M . n 
D 3 75  LYS 75  452 452 LYS LYS M . n 
D 3 76  PRO 76  453 453 PRO PRO M . n 
D 3 77  LEU 77  454 454 LEU LEU M . n 
D 3 78  GLY 78  455 455 GLY GLY M . n 
D 3 79  LEU 79  456 456 LEU LEU M . n 
D 3 80  GLN 80  457 457 GLN GLN M . n 
D 3 81  ILE 81  458 458 ILE ILE M . n 
D 3 82  PHE 82  459 459 PHE PHE M . n 
D 3 83  ILE 83  460 460 ILE ILE M . n 
D 3 84  GLY 84  461 461 GLY GLY M . n 
D 3 85  THR 85  462 462 THR THR M . n 
D 3 86  ALA 86  463 463 ALA ALA M . n 
D 3 87  ASP 87  464 464 ASP ASP M . n 
D 3 88  GLU 88  465 465 GLU GLU M . n 
D 3 89  ARG 89  466 466 ARG ARG M . n 
D 3 90  ILE 90  467 467 ILE ILE M . n 
D 3 91  LEU 91  468 468 LEU LEU M . n 
D 3 92  LYS 92  469 469 LYS LYS M . n 
D 3 93  PRO 93  470 470 PRO PRO M . n 
D 3 94  HIS 94  471 471 HIS HIS M . n 
D 3 95  ALA 95  472 472 ALA ALA M . n 
D 3 96  PHE 96  473 473 PHE PHE M . n 
D 3 97  TYR 97  474 474 TYR TYR M . n 
D 3 98  GLN 98  475 475 GLN GLN M . n 
D 3 99  VAL 99  476 476 VAL VAL M . n 
D 3 100 HIS 100 477 477 HIS HIS M . n 
D 3 101 ARG 101 478 478 ARG ARG M . n 
D 3 102 ILE 102 479 479 ILE ILE M . n 
D 3 103 THR 103 480 480 THR THR M . n 
D 3 104 GLY 104 481 481 GLY GLY M . n 
D 3 105 LYS 105 482 482 LYS LYS M . n 
D 3 106 THR 106 483 483 THR THR M . n 
D 3 107 VAL 107 484 484 VAL VAL M . n 
D 3 108 THR 108 485 485 THR THR M . n 
D 3 109 THR 109 486 486 THR THR M . n 
D 3 110 THR 110 487 487 THR THR M . n 
D 3 111 SER 111 488 488 SER SER M . n 
D 3 112 TYR 112 489 489 TYR TYR M . n 
D 3 113 GLU 113 490 490 GLU GLU M . n 
D 3 114 LYS 114 491 491 LYS LYS M . n 
D 3 115 ILE 115 492 492 ILE ILE M . n 
D 3 116 VAL 116 493 493 VAL VAL M . n 
D 3 117 GLY 117 494 494 GLY GLY M . n 
D 3 118 ASN 118 495 495 ASN ASN M . n 
D 3 119 THR 119 496 496 THR THR M . n 
D 3 120 LYS 120 497 497 LYS LYS M . n 
D 3 121 VAL 121 498 498 VAL VAL M . n 
D 3 122 LEU 122 499 499 LEU LEU M . n 
D 3 123 GLU 123 500 500 GLU GLU M . n 
D 3 124 ILE 124 501 501 ILE ILE M . n 
D 3 125 PRO 125 502 502 PRO PRO M . n 
D 3 126 LEU 126 503 503 LEU LEU M . n 
D 3 127 GLU 127 504 504 GLU GLU M . n 
D 3 128 PRO 128 505 505 PRO PRO M . n 
D 3 129 LYS 129 506 506 LYS LYS M . n 
D 3 130 ASN 130 507 507 ASN ASN M . n 
D 3 131 ASN 131 508 508 ASN ASN M . n 
D 3 132 MET 132 509 509 MET MET M . n 
D 3 133 ARG 133 510 510 ARG ARG M . n 
D 3 134 ALA 134 511 511 ALA ALA M . n 
D 3 135 THR 135 512 512 THR THR M . n 
D 3 136 ILE 136 513 513 ILE ILE M . n 
D 3 137 ASP 137 514 514 ASP ASP M . n 
D 3 138 CYS 138 515 515 CYS CYS M . n 
D 3 139 ALA 139 516 516 ALA ALA M . n 
D 3 140 GLY 140 517 517 GLY GLY M . n 
D 3 141 ILE 141 518 518 ILE ILE M . n 
D 3 142 LEU 142 519 519 LEU LEU M . n 
D 3 143 LYS 143 520 520 LYS LYS M . n 
D 3 144 LEU 144 521 521 LEU LEU M . n 
D 3 145 ARG 145 522 522 ARG ARG M . n 
D 3 146 ASN 146 523 523 ASN ASN M . n 
D 3 147 ALA 147 524 524 ALA ALA M . n 
D 3 148 ASP 148 525 525 ASP ASP M . n 
D 3 149 ILE 149 526 526 ILE ILE M . n 
D 3 150 GLU 150 527 527 GLU GLU M . n 
D 3 151 LEU 151 528 528 LEU LEU M . n 
D 3 152 ARG 152 529 529 ARG ARG M . n 
D 3 153 LYS 153 530 530 LYS LYS M . n 
D 3 154 GLY 154 531 531 GLY GLY M . n 
D 3 155 GLU 155 532 532 GLU GLU M . n 
D 3 156 THR 156 533 533 THR THR M . n 
D 3 157 ASP 157 534 534 ASP ASP M . n 
D 3 158 ILE 158 535 535 ILE ILE M . n 
D 3 159 GLY 159 536 536 GLY GLY M . n 
D 3 160 ARG 160 537 537 ARG ARG M . n 
D 3 161 LYS 161 538 538 LYS LYS M . n 
D 3 162 ASN 162 539 539 ASN ASN M . n 
D 3 163 THR 163 540 540 THR THR M . n 
D 3 164 ARG 164 541 541 ARG ARG M . n 
D 3 165 VAL 165 542 542 VAL VAL M . n 
D 3 166 ARG 166 543 543 ARG ARG M . n 
D 3 167 LEU 167 544 544 LEU LEU M . n 
D 3 168 VAL 168 545 545 VAL VAL M . n 
D 3 169 PHE 169 546 546 PHE PHE M . n 
D 3 170 ARG 170 547 547 ARG ARG M . n 
D 3 171 VAL 171 548 548 VAL VAL M . n 
D 3 172 HIS 172 549 549 HIS HIS M . n 
D 3 173 ILE 173 550 550 ILE ILE M . n 
D 3 174 PRO 174 551 551 PRO PRO M . n 
D 3 175 GLU 175 552 552 GLU GLU M . n 
D 3 176 SER 176 553 553 SER SER M . n 
D 3 177 SER 177 554 554 SER SER M . n 
D 3 178 GLY 178 555 555 GLY GLY M . n 
D 3 179 ARG 179 556 556 ARG ARG M . n 
D 3 180 ILE 180 557 557 ILE ILE M . n 
D 3 181 VAL 181 558 558 VAL VAL M . n 
D 3 182 SER 182 559 559 SER SER M . n 
D 3 183 LEU 183 560 560 LEU LEU M . n 
D 3 184 GLN 184 561 561 GLN GLN M . n 
D 3 185 THR 185 562 562 THR THR M . n 
D 3 186 ALA 186 563 563 ALA ALA M . n 
D 3 187 SER 187 564 564 SER SER M . n 
D 3 188 ASN 188 565 565 ASN ASN M . n 
D 3 189 PRO 189 566 566 PRO PRO M . n 
D 3 190 ILE 190 567 567 ILE ILE M . n 
D 3 191 GLU 191 568 568 GLU GLU M . n 
D 3 192 CYS 192 569 569 CYS CYS M . n 
D 3 193 SER 193 570 570 SER SER M . n 
D 3 194 GLN 194 571 571 GLN GLN M . n 
D 3 195 ARG 195 572 572 ARG ARG M . n 
D 3 196 SER 196 573 573 SER SER M . n 
D 3 197 ALA 197 574 574 ALA ALA M . n 
D 3 198 HIS 198 575 575 HIS HIS M . n 
D 3 199 GLU 199 576 576 GLU GLU M . n 
D 3 200 LEU 200 577 577 LEU LEU M . n 
D 3 201 PRO 201 578 578 PRO PRO M . n 
D 3 202 MET 202 579 579 MET MET M . n 
D 3 203 VAL 203 580 580 VAL VAL M . n 
D 3 204 GLU 204 581 581 GLU GLU M . n 
D 3 205 ARG 205 582 582 ARG ARG M . n 
D 3 206 GLN 206 583 583 GLN GLN M . n 
D 3 207 ASP 207 584 584 ASP ASP M . n 
D 3 208 THR 208 585 585 THR THR M . n 
D 3 209 ASP 209 586 586 ASP ASP M . n 
D 3 210 SER 210 587 587 SER SER M . n 
D 3 211 CYS 211 588 588 CYS CYS M . n 
D 3 212 LEU 212 589 589 LEU LEU M . n 
D 3 213 VAL 213 590 590 VAL VAL M . n 
D 3 214 TYR 214 591 591 TYR TYR M . n 
D 3 215 GLY 215 592 592 GLY GLY M . n 
D 3 216 GLY 216 593 593 GLY GLY M . n 
D 3 217 GLN 217 594 594 GLN GLN M . n 
D 3 218 GLN 218 595 595 GLN GLN M . n 
D 3 219 MET 219 596 596 MET MET M . n 
D 3 220 ILE 220 597 597 ILE ILE M . n 
D 3 221 LEU 221 598 598 LEU LEU M . n 
D 3 222 THR 222 599 599 THR THR M . n 
D 3 223 GLY 223 600 600 GLY GLY M . n 
D 3 224 GLN 224 601 601 GLN GLN M . n 
D 3 225 ASN 225 602 602 ASN ASN M . n 
D 3 226 PHE 226 603 603 PHE PHE M . n 
D 3 227 THR 227 604 604 THR THR M . n 
D 3 228 SER 228 605 605 SER SER M . n 
D 3 229 GLU 229 606 606 GLU GLU M . n 
D 3 230 SER 230 607 607 SER SER M . n 
D 3 231 LYS 231 608 608 LYS LYS M . n 
D 3 232 VAL 232 609 609 VAL VAL M . n 
D 3 233 VAL 233 610 610 VAL VAL M . n 
D 3 234 PHE 234 611 611 PHE PHE M . n 
D 3 235 THR 235 612 612 THR THR M . n 
D 3 236 GLU 236 613 613 GLU GLU M . n 
D 3 237 LYS 237 614 614 LYS LYS M . n 
D 3 238 THR 238 615 615 THR THR M . n 
D 3 239 THR 239 616 616 THR THR M . n 
D 3 240 ASP 240 617 617 ASP ASP M . n 
D 3 241 GLY 241 618 618 GLY GLY M . n 
D 3 242 GLN 242 619 619 GLN GLN M . n 
D 3 243 GLN 243 620 620 GLN GLN M . n 
D 3 244 ILE 244 621 621 ILE ILE M . n 
D 3 245 TRP 245 622 622 TRP TRP M . n 
D 3 246 GLU 246 623 623 GLU GLU M . n 
D 3 247 MET 247 624 624 MET MET M . n 
D 3 248 GLU 248 625 625 GLU GLU M . n 
D 3 249 ALA 249 626 626 ALA ALA M . n 
D 3 250 THR 250 627 627 THR THR M . n 
D 3 251 VAL 251 628 628 VAL VAL M . n 
D 3 252 ASP 252 629 629 ASP ASP M . n 
D 3 253 LYS 253 630 630 LYS LYS M . n 
D 3 254 ASP 254 631 631 ASP ASP M . n 
D 3 255 LYS 255 632 632 LYS LYS M . n 
D 3 256 SER 256 633 633 SER SER M . n 
D 3 257 GLN 257 634 634 GLN GLN M . n 
D 3 258 PRO 258 635 635 PRO PRO M . n 
D 3 259 ASN 259 636 636 ASN ASN M . n 
D 3 260 MET 260 637 637 MET MET M . n 
D 3 261 LEU 261 638 638 LEU LEU M . n 
D 3 262 PHE 262 639 639 PHE PHE M . n 
D 3 263 VAL 263 640 640 VAL VAL M . n 
D 3 264 GLU 264 641 641 GLU GLU M . n 
D 3 265 ILE 265 642 642 ILE ILE M . n 
D 3 266 PRO 266 643 643 PRO PRO M . n 
D 3 267 GLU 267 644 644 GLU GLU M . n 
D 3 268 TYR 268 645 645 TYR TYR M . n 
D 3 269 ARG 269 646 646 ARG ARG M . n 
D 3 270 ASN 270 647 647 ASN ASN M . n 
D 3 271 LYS 271 648 648 LYS LYS M . n 
D 3 272 HIS 272 649 649 HIS HIS M . n 
D 3 273 ILE 273 650 650 ILE ILE M . n 
D 3 274 ARG 274 651 651 ARG ARG M . n 
D 3 275 THR 275 652 652 THR THR M . n 
D 3 276 PRO 276 653 653 PRO PRO M . n 
D 3 277 VAL 277 654 654 VAL VAL M . n 
D 3 278 LYS 278 655 655 LYS LYS M . n 
D 3 279 VAL 279 656 656 VAL VAL M . n 
D 3 280 ASN 280 657 657 ASN ASN M . n 
D 3 281 PHE 281 658 658 PHE PHE M . n 
D 3 282 TYR 282 659 659 TYR TYR M . n 
D 3 283 VAL 283 660 660 VAL VAL M . n 
D 3 284 ILE 284 661 661 ILE ILE M . n 
D 3 285 ASN 285 662 662 ASN ASN M . n 
D 3 286 GLY 286 663 663 GLY GLY M . n 
D 3 287 LYS 287 664 664 LYS LYS M . n 
D 3 288 ARG 288 665 665 ARG ARG M . n 
D 3 289 LYS 289 666 666 LYS LYS M . n 
D 3 290 ARG 290 667 667 ARG ARG M . n 
D 3 291 SER 291 668 668 SER SER M . n 
D 3 292 GLN 292 669 669 GLN GLN M . n 
D 3 293 PRO 293 670 670 PRO PRO M . n 
D 3 294 GLN 294 671 671 GLN GLN M . n 
D 3 295 HIS 295 672 672 HIS HIS M . n 
D 3 296 PHE 296 673 673 PHE PHE M . n 
D 3 297 THR 297 674 674 THR THR M . n 
D 3 298 TYR 298 675 675 TYR TYR M . n 
D 3 299 HIS 299 676 676 HIS HIS M . n 
D 3 300 PRO 300 677 677 PRO PRO M . n 
D 3 301 VAL 301 678 678 VAL VAL M . n 
E 3 1   MET 1   378 ?   ?   ?   O . n 
E 3 2   ARG 2   379 ?   ?   ?   O . n 
E 3 3   GLY 3   380 ?   ?   ?   O . n 
E 3 4   SER 4   381 ?   ?   ?   O . n 
E 3 5   HIS 5   382 ?   ?   ?   O . n 
E 3 6   HIS 6   383 ?   ?   ?   O . n 
E 3 7   HIS 7   384 ?   ?   ?   O . n 
E 3 8   HIS 8   385 ?   ?   ?   O . n 
E 3 9   HIS 9   386 ?   ?   ?   O . n 
E 3 10  HIS 10  387 ?   ?   ?   O . n 
E 3 11  THR 11  388 ?   ?   ?   O . n 
E 3 12  ALA 12  389 ?   ?   ?   O . n 
E 3 13  PRO 13  390 ?   ?   ?   O . n 
E 3 14  HIS 14  391 ?   ?   ?   O . n 
E 3 15  ALA 15  392 392 ALA ALA O . n 
E 3 16  SER 16  393 393 SER SER O . n 
E 3 17  SER 17  394 394 SER SER O . n 
E 3 18  VAL 18  395 395 VAL VAL O . n 
E 3 19  PRO 19  396 396 PRO PRO O . n 
E 3 20  LEU 20  397 397 LEU LEU O . n 
E 3 21  GLU 21  398 398 GLU GLU O . n 
E 3 22  TRP 22  399 399 TRP TRP O . n 
E 3 23  PRO 23  400 400 PRO PRO O . n 
E 3 24  LEU 24  401 401 LEU LEU O . n 
E 3 25  SER 25  402 402 SER SER O . n 
E 3 26  SER 26  403 403 SER SER O . n 
E 3 27  GLN 27  404 404 GLN GLN O . n 
E 3 28  SER 28  405 405 SER SER O . n 
E 3 29  GLY 29  406 406 GLY GLY O . n 
E 3 30  SER 30  407 407 SER SER O . n 
E 3 31  TYR 31  408 408 TYR TYR O . n 
E 3 32  GLU 32  409 409 GLU GLU O . n 
E 3 33  LEU 33  410 410 LEU LEU O . n 
E 3 34  ARG 34  411 411 ARG ARG O . n 
E 3 35  ILE 35  412 412 ILE ILE O . n 
E 3 36  GLU 36  413 413 GLU GLU O . n 
E 3 37  VAL 37  414 414 VAL VAL O . n 
E 3 38  GLN 38  415 415 GLN GLN O . n 
E 3 39  PRO 39  416 416 PRO PRO O . n 
E 3 40  LYS 40  417 417 LYS LYS O . n 
E 3 41  PRO 41  418 418 PRO PRO O . n 
E 3 42  HIS 42  419 419 HIS HIS O . n 
E 3 43  HIS 43  420 420 HIS HIS O . n 
E 3 44  ARG 44  421 421 ARG ARG O . n 
E 3 45  ALA 45  422 422 ALA ALA O . n 
E 3 46  HIS 46  423 423 HIS HIS O . n 
E 3 47  TYR 47  424 424 TYR TYR O . n 
E 3 48  GLU 48  425 425 GLU GLU O . n 
E 3 49  THR 49  426 426 THR THR O . n 
E 3 50  GLU 50  427 427 GLU GLU O . n 
E 3 51  GLY 51  428 428 GLY GLY O . n 
E 3 52  SER 52  429 429 SER SER O . n 
E 3 53  ARG 53  430 430 ARG ARG O . n 
E 3 54  GLY 54  431 431 GLY GLY O . n 
E 3 55  ALA 55  432 432 ALA ALA O . n 
E 3 56  VAL 56  433 433 VAL VAL O . n 
E 3 57  LYS 57  434 434 LYS LYS O . n 
E 3 58  ALA 58  435 435 ALA ALA O . n 
E 3 59  PRO 59  436 436 PRO PRO O . n 
E 3 60  THR 60  437 437 THR THR O . n 
E 3 61  GLY 61  438 438 GLY GLY O . n 
E 3 62  GLY 62  439 439 GLY GLY O . n 
E 3 63  HIS 63  440 440 HIS HIS O . n 
E 3 64  PRO 64  441 441 PRO PRO O . n 
E 3 65  VAL 65  442 442 VAL VAL O . n 
E 3 66  VAL 66  443 443 VAL VAL O . n 
E 3 67  GLN 67  444 444 GLN GLN O . n 
E 3 68  LEU 68  445 445 LEU LEU O . n 
E 3 69  HIS 69  446 446 HIS HIS O . n 
E 3 70  GLY 70  447 447 GLY GLY O . n 
E 3 71  TYR 71  448 448 TYR TYR O . n 
E 3 72  MET 72  449 449 MET MET O . n 
E 3 73  GLU 73  450 450 GLU GLU O . n 
E 3 74  ASN 74  451 451 ASN ASN O . n 
E 3 75  LYS 75  452 452 LYS LYS O . n 
E 3 76  PRO 76  453 453 PRO PRO O . n 
E 3 77  LEU 77  454 454 LEU LEU O . n 
E 3 78  GLY 78  455 455 GLY GLY O . n 
E 3 79  LEU 79  456 456 LEU LEU O . n 
E 3 80  GLN 80  457 457 GLN GLN O . n 
E 3 81  ILE 81  458 458 ILE ILE O . n 
E 3 82  PHE 82  459 459 PHE PHE O . n 
E 3 83  ILE 83  460 460 ILE ILE O . n 
E 3 84  GLY 84  461 461 GLY GLY O . n 
E 3 85  THR 85  462 462 THR THR O . n 
E 3 86  ALA 86  463 463 ALA ALA O . n 
E 3 87  ASP 87  464 464 ASP ASP O . n 
E 3 88  GLU 88  465 465 GLU GLU O . n 
E 3 89  ARG 89  466 466 ARG ARG O . n 
E 3 90  ILE 90  467 467 ILE ILE O . n 
E 3 91  LEU 91  468 468 LEU LEU O . n 
E 3 92  LYS 92  469 469 LYS LYS O . n 
E 3 93  PRO 93  470 470 PRO PRO O . n 
E 3 94  HIS 94  471 471 HIS HIS O . n 
E 3 95  ALA 95  472 472 ALA ALA O . n 
E 3 96  PHE 96  473 473 PHE PHE O . n 
E 3 97  TYR 97  474 474 TYR TYR O . n 
E 3 98  GLN 98  475 475 GLN GLN O . n 
E 3 99  VAL 99  476 476 VAL VAL O . n 
E 3 100 HIS 100 477 477 HIS HIS O . n 
E 3 101 ARG 101 478 478 ARG ARG O . n 
E 3 102 ILE 102 479 479 ILE ILE O . n 
E 3 103 THR 103 480 480 THR THR O . n 
E 3 104 GLY 104 481 481 GLY GLY O . n 
E 3 105 LYS 105 482 482 LYS LYS O . n 
E 3 106 THR 106 483 483 THR THR O . n 
E 3 107 VAL 107 484 484 VAL VAL O . n 
E 3 108 THR 108 485 485 THR THR O . n 
E 3 109 THR 109 486 486 THR THR O . n 
E 3 110 THR 110 487 487 THR THR O . n 
E 3 111 SER 111 488 488 SER SER O . n 
E 3 112 TYR 112 489 489 TYR TYR O . n 
E 3 113 GLU 113 490 490 GLU GLU O . n 
E 3 114 LYS 114 491 491 LYS LYS O . n 
E 3 115 ILE 115 492 492 ILE ILE O . n 
E 3 116 VAL 116 493 493 VAL VAL O . n 
E 3 117 GLY 117 494 494 GLY GLY O . n 
E 3 118 ASN 118 495 495 ASN ASN O . n 
E 3 119 THR 119 496 496 THR THR O . n 
E 3 120 LYS 120 497 497 LYS LYS O . n 
E 3 121 VAL 121 498 498 VAL VAL O . n 
E 3 122 LEU 122 499 499 LEU LEU O . n 
E 3 123 GLU 123 500 500 GLU GLU O . n 
E 3 124 ILE 124 501 501 ILE ILE O . n 
E 3 125 PRO 125 502 502 PRO PRO O . n 
E 3 126 LEU 126 503 503 LEU LEU O . n 
E 3 127 GLU 127 504 504 GLU GLU O . n 
E 3 128 PRO 128 505 505 PRO PRO O . n 
E 3 129 LYS 129 506 506 LYS LYS O . n 
E 3 130 ASN 130 507 507 ASN ASN O . n 
E 3 131 ASN 131 508 508 ASN ASN O . n 
E 3 132 MET 132 509 509 MET MET O . n 
E 3 133 ARG 133 510 510 ARG ARG O . n 
E 3 134 ALA 134 511 511 ALA ALA O . n 
E 3 135 THR 135 512 512 THR THR O . n 
E 3 136 ILE 136 513 513 ILE ILE O . n 
E 3 137 ASP 137 514 514 ASP ASP O . n 
E 3 138 CYS 138 515 515 CYS CYS O . n 
E 3 139 ALA 139 516 516 ALA ALA O . n 
E 3 140 GLY 140 517 517 GLY GLY O . n 
E 3 141 ILE 141 518 518 ILE ILE O . n 
E 3 142 LEU 142 519 519 LEU LEU O . n 
E 3 143 LYS 143 520 520 LYS LYS O . n 
E 3 144 LEU 144 521 521 LEU LEU O . n 
E 3 145 ARG 145 522 522 ARG ARG O . n 
E 3 146 ASN 146 523 523 ASN ASN O . n 
E 3 147 ALA 147 524 524 ALA ALA O . n 
E 3 148 ASP 148 525 525 ASP ASP O . n 
E 3 149 ILE 149 526 526 ILE ILE O . n 
E 3 150 GLU 150 527 527 GLU GLU O . n 
E 3 151 LEU 151 528 528 LEU LEU O . n 
E 3 152 ARG 152 529 529 ARG ARG O . n 
E 3 153 LYS 153 530 530 LYS LYS O . n 
E 3 154 GLY 154 531 531 GLY GLY O . n 
E 3 155 GLU 155 532 532 GLU GLU O . n 
E 3 156 THR 156 533 533 THR THR O . n 
E 3 157 ASP 157 534 534 ASP ASP O . n 
E 3 158 ILE 158 535 535 ILE ILE O . n 
E 3 159 GLY 159 536 536 GLY GLY O . n 
E 3 160 ARG 160 537 537 ARG ARG O . n 
E 3 161 LYS 161 538 538 LYS LYS O . n 
E 3 162 ASN 162 539 539 ASN ASN O . n 
E 3 163 THR 163 540 540 THR THR O . n 
E 3 164 ARG 164 541 541 ARG ARG O . n 
E 3 165 VAL 165 542 542 VAL VAL O . n 
E 3 166 ARG 166 543 543 ARG ARG O . n 
E 3 167 LEU 167 544 544 LEU LEU O . n 
E 3 168 VAL 168 545 545 VAL VAL O . n 
E 3 169 PHE 169 546 546 PHE PHE O . n 
E 3 170 ARG 170 547 547 ARG ARG O . n 
E 3 171 VAL 171 548 548 VAL VAL O . n 
E 3 172 HIS 172 549 549 HIS HIS O . n 
E 3 173 ILE 173 550 550 ILE ILE O . n 
E 3 174 PRO 174 551 551 PRO PRO O . n 
E 3 175 GLU 175 552 552 GLU GLU O . n 
E 3 176 SER 176 553 553 SER SER O . n 
E 3 177 SER 177 554 554 SER SER O . n 
E 3 178 GLY 178 555 555 GLY GLY O . n 
E 3 179 ARG 179 556 556 ARG ARG O . n 
E 3 180 ILE 180 557 557 ILE ILE O . n 
E 3 181 VAL 181 558 558 VAL VAL O . n 
E 3 182 SER 182 559 559 SER SER O . n 
E 3 183 LEU 183 560 560 LEU LEU O . n 
E 3 184 GLN 184 561 561 GLN GLN O . n 
E 3 185 THR 185 562 562 THR THR O . n 
E 3 186 ALA 186 563 563 ALA ALA O . n 
E 3 187 SER 187 564 564 SER SER O . n 
E 3 188 ASN 188 565 565 ASN ASN O . n 
E 3 189 PRO 189 566 566 PRO PRO O . n 
E 3 190 ILE 190 567 567 ILE ILE O . n 
E 3 191 GLU 191 568 568 GLU GLU O . n 
E 3 192 CYS 192 569 569 CYS CYS O . n 
E 3 193 SER 193 570 570 SER SER O . n 
E 3 194 GLN 194 571 571 GLN GLN O . n 
E 3 195 ARG 195 572 572 ARG ARG O . n 
E 3 196 SER 196 573 573 SER SER O . n 
E 3 197 ALA 197 574 574 ALA ALA O . n 
E 3 198 HIS 198 575 575 HIS HIS O . n 
E 3 199 GLU 199 576 576 GLU GLU O . n 
E 3 200 LEU 200 577 577 LEU LEU O . n 
E 3 201 PRO 201 578 578 PRO PRO O . n 
E 3 202 MET 202 579 579 MET MET O . n 
E 3 203 VAL 203 580 580 VAL VAL O . n 
E 3 204 GLU 204 581 581 GLU GLU O . n 
E 3 205 ARG 205 582 582 ARG ARG O . n 
E 3 206 GLN 206 583 583 GLN GLN O . n 
E 3 207 ASP 207 584 584 ASP ASP O . n 
E 3 208 THR 208 585 585 THR THR O . n 
E 3 209 ASP 209 586 586 ASP ASP O . n 
E 3 210 SER 210 587 587 SER SER O . n 
E 3 211 CYS 211 588 588 CYS CYS O . n 
E 3 212 LEU 212 589 589 LEU LEU O . n 
E 3 213 VAL 213 590 590 VAL VAL O . n 
E 3 214 TYR 214 591 591 TYR TYR O . n 
E 3 215 GLY 215 592 592 GLY GLY O . n 
E 3 216 GLY 216 593 593 GLY GLY O . n 
E 3 217 GLN 217 594 594 GLN GLN O . n 
E 3 218 GLN 218 595 595 GLN GLN O . n 
E 3 219 MET 219 596 596 MET MET O . n 
E 3 220 ILE 220 597 597 ILE ILE O . n 
E 3 221 LEU 221 598 598 LEU LEU O . n 
E 3 222 THR 222 599 599 THR THR O . n 
E 3 223 GLY 223 600 600 GLY GLY O . n 
E 3 224 GLN 224 601 601 GLN GLN O . n 
E 3 225 ASN 225 602 602 ASN ASN O . n 
E 3 226 PHE 226 603 603 PHE PHE O . n 
E 3 227 THR 227 604 604 THR THR O . n 
E 3 228 SER 228 605 605 SER SER O . n 
E 3 229 GLU 229 606 606 GLU GLU O . n 
E 3 230 SER 230 607 607 SER SER O . n 
E 3 231 LYS 231 608 608 LYS LYS O . n 
E 3 232 VAL 232 609 609 VAL VAL O . n 
E 3 233 VAL 233 610 610 VAL VAL O . n 
E 3 234 PHE 234 611 611 PHE PHE O . n 
E 3 235 THR 235 612 612 THR THR O . n 
E 3 236 GLU 236 613 613 GLU GLU O . n 
E 3 237 LYS 237 614 614 LYS LYS O . n 
E 3 238 THR 238 615 615 THR THR O . n 
E 3 239 THR 239 616 616 THR THR O . n 
E 3 240 ASP 240 617 617 ASP ASP O . n 
E 3 241 GLY 241 618 618 GLY GLY O . n 
E 3 242 GLN 242 619 619 GLN GLN O . n 
E 3 243 GLN 243 620 620 GLN GLN O . n 
E 3 244 ILE 244 621 621 ILE ILE O . n 
E 3 245 TRP 245 622 622 TRP TRP O . n 
E 3 246 GLU 246 623 623 GLU GLU O . n 
E 3 247 MET 247 624 624 MET MET O . n 
E 3 248 GLU 248 625 625 GLU GLU O . n 
E 3 249 ALA 249 626 626 ALA ALA O . n 
E 3 250 THR 250 627 627 THR THR O . n 
E 3 251 VAL 251 628 628 VAL VAL O . n 
E 3 252 ASP 252 629 629 ASP ASP O . n 
E 3 253 LYS 253 630 630 LYS LYS O . n 
E 3 254 ASP 254 631 631 ASP ASP O . n 
E 3 255 LYS 255 632 632 LYS LYS O . n 
E 3 256 SER 256 633 633 SER SER O . n 
E 3 257 GLN 257 634 634 GLN GLN O . n 
E 3 258 PRO 258 635 635 PRO PRO O . n 
E 3 259 ASN 259 636 636 ASN ASN O . n 
E 3 260 MET 260 637 637 MET MET O . n 
E 3 261 LEU 261 638 638 LEU LEU O . n 
E 3 262 PHE 262 639 639 PHE PHE O . n 
E 3 263 VAL 263 640 640 VAL VAL O . n 
E 3 264 GLU 264 641 641 GLU GLU O . n 
E 3 265 ILE 265 642 642 ILE ILE O . n 
E 3 266 PRO 266 643 643 PRO PRO O . n 
E 3 267 GLU 267 644 644 GLU GLU O . n 
E 3 268 TYR 268 645 645 TYR TYR O . n 
E 3 269 ARG 269 646 646 ARG ARG O . n 
E 3 270 ASN 270 647 647 ASN ASN O . n 
E 3 271 LYS 271 648 648 LYS LYS O . n 
E 3 272 HIS 272 649 649 HIS HIS O . n 
E 3 273 ILE 273 650 650 ILE ILE O . n 
E 3 274 ARG 274 651 651 ARG ARG O . n 
E 3 275 THR 275 652 652 THR THR O . n 
E 3 276 PRO 276 653 653 PRO PRO O . n 
E 3 277 VAL 277 654 654 VAL VAL O . n 
E 3 278 LYS 278 655 655 LYS LYS O . n 
E 3 279 VAL 279 656 656 VAL VAL O . n 
E 3 280 ASN 280 657 657 ASN ASN O . n 
E 3 281 PHE 281 658 658 PHE PHE O . n 
E 3 282 TYR 282 659 659 TYR TYR O . n 
E 3 283 VAL 283 660 660 VAL VAL O . n 
E 3 284 ILE 284 661 661 ILE ILE O . n 
E 3 285 ASN 285 662 662 ASN ASN O . n 
E 3 286 GLY 286 663 663 GLY GLY O . n 
E 3 287 LYS 287 664 664 LYS LYS O . n 
E 3 288 ARG 288 665 665 ARG ARG O . n 
E 3 289 LYS 289 666 666 LYS LYS O . n 
E 3 290 ARG 290 667 667 ARG ARG O . n 
E 3 291 SER 291 668 668 SER SER O . n 
E 3 292 GLN 292 669 669 GLN GLN O . n 
E 3 293 PRO 293 670 670 PRO PRO O . n 
E 3 294 GLN 294 671 671 GLN GLN O . n 
E 3 295 HIS 295 672 672 HIS HIS O . n 
E 3 296 PHE 296 673 673 PHE PHE O . n 
E 3 297 THR 297 674 674 THR THR O . n 
E 3 298 TYR 298 675 675 TYR TYR O . n 
E 3 299 HIS 299 676 676 HIS HIS O . n 
E 3 300 PRO 300 677 677 PRO PRO O . n 
E 3 301 VAL 301 678 678 VAL VAL O . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   pentameric 
_pdbx_struct_assembly.oligomeric_count     5 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9470  ? 
1 MORE         -41   ? 
1 'SSA (A^2)'  50290 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-19 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_phasing_MR.entry_id                     2O93 
_pdbx_phasing_MR.method_rotation              'fast direct' 
_pdbx_phasing_MR.method_translation           &STRIP%trans_method 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          ? 
_pdbx_phasing_MR.d_res_low_rotation           ? 
_pdbx_phasing_MR.d_res_high_translation       ? 
_pdbx_phasing_MR.d_res_low_translation        ? 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
CNS         .     ?                package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
CNS         .     ?                ?       ?                    ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" A DC 10 ? ? "C1'" A DC 10 ? ? N1 A DC 10 ? ? 110.19 108.30 1.89 0.30 N 
2 1 "O4'" A DG 16 ? ? "C1'" A DG 16 ? ? N9 A DG 16 ? ? 110.13 108.30 1.83 0.30 N 
3 1 "O4'" B DA 18 ? ? "C1'" B DA 18 ? ? N9 B DA 18 ? ? 110.16 108.30 1.86 0.30 N 
4 1 "O4'" B DC 23 ? ? "C1'" B DC 23 ? ? N1 B DC 23 ? ? 110.15 108.30 1.85 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER L 393 ? ? -58.39  58.55   
2  1 PRO L 396 ? ? -36.15  145.70  
3  1 SER L 407 ? ? -95.34  35.50   
4  1 ALA L 463 ? ? -101.10 64.67   
5  1 LYS L 482 ? ? -15.39  -119.11 
6  1 THR L 483 ? ? -49.87  -6.33   
7  1 THR L 485 ? ? -64.94  -85.54  
8  1 LYS L 491 ? ? -171.77 141.85  
9  1 ASN L 508 ? ? 77.51   38.65   
10 1 ASP L 514 ? ? -152.20 19.31   
11 1 LYS L 530 ? ? -64.62  89.96   
12 1 ARG L 537 ? ? -6.80   -65.19  
13 1 SER L 554 ? ? -63.11  5.05    
14 1 SER L 564 ? ? -60.27  -170.16 
15 1 GLN L 571 ? ? -31.85  141.97  
16 1 ARG L 572 ? ? -64.00  -152.96 
17 1 ALA L 574 ? ? -45.22  164.05  
18 1 GLU L 606 ? ? -79.79  25.90   
19 1 GLU L 613 ? ? -176.62 123.28  
20 1 GLU L 623 ? ? -168.36 94.96   
21 1 ARG L 665 ? ? -97.11  -85.37  
22 1 LYS L 666 ? ? -29.48  102.26  
23 1 SER M 407 ? ? -98.04  31.94   
24 1 HIS M 420 ? ? -168.88 84.82   
25 1 GLU M 450 ? ? -42.07  175.28  
26 1 ASP M 464 ? ? -46.45  170.58  
27 1 ARG M 466 ? ? -31.97  148.60  
28 1 LEU M 468 ? ? -34.58  133.00  
29 1 LYS M 482 ? ? 66.93   -48.64  
30 1 THR M 483 ? ? -168.98 -3.06   
31 1 ILE M 513 ? ? -58.87  103.26  
32 1 ASP M 514 ? ? -142.03 18.68   
33 1 ARG M 537 ? ? -36.56  135.66  
34 1 LYS M 538 ? ? 48.79   3.66    
35 1 SER M 553 ? ? -58.85  5.10    
36 1 SER M 573 ? ? -38.01  136.59  
37 1 CYS M 588 ? ? 165.84  162.97  
38 1 GLN M 594 ? ? -38.22  162.65  
39 1 SER M 607 ? ? -46.22  150.85  
40 1 TRP M 622 ? ? -170.60 129.09  
41 1 ASP M 631 ? ? -41.86  -79.68  
42 1 SER M 633 ? ? -39.81  131.81  
43 1 LYS M 666 ? ? -41.06  86.59   
44 1 SER M 668 ? ? -68.46  -163.87 
45 1 PRO M 670 ? ? -36.50  121.17  
46 1 SER O 393 ? ? -77.93  37.23   
47 1 PRO O 396 ? ? -28.46  130.53  
48 1 GLN O 404 ? ? -178.83 142.43  
49 1 GLU O 450 ? ? -49.67  -170.70 
50 1 LYS O 482 ? ? -74.58  -73.30  
51 1 SER O 488 ? ? -177.84 145.55  
52 1 LYS O 506 ? ? -65.07  14.85   
53 1 ASN O 508 ? ? 73.74   37.83   
54 1 ARG O 510 ? ? -100.30 -168.97 
55 1 ALA O 511 ? ? 170.27  115.97  
56 1 THR O 533 ? ? -150.23 -0.15   
57 1 ARG O 537 ? ? -29.91  138.80  
58 1 LYS O 538 ? ? 62.45   -28.32  
59 1 ARG O 547 ? ? -174.48 119.88  
60 1 SER O 553 ? ? -64.40  4.71    
61 1 SER O 559 ? ? -169.04 105.11  
62 1 ASN O 565 ? ? -58.00  174.51  
63 1 CYS O 569 ? ? -117.56 51.27   
64 1 ARG O 572 ? ? -48.14  -82.82  
65 1 GLU O 576 ? ? -94.64  -84.88  
66 1 LEU O 577 ? ? -38.44  134.55  
67 1 VAL O 590 ? ? -39.80  -24.89  
68 1 GLN O 594 ? ? -37.58  130.69  
69 1 ASP O 617 ? ? -68.37  1.98    
70 1 GLN O 620 ? ? -66.85  96.05   
71 1 ASP O 631 ? ? -69.62  -99.89  
72 1 LYS O 632 ? ? -39.25  -34.97  
73 1 PRO O 635 ? ? -48.79  -16.18  
74 1 LYS O 666 ? ? -58.98  95.10   
75 1 SER O 668 ? ? -58.84  -160.23 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG A 3  ? ? 0.051 'SIDE CHAIN' 
2 1 DC B 15 ? ? 0.075 'SIDE CHAIN' 
3 1 DG B 16 ? ? 0.050 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 L MET 378 ? C MET 1  
2  1 Y 1 L ARG 379 ? C ARG 2  
3  1 Y 1 L GLY 380 ? C GLY 3  
4  1 Y 1 L SER 381 ? C SER 4  
5  1 Y 1 L HIS 382 ? C HIS 5  
6  1 Y 1 L HIS 383 ? C HIS 6  
7  1 Y 1 L HIS 384 ? C HIS 7  
8  1 Y 1 L HIS 385 ? C HIS 8  
9  1 Y 1 L HIS 386 ? C HIS 9  
10 1 Y 1 L HIS 387 ? C HIS 10 
11 1 Y 1 L THR 388 ? C THR 11 
12 1 Y 1 L ALA 389 ? C ALA 12 
13 1 Y 1 L PRO 390 ? C PRO 13 
14 1 Y 1 L HIS 391 ? C HIS 14 
15 1 Y 1 M MET 378 ? D MET 1  
16 1 Y 1 M ARG 379 ? D ARG 2  
17 1 Y 1 M GLY 380 ? D GLY 3  
18 1 Y 1 M SER 381 ? D SER 4  
19 1 Y 1 M HIS 382 ? D HIS 5  
20 1 Y 1 M HIS 383 ? D HIS 6  
21 1 Y 1 M HIS 384 ? D HIS 7  
22 1 Y 1 M HIS 385 ? D HIS 8  
23 1 Y 1 M HIS 386 ? D HIS 9  
24 1 Y 1 M HIS 387 ? D HIS 10 
25 1 Y 1 M THR 388 ? D THR 11 
26 1 Y 1 M ALA 389 ? D ALA 12 
27 1 Y 1 M PRO 390 ? D PRO 13 
28 1 Y 1 M HIS 391 ? D HIS 14 
29 1 Y 1 M ALA 392 ? D ALA 15 
30 1 Y 1 M SER 393 ? D SER 16 
31 1 Y 1 M SER 394 ? D SER 17 
32 1 Y 1 O MET 378 ? E MET 1  
33 1 Y 1 O ARG 379 ? E ARG 2  
34 1 Y 1 O GLY 380 ? E GLY 3  
35 1 Y 1 O SER 381 ? E SER 4  
36 1 Y 1 O HIS 382 ? E HIS 5  
37 1 Y 1 O HIS 383 ? E HIS 6  
38 1 Y 1 O HIS 384 ? E HIS 7  
39 1 Y 1 O HIS 385 ? E HIS 8  
40 1 Y 1 O HIS 386 ? E HIS 9  
41 1 Y 1 O HIS 387 ? E HIS 10 
42 1 Y 1 O THR 388 ? E THR 11 
43 1 Y 1 O ALA 389 ? E ALA 12 
44 1 Y 1 O PRO 390 ? E PRO 13 
45 1 Y 1 O HIS 391 ? E HIS 14 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
2O93 'double helix'        
2O93 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 25 1_555 -0.125 -0.333 0.797  8.128  -3.555  -0.388 1  A_DG2:DC25_B  A 2  ? B 25 ? 19 1 
1 A DG 3  1_555 B DC 24 1_555 0.098  -0.169 0.339  8.491  -3.355  -1.765 2  A_DG3:DC24_B  A 3  ? B 24 ? 19 1 
1 A DG 4  1_555 B DC 23 1_555 0.132  -0.129 -0.126 -2.868 -1.602  -2.133 3  A_DG4:DC23_B  A 4  ? B 23 ? 19 1 
1 A DA 5  1_555 B DT 22 1_555 -0.067 -0.138 0.308  7.938  -4.638  -2.126 4  A_DA5:DT22_B  A 5  ? B 22 ? 20 1 
1 A DC 6  1_555 B DG 21 1_555 -0.040 -0.073 -0.257 9.344  -14.968 -0.131 5  A_DC6:DG21_B  A 6  ? B 21 ? 19 1 
1 A DT 7  1_555 B DA 20 1_555 -0.133 -0.169 -0.010 -4.522 -9.636  -0.408 6  A_DT7:DA20_B  A 7  ? B 20 ? 20 1 
1 A DT 8  1_555 B DA 19 1_555 0.154  -0.084 -0.157 -0.886 -12.908 5.787  7  A_DT8:DA19_B  A 8  ? B 19 ? 20 1 
1 A DT 9  1_555 B DA 18 1_555 -0.038 -0.128 -0.308 0.514  -8.099  0.631  8  A_DT9:DA18_B  A 9  ? B 18 ? 20 1 
1 A DC 10 1_555 B DG 17 1_555 -0.096 -0.148 -0.344 3.531  -5.905  -3.046 9  A_DC10:DG17_B A 10 ? B 17 ? 19 1 
1 A DC 11 1_555 B DG 16 1_555 0.168  -0.203 -0.310 3.828  -2.874  -3.836 10 A_DC11:DG16_B A 11 ? B 16 ? 19 1 
1 A DG 12 1_555 B DC 15 1_555 -0.144 -0.270 0.194  3.193  -6.507  -0.364 11 A_DG12:DC15_B A 12 ? B 15 ? 19 1 
1 A DC 13 1_555 B DG 14 1_555 0.179  -0.137 0.279  -5.109 -10.231 1.542  12 A_DC13:DG14_B A 13 ? B 14 ? 19 1 
1 A DT 14 1_555 B DA 13 1_555 0.009  -0.076 0.438  -7.766 -4.653  -2.828 13 A_DT14:DA13_B A 14 ? B 13 ? 20 1 
1 A DG 15 1_555 B DC 12 1_555 -0.256 -0.214 0.282  2.547  2.087   -2.141 14 A_DG15:DC12_B A 15 ? B 12 ? 19 1 
1 A DG 16 1_555 B DC 11 1_555 -0.190 -0.031 0.318  5.380  -1.700  -0.341 15 A_DG16:DC11_B A 16 ? B 11 ? 19 1 
1 A DG 17 1_555 B DC 10 1_555 0.002  -0.115 -0.044 1.475  -8.545  -1.995 16 A_DG17:DC10_B A 17 ? B 10 ? 19 1 
1 A DG 18 1_555 B DC 9  1_555 -0.384 -0.200 -0.183 -5.822 -3.462  1.272  17 A_DG18:DC9_B  A 18 ? B 9  ? 19 1 
1 A DA 19 1_555 B DT 8  1_555 0.129  -0.169 0.084  1.373  -7.562  1.447  18 A_DA19:DT8_B  A 19 ? B 8  ? 20 1 
1 A DC 20 1_555 B DG 7  1_555 0.261  -0.205 0.022  3.352  -9.559  0.451  19 A_DC20:DG7_B  A 20 ? B 7  ? 19 1 
1 A DT 21 1_555 B DA 6  1_555 -0.131 -0.156 0.219  -0.429 -5.891  0.481  20 A_DT21:DA6_B  A 21 ? B 6  ? 20 1 
1 A DT 22 1_555 B DA 5  1_555 0.025  -0.219 -0.345 -2.543 -11.197 -1.705 21 A_DT22:DA5_B  A 22 ? B 5  ? 20 1 
1 A DT 23 1_555 B DA 4  1_555 -0.211 -0.143 0.026  -6.549 -5.598  -2.234 22 A_DT23:DA4_B  A 23 ? B 4  ? 20 1 
1 A DC 24 1_555 B DG 3  1_555 0.082  -0.212 -0.117 -1.980 -6.029  1.469  23 A_DC24:DG3_B  A 24 ? B 3  ? 19 1 
1 A DC 25 1_555 B DG 2  1_555 0.040  -0.113 0.221  -5.677 0.727   -0.308 24 A_DC25:DG2_B  A 25 ? B 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 25 1_555 A DG 3  1_555 B DC 24 1_555 0.635  -0.557 3.348 3.988  -0.297 35.293 -0.868 -0.438 3.401 -0.489 
-6.551  35.512 1  AA_DG2DG3:DC24DC25_BB   A 2  ? B 25 ? A 3  ? B 24 ? 
1 A DG 3  1_555 B DC 24 1_555 A DG 4  1_555 B DC 23 1_555 1.214  -0.071 3.683 5.827  -4.718 35.156 0.665  -1.004 3.807 -7.702 
-9.514  35.922 2  AA_DG3DG4:DC23DC24_BB   A 3  ? B 24 ? A 4  ? B 23 ? 
1 A DG 4  1_555 B DC 23 1_555 A DA 5  1_555 B DT 22 1_555 -0.962 -0.135 3.177 -1.569 -0.524 34.959 -0.148 1.368  3.217 -0.871 
2.610   34.997 3  AA_DG4DA5:DT22DC23_BB   A 4  ? B 23 ? A 5  ? B 22 ? 
1 A DA 5  1_555 B DT 22 1_555 A DC 6  1_555 B DG 21 1_555 -0.097 -0.457 3.210 2.760  -0.713 33.985 -0.669 0.595  3.201 -1.217 
-4.712  34.100 4  AA_DA5DC6:DG21DT22_BB   A 5  ? B 22 ? A 6  ? B 21 ? 
1 A DC 6  1_555 B DG 21 1_555 A DT 7  1_555 B DA 20 1_555 0.047  -0.723 3.726 -1.259 2.102  38.114 -1.405 -0.251 3.679 3.215  
1.925   38.190 5  AA_DC6DT7:DA20DG21_BB   A 6  ? B 21 ? A 7  ? B 20 ? 
1 A DT 7  1_555 B DA 20 1_555 A DT 8  1_555 B DA 19 1_555 0.281  -0.144 3.051 2.214  -1.066 40.750 -0.097 -0.175 3.064 -1.530 
-3.176  40.821 6  AA_DT7DT8:DA19DA20_BB   A 7  ? B 20 ? A 8  ? B 19 ? 
1 A DT 8  1_555 B DA 19 1_555 A DT 9  1_555 B DA 18 1_555 0.490  0.346  3.272 1.825  -6.321 39.812 1.212  -0.506 3.201 -9.207 
-2.658  40.330 7  AA_DT8DT9:DA18DA19_BB   A 8  ? B 19 ? A 9  ? B 18 ? 
1 A DT 9  1_555 B DA 18 1_555 A DC 10 1_555 B DG 17 1_555 -0.397 -0.537 3.294 -2.328 2.320  26.125 -1.805 0.245  3.257 5.106  
5.123   26.328 8  AA_DT9DC10:DG17DA18_BB  A 9  ? B 18 ? A 10 ? B 17 ? 
1 A DC 10 1_555 B DG 17 1_555 A DC 11 1_555 B DG 16 1_555 -0.434 -0.921 3.344 -0.017 5.981  35.817 -2.315 0.695  3.155 9.642  
0.027   36.297 9  AA_DC10DC11:DG16DG17_BB A 10 ? B 17 ? A 11 ? B 16 ? 
1 A DC 11 1_555 B DG 16 1_555 A DG 12 1_555 B DC 15 1_555 0.273  -0.414 3.255 -4.581 9.435  33.900 -2.032 -1.105 2.977 15.721 
7.633   35.440 10 AA_DC11DG12:DC15DG16_BB A 11 ? B 16 ? A 12 ? B 15 ? 
1 A DG 12 1_555 B DC 15 1_555 A DC 13 1_555 B DG 14 1_555 -0.726 -0.369 3.437 -1.919 4.028  31.457 -1.451 0.957  3.402 7.383  
3.517   31.764 11 AA_DG12DC13:DG14DC15_BB A 12 ? B 15 ? A 13 ? B 14 ? 
1 A DC 13 1_555 B DG 14 1_555 A DT 14 1_555 B DA 13 1_555 -0.592 -0.281 3.408 -1.325 7.426  29.145 -2.117 0.860  3.261 14.453 
2.578   30.085 12 AA_DC13DT14:DA13DG14_BB A 13 ? B 14 ? A 14 ? B 13 ? 
1 A DT 14 1_555 B DA 13 1_555 A DG 15 1_555 B DC 12 1_555 0.421  1.440  3.042 2.150  -0.982 41.488 2.126  -0.382 3.025 -1.386 
-3.032  41.553 13 AA_DT14DG15:DC12DA13_BB A 14 ? B 13 ? A 15 ? B 12 ? 
1 A DG 15 1_555 B DC 12 1_555 A DG 16 1_555 B DC 11 1_555 0.049  1.166  3.348 -0.198 1.666  32.530 1.780  -0.123 3.402 2.972  
0.354   32.572 14 AA_DG15DG16:DC11DC12_BB A 15 ? B 12 ? A 16 ? B 11 ? 
1 A DG 16 1_555 B DC 11 1_555 A DG 17 1_555 B DC 10 1_555 -0.764 0.257  3.509 0.420  0.718  40.622 0.284  1.150  3.505 1.033  
-0.605  40.630 15 AA_DG16DG17:DC10DC11_BB A 16 ? B 11 ? A 17 ? B 10 ? 
1 A DG 17 1_555 B DC 10 1_555 A DG 18 1_555 B DC 9  1_555 0.699  0.275  3.559 0.429  -5.325 37.525 1.163  -1.017 3.496 -8.227 
-0.663  37.890 16 AA_DG17DG18:DC9DC10_BB  A 17 ? B 10 ? A 18 ? B 9  ? 
1 A DG 18 1_555 B DC 9  1_555 A DA 19 1_555 B DT 8  1_555 -0.703 0.707  3.097 -2.923 -3.126 39.954 1.365  0.708  3.077 -4.559 
4.264   40.173 17 AA_DG18DA19:DT8DC9_BB   A 18 ? B 9  ? A 19 ? B 8  ? 
1 A DA 19 1_555 B DT 8  1_555 A DC 20 1_555 B DG 7  1_555 0.409  -0.509 3.178 -0.798 1.757  33.138 -1.175 -0.846 3.137 3.078  
1.397   33.192 18 AA_DA19DC20:DG7DT8_BB   A 19 ? B 8  ? A 20 ? B 7  ? 
1 A DC 20 1_555 B DG 7  1_555 A DT 21 1_555 B DA 6  1_555 0.083  -0.683 3.485 -0.125 -3.905 34.620 -0.502 -0.158 3.538 -6.536 
0.209   34.833 19 AA_DC20DT21:DA6DG7_BB   A 20 ? B 7  ? A 21 ? B 6  ? 
1 A DT 21 1_555 B DA 6  1_555 A DT 22 1_555 B DA 5  1_555 0.244  -0.039 3.148 6.812  -1.060 39.247 0.061  0.406  3.146 -1.563 
-10.048 39.824 20 AA_DT21DT22:DA5DA6_BB   A 21 ? B 6  ? A 22 ? B 5  ? 
1 A DT 22 1_555 B DA 5  1_555 A DT 23 1_555 B DA 4  1_555 0.397  0.122  3.346 -2.038 -4.394 42.602 0.612  -0.750 3.296 -6.024 
2.795   42.864 21 AA_DT22DT23:DA4DA5_BB   A 22 ? B 5  ? A 23 ? B 4  ? 
1 A DT 23 1_555 B DA 4  1_555 A DC 24 1_555 B DG 3  1_555 -0.362 -1.057 3.205 0.363  -1.618 29.601 -1.729 0.783  3.252 -3.164 
-0.709  29.646 22 AA_DT23DC24:DG3DA4_BB   A 23 ? B 4  ? A 24 ? B 3  ? 
1 A DC 24 1_555 B DG 3  1_555 A DC 25 1_555 B DG 2  1_555 -0.296 -0.531 3.428 -1.641 2.911  32.433 -1.474 0.229  3.379 5.195  
2.929   32.600 23 AA_DC24DC25:DG2DG3_BB   A 24 ? B 3  ? A 25 ? B 2  ? 
#