data_2ODP
# 
_entry.id   2ODP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2ODP         pdb_00002odp 10.2210/pdb2odp/pdb 
RCSB  RCSB041005   ?            ?                   
WWPDB D_1000041005 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2ODQ 
_pdbx_database_related.details        'The same protein without Mg ion' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2ODP 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2006-12-25 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Narayana, S.V.L.' 1 
'Krishnan, V.'     2 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of c2a, the catalytic fragment of classical pathway c3 and c5 convertase of human complement.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            367 
_citation.page_first                224 
_citation.page_last                 233 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17234210 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.12.039 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Krishnan, V.'    1 ? 
primary 'Xu, Y.'          2 ? 
primary 'Macon, K.'       3 ? 
primary 'Volanakis, J.E.' 4 ? 
primary 'Narayana, S.V.'  5 ? 
# 
_cell.length_a           51.398 
_cell.length_b           83.819 
_cell.length_c           75.243 
_cell.angle_alpha        90.000 
_cell.angle_beta         92.100 
_cell.angle_gamma        90.000 
_cell.entry_id           2ODP 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              2 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.entry_id                         2ODP 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                4 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Complement C2' 57459.402 1   3.4.21.43 C241A 'Complement C2a fragment' ? 
2 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-[2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
627.594   1   ?         ?     ?                         ? 
3 branched    man 
;2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
627.594   1   ?         ?     ?                         ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?         ?     ?                         ? 
5 non-polymer syn 'MAGNESIUM ION' 24.305    1   ?         ?     ?                         ? 
6 water       nat water 18.015    259 ?         ?     ?                         ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'C3/C5 convertase'         
3 triacetyl-beta-chitotriose 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;KIQIQRSGHLNLYLLLDASQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSL
ENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRN
DYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVT
IKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIA
LLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVS
QEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVP
PPRDFHINLFRMQPWLRQHLGDVLNFLPL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;KIQIQRSGHLNLYLLLDASQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSL
ENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRN
DYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVT
IKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIA
LLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVS
QEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVP
PPRDFHINLFRMQPWLRQHLGDVLNFLPL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   ILE n 
1 3   GLN n 
1 4   ILE n 
1 5   GLN n 
1 6   ARG n 
1 7   SER n 
1 8   GLY n 
1 9   HIS n 
1 10  LEU n 
1 11  ASN n 
1 12  LEU n 
1 13  TYR n 
1 14  LEU n 
1 15  LEU n 
1 16  LEU n 
1 17  ASP n 
1 18  ALA n 
1 19  SER n 
1 20  GLN n 
1 21  SER n 
1 22  VAL n 
1 23  SER n 
1 24  GLU n 
1 25  ASN n 
1 26  ASP n 
1 27  PHE n 
1 28  LEU n 
1 29  ILE n 
1 30  PHE n 
1 31  LYS n 
1 32  GLU n 
1 33  SER n 
1 34  ALA n 
1 35  SER n 
1 36  LEU n 
1 37  MET n 
1 38  VAL n 
1 39  ASP n 
1 40  ARG n 
1 41  ILE n 
1 42  PHE n 
1 43  SER n 
1 44  PHE n 
1 45  GLU n 
1 46  ILE n 
1 47  ASN n 
1 48  VAL n 
1 49  SER n 
1 50  VAL n 
1 51  ALA n 
1 52  ILE n 
1 53  ILE n 
1 54  THR n 
1 55  PHE n 
1 56  ALA n 
1 57  SER n 
1 58  GLU n 
1 59  PRO n 
1 60  LYS n 
1 61  VAL n 
1 62  LEU n 
1 63  MET n 
1 64  SER n 
1 65  VAL n 
1 66  LEU n 
1 67  ASN n 
1 68  ASP n 
1 69  ASN n 
1 70  SER n 
1 71  ARG n 
1 72  ASP n 
1 73  MET n 
1 74  THR n 
1 75  GLU n 
1 76  VAL n 
1 77  ILE n 
1 78  SER n 
1 79  SER n 
1 80  LEU n 
1 81  GLU n 
1 82  ASN n 
1 83  ALA n 
1 84  ASN n 
1 85  TYR n 
1 86  LYS n 
1 87  ASP n 
1 88  HIS n 
1 89  GLU n 
1 90  ASN n 
1 91  GLY n 
1 92  THR n 
1 93  GLY n 
1 94  THR n 
1 95  ASN n 
1 96  THR n 
1 97  TYR n 
1 98  ALA n 
1 99  ALA n 
1 100 LEU n 
1 101 ASN n 
1 102 SER n 
1 103 VAL n 
1 104 TYR n 
1 105 LEU n 
1 106 MET n 
1 107 MET n 
1 108 ASN n 
1 109 ASN n 
1 110 GLN n 
1 111 MET n 
1 112 ARG n 
1 113 LEU n 
1 114 LEU n 
1 115 GLY n 
1 116 MET n 
1 117 GLU n 
1 118 THR n 
1 119 MET n 
1 120 ALA n 
1 121 TRP n 
1 122 GLN n 
1 123 GLU n 
1 124 ILE n 
1 125 ARG n 
1 126 HIS n 
1 127 ALA n 
1 128 ILE n 
1 129 ILE n 
1 130 LEU n 
1 131 LEU n 
1 132 THR n 
1 133 ASP n 
1 134 GLY n 
1 135 LYS n 
1 136 SER n 
1 137 ASN n 
1 138 MET n 
1 139 GLY n 
1 140 GLY n 
1 141 SER n 
1 142 PRO n 
1 143 LYS n 
1 144 THR n 
1 145 ALA n 
1 146 VAL n 
1 147 ASP n 
1 148 HIS n 
1 149 ILE n 
1 150 ARG n 
1 151 GLU n 
1 152 ILE n 
1 153 LEU n 
1 154 ASN n 
1 155 ILE n 
1 156 ASN n 
1 157 GLN n 
1 158 LYS n 
1 159 ARG n 
1 160 ASN n 
1 161 ASP n 
1 162 TYR n 
1 163 LEU n 
1 164 ASP n 
1 165 ILE n 
1 166 TYR n 
1 167 ALA n 
1 168 ILE n 
1 169 GLY n 
1 170 VAL n 
1 171 GLY n 
1 172 LYS n 
1 173 LEU n 
1 174 ASP n 
1 175 VAL n 
1 176 ASP n 
1 177 TRP n 
1 178 ARG n 
1 179 GLU n 
1 180 LEU n 
1 181 ASN n 
1 182 GLU n 
1 183 LEU n 
1 184 GLY n 
1 185 SER n 
1 186 LYS n 
1 187 LYS n 
1 188 ASP n 
1 189 GLY n 
1 190 GLU n 
1 191 ARG n 
1 192 HIS n 
1 193 ALA n 
1 194 PHE n 
1 195 ILE n 
1 196 LEU n 
1 197 GLN n 
1 198 ASP n 
1 199 THR n 
1 200 LYS n 
1 201 ALA n 
1 202 LEU n 
1 203 HIS n 
1 204 GLN n 
1 205 VAL n 
1 206 PHE n 
1 207 GLU n 
1 208 HIS n 
1 209 MET n 
1 210 LEU n 
1 211 ASP n 
1 212 VAL n 
1 213 SER n 
1 214 LYS n 
1 215 LEU n 
1 216 THR n 
1 217 ASP n 
1 218 THR n 
1 219 ILE n 
1 220 CYS n 
1 221 GLY n 
1 222 VAL n 
1 223 GLY n 
1 224 ASN n 
1 225 MET n 
1 226 SER n 
1 227 ALA n 
1 228 ASN n 
1 229 ALA n 
1 230 SER n 
1 231 ASP n 
1 232 GLN n 
1 233 GLU n 
1 234 ARG n 
1 235 THR n 
1 236 PRO n 
1 237 TRP n 
1 238 HIS n 
1 239 VAL n 
1 240 THR n 
1 241 ILE n 
1 242 LYS n 
1 243 PRO n 
1 244 LYS n 
1 245 SER n 
1 246 GLN n 
1 247 GLU n 
1 248 THR n 
1 249 CYS n 
1 250 ARG n 
1 251 GLY n 
1 252 ALA n 
1 253 LEU n 
1 254 ILE n 
1 255 SER n 
1 256 ASP n 
1 257 GLN n 
1 258 TRP n 
1 259 VAL n 
1 260 LEU n 
1 261 THR n 
1 262 ALA n 
1 263 ALA n 
1 264 HIS n 
1 265 CYS n 
1 266 PHE n 
1 267 ARG n 
1 268 ASP n 
1 269 GLY n 
1 270 ASN n 
1 271 ASP n 
1 272 HIS n 
1 273 SER n 
1 274 LEU n 
1 275 TRP n 
1 276 ARG n 
1 277 VAL n 
1 278 ASN n 
1 279 VAL n 
1 280 GLY n 
1 281 ASP n 
1 282 PRO n 
1 283 LYS n 
1 284 SER n 
1 285 GLN n 
1 286 TRP n 
1 287 GLY n 
1 288 LYS n 
1 289 GLU n 
1 290 PHE n 
1 291 LEU n 
1 292 ILE n 
1 293 GLU n 
1 294 LYS n 
1 295 ALA n 
1 296 VAL n 
1 297 ILE n 
1 298 SER n 
1 299 PRO n 
1 300 GLY n 
1 301 PHE n 
1 302 ASP n 
1 303 VAL n 
1 304 PHE n 
1 305 ALA n 
1 306 LYS n 
1 307 LYS n 
1 308 ASN n 
1 309 GLN n 
1 310 GLY n 
1 311 ILE n 
1 312 LEU n 
1 313 GLU n 
1 314 PHE n 
1 315 TYR n 
1 316 GLY n 
1 317 ASP n 
1 318 ASP n 
1 319 ILE n 
1 320 ALA n 
1 321 LEU n 
1 322 LEU n 
1 323 LYS n 
1 324 LEU n 
1 325 ALA n 
1 326 GLN n 
1 327 LYS n 
1 328 VAL n 
1 329 LYS n 
1 330 MET n 
1 331 SER n 
1 332 THR n 
1 333 HIS n 
1 334 ALA n 
1 335 ARG n 
1 336 PRO n 
1 337 ILE n 
1 338 CYS n 
1 339 LEU n 
1 340 PRO n 
1 341 CYS n 
1 342 THR n 
1 343 MET n 
1 344 GLU n 
1 345 ALA n 
1 346 ASN n 
1 347 LEU n 
1 348 ALA n 
1 349 LEU n 
1 350 ARG n 
1 351 ARG n 
1 352 PRO n 
1 353 GLN n 
1 354 GLY n 
1 355 SER n 
1 356 THR n 
1 357 CYS n 
1 358 ARG n 
1 359 ASP n 
1 360 HIS n 
1 361 GLU n 
1 362 ASN n 
1 363 GLU n 
1 364 LEU n 
1 365 LEU n 
1 366 ASN n 
1 367 LYS n 
1 368 GLN n 
1 369 SER n 
1 370 VAL n 
1 371 PRO n 
1 372 ALA n 
1 373 HIS n 
1 374 PHE n 
1 375 VAL n 
1 376 ALA n 
1 377 LEU n 
1 378 ASN n 
1 379 GLY n 
1 380 SER n 
1 381 LYS n 
1 382 LEU n 
1 383 ASN n 
1 384 ILE n 
1 385 ASN n 
1 386 LEU n 
1 387 LYS n 
1 388 MET n 
1 389 GLY n 
1 390 VAL n 
1 391 GLU n 
1 392 TRP n 
1 393 THR n 
1 394 SER n 
1 395 CYS n 
1 396 ALA n 
1 397 GLU n 
1 398 VAL n 
1 399 VAL n 
1 400 SER n 
1 401 GLN n 
1 402 GLU n 
1 403 LYS n 
1 404 THR n 
1 405 MET n 
1 406 PHE n 
1 407 PRO n 
1 408 ASN n 
1 409 LEU n 
1 410 THR n 
1 411 ASP n 
1 412 VAL n 
1 413 ARG n 
1 414 GLU n 
1 415 VAL n 
1 416 VAL n 
1 417 THR n 
1 418 ASP n 
1 419 GLN n 
1 420 PHE n 
1 421 LEU n 
1 422 CYS n 
1 423 SER n 
1 424 GLY n 
1 425 THR n 
1 426 GLN n 
1 427 GLU n 
1 428 ASP n 
1 429 GLU n 
1 430 SER n 
1 431 PRO n 
1 432 CYS n 
1 433 LYS n 
1 434 GLY n 
1 435 GLU n 
1 436 SER n 
1 437 GLY n 
1 438 GLY n 
1 439 ALA n 
1 440 VAL n 
1 441 PHE n 
1 442 LEU n 
1 443 GLU n 
1 444 ARG n 
1 445 ARG n 
1 446 PHE n 
1 447 ARG n 
1 448 PHE n 
1 449 PHE n 
1 450 GLN n 
1 451 VAL n 
1 452 GLY n 
1 453 LEU n 
1 454 VAL n 
1 455 SER n 
1 456 TRP n 
1 457 GLY n 
1 458 LEU n 
1 459 TYR n 
1 460 ASN n 
1 461 PRO n 
1 462 CYS n 
1 463 LEU n 
1 464 GLY n 
1 465 SER n 
1 466 ALA n 
1 467 ASP n 
1 468 LYS n 
1 469 ASN n 
1 470 SER n 
1 471 ARG n 
1 472 LYS n 
1 473 ARG n 
1 474 ALA n 
1 475 PRO n 
1 476 ARG n 
1 477 SER n 
1 478 LYS n 
1 479 VAL n 
1 480 PRO n 
1 481 PRO n 
1 482 PRO n 
1 483 ARG n 
1 484 ASP n 
1 485 PHE n 
1 486 HIS n 
1 487 ILE n 
1 488 ASN n 
1 489 LEU n 
1 490 PHE n 
1 491 ARG n 
1 492 MET n 
1 493 GLN n 
1 494 PRO n 
1 495 TRP n 
1 496 LEU n 
1 497 ARG n 
1 498 GLN n 
1 499 HIS n 
1 500 LEU n 
1 501 GLY n 
1 502 ASP n 
1 503 VAL n 
1 504 LEU n 
1 505 ASN n 
1 506 PHE n 
1 507 LEU n 
1 508 PRO n 
1 509 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     Trichoplusia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'High Five(BTI-TN-5B1-4)' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CO2_HUMAN 
_struct_ref.pdbx_db_accession          P06681 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSL
ENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRN
DYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPWHVT
IKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVISPGFDVFAKKNQGILEFYGDDIA
LLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVS
QEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVP
PPRDFHINLFRMQPWLRQHLGDVLNFLPL
;
_struct_ref.pdbx_align_begin           244 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ODP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 509 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06681 
_struct_ref_seq.db_align_beg                  244 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  752 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       224 
_struct_ref_seq.pdbx_auth_seq_align_end       732 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2ODP 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      18 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P06681 
_struct_ref_seq_dif.db_mon_id                    CYS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          261 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            241 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer                  . 'MAGNESIUM ION'                          ? 'Mg 2'           24.305  
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2ODP 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.82 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.35 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'20% PEG 10000, 0.1M HEPES, 0.3M glycyl-glycyl-glycine, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 225 mm' 
_diffrn_detector.pdbx_collection_date   2006-06-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97969 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97969 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
# 
_reflns.entry_id                     2ODP 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.9 
_reflns.d_resolution_low             50.48 
_reflns.number_all                   ? 
_reflns.number_obs                   49897 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        31.7 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   91.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    7.1 
_reflns_shell.pdbx_Rsym_value        0.17 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ODP 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             30.00 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.760 
_refine.ls_number_reflns_obs                     48766 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  ? 
_refine.ls_R_factor_obs                          0.209 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.25 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2475 
_refine.B_iso_mean                               24.319 
_refine.aniso_B[1][1]                            0.610 
_refine.aniso_B[2][2]                            0.250 
_refine.aniso_B[3][3]                            -0.780 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.980 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.939 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.pdbx_overall_ESU_R                       0.154 
_refine.pdbx_overall_ESU_R_Free                  0.148 
_refine.overall_SU_ML                            0.096 
_refine.overall_SU_B                             3.166 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ENTRY 2ODQ' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3873 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         113 
_refine_hist.number_atoms_solvent             259 
_refine_hist.number_atoms_total               4245 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         4074 0.017  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      5520 1.637  1.978  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   486  6.104  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   189  33.640 24.444 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   699  15.198 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   26   18.190 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           630  0.116  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     3014 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1816 0.217  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2767 0.309  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    255  0.145  0.200  ? 'X-RAY DIFFRACTION' ? 
r_metal_ion_refined      3    0.042  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   41   0.270  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 10   0.206  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              2519 1.491  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3926 1.813  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1753 3.104  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1594 4.618  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.905 
_refine_ls_shell.d_res_low                        1.955 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               87.060 
_refine_ls_shell.number_reflns_R_work             3010 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.228 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             172 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                3182 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ODP 
_struct.title                     'Complement component C2a, the catalytic fragment of C3- and C5-convertase of human complement' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ODP 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'Complement component C2a, C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, vWFA, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a monomer' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 23  ? SER A 43  ? SER A 246 SER A 266 1 ? 21 
HELX_P HELX_P2  2  ASN A 67  ? ARG A 71  ? ASN A 290 ARG A 294 5 ? 5  
HELX_P HELX_P3  3  ASP A 72  ? ASN A 82  ? ASP A 295 ASN A 305 1 ? 11 
HELX_P HELX_P4  4  ASN A 84  ? GLU A 89  ? ASN A 307 GLU A 312 5 ? 6  
HELX_P HELX_P5  5  ASN A 95  ? GLY A 115 ? ASN A 318 GLY A 338 1 ? 21 
HELX_P HELX_P6  6  THR A 118 ? GLU A 123 ? THR A 341 GLU A 346 1 ? 6  
HELX_P HELX_P7  7  PRO A 142 ? LEU A 153 ? PRO A 365 LEU A 376 1 ? 12 
HELX_P HELX_P8  8  ARG A 159 ? ASP A 161 ? ARG A 382 ASP A 384 5 ? 3  
HELX_P HELX_P9  9  ASP A 176 ? GLY A 184 ? ASP A 399 GLY A 407 1 ? 9  
HELX_P HELX_P10 10 ASP A 198 ? MET A 209 ? ASP A 421 MET A 432 1 ? 12 
HELX_P HELX_P11 11 SER A 230 ? THR A 235 ? SER A 453 THR A 458 1 ? 6  
HELX_P HELX_P12 12 ALA A 262 ? PHE A 266 ? ALA A 485 PHE A 489 5 ? 5  
HELX_P HELX_P13 13 LYS A 306 ? GLY A 310 ? LYS A 529 GLY A 533 5 ? 5  
HELX_P HELX_P14 14 THR A 342 ? LEU A 349 ? THR A 565 LEU A 572 1 ? 8  
HELX_P HELX_P15 15 THR A 356 ? LEU A 365 ? THR A 579 LEU A 588 1 ? 10 
HELX_P HELX_P16 16 GLY A 389 ? VAL A 398 ? GLY A 612 VAL A 621 1 ? 10 
HELX_P HELX_P17 17 VAL A 399 ? GLU A 402 ? VAL A 622 GLU A 625 5 ? 4  
HELX_P HELX_P18 18 ASP A 411 ? VAL A 415 ? ASP A 634 VAL A 638 5 ? 5  
HELX_P HELX_P19 19 CYS A 432 ? SER A 436 ? CYS A 655 SER A 659 5 ? 5  
HELX_P HELX_P20 20 MET A 492 ? GLY A 501 ? MET A 715 GLY A 724 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 220 SG  ? ? ? 1_555 A CYS 338 SG ? ? A CYS 443 A CYS 561 1_555 ? ? ? ? ? ? ? 2.126 ? ?               
disulf2 disulf ?    ? A CYS 249 SG  ? ? ? 1_555 A CYS 265 SG ? ? A CYS 472 A CYS 488 1_555 ? ? ? ? ? ? ? 2.013 ? ?               
disulf3 disulf ?    ? A CYS 341 SG  ? ? ? 1_555 A CYS 357 SG ? ? A CYS 564 A CYS 580 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf4 disulf ?    ? A CYS 395 SG  ? ? ? 1_555 A CYS 422 SG ? ? A CYS 618 A CYS 645 1_555 ? ? ? ? ? ? ? 2.072 ? ?               
disulf5 disulf ?    ? A CYS 432 SG  ? ? ? 1_555 A CYS 462 SG ? ? A CYS 655 A CYS 685 1_555 ? ? ? ? ? ? ? 2.050 ? ?               
covale1 covale one  ? A ASN 90  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 313 A NAG 808 1_555 ? ? ? ? ? ? ? 1.438 ? N-Glycosylation 
covale2 covale one  ? A ASN 224 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 447 C NAG 1   1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
covale3 covale one  ? A ASN 378 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 601 A NAG 807 1_555 ? ? ? ? ? ? ? 1.432 ? N-Glycosylation 
covale4 covale one  ? A ASN 408 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 631 B NAG 1   1_555 ? ? ? ? ? ? ? 2.211 ? N-Glycosylation 
covale5 covale both ? B NAG .   O3  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2   1_555 ? ? ? ? ? ? ? 1.453 ? ?               
covale6 covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 3   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale7 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.425 ? ?               
covale8 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 2   C NAG 3   1_555 ? ? ? ? ? ? ? 1.482 ? ?               
metalc1 metalc ?    ? A SER 19  OG  ? ? ? 1_555 F MG  .   MG ? ? A SER 242 A MG  901 1_555 ? ? ? ? ? ? ? 1.966 ? ?               
metalc2 metalc ?    ? A SER 21  OG  ? ? ? 1_555 F MG  .   MG ? ? A SER 244 A MG  901 1_555 ? ? ? ? ? ? ? 2.203 ? ?               
metalc3 metalc ?    ? A THR 94  OG1 ? ? ? 1_555 F MG  .   MG ? ? A THR 317 A MG  901 1_555 ? ? ? ? ? ? ? 2.104 ? ?               
metalc4 metalc ?    ? F MG  .   MG  ? ? ? 1_555 G HOH .   O  ? ? A MG  901 A HOH 902 1_555 ? ? ? ? ? ? ? 1.929 ? ?               
metalc5 metalc ?    ? F MG  .   MG  ? ? ? 1_555 G HOH .   O  ? ? A MG  901 A HOH 903 1_555 ? ? ? ? ? ? ? 1.958 ? ?               
metalc6 metalc ?    ? F MG  .   MG  ? ? ? 1_555 G HOH .   O  ? ? A MG  901 A HOH 904 1_555 ? ? ? ? ? ? ? 2.234 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          VAL 
_struct_mon_prot_cis.label_seq_id           479 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           VAL 
_struct_mon_prot_cis.auth_seq_id            702 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    480 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     703 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -9.14 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 6 ? 
C ? 7 ? 
D ? 2 ? 
E ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 2   ? GLN A 3   ? ILE A 225 GLN A 226 
A 2 LEU A 210 ? ASP A 211 ? LEU A 433 ASP A 434 
B 1 PRO A 59  ? MET A 63  ? PRO A 282 MET A 286 
B 2 VAL A 48  ? PHE A 55  ? VAL A 271 PHE A 278 
B 3 HIS A 9   ? ASP A 17  ? HIS A 232 ASP A 240 
B 4 ILE A 124 ? LEU A 131 ? ILE A 347 LEU A 354 
B 5 LEU A 163 ? VAL A 170 ? LEU A 386 VAL A 393 
B 6 ALA A 193 ? LEU A 196 ? ALA A 416 LEU A 419 
C 1 LYS A 288 ? PHE A 290 ? LYS A 511 PHE A 513 
C 2 ARG A 276 ? VAL A 279 ? ARG A 499 VAL A 502 
C 3 HIS A 238 ? LYS A 242 ? HIS A 461 LYS A 465 
C 4 CYS A 249 ? LEU A 253 ? CYS A 472 LEU A 476 
C 5 TRP A 258 ? THR A 261 ? TRP A 481 THR A 484 
C 6 ALA A 320 ? LEU A 324 ? ALA A 543 LEU A 547 
C 7 ILE A 292 ? ILE A 297 ? ILE A 515 ILE A 520 
D 1 SER A 369 ? VAL A 375 ? SER A 592 VAL A 598 
D 2 LYS A 381 ? LYS A 387 ? LYS A 604 LYS A 610 
E 1 PHE A 420 ? SER A 423 ? PHE A 643 SER A 646 
E 2 ASP A 484 ? ASN A 488 ? ASP A 707 ASN A 711 
E 3 ARG A 447 ? GLY A 457 ? ARG A 670 GLY A 680 
E 4 ALA A 439 ? ARG A 444 ? ALA A 662 ARG A 667 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 2   ? N ILE A 225 O ASP A 211 ? O ASP A 434 
B 1 2 O LYS A 60  ? O LYS A 283 N THR A 54  ? N THR A 277 
B 2 3 O ALA A 51  ? O ALA A 274 N LEU A 12  ? N LEU A 235 
B 3 4 N HIS A 9   ? N HIS A 232 O ARG A 125 ? O ARG A 348 
B 4 5 N ILE A 128 ? N ILE A 351 O TYR A 166 ? O TYR A 389 
B 5 6 N GLY A 169 ? N GLY A 392 O LEU A 196 ? O LEU A 419 
C 1 2 O LYS A 288 ? O LYS A 511 N VAL A 279 ? N VAL A 502 
C 2 3 O ARG A 276 ? O ARG A 499 N LYS A 242 ? N LYS A 465 
C 3 4 N ILE A 241 ? N ILE A 464 O CYS A 249 ? O CYS A 472 
C 4 5 N ALA A 252 ? N ALA A 475 O LEU A 260 ? O LEU A 483 
C 5 6 N THR A 261 ? N THR A 484 O ALA A 320 ? O ALA A 543 
C 6 7 O LEU A 321 ? O LEU A 544 N VAL A 296 ? N VAL A 519 
D 1 2 N PHE A 374 ? N PHE A 597 O LEU A 382 ? O LEU A 605 
E 1 2 N LEU A 421 ? N LEU A 644 O HIS A 486 ? O HIS A 709 
E 2 3 O PHE A 485 ? O PHE A 708 N TRP A 456 ? N TRP A 679 
E 3 4 O GLY A 452 ? O GLY A 675 N VAL A 440 ? N VAL A 663 
# 
_atom_sites.entry_id                    2ODP 
_atom_sites.fract_transf_matrix[1][1]   0.019456 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000712 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011930 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013299 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 1   ? 16.179  21.504 5.854   1.00 19.51 ? 224  LYS A N   1 
ATOM   2    C  CA  . LYS A 1 1   ? 16.241  22.907 6.365   1.00 19.08 ? 224  LYS A CA  1 
ATOM   3    C  C   . LYS A 1 1   ? 17.689  23.383 6.388   1.00 18.84 ? 224  LYS A C   1 
ATOM   4    O  O   . LYS A 1 1   ? 18.618  22.579 6.467   1.00 20.18 ? 224  LYS A O   1 
ATOM   5    C  CB  . LYS A 1 1   ? 15.593  23.002 7.760   1.00 18.76 ? 224  LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 1   ? 14.066  22.773 7.669   1.00 20.63 ? 224  LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 1   ? 13.264  23.182 8.888   1.00 24.60 ? 224  LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 1   ? 13.395  24.691 9.275   1.00 24.21 ? 224  LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 1   ? 12.451  25.089 10.377  1.00 17.70 ? 224  LYS A NZ  1 
ATOM   10   N  N   . ILE A 1 2   ? 17.884  24.687 6.350   1.00 17.20 ? 225  ILE A N   1 
ATOM   11   C  CA  . ILE A 1 2   ? 19.198  25.251 6.559   1.00 16.57 ? 225  ILE A CA  1 
ATOM   12   C  C   . ILE A 1 2   ? 19.444  25.363 8.078   1.00 16.68 ? 225  ILE A C   1 
ATOM   13   O  O   . ILE A 1 2   ? 18.798  26.162 8.797   1.00 16.05 ? 225  ILE A O   1 
ATOM   14   C  CB  . ILE A 1 2   ? 19.262  26.634 5.882   1.00 16.44 ? 225  ILE A CB  1 
ATOM   15   C  CG1 . ILE A 1 2   ? 18.846  26.504 4.375   1.00 17.69 ? 225  ILE A CG1 1 
ATOM   16   C  CG2 . ILE A 1 2   ? 20.639  27.316 6.118   1.00 16.26 ? 225  ILE A CG2 1 
ATOM   17   C  CD1 . ILE A 1 2   ? 18.687  27.887 3.599   1.00 17.69 ? 225  ILE A CD1 1 
ATOM   18   N  N   . GLN A 1 3   ? 20.409  24.601 8.569   1.00 16.99 ? 226  GLN A N   1 
ATOM   19   C  CA  . GLN A 1 3   ? 20.627  24.574 10.007  1.00 18.62 ? 226  GLN A CA  1 
ATOM   20   C  C   . GLN A 1 3   ? 21.526  25.677 10.504  1.00 18.00 ? 226  GLN A C   1 
ATOM   21   O  O   . GLN A 1 3   ? 22.587  25.937 9.944   1.00 18.56 ? 226  GLN A O   1 
ATOM   22   C  CB  . GLN A 1 3   ? 21.206  23.233 10.433  1.00 18.88 ? 226  GLN A CB  1 
ATOM   23   C  CG  . GLN A 1 3   ? 20.191  22.056 10.316  1.00 22.49 ? 226  GLN A CG  1 
ATOM   24   C  CD  . GLN A 1 3   ? 20.906  20.716 10.486  1.00 25.74 ? 226  GLN A CD  1 
ATOM   25   O  OE1 . GLN A 1 3   ? 22.099  20.616 10.242  1.00 26.54 ? 226  GLN A OE1 1 
ATOM   26   N  NE2 . GLN A 1 3   ? 20.190  19.714 10.953  1.00 26.46 ? 226  GLN A NE2 1 
ATOM   27   N  N   . ILE A 1 4   ? 21.091  26.304 11.583  1.00 17.66 ? 227  ILE A N   1 
ATOM   28   C  CA  . ILE A 1 4   ? 21.797  27.431 12.203  1.00 17.50 ? 227  ILE A CA  1 
ATOM   29   C  C   . ILE A 1 4   ? 22.283  26.894 13.555  1.00 18.22 ? 227  ILE A C   1 
ATOM   30   O  O   . ILE A 1 4   ? 21.488  26.687 14.482  1.00 19.71 ? 227  ILE A O   1 
ATOM   31   C  CB  . ILE A 1 4   ? 20.837  28.639 12.420  1.00 16.78 ? 227  ILE A CB  1 
ATOM   32   C  CG1 . ILE A 1 4   ? 20.264  29.117 11.054  1.00 16.87 ? 227  ILE A CG1 1 
ATOM   33   C  CG2 . ILE A 1 4   ? 21.542  29.783 13.258  1.00 16.81 ? 227  ILE A CG2 1 
ATOM   34   C  CD1 . ILE A 1 4   ? 21.318  29.656 10.041  1.00 16.85 ? 227  ILE A CD1 1 
ATOM   35   N  N   . GLN A 1 5   ? 23.576  26.642 13.648  1.00 19.94 ? 228  GLN A N   1 
ATOM   36   C  CA  . GLN A 1 5   ? 24.134  25.993 14.830  1.00 21.43 ? 228  GLN A CA  1 
ATOM   37   C  C   . GLN A 1 5   ? 25.583  26.363 14.968  1.00 22.46 ? 228  GLN A C   1 
ATOM   38   O  O   . GLN A 1 5   ? 26.204  26.896 14.029  1.00 22.11 ? 228  GLN A O   1 
ATOM   39   C  CB  . GLN A 1 5   ? 23.952  24.454 14.739  1.00 21.31 ? 228  GLN A CB  1 
ATOM   40   C  CG  . GLN A 1 5   ? 24.629  23.821 13.486  1.00 23.73 ? 228  GLN A CG  1 
ATOM   41   C  CD  . GLN A 1 5   ? 24.522  22.290 13.450  1.00 26.96 ? 228  GLN A CD  1 
ATOM   42   O  OE1 . GLN A 1 5   ? 23.474  21.715 13.755  1.00 28.44 ? 228  GLN A OE1 1 
ATOM   43   N  NE2 . GLN A 1 5   ? 25.619  21.625 13.055  1.00 30.70 ? 228  GLN A NE2 1 
ATOM   44   N  N   . ARG A 1 6   ? 26.146  26.025 16.127  1.00 23.38 ? 229  ARG A N   1 
ATOM   45   C  CA  . ARG A 1 6   ? 27.536  26.363 16.444  1.00 25.78 ? 229  ARG A CA  1 
ATOM   46   C  C   . ARG A 1 6   ? 28.559  25.375 15.857  1.00 26.70 ? 229  ARG A C   1 
ATOM   47   O  O   . ARG A 1 6   ? 29.651  25.776 15.443  1.00 28.01 ? 229  ARG A O   1 
ATOM   48   C  CB  . ARG A 1 6   ? 27.729  26.438 17.958  1.00 25.83 ? 229  ARG A CB  1 
ATOM   49   C  CG  . ARG A 1 6   ? 26.995  27.616 18.638  1.00 27.31 ? 229  ARG A CG  1 
ATOM   50   C  CD  . ARG A 1 6   ? 27.368  28.963 18.065  1.00 29.13 ? 229  ARG A CD  1 
ATOM   51   N  NE  . ARG A 1 6   ? 26.375  29.939 18.497  1.00 33.66 ? 229  ARG A NE  1 
ATOM   52   C  CZ  . ARG A 1 6   ? 26.089  31.081 17.876  1.00 35.13 ? 229  ARG A CZ  1 
ATOM   53   N  NH1 . ARG A 1 6   ? 26.753  31.433 16.778  1.00 33.18 ? 229  ARG A NH1 1 
ATOM   54   N  NH2 . ARG A 1 6   ? 25.130  31.873 18.372  1.00 32.23 ? 229  ARG A NH2 1 
ATOM   55   N  N   . SER A 1 7   ? 28.217  24.104 15.811  1.00 27.37 ? 230  SER A N   1 
ATOM   56   C  CA  . SER A 1 7   ? 29.206  23.141 15.330  1.00 28.73 ? 230  SER A CA  1 
ATOM   57   C  C   . SER A 1 7   ? 29.264  23.173 13.791  1.00 27.44 ? 230  SER A C   1 
ATOM   58   O  O   . SER A 1 7   ? 28.230  23.299 13.124  1.00 27.36 ? 230  SER A O   1 
ATOM   59   C  CB  . SER A 1 7   ? 28.924  21.744 15.888  1.00 28.98 ? 230  SER A CB  1 
ATOM   60   O  OG  . SER A 1 7   ? 27.717  21.239 15.367  1.00 32.98 ? 230  SER A OG  1 
ATOM   61   N  N   . GLY A 1 8   ? 30.474  23.124 13.238  1.00 27.09 ? 231  GLY A N   1 
ATOM   62   C  CA  . GLY A 1 8   ? 30.646  22.954 11.792  1.00 25.42 ? 231  GLY A CA  1 
ATOM   63   C  C   . GLY A 1 8   ? 30.699  24.222 10.963  1.00 25.39 ? 231  GLY A C   1 
ATOM   64   O  O   . GLY A 1 8   ? 31.157  25.304 11.408  1.00 25.47 ? 231  GLY A O   1 
ATOM   65   N  N   . HIS A 1 9   ? 30.282  24.079 9.710   1.00 22.34 ? 232  HIS A N   1 
ATOM   66   C  CA  . HIS A 1 9   ? 30.320  25.191 8.797   1.00 20.83 ? 232  HIS A CA  1 
ATOM   67   C  C   . HIS A 1 9   ? 29.183  25.030 7.805   1.00 19.19 ? 232  HIS A C   1 
ATOM   68   O  O   . HIS A 1 9   ? 28.780  23.878 7.466   1.00 19.76 ? 232  HIS A O   1 
ATOM   69   C  CB  . HIS A 1 9   ? 31.642  25.207 8.044   1.00 20.62 ? 232  HIS A CB  1 
ATOM   70   C  CG  . HIS A 1 9   ? 31.952  26.526 7.417   1.00 21.23 ? 232  HIS A CG  1 
ATOM   71   N  ND1 . HIS A 1 9   ? 32.636  27.515 8.086   1.00 21.44 ? 232  HIS A ND1 1 
ATOM   72   C  CD2 . HIS A 1 9   ? 31.699  27.017 6.182   1.00 19.93 ? 232  HIS A CD2 1 
ATOM   73   C  CE1 . HIS A 1 9   ? 32.782  28.566 7.297   1.00 20.89 ? 232  HIS A CE1 1 
ATOM   74   N  NE2 . HIS A 1 9   ? 32.199  28.300 6.142   1.00 18.54 ? 232  HIS A NE2 1 
ATOM   75   N  N   . LEU A 1 10  ? 28.653  26.170 7.364   1.00 17.52 ? 233  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 10  ? 27.582  26.203 6.356   1.00 17.10 ? 233  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 10  ? 28.120  26.883 5.098   1.00 16.70 ? 233  LEU A C   1 
ATOM   78   O  O   . LEU A 1 10  ? 28.600  28.007 5.162   1.00 18.50 ? 233  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 10  ? 26.360  26.995 6.893   1.00 16.41 ? 233  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 10  ? 25.233  27.327 5.886   1.00 16.94 ? 233  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 10  ? 24.592  26.065 5.339   1.00 13.31 ? 233  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 10  ? 24.167  28.262 6.510   1.00 16.45 ? 233  LEU A CD2 1 
ATOM   83   N  N   . ASN A 1 11  ? 28.037  26.213 3.954   1.00 16.87 ? 234  ASN A N   1 
ATOM   84   C  CA  . ASN A 1 11  ? 28.279  26.856 2.653   1.00 17.40 ? 234  ASN A CA  1 
ATOM   85   C  C   . ASN A 1 11  ? 26.901  27.063 2.035   1.00 16.87 ? 234  ASN A C   1 
ATOM   86   O  O   . ASN A 1 11  ? 26.122  26.102 1.867   1.00 15.69 ? 234  ASN A O   1 
ATOM   87   C  CB  . ASN A 1 11  ? 29.081  25.965 1.683   1.00 18.09 ? 234  ASN A CB  1 
ATOM   88   C  CG  . ASN A 1 11  ? 30.574  25.863 2.008   1.00 19.02 ? 234  ASN A CG  1 
ATOM   89   O  OD1 . ASN A 1 11  ? 31.083  26.431 2.987   1.00 21.74 ? 234  ASN A OD1 1 
ATOM   90   N  ND2 . ASN A 1 11  ? 31.297  25.121 1.144   1.00 15.91 ? 234  ASN A ND2 1 
ATOM   91   N  N   . LEU A 1 12  ? 26.589  28.317 1.716   1.00 15.81 ? 235  LEU A N   1 
ATOM   92   C  CA  . LEU A 1 12  ? 25.361  28.639 1.025   1.00 16.58 ? 235  LEU A CA  1 
ATOM   93   C  C   . LEU A 1 12  ? 25.686  29.070 -0.423  1.00 16.53 ? 235  LEU A C   1 
ATOM   94   O  O   . LEU A 1 12  ? 26.527  29.941 -0.630  1.00 18.41 ? 235  LEU A O   1 
ATOM   95   C  CB  . LEU A 1 12  ? 24.679  29.804 1.755   1.00 18.15 ? 235  LEU A CB  1 
ATOM   96   C  CG  . LEU A 1 12  ? 23.443  30.443 1.131   1.00 18.00 ? 235  LEU A CG  1 
ATOM   97   C  CD1 . LEU A 1 12  ? 22.308  29.469 1.167   1.00 18.55 ? 235  LEU A CD1 1 
ATOM   98   C  CD2 . LEU A 1 12  ? 23.039  31.692 1.947   1.00 19.50 ? 235  LEU A CD2 1 
ATOM   99   N  N   . TYR A 1 13  ? 25.058  28.468 -1.415  1.00 15.85 ? 236  TYR A N   1 
ATOM   100  C  CA  . TYR A 1 13  ? 25.354  28.833 -2.813  1.00 15.70 ? 236  TYR A CA  1 
ATOM   101  C  C   . TYR A 1 13  ? 24.109  29.453 -3.426  1.00 15.58 ? 236  TYR A C   1 
ATOM   102  O  O   . TYR A 1 13  ? 23.078  28.788 -3.517  1.00 15.30 ? 236  TYR A O   1 
ATOM   103  C  CB  . TYR A 1 13  ? 25.804  27.600 -3.635  1.00 15.06 ? 236  TYR A CB  1 
ATOM   104  C  CG  . TYR A 1 13  ? 26.821  26.702 -2.959  1.00 14.31 ? 236  TYR A CG  1 
ATOM   105  C  CD1 . TYR A 1 13  ? 26.430  25.811 -1.937  1.00 16.76 ? 236  TYR A CD1 1 
ATOM   106  C  CD2 . TYR A 1 13  ? 28.163  26.702 -3.363  1.00 15.27 ? 236  TYR A CD2 1 
ATOM   107  C  CE1 . TYR A 1 13  ? 27.370  24.961 -1.298  1.00 15.09 ? 236  TYR A CE1 1 
ATOM   108  C  CE2 . TYR A 1 13  ? 29.102  25.840 -2.751  1.00 12.00 ? 236  TYR A CE2 1 
ATOM   109  C  CZ  . TYR A 1 13  ? 28.684  24.990 -1.741  1.00 15.80 ? 236  TYR A CZ  1 
ATOM   110  O  OH  . TYR A 1 13  ? 29.583  24.157 -1.159  1.00 17.57 ? 236  TYR A OH  1 
ATOM   111  N  N   . LEU A 1 14  ? 24.197  30.722 -3.829  1.00 15.16 ? 237  LEU A N   1 
ATOM   112  C  CA  . LEU A 1 14  ? 23.048  31.441 -4.365  1.00 16.05 ? 237  LEU A CA  1 
ATOM   113  C  C   . LEU A 1 14  ? 23.179  31.549 -5.886  1.00 16.04 ? 237  LEU A C   1 
ATOM   114  O  O   . LEU A 1 14  ? 24.117  32.182 -6.379  1.00 16.13 ? 237  LEU A O   1 
ATOM   115  C  CB  . LEU A 1 14  ? 22.897  32.840 -3.695  1.00 15.64 ? 237  LEU A CB  1 
ATOM   116  C  CG  . LEU A 1 14  ? 22.695  32.869 -2.157  1.00 14.50 ? 237  LEU A CG  1 
ATOM   117  C  CD1 . LEU A 1 14  ? 22.565  34.301 -1.568  1.00 19.59 ? 237  LEU A CD1 1 
ATOM   118  C  CD2 . LEU A 1 14  ? 21.518  32.076 -1.690  1.00 15.89 ? 237  LEU A CD2 1 
ATOM   119  N  N   . LEU A 1 15  ? 22.271  30.859 -6.600  1.00 15.55 ? 238  LEU A N   1 
ATOM   120  C  CA  . LEU A 1 15  ? 22.276  30.745 -8.064  1.00 16.20 ? 238  LEU A CA  1 
ATOM   121  C  C   . LEU A 1 15  ? 21.162  31.579 -8.642  1.00 16.11 ? 238  LEU A C   1 
ATOM   122  O  O   . LEU A 1 15  ? 19.983  31.241 -8.490  1.00 16.33 ? 238  LEU A O   1 
ATOM   123  C  CB  . LEU A 1 15  ? 22.095  29.274 -8.510  1.00 15.61 ? 238  LEU A CB  1 
ATOM   124  C  CG  . LEU A 1 15  ? 23.397  28.450 -8.496  1.00 12.46 ? 238  LEU A CG  1 
ATOM   125  C  CD1 . LEU A 1 15  ? 24.065  28.493 -7.105  1.00 11.16 ? 238  LEU A CD1 1 
ATOM   126  C  CD2 . LEU A 1 15  ? 23.114  27.005 -8.968  1.00 13.11 ? 238  LEU A CD2 1 
ATOM   127  N  N   . LEU A 1 16  ? 21.533  32.669 -9.307  1.00 17.03 ? 239  LEU A N   1 
ATOM   128  C  CA  . LEU A 1 16  ? 20.570  33.636 -9.849  1.00 18.45 ? 239  LEU A CA  1 
ATOM   129  C  C   . LEU A 1 16  ? 20.448  33.545 -11.381 1.00 17.62 ? 239  LEU A C   1 
ATOM   130  O  O   . LEU A 1 16  ? 21.410  33.747 -12.078 1.00 16.91 ? 239  LEU A O   1 
ATOM   131  C  CB  . LEU A 1 16  ? 21.036  35.063 -9.526  1.00 20.10 ? 239  LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 16  ? 21.408  35.540 -8.098  1.00 24.16 ? 239  LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 16  ? 21.067  37.079 -7.971  1.00 26.50 ? 239  LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 16  ? 20.832  34.731 -6.939  1.00 24.79 ? 239  LEU A CD2 1 
ATOM   135  N  N   . ASP A 1 17  ? 19.255  33.245 -11.845 1.00 17.97 ? 240  ASP A N   1 
ATOM   136  C  CA  . ASP A 1 17  ? 18.897  33.039 -13.238 1.00 18.44 ? 240  ASP A CA  1 
ATOM   137  C  C   . ASP A 1 17  ? 18.849  34.420 -13.907 1.00 19.86 ? 240  ASP A C   1 
ATOM   138  O  O   . ASP A 1 17  ? 17.995  35.258 -13.578 1.00 19.92 ? 240  ASP A O   1 
ATOM   139  C  CB  . ASP A 1 17  ? 17.521  32.383 -13.273 1.00 17.13 ? 240  ASP A CB  1 
ATOM   140  C  CG  . ASP A 1 17  ? 17.042  31.978 -14.686 1.00 18.23 ? 240  ASP A CG  1 
ATOM   141  O  OD1 . ASP A 1 17  ? 17.531  32.486 -15.723 1.00 16.99 ? 240  ASP A OD1 1 
ATOM   142  O  OD2 . ASP A 1 17  ? 16.125  31.151 -14.734 1.00 18.43 ? 240  ASP A OD2 1 
ATOM   143  N  N   . ALA A 1 18  ? 19.758  34.609 -14.847 1.00 19.37 ? 241  ALA A N   1 
ATOM   144  C  CA  . ALA A 1 18  ? 19.859  35.845 -15.638 1.00 21.90 ? 241  ALA A CA  1 
ATOM   145  C  C   . ALA A 1 18  ? 19.570  35.573 -17.116 1.00 23.42 ? 241  ALA A C   1 
ATOM   146  O  O   . ALA A 1 18  ? 20.038  36.315 -18.007 1.00 23.60 ? 241  ALA A O   1 
ATOM   147  C  CB  . ALA A 1 18  ? 21.263  36.462 -15.467 1.00 20.99 ? 241  ALA A CB  1 
ATOM   148  N  N   . SER A 1 19  ? 18.815  34.509 -17.376 1.00 23.74 ? 242  SER A N   1 
ATOM   149  C  CA  . SER A 1 19  ? 18.398  34.162 -18.725 1.00 24.34 ? 242  SER A CA  1 
ATOM   150  C  C   . SER A 1 19  ? 17.347  35.156 -19.264 1.00 26.43 ? 242  SER A C   1 
ATOM   151  O  O   . SER A 1 19  ? 16.806  35.984 -18.503 1.00 25.28 ? 242  SER A O   1 
ATOM   152  C  CB  . SER A 1 19  ? 17.904  32.719 -18.782 1.00 23.69 ? 242  SER A CB  1 
ATOM   153  O  OG  . SER A 1 19  ? 16.626  32.534 -18.178 1.00 22.23 ? 242  SER A OG  1 
ATOM   154  N  N   . GLN A 1 20  ? 17.106  35.091 -20.574 1.00 27.44 ? 243  GLN A N   1 
ATOM   155  C  CA  . GLN A 1 20  ? 16.174  36.012 -21.228 1.00 30.61 ? 243  GLN A CA  1 
ATOM   156  C  C   . GLN A 1 20  ? 14.737  35.951 -20.683 1.00 30.20 ? 243  GLN A C   1 
ATOM   157  O  O   . GLN A 1 20  ? 14.055  36.975 -20.639 1.00 32.64 ? 243  GLN A O   1 
ATOM   158  C  CB  . GLN A 1 20  ? 16.193  35.815 -22.753 1.00 30.71 ? 243  GLN A CB  1 
ATOM   159  C  CG  . GLN A 1 20  ? 15.664  37.013 -23.518 1.00 36.17 ? 243  GLN A CG  1 
ATOM   160  C  CD  . GLN A 1 20  ? 16.746  38.051 -23.774 1.00 41.32 ? 243  GLN A CD  1 
ATOM   161  O  OE1 . GLN A 1 20  ? 17.833  38.018 -23.178 1.00 43.37 ? 243  GLN A OE1 1 
ATOM   162  N  NE2 . GLN A 1 20  ? 16.463  38.968 -24.683 1.00 43.61 ? 243  GLN A NE2 1 
ATOM   163  N  N   . SER A 1 21  ? 14.267  34.776 -20.280 1.00 29.43 ? 244  SER A N   1 
ATOM   164  C  CA  . SER A 1 21  ? 12.930  34.649 -19.708 1.00 28.43 ? 244  SER A CA  1 
ATOM   165  C  C   . SER A 1 21  ? 12.732  35.449 -18.390 1.00 28.88 ? 244  SER A C   1 
ATOM   166  O  O   . SER A 1 21  ? 11.605  35.603 -17.919 1.00 28.54 ? 244  SER A O   1 
ATOM   167  C  CB  . SER A 1 21  ? 12.627  33.177 -19.448 1.00 29.25 ? 244  SER A CB  1 
ATOM   168  O  OG  . SER A 1 21  ? 13.512  32.681 -18.441 1.00 24.04 ? 244  SER A OG  1 
ATOM   169  N  N   . VAL A 1 22  ? 13.838  35.896 -17.788 1.00 29.15 ? 245  VAL A N   1 
ATOM   170  C  CA  . VAL A 1 22  ? 13.821  36.705 -16.579 1.00 29.85 ? 245  VAL A CA  1 
ATOM   171  C  C   . VAL A 1 22  ? 14.200  38.128 -17.022 1.00 30.18 ? 245  VAL A C   1 
ATOM   172  O  O   . VAL A 1 22  ? 15.289  38.349 -17.540 1.00 30.56 ? 245  VAL A O   1 
ATOM   173  C  CB  . VAL A 1 22  ? 14.823  36.139 -15.501 1.00 29.85 ? 245  VAL A CB  1 
ATOM   174  C  CG1 . VAL A 1 22  ? 14.920  37.062 -14.283 1.00 30.69 ? 245  VAL A CG1 1 
ATOM   175  C  CG2 . VAL A 1 22  ? 14.388  34.752 -15.032 1.00 30.05 ? 245  VAL A CG2 1 
ATOM   176  N  N   . SER A 1 23  ? 13.296  39.096 -16.862 1.00 31.37 ? 246  SER A N   1 
ATOM   177  C  CA  . SER A 1 23  ? 13.622  40.478 -17.257 1.00 31.88 ? 246  SER A CA  1 
ATOM   178  C  C   . SER A 1 23  ? 14.668  41.076 -16.324 1.00 33.21 ? 246  SER A C   1 
ATOM   179  O  O   . SER A 1 23  ? 14.924  40.532 -15.247 1.00 33.09 ? 246  SER A O   1 
ATOM   180  C  CB  . SER A 1 23  ? 12.371  41.348 -17.233 1.00 32.29 ? 246  SER A CB  1 
ATOM   181  O  OG  . SER A 1 23  ? 12.016  41.669 -15.892 1.00 30.98 ? 246  SER A OG  1 
ATOM   182  N  N   . GLU A 1 24  ? 15.271  42.201 -16.726 1.00 33.90 ? 247  GLU A N   1 
ATOM   183  C  CA  . GLU A 1 24  ? 16.199  42.914 -15.863 1.00 35.47 ? 247  GLU A CA  1 
ATOM   184  C  C   . GLU A 1 24  ? 15.561  43.279 -14.530 1.00 35.30 ? 247  GLU A C   1 
ATOM   185  O  O   . GLU A 1 24  ? 16.253  43.298 -13.514 1.00 35.77 ? 247  GLU A O   1 
ATOM   186  C  CB  . GLU A 1 24  ? 16.723  44.182 -16.517 1.00 35.90 ? 247  GLU A CB  1 
ATOM   187  C  CG  . GLU A 1 24  ? 17.903  43.953 -17.392 1.00 40.28 ? 247  GLU A CG  1 
ATOM   188  C  CD  . GLU A 1 24  ? 18.999  44.950 -17.155 1.00 45.48 ? 247  GLU A CD  1 
ATOM   189  O  OE1 . GLU A 1 24  ? 19.271  45.276 -15.973 1.00 47.25 ? 247  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A 1 24  ? 19.602  45.392 -18.152 1.00 46.67 ? 247  GLU A OE2 1 
ATOM   191  N  N   . ASN A 1 25  ? 14.253  43.555 -14.538 1.00 35.25 ? 248  ASN A N   1 
ATOM   192  C  CA  . ASN A 1 25  ? 13.537  43.938 -13.318 1.00 35.11 ? 248  ASN A CA  1 
ATOM   193  C  C   . ASN A 1 25  ? 13.309  42.740 -12.397 1.00 34.32 ? 248  ASN A C   1 
ATOM   194  O  O   . ASN A 1 25  ? 13.463  42.864 -11.186 1.00 33.12 ? 248  ASN A O   1 
ATOM   195  C  CB  . ASN A 1 25  ? 12.216  44.655 -13.626 1.00 35.95 ? 248  ASN A CB  1 
ATOM   196  C  CG  . ASN A 1 25  ? 12.421  46.124 -14.061 1.00 38.61 ? 248  ASN A CG  1 
ATOM   197  O  OD1 . ASN A 1 25  ? 13.451  46.753 -13.766 1.00 42.38 ? 248  ASN A OD1 1 
ATOM   198  N  ND2 . ASN A 1 25  ? 11.428  46.670 -14.762 1.00 41.71 ? 248  ASN A ND2 1 
ATOM   199  N  N   . ASP A 1 26  ? 12.957  41.589 -12.985 1.00 33.00 ? 249  ASP A N   1 
ATOM   200  C  CA  . ASP A 1 26  ? 12.928  40.297 -12.242 1.00 32.45 ? 249  ASP A CA  1 
ATOM   201  C  C   . ASP A 1 26  ? 14.273  40.004 -11.558 1.00 31.38 ? 249  ASP A C   1 
ATOM   202  O  O   . ASP A 1 26  ? 14.323  39.616 -10.382 1.00 31.23 ? 249  ASP A O   1 
ATOM   203  C  CB  . ASP A 1 26  ? 12.588  39.129 -13.168 1.00 32.39 ? 249  ASP A CB  1 
ATOM   204  C  CG  . ASP A 1 26  ? 11.296  39.339 -13.962 1.00 35.14 ? 249  ASP A CG  1 
ATOM   205  O  OD1 . ASP A 1 26  ? 11.195  38.788 -15.101 1.00 33.77 ? 249  ASP A OD1 1 
ATOM   206  O  OD2 . ASP A 1 26  ? 10.365  40.013 -13.443 1.00 37.20 ? 249  ASP A OD2 1 
ATOM   207  N  N   . PHE A 1 27  ? 15.359  40.170 -12.307 1.00 29.60 ? 250  PHE A N   1 
ATOM   208  C  CA  . PHE A 1 27  ? 16.681  39.914 -11.794 1.00 29.08 ? 250  PHE A CA  1 
ATOM   209  C  C   . PHE A 1 27  ? 16.999  40.794 -10.583 1.00 29.28 ? 250  PHE A C   1 
ATOM   210  O  O   . PHE A 1 27  ? 17.664  40.349 -9.635  1.00 28.80 ? 250  PHE A O   1 
ATOM   211  C  CB  . PHE A 1 27  ? 17.720  40.118 -12.895 1.00 28.26 ? 250  PHE A CB  1 
ATOM   212  C  CG  . PHE A 1 27  ? 19.102  39.655 -12.531 1.00 26.57 ? 250  PHE A CG  1 
ATOM   213  C  CD1 . PHE A 1 27  ? 20.095  40.571 -12.232 1.00 25.64 ? 250  PHE A CD1 1 
ATOM   214  C  CD2 . PHE A 1 27  ? 19.419  38.280 -12.518 1.00 25.24 ? 250  PHE A CD2 1 
ATOM   215  C  CE1 . PHE A 1 27  ? 21.385  40.157 -11.902 1.00 26.65 ? 250  PHE A CE1 1 
ATOM   216  C  CE2 . PHE A 1 27  ? 20.700  37.857 -12.207 1.00 22.88 ? 250  PHE A CE2 1 
ATOM   217  C  CZ  . PHE A 1 27  ? 21.690  38.780 -11.897 1.00 27.16 ? 250  PHE A CZ  1 
ATOM   218  N  N   . LEU A 1 28  ? 16.564  42.060 -10.628 1.00 29.45 ? 251  LEU A N   1 
ATOM   219  C  CA  . LEU A 1 28  ? 16.738  42.941 -9.468  1.00 29.47 ? 251  LEU A CA  1 
ATOM   220  C  C   . LEU A 1 28  ? 16.017  42.384 -8.242  1.00 28.21 ? 251  LEU A C   1 
ATOM   221  O  O   . LEU A 1 28  ? 16.552  42.432 -7.150  1.00 29.66 ? 251  LEU A O   1 
ATOM   222  C  CB  . LEU A 1 28  ? 16.226  44.354 -9.769  1.00 30.49 ? 251  LEU A CB  1 
ATOM   223  C  CG  . LEU A 1 28  ? 17.164  45.197 -10.624 1.00 33.26 ? 251  LEU A CG  1 
ATOM   224  C  CD1 . LEU A 1 28  ? 16.396  46.412 -11.205 1.00 36.84 ? 251  LEU A CD1 1 
ATOM   225  C  CD2 . LEU A 1 28  ? 18.409  45.607 -9.812  1.00 37.27 ? 251  LEU A CD2 1 
ATOM   226  N  N   . ILE A 1 29  ? 14.814  41.861 -8.436  1.00 27.00 ? 252  ILE A N   1 
ATOM   227  C  CA  . ILE A 1 29  ? 14.056  41.222 -7.349  1.00 26.60 ? 252  ILE A CA  1 
ATOM   228  C  C   . ILE A 1 29  ? 14.837  39.993 -6.835  1.00 25.72 ? 252  ILE A C   1 
ATOM   229  O  O   . ILE A 1 29  ? 14.928  39.771 -5.627  1.00 25.32 ? 252  ILE A O   1 
ATOM   230  C  CB  . ILE A 1 29  ? 12.671  40.758 -7.811  1.00 25.79 ? 252  ILE A CB  1 
ATOM   231  C  CG1 . ILE A 1 29  ? 11.793  41.918 -8.330  1.00 28.90 ? 252  ILE A CG1 1 
ATOM   232  C  CG2 . ILE A 1 29  ? 11.960  39.957 -6.681  1.00 27.69 ? 252  ILE A CG2 1 
ATOM   233  C  CD1 . ILE A 1 29  ? 11.038  42.660 -7.269  1.00 30.21 ? 252  ILE A CD1 1 
ATOM   234  N  N   . PHE A 1 30  ? 15.393  39.193 -7.754  1.00 24.90 ? 253  PHE A N   1 
ATOM   235  C  CA  . PHE A 1 30  ? 16.325  38.122 -7.335  1.00 23.99 ? 253  PHE A CA  1 
ATOM   236  C  C   . PHE A 1 30  ? 17.475  38.652 -6.485  1.00 24.50 ? 253  PHE A C   1 
ATOM   237  O  O   . PHE A 1 30  ? 17.828  38.069 -5.466  1.00 24.82 ? 253  PHE A O   1 
ATOM   238  C  CB  . PHE A 1 30  ? 16.934  37.366 -8.549  1.00 24.33 ? 253  PHE A CB  1 
ATOM   239  C  CG  . PHE A 1 30  ? 15.947  36.538 -9.352  1.00 22.41 ? 253  PHE A CG  1 
ATOM   240  C  CD1 . PHE A 1 30  ? 16.357  35.955 -10.562 1.00 20.29 ? 253  PHE A CD1 1 
ATOM   241  C  CD2 . PHE A 1 30  ? 14.650  36.308 -8.913  1.00 23.83 ? 253  PHE A CD2 1 
ATOM   242  C  CE1 . PHE A 1 30  ? 15.474  35.205 -11.327 1.00 20.53 ? 253  PHE A CE1 1 
ATOM   243  C  CE2 . PHE A 1 30  ? 13.763  35.552 -9.673  1.00 24.46 ? 253  PHE A CE2 1 
ATOM   244  C  CZ  . PHE A 1 30  ? 14.190  34.985 -10.892 1.00 23.45 ? 253  PHE A CZ  1 
ATOM   245  N  N   . LYS A 1 31  ? 18.102  39.742 -6.911  1.00 24.46 ? 254  LYS A N   1 
ATOM   246  C  CA  . LYS A 1 31  ? 19.226  40.305 -6.166  1.00 25.27 ? 254  LYS A CA  1 
ATOM   247  C  C   . LYS A 1 31  ? 18.781  40.800 -4.764  1.00 24.69 ? 254  LYS A C   1 
ATOM   248  O  O   . LYS A 1 31  ? 19.499  40.633 -3.770  1.00 24.83 ? 254  LYS A O   1 
ATOM   249  C  CB  . LYS A 1 31  ? 19.905  41.424 -6.959  1.00 24.81 ? 254  LYS A CB  1 
ATOM   250  C  CG  . LYS A 1 31  ? 20.824  40.943 -8.109  1.00 27.37 ? 254  LYS A CG  1 
ATOM   251  C  CD  . LYS A 1 31  ? 21.320  42.123 -8.980  1.00 30.31 ? 254  LYS A CD  1 
ATOM   252  C  CE  . LYS A 1 31  ? 22.355  42.976 -8.238  1.00 32.15 ? 254  LYS A CE  1 
ATOM   253  N  NZ  . LYS A 1 31  ? 22.924  44.059 -9.098  1.00 32.70 ? 254  LYS A NZ  1 
ATOM   254  N  N   . GLU A 1 32  ? 17.597  41.399 -4.709  1.00 25.84 ? 255  GLU A N   1 
ATOM   255  C  CA  . GLU A 1 32  ? 16.998  41.876 -3.451  1.00 26.12 ? 255  GLU A CA  1 
ATOM   256  C  C   . GLU A 1 32  ? 16.741  40.713 -2.487  1.00 25.32 ? 255  GLU A C   1 
ATOM   257  O  O   . GLU A 1 32  ? 17.075  40.784 -1.296  1.00 25.27 ? 255  GLU A O   1 
ATOM   258  C  CB  . GLU A 1 32  ? 15.658  42.548 -3.740  1.00 27.45 ? 255  GLU A CB  1 
ATOM   259  C  CG  . GLU A 1 32  ? 14.991  43.089 -2.440  1.00 31.64 ? 255  GLU A CG  1 
ATOM   260  C  CD  . GLU A 1 32  ? 13.643  43.756 -2.645  1.00 38.67 ? 255  GLU A CD  1 
ATOM   261  O  OE1 . GLU A 1 32  ? 13.009  43.519 -3.702  1.00 40.55 ? 255  GLU A OE1 1 
ATOM   262  O  OE2 . GLU A 1 32  ? 13.216  44.512 -1.719  1.00 41.54 ? 255  GLU A OE2 1 
ATOM   263  N  N   . SER A 1 33  ? 16.148  39.645 -3.017  1.00 24.80 ? 256  SER A N   1 
ATOM   264  C  CA  . SER A 1 33  ? 15.886  38.441 -2.226  1.00 24.14 ? 256  SER A CA  1 
ATOM   265  C  C   . SER A 1 33  ? 17.182  37.790 -1.718  1.00 22.76 ? 256  SER A C   1 
ATOM   266  O  O   . SER A 1 33  ? 17.304  37.461 -0.514  1.00 22.25 ? 256  SER A O   1 
ATOM   267  C  CB  . SER A 1 33  ? 15.063  37.481 -3.053  1.00 24.01 ? 256  SER A CB  1 
ATOM   268  O  OG  . SER A 1 33  ? 13.782  38.009 -3.272  1.00 26.52 ? 256  SER A OG  1 
ATOM   269  N  N   . ALA A 1 34  ? 18.163  37.645 -2.621  1.00 22.38 ? 257  ALA A N   1 
ATOM   270  C  CA  . ALA A 1 34  ? 19.478  37.115 -2.252  1.00 21.11 ? 257  ALA A CA  1 
ATOM   271  C  C   . ALA A 1 34  ? 20.164  37.955 -1.156  1.00 20.97 ? 257  ALA A C   1 
ATOM   272  O  O   . ALA A 1 34  ? 20.663  37.403 -0.214  1.00 18.83 ? 257  ALA A O   1 
ATOM   273  C  CB  . ALA A 1 34  ? 20.382  36.976 -3.485  1.00 21.71 ? 257  ALA A CB  1 
ATOM   274  N  N   . SER A 1 35  ? 20.159  39.286 -1.288  1.00 21.35 ? 258  SER A N   1 
ATOM   275  C  CA  . SER A 1 35  ? 20.705  40.178 -0.264  1.00 22.01 ? 258  SER A CA  1 
ATOM   276  C  C   . SER A 1 35  ? 20.043  39.989 1.142   1.00 20.58 ? 258  SER A C   1 
ATOM   277  O  O   . SER A 1 35  ? 20.729  39.931 2.157   1.00 20.47 ? 258  SER A O   1 
ATOM   278  C  CB  . SER A 1 35  ? 20.574  41.640 -0.710  1.00 23.08 ? 258  SER A CB  1 
ATOM   279  O  OG  . SER A 1 35  ? 21.281  41.793 -1.949  1.00 31.43 ? 258  SER A OG  1 
ATOM   280  N  N   . LEU A 1 36  ? 18.727  39.906 1.153   1.00 20.26 ? 259  LEU A N   1 
ATOM   281  C  CA  . LEU A 1 36  ? 17.995  39.644 2.392   1.00 20.57 ? 259  LEU A CA  1 
ATOM   282  C  C   . LEU A 1 36  ? 18.424  38.316 2.995   1.00 19.52 ? 259  LEU A C   1 
ATOM   283  O  O   . LEU A 1 36  ? 18.616  38.238 4.224   1.00 19.90 ? 259  LEU A O   1 
ATOM   284  C  CB  . LEU A 1 36  ? 16.493  39.659 2.147   1.00 20.74 ? 259  LEU A CB  1 
ATOM   285  C  CG  . LEU A 1 36  ? 15.609  39.371 3.381   1.00 25.80 ? 259  LEU A CG  1 
ATOM   286  C  CD1 . LEU A 1 36  ? 14.269  40.162 3.338   1.00 28.79 ? 259  LEU A CD1 1 
ATOM   287  C  CD2 . LEU A 1 36  ? 15.354  37.840 3.492   1.00 29.04 ? 259  LEU A CD2 1 
ATOM   288  N  N   . MET A 1 37  ? 18.584  37.268 2.160   1.00 17.05 ? 260  MET A N   1 
ATOM   289  C  CA  . MET A 1 37  ? 18.910  35.962 2.723   1.00 15.93 ? 260  MET A CA  1 
ATOM   290  C  C   . MET A 1 37  ? 20.312  35.995 3.286   1.00 16.04 ? 260  MET A C   1 
ATOM   291  O  O   . MET A 1 37  ? 20.583  35.425 4.323   1.00 15.76 ? 260  MET A O   1 
ATOM   292  C  CB  . MET A 1 37  ? 18.738  34.837 1.686   1.00 15.81 ? 260  MET A CB  1 
ATOM   293  C  CG  . MET A 1 37  ? 17.245  34.558 1.317   1.00 17.00 ? 260  MET A CG  1 
ATOM   294  S  SD  . MET A 1 37  ? 17.045  33.090 0.270   1.00 20.18 ? 260  MET A SD  1 
ATOM   295  C  CE  . MET A 1 37  ? 17.722  33.735 -1.249  1.00 16.62 ? 260  MET A CE  1 
ATOM   296  N  N   . VAL A 1 38  ? 21.222  36.662 2.590   1.00 15.69 ? 261  VAL A N   1 
ATOM   297  C  CA  . VAL A 1 38  ? 22.585  36.867 3.119   1.00 17.82 ? 261  VAL A CA  1 
ATOM   298  C  C   . VAL A 1 38  ? 22.562  37.652 4.460   1.00 17.55 ? 261  VAL A C   1 
ATOM   299  O  O   . VAL A 1 38  ? 23.190  37.280 5.453   1.00 18.27 ? 261  VAL A O   1 
ATOM   300  C  CB  . VAL A 1 38  ? 23.425  37.612 2.073   1.00 18.74 ? 261  VAL A CB  1 
ATOM   301  C  CG1 . VAL A 1 38  ? 24.768  38.060 2.659   1.00 19.38 ? 261  VAL A CG1 1 
ATOM   302  C  CG2 . VAL A 1 38  ? 23.626  36.693 0.808   1.00 20.01 ? 261  VAL A CG2 1 
ATOM   303  N  N   . ASP A 1 39  ? 21.859  38.763 4.462   1.00 19.16 ? 262  ASP A N   1 
ATOM   304  C  CA  . ASP A 1 39  ? 21.759  39.589 5.685   1.00 20.05 ? 262  ASP A CA  1 
ATOM   305  C  C   . ASP A 1 39  ? 21.234  38.752 6.863   1.00 19.28 ? 262  ASP A C   1 
ATOM   306  O  O   . ASP A 1 39  ? 21.815  38.781 7.958   1.00 18.93 ? 262  ASP A O   1 
ATOM   307  C  CB  . ASP A 1 39  ? 20.800  40.736 5.430   1.00 22.43 ? 262  ASP A CB  1 
ATOM   308  C  CG  . ASP A 1 39  ? 20.821  41.785 6.556   1.00 30.29 ? 262  ASP A CG  1 
ATOM   309  O  OD1 . ASP A 1 39  ? 21.639  41.635 7.525   1.00 35.88 ? 262  ASP A OD1 1 
ATOM   310  O  OD2 . ASP A 1 39  ? 20.012  42.756 6.463   1.00 37.54 ? 262  ASP A OD2 1 
ATOM   311  N  N   . ARG A 1 40  ? 20.182  37.974 6.610   1.00 17.23 ? 263  ARG A N   1 
ATOM   312  C  CA  . ARG A 1 40  ? 19.571  37.134 7.645   1.00 16.20 ? 263  ARG A CA  1 
ATOM   313  C  C   . ARG A 1 40  ? 20.507  36.021 8.112   1.00 16.71 ? 263  ARG A C   1 
ATOM   314  O  O   . ARG A 1 40  ? 20.655  35.777 9.308   1.00 17.01 ? 263  ARG A O   1 
ATOM   315  C  CB  . ARG A 1 40  ? 18.255  36.531 7.154   1.00 15.87 ? 263  ARG A CB  1 
ATOM   316  C  CG  . ARG A 1 40  ? 17.496  35.738 8.254   1.00 14.85 ? 263  ARG A CG  1 
ATOM   317  C  CD  . ARG A 1 40  ? 17.292  36.579 9.522   1.00 14.39 ? 263  ARG A CD  1 
ATOM   318  N  NE  . ARG A 1 40  ? 16.290  35.976 10.424  1.00 14.57 ? 263  ARG A NE  1 
ATOM   319  C  CZ  . ARG A 1 40  ? 16.318  36.079 11.752  1.00 16.58 ? 263  ARG A CZ  1 
ATOM   320  N  NH1 . ARG A 1 40  ? 17.306  36.758 12.364  1.00 15.44 ? 263  ARG A NH1 1 
ATOM   321  N  NH2 . ARG A 1 40  ? 15.358  35.493 12.460  1.00 15.66 ? 263  ARG A NH2 1 
ATOM   322  N  N   . ILE A 1 41  ? 21.106  35.338 7.157   1.00 17.96 ? 264  ILE A N   1 
ATOM   323  C  CA  . ILE A 1 41  ? 22.048  34.283 7.488   1.00 20.04 ? 264  ILE A CA  1 
ATOM   324  C  C   . ILE A 1 41  ? 23.208  34.794 8.348   1.00 19.87 ? 264  ILE A C   1 
ATOM   325  O  O   . ILE A 1 41  ? 23.572  34.155 9.317   1.00 22.58 ? 264  ILE A O   1 
ATOM   326  C  CB  . ILE A 1 41  ? 22.468  33.532 6.196   1.00 20.66 ? 264  ILE A CB  1 
ATOM   327  C  CG1 . ILE A 1 41  ? 22.653  32.043 6.462   1.00 24.56 ? 264  ILE A CG1 1 
ATOM   328  C  CG2 . ILE A 1 41  ? 23.698  34.127 5.513   1.00 20.54 ? 264  ILE A CG2 1 
ATOM   329  C  CD1 . ILE A 1 41  ? 21.366  31.320 6.600   1.00 24.18 ? 264  ILE A CD1 1 
ATOM   330  N  N   . PHE A 1 42  ? 23.759  35.967 8.020   1.00 19.93 ? 265  PHE A N   1 
ATOM   331  C  CA  . PHE A 1 42  ? 24.829  36.531 8.826   1.00 20.31 ? 265  PHE A CA  1 
ATOM   332  C  C   . PHE A 1 42  ? 24.369  37.078 10.204  1.00 20.25 ? 265  PHE A C   1 
ATOM   333  O  O   . PHE A 1 42  ? 25.210  37.371 11.050  1.00 21.57 ? 265  PHE A O   1 
ATOM   334  C  CB  . PHE A 1 42  ? 25.621  37.576 8.044   1.00 20.90 ? 265  PHE A CB  1 
ATOM   335  C  CG  . PHE A 1 42  ? 26.692  36.983 7.134   1.00 21.71 ? 265  PHE A CG  1 
ATOM   336  C  CD1 . PHE A 1 42  ? 27.962  36.695 7.624   1.00 23.02 ? 265  PHE A CD1 1 
ATOM   337  C  CD2 . PHE A 1 42  ? 26.435  36.766 5.795   1.00 23.96 ? 265  PHE A CD2 1 
ATOM   338  C  CE1 . PHE A 1 42  ? 28.960  36.163 6.762   1.00 22.12 ? 265  PHE A CE1 1 
ATOM   339  C  CE2 . PHE A 1 42  ? 27.435  36.252 4.930   1.00 24.56 ? 265  PHE A CE2 1 
ATOM   340  C  CZ  . PHE A 1 42  ? 28.677  35.953 5.434   1.00 21.23 ? 265  PHE A CZ  1 
ATOM   341  N  N   . SER A 1 43  ? 23.061  37.129 10.461  1.00 19.36 ? 266  SER A N   1 
ATOM   342  C  CA  . SER A 1 43  ? 22.586  37.698 11.743  1.00 19.30 ? 266  SER A CA  1 
ATOM   343  C  C   . SER A 1 43  ? 22.762  36.783 12.964  1.00 19.03 ? 266  SER A C   1 
ATOM   344  O  O   . SER A 1 43  ? 22.623  37.242 14.078  1.00 19.80 ? 266  SER A O   1 
ATOM   345  C  CB  . SER A 1 43  ? 21.122  38.161 11.649  1.00 19.61 ? 266  SER A CB  1 
ATOM   346  O  OG  . SER A 1 43  ? 20.243  37.060 11.474  1.00 17.84 ? 266  SER A OG  1 
ATOM   347  N  N   . PHE A 1 44  ? 23.103  35.514 12.754  1.00 17.26 ? 267  PHE A N   1 
ATOM   348  C  CA  . PHE A 1 44  ? 23.167  34.516 13.831  1.00 16.94 ? 267  PHE A CA  1 
ATOM   349  C  C   . PHE A 1 44  ? 24.590  34.293 14.403  1.00 16.12 ? 267  PHE A C   1 
ATOM   350  O  O   . PHE A 1 44  ? 24.762  33.510 15.336  1.00 14.85 ? 267  PHE A O   1 
ATOM   351  C  CB  . PHE A 1 44  ? 22.567  33.190 13.332  1.00 16.94 ? 267  PHE A CB  1 
ATOM   352  C  CG  . PHE A 1 44  ? 21.078  33.267 13.055  1.00 17.17 ? 267  PHE A CG  1 
ATOM   353  C  CD1 . PHE A 1 44  ? 20.151  33.148 14.092  1.00 15.55 ? 267  PHE A CD1 1 
ATOM   354  C  CD2 . PHE A 1 44  ? 20.608  33.460 11.758  1.00 18.02 ? 267  PHE A CD2 1 
ATOM   355  C  CE1 . PHE A 1 44  ? 18.775  33.209 13.829  1.00 16.15 ? 267  PHE A CE1 1 
ATOM   356  C  CE2 . PHE A 1 44  ? 19.248  33.514 11.491  1.00 16.78 ? 267  PHE A CE2 1 
ATOM   357  C  CZ  . PHE A 1 44  ? 18.334  33.377 12.524  1.00 14.65 ? 267  PHE A CZ  1 
ATOM   358  N  N   . GLU A 1 45  ? 25.570  35.036 13.872  1.00 16.14 ? 268  GLU A N   1 
ATOM   359  C  CA  . GLU A 1 45  ? 26.978  34.905 14.257  1.00 17.39 ? 268  GLU A CA  1 
ATOM   360  C  C   . GLU A 1 45  ? 27.501  33.465 14.098  1.00 18.26 ? 268  GLU A C   1 
ATOM   361  O  O   . GLU A 1 45  ? 28.326  33.018 14.904  1.00 19.06 ? 268  GLU A O   1 
ATOM   362  C  CB  . GLU A 1 45  ? 27.187  35.400 15.700  1.00 17.76 ? 268  GLU A CB  1 
ATOM   363  C  CG  . GLU A 1 45  ? 26.836  36.902 15.850  1.00 21.90 ? 268  GLU A CG  1 
ATOM   364  C  CD  . GLU A 1 45  ? 26.899  37.380 17.303  1.00 26.14 ? 268  GLU A CD  1 
ATOM   365  O  OE1 . GLU A 1 45  ? 27.413  36.613 18.147  1.00 27.13 ? 268  GLU A OE1 1 
ATOM   366  O  OE2 . GLU A 1 45  ? 26.408  38.501 17.594  1.00 25.52 ? 268  GLU A OE2 1 
ATOM   367  N  N   . ILE A 1 46  ? 27.010  32.740 13.079  1.00 17.78 ? 269  ILE A N   1 
ATOM   368  C  CA  . ILE A 1 46  ? 27.476  31.366 12.811  1.00 17.86 ? 269  ILE A CA  1 
ATOM   369  C  C   . ILE A 1 46  ? 28.568  31.366 11.723  1.00 18.84 ? 269  ILE A C   1 
ATOM   370  O  O   . ILE A 1 46  ? 28.794  32.377 11.047  1.00 18.20 ? 269  ILE A O   1 
ATOM   371  C  CB  . ILE A 1 46  ? 26.312  30.427 12.363  1.00 18.28 ? 269  ILE A CB  1 
ATOM   372  C  CG1 . ILE A 1 46  ? 25.594  31.022 11.138  1.00 20.34 ? 269  ILE A CG1 1 
ATOM   373  C  CG2 . ILE A 1 46  ? 25.367  30.141 13.549  1.00 17.69 ? 269  ILE A CG2 1 
ATOM   374  C  CD1 . ILE A 1 46  ? 25.368  30.030 9.990   1.00 25.49 ? 269  ILE A CD1 1 
ATOM   375  N  N   . ASN A 1 47  ? 29.219  30.219 11.548  1.00 18.82 ? 270  ASN A N   1 
ATOM   376  C  CA  . ASN A 1 47  ? 30.297  30.114 10.599  1.00 21.22 ? 270  ASN A CA  1 
ATOM   377  C  C   . ASN A 1 47  ? 29.676  29.782 9.245   1.00 19.95 ? 270  ASN A C   1 
ATOM   378  O  O   . ASN A 1 47  ? 29.146  28.688 9.060   1.00 20.34 ? 270  ASN A O   1 
ATOM   379  C  CB  . ASN A 1 47  ? 31.272  28.978 10.999  1.00 20.79 ? 270  ASN A CB  1 
ATOM   380  C  CG  . ASN A 1 47  ? 32.189  29.379 12.146  1.00 26.85 ? 270  ASN A CG  1 
ATOM   381  O  OD1 . ASN A 1 47  ? 32.534  28.554 12.989  1.00 33.92 ? 270  ASN A OD1 1 
ATOM   382  N  ND2 . ASN A 1 47  ? 32.585  30.636 12.178  1.00 23.46 ? 270  ASN A ND2 1 
ATOM   383  N  N   . VAL A 1 48  ? 29.704  30.758 8.349   1.00 20.58 ? 271  VAL A N   1 
ATOM   384  C  CA  . VAL A 1 48  ? 29.028  30.631 7.027   1.00 20.11 ? 271  VAL A CA  1 
ATOM   385  C  C   . VAL A 1 48  ? 29.857  31.228 5.889   1.00 20.47 ? 271  VAL A C   1 
ATOM   386  O  O   . VAL A 1 48  ? 30.452  32.315 6.025   1.00 19.53 ? 271  VAL A O   1 
ATOM   387  C  CB  . VAL A 1 48  ? 27.564  31.242 7.076   1.00 20.69 ? 271  VAL A CB  1 
ATOM   388  C  CG1 . VAL A 1 48  ? 27.565  32.781 7.527   1.00 20.93 ? 271  VAL A CG1 1 
ATOM   389  C  CG2 . VAL A 1 48  ? 26.790  31.049 5.744   1.00 18.34 ? 271  VAL A CG2 1 
ATOM   390  N  N   . SER A 1 49  ? 29.898  30.519 4.752   1.00 20.15 ? 272  SER A N   1 
ATOM   391  C  CA  . SER A 1 49  ? 30.507  31.036 3.531   1.00 20.65 ? 272  SER A CA  1 
ATOM   392  C  C   . SER A 1 49  ? 29.437  31.131 2.465   1.00 20.66 ? 272  SER A C   1 
ATOM   393  O  O   . SER A 1 49  ? 28.595  30.241 2.352   1.00 20.15 ? 272  SER A O   1 
ATOM   394  C  CB  . SER A 1 49  ? 31.631  30.118 3.029   1.00 20.95 ? 272  SER A CB  1 
ATOM   395  O  OG  . SER A 1 49  ? 32.589  29.826 4.033   1.00 22.08 ? 272  SER A OG  1 
ATOM   396  N  N   . VAL A 1 50  ? 29.464  32.195 1.667   1.00 21.58 ? 273  VAL A N   1 
ATOM   397  C  CA  . VAL A 1 50  ? 28.433  32.370 0.646   1.00 21.07 ? 273  VAL A CA  1 
ATOM   398  C  C   . VAL A 1 50  ? 29.025  32.427 -0.744  1.00 21.69 ? 273  VAL A C   1 
ATOM   399  O  O   . VAL A 1 50  ? 29.878  33.291 -1.033  1.00 21.08 ? 273  VAL A O   1 
ATOM   400  C  CB  . VAL A 1 50  ? 27.551  33.633 0.873   1.00 20.91 ? 273  VAL A CB  1 
ATOM   401  C  CG1 . VAL A 1 50  ? 26.447  33.730 -0.226  1.00 19.93 ? 273  VAL A CG1 1 
ATOM   402  C  CG2 . VAL A 1 50  ? 26.879  33.628 2.249   1.00 21.02 ? 273  VAL A CG2 1 
ATOM   403  N  N   . ALA A 1 51  ? 28.580  31.514 -1.620  1.00 19.90 ? 274  ALA A N   1 
ATOM   404  C  CA  . ALA A 1 51  ? 28.871  31.669 -3.055  1.00 19.05 ? 274  ALA A CA  1 
ATOM   405  C  C   . ALA A 1 51  ? 27.763  32.382 -3.837  1.00 18.60 ? 274  ALA A C   1 
ATOM   406  O  O   . ALA A 1 51  ? 26.552  32.231 -3.563  1.00 16.84 ? 274  ALA A O   1 
ATOM   407  C  CB  . ALA A 1 51  ? 29.163  30.316 -3.682  1.00 18.49 ? 274  ALA A CB  1 
ATOM   408  N  N   . ILE A 1 52  ? 28.176  33.154 -4.840  1.00 18.66 ? 275  ILE A N   1 
ATOM   409  C  CA  . ILE A 1 52  ? 27.231  33.857 -5.703  1.00 18.58 ? 275  ILE A CA  1 
ATOM   410  C  C   . ILE A 1 52  ? 27.549  33.525 -7.155  1.00 18.98 ? 275  ILE A C   1 
ATOM   411  O  O   . ILE A 1 52  ? 28.674  33.706 -7.597  1.00 20.18 ? 275  ILE A O   1 
ATOM   412  C  CB  . ILE A 1 52  ? 27.309  35.390 -5.517  1.00 18.66 ? 275  ILE A CB  1 
ATOM   413  C  CG1 . ILE A 1 52  ? 27.256  35.753 -4.026  1.00 18.03 ? 275  ILE A CG1 1 
ATOM   414  C  CG2 . ILE A 1 52  ? 26.203  36.129 -6.387  1.00 18.12 ? 275  ILE A CG2 1 
ATOM   415  C  CD1 . ILE A 1 52  ? 25.886  35.605 -3.356  1.00 18.71 ? 275  ILE A CD1 1 
ATOM   416  N  N   . ILE A 1 53  ? 26.564  32.994 -7.866  1.00 19.41 ? 276  ILE A N   1 
ATOM   417  C  CA  . ILE A 1 53  ? 26.729  32.546 -9.237  1.00 19.52 ? 276  ILE A CA  1 
ATOM   418  C  C   . ILE A 1 53  ? 25.535  33.033 -10.000 1.00 19.77 ? 276  ILE A C   1 
ATOM   419  O  O   . ILE A 1 53  ? 24.386  32.836 -9.565  1.00 19.79 ? 276  ILE A O   1 
ATOM   420  C  CB  . ILE A 1 53  ? 26.746  31.008 -9.347  1.00 19.92 ? 276  ILE A CB  1 
ATOM   421  C  CG1 . ILE A 1 53  ? 27.891  30.387 -8.519  1.00 19.05 ? 276  ILE A CG1 1 
ATOM   422  C  CG2 . ILE A 1 53  ? 26.895  30.586 -10.804 1.00 21.22 ? 276  ILE A CG2 1 
ATOM   423  C  CD1 . ILE A 1 53  ? 27.848  28.832 -8.514  1.00 20.03 ? 276  ILE A CD1 1 
ATOM   424  N  N   . THR A 1 54  ? 25.779  33.677 -11.145 1.00 18.78 ? 277  THR A N   1 
ATOM   425  C  CA  . THR A 1 54  ? 24.677  34.044 -12.005 1.00 18.64 ? 277  THR A CA  1 
ATOM   426  C  C   . THR A 1 54  ? 24.710  33.095 -13.231 1.00 17.97 ? 277  THR A C   1 
ATOM   427  O  O   . THR A 1 54  ? 25.762  32.608 -13.616 1.00 19.20 ? 277  THR A O   1 
ATOM   428  C  CB  . THR A 1 54  ? 24.747  35.543 -12.424 1.00 20.40 ? 277  THR A CB  1 
ATOM   429  O  OG1 . THR A 1 54  ? 25.974  35.774 -13.097 1.00 18.28 ? 277  THR A OG1 1 
ATOM   430  C  CG2 . THR A 1 54  ? 24.666  36.491 -11.165 1.00 17.61 ? 277  THR A CG2 1 
ATOM   431  N  N   . PHE A 1 55  ? 23.557  32.813 -13.815 1.00 18.62 ? 278  PHE A N   1 
ATOM   432  C  CA  . PHE A 1 55  ? 23.517  31.809 -14.891 1.00 18.14 ? 278  PHE A CA  1 
ATOM   433  C  C   . PHE A 1 55  ? 22.480  32.088 -15.964 1.00 18.34 ? 278  PHE A C   1 
ATOM   434  O  O   . PHE A 1 55  ? 21.368  32.578 -15.703 1.00 18.00 ? 278  PHE A O   1 
ATOM   435  C  CB  . PHE A 1 55  ? 23.397  30.368 -14.327 1.00 16.10 ? 278  PHE A CB  1 
ATOM   436  C  CG  . PHE A 1 55  ? 22.008  29.972 -13.917 1.00 16.08 ? 278  PHE A CG  1 
ATOM   437  C  CD1 . PHE A 1 55  ? 21.153  29.327 -14.811 1.00 14.35 ? 278  PHE A CD1 1 
ATOM   438  C  CD2 . PHE A 1 55  ? 21.561  30.220 -12.612 1.00 15.43 ? 278  PHE A CD2 1 
ATOM   439  C  CE1 . PHE A 1 55  ? 19.840  28.925 -14.428 1.00 13.92 ? 278  PHE A CE1 1 
ATOM   440  C  CE2 . PHE A 1 55  ? 20.251  29.879 -12.197 1.00 16.26 ? 278  PHE A CE2 1 
ATOM   441  C  CZ  . PHE A 1 55  ? 19.371  29.242 -13.082 1.00 14.62 ? 278  PHE A CZ  1 
ATOM   442  N  N   . ALA A 1 56  ? 22.879  31.765 -17.193 1.00 19.44 ? 279  ALA A N   1 
ATOM   443  C  CA  . ALA A 1 56  ? 21.949  31.682 -18.308 1.00 19.54 ? 279  ALA A CA  1 
ATOM   444  C  C   . ALA A 1 56  ? 22.409  30.514 -19.171 1.00 20.34 ? 279  ALA A C   1 
ATOM   445  O  O   . ALA A 1 56  ? 22.290  29.360 -18.735 1.00 17.61 ? 279  ALA A O   1 
ATOM   446  C  CB  . ALA A 1 56  ? 21.865  33.021 -19.092 1.00 19.45 ? 279  ALA A CB  1 
ATOM   447  N  N   . SER A 1 57  ? 22.967  30.781 -20.357 1.00 20.69 ? 280  SER A N   1 
ATOM   448  C  CA  . SER A 1 57  ? 23.570  29.708 -21.159 1.00 21.89 ? 280  SER A CA  1 
ATOM   449  C  C   . SER A 1 57  ? 24.743  29.061 -20.447 1.00 21.71 ? 280  SER A C   1 
ATOM   450  O  O   . SER A 1 57  ? 24.984  27.868 -20.620 1.00 21.16 ? 280  SER A O   1 
ATOM   451  C  CB  . SER A 1 57  ? 24.032  30.213 -22.527 1.00 22.11 ? 280  SER A CB  1 
ATOM   452  O  OG  . SER A 1 57  ? 22.880  30.428 -23.306 1.00 23.07 ? 280  SER A OG  1 
ATOM   453  N  N   . GLU A 1 58  ? 25.487  29.881 -19.697 1.00 21.14 ? 281  GLU A N   1 
ATOM   454  C  CA  . GLU A 1 58  ? 26.618  29.456 -18.886 1.00 22.19 ? 281  GLU A CA  1 
ATOM   455  C  C   . GLU A 1 58  ? 26.577  30.196 -17.514 1.00 21.84 ? 281  GLU A C   1 
ATOM   456  O  O   . GLU A 1 58  ? 26.006  31.279 -17.425 1.00 21.71 ? 281  GLU A O   1 
ATOM   457  C  CB  . GLU A 1 58  ? 27.950  29.733 -19.599 1.00 22.47 ? 281  GLU A CB  1 
ATOM   458  C  CG  . GLU A 1 58  ? 28.139  28.890 -20.861 1.00 26.51 ? 281  GLU A CG  1 
ATOM   459  C  CD  . GLU A 1 58  ? 29.448  29.143 -21.547 1.00 30.95 ? 281  GLU A CD  1 
ATOM   460  O  OE1 . GLU A 1 58  ? 30.173  30.116 -21.141 1.00 29.88 ? 281  GLU A OE1 1 
ATOM   461  O  OE2 . GLU A 1 58  ? 29.747  28.406 -22.545 1.00 29.69 ? 281  GLU A OE2 1 
ATOM   462  N  N   . PRO A 1 59  ? 27.163  29.572 -16.461 1.00 21.95 ? 282  PRO A N   1 
ATOM   463  C  CA  . PRO A 1 59  ? 27.257  30.167 -15.122 1.00 22.09 ? 282  PRO A CA  1 
ATOM   464  C  C   . PRO A 1 59  ? 28.427  31.118 -15.035 1.00 21.90 ? 282  PRO A C   1 
ATOM   465  O  O   . PRO A 1 59  ? 29.456  30.907 -15.665 1.00 22.44 ? 282  PRO A O   1 
ATOM   466  C  CB  . PRO A 1 59  ? 27.538  28.964 -14.213 1.00 21.74 ? 282  PRO A CB  1 
ATOM   467  C  CG  . PRO A 1 59  ? 28.294  27.982 -15.123 1.00 20.63 ? 282  PRO A CG  1 
ATOM   468  C  CD  . PRO A 1 59  ? 27.748  28.213 -16.511 1.00 20.88 ? 282  PRO A CD  1 
ATOM   469  N  N   . LYS A 1 60  ? 28.275  32.133 -14.206 1.00 23.01 ? 283  LYS A N   1 
ATOM   470  C  CA  . LYS A 1 60  ? 29.382  33.016 -13.887 1.00 23.52 ? 283  LYS A CA  1 
ATOM   471  C  C   . LYS A 1 60  ? 29.540  33.086 -12.366 1.00 23.16 ? 283  LYS A C   1 
ATOM   472  O  O   . LYS A 1 60  ? 28.607  33.435 -11.689 1.00 22.43 ? 283  LYS A O   1 
ATOM   473  C  CB  . LYS A 1 60  ? 29.102  34.391 -14.468 1.00 23.95 ? 283  LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 60  ? 30.334  35.235 -14.528 1.00 27.53 ? 283  LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 60  ? 30.033  36.681 -14.835 1.00 30.91 ? 283  LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 60  ? 31.361  37.443 -14.807 1.00 35.00 ? 283  LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 60  ? 31.262  38.732 -15.549 1.00 38.17 ? 283  LYS A NZ  1 
ATOM   478  N  N   . VAL A 1 61  ? 30.714  32.738 -11.853 1.00 23.25 ? 284  VAL A N   1 
ATOM   479  C  CA  . VAL A 1 61  ? 30.949  32.737 -10.411 1.00 24.52 ? 284  VAL A CA  1 
ATOM   480  C  C   . VAL A 1 61  ? 31.413  34.131 -9.982  1.00 25.70 ? 284  VAL A C   1 
ATOM   481  O  O   . VAL A 1 61  ? 32.481  34.568 -10.382 1.00 25.64 ? 284  VAL A O   1 
ATOM   482  C  CB  . VAL A 1 61  ? 31.990  31.675 -10.007 1.00 23.81 ? 284  VAL A CB  1 
ATOM   483  C  CG1 . VAL A 1 61  ? 32.324  31.778 -8.537  1.00 25.08 ? 284  VAL A CG1 1 
ATOM   484  C  CG2 . VAL A 1 61  ? 31.471  30.233 -10.374 1.00 24.55 ? 284  VAL A CG2 1 
ATOM   485  N  N   . LEU A 1 62  ? 30.595  34.818 -9.193  1.00 26.66 ? 285  LEU A N   1 
ATOM   486  C  CA  . LEU A 1 62  ? 30.951  36.157 -8.650  1.00 27.41 ? 285  LEU A CA  1 
ATOM   487  C  C   . LEU A 1 62  ? 31.664  36.075 -7.281  1.00 27.55 ? 285  LEU A C   1 
ATOM   488  O  O   . LEU A 1 62  ? 32.445  36.959 -6.912  1.00 27.83 ? 285  LEU A O   1 
ATOM   489  C  CB  . LEU A 1 62  ? 29.717  37.057 -8.613  1.00 27.29 ? 285  LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 62  ? 28.958  37.099 -9.945  1.00 28.11 ? 285  LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 62  ? 27.759  37.956 -9.820  1.00 29.89 ? 285  LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 62  ? 29.853  37.600 -11.079 1.00 30.72 ? 285  LEU A CD2 1 
ATOM   493  N  N   . MET A 1 63  ? 31.390  34.997 -6.544  1.00 26.18 ? 286  MET A N   1 
ATOM   494  C  CA  . MET A 1 63  ? 32.006  34.720 -5.262  1.00 25.71 ? 286  MET A CA  1 
ATOM   495  C  C   . MET A 1 63  ? 32.071  33.215 -5.070  1.00 25.69 ? 286  MET A C   1 
ATOM   496  O  O   . MET A 1 63  ? 31.081  32.508 -5.263  1.00 25.18 ? 286  MET A O   1 
ATOM   497  C  CB  . MET A 1 63  ? 31.202  35.394 -4.122  1.00 25.52 ? 286  MET A CB  1 
ATOM   498  C  CG  . MET A 1 63  ? 31.785  35.154 -2.717  1.00 27.49 ? 286  MET A CG  1 
ATOM   499  S  SD  . MET A 1 63  ? 33.407  35.954 -2.530  1.00 33.57 ? 286  MET A SD  1 
ATOM   500  C  CE  . MET A 1 63  ? 32.885  37.631 -2.159  1.00 28.87 ? 286  MET A CE  1 
ATOM   501  N  N   . SER A 1 64  ? 33.248  32.720 -4.707  1.00 25.32 ? 287  SER A N   1 
ATOM   502  C  CA  . SER A 1 64  ? 33.458  31.307 -4.493  1.00 25.67 ? 287  SER A CA  1 
ATOM   503  C  C   . SER A 1 64  ? 33.670  31.094 -3.017  1.00 26.22 ? 287  SER A C   1 
ATOM   504  O  O   . SER A 1 64  ? 34.202  31.985 -2.360  1.00 27.20 ? 287  SER A O   1 
ATOM   505  C  CB  . SER A 1 64  ? 34.700  30.835 -5.261  1.00 25.78 ? 287  SER A CB  1 
ATOM   506  O  OG  . SER A 1 64  ? 35.056  29.520 -4.871  1.00 24.62 ? 287  SER A OG  1 
ATOM   507  N  N   . VAL A 1 65  ? 33.287  29.923 -2.509  1.00 24.82 ? 288  VAL A N   1 
ATOM   508  C  CA  . VAL A 1 65  ? 33.538  29.551 -1.130  1.00 25.15 ? 288  VAL A CA  1 
ATOM   509  C  C   . VAL A 1 65  ? 35.032  29.239 -0.834  1.00 26.79 ? 288  VAL A C   1 
ATOM   510  O  O   . VAL A 1 65  ? 35.417  29.183 0.317   1.00 25.30 ? 288  VAL A O   1 
ATOM   511  C  CB  . VAL A 1 65  ? 32.667  28.364 -0.666  1.00 23.42 ? 288  VAL A CB  1 
ATOM   512  C  CG1 . VAL A 1 65  ? 31.188  28.732 -0.707  1.00 23.21 ? 288  VAL A CG1 1 
ATOM   513  C  CG2 . VAL A 1 65  ? 32.990  27.078 -1.509  1.00 24.69 ? 288  VAL A CG2 1 
ATOM   514  N  N   . LEU A 1 66  ? 35.848  29.054 -1.878  1.00 27.95 ? 289  LEU A N   1 
ATOM   515  C  CA  . LEU A 1 66  ? 37.298  28.938 -1.727  1.00 30.51 ? 289  LEU A CA  1 
ATOM   516  C  C   . LEU A 1 66  ? 37.957  30.264 -1.289  1.00 31.78 ? 289  LEU A C   1 
ATOM   517  O  O   . LEU A 1 66  ? 39.051  30.253 -0.711  1.00 33.38 ? 289  LEU A O   1 
ATOM   518  C  CB  . LEU A 1 66  ? 37.937  28.462 -3.056  1.00 30.29 ? 289  LEU A CB  1 
ATOM   519  C  CG  . LEU A 1 66  ? 37.755  27.057 -3.668  1.00 31.69 ? 289  LEU A CG  1 
ATOM   520  C  CD1 . LEU A 1 66  ? 38.605  25.991 -3.000  1.00 33.28 ? 289  LEU A CD1 1 
ATOM   521  C  CD2 . LEU A 1 66  ? 36.302  26.587 -3.763  1.00 30.54 ? 289  LEU A CD2 1 
ATOM   522  N  N   . ASN A 1 67  ? 37.305  31.379 -1.620  1.00 32.37 ? 290  ASN A N   1 
ATOM   523  C  CA  . ASN A 1 67  ? 37.749  32.744 -1.340  1.00 33.58 ? 290  ASN A CA  1 
ATOM   524  C  C   . ASN A 1 67  ? 37.365  33.158 0.096   1.00 34.39 ? 290  ASN A C   1 
ATOM   525  O  O   . ASN A 1 67  ? 36.219  32.935 0.537   1.00 33.48 ? 290  ASN A O   1 
ATOM   526  C  CB  . ASN A 1 67  ? 37.074  33.663 -2.368  1.00 33.90 ? 290  ASN A CB  1 
ATOM   527  C  CG  . ASN A 1 67  ? 37.532  35.136 -2.301  1.00 36.78 ? 290  ASN A CG  1 
ATOM   528  O  OD1 . ASN A 1 67  ? 37.087  35.947 -3.125  1.00 37.93 ? 290  ASN A OD1 1 
ATOM   529  N  ND2 . ASN A 1 67  ? 38.406  35.486 -1.338  1.00 36.59 ? 290  ASN A ND2 1 
ATOM   530  N  N   . ASP A 1 68  ? 38.318  33.751 0.828   1.00 35.14 ? 291  ASP A N   1 
ATOM   531  C  CA  . ASP A 1 68  ? 38.076  34.191 2.219   1.00 35.26 ? 291  ASP A CA  1 
ATOM   532  C  C   . ASP A 1 68  ? 37.037  35.313 2.291   1.00 34.13 ? 291  ASP A C   1 
ATOM   533  O  O   . ASP A 1 68  ? 36.307  35.464 3.284   1.00 33.46 ? 291  ASP A O   1 
ATOM   534  C  CB  . ASP A 1 68  ? 39.386  34.623 2.901   1.00 36.75 ? 291  ASP A CB  1 
ATOM   535  C  CG  . ASP A 1 68  ? 40.264  33.452 3.296   1.00 39.70 ? 291  ASP A CG  1 
ATOM   536  O  OD1 . ASP A 1 68  ? 41.487  33.666 3.391   1.00 44.50 ? 291  ASP A OD1 1 
ATOM   537  O  OD2 . ASP A 1 68  ? 39.760  32.322 3.524   1.00 44.74 ? 291  ASP A OD2 1 
ATOM   538  N  N   . ASN A 1 69  ? 36.949  36.105 1.238   1.00 32.63 ? 292  ASN A N   1 
ATOM   539  C  CA  . ASN A 1 69  ? 35.902  37.109 1.187   1.00 32.28 ? 292  ASN A CA  1 
ATOM   540  C  C   . ASN A 1 69  ? 34.482  36.530 1.252   1.00 30.78 ? 292  ASN A C   1 
ATOM   541  O  O   . ASN A 1 69  ? 33.539  37.273 1.468   1.00 30.26 ? 292  ASN A O   1 
ATOM   542  C  CB  . ASN A 1 69  ? 36.030  37.952 -0.070  1.00 33.36 ? 292  ASN A CB  1 
ATOM   543  C  CG  . ASN A 1 69  ? 37.114  39.027 0.026   1.00 36.24 ? 292  ASN A CG  1 
ATOM   544  O  OD1 . ASN A 1 69  ? 37.640  39.333 1.108   1.00 39.06 ? 292  ASN A OD1 1 
ATOM   545  N  ND2 . ASN A 1 69  ? 37.437  39.616 -1.129  1.00 37.65 ? 292  ASN A ND2 1 
ATOM   546  N  N   . SER A 1 70  ? 34.330  35.215 1.040   1.00 29.33 ? 293  SER A N   1 
ATOM   547  C  CA  . SER A 1 70  ? 32.978  34.616 1.047   1.00 27.58 ? 293  SER A CA  1 
ATOM   548  C  C   . SER A 1 70  ? 32.420  34.503 2.479   1.00 28.02 ? 293  SER A C   1 
ATOM   549  O  O   . SER A 1 70  ? 31.233  34.188 2.687   1.00 26.32 ? 293  SER A O   1 
ATOM   550  C  CB  . SER A 1 70  ? 32.979  33.261 0.345   1.00 26.55 ? 293  SER A CB  1 
ATOM   551  O  OG  . SER A 1 70  ? 33.630  32.291 1.139   1.00 24.36 ? 293  SER A OG  1 
ATOM   552  N  N   . ARG A 1 71  ? 33.292  34.769 3.454   1.00 28.92 ? 294  ARG A N   1 
ATOM   553  C  CA  . ARG A 1 71  ? 32.965  34.640 4.879   1.00 29.61 ? 294  ARG A CA  1 
ATOM   554  C  C   . ARG A 1 71  ? 32.787  36.030 5.486   1.00 30.40 ? 294  ARG A C   1 
ATOM   555  O  O   . ARG A 1 71  ? 32.491  36.169 6.664   1.00 30.21 ? 294  ARG A O   1 
ATOM   556  C  CB  . ARG A 1 71  ? 34.058  33.874 5.612   1.00 29.83 ? 294  ARG A CB  1 
ATOM   557  C  CG  . ARG A 1 71  ? 34.164  32.399 5.235   1.00 31.46 ? 294  ARG A CG  1 
ATOM   558  C  CD  . ARG A 1 71  ? 34.853  31.605 6.323   1.00 37.82 ? 294  ARG A CD  1 
ATOM   559  N  NE  . ARG A 1 71  ? 34.223  31.873 7.620   1.00 44.04 ? 294  ARG A NE  1 
ATOM   560  C  CZ  . ARG A 1 71  ? 34.535  31.279 8.772   1.00 45.92 ? 294  ARG A CZ  1 
ATOM   561  N  NH1 . ARG A 1 71  ? 35.476  30.332 8.830   1.00 46.28 ? 294  ARG A NH1 1 
ATOM   562  N  NH2 . ARG A 1 71  ? 33.881  31.629 9.871   1.00 45.76 ? 294  ARG A NH2 1 
ATOM   563  N  N   . ASP A 1 72  ? 32.927  37.040 4.639   1.00 30.89 ? 295  ASP A N   1 
ATOM   564  C  CA  . ASP A 1 72  ? 32.844  38.444 5.029   1.00 31.76 ? 295  ASP A CA  1 
ATOM   565  C  C   . ASP A 1 72  ? 31.578  38.993 4.442   1.00 31.13 ? 295  ASP A C   1 
ATOM   566  O  O   . ASP A 1 72  ? 31.478  39.145 3.233   1.00 31.31 ? 295  ASP A O   1 
ATOM   567  C  CB  . ASP A 1 72  ? 34.074  39.184 4.475   1.00 32.58 ? 295  ASP A CB  1 
ATOM   568  C  CG  . ASP A 1 72  ? 34.103  40.663 4.830   1.00 33.56 ? 295  ASP A CG  1 
ATOM   569  O  OD1 . ASP A 1 72  ? 33.070  41.361 4.768   1.00 34.93 ? 295  ASP A OD1 1 
ATOM   570  O  OD2 . ASP A 1 72  ? 35.211  41.132 5.141   1.00 36.22 ? 295  ASP A OD2 1 
ATOM   571  N  N   . MET A 1 73  ? 30.602  39.290 5.297   1.00 30.19 ? 296  MET A N   1 
ATOM   572  C  CA  . MET A 1 73  ? 29.311  39.756 4.831   1.00 30.40 ? 296  MET A CA  1 
ATOM   573  C  C   . MET A 1 73  ? 29.404  40.905 3.840   1.00 30.36 ? 296  MET A C   1 
ATOM   574  O  O   . MET A 1 73  ? 28.655  40.945 2.872   1.00 29.63 ? 296  MET A O   1 
ATOM   575  C  CB  . MET A 1 73  ? 28.400  40.168 5.984   1.00 30.24 ? 296  MET A CB  1 
ATOM   576  C  CG  . MET A 1 73  ? 26.943  40.308 5.521   1.00 33.12 ? 296  MET A CG  1 
ATOM   577  S  SD  . MET A 1 73  ? 25.702  41.061 6.613   1.00 36.99 ? 296  MET A SD  1 
ATOM   578  C  CE  . MET A 1 73  ? 25.504  42.647 5.791   1.00 39.15 ? 296  MET A CE  1 
ATOM   579  N  N   . THR A 1 74  ? 30.292  41.865 4.102   1.00 30.85 ? 297  THR A N   1 
ATOM   580  C  CA  . THR A 1 74  ? 30.366  43.042 3.227   1.00 31.18 ? 297  THR A CA  1 
ATOM   581  C  C   . THR A 1 74  ? 30.843  42.659 1.813   1.00 30.46 ? 297  THR A C   1 
ATOM   582  O  O   . THR A 1 74  ? 30.318  43.158 0.830   1.00 30.47 ? 297  THR A O   1 
ATOM   583  C  CB  . THR A 1 74  ? 31.241  44.196 3.822   1.00 31.32 ? 297  THR A CB  1 
ATOM   584  O  OG1 . THR A 1 74  ? 31.100  44.224 5.249   1.00 30.35 ? 297  THR A OG1 1 
ATOM   585  C  CG2 . THR A 1 74  ? 30.768  45.516 3.281   1.00 32.14 ? 297  THR A CG2 1 
ATOM   586  N  N   . GLU A 1 75  ? 31.823  41.767 1.733   1.00 30.44 ? 298  GLU A N   1 
ATOM   587  C  CA  . GLU A 1 75  ? 32.339  41.310 0.424   1.00 31.08 ? 298  GLU A CA  1 
ATOM   588  C  C   . GLU A 1 75  ? 31.245  40.562 -0.340  1.00 29.61 ? 298  GLU A C   1 
ATOM   589  O  O   . GLU A 1 75  ? 31.058  40.759 -1.551  1.00 29.15 ? 298  GLU A O   1 
ATOM   590  C  CB  . GLU A 1 75  ? 33.558  40.399 0.617   1.00 31.04 ? 298  GLU A CB  1 
ATOM   591  C  CG  . GLU A 1 75  ? 34.662  41.017 1.460   1.00 35.36 ? 298  GLU A CG  1 
ATOM   592  C  CD  . GLU A 1 75  ? 35.494  42.028 0.708   1.00 40.28 ? 298  GLU A CD  1 
ATOM   593  O  OE1 . GLU A 1 75  ? 35.229  42.249 -0.502  1.00 40.36 ? 298  GLU A OE1 1 
ATOM   594  O  OE2 . GLU A 1 75  ? 36.418  42.591 1.342   1.00 41.72 ? 298  GLU A OE2 1 
ATOM   595  N  N   . VAL A 1 76  ? 30.501  39.729 0.392   1.00 28.98 ? 299  VAL A N   1 
ATOM   596  C  CA  . VAL A 1 76  ? 29.402  38.953 -0.207  1.00 28.07 ? 299  VAL A CA  1 
ATOM   597  C  C   . VAL A 1 76  ? 28.325  39.866 -0.785  1.00 28.12 ? 299  VAL A C   1 
ATOM   598  O  O   . VAL A 1 76  ? 27.961  39.745 -1.947  1.00 27.68 ? 299  VAL A O   1 
ATOM   599  C  CB  . VAL A 1 76  ? 28.802  37.924 0.779   1.00 26.65 ? 299  VAL A CB  1 
ATOM   600  C  CG1 . VAL A 1 76  ? 27.520  37.298 0.182   1.00 26.22 ? 299  VAL A CG1 1 
ATOM   601  C  CG2 . VAL A 1 76  ? 29.824  36.879 1.131   1.00 27.55 ? 299  VAL A CG2 1 
ATOM   602  N  N   . ILE A 1 77  ? 27.833  40.816 0.008   1.00 29.42 ? 300  ILE A N   1 
ATOM   603  C  CA  . ILE A 1 77  ? 26.783  41.718 -0.467  1.00 30.21 ? 300  ILE A CA  1 
ATOM   604  C  C   . ILE A 1 77  ? 27.310  42.558 -1.649  1.00 31.13 ? 300  ILE A C   1 
ATOM   605  O  O   . ILE A 1 77  ? 26.575  42.888 -2.572  1.00 30.62 ? 300  ILE A O   1 
ATOM   606  C  CB  . ILE A 1 77  ? 26.251  42.665 0.694   1.00 30.71 ? 300  ILE A CB  1 
ATOM   607  C  CG1 . ILE A 1 77  ? 25.527  41.871 1.801   1.00 30.63 ? 300  ILE A CG1 1 
ATOM   608  C  CG2 . ILE A 1 77  ? 25.423  43.828 0.135   1.00 31.73 ? 300  ILE A CG2 1 
ATOM   609  C  CD1 . ILE A 1 77  ? 24.194  41.236 1.397   1.00 29.89 ? 300  ILE A CD1 1 
ATOM   610  N  N   . SER A 1 78  ? 28.592  42.882 -1.619  1.00 32.46 ? 301  SER A N   1 
ATOM   611  C  CA  . SER A 1 78  ? 29.162  43.685 -2.680  1.00 34.31 ? 301  SER A CA  1 
ATOM   612  C  C   . SER A 1 78  ? 29.267  42.897 -3.997  1.00 34.74 ? 301  SER A C   1 
ATOM   613  O  O   . SER A 1 78  ? 28.904  43.413 -5.051  1.00 34.80 ? 301  SER A O   1 
ATOM   614  C  CB  . SER A 1 78  ? 30.510  44.251 -2.259  1.00 34.36 ? 301  SER A CB  1 
ATOM   615  O  OG  . SER A 1 78  ? 31.055  45.045 -3.297  1.00 37.56 ? 301  SER A OG  1 
ATOM   616  N  N   . SER A 1 79  ? 29.760  41.660 -3.935  1.00 35.50 ? 302  SER A N   1 
ATOM   617  C  CA  . SER A 1 79  ? 29.729  40.773 -5.106  1.00 36.34 ? 302  SER A CA  1 
ATOM   618  C  C   . SER A 1 79  ? 28.302  40.606 -5.665  1.00 36.62 ? 302  SER A C   1 
ATOM   619  O  O   . SER A 1 79  ? 28.097  40.594 -6.893  1.00 35.84 ? 302  SER A O   1 
ATOM   620  C  CB  . SER A 1 79  ? 30.386  39.432 -4.800  1.00 35.45 ? 302  SER A CB  1 
ATOM   621  O  OG  . SER A 1 79  ? 29.595  38.674 -3.908  1.00 38.76 ? 302  SER A OG  1 
ATOM   622  N  N   . LEU A 1 80  ? 27.318  40.496 -4.766  1.00 36.87 ? 303  LEU A N   1 
ATOM   623  C  CA  . LEU A 1 80  ? 25.916  40.507 -5.161  1.00 37.63 ? 303  LEU A CA  1 
ATOM   624  C  C   . LEU A 1 80  ? 25.501  41.790 -5.880  1.00 39.09 ? 303  LEU A C   1 
ATOM   625  O  O   . LEU A 1 80  ? 24.916  41.708 -6.957  1.00 39.08 ? 303  LEU A O   1 
ATOM   626  C  CB  . LEU A 1 80  ? 24.979  40.255 -3.961  1.00 37.46 ? 303  LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 80  ? 24.294  38.887 -3.820  1.00 37.94 ? 303  LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 80  ? 23.492  38.832 -2.495  1.00 37.03 ? 303  LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 80  ? 23.381  38.548 -5.026  1.00 34.53 ? 303  LEU A CD2 1 
ATOM   630  N  N   . GLU A 1 81  ? 25.773  42.962 -5.288  1.00 40.43 ? 304  GLU A N   1 
ATOM   631  C  CA  . GLU A 1 81  ? 25.351  44.250 -5.884  1.00 42.22 ? 304  GLU A CA  1 
ATOM   632  C  C   . GLU A 1 81  ? 26.087  44.489 -7.212  1.00 41.92 ? 304  GLU A C   1 
ATOM   633  O  O   . GLU A 1 81  ? 25.505  44.975 -8.180  1.00 41.96 ? 304  GLU A O   1 
ATOM   634  C  CB  . GLU A 1 81  ? 25.539  45.430 -4.900  1.00 43.41 ? 304  GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 81  ? 24.612  45.374 -3.663  1.00 47.66 ? 304  GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 81  ? 24.921  46.425 -2.571  1.00 51.46 ? 304  GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 81  ? 26.011  47.080 -2.623  1.00 53.01 ? 304  GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 81  ? 24.064  46.601 -1.651  1.00 53.69 ? 304  GLU A OE2 1 
ATOM   639  N  N   . ASN A 1 82  ? 27.353  44.089 -7.262  1.00 42.54 ? 305  ASN A N   1 
ATOM   640  C  CA  . ASN A 1 82  ? 28.142  44.101 -8.503  1.00 43.07 ? 305  ASN A CA  1 
ATOM   641  C  C   . ASN A 1 82  ? 27.746  43.044 -9.576  1.00 42.88 ? 305  ASN A C   1 
ATOM   642  O  O   . ASN A 1 82  ? 28.454  42.876 -10.576 1.00 43.92 ? 305  ASN A O   1 
ATOM   643  C  CB  . ASN A 1 82  ? 29.654  44.022 -8.174  1.00 43.34 ? 305  ASN A CB  1 
ATOM   644  C  CG  . ASN A 1 82  ? 30.150  45.247 -7.397  1.00 44.73 ? 305  ASN A CG  1 
ATOM   645  O  OD1 . ASN A 1 82  ? 29.589  46.334 -7.540  1.00 44.15 ? 305  ASN A OD1 1 
ATOM   646  N  ND2 . ASN A 1 82  ? 31.188  45.068 -6.564  1.00 42.97 ? 305  ASN A ND2 1 
ATOM   647  N  N   . ALA A 1 83  ? 26.618  42.353 -9.386  1.00 41.76 ? 306  ALA A N   1 
ATOM   648  C  CA  . ALA A 1 83  ? 26.127  41.382 -10.370 1.00 40.84 ? 306  ALA A CA  1 
ATOM   649  C  C   . ALA A 1 83  ? 25.295  42.057 -11.455 1.00 40.50 ? 306  ALA A C   1 
ATOM   650  O  O   . ALA A 1 83  ? 24.211  42.577 -11.171 1.00 40.86 ? 306  ALA A O   1 
ATOM   651  C  CB  . ALA A 1 83  ? 25.298  40.297 -9.682  1.00 40.31 ? 306  ALA A CB  1 
ATOM   652  N  N   . ASN A 1 84  ? 25.790  42.031 -12.697 1.00 40.05 ? 307  ASN A N   1 
ATOM   653  C  CA  . ASN A 1 84  ? 25.061  42.585 -13.846 1.00 39.06 ? 307  ASN A CA  1 
ATOM   654  C  C   . ASN A 1 84  ? 24.367  41.523 -14.690 1.00 37.56 ? 307  ASN A C   1 
ATOM   655  O  O   . ASN A 1 84  ? 24.989  40.571 -15.145 1.00 37.42 ? 307  ASN A O   1 
ATOM   656  C  CB  . ASN A 1 84  ? 25.993  43.425 -14.740 1.00 39.81 ? 307  ASN A CB  1 
ATOM   657  C  CG  . ASN A 1 84  ? 25.226  44.394 -15.680 1.00 42.05 ? 307  ASN A CG  1 
ATOM   658  O  OD1 . ASN A 1 84  ? 23.988  44.347 -15.821 1.00 45.67 ? 307  ASN A OD1 1 
ATOM   659  N  ND2 . ASN A 1 84  ? 25.979  45.288 -16.324 1.00 45.69 ? 307  ASN A ND2 1 
ATOM   660  N  N   . TYR A 1 85  ? 23.076  41.719 -14.900 1.00 35.78 ? 308  TYR A N   1 
ATOM   661  C  CA  . TYR A 1 85  ? 22.260  40.920 -15.798 1.00 35.26 ? 308  TYR A CA  1 
ATOM   662  C  C   . TYR A 1 85  ? 22.795  40.877 -17.249 1.00 35.11 ? 308  TYR A C   1 
ATOM   663  O  O   . TYR A 1 85  ? 22.679  39.854 -17.929 1.00 34.01 ? 308  TYR A O   1 
ATOM   664  C  CB  . TYR A 1 85  ? 20.832  41.479 -15.765 1.00 34.46 ? 308  TYR A CB  1 
ATOM   665  C  CG  . TYR A 1 85  ? 19.841  40.856 -16.728 1.00 34.75 ? 308  TYR A CG  1 
ATOM   666  C  CD1 . TYR A 1 85  ? 18.965  39.862 -16.298 1.00 32.90 ? 308  TYR A CD1 1 
ATOM   667  C  CD2 . TYR A 1 85  ? 19.764  41.270 -18.066 1.00 34.63 ? 308  TYR A CD2 1 
ATOM   668  C  CE1 . TYR A 1 85  ? 18.050  39.296 -17.160 1.00 33.85 ? 308  TYR A CE1 1 
ATOM   669  C  CE2 . TYR A 1 85  ? 18.836  40.698 -18.948 1.00 33.15 ? 308  TYR A CE2 1 
ATOM   670  C  CZ  . TYR A 1 85  ? 17.992  39.713 -18.487 1.00 33.83 ? 308  TYR A CZ  1 
ATOM   671  O  OH  . TYR A 1 85  ? 17.065  39.131 -19.318 1.00 33.07 ? 308  TYR A OH  1 
ATOM   672  N  N   . LYS A 1 86  ? 23.376  41.990 -17.723 1.00 35.09 ? 309  LYS A N   1 
ATOM   673  C  CA  . LYS A 1 86  ? 23.852  42.058 -19.112 1.00 34.84 ? 309  LYS A CA  1 
ATOM   674  C  C   . LYS A 1 86  ? 25.155  41.272 -19.339 1.00 34.29 ? 309  LYS A C   1 
ATOM   675  O  O   . LYS A 1 86  ? 25.590  41.084 -20.494 1.00 33.91 ? 309  LYS A O   1 
ATOM   676  C  CB  . LYS A 1 86  ? 24.000  43.513 -19.603 1.00 35.01 ? 309  LYS A CB  1 
ATOM   677  C  CG  . LYS A 1 86  ? 22.744  44.363 -19.512 1.00 35.93 ? 309  LYS A CG  1 
ATOM   678  C  CD  . LYS A 1 86  ? 22.864  45.605 -20.416 1.00 39.96 ? 309  LYS A CD  1 
ATOM   679  C  CE  . LYS A 1 86  ? 21.783  46.629 -20.102 1.00 41.94 ? 309  LYS A CE  1 
ATOM   680  N  NZ  . LYS A 1 86  ? 22.204  47.540 -18.988 1.00 44.37 ? 309  LYS A NZ  1 
ATOM   681  N  N   . ASP A 1 87  ? 25.784  40.799 -18.261 1.00 33.61 ? 310  ASP A N   1 
ATOM   682  C  CA  . ASP A 1 87  ? 26.952  39.939 -18.441 1.00 33.02 ? 310  ASP A CA  1 
ATOM   683  C  C   . ASP A 1 87  ? 26.622  38.603 -19.123 1.00 31.71 ? 310  ASP A C   1 
ATOM   684  O  O   . ASP A 1 87  ? 27.528  37.918 -19.574 1.00 31.13 ? 310  ASP A O   1 
ATOM   685  C  CB  . ASP A 1 87  ? 27.738  39.739 -17.136 1.00 33.95 ? 310  ASP A CB  1 
ATOM   686  C  CG  . ASP A 1 87  ? 28.548  40.997 -16.736 1.00 36.38 ? 310  ASP A CG  1 
ATOM   687  O  OD1 . ASP A 1 87  ? 28.610  41.981 -17.510 1.00 36.71 ? 310  ASP A OD1 1 
ATOM   688  O  OD2 . ASP A 1 87  ? 29.143  40.978 -15.645 1.00 38.32 ? 310  ASP A OD2 1 
ATOM   689  N  N   . HIS A 1 88  ? 25.330  38.276 -19.205 1.00 30.19 ? 311  HIS A N   1 
ATOM   690  C  CA  . HIS A 1 88  ? 24.821  37.100 -19.924 1.00 30.43 ? 311  HIS A CA  1 
ATOM   691  C  C   . HIS A 1 88  ? 24.121  37.427 -21.264 1.00 30.99 ? 311  HIS A C   1 
ATOM   692  O  O   . HIS A 1 88  ? 23.373  36.622 -21.796 1.00 31.40 ? 311  HIS A O   1 
ATOM   693  C  CB  . HIS A 1 88  ? 23.894  36.279 -18.999 1.00 29.25 ? 311  HIS A CB  1 
ATOM   694  C  CG  . HIS A 1 88  ? 24.631  35.581 -17.895 1.00 27.52 ? 311  HIS A CG  1 
ATOM   695  N  ND1 . HIS A 1 88  ? 24.735  36.094 -16.618 1.00 25.37 ? 311  HIS A ND1 1 
ATOM   696  C  CD2 . HIS A 1 88  ? 25.324  34.423 -17.890 1.00 22.15 ? 311  HIS A CD2 1 
ATOM   697  C  CE1 . HIS A 1 88  ? 25.463  35.281 -15.877 1.00 21.29 ? 311  HIS A CE1 1 
ATOM   698  N  NE2 . HIS A 1 88  ? 25.833  34.260 -16.625 1.00 25.67 ? 311  HIS A NE2 1 
ATOM   699  N  N   . GLU A 1 89  ? 24.394  38.600 -21.832 1.00 32.37 ? 312  GLU A N   1 
ATOM   700  C  CA  . GLU A 1 89  ? 23.672  39.061 -23.029 1.00 32.43 ? 312  GLU A CA  1 
ATOM   701  C  C   . GLU A 1 89  ? 23.882  38.201 -24.287 1.00 32.43 ? 312  GLU A C   1 
ATOM   702  O  O   . GLU A 1 89  ? 23.021  38.177 -25.161 1.00 32.83 ? 312  GLU A O   1 
ATOM   703  C  CB  . GLU A 1 89  ? 24.046  40.513 -23.335 1.00 33.49 ? 312  GLU A CB  1 
ATOM   704  C  CG  . GLU A 1 89  ? 25.484  40.689 -23.782 1.00 34.93 ? 312  GLU A CG  1 
ATOM   705  C  CD  . GLU A 1 89  ? 25.896  42.157 -23.912 1.00 40.22 ? 312  GLU A CD  1 
ATOM   706  O  OE1 . GLU A 1 89  ? 25.006  43.056 -23.857 1.00 40.28 ? 312  GLU A OE1 1 
ATOM   707  O  OE2 . GLU A 1 89  ? 27.125  42.390 -24.054 1.00 40.74 ? 312  GLU A OE2 1 
ATOM   708  N  N   . ASN A 1 90  ? 25.007  37.495 -24.374 1.00 31.65 ? 313  ASN A N   1 
ATOM   709  C  CA  . ASN A 1 90  ? 25.303  36.644 -25.537 1.00 32.09 ? 313  ASN A CA  1 
ATOM   710  C  C   . ASN A 1 90  ? 25.036  35.144 -25.355 1.00 32.31 ? 313  ASN A C   1 
ATOM   711  O  O   . ASN A 1 90  ? 25.388  34.326 -26.203 1.00 31.96 ? 313  ASN A O   1 
ATOM   712  C  CB  . ASN A 1 90  ? 26.750  36.829 -25.957 1.00 32.35 ? 313  ASN A CB  1 
ATOM   713  C  CG  . ASN A 1 90  ? 27.062  38.262 -26.284 1.00 33.55 ? 313  ASN A CG  1 
ATOM   714  O  OD1 . ASN A 1 90  ? 26.216  38.982 -26.837 1.00 32.52 ? 313  ASN A OD1 1 
ATOM   715  N  ND2 . ASN A 1 90  ? 28.245  38.705 -25.881 1.00 34.42 ? 313  ASN A ND2 1 
ATOM   716  N  N   . GLY A 1 91  ? 24.438  34.781 -24.238 1.00 32.43 ? 314  GLY A N   1 
ATOM   717  C  CA  . GLY A 1 91  ? 24.045  33.402 -24.053 1.00 33.15 ? 314  GLY A CA  1 
ATOM   718  C  C   . GLY A 1 91  ? 22.878  33.469 -23.143 1.00 32.96 ? 314  GLY A C   1 
ATOM   719  O  O   . GLY A 1 91  ? 23.038  33.300 -21.939 1.00 34.63 ? 314  GLY A O   1 
ATOM   720  N  N   . THR A 1 92  ? 21.703  33.714 -23.710 1.00 32.88 ? 315  THR A N   1 
ATOM   721  C  CA  . THR A 1 92  ? 20.503  34.023 -22.898 1.00 32.50 ? 315  THR A CA  1 
ATOM   722  C  C   . THR A 1 92  ? 19.537  32.836 -22.688 1.00 30.86 ? 315  THR A C   1 
ATOM   723  O  O   . THR A 1 92  ? 18.395  33.039 -22.258 1.00 30.89 ? 315  THR A O   1 
ATOM   724  C  CB  . THR A 1 92  ? 19.716  35.153 -23.557 1.00 32.97 ? 315  THR A CB  1 
ATOM   725  O  OG1 . THR A 1 92  ? 19.285  34.700 -24.849 1.00 35.37 ? 315  THR A OG1 1 
ATOM   726  C  CG2 . THR A 1 92  ? 20.591  36.392 -23.723 1.00 34.16 ? 315  THR A CG2 1 
ATOM   727  N  N   . GLY A 1 93  ? 19.984  31.617 -23.041 1.00 29.45 ? 316  GLY A N   1 
ATOM   728  C  CA  . GLY A 1 93  ? 19.219  30.390 -22.817 1.00 26.09 ? 316  GLY A CA  1 
ATOM   729  C  C   . GLY A 1 93  ? 19.334  30.079 -21.340 1.00 24.09 ? 316  GLY A C   1 
ATOM   730  O  O   . GLY A 1 93  ? 19.937  30.847 -20.609 1.00 24.67 ? 316  GLY A O   1 
ATOM   731  N  N   . THR A 1 94  ? 18.758  28.962 -20.903 1.00 21.53 ? 317  THR A N   1 
ATOM   732  C  CA  . THR A 1 94  ? 18.675  28.623 -19.479 1.00 19.46 ? 317  THR A CA  1 
ATOM   733  C  C   . THR A 1 94  ? 19.258  27.235 -19.217 1.00 18.05 ? 317  THR A C   1 
ATOM   734  O  O   . THR A 1 94  ? 18.551  26.231 -19.254 1.00 17.88 ? 317  THR A O   1 
ATOM   735  C  CB  . THR A 1 94  ? 17.246  28.705 -18.971 1.00 19.06 ? 317  THR A CB  1 
ATOM   736  O  OG1 . THR A 1 94  ? 16.678  29.957 -19.416 1.00 19.15 ? 317  THR A OG1 1 
ATOM   737  C  CG2 . THR A 1 94  ? 17.186  28.593 -17.417 1.00 19.62 ? 317  THR A CG2 1 
ATOM   738  N  N   . ASN A 1 95  ? 20.536  27.236 -18.876 1.00 16.66 ? 318  ASN A N   1 
ATOM   739  C  CA  . ASN A 1 95  ? 21.257  26.001 -18.643 1.00 15.84 ? 318  ASN A CA  1 
ATOM   740  C  C   . ASN A 1 95  ? 21.375  25.737 -17.156 1.00 15.01 ? 318  ASN A C   1 
ATOM   741  O  O   . ASN A 1 95  ? 22.419  25.960 -16.547 1.00 14.85 ? 318  ASN A O   1 
ATOM   742  C  CB  . ASN A 1 95  ? 22.616  26.079 -19.321 1.00 15.11 ? 318  ASN A CB  1 
ATOM   743  C  CG  . ASN A 1 95  ? 23.298  24.726 -19.394 1.00 17.01 ? 318  ASN A CG  1 
ATOM   744  O  OD1 . ASN A 1 95  ? 22.927  23.805 -18.682 1.00 15.60 ? 318  ASN A OD1 1 
ATOM   745  N  ND2 . ASN A 1 95  ? 24.334  24.625 -20.213 1.00 15.97 ? 318  ASN A ND2 1 
ATOM   746  N  N   . THR A 1 96  ? 20.299  25.234 -16.581 1.00 14.56 ? 319  THR A N   1 
ATOM   747  C  CA  . THR A 1 96  ? 20.284  24.998 -15.144 1.00 15.85 ? 319  THR A CA  1 
ATOM   748  C  C   . THR A 1 96  ? 21.288  23.916 -14.787 1.00 14.93 ? 319  THR A C   1 
ATOM   749  O  O   . THR A 1 96  ? 21.928  23.960 -13.709 1.00 14.92 ? 319  THR A O   1 
ATOM   750  C  CB  . THR A 1 96  ? 18.880  24.634 -14.716 1.00 16.43 ? 319  THR A CB  1 
ATOM   751  O  OG1 . THR A 1 96  ? 18.017  25.725 -15.110 1.00 17.80 ? 319  THR A OG1 1 
ATOM   752  C  CG2 . THR A 1 96  ? 18.817  24.425 -13.211 1.00 17.64 ? 319  THR A CG2 1 
ATOM   753  N  N   . TYR A 1 97  ? 21.427  22.927 -15.669 1.00 13.84 ? 320  TYR A N   1 
ATOM   754  C  CA  . TYR A 1 97  ? 22.450  21.888 -15.403 1.00 12.94 ? 320  TYR A CA  1 
ATOM   755  C  C   . TYR A 1 97  ? 23.823  22.501 -15.143 1.00 13.10 ? 320  TYR A C   1 
ATOM   756  O  O   . TYR A 1 97  ? 24.535  22.161 -14.177 1.00 12.87 ? 320  TYR A O   1 
ATOM   757  C  CB  . TYR A 1 97  ? 22.533  20.844 -16.531 1.00 12.63 ? 320  TYR A CB  1 
ATOM   758  C  CG  . TYR A 1 97  ? 23.834  20.043 -16.380 1.00 11.67 ? 320  TYR A CG  1 
ATOM   759  C  CD1 . TYR A 1 97  ? 24.993  20.468 -17.013 1.00 14.07 ? 320  TYR A CD1 1 
ATOM   760  C  CD2 . TYR A 1 97  ? 23.904  18.941 -15.511 1.00 12.72 ? 320  TYR A CD2 1 
ATOM   761  C  CE1 . TYR A 1 97  ? 26.203  19.794 -16.835 1.00 13.89 ? 320  TYR A CE1 1 
ATOM   762  C  CE2 . TYR A 1 97  ? 25.123  18.224 -15.343 1.00 12.85 ? 320  TYR A CE2 1 
ATOM   763  C  CZ  . TYR A 1 97  ? 26.265  18.702 -15.993 1.00 14.86 ? 320  TYR A CZ  1 
ATOM   764  O  OH  . TYR A 1 97  ? 27.487  18.066 -15.879 1.00 15.26 ? 320  TYR A OH  1 
ATOM   765  N  N   . ALA A 1 98  ? 24.224  23.409 -16.020 1.00 13.03 ? 321  ALA A N   1 
ATOM   766  C  CA  . ALA A 1 98  ? 25.531  23.946 -15.954 1.00 12.58 ? 321  ALA A CA  1 
ATOM   767  C  C   . ALA A 1 98  ? 25.759  24.808 -14.711 1.00 13.68 ? 321  ALA A C   1 
ATOM   768  O  O   . ALA A 1 98  ? 26.906  24.848 -14.201 1.00 13.74 ? 321  ALA A O   1 
ATOM   769  C  CB  . ALA A 1 98  ? 25.870  24.720 -17.239 1.00 13.19 ? 321  ALA A CB  1 
ATOM   770  N  N   . ALA A 1 99  ? 24.709  25.505 -14.257 1.00 13.49 ? 322  ALA A N   1 
ATOM   771  C  CA  . ALA A 1 99  ? 24.748  26.266 -12.961 1.00 14.69 ? 322  ALA A CA  1 
ATOM   772  C  C   . ALA A 1 99  ? 25.031  25.323 -11.783 1.00 14.52 ? 322  ALA A C   1 
ATOM   773  O  O   . ALA A 1 99  ? 25.895  25.590 -10.949 1.00 13.80 ? 322  ALA A O   1 
ATOM   774  C  CB  . ALA A 1 99  ? 23.406  26.989 -12.750 1.00 14.70 ? 322  ALA A CB  1 
ATOM   775  N  N   . LEU A 1 100 ? 24.347  24.180 -11.768 1.00 14.09 ? 323  LEU A N   1 
ATOM   776  C  CA  . LEU A 1 100 ? 24.519  23.232 -10.698 1.00 14.52 ? 323  LEU A CA  1 
ATOM   777  C  C   . LEU A 1 100 ? 25.852  22.545 -10.830 1.00 14.74 ? 323  LEU A C   1 
ATOM   778  O  O   . LEU A 1 100 ? 26.487  22.238 -9.835  1.00 13.95 ? 323  LEU A O   1 
ATOM   779  C  CB  . LEU A 1 100 ? 23.349  22.229 -10.627 1.00 14.78 ? 323  LEU A CB  1 
ATOM   780  C  CG  . LEU A 1 100 ? 22.093  22.868 -10.031 1.00 14.54 ? 323  LEU A CG  1 
ATOM   781  C  CD1 . LEU A 1 100 ? 20.864  22.060 -10.400 1.00 16.76 ? 323  LEU A CD1 1 
ATOM   782  C  CD2 . LEU A 1 100 ? 22.234  23.009 -8.502  1.00 13.15 ? 323  LEU A CD2 1 
ATOM   783  N  N   . ASN A 1 101 ? 26.294  22.275 -12.061 1.00 15.04 ? 324  ASN A N   1 
ATOM   784  C  CA  . ASN A 1 101 ? 27.638  21.714 -12.180 1.00 15.58 ? 324  ASN A CA  1 
ATOM   785  C  C   . ASN A 1 101 ? 28.749  22.700 -11.721 1.00 15.96 ? 324  ASN A C   1 
ATOM   786  O  O   . ASN A 1 101 ? 29.771  22.251 -11.243 1.00 16.00 ? 324  ASN A O   1 
ATOM   787  C  CB  . ASN A 1 101 ? 27.896  21.181 -13.588 1.00 15.65 ? 324  ASN A CB  1 
ATOM   788  C  CG  . ASN A 1 101 ? 29.270  20.585 -13.728 1.00 17.73 ? 324  ASN A CG  1 
ATOM   789  O  OD1 . ASN A 1 101 ? 29.583  19.537 -13.139 1.00 21.52 ? 324  ASN A OD1 1 
ATOM   790  N  ND2 . ASN A 1 101 ? 30.123  21.277 -14.466 1.00 16.10 ? 324  ASN A ND2 1 
ATOM   791  N  N   . SER A 1 102 ? 28.532  24.016 -11.852 1.00 15.28 ? 325  SER A N   1 
ATOM   792  C  CA  . SER A 1 102 ? 29.435  25.023 -11.294 1.00 16.88 ? 325  SER A CA  1 
ATOM   793  C  C   . SER A 1 102 ? 29.626  24.848 -9.769  1.00 16.27 ? 325  SER A C   1 
ATOM   794  O  O   . SER A 1 102 ? 30.743  24.975 -9.239  1.00 17.79 ? 325  SER A O   1 
ATOM   795  C  CB  . SER A 1 102 ? 28.885  26.433 -11.565 1.00 16.67 ? 325  SER A CB  1 
ATOM   796  O  OG  . SER A 1 102 ? 29.916  27.387 -11.360 1.00 27.05 ? 325  SER A OG  1 
ATOM   797  N  N   . VAL A 1 103 ? 28.527  24.603 -9.073  1.00 16.63 ? 326  VAL A N   1 
ATOM   798  C  CA  . VAL A 1 103 ? 28.570  24.278 -7.619  1.00 15.88 ? 326  VAL A CA  1 
ATOM   799  C  C   . VAL A 1 103 ? 29.369  22.994 -7.418  1.00 16.43 ? 326  VAL A C   1 
ATOM   800  O  O   . VAL A 1 103 ? 30.273  22.939 -6.578  1.00 14.35 ? 326  VAL A O   1 
ATOM   801  C  CB  . VAL A 1 103 ? 27.148  24.138 -7.037  1.00 16.31 ? 326  VAL A CB  1 
ATOM   802  C  CG1 . VAL A 1 103 ? 27.157  23.599 -5.566  1.00 15.03 ? 326  VAL A CG1 1 
ATOM   803  C  CG2 . VAL A 1 103 ? 26.422  25.480 -7.132  1.00 16.29 ? 326  VAL A CG2 1 
ATOM   804  N  N   . TYR A 1 104 ? 29.013  21.951 -8.170  1.00 16.24 ? 327  TYR A N   1 
ATOM   805  C  CA  . TYR A 1 104 ? 29.806  20.717 -8.106  1.00 17.40 ? 327  TYR A CA  1 
ATOM   806  C  C   . TYR A 1 104 ? 31.326  20.989 -8.224  1.00 17.88 ? 327  TYR A C   1 
ATOM   807  O  O   . TYR A 1 104 ? 32.118  20.436 -7.439  1.00 18.72 ? 327  TYR A O   1 
ATOM   808  C  CB  . TYR A 1 104 ? 29.367  19.720 -9.188  1.00 17.22 ? 327  TYR A CB  1 
ATOM   809  C  CG  . TYR A 1 104 ? 30.268  18.522 -9.183  1.00 20.14 ? 327  TYR A CG  1 
ATOM   810  C  CD1 . TYR A 1 104 ? 30.136  17.529 -8.190  1.00 18.19 ? 327  TYR A CD1 1 
ATOM   811  C  CD2 . TYR A 1 104 ? 31.308  18.409 -10.121 1.00 22.70 ? 327  TYR A CD2 1 
ATOM   812  C  CE1 . TYR A 1 104 ? 30.995  16.439 -8.147  1.00 22.13 ? 327  TYR A CE1 1 
ATOM   813  C  CE2 . TYR A 1 104 ? 32.176  17.298 -10.094 1.00 25.10 ? 327  TYR A CE2 1 
ATOM   814  C  CZ  . TYR A 1 104 ? 31.997  16.323 -9.107  1.00 25.81 ? 327  TYR A CZ  1 
ATOM   815  O  OH  . TYR A 1 104 ? 32.857  15.247 -9.086  1.00 30.17 ? 327  TYR A OH  1 
ATOM   816  N  N   . LEU A 1 105 ? 31.720  21.824 -9.187  1.00 18.71 ? 328  LEU A N   1 
ATOM   817  C  CA  . LEU A 1 105 ? 33.143  22.082 -9.439  1.00 19.94 ? 328  LEU A CA  1 
ATOM   818  C  C   . LEU A 1 105 ? 33.794  22.786 -8.269  1.00 20.23 ? 328  LEU A C   1 
ATOM   819  O  O   . LEU A 1 105 ? 34.940  22.500 -7.912  1.00 19.99 ? 328  LEU A O   1 
ATOM   820  C  CB  . LEU A 1 105 ? 33.363  22.932 -10.706 1.00 19.80 ? 328  LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 105 ? 32.949  22.269 -12.055 1.00 19.71 ? 328  LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 105 ? 33.065  23.239 -13.224 1.00 19.96 ? 328  LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 105 ? 33.672  20.943 -12.279 1.00 21.41 ? 328  LEU A CD2 1 
ATOM   824  N  N   . MET A 1 106 ? 33.054  23.732 -7.705  1.00 20.64 ? 329  MET A N   1 
ATOM   825  C  CA  . MET A 1 106 ? 33.476  24.430 -6.498  1.00 21.10 ? 329  MET A CA  1 
ATOM   826  C  C   . MET A 1 106 ? 33.681  23.489 -5.320  1.00 21.56 ? 329  MET A C   1 
ATOM   827  O  O   . MET A 1 106 ? 34.694  23.621 -4.608  1.00 22.83 ? 329  MET A O   1 
ATOM   828  C  CB  . MET A 1 106 ? 32.450  25.511 -6.189  1.00 20.89 ? 329  MET A CB  1 
ATOM   829  C  CG  . MET A 1 106 ? 32.878  26.504 -5.136  1.00 21.31 ? 329  MET A CG  1 
ATOM   830  S  SD  . MET A 1 106 ? 31.616  27.741 -4.893  1.00 20.56 ? 329  MET A SD  1 
ATOM   831  C  CE  . MET A 1 106 ? 31.667  28.677 -6.418  1.00 21.39 ? 329  MET A CE  1 
ATOM   832  N  N   . MET A 1 107 ? 32.744  22.548 -5.122  1.00 21.58 ? 330  MET A N   1 
ATOM   833  C  CA  . MET A 1 107 ? 32.825  21.523 -4.086  1.00 21.91 ? 330  MET A CA  1 
ATOM   834  C  C   . MET A 1 107 ? 34.054  20.617 -4.300  1.00 23.87 ? 330  MET A C   1 
ATOM   835  O  O   . MET A 1 107 ? 34.771  20.309 -3.358  1.00 23.58 ? 330  MET A O   1 
ATOM   836  C  CB  . MET A 1 107 ? 31.575  20.660 -4.027  1.00 20.59 ? 330  MET A CB  1 
ATOM   837  C  CG  . MET A 1 107 ? 30.300  21.390 -3.599  1.00 20.19 ? 330  MET A CG  1 
ATOM   838  S  SD  . MET A 1 107 ? 28.796  20.441 -3.774  1.00 18.22 ? 330  MET A SD  1 
ATOM   839  C  CE  . MET A 1 107 ? 27.630  21.447 -2.788  1.00 15.97 ? 330  MET A CE  1 
ATOM   840  N  N   . ASN A 1 108 ? 34.253  20.201 -5.547  1.00 24.33 ? 331  ASN A N   1 
ATOM   841  C  CA  . ASN A 1 108 ? 35.455  19.456 -5.928  1.00 25.97 ? 331  ASN A CA  1 
ATOM   842  C  C   . ASN A 1 108 ? 36.741  20.238 -5.601  1.00 26.05 ? 331  ASN A C   1 
ATOM   843  O  O   . ASN A 1 108 ? 37.689  19.714 -4.995  1.00 27.56 ? 331  ASN A O   1 
ATOM   844  C  CB  . ASN A 1 108 ? 35.360  19.091 -7.413  1.00 25.63 ? 331  ASN A CB  1 
ATOM   845  C  CG  . ASN A 1 108 ? 36.313  17.976 -7.798  1.00 28.67 ? 331  ASN A CG  1 
ATOM   846  O  OD1 . ASN A 1 108 ? 36.161  16.835 -7.363  1.00 30.72 ? 331  ASN A OD1 1 
ATOM   847  N  ND2 . ASN A 1 108 ? 37.287  18.303 -8.620  1.00 27.81 ? 331  ASN A ND2 1 
ATOM   848  N  N   . ASN A 1 109 ? 36.766  21.500 -5.975  1.00 26.36 ? 332  ASN A N   1 
ATOM   849  C  CA  . ASN A 1 109 ? 37.934  22.303 -5.728  1.00 26.96 ? 332  ASN A CA  1 
ATOM   850  C  C   . ASN A 1 109 ? 38.208  22.419 -4.236  1.00 27.19 ? 332  ASN A C   1 
ATOM   851  O  O   . ASN A 1 109 ? 39.359  22.252 -3.812  1.00 25.59 ? 332  ASN A O   1 
ATOM   852  C  CB  . ASN A 1 109 ? 37.808  23.640 -6.430  1.00 26.92 ? 332  ASN A CB  1 
ATOM   853  C  CG  . ASN A 1 109 ? 38.112  23.531 -7.915  1.00 30.70 ? 332  ASN A CG  1 
ATOM   854  O  OD1 . ASN A 1 109 ? 37.696  24.375 -8.716  1.00 32.91 ? 332  ASN A OD1 1 
ATOM   855  N  ND2 . ASN A 1 109 ? 38.854  22.473 -8.297  1.00 30.40 ? 332  ASN A ND2 1 
ATOM   856  N  N   . GLN A 1 110 ? 37.135  22.597 -3.451  1.00 26.71 ? 333  GLN A N   1 
ATOM   857  C  CA  . GLN A 1 110 ? 37.279  22.793 -2.008  1.00 28.26 ? 333  GLN A CA  1 
ATOM   858  C  C   . GLN A 1 110 ? 37.702  21.548 -1.263  1.00 29.44 ? 333  GLN A C   1 
ATOM   859  O  O   . GLN A 1 110 ? 38.605  21.606 -0.423  1.00 30.59 ? 333  GLN A O   1 
ATOM   860  C  CB  . GLN A 1 110 ? 36.016  23.404 -1.365  1.00 27.45 ? 333  GLN A CB  1 
ATOM   861  C  CG  . GLN A 1 110 ? 36.342  23.843 0.060   1.00 26.94 ? 333  GLN A CG  1 
ATOM   862  C  CD  . GLN A 1 110 ? 35.254  24.629 0.724   1.00 27.09 ? 333  GLN A CD  1 
ATOM   863  O  OE1 . GLN A 1 110 ? 35.530  25.628 1.412   1.00 27.06 ? 333  GLN A OE1 1 
ATOM   864  N  NE2 . GLN A 1 110 ? 34.005  24.196 0.535   1.00 19.44 ? 333  GLN A NE2 1 
ATOM   865  N  N   . MET A 1 111 ? 37.053  20.430 -1.573  1.00 31.09 ? 334  MET A N   1 
ATOM   866  C  CA  . MET A 1 111 ? 37.448  19.153 -1.036  1.00 32.75 ? 334  MET A CA  1 
ATOM   867  C  C   . MET A 1 111 ? 38.943  18.888 -1.298  1.00 34.33 ? 334  MET A C   1 
ATOM   868  O  O   . MET A 1 111 ? 39.639  18.438 -0.393  1.00 34.11 ? 334  MET A O   1 
ATOM   869  C  CB  . MET A 1 111 ? 36.605  18.040 -1.632  1.00 32.57 ? 334  MET A CB  1 
ATOM   870  C  CG  . MET A 1 111 ? 36.731  16.731 -0.880  1.00 33.54 ? 334  MET A CG  1 
ATOM   871  S  SD  . MET A 1 111 ? 35.652  15.461 -1.518  1.00 37.15 ? 334  MET A SD  1 
ATOM   872  C  CE  . MET A 1 111 ? 36.355  15.250 -3.167  1.00 38.17 ? 334  MET A CE  1 
ATOM   873  N  N   . ARG A 1 112 ? 39.414  19.169 -2.521  1.00 36.29 ? 335  ARG A N   1 
ATOM   874  C  CA  . ARG A 1 112 ? 40.816  18.943 -2.901  1.00 38.40 ? 335  ARG A CA  1 
ATOM   875  C  C   . ARG A 1 112 ? 41.740  19.774 -2.025  1.00 38.50 ? 335  ARG A C   1 
ATOM   876  O  O   . ARG A 1 112 ? 42.737  19.260 -1.506  1.00 38.31 ? 335  ARG A O   1 
ATOM   877  C  CB  . ARG A 1 112 ? 41.057  19.295 -4.376  1.00 39.01 ? 335  ARG A CB  1 
ATOM   878  C  CG  . ARG A 1 112 ? 42.522  19.092 -4.887  1.00 43.06 ? 335  ARG A CG  1 
ATOM   879  C  CD  . ARG A 1 112 ? 42.573  18.976 -6.428  1.00 47.66 ? 335  ARG A CD  1 
ATOM   880  N  NE  . ARG A 1 112 ? 41.680  17.899 -6.886  1.00 51.92 ? 335  ARG A NE  1 
ATOM   881  C  CZ  . ARG A 1 112 ? 42.079  16.737 -7.404  1.00 52.06 ? 335  ARG A CZ  1 
ATOM   882  N  NH1 . ARG A 1 112 ? 43.371  16.486 -7.585  1.00 52.99 ? 335  ARG A NH1 1 
ATOM   883  N  NH2 . ARG A 1 112 ? 41.176  15.822 -7.747  1.00 52.15 ? 335  ARG A NH2 1 
ATOM   884  N  N   . LEU A 1 113 ? 41.386  21.049 -1.868  1.00 38.98 ? 336  LEU A N   1 
ATOM   885  C  CA  . LEU A 1 113 ? 42.178  22.018 -1.122  1.00 39.95 ? 336  LEU A CA  1 
ATOM   886  C  C   . LEU A 1 113 ? 42.232  21.751 0.385   1.00 40.33 ? 336  LEU A C   1 
ATOM   887  O  O   . LEU A 1 113 ? 43.247  22.051 1.023   1.00 40.75 ? 336  LEU A O   1 
ATOM   888  C  CB  . LEU A 1 113 ? 41.693  23.466 -1.416  1.00 39.96 ? 336  LEU A CB  1 
ATOM   889  N  N   . LEU A 1 114 ? 41.166  21.174 0.943   1.00 39.96 ? 337  LEU A N   1 
ATOM   890  C  CA  . LEU A 1 114 ? 41.085  20.885 2.373   1.00 39.83 ? 337  LEU A CA  1 
ATOM   891  C  C   . LEU A 1 114 ? 41.470  19.447 2.705   1.00 40.49 ? 337  LEU A C   1 
ATOM   892  O  O   . LEU A 1 114 ? 42.072  19.195 3.741   1.00 40.53 ? 337  LEU A O   1 
ATOM   893  C  CB  . LEU A 1 114 ? 39.663  21.151 2.916   1.00 39.30 ? 337  LEU A CB  1 
ATOM   894  C  CG  . LEU A 1 114 ? 39.146  22.598 2.920   1.00 38.96 ? 337  LEU A CG  1 
ATOM   895  C  CD1 . LEU A 1 114 ? 37.707  22.640 3.436   1.00 38.09 ? 337  LEU A CD1 1 
ATOM   896  C  CD2 . LEU A 1 114 ? 40.061  23.572 3.721   1.00 40.12 ? 337  LEU A CD2 1 
ATOM   897  N  N   . GLY A 1 115 ? 41.090  18.506 1.844   1.00 40.91 ? 338  GLY A N   1 
ATOM   898  C  CA  . GLY A 1 115 ? 41.294  17.097 2.113   1.00 41.67 ? 338  GLY A CA  1 
ATOM   899  C  C   . GLY A 1 115 ? 40.032  16.348 2.490   1.00 42.59 ? 338  GLY A C   1 
ATOM   900  O  O   . GLY A 1 115 ? 39.438  16.569 3.551   1.00 42.81 ? 338  GLY A O   1 
ATOM   901  N  N   . MET A 1 116 ? 39.630  15.467 1.586   1.00 43.19 ? 339  MET A N   1 
ATOM   902  C  CA  . MET A 1 116 ? 38.522  14.527 1.723   1.00 44.12 ? 339  MET A CA  1 
ATOM   903  C  C   . MET A 1 116 ? 38.350  13.969 3.126   1.00 44.27 ? 339  MET A C   1 
ATOM   904  O  O   . MET A 1 116 ? 37.227  13.744 3.584   1.00 43.74 ? 339  MET A O   1 
ATOM   905  C  CB  . MET A 1 116 ? 38.853  13.364 0.802   1.00 44.98 ? 339  MET A CB  1 
ATOM   906  C  CG  . MET A 1 116 ? 37.724  12.576 0.212   1.00 48.39 ? 339  MET A CG  1 
ATOM   907  S  SD  . MET A 1 116 ? 38.492  11.488 -1.035  1.00 52.81 ? 339  MET A SD  1 
ATOM   908  C  CE  . MET A 1 116 ? 39.299  12.647 -2.163  1.00 52.72 ? 339  MET A CE  1 
ATOM   909  N  N   . GLU A 1 117 ? 39.478  13.702 3.788   1.00 44.88 ? 340  GLU A N   1 
ATOM   910  C  CA  . GLU A 1 117 ? 39.491  12.943 5.038   1.00 45.00 ? 340  GLU A CA  1 
ATOM   911  C  C   . GLU A 1 117 ? 39.411  13.841 6.285   1.00 44.64 ? 340  GLU A C   1 
ATOM   912  O  O   . GLU A 1 117 ? 39.186  13.351 7.404   1.00 44.76 ? 340  GLU A O   1 
ATOM   913  C  CB  . GLU A 1 117 ? 40.729  12.021 5.079   1.00 45.75 ? 340  GLU A CB  1 
ATOM   914  C  CG  . GLU A 1 117 ? 42.029  12.671 5.629   1.00 47.05 ? 340  GLU A CG  1 
ATOM   915  C  CD  . GLU A 1 117 ? 42.693  13.692 4.686   1.00 50.67 ? 340  GLU A CD  1 
ATOM   916  O  OE1 . GLU A 1 117 ? 42.291  13.809 3.496   1.00 50.32 ? 340  GLU A OE1 1 
ATOM   917  O  OE2 . GLU A 1 117 ? 43.639  14.383 5.147   1.00 51.84 ? 340  GLU A OE2 1 
ATOM   918  N  N   . THR A 1 118 ? 39.575  15.148 6.082   1.00 43.67 ? 341  THR A N   1 
ATOM   919  C  CA  . THR A 1 118 ? 39.659  16.113 7.170   1.00 43.00 ? 341  THR A CA  1 
ATOM   920  C  C   . THR A 1 118 ? 38.280  16.511 7.678   1.00 42.31 ? 341  THR A C   1 
ATOM   921  O  O   . THR A 1 118 ? 37.312  16.531 6.916   1.00 41.76 ? 341  THR A O   1 
ATOM   922  C  CB  . THR A 1 118 ? 40.366  17.407 6.724   1.00 43.12 ? 341  THR A CB  1 
ATOM   923  O  OG1 . THR A 1 118 ? 39.531  18.113 5.796   1.00 42.68 ? 341  THR A OG1 1 
ATOM   924  C  CG2 . THR A 1 118 ? 41.724  17.104 6.085   1.00 43.74 ? 341  THR A CG2 1 
ATOM   925  N  N   . MET A 1 119 ? 38.207  16.852 8.963   1.00 41.32 ? 342  MET A N   1 
ATOM   926  C  CA  . MET A 1 119 ? 36.981  17.404 9.561   1.00 40.42 ? 342  MET A CA  1 
ATOM   927  C  C   . MET A 1 119 ? 36.660  18.791 8.976   1.00 38.40 ? 342  MET A C   1 
ATOM   928  O  O   . MET A 1 119 ? 35.508  19.207 8.965   1.00 38.38 ? 342  MET A O   1 
ATOM   929  C  CB  . MET A 1 119 ? 37.121  17.475 11.096  1.00 41.41 ? 342  MET A CB  1 
ATOM   930  C  CG  . MET A 1 119 ? 35.853  17.835 11.889  1.00 44.78 ? 342  MET A CG  1 
ATOM   931  S  SD  . MET A 1 119 ? 34.349  16.833 11.622  1.00 53.86 ? 342  MET A SD  1 
ATOM   932  C  CE  . MET A 1 119 ? 34.958  15.127 11.611  1.00 50.13 ? 342  MET A CE  1 
ATOM   933  N  N   . ALA A 1 120 ? 37.675  19.507 8.502   1.00 36.18 ? 343  ALA A N   1 
ATOM   934  C  CA  . ALA A 1 120 ? 37.451  20.793 7.846   1.00 34.44 ? 343  ALA A CA  1 
ATOM   935  C  C   . ALA A 1 120 ? 36.505  20.628 6.625   1.00 33.28 ? 343  ALA A C   1 
ATOM   936  O  O   . ALA A 1 120 ? 35.644  21.474 6.377   1.00 32.22 ? 343  ALA A O   1 
ATOM   937  C  CB  . ALA A 1 120 ? 38.766  21.423 7.436   1.00 33.78 ? 343  ALA A CB  1 
ATOM   938  N  N   . TRP A 1 121 ? 36.670  19.528 5.884   1.00 31.80 ? 344  TRP A N   1 
ATOM   939  C  CA  . TRP A 1 121 ? 35.805  19.229 4.746   1.00 30.20 ? 344  TRP A CA  1 
ATOM   940  C  C   . TRP A 1 121 ? 34.541  18.535 5.179   1.00 30.01 ? 344  TRP A C   1 
ATOM   941  O  O   . TRP A 1 121 ? 33.443  18.932 4.781   1.00 29.28 ? 344  TRP A O   1 
ATOM   942  C  CB  . TRP A 1 121 ? 36.520  18.422 3.623   1.00 29.48 ? 344  TRP A CB  1 
ATOM   943  C  CG  . TRP A 1 121 ? 35.534  17.867 2.596   1.00 27.29 ? 344  TRP A CG  1 
ATOM   944  C  CD1 . TRP A 1 121 ? 35.165  16.570 2.435   1.00 29.13 ? 344  TRP A CD1 1 
ATOM   945  C  CD2 . TRP A 1 121 ? 34.757  18.628 1.642   1.00 28.06 ? 344  TRP A CD2 1 
ATOM   946  N  NE1 . TRP A 1 121 ? 34.215  16.455 1.421   1.00 28.91 ? 344  TRP A NE1 1 
ATOM   947  C  CE2 . TRP A 1 121 ? 33.963  17.706 0.913   1.00 29.72 ? 344  TRP A CE2 1 
ATOM   948  C  CE3 . TRP A 1 121 ? 34.682  19.993 1.313   1.00 26.34 ? 344  TRP A CE3 1 
ATOM   949  C  CZ2 . TRP A 1 121 ? 33.080  18.110 -0.112  1.00 27.80 ? 344  TRP A CZ2 1 
ATOM   950  C  CZ3 . TRP A 1 121 ? 33.779  20.396 0.283   1.00 26.64 ? 344  TRP A CZ3 1 
ATOM   951  C  CH2 . TRP A 1 121 ? 33.016  19.445 -0.418  1.00 23.69 ? 344  TRP A CH2 1 
ATOM   952  N  N   . GLN A 1 122 ? 34.667  17.492 5.991   1.00 29.82 ? 345  GLN A N   1 
ATOM   953  C  CA  . GLN A 1 122 ? 33.482  16.702 6.378   1.00 30.50 ? 345  GLN A CA  1 
ATOM   954  C  C   . GLN A 1 122 ? 32.441  17.463 7.218   1.00 29.60 ? 345  GLN A C   1 
ATOM   955  O  O   . GLN A 1 122 ? 31.299  17.047 7.309   1.00 30.14 ? 345  GLN A O   1 
ATOM   956  C  CB  . GLN A 1 122 ? 33.902  15.462 7.177   1.00 31.67 ? 345  GLN A CB  1 
ATOM   957  C  CG  . GLN A 1 122 ? 35.110  14.727 6.620   1.00 33.84 ? 345  GLN A CG  1 
ATOM   958  C  CD  . GLN A 1 122 ? 34.764  13.645 5.646   1.00 39.95 ? 345  GLN A CD  1 
ATOM   959  O  OE1 . GLN A 1 122 ? 33.744  13.703 4.954   1.00 43.62 ? 345  GLN A OE1 1 
ATOM   960  N  NE2 . GLN A 1 122 ? 35.628  12.627 5.572   1.00 42.19 ? 345  GLN A NE2 1 
ATOM   961  N  N   . GLU A 1 123 ? 32.842  18.552 7.858   1.00 29.12 ? 346  GLU A N   1 
ATOM   962  C  CA  . GLU A 1 123 ? 31.926  19.276 8.761   1.00 27.97 ? 346  GLU A CA  1 
ATOM   963  C  C   . GLU A 1 123 ? 31.034  20.283 8.019   1.00 26.69 ? 346  GLU A C   1 
ATOM   964  O  O   . GLU A 1 123 ? 30.129  20.898 8.631   1.00 26.52 ? 346  GLU A O   1 
ATOM   965  C  CB  . GLU A 1 123 ? 32.713  20.025 9.837   1.00 28.98 ? 346  GLU A CB  1 
ATOM   966  C  CG  . GLU A 1 123 ? 33.417  21.324 9.343   1.00 30.18 ? 346  GLU A CG  1 
ATOM   967  C  CD  . GLU A 1 123 ? 34.054  22.088 10.481  1.00 34.37 ? 346  GLU A CD  1 
ATOM   968  O  OE1 . GLU A 1 123 ? 34.081  21.520 11.587  1.00 34.79 ? 346  GLU A OE1 1 
ATOM   969  O  OE2 . GLU A 1 123 ? 34.519  23.241 10.279  1.00 35.32 ? 346  GLU A OE2 1 
ATOM   970  N  N   . ILE A 1 124 ? 31.303  20.486 6.733   1.00 24.48 ? 347  ILE A N   1 
ATOM   971  C  CA  . ILE A 1 124 ? 30.548  21.503 5.975   1.00 22.01 ? 347  ILE A CA  1 
ATOM   972  C  C   . ILE A 1 124 ? 29.181  20.959 5.597   1.00 21.56 ? 347  ILE A C   1 
ATOM   973  O  O   . ILE A 1 124 ? 29.075  19.845 5.071   1.00 20.27 ? 347  ILE A O   1 
ATOM   974  C  CB  . ILE A 1 124 ? 31.284  21.960 4.728   1.00 22.70 ? 347  ILE A CB  1 
ATOM   975  C  CG1 . ILE A 1 124 ? 32.685  22.456 5.071   1.00 21.93 ? 347  ILE A CG1 1 
ATOM   976  C  CG2 . ILE A 1 124 ? 30.471  23.069 4.000   1.00 19.04 ? 347  ILE A CG2 1 
ATOM   977  C  CD1 . ILE A 1 124 ? 33.471  22.989 3.847   1.00 20.42 ? 347  ILE A CD1 1 
ATOM   978  N  N   . ARG A 1 125 ? 28.135  21.729 5.902   1.00 19.33 ? 348  ARG A N   1 
ATOM   979  C  CA  . ARG A 1 125 ? 26.798  21.479 5.385   1.00 18.43 ? 348  ARG A CA  1 
ATOM   980  C  C   . ARG A 1 125 ? 26.544  22.455 4.221   1.00 16.75 ? 348  ARG A C   1 
ATOM   981  O  O   . ARG A 1 125 ? 27.017  23.587 4.230   1.00 16.02 ? 348  ARG A O   1 
ATOM   982  C  CB  . ARG A 1 125 ? 25.730  21.671 6.479   1.00 18.22 ? 348  ARG A CB  1 
ATOM   983  C  CG  . ARG A 1 125 ? 25.741  20.599 7.596   1.00 21.50 ? 348  ARG A CG  1 
ATOM   984  C  CD  . ARG A 1 125 ? 24.887  21.084 8.807   1.00 25.50 ? 348  ARG A CD  1 
ATOM   985  N  NE  . ARG A 1 125 ? 25.710  22.019 9.563   1.00 26.72 ? 348  ARG A NE  1 
ATOM   986  C  CZ  . ARG A 1 125 ? 25.592  23.346 9.567   1.00 32.33 ? 348  ARG A CZ  1 
ATOM   987  N  NH1 . ARG A 1 125 ? 24.601  23.963 8.881   1.00 28.51 ? 348  ARG A NH1 1 
ATOM   988  N  NH2 . ARG A 1 125 ? 26.489  24.052 10.284  1.00 28.73 ? 348  ARG A NH2 1 
ATOM   989  N  N   . HIS A 1 126 ? 25.820  21.983 3.220   1.00 15.79 ? 349  HIS A N   1 
ATOM   990  C  CA  . HIS A 1 126 ? 25.734  22.669 1.943   1.00 15.21 ? 349  HIS A CA  1 
ATOM   991  C  C   . HIS A 1 126 ? 24.267  22.977 1.649   1.00 14.56 ? 349  HIS A C   1 
ATOM   992  O  O   . HIS A 1 126 ? 23.403  22.108 1.729   1.00 14.02 ? 349  HIS A O   1 
ATOM   993  C  CB  . HIS A 1 126 ? 26.356  21.790 0.824   1.00 14.34 ? 349  HIS A CB  1 
ATOM   994  C  CG  . HIS A 1 126 ? 27.836  21.534 1.000   1.00 13.75 ? 349  HIS A CG  1 
ATOM   995  N  ND1 . HIS A 1 126 ? 28.334  20.485 1.753   1.00 17.09 ? 349  HIS A ND1 1 
ATOM   996  C  CD2 . HIS A 1 126 ? 28.917  22.195 0.523   1.00 12.25 ? 349  HIS A CD2 1 
ATOM   997  C  CE1 . HIS A 1 126 ? 29.659  20.535 1.755   1.00 9.69  ? 349  HIS A CE1 1 
ATOM   998  N  NE2 . HIS A 1 126 ? 30.036  21.559 1.010   1.00 17.71 ? 349  HIS A NE2 1 
ATOM   999  N  N   . ALA A 1 127 ? 23.995  24.224 1.286   1.00 14.97 ? 350  ALA A N   1 
ATOM   1000 C  CA  . ALA A 1 127 ? 22.626  24.647 1.002   1.00 14.48 ? 350  ALA A CA  1 
ATOM   1001 C  C   . ALA A 1 127 ? 22.718  25.370 -0.313  1.00 13.79 ? 350  ALA A C   1 
ATOM   1002 O  O   . ALA A 1 127 ? 23.520  26.323 -0.455  1.00 16.23 ? 350  ALA A O   1 
ATOM   1003 C  CB  . ALA A 1 127 ? 22.071  25.588 2.138   1.00 13.39 ? 350  ALA A CB  1 
ATOM   1004 N  N   . ILE A 1 128 ? 21.972  24.902 -1.308  1.00 14.30 ? 351  ILE A N   1 
ATOM   1005 C  CA  . ILE A 1 128 ? 21.981  25.565 -2.617  1.00 14.09 ? 351  ILE A CA  1 
ATOM   1006 C  C   . ILE A 1 128 ? 20.586  26.200 -2.792  1.00 13.65 ? 351  ILE A C   1 
ATOM   1007 O  O   . ILE A 1 128 ? 19.554  25.552 -2.536  1.00 14.05 ? 351  ILE A O   1 
ATOM   1008 C  CB  . ILE A 1 128 ? 22.214  24.537 -3.811  1.00 14.28 ? 351  ILE A CB  1 
ATOM   1009 C  CG1 . ILE A 1 128 ? 23.542  23.792 -3.627  1.00 13.16 ? 351  ILE A CG1 1 
ATOM   1010 C  CG2 . ILE A 1 128 ? 22.104  25.276 -5.162  1.00 14.08 ? 351  ILE A CG2 1 
ATOM   1011 C  CD1 . ILE A 1 128 ? 23.706  22.548 -4.536  1.00 15.68 ? 351  ILE A CD1 1 
ATOM   1012 N  N   . ILE A 1 129 ? 20.562  27.461 -3.226  1.00 12.59 ? 352  ILE A N   1 
ATOM   1013 C  CA  . ILE A 1 129 ? 19.271  28.131 -3.501  1.00 13.84 ? 352  ILE A CA  1 
ATOM   1014 C  C   . ILE A 1 129 ? 19.294  28.704 -4.915  1.00 14.31 ? 352  ILE A C   1 
ATOM   1015 O  O   . ILE A 1 129 ? 20.136  29.561 -5.225  1.00 13.82 ? 352  ILE A O   1 
ATOM   1016 C  CB  . ILE A 1 129 ? 18.968  29.272 -2.481  1.00 13.61 ? 352  ILE A CB  1 
ATOM   1017 C  CG1 . ILE A 1 129 ? 19.109  28.733 -1.033  1.00 15.19 ? 352  ILE A CG1 1 
ATOM   1018 C  CG2 . ILE A 1 129 ? 17.558  29.920 -2.819  1.00 14.09 ? 352  ILE A CG2 1 
ATOM   1019 C  CD1 . ILE A 1 129 ? 18.804  29.718 0.105   1.00 12.20 ? 352  ILE A CD1 1 
ATOM   1020 N  N   . LEU A 1 130 ? 18.400  28.210 -5.774  1.00 15.00 ? 353  LEU A N   1 
ATOM   1021 C  CA  . LEU A 1 130 ? 18.290  28.748 -7.108  1.00 15.61 ? 353  LEU A CA  1 
ATOM   1022 C  C   . LEU A 1 130 ? 17.107  29.705 -7.113  1.00 15.96 ? 353  LEU A C   1 
ATOM   1023 O  O   . LEU A 1 130 ? 16.010  29.337 -6.718  1.00 17.27 ? 353  LEU A O   1 
ATOM   1024 C  CB  . LEU A 1 130 ? 18.077  27.637 -8.142  1.00 15.63 ? 353  LEU A CB  1 
ATOM   1025 C  CG  . LEU A 1 130 ? 19.189  26.574 -8.293  1.00 15.74 ? 353  LEU A CG  1 
ATOM   1026 C  CD1 . LEU A 1 130 ? 18.829  25.277 -7.538  1.00 18.89 ? 353  LEU A CD1 1 
ATOM   1027 C  CD2 . LEU A 1 130 ? 19.373  26.284 -9.769  1.00 15.91 ? 353  LEU A CD2 1 
ATOM   1028 N  N   . LEU A 1 131 ? 17.360  30.934 -7.538  1.00 16.51 ? 354  LEU A N   1 
ATOM   1029 C  CA  . LEU A 1 131 ? 16.314  31.907 -7.846  1.00 17.63 ? 354  LEU A CA  1 
ATOM   1030 C  C   . LEU A 1 131 ? 16.143  31.884 -9.370  1.00 17.11 ? 354  LEU A C   1 
ATOM   1031 O  O   . LEU A 1 131 ? 17.032  32.271 -10.114 1.00 17.00 ? 354  LEU A O   1 
ATOM   1032 C  CB  . LEU A 1 131 ? 16.708  33.302 -7.335  1.00 16.56 ? 354  LEU A CB  1 
ATOM   1033 C  CG  . LEU A 1 131 ? 16.909  33.331 -5.808  1.00 18.60 ? 354  LEU A CG  1 
ATOM   1034 C  CD1 . LEU A 1 131 ? 17.595  34.593 -5.309  1.00 19.77 ? 354  LEU A CD1 1 
ATOM   1035 C  CD2 . LEU A 1 131 ? 15.592  33.115 -5.085  1.00 17.94 ? 354  LEU A CD2 1 
ATOM   1036 N  N   . THR A 1 132 ? 15.009  31.362 -9.811  1.00 18.37 ? 355  THR A N   1 
ATOM   1037 C  CA  . THR A 1 132 ? 14.785  31.068 -11.236 1.00 19.15 ? 355  THR A CA  1 
ATOM   1038 C  C   . THR A 1 132 ? 13.288  30.933 -11.498 1.00 20.26 ? 355  THR A C   1 
ATOM   1039 O  O   . THR A 1 132 ? 12.523  30.749 -10.556 1.00 20.78 ? 355  THR A O   1 
ATOM   1040 C  CB  . THR A 1 132 ? 15.518  29.738 -11.576 1.00 18.40 ? 355  THR A CB  1 
ATOM   1041 O  OG1 . THR A 1 132 ? 15.263  29.337 -12.930 1.00 17.83 ? 355  THR A OG1 1 
ATOM   1042 C  CG2 . THR A 1 132 ? 15.095  28.633 -10.592 1.00 18.05 ? 355  THR A CG2 1 
ATOM   1043 N  N   . ASP A 1 133 ? 12.862  30.982 -12.769 1.00 21.53 ? 356  ASP A N   1 
ATOM   1044 C  CA  . ASP A 1 133 ? 11.469  30.721 -13.115 1.00 23.47 ? 356  ASP A CA  1 
ATOM   1045 C  C   . ASP A 1 133 ? 11.274  29.193 -13.395 1.00 24.69 ? 356  ASP A C   1 
ATOM   1046 O  O   . ASP A 1 133 ? 10.166  28.698 -13.635 1.00 24.60 ? 356  ASP A O   1 
ATOM   1047 C  CB  . ASP A 1 133 ? 11.032  31.633 -14.294 1.00 25.35 ? 356  ASP A CB  1 
ATOM   1048 C  CG  . ASP A 1 133 ? 11.942  31.503 -15.510 1.00 25.28 ? 356  ASP A CG  1 
ATOM   1049 O  OD1 . ASP A 1 133 ? 12.632  30.443 -15.640 1.00 23.72 ? 356  ASP A OD1 1 
ATOM   1050 O  OD2 . ASP A 1 133 ? 11.963  32.455 -16.336 1.00 24.94 ? 356  ASP A OD2 1 
ATOM   1051 N  N   . GLY A 1 134 ? 12.389  28.474 -13.330 1.00 24.17 ? 357  GLY A N   1 
ATOM   1052 C  CA  . GLY A 1 134 ? 12.433  27.030 -13.458 1.00 25.11 ? 357  GLY A CA  1 
ATOM   1053 C  C   . GLY A 1 134 ? 12.205  26.602 -14.891 1.00 25.00 ? 357  GLY A C   1 
ATOM   1054 O  O   . GLY A 1 134 ? 11.634  25.558 -15.113 1.00 26.45 ? 357  GLY A O   1 
ATOM   1055 N  N   . LYS A 1 135 ? 12.585  27.434 -15.857 1.00 24.47 ? 358  LYS A N   1 
ATOM   1056 C  CA  . LYS A 1 135 ? 12.319  27.087 -17.261 1.00 23.99 ? 358  LYS A CA  1 
ATOM   1057 C  C   . LYS A 1 135 ? 13.635  26.708 -17.970 1.00 22.70 ? 358  LYS A C   1 
ATOM   1058 O  O   . LYS A 1 135 ? 14.018  27.296 -18.978 1.00 21.87 ? 358  LYS A O   1 
ATOM   1059 C  CB  . LYS A 1 135 ? 11.442  28.149 -17.977 1.00 24.25 ? 358  LYS A CB  1 
ATOM   1060 C  CG  . LYS A 1 135 ? 9.980   28.190 -17.459 1.00 25.17 ? 358  LYS A CG  1 
ATOM   1061 C  CD  . LYS A 1 135 ? 9.010   29.077 -18.322 1.00 27.96 ? 358  LYS A CD  1 
ATOM   1062 C  CE  . LYS A 1 135 ? 9.597   30.434 -18.632 1.00 30.96 ? 358  LYS A CE  1 
ATOM   1063 N  NZ  . LYS A 1 135 ? 8.572   31.455 -19.048 1.00 37.59 ? 358  LYS A NZ  1 
ATOM   1064 N  N   . SER A 1 136 ? 14.344  25.722 -17.411 1.00 21.18 ? 359  SER A N   1 
ATOM   1065 C  CA  . SER A 1 136 ? 15.542  25.208 -18.072 1.00 22.84 ? 359  SER A CA  1 
ATOM   1066 C  C   . SER A 1 136 ? 15.146  24.683 -19.462 1.00 22.09 ? 359  SER A C   1 
ATOM   1067 O  O   . SER A 1 136 ? 14.057  24.092 -19.608 1.00 23.03 ? 359  SER A O   1 
ATOM   1068 C  CB  . SER A 1 136 ? 16.147  24.059 -17.263 1.00 22.85 ? 359  SER A CB  1 
ATOM   1069 O  OG  . SER A 1 136 ? 15.283  22.948 -17.351 1.00 26.61 ? 359  SER A OG  1 
ATOM   1070 N  N   . ASN A 1 137 ? 16.016  24.873 -20.446 1.00 22.19 ? 360  ASN A N   1 
ATOM   1071 C  CA  . ASN A 1 137 ? 15.718  24.509 -21.844 1.00 22.90 ? 360  ASN A CA  1 
ATOM   1072 C  C   . ASN A 1 137 ? 16.955  24.138 -22.663 1.00 22.73 ? 360  ASN A C   1 
ATOM   1073 O  O   . ASN A 1 137 ? 16.900  24.084 -23.905 1.00 22.36 ? 360  ASN A O   1 
ATOM   1074 C  CB  . ASN A 1 137 ? 14.952  25.664 -22.532 1.00 23.33 ? 360  ASN A CB  1 
ATOM   1075 C  CG  . ASN A 1 137 ? 15.701  27.006 -22.479 1.00 23.09 ? 360  ASN A CG  1 
ATOM   1076 O  OD1 . ASN A 1 137 ? 16.942  27.075 -22.435 1.00 23.34 ? 360  ASN A OD1 1 
ATOM   1077 N  ND2 . ASN A 1 137 ? 14.941  28.080 -22.534 1.00 24.50 ? 360  ASN A ND2 1 
ATOM   1078 N  N   . MET A 1 138 ? 18.089  23.930 -21.981 1.00 21.32 ? 361  MET A N   1 
ATOM   1079 C  CA  . MET A 1 138 ? 19.338  23.542 -22.637 1.00 20.23 ? 361  MET A CA  1 
ATOM   1080 C  C   . MET A 1 138 ? 20.274  22.913 -21.606 1.00 19.66 ? 361  MET A C   1 
ATOM   1081 O  O   . MET A 1 138 ? 20.120  23.159 -20.415 1.00 18.59 ? 361  MET A O   1 
ATOM   1082 C  CB  . MET A 1 138 ? 20.036  24.742 -23.308 1.00 20.53 ? 361  MET A CB  1 
ATOM   1083 C  CG  . MET A 1 138 ? 20.613  25.769 -22.333 1.00 20.58 ? 361  MET A CG  1 
ATOM   1084 S  SD  . MET A 1 138 ? 21.370  27.165 -23.174 1.00 22.16 ? 361  MET A SD  1 
ATOM   1085 C  CE  . MET A 1 138 ? 22.896  26.463 -23.731 1.00 22.00 ? 361  MET A CE  1 
ATOM   1086 N  N   . GLY A 1 139 ? 21.233  22.127 -22.085 1.00 18.65 ? 362  GLY A N   1 
ATOM   1087 C  CA  . GLY A 1 139 ? 22.358  21.655 -21.239 1.00 18.37 ? 362  GLY A CA  1 
ATOM   1088 C  C   . GLY A 1 139 ? 22.160  20.311 -20.578 1.00 17.96 ? 362  GLY A C   1 
ATOM   1089 O  O   . GLY A 1 139 ? 23.084  19.793 -19.939 1.00 18.16 ? 362  GLY A O   1 
ATOM   1090 N  N   . GLY A 1 140 ? 20.959  19.753 -20.747 1.00 17.17 ? 363  GLY A N   1 
ATOM   1091 C  CA  . GLY A 1 140 ? 20.600  18.450 -20.225 1.00 17.03 ? 363  GLY A CA  1 
ATOM   1092 C  C   . GLY A 1 140 ? 19.930  18.499 -18.865 1.00 16.63 ? 363  GLY A C   1 
ATOM   1093 O  O   . GLY A 1 140 ? 19.791  19.571 -18.284 1.00 16.37 ? 363  GLY A O   1 
ATOM   1094 N  N   . SER A 1 141 ? 19.487  17.346 -18.388 1.00 16.56 ? 364  SER A N   1 
ATOM   1095 C  CA  . SER A 1 141 ? 18.814  17.257 -17.100 1.00 16.72 ? 364  SER A CA  1 
ATOM   1096 C  C   . SER A 1 141 ? 19.706  17.705 -15.932 1.00 16.75 ? 364  SER A C   1 
ATOM   1097 O  O   . SER A 1 141 ? 20.864  17.250 -15.794 1.00 15.83 ? 364  SER A O   1 
ATOM   1098 C  CB  . SER A 1 141 ? 18.336  15.844 -16.862 1.00 17.25 ? 364  SER A CB  1 
ATOM   1099 O  OG  . SER A 1 141 ? 17.851  15.731 -15.554 1.00 18.11 ? 364  SER A OG  1 
ATOM   1100 N  N   . PRO A 1 142 ? 19.199  18.636 -15.110 1.00 17.66 ? 365  PRO A N   1 
ATOM   1101 C  CA  . PRO A 1 142 ? 19.916  19.053 -13.887 1.00 16.82 ? 365  PRO A CA  1 
ATOM   1102 C  C   . PRO A 1 142 ? 20.116  17.885 -12.909 1.00 15.59 ? 365  PRO A C   1 
ATOM   1103 O  O   . PRO A 1 142 ? 21.028  17.936 -12.092 1.00 14.78 ? 365  PRO A O   1 
ATOM   1104 C  CB  . PRO A 1 142 ? 18.992  20.144 -13.286 1.00 17.73 ? 365  PRO A CB  1 
ATOM   1105 C  CG  . PRO A 1 142 ? 18.289  20.709 -14.525 1.00 18.91 ? 365  PRO A CG  1 
ATOM   1106 C  CD  . PRO A 1 142 ? 17.976  19.432 -15.338 1.00 17.02 ? 365  PRO A CD  1 
ATOM   1107 N  N   . LYS A 1 143 ? 19.331  16.816 -13.022 1.00 15.17 ? 366  LYS A N   1 
ATOM   1108 C  CA  . LYS A 1 143 ? 19.507  15.691 -12.073 1.00 14.73 ? 366  LYS A CA  1 
ATOM   1109 C  C   . LYS A 1 143 ? 20.938  15.099 -12.078 1.00 14.80 ? 366  LYS A C   1 
ATOM   1110 O  O   . LYS A 1 143 ? 21.434  14.615 -11.038 1.00 13.65 ? 366  LYS A O   1 
ATOM   1111 C  CB  . LYS A 1 143 ? 18.436  14.611 -12.290 1.00 16.03 ? 366  LYS A CB  1 
ATOM   1112 C  CG  . LYS A 1 143 ? 18.638  13.279 -11.458 1.00 18.32 ? 366  LYS A CG  1 
ATOM   1113 C  CD  . LYS A 1 143 ? 17.534  12.236 -11.800 1.00 20.77 ? 366  LYS A CD  1 
ATOM   1114 C  CE  . LYS A 1 143 ? 17.687  10.939 -11.034 1.00 24.04 ? 366  LYS A CE  1 
ATOM   1115 N  NZ  . LYS A 1 143 ? 18.309  11.043 -9.694  1.00 28.43 ? 366  LYS A NZ  1 
ATOM   1116 N  N   . THR A 1 144 ? 21.609  15.134 -13.229 1.00 14.29 ? 367  THR A N   1 
ATOM   1117 C  CA  . THR A 1 144 ? 22.975  14.592 -13.331 1.00 14.02 ? 367  THR A CA  1 
ATOM   1118 C  C   . THR A 1 144 ? 23.868  15.350 -12.368 1.00 13.82 ? 367  THR A C   1 
ATOM   1119 O  O   . THR A 1 144 ? 24.662  14.744 -11.621 1.00 13.73 ? 367  THR A O   1 
ATOM   1120 C  CB  . THR A 1 144 ? 23.514  14.725 -14.767 1.00 13.85 ? 367  THR A CB  1 
ATOM   1121 O  OG1 . THR A 1 144 ? 22.665  14.019 -15.678 1.00 13.90 ? 367  THR A OG1 1 
ATOM   1122 C  CG2 . THR A 1 144 ? 24.952  14.178 -14.885 1.00 14.76 ? 367  THR A CG2 1 
ATOM   1123 N  N   . ALA A 1 145 ? 23.739  16.677 -12.377 1.00 13.54 ? 368  ALA A N   1 
ATOM   1124 C  CA  . ALA A 1 145 ? 24.572  17.524 -11.504 1.00 13.40 ? 368  ALA A CA  1 
ATOM   1125 C  C   . ALA A 1 145 ? 24.167  17.324 -10.046 1.00 13.91 ? 368  ALA A C   1 
ATOM   1126 O  O   . ALA A 1 145 ? 25.031  17.213 -9.172  1.00 12.97 ? 368  ALA A O   1 
ATOM   1127 C  CB  . ALA A 1 145 ? 24.490  18.976 -11.904 1.00 12.63 ? 368  ALA A CB  1 
ATOM   1128 N  N   . VAL A 1 146 ? 22.867  17.229 -9.791  1.00 14.12 ? 369  VAL A N   1 
ATOM   1129 C  CA  . VAL A 1 146 ? 22.394  16.926 -8.426  1.00 15.17 ? 369  VAL A CA  1 
ATOM   1130 C  C   . VAL A 1 146 ? 23.005  15.628 -7.879  1.00 15.64 ? 369  VAL A C   1 
ATOM   1131 O  O   . VAL A 1 146 ? 23.504  15.572 -6.725  1.00 14.63 ? 369  VAL A O   1 
ATOM   1132 C  CB  . VAL A 1 146 ? 20.842  16.912 -8.349  1.00 16.15 ? 369  VAL A CB  1 
ATOM   1133 C  CG1 . VAL A 1 146 ? 20.371  16.481 -6.945  1.00 16.50 ? 369  VAL A CG1 1 
ATOM   1134 C  CG2 . VAL A 1 146 ? 20.298  18.341 -8.682  1.00 14.47 ? 369  VAL A CG2 1 
ATOM   1135 N  N   . ASP A 1 147 ? 22.971  14.578 -8.710  1.00 14.75 ? 370  ASP A N   1 
ATOM   1136 C  CA  . ASP A 1 147 ? 23.500  13.271 -8.323  1.00 16.14 ? 370  ASP A CA  1 
ATOM   1137 C  C   . ASP A 1 147 ? 25.018  13.264 -8.126  1.00 15.42 ? 370  ASP A C   1 
ATOM   1138 O  O   . ASP A 1 147 ? 25.512  12.655 -7.187  1.00 15.98 ? 370  ASP A O   1 
ATOM   1139 C  CB  . ASP A 1 147 ? 23.014  12.200 -9.313  1.00 16.11 ? 370  ASP A CB  1 
ATOM   1140 C  CG  . ASP A 1 147 ? 21.589  11.763 -9.035  1.00 20.53 ? 370  ASP A CG  1 
ATOM   1141 O  OD1 . ASP A 1 147 ? 20.998  11.090 -9.907  1.00 22.18 ? 370  ASP A OD1 1 
ATOM   1142 O  OD2 . ASP A 1 147 ? 21.043  12.118 -7.940  1.00 22.11 ? 370  ASP A OD2 1 
ATOM   1143 N  N   . HIS A 1 148 ? 25.754  14.020 -8.948  1.00 14.54 ? 371  HIS A N   1 
ATOM   1144 C  CA  . HIS A 1 148 ? 27.193  14.224 -8.714  1.00 15.28 ? 371  HIS A CA  1 
ATOM   1145 C  C   . HIS A 1 148 ? 27.513  14.896 -7.371  1.00 16.12 ? 371  HIS A C   1 
ATOM   1146 O  O   . HIS A 1 148 ? 28.464  14.509 -6.640  1.00 14.63 ? 371  HIS A O   1 
ATOM   1147 C  CB  . HIS A 1 148 ? 27.793  15.035 -9.864  1.00 14.90 ? 371  HIS A CB  1 
ATOM   1148 C  CG  . HIS A 1 148 ? 27.959  14.234 -11.126 1.00 18.22 ? 371  HIS A CG  1 
ATOM   1149 N  ND1 . HIS A 1 148 ? 28.068  14.810 -12.375 1.00 19.86 ? 371  HIS A ND1 1 
ATOM   1150 C  CD2 . HIS A 1 148 ? 28.033  12.893 -11.321 1.00 20.51 ? 371  HIS A CD2 1 
ATOM   1151 C  CE1 . HIS A 1 148 ? 28.208  13.859 -13.282 1.00 22.07 ? 371  HIS A CE1 1 
ATOM   1152 N  NE2 . HIS A 1 148 ? 28.201  12.687 -12.669 1.00 20.73 ? 371  HIS A NE2 1 
ATOM   1153 N  N   . ILE A 1 149 ? 26.693  15.882 -7.047  1.00 15.80 ? 372  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 149 ? 26.826  16.611 -5.768  1.00 16.03 ? 372  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 149 ? 26.519  15.688 -4.597  1.00 16.05 ? 372  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 149 ? 27.252  15.672 -3.622  1.00 17.50 ? 372  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 149 ? 25.883  17.830 -5.779  1.00 15.50 ? 372  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 149 ? 26.471  18.908 -6.699  1.00 14.99 ? 372  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 149 ? 25.667  18.391 -4.334  1.00 15.24 ? 372  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 149 ? 25.566  20.082 -6.975  1.00 17.97 ? 372  ILE A CD1 1 
ATOM   1161 N  N   . ARG A 1 150 ? 25.455  14.912 -4.693  1.00 17.38 ? 373  ARG A N   1 
ATOM   1162 C  CA  . ARG A 1 150 ? 25.114  13.967 -3.626  1.00 20.13 ? 373  ARG A CA  1 
ATOM   1163 C  C   . ARG A 1 150 ? 26.252  12.955 -3.404  1.00 21.16 ? 373  ARG A C   1 
ATOM   1164 O  O   . ARG A 1 150 ? 26.482  12.492 -2.286  1.00 21.28 ? 373  ARG A O   1 
ATOM   1165 C  CB  . ARG A 1 150 ? 23.825  13.243 -3.965  1.00 19.16 ? 373  ARG A CB  1 
ATOM   1166 C  CG  . ARG A 1 150 ? 22.580  14.094 -3.735  1.00 23.30 ? 373  ARG A CG  1 
ATOM   1167 C  CD  . ARG A 1 150 ? 21.314  13.400 -4.200  1.00 27.08 ? 373  ARG A CD  1 
ATOM   1168 N  NE  . ARG A 1 150 ? 21.100  12.175 -3.412  1.00 30.35 ? 373  ARG A NE  1 
ATOM   1169 C  CZ  . ARG A 1 150 ? 20.466  12.121 -2.240  1.00 34.47 ? 373  ARG A CZ  1 
ATOM   1170 N  NH1 . ARG A 1 150 ? 19.956  13.220 -1.689  1.00 34.23 ? 373  ARG A NH1 1 
ATOM   1171 N  NH2 . ARG A 1 150 ? 20.356  10.955 -1.596  1.00 35.66 ? 373  ARG A NH2 1 
ATOM   1172 N  N   . GLU A 1 151 ? 26.942  12.625 -4.489  1.00 21.70 ? 374  GLU A N   1 
ATOM   1173 C  CA  . GLU A 1 151 ? 28.047  11.678 -4.453  1.00 22.90 ? 374  GLU A CA  1 
ATOM   1174 C  C   . GLU A 1 151 ? 29.302  12.246 -3.774  1.00 22.94 ? 374  GLU A C   1 
ATOM   1175 O  O   . GLU A 1 151 ? 29.845  11.628 -2.843  1.00 24.12 ? 374  GLU A O   1 
ATOM   1176 C  CB  . GLU A 1 151 ? 28.333  11.235 -5.898  1.00 23.89 ? 374  GLU A CB  1 
ATOM   1177 C  CG  . GLU A 1 151 ? 29.409  10.170 -6.080  1.00 28.34 ? 374  GLU A CG  1 
ATOM   1178 C  CD  . GLU A 1 151 ? 29.481  9.696  -7.550  1.00 33.61 ? 374  GLU A CD  1 
ATOM   1179 O  OE1 . GLU A 1 151 ? 29.883  8.539  -7.749  1.00 34.84 ? 374  GLU A OE1 1 
ATOM   1180 O  OE2 . GLU A 1 151 ? 29.122  10.466 -8.496  1.00 35.14 ? 374  GLU A OE2 1 
ATOM   1181 N  N   . ILE A 1 152 ? 29.759  13.418 -4.195  1.00 21.94 ? 375  ILE A N   1 
ATOM   1182 C  CA  . ILE A 1 152 ? 30.953  14.032 -3.625  1.00 22.47 ? 375  ILE A CA  1 
ATOM   1183 C  C   . ILE A 1 152 ? 30.757  14.376 -2.123  1.00 24.62 ? 375  ILE A C   1 
ATOM   1184 O  O   . ILE A 1 152 ? 31.712  14.300 -1.321  1.00 23.55 ? 375  ILE A O   1 
ATOM   1185 C  CB  . ILE A 1 152 ? 31.425  15.268 -4.455  1.00 22.34 ? 375  ILE A CB  1 
ATOM   1186 C  CG1 . ILE A 1 152 ? 32.849  15.669 -4.115  1.00 20.97 ? 375  ILE A CG1 1 
ATOM   1187 C  CG2 . ILE A 1 152 ? 30.484  16.499 -4.246  1.00 20.95 ? 375  ILE A CG2 1 
ATOM   1188 C  CD1 . ILE A 1 152 ? 33.443  16.630 -5.134  1.00 21.97 ? 375  ILE A CD1 1 
ATOM   1189 N  N   . LEU A 1 153 ? 29.515  14.694 -1.756  1.00 24.63 ? 376  LEU A N   1 
ATOM   1190 C  CA  . LEU A 1 153 ? 29.151  15.057 -0.380  1.00 26.42 ? 376  LEU A CA  1 
ATOM   1191 C  C   . LEU A 1 153 ? 28.825  13.832 0.486   1.00 28.38 ? 376  LEU A C   1 
ATOM   1192 O  O   . LEU A 1 153 ? 28.560  13.967 1.696   1.00 28.80 ? 376  LEU A O   1 
ATOM   1193 C  CB  . LEU A 1 153 ? 27.942  16.025 -0.399  1.00 25.72 ? 376  LEU A CB  1 
ATOM   1194 C  CG  . LEU A 1 153 ? 28.160  17.409 -1.041  1.00 24.32 ? 376  LEU A CG  1 
ATOM   1195 C  CD1 . LEU A 1 153 ? 26.944  18.349 -0.749  1.00 24.17 ? 376  LEU A CD1 1 
ATOM   1196 C  CD2 . LEU A 1 153 ? 29.440  18.088 -0.610  1.00 23.94 ? 376  LEU A CD2 1 
ATOM   1197 N  N   . ASN A 1 154 ? 28.850  12.641 -0.132  1.00 30.32 ? 377  ASN A N   1 
ATOM   1198 C  CA  . ASN A 1 154 ? 28.466  11.396 0.529   1.00 31.88 ? 377  ASN A CA  1 
ATOM   1199 C  C   . ASN A 1 154 ? 27.170  11.557 1.320   1.00 32.57 ? 377  ASN A C   1 
ATOM   1200 O  O   . ASN A 1 154 ? 27.118  11.334 2.533   1.00 32.00 ? 377  ASN A O   1 
ATOM   1201 C  CB  . ASN A 1 154 ? 29.635  10.858 1.397   1.00 32.85 ? 377  ASN A CB  1 
ATOM   1202 C  CG  . ASN A 1 154 ? 29.354  9.478  2.010   1.00 34.21 ? 377  ASN A CG  1 
ATOM   1203 O  OD1 . ASN A 1 154 ? 29.826  9.191  3.117   1.00 36.54 ? 377  ASN A OD1 1 
ATOM   1204 N  ND2 . ASN A 1 154 ? 28.548  8.647  1.327   1.00 34.60 ? 377  ASN A ND2 1 
ATOM   1205 N  N   . ILE A 1 155 ? 26.116  11.960 0.609   1.00 33.05 ? 378  ILE A N   1 
ATOM   1206 C  CA  . ILE A 1 155 ? 24.795  12.099 1.203   1.00 33.37 ? 378  ILE A CA  1 
ATOM   1207 C  C   . ILE A 1 155 ? 24.183  10.714 1.357   1.00 35.63 ? 378  ILE A C   1 
ATOM   1208 O  O   . ILE A 1 155 ? 23.701  10.126 0.391   1.00 35.86 ? 378  ILE A O   1 
ATOM   1209 C  CB  . ILE A 1 155 ? 23.858  13.080 0.376   1.00 32.42 ? 378  ILE A CB  1 
ATOM   1210 C  CG1 . ILE A 1 155 ? 24.543  14.435 0.149   1.00 28.83 ? 378  ILE A CG1 1 
ATOM   1211 C  CG2 . ILE A 1 155 ? 22.462  13.209 0.997   1.00 30.30 ? 378  ILE A CG2 1 
ATOM   1212 C  CD1 . ILE A 1 155 ? 24.923  15.217 1.426   1.00 26.73 ? 378  ILE A CD1 1 
ATOM   1213 N  N   . ASN A 1 156 ? 24.229  10.188 2.579   1.00 37.42 ? 379  ASN A N   1 
ATOM   1214 C  CA  . ASN A 1 156 ? 23.515  8.932  2.930   1.00 38.66 ? 379  ASN A CA  1 
ATOM   1215 C  C   . ASN A 1 156 ? 22.362  9.246  3.886   1.00 38.95 ? 379  ASN A C   1 
ATOM   1216 O  O   . ASN A 1 156 ? 22.000  10.414 4.024   1.00 38.62 ? 379  ASN A O   1 
ATOM   1217 C  CB  . ASN A 1 156 ? 24.470  7.838  3.453   1.00 38.28 ? 379  ASN A CB  1 
ATOM   1218 C  CG  . ASN A 1 156 ? 25.555  8.371  4.402   1.00 40.07 ? 379  ASN A CG  1 
ATOM   1219 O  OD1 . ASN A 1 156 ? 26.747  8.082  4.236   1.00 41.41 ? 379  ASN A OD1 1 
ATOM   1220 N  ND2 . ASN A 1 156 ? 25.144  9.129  5.408   1.00 40.78 ? 379  ASN A ND2 1 
ATOM   1221 N  N   . GLN A 1 157 ? 21.754  8.244  4.523   1.00 39.28 ? 380  GLN A N   1 
ATOM   1222 C  CA  . GLN A 1 157 ? 20.664  8.570  5.452   1.00 40.20 ? 380  GLN A CA  1 
ATOM   1223 C  C   . GLN A 1 157 ? 21.201  9.346  6.651   1.00 39.82 ? 380  GLN A C   1 
ATOM   1224 O  O   . GLN A 1 157 ? 20.543  10.296 7.110   1.00 40.61 ? 380  GLN A O   1 
ATOM   1225 C  CB  . GLN A 1 157 ? 19.840  7.345  5.872   1.00 41.45 ? 380  GLN A CB  1 
ATOM   1226 C  CG  . GLN A 1 157 ? 18.587  7.122  4.993   1.00 43.92 ? 380  GLN A CG  1 
ATOM   1227 C  CD  . GLN A 1 157 ? 17.784  5.880  5.407   1.00 49.17 ? 380  GLN A CD  1 
ATOM   1228 O  OE1 . GLN A 1 157 ? 18.350  4.831  5.762   1.00 50.42 ? 380  GLN A OE1 1 
ATOM   1229 N  NE2 . GLN A 1 157 ? 16.460  5.995  5.361   1.00 49.48 ? 380  GLN A NE2 1 
ATOM   1230 N  N   . LYS A 1 158 ? 22.418  8.988  7.098   1.00 38.34 ? 381  LYS A N   1 
ATOM   1231 C  CA  . LYS A 1 158 ? 23.086  9.650  8.228   1.00 36.84 ? 381  LYS A CA  1 
ATOM   1232 C  C   . LYS A 1 158 ? 23.527  11.062 7.859   1.00 34.92 ? 381  LYS A C   1 
ATOM   1233 O  O   . LYS A 1 158 ? 23.657  11.908 8.730   1.00 34.68 ? 381  LYS A O   1 
ATOM   1234 C  CB  . LYS A 1 158 ? 24.341  8.888  8.704   1.00 37.50 ? 381  LYS A CB  1 
ATOM   1235 C  CG  . LYS A 1 158 ? 24.128  7.472  9.260   1.00 40.61 ? 381  LYS A CG  1 
ATOM   1236 C  CD  . LYS A 1 158 ? 24.431  6.412  8.177   1.00 44.91 ? 381  LYS A CD  1 
ATOM   1237 C  CE  . LYS A 1 158 ? 23.240  6.280  7.177   1.00 47.50 ? 381  LYS A CE  1 
ATOM   1238 N  NZ  . LYS A 1 158 ? 23.519  5.466  5.928   1.00 47.52 ? 381  LYS A NZ  1 
ATOM   1239 N  N   . ARG A 1 159 ? 23.789  11.303 6.576   1.00 32.49 ? 382  ARG A N   1 
ATOM   1240 C  CA  . ARG A 1 159 ? 24.251  12.634 6.135   1.00 29.58 ? 382  ARG A CA  1 
ATOM   1241 C  C   . ARG A 1 159 ? 23.215  13.468 5.339   1.00 27.66 ? 382  ARG A C   1 
ATOM   1242 O  O   . ARG A 1 159 ? 23.567  14.389 4.609   1.00 25.32 ? 382  ARG A O   1 
ATOM   1243 C  CB  . ARG A 1 159 ? 25.607  12.530 5.422   1.00 29.84 ? 382  ARG A CB  1 
ATOM   1244 C  CG  . ARG A 1 159 ? 26.761  12.283 6.393   1.00 29.27 ? 382  ARG A CG  1 
ATOM   1245 C  CD  . ARG A 1 159 ? 28.105  12.149 5.696   1.00 30.38 ? 382  ARG A CD  1 
ATOM   1246 N  NE  . ARG A 1 159 ? 28.383  13.219 4.739   1.00 27.87 ? 382  ARG A NE  1 
ATOM   1247 C  CZ  . ARG A 1 159 ? 29.053  14.338 5.008   1.00 32.15 ? 382  ARG A CZ  1 
ATOM   1248 N  NH1 . ARG A 1 159 ? 29.541  14.580 6.232   1.00 32.77 ? 382  ARG A NH1 1 
ATOM   1249 N  NH2 . ARG A 1 159 ? 29.260  15.225 4.037   1.00 32.45 ? 382  ARG A NH2 1 
ATOM   1250 N  N   . ASN A 1 160 ? 21.943  13.166 5.535   1.00 25.35 ? 383  ASN A N   1 
ATOM   1251 C  CA  . ASN A 1 160 ? 20.898  13.868 4.825   1.00 25.68 ? 383  ASN A CA  1 
ATOM   1252 C  C   . ASN A 1 160 ? 20.871  15.382 5.126   1.00 24.24 ? 383  ASN A C   1 
ATOM   1253 O  O   . ASN A 1 160 ? 20.424  16.188 4.304   1.00 24.80 ? 383  ASN A O   1 
ATOM   1254 C  CB  . ASN A 1 160 ? 19.551  13.227 5.120   1.00 26.30 ? 383  ASN A CB  1 
ATOM   1255 C  CG  . ASN A 1 160 ? 18.553  13.468 4.020   1.00 29.00 ? 383  ASN A CG  1 
ATOM   1256 O  OD1 . ASN A 1 160 ? 18.887  13.350 2.825   1.00 33.50 ? 383  ASN A OD1 1 
ATOM   1257 N  ND2 . ASN A 1 160 ? 17.322  13.808 4.396   1.00 29.83 ? 383  ASN A ND2 1 
ATOM   1258 N  N   . ASP A 1 161 ? 21.396  15.747 6.288   1.00 23.14 ? 384  ASP A N   1 
ATOM   1259 C  CA  . ASP A 1 161 ? 21.439  17.128 6.745   1.00 23.03 ? 384  ASP A CA  1 
ATOM   1260 C  C   . ASP A 1 161 ? 22.548  17.917 6.087   1.00 21.20 ? 384  ASP A C   1 
ATOM   1261 O  O   . ASP A 1 161 ? 22.636  19.134 6.263   1.00 21.72 ? 384  ASP A O   1 
ATOM   1262 C  CB  . ASP A 1 161 ? 21.651  17.165 8.254   1.00 23.55 ? 384  ASP A CB  1 
ATOM   1263 C  CG  . ASP A 1 161 ? 20.444  16.717 9.032   1.00 25.90 ? 384  ASP A CG  1 
ATOM   1264 O  OD1 . ASP A 1 161 ? 20.544  16.696 10.287  1.00 29.88 ? 384  ASP A OD1 1 
ATOM   1265 O  OD2 . ASP A 1 161 ? 19.390  16.421 8.436   1.00 28.52 ? 384  ASP A OD2 1 
ATOM   1266 N  N   . TYR A 1 162 ? 23.391  17.233 5.321   1.00 19.74 ? 385  TYR A N   1 
ATOM   1267 C  CA  . TYR A 1 162 ? 24.556  17.878 4.735   1.00 18.26 ? 385  TYR A CA  1 
ATOM   1268 C  C   . TYR A 1 162 ? 24.279  18.539 3.388   1.00 16.31 ? 385  TYR A C   1 
ATOM   1269 O  O   . TYR A 1 162 ? 25.163  19.188 2.824   1.00 15.75 ? 385  TYR A O   1 
ATOM   1270 C  CB  . TYR A 1 162 ? 25.770  16.931 4.674   1.00 18.76 ? 385  TYR A CB  1 
ATOM   1271 C  CG  . TYR A 1 162 ? 26.341  16.743 6.050   1.00 21.39 ? 385  TYR A CG  1 
ATOM   1272 C  CD1 . TYR A 1 162 ? 25.700  15.916 6.949   1.00 25.59 ? 385  TYR A CD1 1 
ATOM   1273 C  CD2 . TYR A 1 162 ? 27.452  17.480 6.489   1.00 24.02 ? 385  TYR A CD2 1 
ATOM   1274 C  CE1 . TYR A 1 162 ? 26.170  15.756 8.257   1.00 26.94 ? 385  TYR A CE1 1 
ATOM   1275 C  CE2 . TYR A 1 162 ? 27.940  17.331 7.820   1.00 26.87 ? 385  TYR A CE2 1 
ATOM   1276 C  CZ  . TYR A 1 162 ? 27.272  16.450 8.683   1.00 28.79 ? 385  TYR A CZ  1 
ATOM   1277 O  OH  . TYR A 1 162 ? 27.648  16.244 10.009  1.00 30.03 ? 385  TYR A OH  1 
ATOM   1278 N  N   . LEU A 1 163 ? 23.067  18.364 2.900   1.00 15.68 ? 386  LEU A N   1 
ATOM   1279 C  CA  . LEU A 1 163 ? 22.648  18.950 1.610   1.00 15.62 ? 386  LEU A CA  1 
ATOM   1280 C  C   . LEU A 1 163 ? 21.176  19.343 1.590   1.00 15.17 ? 386  LEU A C   1 
ATOM   1281 O  O   . LEU A 1 163 ? 20.265  18.534 1.935   1.00 15.23 ? 386  LEU A O   1 
ATOM   1282 C  CB  . LEU A 1 163 ? 22.960  17.995 0.420   1.00 15.88 ? 386  LEU A CB  1 
ATOM   1283 C  CG  . LEU A 1 163 ? 22.552  18.525 -0.958  1.00 17.80 ? 386  LEU A CG  1 
ATOM   1284 C  CD1 . LEU A 1 163 ? 23.374  19.800 -1.361  1.00 14.92 ? 386  LEU A CD1 1 
ATOM   1285 C  CD2 . LEU A 1 163 ? 22.670  17.444 -2.000  1.00 16.48 ? 386  LEU A CD2 1 
ATOM   1286 N  N   . ASP A 1 164 ? 20.927  20.582 1.148   1.00 13.84 ? 387  ASP A N   1 
ATOM   1287 C  CA  . ASP A 1 164 ? 19.560  21.040 0.894   1.00 13.51 ? 387  ASP A CA  1 
ATOM   1288 C  C   . ASP A 1 164 ? 19.628  21.830 -0.393  1.00 12.63 ? 387  ASP A C   1 
ATOM   1289 O  O   . ASP A 1 164 ? 20.563  22.627 -0.593  1.00 12.97 ? 387  ASP A O   1 
ATOM   1290 C  CB  . ASP A 1 164 ? 19.013  21.967 2.020   1.00 13.10 ? 387  ASP A CB  1 
ATOM   1291 C  CG  . ASP A 1 164 ? 18.722  21.202 3.274   1.00 14.35 ? 387  ASP A CG  1 
ATOM   1292 O  OD1 . ASP A 1 164 ? 19.701  20.952 4.029   1.00 17.50 ? 387  ASP A OD1 1 
ATOM   1293 O  OD2 . ASP A 1 164 ? 17.571  20.810 3.468   1.00 16.77 ? 387  ASP A OD2 1 
ATOM   1294 N  N   . ILE A 1 165 ? 18.684  21.572 -1.265  1.00 12.48 ? 388  ILE A N   1 
ATOM   1295 C  CA  . ILE A 1 165 ? 18.585  22.314 -2.522  1.00 13.54 ? 388  ILE A CA  1 
ATOM   1296 C  C   . ILE A 1 165 ? 17.205  22.922 -2.561  1.00 13.42 ? 388  ILE A C   1 
ATOM   1297 O  O   . ILE A 1 165 ? 16.193  22.194 -2.486  1.00 14.66 ? 388  ILE A O   1 
ATOM   1298 C  CB  . ILE A 1 165 ? 18.783  21.425 -3.795  1.00 13.52 ? 388  ILE A CB  1 
ATOM   1299 C  CG1 . ILE A 1 165 ? 20.136  20.662 -3.700  1.00 13.77 ? 388  ILE A CG1 1 
ATOM   1300 C  CG2 . ILE A 1 165 ? 18.655  22.294 -5.077  1.00 15.30 ? 388  ILE A CG2 1 
ATOM   1301 C  CD1 . ILE A 1 165 ? 20.524  19.865 -4.999  1.00 15.44 ? 388  ILE A CD1 1 
ATOM   1302 N  N   . TYR A 1 166 ? 17.175  24.254 -2.686  1.00 14.71 ? 389  TYR A N   1 
ATOM   1303 C  CA  . TYR A 1 166 ? 15.941  25.053 -2.800  1.00 14.08 ? 389  TYR A CA  1 
ATOM   1304 C  C   . TYR A 1 166 ? 15.816  25.698 -4.154  1.00 14.66 ? 389  TYR A C   1 
ATOM   1305 O  O   . TYR A 1 166 ? 16.794  26.185 -4.680  1.00 15.76 ? 389  TYR A O   1 
ATOM   1306 C  CB  . TYR A 1 166 ? 15.872  26.191 -1.757  1.00 13.83 ? 389  TYR A CB  1 
ATOM   1307 C  CG  . TYR A 1 166 ? 15.697  25.671 -0.353  1.00 14.07 ? 389  TYR A CG  1 
ATOM   1308 C  CD1 . TYR A 1 166 ? 14.420  25.487 0.196   1.00 16.13 ? 389  TYR A CD1 1 
ATOM   1309 C  CD2 . TYR A 1 166 ? 16.801  25.360 0.422   1.00 13.15 ? 389  TYR A CD2 1 
ATOM   1310 C  CE1 . TYR A 1 166 ? 14.280  24.996 1.509   1.00 17.41 ? 389  TYR A CE1 1 
ATOM   1311 C  CE2 . TYR A 1 166 ? 16.675  24.846 1.703   1.00 12.79 ? 389  TYR A CE2 1 
ATOM   1312 C  CZ  . TYR A 1 166 ? 15.421  24.682 2.235   1.00 17.74 ? 389  TYR A CZ  1 
ATOM   1313 O  OH  . TYR A 1 166 ? 15.327  24.191 3.515   1.00 18.06 ? 389  TYR A OH  1 
ATOM   1314 N  N   . ALA A 1 167 ? 14.601  25.691 -4.710  1.00 15.65 ? 390  ALA A N   1 
ATOM   1315 C  CA  . ALA A 1 167 ? 14.340  26.374 -5.951  1.00 15.53 ? 390  ALA A CA  1 
ATOM   1316 C  C   . ALA A 1 167 ? 13.126  27.267 -5.732  1.00 16.40 ? 390  ALA A C   1 
ATOM   1317 O  O   . ALA A 1 167 ? 12.019  26.794 -5.394  1.00 16.81 ? 390  ALA A O   1 
ATOM   1318 C  CB  . ALA A 1 167 ? 14.098  25.370 -7.080  1.00 17.34 ? 390  ALA A CB  1 
ATOM   1319 N  N   . ILE A 1 168 ? 13.349  28.554 -5.931  1.00 15.88 ? 391  ILE A N   1 
ATOM   1320 C  CA  . ILE A 1 168 ? 12.371  29.576 -5.579  1.00 17.01 ? 391  ILE A CA  1 
ATOM   1321 C  C   . ILE A 1 168 ? 12.178  30.548 -6.729  1.00 17.64 ? 391  ILE A C   1 
ATOM   1322 O  O   . ILE A 1 168 ? 13.134  31.180 -7.187  1.00 18.51 ? 391  ILE A O   1 
ATOM   1323 C  CB  . ILE A 1 168 ? 12.829  30.341 -4.352  1.00 16.50 ? 391  ILE A CB  1 
ATOM   1324 C  CG1 . ILE A 1 168 ? 13.063  29.380 -3.175  1.00 16.32 ? 391  ILE A CG1 1 
ATOM   1325 C  CG2 . ILE A 1 168 ? 11.781  31.473 -3.970  1.00 17.14 ? 391  ILE A CG2 1 
ATOM   1326 C  CD1 . ILE A 1 168 ? 13.763  30.010 -2.002  1.00 19.53 ? 391  ILE A CD1 1 
ATOM   1327 N  N   . GLY A 1 169 ? 10.935  30.643 -7.190  1.00 19.72 ? 392  GLY A N   1 
ATOM   1328 C  CA  . GLY A 1 169 ? 10.561  31.631 -8.191  1.00 21.59 ? 392  GLY A CA  1 
ATOM   1329 C  C   . GLY A 1 169 ? 9.930   32.792 -7.450  1.00 23.07 ? 392  GLY A C   1 
ATOM   1330 O  O   . GLY A 1 169 ? 8.788   32.695 -7.008  1.00 24.84 ? 392  GLY A O   1 
ATOM   1331 N  N   . VAL A 1 170 ? 10.683  33.866 -7.276  1.00 24.05 ? 393  VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 170 ? 10.167  35.026 -6.566  1.00 25.85 ? 393  VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 170 ? 9.991   36.161 -7.565  1.00 27.06 ? 393  VAL A C   1 
ATOM   1334 O  O   . VAL A 1 170 ? 10.892  36.436 -8.354  1.00 26.69 ? 393  VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 170 ? 11.031  35.454 -5.339  1.00 25.23 ? 393  VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 170 ? 12.515  35.520 -5.679  1.00 25.83 ? 393  VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 170 ? 10.552  36.821 -4.793  1.00 25.55 ? 393  VAL A CG2 1 
ATOM   1338 N  N   . GLY A 1 171 ? 8.821   36.800 -7.509  1.00 29.52 ? 394  GLY A N   1 
ATOM   1339 C  CA  . GLY A 1 171 ? 8.478   37.914 -8.396  1.00 31.58 ? 394  GLY A CA  1 
ATOM   1340 C  C   . GLY A 1 171 ? 7.197   37.659 -9.193  1.00 33.27 ? 394  GLY A C   1 
ATOM   1341 O  O   . GLY A 1 171 ? 6.500   36.665 -8.983  1.00 34.03 ? 394  GLY A O   1 
ATOM   1342 N  N   . LYS A 1 172 ? 6.891   38.565 -10.123 1.00 35.23 ? 395  LYS A N   1 
ATOM   1343 C  CA  . LYS A 1 172 ? 5.632   38.494 -10.882 1.00 37.59 ? 395  LYS A CA  1 
ATOM   1344 C  C   . LYS A 1 172 ? 5.648   37.538 -12.067 1.00 39.00 ? 395  LYS A C   1 
ATOM   1345 O  O   . LYS A 1 172 ? 4.612   37.281 -12.703 1.00 38.87 ? 395  LYS A O   1 
ATOM   1346 N  N   . LEU A 1 173 ? 6.821   36.984 -12.341 1.00 39.56 ? 396  LEU A N   1 
ATOM   1347 C  CA  . LEU A 1 173 ? 7.058   36.210 -13.553 1.00 39.82 ? 396  LEU A CA  1 
ATOM   1348 C  C   . LEU A 1 173 ? 6.321   34.863 -13.667 1.00 39.73 ? 396  LEU A C   1 
ATOM   1349 O  O   . LEU A 1 173 ? 5.743   34.353 -12.700 1.00 39.63 ? 396  LEU A O   1 
ATOM   1350 C  CB  . LEU A 1 173 ? 8.571   36.056 -13.754 1.00 40.35 ? 396  LEU A CB  1 
ATOM   1351 C  CG  . LEU A 1 173 ? 9.465   35.218 -12.823 1.00 39.63 ? 396  LEU A CG  1 
ATOM   1352 C  CD1 . LEU A 1 173 ? 10.884  35.363 -13.351 1.00 39.63 ? 396  LEU A CD1 1 
ATOM   1353 C  CD2 . LEU A 1 173 ? 9.421   35.628 -11.367 1.00 38.96 ? 396  LEU A CD2 1 
ATOM   1354 N  N   . ASP A 1 174 ? 6.336   34.311 -14.882 1.00 39.53 ? 397  ASP A N   1 
ATOM   1355 C  CA  . ASP A 1 174 ? 5.717   33.035 -15.179 1.00 39.03 ? 397  ASP A CA  1 
ATOM   1356 C  C   . ASP A 1 174 ? 6.716   31.958 -14.778 1.00 38.18 ? 397  ASP A C   1 
ATOM   1357 O  O   . ASP A 1 174 ? 7.872   32.002 -15.205 1.00 38.49 ? 397  ASP A O   1 
ATOM   1358 C  CB  . ASP A 1 174 ? 5.396   32.954 -16.678 1.00 39.97 ? 397  ASP A CB  1 
ATOM   1359 C  CG  . ASP A 1 174 ? 4.932   31.574 -17.112 1.00 41.92 ? 397  ASP A CG  1 
ATOM   1360 O  OD1 . ASP A 1 174 ? 3.854   31.120 -16.664 1.00 45.21 ? 397  ASP A OD1 1 
ATOM   1361 O  OD2 . ASP A 1 174 ? 5.650   30.941 -17.914 1.00 45.34 ? 397  ASP A OD2 1 
ATOM   1362 N  N   . VAL A 1 175 ? 6.261   31.012 -13.959 1.00 36.89 ? 398  VAL A N   1 
ATOM   1363 C  CA  . VAL A 1 175 ? 7.118   29.977 -13.349 1.00 35.80 ? 398  VAL A CA  1 
ATOM   1364 C  C   . VAL A 1 175 ? 6.620   28.578 -13.696 1.00 35.30 ? 398  VAL A C   1 
ATOM   1365 O  O   . VAL A 1 175 ? 5.415   28.329 -13.735 1.00 35.05 ? 398  VAL A O   1 
ATOM   1366 C  CB  . VAL A 1 175 ? 7.186   30.138 -11.784 1.00 36.25 ? 398  VAL A CB  1 
ATOM   1367 C  CG1 . VAL A 1 175 ? 7.889   28.957 -11.120 1.00 33.89 ? 398  VAL A CG1 1 
ATOM   1368 C  CG2 . VAL A 1 175 ? 7.864   31.439 -11.423 1.00 35.77 ? 398  VAL A CG2 1 
ATOM   1369 N  N   . ASP A 1 176 ? 7.556   27.666 -13.950 1.00 34.00 ? 399  ASP A N   1 
ATOM   1370 C  CA  . ASP A 1 176 ? 7.224   26.261 -14.145 1.00 32.53 ? 399  ASP A CA  1 
ATOM   1371 C  C   . ASP A 1 176 ? 7.368   25.523 -12.812 1.00 32.11 ? 399  ASP A C   1 
ATOM   1372 O  O   . ASP A 1 176 ? 8.474   25.118 -12.414 1.00 29.18 ? 399  ASP A O   1 
ATOM   1373 C  CB  . ASP A 1 176 ? 8.115   25.644 -15.246 1.00 32.75 ? 399  ASP A CB  1 
ATOM   1374 C  CG  . ASP A 1 176 ? 7.726   24.221 -15.596 1.00 33.68 ? 399  ASP A CG  1 
ATOM   1375 O  OD1 . ASP A 1 176 ? 7.178   23.497 -14.738 1.00 35.39 ? 399  ASP A OD1 1 
ATOM   1376 O  OD2 . ASP A 1 176 ? 7.997   23.797 -16.735 1.00 35.56 ? 399  ASP A OD2 1 
ATOM   1377 N  N   . TRP A 1 177 ? 6.234   25.369 -12.128 1.00 31.77 ? 400  TRP A N   1 
ATOM   1378 C  CA  . TRP A 1 177 ? 6.181   24.737 -10.811 1.00 31.92 ? 400  TRP A CA  1 
ATOM   1379 C  C   . TRP A 1 177 ? 6.752   23.319 -10.846 1.00 31.69 ? 400  TRP A C   1 
ATOM   1380 O  O   . TRP A 1 177 ? 7.461   22.896 -9.924  1.00 31.69 ? 400  TRP A O   1 
ATOM   1381 C  CB  . TRP A 1 177 ? 4.736   24.723 -10.266 1.00 32.67 ? 400  TRP A CB  1 
ATOM   1382 C  CG  . TRP A 1 177 ? 4.581   23.847 -9.069  1.00 33.68 ? 400  TRP A CG  1 
ATOM   1383 C  CD1 . TRP A 1 177 ? 3.911   22.664 -8.996  1.00 34.93 ? 400  TRP A CD1 1 
ATOM   1384 C  CD2 . TRP A 1 177 ? 5.168   24.062 -7.774  1.00 35.22 ? 400  TRP A CD2 1 
ATOM   1385 N  NE1 . TRP A 1 177 ? 4.025   22.134 -7.728  1.00 37.80 ? 400  TRP A NE1 1 
ATOM   1386 C  CE2 . TRP A 1 177 ? 4.788   22.974 -6.958  1.00 36.10 ? 400  TRP A CE2 1 
ATOM   1387 C  CE3 . TRP A 1 177 ? 5.968   25.080 -7.225  1.00 36.05 ? 400  TRP A CE3 1 
ATOM   1388 C  CZ2 . TRP A 1 177 ? 5.184   22.865 -5.612  1.00 38.27 ? 400  TRP A CZ2 1 
ATOM   1389 C  CZ3 . TRP A 1 177 ? 6.361   24.981 -5.881  1.00 33.97 ? 400  TRP A CZ3 1 
ATOM   1390 C  CH2 . TRP A 1 177 ? 5.966   23.882 -5.093  1.00 36.05 ? 400  TRP A CH2 1 
ATOM   1391 N  N   . ARG A 1 178 ? 6.435   22.569 -11.899 1.00 30.71 ? 401  ARG A N   1 
ATOM   1392 C  CA  . ARG A 1 178 ? 6.996   21.232 -12.022 1.00 30.25 ? 401  ARG A CA  1 
ATOM   1393 C  C   . ARG A 1 178 ? 8.543   21.191 -11.988 1.00 28.44 ? 401  ARG A C   1 
ATOM   1394 O  O   . ARG A 1 178 ? 9.104   20.332 -11.309 1.00 27.47 ? 401  ARG A O   1 
ATOM   1395 C  CB  . ARG A 1 178 ? 6.459   20.508 -13.250 1.00 31.17 ? 401  ARG A CB  1 
ATOM   1396 C  CG  . ARG A 1 178 ? 6.814   19.021 -13.284 1.00 34.55 ? 401  ARG A CG  1 
ATOM   1397 C  CD  . ARG A 1 178 ? 6.113   18.297 -14.449 1.00 41.82 ? 401  ARG A CD  1 
ATOM   1398 N  NE  . ARG A 1 178 ? 5.689   19.214 -15.521 1.00 47.21 ? 401  ARG A NE  1 
ATOM   1399 C  CZ  . ARG A 1 178 ? 4.420   19.508 -15.824 1.00 50.40 ? 401  ARG A CZ  1 
ATOM   1400 N  NH1 . ARG A 1 178 ? 3.403   18.952 -15.153 1.00 51.54 ? 401  ARG A NH1 1 
ATOM   1401 N  NH2 . ARG A 1 178 ? 4.164   20.357 -16.817 1.00 53.01 ? 401  ARG A NH2 1 
ATOM   1402 N  N   . GLU A 1 179 ? 9.227   22.085 -12.704 1.00 27.67 ? 402  GLU A N   1 
ATOM   1403 C  CA  . GLU A 1 179 ? 10.704  22.084 -12.615 1.00 27.47 ? 402  GLU A CA  1 
ATOM   1404 C  C   . GLU A 1 179 ? 11.218  22.526 -11.242 1.00 26.83 ? 402  GLU A C   1 
ATOM   1405 O  O   . GLU A 1 179 ? 12.182  21.952 -10.739 1.00 25.56 ? 402  GLU A O   1 
ATOM   1406 C  CB  . GLU A 1 179 ? 11.391  22.880 -13.728 1.00 28.61 ? 402  GLU A CB  1 
ATOM   1407 C  CG  . GLU A 1 179 ? 12.910  23.122 -13.451 1.00 30.75 ? 402  GLU A CG  1 
ATOM   1408 C  CD  . GLU A 1 179 ? 13.841  22.635 -14.552 1.00 37.26 ? 402  GLU A CD  1 
ATOM   1409 O  OE1 . GLU A 1 179 ? 13.464  22.586 -15.725 1.00 38.50 ? 402  GLU A OE1 1 
ATOM   1410 O  OE2 . GLU A 1 179 ? 15.070  22.265 -14.176 1.00 35.18 ? 402  GLU A OE2 1 
ATOM   1411 N  N   . LEU A 1 180 ? 10.603  23.545 -10.633 1.00 25.42 ? 403  LEU A N   1 
ATOM   1412 C  CA  . LEU A 1 180 ? 11.019  23.938 -9.257  1.00 24.75 ? 403  LEU A CA  1 
ATOM   1413 C  C   . LEU A 1 180 ? 10.960  22.793 -8.252  1.00 23.82 ? 403  LEU A C   1 
ATOM   1414 O  O   . LEU A 1 180 ? 11.885  22.586 -7.435  1.00 21.65 ? 403  LEU A O   1 
ATOM   1415 C  CB  . LEU A 1 180 ? 10.183  25.114 -8.707  1.00 24.04 ? 403  LEU A CB  1 
ATOM   1416 C  CG  . LEU A 1 180 ? 10.298  26.497 -9.339  1.00 25.13 ? 403  LEU A CG  1 
ATOM   1417 C  CD1 . LEU A 1 180 ? 9.505   27.456 -8.416  1.00 22.55 ? 403  LEU A CD1 1 
ATOM   1418 C  CD2 . LEU A 1 180 ? 11.732  26.988 -9.520  1.00 20.34 ? 403  LEU A CD2 1 
ATOM   1419 N  N   . ASN A 1 181 ? 9.848   22.059 -8.310  1.00 23.37 ? 404  ASN A N   1 
ATOM   1420 C  CA  . ASN A 1 181 ? 9.602   20.886 -7.473  1.00 24.16 ? 404  ASN A CA  1 
ATOM   1421 C  C   . ASN A 1 181 ? 10.651  19.793 -7.767  1.00 23.96 ? 404  ASN A C   1 
ATOM   1422 O  O   . ASN A 1 181 ? 11.146  19.108 -6.864  1.00 21.85 ? 404  ASN A O   1 
ATOM   1423 C  CB  . ASN A 1 181 ? 8.205   20.359 -7.828  1.00 25.67 ? 404  ASN A CB  1 
ATOM   1424 C  CG  . ASN A 1 181 ? 7.369   19.977 -6.629  1.00 31.46 ? 404  ASN A CG  1 
ATOM   1425 O  OD1 . ASN A 1 181 ? 6.429   19.167 -6.764  1.00 38.16 ? 404  ASN A OD1 1 
ATOM   1426 N  ND2 . ASN A 1 181 ? 7.687   20.522 -5.457  1.00 33.59 ? 404  ASN A ND2 1 
ATOM   1427 N  N   . GLU A 1 182 ? 10.966  19.610 -9.050  1.00 23.61 ? 405  GLU A N   1 
ATOM   1428 C  CA  . GLU A 1 182 ? 11.978  18.617 -9.439  1.00 24.10 ? 405  GLU A CA  1 
ATOM   1429 C  C   . GLU A 1 182 ? 13.398  18.991 -8.983  1.00 23.38 ? 405  GLU A C   1 
ATOM   1430 O  O   . GLU A 1 182 ? 14.193  18.123 -8.620  1.00 22.48 ? 405  GLU A O   1 
ATOM   1431 C  CB  . GLU A 1 182 ? 11.932  18.467 -10.962 1.00 25.44 ? 405  GLU A CB  1 
ATOM   1432 C  CG  . GLU A 1 182 ? 12.854  17.462 -11.545 1.00 30.06 ? 405  GLU A CG  1 
ATOM   1433 C  CD  . GLU A 1 182 ? 12.866  17.561 -13.065 1.00 37.73 ? 405  GLU A CD  1 
ATOM   1434 O  OE1 . GLU A 1 182 ? 13.822  18.160 -13.648 1.00 39.56 ? 405  GLU A OE1 1 
ATOM   1435 O  OE2 . GLU A 1 182 ? 11.892  17.053 -13.674 1.00 41.65 ? 405  GLU A OE2 1 
ATOM   1436 N  N   . LEU A 1 183 ? 13.714  20.292 -9.000  1.00 22.20 ? 406  LEU A N   1 
ATOM   1437 C  CA  . LEU A 1 183 ? 15.027  20.767 -8.527  1.00 21.52 ? 406  LEU A CA  1 
ATOM   1438 C  C   . LEU A 1 183 ? 15.230  20.643 -7.015  1.00 21.04 ? 406  LEU A C   1 
ATOM   1439 O  O   . LEU A 1 183 ? 16.309  20.204 -6.559  1.00 20.01 ? 406  LEU A O   1 
ATOM   1440 C  CB  . LEU A 1 183 ? 15.261  22.221 -8.950  1.00 20.48 ? 406  LEU A CB  1 
ATOM   1441 C  CG  . LEU A 1 183 ? 15.485  22.503 -10.433 1.00 22.20 ? 406  LEU A CG  1 
ATOM   1442 C  CD1 . LEU A 1 183 ? 15.441  24.004 -10.672 1.00 20.18 ? 406  LEU A CD1 1 
ATOM   1443 C  CD2 . LEU A 1 183 ? 16.812  21.882 -10.914 1.00 24.78 ? 406  LEU A CD2 1 
ATOM   1444 N  N   . GLY A 1 184 ? 14.208  21.042 -6.239  1.00 19.88 ? 407  GLY A N   1 
ATOM   1445 C  CA  . GLY A 1 184 ? 14.288  21.025 -4.792  1.00 20.17 ? 407  GLY A CA  1 
ATOM   1446 C  C   . GLY A 1 184 ? 14.485  19.639 -4.204  1.00 21.12 ? 407  GLY A C   1 
ATOM   1447 O  O   . GLY A 1 184 ? 14.102  18.628 -4.824  1.00 20.90 ? 407  GLY A O   1 
ATOM   1448 N  N   . SER A 1 185 ? 15.099  19.597 -3.020  1.00 19.73 ? 408  SER A N   1 
ATOM   1449 C  CA  . SER A 1 185 ? 15.220  18.393 -2.219  1.00 20.06 ? 408  SER A CA  1 
ATOM   1450 C  C   . SER A 1 185 ? 13.819  17.826 -1.933  1.00 20.93 ? 408  SER A C   1 
ATOM   1451 O  O   . SER A 1 185 ? 12.831  18.555 -1.970  1.00 21.11 ? 408  SER A O   1 
ATOM   1452 C  CB  . SER A 1 185 ? 15.962  18.679 -0.902  1.00 19.90 ? 408  SER A CB  1 
ATOM   1453 O  OG  . SER A 1 185 ? 17.313  19.124 -1.129  1.00 17.55 ? 408  SER A OG  1 
ATOM   1454 N  N   . LYS A 1 186 ? 13.768  16.525 -1.647  1.00 22.18 ? 409  LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 186 ? 12.570  15.814 -1.258  1.00 23.42 ? 409  LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 186 ? 12.791  15.253 0.134   1.00 24.14 ? 409  LYS A C   1 
ATOM   1457 O  O   . LYS A 1 186 ? 13.349  14.189 0.293   1.00 24.06 ? 409  LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 186 ? 12.293  14.682 -2.252  1.00 24.10 ? 409  LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 186 ? 12.098  15.130 -3.698  1.00 27.20 ? 409  LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 186 ? 11.021  16.193 -3.752  1.00 32.05 ? 409  LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 186 ? 10.264  16.227 -5.076  1.00 35.98 ? 409  LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 186 ? 9.310   17.383 -4.955  1.00 37.21 ? 409  LYS A NZ  1 
ATOM   1463 N  N   . LYS A 1 187 ? 12.368  16.003 1.156   1.00 25.03 ? 410  LYS A N   1 
ATOM   1464 C  CA  . LYS A 1 187 ? 12.594  15.621 2.539   1.00 25.09 ? 410  LYS A CA  1 
ATOM   1465 C  C   . LYS A 1 187 ? 11.244  15.586 3.211   1.00 26.04 ? 410  LYS A C   1 
ATOM   1466 O  O   . LYS A 1 187 ? 10.431  16.482 3.013   1.00 25.79 ? 410  LYS A O   1 
ATOM   1467 C  CB  . LYS A 1 187 ? 13.536  16.613 3.243   1.00 25.48 ? 410  LYS A CB  1 
ATOM   1468 C  CG  . LYS A 1 187 ? 14.971  16.598 2.684   1.00 23.62 ? 410  LYS A CG  1 
ATOM   1469 C  CD  . LYS A 1 187 ? 15.923  17.420 3.556   1.00 22.35 ? 410  LYS A CD  1 
ATOM   1470 C  CE  . LYS A 1 187 ? 17.392  17.277 3.119   1.00 19.69 ? 410  LYS A CE  1 
ATOM   1471 N  NZ  . LYS A 1 187 ? 18.380  18.044 3.978   1.00 18.07 ? 410  LYS A NZ  1 
ATOM   1472 N  N   . ASP A 1 188 ? 10.997  14.534 3.984   1.00 27.27 ? 411  ASP A N   1 
ATOM   1473 C  CA  . ASP A 1 188 ? 9.718   14.379 4.684   1.00 29.21 ? 411  ASP A CA  1 
ATOM   1474 C  C   . ASP A 1 188 ? 9.460   15.528 5.666   1.00 28.39 ? 411  ASP A C   1 
ATOM   1475 O  O   . ASP A 1 188 ? 10.331  15.872 6.458   1.00 28.48 ? 411  ASP A O   1 
ATOM   1476 C  CB  . ASP A 1 188 ? 9.711   13.051 5.456   1.00 30.75 ? 411  ASP A CB  1 
ATOM   1477 C  CG  . ASP A 1 188 ? 10.104  11.854 4.581   1.00 35.52 ? 411  ASP A CG  1 
ATOM   1478 O  OD1 . ASP A 1 188 ? 9.791   11.874 3.358   1.00 39.65 ? 411  ASP A OD1 1 
ATOM   1479 O  OD2 . ASP A 1 188 ? 10.719  10.899 5.124   1.00 39.37 ? 411  ASP A OD2 1 
ATOM   1480 N  N   . GLY A 1 189 ? 8.264   16.091 5.632   1.00 27.95 ? 412  GLY A N   1 
ATOM   1481 C  CA  . GLY A 1 189 ? 7.880   17.132 6.578   1.00 27.74 ? 412  GLY A CA  1 
ATOM   1482 C  C   . GLY A 1 189 ? 8.396   18.531 6.289   1.00 27.35 ? 412  GLY A C   1 
ATOM   1483 O  O   . GLY A 1 189 ? 8.202   19.424 7.120   1.00 26.99 ? 412  GLY A O   1 
ATOM   1484 N  N   . GLU A 1 190 ? 9.032   18.718 5.119   1.00 26.07 ? 413  GLU A N   1 
ATOM   1485 C  CA  . GLU A 1 190 ? 9.614   20.008 4.667   1.00 25.30 ? 413  GLU A CA  1 
ATOM   1486 C  C   . GLU A 1 190 ? 9.253   20.266 3.207   1.00 24.56 ? 413  GLU A C   1 
ATOM   1487 O  O   . GLU A 1 190 ? 8.988   19.324 2.453   1.00 23.93 ? 413  GLU A O   1 
ATOM   1488 C  CB  . GLU A 1 190 ? 11.153  19.957 4.666   1.00 25.52 ? 413  GLU A CB  1 
ATOM   1489 C  CG  . GLU A 1 190 ? 11.780  19.334 5.810   1.00 26.67 ? 413  GLU A CG  1 
ATOM   1490 C  CD  . GLU A 1 190 ? 13.227  19.650 5.874   1.00 28.01 ? 413  GLU A CD  1 
ATOM   1491 O  OE1 . GLU A 1 190 ? 13.680  20.585 5.167   1.00 26.81 ? 413  GLU A OE1 1 
ATOM   1492 O  OE2 . GLU A 1 190 ? 13.911  18.988 6.659   1.00 28.00 ? 413  GLU A OE2 1 
ATOM   1493 N  N   . ARG A 1 191 ? 9.303   21.535 2.798   1.00 23.50 ? 414  ARG A N   1 
ATOM   1494 C  CA  . ARG A 1 191 ? 9.167   21.932 1.383   1.00 22.48 ? 414  ARG A CA  1 
ATOM   1495 C  C   . ARG A 1 191 ? 10.482  22.562 0.918   1.00 20.75 ? 414  ARG A C   1 
ATOM   1496 O  O   . ARG A 1 191 ? 11.145  23.222 1.716   1.00 19.48 ? 414  ARG A O   1 
ATOM   1497 C  CB  . ARG A 1 191 ? 8.035   22.955 1.228   1.00 23.15 ? 414  ARG A CB  1 
ATOM   1498 C  CG  . ARG A 1 191 ? 6.617   22.337 1.353   1.00 27.06 ? 414  ARG A CG  1 
ATOM   1499 C  CD  . ARG A 1 191 ? 5.556   23.383 1.019   1.00 30.92 ? 414  ARG A CD  1 
ATOM   1500 N  NE  . ARG A 1 191 ? 5.779   24.019 -0.296  1.00 34.49 ? 414  ARG A NE  1 
ATOM   1501 C  CZ  . ARG A 1 191 ? 5.272   25.205 -0.646  1.00 34.85 ? 414  ARG A CZ  1 
ATOM   1502 N  NH1 . ARG A 1 191 ? 4.499   25.877 0.225   1.00 36.68 ? 414  ARG A NH1 1 
ATOM   1503 N  NH2 . ARG A 1 191 ? 5.519   25.727 -1.849  1.00 31.32 ? 414  ARG A NH2 1 
ATOM   1504 N  N   . HIS A 1 192 ? 10.871  22.328 -0.348  1.00 18.77 ? 415  HIS A N   1 
ATOM   1505 C  CA  . HIS A 1 192 ? 12.079  22.919 -0.912  1.00 17.37 ? 415  HIS A CA  1 
ATOM   1506 C  C   . HIS A 1 192 ? 11.831  23.673 -2.196  1.00 17.19 ? 415  HIS A C   1 
ATOM   1507 O  O   . HIS A 1 192 ? 12.755  24.195 -2.771  1.00 16.43 ? 415  HIS A O   1 
ATOM   1508 C  CB  . HIS A 1 192 ? 13.163  21.859 -1.147  1.00 17.12 ? 415  HIS A CB  1 
ATOM   1509 C  CG  . HIS A 1 192 ? 13.871  21.440 0.097   1.00 17.79 ? 415  HIS A CG  1 
ATOM   1510 N  ND1 . HIS A 1 192 ? 13.309  20.572 1.012   1.00 18.09 ? 415  HIS A ND1 1 
ATOM   1511 C  CD2 . HIS A 1 192 ? 15.102  21.759 0.576   1.00 15.44 ? 415  HIS A CD2 1 
ATOM   1512 C  CE1 . HIS A 1 192 ? 14.160  20.372 1.999   1.00 17.44 ? 415  HIS A CE1 1 
ATOM   1513 N  NE2 . HIS A 1 192 ? 15.255  21.090 1.760   1.00 19.45 ? 415  HIS A NE2 1 
ATOM   1514 N  N   . ALA A 1 193 ? 10.567  23.816 -2.598  1.00 18.12 ? 416  ALA A N   1 
ATOM   1515 C  CA  . ALA A 1 193 ? 10.226  24.617 -3.771  1.00 19.74 ? 416  ALA A CA  1 
ATOM   1516 C  C   . ALA A 1 193 ? 9.100   25.579 -3.449  1.00 19.93 ? 416  ALA A C   1 
ATOM   1517 O  O   . ALA A 1 193 ? 8.080   25.137 -2.890  1.00 21.08 ? 416  ALA A O   1 
ATOM   1518 C  CB  . ALA A 1 193 ? 9.774   23.715 -4.921  1.00 20.74 ? 416  ALA A CB  1 
ATOM   1519 N  N   . PHE A 1 194 ? 9.246   26.837 -3.868  1.00 19.59 ? 417  PHE A N   1 
ATOM   1520 C  CA  . PHE A 1 194 ? 8.261   27.902 -3.549  1.00 20.50 ? 417  PHE A CA  1 
ATOM   1521 C  C   . PHE A 1 194 ? 8.036   28.823 -4.714  1.00 21.08 ? 417  PHE A C   1 
ATOM   1522 O  O   . PHE A 1 194 ? 8.961   29.091 -5.457  1.00 21.48 ? 417  PHE A O   1 
ATOM   1523 C  CB  . PHE A 1 194 ? 8.741   28.755 -2.358  1.00 20.62 ? 417  PHE A CB  1 
ATOM   1524 C  CG  . PHE A 1 194 ? 8.989   27.950 -1.102  1.00 21.71 ? 417  PHE A CG  1 
ATOM   1525 C  CD1 . PHE A 1 194 ? 10.263  27.466 -0.831  1.00 21.14 ? 417  PHE A CD1 1 
ATOM   1526 C  CD2 . PHE A 1 194 ? 7.952   27.669 -0.213  1.00 25.18 ? 417  PHE A CD2 1 
ATOM   1527 C  CE1 . PHE A 1 194 ? 10.521  26.693 0.327   1.00 23.08 ? 417  PHE A CE1 1 
ATOM   1528 C  CE2 . PHE A 1 194 ? 8.181   26.915 0.953   1.00 25.64 ? 417  PHE A CE2 1 
ATOM   1529 C  CZ  . PHE A 1 194 ? 9.470   26.410 1.225   1.00 22.97 ? 417  PHE A CZ  1 
ATOM   1530 N  N   . ILE A 1 195 ? 6.808   29.332 -4.851  1.00 22.27 ? 418  ILE A N   1 
ATOM   1531 C  CA  . ILE A 1 195 ? 6.492   30.412 -5.800  1.00 23.39 ? 418  ILE A CA  1 
ATOM   1532 C  C   . ILE A 1 195 ? 5.993   31.603 -4.948  1.00 24.81 ? 418  ILE A C   1 
ATOM   1533 O  O   . ILE A 1 195 ? 5.008   31.462 -4.223  1.00 24.65 ? 418  ILE A O   1 
ATOM   1534 C  CB  . ILE A 1 195 ? 5.415   29.975 -6.822  1.00 23.57 ? 418  ILE A CB  1 
ATOM   1535 C  CG1 . ILE A 1 195 ? 5.983   28.896 -7.765  1.00 24.45 ? 418  ILE A CG1 1 
ATOM   1536 C  CG2 . ILE A 1 195 ? 4.919   31.181 -7.613  1.00 23.37 ? 418  ILE A CG2 1 
ATOM   1537 C  CD1 . ILE A 1 195 ? 4.942   28.076 -8.525  1.00 29.12 ? 418  ILE A CD1 1 
ATOM   1538 N  N   . LEU A 1 196 ? 6.707   32.728 -5.012  1.00 25.41 ? 419  LEU A N   1 
ATOM   1539 C  CA  . LEU A 1 196 ? 6.464   33.861 -4.111  1.00 26.80 ? 419  LEU A CA  1 
ATOM   1540 C  C   . LEU A 1 196 ? 6.347   35.193 -4.866  1.00 27.98 ? 419  LEU A C   1 
ATOM   1541 O  O   . LEU A 1 196 ? 7.135   35.475 -5.770  1.00 27.57 ? 419  LEU A O   1 
ATOM   1542 C  CB  . LEU A 1 196 ? 7.581   33.943 -3.053  1.00 26.47 ? 419  LEU A CB  1 
ATOM   1543 C  CG  . LEU A 1 196 ? 7.881   32.670 -2.225  1.00 25.28 ? 419  LEU A CG  1 
ATOM   1544 C  CD1 . LEU A 1 196 ? 9.152   32.806 -1.425  1.00 23.54 ? 419  LEU A CD1 1 
ATOM   1545 C  CD2 . LEU A 1 196 ? 6.712   32.215 -1.348  1.00 26.67 ? 419  LEU A CD2 1 
ATOM   1546 N  N   . GLN A 1 197 ? 5.374   36.027 -4.480  1.00 29.45 ? 420  GLN A N   1 
ATOM   1547 C  CA  . GLN A 1 197 ? 5.098   37.280 -5.218  1.00 30.85 ? 420  GLN A CA  1 
ATOM   1548 C  C   . GLN A 1 197 ? 6.228   38.301 -5.077  1.00 30.36 ? 420  GLN A C   1 
ATOM   1549 O  O   . GLN A 1 197 ? 6.538   39.004 -6.018  1.00 30.68 ? 420  GLN A O   1 
ATOM   1550 C  CB  . GLN A 1 197 ? 3.741   37.901 -4.782  1.00 32.11 ? 420  GLN A CB  1 
ATOM   1551 C  CG  . GLN A 1 197 ? 2.493   37.146 -5.320  1.00 36.97 ? 420  GLN A CG  1 
ATOM   1552 C  CD  . GLN A 1 197 ? 1.123   37.759 -4.897  1.00 44.80 ? 420  GLN A CD  1 
ATOM   1553 O  OE1 . GLN A 1 197 ? 1.052   38.826 -4.262  1.00 46.86 ? 420  GLN A OE1 1 
ATOM   1554 N  NE2 . GLN A 1 197 ? 0.028   37.060 -5.254  1.00 47.08 ? 420  GLN A NE2 1 
ATOM   1555 N  N   . ASP A 1 198 ? 6.859   38.382 -3.909  1.00 30.15 ? 421  ASP A N   1 
ATOM   1556 C  CA  . ASP A 1 198 ? 7.836   39.440 -3.669  1.00 30.87 ? 421  ASP A CA  1 
ATOM   1557 C  C   . ASP A 1 198 ? 8.845   39.092 -2.588  1.00 30.22 ? 421  ASP A C   1 
ATOM   1558 O  O   . ASP A 1 198 ? 8.718   38.056 -1.951  1.00 29.62 ? 421  ASP A O   1 
ATOM   1559 C  CB  . ASP A 1 198 ? 7.105   40.764 -3.336  1.00 32.51 ? 421  ASP A CB  1 
ATOM   1560 C  CG  . ASP A 1 198 ? 5.980   40.580 -2.321  1.00 35.41 ? 421  ASP A CG  1 
ATOM   1561 O  OD1 . ASP A 1 198 ? 6.075   39.677 -1.453  1.00 35.70 ? 421  ASP A OD1 1 
ATOM   1562 O  OD2 . ASP A 1 198 ? 4.997   41.364 -2.368  1.00 37.81 ? 421  ASP A OD2 1 
ATOM   1563 N  N   . THR A 1 199 ? 9.836   39.964 -2.381  1.00 29.96 ? 422  THR A N   1 
ATOM   1564 C  CA  . THR A 1 199 ? 10.875  39.717 -1.389  1.00 29.80 ? 422  THR A CA  1 
ATOM   1565 C  C   . THR A 1 199 ? 10.270  39.632 0.019   1.00 29.46 ? 422  THR A C   1 
ATOM   1566 O  O   . THR A 1 199 ? 10.753  38.879 0.871   1.00 28.47 ? 422  THR A O   1 
ATOM   1567 C  CB  . THR A 1 199 ? 12.035  40.749 -1.495  1.00 30.14 ? 422  THR A CB  1 
ATOM   1568 O  OG1 . THR A 1 199 ? 12.689  40.594 -2.765  1.00 30.36 ? 422  THR A OG1 1 
ATOM   1569 C  CG2 . THR A 1 199 ? 13.104  40.529 -0.392  1.00 28.55 ? 422  THR A CG2 1 
ATOM   1570 N  N   . LYS A 1 200 ? 9.184   40.382 0.236   1.00 29.12 ? 423  LYS A N   1 
ATOM   1571 C  CA  . LYS A 1 200 ? 8.451   40.370 1.502   1.00 28.97 ? 423  LYS A CA  1 
ATOM   1572 C  C   . LYS A 1 200 ? 7.983   38.956 1.875   1.00 27.14 ? 423  LYS A C   1 
ATOM   1573 O  O   . LYS A 1 200 ? 8.178   38.484 3.006   1.00 26.09 ? 423  LYS A O   1 
ATOM   1574 C  CB  . LYS A 1 200 ? 7.257   41.328 1.377   1.00 30.09 ? 423  LYS A CB  1 
ATOM   1575 C  CG  . LYS A 1 200 ? 6.825   42.011 2.651   1.00 33.99 ? 423  LYS A CG  1 
ATOM   1576 C  CD  . LYS A 1 200 ? 5.489   42.780 2.411   1.00 37.05 ? 423  LYS A CD  1 
ATOM   1577 C  CE  . LYS A 1 200 ? 4.530   42.634 3.621   1.00 39.43 ? 423  LYS A CE  1 
ATOM   1578 N  NZ  . LYS A 1 200 ? 3.171   43.199 3.346   1.00 41.10 ? 423  LYS A NZ  1 
ATOM   1579 N  N   . ALA A 1 201 ? 7.378   38.279 0.901   1.00 25.38 ? 424  ALA A N   1 
ATOM   1580 C  CA  . ALA A 1 201 ? 6.896   36.921 1.070   1.00 23.93 ? 424  ALA A CA  1 
ATOM   1581 C  C   . ALA A 1 201 ? 8.067   35.946 1.258   1.00 22.80 ? 424  ALA A C   1 
ATOM   1582 O  O   . ALA A 1 201 ? 7.950   34.935 1.945   1.00 20.59 ? 424  ALA A O   1 
ATOM   1583 C  CB  . ALA A 1 201 ? 6.107   36.521 -0.127  1.00 24.38 ? 424  ALA A CB  1 
ATOM   1584 N  N   . LEU A 1 202 ? 9.185   36.259 0.607   1.00 22.40 ? 425  LEU A N   1 
ATOM   1585 C  CA  . LEU A 1 202 ? 10.384  35.431 0.714   1.00 22.39 ? 425  LEU A CA  1 
ATOM   1586 C  C   . LEU A 1 202 ? 10.963  35.513 2.115   1.00 22.27 ? 425  LEU A C   1 
ATOM   1587 O  O   . LEU A 1 202 ? 11.400  34.504 2.683   1.00 22.20 ? 425  LEU A O   1 
ATOM   1588 C  CB  . LEU A 1 202 ? 11.418  35.850 -0.341  1.00 22.38 ? 425  LEU A CB  1 
ATOM   1589 C  CG  . LEU A 1 202 ? 12.786  35.160 -0.469  1.00 23.05 ? 425  LEU A CG  1 
ATOM   1590 C  CD1 . LEU A 1 202 ? 13.793  35.842 0.412   1.00 23.28 ? 425  LEU A CD1 1 
ATOM   1591 C  CD2 . LEU A 1 202 ? 12.709  33.649 -0.192  1.00 23.51 ? 425  LEU A CD2 1 
ATOM   1592 N  N   . HIS A 1 203 ? 10.944  36.712 2.679   1.00 23.17 ? 426  HIS A N   1 
ATOM   1593 C  CA  . HIS A 1 203 ? 11.395  36.918 4.050   1.00 23.42 ? 426  HIS A CA  1 
ATOM   1594 C  C   . HIS A 1 203 ? 10.630  35.989 4.995   1.00 23.05 ? 426  HIS A C   1 
ATOM   1595 O  O   . HIS A 1 203 ? 11.234  35.280 5.811   1.00 22.44 ? 426  HIS A O   1 
ATOM   1596 C  CB  . HIS A 1 203 ? 11.226  38.397 4.430   1.00 23.52 ? 426  HIS A CB  1 
ATOM   1597 C  CG  . HIS A 1 203 ? 11.668  38.719 5.825   1.00 28.91 ? 426  HIS A CG  1 
ATOM   1598 N  ND1 . HIS A 1 203 ? 10.821  39.260 6.771   1.00 33.07 ? 426  HIS A ND1 1 
ATOM   1599 C  CD2 . HIS A 1 203 ? 12.866  38.565 6.438   1.00 31.02 ? 426  HIS A CD2 1 
ATOM   1600 C  CE1 . HIS A 1 203 ? 11.487  39.446 7.897   1.00 33.21 ? 426  HIS A CE1 1 
ATOM   1601 N  NE2 . HIS A 1 203 ? 12.726  39.018 7.726   1.00 32.91 ? 426  HIS A NE2 1 
ATOM   1602 N  N   . GLN A 1 204 ? 9.306   35.934 4.835   1.00 21.97 ? 427  GLN A N   1 
ATOM   1603 C  CA  . GLN A 1 204 ? 8.476   35.007 5.624   1.00 21.32 ? 427  GLN A CA  1 
ATOM   1604 C  C   . GLN A 1 204 ? 8.830   33.528 5.428   1.00 20.62 ? 427  GLN A C   1 
ATOM   1605 O  O   . GLN A 1 204 ? 8.978   32.781 6.406   1.00 19.97 ? 427  GLN A O   1 
ATOM   1606 C  CB  . GLN A 1 204 ? 6.987   35.234 5.324   1.00 20.84 ? 427  GLN A CB  1 
ATOM   1607 C  CG  . GLN A 1 204 ? 6.480   36.598 5.792   1.00 25.03 ? 427  GLN A CG  1 
ATOM   1608 C  CD  . GLN A 1 204 ? 6.597   36.768 7.291   1.00 26.87 ? 427  GLN A CD  1 
ATOM   1609 O  OE1 . GLN A 1 204 ? 6.052   35.975 8.061   1.00 29.33 ? 427  GLN A OE1 1 
ATOM   1610 N  NE2 . GLN A 1 204 ? 7.355   37.775 7.717   1.00 29.55 ? 427  GLN A NE2 1 
ATOM   1611 N  N   . VAL A 1 205 ? 8.962   33.102 4.171   1.00 19.16 ? 428  VAL A N   1 
ATOM   1612 C  CA  . VAL A 1 205 ? 9.326   31.710 3.886   1.00 19.12 ? 428  VAL A CA  1 
ATOM   1613 C  C   . VAL A 1 205 ? 10.740  31.355 4.399   1.00 17.65 ? 428  VAL A C   1 
ATOM   1614 O  O   . VAL A 1 205 ? 10.969  30.248 4.924   1.00 17.78 ? 428  VAL A O   1 
ATOM   1615 C  CB  . VAL A 1 205 ? 9.190   31.364 2.385   1.00 18.41 ? 428  VAL A CB  1 
ATOM   1616 C  CG1 . VAL A 1 205 ? 10.026  30.110 2.033   1.00 18.77 ? 428  VAL A CG1 1 
ATOM   1617 C  CG2 . VAL A 1 205 ? 7.737   31.106 2.068   1.00 19.80 ? 428  VAL A CG2 1 
ATOM   1618 N  N   . PHE A 1 206 ? 11.658  32.303 4.285   1.00 16.65 ? 429  PHE A N   1 
ATOM   1619 C  CA  . PHE A 1 206 ? 13.034  32.060 4.701   1.00 15.22 ? 429  PHE A CA  1 
ATOM   1620 C  C   . PHE A 1 206 ? 13.124  31.751 6.187   1.00 14.50 ? 429  PHE A C   1 
ATOM   1621 O  O   . PHE A 1 206 ? 13.918  30.903 6.636   1.00 13.19 ? 429  PHE A O   1 
ATOM   1622 C  CB  . PHE A 1 206 ? 13.924  33.242 4.350   1.00 15.07 ? 429  PHE A CB  1 
ATOM   1623 C  CG  . PHE A 1 206 ? 15.409  32.909 4.370   1.00 14.22 ? 429  PHE A CG  1 
ATOM   1624 C  CD1 . PHE A 1 206 ? 15.926  31.920 3.523   1.00 13.58 ? 429  PHE A CD1 1 
ATOM   1625 C  CD2 . PHE A 1 206 ? 16.275  33.582 5.226   1.00 13.21 ? 429  PHE A CD2 1 
ATOM   1626 C  CE1 . PHE A 1 206 ? 17.336  31.612 3.545   1.00 14.20 ? 429  PHE A CE1 1 
ATOM   1627 C  CE2 . PHE A 1 206 ? 17.644  33.300 5.224   1.00 13.72 ? 429  PHE A CE2 1 
ATOM   1628 C  CZ  . PHE A 1 206 ? 18.161  32.286 4.402   1.00 13.47 ? 429  PHE A CZ  1 
ATOM   1629 N  N   . GLU A 1 207 ? 12.311  32.435 6.975   1.00 13.53 ? 430  GLU A N   1 
ATOM   1630 C  CA  . GLU A 1 207 ? 12.265  32.125 8.419   1.00 15.38 ? 430  GLU A CA  1 
ATOM   1631 C  C   . GLU A 1 207 ? 11.902  30.685 8.654   1.00 15.76 ? 430  GLU A C   1 
ATOM   1632 O  O   . GLU A 1 207 ? 12.340  30.092 9.629   1.00 15.52 ? 430  GLU A O   1 
ATOM   1633 C  CB  . GLU A 1 207 ? 11.261  33.018 9.171   1.00 15.35 ? 430  GLU A CB  1 
ATOM   1634 C  CG  . GLU A 1 207 ? 11.639  34.499 9.174   1.00 17.04 ? 430  GLU A CG  1 
ATOM   1635 C  CD  . GLU A 1 207 ? 12.940  34.747 9.923   1.00 18.27 ? 430  GLU A CD  1 
ATOM   1636 O  OE1 . GLU A 1 207 ? 12.950  34.738 11.185  1.00 16.89 ? 430  GLU A OE1 1 
ATOM   1637 O  OE2 . GLU A 1 207 ? 13.960  34.929 9.219   1.00 19.34 ? 430  GLU A OE2 1 
ATOM   1638 N  N   . HIS A 1 208 ? 11.105  30.124 7.750   1.00 16.43 ? 431  HIS A N   1 
ATOM   1639 C  CA  . HIS A 1 208 ? 10.662  28.740 7.918   1.00 17.82 ? 431  HIS A CA  1 
ATOM   1640 C  C   . HIS A 1 208 ? 11.606  27.766 7.241   1.00 18.15 ? 431  HIS A C   1 
ATOM   1641 O  O   . HIS A 1 208 ? 11.513  26.563 7.469   1.00 19.67 ? 431  HIS A O   1 
ATOM   1642 C  CB  . HIS A 1 208 ? 9.206   28.569 7.437   1.00 18.54 ? 431  HIS A CB  1 
ATOM   1643 C  CG  . HIS A 1 208 ? 8.195   29.196 8.367   1.00 19.16 ? 431  HIS A CG  1 
ATOM   1644 N  ND1 . HIS A 1 208 ? 7.576   28.477 9.367   1.00 20.84 ? 431  HIS A ND1 1 
ATOM   1645 C  CD2 . HIS A 1 208 ? 7.761   30.477 8.497   1.00 20.88 ? 431  HIS A CD2 1 
ATOM   1646 C  CE1 . HIS A 1 208 ? 6.762   29.277 10.044  1.00 22.72 ? 431  HIS A CE1 1 
ATOM   1647 N  NE2 . HIS A 1 208 ? 6.850   30.495 9.535   1.00 18.69 ? 431  HIS A NE2 1 
ATOM   1648 N  N   . MET A 1 209 ? 12.534  28.278 6.438   1.00 17.79 ? 432  MET A N   1 
ATOM   1649 C  CA  . MET A 1 209 ? 13.638  27.453 5.897   1.00 16.97 ? 432  MET A CA  1 
ATOM   1650 C  C   . MET A 1 209 ? 14.775  27.239 6.888   1.00 16.87 ? 432  MET A C   1 
ATOM   1651 O  O   . MET A 1 209 ? 15.514  26.273 6.793   1.00 16.82 ? 432  MET A O   1 
ATOM   1652 C  CB  . MET A 1 209 ? 14.190  28.098 4.627   1.00 16.56 ? 432  MET A CB  1 
ATOM   1653 C  CG  . MET A 1 209 ? 13.206  28.016 3.458   1.00 17.00 ? 432  MET A CG  1 
ATOM   1654 S  SD  . MET A 1 209 ? 13.601  29.058 2.054   1.00 18.46 ? 432  MET A SD  1 
ATOM   1655 C  CE  . MET A 1 209 ? 15.357  28.649 1.787   1.00 19.78 ? 432  MET A CE  1 
ATOM   1656 N  N   . LEU A 1 210 ? 14.909  28.152 7.841   1.00 15.89 ? 433  LEU A N   1 
ATOM   1657 C  CA  . LEU A 1 210 ? 15.949  28.076 8.866   1.00 16.83 ? 433  LEU A CA  1 
ATOM   1658 C  C   . LEU A 1 210 ? 15.509  27.224 10.046  1.00 16.58 ? 433  LEU A C   1 
ATOM   1659 O  O   . LEU A 1 210 ? 14.436  27.446 10.575  1.00 17.57 ? 433  LEU A O   1 
ATOM   1660 C  CB  . LEU A 1 210 ? 16.250  29.479 9.377   1.00 15.47 ? 433  LEU A CB  1 
ATOM   1661 C  CG  . LEU A 1 210 ? 16.696  30.473 8.284   1.00 17.02 ? 433  LEU A CG  1 
ATOM   1662 C  CD1 . LEU A 1 210 ? 16.912  31.869 8.874   1.00 20.37 ? 433  LEU A CD1 1 
ATOM   1663 C  CD2 . LEU A 1 210 ? 17.945  29.983 7.475   1.00 18.63 ? 433  LEU A CD2 1 
ATOM   1664 N  N   . ASP A 1 211 ? 16.363  26.280 10.441  1.00 17.12 ? 434  ASP A N   1 
ATOM   1665 C  CA  . ASP A 1 211 ? 16.202  25.494 11.682  1.00 18.58 ? 434  ASP A CA  1 
ATOM   1666 C  C   . ASP A 1 211 ? 17.179  26.031 12.743  1.00 17.80 ? 434  ASP A C   1 
ATOM   1667 O  O   . ASP A 1 211 ? 18.424  25.828 12.699  1.00 16.89 ? 434  ASP A O   1 
ATOM   1668 C  CB  . ASP A 1 211 ? 16.420  23.989 11.394  1.00 18.76 ? 434  ASP A CB  1 
ATOM   1669 C  CG  . ASP A 1 211 ? 16.329  23.121 12.639  1.00 22.20 ? 434  ASP A CG  1 
ATOM   1670 O  OD1 . ASP A 1 211 ? 16.259  23.653 13.769  1.00 20.37 ? 434  ASP A OD1 1 
ATOM   1671 O  OD2 . ASP A 1 211 ? 16.359  21.867 12.464  1.00 23.10 ? 434  ASP A OD2 1 
ATOM   1672 N  N   . VAL A 1 212 ? 16.606  26.734 13.720  1.00 16.53 ? 435  VAL A N   1 
ATOM   1673 C  CA  . VAL A 1 212 ? 17.440  27.366 14.730  1.00 18.08 ? 435  VAL A CA  1 
ATOM   1674 C  C   . VAL A 1 212 ? 17.332  26.570 16.043  1.00 19.37 ? 435  VAL A C   1 
ATOM   1675 O  O   . VAL A 1 212 ? 17.801  26.994 17.088  1.00 18.76 ? 435  VAL A O   1 
ATOM   1676 C  CB  . VAL A 1 212 ? 17.027  28.862 14.889  1.00 18.25 ? 435  VAL A CB  1 
ATOM   1677 C  CG1 . VAL A 1 212 ? 18.048  29.594 15.697  1.00 19.64 ? 435  VAL A CG1 1 
ATOM   1678 C  CG2 . VAL A 1 212 ? 16.984  29.489 13.499  1.00 17.99 ? 435  VAL A CG2 1 
ATOM   1679 N  N   . SER A 1 213 ? 16.690  25.413 15.959  1.00 21.60 ? 436  SER A N   1 
ATOM   1680 C  CA  . SER A 1 213 ? 16.353  24.619 17.160  1.00 23.92 ? 436  SER A CA  1 
ATOM   1681 C  C   . SER A 1 213 ? 17.559  24.193 18.000  1.00 24.76 ? 436  SER A C   1 
ATOM   1682 O  O   . SER A 1 213 ? 17.425  24.017 19.221  1.00 25.57 ? 436  SER A O   1 
ATOM   1683 C  CB  . SER A 1 213 ? 15.446  23.427 16.811  1.00 24.15 ? 436  SER A CB  1 
ATOM   1684 O  OG  . SER A 1 213 ? 16.217  22.389 16.230  1.00 24.85 ? 436  SER A OG  1 
ATOM   1685 N  N   . LYS A 1 214 ? 18.742  24.094 17.393  1.00 25.32 ? 437  LYS A N   1 
ATOM   1686 C  CA  . LYS A 1 214 ? 19.908  23.642 18.142  1.00 26.48 ? 437  LYS A CA  1 
ATOM   1687 C  C   . LYS A 1 214 ? 20.826  24.786 18.531  1.00 26.48 ? 437  LYS A C   1 
ATOM   1688 O  O   . LYS A 1 214 ? 21.940  24.573 18.990  1.00 26.21 ? 437  LYS A O   1 
ATOM   1689 C  CB  . LYS A 1 214 ? 20.663  22.553 17.377  1.00 28.43 ? 437  LYS A CB  1 
ATOM   1690 C  CG  . LYS A 1 214 ? 19.834  21.313 17.064  1.00 30.39 ? 437  LYS A CG  1 
ATOM   1691 C  CD  . LYS A 1 214 ? 20.765  20.106 16.716  1.00 36.53 ? 437  LYS A CD  1 
ATOM   1692 C  CE  . LYS A 1 214 ? 19.966  18.842 16.360  1.00 38.34 ? 437  LYS A CE  1 
ATOM   1693 N  NZ  . LYS A 1 214 ? 18.803  18.564 17.281  1.00 39.63 ? 437  LYS A NZ  1 
ATOM   1694 N  N   . LEU A 1 215 ? 20.350  26.017 18.347  1.00 25.57 ? 438  LEU A N   1 
ATOM   1695 C  CA  . LEU A 1 215 ? 21.093  27.197 18.805  1.00 25.59 ? 438  LEU A CA  1 
ATOM   1696 C  C   . LEU A 1 215 ? 20.687  27.490 20.259  1.00 24.73 ? 438  LEU A C   1 
ATOM   1697 O  O   . LEU A 1 215 ? 19.666  28.154 20.541  1.00 24.49 ? 438  LEU A O   1 
ATOM   1698 C  CB  . LEU A 1 215 ? 20.805  28.386 17.871  1.00 24.89 ? 438  LEU A CB  1 
ATOM   1699 C  CG  . LEU A 1 215 ? 21.808  29.517 17.898  1.00 26.68 ? 438  LEU A CG  1 
ATOM   1700 C  CD1 . LEU A 1 215 ? 23.130  29.015 17.305  1.00 27.86 ? 438  LEU A CD1 1 
ATOM   1701 C  CD2 . LEU A 1 215 ? 21.256  30.779 17.144  1.00 25.76 ? 438  LEU A CD2 1 
ATOM   1702 N  N   . THR A 1 216 ? 21.482  26.972 21.192  1.00 24.96 ? 439  THR A N   1 
ATOM   1703 C  CA  . THR A 1 216 ? 21.115  26.970 22.608  1.00 24.30 ? 439  THR A CA  1 
ATOM   1704 C  C   . THR A 1 216 ? 22.186  27.638 23.491  1.00 23.91 ? 439  THR A C   1 
ATOM   1705 O  O   . THR A 1 216 ? 22.209  27.435 24.713  1.00 24.25 ? 439  THR A O   1 
ATOM   1706 C  CB  . THR A 1 216 ? 20.904  25.503 23.129  1.00 25.57 ? 439  THR A CB  1 
ATOM   1707 O  OG1 . THR A 1 216 ? 22.085  24.728 22.869  1.00 25.98 ? 439  THR A OG1 1 
ATOM   1708 C  CG2 . THR A 1 216 ? 19.666  24.828 22.460  1.00 26.26 ? 439  THR A CG2 1 
ATOM   1709 N  N   . ASP A 1 217 ? 23.118  28.368 22.890  1.00 21.88 ? 440  ASP A N   1 
ATOM   1710 C  CA  . ASP A 1 217 ? 24.034  29.197 23.675  1.00 21.54 ? 440  ASP A CA  1 
ATOM   1711 C  C   . ASP A 1 217 ? 23.273  30.496 24.040  1.00 20.48 ? 440  ASP A C   1 
ATOM   1712 O  O   . ASP A 1 217 ? 22.087  30.650 23.674  1.00 19.92 ? 440  ASP A O   1 
ATOM   1713 C  CB  . ASP A 1 217 ? 25.292  29.532 22.847  1.00 22.15 ? 440  ASP A CB  1 
ATOM   1714 C  CG  . ASP A 1 217 ? 24.939  30.028 21.450  1.00 24.36 ? 440  ASP A CG  1 
ATOM   1715 O  OD1 . ASP A 1 217 ? 24.859  29.198 20.528  1.00 30.49 ? 440  ASP A OD1 1 
ATOM   1716 O  OD2 . ASP A 1 217 ? 24.671  31.221 21.275  1.00 27.52 ? 440  ASP A OD2 1 
ATOM   1717 N  N   . THR A 1 218 ? 23.941  31.405 24.742  1.00 19.73 ? 441  THR A N   1 
ATOM   1718 C  CA  . THR A 1 218 ? 23.286  32.633 25.243  1.00 19.20 ? 441  THR A CA  1 
ATOM   1719 C  C   . THR A 1 218 ? 23.282  33.843 24.269  1.00 17.92 ? 441  THR A C   1 
ATOM   1720 O  O   . THR A 1 218 ? 23.141  34.994 24.722  1.00 17.25 ? 441  THR A O   1 
ATOM   1721 C  CB  . THR A 1 218 ? 23.904  33.102 26.569  1.00 20.70 ? 441  THR A CB  1 
ATOM   1722 O  OG1 . THR A 1 218 ? 25.296  33.337 26.352  1.00 22.24 ? 441  THR A OG1 1 
ATOM   1723 C  CG2 . THR A 1 218 ? 23.722  32.050 27.701  1.00 20.58 ? 441  THR A CG2 1 
ATOM   1724 N  N   . ILE A 1 219 ? 23.462  33.601 22.968  1.00 15.53 ? 442  ILE A N   1 
ATOM   1725 C  CA  . ILE A 1 219 ? 23.414  34.667 21.965  1.00 14.86 ? 442  ILE A CA  1 
ATOM   1726 C  C   . ILE A 1 219 ? 22.211  35.605 22.206  1.00 14.54 ? 442  ILE A C   1 
ATOM   1727 O  O   . ILE A 1 219 ? 21.072  35.132 22.352  1.00 14.04 ? 442  ILE A O   1 
ATOM   1728 C  CB  . ILE A 1 219 ? 23.455  34.156 20.496  1.00 15.34 ? 442  ILE A CB  1 
ATOM   1729 C  CG1 . ILE A 1 219 ? 23.545  35.386 19.519  1.00 14.29 ? 442  ILE A CG1 1 
ATOM   1730 C  CG2 . ILE A 1 219 ? 22.306  33.169 20.199  1.00 15.04 ? 442  ILE A CG2 1 
ATOM   1731 C  CD1 . ILE A 1 219 ? 23.756  35.058 18.038  1.00 14.47 ? 442  ILE A CD1 1 
ATOM   1732 N  N   . CYS A 1 220 ? 22.451  36.913 22.272  1.00 13.37 ? 443  CYS A N   1 
ATOM   1733 C  CA  . CYS A 1 220 ? 21.349  37.856 22.650  1.00 13.82 ? 443  CYS A CA  1 
ATOM   1734 C  C   . CYS A 1 220 ? 20.583  38.395 21.447  1.00 13.93 ? 443  CYS A C   1 
ATOM   1735 O  O   . CYS A 1 220 ? 21.157  38.534 20.349  1.00 14.51 ? 443  CYS A O   1 
ATOM   1736 C  CB  . CYS A 1 220 ? 21.879  39.055 23.452  1.00 14.52 ? 443  CYS A CB  1 
ATOM   1737 S  SG  . CYS A 1 220 ? 22.966  40.224 22.468  1.00 22.36 ? 443  CYS A SG  1 
ATOM   1738 N  N   . GLY A 1 221 ? 19.308  38.744 21.669  1.00 12.03 ? 444  GLY A N   1 
ATOM   1739 C  CA  . GLY A 1 221 ? 18.518  39.561 20.725  1.00 12.46 ? 444  GLY A CA  1 
ATOM   1740 C  C   . GLY A 1 221 ? 18.244  38.830 19.443  1.00 13.42 ? 444  GLY A C   1 
ATOM   1741 O  O   . GLY A 1 221 ? 18.159  39.444 18.397  1.00 14.10 ? 444  GLY A O   1 
ATOM   1742 N  N   . VAL A 1 222 ? 18.111  37.507 19.536  1.00 13.71 ? 445  VAL A N   1 
ATOM   1743 C  CA  . VAL A 1 222 ? 17.779  36.666 18.392  1.00 14.34 ? 445  VAL A CA  1 
ATOM   1744 C  C   . VAL A 1 222 ? 16.299  36.324 18.528  1.00 14.77 ? 445  VAL A C   1 
ATOM   1745 O  O   . VAL A 1 222 ? 15.835  35.985 19.616  1.00 15.70 ? 445  VAL A O   1 
ATOM   1746 C  CB  . VAL A 1 222 ? 18.675  35.363 18.362  1.00 14.56 ? 445  VAL A CB  1 
ATOM   1747 C  CG1 . VAL A 1 222 ? 18.119  34.264 17.370  1.00 15.30 ? 445  VAL A CG1 1 
ATOM   1748 C  CG2 . VAL A 1 222 ? 20.092  35.771 17.955  1.00 12.58 ? 445  VAL A CG2 1 
ATOM   1749 N  N   . GLY A 1 223 ? 15.555  36.421 17.440  1.00 14.48 ? 446  GLY A N   1 
ATOM   1750 C  CA  . GLY A 1 223 ? 14.171  35.963 17.487  1.00 15.19 ? 446  GLY A CA  1 
ATOM   1751 C  C   . GLY A 1 223 ? 13.709  35.456 16.137  1.00 15.91 ? 446  GLY A C   1 
ATOM   1752 O  O   . GLY A 1 223 ? 14.500  35.343 15.194  1.00 16.14 ? 446  GLY A O   1 
ATOM   1753 N  N   . ASN A 1 224 ? 12.414  35.151 16.077  1.00 14.56 ? 447  ASN A N   1 
ATOM   1754 C  CA  . ASN A 1 224 ? 11.726  34.737 14.867  1.00 15.71 ? 447  ASN A CA  1 
ATOM   1755 C  C   . ASN A 1 224 ? 11.004  35.911 14.187  1.00 16.16 ? 447  ASN A C   1 
ATOM   1756 O  O   . ASN A 1 224 ? 10.321  36.694 14.862  1.00 17.86 ? 447  ASN A O   1 
ATOM   1757 C  CB  . ASN A 1 224 ? 10.706  33.660 15.230  1.00 15.03 ? 447  ASN A CB  1 
ATOM   1758 C  CG  . ASN A 1 224 ? 10.419  32.752 14.079  1.00 15.88 ? 447  ASN A CG  1 
ATOM   1759 O  OD1 . ASN A 1 224 ? 10.046  33.213 12.999  1.00 15.47 ? 447  ASN A OD1 1 
ATOM   1760 N  ND2 . ASN A 1 224 ? 10.649  31.465 14.293  1.00 15.85 ? 447  ASN A ND2 1 
ATOM   1761 N  N   . MET A 1 225 ? 11.155  36.049 12.866  1.00 15.95 ? 448  MET A N   1 
ATOM   1762 C  CA  . MET A 1 225 ? 10.547  37.175 12.148  1.00 16.42 ? 448  MET A CA  1 
ATOM   1763 C  C   . MET A 1 225 ? 9.260   36.782 11.443  1.00 16.74 ? 448  MET A C   1 
ATOM   1764 O  O   . MET A 1 225 ? 8.628   37.630 10.821  1.00 16.58 ? 448  MET A O   1 
ATOM   1765 C  CB  . MET A 1 225 ? 11.515  37.817 11.117  1.00 16.79 ? 448  MET A CB  1 
ATOM   1766 C  CG  . MET A 1 225 ? 12.913  38.181 11.655  1.00 19.98 ? 448  MET A CG  1 
ATOM   1767 S  SD  . MET A 1 225 ? 12.901  39.102 13.210  1.00 25.86 ? 448  MET A SD  1 
ATOM   1768 C  CE  . MET A 1 225 ? 14.665  39.401 13.364  1.00 19.14 ? 448  MET A CE  1 
ATOM   1769 N  N   . SER A 1 226 ? 8.869   35.516 11.564  1.00 16.21 ? 449  SER A N   1 
ATOM   1770 C  CA  . SER A 1 226 ? 7.690   35.021 10.878  1.00 17.89 ? 449  SER A CA  1 
ATOM   1771 C  C   . SER A 1 226 ? 6.392   35.459 11.590  1.00 18.84 ? 449  SER A C   1 
ATOM   1772 O  O   . SER A 1 226 ? 6.254   35.307 12.793  1.00 17.65 ? 449  SER A O   1 
ATOM   1773 C  CB  . SER A 1 226 ? 7.713   33.491 10.758  1.00 17.50 ? 449  SER A CB  1 
ATOM   1774 O  OG  . SER A 1 226 ? 6.499   33.087 10.157  1.00 19.49 ? 449  SER A OG  1 
ATOM   1775 N  N   . ALA A 1 227 ? 5.466   36.017 10.803  1.00 21.17 ? 450  ALA A N   1 
ATOM   1776 C  CA  . ALA A 1 227 ? 4.096   36.298 11.268  1.00 23.04 ? 450  ALA A CA  1 
ATOM   1777 C  C   . ALA A 1 227 ? 3.382   35.004 11.699  1.00 23.46 ? 450  ALA A C   1 
ATOM   1778 O  O   . ALA A 1 227 ? 2.426   35.030 12.483  1.00 23.53 ? 450  ALA A O   1 
ATOM   1779 C  CB  . ALA A 1 227 ? 3.338   37.014 10.173  1.00 23.49 ? 450  ALA A CB  1 
ATOM   1780 N  N   . ASN A 1 228 ? 3.872   33.863 11.225  1.00 23.24 ? 451  ASN A N   1 
ATOM   1781 C  CA  . ASN A 1 228 ? 3.279   32.576 11.564  1.00 24.64 ? 451  ASN A CA  1 
ATOM   1782 C  C   . ASN A 1 228 ? 3.930   31.899 12.785  1.00 23.90 ? 451  ASN A C   1 
ATOM   1783 O  O   . ASN A 1 228 ? 3.454   30.860 13.267  1.00 23.00 ? 451  ASN A O   1 
ATOM   1784 C  CB  . ASN A 1 228 ? 3.329   31.641 10.336  1.00 26.48 ? 451  ASN A CB  1 
ATOM   1785 C  CG  . ASN A 1 228 ? 2.254   31.947 9.301   1.00 30.93 ? 451  ASN A CG  1 
ATOM   1786 O  OD1 . ASN A 1 228 ? 1.483   32.905 9.427   1.00 37.27 ? 451  ASN A OD1 1 
ATOM   1787 N  ND2 . ASN A 1 228 ? 2.186   31.110 8.271   1.00 34.39 ? 451  ASN A ND2 1 
ATOM   1788 N  N   . ALA A 1 229 ? 4.996   32.497 13.319  1.00 21.74 ? 452  ALA A N   1 
ATOM   1789 C  CA  . ALA A 1 229 ? 5.608   31.960 14.529  1.00 20.97 ? 452  ALA A CA  1 
ATOM   1790 C  C   . ALA A 1 229 ? 4.770   32.322 15.785  1.00 20.85 ? 452  ALA A C   1 
ATOM   1791 O  O   . ALA A 1 229 ? 3.952   33.233 15.717  1.00 21.13 ? 452  ALA A O   1 
ATOM   1792 C  CB  . ALA A 1 229 ? 7.042   32.498 14.678  1.00 20.87 ? 452  ALA A CB  1 
ATOM   1793 N  N   . SER A 1 230 ? 4.987   31.648 16.911  1.00 19.86 ? 453  SER A N   1 
ATOM   1794 C  CA  . SER A 1 230 ? 4.303   32.063 18.172  1.00 19.54 ? 453  SER A CA  1 
ATOM   1795 C  C   . SER A 1 230 ? 4.811   33.427 18.664  1.00 19.67 ? 453  SER A C   1 
ATOM   1796 O  O   . SER A 1 230 ? 5.940   33.813 18.363  1.00 17.66 ? 453  SER A O   1 
ATOM   1797 C  CB  . SER A 1 230 ? 4.449   31.020 19.295  1.00 19.66 ? 453  SER A CB  1 
ATOM   1798 O  OG  . SER A 1 230 ? 5.762   30.977 19.880  1.00 17.84 ? 453  SER A OG  1 
ATOM   1799 N  N   . ASP A 1 231 ? 3.990   34.125 19.451  1.00 18.54 ? 454  ASP A N   1 
ATOM   1800 C  CA  . ASP A 1 231 ? 4.431   35.343 20.158  1.00 19.58 ? 454  ASP A CA  1 
ATOM   1801 C  C   . ASP A 1 231 ? 5.766   35.184 20.890  1.00 18.80 ? 454  ASP A C   1 
ATOM   1802 O  O   . ASP A 1 231 ? 6.655   36.015 20.758  1.00 19.28 ? 454  ASP A O   1 
ATOM   1803 C  CB  . ASP A 1 231 ? 3.353   35.795 21.151  1.00 20.27 ? 454  ASP A CB  1 
ATOM   1804 C  CG  . ASP A 1 231 ? 2.113   36.369 20.451  1.00 24.51 ? 454  ASP A CG  1 
ATOM   1805 O  OD1 . ASP A 1 231 ? 1.045   36.431 21.083  1.00 28.06 ? 454  ASP A OD1 1 
ATOM   1806 O  OD2 . ASP A 1 231 ? 2.214   36.785 19.278  1.00 25.56 ? 454  ASP A OD2 1 
ATOM   1807 N  N   . GLN A 1 232 ? 5.918   34.104 21.635  1.00 17.67 ? 455  GLN A N   1 
ATOM   1808 C  CA  . GLN A 1 232 ? 7.144   33.851 22.380  1.00 16.87 ? 455  GLN A CA  1 
ATOM   1809 C  C   . GLN A 1 232 ? 8.346   33.588 21.484  1.00 16.89 ? 455  GLN A C   1 
ATOM   1810 O  O   . GLN A 1 232 ? 9.480   33.918 21.856  1.00 16.08 ? 455  GLN A O   1 
ATOM   1811 C  CB  . GLN A 1 232 ? 6.987   32.675 23.349  1.00 16.55 ? 455  GLN A CB  1 
ATOM   1812 C  CG  . GLN A 1 232 ? 8.114   32.537 24.389  1.00 17.70 ? 455  GLN A CG  1 
ATOM   1813 C  CD  . GLN A 1 232 ? 8.190   33.723 25.356  1.00 16.40 ? 455  GLN A CD  1 
ATOM   1814 O  OE1 . GLN A 1 232 ? 7.192   34.387 25.633  1.00 20.43 ? 455  GLN A OE1 1 
ATOM   1815 N  NE2 . GLN A 1 232 ? 9.383   34.000 25.852  1.00 13.53 ? 455  GLN A NE2 1 
ATOM   1816 N  N   . GLU A 1 233 ? 8.120   32.945 20.337  1.00 15.34 ? 456  GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 233 ? 9.225   32.761 19.366  1.00 14.22 ? 456  GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 233 ? 9.670   34.100 18.804  1.00 14.09 ? 456  GLU A C   1 
ATOM   1819 O  O   . GLU A 1 233 ? 10.848  34.298 18.467  1.00 13.78 ? 456  GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 233 ? 8.756   31.848 18.225  1.00 14.42 ? 456  GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 233 ? 8.678   30.384 18.671  1.00 14.02 ? 456  GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 233 ? 8.020   29.498 17.637  1.00 17.01 ? 456  GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 233 ? 6.998   29.905 17.043  1.00 21.24 ? 456  GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 233 ? 8.551   28.392 17.417  1.00 21.39 ? 456  GLU A OE2 1 
ATOM   1825 N  N   . ARG A 1 234 ? 8.719   35.028 18.692  1.00 14.90 ? 457  ARG A N   1 
ATOM   1826 C  CA  . ARG A 1 234 ? 8.999   36.361 18.143  1.00 15.33 ? 457  ARG A CA  1 
ATOM   1827 C  C   . ARG A 1 234 ? 9.748   37.226 19.149  1.00 15.51 ? 457  ARG A C   1 
ATOM   1828 O  O   . ARG A 1 234 ? 10.585  38.036 18.752  1.00 16.09 ? 457  ARG A O   1 
ATOM   1829 C  CB  . ARG A 1 234 ? 7.707   37.015 17.624  1.00 16.66 ? 457  ARG A CB  1 
ATOM   1830 C  CG  . ARG A 1 234 ? 7.176   36.344 16.350  1.00 17.41 ? 457  ARG A CG  1 
ATOM   1831 C  CD  . ARG A 1 234 ? 5.732   36.809 16.027  1.00 25.69 ? 457  ARG A CD  1 
ATOM   1832 N  NE  . ARG A 1 234 ? 5.685   38.087 15.324  1.00 31.13 ? 457  ARG A NE  1 
ATOM   1833 C  CZ  . ARG A 1 234 ? 5.083   39.166 15.815  1.00 37.26 ? 457  ARG A CZ  1 
ATOM   1834 N  NH1 . ARG A 1 234 ? 4.498   39.109 17.019  1.00 43.96 ? 457  ARG A NH1 1 
ATOM   1835 N  NH2 . ARG A 1 234 ? 5.038   40.298 15.111  1.00 34.51 ? 457  ARG A NH2 1 
ATOM   1836 N  N   . THR A 1 235 ? 9.536   36.992 20.445  1.00 15.30 ? 458  THR A N   1 
ATOM   1837 C  CA  . THR A 1 235 ? 10.154  37.846 21.499  1.00 15.03 ? 458  THR A CA  1 
ATOM   1838 C  C   . THR A 1 235 ? 10.573  36.947 22.676  1.00 14.91 ? 458  THR A C   1 
ATOM   1839 O  O   . THR A 1 235 ? 9.979   37.010 23.755  1.00 15.10 ? 458  THR A O   1 
ATOM   1840 C  CB  . THR A 1 235 ? 9.192   38.968 21.998  1.00 16.81 ? 458  THR A CB  1 
ATOM   1841 O  OG1 . THR A 1 235 ? 8.020   38.358 22.571  1.00 15.04 ? 458  THR A OG1 1 
ATOM   1842 C  CG2 . THR A 1 235 ? 8.766   39.934 20.866  1.00 14.18 ? 458  THR A CG2 1 
ATOM   1843 N  N   . PRO A 1 236 ? 11.601  36.116 22.467  1.00 14.41 ? 459  PRO A N   1 
ATOM   1844 C  CA  . PRO A 1 236 ? 11.910  35.085 23.437  1.00 15.24 ? 459  PRO A CA  1 
ATOM   1845 C  C   . PRO A 1 236 ? 12.523  35.592 24.740  1.00 14.68 ? 459  PRO A C   1 
ATOM   1846 O  O   . PRO A 1 236 ? 12.673  34.782 25.679  1.00 14.68 ? 459  PRO A O   1 
ATOM   1847 C  CB  . PRO A 1 236 ? 12.907  34.165 22.696  1.00 15.55 ? 459  PRO A CB  1 
ATOM   1848 C  CG  . PRO A 1 236 ? 13.519  35.007 21.657  1.00 16.34 ? 459  PRO A CG  1 
ATOM   1849 C  CD  . PRO A 1 236 ? 12.465  36.029 21.268  1.00 15.05 ? 459  PRO A CD  1 
ATOM   1850 N  N   . TRP A 1 237 ? 12.841  36.898 24.808  1.00 12.49 ? 460  TRP A N   1 
ATOM   1851 C  CA  . TRP A 1 237 ? 13.340  37.499 26.071  1.00 12.17 ? 460  TRP A CA  1 
ATOM   1852 C  C   . TRP A 1 237 ? 12.185  37.797 27.062  1.00 13.01 ? 460  TRP A C   1 
ATOM   1853 O  O   . TRP A 1 237 ? 12.437  38.092 28.243  1.00 11.66 ? 460  TRP A O   1 
ATOM   1854 C  CB  . TRP A 1 237 ? 14.134  38.812 25.830  1.00 11.89 ? 460  TRP A CB  1 
ATOM   1855 C  CG  . TRP A 1 237 ? 13.263  39.800 25.101  1.00 11.22 ? 460  TRP A CG  1 
ATOM   1856 C  CD1 . TRP A 1 237 ? 12.310  40.647 25.626  1.00 13.70 ? 460  TRP A CD1 1 
ATOM   1857 C  CD2 . TRP A 1 237 ? 13.187  39.918 23.699  1.00 12.64 ? 460  TRP A CD2 1 
ATOM   1858 N  NE1 . TRP A 1 237 ? 11.660  41.323 24.599  1.00 13.20 ? 460  TRP A NE1 1 
ATOM   1859 C  CE2 . TRP A 1 237 ? 12.179  40.876 23.404  1.00 13.23 ? 460  TRP A CE2 1 
ATOM   1860 C  CE3 . TRP A 1 237 ? 13.893  39.309 22.642  1.00 13.70 ? 460  TRP A CE3 1 
ATOM   1861 C  CZ2 . TRP A 1 237 ? 11.876  41.251 22.092  1.00 13.65 ? 460  TRP A CZ2 1 
ATOM   1862 C  CZ3 . TRP A 1 237 ? 13.554  39.672 21.322  1.00 15.26 ? 460  TRP A CZ3 1 
ATOM   1863 C  CH2 . TRP A 1 237 ? 12.574  40.636 21.076  1.00 12.17 ? 460  TRP A CH2 1 
ATOM   1864 N  N   . HIS A 1 238 ? 10.944  37.674 26.595  1.00 12.22 ? 461  HIS A N   1 
ATOM   1865 C  CA  . HIS A 1 238 ? 9.795   38.225 27.322  1.00 13.57 ? 461  HIS A CA  1 
ATOM   1866 C  C   . HIS A 1 238 ? 9.446   37.298 28.490  1.00 14.03 ? 461  HIS A C   1 
ATOM   1867 O  O   . HIS A 1 238 ? 9.382   36.068 28.296  1.00 14.61 ? 461  HIS A O   1 
ATOM   1868 C  CB  . HIS A 1 238 ? 8.598   38.368 26.390  1.00 14.36 ? 461  HIS A CB  1 
ATOM   1869 C  CG  . HIS A 1 238 ? 7.551   39.289 26.929  1.00 15.42 ? 461  HIS A CG  1 
ATOM   1870 N  ND1 . HIS A 1 238 ? 6.285   38.853 27.275  1.00 18.63 ? 461  HIS A ND1 1 
ATOM   1871 C  CD2 . HIS A 1 238 ? 7.614   40.599 27.264  1.00 9.77  ? 461  HIS A CD2 1 
ATOM   1872 C  CE1 . HIS A 1 238 ? 5.595   39.873 27.758  1.00 15.09 ? 461  HIS A CE1 1 
ATOM   1873 N  NE2 . HIS A 1 238 ? 6.375   40.948 27.758  1.00 18.64 ? 461  HIS A NE2 1 
ATOM   1874 N  N   . VAL A 1 239 ? 9.238   37.871 29.686  1.00 13.90 ? 462  VAL A N   1 
ATOM   1875 C  CA  . VAL A 1 239 ? 8.858   37.052 30.874  1.00 13.94 ? 462  VAL A CA  1 
ATOM   1876 C  C   . VAL A 1 239 ? 7.677   37.745 31.554  1.00 15.22 ? 462  VAL A C   1 
ATOM   1877 O  O   . VAL A 1 239 ? 7.487   38.953 31.410  1.00 13.05 ? 462  VAL A O   1 
ATOM   1878 C  CB  . VAL A 1 239 ? 10.026  36.814 31.872  1.00 14.11 ? 462  VAL A CB  1 
ATOM   1879 C  CG1 . VAL A 1 239 ? 11.252  36.177 31.196  1.00 15.25 ? 462  VAL A CG1 1 
ATOM   1880 C  CG2 . VAL A 1 239 ? 10.431  38.127 32.611  1.00 14.02 ? 462  VAL A CG2 1 
ATOM   1881 N  N   . THR A 1 240 ? 6.873   36.982 32.286  1.00 16.12 ? 463  THR A N   1 
ATOM   1882 C  CA  . THR A 1 240 ? 5.780   37.552 33.071  1.00 16.94 ? 463  THR A CA  1 
ATOM   1883 C  C   . THR A 1 240 ? 6.144   37.402 34.542  1.00 17.90 ? 463  THR A C   1 
ATOM   1884 O  O   . THR A 1 240 ? 6.628   36.342 34.940  1.00 16.84 ? 463  THR A O   1 
ATOM   1885 C  CB  . THR A 1 240 ? 4.448   36.784 32.767  1.00 17.74 ? 463  THR A CB  1 
ATOM   1886 O  OG1 . THR A 1 240 ? 4.130   36.936 31.377  1.00 20.87 ? 463  THR A OG1 1 
ATOM   1887 C  CG2 . THR A 1 240 ? 3.273   37.362 33.547  1.00 20.67 ? 463  THR A CG2 1 
ATOM   1888 N  N   . ILE A 1 241 ? 5.911   38.456 35.332  1.00 19.02 ? 464  ILE A N   1 
ATOM   1889 C  CA  . ILE A 1 241 ? 6.271   38.446 36.736  1.00 22.04 ? 464  ILE A CA  1 
ATOM   1890 C  C   . ILE A 1 241 ? 4.985   38.443 37.580  1.00 23.19 ? 464  ILE A C   1 
ATOM   1891 O  O   . ILE A 1 241 ? 4.083   39.250 37.338  1.00 21.21 ? 464  ILE A O   1 
ATOM   1892 C  CB  . ILE A 1 241 ? 7.145   39.659 37.071  1.00 21.77 ? 464  ILE A CB  1 
ATOM   1893 C  CG1 . ILE A 1 241 ? 8.449   39.572 36.241  1.00 24.93 ? 464  ILE A CG1 1 
ATOM   1894 C  CG2 . ILE A 1 241 ? 7.429   39.723 38.586  1.00 23.54 ? 464  ILE A CG2 1 
ATOM   1895 C  CD1 . ILE A 1 241 ? 9.263   40.796 36.261  1.00 24.84 ? 464  ILE A CD1 1 
ATOM   1896 N  N   . LYS A 1 242 ? 4.936   37.520 38.542  1.00 26.61 ? 465  LYS A N   1 
ATOM   1897 C  CA  . LYS A 1 242 ? 3.772   37.303 39.407  1.00 30.34 ? 465  LYS A CA  1 
ATOM   1898 C  C   . LYS A 1 242 ? 4.261   37.595 40.814  1.00 32.29 ? 465  LYS A C   1 
ATOM   1899 O  O   . LYS A 1 242 ? 4.894   36.725 41.442  1.00 32.93 ? 465  LYS A O   1 
ATOM   1900 C  CB  . LYS A 1 242 ? 3.286   35.853 39.328  1.00 31.40 ? 465  LYS A CB  1 
ATOM   1901 C  CG  . LYS A 1 242 ? 2.837   35.417 37.958  1.00 35.00 ? 465  LYS A CG  1 
ATOM   1902 C  CD  . LYS A 1 242 ? 3.939   34.657 37.214  1.00 39.03 ? 465  LYS A CD  1 
ATOM   1903 C  CE  . LYS A 1 242 ? 3.523   34.294 35.803  1.00 40.69 ? 465  LYS A CE  1 
ATOM   1904 N  NZ  . LYS A 1 242 ? 2.449   33.238 35.679  1.00 41.86 ? 465  LYS A NZ  1 
ATOM   1905 N  N   . PRO A 1 243 ? 4.043   38.831 41.290  1.00 33.36 ? 466  PRO A N   1 
ATOM   1906 C  CA  . PRO A 1 243 ? 4.583   39.227 42.583  1.00 35.11 ? 466  PRO A CA  1 
ATOM   1907 C  C   . PRO A 1 243 ? 3.616   38.923 43.731  1.00 36.50 ? 466  PRO A C   1 
ATOM   1908 O  O   . PRO A 1 243 ? 3.915   38.039 44.559  1.00 37.55 ? 466  PRO A O   1 
ATOM   1909 C  CB  . PRO A 1 243 ? 4.805   40.738 42.420  1.00 35.49 ? 466  PRO A CB  1 
ATOM   1910 C  CG  . PRO A 1 243 ? 4.095   41.115 41.091  1.00 35.11 ? 466  PRO A CG  1 
ATOM   1911 C  CD  . PRO A 1 243 ? 3.300   39.930 40.670  1.00 33.90 ? 466  PRO A CD  1 
ATOM   1912 N  N   . THR A 1 248 ? 0.515   41.948 38.340  1.00 27.88 ? 471  THR A N   1 
ATOM   1913 C  CA  . THR A 1 248 ? 1.256   41.340 37.254  1.00 26.04 ? 471  THR A CA  1 
ATOM   1914 C  C   . THR A 1 248 ? 2.153   42.443 36.610  1.00 24.41 ? 471  THR A C   1 
ATOM   1915 O  O   . THR A 1 248 ? 1.836   43.651 36.573  1.00 24.20 ? 471  THR A O   1 
ATOM   1916 C  CB  . THR A 1 248 ? 0.286   40.610 36.273  1.00 27.86 ? 471  THR A CB  1 
ATOM   1917 O  OG1 . THR A 1 248 ? 0.663   39.224 36.081  1.00 33.59 ? 471  THR A OG1 1 
ATOM   1918 C  CG2 . THR A 1 248 ? 0.130   41.317 34.931  1.00 26.80 ? 471  THR A CG2 1 
ATOM   1919 N  N   . CYS A 1 249 ? 3.324   42.028 36.168  1.00 21.58 ? 472  CYS A N   1 
ATOM   1920 C  CA  . CYS A 1 249 ? 4.207   42.934 35.461  1.00 19.90 ? 472  CYS A CA  1 
ATOM   1921 C  C   . CYS A 1 249 ? 4.867   42.041 34.441  1.00 17.70 ? 472  CYS A C   1 
ATOM   1922 O  O   . CYS A 1 249 ? 4.647   40.803 34.445  1.00 17.52 ? 472  CYS A O   1 
ATOM   1923 C  CB  . CYS A 1 249 ? 5.237   43.527 36.417  1.00 20.36 ? 472  CYS A CB  1 
ATOM   1924 S  SG  . CYS A 1 249 ? 4.785   45.159 37.080  1.00 27.66 ? 472  CYS A SG  1 
ATOM   1925 N  N   . ARG A 1 250 ? 5.652   42.667 33.561  1.00 15.66 ? 473  ARG A N   1 
ATOM   1926 C  CA  . ARG A 1 250 ? 6.486   41.942 32.622  1.00 14.36 ? 473  ARG A CA  1 
ATOM   1927 C  C   . ARG A 1 250 ? 7.976   42.295 32.922  1.00 14.52 ? 473  ARG A C   1 
ATOM   1928 O  O   . ARG A 1 250 ? 8.261   43.191 33.712  1.00 13.94 ? 473  ARG A O   1 
ATOM   1929 C  CB  . ARG A 1 250 ? 6.086   42.328 31.178  1.00 14.35 ? 473  ARG A CB  1 
ATOM   1930 C  CG  . ARG A 1 250 ? 4.573   42.002 30.796  1.00 15.90 ? 473  ARG A CG  1 
ATOM   1931 C  CD  . ARG A 1 250 ? 4.214   40.519 31.056  1.00 17.39 ? 473  ARG A CD  1 
ATOM   1932 N  NE  . ARG A 1 250 ? 2.857   40.142 30.641  1.00 19.79 ? 473  ARG A NE  1 
ATOM   1933 C  CZ  . ARG A 1 250 ? 1.769   40.168 31.405  1.00 23.77 ? 473  ARG A CZ  1 
ATOM   1934 N  NH1 . ARG A 1 250 ? 1.823   40.603 32.664  1.00 23.30 ? 473  ARG A NH1 1 
ATOM   1935 N  NH2 . ARG A 1 250 ? 0.600   39.732 30.910  1.00 20.85 ? 473  ARG A NH2 1 
ATOM   1936 N  N   . GLY A 1 251 ? 8.895   41.584 32.263  1.00 13.77 ? 474  GLY A N   1 
ATOM   1937 C  CA  . GLY A 1 251 ? 10.331  41.759 32.421  1.00 12.97 ? 474  GLY A CA  1 
ATOM   1938 C  C   . GLY A 1 251 ? 11.008  41.211 31.179  1.00 13.21 ? 474  GLY A C   1 
ATOM   1939 O  O   . GLY A 1 251 ? 10.330  40.684 30.261  1.00 13.10 ? 474  GLY A O   1 
ATOM   1940 N  N   . ALA A 1 252 ? 12.337  41.377 31.135  1.00 11.85 ? 475  ALA A N   1 
ATOM   1941 C  CA  . ALA A 1 252 ? 13.151  40.828 30.066  1.00 12.53 ? 475  ALA A CA  1 
ATOM   1942 C  C   . ALA A 1 252 ? 14.319  40.027 30.624  1.00 11.55 ? 475  ALA A C   1 
ATOM   1943 O  O   . ALA A 1 252 ? 15.043  40.495 31.500  1.00 11.59 ? 475  ALA A O   1 
ATOM   1944 C  CB  . ALA A 1 252 ? 13.661  41.962 29.128  1.00 12.84 ? 475  ALA A CB  1 
ATOM   1945 N  N   . LEU A 1 253 ? 14.515  38.840 30.077  1.00 12.23 ? 476  LEU A N   1 
ATOM   1946 C  CA  . LEU A 1 253 ? 15.740  38.061 30.333  1.00 13.75 ? 476  LEU A CA  1 
ATOM   1947 C  C   . LEU A 1 253 ? 16.885  38.811 29.743  1.00 14.61 ? 476  LEU A C   1 
ATOM   1948 O  O   . LEU A 1 253 ? 16.831  39.203 28.579  1.00 14.31 ? 476  LEU A O   1 
ATOM   1949 C  CB  . LEU A 1 253 ? 15.720  36.729 29.573  1.00 15.15 ? 476  LEU A CB  1 
ATOM   1950 C  CG  . LEU A 1 253 ? 14.998  35.529 30.126  1.00 20.83 ? 476  LEU A CG  1 
ATOM   1951 C  CD1 . LEU A 1 253 ? 15.145  34.341 29.119  1.00 19.62 ? 476  LEU A CD1 1 
ATOM   1952 C  CD2 . LEU A 1 253 ? 15.560  35.181 31.524  1.00 19.35 ? 476  LEU A CD2 1 
ATOM   1953 N  N   . ILE A 1 254 ? 17.932  39.010 30.528  1.00 15.96 ? 477  ILE A N   1 
ATOM   1954 C  CA  . ILE A 1 254 ? 19.098  39.723 30.032  1.00 15.86 ? 477  ILE A CA  1 
ATOM   1955 C  C   . ILE A 1 254 ? 20.356  38.841 30.084  1.00 16.07 ? 477  ILE A C   1 
ATOM   1956 O  O   . ILE A 1 254 ? 21.409  39.228 29.564  1.00 14.16 ? 477  ILE A O   1 
ATOM   1957 C  CB  . ILE A 1 254 ? 19.307  41.066 30.749  1.00 16.06 ? 477  ILE A CB  1 
ATOM   1958 C  CG1 . ILE A 1 254 ? 19.462  40.843 32.282  1.00 16.78 ? 477  ILE A CG1 1 
ATOM   1959 C  CG2 . ILE A 1 254 ? 18.155  42.009 30.428  1.00 17.01 ? 477  ILE A CG2 1 
ATOM   1960 C  CD1 . ILE A 1 254 ? 20.037  42.002 33.056  1.00 21.54 ? 477  ILE A CD1 1 
ATOM   1961 N  N   . SER A 1 255 ? 20.221  37.670 30.715  1.00 17.32 ? 478  SER A N   1 
ATOM   1962 C  CA  . SER A 1 255 ? 21.242  36.632 30.728  1.00 18.19 ? 478  SER A CA  1 
ATOM   1963 C  C   . SER A 1 255 ? 20.470  35.327 30.955  1.00 19.89 ? 478  SER A C   1 
ATOM   1964 O  O   . SER A 1 255 ? 19.231  35.310 30.896  1.00 20.05 ? 478  SER A O   1 
ATOM   1965 C  CB  . SER A 1 255 ? 22.305  36.900 31.828  1.00 19.01 ? 478  SER A CB  1 
ATOM   1966 O  OG  . SER A 1 255 ? 21.810  36.700 33.175  1.00 17.35 ? 478  SER A OG  1 
ATOM   1967 N  N   . ASP A 1 256 ? 21.178  34.231 31.216  1.00 20.92 ? 479  ASP A N   1 
ATOM   1968 C  CA  . ASP A 1 256 ? 20.492  32.961 31.465  1.00 21.82 ? 479  ASP A CA  1 
ATOM   1969 C  C   . ASP A 1 256 ? 20.055  32.828 32.942  1.00 21.54 ? 479  ASP A C   1 
ATOM   1970 O  O   . ASP A 1 256 ? 19.524  31.784 33.329  1.00 22.68 ? 479  ASP A O   1 
ATOM   1971 C  CB  . ASP A 1 256 ? 21.364  31.772 31.018  1.00 22.43 ? 479  ASP A CB  1 
ATOM   1972 C  CG  . ASP A 1 256 ? 22.627  31.614 31.863  1.00 27.49 ? 479  ASP A CG  1 
ATOM   1973 O  OD1 . ASP A 1 256 ? 22.816  32.349 32.884  1.00 28.29 ? 479  ASP A OD1 1 
ATOM   1974 O  OD2 . ASP A 1 256 ? 23.434  30.718 31.499  1.00 32.86 ? 479  ASP A OD2 1 
ATOM   1975 N  N   . GLN A 1 257 ? 20.238  33.870 33.755  1.00 19.30 ? 480  GLN A N   1 
ATOM   1976 C  CA  . GLN A 1 257 ? 19.721  33.859 35.149  1.00 19.71 ? 480  GLN A CA  1 
ATOM   1977 C  C   . GLN A 1 257 ? 19.159  35.208 35.641  1.00 18.94 ? 480  GLN A C   1 
ATOM   1978 O  O   . GLN A 1 257 ? 18.596  35.283 36.731  1.00 19.40 ? 480  GLN A O   1 
ATOM   1979 C  CB  . GLN A 1 257 ? 20.760  33.339 36.148  1.00 19.46 ? 480  GLN A CB  1 
ATOM   1980 C  CG  . GLN A 1 257 ? 20.155  32.458 37.280  1.00 20.78 ? 480  GLN A CG  1 
ATOM   1981 C  CD  . GLN A 1 257 ? 21.220  31.908 38.253  1.00 26.25 ? 480  GLN A CD  1 
ATOM   1982 O  OE1 . GLN A 1 257 ? 20.910  31.494 39.381  1.00 28.39 ? 480  GLN A OE1 1 
ATOM   1983 N  NE2 . GLN A 1 257 ? 22.466  31.935 37.834  1.00 26.80 ? 480  GLN A NE2 1 
ATOM   1984 N  N   . TRP A 1 258 ? 19.288  36.272 34.850  1.00 16.48 ? 481  TRP A N   1 
ATOM   1985 C  CA  . TRP A 1 258 ? 18.860  37.581 35.347  1.00 16.12 ? 481  TRP A CA  1 
ATOM   1986 C  C   . TRP A 1 258 ? 17.776  38.214 34.498  1.00 15.17 ? 481  TRP A C   1 
ATOM   1987 O  O   . TRP A 1 258 ? 17.786  38.079 33.288  1.00 15.53 ? 481  TRP A O   1 
ATOM   1988 C  CB  . TRP A 1 258 ? 20.067  38.527 35.424  1.00 16.07 ? 481  TRP A CB  1 
ATOM   1989 C  CG  . TRP A 1 258 ? 21.021  38.237 36.583  1.00 18.53 ? 481  TRP A CG  1 
ATOM   1990 C  CD1 . TRP A 1 258 ? 22.075  37.340 36.608  1.00 20.79 ? 481  TRP A CD1 1 
ATOM   1991 C  CD2 . TRP A 1 258 ? 21.039  38.915 37.849  1.00 19.80 ? 481  TRP A CD2 1 
ATOM   1992 N  NE1 . TRP A 1 258 ? 22.744  37.425 37.852  1.00 21.39 ? 481  TRP A NE1 1 
ATOM   1993 C  CE2 . TRP A 1 258 ? 22.122  38.377 38.616  1.00 21.67 ? 481  TRP A CE2 1 
ATOM   1994 C  CE3 . TRP A 1 258 ? 20.247  39.930 38.415  1.00 17.84 ? 481  TRP A CE3 1 
ATOM   1995 C  CZ2 . TRP A 1 258 ? 22.413  38.826 39.921  1.00 23.45 ? 481  TRP A CZ2 1 
ATOM   1996 C  CZ3 . TRP A 1 258 ? 20.549  40.382 39.712  1.00 22.70 ? 481  TRP A CZ3 1 
ATOM   1997 C  CH2 . TRP A 1 258 ? 21.624  39.824 40.448  1.00 21.41 ? 481  TRP A CH2 1 
ATOM   1998 N  N   . VAL A 1 259 ? 16.841  38.900 35.160  1.00 14.90 ? 482  VAL A N   1 
ATOM   1999 C  CA  . VAL A 1 259 ? 15.663  39.504 34.521  1.00 13.28 ? 482  VAL A CA  1 
ATOM   2000 C  C   . VAL A 1 259 ? 15.651  40.983 34.863  1.00 12.52 ? 482  VAL A C   1 
ATOM   2001 O  O   . VAL A 1 259 ? 15.804  41.348 36.023  1.00 14.69 ? 482  VAL A O   1 
ATOM   2002 C  CB  . VAL A 1 259 ? 14.314  38.811 34.990  1.00 12.62 ? 482  VAL A CB  1 
ATOM   2003 C  CG1 . VAL A 1 259 ? 13.075  39.722 34.688  1.00 12.86 ? 482  VAL A CG1 1 
ATOM   2004 C  CG2 . VAL A 1 259 ? 14.162  37.438 34.318  1.00 12.47 ? 482  VAL A CG2 1 
ATOM   2005 N  N   . LEU A 1 260 ? 15.456  41.834 33.861  1.00 12.10 ? 483  LEU A N   1 
ATOM   2006 C  CA  . LEU A 1 260 ? 15.315  43.251 34.101  1.00 13.77 ? 483  LEU A CA  1 
ATOM   2007 C  C   . LEU A 1 260 ? 13.840  43.662 34.104  1.00 13.64 ? 483  LEU A C   1 
ATOM   2008 O  O   . LEU A 1 260 ? 13.055  43.288 33.207  1.00 13.98 ? 483  LEU A O   1 
ATOM   2009 C  CB  . LEU A 1 260 ? 16.094  44.041 33.028  1.00 13.34 ? 483  LEU A CB  1 
ATOM   2010 C  CG  . LEU A 1 260 ? 16.131  45.563 33.056  1.00 15.15 ? 483  LEU A CG  1 
ATOM   2011 C  CD1 . LEU A 1 260 ? 16.744  46.141 34.368  1.00 10.27 ? 483  LEU A CD1 1 
ATOM   2012 C  CD2 . LEU A 1 260 ? 16.884  46.033 31.793  1.00 12.06 ? 483  LEU A CD2 1 
ATOM   2013 N  N   . THR A 1 261 ? 13.469  44.470 35.085  1.00 14.26 ? 484  THR A N   1 
ATOM   2014 C  CA  . THR A 1 261 ? 12.070  44.882 35.227  1.00 13.75 ? 484  THR A CA  1 
ATOM   2015 C  C   . THR A 1 261 ? 11.959  46.267 35.875  1.00 13.37 ? 484  THR A C   1 
ATOM   2016 O  O   . THR A 1 261 ? 12.961  46.923 36.014  1.00 14.64 ? 484  THR A O   1 
ATOM   2017 C  CB  . THR A 1 261 ? 11.217  43.779 35.963  1.00 13.30 ? 484  THR A CB  1 
ATOM   2018 O  OG1 . THR A 1 261 ? 9.819   44.087 35.826  1.00 15.35 ? 484  THR A OG1 1 
ATOM   2019 C  CG2 . THR A 1 261 ? 11.570  43.674 37.427  1.00 14.45 ? 484  THR A CG2 1 
ATOM   2020 N  N   . ALA A 1 262 ? 10.735  46.712 36.218  1.00 13.44 ? 485  ALA A N   1 
ATOM   2021 C  CA  . ALA A 1 262 ? 10.477  47.991 36.886  1.00 14.45 ? 485  ALA A CA  1 
ATOM   2022 C  C   . ALA A 1 262 ? 10.442  47.773 38.421  1.00 15.26 ? 485  ALA A C   1 
ATOM   2023 O  O   . ALA A 1 262 ? 9.896   46.779 38.890  1.00 16.74 ? 485  ALA A O   1 
ATOM   2024 C  CB  . ALA A 1 262 ? 9.147   48.579 36.417  1.00 12.37 ? 485  ALA A CB  1 
ATOM   2025 N  N   . ALA A 1 263 ? 11.056  48.676 39.180  1.00 16.18 ? 486  ALA A N   1 
ATOM   2026 C  CA  . ALA A 1 263 ? 10.924  48.692 40.659  1.00 16.30 ? 486  ALA A CA  1 
ATOM   2027 C  C   . ALA A 1 263 ? 9.458   48.805 41.160  1.00 18.22 ? 486  ALA A C   1 
ATOM   2028 O  O   . ALA A 1 263 ? 9.098   48.218 42.188  1.00 18.33 ? 486  ALA A O   1 
ATOM   2029 C  CB  . ALA A 1 263 ? 11.753  49.854 41.235  1.00 16.73 ? 486  ALA A CB  1 
ATOM   2030 N  N   . HIS A 1 264 ? 8.604   49.536 40.442  1.00 19.40 ? 487  HIS A N   1 
ATOM   2031 C  CA  . HIS A 1 264 ? 7.243   49.818 40.975  1.00 20.90 ? 487  HIS A CA  1 
ATOM   2032 C  C   . HIS A 1 264 ? 6.365   48.577 41.055  1.00 22.35 ? 487  HIS A C   1 
ATOM   2033 O  O   . HIS A 1 264 ? 5.355   48.562 41.755  1.00 22.29 ? 487  HIS A O   1 
ATOM   2034 C  CB  . HIS A 1 264 ? 6.548   50.957 40.219  1.00 21.52 ? 487  HIS A CB  1 
ATOM   2035 C  CG  . HIS A 1 264 ? 5.965   50.537 38.901  1.00 21.57 ? 487  HIS A CG  1 
ATOM   2036 N  ND1 . HIS A 1 264 ? 6.533   50.878 37.696  1.00 21.70 ? 487  HIS A ND1 1 
ATOM   2037 C  CD2 . HIS A 1 264 ? 4.868   49.796 38.608  1.00 22.10 ? 487  HIS A CD2 1 
ATOM   2038 C  CE1 . HIS A 1 264 ? 5.819   50.362 36.712  1.00 23.53 ? 487  HIS A CE1 1 
ATOM   2039 N  NE2 . HIS A 1 264 ? 4.785   49.727 37.238  1.00 24.82 ? 487  HIS A NE2 1 
ATOM   2040 N  N   . CYS A 1 265 ? 6.796   47.514 40.376  1.00 23.53 ? 488  CYS A N   1 
ATOM   2041 C  CA  . CYS A 1 265 ? 6.095   46.255 40.355  1.00 24.53 ? 488  CYS A CA  1 
ATOM   2042 C  C   . CYS A 1 265 ? 6.122   45.569 41.733  1.00 25.43 ? 488  CYS A C   1 
ATOM   2043 O  O   . CYS A 1 265 ? 5.324   44.662 41.963  1.00 24.73 ? 488  CYS A O   1 
ATOM   2044 C  CB  . CYS A 1 265 ? 6.753   45.328 39.322  1.00 24.93 ? 488  CYS A CB  1 
ATOM   2045 S  SG  . CYS A 1 265 ? 6.553   45.943 37.640  1.00 26.46 ? 488  CYS A SG  1 
ATOM   2046 N  N   . PHE A 1 266 ? 7.018   46.010 42.625  1.00 26.09 ? 489  PHE A N   1 
ATOM   2047 C  CA  . PHE A 1 266 ? 7.244   45.334 43.934  1.00 28.03 ? 489  PHE A CA  1 
ATOM   2048 C  C   . PHE A 1 266 ? 6.875   46.124 45.195  1.00 28.95 ? 489  PHE A C   1 
ATOM   2049 O  O   . PHE A 1 266 ? 6.197   47.153 45.117  1.00 30.43 ? 489  PHE A O   1 
ATOM   2050 C  CB  . PHE A 1 266 ? 8.699   44.871 44.021  1.00 28.36 ? 489  PHE A CB  1 
ATOM   2051 C  CG  . PHE A 1 266 ? 9.105   44.041 42.839  1.00 31.59 ? 489  PHE A CG  1 
ATOM   2052 C  CD1 . PHE A 1 266 ? 9.874   44.605 41.813  1.00 32.63 ? 489  PHE A CD1 1 
ATOM   2053 C  CD2 . PHE A 1 266 ? 8.642   42.726 42.699  1.00 33.29 ? 489  PHE A CD2 1 
ATOM   2054 C  CE1 . PHE A 1 266 ? 10.221  43.850 40.675  1.00 33.48 ? 489  PHE A CE1 1 
ATOM   2055 C  CE2 . PHE A 1 266 ? 8.982   41.958 41.570  1.00 34.36 ? 489  PHE A CE2 1 
ATOM   2056 C  CZ  . PHE A 1 266 ? 9.781   42.530 40.551  1.00 32.58 ? 489  PHE A CZ  1 
ATOM   2057 N  N   . TRP A 1 275 ? 7.154   35.274 45.091  1.00 32.21 ? 498  TRP A N   1 
ATOM   2058 C  CA  . TRP A 1 275 ? 7.108   35.655 43.669  1.00 31.80 ? 498  TRP A CA  1 
ATOM   2059 C  C   . TRP A 1 275 ? 7.398   34.502 42.681  1.00 30.72 ? 498  TRP A C   1 
ATOM   2060 O  O   . TRP A 1 275 ? 8.071   33.508 43.009  1.00 30.52 ? 498  TRP A O   1 
ATOM   2061 C  CB  . TRP A 1 275 ? 8.010   36.874 43.369  1.00 32.17 ? 498  TRP A CB  1 
ATOM   2062 C  CG  . TRP A 1 275 ? 7.896   38.097 44.306  1.00 35.96 ? 498  TRP A CG  1 
ATOM   2063 C  CD1 . TRP A 1 275 ? 6.834   38.430 45.118  1.00 38.52 ? 498  TRP A CD1 1 
ATOM   2064 C  CD2 . TRP A 1 275 ? 8.881   39.135 44.500  1.00 39.00 ? 498  TRP A CD2 1 
ATOM   2065 N  NE1 . TRP A 1 275 ? 7.108   39.594 45.810  1.00 39.92 ? 498  TRP A NE1 1 
ATOM   2066 C  CE2 . TRP A 1 275 ? 8.352   40.048 45.452  1.00 39.93 ? 498  TRP A CE2 1 
ATOM   2067 C  CE3 . TRP A 1 275 ? 10.162  39.379 43.970  1.00 41.19 ? 498  TRP A CE3 1 
ATOM   2068 C  CZ2 . TRP A 1 275 ? 9.063   41.188 45.888  1.00 41.67 ? 498  TRP A CZ2 1 
ATOM   2069 C  CZ3 . TRP A 1 275 ? 10.877  40.531 44.408  1.00 41.62 ? 498  TRP A CZ3 1 
ATOM   2070 C  CH2 . TRP A 1 275 ? 10.319  41.413 45.355  1.00 41.57 ? 498  TRP A CH2 1 
ATOM   2071 N  N   . ARG A 1 276 ? 6.879   34.650 41.460  1.00 29.60 ? 499  ARG A N   1 
ATOM   2072 C  CA  . ARG A 1 276 ? 7.145   33.715 40.371  1.00 28.62 ? 499  ARG A CA  1 
ATOM   2073 C  C   . ARG A 1 276 ? 7.488   34.494 39.103  1.00 26.73 ? 499  ARG A C   1 
ATOM   2074 O  O   . ARG A 1 276 ? 6.931   35.558 38.870  1.00 25.74 ? 499  ARG A O   1 
ATOM   2075 C  CB  . ARG A 1 276 ? 5.928   32.797 40.108  1.00 30.28 ? 499  ARG A CB  1 
ATOM   2076 C  CG  . ARG A 1 276 ? 5.618   31.827 41.255  1.00 32.93 ? 499  ARG A CG  1 
ATOM   2077 C  CD  . ARG A 1 276 ? 6.744   30.849 41.475  1.00 38.87 ? 499  ARG A CD  1 
ATOM   2078 N  NE  . ARG A 1 276 ? 6.416   29.914 42.556  1.00 45.19 ? 499  ARG A NE  1 
ATOM   2079 C  CZ  . ARG A 1 276 ? 6.670   30.119 43.852  1.00 47.83 ? 499  ARG A CZ  1 
ATOM   2080 N  NH1 . ARG A 1 276 ? 7.279   31.231 44.266  1.00 45.78 ? 499  ARG A NH1 1 
ATOM   2081 N  NH2 . ARG A 1 276 ? 6.309   29.192 44.742  1.00 49.43 ? 499  ARG A NH2 1 
ATOM   2082 N  N   . VAL A 1 277 ? 8.419   33.949 38.317  1.00 25.54 ? 500  VAL A N   1 
ATOM   2083 C  CA  . VAL A 1 277 ? 8.687   34.442 36.960  1.00 23.49 ? 500  VAL A CA  1 
ATOM   2084 C  C   . VAL A 1 277 ? 8.369   33.367 35.925  1.00 22.55 ? 500  VAL A C   1 
ATOM   2085 O  O   . VAL A 1 277 ? 8.898   32.273 36.008  1.00 22.77 ? 500  VAL A O   1 
ATOM   2086 C  CB  . VAL A 1 277 ? 10.131  34.906 36.791  1.00 22.89 ? 500  VAL A CB  1 
ATOM   2087 C  CG1 . VAL A 1 277 ? 10.371  35.478 35.323  1.00 21.42 ? 500  VAL A CG1 1 
ATOM   2088 C  CG2 . VAL A 1 277 ? 10.472  35.920 37.860  1.00 23.85 ? 500  VAL A CG2 1 
ATOM   2089 N  N   . ASN A 1 278 ? 7.506   33.688 34.968  1.00 21.02 ? 501  ASN A N   1 
ATOM   2090 C  CA  . ASN A 1 278 ? 7.200   32.764 33.870  1.00 20.85 ? 501  ASN A CA  1 
ATOM   2091 C  C   . ASN A 1 278 ? 8.034   33.074 32.621  1.00 20.93 ? 501  ASN A C   1 
ATOM   2092 O  O   . ASN A 1 278 ? 7.920   34.179 32.074  1.00 19.11 ? 501  ASN A O   1 
ATOM   2093 C  CB  . ASN A 1 278 ? 5.709   32.797 33.553  1.00 22.19 ? 501  ASN A CB  1 
ATOM   2094 C  CG  . ASN A 1 278 ? 5.297   31.746 32.541  1.00 24.46 ? 501  ASN A CG  1 
ATOM   2095 O  OD1 . ASN A 1 278 ? 5.302   31.993 31.331  1.00 27.06 ? 501  ASN A OD1 1 
ATOM   2096 N  ND2 . ASN A 1 278 ? 4.883   30.578 33.028  1.00 27.27 ? 501  ASN A ND2 1 
ATOM   2097 N  N   . VAL A 1 279 ? 8.822   32.090 32.178  1.00 20.31 ? 502  VAL A N   1 
ATOM   2098 C  CA  . VAL A 1 279 ? 9.811   32.221 31.093  1.00 20.56 ? 502  VAL A CA  1 
ATOM   2099 C  C   . VAL A 1 279 ? 9.321   31.396 29.891  1.00 21.35 ? 502  VAL A C   1 
ATOM   2100 O  O   . VAL A 1 279 ? 8.603   30.413 30.068  1.00 20.45 ? 502  VAL A O   1 
ATOM   2101 C  CB  . VAL A 1 279 ? 11.217  31.767 31.629  1.00 21.05 ? 502  VAL A CB  1 
ATOM   2102 C  CG1 . VAL A 1 279 ? 12.301  31.608 30.525  1.00 21.53 ? 502  VAL A CG1 1 
ATOM   2103 C  CG2 . VAL A 1 279 ? 11.715  32.757 32.708  1.00 21.12 ? 502  VAL A CG2 1 
ATOM   2104 N  N   . GLY A 1 280 ? 9.666   31.803 28.661  1.00 20.59 ? 503  GLY A N   1 
ATOM   2105 C  CA  . GLY A 1 280 ? 9.348   30.966 27.499  1.00 19.97 ? 503  GLY A CA  1 
ATOM   2106 C  C   . GLY A 1 280 ? 9.827   29.523 27.642  1.00 19.91 ? 503  GLY A C   1 
ATOM   2107 O  O   . GLY A 1 280 ? 10.841  29.235 28.303  1.00 18.22 ? 503  GLY A O   1 
ATOM   2108 N  N   . ASP A 1 281 ? 9.084   28.612 27.012  1.00 21.24 ? 504  ASP A N   1 
ATOM   2109 C  CA  . ASP A 1 281 ? 9.461   27.222 26.974  1.00 22.72 ? 504  ASP A CA  1 
ATOM   2110 C  C   . ASP A 1 281 ? 8.949   26.599 25.683  1.00 22.80 ? 504  ASP A C   1 
ATOM   2111 O  O   . ASP A 1 281 ? 7.798   26.802 25.319  1.00 23.12 ? 504  ASP A O   1 
ATOM   2112 C  CB  . ASP A 1 281 ? 8.937   26.467 28.186  1.00 23.62 ? 504  ASP A CB  1 
ATOM   2113 C  CG  . ASP A 1 281 ? 9.639   25.137 28.354  1.00 27.45 ? 504  ASP A CG  1 
ATOM   2114 O  OD1 . ASP A 1 281 ? 9.223   24.168 27.685  1.00 30.96 ? 504  ASP A OD1 1 
ATOM   2115 O  OD2 . ASP A 1 281 ? 10.669  25.096 29.078  1.00 34.49 ? 504  ASP A OD2 1 
ATOM   2116 N  N   . PRO A 1 282 ? 9.837   25.896 24.955  1.00 22.80 ? 505  PRO A N   1 
ATOM   2117 C  CA  . PRO A 1 282 ? 9.461   25.388 23.658  1.00 25.01 ? 505  PRO A CA  1 
ATOM   2118 C  C   . PRO A 1 282 ? 8.333   24.359 23.765  1.00 27.05 ? 505  PRO A C   1 
ATOM   2119 O  O   . PRO A 1 282 ? 7.603   24.161 22.812  1.00 27.52 ? 505  PRO A O   1 
ATOM   2120 C  CB  . PRO A 1 282 ? 10.746  24.771 23.127  1.00 24.52 ? 505  PRO A CB  1 
ATOM   2121 C  CG  . PRO A 1 282 ? 11.831  25.333 23.936  1.00 24.33 ? 505  PRO A CG  1 
ATOM   2122 C  CD  . PRO A 1 282 ? 11.229  25.566 25.291  1.00 22.47 ? 505  PRO A CD  1 
ATOM   2123 N  N   . LYS A 1 283 ? 8.139   23.776 24.942  1.00 29.80 ? 506  LYS A N   1 
ATOM   2124 C  CA  . LYS A 1 283 ? 7.147   22.705 25.069  1.00 32.67 ? 506  LYS A CA  1 
ATOM   2125 C  C   . LYS A 1 283 ? 5.699   23.128 25.364  1.00 33.60 ? 506  LYS A C   1 
ATOM   2126 O  O   . LYS A 1 283 ? 4.778   22.347 25.123  1.00 34.86 ? 506  LYS A O   1 
ATOM   2127 C  CB  . LYS A 1 283 ? 7.669   21.572 25.957  1.00 33.56 ? 506  LYS A CB  1 
ATOM   2128 C  CG  . LYS A 1 283 ? 8.896   20.873 25.319  1.00 37.62 ? 506  LYS A CG  1 
ATOM   2129 C  CD  . LYS A 1 283 ? 9.158   19.477 25.868  1.00 43.53 ? 506  LYS A CD  1 
ATOM   2130 C  CE  . LYS A 1 283 ? 10.662  19.172 25.877  1.00 45.83 ? 506  LYS A CE  1 
ATOM   2131 N  NZ  . LYS A 1 283 ? 11.054  18.538 27.174  1.00 48.54 ? 506  LYS A NZ  1 
ATOM   2132 N  N   . SER A 1 284 ? 5.472   24.360 25.817  1.00 32.83 ? 507  SER A N   1 
ATOM   2133 C  CA  . SER A 1 284 ? 4.119   24.871 25.831  1.00 33.35 ? 507  SER A CA  1 
ATOM   2134 C  C   . SER A 1 284 ? 4.017   26.370 25.833  1.00 32.70 ? 507  SER A C   1 
ATOM   2135 O  O   . SER A 1 284 ? 4.851   27.079 26.440  1.00 32.41 ? 507  SER A O   1 
ATOM   2136 C  CB  . SER A 1 284 ? 3.325   24.324 27.027  1.00 33.92 ? 507  SER A CB  1 
ATOM   2137 O  OG  . SER A 1 284 ? 3.573   25.059 28.214  1.00 34.48 ? 507  SER A OG  1 
ATOM   2138 N  N   . GLN A 1 285 ? 2.949   26.838 25.198  1.00 32.59 ? 508  GLN A N   1 
ATOM   2139 C  CA  . GLN A 1 285 ? 2.548   28.239 25.258  1.00 32.05 ? 508  GLN A CA  1 
ATOM   2140 C  C   . GLN A 1 285 ? 2.494   28.795 26.668  1.00 30.70 ? 508  GLN A C   1 
ATOM   2141 O  O   . GLN A 1 285 ? 2.446   30.022 26.856  1.00 29.90 ? 508  GLN A O   1 
ATOM   2142 C  CB  . GLN A 1 285 ? 1.185   28.446 24.573  1.00 33.37 ? 508  GLN A CB  1 
ATOM   2143 C  CG  . GLN A 1 285 ? -0.051  28.022 25.411  1.00 34.61 ? 508  GLN A CG  1 
ATOM   2144 C  CD  . GLN A 1 285 ? -1.348  28.585 24.845  1.00 36.63 ? 508  GLN A CD  1 
ATOM   2145 O  OE1 . GLN A 1 285 ? -2.098  27.874 24.185  1.00 38.60 ? 508  GLN A OE1 1 
ATOM   2146 N  NE2 . GLN A 1 285 ? -1.612  29.871 25.098  1.00 36.19 ? 508  GLN A NE2 1 
ATOM   2147 N  N   . TRP A 1 286 ? 2.486   27.898 27.666  1.00 29.20 ? 509  TRP A N   1 
ATOM   2148 C  CA  . TRP A 1 286 ? 2.245   28.300 29.047  1.00 27.50 ? 509  TRP A CA  1 
ATOM   2149 C  C   . TRP A 1 286 ? 3.518   28.696 29.747  1.00 27.21 ? 509  TRP A C   1 
ATOM   2150 O  O   . TRP A 1 286 ? 3.481   29.228 30.863  1.00 27.37 ? 509  TRP A O   1 
ATOM   2151 C  CB  . TRP A 1 286 ? 1.524   27.174 29.831  1.00 27.24 ? 509  TRP A CB  1 
ATOM   2152 C  CG  . TRP A 1 286 ? 0.271   26.777 29.119  1.00 25.94 ? 509  TRP A CG  1 
ATOM   2153 C  CD1 . TRP A 1 286 ? 0.024   25.601 28.461  1.00 25.04 ? 509  TRP A CD1 1 
ATOM   2154 C  CD2 . TRP A 1 286 ? -0.876  27.599 28.940  1.00 24.14 ? 509  TRP A CD2 1 
ATOM   2155 N  NE1 . TRP A 1 286 ? -1.240  25.635 27.896  1.00 25.50 ? 509  TRP A NE1 1 
ATOM   2156 C  CE2 . TRP A 1 286 ? -1.813  26.851 28.190  1.00 27.29 ? 509  TRP A CE2 1 
ATOM   2157 C  CE3 . TRP A 1 286 ? -1.222  28.887 29.377  1.00 25.65 ? 509  TRP A CE3 1 
ATOM   2158 C  CZ2 . TRP A 1 286 ? -3.057  27.367 27.832  1.00 27.28 ? 509  TRP A CZ2 1 
ATOM   2159 C  CZ3 . TRP A 1 286 ? -2.452  29.392 29.036  1.00 28.77 ? 509  TRP A CZ3 1 
ATOM   2160 C  CH2 . TRP A 1 286 ? -3.364  28.627 28.276  1.00 27.09 ? 509  TRP A CH2 1 
ATOM   2161 N  N   . GLY A 1 287 ? 4.643   28.438 29.087  1.00 27.24 ? 510  GLY A N   1 
ATOM   2162 C  CA  . GLY A 1 287 ? 5.961   28.824 29.606  1.00 25.45 ? 510  GLY A CA  1 
ATOM   2163 C  C   . GLY A 1 287 ? 6.386   27.915 30.732  1.00 25.59 ? 510  GLY A C   1 
ATOM   2164 O  O   . GLY A 1 287 ? 5.808   26.830 30.914  1.00 25.18 ? 510  GLY A O   1 
ATOM   2165 N  N   . LYS A 1 288 ? 7.407   28.344 31.465  1.00 23.59 ? 511  LYS A N   1 
ATOM   2166 C  CA  . LYS A 1 288 ? 7.951   27.589 32.585  1.00 24.07 ? 511  LYS A CA  1 
ATOM   2167 C  C   . LYS A 1 288 ? 8.140   28.523 33.779  1.00 23.86 ? 511  LYS A C   1 
ATOM   2168 O  O   . LYS A 1 288 ? 8.719   29.609 33.635  1.00 22.78 ? 511  LYS A O   1 
ATOM   2169 C  CB  . LYS A 1 288 ? 9.304   26.997 32.209  1.00 23.74 ? 511  LYS A CB  1 
ATOM   2170 C  CG  . LYS A 1 288 ? 9.883   26.097 33.275  1.00 26.07 ? 511  LYS A CG  1 
ATOM   2171 C  CD  . LYS A 1 288 ? 11.235  25.559 32.845  1.00 30.78 ? 511  LYS A CD  1 
ATOM   2172 C  CE  . LYS A 1 288 ? 11.348  24.071 33.142  1.00 36.73 ? 511  LYS A CE  1 
ATOM   2173 N  NZ  . LYS A 1 288 ? 11.634  23.778 34.574  1.00 37.60 ? 511  LYS A NZ  1 
ATOM   2174 N  N   . GLU A 1 289 ? 7.664   28.086 34.954  1.00 23.75 ? 512  GLU A N   1 
ATOM   2175 C  CA  . GLU A 1 289 ? 7.817   28.838 36.197  1.00 24.75 ? 512  GLU A CA  1 
ATOM   2176 C  C   . GLU A 1 289 ? 9.221   28.772 36.780  1.00 23.88 ? 512  GLU A C   1 
ATOM   2177 O  O   . GLU A 1 289 ? 9.802   27.692 36.915  1.00 25.06 ? 512  GLU A O   1 
ATOM   2178 C  CB  . GLU A 1 289 ? 6.809   28.345 37.273  1.00 24.97 ? 512  GLU A CB  1 
ATOM   2179 C  CG  . GLU A 1 289 ? 5.345   28.436 36.840  1.00 29.17 ? 512  GLU A CG  1 
ATOM   2180 C  CD  . GLU A 1 289 ? 4.802   29.866 36.863  1.00 33.75 ? 512  GLU A CD  1 
ATOM   2181 O  OE1 . GLU A 1 289 ? 4.487   30.400 37.962  1.00 35.66 ? 512  GLU A OE1 1 
ATOM   2182 O  OE2 . GLU A 1 289 ? 4.659   30.446 35.773  1.00 37.84 ? 512  GLU A OE2 1 
ATOM   2183 N  N   . PHE A 1 290 ? 9.738   29.931 37.170  1.00 23.84 ? 513  PHE A N   1 
ATOM   2184 C  CA  . PHE A 1 290 ? 11.002  30.038 37.905  1.00 23.47 ? 513  PHE A CA  1 
ATOM   2185 C  C   . PHE A 1 290 ? 10.808  30.779 39.240  1.00 23.71 ? 513  PHE A C   1 
ATOM   2186 O  O   . PHE A 1 290 ? 10.029  31.748 39.340  1.00 23.64 ? 513  PHE A O   1 
ATOM   2187 C  CB  . PHE A 1 290 ? 12.060  30.760 37.042  1.00 22.75 ? 513  PHE A CB  1 
ATOM   2188 C  CG  . PHE A 1 290 ? 12.668  29.903 35.961  1.00 22.33 ? 513  PHE A CG  1 
ATOM   2189 C  CD1 . PHE A 1 290 ? 11.964  29.619 34.803  1.00 21.10 ? 513  PHE A CD1 1 
ATOM   2190 C  CD2 . PHE A 1 290 ? 13.974  29.415 36.082  1.00 21.67 ? 513  PHE A CD2 1 
ATOM   2191 C  CE1 . PHE A 1 290 ? 12.523  28.830 33.786  1.00 19.72 ? 513  PHE A CE1 1 
ATOM   2192 C  CE2 . PHE A 1 290 ? 14.558  28.601 35.064  1.00 22.42 ? 513  PHE A CE2 1 
ATOM   2193 C  CZ  . PHE A 1 290 ? 13.823  28.303 33.917  1.00 22.20 ? 513  PHE A CZ  1 
ATOM   2194 N  N   . LEU A 1 291 ? 11.501  30.330 40.285  1.00 24.28 ? 514  LEU A N   1 
ATOM   2195 C  CA  . LEU A 1 291 ? 11.540  31.122 41.516  1.00 25.20 ? 514  LEU A CA  1 
ATOM   2196 C  C   . LEU A 1 291 ? 12.691  32.127 41.466  1.00 25.50 ? 514  LEU A C   1 
ATOM   2197 O  O   . LEU A 1 291 ? 13.552  32.052 40.590  1.00 25.61 ? 514  LEU A O   1 
ATOM   2198 C  CB  . LEU A 1 291 ? 11.684  30.236 42.747  1.00 26.30 ? 514  LEU A CB  1 
ATOM   2199 C  CG  . LEU A 1 291 ? 10.867  28.947 42.892  1.00 28.96 ? 514  LEU A CG  1 
ATOM   2200 C  CD1 . LEU A 1 291 ? 11.112  28.332 44.270  1.00 32.02 ? 514  LEU A CD1 1 
ATOM   2201 C  CD2 . LEU A 1 291 ? 9.439   29.245 42.714  1.00 31.85 ? 514  LEU A CD2 1 
ATOM   2202 N  N   . ILE A 1 292 ? 12.685  33.057 42.412  1.00 25.75 ? 515  ILE A N   1 
ATOM   2203 C  CA  . ILE A 1 292 ? 13.642  34.140 42.485  1.00 26.43 ? 515  ILE A CA  1 
ATOM   2204 C  C   . ILE A 1 292 ? 14.650  33.890 43.602  1.00 27.31 ? 515  ILE A C   1 
ATOM   2205 O  O   . ILE A 1 292 ? 14.282  33.579 44.751  1.00 27.60 ? 515  ILE A O   1 
ATOM   2206 C  CB  . ILE A 1 292 ? 12.893  35.475 42.699  1.00 26.73 ? 515  ILE A CB  1 
ATOM   2207 C  CG1 . ILE A 1 292 ? 12.157  35.840 41.397  1.00 27.83 ? 515  ILE A CG1 1 
ATOM   2208 C  CG2 . ILE A 1 292 ? 13.843  36.603 43.133  1.00 25.62 ? 515  ILE A CG2 1 
ATOM   2209 C  CD1 . ILE A 1 292 ? 10.982  36.718 41.577  1.00 30.20 ? 515  ILE A CD1 1 
ATOM   2210 N  N   . GLU A 1 293 ? 15.927  34.014 43.275  1.00 26.68 ? 516  GLU A N   1 
ATOM   2211 C  CA  . GLU A 1 293 ? 16.967  33.893 44.286  1.00 27.35 ? 516  GLU A CA  1 
ATOM   2212 C  C   . GLU A 1 293 ? 17.168  35.211 45.035  1.00 27.10 ? 516  GLU A C   1 
ATOM   2213 O  O   . GLU A 1 293 ? 17.330  35.238 46.264  1.00 26.43 ? 516  GLU A O   1 
ATOM   2214 C  CB  . GLU A 1 293 ? 18.269  33.402 43.659  1.00 27.30 ? 516  GLU A CB  1 
ATOM   2215 C  CG  . GLU A 1 293 ? 19.481  33.605 44.532  1.00 29.35 ? 516  GLU A CG  1 
ATOM   2216 C  CD  . GLU A 1 293 ? 20.742  33.014 43.963  1.00 31.25 ? 516  GLU A CD  1 
ATOM   2217 O  OE1 . GLU A 1 293 ? 21.805  33.670 44.111  1.00 31.59 ? 516  GLU A OE1 1 
ATOM   2218 O  OE2 . GLU A 1 293 ? 20.678  31.898 43.388  1.00 34.55 ? 516  GLU A OE2 1 
ATOM   2219 N  N   . LYS A 1 294 ? 17.127  36.312 44.292  1.00 25.52 ? 517  LYS A N   1 
ATOM   2220 C  CA  . LYS A 1 294 ? 17.563  37.599 44.795  1.00 25.41 ? 517  LYS A CA  1 
ATOM   2221 C  C   . LYS A 1 294 ? 16.774  38.638 43.964  1.00 24.51 ? 517  LYS A C   1 
ATOM   2222 O  O   . LYS A 1 294 ? 16.610  38.445 42.775  1.00 21.48 ? 517  LYS A O   1 
ATOM   2223 C  CB  . LYS A 1 294 ? 19.077  37.724 44.487  1.00 25.92 ? 517  LYS A CB  1 
ATOM   2224 C  CG  . LYS A 1 294 ? 19.808  38.884 45.111  1.00 29.08 ? 517  LYS A CG  1 
ATOM   2225 C  CD  . LYS A 1 294 ? 21.314  38.683 45.009  1.00 34.65 ? 517  LYS A CD  1 
ATOM   2226 C  CE  . LYS A 1 294 ? 22.030  39.895 45.584  1.00 38.74 ? 517  LYS A CE  1 
ATOM   2227 N  NZ  . LYS A 1 294 ? 23.497  39.670 45.745  1.00 41.84 ? 517  LYS A NZ  1 
ATOM   2228 N  N   . ALA A 1 295 ? 16.245  39.685 44.595  1.00 24.50 ? 518  ALA A N   1 
ATOM   2229 C  CA  . ALA A 1 295 ? 15.760  40.849 43.847  1.00 24.42 ? 518  ALA A CA  1 
ATOM   2230 C  C   . ALA A 1 295 ? 16.610  42.027 44.252  1.00 24.70 ? 518  ALA A C   1 
ATOM   2231 O  O   . ALA A 1 295 ? 16.887  42.223 45.460  1.00 24.34 ? 518  ALA A O   1 
ATOM   2232 C  CB  . ALA A 1 295 ? 14.362  41.145 44.155  1.00 23.90 ? 518  ALA A CB  1 
ATOM   2233 N  N   . VAL A 1 296 ? 16.982  42.827 43.254  1.00 22.67 ? 519  VAL A N   1 
ATOM   2234 C  CA  . VAL A 1 296 ? 17.748  44.038 43.461  1.00 22.00 ? 519  VAL A CA  1 
ATOM   2235 C  C   . VAL A 1 296 ? 16.911  45.225 42.943  1.00 22.03 ? 519  VAL A C   1 
ATOM   2236 O  O   . VAL A 1 296 ? 16.764  45.436 41.727  1.00 19.76 ? 519  VAL A O   1 
ATOM   2237 C  CB  . VAL A 1 296 ? 19.092  44.010 42.715  1.00 22.38 ? 519  VAL A CB  1 
ATOM   2238 C  CG1 . VAL A 1 296 ? 19.968  45.196 43.165  1.00 24.11 ? 519  VAL A CG1 1 
ATOM   2239 C  CG2 . VAL A 1 296 ? 19.813  42.661 42.886  1.00 23.45 ? 519  VAL A CG2 1 
ATOM   2240 N  N   . ILE A 1 297 ? 16.359  45.977 43.871  1.00 20.61 ? 520  ILE A N   1 
ATOM   2241 C  CA  . ILE A 1 297 ? 15.476  47.072 43.527  1.00 22.16 ? 520  ILE A CA  1 
ATOM   2242 C  C   . ILE A 1 297 ? 16.240  48.387 43.707  1.00 21.42 ? 520  ILE A C   1 
ATOM   2243 O  O   . ILE A 1 297 ? 16.917  48.563 44.717  1.00 21.88 ? 520  ILE A O   1 
ATOM   2244 C  CB  . ILE A 1 297 ? 14.179  46.985 44.401  1.00 22.35 ? 520  ILE A CB  1 
ATOM   2245 C  CG1 . ILE A 1 297 ? 13.369  45.722 44.007  1.00 22.74 ? 520  ILE A CG1 1 
ATOM   2246 C  CG2 . ILE A 1 297 ? 13.334  48.254 44.219  1.00 23.23 ? 520  ILE A CG2 1 
ATOM   2247 C  CD1 . ILE A 1 297 ? 12.523  45.123 45.075  1.00 28.50 ? 520  ILE A CD1 1 
ATOM   2248 N  N   . SER A 1 298 ? 16.167  49.310 42.747  1.00 20.26 ? 521  SER A N   1 
ATOM   2249 C  CA  . SER A 1 298 ? 16.933  50.540 42.874  1.00 20.77 ? 521  SER A CA  1 
ATOM   2250 C  C   . SER A 1 298 ? 16.519  51.263 44.168  1.00 21.53 ? 521  SER A C   1 
ATOM   2251 O  O   . SER A 1 298 ? 15.325  51.434 44.420  1.00 20.39 ? 521  SER A O   1 
ATOM   2252 C  CB  . SER A 1 298 ? 16.735  51.480 41.712  1.00 20.19 ? 521  SER A CB  1 
ATOM   2253 O  OG  . SER A 1 298 ? 17.441  52.689 41.953  1.00 21.45 ? 521  SER A OG  1 
ATOM   2254 N  N   . PRO A 1 299 ? 17.511  51.624 45.001  1.00 22.86 ? 522  PRO A N   1 
ATOM   2255 C  CA  . PRO A 1 299 ? 17.152  52.314 46.235  1.00 23.80 ? 522  PRO A CA  1 
ATOM   2256 C  C   . PRO A 1 299 ? 16.643  53.735 45.994  1.00 23.83 ? 522  PRO A C   1 
ATOM   2257 O  O   . PRO A 1 299 ? 16.048  54.310 46.897  1.00 24.83 ? 522  PRO A O   1 
ATOM   2258 C  CB  . PRO A 1 299 ? 18.458  52.298 47.047  1.00 23.94 ? 522  PRO A CB  1 
ATOM   2259 C  CG  . PRO A 1 299 ? 19.524  52.287 46.042  1.00 24.42 ? 522  PRO A CG  1 
ATOM   2260 C  CD  . PRO A 1 299 ? 18.967  51.390 44.917  1.00 23.37 ? 522  PRO A CD  1 
ATOM   2261 N  N   . GLY A 1 300 ? 16.862  54.315 44.814  1.00 23.84 ? 523  GLY A N   1 
ATOM   2262 C  CA  . GLY A 1 300 ? 16.285  55.627 44.493  1.00 23.87 ? 523  GLY A CA  1 
ATOM   2263 C  C   . GLY A 1 300 ? 14.767  55.660 44.331  1.00 23.30 ? 523  GLY A C   1 
ATOM   2264 O  O   . GLY A 1 300 ? 14.124  56.736 44.466  1.00 24.50 ? 523  GLY A O   1 
ATOM   2265 N  N   . PHE A 1 301 ? 14.169  54.502 44.068  1.00 22.53 ? 524  PHE A N   1 
ATOM   2266 C  CA  . PHE A 1 301 ? 12.744  54.444 43.742  1.00 21.92 ? 524  PHE A CA  1 
ATOM   2267 C  C   . PHE A 1 301 ? 11.838  54.649 44.943  1.00 22.80 ? 524  PHE A C   1 
ATOM   2268 O  O   . PHE A 1 301 ? 11.946  53.919 45.941  1.00 22.14 ? 524  PHE A O   1 
ATOM   2269 C  CB  . PHE A 1 301 ? 12.356  53.133 43.046  1.00 21.52 ? 524  PHE A CB  1 
ATOM   2270 C  CG  . PHE A 1 301 ? 10.913  53.114 42.630  1.00 20.45 ? 524  PHE A CG  1 
ATOM   2271 C  CD1 . PHE A 1 301 ? 9.959   52.407 43.361  1.00 21.33 ? 524  PHE A CD1 1 
ATOM   2272 C  CD2 . PHE A 1 301 ? 10.497  53.858 41.540  1.00 18.78 ? 524  PHE A CD2 1 
ATOM   2273 C  CE1 . PHE A 1 301 ? 8.618   52.441 42.983  1.00 18.24 ? 524  PHE A CE1 1 
ATOM   2274 C  CE2 . PHE A 1 301 ? 9.149   53.892 41.154  1.00 18.08 ? 524  PHE A CE2 1 
ATOM   2275 C  CZ  . PHE A 1 301 ? 8.232   53.200 41.870  1.00 18.29 ? 524  PHE A CZ  1 
ATOM   2276 N  N   . ASP A 1 302 ? 10.921  55.609 44.819  1.00 22.81 ? 525  ASP A N   1 
ATOM   2277 C  CA  . ASP A 1 302 ? 9.935   55.926 45.870  1.00 22.90 ? 525  ASP A CA  1 
ATOM   2278 C  C   . ASP A 1 302 ? 8.803   56.669 45.192  1.00 21.70 ? 525  ASP A C   1 
ATOM   2279 O  O   . ASP A 1 302 ? 8.893   57.869 44.920  1.00 22.22 ? 525  ASP A O   1 
ATOM   2280 C  CB  . ASP A 1 302 ? 10.557  56.766 46.987  1.00 22.80 ? 525  ASP A CB  1 
ATOM   2281 C  CG  . ASP A 1 302 ? 9.535   57.227 48.062  1.00 26.08 ? 525  ASP A CG  1 
ATOM   2282 O  OD1 . ASP A 1 302 ? 8.322   56.873 47.998  1.00 29.26 ? 525  ASP A OD1 1 
ATOM   2283 O  OD2 . ASP A 1 302 ? 9.979   57.984 48.962  1.00 27.69 ? 525  ASP A OD2 1 
ATOM   2284 N  N   . VAL A 1 303 ? 7.740   55.939 44.910  1.00 21.85 ? 526  VAL A N   1 
ATOM   2285 C  CA  . VAL A 1 303 ? 6.690   56.463 44.051  1.00 21.84 ? 526  VAL A CA  1 
ATOM   2286 C  C   . VAL A 1 303 ? 5.981   57.662 44.685  1.00 22.34 ? 526  VAL A C   1 
ATOM   2287 O  O   . VAL A 1 303 ? 5.495   58.528 43.970  1.00 22.09 ? 526  VAL A O   1 
ATOM   2288 C  CB  . VAL A 1 303 ? 5.681   55.368 43.596  1.00 21.04 ? 526  VAL A CB  1 
ATOM   2289 C  CG1 . VAL A 1 303 ? 4.770   54.917 44.734  1.00 23.12 ? 526  VAL A CG1 1 
ATOM   2290 C  CG2 . VAL A 1 303 ? 4.865   55.836 42.379  1.00 22.63 ? 526  VAL A CG2 1 
ATOM   2291 N  N   . PHE A 1 304 ? 5.957   57.701 46.017  1.00 23.20 ? 527  PHE A N   1 
ATOM   2292 C  CA  . PHE A 1 304 ? 5.380   58.832 46.765  1.00 24.98 ? 527  PHE A CA  1 
ATOM   2293 C  C   . PHE A 1 304 ? 6.419   59.859 47.215  1.00 25.74 ? 527  PHE A C   1 
ATOM   2294 O  O   . PHE A 1 304 ? 6.126   60.703 48.052  1.00 26.92 ? 527  PHE A O   1 
ATOM   2295 C  CB  . PHE A 1 304 ? 4.535   58.335 47.958  1.00 24.92 ? 527  PHE A CB  1 
ATOM   2296 C  CG  . PHE A 1 304 ? 3.472   57.345 47.573  1.00 27.45 ? 527  PHE A CG  1 
ATOM   2297 C  CD1 . PHE A 1 304 ? 3.408   56.088 48.185  1.00 29.11 ? 527  PHE A CD1 1 
ATOM   2298 C  CD2 . PHE A 1 304 ? 2.568   57.640 46.562  1.00 25.92 ? 527  PHE A CD2 1 
ATOM   2299 C  CE1 . PHE A 1 304 ? 2.428   55.156 47.789  1.00 31.29 ? 527  PHE A CE1 1 
ATOM   2300 C  CE2 . PHE A 1 304 ? 1.594   56.709 46.155  1.00 27.62 ? 527  PHE A CE2 1 
ATOM   2301 C  CZ  . PHE A 1 304 ? 1.520   55.481 46.765  1.00 30.03 ? 527  PHE A CZ  1 
ATOM   2302 N  N   . ALA A 1 305 ? 7.610   59.841 46.627  1.00 25.97 ? 528  ALA A N   1 
ATOM   2303 C  CA  . ALA A 1 305 ? 8.665   60.785 46.995  1.00 26.43 ? 528  ALA A CA  1 
ATOM   2304 C  C   . ALA A 1 305 ? 8.237   62.270 46.960  1.00 27.37 ? 528  ALA A C   1 
ATOM   2305 O  O   . ALA A 1 305 ? 8.759   63.109 47.714  1.00 27.09 ? 528  ALA A O   1 
ATOM   2306 C  CB  . ALA A 1 305 ? 9.873   60.588 46.113  1.00 27.57 ? 528  ALA A CB  1 
ATOM   2307 N  N   . LYS A 1 306 ? 7.326   62.603 46.053  1.00 26.39 ? 529  LYS A N   1 
ATOM   2308 C  CA  . LYS A 1 306 ? 6.973   63.998 45.836  1.00 26.03 ? 529  LYS A CA  1 
ATOM   2309 C  C   . LYS A 1 306 ? 5.531   64.297 46.243  1.00 26.06 ? 529  LYS A C   1 
ATOM   2310 O  O   . LYS A 1 306 ? 5.057   65.407 46.020  1.00 26.41 ? 529  LYS A O   1 
ATOM   2311 C  CB  . LYS A 1 306 ? 7.267   64.393 44.376  1.00 25.54 ? 529  LYS A CB  1 
ATOM   2312 C  CG  . LYS A 1 306 ? 8.776   64.362 44.054  1.00 26.16 ? 529  LYS A CG  1 
ATOM   2313 C  CD  . LYS A 1 306 ? 9.124   65.079 42.755  1.00 24.88 ? 529  LYS A CD  1 
ATOM   2314 C  CE  . LYS A 1 306 ? 10.602  64.947 42.464  1.00 27.15 ? 529  LYS A CE  1 
ATOM   2315 N  NZ  . LYS A 1 306 ? 10.893  65.414 41.083  1.00 27.81 ? 529  LYS A NZ  1 
ATOM   2316 N  N   . LYS A 1 307 ? 4.866   63.319 46.870  1.00 26.73 ? 530  LYS A N   1 
ATOM   2317 C  CA  . LYS A 1 307 ? 3.418   63.347 47.091  1.00 27.53 ? 530  LYS A CA  1 
ATOM   2318 C  C   . LYS A 1 307 ? 3.016   64.589 47.916  1.00 28.75 ? 530  LYS A C   1 
ATOM   2319 O  O   . LYS A 1 307 ? 2.042   65.282 47.592  1.00 27.55 ? 530  LYS A O   1 
ATOM   2320 C  CB  . LYS A 1 307 ? 2.950   62.058 47.799  1.00 27.80 ? 530  LYS A CB  1 
ATOM   2321 C  CG  . LYS A 1 307 ? 1.421   61.932 47.939  1.00 29.12 ? 530  LYS A CG  1 
ATOM   2322 C  CD  . LYS A 1 307 ? 0.974   60.562 48.477  1.00 33.07 ? 530  LYS A CD  1 
ATOM   2323 C  CE  . LYS A 1 307 ? -0.536  60.323 48.327  1.00 37.61 ? 530  LYS A CE  1 
ATOM   2324 N  NZ  . LYS A 1 307 ? -0.894  58.853 48.121  1.00 38.94 ? 530  LYS A NZ  1 
ATOM   2325 N  N   . ASN A 1 308 ? 3.811   64.875 48.945  1.00 29.55 ? 531  ASN A N   1 
ATOM   2326 C  CA  . ASN A 1 308 ? 3.477   65.940 49.892  1.00 31.19 ? 531  ASN A CA  1 
ATOM   2327 C  C   . ASN A 1 308 ? 3.566   67.288 49.217  1.00 30.96 ? 531  ASN A C   1 
ATOM   2328 O  O   . ASN A 1 308 ? 2.915   68.231 49.647  1.00 31.69 ? 531  ASN A O   1 
ATOM   2329 C  CB  . ASN A 1 308 ? 4.347   65.854 51.148  1.00 31.65 ? 531  ASN A CB  1 
ATOM   2330 C  CG  . ASN A 1 308 ? 3.952   64.683 52.038  1.00 35.45 ? 531  ASN A CG  1 
ATOM   2331 O  OD1 . ASN A 1 308 ? 2.851   64.118 51.907  1.00 39.27 ? 531  ASN A OD1 1 
ATOM   2332 N  ND2 . ASN A 1 308 ? 4.842   64.313 52.958  1.00 39.82 ? 531  ASN A ND2 1 
ATOM   2333 N  N   . GLN A 1 309 ? 4.328   67.360 48.129  1.00 29.91 ? 532  GLN A N   1 
ATOM   2334 C  CA  . GLN A 1 309 ? 4.412   68.583 47.329  1.00 29.10 ? 532  GLN A CA  1 
ATOM   2335 C  C   . GLN A 1 309 ? 3.621   68.630 45.995  1.00 28.10 ? 532  GLN A C   1 
ATOM   2336 O  O   . GLN A 1 309 ? 3.900   69.453 45.104  1.00 28.09 ? 532  GLN A O   1 
ATOM   2337 C  CB  . GLN A 1 309 ? 5.874   68.974 47.134  1.00 29.45 ? 532  GLN A CB  1 
ATOM   2338 C  CG  . GLN A 1 309 ? 6.490   69.482 48.434  1.00 31.41 ? 532  GLN A CG  1 
ATOM   2339 C  CD  . GLN A 1 309 ? 7.823   70.139 48.221  1.00 35.15 ? 532  GLN A CD  1 
ATOM   2340 O  OE1 . GLN A 1 309 ? 7.929   71.376 48.182  1.00 38.96 ? 532  GLN A OE1 1 
ATOM   2341 N  NE2 . GLN A 1 309 ? 8.855   69.324 48.060  1.00 34.85 ? 532  GLN A NE2 1 
ATOM   2342 N  N   . GLY A 1 310 ? 2.643   67.750 45.867  1.00 26.97 ? 533  GLY A N   1 
ATOM   2343 C  CA  . GLY A 1 310 ? 1.675   67.829 44.784  1.00 25.45 ? 533  GLY A CA  1 
ATOM   2344 C  C   . GLY A 1 310 ? 2.061   67.161 43.488  1.00 24.51 ? 533  GLY A C   1 
ATOM   2345 O  O   . GLY A 1 310 ? 1.611   67.574 42.423  1.00 24.49 ? 533  GLY A O   1 
ATOM   2346 N  N   . ILE A 1 311 ? 2.952   66.174 43.577  1.00 23.30 ? 534  ILE A N   1 
ATOM   2347 C  CA  . ILE A 1 311 ? 3.215   65.258 42.449  1.00 21.88 ? 534  ILE A CA  1 
ATOM   2348 C  C   . ILE A 1 311 ? 2.974   63.884 43.050  1.00 20.61 ? 534  ILE A C   1 
ATOM   2349 O  O   . ILE A 1 311 ? 3.819   63.344 43.727  1.00 21.14 ? 534  ILE A O   1 
ATOM   2350 C  CB  . ILE A 1 311 ? 4.648   65.444 41.851  1.00 22.32 ? 534  ILE A CB  1 
ATOM   2351 C  CG1 . ILE A 1 311 ? 4.715   66.805 41.117  1.00 24.92 ? 534  ILE A CG1 1 
ATOM   2352 C  CG2 . ILE A 1 311 ? 4.987   64.281 40.875  1.00 20.42 ? 534  ILE A CG2 1 
ATOM   2353 C  CD1 . ILE A 1 311 ? 6.121   67.274 40.729  1.00 27.77 ? 534  ILE A CD1 1 
ATOM   2354 N  N   . LEU A 1 312 ? 1.797   63.338 42.794  1.00 19.49 ? 535  LEU A N   1 
ATOM   2355 C  CA  . LEU A 1 312 ? 1.251   62.289 43.620  1.00 19.86 ? 535  LEU A CA  1 
ATOM   2356 C  C   . LEU A 1 312 ? 1.910   60.937 43.369  1.00 19.66 ? 535  LEU A C   1 
ATOM   2357 O  O   . LEU A 1 312 ? 1.870   60.073 44.236  1.00 19.77 ? 535  LEU A O   1 
ATOM   2358 C  CB  . LEU A 1 312 ? -0.263  62.204 43.379  1.00 20.52 ? 535  LEU A CB  1 
ATOM   2359 C  CG  . LEU A 1 312 ? -1.167  63.233 44.111  1.00 23.39 ? 535  LEU A CG  1 
ATOM   2360 C  CD1 . LEU A 1 312 ? -0.488  64.510 44.334  1.00 26.59 ? 535  LEU A CD1 1 
ATOM   2361 C  CD2 . LEU A 1 312 ? -2.534  63.465 43.490  1.00 22.66 ? 535  LEU A CD2 1 
ATOM   2362 N  N   . GLU A 1 313 ? 2.492   60.779 42.177  1.00 19.05 ? 536  GLU A N   1 
ATOM   2363 C  CA  . GLU A 1 313 ? 3.254   59.589 41.786  1.00 18.45 ? 536  GLU A CA  1 
ATOM   2364 C  C   . GLU A 1 313 ? 4.487   60.054 41.022  1.00 17.83 ? 536  GLU A C   1 
ATOM   2365 O  O   . GLU A 1 313 ? 4.356   60.867 40.136  1.00 17.38 ? 536  GLU A O   1 
ATOM   2366 C  CB  . GLU A 1 313 ? 2.407   58.712 40.859  1.00 19.41 ? 536  GLU A CB  1 
ATOM   2367 C  CG  . GLU A 1 313 ? 1.420   57.782 41.573  1.00 22.04 ? 536  GLU A CG  1 
ATOM   2368 C  CD  . GLU A 1 313 ? 0.534   57.014 40.596  1.00 27.60 ? 536  GLU A CD  1 
ATOM   2369 O  OE1 . GLU A 1 313 ? 0.899   56.889 39.392  1.00 27.10 ? 536  GLU A OE1 1 
ATOM   2370 O  OE2 . GLU A 1 313 ? -0.545  56.542 41.038  1.00 27.87 ? 536  GLU A OE2 1 
ATOM   2371 N  N   . PHE A 1 314 ? 5.665   59.515 41.359  1.00 17.46 ? 537  PHE A N   1 
ATOM   2372 C  CA  . PHE A 1 314 ? 6.967   59.894 40.739  1.00 17.62 ? 537  PHE A CA  1 
ATOM   2373 C  C   . PHE A 1 314 ? 7.830   58.645 40.509  1.00 16.64 ? 537  PHE A C   1 
ATOM   2374 O  O   . PHE A 1 314 ? 8.088   57.875 41.431  1.00 16.19 ? 537  PHE A O   1 
ATOM   2375 C  CB  . PHE A 1 314 ? 7.724   60.912 41.585  1.00 18.04 ? 537  PHE A CB  1 
ATOM   2376 C  CG  . PHE A 1 314 ? 9.082   61.276 41.031  1.00 18.67 ? 537  PHE A CG  1 
ATOM   2377 C  CD1 . PHE A 1 314 ? 9.197   62.084 39.901  1.00 19.98 ? 537  PHE A CD1 1 
ATOM   2378 C  CD2 . PHE A 1 314 ? 10.252  60.783 41.638  1.00 20.55 ? 537  PHE A CD2 1 
ATOM   2379 C  CE1 . PHE A 1 314 ? 10.452  62.420 39.370  1.00 20.79 ? 537  PHE A CE1 1 
ATOM   2380 C  CE2 . PHE A 1 314 ? 11.530  61.105 41.115  1.00 20.82 ? 537  PHE A CE2 1 
ATOM   2381 C  CZ  . PHE A 1 314 ? 11.630  61.923 39.985  1.00 21.05 ? 537  PHE A CZ  1 
ATOM   2382 N  N   . TYR A 1 315 ? 8.271   58.463 39.265  1.00 15.72 ? 538  TYR A N   1 
ATOM   2383 C  CA  . TYR A 1 315 ? 8.827   57.178 38.850  1.00 16.14 ? 538  TYR A CA  1 
ATOM   2384 C  C   . TYR A 1 315 ? 10.318  57.220 38.592  1.00 15.73 ? 538  TYR A C   1 
ATOM   2385 O  O   . TYR A 1 315 ? 10.826  56.365 37.898  1.00 16.65 ? 538  TYR A O   1 
ATOM   2386 C  CB  . TYR A 1 315 ? 8.063   56.658 37.612  1.00 14.11 ? 538  TYR A CB  1 
ATOM   2387 C  CG  . TYR A 1 315 ? 6.678   56.199 37.946  1.00 15.19 ? 538  TYR A CG  1 
ATOM   2388 C  CD1 . TYR A 1 315 ? 6.460   54.892 38.431  1.00 14.36 ? 538  TYR A CD1 1 
ATOM   2389 C  CD2 . TYR A 1 315 ? 5.589   57.084 37.872  1.00 14.85 ? 538  TYR A CD2 1 
ATOM   2390 C  CE1 . TYR A 1 315 ? 5.208   54.463 38.798  1.00 17.45 ? 538  TYR A CE1 1 
ATOM   2391 C  CE2 . TYR A 1 315 ? 4.274   56.648 38.235  1.00 15.95 ? 538  TYR A CE2 1 
ATOM   2392 C  CZ  . TYR A 1 315 ? 4.110   55.333 38.668  1.00 17.40 ? 538  TYR A CZ  1 
ATOM   2393 O  OH  . TYR A 1 315 ? 2.877   54.843 39.032  1.00 20.97 ? 538  TYR A OH  1 
ATOM   2394 N  N   . GLY A 1 316 ? 11.026  58.217 39.143  1.00 17.11 ? 539  GLY A N   1 
ATOM   2395 C  CA  . GLY A 1 316 ? 12.486  58.263 39.018  1.00 17.21 ? 539  GLY A CA  1 
ATOM   2396 C  C   . GLY A 1 316 ? 13.085  56.974 39.567  1.00 16.62 ? 539  GLY A C   1 
ATOM   2397 O  O   . GLY A 1 316 ? 12.519  56.383 40.490  1.00 16.67 ? 539  GLY A O   1 
ATOM   2398 N  N   . ASP A 1 317 ? 14.160  56.500 38.936  1.00 16.11 ? 540  ASP A N   1 
ATOM   2399 C  CA  . ASP A 1 317 ? 14.846  55.239 39.327  1.00 16.30 ? 540  ASP A CA  1 
ATOM   2400 C  C   . ASP A 1 317 ? 13.943  53.978 39.358  1.00 15.32 ? 540  ASP A C   1 
ATOM   2401 O  O   . ASP A 1 317 ? 14.156  53.075 40.163  1.00 15.34 ? 540  ASP A O   1 
ATOM   2402 C  CB  . ASP A 1 317 ? 15.576  55.401 40.663  1.00 17.76 ? 540  ASP A CB  1 
ATOM   2403 C  CG  . ASP A 1 317 ? 16.612  56.484 40.625  1.00 20.35 ? 540  ASP A CG  1 
ATOM   2404 O  OD1 . ASP A 1 317 ? 16.616  57.294 41.561  1.00 22.29 ? 540  ASP A OD1 1 
ATOM   2405 O  OD2 . ASP A 1 317 ? 17.418  56.523 39.685  1.00 20.78 ? 540  ASP A OD2 1 
ATOM   2406 N  N   . ASP A 1 318 ? 12.948  53.920 38.472  1.00 13.70 ? 541  ASP A N   1 
ATOM   2407 C  CA  . ASP A 1 318 ? 11.997  52.818 38.424  1.00 13.58 ? 541  ASP A CA  1 
ATOM   2408 C  C   . ASP A 1 318 ? 12.629  51.600 37.719  1.00 13.99 ? 541  ASP A C   1 
ATOM   2409 O  O   . ASP A 1 318 ? 12.283  51.263 36.567  1.00 15.23 ? 541  ASP A O   1 
ATOM   2410 C  CB  . ASP A 1 318 ? 10.732  53.273 37.703  1.00 13.49 ? 541  ASP A CB  1 
ATOM   2411 C  CG  . ASP A 1 318 ? 9.615   52.254 37.770  1.00 13.74 ? 541  ASP A CG  1 
ATOM   2412 O  OD1 . ASP A 1 318 ? 9.728   51.257 38.515  1.00 14.11 ? 541  ASP A OD1 1 
ATOM   2413 O  OD2 . ASP A 1 318 ? 8.610   52.461 37.058  1.00 14.45 ? 541  ASP A OD2 1 
ATOM   2414 N  N   . ILE A 1 319 ? 13.523  50.915 38.424  1.00 13.91 ? 542  ILE A N   1 
ATOM   2415 C  CA  . ILE A 1 319 ? 14.306  49.806 37.796  1.00 13.33 ? 542  ILE A CA  1 
ATOM   2416 C  C   . ILE A 1 319 ? 14.642  48.779 38.864  1.00 14.13 ? 542  ILE A C   1 
ATOM   2417 O  O   . ILE A 1 319 ? 14.863  49.140 40.046  1.00 13.38 ? 542  ILE A O   1 
ATOM   2418 C  CB  . ILE A 1 319 ? 15.549  50.348 37.024  1.00 13.40 ? 542  ILE A CB  1 
ATOM   2419 C  CG1 . ILE A 1 319 ? 16.121  49.312 36.047  1.00 14.93 ? 542  ILE A CG1 1 
ATOM   2420 C  CG2 . ILE A 1 319 ? 16.649  50.882 38.017  1.00 14.81 ? 542  ILE A CG2 1 
ATOM   2421 C  CD1 . ILE A 1 319 ? 17.126  49.878 35.069  1.00 15.94 ? 542  ILE A CD1 1 
ATOM   2422 N  N   . ALA A 1 320 ? 14.641  47.500 38.444  1.00 14.13 ? 543  ALA A N   1 
ATOM   2423 C  CA  . ALA A 1 320 ? 14.865  46.347 39.339  1.00 15.23 ? 543  ALA A CA  1 
ATOM   2424 C  C   . ALA A 1 320 ? 15.450  45.196 38.569  1.00 15.27 ? 543  ALA A C   1 
ATOM   2425 O  O   . ALA A 1 320 ? 15.128  45.006 37.386  1.00 15.29 ? 543  ALA A O   1 
ATOM   2426 C  CB  . ALA A 1 320 ? 13.529  45.875 39.942  1.00 14.78 ? 543  ALA A CB  1 
ATOM   2427 N  N   . LEU A 1 321 ? 16.255  44.389 39.256  1.00 14.99 ? 544  LEU A N   1 
ATOM   2428 C  CA  . LEU A 1 321 ? 16.787  43.177 38.691  1.00 15.27 ? 544  LEU A CA  1 
ATOM   2429 C  C   . LEU A 1 321 ? 16.375  42.010 39.572  1.00 16.39 ? 544  LEU A C   1 
ATOM   2430 O  O   . LEU A 1 321 ? 16.385  42.124 40.816  1.00 15.74 ? 544  LEU A O   1 
ATOM   2431 C  CB  . LEU A 1 321 ? 18.309  43.238 38.606  1.00 15.09 ? 544  LEU A CB  1 
ATOM   2432 C  CG  . LEU A 1 321 ? 18.903  44.143 37.528  1.00 14.12 ? 544  LEU A CG  1 
ATOM   2433 C  CD1 . LEU A 1 321 ? 20.372  44.459 37.936  1.00 18.61 ? 544  LEU A CD1 1 
ATOM   2434 C  CD2 . LEU A 1 321 ? 18.910  43.374 36.201  1.00 13.06 ? 544  LEU A CD2 1 
ATOM   2435 N  N   . LEU A 1 322 ? 16.021  40.917 38.911  1.00 15.88 ? 545  LEU A N   1 
ATOM   2436 C  CA  . LEU A 1 322 ? 15.695  39.639 39.553  1.00 18.10 ? 545  LEU A CA  1 
ATOM   2437 C  C   . LEU A 1 322 ? 16.703  38.583 39.147  1.00 17.92 ? 545  LEU A C   1 
ATOM   2438 O  O   . LEU A 1 322 ? 16.908  38.350 37.944  1.00 18.20 ? 545  LEU A O   1 
ATOM   2439 C  CB  . LEU A 1 322 ? 14.305  39.161 39.118  1.00 17.46 ? 545  LEU A CB  1 
ATOM   2440 C  CG  . LEU A 1 322 ? 13.026  39.643 39.808  1.00 22.96 ? 545  LEU A CG  1 
ATOM   2441 C  CD1 . LEU A 1 322 ? 13.125  40.989 40.571  1.00 24.91 ? 545  LEU A CD1 1 
ATOM   2442 C  CD2 . LEU A 1 322 ? 11.821  39.581 38.846  1.00 21.36 ? 545  LEU A CD2 1 
ATOM   2443 N  N   . LYS A 1 323 ? 17.336  37.928 40.130  1.00 18.15 ? 546  LYS A N   1 
ATOM   2444 C  CA  . LYS A 1 323 ? 18.133  36.729 39.827  1.00 18.57 ? 546  LYS A CA  1 
ATOM   2445 C  C   . LYS A 1 323 ? 17.283  35.489 40.043  1.00 19.46 ? 546  LYS A C   1 
ATOM   2446 O  O   . LYS A 1 323 ? 16.716  35.286 41.148  1.00 19.85 ? 546  LYS A O   1 
ATOM   2447 C  CB  . LYS A 1 323 ? 19.392  36.658 40.678  1.00 19.29 ? 546  LYS A CB  1 
ATOM   2448 C  CG  . LYS A 1 323 ? 20.347  35.532 40.269  1.00 19.37 ? 546  LYS A CG  1 
ATOM   2449 C  CD  . LYS A 1 323 ? 21.597  35.639 41.184  1.00 22.45 ? 546  LYS A CD  1 
ATOM   2450 C  CE  . LYS A 1 323 ? 22.538  34.468 40.957  1.00 27.55 ? 546  LYS A CE  1 
ATOM   2451 N  NZ  . LYS A 1 323 ? 23.527  34.437 42.064  1.00 29.67 ? 546  LYS A NZ  1 
ATOM   2452 N  N   . LEU A 1 324 ? 17.166  34.664 39.003  1.00 19.53 ? 547  LEU A N   1 
ATOM   2453 C  CA  . LEU A 1 324 ? 16.331  33.458 39.093  1.00 21.19 ? 547  LEU A CA  1 
ATOM   2454 C  C   . LEU A 1 324 ? 17.080  32.404 39.895  1.00 21.38 ? 547  LEU A C   1 
ATOM   2455 O  O   . LEU A 1 324 ? 18.300  32.427 39.964  1.00 21.31 ? 547  LEU A O   1 
ATOM   2456 C  CB  . LEU A 1 324 ? 15.931  32.942 37.704  1.00 20.61 ? 547  LEU A CB  1 
ATOM   2457 C  CG  . LEU A 1 324 ? 15.170  33.947 36.817  1.00 20.26 ? 547  LEU A CG  1 
ATOM   2458 C  CD1 . LEU A 1 324 ? 14.817  33.318 35.475  1.00 22.16 ? 547  LEU A CD1 1 
ATOM   2459 C  CD2 . LEU A 1 324 ? 13.920  34.506 37.499  1.00 20.18 ? 547  LEU A CD2 1 
ATOM   2460 N  N   . ALA A 1 325 ? 16.327  31.508 40.531  1.00 23.38 ? 548  ALA A N   1 
ATOM   2461 C  CA  . ALA A 1 325 ? 16.913  30.501 41.402  1.00 24.58 ? 548  ALA A CA  1 
ATOM   2462 C  C   . ALA A 1 325 ? 17.662  29.404 40.653  1.00 25.66 ? 548  ALA A C   1 
ATOM   2463 O  O   . ALA A 1 325 ? 18.556  28.795 41.219  1.00 26.71 ? 548  ALA A O   1 
ATOM   2464 C  CB  . ALA A 1 325 ? 15.834  29.910 42.329  1.00 25.55 ? 548  ALA A CB  1 
ATOM   2465 N  N   . GLN A 1 326 ? 17.312  29.146 39.390  1.00 25.81 ? 549  GLN A N   1 
ATOM   2466 C  CA  . GLN A 1 326 ? 18.133  28.280 38.536  1.00 26.40 ? 549  GLN A CA  1 
ATOM   2467 C  C   . GLN A 1 326 ? 18.340  28.996 37.209  1.00 25.61 ? 549  GLN A C   1 
ATOM   2468 O  O   . GLN A 1 326 ? 17.564  29.887 36.876  1.00 24.59 ? 549  GLN A O   1 
ATOM   2469 C  CB  . GLN A 1 326 ? 17.449  26.926 38.279  1.00 27.78 ? 549  GLN A CB  1 
ATOM   2470 C  CG  . GLN A 1 326 ? 17.341  25.958 39.540  1.00 33.92 ? 549  GLN A CG  1 
ATOM   2471 C  CD  . GLN A 1 326 ? 18.702  25.499 40.129  1.00 40.73 ? 549  GLN A CD  1 
ATOM   2472 O  OE1 . GLN A 1 326 ? 19.616  25.051 39.405  1.00 45.66 ? 549  GLN A OE1 1 
ATOM   2473 N  NE2 . GLN A 1 326 ? 18.820  25.586 41.462  1.00 43.34 ? 549  GLN A NE2 1 
ATOM   2474 N  N   . LYS A 1 327 ? 19.366  28.584 36.463  1.00 24.74 ? 550  LYS A N   1 
ATOM   2475 C  CA  . LYS A 1 327 ? 19.625  29.081 35.092  1.00 24.68 ? 550  LYS A CA  1 
ATOM   2476 C  C   . LYS A 1 327 ? 18.555  28.611 34.127  1.00 23.63 ? 550  LYS A C   1 
ATOM   2477 O  O   . LYS A 1 327 ? 18.054  27.493 34.230  1.00 23.07 ? 550  LYS A O   1 
ATOM   2478 C  CB  . LYS A 1 327 ? 21.015  28.673 34.581  1.00 25.64 ? 550  LYS A CB  1 
ATOM   2479 C  CG  . LYS A 1 327 ? 22.139  29.047 35.543  1.00 28.20 ? 550  LYS A CG  1 
ATOM   2480 C  CD  . LYS A 1 327 ? 23.487  28.862 34.890  1.00 34.56 ? 550  LYS A CD  1 
ATOM   2481 C  CE  . LYS A 1 327 ? 24.526  29.753 35.548  1.00 37.05 ? 550  LYS A CE  1 
ATOM   2482 N  NZ  . LYS A 1 327 ? 24.141  31.218 35.437  1.00 38.67 ? 550  LYS A NZ  1 
ATOM   2483 N  N   . VAL A 1 328 ? 18.182  29.483 33.197  1.00 21.88 ? 551  VAL A N   1 
ATOM   2484 C  CA  . VAL A 1 328 ? 17.242  29.140 32.129  1.00 21.34 ? 551  VAL A CA  1 
ATOM   2485 C  C   . VAL A 1 328 ? 18.027  28.425 31.039  1.00 21.35 ? 551  VAL A C   1 
ATOM   2486 O  O   . VAL A 1 328 ? 19.149  28.821 30.722  1.00 20.11 ? 551  VAL A O   1 
ATOM   2487 C  CB  . VAL A 1 328 ? 16.634  30.462 31.503  1.00 21.60 ? 551  VAL A CB  1 
ATOM   2488 C  CG1 . VAL A 1 328 ? 15.738  30.156 30.325  1.00 21.09 ? 551  VAL A CG1 1 
ATOM   2489 C  CG2 . VAL A 1 328 ? 15.940  31.314 32.588  1.00 18.02 ? 551  VAL A CG2 1 
ATOM   2490 N  N   . LYS A 1 329 ? 17.450  27.369 30.465  1.00 21.99 ? 552  LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 329 ? 18.016  26.777 29.250  1.00 22.55 ? 552  LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 329 ? 17.626  27.641 28.056  1.00 20.98 ? 552  LYS A C   1 
ATOM   2493 O  O   . LYS A 1 329 ? 16.447  27.960 27.862  1.00 21.27 ? 552  LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 329 ? 17.523  25.336 29.035  1.00 24.65 ? 552  LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 329 ? 17.845  24.392 30.200  1.00 27.10 ? 552  LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 329 ? 19.334  24.468 30.622  1.00 31.99 ? 552  LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 329 ? 19.704  23.411 31.634  1.00 34.79 ? 552  LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 329 ? 18.690  22.282 31.694  1.00 35.12 ? 552  LYS A NZ  1 
ATOM   2499 N  N   . MET A 1 330 ? 18.621  28.041 27.274  1.00 20.55 ? 553  MET A N   1 
ATOM   2500 C  CA  . MET A 1 330 ? 18.382  28.889 26.108  1.00 20.26 ? 553  MET A CA  1 
ATOM   2501 C  C   . MET A 1 330 ? 17.749  28.076 25.001  1.00 19.54 ? 553  MET A C   1 
ATOM   2502 O  O   . MET A 1 330 ? 18.082  26.914 24.824  1.00 19.91 ? 553  MET A O   1 
ATOM   2503 C  CB  . MET A 1 330 ? 19.681  29.536 25.631  1.00 20.25 ? 553  MET A CB  1 
ATOM   2504 C  CG  . MET A 1 330 ? 20.494  30.215 26.737  1.00 22.72 ? 553  MET A CG  1 
ATOM   2505 S  SD  . MET A 1 330 ? 19.740  31.809 27.141  1.00 26.32 ? 553  MET A SD  1 
ATOM   2506 C  CE  . MET A 1 330 ? 18.293  31.459 28.075  1.00 20.53 ? 553  MET A CE  1 
ATOM   2507 N  N   . SER A 1 331 ? 16.805  28.676 24.286  1.00 18.94 ? 554  SER A N   1 
ATOM   2508 C  CA  . SER A 1 331 ? 16.089  27.973 23.225  1.00 19.15 ? 554  SER A CA  1 
ATOM   2509 C  C   . SER A 1 331 ? 15.394  28.977 22.306  1.00 18.65 ? 554  SER A C   1 
ATOM   2510 O  O   . SER A 1 331 ? 15.465  30.172 22.541  1.00 19.57 ? 554  SER A O   1 
ATOM   2511 C  CB  . SER A 1 331 ? 15.065  27.014 23.830  1.00 18.45 ? 554  SER A CB  1 
ATOM   2512 O  OG  . SER A 1 331 ? 14.042  27.758 24.513  1.00 18.47 ? 554  SER A OG  1 
ATOM   2513 N  N   . THR A 1 332 ? 14.686  28.482 21.297  1.00 18.52 ? 555  THR A N   1 
ATOM   2514 C  CA  . THR A 1 332 ? 13.810  29.311 20.441  1.00 18.37 ? 555  THR A CA  1 
ATOM   2515 C  C   . THR A 1 332 ? 12.805  30.137 21.268  1.00 18.26 ? 555  THR A C   1 
ATOM   2516 O  O   . THR A 1 332 ? 12.312  31.168 20.820  1.00 17.99 ? 555  THR A O   1 
ATOM   2517 C  CB  . THR A 1 332 ? 13.046  28.424 19.449  1.00 19.22 ? 555  THR A CB  1 
ATOM   2518 O  OG1 . THR A 1 332 ? 12.418  27.354 20.180  1.00 19.81 ? 555  THR A OG1 1 
ATOM   2519 C  CG2 . THR A 1 332 ? 14.035  27.796 18.438  1.00 19.31 ? 555  THR A CG2 1 
ATOM   2520 N  N   . HIS A 1 333 ? 12.525  29.678 22.480  1.00 18.19 ? 556  HIS A N   1 
ATOM   2521 C  CA  . HIS A 1 333 ? 11.498  30.279 23.336  1.00 17.83 ? 556  HIS A CA  1 
ATOM   2522 C  C   . HIS A 1 333 ? 12.020  31.081 24.519  1.00 17.29 ? 556  HIS A C   1 
ATOM   2523 O  O   . HIS A 1 333 ? 11.241  31.770 25.151  1.00 18.30 ? 556  HIS A O   1 
ATOM   2524 C  CB  . HIS A 1 333 ? 10.481  29.209 23.815  1.00 18.63 ? 556  HIS A CB  1 
ATOM   2525 C  CG  . HIS A 1 333 ? 9.534   28.759 22.747  1.00 19.30 ? 556  HIS A CG  1 
ATOM   2526 N  ND1 . HIS A 1 333 ? 9.965   28.096 21.614  1.00 19.02 ? 556  HIS A ND1 1 
ATOM   2527 C  CD2 . HIS A 1 333 ? 8.184   28.837 22.652  1.00 19.43 ? 556  HIS A CD2 1 
ATOM   2528 C  CE1 . HIS A 1 333 ? 8.917   27.793 20.862  1.00 18.61 ? 556  HIS A CE1 1 
ATOM   2529 N  NE2 . HIS A 1 333 ? 7.830   28.243 21.459  1.00 17.78 ? 556  HIS A NE2 1 
ATOM   2530 N  N   . ALA A 1 334 ? 13.314  30.964 24.817  1.00 16.38 ? 557  ALA A N   1 
ATOM   2531 C  CA  . ALA A 1 334 ? 13.965  31.671 25.911  1.00 15.42 ? 557  ALA A CA  1 
ATOM   2532 C  C   . ALA A 1 334 ? 15.375  32.106 25.504  1.00 15.09 ? 557  ALA A C   1 
ATOM   2533 O  O   . ALA A 1 334 ? 16.263  31.265 25.322  1.00 14.66 ? 557  ALA A O   1 
ATOM   2534 C  CB  . ALA A 1 334 ? 13.998  30.787 27.200  1.00 15.67 ? 557  ALA A CB  1 
ATOM   2535 N  N   . ARG A 1 335 ? 15.569  33.421 25.310  1.00 13.91 ? 558  ARG A N   1 
ATOM   2536 C  CA  . ARG A 1 335 ? 16.895  33.994 25.073  1.00 14.29 ? 558  ARG A CA  1 
ATOM   2537 C  C   . ARG A 1 335 ? 17.031  35.381 25.684  1.00 14.24 ? 558  ARG A C   1 
ATOM   2538 O  O   . ARG A 1 335 ? 16.061  36.073 25.782  1.00 13.90 ? 558  ARG A O   1 
ATOM   2539 C  CB  . ARG A 1 335 ? 17.170  34.167 23.570  1.00 14.06 ? 558  ARG A CB  1 
ATOM   2540 C  CG  . ARG A 1 335 ? 16.905  32.950 22.683  1.00 14.66 ? 558  ARG A CG  1 
ATOM   2541 C  CD  . ARG A 1 335 ? 17.444  33.269 21.250  1.00 14.56 ? 558  ARG A CD  1 
ATOM   2542 N  NE  . ARG A 1 335 ? 17.193  32.158 20.349  1.00 14.30 ? 558  ARG A NE  1 
ATOM   2543 C  CZ  . ARG A 1 335 ? 17.862  30.995 20.319  1.00 15.90 ? 558  ARG A CZ  1 
ATOM   2544 N  NH1 . ARG A 1 335 ? 18.866  30.753 21.143  1.00 15.31 ? 558  ARG A NH1 1 
ATOM   2545 N  NH2 . ARG A 1 335 ? 17.491  30.044 19.451  1.00 16.61 ? 558  ARG A NH2 1 
ATOM   2546 N  N   . PRO A 1 336 ? 18.255  35.811 26.018  1.00 14.16 ? 559  PRO A N   1 
ATOM   2547 C  CA  . PRO A 1 336 ? 18.402  37.183 26.495  1.00 15.23 ? 559  PRO A CA  1 
ATOM   2548 C  C   . PRO A 1 336 ? 18.121  38.164 25.354  1.00 14.46 ? 559  PRO A C   1 
ATOM   2549 O  O   . PRO A 1 336 ? 18.387  37.834 24.187  1.00 15.28 ? 559  PRO A O   1 
ATOM   2550 C  CB  . PRO A 1 336 ? 19.889  37.279 26.823  1.00 15.49 ? 559  PRO A CB  1 
ATOM   2551 C  CG  . PRO A 1 336 ? 20.410  35.891 26.864  1.00 15.61 ? 559  PRO A CG  1 
ATOM   2552 C  CD  . PRO A 1 336 ? 19.545  35.112 25.952  1.00 14.97 ? 559  PRO A CD  1 
ATOM   2553 N  N   . ILE A 1 337 ? 17.586  39.332 25.668  1.00 12.74 ? 560  ILE A N   1 
ATOM   2554 C  CA  . ILE A 1 337 ? 17.582  40.466 24.695  1.00 12.39 ? 560  ILE A CA  1 
ATOM   2555 C  C   . ILE A 1 337 ? 18.968  41.116 24.721  1.00 10.78 ? 560  ILE A C   1 
ATOM   2556 O  O   . ILE A 1 337 ? 19.690  40.975 25.729  1.00 11.87 ? 560  ILE A O   1 
ATOM   2557 C  CB  . ILE A 1 337 ? 16.459  41.506 25.021  1.00 12.20 ? 560  ILE A CB  1 
ATOM   2558 C  CG1 . ILE A 1 337 ? 16.255  42.472 23.840  1.00 12.48 ? 560  ILE A CG1 1 
ATOM   2559 C  CG2 . ILE A 1 337 ? 16.699  42.220 26.406  1.00 12.76 ? 560  ILE A CG2 1 
ATOM   2560 C  CD1 . ILE A 1 337 ? 14.976  43.226 23.914  1.00 13.57 ? 560  ILE A CD1 1 
ATOM   2561 N  N   . CYS A 1 338 ? 19.414  41.795 23.656  1.00 11.23 ? 561  CYS A N   1 
ATOM   2562 C  CA  . CYS A 1 338 ? 20.703  42.516 23.762  1.00 12.49 ? 561  CYS A CA  1 
ATOM   2563 C  C   . CYS A 1 338 ? 20.526  43.823 24.525  1.00 13.31 ? 561  CYS A C   1 
ATOM   2564 O  O   . CYS A 1 338 ? 19.581  44.582 24.281  1.00 12.30 ? 561  CYS A O   1 
ATOM   2565 C  CB  . CYS A 1 338 ? 21.364  42.829 22.390  1.00 13.67 ? 561  CYS A CB  1 
ATOM   2566 S  SG  . CYS A 1 338 ? 21.638  41.418 21.314  1.00 19.83 ? 561  CYS A SG  1 
ATOM   2567 N  N   . LEU A 1 339 ? 21.459  44.091 25.434  1.00 13.41 ? 562  LEU A N   1 
ATOM   2568 C  CA  . LEU A 1 339 ? 21.551  45.384 26.089  1.00 16.05 ? 562  LEU A CA  1 
ATOM   2569 C  C   . LEU A 1 339 ? 22.622  46.237 25.407  1.00 15.08 ? 562  LEU A C   1 
ATOM   2570 O  O   . LEU A 1 339 ? 23.723  45.770 25.148  1.00 14.63 ? 562  LEU A O   1 
ATOM   2571 C  CB  . LEU A 1 339 ? 21.884  45.230 27.597  1.00 14.80 ? 562  LEU A CB  1 
ATOM   2572 C  CG  . LEU A 1 339 ? 20.706  45.220 28.597  1.00 22.04 ? 562  LEU A CG  1 
ATOM   2573 C  CD1 . LEU A 1 339 ? 19.376  44.632 28.093  1.00 21.55 ? 562  LEU A CD1 1 
ATOM   2574 C  CD2 . LEU A 1 339 ? 21.131  44.635 29.984  1.00 19.85 ? 562  LEU A CD2 1 
ATOM   2575 N  N   . PRO A 1 340 ? 22.295  47.506 25.141  1.00 16.40 ? 563  PRO A N   1 
ATOM   2576 C  CA  . PRO A 1 340 ? 23.260  48.418 24.513  1.00 15.42 ? 563  PRO A CA  1 
ATOM   2577 C  C   . PRO A 1 340 ? 24.432  48.625 25.482  1.00 14.83 ? 563  PRO A C   1 
ATOM   2578 O  O   . PRO A 1 340 ? 24.297  48.361 26.694  1.00 15.21 ? 563  PRO A O   1 
ATOM   2579 C  CB  . PRO A 1 340 ? 22.475  49.731 24.367  1.00 15.96 ? 563  PRO A CB  1 
ATOM   2580 C  CG  . PRO A 1 340 ? 21.351  49.644 25.476  1.00 18.59 ? 563  PRO A CG  1 
ATOM   2581 C  CD  . PRO A 1 340 ? 21.006  48.160 25.473  1.00 17.72 ? 563  PRO A CD  1 
ATOM   2582 N  N   . CYS A 1 341 ? 25.577  49.063 24.965  1.00 13.54 ? 564  CYS A N   1 
ATOM   2583 C  CA  . CYS A 1 341 ? 26.752  49.321 25.797  1.00 13.58 ? 564  CYS A CA  1 
ATOM   2584 C  C   . CYS A 1 341 ? 27.389  48.055 26.336  1.00 13.51 ? 564  CYS A C   1 
ATOM   2585 O  O   . CYS A 1 341 ? 28.110  48.081 27.327  1.00 14.83 ? 564  CYS A O   1 
ATOM   2586 C  CB  . CYS A 1 341 ? 26.437  50.335 26.921  1.00 14.85 ? 564  CYS A CB  1 
ATOM   2587 S  SG  . CYS A 1 341 ? 25.531  51.799 26.154  1.00 18.58 ? 564  CYS A SG  1 
ATOM   2588 N  N   . THR A 1 342 ? 27.143  46.938 25.657  1.00 13.71 ? 565  THR A N   1 
ATOM   2589 C  CA  . THR A 1 342 ? 27.851  45.693 25.952  1.00 13.79 ? 565  THR A CA  1 
ATOM   2590 C  C   . THR A 1 342 ? 28.619  45.233 24.728  1.00 13.65 ? 565  THR A C   1 
ATOM   2591 O  O   . THR A 1 342 ? 28.279  45.599 23.604  1.00 11.61 ? 565  THR A O   1 
ATOM   2592 C  CB  . THR A 1 342 ? 26.892  44.551 26.352  1.00 14.10 ? 565  THR A CB  1 
ATOM   2593 O  OG1 . THR A 1 342 ? 25.971  44.320 25.275  1.00 12.38 ? 565  THR A OG1 1 
ATOM   2594 C  CG2 . THR A 1 342 ? 26.130  44.923 27.641  1.00 13.69 ? 565  THR A CG2 1 
ATOM   2595 N  N   . MET A 1 343 ? 29.642  44.408 24.933  1.00 14.76 ? 566  MET A N   1 
ATOM   2596 C  CA  . MET A 1 343 ? 30.386  43.864 23.764  1.00 16.93 ? 566  MET A CA  1 
ATOM   2597 C  C   . MET A 1 343 ? 29.513  42.972 22.862  1.00 15.51 ? 566  MET A C   1 
ATOM   2598 O  O   . MET A 1 343 ? 29.694  42.958 21.643  1.00 14.73 ? 566  MET A O   1 
ATOM   2599 C  CB  . MET A 1 343 ? 31.619  43.074 24.199  1.00 17.78 ? 566  MET A CB  1 
ATOM   2600 C  CG  . MET A 1 343 ? 32.520  42.730 22.967  1.00 27.24 ? 566  MET A CG  1 
ATOM   2601 S  SD  . MET A 1 343 ? 32.973  44.168 21.885  1.00 42.20 ? 566  MET A SD  1 
ATOM   2602 C  CE  . MET A 1 343 ? 34.015  45.065 23.047  1.00 41.80 ? 566  MET A CE  1 
ATOM   2603 N  N   . GLU A 1 344 ? 28.562  42.241 23.464  1.00 15.34 ? 567  GLU A N   1 
ATOM   2604 C  CA  . GLU A 1 344 ? 27.622  41.409 22.678  1.00 16.57 ? 567  GLU A CA  1 
ATOM   2605 C  C   . GLU A 1 344 ? 26.751  42.247 21.710  1.00 15.48 ? 567  GLU A C   1 
ATOM   2606 O  O   . GLU A 1 344 ? 26.583  41.901 20.531  1.00 15.33 ? 567  GLU A O   1 
ATOM   2607 C  CB  . GLU A 1 344 ? 26.711  40.619 23.623  1.00 17.04 ? 567  GLU A CB  1 
ATOM   2608 C  CG  . GLU A 1 344 ? 27.436  39.546 24.493  1.00 23.06 ? 567  GLU A CG  1 
ATOM   2609 C  CD  . GLU A 1 344 ? 28.477  40.046 25.537  1.00 30.30 ? 567  GLU A CD  1 
ATOM   2610 O  OE1 . GLU A 1 344 ? 28.507  41.243 25.989  1.00 27.21 ? 567  GLU A OE1 1 
ATOM   2611 O  OE2 . GLU A 1 344 ? 29.292  39.160 25.910  1.00 34.34 ? 567  GLU A OE2 1 
ATOM   2612 N  N   . ALA A 1 345 ? 26.190  43.341 22.219  1.00 14.78 ? 568  ALA A N   1 
ATOM   2613 C  CA  . ALA A 1 345 ? 25.464  44.296 21.381  1.00 13.96 ? 568  ALA A CA  1 
ATOM   2614 C  C   . ALA A 1 345 ? 26.365  44.941 20.329  1.00 13.59 ? 568  ALA A C   1 
ATOM   2615 O  O   . ALA A 1 345 ? 25.974  45.105 19.182  1.00 14.36 ? 568  ALA A O   1 
ATOM   2616 C  CB  . ALA A 1 345 ? 24.776  45.389 22.255  1.00 14.02 ? 568  ALA A CB  1 
ATOM   2617 N  N   . ASN A 1 346 ? 27.579  45.302 20.704  1.00 12.87 ? 569  ASN A N   1 
ATOM   2618 C  CA  . ASN A 1 346 ? 28.519  45.867 19.740  1.00 15.45 ? 569  ASN A CA  1 
ATOM   2619 C  C   . ASN A 1 346 ? 28.736  44.953 18.532  1.00 15.26 ? 569  ASN A C   1 
ATOM   2620 O  O   . ASN A 1 346 ? 28.784  45.420 17.384  1.00 15.68 ? 569  ASN A O   1 
ATOM   2621 C  CB  . ASN A 1 346 ? 29.868  46.164 20.405  1.00 15.29 ? 569  ASN A CB  1 
ATOM   2622 C  CG  . ASN A 1 346 ? 30.719  47.138 19.604  1.00 18.03 ? 569  ASN A CG  1 
ATOM   2623 O  OD1 . ASN A 1 346 ? 31.876  46.840 19.261  1.00 20.10 ? 569  ASN A OD1 1 
ATOM   2624 N  ND2 . ASN A 1 346 ? 30.181  48.315 19.344  1.00 13.85 ? 569  ASN A ND2 1 
ATOM   2625 N  N   . LEU A 1 347 ? 28.891  43.664 18.802  1.00 16.86 ? 570  LEU A N   1 
ATOM   2626 C  CA  . LEU A 1 347 ? 29.076  42.671 17.729  1.00 16.58 ? 570  LEU A CA  1 
ATOM   2627 C  C   . LEU A 1 347 ? 27.799  42.520 16.892  1.00 16.49 ? 570  LEU A C   1 
ATOM   2628 O  O   . LEU A 1 347 ? 27.844  42.544 15.665  1.00 15.99 ? 570  LEU A O   1 
ATOM   2629 C  CB  . LEU A 1 347 ? 29.500  41.341 18.336  1.00 17.15 ? 570  LEU A CB  1 
ATOM   2630 C  CG  . LEU A 1 347 ? 29.806  40.220 17.324  1.00 21.41 ? 570  LEU A CG  1 
ATOM   2631 C  CD1 . LEU A 1 347 ? 30.919  40.606 16.331  1.00 23.08 ? 570  LEU A CD1 1 
ATOM   2632 C  CD2 . LEU A 1 347 ? 30.212  38.995 18.106  1.00 23.09 ? 570  LEU A CD2 1 
ATOM   2633 N  N   . ALA A 1 348 ? 26.650  42.408 17.560  1.00 16.14 ? 571  ALA A N   1 
ATOM   2634 C  CA  . ALA A 1 348 ? 25.351  42.353 16.885  1.00 16.41 ? 571  ALA A CA  1 
ATOM   2635 C  C   . ALA A 1 348 ? 25.171  43.521 15.957  1.00 16.82 ? 571  ALA A C   1 
ATOM   2636 O  O   . ALA A 1 348 ? 24.578  43.367 14.901  1.00 17.60 ? 571  ALA A O   1 
ATOM   2637 C  CB  . ALA A 1 348 ? 24.178  42.329 17.892  1.00 15.47 ? 571  ALA A CB  1 
ATOM   2638 N  N   . LEU A 1 349 ? 25.612  44.699 16.392  1.00 15.67 ? 572  LEU A N   1 
ATOM   2639 C  CA  . LEU A 1 349 ? 25.461  45.921 15.607  1.00 16.59 ? 572  LEU A CA  1 
ATOM   2640 C  C   . LEU A 1 349 ? 26.564  46.105 14.542  1.00 17.83 ? 572  LEU A C   1 
ATOM   2641 O  O   . LEU A 1 349 ? 26.483  47.021 13.696  1.00 18.30 ? 572  LEU A O   1 
ATOM   2642 C  CB  . LEU A 1 349 ? 25.405  47.156 16.528  1.00 15.65 ? 572  LEU A CB  1 
ATOM   2643 C  CG  . LEU A 1 349 ? 24.117  47.249 17.390  1.00 14.42 ? 572  LEU A CG  1 
ATOM   2644 C  CD1 . LEU A 1 349 ? 24.402  48.075 18.589  1.00 12.88 ? 572  LEU A CD1 1 
ATOM   2645 C  CD2 . LEU A 1 349 ? 22.903  47.788 16.568  1.00 17.52 ? 572  LEU A CD2 1 
ATOM   2646 N  N   . ARG A 1 350 ? 27.577  45.249 14.582  1.00 19.10 ? 573  ARG A N   1 
ATOM   2647 C  CA  . ARG A 1 350 ? 28.697  45.312 13.614  1.00 20.85 ? 573  ARG A CA  1 
ATOM   2648 C  C   . ARG A 1 350 ? 29.441  46.646 13.659  1.00 20.39 ? 573  ARG A C   1 
ATOM   2649 O  O   . ARG A 1 350 ? 29.803  47.190 12.631  1.00 20.09 ? 573  ARG A O   1 
ATOM   2650 C  CB  . ARG A 1 350 ? 28.196  44.979 12.185  1.00 22.46 ? 573  ARG A CB  1 
ATOM   2651 C  CG  . ARG A 1 350 ? 27.665  43.551 12.060  1.00 26.94 ? 573  ARG A CG  1 
ATOM   2652 C  CD  . ARG A 1 350 ? 27.244  43.201 10.614  1.00 35.27 ? 573  ARG A CD  1 
ATOM   2653 N  NE  . ARG A 1 350 ? 26.858  41.793 10.495  1.00 44.53 ? 573  ARG A NE  1 
ATOM   2654 C  CZ  . ARG A 1 350 ? 25.644  41.329 10.799  1.00 49.35 ? 573  ARG A CZ  1 
ATOM   2655 N  NH1 . ARG A 1 350 ? 24.699  42.152 11.233  1.00 52.46 ? 573  ARG A NH1 1 
ATOM   2656 N  NH2 . ARG A 1 350 ? 25.372  40.037 10.691  1.00 53.41 ? 573  ARG A NH2 1 
ATOM   2657 N  N   . ARG A 1 351 ? 29.676  47.155 14.869  1.00 19.37 ? 574  ARG A N   1 
ATOM   2658 C  CA  . ARG A 1 351 ? 30.293  48.454 15.044  1.00 19.68 ? 574  ARG A CA  1 
ATOM   2659 C  C   . ARG A 1 351 ? 31.777  48.273 15.425  1.00 19.20 ? 574  ARG A C   1 
ATOM   2660 O  O   . ARG A 1 351 ? 32.190  47.164 15.809  1.00 20.08 ? 574  ARG A O   1 
ATOM   2661 C  CB  . ARG A 1 351 ? 29.535  49.230 16.120  1.00 19.23 ? 574  ARG A CB  1 
ATOM   2662 C  CG  . ARG A 1 351 ? 28.171  49.773 15.669  1.00 20.67 ? 574  ARG A CG  1 
ATOM   2663 C  CD  . ARG A 1 351 ? 28.416  51.163 14.919  1.00 30.26 ? 574  ARG A CD  1 
ATOM   2664 N  NE  . ARG A 1 351 ? 28.557  50.961 13.515  1.00 29.59 ? 574  ARG A NE  1 
ATOM   2665 C  CZ  . ARG A 1 351 ? 29.223  51.688 12.618  1.00 29.22 ? 574  ARG A CZ  1 
ATOM   2666 N  NH1 . ARG A 1 351 ? 29.944  52.800 12.889  1.00 24.88 ? 574  ARG A NH1 1 
ATOM   2667 N  NH2 . ARG A 1 351 ? 29.169  51.214 11.383  1.00 28.21 ? 574  ARG A NH2 1 
ATOM   2668 N  N   . PRO A 1 352 ? 32.577  49.348 15.320  1.00 19.29 ? 575  PRO A N   1 
ATOM   2669 C  CA  . PRO A 1 352 ? 34.002  49.250 15.679  1.00 19.81 ? 575  PRO A CA  1 
ATOM   2670 C  C   . PRO A 1 352 ? 34.292  48.728 17.095  1.00 20.94 ? 575  PRO A C   1 
ATOM   2671 O  O   . PRO A 1 352 ? 33.553  48.986 18.021  1.00 19.22 ? 575  PRO A O   1 
ATOM   2672 C  CB  . PRO A 1 352 ? 34.487  50.701 15.488  1.00 20.32 ? 575  PRO A CB  1 
ATOM   2673 C  CG  . PRO A 1 352 ? 33.623  51.157 14.280  1.00 18.81 ? 575  PRO A CG  1 
ATOM   2674 C  CD  . PRO A 1 352 ? 32.257  50.693 14.798  1.00 18.69 ? 575  PRO A CD  1 
ATOM   2675 N  N   . GLN A 1 353 ? 35.393  47.991 17.253  1.00 22.49 ? 576  GLN A N   1 
ATOM   2676 C  CA  . GLN A 1 353 ? 35.796  47.473 18.560  1.00 24.12 ? 576  GLN A CA  1 
ATOM   2677 C  C   . GLN A 1 353 ? 35.799  48.397 19.775  1.00 23.71 ? 576  GLN A C   1 
ATOM   2678 O  O   . GLN A 1 353 ? 35.342  47.993 20.900  1.00 25.00 ? 576  GLN A O   1 
ATOM   2679 C  CB  . GLN A 1 353 ? 37.170  46.815 18.450  1.00 25.63 ? 576  GLN A CB  1 
ATOM   2680 C  CG  . GLN A 1 353 ? 37.059  45.489 17.767  1.00 30.19 ? 576  GLN A CG  1 
ATOM   2681 C  CD  . GLN A 1 353 ? 35.972  44.619 18.398  1.00 36.05 ? 576  GLN A CD  1 
ATOM   2682 O  OE1 . GLN A 1 353 ? 36.040  44.283 19.590  1.00 40.52 ? 576  GLN A OE1 1 
ATOM   2683 N  NE2 . GLN A 1 353 ? 34.969  44.252 17.600  1.00 36.57 ? 576  GLN A NE2 1 
ATOM   2684 N  N   . GLY A 1 354 ? 36.302  49.605 19.560  1.00 21.86 ? 577  GLY A N   1 
ATOM   2685 C  CA  . GLY A 1 354 ? 36.498  50.572 20.647  1.00 21.21 ? 577  GLY A CA  1 
ATOM   2686 C  C   . GLY A 1 354 ? 35.318  51.494 20.868  1.00 19.10 ? 577  GLY A C   1 
ATOM   2687 O  O   . GLY A 1 354 ? 35.471  52.554 21.465  1.00 19.33 ? 577  GLY A O   1 
ATOM   2688 N  N   . SER A 1 355 ? 34.143  51.076 20.393  1.00 17.33 ? 578  SER A N   1 
ATOM   2689 C  CA  . SER A 1 355 ? 32.903  51.888 20.533  1.00 15.93 ? 578  SER A CA  1 
ATOM   2690 C  C   . SER A 1 355 ? 32.558  52.134 21.992  1.00 14.97 ? 578  SER A C   1 
ATOM   2691 O  O   . SER A 1 355 ? 32.878  51.319 22.869  1.00 14.92 ? 578  SER A O   1 
ATOM   2692 C  CB  . SER A 1 355 ? 31.733  51.200 19.844  1.00 15.92 ? 578  SER A CB  1 
ATOM   2693 O  OG  . SER A 1 355 ? 31.911  51.059 18.459  1.00 16.49 ? 578  SER A OG  1 
ATOM   2694 N  N   . THR A 1 356 ? 31.907  53.264 22.278  1.00 14.37 ? 579  THR A N   1 
ATOM   2695 C  CA  . THR A 1 356 ? 31.572  53.606 23.650  1.00 14.59 ? 579  THR A CA  1 
ATOM   2696 C  C   . THR A 1 356 ? 30.030  53.474 23.813  1.00 15.04 ? 579  THR A C   1 
ATOM   2697 O  O   . THR A 1 356 ? 29.303  53.286 22.827  1.00 14.26 ? 579  THR A O   1 
ATOM   2698 C  CB  . THR A 1 356 ? 31.955  55.044 23.947  1.00 14.72 ? 579  THR A CB  1 
ATOM   2699 O  OG1 . THR A 1 356 ? 31.186  55.908 23.093  1.00 12.84 ? 579  THR A OG1 1 
ATOM   2700 C  CG2 . THR A 1 356 ? 33.463  55.293 23.725  1.00 17.71 ? 579  THR A CG2 1 
ATOM   2701 N  N   . CYS A 1 357 ? 29.535  53.647 25.032  1.00 15.70 ? 580  CYS A N   1 
ATOM   2702 C  CA  . CYS A 1 357 ? 28.086  53.716 25.254  1.00 16.97 ? 580  CYS A CA  1 
ATOM   2703 C  C   . CYS A 1 357 ? 27.435  54.858 24.472  1.00 16.25 ? 580  CYS A C   1 
ATOM   2704 O  O   . CYS A 1 357 ? 26.344  54.708 23.910  1.00 14.61 ? 580  CYS A O   1 
ATOM   2705 C  CB  . CYS A 1 357 ? 27.809  53.853 26.745  1.00 18.59 ? 580  CYS A CB  1 
ATOM   2706 S  SG  . CYS A 1 357 ? 26.125  53.447 27.203  1.00 22.86 ? 580  CYS A SG  1 
ATOM   2707 N  N   . ARG A 1 358 ? 28.105  56.014 24.443  1.00 15.10 ? 581  ARG A N   1 
ATOM   2708 C  CA  . ARG A 1 358 ? 27.601  57.149 23.664  1.00 15.80 ? 581  ARG A CA  1 
ATOM   2709 C  C   . ARG A 1 358 ? 27.447  56.721 22.201  1.00 14.51 ? 581  ARG A C   1 
ATOM   2710 O  O   . ARG A 1 358 ? 26.428  57.047 21.543  1.00 13.56 ? 581  ARG A O   1 
ATOM   2711 C  CB  . ARG A 1 358 ? 28.570  58.339 23.810  1.00 16.19 ? 581  ARG A CB  1 
ATOM   2712 C  CG  . ARG A 1 358 ? 28.221  59.589 22.978  1.00 21.13 ? 581  ARG A CG  1 
ATOM   2713 C  CD  . ARG A 1 358 ? 26.996  60.294 23.540  1.00 25.84 ? 581  ARG A CD  1 
ATOM   2714 N  NE  . ARG A 1 358 ? 25.828  59.945 22.756  1.00 25.90 ? 581  ARG A NE  1 
ATOM   2715 C  CZ  . ARG A 1 358 ? 24.617  60.451 22.955  1.00 29.99 ? 581  ARG A CZ  1 
ATOM   2716 N  NH1 . ARG A 1 358 ? 24.409  61.304 23.949  1.00 31.68 ? 581  ARG A NH1 1 
ATOM   2717 N  NH2 . ARG A 1 358 ? 23.602  60.092 22.172  1.00 26.62 ? 581  ARG A NH2 1 
ATOM   2718 N  N   . ASP A 1 359 ? 28.427  55.971 21.683  1.00 12.97 ? 582  ASP A N   1 
ATOM   2719 C  CA  . ASP A 1 359 ? 28.328  55.489 20.288  1.00 13.15 ? 582  ASP A CA  1 
ATOM   2720 C  C   . ASP A 1 359 ? 27.108  54.588 20.069  1.00 13.14 ? 582  ASP A C   1 
ATOM   2721 O  O   . ASP A 1 359 ? 26.464  54.676 19.020  1.00 12.50 ? 582  ASP A O   1 
ATOM   2722 C  CB  . ASP A 1 359 ? 29.564  54.724 19.840  1.00 13.46 ? 582  ASP A CB  1 
ATOM   2723 C  CG  . ASP A 1 359 ? 30.830  55.594 19.763  1.00 15.69 ? 582  ASP A CG  1 
ATOM   2724 O  OD1 . ASP A 1 359 ? 30.731  56.808 19.507  1.00 15.35 ? 582  ASP A OD1 1 
ATOM   2725 O  OD2 . ASP A 1 359 ? 31.927  55.026 19.918  1.00 17.41 ? 582  ASP A OD2 1 
ATOM   2726 N  N   . HIS A 1 360 ? 26.802  53.704 21.037  1.00 13.58 ? 583  HIS A N   1 
ATOM   2727 C  CA  . HIS A 1 360 ? 25.628  52.815 20.878  1.00 12.36 ? 583  HIS A CA  1 
ATOM   2728 C  C   . HIS A 1 360 ? 24.315  53.622 20.920  1.00 12.51 ? 583  HIS A C   1 
ATOM   2729 O  O   . HIS A 1 360 ? 23.362  53.282 20.210  1.00 11.79 ? 583  HIS A O   1 
ATOM   2730 C  CB  . HIS A 1 360 ? 25.598  51.743 21.987  1.00 12.87 ? 583  HIS A CB  1 
ATOM   2731 C  CG  . HIS A 1 360 ? 26.472  50.546 21.712  1.00 15.09 ? 583  HIS A CG  1 
ATOM   2732 N  ND1 . HIS A 1 360 ? 27.433  50.517 20.710  1.00 17.51 ? 583  HIS A ND1 1 
ATOM   2733 C  CD2 . HIS A 1 360 ? 26.525  49.332 22.313  1.00 12.42 ? 583  HIS A CD2 1 
ATOM   2734 C  CE1 . HIS A 1 360 ? 28.044  49.344 20.727  1.00 15.13 ? 583  HIS A CE1 1 
ATOM   2735 N  NE2 . HIS A 1 360 ? 27.493  48.600 21.669  1.00 17.45 ? 583  HIS A NE2 1 
ATOM   2736 N  N   . GLU A 1 361 ? 24.262  54.657 21.768  1.00 12.32 ? 584  GLU A N   1 
ATOM   2737 C  CA  . GLU A 1 361 ? 23.077  55.549 21.824  1.00 13.14 ? 584  GLU A CA  1 
ATOM   2738 C  C   . GLU A 1 361 ? 22.858  56.292 20.488  1.00 11.48 ? 584  GLU A C   1 
ATOM   2739 O  O   . GLU A 1 361 ? 21.731  56.428 19.988  1.00 11.97 ? 584  GLU A O   1 
ATOM   2740 C  CB  . GLU A 1 361 ? 23.239  56.540 22.983  1.00 12.56 ? 584  GLU A CB  1 
ATOM   2741 C  CG  . GLU A 1 361 ? 21.986  57.374 23.301  1.00 15.46 ? 584  GLU A CG  1 
ATOM   2742 C  CD  . GLU A 1 361 ? 22.129  58.217 24.619  1.00 17.63 ? 584  GLU A CD  1 
ATOM   2743 O  OE1 . GLU A 1 361 ? 23.086  58.014 25.404  1.00 15.78 ? 584  GLU A OE1 1 
ATOM   2744 O  OE2 . GLU A 1 361 ? 21.282  59.100 24.827  1.00 19.54 ? 584  GLU A OE2 1 
ATOM   2745 N  N   . ASN A 1 362 ? 23.953  56.776 19.917  1.00 12.46 ? 585  ASN A N   1 
ATOM   2746 C  CA  . ASN A 1 362 ? 23.958  57.362 18.545  1.00 12.07 ? 585  ASN A CA  1 
ATOM   2747 C  C   . ASN A 1 362 ? 23.531  56.372 17.479  1.00 12.77 ? 585  ASN A C   1 
ATOM   2748 O  O   . ASN A 1 362 ? 22.737  56.710 16.554  1.00 13.34 ? 585  ASN A O   1 
ATOM   2749 C  CB  . ASN A 1 362 ? 25.385  57.838 18.194  1.00 12.83 ? 585  ASN A CB  1 
ATOM   2750 C  CG  . ASN A 1 362 ? 25.830  59.041 18.984  1.00 13.39 ? 585  ASN A CG  1 
ATOM   2751 O  OD1 . ASN A 1 362 ? 25.041  59.689 19.668  1.00 13.99 ? 585  ASN A OD1 1 
ATOM   2752 N  ND2 . ASN A 1 362 ? 27.125  59.336 18.909  1.00 12.70 ? 585  ASN A ND2 1 
ATOM   2753 N  N   . GLU A 1 363 ? 24.047  55.144 17.610  1.00 13.22 ? 586  GLU A N   1 
ATOM   2754 C  CA  . GLU A 1 363 ? 23.738  54.054 16.656  1.00 13.03 ? 586  GLU A CA  1 
ATOM   2755 C  C   . GLU A 1 363 ? 22.230  53.771 16.633  1.00 13.67 ? 586  GLU A C   1 
ATOM   2756 O  O   . GLU A 1 363 ? 21.630  53.646 15.563  1.00 12.83 ? 586  GLU A O   1 
ATOM   2757 C  CB  . GLU A 1 363 ? 24.508  52.775 17.034  1.00 12.26 ? 586  GLU A CB  1 
ATOM   2758 C  CG  . GLU A 1 363 ? 24.262  51.637 16.033  1.00 14.01 ? 586  GLU A CG  1 
ATOM   2759 C  CD  . GLU A 1 363 ? 24.681  51.999 14.595  1.00 20.04 ? 586  GLU A CD  1 
ATOM   2760 O  OE1 . GLU A 1 363 ? 25.660  52.745 14.434  1.00 19.90 ? 586  GLU A OE1 1 
ATOM   2761 O  OE2 . GLU A 1 363 ? 24.034  51.532 13.629  1.00 21.21 ? 586  GLU A OE2 1 
ATOM   2762 N  N   . LEU A 1 364 ? 21.648  53.598 17.830  1.00 13.03 ? 587  LEU A N   1 
ATOM   2763 C  CA  . LEU A 1 364 ? 20.269  53.161 17.970  1.00 13.49 ? 587  LEU A CA  1 
ATOM   2764 C  C   . LEU A 1 364 ? 19.213  54.257 17.937  1.00 14.59 ? 587  LEU A C   1 
ATOM   2765 O  O   . LEU A 1 364 ? 18.092  54.011 17.433  1.00 15.14 ? 587  LEU A O   1 
ATOM   2766 C  CB  . LEU A 1 364 ? 20.104  52.341 19.255  1.00 12.65 ? 587  LEU A CB  1 
ATOM   2767 C  CG  . LEU A 1 364 ? 20.863  50.998 19.175  1.00 14.20 ? 587  LEU A CG  1 
ATOM   2768 C  CD1 . LEU A 1 364 ? 20.805  50.296 20.541  1.00 17.41 ? 587  LEU A CD1 1 
ATOM   2769 C  CD2 . LEU A 1 364 ? 20.300  50.060 18.082  1.00 17.31 ? 587  LEU A CD2 1 
ATOM   2770 N  N   . LEU A 1 365 ? 19.548  55.441 18.444  1.00 13.69 ? 588  LEU A N   1 
ATOM   2771 C  CA  . LEU A 1 365 ? 18.551  56.503 18.669  1.00 16.32 ? 588  LEU A CA  1 
ATOM   2772 C  C   . LEU A 1 365 ? 18.874  57.807 17.961  1.00 19.37 ? 588  LEU A C   1 
ATOM   2773 O  O   . LEU A 1 365 ? 18.613  58.882 18.505  1.00 21.24 ? 588  LEU A O   1 
ATOM   2774 C  CB  . LEU A 1 365 ? 18.374  56.803 20.152  1.00 14.97 ? 588  LEU A CB  1 
ATOM   2775 C  CG  . LEU A 1 365 ? 17.966  55.687 21.101  1.00 15.73 ? 588  LEU A CG  1 
ATOM   2776 C  CD1 . LEU A 1 365 ? 17.858  56.255 22.473  1.00 17.81 ? 588  LEU A CD1 1 
ATOM   2777 C  CD2 . LEU A 1 365 ? 16.607  55.113 20.666  1.00 15.91 ? 588  LEU A CD2 1 
ATOM   2778 N  N   . ASN A 1 366 ? 19.339  57.700 16.728  1.00 22.19 ? 589  ASN A N   1 
ATOM   2779 C  CA  . ASN A 1 366 ? 19.806  58.870 15.973  1.00 24.66 ? 589  ASN A CA  1 
ATOM   2780 C  C   . ASN A 1 366 ? 18.689  59.787 15.418  1.00 25.19 ? 589  ASN A C   1 
ATOM   2781 O  O   . ASN A 1 366 ? 18.877  61.034 15.320  1.00 26.31 ? 589  ASN A O   1 
ATOM   2782 C  CB  . ASN A 1 366 ? 20.711  58.384 14.847  1.00 26.06 ? 589  ASN A CB  1 
ATOM   2783 C  CG  . ASN A 1 366 ? 20.299  57.042 14.340  1.00 26.34 ? 589  ASN A CG  1 
ATOM   2784 O  OD1 . ASN A 1 366 ? 19.445  56.914 13.491  1.00 35.41 ? 589  ASN A OD1 1 
ATOM   2785 N  ND2 . ASN A 1 366 ? 20.894  56.000 14.906  1.00 36.95 ? 589  ASN A ND2 1 
ATOM   2786 N  N   . LYS A 1 367 ? 17.528  59.207 15.108  1.00 23.16 ? 590  LYS A N   1 
ATOM   2787 C  CA  . LYS A 1 367 ? 16.434  59.981 14.484  1.00 22.89 ? 590  LYS A CA  1 
ATOM   2788 C  C   . LYS A 1 367 ? 15.564  60.719 15.497  1.00 21.74 ? 590  LYS A C   1 
ATOM   2789 O  O   . LYS A 1 367 ? 15.539  60.362 16.662  1.00 20.21 ? 590  LYS A O   1 
ATOM   2790 C  CB  . LYS A 1 367 ? 15.584  59.055 13.607  1.00 22.96 ? 590  LYS A CB  1 
ATOM   2791 C  CG  . LYS A 1 367 ? 16.361  58.549 12.379  1.00 26.89 ? 590  LYS A CG  1 
ATOM   2792 C  CD  . LYS A 1 367 ? 15.429  58.048 11.273  1.00 30.77 ? 590  LYS A CD  1 
ATOM   2793 C  CE  . LYS A 1 367 ? 15.002  56.636 11.477  1.00 36.84 ? 590  LYS A CE  1 
ATOM   2794 N  NZ  . LYS A 1 367 ? 16.170  55.717 11.633  1.00 38.89 ? 590  LYS A NZ  1 
ATOM   2795 N  N   . GLN A 1 368 ? 14.830  61.745 15.054  1.00 21.10 ? 591  GLN A N   1 
ATOM   2796 C  CA  . GLN A 1 368 ? 13.948  62.451 15.991  1.00 21.07 ? 591  GLN A CA  1 
ATOM   2797 C  C   . GLN A 1 368 ? 12.735  61.619 16.370  1.00 19.85 ? 591  GLN A C   1 
ATOM   2798 O  O   . GLN A 1 368 ? 12.101  61.901 17.365  1.00 20.61 ? 591  GLN A O   1 
ATOM   2799 C  CB  . GLN A 1 368 ? 13.533  63.844 15.473  1.00 22.74 ? 591  GLN A CB  1 
ATOM   2800 C  CG  . GLN A 1 368 ? 14.611  64.825 15.772  1.00 26.44 ? 591  GLN A CG  1 
ATOM   2801 C  CD  . GLN A 1 368 ? 14.371  66.177 15.174  1.00 31.99 ? 591  GLN A CD  1 
ATOM   2802 O  OE1 . GLN A 1 368 ? 15.271  67.004 15.170  1.00 35.41 ? 591  GLN A OE1 1 
ATOM   2803 N  NE2 . GLN A 1 368 ? 13.153  66.430 14.691  1.00 34.05 ? 591  GLN A NE2 1 
ATOM   2804 N  N   . SER A 1 369 ? 12.409  60.617 15.562  1.00 18.10 ? 592  SER A N   1 
ATOM   2805 C  CA  . SER A 1 369 ? 11.282  59.696 15.851  1.00 18.04 ? 592  SER A CA  1 
ATOM   2806 C  C   . SER A 1 369 ? 11.735  58.313 15.457  1.00 17.92 ? 592  SER A C   1 
ATOM   2807 O  O   . SER A 1 369 ? 12.042  58.046 14.282  1.00 17.84 ? 592  SER A O   1 
ATOM   2808 C  CB  . SER A 1 369 ? 10.003  60.115 15.111  1.00 18.56 ? 592  SER A CB  1 
ATOM   2809 O  OG  . SER A 1 369 ? 8.894   59.238 15.390  1.00 20.25 ? 592  SER A OG  1 
ATOM   2810 N  N   . VAL A 1 370 ? 11.843  57.441 16.463  1.00 17.14 ? 593  VAL A N   1 
ATOM   2811 C  CA  . VAL A 1 370 ? 12.453  56.118 16.314  1.00 16.79 ? 593  VAL A CA  1 
ATOM   2812 C  C   . VAL A 1 370 ? 11.403  55.038 16.545  1.00 16.67 ? 593  VAL A C   1 
ATOM   2813 O  O   . VAL A 1 370 ? 10.937  54.864 17.697  1.00 17.50 ? 593  VAL A O   1 
ATOM   2814 C  CB  . VAL A 1 370 ? 13.612  55.927 17.376  1.00 16.80 ? 593  VAL A CB  1 
ATOM   2815 C  CG1 . VAL A 1 370 ? 14.271  54.544 17.278  1.00 16.90 ? 593  VAL A CG1 1 
ATOM   2816 C  CG2 . VAL A 1 370 ? 14.661  57.053 17.233  1.00 17.91 ? 593  VAL A CG2 1 
ATOM   2817 N  N   . PRO A 1 371 ? 11.034  54.309 15.483  1.00 16.41 ? 594  PRO A N   1 
ATOM   2818 C  CA  . PRO A 1 371 ? 10.124  53.166 15.620  1.00 15.81 ? 594  PRO A CA  1 
ATOM   2819 C  C   . PRO A 1 371 ? 10.665  52.096 16.575  1.00 15.09 ? 594  PRO A C   1 
ATOM   2820 O  O   . PRO A 1 371 ? 11.861  51.723 16.542  1.00 13.05 ? 594  PRO A O   1 
ATOM   2821 C  CB  . PRO A 1 371 ? 9.999   52.639 14.197  1.00 15.92 ? 594  PRO A CB  1 
ATOM   2822 C  CG  . PRO A 1 371 ? 10.254  53.866 13.321  1.00 17.65 ? 594  PRO A CG  1 
ATOM   2823 C  CD  . PRO A 1 371 ? 11.396  54.543 14.055  1.00 16.20 ? 594  PRO A CD  1 
ATOM   2824 N  N   . ALA A 1 372 ? 9.788   51.699 17.497  1.00 14.13 ? 595  ALA A N   1 
ATOM   2825 C  CA  . ALA A 1 372 ? 10.142  50.807 18.591  1.00 13.72 ? 595  ALA A CA  1 
ATOM   2826 C  C   . ALA A 1 372 ? 8.875   49.994 18.963  1.00 13.95 ? 595  ALA A C   1 
ATOM   2827 O  O   . ALA A 1 372 ? 7.828   50.095 18.264  1.00 13.54 ? 595  ALA A O   1 
ATOM   2828 C  CB  . ALA A 1 372 ? 10.705  51.623 19.790  1.00 13.71 ? 595  ALA A CB  1 
ATOM   2829 N  N   . HIS A 1 373 ? 8.982   49.156 19.996  1.00 13.02 ? 596  HIS A N   1 
ATOM   2830 C  CA  . HIS A 1 373 ? 7.948   48.191 20.337  1.00 13.45 ? 596  HIS A CA  1 
ATOM   2831 C  C   . HIS A 1 373 ? 7.927   47.967 21.829  1.00 14.42 ? 596  HIS A C   1 
ATOM   2832 O  O   . HIS A 1 373 ? 8.948   48.136 22.539  1.00 13.34 ? 596  HIS A O   1 
ATOM   2833 C  CB  . HIS A 1 373 ? 8.239   46.791 19.727  1.00 13.11 ? 596  HIS A CB  1 
ATOM   2834 C  CG  . HIS A 1 373 ? 8.468   46.816 18.253  1.00 17.64 ? 596  HIS A CG  1 
ATOM   2835 N  ND1 . HIS A 1 373 ? 7.443   46.979 17.347  1.00 18.68 ? 596  HIS A ND1 1 
ATOM   2836 C  CD2 . HIS A 1 373 ? 9.617   46.816 17.531  1.00 19.82 ? 596  HIS A CD2 1 
ATOM   2837 C  CE1 . HIS A 1 373 ? 7.941   47.017 16.120  1.00 22.60 ? 596  HIS A CE1 1 
ATOM   2838 N  NE2 . HIS A 1 373 ? 9.258   46.941 16.206  1.00 22.23 ? 596  HIS A NE2 1 
ATOM   2839 N  N   . PHE A 1 374 ? 6.764   47.499 22.287  1.00 13.72 ? 597  PHE A N   1 
ATOM   2840 C  CA  . PHE A 1 374 ? 6.684   46.768 23.547  1.00 13.91 ? 597  PHE A CA  1 
ATOM   2841 C  C   . PHE A 1 374 ? 5.723   45.579 23.366  1.00 13.24 ? 597  PHE A C   1 
ATOM   2842 O  O   . PHE A 1 374 ? 5.019   45.516 22.354  1.00 13.79 ? 597  PHE A O   1 
ATOM   2843 C  CB  . PHE A 1 374 ? 6.223   47.706 24.669  1.00 13.18 ? 597  PHE A CB  1 
ATOM   2844 C  CG  . PHE A 1 374 ? 4.784   48.214 24.497  1.00 13.37 ? 597  PHE A CG  1 
ATOM   2845 C  CD1 . PHE A 1 374 ? 3.713   47.521 25.083  1.00 12.56 ? 597  PHE A CD1 1 
ATOM   2846 C  CD2 . PHE A 1 374 ? 4.511   49.357 23.780  1.00 17.29 ? 597  PHE A CD2 1 
ATOM   2847 C  CE1 . PHE A 1 374 ? 2.397   47.952 24.946  1.00 15.91 ? 597  PHE A CE1 1 
ATOM   2848 C  CE2 . PHE A 1 374 ? 3.186   49.814 23.620  1.00 15.80 ? 597  PHE A CE2 1 
ATOM   2849 C  CZ  . PHE A 1 374 ? 2.117   49.075 24.222  1.00 14.31 ? 597  PHE A CZ  1 
ATOM   2850 N  N   . VAL A 1 375 ? 5.707   44.654 24.324  1.00 13.54 ? 598  VAL A N   1 
ATOM   2851 C  CA  . VAL A 1 375 ? 4.870   43.429 24.221  1.00 14.96 ? 598  VAL A CA  1 
ATOM   2852 C  C   . VAL A 1 375 ? 3.607   43.576 25.079  1.00 15.57 ? 598  VAL A C   1 
ATOM   2853 O  O   . VAL A 1 375 ? 3.682   44.013 26.253  1.00 16.15 ? 598  VAL A O   1 
ATOM   2854 C  CB  . VAL A 1 375 ? 5.668   42.146 24.549  1.00 14.82 ? 598  VAL A CB  1 
ATOM   2855 C  CG1 . VAL A 1 375 ? 4.744   40.920 24.721  1.00 14.43 ? 598  VAL A CG1 1 
ATOM   2856 C  CG2 . VAL A 1 375 ? 6.660   41.836 23.388  1.00 15.42 ? 598  VAL A CG2 1 
ATOM   2857 N  N   . ALA A 1 376 ? 2.459   43.247 24.477  1.00 16.00 ? 599  ALA A N   1 
ATOM   2858 C  CA  . ALA A 1 376 ? 1.152   43.373 25.145  1.00 17.16 ? 599  ALA A CA  1 
ATOM   2859 C  C   . ALA A 1 376 ? 0.912   42.254 26.155  1.00 17.53 ? 599  ALA A C   1 
ATOM   2860 O  O   . ALA A 1 376 ? 1.633   41.243 26.170  1.00 17.68 ? 599  ALA A O   1 
ATOM   2861 C  CB  . ALA A 1 376 ? -0.021  43.395 24.086  1.00 17.44 ? 599  ALA A CB  1 
ATOM   2862 N  N   . LEU A 1 377 ? -0.138  42.425 26.982  1.00 18.15 ? 600  LEU A N   1 
ATOM   2863 C  CA  . LEU A 1 377 ? -0.511  41.412 27.984  1.00 19.15 ? 600  LEU A CA  1 
ATOM   2864 C  C   . LEU A 1 377 ? -0.667  40.033 27.352  1.00 19.77 ? 600  LEU A C   1 
ATOM   2865 O  O   . LEU A 1 377 ? -0.312  39.015 27.955  1.00 20.29 ? 600  LEU A O   1 
ATOM   2866 C  CB  . LEU A 1 377 ? -1.869  41.769 28.648  1.00 19.64 ? 600  LEU A CB  1 
ATOM   2867 C  CG  . LEU A 1 377 ? -1.972  43.011 29.541  1.00 20.26 ? 600  LEU A CG  1 
ATOM   2868 C  CD1 . LEU A 1 377 ? -3.447  43.292 29.943  1.00 22.68 ? 600  LEU A CD1 1 
ATOM   2869 C  CD2 . LEU A 1 377 ? -1.098  42.815 30.778  1.00 23.15 ? 600  LEU A CD2 1 
ATOM   2870 N  N   . ASN A 1 378 ? -1.225  40.028 26.149  1.00 20.35 ? 601  ASN A N   1 
ATOM   2871 C  CA  . ASN A 1 378 ? -1.515  38.793 25.420  1.00 21.46 ? 601  ASN A CA  1 
ATOM   2872 C  C   . ASN A 1 378 ? -0.370  38.250 24.565  1.00 21.02 ? 601  ASN A C   1 
ATOM   2873 O  O   . ASN A 1 378 ? -0.538  37.256 23.871  1.00 21.72 ? 601  ASN A O   1 
ATOM   2874 C  CB  . ASN A 1 378 ? -2.793  38.939 24.574  1.00 21.87 ? 601  ASN A CB  1 
ATOM   2875 C  CG  . ASN A 1 378 ? -2.624  39.839 23.363  1.00 25.24 ? 601  ASN A CG  1 
ATOM   2876 O  OD1 . ASN A 1 378 ? -1.541  40.402 23.094  1.00 24.57 ? 601  ASN A OD1 1 
ATOM   2877 N  ND2 . ASN A 1 378 ? -3.728  39.996 22.624  1.00 23.18 ? 601  ASN A ND2 1 
ATOM   2878 N  N   . GLY A 1 379 ? 0.787   38.905 24.641  1.00 20.40 ? 602  GLY A N   1 
ATOM   2879 C  CA  . GLY A 1 379 ? 1.985   38.474 23.934  1.00 19.53 ? 602  GLY A CA  1 
ATOM   2880 C  C   . GLY A 1 379 ? 2.236   39.176 22.602  1.00 18.40 ? 602  GLY A C   1 
ATOM   2881 O  O   . GLY A 1 379 ? 3.308   38.982 22.009  1.00 18.71 ? 602  GLY A O   1 
ATOM   2882 N  N   . SER A 1 380 ? 1.285   39.985 22.122  1.00 18.43 ? 603  SER A N   1 
ATOM   2883 C  CA  . SER A 1 380 ? 1.434   40.647 20.821  1.00 18.10 ? 603  SER A CA  1 
ATOM   2884 C  C   . SER A 1 380 ? 2.499   41.745 20.840  1.00 18.75 ? 603  SER A C   1 
ATOM   2885 O  O   . SER A 1 380 ? 2.611   42.499 21.830  1.00 16.23 ? 603  SER A O   1 
ATOM   2886 C  CB  . SER A 1 380 ? 0.103   41.253 20.316  1.00 19.41 ? 603  SER A CB  1 
ATOM   2887 O  OG  . SER A 1 380 ? -0.595  40.241 19.612  1.00 22.21 ? 603  SER A OG  1 
ATOM   2888 N  N   . LYS A 1 381 ? 3.265   41.838 19.742  1.00 19.09 ? 604  LYS A N   1 
ATOM   2889 C  CA  . LYS A 1 381 ? 4.224   42.944 19.610  1.00 19.56 ? 604  LYS A CA  1 
ATOM   2890 C  C   . LYS A 1 381 ? 3.524   44.217 19.151  1.00 19.64 ? 604  LYS A C   1 
ATOM   2891 O  O   . LYS A 1 381 ? 2.911   44.241 18.070  1.00 20.58 ? 604  LYS A O   1 
ATOM   2892 C  CB  . LYS A 1 381 ? 5.378   42.528 18.672  1.00 19.92 ? 604  LYS A CB  1 
ATOM   2893 C  CG  . LYS A 1 381 ? 6.394   43.663 18.448  1.00 21.83 ? 604  LYS A CG  1 
ATOM   2894 C  CD  . LYS A 1 381 ? 7.656   43.191 17.691  1.00 26.47 ? 604  LYS A CD  1 
ATOM   2895 C  CE  . LYS A 1 381 ? 7.456   42.370 16.424  1.00 31.68 ? 604  LYS A CE  1 
ATOM   2896 N  NZ  . LYS A 1 381 ? 8.776   41.611 16.041  1.00 26.37 ? 604  LYS A NZ  1 
ATOM   2897 N  N   . LEU A 1 382 ? 3.555   45.283 19.955  1.00 18.02 ? 605  LEU A N   1 
ATOM   2898 C  CA  . LEU A 1 382 ? 2.898   46.533 19.568  1.00 18.82 ? 605  LEU A CA  1 
ATOM   2899 C  C   . LEU A 1 382 ? 3.915   47.615 19.204  1.00 18.44 ? 605  LEU A C   1 
ATOM   2900 O  O   . LEU A 1 382 ? 5.070   47.485 19.537  1.00 17.99 ? 605  LEU A O   1 
ATOM   2901 C  CB  . LEU A 1 382 ? 1.963   47.047 20.671  1.00 18.67 ? 605  LEU A CB  1 
ATOM   2902 C  CG  . LEU A 1 382 ? 0.980   46.001 21.231  1.00 20.25 ? 605  LEU A CG  1 
ATOM   2903 C  CD1 . LEU A 1 382 ? 0.072   46.654 22.260  1.00 18.54 ? 605  LEU A CD1 1 
ATOM   2904 C  CD2 . LEU A 1 382 ? 0.148   45.398 20.095  1.00 20.01 ? 605  LEU A CD2 1 
ATOM   2905 N  N   . ASN A 1 383 ? 3.469   48.644 18.499  1.00 18.58 ? 606  ASN A N   1 
ATOM   2906 C  CA  . ASN A 1 383 ? 4.350   49.667 17.921  1.00 17.25 ? 606  ASN A CA  1 
ATOM   2907 C  C   . ASN A 1 383 ? 4.231   51.035 18.567  1.00 16.61 ? 606  ASN A C   1 
ATOM   2908 O  O   . ASN A 1 383 ? 3.122   51.519 18.869  1.00 17.55 ? 606  ASN A O   1 
ATOM   2909 C  CB  . ASN A 1 383 ? 4.063   49.805 16.417  1.00 19.19 ? 606  ASN A CB  1 
ATOM   2910 C  CG  . ASN A 1 383 ? 4.322   48.514 15.649  1.00 19.14 ? 606  ASN A CG  1 
ATOM   2911 O  OD1 . ASN A 1 383 ? 4.984   47.588 16.130  1.00 22.13 ? 606  ASN A OD1 1 
ATOM   2912 N  ND2 . ASN A 1 383 ? 3.754   48.429 14.448  1.00 26.08 ? 606  ASN A ND2 1 
ATOM   2913 N  N   . ILE A 1 384 ? 5.374   51.697 18.722  1.00 14.77 ? 607  ILE A N   1 
ATOM   2914 C  CA  . ILE A 1 384 ? 5.412   53.041 19.258  1.00 14.95 ? 607  ILE A CA  1 
ATOM   2915 C  C   . ILE A 1 384 ? 6.482   53.828 18.493  1.00 15.10 ? 607  ILE A C   1 
ATOM   2916 O  O   . ILE A 1 384 ? 7.274   53.248 17.757  1.00 16.26 ? 607  ILE A O   1 
ATOM   2917 C  CB  . ILE A 1 384 ? 5.778   53.047 20.795  1.00 14.90 ? 607  ILE A CB  1 
ATOM   2918 C  CG1 . ILE A 1 384 ? 7.214   52.508 21.008  1.00 14.10 ? 607  ILE A CG1 1 
ATOM   2919 C  CG2 . ILE A 1 384 ? 4.728   52.276 21.660  1.00 13.68 ? 607  ILE A CG2 1 
ATOM   2920 C  CD1 . ILE A 1 384 ? 7.651   52.536 22.521  1.00 14.04 ? 607  ILE A CD1 1 
ATOM   2921 N  N   . ASN A 1 385 ? 6.512   55.134 18.673  1.00 16.24 ? 608  ASN A N   1 
ATOM   2922 C  CA  . ASN A 1 385 ? 7.615   55.914 18.114  1.00 16.68 ? 608  ASN A CA  1 
ATOM   2923 C  C   . ASN A 1 385 ? 8.262   56.708 19.227  1.00 15.61 ? 608  ASN A C   1 
ATOM   2924 O  O   . ASN A 1 385 ? 7.635   57.568 19.824  1.00 16.86 ? 608  ASN A O   1 
ATOM   2925 C  CB  . ASN A 1 385 ? 7.115   56.832 16.979  1.00 17.71 ? 608  ASN A CB  1 
ATOM   2926 C  CG  . ASN A 1 385 ? 6.705   56.060 15.724  1.00 19.36 ? 608  ASN A CG  1 
ATOM   2927 O  OD1 . ASN A 1 385 ? 5.544   56.100 15.321  1.00 29.39 ? 608  ASN A OD1 1 
ATOM   2928 N  ND2 . ASN A 1 385 ? 7.621   55.387 15.109  1.00 15.90 ? 608  ASN A ND2 1 
ATOM   2929 N  N   . LEU A 1 386 ? 9.519   56.419 19.534  1.00 14.96 ? 609  LEU A N   1 
ATOM   2930 C  CA  . LEU A 1 386 ? 10.241  57.189 20.555  1.00 14.95 ? 609  LEU A CA  1 
ATOM   2931 C  C   . LEU A 1 386 ? 10.660  58.544 20.001  1.00 15.60 ? 609  LEU A C   1 
ATOM   2932 O  O   . LEU A 1 386 ? 11.250  58.613 18.912  1.00 16.60 ? 609  LEU A O   1 
ATOM   2933 C  CB  . LEU A 1 386 ? 11.499  56.439 21.008  1.00 14.71 ? 609  LEU A CB  1 
ATOM   2934 C  CG  . LEU A 1 386 ? 11.306  55.022 21.478  1.00 13.76 ? 609  LEU A CG  1 
ATOM   2935 C  CD1 . LEU A 1 386 ? 12.681  54.298 21.554  1.00 11.65 ? 609  LEU A CD1 1 
ATOM   2936 C  CD2 . LEU A 1 386 ? 10.551  54.998 22.816  1.00 13.06 ? 609  LEU A CD2 1 
ATOM   2937 N  N   . LYS A 1 387 ? 10.379  59.589 20.760  1.00 15.40 ? 610  LYS A N   1 
ATOM   2938 C  CA  . LYS A 1 387 ? 10.589  60.943 20.306  1.00 16.95 ? 610  LYS A CA  1 
ATOM   2939 C  C   . LYS A 1 387 ? 11.813  61.526 20.983  1.00 17.62 ? 610  LYS A C   1 
ATOM   2940 O  O   . LYS A 1 387 ? 11.892  61.560 22.226  1.00 18.01 ? 610  LYS A O   1 
ATOM   2941 C  CB  . LYS A 1 387 ? 9.347   61.789 20.612  1.00 17.35 ? 610  LYS A CB  1 
ATOM   2942 C  CG  . LYS A 1 387 ? 8.094   61.259 19.904  1.00 16.91 ? 610  LYS A CG  1 
ATOM   2943 C  CD  . LYS A 1 387 ? 8.301   61.116 18.356  1.00 20.13 ? 610  LYS A CD  1 
ATOM   2944 C  CE  . LYS A 1 387 ? 6.980   60.714 17.668  1.00 22.76 ? 610  LYS A CE  1 
ATOM   2945 N  NZ  . LYS A 1 387 ? 7.028   60.772 16.150  1.00 25.73 ? 610  LYS A NZ  1 
ATOM   2946 N  N   . MET A 1 388 ? 12.759  61.975 20.161  1.00 18.74 ? 611  MET A N   1 
ATOM   2947 C  CA  . MET A 1 388 ? 14.107  62.396 20.633  1.00 20.35 ? 611  MET A CA  1 
ATOM   2948 C  C   . MET A 1 388 ? 14.311  63.869 20.331  1.00 20.69 ? 611  MET A C   1 
ATOM   2949 O  O   . MET A 1 388 ? 13.637  64.434 19.440  1.00 21.34 ? 611  MET A O   1 
ATOM   2950 C  CB  . MET A 1 388 ? 15.234  61.611 19.925  1.00 19.93 ? 611  MET A CB  1 
ATOM   2951 C  CG  . MET A 1 388 ? 15.060  60.106 19.809  1.00 22.86 ? 611  MET A CG  1 
ATOM   2952 S  SD  . MET A 1 388 ? 14.921  59.261 21.406  1.00 26.94 ? 611  MET A SD  1 
ATOM   2953 C  CE  . MET A 1 388 ? 14.254  57.751 20.820  1.00 32.84 ? 611  MET A CE  1 
ATOM   2954 N  N   . GLY A 1 389 ? 15.221  64.489 21.084  1.00 21.92 ? 612  GLY A N   1 
ATOM   2955 C  CA  . GLY A 1 389 ? 15.618  65.891 20.882  1.00 23.27 ? 612  GLY A CA  1 
ATOM   2956 C  C   . GLY A 1 389 ? 14.480  66.870 21.082  1.00 23.90 ? 612  GLY A C   1 
ATOM   2957 O  O   . GLY A 1 389 ? 13.785  66.844 22.099  1.00 24.26 ? 612  GLY A O   1 
ATOM   2958 N  N   . VAL A 1 390 ? 14.259  67.730 20.093  1.00 24.35 ? 613  VAL A N   1 
ATOM   2959 C  CA  . VAL A 1 390 ? 13.152  68.701 20.192  1.00 25.44 ? 613  VAL A CA  1 
ATOM   2960 C  C   . VAL A 1 390 ? 11.783  68.019 20.299  1.00 24.37 ? 613  VAL A C   1 
ATOM   2961 O  O   . VAL A 1 390 ? 10.872  68.533 20.974  1.00 24.85 ? 613  VAL A O   1 
ATOM   2962 C  CB  . VAL A 1 390 ? 13.203  69.740 19.008  1.00 25.83 ? 613  VAL A CB  1 
ATOM   2963 C  CG1 . VAL A 1 390 ? 11.950  70.619 18.989  1.00 29.46 ? 613  VAL A CG1 1 
ATOM   2964 C  CG2 . VAL A 1 390 ? 14.439  70.633 19.135  1.00 27.77 ? 613  VAL A CG2 1 
ATOM   2965 N  N   . GLU A 1 391 ? 11.623  66.884 19.626  1.00 22.36 ? 614  GLU A N   1 
ATOM   2966 C  CA  . GLU A 1 391 ? 10.345  66.146 19.661  1.00 21.88 ? 614  GLU A CA  1 
ATOM   2967 C  C   . GLU A 1 391 ? 10.113  65.495 21.040  1.00 21.25 ? 614  GLU A C   1 
ATOM   2968 O  O   . GLU A 1 391 ? 8.990   65.278 21.426  1.00 19.98 ? 614  GLU A O   1 
ATOM   2969 C  CB  . GLU A 1 391 ? 10.239  65.114 18.532  1.00 22.15 ? 614  GLU A CB  1 
ATOM   2970 C  CG  . GLU A 1 391 ? 10.272  65.716 17.082  1.00 24.70 ? 614  GLU A CG  1 
ATOM   2971 C  CD  . GLU A 1 391 ? 9.593   64.799 16.044  1.00 29.68 ? 614  GLU A CD  1 
ATOM   2972 O  OE1 . GLU A 1 391 ? 8.601   64.130 16.372  1.00 35.27 ? 614  GLU A OE1 1 
ATOM   2973 O  OE2 . GLU A 1 391 ? 10.037  64.733 14.879  1.00 35.33 ? 614  GLU A OE2 1 
ATOM   2974 N  N   . TRP A 1 392 ? 11.179  65.186 21.775  1.00 21.07 ? 615  TRP A N   1 
ATOM   2975 C  CA  . TRP A 1 392 ? 11.045  64.709 23.188  1.00 20.91 ? 615  TRP A CA  1 
ATOM   2976 C  C   . TRP A 1 392 ? 10.364  65.774 24.051  1.00 21.18 ? 615  TRP A C   1 
ATOM   2977 O  O   . TRP A 1 392 ? 9.495   65.465 24.868  1.00 20.91 ? 615  TRP A O   1 
ATOM   2978 C  CB  . TRP A 1 392 ? 12.443  64.441 23.776  1.00 19.40 ? 615  TRP A CB  1 
ATOM   2979 C  CG  . TRP A 1 392 ? 12.417  63.779 25.120  1.00 20.23 ? 615  TRP A CG  1 
ATOM   2980 C  CD1 . TRP A 1 392 ? 12.356  62.424 25.371  1.00 19.99 ? 615  TRP A CD1 1 
ATOM   2981 C  CD2 . TRP A 1 392 ? 12.451  64.420 26.404  1.00 21.17 ? 615  TRP A CD2 1 
ATOM   2982 N  NE1 . TRP A 1 392 ? 12.349  62.183 26.730  1.00 20.47 ? 615  TRP A NE1 1 
ATOM   2983 C  CE2 . TRP A 1 392 ? 12.396  63.384 27.390  1.00 20.02 ? 615  TRP A CE2 1 
ATOM   2984 C  CE3 . TRP A 1 392 ? 12.484  65.760 26.823  1.00 22.02 ? 615  TRP A CE3 1 
ATOM   2985 C  CZ2 . TRP A 1 392 ? 12.413  63.650 28.760  1.00 23.57 ? 615  TRP A CZ2 1 
ATOM   2986 C  CZ3 . TRP A 1 392 ? 12.480  66.032 28.204  1.00 25.34 ? 615  TRP A CZ3 1 
ATOM   2987 C  CH2 . TRP A 1 392 ? 12.454  64.976 29.157  1.00 25.00 ? 615  TRP A CH2 1 
ATOM   2988 N  N   . THR A 1 393 ? 10.804  67.020 23.898  1.00 21.52 ? 616  THR A N   1 
ATOM   2989 C  CA  . THR A 1 393 ? 10.224  68.131 24.664  1.00 22.69 ? 616  THR A CA  1 
ATOM   2990 C  C   . THR A 1 393 ? 8.723   68.291 24.405  1.00 22.82 ? 616  THR A C   1 
ATOM   2991 O  O   . THR A 1 393 ? 7.923   68.390 25.356  1.00 23.42 ? 616  THR A O   1 
ATOM   2992 C  CB  . THR A 1 393 ? 10.978  69.435 24.354  1.00 21.81 ? 616  THR A CB  1 
ATOM   2993 O  OG1 . THR A 1 393 ? 12.360  69.199 24.601  1.00 23.19 ? 616  THR A OG1 1 
ATOM   2994 C  CG2 . THR A 1 393 ? 10.470  70.611 25.223  1.00 22.82 ? 616  THR A CG2 1 
ATOM   2995 N  N   . SER A 1 394 ? 8.338   68.280 23.130  1.00 23.54 ? 617  SER A N   1 
ATOM   2996 C  CA  . SER A 1 394 ? 6.908   68.374 22.776  1.00 23.54 ? 617  SER A CA  1 
ATOM   2997 C  C   . SER A 1 394 ? 6.146   67.134 23.240  1.00 22.91 ? 617  SER A C   1 
ATOM   2998 O  O   . SER A 1 394 ? 5.027   67.232 23.745  1.00 22.07 ? 617  SER A O   1 
ATOM   2999 C  CB  . SER A 1 394 ? 6.708   68.604 21.280  1.00 23.64 ? 617  SER A CB  1 
ATOM   3000 O  OG  . SER A 1 394 ? 7.342   67.595 20.549  1.00 26.41 ? 617  SER A OG  1 
ATOM   3001 N  N   . CYS A 1 395 ? 6.754   65.966 23.089  1.00 22.04 ? 618  CYS A N   1 
ATOM   3002 C  CA  . CYS A 1 395 ? 6.127   64.718 23.528  1.00 21.05 ? 618  CYS A CA  1 
ATOM   3003 C  C   . CYS A 1 395 ? 5.805   64.771 25.007  1.00 20.84 ? 618  CYS A C   1 
ATOM   3004 O  O   . CYS A 1 395 ? 4.684   64.430 25.419  1.00 20.69 ? 618  CYS A O   1 
ATOM   3005 C  CB  . CYS A 1 395 ? 7.067   63.516 23.203  1.00 21.20 ? 618  CYS A CB  1 
ATOM   3006 S  SG  . CYS A 1 395 ? 6.435   61.878 23.548  1.00 22.85 ? 618  CYS A SG  1 
ATOM   3007 N  N   . ALA A 1 396 ? 6.785   65.184 25.822  1.00 20.22 ? 619  ALA A N   1 
ATOM   3008 C  CA  . ALA A 1 396 ? 6.656   65.184 27.303  1.00 20.98 ? 619  ALA A CA  1 
ATOM   3009 C  C   . ALA A 1 396 ? 5.757   66.314 27.867  1.00 21.75 ? 619  ALA A C   1 
ATOM   3010 O  O   . ALA A 1 396 ? 5.112   66.152 28.903  1.00 21.33 ? 619  ALA A O   1 
ATOM   3011 C  CB  . ALA A 1 396 ? 8.050   65.260 27.939  1.00 20.76 ? 619  ALA A CB  1 
ATOM   3012 N  N   . GLU A 1 397 ? 5.724   67.444 27.171  1.00 22.33 ? 620  GLU A N   1 
ATOM   3013 C  CA  . GLU A 1 397 ? 5.049   68.666 27.675  1.00 24.07 ? 620  GLU A CA  1 
ATOM   3014 C  C   . GLU A 1 397 ? 3.603   68.481 28.120  1.00 23.63 ? 620  GLU A C   1 
ATOM   3015 O  O   . GLU A 1 397 ? 3.156   69.164 29.045  1.00 25.46 ? 620  GLU A O   1 
ATOM   3016 C  CB  . GLU A 1 397 ? 5.132   69.792 26.634  1.00 24.18 ? 620  GLU A CB  1 
ATOM   3017 C  CG  . GLU A 1 397 ? 4.497   71.161 27.094  1.00 30.13 ? 620  GLU A CG  1 
ATOM   3018 C  CD  . GLU A 1 397 ? 2.968   71.196 26.975  1.00 35.11 ? 620  GLU A CD  1 
ATOM   3019 O  OE1 . GLU A 1 397 ? 2.395   70.390 26.206  1.00 38.17 ? 620  GLU A OE1 1 
ATOM   3020 O  OE2 . GLU A 1 397 ? 2.328   72.028 27.663  1.00 39.33 ? 620  GLU A OE2 1 
ATOM   3021 N  N   . VAL A 1 398 ? 2.888   67.565 27.484  1.00 23.84 ? 621  VAL A N   1 
ATOM   3022 C  CA  . VAL A 1 398 ? 1.465   67.361 27.780  1.00 23.75 ? 621  VAL A CA  1 
ATOM   3023 C  C   . VAL A 1 398 ? 1.157   66.870 29.199  1.00 24.89 ? 621  VAL A C   1 
ATOM   3024 O  O   . VAL A 1 398 ? -0.021  66.867 29.591  1.00 24.70 ? 621  VAL A O   1 
ATOM   3025 C  CB  . VAL A 1 398 ? 0.767   66.445 26.771  1.00 23.93 ? 621  VAL A CB  1 
ATOM   3026 C  CG1 . VAL A 1 398 ? 0.981   66.957 25.334  1.00 24.34 ? 621  VAL A CG1 1 
ATOM   3027 C  CG2 . VAL A 1 398 ? 1.205   64.967 26.916  1.00 21.86 ? 621  VAL A CG2 1 
ATOM   3028 N  N   . VAL A 1 399 ? 2.180   66.462 29.964  1.00 24.02 ? 622  VAL A N   1 
ATOM   3029 C  CA  . VAL A 1 399 ? 1.971   66.152 31.375  1.00 24.96 ? 622  VAL A CA  1 
ATOM   3030 C  C   . VAL A 1 399 ? 1.428   67.359 32.130  1.00 25.65 ? 622  VAL A C   1 
ATOM   3031 O  O   . VAL A 1 399 ? 0.809   67.194 33.184  1.00 24.79 ? 622  VAL A O   1 
ATOM   3032 C  CB  . VAL A 1 399 ? 3.242   65.659 32.153  1.00 25.18 ? 622  VAL A CB  1 
ATOM   3033 C  CG1 . VAL A 1 399 ? 3.681   64.295 31.680  1.00 25.30 ? 622  VAL A CG1 1 
ATOM   3034 C  CG2 . VAL A 1 399 ? 4.357   66.655 32.099  1.00 24.41 ? 622  VAL A CG2 1 
ATOM   3035 N  N   . SER A 1 400 ? 1.691   68.560 31.606  1.00 26.83 ? 623  SER A N   1 
ATOM   3036 C  CA  . SER A 1 400 ? 1.158   69.789 32.199  1.00 28.68 ? 623  SER A CA  1 
ATOM   3037 C  C   . SER A 1 400 ? -0.373  69.896 32.168  1.00 29.03 ? 623  SER A C   1 
ATOM   3038 O  O   . SER A 1 400 ? -0.927  70.748 32.847  1.00 30.07 ? 623  SER A O   1 
ATOM   3039 C  CB  . SER A 1 400 ? 1.821   71.039 31.599  1.00 28.36 ? 623  SER A CB  1 
ATOM   3040 O  OG  . SER A 1 400 ? 1.381   71.227 30.272  1.00 31.11 ? 623  SER A OG  1 
ATOM   3041 N  N   . GLN A 1 401 ? -1.047  69.021 31.424  1.00 29.60 ? 624  GLN A N   1 
ATOM   3042 C  CA  . GLN A 1 401 ? -2.520  68.924 31.449  1.00 30.23 ? 624  GLN A CA  1 
ATOM   3043 C  C   . GLN A 1 401 ? -3.019  67.979 32.549  1.00 30.06 ? 624  GLN A C   1 
ATOM   3044 O  O   . GLN A 1 401 ? -4.222  67.944 32.851  1.00 30.18 ? 624  GLN A O   1 
ATOM   3045 C  CB  . GLN A 1 401 ? -3.069  68.404 30.115  1.00 30.49 ? 624  GLN A CB  1 
ATOM   3046 C  CG  . GLN A 1 401 ? -2.718  69.243 28.881  1.00 32.39 ? 624  GLN A CG  1 
ATOM   3047 C  CD  . GLN A 1 401 ? -3.142  68.590 27.579  1.00 31.76 ? 624  GLN A CD  1 
ATOM   3048 O  OE1 . GLN A 1 401 ? -4.122  67.829 27.512  1.00 36.09 ? 624  GLN A OE1 1 
ATOM   3049 N  NE2 . GLN A 1 401 ? -2.421  68.895 26.527  1.00 33.98 ? 624  GLN A NE2 1 
ATOM   3050 N  N   . GLU A 1 402 ? -2.118  67.162 33.102  1.00 28.90 ? 625  GLU A N   1 
ATOM   3051 C  CA  . GLU A 1 402 ? -2.500  66.182 34.091  1.00 28.21 ? 625  GLU A CA  1 
ATOM   3052 C  C   . GLU A 1 402 ? -2.469  66.841 35.469  1.00 28.41 ? 625  GLU A C   1 
ATOM   3053 O  O   . GLU A 1 402 ? -1.543  66.669 36.272  1.00 26.38 ? 625  GLU A O   1 
ATOM   3054 C  CB  . GLU A 1 402 ? -1.606  64.920 33.999  1.00 28.70 ? 625  GLU A CB  1 
ATOM   3055 C  CG  . GLU A 1 402 ? -1.977  63.793 34.959  1.00 27.84 ? 625  GLU A CG  1 
ATOM   3056 C  CD  . GLU A 1 402 ? -3.475  63.603 35.109  1.00 32.71 ? 625  GLU A CD  1 
ATOM   3057 O  OE1 . GLU A 1 402 ? -4.041  63.948 36.178  1.00 29.46 ? 625  GLU A OE1 1 
ATOM   3058 O  OE2 . GLU A 1 402 ? -4.089  63.134 34.140  1.00 33.16 ? 625  GLU A OE2 1 
ATOM   3059 N  N   . LYS A 1 403 ? -3.514  67.619 35.733  1.00 28.09 ? 626  LYS A N   1 
ATOM   3060 C  CA  . LYS A 1 403 ? -3.594  68.396 36.947  1.00 28.58 ? 626  LYS A CA  1 
ATOM   3061 C  C   . LYS A 1 403 ? -4.068  67.591 38.152  1.00 28.04 ? 626  LYS A C   1 
ATOM   3062 O  O   . LYS A 1 403 ? -3.929  68.022 39.285  1.00 28.26 ? 626  LYS A O   1 
ATOM   3063 C  CB  . LYS A 1 403 ? -4.497  69.624 36.714  1.00 28.90 ? 626  LYS A CB  1 
ATOM   3064 C  CG  . LYS A 1 403 ? -3.875  70.664 35.777  1.00 31.00 ? 626  LYS A CG  1 
ATOM   3065 C  CD  . LYS A 1 403 ? -2.564  71.210 36.350  1.00 33.28 ? 626  LYS A CD  1 
ATOM   3066 C  CE  . LYS A 1 403 ? -1.763  71.972 35.304  1.00 35.16 ? 626  LYS A CE  1 
ATOM   3067 N  NZ  . LYS A 1 403 ? -0.259  71.803 35.497  1.00 31.54 ? 626  LYS A NZ  1 
ATOM   3068 N  N   . THR A 1 404 ? -4.625  66.419 37.912  1.00 27.82 ? 627  THR A N   1 
ATOM   3069 C  CA  . THR A 1 404 ? -5.118  65.599 39.004  1.00 28.32 ? 627  THR A CA  1 
ATOM   3070 C  C   . THR A 1 404 ? -3.983  64.770 39.630  1.00 26.50 ? 627  THR A C   1 
ATOM   3071 O  O   . THR A 1 404 ? -3.878  64.697 40.844  1.00 25.49 ? 627  THR A O   1 
ATOM   3072 C  CB  . THR A 1 404 ? -6.331  64.760 38.581  1.00 28.76 ? 627  THR A CB  1 
ATOM   3073 O  OG1 . THR A 1 404 ? -7.469  65.630 38.443  1.00 32.84 ? 627  THR A OG1 1 
ATOM   3074 C  CG2 . THR A 1 404 ? -6.660  63.675 39.602  1.00 30.85 ? 627  THR A CG2 1 
ATOM   3075 N  N   . MET A 1 405 ? -3.115  64.187 38.806  1.00 24.54 ? 628  MET A N   1 
ATOM   3076 C  CA  . MET A 1 405 ? -1.969  63.486 39.383  1.00 23.01 ? 628  MET A CA  1 
ATOM   3077 C  C   . MET A 1 405 ? -0.820  64.435 39.757  1.00 20.74 ? 628  MET A C   1 
ATOM   3078 O  O   . MET A 1 405 ? 0.000   64.125 40.632  1.00 19.29 ? 628  MET A O   1 
ATOM   3079 C  CB  . MET A 1 405 ? -1.418  62.352 38.484  1.00 23.86 ? 628  MET A CB  1 
ATOM   3080 C  CG  . MET A 1 405 ? -0.515  61.392 39.318  1.00 25.85 ? 628  MET A CG  1 
ATOM   3081 S  SD  . MET A 1 405 ? -1.618  60.319 40.243  1.00 33.84 ? 628  MET A SD  1 
ATOM   3082 C  CE  . MET A 1 405 ? -0.779  59.887 41.736  1.00 36.82 ? 628  MET A CE  1 
ATOM   3083 N  N   . PHE A 1 406 ? -0.715  65.531 39.019  1.00 19.97 ? 629  PHE A N   1 
ATOM   3084 C  CA  . PHE A 1 406 ? 0.333   66.521 39.212  1.00 19.91 ? 629  PHE A CA  1 
ATOM   3085 C  C   . PHE A 1 406 ? -0.285  67.920 39.518  1.00 21.41 ? 629  PHE A C   1 
ATOM   3086 O  O   . PHE A 1 406 ? -0.063  68.869 38.772  1.00 21.24 ? 629  PHE A O   1 
ATOM   3087 C  CB  . PHE A 1 406 ? 1.272   66.567 37.992  1.00 20.39 ? 629  PHE A CB  1 
ATOM   3088 C  CG  . PHE A 1 406 ? 1.623   65.187 37.458  1.00 17.58 ? 629  PHE A CG  1 
ATOM   3089 C  CD1 . PHE A 1 406 ? 1.431   64.877 36.117  1.00 22.37 ? 629  PHE A CD1 1 
ATOM   3090 C  CD2 . PHE A 1 406 ? 2.081   64.180 38.327  1.00 19.09 ? 629  PHE A CD2 1 
ATOM   3091 C  CE1 . PHE A 1 406 ? 1.711   63.606 35.615  1.00 20.00 ? 629  PHE A CE1 1 
ATOM   3092 C  CE2 . PHE A 1 406 ? 2.368   62.861 37.821  1.00 21.09 ? 629  PHE A CE2 1 
ATOM   3093 C  CZ  . PHE A 1 406 ? 2.177   62.603 36.471  1.00 19.90 ? 629  PHE A CZ  1 
ATOM   3094 N  N   . PRO A 1 407 ? -1.044  68.035 40.626  1.00 22.30 ? 630  PRO A N   1 
ATOM   3095 C  CA  . PRO A 1 407 ? -1.680  69.336 40.941  1.00 23.37 ? 630  PRO A CA  1 
ATOM   3096 C  C   . PRO A 1 407 ? -0.680  70.451 41.141  1.00 24.96 ? 630  PRO A C   1 
ATOM   3097 O  O   . PRO A 1 407 ? -1.000  71.605 40.920  1.00 24.66 ? 630  PRO A O   1 
ATOM   3098 C  CB  . PRO A 1 407 ? -2.397  69.085 42.274  1.00 23.49 ? 630  PRO A CB  1 
ATOM   3099 C  CG  . PRO A 1 407 ? -1.818  67.837 42.838  1.00 23.22 ? 630  PRO A CG  1 
ATOM   3100 C  CD  . PRO A 1 407 ? -1.369  67.009 41.630  1.00 21.56 ? 630  PRO A CD  1 
ATOM   3101 N  N   . ASN A 1 408 ? 0.521   70.104 41.559  1.00 26.18 ? 631  ASN A N   1 
ATOM   3102 C  CA  . ASN A 1 408 ? 1.544   71.116 41.787  1.00 28.45 ? 631  ASN A CA  1 
ATOM   3103 C  C   . ASN A 1 408 ? 2.792   70.977 40.902  1.00 29.96 ? 631  ASN A C   1 
ATOM   3104 O  O   . ASN A 1 408 ? 3.904   70.754 41.403  1.00 31.07 ? 631  ASN A O   1 
ATOM   3105 C  CB  . ASN A 1 408 ? 1.908   71.052 43.255  1.00 28.19 ? 631  ASN A CB  1 
ATOM   3106 C  CG  . ASN A 1 408 ? 2.747   72.192 43.687  1.00 30.03 ? 631  ASN A CG  1 
ATOM   3107 O  OD1 . ASN A 1 408 ? 2.656   73.288 43.140  1.00 31.46 ? 631  ASN A OD1 1 
ATOM   3108 N  ND2 . ASN A 1 408 ? 3.617   71.939 44.663  1.00 31.32 ? 631  ASN A ND2 1 
ATOM   3109 N  N   . LEU A 1 409 ? 2.617   71.106 39.594  1.00 30.55 ? 632  LEU A N   1 
ATOM   3110 C  CA  . LEU A 1 409 ? 3.726   70.899 38.653  1.00 31.97 ? 632  LEU A CA  1 
ATOM   3111 C  C   . LEU A 1 409 ? 4.191   72.231 38.100  1.00 32.99 ? 632  LEU A C   1 
ATOM   3112 O  O   . LEU A 1 409 ? 3.506   72.828 37.260  1.00 33.03 ? 632  LEU A O   1 
ATOM   3113 C  CB  . LEU A 1 409 ? 3.293   69.979 37.495  1.00 32.02 ? 632  LEU A CB  1 
ATOM   3114 C  CG  . LEU A 1 409 ? 4.333   69.482 36.476  1.00 31.91 ? 632  LEU A CG  1 
ATOM   3115 C  CD1 . LEU A 1 409 ? 5.330   68.555 37.158  1.00 28.13 ? 632  LEU A CD1 1 
ATOM   3116 C  CD2 . LEU A 1 409 ? 3.635   68.748 35.343  1.00 31.55 ? 632  LEU A CD2 1 
ATOM   3117 N  N   . THR A 1 410 ? 5.351   72.690 38.567  1.00 34.36 ? 633  THR A N   1 
ATOM   3118 C  CA  . THR A 1 410 ? 5.918   73.973 38.112  1.00 36.09 ? 633  THR A CA  1 
ATOM   3119 C  C   . THR A 1 410 ? 6.746   73.847 36.831  1.00 36.07 ? 633  THR A C   1 
ATOM   3120 O  O   . THR A 1 410 ? 6.845   74.797 36.050  1.00 37.09 ? 633  THR A O   1 
ATOM   3121 C  CB  . THR A 1 410 ? 6.794   74.612 39.189  1.00 36.41 ? 633  THR A CB  1 
ATOM   3122 O  OG1 . THR A 1 410 ? 7.804   73.675 39.602  1.00 38.65 ? 633  THR A OG1 1 
ATOM   3123 C  CG2 . THR A 1 410 ? 5.928   75.022 40.403  1.00 38.09 ? 633  THR A CG2 1 
ATOM   3124 N  N   . ASP A 1 411 ? 7.363   72.685 36.639  1.00 34.71 ? 634  ASP A N   1 
ATOM   3125 C  CA  . ASP A 1 411 ? 8.199   72.420 35.476  1.00 33.21 ? 634  ASP A CA  1 
ATOM   3126 C  C   . ASP A 1 411 ? 7.977   70.960 35.110  1.00 31.15 ? 634  ASP A C   1 
ATOM   3127 O  O   . ASP A 1 411 ? 7.991   70.094 35.976  1.00 30.35 ? 634  ASP A O   1 
ATOM   3128 C  CB  . ASP A 1 411 ? 9.672   72.697 35.795  1.00 33.82 ? 634  ASP A CB  1 
ATOM   3129 C  CG  . ASP A 1 411 ? 10.619  72.534 34.566  1.00 37.53 ? 634  ASP A CG  1 
ATOM   3130 O  OD1 . ASP A 1 411 ? 10.310  71.822 33.567  1.00 37.97 ? 634  ASP A OD1 1 
ATOM   3131 O  OD2 . ASP A 1 411 ? 11.729  73.122 34.630  1.00 42.42 ? 634  ASP A OD2 1 
ATOM   3132 N  N   . VAL A 1 412 ? 7.753   70.716 33.824  1.00 29.75 ? 635  VAL A N   1 
ATOM   3133 C  CA  . VAL A 1 412 ? 7.617   69.352 33.242  1.00 29.17 ? 635  VAL A CA  1 
ATOM   3134 C  C   . VAL A 1 412 ? 8.696   68.389 33.752  1.00 28.75 ? 635  VAL A C   1 
ATOM   3135 O  O   . VAL A 1 412 ? 8.442   67.211 33.981  1.00 28.61 ? 635  VAL A O   1 
ATOM   3136 C  CB  . VAL A 1 412 ? 7.627   69.400 31.681  1.00 27.98 ? 635  VAL A CB  1 
ATOM   3137 C  CG1 . VAL A 1 412 ? 8.096   68.065 31.070  1.00 26.94 ? 635  VAL A CG1 1 
ATOM   3138 C  CG2 . VAL A 1 412 ? 6.230   69.724 31.149  1.00 30.25 ? 635  VAL A CG2 1 
ATOM   3139 N  N   . ARG A 1 413 ? 9.898   68.912 33.957  1.00 29.49 ? 636  ARG A N   1 
ATOM   3140 C  CA  . ARG A 1 413 ? 11.034  68.070 34.325  1.00 29.05 ? 636  ARG A CA  1 
ATOM   3141 C  C   . ARG A 1 413 ? 11.013  67.597 35.776  1.00 28.17 ? 636  ARG A C   1 
ATOM   3142 O  O   . ARG A 1 413 ? 11.837  66.788 36.178  1.00 26.66 ? 636  ARG A O   1 
ATOM   3143 C  CB  . ARG A 1 413 ? 12.342  68.761 33.958  1.00 29.81 ? 636  ARG A CB  1 
ATOM   3144 C  CG  . ARG A 1 413 ? 12.524  68.889 32.424  1.00 36.01 ? 636  ARG A CG  1 
ATOM   3145 C  CD  . ARG A 1 413 ? 12.861  67.529 31.798  1.00 42.74 ? 636  ARG A CD  1 
ATOM   3146 N  NE  . ARG A 1 413 ? 13.915  67.593 30.779  1.00 47.29 ? 636  ARG A NE  1 
ATOM   3147 C  CZ  . ARG A 1 413 ? 15.226  67.600 31.017  1.00 48.99 ? 636  ARG A CZ  1 
ATOM   3148 N  NH1 . ARG A 1 413 ? 15.687  67.565 32.263  1.00 50.76 ? 636  ARG A NH1 1 
ATOM   3149 N  NH2 . ARG A 1 413 ? 16.083  67.651 29.994  1.00 49.95 ? 636  ARG A NH2 1 
ATOM   3150 N  N   . GLU A 1 414 ? 10.054  68.078 36.557  1.00 27.57 ? 637  GLU A N   1 
ATOM   3151 C  CA  . GLU A 1 414 ? 9.862   67.553 37.897  1.00 27.77 ? 637  GLU A CA  1 
ATOM   3152 C  C   . GLU A 1 414 ? 9.255   66.134 37.894  1.00 27.03 ? 637  GLU A C   1 
ATOM   3153 O  O   . GLU A 1 414 ? 9.330   65.428 38.913  1.00 26.62 ? 637  GLU A O   1 
ATOM   3154 C  CB  . GLU A 1 414 ? 8.966   68.489 38.698  1.00 28.74 ? 637  GLU A CB  1 
ATOM   3155 C  CG  . GLU A 1 414 ? 9.645   69.752 39.135  1.00 30.27 ? 637  GLU A CG  1 
ATOM   3156 C  CD  . GLU A 1 414 ? 10.880  69.501 40.000  1.00 32.87 ? 637  GLU A CD  1 
ATOM   3157 O  OE1 . GLU A 1 414 ? 10.864  68.618 40.899  1.00 36.31 ? 637  GLU A OE1 1 
ATOM   3158 O  OE2 . GLU A 1 414 ? 11.872  70.212 39.772  1.00 37.44 ? 637  GLU A OE2 1 
ATOM   3159 N  N   . VAL A 1 415 ? 8.615   65.759 36.777  1.00 25.86 ? 638  VAL A N   1 
ATOM   3160 C  CA  . VAL A 1 415 ? 7.973   64.430 36.639  1.00 25.71 ? 638  VAL A CA  1 
ATOM   3161 C  C   . VAL A 1 415 ? 8.560   63.650 35.473  1.00 23.93 ? 638  VAL A C   1 
ATOM   3162 O  O   . VAL A 1 415 ? 8.844   62.463 35.610  1.00 23.83 ? 638  VAL A O   1 
ATOM   3163 C  CB  . VAL A 1 415 ? 6.418   64.456 36.483  1.00 25.69 ? 638  VAL A CB  1 
ATOM   3164 C  CG1 . VAL A 1 415 ? 5.801   64.877 37.751  1.00 28.94 ? 638  VAL A CG1 1 
ATOM   3165 C  CG2 . VAL A 1 415 ? 5.949   65.383 35.355  1.00 26.59 ? 638  VAL A CG2 1 
ATOM   3166 N  N   . VAL A 1 416 ? 8.728   64.325 34.336  1.00 22.13 ? 639  VAL A N   1 
ATOM   3167 C  CA  . VAL A 1 416 ? 9.412   63.700 33.209  1.00 20.94 ? 639  VAL A CA  1 
ATOM   3168 C  C   . VAL A 1 416 ? 10.867  64.167 33.203  1.00 20.75 ? 639  VAL A C   1 
ATOM   3169 O  O   . VAL A 1 416 ? 11.219  65.122 32.519  1.00 20.56 ? 639  VAL A O   1 
ATOM   3170 C  CB  . VAL A 1 416 ? 8.791   63.963 31.833  1.00 21.10 ? 639  VAL A CB  1 
ATOM   3171 C  CG1 . VAL A 1 416 ? 9.441   63.018 30.776  1.00 19.82 ? 639  VAL A CG1 1 
ATOM   3172 C  CG2 . VAL A 1 416 ? 7.263   63.782 31.845  1.00 21.47 ? 639  VAL A CG2 1 
ATOM   3173 N  N   . THR A 1 417 ? 11.699  63.465 33.966  1.00 20.24 ? 640  THR A N   1 
ATOM   3174 C  CA  . THR A 1 417 ? 13.099  63.790 34.024  1.00 19.82 ? 640  THR A CA  1 
ATOM   3175 C  C   . THR A 1 417 ? 13.834  63.241 32.786  1.00 20.23 ? 640  THR A C   1 
ATOM   3176 O  O   . THR A 1 417 ? 13.263  62.491 31.972  1.00 17.00 ? 640  THR A O   1 
ATOM   3177 C  CB  . THR A 1 417 ? 13.729  63.191 35.295  1.00 20.79 ? 640  THR A CB  1 
ATOM   3178 O  OG1 . THR A 1 417 ? 13.838  61.766 35.141  1.00 18.54 ? 640  THR A OG1 1 
ATOM   3179 C  CG2 . THR A 1 417 ? 12.891  63.499 36.532  1.00 17.58 ? 640  THR A CG2 1 
ATOM   3180 N  N   . ASP A 1 418 ? 15.131  63.545 32.700  1.00 19.00 ? 641  ASP A N   1 
ATOM   3181 C  CA  . ASP A 1 418 ? 15.955  62.993 31.618  1.00 20.72 ? 641  ASP A CA  1 
ATOM   3182 C  C   . ASP A 1 418 ? 16.141  61.470 31.697  1.00 18.55 ? 641  ASP A C   1 
ATOM   3183 O  O   . ASP A 1 418 ? 16.727  60.883 30.784  1.00 19.64 ? 641  ASP A O   1 
ATOM   3184 C  CB  . ASP A 1 418 ? 17.326  63.688 31.552  1.00 21.21 ? 641  ASP A CB  1 
ATOM   3185 C  CG  . ASP A 1 418 ? 18.134  63.526 32.823  1.00 27.85 ? 641  ASP A CG  1 
ATOM   3186 O  OD1 . ASP A 1 418 ? 17.661  62.888 33.808  1.00 32.44 ? 641  ASP A OD1 1 
ATOM   3187 O  OD2 . ASP A 1 418 ? 19.299  64.043 32.849  1.00 37.65 ? 641  ASP A OD2 1 
ATOM   3188 N  N   . GLN A 1 419 ? 15.674  60.835 32.775  1.00 16.61 ? 642  GLN A N   1 
ATOM   3189 C  CA  . GLN A 1 419 ? 15.734  59.367 32.861  1.00 16.48 ? 642  GLN A CA  1 
ATOM   3190 C  C   . GLN A 1 419 ? 14.754  58.640 31.922  1.00 16.06 ? 642  GLN A C   1 
ATOM   3191 O  O   . GLN A 1 419 ? 14.792  57.380 31.824  1.00 15.27 ? 642  GLN A O   1 
ATOM   3192 C  CB  . GLN A 1 419 ? 15.452  58.902 34.284  1.00 18.08 ? 642  GLN A CB  1 
ATOM   3193 C  CG  . GLN A 1 419 ? 16.580  59.179 35.300  1.00 18.84 ? 642  GLN A CG  1 
ATOM   3194 C  CD  . GLN A 1 419 ? 16.405  58.314 36.534  1.00 20.36 ? 642  GLN A CD  1 
ATOM   3195 O  OE1 . GLN A 1 419 ? 15.276  58.058 36.951  1.00 20.00 ? 642  GLN A OE1 1 
ATOM   3196 N  NE2 . GLN A 1 419 ? 17.530  57.844 37.129  1.00 20.85 ? 642  GLN A NE2 1 
ATOM   3197 N  N   . PHE A 1 420 ? 13.825  59.396 31.307  1.00 15.79 ? 643  PHE A N   1 
ATOM   3198 C  CA  . PHE A 1 420 ? 12.728  58.767 30.517  1.00 14.78 ? 643  PHE A CA  1 
ATOM   3199 C  C   . PHE A 1 420 ? 12.778  59.000 29.035  1.00 15.00 ? 643  PHE A C   1 
ATOM   3200 O  O   . PHE A 1 420 ? 12.973  60.132 28.595  1.00 16.76 ? 643  PHE A O   1 
ATOM   3201 C  CB  . PHE A 1 420 ? 11.342  59.249 31.004  1.00 14.61 ? 643  PHE A CB  1 
ATOM   3202 C  CG  . PHE A 1 420 ? 11.061  58.897 32.422  1.00 14.62 ? 643  PHE A CG  1 
ATOM   3203 C  CD1 . PHE A 1 420 ? 11.367  59.787 33.445  1.00 14.55 ? 643  PHE A CD1 1 
ATOM   3204 C  CD2 . PHE A 1 420 ? 10.497  57.674 32.733  1.00 14.22 ? 643  PHE A CD2 1 
ATOM   3205 C  CE1 . PHE A 1 420 ? 11.145  59.465 34.748  1.00 16.50 ? 643  PHE A CE1 1 
ATOM   3206 C  CE2 . PHE A 1 420 ? 10.270  57.318 34.057  1.00 15.55 ? 643  PHE A CE2 1 
ATOM   3207 C  CZ  . PHE A 1 420 ? 10.589  58.237 35.075  1.00 15.27 ? 643  PHE A CZ  1 
ATOM   3208 N  N   . LEU A 1 421 ? 12.538  57.929 28.269  1.00 13.21 ? 644  LEU A N   1 
ATOM   3209 C  CA  . LEU A 1 421 ? 12.176  58.038 26.875  1.00 13.87 ? 644  LEU A CA  1 
ATOM   3210 C  C   . LEU A 1 421 ? 10.664  58.390 26.841  1.00 15.49 ? 644  LEU A C   1 
ATOM   3211 O  O   . LEU A 1 421 ? 9.954   58.157 27.826  1.00 13.17 ? 644  LEU A O   1 
ATOM   3212 C  CB  . LEU A 1 421 ? 12.383  56.700 26.169  1.00 13.15 ? 644  LEU A CB  1 
ATOM   3213 C  CG  . LEU A 1 421 ? 13.804  56.171 26.079  1.00 12.72 ? 644  LEU A CG  1 
ATOM   3214 C  CD1 . LEU A 1 421 ? 13.688  54.644 25.783  1.00 12.56 ? 644  LEU A CD1 1 
ATOM   3215 C  CD2 . LEU A 1 421 ? 14.605  56.873 25.013  1.00 16.41 ? 644  LEU A CD2 1 
ATOM   3216 N  N   . CYS A 1 422 ? 10.204  58.948 25.714  1.00 16.31 ? 645  CYS A N   1 
ATOM   3217 C  CA  . CYS A 1 422 ? 8.791   59.376 25.554  1.00 17.30 ? 645  CYS A CA  1 
ATOM   3218 C  C   . CYS A 1 422 ? 8.203   58.798 24.250  1.00 16.64 ? 645  CYS A C   1 
ATOM   3219 O  O   . CYS A 1 422 ? 8.877   58.770 23.195  1.00 15.27 ? 645  CYS A O   1 
ATOM   3220 C  CB  . CYS A 1 422 ? 8.667   60.935 25.564  1.00 18.35 ? 645  CYS A CB  1 
ATOM   3221 S  SG  . CYS A 1 422 ? 6.898   61.556 25.542  1.00 27.97 ? 645  CYS A SG  1 
ATOM   3222 N  N   . SER A 1 423 ? 6.957   58.321 24.320  1.00 15.32 ? 646  SER A N   1 
ATOM   3223 C  CA  . SER A 1 423 ? 6.210   57.893 23.120  1.00 15.62 ? 646  SER A CA  1 
ATOM   3224 C  C   . SER A 1 423 ? 4.690   58.056 23.409  1.00 16.04 ? 646  SER A C   1 
ATOM   3225 O  O   . SER A 1 423 ? 4.314   58.561 24.462  1.00 15.84 ? 646  SER A O   1 
ATOM   3226 C  CB  . SER A 1 423 ? 6.536   56.435 22.720  1.00 13.86 ? 646  SER A CB  1 
ATOM   3227 O  OG  . SER A 1 423 ? 6.069   55.485 23.672  1.00 15.91 ? 646  SER A OG  1 
ATOM   3228 N  N   . GLY A 1 424 ? 3.829   57.634 22.492  1.00 16.85 ? 647  GLY A N   1 
ATOM   3229 C  CA  . GLY A 1 424 ? 2.363   57.688 22.798  1.00 17.51 ? 647  GLY A CA  1 
ATOM   3230 C  C   . GLY A 1 424 ? 1.638   58.708 21.939  1.00 19.43 ? 647  GLY A C   1 
ATOM   3231 O  O   . GLY A 1 424 ? 0.399   58.806 22.016  1.00 19.73 ? 647  GLY A O   1 
ATOM   3232 N  N   . THR A 1 425 ? 2.388   59.452 21.116  1.00 20.38 ? 648  THR A N   1 
ATOM   3233 C  CA  . THR A 1 425 ? 1.808   60.432 20.186  1.00 21.37 ? 648  THR A CA  1 
ATOM   3234 C  C   . THR A 1 425 ? 1.083   59.746 19.033  1.00 22.58 ? 648  THR A C   1 
ATOM   3235 O  O   . THR A 1 425 ? 1.341   58.579 18.734  1.00 22.53 ? 648  THR A O   1 
ATOM   3236 C  CB  . THR A 1 425 ? 2.875   61.380 19.563  1.00 20.98 ? 648  THR A CB  1 
ATOM   3237 O  OG1 . THR A 1 425 ? 3.707   60.649 18.655  1.00 19.98 ? 648  THR A OG1 1 
ATOM   3238 C  CG2 . THR A 1 425 ? 3.768   62.055 20.659  1.00 19.28 ? 648  THR A CG2 1 
ATOM   3239 N  N   . GLN A 1 426 ? 0.223   60.516 18.364  1.00 23.66 ? 649  GLN A N   1 
ATOM   3240 C  CA  . GLN A 1 426 ? -0.503  60.093 17.162  1.00 25.26 ? 649  GLN A CA  1 
ATOM   3241 C  C   . GLN A 1 426 ? -1.060  58.687 17.302  1.00 24.20 ? 649  GLN A C   1 
ATOM   3242 O  O   . GLN A 1 426 ? -1.810  58.414 18.227  1.00 25.54 ? 649  GLN A O   1 
ATOM   3243 C  CB  . GLN A 1 426 ? 0.339   60.256 15.872  1.00 26.24 ? 649  GLN A CB  1 
ATOM   3244 C  CG  . GLN A 1 426 ? 1.130   61.594 15.719  1.00 31.31 ? 649  GLN A CG  1 
ATOM   3245 C  CD  . GLN A 1 426 ? 1.764   61.775 14.317  1.00 38.26 ? 649  GLN A CD  1 
ATOM   3246 O  OE1 . GLN A 1 426 ? 2.975   62.060 14.178  1.00 40.64 ? 649  GLN A OE1 1 
ATOM   3247 N  NE2 . GLN A 1 426 ? 0.940   61.624 13.274  1.00 40.77 ? 649  GLN A NE2 1 
ATOM   3248 N  N   . GLU A 1 427 ? -0.691  57.796 16.392  1.00 23.87 ? 650  GLU A N   1 
ATOM   3249 C  CA  . GLU A 1 427 ? -1.260  56.451 16.324  1.00 24.39 ? 650  GLU A CA  1 
ATOM   3250 C  C   . GLU A 1 427 ? -0.534  55.391 17.149  1.00 23.12 ? 650  GLU A C   1 
ATOM   3251 O  O   . GLU A 1 427 ? -0.835  54.207 17.017  1.00 23.70 ? 650  GLU A O   1 
ATOM   3252 C  CB  . GLU A 1 427 ? -1.355  55.971 14.864  1.00 26.23 ? 650  GLU A CB  1 
ATOM   3253 C  CG  . GLU A 1 427 ? -2.303  56.775 13.956  1.00 29.83 ? 650  GLU A CG  1 
ATOM   3254 C  CD  . GLU A 1 427 ? -3.549  57.228 14.676  1.00 38.93 ? 650  GLU A CD  1 
ATOM   3255 O  OE1 . GLU A 1 427 ? -3.612  58.442 14.984  1.00 43.67 ? 650  GLU A OE1 1 
ATOM   3256 O  OE2 . GLU A 1 427 ? -4.448  56.385 14.974  1.00 40.53 ? 650  GLU A OE2 1 
ATOM   3257 N  N   . ASP A 1 428 ? 0.423   55.804 17.994  1.00 22.28 ? 651  ASP A N   1 
ATOM   3258 C  CA  . ASP A 1 428 ? 1.102   54.867 18.907  1.00 21.26 ? 651  ASP A CA  1 
ATOM   3259 C  C   . ASP A 1 428 ? 0.126   54.095 19.784  1.00 21.60 ? 651  ASP A C   1 
ATOM   3260 O  O   . ASP A 1 428 ? -0.889  54.648 20.243  1.00 23.11 ? 651  ASP A O   1 
ATOM   3261 C  CB  . ASP A 1 428 ? 2.034   55.627 19.873  1.00 20.64 ? 651  ASP A CB  1 
ATOM   3262 C  CG  . ASP A 1 428 ? 3.360   55.993 19.252  1.00 21.85 ? 651  ASP A CG  1 
ATOM   3263 O  OD1 . ASP A 1 428 ? 3.458   55.932 18.001  1.00 16.30 ? 651  ASP A OD1 1 
ATOM   3264 O  OD2 . ASP A 1 428 ? 4.305   56.347 20.031  1.00 17.77 ? 651  ASP A OD2 1 
ATOM   3265 N  N   . GLU A 1 429 ? 0.478   52.849 20.058  1.00 20.27 ? 652  GLU A N   1 
ATOM   3266 C  CA  . GLU A 1 429 ? -0.087  52.097 21.187  1.00 19.65 ? 652  GLU A CA  1 
ATOM   3267 C  C   . GLU A 1 429 ? 0.523   52.601 22.518  1.00 19.26 ? 652  GLU A C   1 
ATOM   3268 O  O   . GLU A 1 429 ? 1.648   53.134 22.533  1.00 18.36 ? 652  GLU A O   1 
ATOM   3269 C  CB  . GLU A 1 429 ? 0.161   50.594 21.007  1.00 19.56 ? 652  GLU A CB  1 
ATOM   3270 C  CG  . GLU A 1 429 ? -0.380  49.995 19.709  1.00 20.51 ? 652  GLU A CG  1 
ATOM   3271 C  CD  . GLU A 1 429 ? -1.915  50.117 19.581  1.00 25.65 ? 652  GLU A CD  1 
ATOM   3272 O  OE1 . GLU A 1 429 ? -2.416  50.276 18.427  1.00 25.34 ? 652  GLU A OE1 1 
ATOM   3273 O  OE2 . GLU A 1 429 ? -2.604  50.071 20.631  1.00 26.13 ? 652  GLU A OE2 1 
ATOM   3274 N  N   . SER A 1 430 ? -0.229  52.424 23.618  1.00 18.18 ? 653  SER A N   1 
ATOM   3275 C  CA  . SER A 1 430 ? 0.156   52.901 24.953  1.00 17.48 ? 653  SER A CA  1 
ATOM   3276 C  C   . SER A 1 430 ? 0.119   51.712 25.876  1.00 17.84 ? 653  SER A C   1 
ATOM   3277 O  O   . SER A 1 430 ? -0.872  50.928 25.839  1.00 19.29 ? 653  SER A O   1 
ATOM   3278 C  CB  . SER A 1 430 ? -0.790  54.011 25.448  1.00 17.62 ? 653  SER A CB  1 
ATOM   3279 O  OG  . SER A 1 430 ? -0.454  55.280 24.903  1.00 20.20 ? 653  SER A OG  1 
ATOM   3280 N  N   . PRO A 1 431 ? 1.209   51.481 26.662  1.00 16.64 ? 654  PRO A N   1 
ATOM   3281 C  CA  . PRO A 1 431 ? 1.186   50.293 27.557  1.00 16.66 ? 654  PRO A CA  1 
ATOM   3282 C  C   . PRO A 1 431 ? 0.062   50.309 28.605  1.00 17.04 ? 654  PRO A C   1 
ATOM   3283 O  O   . PRO A 1 431 ? -0.290  51.386 29.114  1.00 16.25 ? 654  PRO A O   1 
ATOM   3284 C  CB  . PRO A 1 431 ? 2.561   50.356 28.262  1.00 15.95 ? 654  PRO A CB  1 
ATOM   3285 C  CG  . PRO A 1 431 ? 3.438   51.156 27.277  1.00 15.60 ? 654  PRO A CG  1 
ATOM   3286 C  CD  . PRO A 1 431 ? 2.511   52.201 26.734  1.00 17.56 ? 654  PRO A CD  1 
ATOM   3287 N  N   . CYS A 1 432 ? -0.434  49.120 28.941  1.00 17.16 ? 655  CYS A N   1 
ATOM   3288 C  CA  . CYS A 1 432 ? -1.361  48.916 30.067  1.00 19.29 ? 655  CYS A CA  1 
ATOM   3289 C  C   . CYS A 1 432 ? -0.585  48.698 31.380  1.00 19.18 ? 655  CYS A C   1 
ATOM   3290 O  O   . CYS A 1 432 ? 0.629   48.491 31.383  1.00 19.04 ? 655  CYS A O   1 
ATOM   3291 C  CB  . CYS A 1 432 ? -2.328  47.752 29.772  1.00 20.11 ? 655  CYS A CB  1 
ATOM   3292 S  SG  . CYS A 1 432 ? -3.292  48.117 28.285  1.00 22.92 ? 655  CYS A SG  1 
ATOM   3293 N  N   . LYS A 1 433 ? -1.289  48.777 32.503  1.00 19.05 ? 656  LYS A N   1 
ATOM   3294 C  CA  . LYS A 1 433 ? -0.636  48.652 33.822  1.00 20.18 ? 656  LYS A CA  1 
ATOM   3295 C  C   . LYS A 1 433 ? 0.167   47.332 33.962  1.00 19.42 ? 656  LYS A C   1 
ATOM   3296 O  O   . LYS A 1 433 ? 1.320   47.325 34.454  1.00 20.46 ? 656  LYS A O   1 
ATOM   3297 C  CB  . LYS A 1 433 ? -1.699  48.843 34.952  1.00 20.02 ? 656  LYS A CB  1 
ATOM   3298 C  CG  . LYS A 1 433 ? -1.092  48.852 36.336  1.00 24.25 ? 656  LYS A CG  1 
ATOM   3299 C  CD  . LYS A 1 433 ? -2.112  49.011 37.517  1.00 28.02 ? 656  LYS A CD  1 
ATOM   3300 C  CE  . LYS A 1 433 ? -1.341  49.326 38.801  1.00 32.80 ? 656  LYS A CE  1 
ATOM   3301 N  NZ  . LYS A 1 433 ? -2.022  48.889 40.058  1.00 35.14 ? 656  LYS A NZ  1 
ATOM   3302 N  N   . GLY A 1 434 ? -0.411  46.215 33.513  1.00 17.71 ? 657  GLY A N   1 
ATOM   3303 C  CA  . GLY A 1 434 ? 0.258   44.916 33.650  1.00 16.84 ? 657  GLY A CA  1 
ATOM   3304 C  C   . GLY A 1 434 ? 1.396   44.707 32.645  1.00 16.01 ? 657  GLY A C   1 
ATOM   3305 O  O   . GLY A 1 434 ? 2.114   43.715 32.718  1.00 16.52 ? 657  GLY A O   1 
ATOM   3306 N  N   . GLU A 1 435 ? 1.578   45.656 31.734  1.00 16.52 ? 658  GLU A N   1 
ATOM   3307 C  CA  . GLU A 1 435 ? 2.697   45.588 30.756  1.00 16.04 ? 658  GLU A CA  1 
ATOM   3308 C  C   . GLU A 1 435 ? 3.957   46.253 31.248  1.00 16.64 ? 658  GLU A C   1 
ATOM   3309 O  O   . GLU A 1 435 ? 5.036   46.121 30.610  1.00 16.08 ? 658  GLU A O   1 
ATOM   3310 C  CB  . GLU A 1 435 ? 2.242   46.170 29.445  1.00 16.35 ? 658  GLU A CB  1 
ATOM   3311 C  CG  . GLU A 1 435 ? 1.163   45.235 28.763  1.00 12.81 ? 658  GLU A CG  1 
ATOM   3312 C  CD  . GLU A 1 435 ? 0.299   45.945 27.741  1.00 15.70 ? 658  GLU A CD  1 
ATOM   3313 O  OE1 . GLU A 1 435 ? 0.465   47.147 27.510  1.00 18.25 ? 658  GLU A OE1 1 
ATOM   3314 O  OE2 . GLU A 1 435 ? -0.617  45.302 27.149  1.00 17.54 ? 658  GLU A OE2 1 
ATOM   3315 N  N   . SER A 1 436 ? 3.806   46.975 32.368  1.00 15.47 ? 659  SER A N   1 
ATOM   3316 C  CA  . SER A 1 436 ? 4.891   47.604 33.101  1.00 15.09 ? 659  SER A CA  1 
ATOM   3317 C  C   . SER A 1 436 ? 6.043   46.651 33.328  1.00 14.70 ? 659  SER A C   1 
ATOM   3318 O  O   . SER A 1 436 ? 5.818   45.468 33.645  1.00 13.68 ? 659  SER A O   1 
ATOM   3319 C  CB  . SER A 1 436 ? 4.391   48.021 34.500  1.00 16.33 ? 659  SER A CB  1 
ATOM   3320 O  OG  . SER A 1 436 ? 3.856   49.303 34.431  1.00 21.46 ? 659  SER A OG  1 
ATOM   3321 N  N   . GLY A 1 437 ? 7.266   47.183 33.217  1.00 13.18 ? 660  GLY A N   1 
ATOM   3322 C  CA  . GLY A 1 437 ? 8.466   46.422 33.482  1.00 12.51 ? 660  GLY A CA  1 
ATOM   3323 C  C   . GLY A 1 437 ? 8.990   45.734 32.223  1.00 13.14 ? 660  GLY A C   1 
ATOM   3324 O  O   . GLY A 1 437 ? 10.137  45.300 32.191  1.00 13.00 ? 660  GLY A O   1 
ATOM   3325 N  N   . GLY A 1 438 ? 8.132   45.589 31.210  1.00 13.61 ? 661  GLY A N   1 
ATOM   3326 C  CA  . GLY A 1 438 ? 8.523   44.884 29.977  1.00 12.43 ? 661  GLY A CA  1 
ATOM   3327 C  C   . GLY A 1 438 ? 9.486   45.743 29.158  1.00 12.51 ? 661  GLY A C   1 
ATOM   3328 O  O   . GLY A 1 438 ? 9.545   46.999 29.306  1.00 12.31 ? 661  GLY A O   1 
ATOM   3329 N  N   . ALA A 1 439 ? 10.236  45.092 28.277  1.00 11.73 ? 662  ALA A N   1 
ATOM   3330 C  CA  . ALA A 1 439 ? 11.238  45.813 27.455  1.00 11.68 ? 662  ALA A CA  1 
ATOM   3331 C  C   . ALA A 1 439 ? 10.591  46.761 26.453  1.00 12.20 ? 662  ALA A C   1 
ATOM   3332 O  O   . ALA A 1 439 ? 9.532   46.458 25.898  1.00 12.58 ? 662  ALA A O   1 
ATOM   3333 C  CB  . ALA A 1 439 ? 12.158  44.794 26.706  1.00 11.95 ? 662  ALA A CB  1 
ATOM   3334 N  N   . VAL A 1 440 ? 11.210  47.915 26.243  1.00 11.01 ? 663  VAL A N   1 
ATOM   3335 C  CA  . VAL A 1 440 ? 10.936  48.742 25.083  1.00 10.68 ? 663  VAL A CA  1 
ATOM   3336 C  C   . VAL A 1 440 ? 12.146  48.523 24.179  1.00 11.38 ? 663  VAL A C   1 
ATOM   3337 O  O   . VAL A 1 440 ? 13.307  48.744 24.587  1.00 10.41 ? 663  VAL A O   1 
ATOM   3338 C  CB  . VAL A 1 440 ? 10.813  50.224 25.480  1.00 11.16 ? 663  VAL A CB  1 
ATOM   3339 C  CG1 . VAL A 1 440 ? 10.850  51.171 24.199  1.00 12.22 ? 663  VAL A CG1 1 
ATOM   3340 C  CG2 . VAL A 1 440 ? 9.525   50.425 26.356  1.00 12.55 ? 663  VAL A CG2 1 
ATOM   3341 N  N   . PHE A 1 441 ? 11.908  48.042 22.968  1.00 10.85 ? 664  PHE A N   1 
ATOM   3342 C  CA  . PHE A 1 441 ? 13.014  47.495 22.223  1.00 9.74  ? 664  PHE A CA  1 
ATOM   3343 C  C   . PHE A 1 441 ? 12.906  47.891 20.768  1.00 12.00 ? 664  PHE A C   1 
ATOM   3344 O  O   . PHE A 1 441 ? 11.825  48.302 20.298  1.00 11.41 ? 664  PHE A O   1 
ATOM   3345 C  CB  . PHE A 1 441 ? 13.101  45.956 22.408  1.00 9.86  ? 664  PHE A CB  1 
ATOM   3346 C  CG  . PHE A 1 441 ? 11.896  45.200 21.863  1.00 13.59 ? 664  PHE A CG  1 
ATOM   3347 C  CD1 . PHE A 1 441 ? 10.751  44.978 22.677  1.00 15.77 ? 664  PHE A CD1 1 
ATOM   3348 C  CD2 . PHE A 1 441 ? 11.912  44.691 20.546  1.00 12.20 ? 664  PHE A CD2 1 
ATOM   3349 C  CE1 . PHE A 1 441 ? 9.641   44.278 22.161  1.00 14.62 ? 664  PHE A CE1 1 
ATOM   3350 C  CE2 . PHE A 1 441 ? 10.782  43.986 20.024  1.00 13.63 ? 664  PHE A CE2 1 
ATOM   3351 C  CZ  . PHE A 1 441 ? 9.684   43.757 20.843  1.00 14.16 ? 664  PHE A CZ  1 
ATOM   3352 N  N   . LEU A 1 442 ? 14.024  47.745 20.061  1.00 12.47 ? 665  LEU A N   1 
ATOM   3353 C  CA  . LEU A 1 442 ? 14.056  48.026 18.632  1.00 13.82 ? 665  LEU A CA  1 
ATOM   3354 C  C   . LEU A 1 442 ? 14.765  46.884 17.914  1.00 13.11 ? 665  LEU A C   1 
ATOM   3355 O  O   . LEU A 1 442 ? 15.482  46.124 18.517  1.00 13.00 ? 665  LEU A O   1 
ATOM   3356 C  CB  . LEU A 1 442 ? 14.783  49.355 18.335  1.00 16.24 ? 665  LEU A CB  1 
ATOM   3357 C  CG  . LEU A 1 442 ? 15.254  50.316 19.434  1.00 19.93 ? 665  LEU A CG  1 
ATOM   3358 C  CD1 . LEU A 1 442 ? 16.150  51.426 18.917  1.00 23.99 ? 665  LEU A CD1 1 
ATOM   3359 C  CD2 . LEU A 1 442 ? 13.948  50.940 20.006  1.00 26.85 ? 665  LEU A CD2 1 
ATOM   3360 N  N   . GLU A 1 443 ? 14.536  46.777 16.616  1.00 13.54 ? 666  GLU A N   1 
ATOM   3361 C  CA  . GLU A 1 443 ? 15.142  45.759 15.767  1.00 13.92 ? 666  GLU A CA  1 
ATOM   3362 C  C   . GLU A 1 443 ? 16.132  46.460 14.858  1.00 15.07 ? 666  GLU A C   1 
ATOM   3363 O  O   . GLU A 1 443 ? 15.810  47.499 14.264  1.00 14.51 ? 666  GLU A O   1 
ATOM   3364 C  CB  . GLU A 1 443 ? 14.074  45.055 14.929  1.00 14.87 ? 666  GLU A CB  1 
ATOM   3365 C  CG  . GLU A 1 443 ? 14.603  43.867 14.097  1.00 16.30 ? 666  GLU A CG  1 
ATOM   3366 C  CD  . GLU A 1 443 ? 13.597  43.425 13.042  1.00 22.01 ? 666  GLU A CD  1 
ATOM   3367 O  OE1 . GLU A 1 443 ? 12.375  43.579 13.281  1.00 24.79 ? 666  GLU A OE1 1 
ATOM   3368 O  OE2 . GLU A 1 443 ? 14.041  42.973 11.967  1.00 20.93 ? 666  GLU A OE2 1 
ATOM   3369 N  N   . ARG A 1 444 ? 17.345  45.918 14.786  1.00 15.76 ? 667  ARG A N   1 
ATOM   3370 C  CA  . ARG A 1 444 ? 18.376  46.476 13.893  1.00 17.77 ? 667  ARG A CA  1 
ATOM   3371 C  C   . ARG A 1 444 ? 19.292  45.348 13.469  1.00 17.72 ? 667  ARG A C   1 
ATOM   3372 O  O   . ARG A 1 444 ? 19.767  44.590 14.319  1.00 15.85 ? 667  ARG A O   1 
ATOM   3373 C  CB  . ARG A 1 444 ? 19.225  47.534 14.606  1.00 18.56 ? 667  ARG A CB  1 
ATOM   3374 C  CG  . ARG A 1 444 ? 18.535  48.873 14.728  1.00 24.94 ? 667  ARG A CG  1 
ATOM   3375 C  CD  . ARG A 1 444 ? 19.413  49.919 14.011  1.00 38.70 ? 667  ARG A CD  1 
ATOM   3376 N  NE  . ARG A 1 444 ? 18.736  51.241 13.971  1.00 43.17 ? 667  ARG A NE  1 
ATOM   3377 C  CZ  . ARG A 1 444 ? 17.430  51.483 14.201  1.00 47.85 ? 667  ARG A CZ  1 
ATOM   3378 N  NH1 . ARG A 1 444 ? 16.515  50.503 14.529  1.00 45.56 ? 667  ARG A NH1 1 
ATOM   3379 N  NH2 . ARG A 1 444 ? 17.012  52.755 14.052  1.00 48.71 ? 667  ARG A NH2 1 
ATOM   3380 N  N   . ARG A 1 445 ? 19.541  45.255 12.175  1.00 18.61 ? 668  ARG A N   1 
ATOM   3381 C  CA  . ARG A 1 445 ? 20.271  44.123 11.586  1.00 20.79 ? 668  ARG A CA  1 
ATOM   3382 C  C   . ARG A 1 445 ? 19.714  42.765 12.056  1.00 19.56 ? 668  ARG A C   1 
ATOM   3383 O  O   . ARG A 1 445 ? 20.496  41.877 12.440  1.00 19.18 ? 668  ARG A O   1 
ATOM   3384 C  CB  . ARG A 1 445 ? 21.745  44.218 11.934  1.00 23.02 ? 668  ARG A CB  1 
ATOM   3385 C  CG  . ARG A 1 445 ? 22.583  44.675 10.787  1.00 33.34 ? 668  ARG A CG  1 
ATOM   3386 C  CD  . ARG A 1 445 ? 23.792  45.438 11.319  1.00 41.95 ? 668  ARG A CD  1 
ATOM   3387 N  NE  . ARG A 1 445 ? 24.864  45.460 10.308  1.00 49.05 ? 668  ARG A NE  1 
ATOM   3388 C  CZ  . ARG A 1 445 ? 24.911  44.739 9.179   1.00 52.05 ? 668  ARG A CZ  1 
ATOM   3389 N  NH1 . ARG A 1 445 ? 23.943  43.864 8.856   1.00 53.56 ? 668  ARG A NH1 1 
ATOM   3390 N  NH2 . ARG A 1 445 ? 25.956  44.885 8.357   1.00 53.70 ? 668  ARG A NH2 1 
ATOM   3391 N  N   . PHE A 1 446 ? 18.375  42.632 12.050  1.00 17.64 ? 669  PHE A N   1 
ATOM   3392 C  CA  . PHE A 1 446 ? 17.676  41.425 12.508  1.00 16.98 ? 669  PHE A CA  1 
ATOM   3393 C  C   . PHE A 1 446 ? 17.957  40.971 13.934  1.00 15.78 ? 669  PHE A C   1 
ATOM   3394 O  O   . PHE A 1 446 ? 17.727  39.809 14.273  1.00 15.53 ? 669  PHE A O   1 
ATOM   3395 C  CB  . PHE A 1 446 ? 18.007  40.241 11.595  1.00 17.95 ? 669  PHE A CB  1 
ATOM   3396 C  CG  . PHE A 1 446 ? 17.505  40.414 10.207  1.00 17.65 ? 669  PHE A CG  1 
ATOM   3397 C  CD1 . PHE A 1 446 ? 16.142  40.512 9.971   1.00 21.03 ? 669  PHE A CD1 1 
ATOM   3398 C  CD2 . PHE A 1 446 ? 18.387  40.424 9.153   1.00 18.04 ? 669  PHE A CD2 1 
ATOM   3399 C  CE1 . PHE A 1 446 ? 15.643  40.657 8.651   1.00 26.33 ? 669  PHE A CE1 1 
ATOM   3400 C  CE2 . PHE A 1 446 ? 17.911  40.555 7.812   1.00 22.56 ? 669  PHE A CE2 1 
ATOM   3401 C  CZ  . PHE A 1 446 ? 16.542  40.670 7.569   1.00 21.86 ? 669  PHE A CZ  1 
ATOM   3402 N  N   . ARG A 1 447 ? 18.476  41.871 14.738  1.00 12.87 ? 670  ARG A N   1 
ATOM   3403 C  CA  . ARG A 1 447 ? 18.706  41.608 16.158  1.00 13.77 ? 670  ARG A CA  1 
ATOM   3404 C  C   . ARG A 1 447 ? 17.917  42.613 16.990  1.00 12.31 ? 670  ARG A C   1 
ATOM   3405 O  O   . ARG A 1 447 ? 17.570  43.672 16.515  1.00 11.61 ? 670  ARG A O   1 
ATOM   3406 C  CB  . ARG A 1 447 ? 20.195  41.684 16.512  1.00 12.38 ? 670  ARG A CB  1 
ATOM   3407 C  CG  . ARG A 1 447 ? 21.028  40.627 15.711  1.00 13.10 ? 670  ARG A CG  1 
ATOM   3408 C  CD  . ARG A 1 447 ? 20.918  39.175 16.324  1.00 13.31 ? 670  ARG A CD  1 
ATOM   3409 N  NE  . ARG A 1 447 ? 21.662  39.030 17.592  1.00 11.13 ? 670  ARG A NE  1 
ATOM   3410 C  CZ  . ARG A 1 447 ? 22.991  38.970 17.732  1.00 13.92 ? 670  ARG A CZ  1 
ATOM   3411 N  NH1 . ARG A 1 447 ? 23.811  39.032 16.674  1.00 14.37 ? 670  ARG A NH1 1 
ATOM   3412 N  NH2 . ARG A 1 447 ? 23.533  38.857 18.943  1.00 10.51 ? 670  ARG A NH2 1 
ATOM   3413 N  N   . PHE A 1 448 ? 17.648  42.245 18.244  1.00 11.10 ? 671  PHE A N   1 
ATOM   3414 C  CA  . PHE A 1 448 ? 16.746  43.037 19.108  1.00 10.39 ? 671  PHE A CA  1 
ATOM   3415 C  C   . PHE A 1 448 ? 17.513  43.599 20.267  1.00 9.54  ? 671  PHE A C   1 
ATOM   3416 O  O   . PHE A 1 448 ? 18.306  42.883 20.857  1.00 8.62  ? 671  PHE A O   1 
ATOM   3417 C  CB  . PHE A 1 448 ? 15.611  42.142 19.627  1.00 10.20 ? 671  PHE A CB  1 
ATOM   3418 C  CG  . PHE A 1 448 ? 14.683  41.664 18.522  1.00 13.43 ? 671  PHE A CG  1 
ATOM   3419 C  CD1 . PHE A 1 448 ? 13.709  42.522 17.989  1.00 16.39 ? 671  PHE A CD1 1 
ATOM   3420 C  CD2 . PHE A 1 448 ? 14.822  40.387 17.984  1.00 16.04 ? 671  PHE A CD2 1 
ATOM   3421 C  CE1 . PHE A 1 448 ? 12.872  42.098 16.958  1.00 16.79 ? 671  PHE A CE1 1 
ATOM   3422 C  CE2 . PHE A 1 448 ? 13.953  39.927 16.966  1.00 16.86 ? 671  PHE A CE2 1 
ATOM   3423 C  CZ  . PHE A 1 448 ? 12.987  40.795 16.462  1.00 17.98 ? 671  PHE A CZ  1 
ATOM   3424 N  N   . PHE A 1 449 ? 17.281  44.888 20.567  1.00 9.68  ? 672  PHE A N   1 
ATOM   3425 C  CA  . PHE A 1 449 ? 18.015  45.644 21.568  1.00 9.10  ? 672  PHE A CA  1 
ATOM   3426 C  C   . PHE A 1 449 ? 17.039  46.333 22.497  1.00 9.52  ? 672  PHE A C   1 
ATOM   3427 O  O   . PHE A 1 449 ? 16.100  46.985 22.034  1.00 10.58 ? 672  PHE A O   1 
ATOM   3428 C  CB  . PHE A 1 449 ? 18.878  46.716 20.865  1.00 8.74  ? 672  PHE A CB  1 
ATOM   3429 C  CG  . PHE A 1 449 ? 19.832  46.127 19.896  1.00 11.73 ? 672  PHE A CG  1 
ATOM   3430 C  CD1 . PHE A 1 449 ? 19.427  45.819 18.582  1.00 10.34 ? 672  PHE A CD1 1 
ATOM   3431 C  CD2 . PHE A 1 449 ? 21.097  45.766 20.317  1.00 10.85 ? 672  PHE A CD2 1 
ATOM   3432 C  CE1 . PHE A 1 449 ? 20.317  45.204 17.663  1.00 10.47 ? 672  PHE A CE1 1 
ATOM   3433 C  CE2 . PHE A 1 449 ? 22.011  45.164 19.412  1.00 10.83 ? 672  PHE A CE2 1 
ATOM   3434 C  CZ  . PHE A 1 449 ? 21.624  44.896 18.088  1.00 12.27 ? 672  PHE A CZ  1 
ATOM   3435 N  N   . GLN A 1 450 ? 17.267  46.189 23.794  1.00 9.31  ? 673  GLN A N   1 
ATOM   3436 C  CA  . GLN A 1 450 ? 16.422  46.874 24.757  1.00 10.01 ? 673  GLN A CA  1 
ATOM   3437 C  C   . GLN A 1 450 ? 16.960  48.257 25.023  1.00 10.53 ? 673  GLN A C   1 
ATOM   3438 O  O   . GLN A 1 450 ? 18.084  48.386 25.538  1.00 12.75 ? 673  GLN A O   1 
ATOM   3439 C  CB  . GLN A 1 450 ? 16.380  46.098 26.072  1.00 9.63  ? 673  GLN A CB  1 
ATOM   3440 C  CG  . GLN A 1 450 ? 15.433  46.766 27.056  1.00 8.53  ? 673  GLN A CG  1 
ATOM   3441 C  CD  . GLN A 1 450 ? 15.144  45.880 28.277  1.00 12.77 ? 673  GLN A CD  1 
ATOM   3442 O  OE1 . GLN A 1 450 ? 15.636  44.750 28.395  1.00 11.71 ? 673  GLN A OE1 1 
ATOM   3443 N  NE2 . GLN A 1 450 ? 14.345  46.408 29.189  1.00 12.41 ? 673  GLN A NE2 1 
ATOM   3444 N  N   . VAL A 1 451 ? 16.176  49.298 24.724  1.00 10.77 ? 674  VAL A N   1 
ATOM   3445 C  CA  . VAL A 1 451 ? 16.604  50.698 24.996  1.00 10.60 ? 674  VAL A CA  1 
ATOM   3446 C  C   . VAL A 1 451 ? 15.922  51.261 26.232  1.00 11.08 ? 674  VAL A C   1 
ATOM   3447 O  O   . VAL A 1 451 ? 16.410  52.211 26.840  1.00 8.89  ? 674  VAL A O   1 
ATOM   3448 C  CB  . VAL A 1 451 ? 16.404  51.647 23.762  1.00 11.66 ? 674  VAL A CB  1 
ATOM   3449 C  CG1 . VAL A 1 451 ? 17.335  51.199 22.639  1.00 12.89 ? 674  VAL A CG1 1 
ATOM   3450 C  CG2 . VAL A 1 451 ? 14.918  51.674 23.282  1.00 11.99 ? 674  VAL A CG2 1 
ATOM   3451 N  N   . GLY A 1 452 ? 14.807  50.651 26.648  1.00 10.90 ? 675  GLY A N   1 
ATOM   3452 C  CA  . GLY A 1 452 ? 14.157  51.111 27.877  1.00 10.93 ? 675  GLY A CA  1 
ATOM   3453 C  C   . GLY A 1 452 ? 13.226  50.057 28.458  1.00 10.57 ? 675  GLY A C   1 
ATOM   3454 O  O   . GLY A 1 452 ? 13.170  48.960 27.959  1.00 10.91 ? 675  GLY A O   1 
ATOM   3455 N  N   . LEU A 1 453 ? 12.446  50.428 29.478  1.00 11.21 ? 676  LEU A N   1 
ATOM   3456 C  CA  . LEU A 1 453 ? 11.451  49.504 30.025  1.00 11.20 ? 676  LEU A CA  1 
ATOM   3457 C  C   . LEU A 1 453 ? 10.233  50.321 30.388  1.00 11.67 ? 676  LEU A C   1 
ATOM   3458 O  O   . LEU A 1 453 ? 10.342  51.510 30.773  1.00 10.61 ? 676  LEU A O   1 
ATOM   3459 C  CB  . LEU A 1 453 ? 12.014  48.717 31.228  1.00 12.71 ? 676  LEU A CB  1 
ATOM   3460 C  CG  . LEU A 1 453 ? 12.431  49.558 32.449  1.00 14.92 ? 676  LEU A CG  1 
ATOM   3461 C  CD1 . LEU A 1 453 ? 11.288  49.691 33.505  1.00 16.24 ? 676  LEU A CD1 1 
ATOM   3462 C  CD2 . LEU A 1 453 ? 13.709  48.926 33.108  1.00 12.98 ? 676  LEU A CD2 1 
ATOM   3463 N  N   . VAL A 1 454 ? 9.076   49.671 30.256  1.00 11.42 ? 677  VAL A N   1 
ATOM   3464 C  CA  . VAL A 1 454 ? 7.788   50.359 30.487  1.00 12.26 ? 677  VAL A CA  1 
ATOM   3465 C  C   . VAL A 1 454 ? 7.682   50.788 31.949  1.00 12.48 ? 677  VAL A C   1 
ATOM   3466 O  O   . VAL A 1 454 ? 7.812   49.952 32.879  1.00 12.77 ? 677  VAL A O   1 
ATOM   3467 C  CB  . VAL A 1 454 ? 6.635   49.409 30.107  1.00 11.72 ? 677  VAL A CB  1 
ATOM   3468 C  CG1 . VAL A 1 454 ? 5.225   50.067 30.415  1.00 9.93  ? 677  VAL A CG1 1 
ATOM   3469 C  CG2 . VAL A 1 454 ? 6.799   49.027 28.628  1.00 11.43 ? 677  VAL A CG2 1 
ATOM   3470 N  N   . SER A 1 455 ? 7.410   52.079 32.154  1.00 13.13 ? 678  SER A N   1 
ATOM   3471 C  CA  . SER A 1 455 ? 7.335   52.625 33.527  1.00 13.75 ? 678  SER A CA  1 
ATOM   3472 C  C   . SER A 1 455 ? 5.943   53.219 33.860  1.00 13.59 ? 678  SER A C   1 
ATOM   3473 O  O   . SER A 1 455 ? 5.192   52.688 34.718  1.00 12.62 ? 678  SER A O   1 
ATOM   3474 C  CB  . SER A 1 455 ? 8.442   53.682 33.708  1.00 13.08 ? 678  SER A CB  1 
ATOM   3475 O  OG  . SER A 1 455 ? 8.450   54.190 35.031  1.00 14.13 ? 678  SER A OG  1 
ATOM   3476 N  N   . TRP A 1 456 ? 5.573   54.268 33.148  1.00 11.86 ? 679  TRP A N   1 
ATOM   3477 C  CA  . TRP A 1 456 ? 4.264   54.902 33.402  1.00 14.46 ? 679  TRP A CA  1 
ATOM   3478 C  C   . TRP A 1 456 ? 3.735   55.691 32.217  1.00 15.06 ? 679  TRP A C   1 
ATOM   3479 O  O   . TRP A 1 456 ? 4.406   55.844 31.173  1.00 14.05 ? 679  TRP A O   1 
ATOM   3480 C  CB  . TRP A 1 456 ? 4.361   55.797 34.628  1.00 13.75 ? 679  TRP A CB  1 
ATOM   3481 C  CG  . TRP A 1 456 ? 5.265   56.978 34.465  1.00 14.60 ? 679  TRP A CG  1 
ATOM   3482 C  CD1 . TRP A 1 456 ? 6.659   56.990 34.527  1.00 14.96 ? 679  TRP A CD1 1 
ATOM   3483 C  CD2 . TRP A 1 456 ? 4.863   58.341 34.266  1.00 15.35 ? 679  TRP A CD2 1 
ATOM   3484 N  NE1 . TRP A 1 456 ? 7.132   58.278 34.344  1.00 12.69 ? 679  TRP A NE1 1 
ATOM   3485 C  CE2 . TRP A 1 456 ? 6.054   59.131 34.206  1.00 15.53 ? 679  TRP A CE2 1 
ATOM   3486 C  CE3 . TRP A 1 456 ? 3.610   58.979 34.146  1.00 17.46 ? 679  TRP A CE3 1 
ATOM   3487 C  CZ2 . TRP A 1 456 ? 6.019   60.534 34.032  1.00 17.68 ? 679  TRP A CZ2 1 
ATOM   3488 C  CZ3 . TRP A 1 456 ? 3.569   60.363 33.974  1.00 13.78 ? 679  TRP A CZ3 1 
ATOM   3489 C  CH2 . TRP A 1 456 ? 4.752   61.134 33.911  1.00 15.73 ? 679  TRP A CH2 1 
ATOM   3490 N  N   . GLY A 1 457 ? 2.514   56.200 32.378  1.00 16.09 ? 680  GLY A N   1 
ATOM   3491 C  CA  . GLY A 1 457 ? 1.896   56.950 31.306  1.00 16.90 ? 680  GLY A CA  1 
ATOM   3492 C  C   . GLY A 1 457 ? 0.642   57.656 31.819  1.00 17.76 ? 680  GLY A C   1 
ATOM   3493 O  O   . GLY A 1 457 ? 0.289   57.541 33.003  1.00 16.95 ? 680  GLY A O   1 
ATOM   3494 N  N   . LEU A 1 458 ? -0.013  58.359 30.905  1.00 17.91 ? 681  LEU A N   1 
ATOM   3495 C  CA  . LEU A 1 458 ? -1.160  59.223 31.247  1.00 19.64 ? 681  LEU A CA  1 
ATOM   3496 C  C   . LEU A 1 458 ? -2.500  58.543 30.907  1.00 21.36 ? 681  LEU A C   1 
ATOM   3497 O  O   . LEU A 1 458 ? -3.550  59.064 31.283  1.00 21.83 ? 681  LEU A O   1 
ATOM   3498 C  CB  . LEU A 1 458 ? -1.050  60.579 30.556  1.00 19.25 ? 681  LEU A CB  1 
ATOM   3499 C  CG  . LEU A 1 458 ? 0.203   61.403 30.834  1.00 17.71 ? 681  LEU A CG  1 
ATOM   3500 C  CD1 . LEU A 1 458 ? 0.198   62.644 29.913  1.00 20.77 ? 681  LEU A CD1 1 
ATOM   3501 C  CD2 . LEU A 1 458 ? 0.281   61.794 32.277  1.00 17.66 ? 681  LEU A CD2 1 
ATOM   3502 N  N   . TYR A 1 459 ? -2.443  57.378 30.255  1.00 21.21 ? 682  TYR A N   1 
ATOM   3503 C  CA  . TYR A 1 459 ? -3.635  56.676 29.795  1.00 23.07 ? 682  TYR A CA  1 
ATOM   3504 C  C   . TYR A 1 459 ? -3.447  55.154 29.698  1.00 23.18 ? 682  TYR A C   1 
ATOM   3505 O  O   . TYR A 1 459 ? -2.540  54.664 28.997  1.00 22.60 ? 682  TYR A O   1 
ATOM   3506 C  CB  . TYR A 1 459 ? -4.113  57.281 28.455  1.00 23.99 ? 682  TYR A CB  1 
ATOM   3507 C  CG  . TYR A 1 459 ? -5.338  56.593 27.931  1.00 25.70 ? 682  TYR A CG  1 
ATOM   3508 C  CD1 . TYR A 1 459 ? -5.235  55.580 26.970  1.00 25.07 ? 682  TYR A CD1 1 
ATOM   3509 C  CD2 . TYR A 1 459 ? -6.616  56.920 28.438  1.00 28.39 ? 682  TYR A CD2 1 
ATOM   3510 C  CE1 . TYR A 1 459 ? -6.366  54.907 26.518  1.00 28.31 ? 682  TYR A CE1 1 
ATOM   3511 C  CE2 . TYR A 1 459 ? -7.762  56.249 27.987  1.00 28.34 ? 682  TYR A CE2 1 
ATOM   3512 C  CZ  . TYR A 1 459 ? -7.628  55.258 27.041  1.00 27.79 ? 682  TYR A CZ  1 
ATOM   3513 O  OH  . TYR A 1 459 ? -8.747  54.605 26.613  1.00 26.97 ? 682  TYR A OH  1 
ATOM   3514 N  N   . ASN A 1 460 ? -4.313  54.413 30.406  1.00 22.68 ? 683  ASN A N   1 
ATOM   3515 C  CA  . ASN A 1 460 ? -4.276  52.954 30.445  1.00 23.41 ? 683  ASN A CA  1 
ATOM   3516 C  C   . ASN A 1 460 ? -5.362  52.381 29.532  1.00 24.58 ? 683  ASN A C   1 
ATOM   3517 O  O   . ASN A 1 460 ? -6.529  52.306 29.947  1.00 24.16 ? 683  ASN A O   1 
ATOM   3518 C  CB  . ASN A 1 460 ? -4.471  52.466 31.893  1.00 22.76 ? 683  ASN A CB  1 
ATOM   3519 C  CG  . ASN A 1 460 ? -4.359  50.952 32.041  1.00 23.39 ? 683  ASN A CG  1 
ATOM   3520 O  OD1 . ASN A 1 460 ? -4.164  50.214 31.061  1.00 21.62 ? 683  ASN A OD1 1 
ATOM   3521 N  ND2 . ASN A 1 460 ? -4.482  50.482 33.277  1.00 22.94 ? 683  ASN A ND2 1 
ATOM   3522 N  N   . PRO A 1 461 ? -5.005  51.985 28.287  1.00 24.79 ? 684  PRO A N   1 
ATOM   3523 C  CA  . PRO A 1 461 ? -6.036  51.434 27.378  1.00 25.64 ? 684  PRO A CA  1 
ATOM   3524 C  C   . PRO A 1 461 ? -6.735  50.140 27.859  1.00 26.22 ? 684  PRO A C   1 
ATOM   3525 O  O   . PRO A 1 461 ? -7.747  49.725 27.256  1.00 26.44 ? 684  PRO A O   1 
ATOM   3526 C  CB  . PRO A 1 461 ? -5.243  51.122 26.087  1.00 26.18 ? 684  PRO A CB  1 
ATOM   3527 C  CG  . PRO A 1 461 ? -3.988  51.913 26.183  1.00 23.98 ? 684  PRO A CG  1 
ATOM   3528 C  CD  . PRO A 1 461 ? -3.677  52.021 27.643  1.00 25.06 ? 684  PRO A CD  1 
ATOM   3529 N  N   . CYS A 1 462 ? -6.194  49.482 28.872  1.00 26.98 ? 685  CYS A N   1 
ATOM   3530 C  CA  . CYS A 1 462 ? -6.806  48.250 29.378  1.00 27.88 ? 685  CYS A CA  1 
ATOM   3531 C  C   . CYS A 1 462 ? -7.668  48.461 30.627  1.00 29.26 ? 685  CYS A C   1 
ATOM   3532 O  O   . CYS A 1 462 ? -8.272  47.501 31.103  1.00 29.31 ? 685  CYS A O   1 
ATOM   3533 C  CB  . CYS A 1 462 ? -5.756  47.188 29.696  1.00 28.26 ? 685  CYS A CB  1 
ATOM   3534 S  SG  . CYS A 1 462 ? -4.742  46.668 28.275  1.00 27.06 ? 685  CYS A SG  1 
ATOM   3535 N  N   . LEU A 1 463 ? -7.685  49.677 31.185  1.00 29.58 ? 686  LEU A N   1 
ATOM   3536 C  CA  . LEU A 1 463 ? -8.446  49.937 32.422  1.00 30.86 ? 686  LEU A CA  1 
ATOM   3537 C  C   . LEU A 1 463 ? -9.953  49.665 32.235  1.00 31.04 ? 686  LEU A C   1 
ATOM   3538 O  O   . LEU A 1 463 ? -10.524 50.019 31.196  1.00 31.73 ? 686  LEU A O   1 
ATOM   3539 C  CB  . LEU A 1 463 ? -8.227  51.374 32.908  1.00 30.88 ? 686  LEU A CB  1 
ATOM   3540 C  CG  . LEU A 1 463 ? -9.032  51.831 34.134  1.00 32.62 ? 686  LEU A CG  1 
ATOM   3541 C  CD1 . LEU A 1 463 ? -8.483  51.149 35.383  1.00 33.86 ? 686  LEU A CD1 1 
ATOM   3542 C  CD2 . LEU A 1 463 ? -9.016  53.362 34.289  1.00 33.02 ? 686  LEU A CD2 1 
ATOM   3543 N  N   . ASN A 1 469 ? -7.170  41.044 25.324  1.00 38.77 ? 692  ASN A N   1 
ATOM   3544 C  CA  . ASN A 1 469 ? -7.018  41.283 23.891  1.00 39.12 ? 692  ASN A CA  1 
ATOM   3545 C  C   . ASN A 1 469 ? -7.658  42.590 23.445  1.00 38.92 ? 692  ASN A C   1 
ATOM   3546 O  O   . ASN A 1 469 ? -7.695  42.911 22.250  1.00 39.04 ? 692  ASN A O   1 
ATOM   3547 C  CB  . ASN A 1 469 ? -7.634  40.140 23.080  1.00 40.12 ? 692  ASN A CB  1 
ATOM   3548 C  CG  . ASN A 1 469 ? -7.091  38.793 23.467  1.00 41.34 ? 692  ASN A CG  1 
ATOM   3549 O  OD1 . ASN A 1 469 ? -5.879  38.596 23.544  1.00 43.15 ? 692  ASN A OD1 1 
ATOM   3550 N  ND2 . ASN A 1 469 ? -7.984  37.853 23.726  1.00 43.64 ? 692  ASN A ND2 1 
ATOM   3551 N  N   . SER A 1 470 ? -8.171  43.335 24.412  1.00 37.85 ? 693  SER A N   1 
ATOM   3552 C  CA  . SER A 1 470 ? -8.962  44.497 24.118  1.00 37.71 ? 693  SER A CA  1 
ATOM   3553 C  C   . SER A 1 470 ? -8.265  45.721 24.687  1.00 36.31 ? 693  SER A C   1 
ATOM   3554 O  O   . SER A 1 470 ? -7.863  45.739 25.849  1.00 36.94 ? 693  SER A O   1 
ATOM   3555 C  CB  . SER A 1 470 ? -10.364 44.329 24.717  1.00 37.75 ? 693  SER A CB  1 
ATOM   3556 O  OG  . SER A 1 470 ? -10.715 42.948 24.732  1.00 39.99 ? 693  SER A OG  1 
ATOM   3557 N  N   . ARG A 1 471 ? -8.101  46.732 23.855  1.00 34.93 ? 694  ARG A N   1 
ATOM   3558 C  CA  . ARG A 1 471 ? -7.560  47.995 24.326  1.00 34.13 ? 694  ARG A CA  1 
ATOM   3559 C  C   . ARG A 1 471 ? -8.458  49.106 23.802  1.00 34.11 ? 694  ARG A C   1 
ATOM   3560 O  O   . ARG A 1 471 ? -8.818  49.108 22.639  1.00 33.65 ? 694  ARG A O   1 
ATOM   3561 C  CB  . ARG A 1 471 ? -6.134  48.226 23.809  1.00 33.38 ? 694  ARG A CB  1 
ATOM   3562 C  CG  . ARG A 1 471 ? -5.246  47.018 23.753  1.00 31.68 ? 694  ARG A CG  1 
ATOM   3563 C  CD  . ARG A 1 471 ? -3.965  47.358 23.027  1.00 26.62 ? 694  ARG A CD  1 
ATOM   3564 N  NE  . ARG A 1 471 ? -2.979  48.057 23.882  1.00 18.82 ? 694  ARG A NE  1 
ATOM   3565 C  CZ  . ARG A 1 471 ? -2.221  47.442 24.804  1.00 19.53 ? 694  ARG A CZ  1 
ATOM   3566 N  NH1 . ARG A 1 471 ? -2.360  46.143 25.052  1.00 17.25 ? 694  ARG A NH1 1 
ATOM   3567 N  NH2 . ARG A 1 471 ? -1.320  48.128 25.491  1.00 17.25 ? 694  ARG A NH2 1 
ATOM   3568 N  N   . LYS A 1 472 ? -8.791  50.062 24.653  1.00 34.66 ? 695  LYS A N   1 
ATOM   3569 C  CA  . LYS A 1 472 ? -9.608  51.192 24.216  1.00 36.03 ? 695  LYS A CA  1 
ATOM   3570 C  C   . LYS A 1 472 ? -8.716  52.318 23.757  1.00 35.67 ? 695  LYS A C   1 
ATOM   3571 O  O   . LYS A 1 472 ? -7.648  52.509 24.328  1.00 36.02 ? 695  LYS A O   1 
ATOM   3572 C  CB  . LYS A 1 472 ? -10.555 51.674 25.329  1.00 36.30 ? 695  LYS A CB  1 
ATOM   3573 C  CG  . LYS A 1 472 ? -10.208 51.175 26.723  1.00 40.03 ? 695  LYS A CG  1 
ATOM   3574 C  CD  . LYS A 1 472 ? -10.590 52.174 27.856  1.00 43.98 ? 695  LYS A CD  1 
ATOM   3575 C  CE  . LYS A 1 472 ? -9.385  52.331 28.841  1.00 43.54 ? 695  LYS A CE  1 
ATOM   3576 N  NZ  . LYS A 1 472 ? -9.473  53.506 29.766  1.00 46.10 ? 695  LYS A NZ  1 
ATOM   3577 N  N   . ARG A 1 473 ? -9.124  53.031 22.711  1.00 35.16 ? 696  ARG A N   1 
ATOM   3578 C  CA  . ARG A 1 473 ? -8.452  54.270 22.334  1.00 36.53 ? 696  ARG A CA  1 
ATOM   3579 C  C   . ARG A 1 473 ? -9.049  55.407 23.134  1.00 36.13 ? 696  ARG A C   1 
ATOM   3580 O  O   . ARG A 1 473 ? -10.251 55.428 23.387  1.00 36.02 ? 696  ARG A O   1 
ATOM   3581 C  CB  . ARG A 1 473 ? -8.588  54.571 20.848  1.00 37.06 ? 696  ARG A CB  1 
ATOM   3582 C  CG  . ARG A 1 473 ? -8.194  53.413 19.940  1.00 41.25 ? 696  ARG A CG  1 
ATOM   3583 C  CD  . ARG A 1 473 ? -8.035  53.858 18.483  1.00 48.49 ? 696  ARG A CD  1 
ATOM   3584 N  NE  . ARG A 1 473 ? -7.961  52.703 17.576  1.00 53.45 ? 696  ARG A NE  1 
ATOM   3585 C  CZ  . ARG A 1 473 ? -6.832  52.079 17.226  1.00 56.11 ? 696  ARG A CZ  1 
ATOM   3586 N  NH1 . ARG A 1 473 ? -5.656  52.496 17.700  1.00 58.25 ? 696  ARG A NH1 1 
ATOM   3587 N  NH2 . ARG A 1 473 ? -6.869  51.034 16.397  1.00 55.66 ? 696  ARG A NH2 1 
ATOM   3588 N  N   . ALA A 1 474 ? -8.210  56.341 23.558  1.00 34.99 ? 697  ALA A N   1 
ATOM   3589 C  CA  . ALA A 1 474 ? -8.709  57.547 24.185  1.00 35.24 ? 697  ALA A CA  1 
ATOM   3590 C  C   . ALA A 1 474 ? -9.494  58.326 23.121  1.00 35.21 ? 697  ALA A C   1 
ATOM   3591 O  O   . ALA A 1 474 ? -9.140  58.284 21.925  1.00 35.37 ? 697  ALA A O   1 
ATOM   3592 C  CB  . ALA A 1 474 ? -7.581  58.390 24.725  1.00 34.29 ? 697  ALA A CB  1 
ATOM   3593 N  N   . PRO A 1 475 ? -10.575 58.983 23.537  1.00 35.28 ? 698  PRO A N   1 
ATOM   3594 C  CA  . PRO A 1 475 ? -11.233 60.018 22.710  1.00 35.76 ? 698  PRO A CA  1 
ATOM   3595 C  C   . PRO A 1 475 ? -10.251 61.137 22.334  1.00 35.78 ? 698  PRO A C   1 
ATOM   3596 O  O   . PRO A 1 475 ? -9.429  61.527 23.177  1.00 34.78 ? 698  PRO A O   1 
ATOM   3597 C  CB  . PRO A 1 475 ? -12.296 60.592 23.646  1.00 35.83 ? 698  PRO A CB  1 
ATOM   3598 C  CG  . PRO A 1 475 ? -12.535 59.528 24.681  1.00 36.32 ? 698  PRO A CG  1 
ATOM   3599 C  CD  . PRO A 1 475 ? -11.279 58.727 24.811  1.00 35.46 ? 698  PRO A CD  1 
ATOM   3600 N  N   . ARG A 1 476 ? -10.333 61.655 21.098  1.00 35.53 ? 699  ARG A N   1 
ATOM   3601 C  CA  . ARG A 1 476 ? -9.407  62.714 20.657  1.00 35.47 ? 699  ARG A CA  1 
ATOM   3602 C  C   . ARG A 1 476 ? -9.494  63.949 21.542  1.00 35.29 ? 699  ARG A C   1 
ATOM   3603 O  O   . ARG A 1 476 ? -8.612  64.803 21.523  1.00 34.75 ? 699  ARG A O   1 
ATOM   3604 C  CB  . ARG A 1 476 ? -9.584  63.084 19.156  1.00 35.07 ? 699  ARG A CB  1 
ATOM   3605 C  CG  . ARG A 1 476 ? -9.034  62.000 18.208  1.00 36.95 ? 699  ARG A CG  1 
ATOM   3606 C  CD  . ARG A 1 476 ? -9.028  62.413 16.738  1.00 39.80 ? 699  ARG A CD  1 
ATOM   3607 N  NE  . ARG A 1 476 ? -10.388 62.600 16.210  1.00 40.10 ? 699  ARG A NE  1 
ATOM   3608 C  CZ  . ARG A 1 476 ? -11.026 61.738 15.425  1.00 40.13 ? 699  ARG A CZ  1 
ATOM   3609 N  NH1 . ARG A 1 476 ? -10.442 60.602 15.038  1.00 39.43 ? 699  ARG A NH1 1 
ATOM   3610 N  NH2 . ARG A 1 476 ? -12.261 62.019 15.028  1.00 39.46 ? 699  ARG A NH2 1 
ATOM   3611 N  N   . SER A 1 477 ? -10.570 64.041 22.317  1.00 35.76 ? 700  SER A N   1 
ATOM   3612 C  CA  . SER A 1 477 ? -10.760 65.177 23.190  1.00 36.14 ? 700  SER A CA  1 
ATOM   3613 C  C   . SER A 1 477 ? -10.215 64.963 24.614  1.00 36.82 ? 700  SER A C   1 
ATOM   3614 O  O   . SER A 1 477 ? -10.145 65.923 25.390  1.00 36.68 ? 700  SER A O   1 
ATOM   3615 C  CB  . SER A 1 477 ? -12.252 65.547 23.238  1.00 36.18 ? 700  SER A CB  1 
ATOM   3616 O  OG  . SER A 1 477 ? -13.060 64.483 23.742  1.00 36.97 ? 700  SER A OG  1 
ATOM   3617 N  N   . LYS A 1 478 ? -9.799  63.729 24.925  1.00 37.52 ? 701  LYS A N   1 
ATOM   3618 C  CA  . LYS A 1 478 ? -9.715  63.191 26.312  1.00 38.95 ? 701  LYS A CA  1 
ATOM   3619 C  C   . LYS A 1 478 ? -8.651  63.638 27.339  1.00 39.39 ? 701  LYS A C   1 
ATOM   3620 O  O   . LYS A 1 478 ? -8.199  62.794 28.159  1.00 40.96 ? 701  LYS A O   1 
ATOM   3621 C  CB  . LYS A 1 478 ? -9.717  61.658 26.250  1.00 39.81 ? 701  LYS A CB  1 
ATOM   3622 N  N   . VAL A 1 479 ? -8.313  64.928 27.329  1.00 38.44 ? 702  VAL A N   1 
ATOM   3623 C  CA  . VAL A 1 479 ? -7.378  65.647 28.266  1.00 38.31 ? 702  VAL A CA  1 
ATOM   3624 C  C   . VAL A 1 479 ? -6.917  65.077 29.652  1.00 37.49 ? 702  VAL A C   1 
ATOM   3625 O  O   . VAL A 1 479 ? -7.744  64.808 30.544  1.00 37.89 ? 702  VAL A O   1 
ATOM   3626 C  CB  . VAL A 1 479 ? -7.861  67.121 28.483  1.00 38.52 ? 702  VAL A CB  1 
ATOM   3627 C  CG1 . VAL A 1 479 ? -7.011  67.834 29.520  1.00 39.32 ? 702  VAL A CG1 1 
ATOM   3628 C  CG2 . VAL A 1 479 ? -7.836  67.898 27.186  1.00 38.99 ? 702  VAL A CG2 1 
ATOM   3629 N  N   . PRO A 1 480 ? -5.579  64.875 29.829  1.00 35.85 ? 703  PRO A N   1 
ATOM   3630 C  CA  . PRO A 1 480 ? -4.571  64.969 28.766  1.00 33.63 ? 703  PRO A CA  1 
ATOM   3631 C  C   . PRO A 1 480 ? -4.663  63.768 27.825  1.00 30.32 ? 703  PRO A C   1 
ATOM   3632 O  O   . PRO A 1 480 ? -5.292  62.775 28.155  1.00 30.60 ? 703  PRO A O   1 
ATOM   3633 C  CB  . PRO A 1 480 ? -3.229  64.956 29.537  1.00 34.43 ? 703  PRO A CB  1 
ATOM   3634 C  CG  . PRO A 1 480 ? -3.513  64.235 30.791  1.00 34.87 ? 703  PRO A CG  1 
ATOM   3635 C  CD  . PRO A 1 480 ? -4.971  64.535 31.133  1.00 36.04 ? 703  PRO A CD  1 
ATOM   3636 N  N   . PRO A 1 481 ? -4.019  63.852 26.662  1.00 27.88 ? 704  PRO A N   1 
ATOM   3637 C  CA  . PRO A 1 481 ? -3.994  62.737 25.727  1.00 25.70 ? 704  PRO A CA  1 
ATOM   3638 C  C   . PRO A 1 481 ? -3.095  61.595 26.254  1.00 23.64 ? 704  PRO A C   1 
ATOM   3639 O  O   . PRO A 1 481 ? -2.310  61.842 27.186  1.00 22.83 ? 704  PRO A O   1 
ATOM   3640 C  CB  . PRO A 1 481 ? -3.383  63.362 24.475  1.00 25.46 ? 704  PRO A CB  1 
ATOM   3641 C  CG  . PRO A 1 481 ? -2.604  64.523 24.941  1.00 27.52 ? 704  PRO A CG  1 
ATOM   3642 C  CD  . PRO A 1 481 ? -3.269  65.024 26.174  1.00 27.82 ? 704  PRO A CD  1 
ATOM   3643 N  N   . PRO A 1 482 ? -3.187  60.379 25.675  1.00 22.86 ? 705  PRO A N   1 
ATOM   3644 C  CA  . PRO A 1 482 ? -2.231  59.351 26.123  1.00 21.35 ? 705  PRO A CA  1 
ATOM   3645 C  C   . PRO A 1 482 ? -0.791  59.811 25.864  1.00 20.23 ? 705  PRO A C   1 
ATOM   3646 O  O   . PRO A 1 482 ? -0.528  60.512 24.874  1.00 19.30 ? 705  PRO A O   1 
ATOM   3647 C  CB  . PRO A 1 482 ? -2.547  58.155 25.236  1.00 22.03 ? 705  PRO A CB  1 
ATOM   3648 C  CG  . PRO A 1 482 ? -4.036  58.359 24.832  1.00 22.35 ? 705  PRO A CG  1 
ATOM   3649 C  CD  . PRO A 1 482 ? -4.100  59.856 24.633  1.00 22.81 ? 705  PRO A CD  1 
ATOM   3650 N  N   . ARG A 1 483 ? 0.117   59.471 26.782  1.00 19.87 ? 706  ARG A N   1 
ATOM   3651 C  CA  . ARG A 1 483 ? 1.570   59.703 26.584  1.00 17.55 ? 706  ARG A CA  1 
ATOM   3652 C  C   . ARG A 1 483 ? 2.282   58.772 27.553  1.00 16.41 ? 706  ARG A C   1 
ATOM   3653 O  O   . ARG A 1 483 ? 1.783   58.549 28.635  1.00 15.73 ? 706  ARG A O   1 
ATOM   3654 C  CB  . ARG A 1 483 ? 1.945   61.151 26.859  1.00 18.18 ? 706  ARG A CB  1 
ATOM   3655 C  CG  . ARG A 1 483 ? 3.011   61.702 25.902  1.00 20.38 ? 706  ARG A CG  1 
ATOM   3656 C  CD  . ARG A 1 483 ? 2.417   61.747 24.484  1.00 25.56 ? 706  ARG A CD  1 
ATOM   3657 N  NE  . ARG A 1 483 ? 2.662   63.096 24.025  1.00 35.07 ? 706  ARG A NE  1 
ATOM   3658 C  CZ  . ARG A 1 483 ? 1.837   63.916 23.408  1.00 30.61 ? 706  ARG A CZ  1 
ATOM   3659 N  NH1 . ARG A 1 483 ? 0.600   63.577 23.024  1.00 30.85 ? 706  ARG A NH1 1 
ATOM   3660 N  NH2 . ARG A 1 483 ? 2.326   65.100 23.125  1.00 34.78 ? 706  ARG A NH2 1 
ATOM   3661 N  N   . ASP A 1 484 ? 3.417   58.194 27.135  1.00 15.12 ? 707  ASP A N   1 
ATOM   3662 C  CA  . ASP A 1 484 ? 4.028   57.078 27.873  1.00 14.74 ? 707  ASP A CA  1 
ATOM   3663 C  C   . ASP A 1 484 ? 5.505   57.374 28.058  1.00 14.05 ? 707  ASP A C   1 
ATOM   3664 O  O   . ASP A 1 484 ? 6.147   57.934 27.153  1.00 13.67 ? 707  ASP A O   1 
ATOM   3665 C  CB  . ASP A 1 484 ? 3.834   55.763 27.117  1.00 13.46 ? 707  ASP A CB  1 
ATOM   3666 C  CG  . ASP A 1 484 ? 2.371   55.560 26.741  1.00 17.78 ? 707  ASP A CG  1 
ATOM   3667 O  OD1 . ASP A 1 484 ? 1.572   55.389 27.709  1.00 17.69 ? 707  ASP A OD1 1 
ATOM   3668 O  OD2 . ASP A 1 484 ? 2.063   55.646 25.526  1.00 17.14 ? 707  ASP A OD2 1 
ATOM   3669 N  N   . PHE A 1 485 ? 5.998   57.011 29.259  1.00 13.66 ? 708  PHE A N   1 
ATOM   3670 C  CA  . PHE A 1 485 ? 7.346   57.368 29.728  1.00 14.08 ? 708  PHE A CA  1 
ATOM   3671 C  C   . PHE A 1 485 ? 8.068   56.098 30.178  1.00 13.35 ? 708  PHE A C   1 
ATOM   3672 O  O   . PHE A 1 485 ? 7.562   55.377 31.029  1.00 14.80 ? 708  PHE A O   1 
ATOM   3673 C  CB  . PHE A 1 485 ? 7.189   58.388 30.843  1.00 14.13 ? 708  PHE A CB  1 
ATOM   3674 C  CG  . PHE A 1 485 ? 6.445   59.602 30.385  1.00 15.26 ? 708  PHE A CG  1 
ATOM   3675 C  CD1 . PHE A 1 485 ? 7.038   60.456 29.446  1.00 14.97 ? 708  PHE A CD1 1 
ATOM   3676 C  CD2 . PHE A 1 485 ? 5.112   59.841 30.766  1.00 15.83 ? 708  PHE A CD2 1 
ATOM   3677 C  CE1 . PHE A 1 485 ? 6.370   61.544 28.935  1.00 17.62 ? 708  PHE A CE1 1 
ATOM   3678 C  CE2 . PHE A 1 485 ? 4.445   60.963 30.267  1.00 18.17 ? 708  PHE A CE2 1 
ATOM   3679 C  CZ  . PHE A 1 485 ? 5.075   61.810 29.358  1.00 15.23 ? 708  PHE A CZ  1 
ATOM   3680 N  N   . HIS A 1 486 ? 9.210   55.824 29.566  1.00 13.59 ? 709  HIS A N   1 
ATOM   3681 C  CA  . HIS A 1 486 ? 9.921   54.544 29.715  1.00 12.34 ? 709  HIS A CA  1 
ATOM   3682 C  C   . HIS A 1 486 ? 11.310  54.856 30.294  1.00 11.64 ? 709  HIS A C   1 
ATOM   3683 O  O   . HIS A 1 486 ? 11.995  55.754 29.811  1.00 12.09 ? 709  HIS A O   1 
ATOM   3684 C  CB  . HIS A 1 486 ? 10.081  53.846 28.347  1.00 12.66 ? 709  HIS A CB  1 
ATOM   3685 C  CG  . HIS A 1 486 ? 8.821   53.848 27.517  1.00 9.59  ? 709  HIS A CG  1 
ATOM   3686 N  ND1 . HIS A 1 486 ? 8.732   54.493 26.299  1.00 13.38 ? 709  HIS A ND1 1 
ATOM   3687 C  CD2 . HIS A 1 486 ? 7.608   53.296 27.742  1.00 8.71  ? 709  HIS A CD2 1 
ATOM   3688 C  CE1 . HIS A 1 486 ? 7.505   54.353 25.815  1.00 12.67 ? 709  HIS A CE1 1 
ATOM   3689 N  NE2 . HIS A 1 486 ? 6.803   53.635 26.678  1.00 16.12 ? 709  HIS A NE2 1 
ATOM   3690 N  N   . ILE A 1 487 ? 11.698  54.139 31.349  1.00 11.65 ? 710  ILE A N   1 
ATOM   3691 C  CA  . ILE A 1 487 ? 13.036  54.311 31.914  1.00 11.45 ? 710  ILE A CA  1 
ATOM   3692 C  C   . ILE A 1 487 ? 13.994  54.076 30.729  1.00 12.00 ? 710  ILE A C   1 
ATOM   3693 O  O   . ILE A 1 487 ? 13.876  53.056 30.040  1.00 12.55 ? 710  ILE A O   1 
ATOM   3694 C  CB  . ILE A 1 487 ? 13.284  53.304 33.077  1.00 12.26 ? 710  ILE A CB  1 
ATOM   3695 C  CG1 . ILE A 1 487 ? 12.548  53.803 34.345  1.00 11.52 ? 710  ILE A CG1 1 
ATOM   3696 C  CG2 . ILE A 1 487 ? 14.798  53.189 33.384  1.00 10.72 ? 710  ILE A CG2 1 
ATOM   3697 C  CD1 . ILE A 1 487 ? 13.125  55.212 34.826  1.00 12.50 ? 710  ILE A CD1 1 
ATOM   3698 N  N   . ASN A 1 488 ? 14.897  55.012 30.514  1.00 11.56 ? 711  ASN A N   1 
ATOM   3699 C  CA  . ASN A 1 488 ? 15.919  54.980 29.443  1.00 11.16 ? 711  ASN A CA  1 
ATOM   3700 C  C   . ASN A 1 488 ? 17.198  54.224 29.910  1.00 11.64 ? 711  ASN A C   1 
ATOM   3701 O  O   . ASN A 1 488 ? 17.906  54.710 30.795  1.00 11.37 ? 711  ASN A O   1 
ATOM   3702 C  CB  . ASN A 1 488 ? 16.260  56.441 29.082  1.00 10.65 ? 711  ASN A CB  1 
ATOM   3703 C  CG  . ASN A 1 488 ? 17.124  56.579 27.854  1.00 12.05 ? 711  ASN A CG  1 
ATOM   3704 O  OD1 . ASN A 1 488 ? 17.177  57.662 27.247  1.00 14.29 ? 711  ASN A OD1 1 
ATOM   3705 N  ND2 . ASN A 1 488 ? 17.846  55.532 27.503  1.00 8.42  ? 711  ASN A ND2 1 
ATOM   3706 N  N   . LEU A 1 489 ? 17.481  53.061 29.324  1.00 10.00 ? 712  LEU A N   1 
ATOM   3707 C  CA  . LEU A 1 489 ? 18.654  52.258 29.782  1.00 11.58 ? 712  LEU A CA  1 
ATOM   3708 C  C   . LEU A 1 489 ? 19.993  52.994 29.612  1.00 11.52 ? 712  LEU A C   1 
ATOM   3709 O  O   . LEU A 1 489 ? 20.925  52.784 30.397  1.00 12.13 ? 712  LEU A O   1 
ATOM   3710 C  CB  . LEU A 1 489 ? 18.715  50.861 29.140  1.00 11.61 ? 712  LEU A CB  1 
ATOM   3711 C  CG  . LEU A 1 489 ? 17.610  49.844 29.496  1.00 12.71 ? 712  LEU A CG  1 
ATOM   3712 C  CD1 . LEU A 1 489 ? 18.134  48.420 29.122  1.00 11.81 ? 712  LEU A CD1 1 
ATOM   3713 C  CD2 . LEU A 1 489 ? 17.100  49.926 30.974  1.00 15.36 ? 712  LEU A CD2 1 
ATOM   3714 N  N   . PHE A 1 490 ? 20.058  53.908 28.658  1.00 11.73 ? 713  PHE A N   1 
ATOM   3715 C  CA  . PHE A 1 490 ? 21.288  54.684 28.475  1.00 13.00 ? 713  PHE A CA  1 
ATOM   3716 C  C   . PHE A 1 490 ? 21.549  55.642 29.632  1.00 13.62 ? 713  PHE A C   1 
ATOM   3717 O  O   . PHE A 1 490 ? 22.668  56.138 29.773  1.00 13.68 ? 713  PHE A O   1 
ATOM   3718 C  CB  . PHE A 1 490 ? 21.221  55.497 27.197  1.00 13.55 ? 713  PHE A CB  1 
ATOM   3719 C  CG  . PHE A 1 490 ? 21.257  54.664 25.974  1.00 11.96 ? 713  PHE A CG  1 
ATOM   3720 C  CD1 . PHE A 1 490 ? 22.465  54.088 25.569  1.00 13.36 ? 713  PHE A CD1 1 
ATOM   3721 C  CD2 . PHE A 1 490 ? 20.074  54.415 25.239  1.00 12.22 ? 713  PHE A CD2 1 
ATOM   3722 C  CE1 . PHE A 1 490 ? 22.519  53.289 24.442  1.00 15.76 ? 713  PHE A CE1 1 
ATOM   3723 C  CE2 . PHE A 1 490 ? 20.136  53.615 24.092  1.00 14.43 ? 713  PHE A CE2 1 
ATOM   3724 C  CZ  . PHE A 1 490 ? 21.332  53.044 23.711  1.00 13.59 ? 713  PHE A CZ  1 
ATOM   3725 N  N   . ARG A 1 491 ? 20.504  55.955 30.391  1.00 13.83 ? 714  ARG A N   1 
ATOM   3726 C  CA  . ARG A 1 491 ? 20.618  56.822 31.580  1.00 13.40 ? 714  ARG A CA  1 
ATOM   3727 C  C   . ARG A 1 491 ? 20.852  56.040 32.884  1.00 13.84 ? 714  ARG A C   1 
ATOM   3728 O  O   . ARG A 1 491 ? 21.068  56.652 33.965  1.00 13.36 ? 714  ARG A O   1 
ATOM   3729 C  CB  . ARG A 1 491 ? 19.352  57.691 31.765  1.00 13.10 ? 714  ARG A CB  1 
ATOM   3730 C  CG  . ARG A 1 491 ? 19.046  58.620 30.611  1.00 15.99 ? 714  ARG A CG  1 
ATOM   3731 C  CD  . ARG A 1 491 ? 20.115  59.757 30.453  1.00 17.46 ? 714  ARG A CD  1 
ATOM   3732 N  NE  . ARG A 1 491 ? 19.974  60.086 29.068  1.00 29.40 ? 714  ARG A NE  1 
ATOM   3733 C  CZ  . ARG A 1 491 ? 20.704  59.564 28.084  1.00 28.10 ? 714  ARG A CZ  1 
ATOM   3734 N  NH1 . ARG A 1 491 ? 21.758  58.804 28.322  1.00 30.64 ? 714  ARG A NH1 1 
ATOM   3735 N  NH2 . ARG A 1 491 ? 20.402  59.893 26.863  1.00 30.65 ? 714  ARG A NH2 1 
ATOM   3736 N  N   . MET A 1 492 ? 20.823  54.723 32.812  1.00 12.72 ? 715  MET A N   1 
ATOM   3737 C  CA  . MET A 1 492 ? 20.917  53.862 34.008  1.00 12.56 ? 715  MET A CA  1 
ATOM   3738 C  C   . MET A 1 492 ? 22.199  53.016 34.055  1.00 12.32 ? 715  MET A C   1 
ATOM   3739 O  O   . MET A 1 492 ? 22.273  52.010 34.764  1.00 11.74 ? 715  MET A O   1 
ATOM   3740 C  CB  . MET A 1 492 ? 19.718  52.893 34.032  1.00 12.96 ? 715  MET A CB  1 
ATOM   3741 C  CG  . MET A 1 492 ? 18.353  53.609 33.779  1.00 14.02 ? 715  MET A CG  1 
ATOM   3742 S  SD  . MET A 1 492 ? 18.016  54.935 34.991  1.00 21.91 ? 715  MET A SD  1 
ATOM   3743 C  CE  . MET A 1 492 ? 17.572  53.900 36.375  1.00 21.02 ? 715  MET A CE  1 
ATOM   3744 N  N   . GLN A 1 493 ? 23.214  53.438 33.330  1.00 12.61 ? 716  GLN A N   1 
ATOM   3745 C  CA  . GLN A 1 493 ? 24.417  52.628 33.219  1.00 13.26 ? 716  GLN A CA  1 
ATOM   3746 C  C   . GLN A 1 493 ? 25.188  52.354 34.533  1.00 15.17 ? 716  GLN A C   1 
ATOM   3747 O  O   . GLN A 1 493 ? 25.633  51.225 34.711  1.00 14.62 ? 716  GLN A O   1 
ATOM   3748 C  CB  . GLN A 1 493 ? 25.346  53.134 32.114  1.00 12.78 ? 716  GLN A CB  1 
ATOM   3749 C  CG  . GLN A 1 493 ? 24.708  53.020 30.716  1.00 13.19 ? 716  GLN A CG  1 
ATOM   3750 C  CD  . GLN A 1 493 ? 24.604  51.565 30.278  1.00 15.98 ? 716  GLN A CD  1 
ATOM   3751 O  OE1 . GLN A 1 493 ? 25.601  50.835 30.251  1.00 15.88 ? 716  GLN A OE1 1 
ATOM   3752 N  NE2 . GLN A 1 493 ? 23.377  51.124 29.958  1.00 13.70 ? 716  GLN A NE2 1 
ATOM   3753 N  N   . PRO A 1 494 ? 25.415  53.384 35.379  1.00 16.52 ? 717  PRO A N   1 
ATOM   3754 C  CA  . PRO A 1 494 ? 26.112  53.172 36.673  1.00 17.94 ? 717  PRO A CA  1 
ATOM   3755 C  C   . PRO A 1 494 ? 25.447  52.095 37.556  1.00 17.99 ? 717  PRO A C   1 
ATOM   3756 O  O   . PRO A 1 494 ? 26.121  51.225 38.070  1.00 17.69 ? 717  PRO A O   1 
ATOM   3757 C  CB  . PRO A 1 494 ? 26.070  54.562 37.338  1.00 18.30 ? 717  PRO A CB  1 
ATOM   3758 C  CG  . PRO A 1 494 ? 25.828  55.568 36.145  1.00 18.61 ? 717  PRO A CG  1 
ATOM   3759 C  CD  . PRO A 1 494 ? 25.142  54.818 35.089  1.00 16.49 ? 717  PRO A CD  1 
ATOM   3760 N  N   . TRP A 1 495 ? 24.119  52.106 37.640  1.00 16.96 ? 718  TRP A N   1 
ATOM   3761 C  CA  . TRP A 1 495 ? 23.381  51.105 38.407  1.00 16.25 ? 718  TRP A CA  1 
ATOM   3762 C  C   . TRP A 1 495 ? 23.447  49.732 37.745  1.00 16.33 ? 718  TRP A C   1 
ATOM   3763 O  O   . TRP A 1 495 ? 23.710  48.692 38.395  1.00 15.54 ? 718  TRP A O   1 
ATOM   3764 C  CB  . TRP A 1 495 ? 21.930  51.568 38.544  1.00 16.74 ? 718  TRP A CB  1 
ATOM   3765 C  CG  . TRP A 1 495 ? 21.131  50.701 39.510  1.00 16.23 ? 718  TRP A CG  1 
ATOM   3766 C  CD1 . TRP A 1 495 ? 21.122  50.799 40.865  1.00 16.44 ? 718  TRP A CD1 1 
ATOM   3767 C  CD2 . TRP A 1 495 ? 20.287  49.600 39.174  1.00 16.14 ? 718  TRP A CD2 1 
ATOM   3768 N  NE1 . TRP A 1 495 ? 20.319  49.820 41.413  1.00 15.24 ? 718  TRP A NE1 1 
ATOM   3769 C  CE2 . TRP A 1 495 ? 19.779  49.077 40.393  1.00 16.57 ? 718  TRP A CE2 1 
ATOM   3770 C  CE3 . TRP A 1 495 ? 19.892  49.006 37.963  1.00 18.03 ? 718  TRP A CE3 1 
ATOM   3771 C  CZ2 . TRP A 1 495 ? 18.930  47.990 40.436  1.00 16.29 ? 718  TRP A CZ2 1 
ATOM   3772 C  CZ3 . TRP A 1 495 ? 19.011  47.924 38.007  1.00 17.27 ? 718  TRP A CZ3 1 
ATOM   3773 C  CH2 . TRP A 1 495 ? 18.540  47.431 39.248  1.00 18.47 ? 718  TRP A CH2 1 
ATOM   3774 N  N   . LEU A 1 496 ? 23.222  49.694 36.428  1.00 15.32 ? 719  LEU A N   1 
ATOM   3775 C  CA  . LEU A 1 496 ? 23.292  48.406 35.767  1.00 16.14 ? 719  LEU A CA  1 
ATOM   3776 C  C   . LEU A 1 496 ? 24.702  47.829 35.957  1.00 16.43 ? 719  LEU A C   1 
ATOM   3777 O  O   . LEU A 1 496 ? 24.854  46.627 36.183  1.00 16.13 ? 719  LEU A O   1 
ATOM   3778 C  CB  . LEU A 1 496 ? 23.002  48.596 34.286  1.00 16.16 ? 719  LEU A CB  1 
ATOM   3779 C  CG  . LEU A 1 496 ? 21.637  48.305 33.642  1.00 18.29 ? 719  LEU A CG  1 
ATOM   3780 C  CD1 . LEU A 1 496 ? 20.517  47.764 34.468  1.00 18.48 ? 719  LEU A CD1 1 
ATOM   3781 C  CD2 . LEU A 1 496 ? 21.241  49.357 32.662  1.00 19.31 ? 719  LEU A CD2 1 
ATOM   3782 N  N   . ARG A 1 497 ? 25.723  48.680 35.787  1.00 17.17 ? 720  ARG A N   1 
ATOM   3783 C  CA  . ARG A 1 497 ? 27.117  48.203 35.903  1.00 19.08 ? 720  ARG A CA  1 
ATOM   3784 C  C   . ARG A 1 497 ? 27.455  47.764 37.347  1.00 19.63 ? 720  ARG A C   1 
ATOM   3785 O  O   . ARG A 1 497 ? 28.203  46.794 37.535  1.00 20.10 ? 720  ARG A O   1 
ATOM   3786 C  CB  . ARG A 1 497 ? 28.103  49.274 35.409  1.00 19.04 ? 720  ARG A CB  1 
ATOM   3787 C  CG  . ARG A 1 497 ? 28.168  49.356 33.897  1.00 20.44 ? 720  ARG A CG  1 
ATOM   3788 C  CD  . ARG A 1 497 ? 28.515  50.767 33.347  1.00 25.70 ? 720  ARG A CD  1 
ATOM   3789 N  NE  . ARG A 1 497 ? 29.545  50.641 32.323  1.00 36.55 ? 720  ARG A NE  1 
ATOM   3790 C  CZ  . ARG A 1 497 ? 29.434  50.876 31.018  1.00 37.21 ? 720  ARG A CZ  1 
ATOM   3791 N  NH1 . ARG A 1 497 ? 28.295  51.304 30.422  1.00 33.81 ? 720  ARG A NH1 1 
ATOM   3792 N  NH2 . ARG A 1 497 ? 30.528  50.673 30.291  1.00 39.56 ? 720  ARG A NH2 1 
ATOM   3793 N  N   . GLN A 1 498 ? 26.875  48.441 38.343  1.00 20.90 ? 721  GLN A N   1 
ATOM   3794 C  CA  . GLN A 1 498 ? 27.108  48.091 39.760  1.00 22.15 ? 721  GLN A CA  1 
ATOM   3795 C  C   . GLN A 1 498 ? 26.711  46.649 40.020  1.00 22.00 ? 721  GLN A C   1 
ATOM   3796 O  O   . GLN A 1 498 ? 27.405  45.918 40.734  1.00 22.85 ? 721  GLN A O   1 
ATOM   3797 C  CB  . GLN A 1 498 ? 26.362  49.064 40.683  1.00 22.44 ? 721  GLN A CB  1 
ATOM   3798 C  CG  . GLN A 1 498 ? 26.352  48.693 42.167  1.00 27.06 ? 721  GLN A CG  1 
ATOM   3799 C  CD  . GLN A 1 498 ? 25.532  49.671 43.000  1.00 31.10 ? 721  GLN A CD  1 
ATOM   3800 O  OE1 . GLN A 1 498 ? 24.907  50.589 42.475  1.00 33.57 ? 721  GLN A OE1 1 
ATOM   3801 N  NE2 . GLN A 1 498 ? 25.543  49.478 44.300  1.00 34.48 ? 721  GLN A NE2 1 
ATOM   3802 N  N   . HIS A 1 499 ? 25.624  46.216 39.373  1.00 21.04 ? 722  HIS A N   1 
ATOM   3803 C  CA  . HIS A 1 499 ? 25.010  44.942 39.631  1.00 20.24 ? 722  HIS A CA  1 
ATOM   3804 C  C   . HIS A 1 499 ? 25.300  43.846 38.620  1.00 19.70 ? 722  HIS A C   1 
ATOM   3805 O  O   . HIS A 1 499 ? 25.177  42.687 38.950  1.00 21.07 ? 722  HIS A O   1 
ATOM   3806 C  CB  . HIS A 1 499 ? 23.481  45.124 39.833  1.00 19.70 ? 722  HIS A CB  1 
ATOM   3807 C  CG  . HIS A 1 499 ? 23.172  45.874 41.072  1.00 21.09 ? 722  HIS A CG  1 
ATOM   3808 N  ND1 . HIS A 1 499 ? 22.753  47.188 41.065  1.00 24.33 ? 722  HIS A ND1 1 
ATOM   3809 C  CD2 . HIS A 1 499 ? 23.358  45.540 42.376  1.00 18.54 ? 722  HIS A CD2 1 
ATOM   3810 C  CE1 . HIS A 1 499 ? 22.654  47.623 42.312  1.00 22.72 ? 722  HIS A CE1 1 
ATOM   3811 N  NE2 . HIS A 1 499 ? 23.007  46.638 43.126  1.00 23.23 ? 722  HIS A NE2 1 
ATOM   3812 N  N   . LEU A 1 500 ? 25.659  44.203 37.396  1.00 19.05 ? 723  LEU A N   1 
ATOM   3813 C  CA  . LEU A 1 500 ? 25.774  43.202 36.312  1.00 19.46 ? 723  LEU A CA  1 
ATOM   3814 C  C   . LEU A 1 500 ? 27.178  43.173 35.720  1.00 18.83 ? 723  LEU A C   1 
ATOM   3815 O  O   . LEU A 1 500 ? 27.396  42.552 34.680  1.00 18.62 ? 723  LEU A O   1 
ATOM   3816 C  CB  . LEU A 1 500 ? 24.758  43.488 35.182  1.00 18.37 ? 723  LEU A CB  1 
ATOM   3817 C  CG  . LEU A 1 500 ? 23.292  43.561 35.640  1.00 18.61 ? 723  LEU A CG  1 
ATOM   3818 C  CD1 . LEU A 1 500 ? 22.428  44.137 34.498  1.00 17.52 ? 723  LEU A CD1 1 
ATOM   3819 C  CD2 . LEU A 1 500 ? 22.852  42.179 35.996  1.00 18.07 ? 723  LEU A CD2 1 
ATOM   3820 N  N   . GLY A 1 501 ? 28.128  43.793 36.408  1.00 20.77 ? 724  GLY A N   1 
ATOM   3821 C  CA  . GLY A 1 501 ? 29.489  43.936 35.870  1.00 23.44 ? 724  GLY A CA  1 
ATOM   3822 C  C   . GLY A 1 501 ? 30.151  42.603 35.578  1.00 25.17 ? 724  GLY A C   1 
ATOM   3823 O  O   . GLY A 1 501 ? 30.947  42.487 34.653  1.00 25.60 ? 724  GLY A O   1 
ATOM   3824 N  N   . ASP A 1 502 ? 29.758  41.577 36.333  1.00 26.88 ? 725  ASP A N   1 
ATOM   3825 C  CA  . ASP A 1 502 ? 30.310  40.228 36.176  1.00 28.58 ? 725  ASP A CA  1 
ATOM   3826 C  C   . ASP A 1 502 ? 29.299  39.314 35.551  1.00 28.41 ? 725  ASP A C   1 
ATOM   3827 O  O   . ASP A 1 502 ? 29.563  38.126 35.389  1.00 29.68 ? 725  ASP A O   1 
ATOM   3828 C  CB  . ASP A 1 502 ? 30.724  39.643 37.526  1.00 29.57 ? 725  ASP A CB  1 
ATOM   3829 C  CG  . ASP A 1 502 ? 31.842  40.422 38.188  1.00 33.68 ? 725  ASP A CG  1 
ATOM   3830 O  OD1 . ASP A 1 502 ? 32.677  41.034 37.474  1.00 39.12 ? 725  ASP A OD1 1 
ATOM   3831 O  OD2 . ASP A 1 502 ? 31.877  40.431 39.436  1.00 39.48 ? 725  ASP A OD2 1 
ATOM   3832 N  N   . VAL A 1 503 ? 28.130  39.855 35.227  1.00 27.21 ? 726  VAL A N   1 
ATOM   3833 C  CA  . VAL A 1 503 ? 27.121  39.108 34.473  1.00 26.71 ? 726  VAL A CA  1 
ATOM   3834 C  C   . VAL A 1 503 ? 27.216  39.376 32.969  1.00 26.93 ? 726  VAL A C   1 
ATOM   3835 O  O   . VAL A 1 503 ? 27.201  38.445 32.168  1.00 27.55 ? 726  VAL A O   1 
ATOM   3836 C  CB  . VAL A 1 503 ? 25.681  39.400 35.000  1.00 26.18 ? 726  VAL A CB  1 
ATOM   3837 C  CG1 . VAL A 1 503 ? 24.622  38.751 34.110  1.00 25.73 ? 726  VAL A CG1 1 
ATOM   3838 C  CG2 . VAL A 1 503 ? 25.537  38.916 36.410  1.00 25.03 ? 726  VAL A CG2 1 
ATOM   3839 N  N   . LEU A 1 504 ? 27.294  40.654 32.590  1.00 25.88 ? 727  LEU A N   1 
ATOM   3840 C  CA  . LEU A 1 504 ? 27.412  41.057 31.193  1.00 24.86 ? 727  LEU A CA  1 
ATOM   3841 C  C   . LEU A 1 504 ? 28.774  41.694 30.969  1.00 24.90 ? 727  LEU A C   1 
ATOM   3842 O  O   . LEU A 1 504 ? 29.440  42.094 31.905  1.00 23.99 ? 727  LEU A O   1 
ATOM   3843 C  CB  . LEU A 1 504 ? 26.320  42.076 30.835  1.00 25.42 ? 727  LEU A CB  1 
ATOM   3844 C  CG  . LEU A 1 504 ? 24.846  41.794 31.202  1.00 26.80 ? 727  LEU A CG  1 
ATOM   3845 C  CD1 . LEU A 1 504 ? 23.948  42.823 30.584  1.00 27.73 ? 727  LEU A CD1 1 
ATOM   3846 C  CD2 . LEU A 1 504 ? 24.412  40.389 30.781  1.00 26.98 ? 727  LEU A CD2 1 
ATOM   3847 N  N   . ASN A 1 505 ? 29.162  41.814 29.716  1.00 24.46 ? 728  ASN A N   1 
ATOM   3848 C  CA  . ASN A 1 505 ? 30.480  42.324 29.378  1.00 25.15 ? 728  ASN A CA  1 
ATOM   3849 C  C   . ASN A 1 505 ? 30.273  43.747 28.854  1.00 23.54 ? 728  ASN A C   1 
ATOM   3850 O  O   . ASN A 1 505 ? 30.002  43.923 27.670  1.00 22.54 ? 728  ASN A O   1 
ATOM   3851 C  CB  . ASN A 1 505 ? 31.120  41.365 28.339  1.00 26.42 ? 728  ASN A CB  1 
ATOM   3852 C  CG  . ASN A 1 505 ? 31.200  39.898 28.864  1.00 31.77 ? 728  ASN A CG  1 
ATOM   3853 O  OD1 . ASN A 1 505 ? 31.778  39.650 29.931  1.00 37.23 ? 728  ASN A OD1 1 
ATOM   3854 N  ND2 . ASN A 1 505 ? 30.611  38.939 28.128  1.00 33.79 ? 728  ASN A ND2 1 
ATOM   3855 N  N   . PHE A 1 506 ? 30.333  44.749 29.748  1.00 22.04 ? 729  PHE A N   1 
ATOM   3856 C  CA  . PHE A 1 506 ? 30.109  46.144 29.345  1.00 22.60 ? 729  PHE A CA  1 
ATOM   3857 C  C   . PHE A 1 506 ? 31.268  46.693 28.568  1.00 24.04 ? 729  PHE A C   1 
ATOM   3858 O  O   . PHE A 1 506 ? 32.427  46.308 28.796  1.00 24.24 ? 729  PHE A O   1 
ATOM   3859 C  CB  . PHE A 1 506 ? 29.835  47.059 30.531  1.00 22.11 ? 729  PHE A CB  1 
ATOM   3860 C  CG  . PHE A 1 506 ? 28.498  46.800 31.182  1.00 21.22 ? 729  PHE A CG  1 
ATOM   3861 C  CD1 . PHE A 1 506 ? 28.373  45.832 32.185  1.00 20.55 ? 729  PHE A CD1 1 
ATOM   3862 C  CD2 . PHE A 1 506 ? 27.364  47.459 30.745  1.00 20.16 ? 729  PHE A CD2 1 
ATOM   3863 C  CE1 . PHE A 1 506 ? 27.134  45.594 32.801  1.00 19.38 ? 729  PHE A CE1 1 
ATOM   3864 C  CE2 . PHE A 1 506 ? 26.110  47.200 31.327  1.00 21.68 ? 729  PHE A CE2 1 
ATOM   3865 C  CZ  . PHE A 1 506 ? 26.002  46.267 32.356  1.00 21.49 ? 729  PHE A CZ  1 
ATOM   3866 N  N   . LEU A 1 507 ? 30.966  47.594 27.653  1.00 24.27 ? 730  LEU A N   1 
ATOM   3867 C  CA  . LEU A 1 507 ? 32.016  48.304 26.951  1.00 26.45 ? 730  LEU A CA  1 
ATOM   3868 C  C   . LEU A 1 507 ? 32.806  49.078 27.991  1.00 29.22 ? 730  LEU A C   1 
ATOM   3869 O  O   . LEU A 1 507 ? 32.190  49.887 28.707  1.00 30.66 ? 730  LEU A O   1 
ATOM   3870 C  CB  . LEU A 1 507 ? 31.385  49.254 25.934  1.00 25.95 ? 730  LEU A CB  1 
ATOM   3871 C  CG  . LEU A 1 507 ? 30.636  48.614 24.764  1.00 24.53 ? 730  LEU A CG  1 
ATOM   3872 C  CD1 . LEU A 1 507 ? 30.115  49.716 23.860  1.00 23.96 ? 730  LEU A CD1 1 
ATOM   3873 C  CD2 . LEU A 1 507 ? 31.544  47.653 23.988  1.00 21.07 ? 730  LEU A CD2 1 
HETATM 3874 C  C1  . NAG B 2 .   ? 4.992   73.670 44.684  1.00 48.05 ? 1    NAG B C1  1 
HETATM 3875 C  C2  . NAG B 2 .   ? 5.176   73.437 46.183  1.00 47.59 ? 1    NAG B C2  1 
HETATM 3876 C  C3  . NAG B 2 .   ? 6.415   74.242 46.628  1.00 48.93 ? 1    NAG B C3  1 
HETATM 3877 C  C4  . NAG B 2 .   ? 7.599   74.094 45.656  1.00 48.95 ? 1    NAG B C4  1 
HETATM 3878 C  C5  . NAG B 2 .   ? 7.225   73.978 44.156  1.00 47.65 ? 1    NAG B C5  1 
HETATM 3879 C  C6  . NAG B 2 .   ? 8.362   73.490 43.247  1.00 46.55 ? 1    NAG B C6  1 
HETATM 3880 C  C7  . NAG B 2 .   ? 3.383   72.936 47.838  1.00 42.97 ? 1    NAG B C7  1 
HETATM 3881 C  C8  . NAG B 2 .   ? 2.096   73.405 48.449  1.00 43.98 ? 1    NAG B C8  1 
HETATM 3882 N  N2  . NAG B 2 .   ? 3.937   73.727 46.908  1.00 43.93 ? 1    NAG B N2  1 
HETATM 3883 O  O3  . NAG B 2 .   ? 6.865   73.835 47.907  1.00 53.03 ? 1    NAG B O3  1 
HETATM 3884 O  O4  . NAG B 2 .   ? 8.440   75.206 45.856  1.00 49.92 ? 1    NAG B O4  1 
HETATM 3885 O  O5  . NAG B 2 .   ? 6.099   73.146 43.974  1.00 46.12 ? 1    NAG B O5  1 
HETATM 3886 O  O6  . NAG B 2 .   ? 9.021   72.370 43.812  1.00 47.32 ? 1    NAG B O6  1 
HETATM 3887 O  O7  . NAG B 2 .   ? 3.860   71.873 48.246  1.00 43.54 ? 1    NAG B O7  1 
HETATM 3888 C  C1  . NAG B 2 .   ? 6.262   74.606 48.981  1.00 56.47 ? 2    NAG B C1  1 
HETATM 3889 C  C2  . NAG B 2 .   ? 6.715   74.005 50.317  1.00 58.24 ? 2    NAG B C2  1 
HETATM 3890 C  C3  . NAG B 2 .   ? 7.843   74.764 51.014  1.00 59.79 ? 2    NAG B C3  1 
HETATM 3891 C  C4  . NAG B 2 .   ? 8.447   75.809 50.092  1.00 58.79 ? 2    NAG B C4  1 
HETATM 3892 C  C5  . NAG B 2 .   ? 7.313   76.725 49.637  1.00 58.71 ? 2    NAG B C5  1 
HETATM 3893 C  C6  . NAG B 2 .   ? 7.760   77.977 48.880  1.00 59.05 ? 2    NAG B C6  1 
HETATM 3894 C  C7  . NAG B 2 .   ? 5.376   72.827 51.950  1.00 62.43 ? 2    NAG B C7  1 
HETATM 3895 C  C8  . NAG B 2 .   ? 5.483   72.970 53.445  1.00 62.76 ? 2    NAG B C8  1 
HETATM 3896 N  N2  . NAG B 2 .   ? 5.591   73.921 51.219  1.00 60.98 ? 2    NAG B N2  1 
HETATM 3897 O  O3  . NAG B 2 .   ? 8.812   73.852 51.504  1.00 60.73 ? 2    NAG B O3  1 
HETATM 3898 O  O4  . NAG B 2 .   ? 9.395   76.554 50.804  1.00 60.01 ? 2    NAG B O4  1 
HETATM 3899 O  O5  . NAG B 2 .   ? 6.393   76.021 48.832  1.00 56.25 ? 2    NAG B O5  1 
HETATM 3900 O  O6  . NAG B 2 .   ? 8.704   77.660 47.873  1.00 60.51 ? 2    NAG B O6  1 
HETATM 3901 O  O7  . NAG B 2 .   ? 5.099   71.740 51.445  1.00 63.55 ? 2    NAG B O7  1 
HETATM 3902 C  C1  . NAG B 2 .   ? 9.834   74.833 45.919  1.00 52.51 ? 3    NAG B C1  1 
HETATM 3903 C  C2  . NAG B 2 .   ? 10.641  76.055 45.477  1.00 53.62 ? 3    NAG B C2  1 
HETATM 3904 C  C3  . NAG B 2 .   ? 12.149  75.918 45.691  1.00 54.69 ? 3    NAG B C3  1 
HETATM 3905 C  C4  . NAG B 2 .   ? 12.437  75.354 47.079  1.00 53.89 ? 3    NAG B C4  1 
HETATM 3906 C  C5  . NAG B 2 .   ? 11.640  74.057 47.255  1.00 53.88 ? 3    NAG B C5  1 
HETATM 3907 C  C6  . NAG B 2 .   ? 11.913  73.347 48.573  1.00 54.37 ? 3    NAG B C6  1 
HETATM 3908 C  C7  . NAG B 2 .   ? 9.626   77.297 43.673  1.00 54.60 ? 3    NAG B C7  1 
HETATM 3909 C  C8  . NAG B 2 .   ? 9.470   77.389 42.185  1.00 54.41 ? 3    NAG B C8  1 
HETATM 3910 N  N2  . NAG B 2 .   ? 10.398  76.304 44.076  1.00 54.08 ? 3    NAG B N2  1 
HETATM 3911 O  O3  . NAG B 2 .   ? 12.753  77.189 45.506  1.00 55.58 ? 3    NAG B O3  1 
HETATM 3912 O  O4  . NAG B 2 .   ? 13.830  75.193 47.243  1.00 54.65 ? 3    NAG B O4  1 
HETATM 3913 O  O5  . NAG B 2 .   ? 10.251  74.364 47.191  1.00 54.25 ? 3    NAG B O5  1 
HETATM 3914 O  O6  . NAG B 2 .   ? 10.863  72.433 48.823  1.00 54.53 ? 3    NAG B O6  1 
HETATM 3915 O  O7  . NAG B 2 .   ? 9.073   78.086 44.454  1.00 55.06 ? 3    NAG B O7  1 
HETATM 3916 C  C1  . NAG C 3 .   ? 10.154  30.469 13.344  1.00 15.74 ? 1    NAG C C1  1 
HETATM 3917 C  C2  . NAG C 3 .   ? 11.423  29.652 13.024  1.00 15.46 ? 1    NAG C C2  1 
HETATM 3918 C  C3  . NAG C 3 .   ? 11.075  28.371 12.212  1.00 17.84 ? 1    NAG C C3  1 
HETATM 3919 C  C4  . NAG C 3 .   ? 10.012  27.534 12.959  1.00 17.88 ? 1    NAG C C4  1 
HETATM 3920 C  C5  . NAG C 3 .   ? 8.834   28.470 13.291  1.00 18.82 ? 1    NAG C C5  1 
HETATM 3921 C  C6  . NAG C 3 .   ? 7.626   27.843 14.012  1.00 20.73 ? 1    NAG C C6  1 
HETATM 3922 C  C7  . NAG C 3 .   ? 13.463  31.101 12.970  1.00 17.59 ? 1    NAG C C7  1 
HETATM 3923 C  C8  . NAG C 3 .   ? 14.424  31.903 12.126  1.00 14.17 ? 1    NAG C C8  1 
HETATM 3924 N  N2  . NAG C 3 .   ? 12.479  30.412 12.331  1.00 14.79 ? 1    NAG C N2  1 
HETATM 3925 O  O3  . NAG C 3 .   ? 12.235  27.596 12.008  1.00 18.24 ? 1    NAG C O3  1 
HETATM 3926 O  O4  . NAG C 3 .   ? 9.611   26.460 12.124  1.00 19.90 ? 1    NAG C O4  1 
HETATM 3927 O  O5  . NAG C 3 .   ? 9.312   29.572 14.060  1.00 18.56 ? 1    NAG C O5  1 
HETATM 3928 O  O6  . NAG C 3 .   ? 8.081   27.131 15.140  1.00 24.20 ? 1    NAG C O6  1 
HETATM 3929 O  O7  . NAG C 3 .   ? 13.627  31.100 14.185  1.00 17.67 ? 1    NAG C O7  1 
HETATM 3930 C  C1  . NAG C 3 .   ? 9.671   25.217 12.819  1.00 21.33 ? 2    NAG C C1  1 
HETATM 3931 C  C2  . NAG C 3 .   ? 8.753   24.224 12.087  1.00 23.18 ? 2    NAG C C2  1 
HETATM 3932 C  C3  . NAG C 3 .   ? 8.847   22.820 12.695  1.00 25.54 ? 2    NAG C C3  1 
HETATM 3933 C  C4  . NAG C 3 .   ? 10.303  22.363 12.832  1.00 26.45 ? 2    NAG C C4  1 
HETATM 3934 C  C5  . NAG C 3 .   ? 11.160  23.517 13.423  1.00 23.28 ? 2    NAG C C5  1 
HETATM 3935 C  C6  . NAG C 3 .   ? 12.649  23.197 13.447  1.00 22.67 ? 2    NAG C C6  1 
HETATM 3936 C  C7  . NAG C 3 .   ? 6.847   25.300 10.918  1.00 23.26 ? 2    NAG C C7  1 
HETATM 3937 C  C8  . NAG C 3 .   ? 5.419   25.747 11.002  1.00 24.88 ? 2    NAG C C8  1 
HETATM 3938 N  N2  . NAG C 3 .   ? 7.371   24.674 11.985  1.00 22.48 ? 2    NAG C N2  1 
HETATM 3939 O  O3  . NAG C 3 .   ? 8.094   21.982 11.830  1.00 25.27 ? 2    NAG C O3  1 
HETATM 3940 O  O4  . NAG C 3 .   ? 10.508  21.289 13.757  1.00 34.36 ? 2    NAG C O4  1 
HETATM 3941 O  O5  . NAG C 3 .   ? 10.997  24.738 12.754  1.00 22.50 ? 2    NAG C O5  1 
HETATM 3942 O  O6  . NAG C 3 .   ? 13.130  23.045 12.138  1.00 22.24 ? 2    NAG C O6  1 
HETATM 3943 O  O7  . NAG C 3 .   ? 7.465   25.570 9.885   1.00 24.72 ? 2    NAG C O7  1 
HETATM 3944 C  C1  . NAG C 3 .   ? 10.338  19.833 13.541  1.00 42.89 ? 3    NAG C C1  1 
HETATM 3945 C  C2  . NAG C 3 .   ? 9.234   19.325 12.577  1.00 47.26 ? 3    NAG C C2  1 
HETATM 3946 C  C3  . NAG C 3 .   ? 9.305   17.825 12.265  1.00 50.05 ? 3    NAG C C3  1 
HETATM 3947 C  C4  . NAG C 3 .   ? 10.715  17.253 12.283  1.00 49.16 ? 3    NAG C C4  1 
HETATM 3948 C  C5  . NAG C 3 .   ? 11.405  17.673 13.571  1.00 47.43 ? 3    NAG C C5  1 
HETATM 3949 C  C6  . NAG C 3 .   ? 12.642  16.781 13.851  1.00 46.47 ? 3    NAG C C6  1 
HETATM 3950 C  C7  . NAG C 3 .   ? 6.820   18.750 13.020  1.00 52.55 ? 3    NAG C C7  1 
HETATM 3951 C  C8  . NAG C 3 .   ? 6.430   17.860 14.174  1.00 53.02 ? 3    NAG C C8  1 
HETATM 3952 N  N2  . NAG C 3 .   ? 7.912   19.540 13.177  1.00 51.72 ? 3    NAG C N2  1 
HETATM 3953 O  O3  . NAG C 3 .   ? 8.672   17.541 11.020  1.00 51.93 ? 3    NAG C O3  1 
HETATM 3954 O  O4  . NAG C 3 .   ? 10.586  15.853 12.207  1.00 52.90 ? 3    NAG C O4  1 
HETATM 3955 O  O5  . NAG C 3 .   ? 11.574  19.097 13.510  1.00 44.41 ? 3    NAG C O5  1 
HETATM 3956 O  O6  . NAG C 3 .   ? 13.915  17.369 13.604  1.00 47.41 ? 3    NAG C O6  1 
HETATM 3957 O  O7  . NAG C 3 .   ? 6.124   18.741 11.995  1.00 52.59 ? 3    NAG C O7  1 
HETATM 3958 C  C1  . NAG D 4 .   ? -3.606  40.593 21.328  1.00 26.87 ? 807  NAG A C1  1 
HETATM 3959 C  C2  . NAG D 4 .   ? -4.702  40.006 20.421  1.00 32.50 ? 807  NAG A C2  1 
HETATM 3960 C  C3  . NAG D 4 .   ? -4.875  40.800 19.137  1.00 34.57 ? 807  NAG A C3  1 
HETATM 3961 C  C4  . NAG D 4 .   ? -4.942  42.302 19.404  1.00 32.57 ? 807  NAG A C4  1 
HETATM 3962 C  C5  . NAG D 4 .   ? -3.789  42.722 20.314  1.00 30.67 ? 807  NAG A C5  1 
HETATM 3963 C  C6  . NAG D 4 .   ? -3.805  44.233 20.608  1.00 29.49 ? 807  NAG A C6  1 
HETATM 3964 C  C7  . NAG D 4 .   ? -5.376  37.654 20.322  1.00 36.43 ? 807  NAG A C7  1 
HETATM 3965 C  C8  . NAG D 4 .   ? -4.902  36.271 20.664  1.00 36.83 ? 807  NAG A C8  1 
HETATM 3966 N  N2  . NAG D 4 .   ? -4.460  38.597 20.091  1.00 35.09 ? 807  NAG A N2  1 
HETATM 3967 O  O3  . NAG D 4 .   ? -6.116  40.434 18.567  1.00 38.68 ? 807  NAG A O3  1 
HETATM 3968 O  O4  . NAG D 4 .   ? -4.840  42.961 18.171  1.00 36.34 ? 807  NAG A O4  1 
HETATM 3969 O  O5  . NAG D 4 .   ? -3.883  41.953 21.487  1.00 24.90 ? 807  NAG A O5  1 
HETATM 3970 O  O6  . NAG D 4 .   ? -5.099  44.623 21.018  1.00 37.93 ? 807  NAG A O6  1 
HETATM 3971 O  O7  . NAG D 4 .   ? -6.572  37.899 20.263  1.00 37.87 ? 807  NAG A O7  1 
HETATM 3972 C  C1  . NAG E 4 .   ? 28.674  39.916 -26.528 1.00 39.08 ? 808  NAG A C1  1 
HETATM 3973 C  C2  . NAG E 4 .   ? 29.724  40.469 -25.539 1.00 39.33 ? 808  NAG A C2  1 
HETATM 3974 C  C3  . NAG E 4 .   ? 30.343  41.730 -26.168 1.00 39.80 ? 808  NAG A C3  1 
HETATM 3975 C  C4  . NAG E 4 .   ? 30.912  41.427 -27.565 1.00 40.63 ? 808  NAG A C4  1 
HETATM 3976 C  C5  . NAG E 4 .   ? 29.828  40.784 -28.444 1.00 41.51 ? 808  NAG A C5  1 
HETATM 3977 C  C6  . NAG E 4 .   ? 30.346  40.375 -29.824 1.00 41.65 ? 808  NAG A C6  1 
HETATM 3978 C  C7  . NAG E 4 .   ? 29.635  40.308 -23.063 1.00 39.43 ? 808  NAG A C7  1 
HETATM 3979 C  C8  . NAG E 4 .   ? 28.901  40.655 -21.789 1.00 37.79 ? 808  NAG A C8  1 
HETATM 3980 N  N2  . NAG E 4 .   ? 29.150  40.779 -24.230 1.00 39.47 ? 808  NAG A N2  1 
HETATM 3981 O  O3  . NAG E 4 .   ? 31.309  42.298 -25.306 1.00 36.90 ? 808  NAG A O3  1 
HETATM 3982 O  O4  . NAG E 4 .   ? 31.448  42.599 -28.189 1.00 41.01 ? 808  NAG A O4  1 
HETATM 3983 O  O5  . NAG E 4 .   ? 29.276  39.636 -27.801 1.00 41.39 ? 808  NAG A O5  1 
HETATM 3984 O  O6  . NAG E 4 .   ? 31.342  39.373 -29.744 1.00 42.28 ? 808  NAG A O6  1 
HETATM 3985 O  O7  . NAG E 4 .   ? 30.642  39.606 -22.985 1.00 38.18 ? 808  NAG A O7  1 
HETATM 3986 MG MG  . MG  F 5 .   ? 15.204  31.307 -18.760 1.00 19.96 ? 901  MG  A MG  1 
HETATM 3987 O  O   . HOH G 6 .   ? 14.783  30.620 -17.007 1.00 21.53 ? 902  HOH A O   1 
HETATM 3988 O  O   . HOH G 6 .   ? 13.888  30.076 -19.526 1.00 24.02 ? 903  HOH A O   1 
HETATM 3989 O  O   . HOH G 6 .   ? 15.298  32.167 -20.820 1.00 20.11 ? 904  HOH A O   1 
HETATM 3990 O  O   . HOH G 6 .   ? 10.021  42.552 -3.886  1.00 27.83 ? 905  HOH A O   1 
HETATM 3991 O  O   . HOH G 6 .   ? 5.326   37.809 23.256  1.00 25.21 ? 906  HOH A O   1 
HETATM 3992 O  O   . HOH G 6 .   ? 25.325  37.518 22.269  1.00 19.94 ? 907  HOH A O   1 
HETATM 3993 O  O   . HOH G 6 .   ? 14.812  26.737 30.857  1.00 24.92 ? 908  HOH A O   1 
HETATM 3994 O  O   . HOH G 6 .   ? 26.632  39.400 19.841  1.00 20.29 ? 909  HOH A O   1 
HETATM 3995 O  O   . HOH G 6 .   ? 17.415  55.604 15.353  1.00 24.20 ? 910  HOH A O   1 
HETATM 3996 O  O   . HOH G 6 .   ? 34.174  56.612 20.163  1.00 27.35 ? 911  HOH A O   1 
HETATM 3997 O  O   . HOH G 6 .   ? 27.265  34.196 19.191  1.00 31.13 ? 912  HOH A O   1 
HETATM 3998 O  O   . HOH G 6 .   ? 13.357  51.840 46.407  1.00 27.70 ? 913  HOH A O   1 
HETATM 3999 O  O   . HOH G 6 .   ? 6.736   34.042 -8.494  1.00 27.82 ? 914  HOH A O   1 
HETATM 4000 O  O   . HOH G 6 .   ? -4.707  47.360 33.529  1.00 30.66 ? 915  HOH A O   1 
HETATM 4001 O  O   . HOH G 6 .   ? 23.718  37.405 28.545  1.00 32.81 ? 916  HOH A O   1 
HETATM 4002 O  O   . HOH G 6 .   ? 17.194  17.805 -6.016  1.00 27.72 ? 917  HOH A O   1 
HETATM 4003 O  O   . HOH G 6 .   ? 31.071  18.582 3.435   1.00 32.67 ? 918  HOH A O   1 
HETATM 4004 O  O   . HOH G 6 .   ? -11.584 51.867 21.409  1.00 32.54 ? 919  HOH A O   1 
HETATM 4005 O  O   . HOH G 6 .   ? 6.954   34.381 28.653  1.00 41.41 ? 920  HOH A O   1 
HETATM 4006 O  O   . HOH G 6 .   ? 31.854  27.320 -13.316 1.00 30.00 ? 921  HOH A O   1 
HETATM 4007 O  O   . HOH G 6 .   ? 26.877  33.040 21.854  1.00 27.17 ? 922  HOH A O   1 
HETATM 4008 O  O   . HOH G 6 .   ? 4.525   55.754 12.387  1.00 35.59 ? 923  HOH A O   1 
HETATM 4009 O  O   . HOH G 6 .   ? 22.935  48.440 29.099  1.00 25.15 ? 924  HOH A O   1 
HETATM 4010 O  O   . HOH G 6 .   ? 32.309  53.794 17.197  1.00 27.28 ? 925  HOH A O   1 
HETATM 4011 O  O   . HOH G 6 .   ? 17.095  20.233 10.506  1.00 27.96 ? 926  HOH A O   1 
HETATM 4012 O  O   . HOH G 6 .   ? 9.629   20.278 -1.884  1.00 28.63 ? 927  HOH A O   1 
HETATM 4013 O  O   . HOH G 6 .   ? 15.195  47.129 11.416  1.00 37.12 ? 928  HOH A O   1 
HETATM 4014 O  O   . HOH G 6 .   ? 19.787  24.658 14.782  1.00 19.98 ? 929  HOH A O   1 
HETATM 4015 O  O   . HOH G 6 .   ? 24.252  28.114 -16.879 1.00 21.65 ? 930  HOH A O   1 
HETATM 4016 O  O   . HOH G 6 .   ? 21.464  49.511 44.120  1.00 27.20 ? 931  HOH A O   1 
HETATM 4017 O  O   . HOH G 6 .   ? 19.635  22.202 -17.826 1.00 14.11 ? 932  HOH A O   1 
HETATM 4018 O  O   . HOH G 6 .   ? 25.368  32.877 -20.281 1.00 17.51 ? 933  HOH A O   1 
HETATM 4019 O  O   . HOH G 6 .   ? 24.995  26.903 11.033  1.00 27.67 ? 934  HOH A O   1 
HETATM 4020 O  O   . HOH G 6 .   ? 11.514  34.015 28.204  1.00 16.92 ? 935  HOH A O   1 
HETATM 4021 O  O   . HOH G 6 .   ? 29.169  57.677 17.477  1.00 11.42 ? 936  HOH A O   1 
HETATM 4022 O  O   . HOH G 6 .   ? -0.717  56.695 28.096  1.00 16.23 ? 937  HOH A O   1 
HETATM 4023 O  O   . HOH G 6 .   ? 10.232  42.171 28.070  1.00 22.49 ? 938  HOH A O   1 
HETATM 4024 O  O   . HOH G 6 .   ? 12.370  59.172 23.797  1.00 14.24 ? 939  HOH A O   1 
HETATM 4025 O  O   . HOH G 6 .   ? 19.682  36.374 14.478  1.00 17.38 ? 940  HOH A O   1 
HETATM 4026 O  O   . HOH G 6 .   ? 10.751  57.349 42.445  1.00 15.43 ? 941  HOH A O   1 
HETATM 4027 O  O   . HOH G 6 .   ? 29.006  51.832 17.961  1.00 30.39 ? 942  HOH A O   1 
HETATM 4028 O  O   . HOH G 6 .   ? 5.553   53.440 29.845  1.00 14.89 ? 943  HOH A O   1 
HETATM 4029 O  O   . HOH G 6 .   ? -2.736  50.915 23.106  1.00 19.22 ? 944  HOH A O   1 
HETATM 4030 O  O   . HOH G 6 .   ? 3.587   54.710 23.727  1.00 17.17 ? 945  HOH A O   1 
HETATM 4031 O  O   . HOH G 6 .   ? 7.606   44.629 26.352  1.00 13.57 ? 946  HOH A O   1 
HETATM 4032 O  O   . HOH G 6 .   ? 17.284  37.333 15.155  1.00 19.59 ? 947  HOH A O   1 
HETATM 4033 O  O   . HOH G 6 .   ? 5.600   61.113 44.438  1.00 22.83 ? 948  HOH A O   1 
HETATM 4034 O  O   . HOH G 6 .   ? 13.983  35.775 6.931   1.00 25.39 ? 949  HOH A O   1 
HETATM 4035 O  O   . HOH G 6 .   ? 9.334   42.482 25.378  1.00 22.80 ? 950  HOH A O   1 
HETATM 4036 O  O   . HOH G 6 .   ? 23.757  40.938 13.638  1.00 25.12 ? 951  HOH A O   1 
HETATM 4037 O  O   . HOH G 6 .   ? 14.376  60.658 37.522  1.00 24.66 ? 952  HOH A O   1 
HETATM 4038 O  O   . HOH G 6 .   ? 12.386  48.605 15.663  1.00 25.84 ? 953  HOH A O   1 
HETATM 4039 O  O   . HOH G 6 .   ? 12.591  44.933 31.071  1.00 15.51 ? 954  HOH A O   1 
HETATM 4040 O  O   . HOH G 6 .   ? 15.577  32.577 15.471  1.00 15.57 ? 955  HOH A O   1 
HETATM 4041 O  O   . HOH G 6 .   ? 12.106  30.557 16.469  1.00 13.94 ? 956  HOH A O   1 
HETATM 4042 O  O   . HOH G 6 .   ? 1.389   32.952 19.667  1.00 23.56 ? 957  HOH A O   1 
HETATM 4043 O  O   . HOH G 6 .   ? 5.235   58.753 19.791  1.00 18.00 ? 958  HOH A O   1 
HETATM 4044 O  O   . HOH G 6 .   ? 28.052  53.164 16.037  1.00 21.56 ? 959  HOH A O   1 
HETATM 4045 O  O   . HOH G 6 .   ? 5.515   44.613 28.349  1.00 17.32 ? 960  HOH A O   1 
HETATM 4046 O  O   . HOH G 6 .   ? 31.633  44.340 32.356  1.00 20.81 ? 961  HOH A O   1 
HETATM 4047 O  O   . HOH G 6 .   ? 12.691  32.277 18.489  1.00 16.61 ? 962  HOH A O   1 
HETATM 4048 O  O   . HOH G 6 .   ? 16.223  44.341 11.136  1.00 20.21 ? 963  HOH A O   1 
HETATM 4049 O  O   . HOH G 6 .   ? 8.406   69.343 27.874  1.00 29.76 ? 964  HOH A O   1 
HETATM 4050 O  O   . HOH G 6 .   ? 6.720   29.407 25.996  1.00 29.37 ? 965  HOH A O   1 
HETATM 4051 O  O   . HOH G 6 .   ? 7.737   60.351 37.196  1.00 19.17 ? 966  HOH A O   1 
HETATM 4052 O  O   . HOH G 6 .   ? 7.242   50.569 15.651  1.00 15.82 ? 967  HOH A O   1 
HETATM 4053 O  O   . HOH G 6 .   ? 24.951  11.711 -11.975 1.00 18.57 ? 968  HOH A O   1 
HETATM 4054 O  O   . HOH G 6 .   ? 32.297  23.109 -1.304  1.00 22.91 ? 969  HOH A O   1 
HETATM 4055 O  O   . HOH G 6 .   ? 2.831   39.445 28.012  1.00 18.97 ? 970  HOH A O   1 
HETATM 4056 O  O   . HOH G 6 .   ? 31.988  58.394 22.860  1.00 28.80 ? 971  HOH A O   1 
HETATM 4057 O  O   . HOH G 6 .   ? 27.681  17.441 -13.119 1.00 14.14 ? 972  HOH A O   1 
HETATM 4058 O  O   . HOH G 6 .   ? 18.338  20.399 -22.022 1.00 29.83 ? 973  HOH A O   1 
HETATM 4059 O  O   . HOH G 6 .   ? 10.468  44.156 15.369  1.00 22.20 ? 974  HOH A O   1 
HETATM 4060 O  O   . HOH G 6 .   ? 21.859  22.592 4.188   1.00 24.06 ? 975  HOH A O   1 
HETATM 4061 O  O   . HOH G 6 .   ? 7.570   53.422 46.433  1.00 23.35 ? 976  HOH A O   1 
HETATM 4062 O  O   . HOH G 6 .   ? 4.785   35.871 25.097  1.00 19.41 ? 977  HOH A O   1 
HETATM 4063 O  O   . HOH G 6 .   ? 16.083  30.868 -21.933 1.00 22.32 ? 978  HOH A O   1 
HETATM 4064 O  O   . HOH G 6 .   ? 15.402  31.959 18.030  1.00 14.76 ? 979  HOH A O   1 
HETATM 4065 O  O   . HOH G 6 .   ? 20.153  32.541 23.170  1.00 16.24 ? 980  HOH A O   1 
HETATM 4066 O  O   . HOH G 6 .   ? 13.847  26.710 14.006  1.00 20.04 ? 981  HOH A O   1 
HETATM 4067 O  O   . HOH G 6 .   ? 29.358  18.795 -17.639 1.00 24.39 ? 982  HOH A O   1 
HETATM 4068 O  O   . HOH G 6 .   ? 25.452  20.595 -20.480 1.00 23.07 ? 983  HOH A O   1 
HETATM 4069 O  O   . HOH G 6 .   ? 23.958  56.162 32.166  1.00 16.33 ? 984  HOH A O   1 
HETATM 4070 O  O   . HOH G 6 .   ? 28.717  27.936 13.097  1.00 26.09 ? 985  HOH A O   1 
HETATM 4071 O  O   . HOH G 6 .   ? 21.687  41.056 27.727  1.00 17.94 ? 986  HOH A O   1 
HETATM 4072 O  O   . HOH G 6 .   ? 18.585  47.259 10.309  1.00 24.58 ? 987  HOH A O   1 
HETATM 4073 O  O   . HOH G 6 .   ? 19.580  60.917 34.175  1.00 30.66 ? 988  HOH A O   1 
HETATM 4074 O  O   . HOH G 6 .   ? 0.977   53.704 29.759  1.00 19.07 ? 989  HOH A O   1 
HETATM 4075 O  O   . HOH G 6 .   ? 13.868  52.046 14.755  1.00 19.72 ? 990  HOH A O   1 
HETATM 4076 O  O   . HOH G 6 .   ? 26.276  38.407 -13.458 1.00 24.19 ? 991  HOH A O   1 
HETATM 4077 O  O   . HOH G 6 .   ? 24.490  25.107 18.291  1.00 28.28 ? 992  HOH A O   1 
HETATM 4078 O  O   . HOH G 6 .   ? 14.099  16.602 -6.260  1.00 31.42 ? 993  HOH A O   1 
HETATM 4079 O  O   . HOH G 6 .   ? 22.313  54.717 37.269  1.00 21.13 ? 994  HOH A O   1 
HETATM 4080 O  O   . HOH G 6 .   ? 6.296   52.940 14.795  1.00 24.42 ? 995  HOH A O   1 
HETATM 4081 O  O   . HOH G 6 .   ? 28.631  51.531 38.471  1.00 21.76 ? 996  HOH A O   1 
HETATM 4082 O  O   . HOH G 6 .   ? 1.013   48.070 17.176  1.00 19.95 ? 997  HOH A O   1 
HETATM 4083 O  O   . HOH G 6 .   ? 22.140  22.993 6.979   1.00 19.51 ? 998  HOH A O   1 
HETATM 4084 O  O   . HOH G 6 .   ? 16.034  63.047 23.575  1.00 24.70 ? 999  HOH A O   1 
HETATM 4085 O  O   . HOH G 6 .   ? 20.302  20.498 6.609   1.00 24.11 ? 1000 HOH A O   1 
HETATM 4086 O  O   . HOH G 6 .   ? 11.139  19.617 -4.158  1.00 24.12 ? 1001 HOH A O   1 
HETATM 4087 O  O   . HOH G 6 .   ? 34.837  49.178 23.216  1.00 25.87 ? 1002 HOH A O   1 
HETATM 4088 O  O   . HOH G 6 .   ? 12.937  23.020 3.872   1.00 18.87 ? 1003 HOH A O   1 
HETATM 4089 O  O   . HOH G 6 .   ? 5.997   25.567 34.945  1.00 24.41 ? 1004 HOH A O   1 
HETATM 4090 O  O   . HOH G 6 .   ? 12.475  58.778 43.800  1.00 22.24 ? 1005 HOH A O   1 
HETATM 4091 O  O   . HOH G 6 .   ? 2.255   50.683 32.641  1.00 26.76 ? 1006 HOH A O   1 
HETATM 4092 O  O   . HOH G 6 .   ? 14.091  27.069 26.936  1.00 21.37 ? 1007 HOH A O   1 
HETATM 4093 O  O   . HOH G 6 .   ? 11.307  18.697 0.574   1.00 28.13 ? 1008 HOH A O   1 
HETATM 4094 O  O   . HOH G 6 .   ? 3.794   32.244 22.667  1.00 19.00 ? 1009 HOH A O   1 
HETATM 4095 O  O   . HOH G 6 .   ? 1.017   54.927 34.642  1.00 18.77 ? 1010 HOH A O   1 
HETATM 4096 O  O   . HOH G 6 .   ? 5.305   38.892 20.044  1.00 25.08 ? 1011 HOH A O   1 
HETATM 4097 O  O   . HOH G 6 .   ? 18.515  13.489 -7.744  1.00 34.28 ? 1012 HOH A O   1 
HETATM 4098 O  O   . HOH G 6 .   ? 6.443   64.833 20.150  1.00 29.32 ? 1013 HOH A O   1 
HETATM 4099 O  O   . HOH G 6 .   ? -1.317  61.121 22.435  1.00 20.60 ? 1014 HOH A O   1 
HETATM 4100 O  O   . HOH G 6 .   ? 16.070  65.893 34.081  1.00 30.45 ? 1015 HOH A O   1 
HETATM 4101 O  O   . HOH G 6 .   ? 25.074  36.018 38.569  1.00 28.42 ? 1016 HOH A O   1 
HETATM 4102 O  O   . HOH G 6 .   ? 15.785  60.183 27.721  1.00 33.04 ? 1017 HOH A O   1 
HETATM 4103 O  O   . HOH G 6 .   ? 10.005  39.151 16.161  1.00 22.34 ? 1018 HOH A O   1 
HETATM 4104 O  O   . HOH G 6 .   ? 22.195  61.678 25.304  1.00 34.69 ? 1019 HOH A O   1 
HETATM 4105 O  O   . HOH G 6 .   ? 15.458  25.333 20.918  1.00 20.05 ? 1020 HOH A O   1 
HETATM 4106 O  O   . HOH G 6 .   ? 32.961  31.880 -13.712 1.00 28.41 ? 1021 HOH A O   1 
HETATM 4107 O  O   . HOH G 6 .   ? 12.466  27.255 29.324  1.00 22.35 ? 1022 HOH A O   1 
HETATM 4108 O  O   . HOH G 6 .   ? 3.864   26.324 33.018  1.00 26.81 ? 1023 HOH A O   1 
HETATM 4109 O  O   . HOH G 6 .   ? 20.088  15.876 1.131   1.00 25.17 ? 1024 HOH A O   1 
HETATM 4110 O  O   . HOH G 6 .   ? 3.672   58.228 16.650  1.00 27.56 ? 1025 HOH A O   1 
HETATM 4111 O  O   . HOH G 6 .   ? 36.507  21.209 -9.942  1.00 27.11 ? 1026 HOH A O   1 
HETATM 4112 O  O   . HOH G 6 .   ? 0.174   56.422 36.784  1.00 32.59 ? 1027 HOH A O   1 
HETATM 4113 O  O   . HOH G 6 .   ? 21.328  26.980 27.615  1.00 28.79 ? 1028 HOH A O   1 
HETATM 4114 O  O   . HOH G 6 .   ? 29.213  24.071 -15.309 1.00 23.46 ? 1029 HOH A O   1 
HETATM 4115 O  O   . HOH G 6 .   ? -0.202  63.283 19.274  1.00 25.30 ? 1030 HOH A O   1 
HETATM 4116 O  O   . HOH G 6 .   ? 11.071  28.048 16.750  1.00 21.91 ? 1031 HOH A O   1 
HETATM 4117 O  O   . HOH G 6 .   ? 34.018  26.866 10.635  1.00 31.70 ? 1032 HOH A O   1 
HETATM 4118 O  O   . HOH G 6 .   ? 23.686  42.466 25.860  1.00 24.95 ? 1033 HOH A O   1 
HETATM 4119 O  O   . HOH G 6 .   ? 24.351  26.578 20.566  1.00 26.28 ? 1034 HOH A O   1 
HETATM 4120 O  O   . HOH G 6 .   ? 14.742  59.034 41.951  1.00 27.63 ? 1035 HOH A O   1 
HETATM 4121 O  O   . HOH G 6 .   ? 2.103   48.807 36.941  1.00 29.59 ? 1036 HOH A O   1 
HETATM 4122 O  O   . HOH G 6 .   ? 10.844  47.993 14.000  1.00 30.80 ? 1037 HOH A O   1 
HETATM 4123 O  O   . HOH G 6 .   ? 25.226  53.061 40.813  1.00 33.50 ? 1038 HOH A O   1 
HETATM 4124 O  O   . HOH G 6 .   ? -6.401  65.034 34.403  1.00 33.08 ? 1039 HOH A O   1 
HETATM 4125 O  O   . HOH G 6 .   ? 0.679   34.666 23.503  1.00 33.67 ? 1040 HOH A O   1 
HETATM 4126 O  O   . HOH G 6 .   ? -5.496  70.295 40.449  1.00 27.59 ? 1041 HOH A O   1 
HETATM 4127 O  O   . HOH G 6 .   ? 20.426  12.412 -14.855 1.00 20.04 ? 1042 HOH A O   1 
HETATM 4128 O  O   . HOH G 6 .   ? 13.100  20.630 11.233  1.00 29.32 ? 1043 HOH A O   1 
HETATM 4129 O  O   . HOH G 6 .   ? 27.755  26.909 10.784  1.00 26.24 ? 1044 HOH A O   1 
HETATM 4130 O  O   . HOH G 6 .   ? 31.391  33.534 8.301   1.00 30.61 ? 1045 HOH A O   1 
HETATM 4131 O  O   . HOH G 6 .   ? -1.291  37.640 20.694  1.00 28.62 ? 1046 HOH A O   1 
HETATM 4132 O  O   . HOH G 6 .   ? 4.853   60.291 37.529  1.00 20.51 ? 1047 HOH A O   1 
HETATM 4133 O  O   . HOH G 6 .   ? 21.773  21.458 -24.748 1.00 30.71 ? 1048 HOH A O   1 
HETATM 4134 O  O   . HOH G 6 .   ? 33.696  26.812 3.469   1.00 19.68 ? 1049 HOH A O   1 
HETATM 4135 O  O   . HOH G 6 .   ? -1.859  55.577 22.697  1.00 31.47 ? 1050 HOH A O   1 
HETATM 4136 O  O   . HOH G 6 .   ? -4.556  52.555 35.436  1.00 26.00 ? 1051 HOH A O   1 
HETATM 4137 O  O   . HOH G 6 .   ? 36.679  48.472 27.282  1.00 33.64 ? 1052 HOH A O   1 
HETATM 4138 O  O   . HOH G 6 .   ? 32.821  26.481 -9.942  1.00 22.03 ? 1053 HOH A O   1 
HETATM 4139 O  O   . HOH G 6 .   ? 23.748  58.318 34.160  1.00 22.21 ? 1054 HOH A O   1 
HETATM 4140 O  O   . HOH G 6 .   ? 16.030  14.961 -1.848  1.00 26.12 ? 1055 HOH A O   1 
HETATM 4141 O  O   . HOH G 6 .   ? -11.402 55.510 26.249  1.00 35.44 ? 1056 HOH A O   1 
HETATM 4142 O  O   . HOH G 6 .   ? 20.117  58.597 35.722  1.00 21.18 ? 1057 HOH A O   1 
HETATM 4143 O  O   . HOH G 6 .   ? 16.028  26.618 -13.498 1.00 23.60 ? 1058 HOH A O   1 
HETATM 4144 O  O   . HOH G 6 .   ? 20.632  22.363 13.746  1.00 30.93 ? 1059 HOH A O   1 
HETATM 4145 O  O   . HOH G 6 .   ? -3.273  45.856 32.886  1.00 33.55 ? 1060 HOH A O   1 
HETATM 4146 O  O   . HOH G 6 .   ? 11.615  38.273 -10.182 1.00 34.90 ? 1061 HOH A O   1 
HETATM 4147 O  O   . HOH G 6 .   ? 25.304  34.246 11.088  1.00 28.98 ? 1062 HOH A O   1 
HETATM 4148 O  O   . HOH G 6 .   ? 18.623  53.466 39.897  1.00 30.41 ? 1063 HOH A O   1 
HETATM 4149 O  O   . HOH G 6 .   ? 30.357  40.629 -8.417  1.00 38.28 ? 1064 HOH A O   1 
HETATM 4150 O  O   . HOH G 6 .   ? 2.702   35.769 16.644  1.00 36.24 ? 1065 HOH A O   1 
HETATM 4151 O  O   . HOH G 6 .   ? 4.056   63.350 16.890  1.00 41.27 ? 1066 HOH A O   1 
HETATM 4152 O  O   . HOH G 6 .   ? 14.922  20.131 13.834  1.00 34.15 ? 1067 HOH A O   1 
HETATM 4153 O  O   . HOH G 6 .   ? 35.878  28.193 -7.277  1.00 38.83 ? 1068 HOH A O   1 
HETATM 4154 O  O   . HOH G 6 .   ? 24.157  34.545 30.321  1.00 33.10 ? 1069 HOH A O   1 
HETATM 4155 O  O   . HOH G 6 .   ? -0.865  51.984 32.079  1.00 29.12 ? 1070 HOH A O   1 
HETATM 4156 O  O   . HOH G 6 .   ? 1.639   57.672 14.580  1.00 38.07 ? 1071 HOH A O   1 
HETATM 4157 O  O   . HOH G 6 .   ? 2.624   40.688 17.216  1.00 27.47 ? 1072 HOH A O   1 
HETATM 4158 O  O   . HOH G 6 .   ? 27.929  41.215 38.555  1.00 26.81 ? 1073 HOH A O   1 
HETATM 4159 O  O   . HOH G 6 .   ? 11.696  44.456 -16.924 1.00 39.40 ? 1074 HOH A O   1 
HETATM 4160 O  O   . HOH G 6 .   ? 24.934  55.893 28.544  1.00 30.33 ? 1075 HOH A O   1 
HETATM 4161 O  O   . HOH G 6 .   ? 15.183  54.567 13.618  1.00 33.15 ? 1076 HOH A O   1 
HETATM 4162 O  O   . HOH G 6 .   ? -0.523  58.935 45.218  1.00 37.90 ? 1077 HOH A O   1 
HETATM 4163 O  O   . HOH G 6 .   ? 17.108  43.171 0.076   1.00 36.55 ? 1078 HOH A O   1 
HETATM 4164 O  O   . HOH G 6 .   ? -0.703  49.906 16.276  1.00 35.08 ? 1079 HOH A O   1 
HETATM 4165 O  O   . HOH G 6 .   ? 9.135   23.852 4.871   1.00 42.68 ? 1080 HOH A O   1 
HETATM 4166 O  O   . HOH G 6 .   ? 12.120  72.307 38.045  1.00 45.61 ? 1081 HOH A O   1 
HETATM 4167 O  O   . HOH G 6 .   ? 7.221   26.969 40.563  1.00 44.13 ? 1082 HOH A O   1 
HETATM 4168 O  O   . HOH G 6 .   ? 18.069  16.342 11.410  1.00 34.14 ? 1083 HOH A O   1 
HETATM 4169 O  O   . HOH G 6 .   ? 1.795   58.950 37.403  1.00 39.07 ? 1084 HOH A O   1 
HETATM 4170 O  O   . HOH G 6 .   ? 28.177  54.490 30.448  1.00 35.49 ? 1085 HOH A O   1 
HETATM 4171 O  O   . HOH G 6 .   ? 27.290  36.708 -22.286 1.00 28.17 ? 1086 HOH A O   1 
HETATM 4172 O  O   . HOH G 6 .   ? 10.252  68.075 43.585  1.00 31.48 ? 1087 HOH A O   1 
HETATM 4173 O  O   . HOH G 6 .   ? 16.318  37.427 21.870  1.00 23.35 ? 1088 HOH A O   1 
HETATM 4174 O  O   . HOH G 6 .   ? 5.294   33.902 2.352   1.00 30.38 ? 1089 HOH A O   1 
HETATM 4175 O  O   . HOH G 6 .   ? 30.816  39.271 8.043   1.00 30.17 ? 1090 HOH A O   1 
HETATM 4176 O  O   . HOH G 6 .   ? 4.950   28.179 -2.841  1.00 33.25 ? 1091 HOH A O   1 
HETATM 4177 O  O   . HOH G 6 .   ? 18.075  17.070 6.628   1.00 29.79 ? 1092 HOH A O   1 
HETATM 4178 O  O   . HOH G 6 .   ? 22.785  52.093 44.005  1.00 39.89 ? 1093 HOH A O   1 
HETATM 4179 O  O   . HOH G 6 .   ? -10.935 46.544 32.292  1.00 45.42 ? 1094 HOH A O   1 
HETATM 4180 O  O   . HOH G 6 .   ? 27.697  35.150 10.859  1.00 32.19 ? 1095 HOH A O   1 
HETATM 4181 O  O   . HOH G 6 .   ? 10.084  25.007 8.862   1.00 31.22 ? 1096 HOH A O   1 
HETATM 4182 O  O   . HOH G 6 .   ? 3.366   69.060 23.561  1.00 31.18 ? 1097 HOH A O   1 
HETATM 4183 O  O   . HOH G 6 .   ? 5.942   24.105 14.271  1.00 36.97 ? 1098 HOH A O   1 
HETATM 4184 O  O   . HOH G 6 .   ? -6.453  55.650 31.971  1.00 29.06 ? 1099 HOH A O   1 
HETATM 4185 O  O   . HOH G 6 .   ? 13.379  65.238 40.101  1.00 32.21 ? 1100 HOH A O   1 
HETATM 4186 O  O   . HOH G 6 .   ? 3.353   53.784 16.170  1.00 30.16 ? 1101 HOH A O   1 
HETATM 4187 O  O   . HOH G 6 .   ? -7.489  40.446 28.210  1.00 39.18 ? 1102 HOH A O   1 
HETATM 4188 O  O   . HOH G 6 .   ? 41.155  15.106 -0.862  1.00 33.50 ? 1103 HOH A O   1 
HETATM 4189 O  O   . HOH G 6 .   ? 9.420   48.724 44.805  1.00 29.13 ? 1104 HOH A O   1 
HETATM 4190 O  O   . HOH G 6 .   ? 37.383  48.114 15.110  1.00 36.01 ? 1105 HOH A O   1 
HETATM 4191 O  O   . HOH G 6 .   ? 19.036  29.637 44.014  1.00 36.45 ? 1106 HOH A O   1 
HETATM 4192 O  O   . HOH G 6 .   ? 35.097  29.556 3.096   1.00 28.91 ? 1107 HOH A O   1 
HETATM 4193 O  O   . HOH G 6 .   ? 4.453   44.948 15.725  1.00 31.47 ? 1108 HOH A O   1 
HETATM 4194 O  O   . HOH G 6 .   ? 14.125  70.877 23.053  1.00 37.84 ? 1109 HOH A O   1 
HETATM 4195 O  O   . HOH G 6 .   ? -1.524  39.208 32.740  1.00 34.25 ? 1110 HOH A O   1 
HETATM 4196 O  O   . HOH G 6 .   ? 41.184  33.557 -0.219  1.00 44.03 ? 1111 HOH A O   1 
HETATM 4197 O  O   . HOH G 6 .   ? 9.234   25.031 36.393  1.00 34.15 ? 1112 HOH A O   1 
HETATM 4198 O  O   . HOH G 6 .   ? 13.398  28.183 39.705  1.00 31.05 ? 1113 HOH A O   1 
HETATM 4199 O  O   . HOH G 6 .   ? 17.628  22.125 21.063  1.00 27.66 ? 1114 HOH A O   1 
HETATM 4200 O  O   . HOH G 6 .   ? 26.444  22.658 -20.256 1.00 28.42 ? 1115 HOH A O   1 
HETATM 4201 O  O   . HOH G 6 .   ? 7.830   58.653 50.652  1.00 45.30 ? 1116 HOH A O   1 
HETATM 4202 O  O   . HOH G 6 .   ? 7.727   72.999 31.974  1.00 34.97 ? 1117 HOH A O   1 
HETATM 4203 O  O   . HOH G 6 .   ? -5.105  61.144 37.249  1.00 37.51 ? 1118 HOH A O   1 
HETATM 4204 O  O   . HOH G 6 .   ? 3.706   35.305 -2.157  1.00 33.53 ? 1119 HOH A O   1 
HETATM 4205 O  O   . HOH G 6 .   ? 16.139  17.726 -12.691 1.00 32.27 ? 1120 HOH A O   1 
HETATM 4206 O  O   . HOH G 6 .   ? 18.608  20.689 13.831  1.00 31.02 ? 1121 HOH A O   1 
HETATM 4207 O  O   . HOH G 6 .   ? 7.943   39.655 5.500   1.00 40.16 ? 1122 HOH A O   1 
HETATM 4208 O  O   . HOH G 6 .   ? -6.846  62.309 23.657  1.00 34.92 ? 1123 HOH A O   1 
HETATM 4209 O  O   . HOH G 6 .   ? 34.975  23.675 7.543   1.00 33.38 ? 1124 HOH A O   1 
HETATM 4210 O  O   . HOH G 6 .   ? 17.271  24.439 25.027  1.00 32.08 ? 1125 HOH A O   1 
HETATM 4211 O  O   . HOH G 6 .   ? 16.843  21.140 -19.236 1.00 40.47 ? 1126 HOH A O   1 
HETATM 4212 O  O   . HOH G 6 .   ? 26.578  30.122 25.744  1.00 24.46 ? 1127 HOH A O   1 
HETATM 4213 O  O   . HOH G 6 .   ? 31.868  44.597 15.875  1.00 26.32 ? 1128 HOH A O   1 
HETATM 4214 O  O   . HOH G 6 .   ? 12.298  61.199 12.364  1.00 31.46 ? 1129 HOH A O   1 
HETATM 4215 O  O   . HOH G 6 .   ? 12.125  26.524 37.666  1.00 32.72 ? 1130 HOH A O   1 
HETATM 4216 O  O   . HOH G 6 .   ? 24.349  10.272 -6.100  1.00 25.83 ? 1131 HOH A O   1 
HETATM 4217 O  O   . HOH G 6 .   ? 5.219   31.651 26.962  1.00 40.62 ? 1132 HOH A O   1 
HETATM 4218 O  O   . HOH G 6 .   ? -3.751  54.927 19.440  1.00 35.32 ? 1133 HOH A O   1 
HETATM 4219 O  O   . HOH G 6 .   ? 18.027  19.999 7.870   1.00 30.53 ? 1134 HOH A O   1 
HETATM 4220 O  O   . HOH G 6 .   ? 24.400  36.909 42.520  1.00 41.77 ? 1135 HOH A O   1 
HETATM 4221 O  O   . HOH G 6 .   ? 4.800   33.450 -10.291 1.00 35.81 ? 1136 HOH A O   1 
HETATM 4222 O  O   . HOH G 6 .   ? 22.559  30.692 41.746  1.00 35.90 ? 1137 HOH A O   1 
HETATM 4223 O  O   . HOH G 6 .   ? -0.131  59.478 35.358  1.00 30.27 ? 1138 HOH A O   1 
HETATM 4224 O  O   . HOH G 6 .   ? 29.264  12.949 8.663   1.00 38.03 ? 1139 HOH A O   1 
HETATM 4225 O  O   . HOH G 6 .   ? 32.377  14.136 1.288   1.00 39.13 ? 1140 HOH A O   1 
HETATM 4226 O  O   . HOH G 6 .   ? 12.522  24.493 19.710  1.00 42.43 ? 1141 HOH A O   1 
HETATM 4227 O  O   . HOH G 6 .   ? 30.139  6.517  3.700   1.00 42.33 ? 1142 HOH A O   1 
HETATM 4228 O  O   . HOH G 6 .   ? 24.124  37.259 25.941  1.00 38.98 ? 1143 HOH A O   1 
HETATM 4229 O  O   . HOH G 6 .   ? 23.556  35.089 34.177  1.00 21.24 ? 1144 HOH A O   1 
HETATM 4230 O  O   . HOH G 6 .   ? 30.830  31.138 15.418  1.00 36.52 ? 1145 HOH A O   1 
HETATM 4231 O  O   . HOH G 6 .   ? 26.315  22.923 17.345  1.00 38.52 ? 1146 HOH A O   1 
HETATM 4232 O  O   . HOH G 6 .   ? 2.513   52.155 35.483  1.00 32.64 ? 1147 HOH A O   1 
HETATM 4233 O  O   . HOH G 6 .   ? 31.830  40.617 32.653  1.00 42.03 ? 1148 HOH A O   1 
HETATM 4234 O  O   . HOH G 6 .   ? 10.372  33.195 44.366  1.00 32.95 ? 1149 HOH A O   1 
HETATM 4235 O  O   . HOH G 6 .   ? 16.731  45.177 46.690  1.00 34.33 ? 1150 HOH A O   1 
HETATM 4236 O  O   . HOH G 6 .   ? -0.818  66.030 21.944  1.00 31.34 ? 1151 HOH A O   1 
HETATM 4237 O  O   . HOH G 6 .   ? 29.989  35.610 17.797  1.00 40.59 ? 1152 HOH A O   1 
HETATM 4238 O  O   . HOH G 6 .   ? 10.693  23.684 -16.925 1.00 51.02 ? 1153 HOH A O   1 
HETATM 4239 O  O   . HOH G 6 .   ? 19.772  54.760 43.136  1.00 44.47 ? 1154 HOH A O   1 
HETATM 4240 O  O   . HOH G 6 .   ? 21.001  39.191 -25.916 1.00 40.52 ? 1155 HOH A O   1 
HETATM 4241 O  O   . HOH G 6 .   ? 25.154  56.801 26.007  1.00 23.65 ? 1156 HOH A O   1 
HETATM 4242 O  O   . HOH G 6 .   ? 8.292   49.053 13.398  1.00 26.72 ? 1157 HOH A O   1 
HETATM 4243 O  O   . HOH G 6 .   ? 15.182  67.419 24.884  1.00 34.21 ? 1158 HOH A O   1 
HETATM 4244 O  O   . HOH G 6 .   ? 0.204   68.955 35.372  1.00 32.35 ? 1159 HOH A O   1 
HETATM 4245 O  O   . HOH G 6 .   ? 3.203   52.718 31.093  1.00 14.60 ? 1160 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   224 224 LYS LYS A . n 
A 1 2   ILE 2   225 225 ILE ILE A . n 
A 1 3   GLN 3   226 226 GLN GLN A . n 
A 1 4   ILE 4   227 227 ILE ILE A . n 
A 1 5   GLN 5   228 228 GLN GLN A . n 
A 1 6   ARG 6   229 229 ARG ARG A . n 
A 1 7   SER 7   230 230 SER SER A . n 
A 1 8   GLY 8   231 231 GLY GLY A . n 
A 1 9   HIS 9   232 232 HIS HIS A . n 
A 1 10  LEU 10  233 233 LEU LEU A . n 
A 1 11  ASN 11  234 234 ASN ASN A . n 
A 1 12  LEU 12  235 235 LEU LEU A . n 
A 1 13  TYR 13  236 236 TYR TYR A . n 
A 1 14  LEU 14  237 237 LEU LEU A . n 
A 1 15  LEU 15  238 238 LEU LEU A . n 
A 1 16  LEU 16  239 239 LEU LEU A . n 
A 1 17  ASP 17  240 240 ASP ASP A . n 
A 1 18  ALA 18  241 241 ALA ALA A . n 
A 1 19  SER 19  242 242 SER SER A . n 
A 1 20  GLN 20  243 243 GLN GLN A . n 
A 1 21  SER 21  244 244 SER SER A . n 
A 1 22  VAL 22  245 245 VAL VAL A . n 
A 1 23  SER 23  246 246 SER SER A . n 
A 1 24  GLU 24  247 247 GLU GLU A . n 
A 1 25  ASN 25  248 248 ASN ASN A . n 
A 1 26  ASP 26  249 249 ASP ASP A . n 
A 1 27  PHE 27  250 250 PHE PHE A . n 
A 1 28  LEU 28  251 251 LEU LEU A . n 
A 1 29  ILE 29  252 252 ILE ILE A . n 
A 1 30  PHE 30  253 253 PHE PHE A . n 
A 1 31  LYS 31  254 254 LYS LYS A . n 
A 1 32  GLU 32  255 255 GLU GLU A . n 
A 1 33  SER 33  256 256 SER SER A . n 
A 1 34  ALA 34  257 257 ALA ALA A . n 
A 1 35  SER 35  258 258 SER SER A . n 
A 1 36  LEU 36  259 259 LEU LEU A . n 
A 1 37  MET 37  260 260 MET MET A . n 
A 1 38  VAL 38  261 261 VAL VAL A . n 
A 1 39  ASP 39  262 262 ASP ASP A . n 
A 1 40  ARG 40  263 263 ARG ARG A . n 
A 1 41  ILE 41  264 264 ILE ILE A . n 
A 1 42  PHE 42  265 265 PHE PHE A . n 
A 1 43  SER 43  266 266 SER SER A . n 
A 1 44  PHE 44  267 267 PHE PHE A . n 
A 1 45  GLU 45  268 268 GLU GLU A . n 
A 1 46  ILE 46  269 269 ILE ILE A . n 
A 1 47  ASN 47  270 270 ASN ASN A . n 
A 1 48  VAL 48  271 271 VAL VAL A . n 
A 1 49  SER 49  272 272 SER SER A . n 
A 1 50  VAL 50  273 273 VAL VAL A . n 
A 1 51  ALA 51  274 274 ALA ALA A . n 
A 1 52  ILE 52  275 275 ILE ILE A . n 
A 1 53  ILE 53  276 276 ILE ILE A . n 
A 1 54  THR 54  277 277 THR THR A . n 
A 1 55  PHE 55  278 278 PHE PHE A . n 
A 1 56  ALA 56  279 279 ALA ALA A . n 
A 1 57  SER 57  280 280 SER SER A . n 
A 1 58  GLU 58  281 281 GLU GLU A . n 
A 1 59  PRO 59  282 282 PRO PRO A . n 
A 1 60  LYS 60  283 283 LYS LYS A . n 
A 1 61  VAL 61  284 284 VAL VAL A . n 
A 1 62  LEU 62  285 285 LEU LEU A . n 
A 1 63  MET 63  286 286 MET MET A . n 
A 1 64  SER 64  287 287 SER SER A . n 
A 1 65  VAL 65  288 288 VAL VAL A . n 
A 1 66  LEU 66  289 289 LEU LEU A . n 
A 1 67  ASN 67  290 290 ASN ASN A . n 
A 1 68  ASP 68  291 291 ASP ASP A . n 
A 1 69  ASN 69  292 292 ASN ASN A . n 
A 1 70  SER 70  293 293 SER SER A . n 
A 1 71  ARG 71  294 294 ARG ARG A . n 
A 1 72  ASP 72  295 295 ASP ASP A . n 
A 1 73  MET 73  296 296 MET MET A . n 
A 1 74  THR 74  297 297 THR THR A . n 
A 1 75  GLU 75  298 298 GLU GLU A . n 
A 1 76  VAL 76  299 299 VAL VAL A . n 
A 1 77  ILE 77  300 300 ILE ILE A . n 
A 1 78  SER 78  301 301 SER SER A . n 
A 1 79  SER 79  302 302 SER SER A . n 
A 1 80  LEU 80  303 303 LEU LEU A . n 
A 1 81  GLU 81  304 304 GLU GLU A . n 
A 1 82  ASN 82  305 305 ASN ASN A . n 
A 1 83  ALA 83  306 306 ALA ALA A . n 
A 1 84  ASN 84  307 307 ASN ASN A . n 
A 1 85  TYR 85  308 308 TYR TYR A . n 
A 1 86  LYS 86  309 309 LYS LYS A . n 
A 1 87  ASP 87  310 310 ASP ASP A . n 
A 1 88  HIS 88  311 311 HIS HIS A . n 
A 1 89  GLU 89  312 312 GLU GLU A . n 
A 1 90  ASN 90  313 313 ASN ASN A . n 
A 1 91  GLY 91  314 314 GLY GLY A . n 
A 1 92  THR 92  315 315 THR THR A . n 
A 1 93  GLY 93  316 316 GLY GLY A . n 
A 1 94  THR 94  317 317 THR THR A . n 
A 1 95  ASN 95  318 318 ASN ASN A . n 
A 1 96  THR 96  319 319 THR THR A . n 
A 1 97  TYR 97  320 320 TYR TYR A . n 
A 1 98  ALA 98  321 321 ALA ALA A . n 
A 1 99  ALA 99  322 322 ALA ALA A . n 
A 1 100 LEU 100 323 323 LEU LEU A . n 
A 1 101 ASN 101 324 324 ASN ASN A . n 
A 1 102 SER 102 325 325 SER SER A . n 
A 1 103 VAL 103 326 326 VAL VAL A . n 
A 1 104 TYR 104 327 327 TYR TYR A . n 
A 1 105 LEU 105 328 328 LEU LEU A . n 
A 1 106 MET 106 329 329 MET MET A . n 
A 1 107 MET 107 330 330 MET MET A . n 
A 1 108 ASN 108 331 331 ASN ASN A . n 
A 1 109 ASN 109 332 332 ASN ASN A . n 
A 1 110 GLN 110 333 333 GLN GLN A . n 
A 1 111 MET 111 334 334 MET MET A . n 
A 1 112 ARG 112 335 335 ARG ARG A . n 
A 1 113 LEU 113 336 336 LEU ALA A . n 
A 1 114 LEU 114 337 337 LEU LEU A . n 
A 1 115 GLY 115 338 338 GLY GLY A . n 
A 1 116 MET 116 339 339 MET MET A . n 
A 1 117 GLU 117 340 340 GLU GLU A . n 
A 1 118 THR 118 341 341 THR THR A . n 
A 1 119 MET 119 342 342 MET MET A . n 
A 1 120 ALA 120 343 343 ALA ALA A . n 
A 1 121 TRP 121 344 344 TRP TRP A . n 
A 1 122 GLN 122 345 345 GLN GLN A . n 
A 1 123 GLU 123 346 346 GLU GLU A . n 
A 1 124 ILE 124 347 347 ILE ILE A . n 
A 1 125 ARG 125 348 348 ARG ARG A . n 
A 1 126 HIS 126 349 349 HIS HIS A . n 
A 1 127 ALA 127 350 350 ALA ALA A . n 
A 1 128 ILE 128 351 351 ILE ILE A . n 
A 1 129 ILE 129 352 352 ILE ILE A . n 
A 1 130 LEU 130 353 353 LEU LEU A . n 
A 1 131 LEU 131 354 354 LEU LEU A . n 
A 1 132 THR 132 355 355 THR THR A . n 
A 1 133 ASP 133 356 356 ASP ASP A . n 
A 1 134 GLY 134 357 357 GLY GLY A . n 
A 1 135 LYS 135 358 358 LYS LYS A . n 
A 1 136 SER 136 359 359 SER SER A . n 
A 1 137 ASN 137 360 360 ASN ASN A . n 
A 1 138 MET 138 361 361 MET MET A . n 
A 1 139 GLY 139 362 362 GLY GLY A . n 
A 1 140 GLY 140 363 363 GLY GLY A . n 
A 1 141 SER 141 364 364 SER SER A . n 
A 1 142 PRO 142 365 365 PRO PRO A . n 
A 1 143 LYS 143 366 366 LYS LYS A . n 
A 1 144 THR 144 367 367 THR THR A . n 
A 1 145 ALA 145 368 368 ALA ALA A . n 
A 1 146 VAL 146 369 369 VAL VAL A . n 
A 1 147 ASP 147 370 370 ASP ASP A . n 
A 1 148 HIS 148 371 371 HIS HIS A . n 
A 1 149 ILE 149 372 372 ILE ILE A . n 
A 1 150 ARG 150 373 373 ARG ARG A . n 
A 1 151 GLU 151 374 374 GLU GLU A . n 
A 1 152 ILE 152 375 375 ILE ILE A . n 
A 1 153 LEU 153 376 376 LEU LEU A . n 
A 1 154 ASN 154 377 377 ASN ASN A . n 
A 1 155 ILE 155 378 378 ILE ILE A . n 
A 1 156 ASN 156 379 379 ASN ASN A . n 
A 1 157 GLN 157 380 380 GLN GLN A . n 
A 1 158 LYS 158 381 381 LYS LYS A . n 
A 1 159 ARG 159 382 382 ARG ARG A . n 
A 1 160 ASN 160 383 383 ASN ASN A . n 
A 1 161 ASP 161 384 384 ASP ASP A . n 
A 1 162 TYR 162 385 385 TYR TYR A . n 
A 1 163 LEU 163 386 386 LEU LEU A . n 
A 1 164 ASP 164 387 387 ASP ASP A . n 
A 1 165 ILE 165 388 388 ILE ILE A . n 
A 1 166 TYR 166 389 389 TYR TYR A . n 
A 1 167 ALA 167 390 390 ALA ALA A . n 
A 1 168 ILE 168 391 391 ILE ILE A . n 
A 1 169 GLY 169 392 392 GLY GLY A . n 
A 1 170 VAL 170 393 393 VAL VAL A . n 
A 1 171 GLY 171 394 394 GLY GLY A . n 
A 1 172 LYS 172 395 395 LYS GLY A . n 
A 1 173 LEU 173 396 396 LEU LEU A . n 
A 1 174 ASP 174 397 397 ASP ASP A . n 
A 1 175 VAL 175 398 398 VAL VAL A . n 
A 1 176 ASP 176 399 399 ASP ASP A . n 
A 1 177 TRP 177 400 400 TRP TRP A . n 
A 1 178 ARG 178 401 401 ARG ARG A . n 
A 1 179 GLU 179 402 402 GLU GLN A . n 
A 1 180 LEU 180 403 403 LEU LEU A . n 
A 1 181 ASN 181 404 404 ASN ASN A . n 
A 1 182 GLU 182 405 405 GLU GLU A . n 
A 1 183 LEU 183 406 406 LEU LEU A . n 
A 1 184 GLY 184 407 407 GLY GLY A . n 
A 1 185 SER 185 408 408 SER SER A . n 
A 1 186 LYS 186 409 409 LYS LYS A . n 
A 1 187 LYS 187 410 410 LYS LYS A . n 
A 1 188 ASP 188 411 411 ASP ASP A . n 
A 1 189 GLY 189 412 412 GLY GLY A . n 
A 1 190 GLU 190 413 413 GLU GLU A . n 
A 1 191 ARG 191 414 414 ARG ARG A . n 
A 1 192 HIS 192 415 415 HIS HIS A . n 
A 1 193 ALA 193 416 416 ALA ALA A . n 
A 1 194 PHE 194 417 417 PHE PHE A . n 
A 1 195 ILE 195 418 418 ILE ILE A . n 
A 1 196 LEU 196 419 419 LEU LEU A . n 
A 1 197 GLN 197 420 420 GLN GLN A . n 
A 1 198 ASP 198 421 421 ASP ASP A . n 
A 1 199 THR 199 422 422 THR THR A . n 
A 1 200 LYS 200 423 423 LYS LYS A . n 
A 1 201 ALA 201 424 424 ALA ALA A . n 
A 1 202 LEU 202 425 425 LEU LEU A . n 
A 1 203 HIS 203 426 426 HIS HIS A . n 
A 1 204 GLN 204 427 427 GLN GLN A . n 
A 1 205 VAL 205 428 428 VAL VAL A . n 
A 1 206 PHE 206 429 429 PHE PHE A . n 
A 1 207 GLU 207 430 430 GLU GLU A . n 
A 1 208 HIS 208 431 431 HIS HIS A . n 
A 1 209 MET 209 432 432 MET MET A . n 
A 1 210 LEU 210 433 433 LEU LEU A . n 
A 1 211 ASP 211 434 434 ASP ASP A . n 
A 1 212 VAL 212 435 435 VAL VAL A . n 
A 1 213 SER 213 436 436 SER SER A . n 
A 1 214 LYS 214 437 437 LYS LYS A . n 
A 1 215 LEU 215 438 438 LEU LEU A . n 
A 1 216 THR 216 439 439 THR THR A . n 
A 1 217 ASP 217 440 440 ASP ASP A . n 
A 1 218 THR 218 441 441 THR THR A . n 
A 1 219 ILE 219 442 442 ILE ILE A . n 
A 1 220 CYS 220 443 443 CYS CYS A . n 
A 1 221 GLY 221 444 444 GLY GLY A . n 
A 1 222 VAL 222 445 445 VAL VAL A . n 
A 1 223 GLY 223 446 446 GLY GLY A . n 
A 1 224 ASN 224 447 447 ASN ASN A . n 
A 1 225 MET 225 448 448 MET MET A . n 
A 1 226 SER 226 449 449 SER SER A . n 
A 1 227 ALA 227 450 450 ALA ALA A . n 
A 1 228 ASN 228 451 451 ASN ASN A . n 
A 1 229 ALA 229 452 452 ALA ALA A . n 
A 1 230 SER 230 453 453 SER SER A . n 
A 1 231 ASP 231 454 454 ASP ASP A . n 
A 1 232 GLN 232 455 455 GLN GLN A . n 
A 1 233 GLU 233 456 456 GLU GLU A . n 
A 1 234 ARG 234 457 457 ARG ARG A . n 
A 1 235 THR 235 458 458 THR THR A . n 
A 1 236 PRO 236 459 459 PRO PRO A . n 
A 1 237 TRP 237 460 460 TRP TRP A . n 
A 1 238 HIS 238 461 461 HIS HIS A . n 
A 1 239 VAL 239 462 462 VAL VAL A . n 
A 1 240 THR 240 463 463 THR THR A . n 
A 1 241 ILE 241 464 464 ILE ILE A . n 
A 1 242 LYS 242 465 465 LYS LYS A . n 
A 1 243 PRO 243 466 466 PRO PRO A . n 
A 1 244 LYS 244 467 ?   ?   ?   A . n 
A 1 245 SER 245 468 ?   ?   ?   A . n 
A 1 246 GLN 246 469 ?   ?   ?   A . n 
A 1 247 GLU 247 470 ?   ?   ?   A . n 
A 1 248 THR 248 471 471 THR THR A . n 
A 1 249 CYS 249 472 472 CYS CYS A . n 
A 1 250 ARG 250 473 473 ARG ARG A . n 
A 1 251 GLY 251 474 474 GLY GLY A . n 
A 1 252 ALA 252 475 475 ALA ALA A . n 
A 1 253 LEU 253 476 476 LEU LEU A . n 
A 1 254 ILE 254 477 477 ILE ILE A . n 
A 1 255 SER 255 478 478 SER SER A . n 
A 1 256 ASP 256 479 479 ASP ASP A . n 
A 1 257 GLN 257 480 480 GLN GLN A . n 
A 1 258 TRP 258 481 481 TRP TRP A . n 
A 1 259 VAL 259 482 482 VAL VAL A . n 
A 1 260 LEU 260 483 483 LEU LEU A . n 
A 1 261 THR 261 484 484 THR THR A . n 
A 1 262 ALA 262 485 485 ALA ALA A . n 
A 1 263 ALA 263 486 486 ALA ALA A . n 
A 1 264 HIS 264 487 487 HIS HIS A . n 
A 1 265 CYS 265 488 488 CYS CYS A . n 
A 1 266 PHE 266 489 489 PHE PHE A . n 
A 1 267 ARG 267 490 ?   ?   ?   A . n 
A 1 268 ASP 268 491 ?   ?   ?   A . n 
A 1 269 GLY 269 492 ?   ?   ?   A . n 
A 1 270 ASN 270 493 ?   ?   ?   A . n 
A 1 271 ASP 271 494 ?   ?   ?   A . n 
A 1 272 HIS 272 495 ?   ?   ?   A . n 
A 1 273 SER 273 496 ?   ?   ?   A . n 
A 1 274 LEU 274 497 ?   ?   ?   A . n 
A 1 275 TRP 275 498 498 TRP TRP A . n 
A 1 276 ARG 276 499 499 ARG ARG A . n 
A 1 277 VAL 277 500 500 VAL VAL A . n 
A 1 278 ASN 278 501 501 ASN ASN A . n 
A 1 279 VAL 279 502 502 VAL VAL A . n 
A 1 280 GLY 280 503 503 GLY GLY A . n 
A 1 281 ASP 281 504 504 ASP ASP A . n 
A 1 282 PRO 282 505 505 PRO PRO A . n 
A 1 283 LYS 283 506 506 LYS LYS A . n 
A 1 284 SER 284 507 507 SER SER A . n 
A 1 285 GLN 285 508 508 GLN GLN A . n 
A 1 286 TRP 286 509 509 TRP TRP A . n 
A 1 287 GLY 287 510 510 GLY GLY A . n 
A 1 288 LYS 288 511 511 LYS LYS A . n 
A 1 289 GLU 289 512 512 GLU GLU A . n 
A 1 290 PHE 290 513 513 PHE PHE A . n 
A 1 291 LEU 291 514 514 LEU LEU A . n 
A 1 292 ILE 292 515 515 ILE ILE A . n 
A 1 293 GLU 293 516 516 GLU GLU A . n 
A 1 294 LYS 294 517 517 LYS LYS A . n 
A 1 295 ALA 295 518 518 ALA ALA A . n 
A 1 296 VAL 296 519 519 VAL VAL A . n 
A 1 297 ILE 297 520 520 ILE ILE A . n 
A 1 298 SER 298 521 521 SER SER A . n 
A 1 299 PRO 299 522 522 PRO PRO A . n 
A 1 300 GLY 300 523 523 GLY GLY A . n 
A 1 301 PHE 301 524 524 PHE PHE A . n 
A 1 302 ASP 302 525 525 ASP ASP A . n 
A 1 303 VAL 303 526 526 VAL VAL A . n 
A 1 304 PHE 304 527 527 PHE PHE A . n 
A 1 305 ALA 305 528 528 ALA ALA A . n 
A 1 306 LYS 306 529 529 LYS LYS A . n 
A 1 307 LYS 307 530 530 LYS LYS A . n 
A 1 308 ASN 308 531 531 ASN ASN A . n 
A 1 309 GLN 309 532 532 GLN GLN A . n 
A 1 310 GLY 310 533 533 GLY GLY A . n 
A 1 311 ILE 311 534 534 ILE ILE A . n 
A 1 312 LEU 312 535 535 LEU LEU A . n 
A 1 313 GLU 313 536 536 GLU GLU A . n 
A 1 314 PHE 314 537 537 PHE PHE A . n 
A 1 315 TYR 315 538 538 TYR TYR A . n 
A 1 316 GLY 316 539 539 GLY GLY A . n 
A 1 317 ASP 317 540 540 ASP ASP A . n 
A 1 318 ASP 318 541 541 ASP ASP A . n 
A 1 319 ILE 319 542 542 ILE ILE A . n 
A 1 320 ALA 320 543 543 ALA ALA A . n 
A 1 321 LEU 321 544 544 LEU LEU A . n 
A 1 322 LEU 322 545 545 LEU LEU A . n 
A 1 323 LYS 323 546 546 LYS LYS A . n 
A 1 324 LEU 324 547 547 LEU LEU A . n 
A 1 325 ALA 325 548 548 ALA ALA A . n 
A 1 326 GLN 326 549 549 GLN GLN A . n 
A 1 327 LYS 327 550 550 LYS LYS A . n 
A 1 328 VAL 328 551 551 VAL VAL A . n 
A 1 329 LYS 329 552 552 LYS LYS A . n 
A 1 330 MET 330 553 553 MET MET A . n 
A 1 331 SER 331 554 554 SER SER A . n 
A 1 332 THR 332 555 555 THR THR A . n 
A 1 333 HIS 333 556 556 HIS HIS A . n 
A 1 334 ALA 334 557 557 ALA ALA A . n 
A 1 335 ARG 335 558 558 ARG ARG A . n 
A 1 336 PRO 336 559 559 PRO PRO A . n 
A 1 337 ILE 337 560 560 ILE ILE A . n 
A 1 338 CYS 338 561 561 CYS CYS A . n 
A 1 339 LEU 339 562 562 LEU LEU A . n 
A 1 340 PRO 340 563 563 PRO PRO A . n 
A 1 341 CYS 341 564 564 CYS CYS A . n 
A 1 342 THR 342 565 565 THR THR A . n 
A 1 343 MET 343 566 566 MET MET A . n 
A 1 344 GLU 344 567 567 GLU GLU A . n 
A 1 345 ALA 345 568 568 ALA ALA A . n 
A 1 346 ASN 346 569 569 ASN ASN A . n 
A 1 347 LEU 347 570 570 LEU LEU A . n 
A 1 348 ALA 348 571 571 ALA ALA A . n 
A 1 349 LEU 349 572 572 LEU LEU A . n 
A 1 350 ARG 350 573 573 ARG ARG A . n 
A 1 351 ARG 351 574 574 ARG ARG A . n 
A 1 352 PRO 352 575 575 PRO PRO A . n 
A 1 353 GLN 353 576 576 GLN GLN A . n 
A 1 354 GLY 354 577 577 GLY GLY A . n 
A 1 355 SER 355 578 578 SER SER A . n 
A 1 356 THR 356 579 579 THR THR A . n 
A 1 357 CYS 357 580 580 CYS CYS A . n 
A 1 358 ARG 358 581 581 ARG ARG A . n 
A 1 359 ASP 359 582 582 ASP ASP A . n 
A 1 360 HIS 360 583 583 HIS HIS A . n 
A 1 361 GLU 361 584 584 GLU GLU A . n 
A 1 362 ASN 362 585 585 ASN ASN A . n 
A 1 363 GLU 363 586 586 GLU GLU A . n 
A 1 364 LEU 364 587 587 LEU LEU A . n 
A 1 365 LEU 365 588 588 LEU LEU A . n 
A 1 366 ASN 366 589 589 ASN ASN A . n 
A 1 367 LYS 367 590 590 LYS LYS A . n 
A 1 368 GLN 368 591 591 GLN GLN A . n 
A 1 369 SER 369 592 592 SER SER A . n 
A 1 370 VAL 370 593 593 VAL VAL A . n 
A 1 371 PRO 371 594 594 PRO PRO A . n 
A 1 372 ALA 372 595 595 ALA ALA A . n 
A 1 373 HIS 373 596 596 HIS HIS A . n 
A 1 374 PHE 374 597 597 PHE PHE A . n 
A 1 375 VAL 375 598 598 VAL VAL A . n 
A 1 376 ALA 376 599 599 ALA ALA A . n 
A 1 377 LEU 377 600 600 LEU LEU A . n 
A 1 378 ASN 378 601 601 ASN ASN A . n 
A 1 379 GLY 379 602 602 GLY GLY A . n 
A 1 380 SER 380 603 603 SER SER A . n 
A 1 381 LYS 381 604 604 LYS LYS A . n 
A 1 382 LEU 382 605 605 LEU LEU A . n 
A 1 383 ASN 383 606 606 ASN ASN A . n 
A 1 384 ILE 384 607 607 ILE ILE A . n 
A 1 385 ASN 385 608 608 ASN ASN A . n 
A 1 386 LEU 386 609 609 LEU LEU A . n 
A 1 387 LYS 387 610 610 LYS LYS A . n 
A 1 388 MET 388 611 611 MET MET A . n 
A 1 389 GLY 389 612 612 GLY GLY A . n 
A 1 390 VAL 390 613 613 VAL VAL A . n 
A 1 391 GLU 391 614 614 GLU GLU A . n 
A 1 392 TRP 392 615 615 TRP TRP A . n 
A 1 393 THR 393 616 616 THR THR A . n 
A 1 394 SER 394 617 617 SER SER A . n 
A 1 395 CYS 395 618 618 CYS CYS A . n 
A 1 396 ALA 396 619 619 ALA ALA A . n 
A 1 397 GLU 397 620 620 GLU GLU A . n 
A 1 398 VAL 398 621 621 VAL VAL A . n 
A 1 399 VAL 399 622 622 VAL VAL A . n 
A 1 400 SER 400 623 623 SER SER A . n 
A 1 401 GLN 401 624 624 GLN GLN A . n 
A 1 402 GLU 402 625 625 GLU GLU A . n 
A 1 403 LYS 403 626 626 LYS LYS A . n 
A 1 404 THR 404 627 627 THR THR A . n 
A 1 405 MET 405 628 628 MET MET A . n 
A 1 406 PHE 406 629 629 PHE PHE A . n 
A 1 407 PRO 407 630 630 PRO PRO A . n 
A 1 408 ASN 408 631 631 ASN ASN A . n 
A 1 409 LEU 409 632 632 LEU LEU A . n 
A 1 410 THR 410 633 633 THR THR A . n 
A 1 411 ASP 411 634 634 ASP ASP A . n 
A 1 412 VAL 412 635 635 VAL VAL A . n 
A 1 413 ARG 413 636 636 ARG ARG A . n 
A 1 414 GLU 414 637 637 GLU GLU A . n 
A 1 415 VAL 415 638 638 VAL VAL A . n 
A 1 416 VAL 416 639 639 VAL VAL A . n 
A 1 417 THR 417 640 640 THR THR A . n 
A 1 418 ASP 418 641 641 ASP ASP A . n 
A 1 419 GLN 419 642 642 GLN GLN A . n 
A 1 420 PHE 420 643 643 PHE PHE A . n 
A 1 421 LEU 421 644 644 LEU LEU A . n 
A 1 422 CYS 422 645 645 CYS CYS A . n 
A 1 423 SER 423 646 646 SER SER A . n 
A 1 424 GLY 424 647 647 GLY GLY A . n 
A 1 425 THR 425 648 648 THR THR A . n 
A 1 426 GLN 426 649 649 GLN GLN A . n 
A 1 427 GLU 427 650 650 GLU GLU A . n 
A 1 428 ASP 428 651 651 ASP ASP A . n 
A 1 429 GLU 429 652 652 GLU GLU A . n 
A 1 430 SER 430 653 653 SER SER A . n 
A 1 431 PRO 431 654 654 PRO PRO A . n 
A 1 432 CYS 432 655 655 CYS CYS A . n 
A 1 433 LYS 433 656 656 LYS LYS A . n 
A 1 434 GLY 434 657 657 GLY GLY A . n 
A 1 435 GLU 435 658 658 GLU GLU A . n 
A 1 436 SER 436 659 659 SER SER A . n 
A 1 437 GLY 437 660 660 GLY GLY A . n 
A 1 438 GLY 438 661 661 GLY GLY A . n 
A 1 439 ALA 439 662 662 ALA ALA A . n 
A 1 440 VAL 440 663 663 VAL VAL A . n 
A 1 441 PHE 441 664 664 PHE PHE A . n 
A 1 442 LEU 442 665 665 LEU LEU A . n 
A 1 443 GLU 443 666 666 GLU GLU A . n 
A 1 444 ARG 444 667 667 ARG ARG A . n 
A 1 445 ARG 445 668 668 ARG ARG A . n 
A 1 446 PHE 446 669 669 PHE PHE A . n 
A 1 447 ARG 447 670 670 ARG ARG A . n 
A 1 448 PHE 448 671 671 PHE PHE A . n 
A 1 449 PHE 449 672 672 PHE PHE A . n 
A 1 450 GLN 450 673 673 GLN GLN A . n 
A 1 451 VAL 451 674 674 VAL VAL A . n 
A 1 452 GLY 452 675 675 GLY GLY A . n 
A 1 453 LEU 453 676 676 LEU LEU A . n 
A 1 454 VAL 454 677 677 VAL VAL A . n 
A 1 455 SER 455 678 678 SER SER A . n 
A 1 456 TRP 456 679 679 TRP TRP A . n 
A 1 457 GLY 457 680 680 GLY GLY A . n 
A 1 458 LEU 458 681 681 LEU LEU A . n 
A 1 459 TYR 459 682 682 TYR TYR A . n 
A 1 460 ASN 460 683 683 ASN ASN A . n 
A 1 461 PRO 461 684 684 PRO PRO A . n 
A 1 462 CYS 462 685 685 CYS CYS A . n 
A 1 463 LEU 463 686 686 LEU LEU A . n 
A 1 464 GLY 464 687 ?   ?   ?   A . n 
A 1 465 SER 465 688 ?   ?   ?   A . n 
A 1 466 ALA 466 689 ?   ?   ?   A . n 
A 1 467 ASP 467 690 ?   ?   ?   A . n 
A 1 468 LYS 468 691 ?   ?   ?   A . n 
A 1 469 ASN 469 692 692 ASN ASN A . n 
A 1 470 SER 470 693 693 SER SER A . n 
A 1 471 ARG 471 694 694 ARG ARG A . n 
A 1 472 LYS 472 695 695 LYS LYS A . n 
A 1 473 ARG 473 696 696 ARG ARG A . n 
A 1 474 ALA 474 697 697 ALA ALA A . n 
A 1 475 PRO 475 698 698 PRO PRO A . n 
A 1 476 ARG 476 699 699 ARG ARG A . n 
A 1 477 SER 477 700 700 SER SER A . n 
A 1 478 LYS 478 701 701 LYS ALA A . n 
A 1 479 VAL 479 702 702 VAL VAL A . n 
A 1 480 PRO 480 703 703 PRO PRO A . n 
A 1 481 PRO 481 704 704 PRO PRO A . n 
A 1 482 PRO 482 705 705 PRO PRO A . n 
A 1 483 ARG 483 706 706 ARG ARG A . n 
A 1 484 ASP 484 707 707 ASP ASP A . n 
A 1 485 PHE 485 708 708 PHE PHE A . n 
A 1 486 HIS 486 709 709 HIS HIS A . n 
A 1 487 ILE 487 710 710 ILE ILE A . n 
A 1 488 ASN 488 711 711 ASN ASN A . n 
A 1 489 LEU 489 712 712 LEU LEU A . n 
A 1 490 PHE 490 713 713 PHE PHE A . n 
A 1 491 ARG 491 714 714 ARG ARG A . n 
A 1 492 MET 492 715 715 MET MET A . n 
A 1 493 GLN 493 716 716 GLN GLN A . n 
A 1 494 PRO 494 717 717 PRO PRO A . n 
A 1 495 TRP 495 718 718 TRP TRP A . n 
A 1 496 LEU 496 719 719 LEU LEU A . n 
A 1 497 ARG 497 720 720 ARG ARG A . n 
A 1 498 GLN 498 721 721 GLN GLN A . n 
A 1 499 HIS 499 722 722 HIS HIS A . n 
A 1 500 LEU 500 723 723 LEU LEU A . n 
A 1 501 GLY 501 724 724 GLY GLY A . n 
A 1 502 ASP 502 725 725 ASP ASP A . n 
A 1 503 VAL 503 726 726 VAL VAL A . n 
A 1 504 LEU 504 727 727 LEU LEU A . n 
A 1 505 ASN 505 728 728 ASN ASN A . n 
A 1 506 PHE 506 729 729 PHE PHE A . n 
A 1 507 LEU 507 730 730 LEU LEU A . n 
A 1 508 PRO 508 731 ?   ?   ?   A . n 
A 1 509 LEU 509 732 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NAG 1   807  807 NAG NAG A . 
E 4 NAG 1   808  808 NAG NAG A . 
F 5 MG  1   901  1   MG  MG  A . 
G 6 HOH 1   902  1   HOH HOH A . 
G 6 HOH 2   903  2   HOH HOH A . 
G 6 HOH 3   904  3   HOH HOH A . 
G 6 HOH 4   905  1   HOH HOH A . 
G 6 HOH 5   906  3   HOH HOH A . 
G 6 HOH 6   907  4   HOH HOH A . 
G 6 HOH 7   908  5   HOH HOH A . 
G 6 HOH 8   909  6   HOH HOH A . 
G 6 HOH 9   910  7   HOH HOH A . 
G 6 HOH 10  911  8   HOH HOH A . 
G 6 HOH 11  912  9   HOH HOH A . 
G 6 HOH 12  913  10  HOH HOH A . 
G 6 HOH 13  914  11  HOH HOH A . 
G 6 HOH 14  915  12  HOH HOH A . 
G 6 HOH 15  916  13  HOH HOH A . 
G 6 HOH 16  917  14  HOH HOH A . 
G 6 HOH 17  918  15  HOH HOH A . 
G 6 HOH 18  919  16  HOH HOH A . 
G 6 HOH 19  920  17  HOH HOH A . 
G 6 HOH 20  921  18  HOH HOH A . 
G 6 HOH 21  922  19  HOH HOH A . 
G 6 HOH 22  923  21  HOH HOH A . 
G 6 HOH 23  924  22  HOH HOH A . 
G 6 HOH 24  925  23  HOH HOH A . 
G 6 HOH 25  926  24  HOH HOH A . 
G 6 HOH 26  927  25  HOH HOH A . 
G 6 HOH 27  928  26  HOH HOH A . 
G 6 HOH 28  929  27  HOH HOH A . 
G 6 HOH 29  930  29  HOH HOH A . 
G 6 HOH 30  931  30  HOH HOH A . 
G 6 HOH 31  932  31  HOH HOH A . 
G 6 HOH 32  933  32  HOH HOH A . 
G 6 HOH 33  934  33  HOH HOH A . 
G 6 HOH 34  935  34  HOH HOH A . 
G 6 HOH 35  936  35  HOH HOH A . 
G 6 HOH 36  937  36  HOH HOH A . 
G 6 HOH 37  938  37  HOH HOH A . 
G 6 HOH 38  939  38  HOH HOH A . 
G 6 HOH 39  940  39  HOH HOH A . 
G 6 HOH 40  941  40  HOH HOH A . 
G 6 HOH 41  942  41  HOH HOH A . 
G 6 HOH 42  943  42  HOH HOH A . 
G 6 HOH 43  944  43  HOH HOH A . 
G 6 HOH 44  945  44  HOH HOH A . 
G 6 HOH 45  946  45  HOH HOH A . 
G 6 HOH 46  947  46  HOH HOH A . 
G 6 HOH 47  948  47  HOH HOH A . 
G 6 HOH 48  949  48  HOH HOH A . 
G 6 HOH 49  950  49  HOH HOH A . 
G 6 HOH 50  951  50  HOH HOH A . 
G 6 HOH 51  952  51  HOH HOH A . 
G 6 HOH 52  953  52  HOH HOH A . 
G 6 HOH 53  954  53  HOH HOH A . 
G 6 HOH 54  955  54  HOH HOH A . 
G 6 HOH 55  956  55  HOH HOH A . 
G 6 HOH 56  957  56  HOH HOH A . 
G 6 HOH 57  958  57  HOH HOH A . 
G 6 HOH 58  959  58  HOH HOH A . 
G 6 HOH 59  960  59  HOH HOH A . 
G 6 HOH 60  961  60  HOH HOH A . 
G 6 HOH 61  962  61  HOH HOH A . 
G 6 HOH 62  963  62  HOH HOH A . 
G 6 HOH 63  964  63  HOH HOH A . 
G 6 HOH 64  965  64  HOH HOH A . 
G 6 HOH 65  966  65  HOH HOH A . 
G 6 HOH 66  967  66  HOH HOH A . 
G 6 HOH 67  968  67  HOH HOH A . 
G 6 HOH 68  969  68  HOH HOH A . 
G 6 HOH 69  970  69  HOH HOH A . 
G 6 HOH 70  971  70  HOH HOH A . 
G 6 HOH 71  972  71  HOH HOH A . 
G 6 HOH 72  973  72  HOH HOH A . 
G 6 HOH 73  974  73  HOH HOH A . 
G 6 HOH 74  975  74  HOH HOH A . 
G 6 HOH 75  976  75  HOH HOH A . 
G 6 HOH 76  977  76  HOH HOH A . 
G 6 HOH 77  978  77  HOH HOH A . 
G 6 HOH 78  979  78  HOH HOH A . 
G 6 HOH 79  980  79  HOH HOH A . 
G 6 HOH 80  981  80  HOH HOH A . 
G 6 HOH 81  982  81  HOH HOH A . 
G 6 HOH 82  983  82  HOH HOH A . 
G 6 HOH 83  984  83  HOH HOH A . 
G 6 HOH 84  985  84  HOH HOH A . 
G 6 HOH 85  986  85  HOH HOH A . 
G 6 HOH 86  987  86  HOH HOH A . 
G 6 HOH 87  988  87  HOH HOH A . 
G 6 HOH 88  989  88  HOH HOH A . 
G 6 HOH 89  990  89  HOH HOH A . 
G 6 HOH 90  991  90  HOH HOH A . 
G 6 HOH 91  992  91  HOH HOH A . 
G 6 HOH 92  993  92  HOH HOH A . 
G 6 HOH 93  994  93  HOH HOH A . 
G 6 HOH 94  995  94  HOH HOH A . 
G 6 HOH 95  996  95  HOH HOH A . 
G 6 HOH 96  997  97  HOH HOH A . 
G 6 HOH 97  998  98  HOH HOH A . 
G 6 HOH 98  999  99  HOH HOH A . 
G 6 HOH 99  1000 100 HOH HOH A . 
G 6 HOH 100 1001 101 HOH HOH A . 
G 6 HOH 101 1002 102 HOH HOH A . 
G 6 HOH 102 1003 103 HOH HOH A . 
G 6 HOH 103 1004 104 HOH HOH A . 
G 6 HOH 104 1005 105 HOH HOH A . 
G 6 HOH 105 1006 106 HOH HOH A . 
G 6 HOH 106 1007 107 HOH HOH A . 
G 6 HOH 107 1008 108 HOH HOH A . 
G 6 HOH 108 1009 109 HOH HOH A . 
G 6 HOH 109 1010 110 HOH HOH A . 
G 6 HOH 110 1011 112 HOH HOH A . 
G 6 HOH 111 1012 113 HOH HOH A . 
G 6 HOH 112 1013 114 HOH HOH A . 
G 6 HOH 113 1014 115 HOH HOH A . 
G 6 HOH 114 1015 116 HOH HOH A . 
G 6 HOH 115 1016 117 HOH HOH A . 
G 6 HOH 116 1017 118 HOH HOH A . 
G 6 HOH 117 1018 119 HOH HOH A . 
G 6 HOH 118 1019 120 HOH HOH A . 
G 6 HOH 119 1020 121 HOH HOH A . 
G 6 HOH 120 1021 122 HOH HOH A . 
G 6 HOH 121 1022 123 HOH HOH A . 
G 6 HOH 122 1023 124 HOH HOH A . 
G 6 HOH 123 1024 125 HOH HOH A . 
G 6 HOH 124 1025 126 HOH HOH A . 
G 6 HOH 125 1026 127 HOH HOH A . 
G 6 HOH 126 1027 128 HOH HOH A . 
G 6 HOH 127 1028 129 HOH HOH A . 
G 6 HOH 128 1029 130 HOH HOH A . 
G 6 HOH 129 1030 131 HOH HOH A . 
G 6 HOH 130 1031 132 HOH HOH A . 
G 6 HOH 131 1032 134 HOH HOH A . 
G 6 HOH 132 1033 135 HOH HOH A . 
G 6 HOH 133 1034 136 HOH HOH A . 
G 6 HOH 134 1035 137 HOH HOH A . 
G 6 HOH 135 1036 138 HOH HOH A . 
G 6 HOH 136 1037 139 HOH HOH A . 
G 6 HOH 137 1038 140 HOH HOH A . 
G 6 HOH 138 1039 141 HOH HOH A . 
G 6 HOH 139 1040 142 HOH HOH A . 
G 6 HOH 140 1041 143 HOH HOH A . 
G 6 HOH 141 1042 144 HOH HOH A . 
G 6 HOH 142 1043 145 HOH HOH A . 
G 6 HOH 143 1044 146 HOH HOH A . 
G 6 HOH 144 1045 147 HOH HOH A . 
G 6 HOH 145 1046 148 HOH HOH A . 
G 6 HOH 146 1047 149 HOH HOH A . 
G 6 HOH 147 1048 150 HOH HOH A . 
G 6 HOH 148 1049 151 HOH HOH A . 
G 6 HOH 149 1050 152 HOH HOH A . 
G 6 HOH 150 1051 153 HOH HOH A . 
G 6 HOH 151 1052 154 HOH HOH A . 
G 6 HOH 152 1053 155 HOH HOH A . 
G 6 HOH 153 1054 156 HOH HOH A . 
G 6 HOH 154 1055 157 HOH HOH A . 
G 6 HOH 155 1056 158 HOH HOH A . 
G 6 HOH 156 1057 159 HOH HOH A . 
G 6 HOH 157 1058 161 HOH HOH A . 
G 6 HOH 158 1059 162 HOH HOH A . 
G 6 HOH 159 1060 164 HOH HOH A . 
G 6 HOH 160 1061 165 HOH HOH A . 
G 6 HOH 161 1062 166 HOH HOH A . 
G 6 HOH 162 1063 167 HOH HOH A . 
G 6 HOH 163 1064 168 HOH HOH A . 
G 6 HOH 164 1065 169 HOH HOH A . 
G 6 HOH 165 1066 170 HOH HOH A . 
G 6 HOH 166 1067 171 HOH HOH A . 
G 6 HOH 167 1068 172 HOH HOH A . 
G 6 HOH 168 1069 173 HOH HOH A . 
G 6 HOH 169 1070 174 HOH HOH A . 
G 6 HOH 170 1071 175 HOH HOH A . 
G 6 HOH 171 1072 176 HOH HOH A . 
G 6 HOH 172 1073 177 HOH HOH A . 
G 6 HOH 173 1074 178 HOH HOH A . 
G 6 HOH 174 1075 179 HOH HOH A . 
G 6 HOH 175 1076 180 HOH HOH A . 
G 6 HOH 176 1077 181 HOH HOH A . 
G 6 HOH 177 1078 182 HOH HOH A . 
G 6 HOH 178 1079 183 HOH HOH A . 
G 6 HOH 179 1080 184 HOH HOH A . 
G 6 HOH 180 1081 185 HOH HOH A . 
G 6 HOH 181 1082 186 HOH HOH A . 
G 6 HOH 182 1083 188 HOH HOH A . 
G 6 HOH 183 1084 189 HOH HOH A . 
G 6 HOH 184 1085 190 HOH HOH A . 
G 6 HOH 185 1086 191 HOH HOH A . 
G 6 HOH 186 1087 192 HOH HOH A . 
G 6 HOH 187 1088 193 HOH HOH A . 
G 6 HOH 188 1089 194 HOH HOH A . 
G 6 HOH 189 1090 195 HOH HOH A . 
G 6 HOH 190 1091 196 HOH HOH A . 
G 6 HOH 191 1092 197 HOH HOH A . 
G 6 HOH 192 1093 198 HOH HOH A . 
G 6 HOH 193 1094 199 HOH HOH A . 
G 6 HOH 194 1095 200 HOH HOH A . 
G 6 HOH 195 1096 201 HOH HOH A . 
G 6 HOH 196 1097 202 HOH HOH A . 
G 6 HOH 197 1098 203 HOH HOH A . 
G 6 HOH 198 1099 204 HOH HOH A . 
G 6 HOH 199 1100 205 HOH HOH A . 
G 6 HOH 200 1101 206 HOH HOH A . 
G 6 HOH 201 1102 207 HOH HOH A . 
G 6 HOH 202 1103 208 HOH HOH A . 
G 6 HOH 203 1104 209 HOH HOH A . 
G 6 HOH 204 1105 210 HOH HOH A . 
G 6 HOH 205 1106 211 HOH HOH A . 
G 6 HOH 206 1107 212 HOH HOH A . 
G 6 HOH 207 1108 213 HOH HOH A . 
G 6 HOH 208 1109 214 HOH HOH A . 
G 6 HOH 209 1110 215 HOH HOH A . 
G 6 HOH 210 1111 216 HOH HOH A . 
G 6 HOH 211 1112 217 HOH HOH A . 
G 6 HOH 212 1113 218 HOH HOH A . 
G 6 HOH 213 1114 219 HOH HOH A . 
G 6 HOH 214 1115 220 HOH HOH A . 
G 6 HOH 215 1116 221 HOH HOH A . 
G 6 HOH 216 1117 222 HOH HOH A . 
G 6 HOH 217 1118 223 HOH HOH A . 
G 6 HOH 218 1119 224 HOH HOH A . 
G 6 HOH 219 1120 226 HOH HOH A . 
G 6 HOH 220 1121 227 HOH HOH A . 
G 6 HOH 221 1122 228 HOH HOH A . 
G 6 HOH 222 1123 229 HOH HOH A . 
G 6 HOH 223 1124 230 HOH HOH A . 
G 6 HOH 224 1125 231 HOH HOH A . 
G 6 HOH 225 1126 232 HOH HOH A . 
G 6 HOH 226 1127 233 HOH HOH A . 
G 6 HOH 227 1128 234 HOH HOH A . 
G 6 HOH 228 1129 235 HOH HOH A . 
G 6 HOH 229 1130 236 HOH HOH A . 
G 6 HOH 230 1131 237 HOH HOH A . 
G 6 HOH 231 1132 238 HOH HOH A . 
G 6 HOH 232 1133 239 HOH HOH A . 
G 6 HOH 233 1134 240 HOH HOH A . 
G 6 HOH 234 1135 241 HOH HOH A . 
G 6 HOH 235 1136 242 HOH HOH A . 
G 6 HOH 236 1137 243 HOH HOH A . 
G 6 HOH 237 1138 244 HOH HOH A . 
G 6 HOH 238 1139 245 HOH HOH A . 
G 6 HOH 239 1140 246 HOH HOH A . 
G 6 HOH 240 1141 247 HOH HOH A . 
G 6 HOH 241 1142 248 HOH HOH A . 
G 6 HOH 242 1143 249 HOH HOH A . 
G 6 HOH 243 1144 250 HOH HOH A . 
G 6 HOH 244 1145 251 HOH HOH A . 
G 6 HOH 245 1146 252 HOH HOH A . 
G 6 HOH 246 1147 253 HOH HOH A . 
G 6 HOH 247 1148 254 HOH HOH A . 
G 6 HOH 248 1149 255 HOH HOH A . 
G 6 HOH 249 1150 256 HOH HOH A . 
G 6 HOH 250 1151 257 HOH HOH A . 
G 6 HOH 251 1152 258 HOH HOH A . 
G 6 HOH 252 1153 259 HOH HOH A . 
G 6 HOH 253 1154 260 HOH HOH A . 
G 6 HOH 254 1155 262 HOH HOH A . 
G 6 HOH 255 1156 263 HOH HOH A . 
G 6 HOH 256 1157 264 HOH HOH A . 
G 6 HOH 257 1158 265 HOH HOH A . 
G 6 HOH 258 1159 266 HOH HOH A . 
G 6 HOH 259 1160 267 HOH HOH A . 
# 
_pdbx_molecule_features.prd_id    PRD_900017 
_pdbx_molecule_features.name      triacetyl-beta-chitotriose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   oligosaccharide 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900017 
_pdbx_molecule.asym_id       C 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 408 A ASN 631 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 224 A ASN 447 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 378 A ASN 601 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 90  A ASN 313 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG  ? A SER 19 ? A SER 242 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OG  ? A SER 21 ? A SER 244 ? 1_555 97.1  ? 
2  OG  ? A SER 19 ? A SER 242 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OG1 ? A THR 94 ? A THR 317 ? 1_555 89.2  ? 
3  OG  ? A SER 21 ? A SER 244 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 OG1 ? A THR 94 ? A THR 317 ? 1_555 169.6 ? 
4  OG  ? A SER 19 ? A SER 242 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 1_555 96.4  ? 
5  OG  ? A SER 21 ? A SER 244 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 1_555 85.6  ? 
6  OG1 ? A THR 94 ? A THR 317 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 902 ? 1_555 102.0 ? 
7  OG  ? A SER 19 ? A SER 242 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 173.8 ? 
8  OG  ? A SER 21 ? A SER 244 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 86.1  ? 
9  OG1 ? A THR 94 ? A THR 317 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 86.9  ? 
10 O   ? G HOH .  ? A HOH 902 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 903 ? 1_555 89.1  ? 
11 OG  ? A SER 19 ? A SER 242 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 90.1  ? 
12 OG  ? A SER 21 ? A SER 244 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 85.7  ? 
13 OG1 ? A THR 94 ? A THR 317 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 86.0  ? 
14 O   ? G HOH .  ? A HOH 902 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 169.7 ? 
15 O   ? G HOH .  ? A HOH 903 ? 1_555 MG ? F MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 904 ? 1_555 84.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-06 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
5 'Structure model' 2 1 2021-11-10 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Structure summary'         
8 5 'Structure model' 'Database references'       
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' entity_name_com               
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_molecule_features        
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' pdbx_struct_assembly_gen      
15 4 'Structure model' pdbx_struct_conn_angle        
16 4 'Structure model' struct_asym                   
17 4 'Structure model' struct_conn                   
18 4 'Structure model' struct_site                   
19 4 'Structure model' struct_site_gen               
20 5 'Structure model' chem_comp                     
21 5 'Structure model' database_2                    
22 5 'Structure model' struct_ref_seq_dif            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.auth_asym_id'                     
2  4 'Structure model' '_atom_site.auth_seq_id'                      
3  4 'Structure model' '_atom_site.label_asym_id'                    
4  4 'Structure model' '_atom_site.label_entity_id'                  
5  4 'Structure model' '_chem_comp.name'                             
6  4 'Structure model' '_chem_comp.type'                             
7  4 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
8  4 'Structure model' '_pdbx_entity_nonpoly.name'                   
9  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
23 4 'Structure model' '_pdbx_struct_conn_angle.value'               
24 4 'Structure model' '_struct_conn.pdbx_dist_value'                
25 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
26 4 'Structure model' '_struct_conn.pdbx_role'                      
27 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
28 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
29 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
30 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
31 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
32 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
33 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
34 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
35 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
36 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
37 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
38 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
39 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
40 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
41 5 'Structure model' '_chem_comp.pdbx_synonyms'                    
42 5 'Structure model' '_database_2.pdbx_DOI'                        
43 5 'Structure model' '_database_2.pdbx_database_accession'         
44 5 'Structure model' '_struct_ref_seq_dif.details'                 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      .     ?                program 'Murshudov, G.N.' ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html  Fortran_77 ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-2000    .     ?                ?       ?                 ?                        'data reduction'  ? ?          ? 3 
HKL-2000    .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 4 
CNS         .     ?                ?       ?                 ?                        phasing           ? ?          ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 904 ? ? O A HOH 978  ? ? 1.88 
2 1 O A HOH 915 ? ? O A HOH 1060 ? ? 2.18 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             402 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE2 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             402 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.337 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.085 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 574 ? ? CZ A ARG 574 ? ? NH1 A ARG 574 ? ? 125.44 120.30 5.14  0.50 N 
2 1 NE A ARG 574 ? ? CZ A ARG 574 ? ? NH2 A ARG 574 ? ? 114.34 120.30 -5.96 0.50 N 
3 1 NE A ARG 667 ? ? CZ A ARG 667 ? ? NH1 A ARG 667 ? ? 123.73 120.30 3.43  0.50 N 
4 1 NE A ARG 667 ? ? CZ A ARG 667 ? ? NH2 A ARG 667 ? ? 116.82 120.30 -3.48 0.50 N 
5 1 NE A ARG 706 ? ? CZ A ARG 706 ? ? NH1 A ARG 706 ? ? 123.75 120.30 3.45  0.50 N 
6 1 NE A ARG 706 ? ? CZ A ARG 706 ? ? NH2 A ARG 706 ? ? 115.44 120.30 -4.86 0.50 N 
7 1 NE A ARG 720 ? ? CZ A ARG 720 ? ? NH1 A ARG 720 ? ? 123.87 120.30 3.57  0.50 N 
8 1 NE A ARG 720 ? ? CZ A ARG 720 ? ? NH2 A ARG 720 ? ? 116.16 120.30 -4.14 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 279 ? ? -142.87 -108.40 
2  1 ASN A 318 ? ? -100.66 79.15   
3  1 MET A 339 ? ? -35.84  -38.32  
4  1 LYS A 358 ? ? -108.16 55.92   
5  1 ASN A 360 ? ? -151.08 12.70   
6  1 ASN A 379 ? ? -111.12 -167.35 
7  1 GLN A 480 ? ? -141.82 -5.87   
8  1 GLN A 508 ? ? -49.31  -15.90  
9  1 ASN A 631 ? ? -118.17 62.98   
10 1 GLN A 649 ? ? 43.68   -122.89 
11 1 PHE A 669 ? ? 56.81   18.72   
12 1 LYS A 701 ? ? -72.04  37.48   
13 1 VAL A 702 ? ? -16.59  119.51  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 336 ? CG  ? A LEU 113 CG  
2  1 Y 1 A LEU 336 ? CD1 ? A LEU 113 CD1 
3  1 Y 1 A LEU 336 ? CD2 ? A LEU 113 CD2 
4  1 Y 1 A LYS 395 ? CB  ? A LYS 172 CB  
5  1 Y 1 A LYS 395 ? CG  ? A LYS 172 CG  
6  1 Y 1 A LYS 395 ? CD  ? A LYS 172 CD  
7  1 Y 1 A LYS 395 ? CE  ? A LYS 172 CE  
8  1 Y 1 A LYS 395 ? NZ  ? A LYS 172 NZ  
9  1 Y 1 A LYS 701 ? CG  ? A LYS 478 CG  
10 1 Y 1 A LYS 701 ? CD  ? A LYS 478 CD  
11 1 Y 1 A LYS 701 ? CE  ? A LYS 478 CE  
12 1 Y 1 A LYS 701 ? NZ  ? A LYS 478 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 467 ? A LYS 244 
2  1 Y 1 A SER 468 ? A SER 245 
3  1 Y 1 A GLN 469 ? A GLN 246 
4  1 Y 1 A GLU 470 ? A GLU 247 
5  1 Y 1 A ARG 490 ? A ARG 267 
6  1 Y 1 A ASP 491 ? A ASP 268 
7  1 Y 1 A GLY 492 ? A GLY 269 
8  1 Y 1 A ASN 493 ? A ASN 270 
9  1 Y 1 A ASP 494 ? A ASP 271 
10 1 Y 1 A HIS 495 ? A HIS 272 
11 1 Y 1 A SER 496 ? A SER 273 
12 1 Y 1 A LEU 497 ? A LEU 274 
13 1 Y 1 A GLY 687 ? A GLY 464 
14 1 Y 1 A SER 688 ? A SER 465 
15 1 Y 1 A ALA 689 ? A ALA 466 
16 1 Y 1 A ASP 690 ? A ASP 467 
17 1 Y 1 A LYS 691 ? A LYS 468 
18 1 Y 1 A PRO 731 ? A PRO 508 
19 1 Y 1 A LEU 732 ? A LEU 509 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 S NAG 801 n 
B 2 NAG 2 B NAG 2 S NAG 802 n 
B 2 NAG 3 B NAG 3 S NAG 803 n 
C 3 NAG 1 C NAG 1 S NAG 804 n 
C 3 NAG 2 C NAG 2 S NAG 805 n 
C 3 NAG 3 C NAG 3 S NAG 806 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-3[DGlcpNAcb1-4]DGlcpNAcb1-'                                  'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/1,3,2/[a2122h-1b_1-5_2*NCC/3=O]/1-1-1/a3-b1_a4-c1'            WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(3+1)][b-D-GlcpNAc]{}[(4+1)][b-D-GlcpNAc]{}}}' LINUCS                      PDB-CARE   ?     
4 3 DGlcpNAcb1-4DGlcpNAcb1-4DGlcpNAcb1-                                      'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/1,3,2/[a2122h-1b_1-5_2*NCC/3=O]/1-1-1/a4-b1_b4-c1'            WURCS                       PDB2Glycan 1.1.0 
6 3 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}}}' LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O3 HO3 sing ? 
2 2 3 NAG C1 O1 1 NAG O4 HO4 sing ? 
3 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
4 3 3 NAG C1 O1 2 NAG O4 HO4 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 NAG 3 n 
3 NAG 1 n 
3 NAG 2 n 
3 NAG 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 'MAGNESIUM ION'                          MG  
6 water                                    HOH 
#