data_2OM2
# 
_entry.id   2OM2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OM2         
RCSB  RCSB041304   
WWPDB D_1000041304 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1KJY 
_pdbx_database_related.details        '2.7 Angstrom resolution structure of G{alpha}i1 and R14GL peptide' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2OM2 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-20 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Siderovski, D.P.' 1 
'Kimple, R.J.'     2 
# 
_citation.id                        primary 
_citation.title                     
'Structure-based Protocol for Identifying Mutations that Enhance Protein-Protein Binding Affinities.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            371 
_citation.page_first                1392 
_citation.page_last                 1404 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17603074 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.05.096 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sammond, D.W.'    1 
primary 'Eletr, Z.M.'      2 
primary 'Purbeck, C.'      3 
primary 'Kimple, R.J.'     4 
primary 'Siderovski, D.P.' 5 
primary 'Kuhlman, B.'      6 
# 
_cell.length_a           69.592 
_cell.length_b           82.311 
_cell.length_c           187.566 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           2OM2 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 2 2 21' 
_symmetry.entry_id                         2OM2 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                17 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Guanine nucleotide-binding protein G(i), alpha-1 subunit'  37159.348 2   ? ? 'G{alpha}i1' ? 
2 polymer     syn 'Regulator of G-protein signalling 14 GoLoco motif peptide' 4093.621  2   ? ? ?            ? 
3 non-polymer syn 'MAGNESIUM ION'                                             24.305    2   ? ? ?            ? 
4 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE"                                  443.201   2   ? ? ?            ? 
5 water       nat water                                                       18.015    286 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Adenylate cyclase-inhibiting G alpha protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFV
LAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHF
TFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLN
KKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK
DCGLF
;
;GAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFV
LAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHF
TFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLN
KKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK
DCGLF
;
A,C ? 
2 'polypeptide(L)' no no DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   ARG n 
1 4   GLU n 
1 5   VAL n 
1 6   LYS n 
1 7   LEU n 
1 8   LEU n 
1 9   LEU n 
1 10  LEU n 
1 11  GLY n 
1 12  ALA n 
1 13  GLY n 
1 14  GLU n 
1 15  SER n 
1 16  GLY n 
1 17  LYS n 
1 18  SER n 
1 19  THR n 
1 20  ILE n 
1 21  VAL n 
1 22  LYS n 
1 23  GLN n 
1 24  MET n 
1 25  LYS n 
1 26  ILE n 
1 27  ILE n 
1 28  HIS n 
1 29  GLU n 
1 30  ALA n 
1 31  GLY n 
1 32  TYR n 
1 33  SER n 
1 34  GLU n 
1 35  GLU n 
1 36  GLU n 
1 37  CYS n 
1 38  LYS n 
1 39  GLN n 
1 40  TYR n 
1 41  LYS n 
1 42  ALA n 
1 43  VAL n 
1 44  VAL n 
1 45  TYR n 
1 46  SER n 
1 47  ASN n 
1 48  THR n 
1 49  ILE n 
1 50  GLN n 
1 51  SER n 
1 52  ILE n 
1 53  ILE n 
1 54  ALA n 
1 55  ILE n 
1 56  ILE n 
1 57  ARG n 
1 58  ALA n 
1 59  MET n 
1 60  GLY n 
1 61  ARG n 
1 62  LEU n 
1 63  LYS n 
1 64  ILE n 
1 65  ASP n 
1 66  PHE n 
1 67  GLY n 
1 68  ASP n 
1 69  SER n 
1 70  ALA n 
1 71  ARG n 
1 72  ALA n 
1 73  ASP n 
1 74  ASP n 
1 75  ALA n 
1 76  ARG n 
1 77  GLN n 
1 78  LEU n 
1 79  PHE n 
1 80  VAL n 
1 81  LEU n 
1 82  ALA n 
1 83  GLY n 
1 84  ALA n 
1 85  ALA n 
1 86  GLU n 
1 87  GLU n 
1 88  GLY n 
1 89  PHE n 
1 90  MET n 
1 91  THR n 
1 92  ALA n 
1 93  GLU n 
1 94  LEU n 
1 95  ALA n 
1 96  GLY n 
1 97  VAL n 
1 98  ILE n 
1 99  LYS n 
1 100 ARG n 
1 101 LEU n 
1 102 TRP n 
1 103 LYS n 
1 104 ASP n 
1 105 SER n 
1 106 GLY n 
1 107 VAL n 
1 108 GLN n 
1 109 ALA n 
1 110 CYS n 
1 111 PHE n 
1 112 ASN n 
1 113 ARG n 
1 114 SER n 
1 115 ARG n 
1 116 GLU n 
1 117 TYR n 
1 118 GLN n 
1 119 LEU n 
1 120 ASN n 
1 121 ASP n 
1 122 SER n 
1 123 ALA n 
1 124 ALA n 
1 125 TYR n 
1 126 TYR n 
1 127 LEU n 
1 128 ASN n 
1 129 ASP n 
1 130 LEU n 
1 131 ASP n 
1 132 ARG n 
1 133 ILE n 
1 134 ALA n 
1 135 GLN n 
1 136 PRO n 
1 137 ASN n 
1 138 TYR n 
1 139 ILE n 
1 140 PRO n 
1 141 THR n 
1 142 GLN n 
1 143 GLN n 
1 144 ASP n 
1 145 VAL n 
1 146 LEU n 
1 147 ARG n 
1 148 THR n 
1 149 ARG n 
1 150 VAL n 
1 151 LYS n 
1 152 THR n 
1 153 THR n 
1 154 GLY n 
1 155 ILE n 
1 156 VAL n 
1 157 GLU n 
1 158 THR n 
1 159 HIS n 
1 160 PHE n 
1 161 THR n 
1 162 PHE n 
1 163 LYS n 
1 164 ASP n 
1 165 LEU n 
1 166 HIS n 
1 167 PHE n 
1 168 LYS n 
1 169 MET n 
1 170 PHE n 
1 171 ASP n 
1 172 VAL n 
1 173 GLY n 
1 174 GLY n 
1 175 GLN n 
1 176 ARG n 
1 177 SER n 
1 178 GLU n 
1 179 ARG n 
1 180 LYS n 
1 181 LYS n 
1 182 TRP n 
1 183 ILE n 
1 184 HIS n 
1 185 CYS n 
1 186 PHE n 
1 187 GLU n 
1 188 GLY n 
1 189 VAL n 
1 190 THR n 
1 191 ALA n 
1 192 ILE n 
1 193 ILE n 
1 194 PHE n 
1 195 CYS n 
1 196 VAL n 
1 197 ALA n 
1 198 LEU n 
1 199 SER n 
1 200 ASP n 
1 201 TYR n 
1 202 ASP n 
1 203 LEU n 
1 204 VAL n 
1 205 LEU n 
1 206 ALA n 
1 207 GLU n 
1 208 ASP n 
1 209 GLU n 
1 210 GLU n 
1 211 MET n 
1 212 ASN n 
1 213 ARG n 
1 214 MET n 
1 215 HIS n 
1 216 GLU n 
1 217 SER n 
1 218 MET n 
1 219 LYS n 
1 220 LEU n 
1 221 PHE n 
1 222 ASP n 
1 223 SER n 
1 224 ILE n 
1 225 CYS n 
1 226 ASN n 
1 227 ASN n 
1 228 LYS n 
1 229 TRP n 
1 230 PHE n 
1 231 THR n 
1 232 ASP n 
1 233 THR n 
1 234 SER n 
1 235 ILE n 
1 236 ILE n 
1 237 LEU n 
1 238 PHE n 
1 239 LEU n 
1 240 ASN n 
1 241 LYS n 
1 242 LYS n 
1 243 ASP n 
1 244 LEU n 
1 245 PHE n 
1 246 GLU n 
1 247 GLU n 
1 248 LYS n 
1 249 ILE n 
1 250 LYS n 
1 251 LYS n 
1 252 SER n 
1 253 PRO n 
1 254 LEU n 
1 255 THR n 
1 256 ILE n 
1 257 CYS n 
1 258 TYR n 
1 259 PRO n 
1 260 GLU n 
1 261 TYR n 
1 262 ALA n 
1 263 GLY n 
1 264 SER n 
1 265 ASN n 
1 266 THR n 
1 267 TYR n 
1 268 GLU n 
1 269 GLU n 
1 270 ALA n 
1 271 ALA n 
1 272 ALA n 
1 273 TYR n 
1 274 ILE n 
1 275 GLN n 
1 276 CYS n 
1 277 GLN n 
1 278 PHE n 
1 279 GLU n 
1 280 ASP n 
1 281 LEU n 
1 282 ASN n 
1 283 LYS n 
1 284 ARG n 
1 285 LYS n 
1 286 ASP n 
1 287 THR n 
1 288 LYS n 
1 289 GLU n 
1 290 ILE n 
1 291 TYR n 
1 292 THR n 
1 293 HIS n 
1 294 PHE n 
1 295 THR n 
1 296 CYS n 
1 297 ALA n 
1 298 THR n 
1 299 ASP n 
1 300 THR n 
1 301 LYS n 
1 302 ASN n 
1 303 VAL n 
1 304 GLN n 
1 305 PHE n 
1 306 VAL n 
1 307 PHE n 
1 308 ASP n 
1 309 ALA n 
1 310 VAL n 
1 311 THR n 
1 312 ASP n 
1 313 VAL n 
1 314 ILE n 
1 315 ILE n 
1 316 LYS n 
1 317 ASN n 
1 318 ASN n 
1 319 LEU n 
1 320 LYS n 
1 321 ASP n 
1 322 CYS n 
1 323 GLY n 
1 324 LEU n 
1 325 PHE n 
2 1   ASP n 
2 2   ILE n 
2 3   GLU n 
2 4   GLY n 
2 5   LEU n 
2 6   VAL n 
2 7   GLU n 
2 8   LEU n 
2 9   LEU n 
2 10  ASN n 
2 11  ARG n 
2 12  VAL n 
2 13  GLN n 
2 14  SER n 
2 15  SER n 
2 16  GLY n 
2 17  ALA n 
2 18  HIS n 
2 19  ASP n 
2 20  GLN n 
2 21  ARG n 
2 22  GLY n 
2 23  LEU n 
2 24  LEU n 
2 25  ARG n 
2 26  LYS n 
2 27  GLU n 
2 28  ASP n 
2 29  LEU n 
2 30  VAL n 
2 31  LEU n 
2 32  PRO n 
2 33  GLU n 
2 34  PHE n 
2 35  LEU n 
2 36  GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GNAI1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pPROEX Htb' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'The peptide was chemically synthesized. The sequence occurs naturally in Homo sapiens (human).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP GNAI1_HUMAN  P63096 1 
;AREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVL
AGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFT
FKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNK
KDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKD
CGLF
;
31  ? 
2 UNP Q506M1_HUMAN Q506M1 2 DIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQ 345 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OM2 A 2 ? 325 ? P63096 31  ? 354 ? 31   354  
2 1 2OM2 C 2 ? 325 ? P63096 31  ? 354 ? 1031 1354 
3 2 2OM2 B 1 ? 36  ? Q506M1 345 ? 380 ? 496  531  
4 2 2OM2 D 1 ? 36  ? Q506M1 345 ? 380 ? 1496 1531 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OM2 GLY A 1 ? UNP P63096 ? ? 'CLONING ARTIFACT' 30   1 
2 2OM2 GLY C 1 ? UNP P63096 ? ? 'CLONING ARTIFACT' 1030 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GDP 'RNA linking'       n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2OM2 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.26 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.21 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'1.55M Ammonium Sulfate, 100 mM Sodium Acetate pH 5.0, 10% Glycerol, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-02-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
# 
_reflns.entry_id                     2OM2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             20 
_reflns.number_all                   55498 
_reflns.number_obs                   55436 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 2OM2 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             20.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.900 
_refine.ls_number_reflns_obs                     55436 
_refine.ls_R_factor_R_work                       0.227 
_refine.ls_R_factor_R_free                       0.26 
_refine.ls_percent_reflns_R_free                 10.100 
_refine.ls_number_reflns_R_free                  5627 
_refine.B_iso_mean                               41.252 
_refine.solvent_model_param_bsol                 44.552 
_refine.aniso_B[1][1]                            3.569 
_refine.aniso_B[2][2]                            -2.612 
_refine.aniso_B[3][3]                            -0.956 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1KJY' 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5695 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         58 
_refine_hist.number_atoms_solvent             286 
_refine_hist.number_atoms_total               6039 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d     ? 0.006 ?     ? 'X-RAY DIFFRACTION' ? 
c_angle_deg  ? 1.130 ?     ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  ? 1.577 1.500 ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  ? 2.150 2.000 ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it ? 2.636 2.000 ? 'X-RAY DIFFRACTION' ? 
c_scangle_it ? 3.161 2.500 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 ion.param         ion.top     'X-RAY DIFFRACTION' 
4 gdp.param         gdp.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OM2 
_struct.title                     'Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14' 
_struct.pdbx_descriptor           
'Guanine nucleotide-binding protein G(i), alpha-1 subunit, Regulator of G-protein signalling 14 GoLoco motif peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OM2 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'Arginine finger, RGS14 GoLoco, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 16  ? GLU A 29  ? GLY A 45   GLU A 58   1 ? 14 
HELX_P HELX_P2  2  SER A 33  ? GLN A 39  ? SER A 62   GLN A 68   1 ? 7  
HELX_P HELX_P3  3  TYR A 40  ? LEU A 62  ? TYR A 69   LEU A 91   1 ? 23 
HELX_P HELX_P4  4  ALA A 70  ? ALA A 85  ? ALA A 99   ALA A 114  1 ? 16 
HELX_P HELX_P5  5  THR A 91  ? ASP A 104 ? THR A 120  ASP A 133  1 ? 14 
HELX_P HELX_P6  6  ASP A 104 ? ASN A 112 ? ASP A 133  ASN A 141  1 ? 9  
HELX_P HELX_P7  7  ARG A 113 ? TYR A 117 ? ARG A 142  TYR A 146  5 ? 5  
HELX_P HELX_P8  8  SER A 122 ? ASP A 129 ? SER A 151  ASP A 158  1 ? 8  
HELX_P HELX_P9  9  ASP A 129 ? GLN A 135 ? ASP A 158  GLN A 164  1 ? 7  
HELX_P HELX_P10 10 THR A 141 ? THR A 148 ? THR A 170  THR A 177  1 ? 8  
HELX_P HELX_P11 11 GLU A 178 ? GLU A 187 ? GLU A 207  GLU A 216  1 ? 10 
HELX_P HELX_P12 12 SER A 199 ? LEU A 203 ? SER A 228  LEU A 232  5 ? 5  
HELX_P HELX_P13 13 ASN A 212 ? ASN A 227 ? ASN A 241  ASN A 256  1 ? 16 
HELX_P HELX_P14 14 LYS A 228 ? THR A 231 ? LYS A 257  THR A 260  5 ? 4  
HELX_P HELX_P15 15 LYS A 241 ? ILE A 249 ? LYS A 270  ILE A 278  1 ? 9  
HELX_P HELX_P16 16 PRO A 253 ? CYS A 257 ? PRO A 282  CYS A 286  5 ? 5  
HELX_P HELX_P17 17 THR A 266 ? ASP A 280 ? THR A 295  ASP A 309  1 ? 15 
HELX_P HELX_P18 18 ASP A 299 ? ASN A 318 ? ASP A 328  ASN A 347  1 ? 20 
HELX_P HELX_P19 19 ILE B 2   ? SER B 14  ? ILE B 497  SER B 509  1 ? 13 
HELX_P HELX_P20 20 PRO B 32  ? GLN B 36  ? PRO B 527  GLN B 531  5 ? 5  
HELX_P HELX_P21 21 SER C 18  ? GLU C 29  ? SER C 1047 GLU C 1058 1 ? 12 
HELX_P HELX_P22 22 SER C 33  ? TYR C 40  ? SER C 1062 TYR C 1069 1 ? 8  
HELX_P HELX_P23 23 TYR C 40  ? LEU C 62  ? TYR C 1069 LEU C 1091 1 ? 23 
HELX_P HELX_P24 24 ALA C 70  ? ALA C 85  ? ALA C 1099 ALA C 1114 1 ? 16 
HELX_P HELX_P25 25 THR C 91  ? ASP C 104 ? THR C 1120 ASP C 1133 1 ? 14 
HELX_P HELX_P26 26 ASP C 104 ? ASN C 112 ? ASP C 1133 ASN C 1141 1 ? 9  
HELX_P HELX_P27 27 ARG C 113 ? TYR C 117 ? ARG C 1142 TYR C 1146 5 ? 5  
HELX_P HELX_P28 28 SER C 122 ? ASN C 128 ? SER C 1151 ASN C 1157 1 ? 7  
HELX_P HELX_P29 29 ASP C 129 ? ALA C 134 ? ASP C 1158 ALA C 1163 1 ? 6  
HELX_P HELX_P30 30 THR C 141 ? ARG C 147 ? THR C 1170 ARG C 1176 1 ? 7  
HELX_P HELX_P31 31 GLU C 178 ? GLU C 187 ? GLU C 1207 GLU C 1216 1 ? 10 
HELX_P HELX_P32 32 LEU C 198 ? LEU C 203 ? LEU C 1227 LEU C 1232 5 ? 6  
HELX_P HELX_P33 33 ASN C 212 ? ASN C 227 ? ASN C 1241 ASN C 1256 1 ? 16 
HELX_P HELX_P34 34 LYS C 228 ? THR C 231 ? LYS C 1257 THR C 1260 5 ? 4  
HELX_P HELX_P35 35 LYS C 241 ? ILE C 249 ? LYS C 1270 ILE C 1278 1 ? 9  
HELX_P HELX_P36 36 PRO C 253 ? CYS C 257 ? PRO C 1282 CYS C 1286 5 ? 5  
HELX_P HELX_P37 37 THR C 266 ? ASP C 280 ? THR C 1295 ASP C 1309 1 ? 15 
HELX_P HELX_P38 38 ASP C 299 ? ASN C 317 ? ASP C 1328 ASN C 1346 1 ? 19 
HELX_P HELX_P39 39 ASP D 1   ? SER D 15  ? ASP D 1496 SER D 1510 1 ? 15 
HELX_P HELX_P40 40 ARG D 25  ? VAL D 30  ? ARG D 1520 VAL D 1525 5 ? 6  
HELX_P HELX_P41 41 PRO D 32  ? GLN D 36  ? PRO D 1527 GLN D 1531 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E MG . MG ? ? ? 1_555 F GDP .   O2B ? ? A MG 800 A GDP 355  1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc2 metalc ? ? E MG . MG ? ? ? 1_555 J HOH .   O   ? ? A MG 800 B HOH 4158 1_555 ? ? ? ? ? ? ? 2.995 ? 
metalc3 metalc ? ? E MG . MG ? ? ? 1_555 I HOH .   O   ? ? A MG 800 A HOH 4062 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc4 metalc ? ? G MG . MG ? ? ? 1_555 H GDP .   O1B ? ? C MG 801 C GDP 356  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc5 metalc ? ? G MG . MG ? ? ? 1_555 C ASP 171 OD2 ? ? C MG 801 C ASP 1200 1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc6 metalc ? ? G MG . MG ? ? ? 1_555 C LYS 17  O   ? ? C MG 801 C LYS 1046 1_555 ? ? ? ? ? ? ? 2.507 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 156 ? THR A 161 ? VAL A 185  THR A 190  
A 2 HIS A 166 ? ASP A 171 ? HIS A 195  ASP A 200  
A 3 GLU A 4   ? GLY A 11  ? GLU A 33   GLY A 40   
A 4 ALA A 191 ? ALA A 197 ? ALA A 220  ALA A 226  
A 5 SER A 234 ? ASN A 240 ? SER A 263  ASN A 269  
A 6 ILE A 290 ? PHE A 294 ? ILE A 319  PHE A 323  
B 1 VAL C 156 ? PHE C 162 ? VAL C 1185 PHE C 1191 
B 2 LEU C 165 ? ASP C 171 ? LEU C 1194 ASP C 1200 
B 3 GLU C 4   ? LEU C 10  ? GLU C 1033 LEU C 1039 
B 4 ALA C 191 ? VAL C 196 ? ALA C 1220 VAL C 1225 
B 5 SER C 234 ? LEU C 239 ? SER C 1263 LEU C 1268 
B 6 ILE C 290 ? PHE C 294 ? ILE C 1319 PHE C 1323 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 156 ? N VAL A 185  O ASP A 171 ? O ASP A 200  
A 2 3 O PHE A 170 ? O PHE A 199  N LEU A 7   ? N LEU A 36   
A 3 4 N LEU A 10  ? N LEU A 39   O CYS A 195 ? O CYS A 224  
A 4 5 N ILE A 192 ? N ILE A 221  O ILE A 236 ? O ILE A 265  
A 5 6 N LEU A 237 ? N LEU A 266  O TYR A 291 ? O TYR A 320  
B 1 2 N PHE C 160 ? N PHE C 1189 O PHE C 167 ? O PHE C 1196 
B 2 3 O LYS C 168 ? O LYS C 1197 N LEU C 7   ? N LEU C 1036 
B 3 4 N LEU C 10  ? N LEU C 1039 O CYS C 195 ? O CYS C 1224 
B 4 5 N ILE C 192 ? N ILE C 1221 O ILE C 236 ? O ILE C 1265 
B 5 6 N LEU C 239 ? N LEU C 1268 O HIS C 293 ? O HIS C 1322 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG A 800'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG C 801'  
AC3 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE GDP A 355' 
AC4 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE GDP C 356' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  GDP F .   ? GDP A 355  . ? 1_555 ? 
2  AC1 3  HOH I .   ? HOH A 4062 . ? 1_555 ? 
3  AC1 3  HOH J .   ? HOH B 4158 . ? 1_555 ? 
4  AC2 4  GDP H .   ? GDP C 356  . ? 1_555 ? 
5  AC2 4  LYS C 17  ? LYS C 1046 . ? 1_555 ? 
6  AC2 4  ASP C 171 ? ASP C 1200 . ? 1_555 ? 
7  AC2 4  GLY C 173 ? GLY C 1202 . ? 1_555 ? 
8  AC3 23 ALA A 12  ? ALA A 41   . ? 1_555 ? 
9  AC3 23 GLU A 14  ? GLU A 43   . ? 1_555 ? 
10 AC3 23 SER A 15  ? SER A 44   . ? 1_555 ? 
11 AC3 23 GLY A 16  ? GLY A 45   . ? 1_555 ? 
12 AC3 23 LYS A 17  ? LYS A 46   . ? 1_555 ? 
13 AC3 23 SER A 18  ? SER A 47   . ? 1_555 ? 
14 AC3 23 THR A 19  ? THR A 48   . ? 1_555 ? 
15 AC3 23 ASP A 121 ? ASP A 150  . ? 1_555 ? 
16 AC3 23 SER A 122 ? SER A 151  . ? 1_555 ? 
17 AC3 23 ARG A 147 ? ARG A 176  . ? 1_555 ? 
18 AC3 23 ARG A 149 ? ARG A 178  . ? 1_555 ? 
19 AC3 23 ASN A 240 ? ASN A 269  . ? 1_555 ? 
20 AC3 23 LYS A 241 ? LYS A 270  . ? 1_555 ? 
21 AC3 23 ASP A 243 ? ASP A 272  . ? 1_555 ? 
22 AC3 23 LEU A 244 ? LEU A 273  . ? 1_555 ? 
23 AC3 23 CYS A 296 ? CYS A 325  . ? 1_555 ? 
24 AC3 23 ALA A 297 ? ALA A 326  . ? 1_555 ? 
25 AC3 23 THR A 298 ? THR A 327  . ? 1_555 ? 
26 AC3 23 MG  E .   ? MG  A 800  . ? 1_555 ? 
27 AC3 23 HOH I .   ? HOH A 4032 . ? 1_555 ? 
28 AC3 23 HOH I .   ? HOH A 4089 . ? 1_555 ? 
29 AC3 23 HOH I .   ? HOH A 4120 . ? 1_555 ? 
30 AC3 23 ARG B 21  ? ARG B 516  . ? 1_555 ? 
31 AC4 24 MG  G .   ? MG  C 801  . ? 1_555 ? 
32 AC4 24 ALA C 12  ? ALA C 1041 . ? 1_555 ? 
33 AC4 24 GLY C 13  ? GLY C 1042 . ? 1_555 ? 
34 AC4 24 GLU C 14  ? GLU C 1043 . ? 1_555 ? 
35 AC4 24 SER C 15  ? SER C 1044 . ? 1_555 ? 
36 AC4 24 GLY C 16  ? GLY C 1045 . ? 1_555 ? 
37 AC4 24 LYS C 17  ? LYS C 1046 . ? 1_555 ? 
38 AC4 24 SER C 18  ? SER C 1047 . ? 1_555 ? 
39 AC4 24 THR C 19  ? THR C 1048 . ? 1_555 ? 
40 AC4 24 ASP C 121 ? ASP C 1150 . ? 1_555 ? 
41 AC4 24 SER C 122 ? SER C 1151 . ? 1_555 ? 
42 AC4 24 ARG C 147 ? ARG C 1176 . ? 1_555 ? 
43 AC4 24 ARG C 149 ? ARG C 1178 . ? 1_555 ? 
44 AC4 24 ASN C 240 ? ASN C 1269 . ? 1_555 ? 
45 AC4 24 LYS C 241 ? LYS C 1270 . ? 1_555 ? 
46 AC4 24 ASP C 243 ? ASP C 1272 . ? 1_555 ? 
47 AC4 24 LEU C 244 ? LEU C 1273 . ? 1_555 ? 
48 AC4 24 CYS C 296 ? CYS C 1325 . ? 1_555 ? 
49 AC4 24 ALA C 297 ? ALA C 1326 . ? 1_555 ? 
50 AC4 24 THR C 298 ? THR C 1327 . ? 1_555 ? 
51 AC4 24 HOH K .   ? HOH C 4086 . ? 1_555 ? 
52 AC4 24 HOH K .   ? HOH C 4087 . ? 1_555 ? 
53 AC4 24 HOH K .   ? HOH C 4108 . ? 1_555 ? 
54 AC4 24 ARG D 21  ? ARG D 1516 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OM2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    2OM2 
_atom_sites.fract_transf_matrix[1][1]   0.014369 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012149 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005331 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 19.470  38.543  3.376  1.00 75.52 ? 30   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 20.145  38.422  4.703  1.00 75.35 ? 30   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 20.113  37.004  5.243  1.00 74.79 ? 30   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 19.120  36.291  5.078  1.00 75.31 ? 30   GLY A O     1 
ATOM   5    N  N     . ALA A 1 2   ? 21.201  36.595  5.892  1.00 73.44 ? 31   ALA A N     1 
ATOM   6    C  CA    . ALA A 1 2   ? 21.303  35.254  6.459  1.00 71.87 ? 31   ALA A CA    1 
ATOM   7    C  C     . ALA A 1 2   ? 20.352  35.095  7.639  1.00 70.64 ? 31   ALA A C     1 
ATOM   8    O  O     . ALA A 1 2   ? 20.735  35.297  8.795  1.00 70.68 ? 31   ALA A O     1 
ATOM   9    C  CB    . ALA A 1 2   ? 22.738  34.981  6.901  1.00 71.61 ? 31   ALA A CB    1 
ATOM   10   N  N     . ARG A 1 3   ? 19.107  34.734  7.340  1.00 68.69 ? 32   ARG A N     1 
ATOM   11   C  CA    . ARG A 1 3   ? 18.103  34.548  8.379  1.00 65.42 ? 32   ARG A CA    1 
ATOM   12   C  C     . ARG A 1 3   ? 18.494  33.375  9.266  1.00 61.77 ? 32   ARG A C     1 
ATOM   13   O  O     . ARG A 1 3   ? 19.349  32.564  8.903  1.00 60.18 ? 32   ARG A O     1 
ATOM   14   C  CB    . ARG A 1 3   ? 16.721  34.279  7.764  1.00 67.35 ? 32   ARG A CB    1 
ATOM   15   C  CG    . ARG A 1 3   ? 16.640  34.424  6.247  1.00 70.69 ? 32   ARG A CG    1 
ATOM   16   C  CD    . ARG A 1 3   ? 16.583  33.066  5.542  1.00 73.49 ? 32   ARG A CD    1 
ATOM   17   N  NE    . ARG A 1 3   ? 15.407  32.281  5.927  1.00 75.02 ? 32   ARG A NE    1 
ATOM   18   C  CZ    . ARG A 1 3   ? 15.059  31.122  5.369  1.00 76.14 ? 32   ARG A CZ    1 
ATOM   19   N  NH1   . ARG A 1 3   ? 15.793  30.600  4.394  1.00 76.70 ? 32   ARG A NH1   1 
ATOM   20   N  NH2   . ARG A 1 3   ? 13.974  30.480  5.788  1.00 75.83 ? 32   ARG A NH2   1 
ATOM   21   N  N     . GLU A 1 4   ? 17.874  33.296  10.438 1.00 57.69 ? 33   GLU A N     1 
ATOM   22   C  CA    . GLU A 1 4   ? 18.150  32.199  11.347 1.00 53.51 ? 33   GLU A CA    1 
ATOM   23   C  C     . GLU A 1 4   ? 17.199  31.055  11.020 1.00 50.22 ? 33   GLU A C     1 
ATOM   24   O  O     . GLU A 1 4   ? 16.028  31.276  10.713 1.00 47.64 ? 33   GLU A O     1 
ATOM   25   C  CB    . GLU A 1 4   ? 17.943  32.613  12.809 1.00 53.81 ? 33   GLU A CB    1 
ATOM   26   C  CG    . GLU A 1 4   ? 18.292  31.490  13.785 1.00 55.30 ? 33   GLU A CG    1 
ATOM   27   C  CD    . GLU A 1 4   ? 17.738  31.700  15.183 1.00 55.52 ? 33   GLU A CD    1 
ATOM   28   O  OE1   . GLU A 1 4   ? 18.115  32.694  15.840 1.00 55.64 ? 33   GLU A OE1   1 
ATOM   29   O  OE2   . GLU A 1 4   ? 16.927  30.858  15.626 1.00 54.22 ? 33   GLU A OE2   1 
ATOM   30   N  N     . VAL A 1 5   ? 17.721  29.836  11.077 1.00 47.24 ? 34   VAL A N     1 
ATOM   31   C  CA    . VAL A 1 5   ? 16.931  28.641  10.823 1.00 43.75 ? 34   VAL A CA    1 
ATOM   32   C  C     . VAL A 1 5   ? 17.017  27.797  12.087 1.00 41.07 ? 34   VAL A C     1 
ATOM   33   O  O     . VAL A 1 5   ? 18.041  27.169  12.362 1.00 38.69 ? 34   VAL A O     1 
ATOM   34   C  CB    . VAL A 1 5   ? 17.486  27.836  9.626  1.00 44.50 ? 34   VAL A CB    1 
ATOM   35   C  CG1   . VAL A 1 5   ? 16.680  26.562  9.435  1.00 44.42 ? 34   VAL A CG1   1 
ATOM   36   C  CG2   . VAL A 1 5   ? 17.434  28.679  8.369  1.00 43.83 ? 34   VAL A CG2   1 
ATOM   37   N  N     . LYS A 1 6   ? 15.945  27.811  12.868 1.00 39.18 ? 35   LYS A N     1 
ATOM   38   C  CA    . LYS A 1 6   ? 15.905  27.050  14.107 1.00 37.95 ? 35   LYS A CA    1 
ATOM   39   C  C     . LYS A 1 6   ? 15.335  25.661  13.824 1.00 36.33 ? 35   LYS A C     1 
ATOM   40   O  O     . LYS A 1 6   ? 14.182  25.517  13.418 1.00 36.64 ? 35   LYS A O     1 
ATOM   41   C  CB    . LYS A 1 6   ? 15.051  27.783  15.142 1.00 36.10 ? 35   LYS A CB    1 
ATOM   42   C  CG    . LYS A 1 6   ? 15.081  27.172  16.525 1.00 37.56 ? 35   LYS A CG    1 
ATOM   43   C  CD    . LYS A 1 6   ? 14.261  27.996  17.511 1.00 38.82 ? 35   LYS A CD    1 
ATOM   44   C  CE    . LYS A 1 6   ? 14.254  27.351  18.892 1.00 39.00 ? 35   LYS A CE    1 
ATOM   45   N  NZ    . LYS A 1 6   ? 13.472  28.132  19.896 1.00 40.24 ? 35   LYS A NZ    1 
ATOM   46   N  N     . LEU A 1 7   ? 16.166  24.647  14.031 1.00 36.42 ? 36   LEU A N     1 
ATOM   47   C  CA    . LEU A 1 7   ? 15.787  23.258  13.794 1.00 34.61 ? 36   LEU A CA    1 
ATOM   48   C  C     . LEU A 1 7   ? 15.639  22.485  15.097 1.00 32.60 ? 36   LEU A C     1 
ATOM   49   O  O     . LEU A 1 7   ? 16.553  22.453  15.919 1.00 31.00 ? 36   LEU A O     1 
ATOM   50   C  CB    . LEU A 1 7   ? 16.845  22.576  12.921 1.00 36.20 ? 36   LEU A CB    1 
ATOM   51   C  CG    . LEU A 1 7   ? 16.481  22.199  11.482 1.00 38.22 ? 36   LEU A CG    1 
ATOM   52   C  CD1   . LEU A 1 7   ? 15.978  23.415  10.716 1.00 39.91 ? 36   LEU A CD1   1 
ATOM   53   C  CD2   . LEU A 1 7   ? 17.708  21.610  10.809 1.00 37.89 ? 36   LEU A CD2   1 
ATOM   54   N  N     . LEU A 1 8   ? 14.484  21.859  15.280 1.00 30.68 ? 37   LEU A N     1 
ATOM   55   C  CA    . LEU A 1 8   ? 14.239  21.077  16.480 1.00 30.62 ? 37   LEU A CA    1 
ATOM   56   C  C     . LEU A 1 8   ? 14.136  19.577  16.168 1.00 29.36 ? 37   LEU A C     1 
ATOM   57   O  O     . LEU A 1 8   ? 13.306  19.146  15.362 1.00 28.25 ? 37   LEU A O     1 
ATOM   58   C  CB    . LEU A 1 8   ? 12.959  21.565  17.162 1.00 30.90 ? 37   LEU A CB    1 
ATOM   59   C  CG    . LEU A 1 8   ? 12.588  20.929  18.500 1.00 33.02 ? 37   LEU A CG    1 
ATOM   60   C  CD1   . LEU A 1 8   ? 13.806  20.866  19.414 1.00 33.99 ? 37   LEU A CD1   1 
ATOM   61   C  CD2   . LEU A 1 8   ? 11.474  21.746  19.141 1.00 34.96 ? 37   LEU A CD2   1 
ATOM   62   N  N     . LEU A 1 9   ? 15.008  18.790  16.785 1.00 27.49 ? 38   LEU A N     1 
ATOM   63   C  CA    . LEU A 1 9   ? 14.987  17.346  16.597 1.00 27.21 ? 38   LEU A CA    1 
ATOM   64   C  C     . LEU A 1 9   ? 14.088  16.794  17.687 1.00 27.69 ? 38   LEU A C     1 
ATOM   65   O  O     . LEU A 1 9   ? 14.250  17.136  18.861 1.00 30.37 ? 38   LEU A O     1 
ATOM   66   C  CB    . LEU A 1 9   ? 16.386  16.750  16.749 1.00 26.42 ? 38   LEU A CB    1 
ATOM   67   C  CG    . LEU A 1 9   ? 17.453  17.061  15.700 1.00 27.50 ? 38   LEU A CG    1 
ATOM   68   C  CD1   . LEU A 1 9   ? 18.822  16.735  16.271 1.00 26.31 ? 38   LEU A CD1   1 
ATOM   69   C  CD2   . LEU A 1 9   ? 17.198  16.269  14.426 1.00 27.92 ? 38   LEU A CD2   1 
ATOM   70   N  N     . LEU A 1 10  ? 13.121  15.971  17.300 1.00 26.22 ? 39   LEU A N     1 
ATOM   71   C  CA    . LEU A 1 10  ? 12.210  15.352  18.256 1.00 24.98 ? 39   LEU A CA    1 
ATOM   72   C  C     . LEU A 1 10  ? 12.157  13.864  17.941 1.00 24.53 ? 39   LEU A C     1 
ATOM   73   O  O     . LEU A 1 10  ? 12.532  13.440  16.844 1.00 24.20 ? 39   LEU A O     1 
ATOM   74   C  CB    . LEU A 1 10  ? 10.803  15.960  18.155 1.00 25.72 ? 39   LEU A CB    1 
ATOM   75   C  CG    . LEU A 1 10  ? 10.623  17.461  18.459 1.00 29.64 ? 39   LEU A CG    1 
ATOM   76   C  CD1   . LEU A 1 10  ? 9.161   17.849  18.223 1.00 27.81 ? 39   LEU A CD1   1 
ATOM   77   C  CD2   . LEU A 1 10  ? 11.029  17.773  19.902 1.00 26.79 ? 39   LEU A CD2   1 
ATOM   78   N  N     . GLY A 1 11  ? 11.702  13.070  18.901 1.00 24.17 ? 40   GLY A N     1 
ATOM   79   C  CA    . GLY A 1 11  ? 11.615  11.637  18.688 1.00 23.60 ? 40   GLY A CA    1 
ATOM   80   C  C     . GLY A 1 11  ? 11.961  10.864  19.944 1.00 24.65 ? 40   GLY A C     1 
ATOM   81   O  O     . GLY A 1 11  ? 12.567  11.414  20.869 1.00 24.09 ? 40   GLY A O     1 
ATOM   82   N  N     . ALA A 1 12  ? 11.576  9.591   19.973 1.00 23.64 ? 41   ALA A N     1 
ATOM   83   C  CA    . ALA A 1 12  ? 11.837  8.722   21.117 1.00 20.66 ? 41   ALA A CA    1 
ATOM   84   C  C     . ALA A 1 12  ? 13.319  8.540   21.392 1.00 21.57 ? 41   ALA A C     1 
ATOM   85   O  O     . ALA A 1 12  ? 14.171  8.772   20.525 1.00 19.35 ? 41   ALA A O     1 
ATOM   86   C  CB    . ALA A 1 12  ? 11.195  7.351   20.891 1.00 19.41 ? 41   ALA A CB    1 
ATOM   87   N  N     . GLY A 1 13  ? 13.629  8.119   22.614 1.00 22.50 ? 42   GLY A N     1 
ATOM   88   C  CA    . GLY A 1 13  ? 15.019  7.883   22.954 1.00 20.01 ? 42   GLY A CA    1 
ATOM   89   C  C     . GLY A 1 13  ? 15.545  6.793   22.033 1.00 21.66 ? 42   GLY A C     1 
ATOM   90   O  O     . GLY A 1 13  ? 14.805  5.875   21.665 1.00 20.87 ? 42   GLY A O     1 
ATOM   91   N  N     . GLU A 1 14  ? 16.813  6.915   21.651 1.00 20.95 ? 43   GLU A N     1 
ATOM   92   C  CA    . GLU A 1 14  ? 17.488  5.961   20.781 1.00 23.04 ? 43   GLU A CA    1 
ATOM   93   C  C     . GLU A 1 14  ? 17.043  6.019   19.315 1.00 23.90 ? 43   GLU A C     1 
ATOM   94   O  O     . GLU A 1 14  ? 17.388  5.137   18.529 1.00 25.55 ? 43   GLU A O     1 
ATOM   95   C  CB    . GLU A 1 14  ? 17.315  4.529   21.329 1.00 24.00 ? 43   GLU A CB    1 
ATOM   96   C  CG    . GLU A 1 14  ? 17.790  4.356   22.789 1.00 25.14 ? 43   GLU A CG    1 
ATOM   97   C  CD    . GLU A 1 14  ? 19.302  4.499   22.960 1.00 27.59 ? 43   GLU A CD    1 
ATOM   98   O  OE1   . GLU A 1 14  ? 19.735  5.007   24.022 1.00 31.15 ? 43   GLU A OE1   1 
ATOM   99   O  OE2   . GLU A 1 14  ? 20.063  4.095   22.051 1.00 25.34 ? 43   GLU A OE2   1 
ATOM   100  N  N     . SER A 1 15  ? 16.308  7.064   18.940 1.00 22.84 ? 44   SER A N     1 
ATOM   101  C  CA    . SER A 1 15  ? 15.832  7.188   17.565 1.00 21.34 ? 44   SER A CA    1 
ATOM   102  C  C     . SER A 1 15  ? 16.875  7.760   16.602 1.00 21.43 ? 44   SER A C     1 
ATOM   103  O  O     . SER A 1 15  ? 16.684  7.737   15.374 1.00 18.17 ? 44   SER A O     1 
ATOM   104  C  CB    . SER A 1 15  ? 14.538  8.016   17.520 1.00 18.50 ? 44   SER A CB    1 
ATOM   105  O  OG    . SER A 1 15  ? 14.738  9.338   17.987 1.00 21.96 ? 44   SER A OG    1 
ATOM   106  N  N     . GLY A 1 16  ? 17.976  8.265   17.157 1.00 21.01 ? 45   GLY A N     1 
ATOM   107  C  CA    . GLY A 1 16  ? 19.052  8.805   16.337 1.00 20.43 ? 45   GLY A CA    1 
ATOM   108  C  C     . GLY A 1 16  ? 19.277  10.309  16.385 1.00 23.54 ? 45   GLY A C     1 
ATOM   109  O  O     . GLY A 1 16  ? 20.029  10.846  15.562 1.00 23.94 ? 45   GLY A O     1 
ATOM   110  N  N     . LYS A 1 17  ? 18.654  10.996  17.340 1.00 23.54 ? 46   LYS A N     1 
ATOM   111  C  CA    . LYS A 1 17  ? 18.805  12.452  17.444 1.00 24.71 ? 46   LYS A CA    1 
ATOM   112  C  C     . LYS A 1 17  ? 20.242  12.916  17.695 1.00 26.43 ? 46   LYS A C     1 
ATOM   113  O  O     . LYS A 1 17  ? 20.731  13.828  17.009 1.00 27.29 ? 46   LYS A O     1 
ATOM   114  C  CB    . LYS A 1 17  ? 17.884  13.000  18.536 1.00 22.75 ? 46   LYS A CB    1 
ATOM   115  C  CG    . LYS A 1 17  ? 16.405  12.732  18.273 1.00 24.72 ? 46   LYS A CG    1 
ATOM   116  C  CD    . LYS A 1 17  ? 15.521  13.366  19.334 1.00 23.65 ? 46   LYS A CD    1 
ATOM   117  C  CE    . LYS A 1 17  ? 15.867  12.860  20.729 1.00 23.14 ? 46   LYS A CE    1 
ATOM   118  N  NZ    . LYS A 1 17  ? 15.520  11.430  20.931 1.00 21.96 ? 46   LYS A NZ    1 
ATOM   119  N  N     . SER A 1 18  ? 20.915  12.298  18.667 1.00 23.77 ? 47   SER A N     1 
ATOM   120  C  CA    . SER A 1 18  ? 22.301  12.660  18.989 1.00 25.98 ? 47   SER A CA    1 
ATOM   121  C  C     . SER A 1 18  ? 23.204  12.442  17.780 1.00 25.99 ? 47   SER A C     1 
ATOM   122  O  O     . SER A 1 18  ? 24.109  13.240  17.511 1.00 26.76 ? 47   SER A O     1 
ATOM   123  C  CB    . SER A 1 18  ? 22.843  11.805  20.142 1.00 23.97 ? 47   SER A CB    1 
ATOM   124  O  OG    . SER A 1 18  ? 22.058  11.939  21.306 1.00 33.37 ? 47   SER A OG    1 
ATOM   125  N  N     . THR A 1 19  ? 22.955  11.345  17.069 1.00 24.96 ? 48   THR A N     1 
ATOM   126  C  CA    . THR A 1 19  ? 23.736  10.983  15.896 1.00 25.35 ? 48   THR A CA    1 
ATOM   127  C  C     . THR A 1 19  ? 23.616  12.022  14.787 1.00 26.51 ? 48   THR A C     1 
ATOM   128  O  O     . THR A 1 19  ? 24.609  12.371  14.155 1.00 26.51 ? 48   THR A O     1 
ATOM   129  C  CB    . THR A 1 19  ? 23.308  9.597   15.353 1.00 25.97 ? 48   THR A CB    1 
ATOM   130  O  OG1   . THR A 1 19  ? 23.510  8.614   16.376 1.00 23.88 ? 48   THR A OG1   1 
ATOM   131  C  CG2   . THR A 1 19  ? 24.136  9.212   14.119 1.00 20.52 ? 48   THR A CG2   1 
ATOM   132  N  N     . ILE A 1 20  ? 22.401  12.508  14.551 1.00 27.87 ? 49   ILE A N     1 
ATOM   133  C  CA    . ILE A 1 20  ? 22.181  13.520  13.527 1.00 28.80 ? 49   ILE A CA    1 
ATOM   134  C  C     . ILE A 1 20  ? 22.978  14.782  13.862 1.00 29.91 ? 49   ILE A C     1 
ATOM   135  O  O     . ILE A 1 20  ? 23.551  15.417  12.981 1.00 31.28 ? 49   ILE A O     1 
ATOM   136  C  CB    . ILE A 1 20  ? 20.682  13.876  13.410 1.00 28.70 ? 49   ILE A CB    1 
ATOM   137  C  CG1   . ILE A 1 20  ? 19.917  12.690  12.812 1.00 28.56 ? 49   ILE A CG1   1 
ATOM   138  C  CG2   . ILE A 1 20  ? 20.501  15.109  12.530 1.00 27.58 ? 49   ILE A CG2   1 
ATOM   139  C  CD1   . ILE A 1 20  ? 20.416  12.272  11.415 1.00 23.82 ? 49   ILE A CD1   1 
ATOM   140  N  N     . VAL A 1 21  ? 23.016  15.136  15.142 1.00 31.63 ? 50   VAL A N     1 
ATOM   141  C  CA    . VAL A 1 21  ? 23.755  16.309  15.585 1.00 31.83 ? 50   VAL A CA    1 
ATOM   142  C  C     . VAL A 1 21  ? 25.244  16.158  15.269 1.00 33.45 ? 50   VAL A C     1 
ATOM   143  O  O     . VAL A 1 21  ? 25.877  17.083  14.755 1.00 33.10 ? 50   VAL A O     1 
ATOM   144  C  CB    . VAL A 1 21  ? 23.578  16.532  17.102 1.00 32.71 ? 50   VAL A CB    1 
ATOM   145  C  CG1   . VAL A 1 21  ? 24.542  17.612  17.593 1.00 31.92 ? 50   VAL A CG1   1 
ATOM   146  C  CG2   . VAL A 1 21  ? 22.142  16.933  17.394 1.00 29.93 ? 50   VAL A CG2   1 
ATOM   147  N  N     . LYS A 1 22  ? 25.804  14.990  15.567 1.00 34.29 ? 51   LYS A N     1 
ATOM   148  C  CA    . LYS A 1 22  ? 27.219  14.756  15.300 1.00 34.63 ? 51   LYS A CA    1 
ATOM   149  C  C     . LYS A 1 22  ? 27.520  14.699  13.803 1.00 34.61 ? 51   LYS A C     1 
ATOM   150  O  O     . LYS A 1 22  ? 28.641  14.981  13.378 1.00 33.33 ? 51   LYS A O     1 
ATOM   151  C  CB    . LYS A 1 22  ? 27.684  13.471  15.991 1.00 35.20 ? 51   LYS A CB    1 
ATOM   152  C  CG    . LYS A 1 22  ? 27.705  13.592  17.509 1.00 38.65 ? 51   LYS A CG    1 
ATOM   153  C  CD    . LYS A 1 22  ? 28.283  12.357  18.195 1.00 41.83 ? 51   LYS A CD    1 
ATOM   154  C  CE    . LYS A 1 22  ? 27.315  11.188  18.187 1.00 43.38 ? 51   LYS A CE    1 
ATOM   155  N  NZ    . LYS A 1 22  ? 27.831  10.056  19.009 1.00 43.38 ? 51   LYS A NZ    1 
ATOM   156  N  N     . GLN A 1 23  ? 26.525  14.336  13.000 1.00 34.52 ? 52   GLN A N     1 
ATOM   157  C  CA    . GLN A 1 23  ? 26.736  14.280  11.561 1.00 34.44 ? 52   GLN A CA    1 
ATOM   158  C  C     . GLN A 1 23  ? 26.863  15.713  11.038 1.00 34.86 ? 52   GLN A C     1 
ATOM   159  O  O     . GLN A 1 23  ? 27.677  15.987  10.166 1.00 34.89 ? 52   GLN A O     1 
ATOM   160  C  CB    . GLN A 1 23  ? 25.581  13.539  10.876 1.00 34.20 ? 52   GLN A CB    1 
ATOM   161  C  CG    . GLN A 1 23  ? 25.573  12.024  11.131 1.00 33.17 ? 52   GLN A CG    1 
ATOM   162  C  CD    . GLN A 1 23  ? 26.643  11.273  10.340 1.00 33.31 ? 52   GLN A CD    1 
ATOM   163  O  OE1   . GLN A 1 23  ? 27.744  11.778  10.124 1.00 34.44 ? 52   GLN A OE1   1 
ATOM   164  N  NE2   . GLN A 1 23  ? 26.323  10.053  9.921  1.00 31.51 ? 52   GLN A NE2   1 
ATOM   165  N  N     . MET A 1 24  ? 26.070  16.629  11.588 1.00 35.93 ? 53   MET A N     1 
ATOM   166  C  CA    . MET A 1 24  ? 26.135  18.027  11.175 1.00 36.96 ? 53   MET A CA    1 
ATOM   167  C  C     . MET A 1 24  ? 27.541  18.560  11.427 1.00 39.90 ? 53   MET A C     1 
ATOM   168  O  O     . MET A 1 24  ? 28.110  19.272  10.596 1.00 38.52 ? 53   MET A O     1 
ATOM   169  C  CB    . MET A 1 24  ? 25.126  18.875  11.952 1.00 35.35 ? 53   MET A CB    1 
ATOM   170  C  CG    . MET A 1 24  ? 23.673  18.577  11.634 1.00 34.39 ? 53   MET A CG    1 
ATOM   171  S  SD    . MET A 1 24  ? 23.300  18.721  9.875  1.00 35.64 ? 53   MET A SD    1 
ATOM   172  C  CE    . MET A 1 24  ? 23.493  16.996  9.349  1.00 33.90 ? 53   MET A CE    1 
ATOM   173  N  N     . LYS A 1 25  ? 28.099  18.212  12.581 1.00 42.29 ? 54   LYS A N     1 
ATOM   174  C  CA    . LYS A 1 25  ? 29.443  18.647  12.931 1.00 44.60 ? 54   LYS A CA    1 
ATOM   175  C  C     . LYS A 1 25  ? 30.458  18.090  11.940 1.00 44.96 ? 54   LYS A C     1 
ATOM   176  O  O     . LYS A 1 25  ? 31.388  18.788  11.533 1.00 45.80 ? 54   LYS A O     1 
ATOM   177  C  CB    . LYS A 1 25  ? 29.799  18.188  14.345 1.00 46.17 ? 54   LYS A CB    1 
ATOM   178  C  CG    . LYS A 1 25  ? 31.234  18.492  14.749 1.00 49.28 ? 54   LYS A CG    1 
ATOM   179  C  CD    . LYS A 1 25  ? 31.501  18.069  16.185 1.00 52.75 ? 54   LYS A CD    1 
ATOM   180  C  CE    . LYS A 1 25  ? 32.915  18.429  16.619 1.00 54.99 ? 54   LYS A CE    1 
ATOM   181  N  NZ    . LYS A 1 25  ? 33.140  18.118  18.063 1.00 57.28 ? 54   LYS A NZ    1 
ATOM   182  N  N     . ILE A 1 26  ? 30.274  16.831  11.555 1.00 43.78 ? 55   ILE A N     1 
ATOM   183  C  CA    . ILE A 1 26  ? 31.175  16.176  10.611 1.00 43.75 ? 55   ILE A CA    1 
ATOM   184  C  C     . ILE A 1 26  ? 31.005  16.699  9.188  1.00 44.73 ? 55   ILE A C     1 
ATOM   185  O  O     . ILE A 1 26  ? 31.976  16.832  8.443  1.00 45.35 ? 55   ILE A O     1 
ATOM   186  C  CB    . ILE A 1 26  ? 30.935  14.651  10.587 1.00 43.56 ? 55   ILE A CB    1 
ATOM   187  C  CG1   . ILE A 1 26  ? 31.333  14.043  11.930 1.00 43.37 ? 55   ILE A CG1   1 
ATOM   188  C  CG2   . ILE A 1 26  ? 31.710  14.011  9.441  1.00 42.51 ? 55   ILE A CG2   1 
ATOM   189  C  CD1   . ILE A 1 26  ? 31.009  12.576  12.044 1.00 45.43 ? 55   ILE A CD1   1 
ATOM   190  N  N     . ILE A 1 27  ? 29.768  17.000  8.818  1.00 45.09 ? 56   ILE A N     1 
ATOM   191  C  CA    . ILE A 1 27  ? 29.470  17.469  7.473  1.00 46.61 ? 56   ILE A CA    1 
ATOM   192  C  C     . ILE A 1 27  ? 29.598  18.973  7.246  1.00 47.74 ? 56   ILE A C     1 
ATOM   193  O  O     . ILE A 1 27  ? 30.239  19.400  6.287  1.00 47.49 ? 56   ILE A O     1 
ATOM   194  C  CB    . ILE A 1 27  ? 28.049  17.029  7.054  1.00 45.17 ? 56   ILE A CB    1 
ATOM   195  C  CG1   . ILE A 1 27  ? 27.941  15.504  7.131  1.00 43.79 ? 56   ILE A CG1   1 
ATOM   196  C  CG2   . ILE A 1 27  ? 27.743  17.511  5.642  1.00 45.12 ? 56   ILE A CG2   1 
ATOM   197  C  CD1   . ILE A 1 27  ? 26.547  14.970  6.861  1.00 43.65 ? 56   ILE A CD1   1 
ATOM   198  N  N     . HIS A 1 28  ? 28.997  19.775  8.120  1.00 48.99 ? 57   HIS A N     1 
ATOM   199  C  CA    . HIS A 1 28  ? 29.033  21.225  7.956  1.00 50.22 ? 57   HIS A CA    1 
ATOM   200  C  C     . HIS A 1 28  ? 29.941  21.992  8.908  1.00 50.80 ? 57   HIS A C     1 
ATOM   201  O  O     . HIS A 1 28  ? 29.892  23.218  8.956  1.00 50.95 ? 57   HIS A O     1 
ATOM   202  C  CB    . HIS A 1 28  ? 27.613  21.788  8.045  1.00 49.67 ? 57   HIS A CB    1 
ATOM   203  C  CG    . HIS A 1 28  ? 26.684  21.233  7.012  1.00 50.87 ? 57   HIS A CG    1 
ATOM   204  N  ND1   . HIS A 1 28  ? 25.701  20.314  7.310  1.00 51.53 ? 57   HIS A ND1   1 
ATOM   205  C  CD2   . HIS A 1 28  ? 26.613  21.440  5.676  1.00 50.77 ? 57   HIS A CD2   1 
ATOM   206  C  CE1   . HIS A 1 28  ? 25.064  19.979  6.202  1.00 52.53 ? 57   HIS A CE1   1 
ATOM   207  N  NE2   . HIS A 1 28  ? 25.599  20.649  5.196  1.00 51.79 ? 57   HIS A NE2   1 
ATOM   208  N  N     . GLU A 1 29  ? 30.765  21.277  9.664  1.00 52.25 ? 58   GLU A N     1 
ATOM   209  C  CA    . GLU A 1 29  ? 31.685  21.918  10.594 1.00 52.74 ? 58   GLU A CA    1 
ATOM   210  C  C     . GLU A 1 29  ? 33.076  21.306  10.425 1.00 53.40 ? 58   GLU A C     1 
ATOM   211  O  O     . GLU A 1 29  ? 33.380  20.725  9.378  1.00 53.18 ? 58   GLU A O     1 
ATOM   212  C  CB    . GLU A 1 29  ? 31.179  21.756  12.033 1.00 53.16 ? 58   GLU A CB    1 
ATOM   213  C  CG    . GLU A 1 29  ? 29.743  22.252  12.225 1.00 53.06 ? 58   GLU A CG    1 
ATOM   214  C  CD    . GLU A 1 29  ? 29.241  22.131  13.659 1.00 53.62 ? 58   GLU A CD    1 
ATOM   215  O  OE1   . GLU A 1 29  ? 28.009  22.195  13.864 1.00 52.26 ? 58   GLU A OE1   1 
ATOM   216  O  OE2   . GLU A 1 29  ? 30.070  21.980  14.581 1.00 54.26 ? 58   GLU A OE2   1 
ATOM   217  N  N     . ALA A 1 30  ? 33.919  21.429  11.443 1.00 54.51 ? 59   ALA A N     1 
ATOM   218  C  CA    . ALA A 1 30  ? 35.278  20.895  11.361 1.00 56.50 ? 59   ALA A CA    1 
ATOM   219  C  C     . ALA A 1 30  ? 35.334  19.382  11.541 1.00 56.84 ? 59   ALA A C     1 
ATOM   220  O  O     . ALA A 1 30  ? 36.310  18.739  11.155 1.00 57.30 ? 59   ALA A O     1 
ATOM   221  C  CB    . ALA A 1 30  ? 36.175  21.576  12.400 1.00 56.92 ? 59   ALA A CB    1 
ATOM   222  N  N     . GLY A 1 31  ? 34.284  18.812  12.119 1.00 56.60 ? 60   GLY A N     1 
ATOM   223  C  CA    . GLY A 1 31  ? 34.275  17.380  12.337 1.00 57.02 ? 60   GLY A CA    1 
ATOM   224  C  C     . GLY A 1 31  ? 35.169  17.029  13.510 1.00 57.16 ? 60   GLY A C     1 
ATOM   225  O  O     . GLY A 1 31  ? 35.217  17.766  14.497 1.00 56.67 ? 60   GLY A O     1 
ATOM   226  N  N     . TYR A 1 32  ? 35.882  15.912  13.409 1.00 57.31 ? 61   TYR A N     1 
ATOM   227  C  CA    . TYR A 1 32  ? 36.764  15.487  14.489 1.00 58.12 ? 61   TYR A CA    1 
ATOM   228  C  C     . TYR A 1 32  ? 38.200  15.271  14.033 1.00 58.96 ? 61   TYR A C     1 
ATOM   229  O  O     . TYR A 1 32  ? 38.457  14.535  13.081 1.00 58.63 ? 61   TYR A O     1 
ATOM   230  C  CB    . TYR A 1 32  ? 36.246  14.194  15.133 1.00 56.79 ? 61   TYR A CB    1 
ATOM   231  C  CG    . TYR A 1 32  ? 34.853  14.300  15.713 1.00 56.26 ? 61   TYR A CG    1 
ATOM   232  C  CD1   . TYR A 1 32  ? 33.725  14.149  14.906 1.00 56.03 ? 61   TYR A CD1   1 
ATOM   233  C  CD2   . TYR A 1 32  ? 34.662  14.579  17.067 1.00 56.01 ? 61   TYR A CD2   1 
ATOM   234  C  CE1   . TYR A 1 32  ? 32.439  14.273  15.435 1.00 56.20 ? 61   TYR A CE1   1 
ATOM   235  C  CE2   . TYR A 1 32  ? 33.383  14.707  17.605 1.00 55.41 ? 61   TYR A CE2   1 
ATOM   236  C  CZ    . TYR A 1 32  ? 32.278  14.554  16.784 1.00 56.01 ? 61   TYR A CZ    1 
ATOM   237  O  OH    . TYR A 1 32  ? 31.014  14.693  17.312 1.00 57.09 ? 61   TYR A OH    1 
ATOM   238  N  N     . SER A 1 33  ? 39.131  15.921  14.721 1.00 60.48 ? 62   SER A N     1 
ATOM   239  C  CA    . SER A 1 33  ? 40.548  15.783  14.412 1.00 62.14 ? 62   SER A CA    1 
ATOM   240  C  C     . SER A 1 33  ? 41.029  14.528  15.130 1.00 63.52 ? 62   SER A C     1 
ATOM   241  O  O     . SER A 1 33  ? 40.364  14.040  16.047 1.00 63.21 ? 62   SER A O     1 
ATOM   242  C  CB    . SER A 1 33  ? 41.328  16.996  14.921 1.00 60.69 ? 62   SER A CB    1 
ATOM   243  O  OG    . SER A 1 33  ? 41.272  17.068  16.335 1.00 58.25 ? 62   SER A OG    1 
ATOM   244  N  N     . GLU A 1 34  ? 42.182  14.010  14.722 1.00 65.09 ? 63   GLU A N     1 
ATOM   245  C  CA    . GLU A 1 34  ? 42.717  12.808  15.345 1.00 66.61 ? 63   GLU A CA    1 
ATOM   246  C  C     . GLU A 1 34  ? 42.917  13.017  16.840 1.00 66.56 ? 63   GLU A C     1 
ATOM   247  O  O     . GLU A 1 34  ? 42.740  12.092  17.635 1.00 66.92 ? 63   GLU A O     1 
ATOM   248  C  CB    . GLU A 1 34  ? 44.045  12.412  14.695 1.00 67.98 ? 63   GLU A CB    1 
ATOM   249  C  CG    . GLU A 1 34  ? 44.538  11.041  15.122 1.00 69.68 ? 63   GLU A CG    1 
ATOM   250  C  CD    . GLU A 1 34  ? 45.779  10.605  14.373 1.00 70.98 ? 63   GLU A CD    1 
ATOM   251  O  OE1   . GLU A 1 34  ? 46.833  11.255  14.541 1.00 71.65 ? 63   GLU A OE1   1 
ATOM   252  O  OE2   . GLU A 1 34  ? 45.696  9.615   13.613 1.00 70.85 ? 63   GLU A OE2   1 
ATOM   253  N  N     . GLU A 1 35  ? 43.279  14.238  17.220 1.00 66.09 ? 64   GLU A N     1 
ATOM   254  C  CA    . GLU A 1 35  ? 43.498  14.561  18.623 1.00 65.31 ? 64   GLU A CA    1 
ATOM   255  C  C     . GLU A 1 35  ? 42.186  14.474  19.391 1.00 64.79 ? 64   GLU A C     1 
ATOM   256  O  O     . GLU A 1 35  ? 42.157  14.074  20.560 1.00 63.88 ? 64   GLU A O     1 
ATOM   257  C  CB    . GLU A 1 35  ? 44.088  15.967  18.754 1.00 67.38 ? 64   GLU A CB    1 
ATOM   258  C  CG    . GLU A 1 35  ? 44.323  16.418  20.191 1.00 68.80 ? 64   GLU A CG    1 
ATOM   259  C  CD    . GLU A 1 35  ? 45.098  15.397  21.003 1.00 69.95 ? 64   GLU A CD    1 
ATOM   260  O  OE1   . GLU A 1 35  ? 46.179  14.961  20.549 1.00 70.09 ? 64   GLU A OE1   1 
ATOM   261  O  OE2   . GLU A 1 35  ? 44.623  15.031  22.100 1.00 71.18 ? 64   GLU A OE2   1 
ATOM   262  N  N     . GLU A 1 36  ? 41.100  14.855  18.727 1.00 63.56 ? 65   GLU A N     1 
ATOM   263  C  CA    . GLU A 1 36  ? 39.781  14.807  19.341 1.00 62.58 ? 65   GLU A CA    1 
ATOM   264  C  C     . GLU A 1 36  ? 39.326  13.357  19.434 1.00 61.00 ? 65   GLU A C     1 
ATOM   265  O  O     . GLU A 1 36  ? 38.720  12.949  20.424 1.00 60.37 ? 65   GLU A O     1 
ATOM   266  C  CB    . GLU A 1 36  ? 38.785  15.617  18.514 1.00 63.63 ? 65   GLU A CB    1 
ATOM   267  C  CG    . GLU A 1 36  ? 39.119  17.097  18.435 1.00 65.29 ? 65   GLU A CG    1 
ATOM   268  C  CD    . GLU A 1 36  ? 38.123  17.874  17.600 1.00 66.27 ? 65   GLU A CD    1 
ATOM   269  O  OE1   . GLU A 1 36  ? 38.019  17.594  16.386 1.00 66.51 ? 65   GLU A OE1   1 
ATOM   270  O  OE2   . GLU A 1 36  ? 37.443  18.761  18.158 1.00 66.78 ? 65   GLU A OE2   1 
ATOM   271  N  N     . CYS A 1 37  ? 39.632  12.583  18.396 1.00 58.87 ? 66   CYS A N     1 
ATOM   272  C  CA    . CYS A 1 37  ? 39.265  11.176  18.354 1.00 57.44 ? 66   CYS A CA    1 
ATOM   273  C  C     . CYS A 1 37  ? 39.884  10.406  19.518 1.00 57.21 ? 66   CYS A C     1 
ATOM   274  O  O     . CYS A 1 37  ? 39.200  9.634   20.191 1.00 56.44 ? 66   CYS A O     1 
ATOM   275  C  CB    . CYS A 1 37  ? 39.707  10.553  17.027 1.00 56.61 ? 66   CYS A CB    1 
ATOM   276  S  SG    . CYS A 1 37  ? 38.869  11.217  15.564 1.00 52.15 ? 66   CYS A SG    1 
ATOM   277  N  N     . LYS A 1 38  ? 41.175  10.621  19.759 1.00 56.96 ? 67   LYS A N     1 
ATOM   278  C  CA    . LYS A 1 38  ? 41.859  9.934   20.848 1.00 56.52 ? 67   LYS A CA    1 
ATOM   279  C  C     . LYS A 1 38  ? 41.117  10.159  22.161 1.00 55.71 ? 67   LYS A C     1 
ATOM   280  O  O     . LYS A 1 38  ? 41.122  9.306   23.046 1.00 55.69 ? 67   LYS A O     1 
ATOM   281  C  CB    . LYS A 1 38  ? 43.303  10.436  20.990 1.00 57.61 ? 67   LYS A CB    1 
ATOM   282  C  CG    . LYS A 1 38  ? 44.206  10.195  19.778 1.00 58.38 ? 67   LYS A CG    1 
ATOM   283  C  CD    . LYS A 1 38  ? 45.634  10.659  20.071 1.00 59.00 ? 67   LYS A CD    1 
ATOM   284  C  CE    . LYS A 1 38  ? 46.518  10.637  18.830 1.00 59.58 ? 67   LYS A CE    1 
ATOM   285  N  NZ    . LYS A 1 38  ? 46.663  9.275   18.251 1.00 61.17 ? 67   LYS A NZ    1 
ATOM   286  N  N     . GLN A 1 39  ? 40.472  11.313  22.277 1.00 54.86 ? 68   GLN A N     1 
ATOM   287  C  CA    . GLN A 1 39  ? 39.735  11.651  23.487 1.00 54.85 ? 68   GLN A CA    1 
ATOM   288  C  C     . GLN A 1 39  ? 38.542  10.731  23.733 1.00 53.20 ? 68   GLN A C     1 
ATOM   289  O  O     . GLN A 1 39  ? 38.086  10.592  24.870 1.00 52.44 ? 68   GLN A O     1 
ATOM   290  C  CB    . GLN A 1 39  ? 39.243  13.100  23.417 1.00 57.54 ? 68   GLN A CB    1 
ATOM   291  C  CG    . GLN A 1 39  ? 40.331  14.121  23.106 1.00 61.30 ? 68   GLN A CG    1 
ATOM   292  C  CD    . GLN A 1 39  ? 41.513  14.023  24.051 1.00 63.01 ? 68   GLN A CD    1 
ATOM   293  O  OE1   . GLN A 1 39  ? 41.361  14.095  25.273 1.00 64.66 ? 68   GLN A OE1   1 
ATOM   294  N  NE2   . GLN A 1 39  ? 42.704  13.857  23.486 1.00 64.16 ? 68   GLN A NE2   1 
ATOM   295  N  N     . TYR A 1 40  ? 38.036  10.105  22.672 1.00 51.13 ? 69   TYR A N     1 
ATOM   296  C  CA    . TYR A 1 40  ? 36.881  9.216   22.799 1.00 51.03 ? 69   TYR A CA    1 
ATOM   297  C  C     . TYR A 1 40  ? 37.216  7.762   23.116 1.00 49.91 ? 69   TYR A C     1 
ATOM   298  O  O     . TYR A 1 40  ? 36.313  6.947   23.308 1.00 50.64 ? 69   TYR A O     1 
ATOM   299  C  CB    . TYR A 1 40  ? 36.020  9.258   21.528 1.00 49.58 ? 69   TYR A CB    1 
ATOM   300  C  CG    . TYR A 1 40  ? 35.185  10.511  21.392 1.00 50.36 ? 69   TYR A CG    1 
ATOM   301  C  CD1   . TYR A 1 40  ? 35.711  11.667  20.810 1.00 50.10 ? 69   TYR A CD1   1 
ATOM   302  C  CD2   . TYR A 1 40  ? 33.876  10.553  21.878 1.00 48.10 ? 69   TYR A CD2   1 
ATOM   303  C  CE1   . TYR A 1 40  ? 34.955  12.833  20.716 1.00 49.28 ? 69   TYR A CE1   1 
ATOM   304  C  CE2   . TYR A 1 40  ? 33.113  11.714  21.791 1.00 48.92 ? 69   TYR A CE2   1 
ATOM   305  C  CZ    . TYR A 1 40  ? 33.660  12.850  21.208 1.00 49.34 ? 69   TYR A CZ    1 
ATOM   306  O  OH    . TYR A 1 40  ? 32.915  14.003  21.119 1.00 48.79 ? 69   TYR A OH    1 
ATOM   307  N  N     . LYS A 1 41  ? 38.502  7.432   23.177 1.00 47.94 ? 70   LYS A N     1 
ATOM   308  C  CA    . LYS A 1 41  ? 38.897  6.061   23.468 1.00 46.75 ? 70   LYS A CA    1 
ATOM   309  C  C     . LYS A 1 41  ? 38.240  5.534   24.750 1.00 44.02 ? 70   LYS A C     1 
ATOM   310  O  O     . LYS A 1 41  ? 37.797  4.388   24.803 1.00 42.52 ? 70   LYS A O     1 
ATOM   311  C  CB    . LYS A 1 41  ? 40.425  5.955   23.570 1.00 48.55 ? 70   LYS A CB    1 
ATOM   312  C  CG    . LYS A 1 41  ? 40.925  4.521   23.660 1.00 50.71 ? 70   LYS A CG    1 
ATOM   313  C  CD    . LYS A 1 41  ? 42.363  4.367   23.188 1.00 52.68 ? 70   LYS A CD    1 
ATOM   314  C  CE    . LYS A 1 41  ? 43.355  4.982   24.156 1.00 54.27 ? 70   LYS A CE    1 
ATOM   315  N  NZ    . LYS A 1 41  ? 44.758  4.782   23.677 1.00 55.36 ? 70   LYS A NZ    1 
ATOM   316  N  N     . ALA A 1 42  ? 38.153  6.377   25.771 1.00 41.52 ? 71   ALA A N     1 
ATOM   317  C  CA    . ALA A 1 42  ? 37.559  5.966   27.038 1.00 40.53 ? 71   ALA A CA    1 
ATOM   318  C  C     . ALA A 1 42  ? 36.060  5.665   26.946 1.00 40.08 ? 71   ALA A C     1 
ATOM   319  O  O     . ALA A 1 42  ? 35.582  4.704   27.550 1.00 39.63 ? 71   ALA A O     1 
ATOM   320  C  CB    . ALA A 1 42  ? 37.816  7.027   28.102 1.00 39.50 ? 71   ALA A CB    1 
ATOM   321  N  N     . VAL A 1 43  ? 35.314  6.480   26.201 1.00 38.74 ? 72   VAL A N     1 
ATOM   322  C  CA    . VAL A 1 43  ? 33.875  6.248   26.067 1.00 36.63 ? 72   VAL A CA    1 
ATOM   323  C  C     . VAL A 1 43  ? 33.644  5.053   25.137 1.00 35.38 ? 72   VAL A C     1 
ATOM   324  O  O     . VAL A 1 43  ? 32.668  4.319   25.288 1.00 33.92 ? 72   VAL A O     1 
ATOM   325  C  CB    . VAL A 1 43  ? 33.126  7.510   25.528 1.00 36.36 ? 72   VAL A CB    1 
ATOM   326  C  CG1   . VAL A 1 43  ? 33.566  7.821   24.115 1.00 36.10 ? 72   VAL A CG1   1 
ATOM   327  C  CG2   . VAL A 1 43  ? 31.615  7.290   25.581 1.00 35.10 ? 72   VAL A CG2   1 
ATOM   328  N  N     . VAL A 1 44  ? 34.552  4.855   24.185 1.00 35.21 ? 73   VAL A N     1 
ATOM   329  C  CA    . VAL A 1 44  ? 34.451  3.723   23.269 1.00 35.37 ? 73   VAL A CA    1 
ATOM   330  C  C     . VAL A 1 44  ? 34.519  2.429   24.085 1.00 35.90 ? 73   VAL A C     1 
ATOM   331  O  O     . VAL A 1 44  ? 33.714  1.517   23.889 1.00 34.96 ? 73   VAL A O     1 
ATOM   332  C  CB    . VAL A 1 44  ? 35.602  3.727   22.229 1.00 35.31 ? 73   VAL A CB    1 
ATOM   333  C  CG1   . VAL A 1 44  ? 35.753  2.347   21.599 1.00 36.54 ? 73   VAL A CG1   1 
ATOM   334  C  CG2   . VAL A 1 44  ? 35.312  4.740   21.143 1.00 34.12 ? 73   VAL A CG2   1 
ATOM   335  N  N     . TYR A 1 45  ? 35.478  2.361   25.007 1.00 35.60 ? 74   TYR A N     1 
ATOM   336  C  CA    . TYR A 1 45  ? 35.634  1.182   25.852 1.00 35.21 ? 74   TYR A CA    1 
ATOM   337  C  C     . TYR A 1 45  ? 34.487  1.062   26.847 1.00 34.71 ? 74   TYR A C     1 
ATOM   338  O  O     . TYR A 1 45  ? 34.022  -0.039  27.147 1.00 34.37 ? 74   TYR A O     1 
ATOM   339  C  CB    . TYR A 1 45  ? 36.963  1.221   26.621 1.00 36.92 ? 74   TYR A CB    1 
ATOM   340  C  CG    . TYR A 1 45  ? 38.199  1.061   25.761 1.00 36.46 ? 74   TYR A CG    1 
ATOM   341  C  CD1   . TYR A 1 45  ? 38.172  0.284   24.605 1.00 37.99 ? 74   TYR A CD1   1 
ATOM   342  C  CD2   . TYR A 1 45  ? 39.409  1.661   26.124 1.00 39.39 ? 74   TYR A CD2   1 
ATOM   343  C  CE1   . TYR A 1 45  ? 39.319  0.107   23.827 1.00 38.58 ? 74   TYR A CE1   1 
ATOM   344  C  CE2   . TYR A 1 45  ? 40.566  1.487   25.350 1.00 37.68 ? 74   TYR A CE2   1 
ATOM   345  C  CZ    . TYR A 1 45  ? 40.508  0.711   24.206 1.00 37.42 ? 74   TYR A CZ    1 
ATOM   346  O  OH    . TYR A 1 45  ? 41.626  0.540   23.427 1.00 40.00 ? 74   TYR A OH    1 
ATOM   347  N  N     . SER A 1 46  ? 34.035  2.193   27.371 1.00 34.32 ? 75   SER A N     1 
ATOM   348  C  CA    . SER A 1 46  ? 32.938  2.165   28.325 1.00 34.08 ? 75   SER A CA    1 
ATOM   349  C  C     . SER A 1 46  ? 31.685  1.615   27.634 1.00 32.33 ? 75   SER A C     1 
ATOM   350  O  O     . SER A 1 46  ? 31.009  0.731   28.161 1.00 31.64 ? 75   SER A O     1 
ATOM   351  C  CB    . SER A 1 46  ? 32.673  3.567   28.869 1.00 35.26 ? 75   SER A CB    1 
ATOM   352  O  OG    . SER A 1 46  ? 31.722  3.520   29.919 1.00 41.56 ? 75   SER A OG    1 
ATOM   353  N  N     . ASN A 1 47  ? 31.394  2.135   26.446 1.00 30.73 ? 76   ASN A N     1 
ATOM   354  C  CA    . ASN A 1 47  ? 30.233  1.697   25.669 1.00 27.94 ? 76   ASN A CA    1 
ATOM   355  C  C     . ASN A 1 47  ? 30.360  0.224   25.297 1.00 28.14 ? 76   ASN A C     1 
ATOM   356  O  O     . ASN A 1 47  ? 29.381  -0.523  25.317 1.00 25.66 ? 76   ASN A O     1 
ATOM   357  C  CB    . ASN A 1 47  ? 30.111  2.526   24.389 1.00 25.42 ? 76   ASN A CB    1 
ATOM   358  C  CG    . ASN A 1 47  ? 29.678  3.959   24.649 1.00 23.03 ? 76   ASN A CG    1 
ATOM   359  O  OD1   . ASN A 1 47  ? 29.746  4.797   23.753 1.00 28.04 ? 76   ASN A OD1   1 
ATOM   360  N  ND2   . ASN A 1 47  ? 29.222  4.244   25.863 1.00 20.00 ? 76   ASN A ND2   1 
ATOM   361  N  N     . THR A 1 48  ? 31.573  -0.189  24.943 1.00 29.92 ? 77   THR A N     1 
ATOM   362  C  CA    . THR A 1 48  ? 31.810  -1.577  24.580 1.00 29.40 ? 77   THR A CA    1 
ATOM   363  C  C     . THR A 1 48  ? 31.484  -2.494  25.763 1.00 29.68 ? 77   THR A C     1 
ATOM   364  O  O     . THR A 1 48  ? 30.785  -3.493  25.609 1.00 28.47 ? 77   THR A O     1 
ATOM   365  C  CB    . THR A 1 48  ? 33.278  -1.795  24.143 1.00 30.66 ? 77   THR A CB    1 
ATOM   366  O  OG1   . THR A 1 48  ? 33.558  -0.997  22.985 1.00 26.27 ? 77   THR A OG1   1 
ATOM   367  C  CG2   . THR A 1 48  ? 33.519  -3.266  23.798 1.00 30.88 ? 77   THR A CG2   1 
ATOM   368  N  N     . ILE A 1 49  ? 31.974  -2.136  26.947 1.00 30.42 ? 78   ILE A N     1 
ATOM   369  C  CA    . ILE A 1 49  ? 31.740  -2.928  28.156 1.00 30.62 ? 78   ILE A CA    1 
ATOM   370  C  C     . ILE A 1 49  ? 30.283  -2.875  28.622 1.00 30.84 ? 78   ILE A C     1 
ATOM   371  O  O     . ILE A 1 49  ? 29.735  -3.876  29.089 1.00 28.58 ? 78   ILE A O     1 
ATOM   372  C  CB    . ILE A 1 49  ? 32.660  -2.447  29.304 1.00 32.88 ? 78   ILE A CB    1 
ATOM   373  C  CG1   . ILE A 1 49  ? 34.119  -2.696  28.921 1.00 34.69 ? 78   ILE A CG1   1 
ATOM   374  C  CG2   . ILE A 1 49  ? 32.314  -3.153  30.606 1.00 31.79 ? 78   ILE A CG2   1 
ATOM   375  C  CD1   . ILE A 1 49  ? 35.116  -2.185  29.933 1.00 37.32 ? 78   ILE A CD1   1 
ATOM   376  N  N     . GLN A 1 50  ? 29.659  -1.707  28.507 1.00 29.74 ? 79   GLN A N     1 
ATOM   377  C  CA    . GLN A 1 50  ? 28.266  -1.570  28.916 1.00 30.79 ? 79   GLN A CA    1 
ATOM   378  C  C     . GLN A 1 50  ? 27.418  -2.500  28.052 1.00 28.93 ? 79   GLN A C     1 
ATOM   379  O  O     . GLN A 1 50  ? 26.465  -3.123  28.532 1.00 27.72 ? 79   GLN A O     1 
ATOM   380  C  CB    . GLN A 1 50  ? 27.803  -0.113  28.755 1.00 31.80 ? 79   GLN A CB    1 
ATOM   381  C  CG    . GLN A 1 50  ? 28.561  0.865   29.655 1.00 32.97 ? 79   GLN A CG    1 
ATOM   382  C  CD    . GLN A 1 50  ? 28.344  2.323   29.274 1.00 33.31 ? 79   GLN A CD    1 
ATOM   383  O  OE1   . GLN A 1 50  ? 28.269  2.669   28.090 1.00 30.96 ? 79   GLN A OE1   1 
ATOM   384  N  NE2   . GLN A 1 50  ? 28.267  3.190   30.278 1.00 30.91 ? 79   GLN A NE2   1 
ATOM   385  N  N     . SER A 1 51  ? 27.791  -2.604  26.780 1.00 27.96 ? 80   SER A N     1 
ATOM   386  C  CA    . SER A 1 51  ? 27.077  -3.448  25.828 1.00 27.79 ? 80   SER A CA    1 
ATOM   387  C  C     . SER A 1 51  ? 27.128  -4.928  26.191 1.00 27.92 ? 80   SER A C     1 
ATOM   388  O  O     . SER A 1 51  ? 26.087  -5.583  26.262 1.00 26.80 ? 80   SER A O     1 
ATOM   389  C  CB    . SER A 1 51  ? 27.639  -3.253  24.414 1.00 25.92 ? 80   SER A CB    1 
ATOM   390  O  OG    . SER A 1 51  ? 27.406  -1.935  23.949 1.00 25.91 ? 80   SER A OG    1 
ATOM   391  N  N     . ILE A 1 52  ? 28.329  -5.459  26.422 1.00 27.81 ? 81   ILE A N     1 
ATOM   392  C  CA    . ILE A 1 52  ? 28.443  -6.871  26.771 1.00 28.29 ? 81   ILE A CA    1 
ATOM   393  C  C     . ILE A 1 52  ? 27.754  -7.137  28.109 1.00 25.71 ? 81   ILE A C     1 
ATOM   394  O  O     . ILE A 1 52  ? 27.146  -8.187  28.291 1.00 27.06 ? 81   ILE A O     1 
ATOM   395  C  CB    . ILE A 1 52  ? 29.930  -7.359  26.811 1.00 28.74 ? 81   ILE A CB    1 
ATOM   396  C  CG1   . ILE A 1 52  ? 29.972  -8.888  26.947 1.00 30.17 ? 81   ILE A CG1   1 
ATOM   397  C  CG2   . ILE A 1 52  ? 30.671  -6.747  27.989 1.00 30.35 ? 81   ILE A CG2   1 
ATOM   398  C  CD1   . ILE A 1 52  ? 29.361  -9.646  25.763 1.00 29.76 ? 81   ILE A CD1   1 
ATOM   399  N  N     . ILE A 1 53  ? 27.838  -6.189  29.040 1.00 25.54 ? 82   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 53  ? 27.176  -6.338  30.341 1.00 25.87 ? 82   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 53  ? 25.641  -6.376  30.178 1.00 26.25 ? 82   ILE A C     1 
ATOM   402  O  O     . ILE A 1 53  ? 24.952  -7.147  30.843 1.00 26.17 ? 82   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 53  ? 27.546  -5.175  31.306 1.00 25.97 ? 82   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 53  ? 28.970  -5.369  31.835 1.00 28.20 ? 82   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 53  ? 26.561  -5.120  32.488 1.00 24.93 ? 82   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 53  ? 29.381  -4.324  32.853 1.00 29.84 ? 82   ILE A CD1   1 
ATOM   407  N  N     . ALA A 1 54  ? 25.111  -5.535  29.297 1.00 27.15 ? 83   ALA A N     1 
ATOM   408  C  CA    . ALA A 1 54  ? 23.670  -5.499  29.063 1.00 27.35 ? 83   ALA A CA    1 
ATOM   409  C  C     . ALA A 1 54  ? 23.188  -6.881  28.611 1.00 27.49 ? 83   ALA A C     1 
ATOM   410  O  O     . ALA A 1 54  ? 22.186  -7.396  29.105 1.00 27.07 ? 83   ALA A O     1 
ATOM   411  C  CB    . ALA A 1 54  ? 23.340  -4.444  28.002 1.00 26.93 ? 83   ALA A CB    1 
ATOM   412  N  N     . ILE A 1 55  ? 23.911  -7.475  27.666 1.00 27.01 ? 84   ILE A N     1 
ATOM   413  C  CA    . ILE A 1 55  ? 23.573  -8.801  27.162 1.00 28.18 ? 84   ILE A CA    1 
ATOM   414  C  C     . ILE A 1 55  ? 23.671  -9.859  28.277 1.00 29.61 ? 84   ILE A C     1 
ATOM   415  O  O     . ILE A 1 55  ? 22.820  -10.744 28.382 1.00 28.38 ? 84   ILE A O     1 
ATOM   416  C  CB    . ILE A 1 55  ? 24.511  -9.191  25.995 1.00 28.65 ? 84   ILE A CB    1 
ATOM   417  C  CG1   . ILE A 1 55  ? 24.344  -8.180  24.852 1.00 26.45 ? 84   ILE A CG1   1 
ATOM   418  C  CG2   . ILE A 1 55  ? 24.213  -10.627 25.524 1.00 26.07 ? 84   ILE A CG2   1 
ATOM   419  C  CD1   . ILE A 1 55  ? 25.271  -8.410  23.663 1.00 27.10 ? 84   ILE A CD1   1 
ATOM   420  N  N     . ILE A 1 56  ? 24.703  -9.759  29.113 1.00 31.53 ? 85   ILE A N     1 
ATOM   421  C  CA    . ILE A 1 56  ? 24.885  -10.708 30.213 1.00 33.68 ? 85   ILE A CA    1 
ATOM   422  C  C     . ILE A 1 56  ? 23.716  -10.621 31.190 1.00 33.68 ? 85   ILE A C     1 
ATOM   423  O  O     . ILE A 1 56  ? 23.178  -11.641 31.620 1.00 35.40 ? 85   ILE A O     1 
ATOM   424  C  CB    . ILE A 1 56  ? 26.213  -10.444 30.991 1.00 35.12 ? 85   ILE A CB    1 
ATOM   425  C  CG1   . ILE A 1 56  ? 27.414  -10.679 30.077 1.00 34.34 ? 85   ILE A CG1   1 
ATOM   426  C  CG2   . ILE A 1 56  ? 26.304  -11.350 32.212 1.00 35.52 ? 85   ILE A CG2   1 
ATOM   427  C  CD1   . ILE A 1 56  ? 27.482  -12.073 29.511 1.00 36.45 ? 85   ILE A CD1   1 
ATOM   428  N  N     . ARG A 1 57  ? 23.326  -9.400  31.543 1.00 34.73 ? 86   ARG A N     1 
ATOM   429  C  CA    . ARG A 1 57  ? 22.207  -9.203  32.460 1.00 34.39 ? 86   ARG A CA    1 
ATOM   430  C  C     . ARG A 1 57  ? 20.933  -9.833  31.894 1.00 32.19 ? 86   ARG A C     1 
ATOM   431  O  O     . ARG A 1 57  ? 20.172  -10.458 32.628 1.00 31.45 ? 86   ARG A O     1 
ATOM   432  C  CB    . ARG A 1 57  ? 21.974  -7.708  32.710 1.00 36.50 ? 86   ARG A CB    1 
ATOM   433  C  CG    . ARG A 1 57  ? 23.029  -7.034  33.577 1.00 41.02 ? 86   ARG A CG    1 
ATOM   434  C  CD    . ARG A 1 57  ? 22.804  -7.308  35.069 1.00 47.78 ? 86   ARG A CD    1 
ATOM   435  N  NE    . ARG A 1 57  ? 23.773  -6.606  35.917 1.00 49.57 ? 86   ARG A NE    1 
ATOM   436  C  CZ    . ARG A 1 57  ? 24.069  -5.314  35.794 1.00 52.47 ? 86   ARG A CZ    1 
ATOM   437  N  NH1   . ARG A 1 57  ? 23.474  -4.583  34.858 1.00 53.41 ? 86   ARG A NH1   1 
ATOM   438  N  NH2   . ARG A 1 57  ? 24.958  -4.749  36.599 1.00 52.38 ? 86   ARG A NH2   1 
ATOM   439  N  N     . ALA A 1 58  ? 20.709  -9.674  30.591 1.00 30.49 ? 87   ALA A N     1 
ATOM   440  C  CA    . ALA A 1 58  ? 19.518  -10.225 29.942 1.00 29.57 ? 87   ALA A CA    1 
ATOM   441  C  C     . ALA A 1 58  ? 19.491  -11.759 30.005 1.00 29.87 ? 87   ALA A C     1 
ATOM   442  O  O     . ALA A 1 58  ? 18.422  -12.369 30.116 1.00 27.71 ? 87   ALA A O     1 
ATOM   443  C  CB    . ALA A 1 58  ? 19.445  -9.751  28.484 1.00 28.83 ? 87   ALA A CB    1 
ATOM   444  N  N     . MET A 1 59  ? 20.666  -12.378 29.926 1.00 29.08 ? 88   MET A N     1 
ATOM   445  C  CA    . MET A 1 59  ? 20.756  -13.835 29.993 1.00 30.65 ? 88   MET A CA    1 
ATOM   446  C  C     . MET A 1 59  ? 20.200  -14.343 31.321 1.00 29.68 ? 88   MET A C     1 
ATOM   447  O  O     . MET A 1 59  ? 19.560  -15.393 31.373 1.00 29.89 ? 88   MET A O     1 
ATOM   448  C  CB    . MET A 1 59  ? 22.206  -14.290 29.843 1.00 30.34 ? 88   MET A CB    1 
ATOM   449  C  CG    . MET A 1 59  ? 22.802  -14.025 28.479 1.00 31.73 ? 88   MET A CG    1 
ATOM   450  S  SD    . MET A 1 59  ? 24.531  -14.520 28.445 1.00 31.58 ? 88   MET A SD    1 
ATOM   451  C  CE    . MET A 1 59  ? 24.358  -16.331 28.363 1.00 28.17 ? 88   MET A CE    1 
ATOM   452  N  N     . GLY A 1 60  ? 20.451  -13.587 32.387 1.00 30.32 ? 89   GLY A N     1 
ATOM   453  C  CA    . GLY A 1 60  ? 19.962  -13.966 33.698 1.00 31.29 ? 89   GLY A CA    1 
ATOM   454  C  C     . GLY A 1 60  ? 18.455  -13.798 33.767 1.00 33.33 ? 89   GLY A C     1 
ATOM   455  O  O     . GLY A 1 60  ? 17.752  -14.678 34.255 1.00 31.53 ? 89   GLY A O     1 
ATOM   456  N  N     . ARG A 1 61  ? 17.962  -12.665 33.273 1.00 34.45 ? 90   ARG A N     1 
ATOM   457  C  CA    . ARG A 1 61  ? 16.531  -12.377 33.266 1.00 35.79 ? 90   ARG A CA    1 
ATOM   458  C  C     . ARG A 1 61  ? 15.762  -13.348 32.365 1.00 34.55 ? 90   ARG A C     1 
ATOM   459  O  O     . ARG A 1 61  ? 14.757  -13.922 32.784 1.00 33.80 ? 90   ARG A O     1 
ATOM   460  C  CB    . ARG A 1 61  ? 16.292  -10.930 32.812 1.00 38.59 ? 90   ARG A CB    1 
ATOM   461  C  CG    . ARG A 1 61  ? 16.817  -9.886  33.797 1.00 44.36 ? 90   ARG A CG    1 
ATOM   462  C  CD    . ARG A 1 61  ? 16.547  -8.454  33.326 1.00 47.44 ? 90   ARG A CD    1 
ATOM   463  N  NE    . ARG A 1 61  ? 17.580  -7.950  32.420 1.00 49.49 ? 90   ARG A NE    1 
ATOM   464  C  CZ    . ARG A 1 61  ? 17.327  -7.318  31.279 1.00 50.68 ? 90   ARG A CZ    1 
ATOM   465  N  NH1   . ARG A 1 61  ? 16.070  -7.115  30.899 1.00 50.99 ? 90   ARG A NH1   1 
ATOM   466  N  NH2   . ARG A 1 61  ? 18.326  -6.882  30.520 1.00 52.36 ? 90   ARG A NH2   1 
ATOM   467  N  N     . LEU A 1 62  ? 16.238  -13.531 31.133 1.00 34.30 ? 91   LEU A N     1 
ATOM   468  C  CA    . LEU A 1 62  ? 15.599  -14.436 30.169 1.00 33.19 ? 91   LEU A CA    1 
ATOM   469  C  C     . LEU A 1 62  ? 15.944  -15.903 30.417 1.00 32.73 ? 91   LEU A C     1 
ATOM   470  O  O     . LEU A 1 62  ? 15.425  -16.790 29.739 1.00 29.71 ? 91   LEU A O     1 
ATOM   471  C  CB    . LEU A 1 62  ? 16.011  -14.081 28.735 1.00 33.73 ? 91   LEU A CB    1 
ATOM   472  C  CG    . LEU A 1 62  ? 15.669  -12.694 28.191 1.00 33.65 ? 91   LEU A CG    1 
ATOM   473  C  CD1   . LEU A 1 62  ? 16.276  -12.539 26.809 1.00 34.55 ? 91   LEU A CD1   1 
ATOM   474  C  CD2   . LEU A 1 62  ? 14.161  -12.508 28.141 1.00 34.62 ? 91   LEU A CD2   1 
ATOM   475  N  N     . LYS A 1 63  ? 16.828  -16.154 31.379 1.00 35.08 ? 92   LYS A N     1 
ATOM   476  C  CA    . LYS A 1 63  ? 17.244  -17.518 31.711 1.00 36.41 ? 92   LYS A CA    1 
ATOM   477  C  C     . LYS A 1 63  ? 17.883  -18.226 30.513 1.00 36.53 ? 92   LYS A C     1 
ATOM   478  O  O     . LYS A 1 63  ? 17.443  -19.295 30.091 1.00 35.84 ? 92   LYS A O     1 
ATOM   479  C  CB    . LYS A 1 63  ? 16.044  -18.333 32.205 1.00 38.00 ? 92   LYS A CB    1 
ATOM   480  C  CG    . LYS A 1 63  ? 16.409  -19.630 32.924 1.00 41.37 ? 92   LYS A CG    1 
ATOM   481  C  CD    . LYS A 1 63  ? 17.101  -19.333 34.246 1.00 45.64 ? 92   LYS A CD    1 
ATOM   482  C  CE    . LYS A 1 63  ? 17.323  -20.588 35.074 1.00 47.65 ? 92   LYS A CE    1 
ATOM   483  N  NZ    . LYS A 1 63  ? 17.782  -20.230 36.448 1.00 48.98 ? 92   LYS A NZ    1 
ATOM   484  N  N     . ILE A 1 64  ? 18.922  -17.617 29.960 1.00 36.93 ? 93   ILE A N     1 
ATOM   485  C  CA    . ILE A 1 64  ? 19.628  -18.198 28.827 1.00 37.29 ? 93   ILE A CA    1 
ATOM   486  C  C     . ILE A 1 64  ? 21.003  -18.609 29.331 1.00 38.48 ? 93   ILE A C     1 
ATOM   487  O  O     . ILE A 1 64  ? 21.764  -17.772 29.822 1.00 39.79 ? 93   ILE A O     1 
ATOM   488  C  CB    . ILE A 1 64  ? 19.791  -17.172 27.686 1.00 36.60 ? 93   ILE A CB    1 
ATOM   489  C  CG1   . ILE A 1 64  ? 18.412  -16.711 27.198 1.00 35.47 ? 93   ILE A CG1   1 
ATOM   490  C  CG2   . ILE A 1 64  ? 20.579  -17.782 26.545 1.00 35.18 ? 93   ILE A CG2   1 
ATOM   491  C  CD1   . ILE A 1 64  ? 18.459  -15.573 26.190 1.00 32.48 ? 93   ILE A CD1   1 
ATOM   492  N  N     . ASP A 1 65  ? 21.322  -19.894 29.221 1.00 38.67 ? 94   ASP A N     1 
ATOM   493  C  CA    . ASP A 1 65  ? 22.613  -20.380 29.692 1.00 40.16 ? 94   ASP A CA    1 
ATOM   494  C  C     . ASP A 1 65  ? 23.729  -20.162 28.682 1.00 37.71 ? 94   ASP A C     1 
ATOM   495  O  O     . ASP A 1 65  ? 23.483  -20.022 27.487 1.00 37.22 ? 94   ASP A O     1 
ATOM   496  C  CB    . ASP A 1 65  ? 22.538  -21.873 30.030 1.00 42.22 ? 94   ASP A CB    1 
ATOM   497  C  CG    . ASP A 1 65  ? 21.426  -22.194 31.003 1.00 45.74 ? 94   ASP A CG    1 
ATOM   498  O  OD1   . ASP A 1 65  ? 21.354  -21.547 32.073 1.00 44.12 ? 94   ASP A OD1   1 
ATOM   499  O  OD2   . ASP A 1 65  ? 20.624  -23.103 30.694 1.00 49.59 ? 94   ASP A OD2   1 
ATOM   500  N  N     . PHE A 1 66  ? 24.960  -20.133 29.185 1.00 38.04 ? 95   PHE A N     1 
ATOM   501  C  CA    . PHE A 1 66  ? 26.148  -19.964 28.349 1.00 37.46 ? 95   PHE A CA    1 
ATOM   502  C  C     . PHE A 1 66  ? 26.367  -21.246 27.557 1.00 37.99 ? 95   PHE A C     1 
ATOM   503  O  O     . PHE A 1 66  ? 26.042  -22.332 28.038 1.00 39.18 ? 95   PHE A O     1 
ATOM   504  C  CB    . PHE A 1 66  ? 27.375  -19.717 29.229 1.00 35.04 ? 95   PHE A CB    1 
ATOM   505  C  CG    . PHE A 1 66  ? 27.356  -18.406 29.942 1.00 33.25 ? 95   PHE A CG    1 
ATOM   506  C  CD1   . PHE A 1 66  ? 27.562  -17.218 29.246 1.00 30.92 ? 95   PHE A CD1   1 
ATOM   507  C  CD2   . PHE A 1 66  ? 27.126  -18.351 31.313 1.00 33.33 ? 95   PHE A CD2   1 
ATOM   508  C  CE1   . PHE A 1 66  ? 27.541  -15.994 29.906 1.00 32.05 ? 95   PHE A CE1   1 
ATOM   509  C  CE2   . PHE A 1 66  ? 27.102  -17.131 31.987 1.00 32.10 ? 95   PHE A CE2   1 
ATOM   510  C  CZ    . PHE A 1 66  ? 27.310  -15.949 31.282 1.00 32.26 ? 95   PHE A CZ    1 
ATOM   511  N  N     . GLY A 1 67  ? 26.909  -21.126 26.348 1.00 38.22 ? 96   GLY A N     1 
ATOM   512  C  CA    . GLY A 1 67  ? 27.179  -22.309 25.549 1.00 40.04 ? 96   GLY A CA    1 
ATOM   513  C  C     . GLY A 1 67  ? 28.181  -23.178 26.294 1.00 43.19 ? 96   GLY A C     1 
ATOM   514  O  O     . GLY A 1 67  ? 28.115  -24.408 26.260 1.00 42.34 ? 96   GLY A O     1 
ATOM   515  N  N     . ASP A 1 68  ? 29.113  -22.523 26.984 1.00 45.50 ? 97   ASP A N     1 
ATOM   516  C  CA    . ASP A 1 68  ? 30.132  -23.214 27.764 1.00 46.36 ? 97   ASP A CA    1 
ATOM   517  C  C     . ASP A 1 68  ? 30.066  -22.745 29.210 1.00 46.39 ? 97   ASP A C     1 
ATOM   518  O  O     . ASP A 1 68  ? 30.144  -21.549 29.492 1.00 46.24 ? 97   ASP A O     1 
ATOM   519  C  CB    . ASP A 1 68  ? 31.522  -22.926 27.202 1.00 49.23 ? 97   ASP A CB    1 
ATOM   520  C  CG    . ASP A 1 68  ? 32.610  -23.700 27.922 1.00 53.17 ? 97   ASP A CG    1 
ATOM   521  O  OD1   . ASP A 1 68  ? 32.714  -23.580 29.166 1.00 52.47 ? 97   ASP A OD1   1 
ATOM   522  O  OD2   . ASP A 1 68  ? 33.362  -24.433 27.241 1.00 56.22 ? 97   ASP A OD2   1 
ATOM   523  N  N     . SER A 1 69  ? 29.934  -23.695 30.126 1.00 45.67 ? 98   SER A N     1 
ATOM   524  C  CA    . SER A 1 69  ? 29.842  -23.384 31.546 1.00 46.27 ? 98   SER A CA    1 
ATOM   525  C  C     . SER A 1 69  ? 30.974  -22.496 32.071 1.00 45.36 ? 98   SER A C     1 
ATOM   526  O  O     . SER A 1 69  ? 30.803  -21.777 33.056 1.00 44.37 ? 98   SER A O     1 
ATOM   527  C  CB    . SER A 1 69  ? 29.793  -24.686 32.351 1.00 47.14 ? 98   SER A CB    1 
ATOM   528  O  OG    . SER A 1 69  ? 29.650  -24.416 33.734 1.00 51.69 ? 98   SER A OG    1 
ATOM   529  N  N     . ALA A 1 70  ? 32.129  -22.547 31.417 1.00 45.56 ? 99   ALA A N     1 
ATOM   530  C  CA    . ALA A 1 70  ? 33.281  -21.754 31.838 1.00 46.22 ? 99   ALA A CA    1 
ATOM   531  C  C     . ALA A 1 70  ? 33.050  -20.247 31.738 1.00 45.90 ? 99   ALA A C     1 
ATOM   532  O  O     . ALA A 1 70  ? 33.604  -19.471 32.521 1.00 45.26 ? 99   ALA A O     1 
ATOM   533  C  CB    . ALA A 1 70  ? 34.507  -22.142 31.011 1.00 46.29 ? 99   ALA A CB    1 
ATOM   534  N  N     . ARG A 1 71  ? 32.230  -19.837 30.778 1.00 46.18 ? 100  ARG A N     1 
ATOM   535  C  CA    . ARG A 1 71  ? 31.951  -18.419 30.572 1.00 46.00 ? 100  ARG A CA    1 
ATOM   536  C  C     . ARG A 1 71  ? 31.396  -17.713 31.805 1.00 46.55 ? 100  ARG A C     1 
ATOM   537  O  O     . ARG A 1 71  ? 31.486  -16.492 31.917 1.00 47.70 ? 100  ARG A O     1 
ATOM   538  C  CB    . ARG A 1 71  ? 30.998  -18.244 29.392 1.00 44.48 ? 100  ARG A CB    1 
ATOM   539  C  CG    . ARG A 1 71  ? 31.546  -18.766 28.064 1.00 45.29 ? 100  ARG A CG    1 
ATOM   540  C  CD    . ARG A 1 71  ? 32.787  -17.995 27.598 1.00 45.76 ? 100  ARG A CD    1 
ATOM   541  N  NE    . ARG A 1 71  ? 33.999  -18.339 28.343 1.00 45.89 ? 100  ARG A NE    1 
ATOM   542  C  CZ    . ARG A 1 71  ? 34.739  -19.423 28.116 1.00 47.38 ? 100  ARG A CZ    1 
ATOM   543  N  NH1   . ARG A 1 71  ? 34.396  -20.278 27.159 1.00 45.38 ? 100  ARG A NH1   1 
ATOM   544  N  NH2   . ARG A 1 71  ? 35.828  -19.652 28.842 1.00 46.28 ? 100  ARG A NH2   1 
ATOM   545  N  N     . ALA A 1 72  ? 30.835  -18.475 32.738 1.00 47.87 ? 101  ALA A N     1 
ATOM   546  C  CA    . ALA A 1 72  ? 30.278  -17.888 33.955 1.00 48.95 ? 101  ALA A CA    1 
ATOM   547  C  C     . ALA A 1 72  ? 31.356  -17.164 34.762 1.00 49.88 ? 101  ALA A C     1 
ATOM   548  O  O     . ALA A 1 72  ? 31.121  -16.082 35.309 1.00 49.47 ? 101  ALA A O     1 
ATOM   549  C  CB    . ALA A 1 72  ? 29.620  -18.972 34.811 1.00 47.75 ? 101  ALA A CB    1 
ATOM   550  N  N     . ASP A 1 73  ? 32.536  -17.770 34.844 1.00 50.80 ? 102  ASP A N     1 
ATOM   551  C  CA    . ASP A 1 73  ? 33.639  -17.171 35.582 1.00 50.72 ? 102  ASP A CA    1 
ATOM   552  C  C     . ASP A 1 73  ? 34.132  -15.945 34.826 1.00 49.31 ? 102  ASP A C     1 
ATOM   553  O  O     . ASP A 1 73  ? 34.562  -14.966 35.435 1.00 49.66 ? 102  ASP A O     1 
ATOM   554  C  CB    . ASP A 1 73  ? 34.757  -18.197 35.766 1.00 53.91 ? 102  ASP A CB    1 
ATOM   555  C  CG    . ASP A 1 73  ? 34.317  -19.382 36.608 1.00 56.63 ? 102  ASP A CG    1 
ATOM   556  O  OD1   . ASP A 1 73  ? 34.163  -19.211 37.838 1.00 57.34 ? 102  ASP A OD1   1 
ATOM   557  O  OD2   . ASP A 1 73  ? 34.107  -20.478 36.039 1.00 58.73 ? 102  ASP A OD2   1 
ATOM   558  N  N     . ASP A 1 74  ? 34.060  -15.997 33.497 1.00 47.66 ? 103  ASP A N     1 
ATOM   559  C  CA    . ASP A 1 74  ? 34.467  -14.859 32.678 1.00 47.50 ? 103  ASP A CA    1 
ATOM   560  C  C     . ASP A 1 74  ? 33.527  -13.689 32.953 1.00 47.20 ? 103  ASP A C     1 
ATOM   561  O  O     . ASP A 1 74  ? 33.970  -12.550 33.114 1.00 46.33 ? 103  ASP A O     1 
ATOM   562  C  CB    . ASP A 1 74  ? 34.427  -15.201 31.182 1.00 46.07 ? 103  ASP A CB    1 
ATOM   563  C  CG    . ASP A 1 74  ? 35.691  -15.909 30.705 1.00 46.26 ? 103  ASP A CG    1 
ATOM   564  O  OD1   . ASP A 1 74  ? 36.715  -15.844 31.419 1.00 45.25 ? 103  ASP A OD1   1 
ATOM   565  O  OD2   . ASP A 1 74  ? 35.666  -16.514 29.609 1.00 44.37 ? 103  ASP A OD2   1 
ATOM   566  N  N     . ALA A 1 75  ? 32.228  -13.978 33.014 1.00 46.17 ? 104  ALA A N     1 
ATOM   567  C  CA    . ALA A 1 75  ? 31.234  -12.943 33.274 1.00 46.61 ? 104  ALA A CA    1 
ATOM   568  C  C     . ALA A 1 75  ? 31.541  -12.227 34.585 1.00 47.25 ? 104  ALA A C     1 
ATOM   569  O  O     . ALA A 1 75  ? 31.535  -10.999 34.645 1.00 46.91 ? 104  ALA A O     1 
ATOM   570  C  CB    . ALA A 1 75  ? 29.831  -13.554 33.319 1.00 46.03 ? 104  ALA A CB    1 
ATOM   571  N  N     . ARG A 1 76  ? 31.805  -12.997 35.637 1.00 48.23 ? 105  ARG A N     1 
ATOM   572  C  CA    . ARG A 1 76  ? 32.124  -12.410 36.932 1.00 50.04 ? 105  ARG A CA    1 
ATOM   573  C  C     . ARG A 1 76  ? 33.414  -11.607 36.815 1.00 50.30 ? 105  ARG A C     1 
ATOM   574  O  O     . ARG A 1 76  ? 33.524  -10.493 37.337 1.00 49.60 ? 105  ARG A O     1 
ATOM   575  C  CB    . ARG A 1 76  ? 32.294  -13.503 37.994 1.00 51.94 ? 105  ARG A CB    1 
ATOM   576  C  CG    . ARG A 1 76  ? 30.989  -14.083 38.527 1.00 54.47 ? 105  ARG A CG    1 
ATOM   577  C  CD    . ARG A 1 76  ? 31.255  -15.140 39.595 1.00 54.83 ? 105  ARG A CD    1 
ATOM   578  N  NE    . ARG A 1 76  ? 31.681  -16.413 39.018 1.00 56.17 ? 105  ARG A NE    1 
ATOM   579  C  CZ    . ARG A 1 76  ? 30.847  -17.333 38.545 1.00 56.30 ? 105  ARG A CZ    1 
ATOM   580  N  NH1   . ARG A 1 76  ? 29.537  -17.122 38.584 1.00 57.00 ? 105  ARG A NH1   1 
ATOM   581  N  NH2   . ARG A 1 76  ? 31.318  -18.461 38.028 1.00 56.13 ? 105  ARG A NH2   1 
ATOM   582  N  N     . GLN A 1 77  ? 34.387  -12.184 36.119 1.00 50.54 ? 106  GLN A N     1 
ATOM   583  C  CA    . GLN A 1 77  ? 35.680  -11.540 35.924 1.00 52.01 ? 106  GLN A CA    1 
ATOM   584  C  C     . GLN A 1 77  ? 35.474  -10.241 35.146 1.00 51.07 ? 106  GLN A C     1 
ATOM   585  O  O     . GLN A 1 77  ? 36.133  -9.233  35.406 1.00 51.34 ? 106  GLN A O     1 
ATOM   586  C  CB    . GLN A 1 77  ? 36.609  -12.493 35.168 1.00 54.05 ? 106  GLN A CB    1 
ATOM   587  C  CG    . GLN A 1 77  ? 38.073  -12.102 35.172 1.00 59.69 ? 106  GLN A CG    1 
ATOM   588  C  CD    . GLN A 1 77  ? 38.972  -13.244 34.724 1.00 62.49 ? 106  GLN A CD    1 
ATOM   589  O  OE1   . GLN A 1 77  ? 40.177  -13.066 34.524 1.00 62.62 ? 106  GLN A OE1   1 
ATOM   590  N  NE2   . GLN A 1 77  ? 38.386  -14.431 34.573 1.00 63.86 ? 106  GLN A NE2   1 
ATOM   591  N  N     . LEU A 1 78  ? 34.541  -10.276 34.199 1.00 49.79 ? 107  LEU A N     1 
ATOM   592  C  CA    . LEU A 1 78  ? 34.214  -9.112  33.388 1.00 48.12 ? 107  LEU A CA    1 
ATOM   593  C  C     . LEU A 1 78  ? 33.921  -7.931  34.298 1.00 47.92 ? 107  LEU A C     1 
ATOM   594  O  O     . LEU A 1 78  ? 34.445  -6.834  34.101 1.00 48.13 ? 107  LEU A O     1 
ATOM   595  C  CB    . LEU A 1 78  ? 32.984  -9.405  32.525 1.00 48.00 ? 107  LEU A CB    1 
ATOM   596  C  CG    . LEU A 1 78  ? 32.359  -8.241  31.749 1.00 47.57 ? 107  LEU A CG    1 
ATOM   597  C  CD1   . LEU A 1 78  ? 33.359  -7.685  30.745 1.00 47.78 ? 107  LEU A CD1   1 
ATOM   598  C  CD2   . LEU A 1 78  ? 31.104  -8.723  31.043 1.00 46.37 ? 107  LEU A CD2   1 
ATOM   599  N  N     . PHE A 1 79  ? 33.092  -8.172  35.307 1.00 47.32 ? 108  PHE A N     1 
ATOM   600  C  CA    . PHE A 1 79  ? 32.704  -7.136  36.254 1.00 47.35 ? 108  PHE A CA    1 
ATOM   601  C  C     . PHE A 1 79  ? 33.833  -6.632  37.153 1.00 47.79 ? 108  PHE A C     1 
ATOM   602  O  O     . PHE A 1 79  ? 33.884  -5.442  37.483 1.00 48.08 ? 108  PHE A O     1 
ATOM   603  C  CB    . PHE A 1 79  ? 31.533  -7.638  37.099 1.00 46.22 ? 108  PHE A CB    1 
ATOM   604  C  CG    . PHE A 1 79  ? 30.233  -7.687  36.351 1.00 47.02 ? 108  PHE A CG    1 
ATOM   605  C  CD1   . PHE A 1 79  ? 29.471  -6.535  36.183 1.00 47.60 ? 108  PHE A CD1   1 
ATOM   606  C  CD2   . PHE A 1 79  ? 29.789  -8.871  35.778 1.00 46.72 ? 108  PHE A CD2   1 
ATOM   607  C  CE1   . PHE A 1 79  ? 28.285  -6.565  35.454 1.00 47.39 ? 108  PHE A CE1   1 
ATOM   608  C  CE2   . PHE A 1 79  ? 28.605  -8.911  35.047 1.00 47.62 ? 108  PHE A CE2   1 
ATOM   609  C  CZ    . PHE A 1 79  ? 27.852  -7.755  34.884 1.00 46.29 ? 108  PHE A CZ    1 
ATOM   610  N  N     . VAL A 1 80  ? 34.738  -7.520  37.552 1.00 46.89 ? 109  VAL A N     1 
ATOM   611  C  CA    . VAL A 1 80  ? 35.848  -7.104  38.404 1.00 46.61 ? 109  VAL A CA    1 
ATOM   612  C  C     . VAL A 1 80  ? 36.904  -6.361  37.587 1.00 46.10 ? 109  VAL A C     1 
ATOM   613  O  O     . VAL A 1 80  ? 37.344  -5.276  37.972 1.00 45.79 ? 109  VAL A O     1 
ATOM   614  C  CB    . VAL A 1 80  ? 36.502  -8.307  39.117 1.00 46.85 ? 109  VAL A CB    1 
ATOM   615  C  CG1   . VAL A 1 80  ? 37.696  -7.840  39.932 1.00 47.40 ? 109  VAL A CG1   1 
ATOM   616  C  CG2   . VAL A 1 80  ? 35.488  -8.977  40.036 1.00 47.78 ? 109  VAL A CG2   1 
ATOM   617  N  N     . LEU A 1 81  ? 37.300  -6.939  36.457 1.00 45.62 ? 110  LEU A N     1 
ATOM   618  C  CA    . LEU A 1 81  ? 38.294  -6.313  35.589 1.00 46.90 ? 110  LEU A CA    1 
ATOM   619  C  C     . LEU A 1 81  ? 37.853  -4.916  35.150 1.00 48.06 ? 110  LEU A C     1 
ATOM   620  O  O     . LEU A 1 81  ? 38.635  -3.964  35.190 1.00 48.40 ? 110  LEU A O     1 
ATOM   621  C  CB    . LEU A 1 81  ? 38.543  -7.182  34.352 1.00 45.43 ? 110  LEU A CB    1 
ATOM   622  C  CG    . LEU A 1 81  ? 39.171  -8.553  34.607 1.00 45.60 ? 110  LEU A CG    1 
ATOM   623  C  CD1   . LEU A 1 81  ? 39.278  -9.313  33.301 1.00 45.37 ? 110  LEU A CD1   1 
ATOM   624  C  CD2   . LEU A 1 81  ? 40.540  -8.383  35.238 1.00 43.85 ? 110  LEU A CD2   1 
ATOM   625  N  N     . ALA A 1 82  ? 36.597  -4.800  34.730 1.00 48.37 ? 111  ALA A N     1 
ATOM   626  C  CA    . ALA A 1 82  ? 36.056  -3.525  34.283 1.00 49.51 ? 111  ALA A CA    1 
ATOM   627  C  C     . ALA A 1 82  ? 36.054  -2.507  35.415 1.00 50.79 ? 111  ALA A C     1 
ATOM   628  O  O     . ALA A 1 82  ? 36.349  -1.327  35.204 1.00 49.98 ? 111  ALA A O     1 
ATOM   629  C  CB    . ALA A 1 82  ? 34.635  -3.718  33.754 1.00 49.37 ? 111  ALA A CB    1 
ATOM   630  N  N     . GLY A 1 83  ? 35.722  -2.970  36.616 1.00 52.01 ? 112  GLY A N     1 
ATOM   631  C  CA    . GLY A 1 83  ? 35.671  -2.085  37.767 1.00 54.37 ? 112  GLY A CA    1 
ATOM   632  C  C     . GLY A 1 83  ? 37.021  -1.577  38.241 1.00 56.27 ? 112  GLY A C     1 
ATOM   633  O  O     . GLY A 1 83  ? 37.093  -0.623  39.019 1.00 55.55 ? 112  GLY A O     1 
ATOM   634  N  N     . ALA A 1 84  ? 38.092  -2.209  37.773 1.00 57.76 ? 113  ALA A N     1 
ATOM   635  C  CA    . ALA A 1 84  ? 39.440  -1.817  38.166 1.00 59.67 ? 113  ALA A CA    1 
ATOM   636  C  C     . ALA A 1 84  ? 40.215  -1.235  36.994 1.00 60.77 ? 113  ALA A C     1 
ATOM   637  O  O     . ALA A 1 84  ? 41.292  -0.668  37.178 1.00 60.96 ? 113  ALA A O     1 
ATOM   638  C  CB    . ALA A 1 84  ? 40.188  -3.019  38.738 1.00 59.40 ? 113  ALA A CB    1 
ATOM   639  N  N     . ALA A 1 85  ? 39.666  -1.379  35.791 1.00 61.55 ? 114  ALA A N     1 
ATOM   640  C  CA    . ALA A 1 85  ? 40.317  -0.867  34.592 1.00 62.26 ? 114  ALA A CA    1 
ATOM   641  C  C     . ALA A 1 85  ? 40.368  0.653   34.639 1.00 63.13 ? 114  ALA A C     1 
ATOM   642  O  O     . ALA A 1 85  ? 39.424  1.293   35.104 1.00 63.52 ? 114  ALA A O     1 
ATOM   643  C  CB    . ALA A 1 85  ? 39.559  -1.325  33.353 1.00 63.25 ? 114  ALA A CB    1 
ATOM   644  N  N     . GLU A 1 86  ? 41.471  1.232   34.171 1.00 63.23 ? 115  GLU A N     1 
ATOM   645  C  CA    . GLU A 1 86  ? 41.598  2.686   34.161 1.00 63.82 ? 115  GLU A CA    1 
ATOM   646  C  C     . GLU A 1 86  ? 40.917  3.207   32.906 1.00 62.66 ? 115  GLU A C     1 
ATOM   647  O  O     . GLU A 1 86  ? 41.106  2.664   31.817 1.00 62.14 ? 115  GLU A O     1 
ATOM   648  C  CB    . GLU A 1 86  ? 43.071  3.126   34.164 1.00 65.49 ? 115  GLU A CB    1 
ATOM   649  C  CG    . GLU A 1 86  ? 43.851  2.795   32.893 1.00 68.09 ? 115  GLU A CG    1 
ATOM   650  C  CD    . GLU A 1 86  ? 45.053  3.710   32.685 1.00 69.51 ? 115  GLU A CD    1 
ATOM   651  O  OE1   . GLU A 1 86  ? 44.853  4.903   32.371 1.00 69.76 ? 115  GLU A OE1   1 
ATOM   652  O  OE2   . GLU A 1 86  ? 46.199  3.240   32.841 1.00 69.46 ? 115  GLU A OE2   1 
ATOM   653  N  N     . GLU A 1 87  ? 40.118  4.256   33.058 1.00 61.93 ? 116  GLU A N     1 
ATOM   654  C  CA    . GLU A 1 87  ? 39.421  4.820   31.915 1.00 61.12 ? 116  GLU A CA    1 
ATOM   655  C  C     . GLU A 1 87  ? 40.419  5.190   30.830 1.00 59.72 ? 116  GLU A C     1 
ATOM   656  O  O     . GLU A 1 87  ? 41.383  5.911   31.087 1.00 58.99 ? 116  GLU A O     1 
ATOM   657  C  CB    . GLU A 1 87  ? 38.630  6.059   32.330 1.00 63.03 ? 116  GLU A CB    1 
ATOM   658  C  CG    . GLU A 1 87  ? 37.686  5.825   33.493 1.00 65.75 ? 116  GLU A CG    1 
ATOM   659  C  CD    . GLU A 1 87  ? 36.742  6.988   33.716 1.00 68.18 ? 116  GLU A CD    1 
ATOM   660  O  OE1   . GLU A 1 87  ? 37.219  8.143   33.783 1.00 69.14 ? 116  GLU A OE1   1 
ATOM   661  O  OE2   . GLU A 1 87  ? 35.521  6.746   33.829 1.00 69.53 ? 116  GLU A OE2   1 
ATOM   662  N  N     . GLY A 1 88  ? 40.196  4.675   29.625 1.00 58.24 ? 117  GLY A N     1 
ATOM   663  C  CA    . GLY A 1 88  ? 41.081  4.988   28.519 1.00 56.57 ? 117  GLY A CA    1 
ATOM   664  C  C     . GLY A 1 88  ? 41.916  3.844   27.982 1.00 55.89 ? 117  GLY A C     1 
ATOM   665  O  O     . GLY A 1 88  ? 42.406  3.917   26.855 1.00 56.67 ? 117  GLY A O     1 
ATOM   666  N  N     . PHE A 1 89  ? 42.084  2.783   28.763 1.00 54.45 ? 118  PHE A N     1 
ATOM   667  C  CA    . PHE A 1 89  ? 42.896  1.658   28.310 1.00 52.95 ? 118  PHE A CA    1 
ATOM   668  C  C     . PHE A 1 89  ? 42.222  0.315   28.569 1.00 50.94 ? 118  PHE A C     1 
ATOM   669  O  O     . PHE A 1 89  ? 41.471  0.167   29.530 1.00 49.09 ? 118  PHE A O     1 
ATOM   670  C  CB    . PHE A 1 89  ? 44.260  1.688   29.011 1.00 53.71 ? 118  PHE A CB    1 
ATOM   671  C  CG    . PHE A 1 89  ? 45.315  0.871   28.321 1.00 55.17 ? 118  PHE A CG    1 
ATOM   672  C  CD1   . PHE A 1 89  ? 45.873  1.303   27.119 1.00 55.38 ? 118  PHE A CD1   1 
ATOM   673  C  CD2   . PHE A 1 89  ? 45.736  -0.345  28.857 1.00 55.11 ? 118  PHE A CD2   1 
ATOM   674  C  CE1   . PHE A 1 89  ? 46.836  0.536   26.455 1.00 55.69 ? 118  PHE A CE1   1 
ATOM   675  C  CE2   . PHE A 1 89  ? 46.697  -1.120  28.202 1.00 54.80 ? 118  PHE A CE2   1 
ATOM   676  C  CZ    . PHE A 1 89  ? 47.247  -0.678  26.998 1.00 54.35 ? 118  PHE A CZ    1 
ATOM   677  N  N     . MET A 1 90  ? 42.495  -0.658  27.703 1.00 49.97 ? 119  MET A N     1 
ATOM   678  C  CA    . MET A 1 90  ? 41.927  -1.997  27.847 1.00 49.96 ? 119  MET A CA    1 
ATOM   679  C  C     . MET A 1 90  ? 43.021  -3.064  27.851 1.00 48.24 ? 119  MET A C     1 
ATOM   680  O  O     . MET A 1 90  ? 43.722  -3.259  26.858 1.00 46.81 ? 119  MET A O     1 
ATOM   681  C  CB    . MET A 1 90  ? 40.931  -2.295  26.718 1.00 51.04 ? 119  MET A CB    1 
ATOM   682  C  CG    . MET A 1 90  ? 40.353  -3.709  26.787 1.00 50.64 ? 119  MET A CG    1 
ATOM   683  S  SD    . MET A 1 90  ? 39.012  -4.022  25.615 1.00 52.34 ? 119  MET A SD    1 
ATOM   684  C  CE    . MET A 1 90  ? 37.634  -3.356  26.520 1.00 50.28 ? 119  MET A CE    1 
ATOM   685  N  N     . THR A 1 91  ? 43.149  -3.761  28.974 1.00 47.25 ? 120  THR A N     1 
ATOM   686  C  CA    . THR A 1 91  ? 44.161  -4.803  29.122 1.00 45.72 ? 120  THR A CA    1 
ATOM   687  C  C     . THR A 1 91  ? 43.859  -6.029  28.269 1.00 44.57 ? 120  THR A C     1 
ATOM   688  O  O     . THR A 1 91  ? 42.706  -6.284  27.923 1.00 44.83 ? 120  THR A O     1 
ATOM   689  C  CB    . THR A 1 91  ? 44.272  -5.258  30.586 1.00 44.44 ? 120  THR A CB    1 
ATOM   690  O  OG1   . THR A 1 91  ? 43.074  -5.944  30.966 1.00 43.47 ? 120  THR A OG1   1 
ATOM   691  C  CG2   . THR A 1 91  ? 44.471  -4.060  31.496 1.00 42.95 ? 120  THR A CG2   1 
ATOM   692  N  N     . ALA A 1 92  ? 44.903  -6.780  27.932 1.00 42.53 ? 121  ALA A N     1 
ATOM   693  C  CA    . ALA A 1 92  ? 44.751  -7.994  27.139 1.00 42.28 ? 121  ALA A CA    1 
ATOM   694  C  C     . ALA A 1 92  ? 43.851  -8.969  27.897 1.00 41.74 ? 121  ALA A C     1 
ATOM   695  O  O     . ALA A 1 92  ? 43.207  -9.836  27.305 1.00 38.01 ? 121  ALA A O     1 
ATOM   696  C  CB    . ALA A 1 92  ? 46.110  -8.632  26.896 1.00 43.37 ? 121  ALA A CB    1 
ATOM   697  N  N     . GLU A 1 93  ? 43.823  -8.818  29.216 1.00 41.44 ? 122  GLU A N     1 
ATOM   698  C  CA    . GLU A 1 93  ? 43.009  -9.675  30.067 1.00 42.58 ? 122  GLU A CA    1 
ATOM   699  C  C     . GLU A 1 93  ? 41.522  -9.404  29.812 1.00 40.61 ? 122  GLU A C     1 
ATOM   700  O  O     . GLU A 1 93  ? 40.766  -10.311 29.450 1.00 39.01 ? 122  GLU A O     1 
ATOM   701  C  CB    . GLU A 1 93  ? 43.345  -9.414  31.539 1.00 44.25 ? 122  GLU A CB    1 
ATOM   702  C  CG    . GLU A 1 93  ? 42.666  -10.358 32.520 1.00 49.21 ? 122  GLU A CG    1 
ATOM   703  C  CD    . GLU A 1 93  ? 43.152  -11.788 32.384 1.00 50.54 ? 122  GLU A CD    1 
ATOM   704  O  OE1   . GLU A 1 93  ? 44.371  -12.015 32.529 1.00 53.53 ? 122  GLU A OE1   1 
ATOM   705  O  OE2   . GLU A 1 93  ? 42.319  -12.683 32.137 1.00 51.27 ? 122  GLU A OE2   1 
ATOM   706  N  N     . LEU A 1 94  ? 41.110  -8.152  29.992 1.00 38.93 ? 123  LEU A N     1 
ATOM   707  C  CA    . LEU A 1 94  ? 39.717  -7.789  29.776 1.00 37.83 ? 123  LEU A CA    1 
ATOM   708  C  C     . LEU A 1 94  ? 39.311  -8.055  28.328 1.00 36.48 ? 123  LEU A C     1 
ATOM   709  O  O     . LEU A 1 94  ? 38.207  -8.533  28.069 1.00 36.13 ? 123  LEU A O     1 
ATOM   710  C  CB    . LEU A 1 94  ? 39.485  -6.314  30.130 1.00 37.62 ? 123  LEU A CB    1 
ATOM   711  C  CG    . LEU A 1 94  ? 38.031  -5.821  30.090 1.00 34.25 ? 123  LEU A CG    1 
ATOM   712  C  CD1   . LEU A 1 94  ? 37.149  -6.717  30.940 1.00 32.30 ? 123  LEU A CD1   1 
ATOM   713  C  CD2   . LEU A 1 94  ? 37.967  -4.390  30.597 1.00 35.68 ? 123  LEU A CD2   1 
ATOM   714  N  N     . ALA A 1 95  ? 40.204  -7.756  27.389 1.00 34.23 ? 124  ALA A N     1 
ATOM   715  C  CA    . ALA A 1 95  ? 39.913  -7.980  25.975 1.00 34.12 ? 124  ALA A CA    1 
ATOM   716  C  C     . ALA A 1 95  ? 39.559  -9.442  25.740 1.00 34.43 ? 124  ALA A C     1 
ATOM   717  O  O     . ALA A 1 95  ? 38.594  -9.755  25.036 1.00 34.95 ? 124  ALA A O     1 
ATOM   718  C  CB    . ALA A 1 95  ? 41.115  -7.595  25.116 1.00 34.77 ? 124  ALA A CB    1 
ATOM   719  N  N     . GLY A 1 96  ? 40.349  -10.339 26.329 1.00 34.04 ? 125  GLY A N     1 
ATOM   720  C  CA    . GLY A 1 96  ? 40.094  -11.759 26.172 1.00 31.94 ? 125  GLY A CA    1 
ATOM   721  C  C     . GLY A 1 96  ? 38.773  -12.165 26.802 1.00 31.66 ? 125  GLY A C     1 
ATOM   722  O  O     . GLY A 1 96  ? 37.996  -12.906 26.207 1.00 30.46 ? 125  GLY A O     1 
ATOM   723  N  N     . VAL A 1 97  ? 38.521  -11.681 28.013 1.00 32.85 ? 126  VAL A N     1 
ATOM   724  C  CA    . VAL A 1 97  ? 37.281  -11.997 28.710 1.00 36.89 ? 126  VAL A CA    1 
ATOM   725  C  C     . VAL A 1 97  ? 36.077  -11.620 27.846 1.00 38.05 ? 126  VAL A C     1 
ATOM   726  O  O     . VAL A 1 97  ? 35.135  -12.401 27.706 1.00 38.58 ? 126  VAL A O     1 
ATOM   727  C  CB    . VAL A 1 97  ? 37.188  -11.243 30.054 1.00 37.73 ? 126  VAL A CB    1 
ATOM   728  C  CG1   . VAL A 1 97  ? 35.817  -11.443 30.672 1.00 38.99 ? 126  VAL A CG1   1 
ATOM   729  C  CG2   . VAL A 1 97  ? 38.262  -11.743 31.002 1.00 38.06 ? 126  VAL A CG2   1 
ATOM   730  N  N     . ILE A 1 98  ? 36.121  -10.423 27.264 1.00 37.87 ? 127  ILE A N     1 
ATOM   731  C  CA    . ILE A 1 98  ? 35.040  -9.939  26.419 1.00 36.28 ? 127  ILE A CA    1 
ATOM   732  C  C     . ILE A 1 98  ? 34.933  -10.742 25.128 1.00 37.25 ? 127  ILE A C     1 
ATOM   733  O  O     . ILE A 1 98  ? 33.835  -11.145 24.745 1.00 38.44 ? 127  ILE A O     1 
ATOM   734  C  CB    . ILE A 1 98  ? 35.215  -8.429  26.105 1.00 35.97 ? 127  ILE A CB    1 
ATOM   735  C  CG1   . ILE A 1 98  ? 35.082  -7.624  27.406 1.00 35.04 ? 127  ILE A CG1   1 
ATOM   736  C  CG2   . ILE A 1 98  ? 34.175  -7.971  25.089 1.00 34.04 ? 127  ILE A CG2   1 
ATOM   737  C  CD1   . ILE A 1 98  ? 35.282  -6.134  27.250 1.00 34.38 ? 127  ILE A CD1   1 
ATOM   738  N  N     . LYS A 1 99  ? 36.059  -10.982 24.457 1.00 38.14 ? 128  LYS A N     1 
ATOM   739  C  CA    . LYS A 1 99  ? 36.041  -11.762 23.217 1.00 38.08 ? 128  LYS A CA    1 
ATOM   740  C  C     . LYS A 1 99  ? 35.464  -13.167 23.427 1.00 38.11 ? 128  LYS A C     1 
ATOM   741  O  O     . LYS A 1 99  ? 34.735  -13.674 22.573 1.00 38.26 ? 128  LYS A O     1 
ATOM   742  C  CB    . LYS A 1 99  ? 37.449  -11.876 22.610 1.00 38.30 ? 128  LYS A CB    1 
ATOM   743  C  CG    . LYS A 1 99  ? 37.893  -10.655 21.805 1.00 40.44 ? 128  LYS A CG    1 
ATOM   744  C  CD    . LYS A 1 99  ? 39.249  -10.872 21.115 1.00 40.78 ? 128  LYS A CD    1 
ATOM   745  C  CE    . LYS A 1 99  ? 39.655  -9.639  20.300 1.00 43.24 ? 128  LYS A CE    1 
ATOM   746  N  NZ    . LYS A 1 99  ? 40.952  -9.778  19.561 1.00 40.46 ? 128  LYS A NZ    1 
ATOM   747  N  N     . ARG A 1 100 ? 35.783  -13.797 24.556 1.00 37.46 ? 129  ARG A N     1 
ATOM   748  C  CA    . ARG A 1 100 ? 35.266  -15.140 24.826 1.00 38.52 ? 129  ARG A CA    1 
ATOM   749  C  C     . ARG A 1 100 ? 33.746  -15.133 25.072 1.00 38.81 ? 129  ARG A C     1 
ATOM   750  O  O     . ARG A 1 100 ? 33.029  -16.019 24.602 1.00 36.72 ? 129  ARG A O     1 
ATOM   751  C  CB    . ARG A 1 100 ? 35.998  -15.777 26.019 1.00 35.74 ? 129  ARG A CB    1 
ATOM   752  C  CG    . ARG A 1 100 ? 37.466  -16.122 25.732 1.00 37.70 ? 129  ARG A CG    1 
ATOM   753  C  CD    . ARG A 1 100 ? 38.022  -17.133 26.729 1.00 35.47 ? 129  ARG A CD    1 
ATOM   754  N  NE    . ARG A 1 100 ? 38.039  -16.626 28.098 1.00 36.50 ? 129  ARG A NE    1 
ATOM   755  C  CZ    . ARG A 1 100 ? 39.086  -16.043 28.671 1.00 37.22 ? 129  ARG A CZ    1 
ATOM   756  N  NH1   . ARG A 1 100 ? 40.216  -15.893 27.993 1.00 39.06 ? 129  ARG A NH1   1 
ATOM   757  N  NH2   . ARG A 1 100 ? 39.001  -15.603 29.922 1.00 35.03 ? 129  ARG A NH2   1 
ATOM   758  N  N     . LEU A 1 101 ? 33.264  -14.130 25.802 1.00 38.41 ? 130  LEU A N     1 
ATOM   759  C  CA    . LEU A 1 101 ? 31.836  -14.006 26.080 1.00 38.38 ? 130  LEU A CA    1 
ATOM   760  C  C     . LEU A 1 101 ? 31.054  -13.703 24.796 1.00 38.26 ? 130  LEU A C     1 
ATOM   761  O  O     . LEU A 1 101 ? 30.065  -14.367 24.492 1.00 39.50 ? 130  LEU A O     1 
ATOM   762  C  CB    . LEU A 1 101 ? 31.597  -12.899 27.108 1.00 36.65 ? 130  LEU A CB    1 
ATOM   763  C  CG    . LEU A 1 101 ? 32.002  -13.208 28.550 1.00 36.41 ? 130  LEU A CG    1 
ATOM   764  C  CD1   . LEU A 1 101 ? 32.021  -11.928 29.375 1.00 35.98 ? 130  LEU A CD1   1 
ATOM   765  C  CD2   . LEU A 1 101 ? 31.029  -14.219 29.146 1.00 36.29 ? 130  LEU A CD2   1 
ATOM   766  N  N     . TRP A 1 102 ? 31.505  -12.704 24.042 1.00 38.48 ? 131  TRP A N     1 
ATOM   767  C  CA    . TRP A 1 102 ? 30.847  -12.318 22.790 1.00 37.40 ? 131  TRP A CA    1 
ATOM   768  C  C     . TRP A 1 102 ? 30.783  -13.508 21.837 1.00 39.09 ? 131  TRP A C     1 
ATOM   769  O  O     . TRP A 1 102 ? 29.859  -13.632 21.032 1.00 40.52 ? 131  TRP A O     1 
ATOM   770  C  CB    . TRP A 1 102 ? 31.613  -11.153 22.139 1.00 33.88 ? 131  TRP A CB    1 
ATOM   771  C  CG    . TRP A 1 102 ? 31.074  -10.673 20.804 1.00 29.65 ? 131  TRP A CG    1 
ATOM   772  C  CD1   . TRP A 1 102 ? 31.777  -10.547 19.637 1.00 27.68 ? 131  TRP A CD1   1 
ATOM   773  C  CD2   . TRP A 1 102 ? 29.735  -10.248 20.509 1.00 27.76 ? 131  TRP A CD2   1 
ATOM   774  N  NE1   . TRP A 1 102 ? 30.961  -10.072 18.634 1.00 27.06 ? 131  TRP A NE1   1 
ATOM   775  C  CE2   . TRP A 1 102 ? 29.703  -9.881  19.142 1.00 28.47 ? 131  TRP A CE2   1 
ATOM   776  C  CE3   . TRP A 1 102 ? 28.560  -10.140 21.265 1.00 27.21 ? 131  TRP A CE3   1 
ATOM   777  C  CZ2   . TRP A 1 102 ? 28.539  -9.417  18.517 1.00 26.89 ? 131  TRP A CZ2   1 
ATOM   778  C  CZ3   . TRP A 1 102 ? 27.401  -9.676  20.640 1.00 23.86 ? 131  TRP A CZ3   1 
ATOM   779  C  CH2   . TRP A 1 102 ? 27.402  -9.323  19.283 1.00 27.61 ? 131  TRP A CH2   1 
ATOM   780  N  N     . LYS A 1 103 ? 31.771  -14.388 21.951 1.00 41.06 ? 132  LYS A N     1 
ATOM   781  C  CA    . LYS A 1 103 ? 31.873  -15.578 21.112 1.00 42.00 ? 132  LYS A CA    1 
ATOM   782  C  C     . LYS A 1 103 ? 30.952  -16.721 21.552 1.00 39.49 ? 132  LYS A C     1 
ATOM   783  O  O     . LYS A 1 103 ? 30.529  -17.534 20.731 1.00 38.38 ? 132  LYS A O     1 
ATOM   784  C  CB    . LYS A 1 103 ? 33.328  -16.059 21.104 1.00 44.16 ? 132  LYS A CB    1 
ATOM   785  C  CG    . LYS A 1 103 ? 33.563  -17.373 20.386 1.00 48.53 ? 132  LYS A CG    1 
ATOM   786  C  CD    . LYS A 1 103 ? 35.051  -17.691 20.304 1.00 50.78 ? 132  LYS A CD    1 
ATOM   787  C  CE    . LYS A 1 103 ? 35.289  -19.060 19.688 1.00 52.02 ? 132  LYS A CE    1 
ATOM   788  N  NZ    . LYS A 1 103 ? 36.742  -19.366 19.555 1.00 54.37 ? 132  LYS A NZ    1 
ATOM   789  N  N     . ASP A 1 104 ? 30.652  -16.777 22.846 1.00 38.51 ? 133  ASP A N     1 
ATOM   790  C  CA    . ASP A 1 104 ? 29.792  -17.823 23.403 1.00 38.55 ? 133  ASP A CA    1 
ATOM   791  C  C     . ASP A 1 104 ? 28.447  -17.919 22.680 1.00 37.59 ? 133  ASP A C     1 
ATOM   792  O  O     . ASP A 1 104 ? 27.810  -16.902 22.391 1.00 36.53 ? 133  ASP A O     1 
ATOM   793  C  CB    . ASP A 1 104 ? 29.558  -17.559 24.887 1.00 39.49 ? 133  ASP A CB    1 
ATOM   794  C  CG    . ASP A 1 104 ? 28.817  -18.690 25.566 1.00 41.76 ? 133  ASP A CG    1 
ATOM   795  O  OD1   . ASP A 1 104 ? 29.420  -19.775 25.726 1.00 42.82 ? 133  ASP A OD1   1 
ATOM   796  O  OD2   . ASP A 1 104 ? 27.636  -18.499 25.932 1.00 38.70 ? 133  ASP A OD2   1 
ATOM   797  N  N     . SER A 1 105 ? 28.016  -19.146 22.394 1.00 37.07 ? 134  SER A N     1 
ATOM   798  C  CA    . SER A 1 105 ? 26.755  -19.375 21.685 1.00 35.54 ? 134  SER A CA    1 
ATOM   799  C  C     . SER A 1 105 ? 25.543  -18.943 22.512 1.00 34.33 ? 134  SER A C     1 
ATOM   800  O  O     . SER A 1 105 ? 24.520  -18.541 21.961 1.00 34.63 ? 134  SER A O     1 
ATOM   801  C  CB    . SER A 1 105 ? 26.618  -20.856 21.299 1.00 33.95 ? 134  SER A CB    1 
ATOM   802  O  OG    . SER A 1 105 ? 26.536  -21.677 22.452 1.00 32.21 ? 134  SER A OG    1 
ATOM   803  N  N     . GLY A 1 106 ? 25.662  -19.044 23.831 1.00 34.47 ? 135  GLY A N     1 
ATOM   804  C  CA    . GLY A 1 106 ? 24.577  -18.640 24.708 1.00 34.15 ? 135  GLY A CA    1 
ATOM   805  C  C     . GLY A 1 106 ? 24.437  -17.126 24.668 1.00 34.36 ? 135  GLY A C     1 
ATOM   806  O  O     . GLY A 1 106 ? 23.327  -16.582 24.606 1.00 33.45 ? 135  GLY A O     1 
ATOM   807  N  N     . VAL A 1 107 ? 25.578  -16.445 24.705 1.00 32.28 ? 136  VAL A N     1 
ATOM   808  C  CA    . VAL A 1 107 ? 25.607  -14.993 24.651 1.00 30.76 ? 136  VAL A CA    1 
ATOM   809  C  C     . VAL A 1 107 ? 25.043  -14.542 23.310 1.00 29.13 ? 136  VAL A C     1 
ATOM   810  O  O     . VAL A 1 107 ? 24.265  -13.595 23.247 1.00 28.99 ? 136  VAL A O     1 
ATOM   811  C  CB    . VAL A 1 107 ? 27.054  -14.457 24.817 1.00 30.66 ? 136  VAL A CB    1 
ATOM   812  C  CG1   . VAL A 1 107 ? 27.115  -12.980 24.453 1.00 28.85 ? 136  VAL A CG1   1 
ATOM   813  C  CG2   . VAL A 1 107 ? 27.510  -14.654 26.260 1.00 30.91 ? 136  VAL A CG2   1 
ATOM   814  N  N     . GLN A 1 108 ? 25.427  -15.226 22.237 1.00 28.44 ? 137  GLN A N     1 
ATOM   815  C  CA    . GLN A 1 108 ? 24.926  -14.871 20.917 1.00 28.58 ? 137  GLN A CA    1 
ATOM   816  C  C     . GLN A 1 108 ? 23.415  -15.101 20.827 1.00 29.83 ? 137  GLN A C     1 
ATOM   817  O  O     . GLN A 1 108 ? 22.701  -14.325 20.194 1.00 30.17 ? 137  GLN A O     1 
ATOM   818  C  CB    . GLN A 1 108 ? 25.644  -15.676 19.827 1.00 29.25 ? 137  GLN A CB    1 
ATOM   819  C  CG    . GLN A 1 108 ? 27.006  -15.107 19.419 1.00 29.72 ? 137  GLN A CG    1 
ATOM   820  C  CD    . GLN A 1 108 ? 26.927  -13.647 18.970 1.00 30.91 ? 137  GLN A CD    1 
ATOM   821  O  OE1   . GLN A 1 108 ? 26.198  -13.307 18.036 1.00 29.16 ? 137  GLN A OE1   1 
ATOM   822  N  NE2   . GLN A 1 108 ? 27.686  -12.782 19.635 1.00 31.49 ? 137  GLN A NE2   1 
ATOM   823  N  N     . ALA A 1 109 ? 22.931  -16.158 21.472 1.00 29.28 ? 138  ALA A N     1 
ATOM   824  C  CA    . ALA A 1 109 ? 21.508  -16.467 21.463 1.00 29.14 ? 138  ALA A CA    1 
ATOM   825  C  C     . ALA A 1 109 ? 20.747  -15.321 22.118 1.00 29.07 ? 138  ALA A C     1 
ATOM   826  O  O     . ALA A 1 109 ? 19.682  -14.918 21.649 1.00 27.09 ? 138  ALA A O     1 
ATOM   827  C  CB    . ALA A 1 109 ? 21.246  -17.769 22.213 1.00 30.60 ? 138  ALA A CB    1 
ATOM   828  N  N     . CYS A 1 110 ? 21.304  -14.795 23.204 1.00 28.29 ? 139  CYS A N     1 
ATOM   829  C  CA    . CYS A 1 110 ? 20.669  -13.689 23.905 1.00 27.74 ? 139  CYS A CA    1 
ATOM   830  C  C     . CYS A 1 110 ? 20.773  -12.433 23.042 1.00 27.53 ? 139  CYS A C     1 
ATOM   831  O  O     . CYS A 1 110 ? 19.822  -11.660 22.936 1.00 27.82 ? 139  CYS A O     1 
ATOM   832  C  CB    . CYS A 1 110 ? 21.340  -13.455 25.259 1.00 28.49 ? 139  CYS A CB    1 
ATOM   833  S  SG    . CYS A 1 110 ? 20.486  -12.240 26.303 1.00 27.11 ? 139  CYS A SG    1 
ATOM   834  N  N     . PHE A 1 111 ? 21.929  -12.230 22.422 1.00 24.83 ? 140  PHE A N     1 
ATOM   835  C  CA    . PHE A 1 111 ? 22.105  -11.067 21.567 1.00 24.97 ? 140  PHE A CA    1 
ATOM   836  C  C     . PHE A 1 111 ? 21.050  -11.073 20.467 1.00 23.82 ? 140  PHE A C     1 
ATOM   837  O  O     . PHE A 1 111 ? 20.513  -10.030 20.113 1.00 23.35 ? 140  PHE A O     1 
ATOM   838  C  CB    . PHE A 1 111 ? 23.495  -11.059 20.918 1.00 23.05 ? 140  PHE A CB    1 
ATOM   839  C  CG    . PHE A 1 111 ? 23.636  -10.037 19.828 1.00 24.23 ? 140  PHE A CG    1 
ATOM   840  C  CD1   . PHE A 1 111 ? 23.765  -8.683  20.134 1.00 21.68 ? 140  PHE A CD1   1 
ATOM   841  C  CD2   . PHE A 1 111 ? 23.591  -10.421 18.487 1.00 24.30 ? 140  PHE A CD2   1 
ATOM   842  C  CE1   . PHE A 1 111 ? 23.845  -7.727  19.124 1.00 22.02 ? 140  PHE A CE1   1 
ATOM   843  C  CE2   . PHE A 1 111 ? 23.669  -9.465  17.462 1.00 23.44 ? 140  PHE A CE2   1 
ATOM   844  C  CZ    . PHE A 1 111 ? 23.796  -8.119  17.783 1.00 22.43 ? 140  PHE A CZ    1 
ATOM   845  N  N     . ASN A 1 112 ? 20.760  -12.254 19.927 1.00 24.49 ? 141  ASN A N     1 
ATOM   846  C  CA    . ASN A 1 112 ? 19.778  -12.365 18.855 1.00 26.14 ? 141  ASN A CA    1 
ATOM   847  C  C     . ASN A 1 112 ? 18.322  -12.204 19.300 1.00 26.19 ? 141  ASN A C     1 
ATOM   848  O  O     . ASN A 1 112 ? 17.417  -12.099 18.470 1.00 25.66 ? 141  ASN A O     1 
ATOM   849  C  CB    . ASN A 1 112 ? 19.974  -13.678 18.105 1.00 27.08 ? 141  ASN A CB    1 
ATOM   850  C  CG    . ASN A 1 112 ? 21.256  -13.686 17.293 1.00 29.65 ? 141  ASN A CG    1 
ATOM   851  O  OD1   . ASN A 1 112 ? 21.601  -12.688 16.657 1.00 30.79 ? 141  ASN A OD1   1 
ATOM   852  N  ND2   . ASN A 1 112 ? 21.963  -14.809 17.301 1.00 29.46 ? 141  ASN A ND2   1 
ATOM   853  N  N     . ARG A 1 113 ? 18.100  -12.167 20.608 1.00 24.37 ? 142  ARG A N     1 
ATOM   854  C  CA    . ARG A 1 113 ? 16.760  -11.968 21.140 1.00 23.78 ? 142  ARG A CA    1 
ATOM   855  C  C     . ARG A 1 113 ? 16.688  -10.586 21.800 1.00 24.10 ? 142  ARG A C     1 
ATOM   856  O  O     . ARG A 1 113 ? 15.911  -10.364 22.726 1.00 24.42 ? 142  ARG A O     1 
ATOM   857  C  CB    . ARG A 1 113 ? 16.437  -13.065 22.154 1.00 23.56 ? 142  ARG A CB    1 
ATOM   858  C  CG    . ARG A 1 113 ? 16.157  -14.427 21.510 1.00 22.14 ? 142  ARG A CG    1 
ATOM   859  C  CD    . ARG A 1 113 ? 16.120  -15.523 22.561 1.00 22.60 ? 142  ARG A CD    1 
ATOM   860  N  NE    . ARG A 1 113 ? 15.116  -15.251 23.586 1.00 23.66 ? 142  ARG A NE    1 
ATOM   861  C  CZ    . ARG A 1 113 ? 14.854  -16.054 24.615 1.00 27.66 ? 142  ARG A CZ    1 
ATOM   862  N  NH1   . ARG A 1 113 ? 15.526  -17.190 24.761 1.00 23.51 ? 142  ARG A NH1   1 
ATOM   863  N  NH2   . ARG A 1 113 ? 13.911  -15.724 25.498 1.00 24.74 ? 142  ARG A NH2   1 
ATOM   864  N  N     . SER A 1 114 ? 17.506  -9.659  21.311 1.00 24.54 ? 143  SER A N     1 
ATOM   865  C  CA    . SER A 1 114 ? 17.556  -8.304  21.856 1.00 24.52 ? 143  SER A CA    1 
ATOM   866  C  C     . SER A 1 114 ? 16.212  -7.576  21.841 1.00 24.13 ? 143  SER A C     1 
ATOM   867  O  O     . SER A 1 114 ? 16.031  -6.606  22.584 1.00 24.24 ? 143  SER A O     1 
ATOM   868  C  CB    . SER A 1 114 ? 18.604  -7.461  21.109 1.00 24.36 ? 143  SER A CB    1 
ATOM   869  O  OG    . SER A 1 114 ? 18.252  -7.291  19.745 1.00 25.25 ? 143  SER A OG    1 
ATOM   870  N  N     . ARG A 1 115 ? 15.273  -8.026  21.010 1.00 22.24 ? 144  ARG A N     1 
ATOM   871  C  CA    . ARG A 1 115 ? 13.958  -7.377  20.962 1.00 22.76 ? 144  ARG A CA    1 
ATOM   872  C  C     . ARG A 1 115 ? 13.243  -7.517  22.307 1.00 20.91 ? 144  ARG A C     1 
ATOM   873  O  O     . ARG A 1 115 ? 12.330  -6.753  22.615 1.00 20.28 ? 144  ARG A O     1 
ATOM   874  C  CB    . ARG A 1 115 ? 13.077  -7.981  19.848 1.00 23.56 ? 144  ARG A CB    1 
ATOM   875  C  CG    . ARG A 1 115 ? 12.870  -9.487  19.958 1.00 26.53 ? 144  ARG A CG    1 
ATOM   876  C  CD    . ARG A 1 115 ? 12.039  -10.072 18.804 1.00 25.59 ? 144  ARG A CD    1 
ATOM   877  N  NE    . ARG A 1 115 ? 10.693  -9.527  18.818 1.00 29.82 ? 144  ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1 115 ? 9.574   -10.226 18.976 1.00 23.86 ? 144  ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1 115 ? 9.587   -11.539 19.131 1.00 21.06 ? 144  ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1 115 ? 8.425   -9.580  18.995 1.00 28.56 ? 144  ARG A NH2   1 
ATOM   881  N  N     . GLU A 1 116 ? 13.670  -8.491  23.105 1.00 21.76 ? 145  GLU A N     1 
ATOM   882  C  CA    . GLU A 1 116 ? 13.067  -8.748  24.416 1.00 22.37 ? 145  GLU A CA    1 
ATOM   883  C  C     . GLU A 1 116 ? 13.572  -7.879  25.564 1.00 21.27 ? 145  GLU A C     1 
ATOM   884  O  O     . GLU A 1 116 ? 13.002  -7.883  26.654 1.00 22.99 ? 145  GLU A O     1 
ATOM   885  C  CB    . GLU A 1 116 ? 13.225  -10.222 24.766 1.00 22.33 ? 145  GLU A CB    1 
ATOM   886  C  CG    . GLU A 1 116 ? 12.470  -11.117 23.792 1.00 25.98 ? 145  GLU A CG    1 
ATOM   887  C  CD    . GLU A 1 116 ? 12.602  -12.582 24.118 1.00 26.13 ? 145  GLU A CD    1 
ATOM   888  O  OE1   . GLU A 1 116 ? 12.255  -12.954 25.257 1.00 29.25 ? 145  GLU A OE1   1 
ATOM   889  O  OE2   . GLU A 1 116 ? 13.053  -13.354 23.239 1.00 28.77 ? 145  GLU A OE2   1 
ATOM   890  N  N     . TYR A 1 117 ? 14.649  -7.146  25.330 1.00 21.05 ? 146  TYR A N     1 
ATOM   891  C  CA    . TYR A 1 117 ? 15.182  -6.247  26.345 1.00 21.14 ? 146  TYR A CA    1 
ATOM   892  C  C     . TYR A 1 117 ? 15.627  -4.996  25.612 1.00 20.87 ? 146  TYR A C     1 
ATOM   893  O  O     . TYR A 1 117 ? 15.228  -4.798  24.467 1.00 23.13 ? 146  TYR A O     1 
ATOM   894  C  CB    . TYR A 1 117 ? 16.332  -6.893  27.146 1.00 20.72 ? 146  TYR A CB    1 
ATOM   895  C  CG    . TYR A 1 117 ? 17.442  -7.546  26.346 1.00 21.68 ? 146  TYR A CG    1 
ATOM   896  C  CD1   . TYR A 1 117 ? 17.296  -8.835  25.836 1.00 22.74 ? 146  TYR A CD1   1 
ATOM   897  C  CD2   . TYR A 1 117 ? 18.648  -6.881  26.122 1.00 22.12 ? 146  TYR A CD2   1 
ATOM   898  C  CE1   . TYR A 1 117 ? 18.328  -9.452  25.119 1.00 23.12 ? 146  TYR A CE1   1 
ATOM   899  C  CE2   . TYR A 1 117 ? 19.684  -7.483  25.404 1.00 21.47 ? 146  TYR A CE2   1 
ATOM   900  C  CZ    . TYR A 1 117 ? 19.517  -8.764  24.906 1.00 23.10 ? 146  TYR A CZ    1 
ATOM   901  O  OH    . TYR A 1 117 ? 20.520  -9.345  24.167 1.00 24.35 ? 146  TYR A OH    1 
ATOM   902  N  N     . GLN A 1 118 ? 16.422  -4.141  26.241 1.00 23.14 ? 147  GLN A N     1 
ATOM   903  C  CA    . GLN A 1 118 ? 16.849  -2.914  25.574 1.00 26.14 ? 147  GLN A CA    1 
ATOM   904  C  C     . GLN A 1 118 ? 18.358  -2.815  25.389 1.00 26.40 ? 147  GLN A C     1 
ATOM   905  O  O     . GLN A 1 118 ? 19.081  -2.411  26.302 1.00 30.03 ? 147  GLN A O     1 
ATOM   906  C  CB    . GLN A 1 118 ? 16.335  -1.698  26.346 1.00 29.03 ? 147  GLN A CB    1 
ATOM   907  C  CG    . GLN A 1 118 ? 14.814  -1.672  26.501 1.00 34.51 ? 147  GLN A CG    1 
ATOM   908  C  CD    . GLN A 1 118 ? 14.299  -0.353  27.073 1.00 40.40 ? 147  GLN A CD    1 
ATOM   909  O  OE1   . GLN A 1 118 ? 14.092  0.618   26.340 1.00 42.40 ? 147  GLN A OE1   1 
ATOM   910  N  NE2   . GLN A 1 118 ? 14.101  -0.313  28.390 1.00 37.81 ? 147  GLN A NE2   1 
ATOM   911  N  N     . LEU A 1 119 ? 18.831  -3.176  24.200 1.00 23.39 ? 148  LEU A N     1 
ATOM   912  C  CA    . LEU A 1 119 ? 20.262  -3.144  23.907 1.00 22.49 ? 148  LEU A CA    1 
ATOM   913  C  C     . LEU A 1 119 ? 20.589  -2.035  22.914 1.00 20.85 ? 148  LEU A C     1 
ATOM   914  O  O     . LEU A 1 119 ? 19.995  -1.964  21.839 1.00 20.67 ? 148  LEU A O     1 
ATOM   915  C  CB    . LEU A 1 119 ? 20.710  -4.499  23.336 1.00 19.37 ? 148  LEU A CB    1 
ATOM   916  C  CG    . LEU A 1 119 ? 22.202  -4.671  23.024 1.00 20.90 ? 148  LEU A CG    1 
ATOM   917  C  CD1   . LEU A 1 119 ? 22.996  -4.620  24.328 1.00 15.12 ? 148  LEU A CD1   1 
ATOM   918  C  CD2   . LEU A 1 119 ? 22.439  -6.006  22.284 1.00 17.96 ? 148  LEU A CD2   1 
ATOM   919  N  N     . ASN A 1 120 ? 21.541  -1.175  23.263 1.00 21.89 ? 149  ASN A N     1 
ATOM   920  C  CA    . ASN A 1 120 ? 21.913  -0.074  22.376 1.00 23.27 ? 149  ASN A CA    1 
ATOM   921  C  C     . ASN A 1 120 ? 22.418  -0.615  21.037 1.00 24.49 ? 149  ASN A C     1 
ATOM   922  O  O     . ASN A 1 120 ? 23.018  -1.694  20.972 1.00 24.36 ? 149  ASN A O     1 
ATOM   923  C  CB    . ASN A 1 120 ? 22.977  0.811   23.032 1.00 21.91 ? 149  ASN A CB    1 
ATOM   924  C  CG    . ASN A 1 120 ? 24.370  0.229   22.928 1.00 22.30 ? 149  ASN A CG    1 
ATOM   925  O  OD1   . ASN A 1 120 ? 25.106  0.526   21.987 1.00 24.00 ? 149  ASN A OD1   1 
ATOM   926  N  ND2   . ASN A 1 120 ? 24.735  -0.617  23.887 1.00 21.75 ? 149  ASN A ND2   1 
ATOM   927  N  N     . ASP A 1 121 ? 22.169  0.141   19.973 1.00 23.83 ? 150  ASP A N     1 
ATOM   928  C  CA    . ASP A 1 121 ? 22.570  -0.270  18.633 1.00 25.25 ? 150  ASP A CA    1 
ATOM   929  C  C     . ASP A 1 121 ? 24.031  -0.062  18.261 1.00 25.25 ? 150  ASP A C     1 
ATOM   930  O  O     . ASP A 1 121 ? 24.398  -0.181  17.093 1.00 27.01 ? 150  ASP A O     1 
ATOM   931  C  CB    . ASP A 1 121 ? 21.668  0.392   17.588 1.00 22.48 ? 150  ASP A CB    1 
ATOM   932  C  CG    . ASP A 1 121 ? 20.302  -0.265  17.510 1.00 22.28 ? 150  ASP A CG    1 
ATOM   933  O  OD1   . ASP A 1 121 ? 20.249  -1.515  17.557 1.00 23.80 ? 150  ASP A OD1   1 
ATOM   934  O  OD2   . ASP A 1 121 ? 19.287  0.453   17.388 1.00 20.98 ? 150  ASP A OD2   1 
ATOM   935  N  N     . SER A 1 122 ? 24.870  0.245   19.242 1.00 26.24 ? 151  SER A N     1 
ATOM   936  C  CA    . SER A 1 122 ? 26.293  0.404   18.968 1.00 27.57 ? 151  SER A CA    1 
ATOM   937  C  C     . SER A 1 122 ? 27.014  -0.844  19.484 1.00 28.20 ? 151  SER A C     1 
ATOM   938  O  O     . SER A 1 122 ? 28.191  -1.061  19.192 1.00 29.33 ? 151  SER A O     1 
ATOM   939  C  CB    . SER A 1 122 ? 26.847  1.658   19.654 1.00 28.12 ? 151  SER A CB    1 
ATOM   940  O  OG    . SER A 1 122 ? 26.443  2.835   18.973 1.00 31.34 ? 151  SER A OG    1 
ATOM   941  N  N     . ALA A 1 123 ? 26.289  -1.665  20.240 1.00 27.52 ? 152  ALA A N     1 
ATOM   942  C  CA    . ALA A 1 123 ? 26.841  -2.885  20.822 1.00 29.03 ? 152  ALA A CA    1 
ATOM   943  C  C     . ALA A 1 123 ? 27.564  -3.779  19.813 1.00 29.91 ? 152  ALA A C     1 
ATOM   944  O  O     . ALA A 1 123 ? 28.741  -4.094  19.988 1.00 27.37 ? 152  ALA A O     1 
ATOM   945  C  CB    . ALA A 1 123 ? 25.734  -3.674  21.514 1.00 27.35 ? 152  ALA A CB    1 
ATOM   946  N  N     . ALA A 1 124 ? 26.855  -4.189  18.765 1.00 31.27 ? 153  ALA A N     1 
ATOM   947  C  CA    . ALA A 1 124 ? 27.437  -5.050  17.733 1.00 33.67 ? 153  ALA A CA    1 
ATOM   948  C  C     . ALA A 1 124 ? 28.613  -4.370  17.033 1.00 34.40 ? 153  ALA A C     1 
ATOM   949  O  O     . ALA A 1 124 ? 29.649  -4.991  16.807 1.00 36.28 ? 153  ALA A O     1 
ATOM   950  C  CB    . ALA A 1 124 ? 26.372  -5.429  16.704 1.00 31.49 ? 153  ALA A CB    1 
ATOM   951  N  N     . TYR A 1 125 ? 28.439  -3.097  16.691 1.00 35.71 ? 154  TYR A N     1 
ATOM   952  C  CA    . TYR A 1 125 ? 29.474  -2.320  16.012 1.00 35.89 ? 154  TYR A CA    1 
ATOM   953  C  C     . TYR A 1 125 ? 30.828  -2.457  16.708 1.00 35.54 ? 154  TYR A C     1 
ATOM   954  O  O     . TYR A 1 125 ? 31.834  -2.790  16.082 1.00 35.68 ? 154  TYR A O     1 
ATOM   955  C  CB    . TYR A 1 125 ? 29.080  -0.839  15.965 1.00 36.12 ? 154  TYR A CB    1 
ATOM   956  C  CG    . TYR A 1 125 ? 30.127  0.042   15.311 1.00 36.81 ? 154  TYR A CG    1 
ATOM   957  C  CD1   . TYR A 1 125 ? 30.186  0.177   13.921 1.00 35.22 ? 154  TYR A CD1   1 
ATOM   958  C  CD2   . TYR A 1 125 ? 31.100  0.685   16.080 1.00 34.70 ? 154  TYR A CD2   1 
ATOM   959  C  CE1   . TYR A 1 125 ? 31.195  0.927   13.311 1.00 36.90 ? 154  TYR A CE1   1 
ATOM   960  C  CE2   . TYR A 1 125 ? 32.111  1.436   15.483 1.00 37.67 ? 154  TYR A CE2   1 
ATOM   961  C  CZ    . TYR A 1 125 ? 32.155  1.551   14.099 1.00 37.20 ? 154  TYR A CZ    1 
ATOM   962  O  OH    . TYR A 1 125 ? 33.172  2.265   13.509 1.00 37.60 ? 154  TYR A OH    1 
ATOM   963  N  N     . TYR A 1 126 ? 30.849  -2.191  18.006 1.00 35.26 ? 155  TYR A N     1 
ATOM   964  C  CA    . TYR A 1 126 ? 32.078  -2.290  18.772 1.00 35.64 ? 155  TYR A CA    1 
ATOM   965  C  C     . TYR A 1 126 ? 32.489  -3.734  19.070 1.00 37.77 ? 155  TYR A C     1 
ATOM   966  O  O     . TYR A 1 126 ? 33.647  -4.115  18.860 1.00 38.20 ? 155  TYR A O     1 
ATOM   967  C  CB    . TYR A 1 126 ? 31.939  -1.529  20.091 1.00 34.34 ? 155  TYR A CB    1 
ATOM   968  C  CG    . TYR A 1 126 ? 31.854  -0.029  19.939 1.00 35.68 ? 155  TYR A CG    1 
ATOM   969  C  CD1   . TYR A 1 126 ? 32.784  0.666   19.163 1.00 33.44 ? 155  TYR A CD1   1 
ATOM   970  C  CD2   . TYR A 1 126 ? 30.863  0.702   20.594 1.00 34.22 ? 155  TYR A CD2   1 
ATOM   971  C  CE1   . TYR A 1 126 ? 32.728  2.051   19.044 1.00 34.28 ? 155  TYR A CE1   1 
ATOM   972  C  CE2   . TYR A 1 126 ? 30.799  2.087   20.484 1.00 33.33 ? 155  TYR A CE2   1 
ATOM   973  C  CZ    . TYR A 1 126 ? 31.732  2.756   19.707 1.00 33.80 ? 155  TYR A CZ    1 
ATOM   974  O  OH    . TYR A 1 126 ? 31.670  4.125   19.584 1.00 31.98 ? 155  TYR A OH    1 
ATOM   975  N  N     . LEU A 1 127 ? 31.548  -4.532  19.565 1.00 35.84 ? 156  LEU A N     1 
ATOM   976  C  CA    . LEU A 1 127 ? 31.846  -5.917  19.913 1.00 37.61 ? 156  LEU A CA    1 
ATOM   977  C  C     . LEU A 1 127 ? 32.448  -6.753  18.782 1.00 37.99 ? 156  LEU A C     1 
ATOM   978  O  O     . LEU A 1 127 ? 33.264  -7.632  19.037 1.00 37.73 ? 156  LEU A O     1 
ATOM   979  C  CB    . LEU A 1 127 ? 30.595  -6.600  20.478 1.00 33.95 ? 156  LEU A CB    1 
ATOM   980  C  CG    . LEU A 1 127 ? 30.208  -6.093  21.878 1.00 34.31 ? 156  LEU A CG    1 
ATOM   981  C  CD1   . LEU A 1 127 ? 28.949  -6.803  22.360 1.00 31.55 ? 156  LEU A CD1   1 
ATOM   982  C  CD2   . LEU A 1 127 ? 31.355  -6.336  22.852 1.00 29.72 ? 156  LEU A CD2   1 
ATOM   983  N  N     . ASN A 1 128 ? 32.058  -6.484  17.541 1.00 40.58 ? 157  ASN A N     1 
ATOM   984  C  CA    . ASN A 1 128 ? 32.609  -7.229  16.411 1.00 43.90 ? 157  ASN A CA    1 
ATOM   985  C  C     . ASN A 1 128 ? 34.024  -6.760  16.051 1.00 46.42 ? 157  ASN A C     1 
ATOM   986  O  O     . ASN A 1 128 ? 34.805  -7.516  15.470 1.00 48.06 ? 157  ASN A O     1 
ATOM   987  C  CB    . ASN A 1 128 ? 31.703  -7.105  15.178 1.00 41.03 ? 157  ASN A CB    1 
ATOM   988  C  CG    . ASN A 1 128 ? 30.449  -7.954  15.285 1.00 40.82 ? 157  ASN A CG    1 
ATOM   989  O  OD1   . ASN A 1 128 ? 30.472  -9.038  15.871 1.00 38.78 ? 157  ASN A OD1   1 
ATOM   990  N  ND2   . ASN A 1 128 ? 29.351  -7.475  14.703 1.00 37.42 ? 157  ASN A ND2   1 
ATOM   991  N  N     . ASP A 1 129 ? 34.352  -5.519  16.403 1.00 47.96 ? 158  ASP A N     1 
ATOM   992  C  CA    . ASP A 1 129 ? 35.668  -4.959  16.102 1.00 49.45 ? 158  ASP A CA    1 
ATOM   993  C  C     . ASP A 1 129 ? 36.630  -4.988  17.285 1.00 50.12 ? 158  ASP A C     1 
ATOM   994  O  O     . ASP A 1 129 ? 37.509  -4.131  17.395 1.00 51.18 ? 158  ASP A O     1 
ATOM   995  C  CB    . ASP A 1 129 ? 35.529  -3.514  15.605 1.00 49.05 ? 158  ASP A CB    1 
ATOM   996  C  CG    . ASP A 1 129 ? 34.762  -3.413  14.303 1.00 50.45 ? 158  ASP A CG    1 
ATOM   997  O  OD1   . ASP A 1 129 ? 34.407  -4.470  13.740 1.00 51.65 ? 158  ASP A OD1   1 
ATOM   998  O  OD2   . ASP A 1 129 ? 34.516  -2.278  13.839 1.00 50.28 ? 158  ASP A OD2   1 
ATOM   999  N  N     . LEU A 1 130 ? 36.477  -5.973  18.165 1.00 51.18 ? 159  LEU A N     1 
ATOM   1000 C  CA    . LEU A 1 130 ? 37.351  -6.079  19.329 1.00 51.87 ? 159  LEU A CA    1 
ATOM   1001 C  C     . LEU A 1 130 ? 38.823  -6.230  18.952 1.00 52.79 ? 159  LEU A C     1 
ATOM   1002 O  O     . LEU A 1 130 ? 39.702  -5.886  19.740 1.00 52.37 ? 159  LEU A O     1 
ATOM   1003 C  CB    . LEU A 1 130 ? 36.922  -7.247  20.221 1.00 52.27 ? 159  LEU A CB    1 
ATOM   1004 C  CG    . LEU A 1 130 ? 35.678  -7.031  21.089 1.00 53.19 ? 159  LEU A CG    1 
ATOM   1005 C  CD1   . LEU A 1 130 ? 35.307  -8.329  21.803 1.00 53.22 ? 159  LEU A CD1   1 
ATOM   1006 C  CD2   . LEU A 1 130 ? 35.947  -5.925  22.101 1.00 50.96 ? 159  LEU A CD2   1 
ATOM   1007 N  N     . ASP A 1 131 ? 39.096  -6.750  17.757 1.00 53.60 ? 160  ASP A N     1 
ATOM   1008 C  CA    . ASP A 1 131 ? 40.480  -6.910  17.324 1.00 54.87 ? 160  ASP A CA    1 
ATOM   1009 C  C     . ASP A 1 131 ? 41.118  -5.528  17.236 1.00 54.76 ? 160  ASP A C     1 
ATOM   1010 O  O     . ASP A 1 131 ? 42.120  -5.242  17.895 1.00 54.88 ? 160  ASP A O     1 
ATOM   1011 C  CB    . ASP A 1 131 ? 40.561  -7.590  15.951 1.00 55.32 ? 160  ASP A CB    1 
ATOM   1012 C  CG    . ASP A 1 131 ? 40.229  -9.074  16.005 1.00 56.89 ? 160  ASP A CG    1 
ATOM   1013 O  OD1   . ASP A 1 131 ? 40.658  -9.755  16.965 1.00 55.55 ? 160  ASP A OD1   1 
ATOM   1014 O  OD2   . ASP A 1 131 ? 39.555  -9.563  15.071 1.00 56.28 ? 160  ASP A OD2   1 
ATOM   1015 N  N     . ARG A 1 132 ? 40.507  -4.671  16.426 1.00 54.22 ? 161  ARG A N     1 
ATOM   1016 C  CA    . ARG A 1 132 ? 40.972  -3.308  16.214 1.00 52.57 ? 161  ARG A CA    1 
ATOM   1017 C  C     . ARG A 1 132 ? 40.923  -2.436  17.471 1.00 52.28 ? 161  ARG A C     1 
ATOM   1018 O  O     . ARG A 1 132 ? 41.917  -1.819  17.842 1.00 52.53 ? 161  ARG A O     1 
ATOM   1019 C  CB    . ARG A 1 132 ? 40.137  -2.670  15.099 1.00 52.61 ? 161  ARG A CB    1 
ATOM   1020 C  CG    . ARG A 1 132 ? 40.490  -1.236  14.760 1.00 51.00 ? 161  ARG A CG    1 
ATOM   1021 C  CD    . ARG A 1 132 ? 39.835  -0.830  13.450 1.00 52.08 ? 161  ARG A CD    1 
ATOM   1022 N  NE    . ARG A 1 132 ? 38.377  -0.772  13.533 1.00 51.39 ? 161  ARG A NE    1 
ATOM   1023 C  CZ    . ARG A 1 132 ? 37.700  0.199   14.137 1.00 51.03 ? 161  ARG A CZ    1 
ATOM   1024 N  NH1   . ARG A 1 132 ? 38.347  1.202   14.714 1.00 49.41 ? 161  ARG A NH1   1 
ATOM   1025 N  NH2   . ARG A 1 132 ? 36.375  0.171   14.161 1.00 50.44 ? 161  ARG A NH2   1 
ATOM   1026 N  N     . ILE A 1 133 ? 39.770  -2.405  18.132 1.00 52.47 ? 162  ILE A N     1 
ATOM   1027 C  CA    . ILE A 1 133 ? 39.571  -1.582  19.324 1.00 51.27 ? 162  ILE A CA    1 
ATOM   1028 C  C     . ILE A 1 133 ? 40.416  -1.927  20.551 1.00 50.71 ? 162  ILE A C     1 
ATOM   1029 O  O     . ILE A 1 133 ? 40.865  -1.032  21.275 1.00 49.15 ? 162  ILE A O     1 
ATOM   1030 C  CB    . ILE A 1 133 ? 38.086  -1.607  19.753 1.00 51.88 ? 162  ILE A CB    1 
ATOM   1031 C  CG1   . ILE A 1 133 ? 37.188  -1.322  18.552 1.00 51.86 ? 162  ILE A CG1   1 
ATOM   1032 C  CG2   . ILE A 1 133 ? 37.834  -0.577  20.830 1.00 52.64 ? 162  ILE A CG2   1 
ATOM   1033 C  CD1   . ILE A 1 133 ? 37.435  0.004   17.896 1.00 51.19 ? 162  ILE A CD1   1 
ATOM   1034 N  N     . ALA A 1 134 ? 40.626  -3.218  20.792 1.00 51.97 ? 163  ALA A N     1 
ATOM   1035 C  CA    . ALA A 1 134 ? 41.392  -3.669  21.957 1.00 53.81 ? 163  ALA A CA    1 
ATOM   1036 C  C     . ALA A 1 134 ? 42.884  -3.310  21.949 1.00 54.24 ? 163  ALA A C     1 
ATOM   1037 O  O     . ALA A 1 134 ? 43.465  -3.034  23.002 1.00 53.96 ? 163  ALA A O     1 
ATOM   1038 C  CB    . ALA A 1 134 ? 41.224  -5.177  22.129 1.00 54.41 ? 163  ALA A CB    1 
ATOM   1039 N  N     . GLN A 1 135 ? 43.497  -3.319  20.769 1.00 54.96 ? 164  GLN A N     1 
ATOM   1040 C  CA    . GLN A 1 135 ? 44.918  -3.005  20.636 1.00 56.57 ? 164  GLN A CA    1 
ATOM   1041 C  C     . GLN A 1 135 ? 45.304  -1.729  21.379 1.00 57.22 ? 164  GLN A C     1 
ATOM   1042 O  O     . GLN A 1 135 ? 44.644  -0.698  21.252 1.00 57.73 ? 164  GLN A O     1 
ATOM   1043 C  CB    . GLN A 1 135 ? 45.290  -2.871  19.157 1.00 57.45 ? 164  GLN A CB    1 
ATOM   1044 C  CG    . GLN A 1 135 ? 45.084  -4.144  18.353 1.00 58.81 ? 164  GLN A CG    1 
ATOM   1045 C  CD    . GLN A 1 135 ? 45.529  -4.003  16.914 1.00 61.28 ? 164  GLN A CD    1 
ATOM   1046 O  OE1   . GLN A 1 135 ? 46.693  -3.704  16.640 1.00 63.59 ? 164  GLN A OE1   1 
ATOM   1047 N  NE2   . GLN A 1 135 ? 44.606  -4.218  15.983 1.00 62.23 ? 164  GLN A NE2   1 
ATOM   1048 N  N     . PRO A 1 136 ? 46.394  -1.784  22.162 1.00 57.67 ? 165  PRO A N     1 
ATOM   1049 C  CA    . PRO A 1 136 ? 46.883  -0.638  22.939 1.00 57.27 ? 165  PRO A CA    1 
ATOM   1050 C  C     . PRO A 1 136 ? 47.202  0.614   22.112 1.00 56.53 ? 165  PRO A C     1 
ATOM   1051 O  O     . PRO A 1 136 ? 47.209  1.724   22.641 1.00 56.14 ? 165  PRO A O     1 
ATOM   1052 C  CB    . PRO A 1 136 ? 48.111  -1.204  23.650 1.00 58.18 ? 165  PRO A CB    1 
ATOM   1053 C  CG    . PRO A 1 136 ? 48.606  -2.244  22.684 1.00 58.52 ? 165  PRO A CG    1 
ATOM   1054 C  CD    . PRO A 1 136 ? 47.324  -2.923  22.270 1.00 58.27 ? 165  PRO A CD    1 
ATOM   1055 N  N     . ASN A 1 137 ? 47.464  0.438   20.820 1.00 56.35 ? 166  ASN A N     1 
ATOM   1056 C  CA    . ASN A 1 137 ? 47.761  1.576   19.951 1.00 56.14 ? 166  ASN A CA    1 
ATOM   1057 C  C     . ASN A 1 137 ? 46.508  2.021   19.192 1.00 54.44 ? 166  ASN A C     1 
ATOM   1058 O  O     . ASN A 1 137 ? 46.591  2.661   18.139 1.00 54.06 ? 166  ASN A O     1 
ATOM   1059 C  CB    . ASN A 1 137 ? 48.877  1.219   18.957 1.00 58.79 ? 166  ASN A CB    1 
ATOM   1060 C  CG    . ASN A 1 137 ? 48.561  -0.021  18.132 1.00 61.98 ? 166  ASN A CG    1 
ATOM   1061 O  OD1   . ASN A 1 137 ? 47.492  -0.129  17.522 1.00 62.27 ? 166  ASN A OD1   1 
ATOM   1062 N  ND2   . ASN A 1 137 ? 49.503  -0.964  18.102 1.00 64.00 ? 166  ASN A ND2   1 
ATOM   1063 N  N     . TYR A 1 138 ? 45.347  1.686   19.748 1.00 51.57 ? 167  TYR A N     1 
ATOM   1064 C  CA    . TYR A 1 138 ? 44.065  2.023   19.140 1.00 46.99 ? 167  TYR A CA    1 
ATOM   1065 C  C     . TYR A 1 138 ? 43.754  3.514   19.084 1.00 44.79 ? 167  TYR A C     1 
ATOM   1066 O  O     . TYR A 1 138 ? 43.866  4.226   20.077 1.00 44.07 ? 167  TYR A O     1 
ATOM   1067 C  CB    . TYR A 1 138 ? 42.937  1.300   19.884 1.00 45.47 ? 167  TYR A CB    1 
ATOM   1068 C  CG    . TYR A 1 138 ? 41.547  1.800   19.554 1.00 43.08 ? 167  TYR A CG    1 
ATOM   1069 C  CD1   . TYR A 1 138 ? 41.067  1.772   18.249 1.00 40.89 ? 167  TYR A CD1   1 
ATOM   1070 C  CD2   . TYR A 1 138 ? 40.711  2.303   20.555 1.00 43.11 ? 167  TYR A CD2   1 
ATOM   1071 C  CE1   . TYR A 1 138 ? 39.789  2.233   17.944 1.00 42.45 ? 167  TYR A CE1   1 
ATOM   1072 C  CE2   . TYR A 1 138 ? 39.428  2.764   20.261 1.00 42.03 ? 167  TYR A CE2   1 
ATOM   1073 C  CZ    . TYR A 1 138 ? 38.974  2.726   18.954 1.00 41.10 ? 167  TYR A CZ    1 
ATOM   1074 O  OH    . TYR A 1 138 ? 37.705  3.166   18.654 1.00 40.67 ? 167  TYR A OH    1 
ATOM   1075 N  N     . ILE A 1 139 ? 43.365  3.977   17.902 1.00 44.43 ? 168  ILE A N     1 
ATOM   1076 C  CA    . ILE A 1 139 ? 42.988  5.371   17.707 1.00 43.40 ? 168  ILE A CA    1 
ATOM   1077 C  C     . ILE A 1 139 ? 41.598  5.348   17.085 1.00 40.89 ? 168  ILE A C     1 
ATOM   1078 O  O     . ILE A 1 139 ? 41.433  4.947   15.933 1.00 40.12 ? 168  ILE A O     1 
ATOM   1079 C  CB    . ILE A 1 139 ? 43.942  6.105   16.746 1.00 44.57 ? 168  ILE A CB    1 
ATOM   1080 C  CG1   . ILE A 1 139 ? 45.366  6.081   17.303 1.00 45.22 ? 168  ILE A CG1   1 
ATOM   1081 C  CG2   . ILE A 1 139 ? 43.473  7.547   16.558 1.00 43.82 ? 168  ILE A CG2   1 
ATOM   1082 C  CD1   . ILE A 1 139 ? 46.395  6.697   16.373 1.00 45.90 ? 168  ILE A CD1   1 
ATOM   1083 N  N     . PRO A 1 140 ? 40.578  5.764   17.847 1.00 39.61 ? 169  PRO A N     1 
ATOM   1084 C  CA    . PRO A 1 140 ? 39.195  5.785   17.359 1.00 38.77 ? 169  PRO A CA    1 
ATOM   1085 C  C     . PRO A 1 140 ? 39.050  6.548   16.045 1.00 38.96 ? 169  PRO A C     1 
ATOM   1086 O  O     . PRO A 1 140 ? 39.521  7.677   15.921 1.00 38.38 ? 169  PRO A O     1 
ATOM   1087 C  CB    . PRO A 1 140 ? 38.437  6.464   18.498 1.00 38.25 ? 169  PRO A CB    1 
ATOM   1088 C  CG    . PRO A 1 140 ? 39.241  6.104   19.711 1.00 38.55 ? 169  PRO A CG    1 
ATOM   1089 C  CD    . PRO A 1 140 ? 40.659  6.276   19.226 1.00 38.05 ? 169  PRO A CD    1 
ATOM   1090 N  N     . THR A 1 141 ? 38.408  5.926   15.062 1.00 39.69 ? 170  THR A N     1 
ATOM   1091 C  CA    . THR A 1 141 ? 38.190  6.579   13.777 1.00 40.67 ? 170  THR A CA    1 
ATOM   1092 C  C     . THR A 1 141 ? 37.017  7.549   13.917 1.00 41.70 ? 170  THR A C     1 
ATOM   1093 O  O     . THR A 1 141 ? 36.390  7.633   14.976 1.00 41.82 ? 170  THR A O     1 
ATOM   1094 C  CB    . THR A 1 141 ? 37.852  5.556   12.677 1.00 42.21 ? 170  THR A CB    1 
ATOM   1095 O  OG1   . THR A 1 141 ? 36.646  4.860   13.023 1.00 40.21 ? 170  THR A OG1   1 
ATOM   1096 C  CG2   . THR A 1 141 ? 38.987  4.556   12.515 1.00 38.95 ? 170  THR A CG2   1 
ATOM   1097 N  N     . GLN A 1 142 ? 36.719  8.285   12.855 1.00 42.32 ? 171  GLN A N     1 
ATOM   1098 C  CA    . GLN A 1 142 ? 35.614  9.231   12.904 1.00 43.17 ? 171  GLN A CA    1 
ATOM   1099 C  C     . GLN A 1 142 ? 34.307  8.465   13.082 1.00 42.57 ? 171  GLN A C     1 
ATOM   1100 O  O     . GLN A 1 142 ? 33.420  8.888   13.822 1.00 42.76 ? 171  GLN A O     1 
ATOM   1101 C  CB    . GLN A 1 142 ? 35.562  10.067  11.623 1.00 44.05 ? 171  GLN A CB    1 
ATOM   1102 C  CG    . GLN A 1 142 ? 34.611  11.247  11.719 1.00 46.94 ? 171  GLN A CG    1 
ATOM   1103 C  CD    . GLN A 1 142 ? 34.824  12.267  10.619 1.00 48.83 ? 171  GLN A CD    1 
ATOM   1104 O  OE1   . GLN A 1 142 ? 34.575  11.995  9.442  1.00 48.75 ? 171  GLN A OE1   1 
ATOM   1105 N  NE2   . GLN A 1 142 ? 35.292  13.452  10.998 1.00 48.49 ? 171  GLN A NE2   1 
ATOM   1106 N  N     . GLN A 1 143 ? 34.198  7.327   12.405 1.00 41.45 ? 172  GLN A N     1 
ATOM   1107 C  CA    . GLN A 1 143 ? 33.004  6.511   12.508 1.00 40.97 ? 172  GLN A CA    1 
ATOM   1108 C  C     . GLN A 1 143 ? 32.865  5.982   13.936 1.00 40.51 ? 172  GLN A C     1 
ATOM   1109 O  O     . GLN A 1 143 ? 31.759  5.912   14.469 1.00 40.02 ? 172  GLN A O     1 
ATOM   1110 C  CB    . GLN A 1 143 ? 33.064  5.349   11.517 1.00 41.24 ? 172  GLN A CB    1 
ATOM   1111 C  CG    . GLN A 1 143 ? 31.756  4.577   11.418 1.00 41.48 ? 172  GLN A CG    1 
ATOM   1112 C  CD    . GLN A 1 143 ? 30.636  5.390   10.790 1.00 41.36 ? 172  GLN A CD    1 
ATOM   1113 O  OE1   . GLN A 1 143 ? 29.463  5.006   10.853 1.00 40.52 ? 172  GLN A OE1   1 
ATOM   1114 N  NE2   . GLN A 1 143 ? 30.991  6.513   10.171 1.00 40.06 ? 172  GLN A NE2   1 
ATOM   1115 N  N     . ASP A 1 144 ? 33.986  5.619   14.558 1.00 39.45 ? 173  ASP A N     1 
ATOM   1116 C  CA    . ASP A 1 144 ? 33.956  5.117   15.930 1.00 38.76 ? 173  ASP A CA    1 
ATOM   1117 C  C     . ASP A 1 144 ? 33.399  6.197   16.852 1.00 38.42 ? 173  ASP A C     1 
ATOM   1118 O  O     . ASP A 1 144 ? 32.553  5.926   17.703 1.00 37.31 ? 173  ASP A O     1 
ATOM   1119 C  CB    . ASP A 1 144 ? 35.359  4.727   16.413 1.00 37.87 ? 173  ASP A CB    1 
ATOM   1120 C  CG    . ASP A 1 144 ? 35.888  3.469   15.749 1.00 38.28 ? 173  ASP A CG    1 
ATOM   1121 O  OD1   . ASP A 1 144 ? 35.113  2.762   15.072 1.00 38.76 ? 173  ASP A OD1   1 
ATOM   1122 O  OD2   . ASP A 1 144 ? 37.088  3.176   15.917 1.00 40.52 ? 173  ASP A OD2   1 
ATOM   1123 N  N     . VAL A 1 145 ? 33.884  7.423   16.677 1.00 38.45 ? 174  VAL A N     1 
ATOM   1124 C  CA    . VAL A 1 145 ? 33.441  8.554   17.488 1.00 38.98 ? 174  VAL A CA    1 
ATOM   1125 C  C     . VAL A 1 145 ? 31.946  8.795   17.288 1.00 38.84 ? 174  VAL A C     1 
ATOM   1126 O  O     . VAL A 1 145 ? 31.215  9.090   18.235 1.00 38.96 ? 174  VAL A O     1 
ATOM   1127 C  CB    . VAL A 1 145 ? 34.215  9.846   17.113 1.00 39.89 ? 174  VAL A CB    1 
ATOM   1128 C  CG1   . VAL A 1 145 ? 33.659  11.035  17.887 1.00 39.72 ? 174  VAL A CG1   1 
ATOM   1129 C  CG2   . VAL A 1 145 ? 35.697  9.671   17.410 1.00 39.19 ? 174  VAL A CG2   1 
ATOM   1130 N  N     . LEU A 1 146 ? 31.501  8.658   16.044 1.00 38.38 ? 175  LEU A N     1 
ATOM   1131 C  CA    . LEU A 1 146 ? 30.098  8.855   15.699 1.00 37.42 ? 175  LEU A CA    1 
ATOM   1132 C  C     . LEU A 1 146 ? 29.235  7.869   16.472 1.00 35.97 ? 175  LEU A C     1 
ATOM   1133 O  O     . LEU A 1 146 ? 28.146  8.210   16.933 1.00 35.81 ? 175  LEU A O     1 
ATOM   1134 C  CB    . LEU A 1 146 ? 29.906  8.650   14.195 1.00 38.39 ? 175  LEU A CB    1 
ATOM   1135 C  CG    . LEU A 1 146 ? 28.537  8.918   13.577 1.00 39.93 ? 175  LEU A CG    1 
ATOM   1136 C  CD1   . LEU A 1 146 ? 28.128  10.374  13.810 1.00 39.54 ? 175  LEU A CD1   1 
ATOM   1137 C  CD2   . LEU A 1 146 ? 28.608  8.611   12.086 1.00 40.27 ? 175  LEU A CD2   1 
ATOM   1138 N  N     . ARG A 1 147 ? 29.744  6.648   16.617 1.00 34.64 ? 176  ARG A N     1 
ATOM   1139 C  CA    . ARG A 1 147 ? 29.045  5.580   17.321 1.00 32.49 ? 176  ARG A CA    1 
ATOM   1140 C  C     . ARG A 1 147 ? 29.088  5.675   18.843 1.00 31.95 ? 176  ARG A C     1 
ATOM   1141 O  O     . ARG A 1 147 ? 28.404  4.922   19.530 1.00 30.42 ? 176  ARG A O     1 
ATOM   1142 C  CB    . ARG A 1 147 ? 29.611  4.223   16.897 1.00 31.47 ? 176  ARG A CB    1 
ATOM   1143 C  CG    . ARG A 1 147 ? 29.239  3.805   15.494 1.00 32.00 ? 176  ARG A CG    1 
ATOM   1144 C  CD    . ARG A 1 147 ? 27.750  3.616   15.405 1.00 32.49 ? 176  ARG A CD    1 
ATOM   1145 N  NE    . ARG A 1 147 ? 27.397  2.615   14.411 1.00 34.74 ? 176  ARG A NE    1 
ATOM   1146 C  CZ    . ARG A 1 147 ? 26.271  1.911   14.439 1.00 35.71 ? 176  ARG A CZ    1 
ATOM   1147 N  NH1   . ARG A 1 147 ? 25.387  2.102   15.418 1.00 32.43 ? 176  ARG A NH1   1 
ATOM   1148 N  NH2   . ARG A 1 147 ? 26.034  1.014   13.492 1.00 36.03 ? 176  ARG A NH2   1 
ATOM   1149 N  N     . THR A 1 148 ? 29.893  6.577   19.384 1.00 32.88 ? 177  THR A N     1 
ATOM   1150 C  CA    . THR A 1 148 ? 29.954  6.683   20.835 1.00 34.41 ? 177  THR A CA    1 
ATOM   1151 C  C     . THR A 1 148 ? 28.625  7.190   21.378 1.00 34.24 ? 177  THR A C     1 
ATOM   1152 O  O     . THR A 1 148 ? 27.854  7.849   20.677 1.00 31.55 ? 177  THR A O     1 
ATOM   1153 C  CB    . THR A 1 148 ? 31.083  7.630   21.307 1.00 35.32 ? 177  THR A CB    1 
ATOM   1154 O  OG1   . THR A 1 148 ? 30.874  8.938   20.762 1.00 38.54 ? 177  THR A OG1   1 
ATOM   1155 C  CG2   . THR A 1 148 ? 32.441  7.105   20.861 1.00 35.64 ? 177  THR A CG2   1 
ATOM   1156 N  N     . ARG A 1 149 ? 28.360  6.850   22.631 1.00 34.09 ? 178  ARG A N     1 
ATOM   1157 C  CA    . ARG A 1 149 ? 27.144  7.262   23.308 1.00 36.56 ? 178  ARG A CA    1 
ATOM   1158 C  C     . ARG A 1 149 ? 27.649  7.975   24.551 1.00 40.07 ? 178  ARG A C     1 
ATOM   1159 O  O     . ARG A 1 149 ? 28.404  7.391   25.321 1.00 39.73 ? 178  ARG A O     1 
ATOM   1160 C  CB    . ARG A 1 149 ? 26.315  6.031   23.692 1.00 32.35 ? 178  ARG A CB    1 
ATOM   1161 C  CG    . ARG A 1 149 ? 25.909  5.149   22.503 1.00 29.56 ? 178  ARG A CG    1 
ATOM   1162 C  CD    . ARG A 1 149 ? 25.489  3.748   22.952 1.00 25.51 ? 178  ARG A CD    1 
ATOM   1163 N  NE    . ARG A 1 149 ? 24.381  3.782   23.904 1.00 27.03 ? 178  ARG A NE    1 
ATOM   1164 C  CZ    . ARG A 1 149 ? 23.105  3.992   23.584 1.00 27.79 ? 178  ARG A CZ    1 
ATOM   1165 N  NH1   . ARG A 1 149 ? 22.745  4.186   22.318 1.00 25.47 ? 178  ARG A NH1   1 
ATOM   1166 N  NH2   . ARG A 1 149 ? 22.185  4.027   24.539 1.00 25.33 ? 178  ARG A NH2   1 
ATOM   1167 N  N     . VAL A 1 150 ? 27.262  9.236   24.733 1.00 43.75 ? 179  VAL A N     1 
ATOM   1168 C  CA    . VAL A 1 150 ? 27.710  10.002  25.894 1.00 47.88 ? 179  VAL A CA    1 
ATOM   1169 C  C     . VAL A 1 150 ? 26.584  10.505  26.786 1.00 51.40 ? 179  VAL A C     1 
ATOM   1170 O  O     . VAL A 1 150 ? 25.407  10.403  26.444 1.00 51.17 ? 179  VAL A O     1 
ATOM   1171 C  CB    . VAL A 1 150 ? 28.564  11.214  25.469 1.00 47.51 ? 179  VAL A CB    1 
ATOM   1172 C  CG1   . VAL A 1 150 ? 29.846  10.740  24.803 1.00 46.27 ? 179  VAL A CG1   1 
ATOM   1173 C  CG2   . VAL A 1 150 ? 27.775  12.099  24.526 1.00 46.71 ? 179  VAL A CG2   1 
ATOM   1174 N  N     . LYS A 1 151 ? 26.972  11.050  27.936 1.00 57.43 ? 180  LYS A N     1 
ATOM   1175 C  CA    . LYS A 1 151 ? 26.041  11.591  28.927 1.00 62.86 ? 180  LYS A CA    1 
ATOM   1176 C  C     . LYS A 1 151 ? 25.314  12.820  28.383 1.00 65.03 ? 180  LYS A C     1 
ATOM   1177 O  O     . LYS A 1 151 ? 25.945  13.829  28.061 1.00 64.67 ? 180  LYS A O     1 
ATOM   1178 C  CB    . LYS A 1 151 ? 26.801  12.006  30.189 1.00 65.91 ? 180  LYS A CB    1 
ATOM   1179 C  CG    . LYS A 1 151 ? 27.972  11.107  30.562 1.00 69.51 ? 180  LYS A CG    1 
ATOM   1180 C  CD    . LYS A 1 151 ? 28.888  11.795  31.576 1.00 71.66 ? 180  LYS A CD    1 
ATOM   1181 C  CE    . LYS A 1 151 ? 29.464  13.096  31.011 1.00 73.27 ? 180  LYS A CE    1 
ATOM   1182 N  NZ    . LYS A 1 151 ? 30.330  13.815  31.989 1.00 74.53 ? 180  LYS A NZ    1 
ATOM   1183 N  N     . THR A 1 152 ? 23.990  12.736  28.301 1.00 68.23 ? 181  THR A N     1 
ATOM   1184 C  CA    . THR A 1 152 ? 23.168  13.837  27.798 1.00 71.20 ? 181  THR A CA    1 
ATOM   1185 C  C     . THR A 1 152 ? 22.743  14.769  28.934 1.00 71.66 ? 181  THR A C     1 
ATOM   1186 O  O     . THR A 1 152 ? 21.720  14.540  29.584 1.00 72.19 ? 181  THR A O     1 
ATOM   1187 C  CB    . THR A 1 152 ? 21.892  13.300  27.106 1.00 72.85 ? 181  THR A CB    1 
ATOM   1188 O  OG1   . THR A 1 152 ? 22.260  12.448  26.011 1.00 73.63 ? 181  THR A OG1   1 
ATOM   1189 C  CG2   . THR A 1 152 ? 21.034  14.455  26.594 1.00 73.89 ? 181  THR A CG2   1 
ATOM   1190 N  N     . THR A 1 153 ? 23.522  15.821  29.167 1.00 71.33 ? 182  THR A N     1 
ATOM   1191 C  CA    . THR A 1 153 ? 23.211  16.768  30.235 1.00 70.81 ? 182  THR A CA    1 
ATOM   1192 C  C     . THR A 1 153 ? 22.538  18.041  29.718 1.00 69.53 ? 182  THR A C     1 
ATOM   1193 O  O     . THR A 1 153 ? 23.209  18.970  29.264 1.00 69.54 ? 182  THR A O     1 
ATOM   1194 C  CB    . THR A 1 153 ? 24.481  17.169  31.008 1.00 71.19 ? 182  THR A CB    1 
ATOM   1195 O  OG1   . THR A 1 153 ? 25.395  17.819  30.119 1.00 71.85 ? 182  THR A OG1   1 
ATOM   1196 C  CG2   . THR A 1 153 ? 25.151  15.937  31.603 1.00 71.51 ? 182  THR A CG2   1 
ATOM   1197 N  N     . GLY A 1 154 ? 21.210  18.077  29.795 1.00 67.56 ? 183  GLY A N     1 
ATOM   1198 C  CA    . GLY A 1 154 ? 20.474  19.241  29.336 1.00 63.60 ? 183  GLY A CA    1 
ATOM   1199 C  C     . GLY A 1 154 ? 20.371  19.306  27.825 1.00 61.15 ? 183  GLY A C     1 
ATOM   1200 O  O     . GLY A 1 154 ? 20.844  18.414  27.122 1.00 60.31 ? 183  GLY A O     1 
ATOM   1201 N  N     . ILE A 1 155 ? 19.753  20.370  27.325 1.00 58.79 ? 184  ILE A N     1 
ATOM   1202 C  CA    . ILE A 1 155 ? 19.583  20.551  25.890 1.00 56.83 ? 184  ILE A CA    1 
ATOM   1203 C  C     . ILE A 1 155 ? 20.918  20.634  25.166 1.00 55.41 ? 184  ILE A C     1 
ATOM   1204 O  O     . ILE A 1 155 ? 21.840  21.309  25.619 1.00 55.95 ? 184  ILE A O     1 
ATOM   1205 C  CB    . ILE A 1 155 ? 18.776  21.829  25.576 1.00 56.32 ? 184  ILE A CB    1 
ATOM   1206 C  CG1   . ILE A 1 155 ? 17.353  21.687  26.116 1.00 56.70 ? 184  ILE A CG1   1 
ATOM   1207 C  CG2   . ILE A 1 155 ? 18.746  22.074  24.074 1.00 56.41 ? 184  ILE A CG2   1 
ATOM   1208 C  CD1   . ILE A 1 155 ? 16.450  22.855  25.793 1.00 57.58 ? 184  ILE A CD1   1 
ATOM   1209 N  N     . VAL A 1 156 ? 21.013  19.932  24.043 1.00 53.36 ? 185  VAL A N     1 
ATOM   1210 C  CA    . VAL A 1 156 ? 22.220  19.926  23.235 1.00 51.84 ? 185  VAL A CA    1 
ATOM   1211 C  C     . VAL A 1 156 ? 21.969  20.797  22.013 1.00 52.80 ? 185  VAL A C     1 
ATOM   1212 O  O     . VAL A 1 156 ? 20.841  20.886  21.524 1.00 51.60 ? 185  VAL A O     1 
ATOM   1213 C  CB    . VAL A 1 156 ? 22.576  18.502  22.782 1.00 51.35 ? 185  VAL A CB    1 
ATOM   1214 C  CG1   . VAL A 1 156 ? 23.796  18.527  21.878 1.00 50.77 ? 185  VAL A CG1   1 
ATOM   1215 C  CG2   . VAL A 1 156 ? 22.833  17.631  23.994 1.00 50.90 ? 185  VAL A CG2   1 
ATOM   1216 N  N     . GLU A 1 157 ? 23.021  21.436  21.518 1.00 53.80 ? 186  GLU A N     1 
ATOM   1217 C  CA    . GLU A 1 157 ? 22.883  22.314  20.367 1.00 54.46 ? 186  GLU A CA    1 
ATOM   1218 C  C     . GLU A 1 157 ? 24.141  22.341  19.508 1.00 54.04 ? 186  GLU A C     1 
ATOM   1219 O  O     . GLU A 1 157 ? 25.239  22.040  19.980 1.00 55.06 ? 186  GLU A O     1 
ATOM   1220 C  CB    . GLU A 1 157 ? 22.572  23.731  20.845 1.00 56.20 ? 186  GLU A CB    1 
ATOM   1221 C  CG    . GLU A 1 157 ? 22.158  24.679  19.738 1.00 60.30 ? 186  GLU A CG    1 
ATOM   1222 C  CD    . GLU A 1 157 ? 22.181  26.129  20.175 1.00 62.74 ? 186  GLU A CD    1 
ATOM   1223 O  OE1   . GLU A 1 157 ? 21.714  26.426  21.296 1.00 63.84 ? 186  GLU A OE1   1 
ATOM   1224 O  OE2   . GLU A 1 157 ? 22.660  26.973  19.390 1.00 62.35 ? 186  GLU A OE2   1 
ATOM   1225 N  N     . THR A 1 158 ? 23.974  22.700  18.239 1.00 52.30 ? 187  THR A N     1 
ATOM   1226 C  CA    . THR A 1 158 ? 25.098  22.794  17.323 1.00 50.95 ? 187  THR A CA    1 
ATOM   1227 C  C     . THR A 1 158 ? 24.842  23.903  16.309 1.00 50.93 ? 187  THR A C     1 
ATOM   1228 O  O     . THR A 1 158 ? 23.716  24.093  15.846 1.00 49.06 ? 187  THR A O     1 
ATOM   1229 C  CB    . THR A 1 158 ? 25.347  21.466  16.583 1.00 50.05 ? 187  THR A CB    1 
ATOM   1230 O  OG1   . THR A 1 158 ? 26.566  21.566  15.836 1.00 49.34 ? 187  THR A OG1   1 
ATOM   1231 C  CG2   . THR A 1 158 ? 24.201  21.151  15.635 1.00 48.99 ? 187  THR A CG2   1 
ATOM   1232 N  N     . HIS A 1 159 ? 25.897  24.638  15.980 1.00 52.80 ? 188  HIS A N     1 
ATOM   1233 C  CA    . HIS A 1 159 ? 25.815  25.749  15.040 1.00 53.99 ? 188  HIS A CA    1 
ATOM   1234 C  C     . HIS A 1 159 ? 26.513  25.411  13.743 1.00 52.17 ? 188  HIS A C     1 
ATOM   1235 O  O     . HIS A 1 159 ? 27.500  24.687  13.741 1.00 52.39 ? 188  HIS A O     1 
ATOM   1236 C  CB    . HIS A 1 159 ? 26.508  26.982  15.617 1.00 58.17 ? 188  HIS A CB    1 
ATOM   1237 C  CG    . HIS A 1 159 ? 25.866  27.522  16.851 1.00 62.59 ? 188  HIS A CG    1 
ATOM   1238 N  ND1   . HIS A 1 159 ? 24.628  28.127  16.840 1.00 65.79 ? 188  HIS A ND1   1 
ATOM   1239 C  CD2   . HIS A 1 159 ? 26.311  27.593  18.128 1.00 64.81 ? 188  HIS A CD2   1 
ATOM   1240 C  CE1   . HIS A 1 159 ? 24.339  28.554  18.056 1.00 67.03 ? 188  HIS A CE1   1 
ATOM   1241 N  NE2   . HIS A 1 159 ? 25.343  28.242  18.857 1.00 67.85 ? 188  HIS A NE2   1 
ATOM   1242 N  N     . PHE A 1 160 ? 26.009  25.950  12.642 1.00 50.58 ? 189  PHE A N     1 
ATOM   1243 C  CA    . PHE A 1 160 ? 26.637  25.733  11.350 1.00 50.91 ? 189  PHE A CA    1 
ATOM   1244 C  C     . PHE A 1 160 ? 25.915  26.493  10.256 1.00 52.01 ? 189  PHE A C     1 
ATOM   1245 O  O     . PHE A 1 160 ? 24.702  26.686  10.311 1.00 53.00 ? 189  PHE A O     1 
ATOM   1246 C  CB    . PHE A 1 160 ? 26.727  24.231  11.018 1.00 48.85 ? 189  PHE A CB    1 
ATOM   1247 C  CG    . PHE A 1 160 ? 25.403  23.569  10.736 1.00 48.73 ? 189  PHE A CG    1 
ATOM   1248 C  CD1   . PHE A 1 160 ? 24.806  23.675  9.483  1.00 46.71 ? 189  PHE A CD1   1 
ATOM   1249 C  CD2   . PHE A 1 160 ? 24.777  22.796  11.712 1.00 47.22 ? 189  PHE A CD2   1 
ATOM   1250 C  CE1   . PHE A 1 160 ? 23.609  23.016  9.202  1.00 47.49 ? 189  PHE A CE1   1 
ATOM   1251 C  CE2   . PHE A 1 160 ? 23.578  22.133  11.439 1.00 47.36 ? 189  PHE A CE2   1 
ATOM   1252 C  CZ    . PHE A 1 160 ? 22.994  22.242  10.182 1.00 46.44 ? 189  PHE A CZ    1 
ATOM   1253 N  N     . THR A 1 161 ? 26.680  26.954  9.275  1.00 54.19 ? 190  THR A N     1 
ATOM   1254 C  CA    . THR A 1 161 ? 26.117  27.693  8.159  1.00 56.01 ? 190  THR A CA    1 
ATOM   1255 C  C     . THR A 1 161 ? 26.112  26.797  6.935  1.00 56.42 ? 190  THR A C     1 
ATOM   1256 O  O     . THR A 1 161 ? 27.101  26.132  6.628  1.00 55.80 ? 190  THR A O     1 
ATOM   1257 C  CB    . THR A 1 161 ? 26.934  28.965  7.849  1.00 56.89 ? 190  THR A CB    1 
ATOM   1258 O  OG1   . THR A 1 161 ? 26.961  29.811  9.006  1.00 56.75 ? 190  THR A OG1   1 
ATOM   1259 C  CG2   . THR A 1 161 ? 26.305  29.728  6.687  1.00 57.17 ? 190  THR A CG2   1 
ATOM   1260 N  N     . PHE A 1 162 ? 24.983  26.778  6.243  1.00 57.86 ? 191  PHE A N     1 
ATOM   1261 C  CA    . PHE A 1 162 ? 24.833  25.958  5.053  1.00 59.39 ? 191  PHE A CA    1 
ATOM   1262 C  C     . PHE A 1 162 ? 23.940  26.726  4.090  1.00 59.99 ? 191  PHE A C     1 
ATOM   1263 O  O     . PHE A 1 162 ? 22.820  27.102  4.436  1.00 60.29 ? 191  PHE A O     1 
ATOM   1264 C  CB    . PHE A 1 162 ? 24.204  24.607  5.431  1.00 59.40 ? 191  PHE A CB    1 
ATOM   1265 C  CG    . PHE A 1 162 ? 24.097  23.633  4.289  1.00 59.02 ? 191  PHE A CG    1 
ATOM   1266 C  CD1   . PHE A 1 162 ? 25.183  23.396  3.450  1.00 58.97 ? 191  PHE A CD1   1 
ATOM   1267 C  CD2   . PHE A 1 162 ? 22.916  22.932  4.068  1.00 59.36 ? 191  PHE A CD2   1 
ATOM   1268 C  CE1   . PHE A 1 162 ? 25.094  22.475  2.409  1.00 59.50 ? 191  PHE A CE1   1 
ATOM   1269 C  CE2   . PHE A 1 162 ? 22.814  22.007  3.030  1.00 59.27 ? 191  PHE A CE2   1 
ATOM   1270 C  CZ    . PHE A 1 162 ? 23.904  21.779  2.200  1.00 59.91 ? 191  PHE A CZ    1 
ATOM   1271 N  N     . LYS A 1 163 ? 24.452  26.976  2.891  1.00 60.94 ? 192  LYS A N     1 
ATOM   1272 C  CA    . LYS A 1 163 ? 23.704  27.713  1.884  1.00 62.18 ? 192  LYS A CA    1 
ATOM   1273 C  C     . LYS A 1 163 ? 23.233  29.056  2.446  1.00 62.19 ? 192  LYS A C     1 
ATOM   1274 O  O     . LYS A 1 163 ? 22.052  29.395  2.384  1.00 61.68 ? 192  LYS A O     1 
ATOM   1275 C  CB    . LYS A 1 163 ? 22.517  26.874  1.402  1.00 62.69 ? 192  LYS A CB    1 
ATOM   1276 C  CG    . LYS A 1 163 ? 22.934  25.561  0.749  1.00 64.43 ? 192  LYS A CG    1 
ATOM   1277 C  CD    . LYS A 1 163 ? 21.736  24.768  0.243  1.00 66.65 ? 192  LYS A CD    1 
ATOM   1278 C  CE    . LYS A 1 163 ? 22.168  23.455  -0.405 1.00 67.14 ? 192  LYS A CE    1 
ATOM   1279 N  NZ    . LYS A 1 163 ? 21.007  22.655  -0.899 1.00 67.75 ? 192  LYS A NZ    1 
ATOM   1280 N  N     . ASP A 1 164 ? 24.181  29.807  2.998  1.00 62.81 ? 193  ASP A N     1 
ATOM   1281 C  CA    . ASP A 1 164 ? 23.926  31.124  3.579  1.00 63.57 ? 193  ASP A CA    1 
ATOM   1282 C  C     . ASP A 1 164 ? 22.768  31.185  4.563  1.00 62.82 ? 193  ASP A C     1 
ATOM   1283 O  O     . ASP A 1 164 ? 22.008  32.157  4.593  1.00 63.12 ? 193  ASP A O     1 
ATOM   1284 C  CB    . ASP A 1 164 ? 23.721  32.159  2.474  1.00 65.15 ? 193  ASP A CB    1 
ATOM   1285 C  CG    . ASP A 1 164 ? 25.002  32.464  1.725  1.00 67.29 ? 193  ASP A CG    1 
ATOM   1286 O  OD1   . ASP A 1 164 ? 25.990  32.868  2.379  1.00 67.23 ? 193  ASP A OD1   1 
ATOM   1287 O  OD2   . ASP A 1 164 ? 25.022  32.298  0.486  1.00 68.62 ? 193  ASP A OD2   1 
ATOM   1288 N  N     . LEU A 1 165 ? 22.646  30.140  5.372  1.00 60.97 ? 194  LEU A N     1 
ATOM   1289 C  CA    . LEU A 1 165 ? 21.607  30.068  6.386  1.00 59.19 ? 194  LEU A CA    1 
ATOM   1290 C  C     . LEU A 1 165 ? 22.289  29.742  7.709  1.00 57.51 ? 194  LEU A C     1 
ATOM   1291 O  O     . LEU A 1 165 ? 23.177  28.892  7.760  1.00 56.55 ? 194  LEU A O     1 
ATOM   1292 C  CB    . LEU A 1 165 ? 20.591  28.975  6.035  1.00 59.24 ? 194  LEU A CB    1 
ATOM   1293 C  CG    . LEU A 1 165 ? 19.733  29.183  4.782  1.00 59.24 ? 194  LEU A CG    1 
ATOM   1294 C  CD1   . LEU A 1 165 ? 18.930  27.930  4.489  1.00 58.77 ? 194  LEU A CD1   1 
ATOM   1295 C  CD2   . LEU A 1 165 ? 18.807  30.366  4.990  1.00 59.68 ? 194  LEU A CD2   1 
ATOM   1296 N  N     . HIS A 1 166 ? 21.892  30.436  8.771  1.00 56.51 ? 195  HIS A N     1 
ATOM   1297 C  CA    . HIS A 1 166 ? 22.462  30.192  10.093 1.00 55.72 ? 195  HIS A CA    1 
ATOM   1298 C  C     . HIS A 1 166 ? 21.627  29.141  10.817 1.00 53.01 ? 195  HIS A C     1 
ATOM   1299 O  O     . HIS A 1 166 ? 20.628  29.468  11.463 1.00 52.19 ? 195  HIS A O     1 
ATOM   1300 C  CB    . HIS A 1 166 ? 22.484  31.479  10.924 1.00 58.34 ? 195  HIS A CB    1 
ATOM   1301 C  CG    . HIS A 1 166 ? 23.460  32.502  10.434 1.00 61.99 ? 195  HIS A CG    1 
ATOM   1302 N  ND1   . HIS A 1 166 ? 24.793  32.218  10.221 1.00 63.11 ? 195  HIS A ND1   1 
ATOM   1303 C  CD2   . HIS A 1 166 ? 23.304  33.816  10.144 1.00 62.53 ? 195  HIS A CD2   1 
ATOM   1304 C  CE1   . HIS A 1 166 ? 25.415  33.313  9.823  1.00 63.98 ? 195  HIS A CE1   1 
ATOM   1305 N  NE2   . HIS A 1 166 ? 24.535  34.297  9.769  1.00 64.11 ? 195  HIS A NE2   1 
ATOM   1306 N  N     . PHE A 1 167 ? 22.036  27.880  10.702 1.00 49.85 ? 196  PHE A N     1 
ATOM   1307 C  CA    . PHE A 1 167 ? 21.314  26.788  11.343 1.00 47.17 ? 196  PHE A CA    1 
ATOM   1308 C  C     . PHE A 1 167 ? 21.613  26.655  12.825 1.00 45.99 ? 196  PHE A C     1 
ATOM   1309 O  O     . PHE A 1 167 ? 22.765  26.692  13.247 1.00 44.35 ? 196  PHE A O     1 
ATOM   1310 C  CB    . PHE A 1 167 ? 21.639  25.441  10.681 1.00 46.06 ? 196  PHE A CB    1 
ATOM   1311 C  CG    . PHE A 1 167 ? 20.964  25.225  9.358  1.00 45.43 ? 196  PHE A CG    1 
ATOM   1312 C  CD1   . PHE A 1 167 ? 21.574  25.622  8.174  1.00 45.01 ? 196  PHE A CD1   1 
ATOM   1313 C  CD2   . PHE A 1 167 ? 19.719  24.609  9.295  1.00 46.01 ? 196  PHE A CD2   1 
ATOM   1314 C  CE1   . PHE A 1 167 ? 20.954  25.405  6.943  1.00 45.48 ? 196  PHE A CE1   1 
ATOM   1315 C  CE2   . PHE A 1 167 ? 19.089  24.388  8.066  1.00 45.39 ? 196  PHE A CE2   1 
ATOM   1316 C  CZ    . PHE A 1 167 ? 19.709  24.786  6.890  1.00 43.58 ? 196  PHE A CZ    1 
ATOM   1317 N  N     . LYS A 1 168 ? 20.555  26.498  13.608 1.00 46.22 ? 197  LYS A N     1 
ATOM   1318 C  CA    . LYS A 1 168 ? 20.674  26.292  15.045 1.00 45.64 ? 197  LYS A CA    1 
ATOM   1319 C  C     . LYS A 1 168 ? 19.858  25.027  15.317 1.00 44.13 ? 197  LYS A C     1 
ATOM   1320 O  O     . LYS A 1 168 ? 18.628  25.072  15.384 1.00 42.25 ? 197  LYS A O     1 
ATOM   1321 C  CB    . LYS A 1 168 ? 20.110  27.488  15.820 1.00 47.87 ? 197  LYS A CB    1 
ATOM   1322 C  CG    . LYS A 1 168 ? 20.909  28.773  15.627 1.00 51.55 ? 197  LYS A CG    1 
ATOM   1323 C  CD    . LYS A 1 168 ? 20.473  29.860  16.600 1.00 53.70 ? 197  LYS A CD    1 
ATOM   1324 C  CE    . LYS A 1 168 ? 21.365  31.092  16.490 1.00 54.97 ? 197  LYS A CE    1 
ATOM   1325 N  NZ    . LYS A 1 168 ? 20.987  32.158  17.469 1.00 55.72 ? 197  LYS A NZ    1 
ATOM   1326 N  N     . MET A 1 169 ? 20.554  23.899  15.446 1.00 43.26 ? 198  MET A N     1 
ATOM   1327 C  CA    . MET A 1 169 ? 19.914  22.602  15.678 1.00 41.61 ? 198  MET A CA    1 
ATOM   1328 C  C     . MET A 1 169 ? 19.841  22.240  17.159 1.00 40.21 ? 198  MET A C     1 
ATOM   1329 O  O     . MET A 1 169 ? 20.864  22.102  17.823 1.00 40.54 ? 198  MET A O     1 
ATOM   1330 C  CB    . MET A 1 169 ? 20.673  21.513  14.912 1.00 39.93 ? 198  MET A CB    1 
ATOM   1331 C  CG    . MET A 1 169 ? 20.070  20.122  15.036 1.00 39.98 ? 198  MET A CG    1 
ATOM   1332 S  SD    . MET A 1 169 ? 20.880  18.901  13.968 1.00 37.48 ? 198  MET A SD    1 
ATOM   1333 C  CE    . MET A 1 169 ? 19.968  19.150  12.460 1.00 34.89 ? 198  MET A CE    1 
ATOM   1334 N  N     . PHE A 1 170 ? 18.622  22.078  17.664 1.00 38.79 ? 199  PHE A N     1 
ATOM   1335 C  CA    . PHE A 1 170 ? 18.391  21.742  19.070 1.00 38.25 ? 199  PHE A CA    1 
ATOM   1336 C  C     . PHE A 1 170 ? 17.880  20.314  19.287 1.00 37.27 ? 199  PHE A C     1 
ATOM   1337 O  O     . PHE A 1 170 ? 17.087  19.795  18.495 1.00 36.40 ? 199  PHE A O     1 
ATOM   1338 C  CB    . PHE A 1 170 ? 17.365  22.705  19.677 1.00 39.60 ? 199  PHE A CB    1 
ATOM   1339 C  CG    . PHE A 1 170 ? 17.837  24.127  19.779 1.00 42.89 ? 199  PHE A CG    1 
ATOM   1340 C  CD1   . PHE A 1 170 ? 18.447  24.589  20.945 1.00 42.61 ? 199  PHE A CD1   1 
ATOM   1341 C  CD2   . PHE A 1 170 ? 17.656  25.014  18.716 1.00 41.51 ? 199  PHE A CD2   1 
ATOM   1342 C  CE1   . PHE A 1 170 ? 18.867  25.917  21.054 1.00 43.44 ? 199  PHE A CE1   1 
ATOM   1343 C  CE2   . PHE A 1 170 ? 18.072  26.341  18.811 1.00 42.76 ? 199  PHE A CE2   1 
ATOM   1344 C  CZ    . PHE A 1 170 ? 18.680  26.796  19.985 1.00 43.53 ? 199  PHE A CZ    1 
ATOM   1345 N  N     . ASP A 1 171 ? 18.327  19.701  20.381 1.00 36.09 ? 200  ASP A N     1 
ATOM   1346 C  CA    . ASP A 1 171 ? 17.913  18.355  20.771 1.00 34.76 ? 200  ASP A CA    1 
ATOM   1347 C  C     . ASP A 1 171 ? 17.751  18.303  22.289 1.00 36.05 ? 200  ASP A C     1 
ATOM   1348 O  O     . ASP A 1 171 ? 18.733  18.222  23.023 1.00 36.80 ? 200  ASP A O     1 
ATOM   1349 C  CB    . ASP A 1 171 ? 18.942  17.303  20.327 1.00 29.84 ? 200  ASP A CB    1 
ATOM   1350 C  CG    . ASP A 1 171 ? 18.635  15.909  20.879 1.00 30.34 ? 200  ASP A CG    1 
ATOM   1351 O  OD1   . ASP A 1 171 ? 17.451  15.620  21.166 1.00 30.45 ? 200  ASP A OD1   1 
ATOM   1352 O  OD2   . ASP A 1 171 ? 19.572  15.091  21.017 1.00 29.32 ? 200  ASP A OD2   1 
ATOM   1353 N  N     . VAL A 1 172 ? 16.507  18.366  22.751 1.00 38.07 ? 201  VAL A N     1 
ATOM   1354 C  CA    . VAL A 1 172 ? 16.206  18.309  24.178 1.00 41.31 ? 201  VAL A CA    1 
ATOM   1355 C  C     . VAL A 1 172 ? 16.492  16.898  24.675 1.00 44.01 ? 201  VAL A C     1 
ATOM   1356 O  O     . VAL A 1 172 ? 16.937  16.693  25.804 1.00 43.36 ? 201  VAL A O     1 
ATOM   1357 C  CB    . VAL A 1 172 ? 14.717  18.614  24.444 1.00 41.76 ? 201  VAL A CB    1 
ATOM   1358 C  CG1   . VAL A 1 172 ? 14.398  18.403  25.912 1.00 40.75 ? 201  VAL A CG1   1 
ATOM   1359 C  CG2   . VAL A 1 172 ? 14.390  20.037  24.017 1.00 41.93 ? 201  VAL A CG2   1 
ATOM   1360 N  N     . GLY A 1 173 ? 16.214  15.942  23.794 1.00 47.29 ? 202  GLY A N     1 
ATOM   1361 C  CA    . GLY A 1 173 ? 16.400  14.525  24.050 1.00 50.82 ? 202  GLY A CA    1 
ATOM   1362 C  C     . GLY A 1 173 ? 16.806  14.021  25.417 1.00 53.18 ? 202  GLY A C     1 
ATOM   1363 O  O     . GLY A 1 173 ? 17.875  14.358  25.926 1.00 57.46 ? 202  GLY A O     1 
ATOM   1364 N  N     . GLY A 1 174 ? 15.949  13.194  26.008 1.00 54.35 ? 203  GLY A N     1 
ATOM   1365 C  CA    . GLY A 1 174 ? 16.248  12.610  27.303 1.00 55.74 ? 203  GLY A CA    1 
ATOM   1366 C  C     . GLY A 1 174 ? 15.951  13.462  28.521 1.00 57.61 ? 203  GLY A C     1 
ATOM   1367 O  O     . GLY A 1 174 ? 15.119  13.099  29.351 1.00 56.56 ? 203  GLY A O     1 
ATOM   1368 N  N     . GLN A 1 175 ? 16.644  14.590  28.635 1.00 59.84 ? 204  GLN A N     1 
ATOM   1369 C  CA    . GLN A 1 175 ? 16.459  15.490  29.764 1.00 61.86 ? 204  GLN A CA    1 
ATOM   1370 C  C     . GLN A 1 175 ? 14.995  15.895  29.909 1.00 61.79 ? 204  GLN A C     1 
ATOM   1371 O  O     . GLN A 1 175 ? 14.470  16.657  29.097 1.00 61.12 ? 204  GLN A O     1 
ATOM   1372 C  CB    . GLN A 1 175 ? 17.335  16.736  29.582 1.00 64.39 ? 204  GLN A CB    1 
ATOM   1373 C  CG    . GLN A 1 175 ? 17.269  17.738  30.730 1.00 66.73 ? 204  GLN A CG    1 
ATOM   1374 C  CD    . GLN A 1 175 ? 17.600  17.114  32.075 1.00 68.48 ? 204  GLN A CD    1 
ATOM   1375 O  OE1   . GLN A 1 175 ? 16.830  16.310  32.609 1.00 69.43 ? 204  GLN A OE1   1 
ATOM   1376 N  NE2   . GLN A 1 175 ? 18.752  17.478  32.627 1.00 69.27 ? 204  GLN A NE2   1 
ATOM   1377 N  N     . ARG A 1 176 ? 14.338  15.373  30.942 1.00 62.29 ? 205  ARG A N     1 
ATOM   1378 C  CA    . ARG A 1 176 ? 12.935  15.693  31.189 1.00 63.12 ? 205  ARG A CA    1 
ATOM   1379 C  C     . ARG A 1 176 ? 12.792  17.203  31.340 1.00 62.15 ? 205  ARG A C     1 
ATOM   1380 O  O     . ARG A 1 176 ? 13.453  17.816  32.181 1.00 61.30 ? 205  ARG A O     1 
ATOM   1381 C  CB    . ARG A 1 176 ? 12.446  15.003  32.460 1.00 64.58 ? 205  ARG A CB    1 
ATOM   1382 C  CG    . ARG A 1 176 ? 11.002  15.310  32.813 1.00 68.62 ? 205  ARG A CG    1 
ATOM   1383 C  CD    . ARG A 1 176 ? 10.657  14.761  34.185 1.00 71.80 ? 205  ARG A CD    1 
ATOM   1384 N  NE    . ARG A 1 176 ? 11.535  15.308  35.217 1.00 75.12 ? 205  ARG A NE    1 
ATOM   1385 C  CZ    . ARG A 1 176 ? 11.488  14.967  36.502 1.00 76.96 ? 205  ARG A CZ    1 
ATOM   1386 N  NH1   . ARG A 1 176 ? 10.601  14.074  36.924 1.00 77.72 ? 205  ARG A NH1   1 
ATOM   1387 N  NH2   . ARG A 1 176 ? 12.327  15.519  37.369 1.00 77.44 ? 205  ARG A NH2   1 
ATOM   1388 N  N     . SER A 1 177 ? 11.927  17.798  30.526 1.00 60.84 ? 206  SER A N     1 
ATOM   1389 C  CA    . SER A 1 177 ? 11.730  19.238  30.567 1.00 60.11 ? 206  SER A CA    1 
ATOM   1390 C  C     . SER A 1 177 ? 10.329  19.667  30.984 1.00 60.04 ? 206  SER A C     1 
ATOM   1391 O  O     . SER A 1 177 ? 9.350   18.950  30.772 1.00 60.02 ? 206  SER A O     1 
ATOM   1392 C  CB    . SER A 1 177 ? 12.073  19.843  29.206 1.00 59.56 ? 206  SER A CB    1 
ATOM   1393 O  OG    . SER A 1 177 ? 13.438  19.623  28.893 1.00 59.03 ? 206  SER A OG    1 
ATOM   1394 N  N     . GLU A 1 178 ? 10.256  20.852  31.583 1.00 60.17 ? 207  GLU A N     1 
ATOM   1395 C  CA    . GLU A 1 178 ? 9.003   21.431  32.054 1.00 59.86 ? 207  GLU A CA    1 
ATOM   1396 C  C     . GLU A 1 178 ? 8.320   22.203  30.928 1.00 57.77 ? 207  GLU A C     1 
ATOM   1397 O  O     . GLU A 1 178 ? 8.978   22.678  30.005 1.00 55.64 ? 207  GLU A O     1 
ATOM   1398 C  CB    . GLU A 1 178 ? 9.282   22.370  33.230 1.00 62.47 ? 207  GLU A CB    1 
ATOM   1399 C  CG    . GLU A 1 178 ? 8.044   22.993  33.853 1.00 66.95 ? 207  GLU A CG    1 
ATOM   1400 C  CD    . GLU A 1 178 ? 7.093   21.958  34.424 1.00 69.10 ? 207  GLU A CD    1 
ATOM   1401 O  OE1   . GLU A 1 178 ? 6.420   21.255  33.636 1.00 69.42 ? 207  GLU A OE1   1 
ATOM   1402 O  OE2   . GLU A 1 178 ? 7.028   21.845  35.667 1.00 71.06 ? 207  GLU A OE2   1 
ATOM   1403 N  N     . ARG A 1 179 ? 6.998   22.324  31.022 1.00 56.78 ? 208  ARG A N     1 
ATOM   1404 C  CA    . ARG A 1 179 ? 6.193   23.020  30.023 1.00 56.49 ? 208  ARG A CA    1 
ATOM   1405 C  C     . ARG A 1 179 ? 6.839   24.313  29.525 1.00 55.72 ? 208  ARG A C     1 
ATOM   1406 O  O     . ARG A 1 179 ? 6.859   24.583  28.323 1.00 54.62 ? 208  ARG A O     1 
ATOM   1407 C  CB    . ARG A 1 179 ? 4.802   23.312  30.598 1.00 58.19 ? 208  ARG A CB    1 
ATOM   1408 C  CG    . ARG A 1 179 ? 3.805   23.873  29.592 1.00 60.64 ? 208  ARG A CG    1 
ATOM   1409 C  CD    . ARG A 1 179 ? 2.389   23.888  30.159 1.00 62.69 ? 208  ARG A CD    1 
ATOM   1410 N  NE    . ARG A 1 179 ? 1.397   24.249  29.147 1.00 65.63 ? 208  ARG A NE    1 
ATOM   1411 C  CZ    . ARG A 1 179 ? 0.080   24.149  29.312 1.00 67.87 ? 208  ARG A CZ    1 
ATOM   1412 N  NH1   . ARG A 1 179 ? -0.422  23.695  30.456 1.00 68.59 ? 208  ARG A NH1   1 
ATOM   1413 N  NH2   . ARG A 1 179 ? -0.741  24.502  28.330 1.00 68.16 ? 208  ARG A NH2   1 
ATOM   1414 N  N     . LYS A 1 180 ? 7.373   25.101  30.453 1.00 54.53 ? 209  LYS A N     1 
ATOM   1415 C  CA    . LYS A 1 180 ? 8.023   26.368  30.120 1.00 54.01 ? 209  LYS A CA    1 
ATOM   1416 C  C     . LYS A 1 180 ? 9.179   26.169  29.144 1.00 51.94 ? 209  LYS A C     1 
ATOM   1417 O  O     . LYS A 1 180 ? 9.261   26.829  28.106 1.00 51.41 ? 209  LYS A O     1 
ATOM   1418 C  CB    . LYS A 1 180 ? 8.559   27.033  31.393 1.00 56.48 ? 209  LYS A CB    1 
ATOM   1419 C  CG    . LYS A 1 180 ? 7.509   27.265  32.472 1.00 60.46 ? 209  LYS A CG    1 
ATOM   1420 C  CD    . LYS A 1 180 ? 8.145   27.738  33.777 1.00 62.97 ? 209  LYS A CD    1 
ATOM   1421 C  CE    . LYS A 1 180 ? 8.947   29.019  33.582 1.00 64.47 ? 209  LYS A CE    1 
ATOM   1422 N  NZ    . LYS A 1 180 ? 9.557   29.494  34.857 1.00 66.09 ? 209  LYS A NZ    1 
ATOM   1423 N  N     . LYS A 1 181 ? 10.077  25.259  29.502 1.00 50.31 ? 210  LYS A N     1 
ATOM   1424 C  CA    . LYS A 1 181 ? 11.247  24.952  28.692 1.00 49.16 ? 210  LYS A CA    1 
ATOM   1425 C  C     . LYS A 1 181 ? 10.839  24.538  27.272 1.00 46.49 ? 210  LYS A C     1 
ATOM   1426 O  O     . LYS A 1 181 ? 11.418  25.012  26.293 1.00 44.95 ? 210  LYS A O     1 
ATOM   1427 C  CB    . LYS A 1 181 ? 12.051  23.842  29.376 1.00 51.45 ? 210  LYS A CB    1 
ATOM   1428 C  CG    . LYS A 1 181 ? 13.439  23.592  28.805 1.00 54.92 ? 210  LYS A CG    1 
ATOM   1429 C  CD    . LYS A 1 181 ? 14.141  22.489  29.598 1.00 58.05 ? 210  LYS A CD    1 
ATOM   1430 C  CE    . LYS A 1 181 ? 15.400  21.987  28.898 1.00 59.33 ? 210  LYS A CE    1 
ATOM   1431 N  NZ    . LYS A 1 181 ? 15.939  20.753  29.544 1.00 59.56 ? 210  LYS A NZ    1 
ATOM   1432 N  N     . TRP A 1 182 ? 9.834   23.670  27.164 1.00 43.93 ? 211  TRP A N     1 
ATOM   1433 C  CA    . TRP A 1 182 ? 9.361   23.212  25.858 1.00 43.02 ? 211  TRP A CA    1 
ATOM   1434 C  C     . TRP A 1 182 ? 8.791   24.351  25.011 1.00 42.67 ? 211  TRP A C     1 
ATOM   1435 O  O     . TRP A 1 182 ? 9.077   24.445  23.814 1.00 39.95 ? 211  TRP A O     1 
ATOM   1436 C  CB    . TRP A 1 182 ? 8.309   22.105  26.018 1.00 42.64 ? 211  TRP A CB    1 
ATOM   1437 C  CG    . TRP A 1 182 ? 8.906   20.737  26.210 1.00 43.10 ? 211  TRP A CG    1 
ATOM   1438 C  CD1   . TRP A 1 182 ? 8.886   19.980  27.348 1.00 40.90 ? 211  TRP A CD1   1 
ATOM   1439 C  CD2   . TRP A 1 182 ? 9.627   19.971  25.233 1.00 41.99 ? 211  TRP A CD2   1 
ATOM   1440 N  NE1   . TRP A 1 182 ? 9.549   18.792  27.141 1.00 40.92 ? 211  TRP A NE1   1 
ATOM   1441 C  CE2   . TRP A 1 182 ? 10.012  18.761  25.851 1.00 42.28 ? 211  TRP A CE2   1 
ATOM   1442 C  CE3   . TRP A 1 182 ? 9.985   20.192  23.896 1.00 41.60 ? 211  TRP A CE3   1 
ATOM   1443 C  CZ2   . TRP A 1 182 ? 10.737  17.773  25.177 1.00 40.74 ? 211  TRP A CZ2   1 
ATOM   1444 C  CZ3   . TRP A 1 182 ? 10.705  19.210  23.226 1.00 41.26 ? 211  TRP A CZ3   1 
ATOM   1445 C  CH2   . TRP A 1 182 ? 11.072  18.015  23.869 1.00 41.66 ? 211  TRP A CH2   1 
ATOM   1446 N  N     . ILE A 1 183 ? 7.983   25.209  25.630 1.00 42.24 ? 212  ILE A N     1 
ATOM   1447 C  CA    . ILE A 1 183 ? 7.402   26.342  24.920 1.00 42.80 ? 212  ILE A CA    1 
ATOM   1448 C  C     . ILE A 1 183 ? 8.527   27.180  24.328 1.00 42.26 ? 212  ILE A C     1 
ATOM   1449 O  O     . ILE A 1 183 ? 8.437   27.646  23.192 1.00 41.54 ? 212  ILE A O     1 
ATOM   1450 C  CB    . ILE A 1 183 ? 6.574   27.252  25.855 1.00 43.75 ? 212  ILE A CB    1 
ATOM   1451 C  CG1   . ILE A 1 183 ? 5.384   26.481  26.433 1.00 44.44 ? 212  ILE A CG1   1 
ATOM   1452 C  CG2   . ILE A 1 183 ? 6.097   28.480  25.086 1.00 44.59 ? 212  ILE A CG2   1 
ATOM   1453 C  CD1   . ILE A 1 183 ? 4.435   25.947  25.389 1.00 46.28 ? 212  ILE A CD1   1 
ATOM   1454 N  N     . HIS A 1 184 ? 9.588   27.367  25.109 1.00 41.88 ? 213  HIS A N     1 
ATOM   1455 C  CA    . HIS A 1 184 ? 10.725  28.152  24.657 1.00 43.05 ? 213  HIS A CA    1 
ATOM   1456 C  C     . HIS A 1 184 ? 11.429  27.460  23.502 1.00 41.60 ? 213  HIS A C     1 
ATOM   1457 O  O     . HIS A 1 184 ? 11.906  28.112  22.579 1.00 41.98 ? 213  HIS A O     1 
ATOM   1458 C  CB    . HIS A 1 184 ? 11.704  28.390  25.808 1.00 46.78 ? 213  HIS A CB    1 
ATOM   1459 C  CG    . HIS A 1 184 ? 11.126  29.193  26.932 1.00 50.55 ? 213  HIS A CG    1 
ATOM   1460 N  ND1   . HIS A 1 184 ? 10.346  30.311  26.722 1.00 52.69 ? 213  HIS A ND1   1 
ATOM   1461 C  CD2   . HIS A 1 184 ? 11.225  29.050  28.276 1.00 51.71 ? 213  HIS A CD2   1 
ATOM   1462 C  CE1   . HIS A 1 184 ? 9.987   30.820  27.888 1.00 52.78 ? 213  HIS A CE1   1 
ATOM   1463 N  NE2   . HIS A 1 184 ? 10.508  30.074  28.846 1.00 51.83 ? 213  HIS A NE2   1 
ATOM   1464 N  N     . CYS A 1 185 ? 11.489  26.135  23.553 1.00 41.14 ? 214  CYS A N     1 
ATOM   1465 C  CA    . CYS A 1 185 ? 12.122  25.373  22.489 1.00 41.25 ? 214  CYS A CA    1 
ATOM   1466 C  C     . CYS A 1 185 ? 11.330  25.525  21.193 1.00 39.69 ? 214  CYS A C     1 
ATOM   1467 O  O     . CYS A 1 185 ? 11.907  25.733  20.126 1.00 39.35 ? 214  CYS A O     1 
ATOM   1468 C  CB    . CYS A 1 185 ? 12.205  23.891  22.871 1.00 43.01 ? 214  CYS A CB    1 
ATOM   1469 S  SG    . CYS A 1 185 ? 13.530  23.479  24.032 1.00 47.79 ? 214  CYS A SG    1 
ATOM   1470 N  N     . PHE A 1 186 ? 10.008  25.431  21.302 1.00 38.67 ? 215  PHE A N     1 
ATOM   1471 C  CA    . PHE A 1 186 ? 9.109   25.540  20.152 1.00 39.23 ? 215  PHE A CA    1 
ATOM   1472 C  C     . PHE A 1 186 ? 9.055   26.929  19.516 1.00 38.71 ? 215  PHE A C     1 
ATOM   1473 O  O     . PHE A 1 186 ? 9.118   27.053  18.296 1.00 38.04 ? 215  PHE A O     1 
ATOM   1474 C  CB    . PHE A 1 186 ? 7.698   25.103  20.557 1.00 40.32 ? 215  PHE A CB    1 
ATOM   1475 C  CG    . PHE A 1 186 ? 7.582   23.638  20.855 1.00 41.50 ? 215  PHE A CG    1 
ATOM   1476 C  CD1   . PHE A 1 186 ? 6.782   23.189  21.892 1.00 43.34 ? 215  PHE A CD1   1 
ATOM   1477 C  CD2   . PHE A 1 186 ? 8.272   22.704  20.093 1.00 43.38 ? 215  PHE A CD2   1 
ATOM   1478 C  CE1   . PHE A 1 186 ? 6.669   21.828  22.171 1.00 43.32 ? 215  PHE A CE1   1 
ATOM   1479 C  CE2   . PHE A 1 186 ? 8.165   21.344  20.362 1.00 43.95 ? 215  PHE A CE2   1 
ATOM   1480 C  CZ    . PHE A 1 186 ? 7.361   20.907  21.405 1.00 43.18 ? 215  PHE A CZ    1 
ATOM   1481 N  N     . GLU A 1 187 ? 8.930   27.969  20.337 1.00 38.84 ? 216  GLU A N     1 
ATOM   1482 C  CA    . GLU A 1 187 ? 8.877   29.336  19.823 1.00 38.23 ? 216  GLU A CA    1 
ATOM   1483 C  C     . GLU A 1 187 ? 10.077  29.599  18.924 1.00 37.13 ? 216  GLU A C     1 
ATOM   1484 O  O     . GLU A 1 187 ? 11.222  29.412  19.334 1.00 37.09 ? 216  GLU A O     1 
ATOM   1485 C  CB    . GLU A 1 187 ? 8.875   30.345  20.975 1.00 40.56 ? 216  GLU A CB    1 
ATOM   1486 C  CG    . GLU A 1 187 ? 7.669   30.236  21.895 1.00 44.16 ? 216  GLU A CG    1 
ATOM   1487 C  CD    . GLU A 1 187 ? 7.809   31.082  23.149 1.00 45.19 ? 216  GLU A CD    1 
ATOM   1488 O  OE1   . GLU A 1 187 ? 8.875   31.006  23.796 1.00 46.04 ? 216  GLU A OE1   1 
ATOM   1489 O  OE2   . GLU A 1 187 ? 6.851   31.811  23.494 1.00 45.40 ? 216  GLU A OE2   1 
ATOM   1490 N  N     . GLY A 1 188 ? 9.807   30.019  17.694 1.00 35.48 ? 217  GLY A N     1 
ATOM   1491 C  CA    . GLY A 1 188 ? 10.876  30.304  16.759 1.00 35.42 ? 217  GLY A CA    1 
ATOM   1492 C  C     . GLY A 1 188 ? 11.284  29.131  15.882 1.00 37.43 ? 217  GLY A C     1 
ATOM   1493 O  O     . GLY A 1 188 ? 12.092  29.303  14.969 1.00 37.86 ? 217  GLY A O     1 
ATOM   1494 N  N     . VAL A 1 189 ? 10.736  27.943  16.132 1.00 35.91 ? 218  VAL A N     1 
ATOM   1495 C  CA    . VAL A 1 189 ? 11.117  26.787  15.325 1.00 36.88 ? 218  VAL A CA    1 
ATOM   1496 C  C     . VAL A 1 189 ? 10.718  26.969  13.862 1.00 36.14 ? 218  VAL A C     1 
ATOM   1497 O  O     . VAL A 1 189 ? 9.571   27.299  13.548 1.00 36.27 ? 218  VAL A O     1 
ATOM   1498 C  CB    . VAL A 1 189 ? 10.518  25.457  15.884 1.00 36.37 ? 218  VAL A CB    1 
ATOM   1499 C  CG1   . VAL A 1 189 ? 8.999   25.471  15.804 1.00 36.81 ? 218  VAL A CG1   1 
ATOM   1500 C  CG2   . VAL A 1 189 ? 11.086  24.271  15.110 1.00 36.11 ? 218  VAL A CG2   1 
ATOM   1501 N  N     . THR A 1 190 ? 11.686  26.771  12.974 1.00 34.99 ? 219  THR A N     1 
ATOM   1502 C  CA    . THR A 1 190 ? 11.463  26.913  11.540 1.00 36.76 ? 219  THR A CA    1 
ATOM   1503 C  C     . THR A 1 190 ? 11.145  25.553  10.921 1.00 35.87 ? 219  THR A C     1 
ATOM   1504 O  O     . THR A 1 190 ? 10.469  25.459  9.897  1.00 34.88 ? 219  THR A O     1 
ATOM   1505 C  CB    . THR A 1 190 ? 12.716  27.485  10.839 1.00 37.74 ? 219  THR A CB    1 
ATOM   1506 O  OG1   . THR A 1 190 ? 13.106  28.709  11.477 1.00 41.95 ? 219  THR A OG1   1 
ATOM   1507 C  CG2   . THR A 1 190 ? 12.428  27.756  9.371  1.00 38.33 ? 219  THR A CG2   1 
ATOM   1508 N  N     . ALA A 1 191 ? 11.643  24.498  11.554 1.00 34.44 ? 220  ALA A N     1 
ATOM   1509 C  CA    . ALA A 1 191 ? 11.424  23.150  11.060 1.00 32.86 ? 220  ALA A CA    1 
ATOM   1510 C  C     . ALA A 1 191 ? 11.688  22.134  12.154 1.00 32.36 ? 220  ALA A C     1 
ATOM   1511 O  O     . ALA A 1 191 ? 12.577  22.307  12.994 1.00 30.75 ? 220  ALA A O     1 
ATOM   1512 C  CB    . ALA A 1 191 ? 12.329  22.875  9.864  1.00 32.11 ? 220  ALA A CB    1 
ATOM   1513 N  N     . ILE A 1 192 ? 10.890  21.077  12.130 1.00 30.99 ? 221  ILE A N     1 
ATOM   1514 C  CA    . ILE A 1 192 ? 10.992  19.995  13.088 1.00 29.39 ? 221  ILE A CA    1 
ATOM   1515 C  C     . ILE A 1 192 ? 11.402  18.726  12.361 1.00 29.88 ? 221  ILE A C     1 
ATOM   1516 O  O     . ILE A 1 192 ? 10.773  18.333  11.370 1.00 28.06 ? 221  ILE A O     1 
ATOM   1517 C  CB    . ILE A 1 192 ? 9.636   19.725  13.776 1.00 31.17 ? 221  ILE A CB    1 
ATOM   1518 C  CG1   . ILE A 1 192 ? 9.258   20.904  14.686 1.00 28.21 ? 221  ILE A CG1   1 
ATOM   1519 C  CG2   . ILE A 1 192 ? 9.697   18.397  14.533 1.00 29.25 ? 221  ILE A CG2   1 
ATOM   1520 C  CD1   . ILE A 1 192 ? 7.846   20.827  15.239 1.00 26.23 ? 221  ILE A CD1   1 
ATOM   1521 N  N     . ILE A 1 193 ? 12.473  18.102  12.841 1.00 29.98 ? 222  ILE A N     1 
ATOM   1522 C  CA    . ILE A 1 193 ? 12.933  16.847  12.275 1.00 28.39 ? 222  ILE A CA    1 
ATOM   1523 C  C     . ILE A 1 193 ? 12.567  15.770  13.287 1.00 28.24 ? 222  ILE A C     1 
ATOM   1524 O  O     . ILE A 1 193 ? 13.216  15.625  14.331 1.00 29.56 ? 222  ILE A O     1 
ATOM   1525 C  CB    . ILE A 1 193 ? 14.447  16.829  12.043 1.00 27.48 ? 222  ILE A CB    1 
ATOM   1526 C  CG1   . ILE A 1 193 ? 14.819  17.846  10.963 1.00 26.02 ? 222  ILE A CG1   1 
ATOM   1527 C  CG2   . ILE A 1 193 ? 14.880  15.421  11.636 1.00 28.49 ? 222  ILE A CG2   1 
ATOM   1528 C  CD1   . ILE A 1 193 ? 16.300  17.898  10.669 1.00 25.14 ? 222  ILE A CD1   1 
ATOM   1529 N  N     . PHE A 1 194 ? 11.507  15.033  12.973 1.00 25.69 ? 223  PHE A N     1 
ATOM   1530 C  CA    . PHE A 1 194 ? 11.009  13.969  13.833 1.00 24.40 ? 223  PHE A CA    1 
ATOM   1531 C  C     . PHE A 1 194 ? 11.653  12.640  13.471 1.00 24.07 ? 223  PHE A C     1 
ATOM   1532 O  O     . PHE A 1 194 ? 11.413  12.105  12.390 1.00 22.39 ? 223  PHE A O     1 
ATOM   1533 C  CB    . PHE A 1 194 ? 9.497   13.845  13.681 1.00 23.93 ? 223  PHE A CB    1 
ATOM   1534 C  CG    . PHE A 1 194 ? 8.863   12.958  14.700 1.00 25.59 ? 223  PHE A CG    1 
ATOM   1535 C  CD1   . PHE A 1 194 ? 8.447   13.475  15.925 1.00 26.29 ? 223  PHE A CD1   1 
ATOM   1536 C  CD2   . PHE A 1 194 ? 8.698   11.601  14.451 1.00 23.48 ? 223  PHE A CD2   1 
ATOM   1537 C  CE1   . PHE A 1 194 ? 7.872   12.649  16.892 1.00 27.59 ? 223  PHE A CE1   1 
ATOM   1538 C  CE2   . PHE A 1 194 ? 8.130   10.768  15.406 1.00 26.16 ? 223  PHE A CE2   1 
ATOM   1539 C  CZ    . PHE A 1 194 ? 7.714   11.293  16.633 1.00 27.87 ? 223  PHE A CZ    1 
ATOM   1540 N  N     . CYS A 1 195 ? 12.461  12.110  14.386 1.00 22.18 ? 224  CYS A N     1 
ATOM   1541 C  CA    . CYS A 1 195 ? 13.151  10.849  14.172 1.00 24.37 ? 224  CYS A CA    1 
ATOM   1542 C  C     . CYS A 1 195 ? 12.395  9.643   14.701 1.00 24.65 ? 224  CYS A C     1 
ATOM   1543 O  O     . CYS A 1 195 ? 11.827  9.672   15.799 1.00 25.97 ? 224  CYS A O     1 
ATOM   1544 C  CB    . CYS A 1 195 ? 14.532  10.895  14.819 1.00 24.98 ? 224  CYS A CB    1 
ATOM   1545 S  SG    . CYS A 1 195 ? 15.559  12.201  14.160 1.00 24.93 ? 224  CYS A SG    1 
ATOM   1546 N  N     . VAL A 1 196 ? 12.406  8.576   13.907 1.00 23.13 ? 225  VAL A N     1 
ATOM   1547 C  CA    . VAL A 1 196 ? 11.745  7.322   14.255 1.00 20.77 ? 225  VAL A CA    1 
ATOM   1548 C  C     . VAL A 1 196 ? 12.715  6.158   14.011 1.00 20.32 ? 225  VAL A C     1 
ATOM   1549 O  O     . VAL A 1 196 ? 13.351  6.093   12.968 1.00 20.11 ? 225  VAL A O     1 
ATOM   1550 C  CB    . VAL A 1 196 ? 10.490  7.086   13.368 1.00 20.87 ? 225  VAL A CB    1 
ATOM   1551 C  CG1   . VAL A 1 196 ? 9.920   5.702   13.628 1.00 17.15 ? 225  VAL A CG1   1 
ATOM   1552 C  CG2   . VAL A 1 196 ? 9.437   8.151   13.640 1.00 21.48 ? 225  VAL A CG2   1 
ATOM   1553 N  N     . ALA A 1 197 ? 12.840  5.249   14.971 1.00 18.42 ? 226  ALA A N     1 
ATOM   1554 C  CA    . ALA A 1 197 ? 13.707  4.089   14.780 1.00 18.71 ? 226  ALA A CA    1 
ATOM   1555 C  C     . ALA A 1 197 ? 12.818  3.009   14.167 1.00 19.12 ? 226  ALA A C     1 
ATOM   1556 O  O     . ALA A 1 197 ? 11.989  2.436   14.863 1.00 18.62 ? 226  ALA A O     1 
ATOM   1557 C  CB    . ALA A 1 197 ? 14.272  3.607   16.111 1.00 16.67 ? 226  ALA A CB    1 
ATOM   1558 N  N     . LEU A 1 198 ? 12.977  2.755   12.864 1.00 18.57 ? 227  LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 198 ? 12.169  1.749   12.169 1.00 20.27 ? 227  LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 198 ? 12.326  0.379   12.805 1.00 19.78 ? 227  LEU A C     1 
ATOM   1561 O  O     . LEU A 1 198 ? 11.365  -0.385  12.893 1.00 20.02 ? 227  LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 198 ? 12.560  1.660   10.675 1.00 19.50 ? 227  LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 198 ? 12.179  2.831   9.746  1.00 18.41 ? 227  LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 198 ? 12.964  2.756   8.440  1.00 14.73 ? 227  LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 198 ? 10.673  2.788   9.467  1.00 18.51 ? 227  LEU A CD2   1 
ATOM   1566 N  N     . SER A 1 199 ? 13.542  0.075   13.251 1.00 21.12 ? 228  SER A N     1 
ATOM   1567 C  CA    . SER A 1 199 ? 13.842  -1.220  13.859 1.00 22.30 ? 228  SER A CA    1 
ATOM   1568 C  C     . SER A 1 199 ? 13.154  -1.457  15.204 1.00 22.53 ? 228  SER A C     1 
ATOM   1569 O  O     . SER A 1 199 ? 13.214  -2.556  15.750 1.00 22.33 ? 228  SER A O     1 
ATOM   1570 C  CB    . SER A 1 199 ? 15.353  -1.384  14.012 1.00 21.82 ? 228  SER A CB    1 
ATOM   1571 O  OG    . SER A 1 199 ? 15.923  -0.221  14.585 1.00 25.30 ? 228  SER A OG    1 
ATOM   1572 N  N     . ASP A 1 200 ? 12.500  -0.431  15.736 1.00 20.93 ? 229  ASP A N     1 
ATOM   1573 C  CA    . ASP A 1 200 ? 11.792  -0.570  17.009 1.00 20.95 ? 229  ASP A CA    1 
ATOM   1574 C  C     . ASP A 1 200 ? 10.459  -1.288  16.837 1.00 20.42 ? 229  ASP A C     1 
ATOM   1575 O  O     . ASP A 1 200 ? 9.769   -1.557  17.823 1.00 21.23 ? 229  ASP A O     1 
ATOM   1576 C  CB    . ASP A 1 200 ? 11.531  0.811   17.626 1.00 18.79 ? 229  ASP A CB    1 
ATOM   1577 C  CG    . ASP A 1 200 ? 12.692  1.307   18.459 1.00 20.48 ? 229  ASP A CG    1 
ATOM   1578 O  OD1   . ASP A 1 200 ? 13.826  0.834   18.247 1.00 21.55 ? 229  ASP A OD1   1 
ATOM   1579 O  OD2   . ASP A 1 200 ? 12.473  2.180   19.325 1.00 25.10 ? 229  ASP A OD2   1 
ATOM   1580 N  N     . TYR A 1 201 ? 10.094  -1.605  15.593 1.00 18.68 ? 230  TYR A N     1 
ATOM   1581 C  CA    . TYR A 1 201 ? 8.804   -2.251  15.325 1.00 16.35 ? 230  TYR A CA    1 
ATOM   1582 C  C     . TYR A 1 201 ? 8.604   -3.621  15.973 1.00 16.50 ? 230  TYR A C     1 
ATOM   1583 O  O     . TYR A 1 201 ? 7.465   -4.025  16.227 1.00 18.40 ? 230  TYR A O     1 
ATOM   1584 C  CB    . TYR A 1 201 ? 8.571   -2.407  13.819 1.00 15.14 ? 230  TYR A CB    1 
ATOM   1585 C  CG    . TYR A 1 201 ? 9.303   -3.584  13.216 1.00 13.16 ? 230  TYR A CG    1 
ATOM   1586 C  CD1   . TYR A 1 201 ? 10.651  -3.496  12.874 1.00 15.07 ? 230  TYR A CD1   1 
ATOM   1587 C  CD2   . TYR A 1 201 ? 8.648   -4.802  13.014 1.00 15.66 ? 230  TYR A CD2   1 
ATOM   1588 C  CE1   . TYR A 1 201 ? 11.329  -4.590  12.348 1.00 16.88 ? 230  TYR A CE1   1 
ATOM   1589 C  CE2   . TYR A 1 201 ? 9.310   -5.899  12.490 1.00 13.63 ? 230  TYR A CE2   1 
ATOM   1590 C  CZ    . TYR A 1 201 ? 10.650  -5.792  12.160 1.00 17.07 ? 230  TYR A CZ    1 
ATOM   1591 O  OH    . TYR A 1 201 ? 11.309  -6.890  11.653 1.00 17.15 ? 230  TYR A OH    1 
ATOM   1592 N  N     . ASP A 1 202 ? 9.687   -4.345  16.226 1.00 14.06 ? 231  ASP A N     1 
ATOM   1593 C  CA    . ASP A 1 202 ? 9.553   -5.667  16.821 1.00 15.74 ? 231  ASP A CA    1 
ATOM   1594 C  C     . ASP A 1 202 ? 9.844   -5.736  18.329 1.00 16.83 ? 231  ASP A C     1 
ATOM   1595 O  O     . ASP A 1 202 ? 9.965   -6.831  18.883 1.00 16.42 ? 231  ASP A O     1 
ATOM   1596 C  CB    . ASP A 1 202 ? 10.448  -6.666  16.079 1.00 15.44 ? 231  ASP A CB    1 
ATOM   1597 C  CG    . ASP A 1 202 ? 11.921  -6.468  16.376 1.00 20.80 ? 231  ASP A CG    1 
ATOM   1598 O  OD1   . ASP A 1 202 ? 12.291  -5.432  16.973 1.00 21.89 ? 231  ASP A OD1   1 
ATOM   1599 O  OD2   . ASP A 1 202 ? 12.716  -7.354  16.000 1.00 24.29 ? 231  ASP A OD2   1 
ATOM   1600 N  N     . LEU A 1 203 ? 9.936   -4.583  18.990 1.00 16.82 ? 232  LEU A N     1 
ATOM   1601 C  CA    . LEU A 1 203 ? 10.225  -4.553  20.426 1.00 19.09 ? 232  LEU A CA    1 
ATOM   1602 C  C     . LEU A 1 203 ? 9.086   -5.085  21.295 1.00 18.51 ? 232  LEU A C     1 
ATOM   1603 O  O     . LEU A 1 203 ? 7.926   -4.710  21.132 1.00 20.57 ? 232  LEU A O     1 
ATOM   1604 C  CB    . LEU A 1 203 ? 10.578  -3.127  20.874 1.00 17.96 ? 232  LEU A CB    1 
ATOM   1605 C  CG    . LEU A 1 203 ? 11.933  -2.562  20.425 1.00 20.02 ? 232  LEU A CG    1 
ATOM   1606 C  CD1   . LEU A 1 203 ? 12.057  -1.095  20.853 1.00 18.08 ? 232  LEU A CD1   1 
ATOM   1607 C  CD2   . LEU A 1 203 ? 13.060  -3.396  21.013 1.00 18.93 ? 232  LEU A CD2   1 
ATOM   1608 N  N     . VAL A 1 204 ? 9.427   -5.965  22.222 1.00 21.71 ? 233  VAL A N     1 
ATOM   1609 C  CA    . VAL A 1 204 ? 8.439   -6.540  23.129 1.00 22.78 ? 233  VAL A CA    1 
ATOM   1610 C  C     . VAL A 1 204 ? 7.895   -5.442  24.028 1.00 24.59 ? 233  VAL A C     1 
ATOM   1611 O  O     . VAL A 1 204 ? 8.630   -4.568  24.468 1.00 26.83 ? 233  VAL A O     1 
ATOM   1612 C  CB    . VAL A 1 204 ? 9.065   -7.681  23.983 1.00 23.17 ? 233  VAL A CB    1 
ATOM   1613 C  CG1   . VAL A 1 204 ? 8.117   -8.107  25.118 1.00 21.75 ? 233  VAL A CG1   1 
ATOM   1614 C  CG2   . VAL A 1 204 ? 9.356   -8.872  23.082 1.00 24.36 ? 233  VAL A CG2   1 
ATOM   1615 N  N     . LEU A 1 205 ? 6.593   -5.485  24.276 1.00 27.86 ? 234  LEU A N     1 
ATOM   1616 C  CA    . LEU A 1 205 ? 5.923   -4.500  25.116 1.00 31.65 ? 234  LEU A CA    1 
ATOM   1617 C  C     . LEU A 1 205 ? 6.502   -4.507  26.539 1.00 33.13 ? 234  LEU A C     1 
ATOM   1618 O  O     . LEU A 1 205 ? 6.769   -5.569  27.104 1.00 32.99 ? 234  LEU A O     1 
ATOM   1619 C  CB    . LEU A 1 205 ? 4.422   -4.819  25.141 1.00 34.24 ? 234  LEU A CB    1 
ATOM   1620 C  CG    . LEU A 1 205 ? 3.392   -3.693  25.264 1.00 37.09 ? 234  LEU A CG    1 
ATOM   1621 C  CD1   . LEU A 1 205 ? 3.612   -2.676  24.159 1.00 38.18 ? 234  LEU A CD1   1 
ATOM   1622 C  CD2   . LEU A 1 205 ? 1.986   -4.271  25.184 1.00 34.67 ? 234  LEU A CD2   1 
ATOM   1623 N  N     . ALA A 1 206 ? 6.720   -3.322  27.102 1.00 34.74 ? 235  ALA A N     1 
ATOM   1624 C  CA    . ALA A 1 206 ? 7.248   -3.197  28.460 1.00 38.52 ? 235  ALA A CA    1 
ATOM   1625 C  C     . ALA A 1 206 ? 6.107   -3.418  29.461 1.00 39.81 ? 235  ALA A C     1 
ATOM   1626 O  O     . ALA A 1 206 ? 4.936   -3.336  29.099 1.00 39.28 ? 235  ALA A O     1 
ATOM   1627 C  CB    . ALA A 1 206 ? 7.866   -1.813  28.659 1.00 38.39 ? 235  ALA A CB    1 
ATOM   1628 N  N     . GLU A 1 207 ? 6.443   -3.683  30.720 1.00 44.79 ? 236  GLU A N     1 
ATOM   1629 C  CA    . GLU A 1 207 ? 5.418   -3.937  31.735 1.00 48.85 ? 236  GLU A CA    1 
ATOM   1630 C  C     . GLU A 1 207 ? 4.395   -2.806  31.876 1.00 49.21 ? 236  GLU A C     1 
ATOM   1631 O  O     . GLU A 1 207 ? 3.192   -3.051  31.990 1.00 47.78 ? 236  GLU A O     1 
ATOM   1632 C  CB    . GLU A 1 207 ? 6.070   -4.210  33.105 1.00 52.66 ? 236  GLU A CB    1 
ATOM   1633 C  CG    . GLU A 1 207 ? 6.438   -2.957  33.911 1.00 57.60 ? 236  GLU A CG    1 
ATOM   1634 C  CD    . GLU A 1 207 ? 7.024   -3.271  35.288 1.00 60.48 ? 236  GLU A CD    1 
ATOM   1635 O  OE1   . GLU A 1 207 ? 8.216   -3.644  35.367 1.00 63.25 ? 236  GLU A OE1   1 
ATOM   1636 O  OE2   . GLU A 1 207 ? 6.291   -3.150  36.294 1.00 61.80 ? 236  GLU A OE2   1 
ATOM   1637 N  N     . ASP A 1 208 ? 4.867   -1.566  31.838 1.00 50.94 ? 237  ASP A N     1 
ATOM   1638 C  CA    . ASP A 1 208 ? 3.977   -0.427  32.020 1.00 53.60 ? 237  ASP A CA    1 
ATOM   1639 C  C     . ASP A 1 208 ? 3.492   0.314   30.775 1.00 53.21 ? 237  ASP A C     1 
ATOM   1640 O  O     . ASP A 1 208 ? 3.028   1.453   30.889 1.00 54.07 ? 237  ASP A O     1 
ATOM   1641 C  CB    . ASP A 1 208 ? 4.640   0.578   32.966 1.00 56.21 ? 237  ASP A CB    1 
ATOM   1642 C  CG    . ASP A 1 208 ? 5.866   1.229   32.353 1.00 60.00 ? 237  ASP A CG    1 
ATOM   1643 O  OD1   . ASP A 1 208 ? 6.661   0.512   31.700 1.00 60.38 ? 237  ASP A OD1   1 
ATOM   1644 O  OD2   . ASP A 1 208 ? 6.039   2.457   32.531 1.00 62.00 ? 237  ASP A OD2   1 
ATOM   1645 N  N     . GLU A 1 209 ? 3.589   -0.291  29.592 1.00 50.94 ? 238  GLU A N     1 
ATOM   1646 C  CA    . GLU A 1 209 ? 3.114   0.417   28.407 1.00 49.45 ? 238  GLU A CA    1 
ATOM   1647 C  C     . GLU A 1 209 ? 1.899   -0.211  27.741 1.00 46.91 ? 238  GLU A C     1 
ATOM   1648 O  O     . GLU A 1 209 ? 1.821   -1.422  27.541 1.00 45.62 ? 238  GLU A O     1 
ATOM   1649 C  CB    . GLU A 1 209 ? 4.245   0.636   27.379 1.00 49.77 ? 238  GLU A CB    1 
ATOM   1650 C  CG    . GLU A 1 209 ? 5.067   -0.577  26.981 1.00 50.68 ? 238  GLU A CG    1 
ATOM   1651 C  CD    . GLU A 1 209 ? 6.129   -0.239  25.926 1.00 51.78 ? 238  GLU A CD    1 
ATOM   1652 O  OE1   . GLU A 1 209 ? 7.051   -1.057  25.722 1.00 48.73 ? 238  GLU A OE1   1 
ATOM   1653 O  OE2   . GLU A 1 209 ? 6.040   0.840   25.293 1.00 51.43 ? 238  GLU A OE2   1 
ATOM   1654 N  N     . GLU A 1 210 ? 0.940   0.647   27.419 1.00 46.34 ? 239  GLU A N     1 
ATOM   1655 C  CA    . GLU A 1 210 ? -0.304  0.240   26.783 1.00 45.86 ? 239  GLU A CA    1 
ATOM   1656 C  C     . GLU A 1 210 ? -0.105  -0.075  25.300 1.00 42.80 ? 239  GLU A C     1 
ATOM   1657 O  O     . GLU A 1 210 ? -0.743  -0.979  24.765 1.00 44.39 ? 239  GLU A O     1 
ATOM   1658 C  CB    . GLU A 1 210 ? -1.345  1.352   26.946 1.00 48.36 ? 239  GLU A CB    1 
ATOM   1659 C  CG    . GLU A 1 210 ? -0.962  2.656   26.259 1.00 52.70 ? 239  GLU A CG    1 
ATOM   1660 C  CD    . GLU A 1 210 ? -1.819  3.832   26.695 1.00 54.79 ? 239  GLU A CD    1 
ATOM   1661 O  OE1   . GLU A 1 210 ? -1.667  4.279   27.853 1.00 56.55 ? 239  GLU A OE1   1 
ATOM   1662 O  OE2   . GLU A 1 210 ? -2.646  4.306   25.883 1.00 55.38 ? 239  GLU A OE2   1 
ATOM   1663 N  N     . MET A 1 211 ? 0.781   0.667   24.640 1.00 38.57 ? 240  MET A N     1 
ATOM   1664 C  CA    . MET A 1 211 ? 1.046   0.450   23.219 1.00 34.32 ? 240  MET A CA    1 
ATOM   1665 C  C     . MET A 1 211 ? 2.534   0.255   22.940 1.00 30.87 ? 240  MET A C     1 
ATOM   1666 O  O     . MET A 1 211 ? 3.378   0.735   23.699 1.00 30.29 ? 240  MET A O     1 
ATOM   1667 C  CB    . MET A 1 211 ? 0.511   1.632   22.405 1.00 36.42 ? 240  MET A CB    1 
ATOM   1668 C  CG    . MET A 1 211 ? 0.996   2.988   22.867 1.00 35.10 ? 240  MET A CG    1 
ATOM   1669 S  SD    . MET A 1 211 ? 0.346   4.349   21.857 1.00 40.90 ? 240  MET A SD    1 
ATOM   1670 C  CE    . MET A 1 211 ? -1.404  4.196   22.142 1.00 38.69 ? 240  MET A CE    1 
ATOM   1671 N  N     . ASN A 1 212 ? 2.859   -0.443  21.853 1.00 26.15 ? 241  ASN A N     1 
ATOM   1672 C  CA    . ASN A 1 212 ? 4.260   -0.681  21.513 1.00 23.05 ? 241  ASN A CA    1 
ATOM   1673 C  C     . ASN A 1 212 ? 4.988   0.632   21.206 1.00 19.83 ? 241  ASN A C     1 
ATOM   1674 O  O     . ASN A 1 212 ? 4.354   1.658   20.986 1.00 18.40 ? 241  ASN A O     1 
ATOM   1675 C  CB    . ASN A 1 212 ? 4.385   -1.674  20.336 1.00 21.83 ? 241  ASN A CB    1 
ATOM   1676 C  CG    . ASN A 1 212 ? 3.657   -1.213  19.075 1.00 21.82 ? 241  ASN A CG    1 
ATOM   1677 O  OD1   . ASN A 1 212 ? 3.814   -0.079  18.631 1.00 22.10 ? 241  ASN A OD1   1 
ATOM   1678 N  ND2   . ASN A 1 212 ? 2.879   -2.112  18.477 1.00 23.06 ? 241  ASN A ND2   1 
ATOM   1679 N  N     . ARG A 1 213 ? 6.319   0.592   21.212 1.00 18.93 ? 242  ARG A N     1 
ATOM   1680 C  CA    . ARG A 1 213 ? 7.144   1.774   20.961 1.00 21.49 ? 242  ARG A CA    1 
ATOM   1681 C  C     . ARG A 1 213 ? 6.783   2.533   19.681 1.00 22.90 ? 242  ARG A C     1 
ATOM   1682 O  O     . ARG A 1 213 ? 6.759   3.766   19.671 1.00 20.17 ? 242  ARG A O     1 
ATOM   1683 C  CB    . ARG A 1 213 ? 8.626   1.383   20.908 1.00 22.84 ? 242  ARG A CB    1 
ATOM   1684 C  CG    . ARG A 1 213 ? 9.225   0.949   22.239 1.00 27.80 ? 242  ARG A CG    1 
ATOM   1685 C  CD    . ARG A 1 213 ? 9.372   2.125   23.214 1.00 33.11 ? 242  ARG A CD    1 
ATOM   1686 N  NE    . ARG A 1 213 ? 10.127  1.747   24.412 1.00 37.33 ? 242  ARG A NE    1 
ATOM   1687 C  CZ    . ARG A 1 213 ? 9.661   1.849   25.654 1.00 39.07 ? 242  ARG A CZ    1 
ATOM   1688 N  NH1   . ARG A 1 213 ? 8.439   2.323   25.870 1.00 41.86 ? 242  ARG A NH1   1 
ATOM   1689 N  NH2   . ARG A 1 213 ? 10.409  1.468   26.680 1.00 40.00 ? 242  ARG A NH2   1 
ATOM   1690 N  N     . MET A 1 214 ? 6.510   1.794   18.608 1.00 21.85 ? 243  MET A N     1 
ATOM   1691 C  CA    . MET A 1 214 ? 6.167   2.410   17.334 1.00 23.28 ? 243  MET A CA    1 
ATOM   1692 C  C     . MET A 1 214 ? 4.885   3.227   17.438 1.00 23.51 ? 243  MET A C     1 
ATOM   1693 O  O     . MET A 1 214 ? 4.809   4.337   16.922 1.00 23.61 ? 243  MET A O     1 
ATOM   1694 C  CB    . MET A 1 214 ? 6.018   1.337   16.251 1.00 22.68 ? 243  MET A CB    1 
ATOM   1695 C  CG    . MET A 1 214 ? 5.895   1.900   14.835 1.00 25.44 ? 243  MET A CG    1 
ATOM   1696 S  SD    . MET A 1 214 ? 7.383   2.779   14.337 1.00 30.38 ? 243  MET A SD    1 
ATOM   1697 C  CE    . MET A 1 214 ? 8.427   1.451   13.812 1.00 26.06 ? 243  MET A CE    1 
ATOM   1698 N  N     . HIS A 1 215 ? 3.873   2.689   18.108 1.00 24.26 ? 244  HIS A N     1 
ATOM   1699 C  CA    . HIS A 1 215 ? 2.626   3.430   18.243 1.00 26.20 ? 244  HIS A CA    1 
ATOM   1700 C  C     . HIS A 1 215 ? 2.741   4.627   19.181 1.00 26.84 ? 244  HIS A C     1 
ATOM   1701 O  O     . HIS A 1 215 ? 2.014   5.607   19.026 1.00 27.48 ? 244  HIS A O     1 
ATOM   1702 C  CB    . HIS A 1 215 ? 1.494   2.502   18.675 1.00 25.52 ? 244  HIS A CB    1 
ATOM   1703 C  CG    . HIS A 1 215 ? 0.982   1.645   17.559 1.00 27.01 ? 244  HIS A CG    1 
ATOM   1704 N  ND1   . HIS A 1 215 ? 1.725   0.624   17.004 1.00 24.28 ? 244  HIS A ND1   1 
ATOM   1705 C  CD2   . HIS A 1 215 ? -0.176  1.691   16.857 1.00 25.64 ? 244  HIS A CD2   1 
ATOM   1706 C  CE1   . HIS A 1 215 ? 1.047   0.079   16.009 1.00 27.32 ? 244  HIS A CE1   1 
ATOM   1707 N  NE2   . HIS A 1 215 ? -0.110  0.709   15.898 1.00 27.64 ? 244  HIS A NE2   1 
ATOM   1708 N  N     . GLU A 1 216 ? 3.651   4.555   20.149 1.00 26.63 ? 245  GLU A N     1 
ATOM   1709 C  CA    . GLU A 1 216 ? 3.862   5.679   21.051 1.00 26.66 ? 245  GLU A CA    1 
ATOM   1710 C  C     . GLU A 1 216 ? 4.479   6.795   20.210 1.00 25.88 ? 245  GLU A C     1 
ATOM   1711 O  O     . GLU A 1 216 ? 4.141   7.967   20.357 1.00 25.18 ? 245  GLU A O     1 
ATOM   1712 C  CB    . GLU A 1 216 ? 4.820   5.290   22.179 1.00 29.41 ? 245  GLU A CB    1 
ATOM   1713 C  CG    . GLU A 1 216 ? 4.248   4.283   23.167 1.00 35.68 ? 245  GLU A CG    1 
ATOM   1714 C  CD    . GLU A 1 216 ? 5.281   3.810   24.185 1.00 39.72 ? 245  GLU A CD    1 
ATOM   1715 O  OE1   . GLU A 1 216 ? 4.897   3.104   25.140 1.00 42.59 ? 245  GLU A OE1   1 
ATOM   1716 O  OE2   . GLU A 1 216 ? 6.478   4.137   24.029 1.00 42.00 ? 245  GLU A OE2   1 
ATOM   1717 N  N     . SER A 1 217 ? 5.392   6.413   19.323 1.00 23.67 ? 246  SER A N     1 
ATOM   1718 C  CA    . SER A 1 217 ? 6.050   7.366   18.446 1.00 23.57 ? 246  SER A CA    1 
ATOM   1719 C  C     . SER A 1 217 ? 5.003   7.981   17.510 1.00 22.75 ? 246  SER A C     1 
ATOM   1720 O  O     . SER A 1 217 ? 5.018   9.188   17.247 1.00 22.90 ? 246  SER A O     1 
ATOM   1721 C  CB    . SER A 1 217 ? 7.147   6.662   17.642 1.00 23.19 ? 246  SER A CB    1 
ATOM   1722 O  OG    . SER A 1 217 ? 7.930   7.601   16.927 1.00 28.15 ? 246  SER A OG    1 
ATOM   1723 N  N     . MET A 1 218 ? 4.085   7.152   17.025 1.00 20.89 ? 247  MET A N     1 
ATOM   1724 C  CA    . MET A 1 218 ? 3.024   7.636   16.146 1.00 22.94 ? 247  MET A CA    1 
ATOM   1725 C  C     . MET A 1 218 ? 2.118   8.623   16.880 1.00 23.18 ? 247  MET A C     1 
ATOM   1726 O  O     . MET A 1 218 ? 1.685   9.631   16.310 1.00 21.19 ? 247  MET A O     1 
ATOM   1727 C  CB    . MET A 1 218 ? 2.177   6.472   15.635 1.00 20.05 ? 247  MET A CB    1 
ATOM   1728 C  CG    . MET A 1 218 ? 2.854   5.633   14.562 1.00 22.54 ? 247  MET A CG    1 
ATOM   1729 S  SD    . MET A 1 218 ? 1.989   4.084   14.250 1.00 21.23 ? 247  MET A SD    1 
ATOM   1730 C  CE    . MET A 1 218 ? 0.298   4.662   13.824 1.00 16.82 ? 247  MET A CE    1 
ATOM   1731 N  N     . LYS A 1 219 ? 1.840   8.329   18.147 1.00 24.86 ? 248  LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 219 ? 0.976   9.179   18.952 1.00 25.64 ? 248  LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 219 ? 1.573   10.582  19.057 1.00 24.72 ? 248  LYS A C     1 
ATOM   1734 O  O     . LYS A 1 219 ? 0.873   11.575  18.905 1.00 25.86 ? 248  LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 219 ? 0.790   8.577   20.349 1.00 28.30 ? 248  LYS A CB    1 
ATOM   1736 C  CG    . LYS A 1 219 ? -0.352  9.213   21.126 1.00 32.47 ? 248  LYS A CG    1 
ATOM   1737 C  CD    . LYS A 1 219 ? -0.344  8.808   22.595 1.00 36.43 ? 248  LYS A CD    1 
ATOM   1738 C  CE    . LYS A 1 219 ? -1.414  9.584   23.365 1.00 38.41 ? 248  LYS A CE    1 
ATOM   1739 N  NZ    . LYS A 1 219 ? -1.381  9.297   24.822 1.00 42.41 ? 248  LYS A NZ    1 
ATOM   1740 N  N     . LEU A 1 220 ? 2.872   10.651  19.309 1.00 25.50 ? 249  LEU A N     1 
ATOM   1741 C  CA    . LEU A 1 220 ? 3.576   11.922  19.417 1.00 24.74 ? 249  LEU A CA    1 
ATOM   1742 C  C     . LEU A 1 220 ? 3.656   12.644  18.070 1.00 26.80 ? 249  LEU A C     1 
ATOM   1743 O  O     . LEU A 1 220 ? 3.485   13.862  18.002 1.00 26.90 ? 249  LEU A O     1 
ATOM   1744 C  CB    . LEU A 1 220 ? 4.988   11.688  19.947 1.00 22.66 ? 249  LEU A CB    1 
ATOM   1745 C  CG    . LEU A 1 220 ? 5.882   12.923  20.054 1.00 24.27 ? 249  LEU A CG    1 
ATOM   1746 C  CD1   . LEU A 1 220 ? 5.233   13.959  20.968 1.00 23.13 ? 249  LEU A CD1   1 
ATOM   1747 C  CD2   . LEU A 1 220 ? 7.256   12.501  20.594 1.00 24.98 ? 249  LEU A CD2   1 
ATOM   1748 N  N     . PHE A 1 221 ? 3.935   11.903  16.999 1.00 26.66 ? 250  PHE A N     1 
ATOM   1749 C  CA    . PHE A 1 221 ? 4.021   12.524  15.680 1.00 27.88 ? 250  PHE A CA    1 
ATOM   1750 C  C     . PHE A 1 221 ? 2.664   13.108  15.308 1.00 28.33 ? 250  PHE A C     1 
ATOM   1751 O  O     . PHE A 1 221 ? 2.572   14.130  14.630 1.00 28.32 ? 250  PHE A O     1 
ATOM   1752 C  CB    . PHE A 1 221 ? 4.427   11.512  14.610 1.00 24.04 ? 250  PHE A CB    1 
ATOM   1753 C  CG    . PHE A 1 221 ? 4.543   12.114  13.239 1.00 23.84 ? 250  PHE A CG    1 
ATOM   1754 C  CD1   . PHE A 1 221 ? 5.593   12.973  12.933 1.00 22.67 ? 250  PHE A CD1   1 
ATOM   1755 C  CD2   . PHE A 1 221 ? 3.568   11.871  12.273 1.00 22.82 ? 250  PHE A CD2   1 
ATOM   1756 C  CE1   . PHE A 1 221 ? 5.674   13.587  11.685 1.00 24.53 ? 250  PHE A CE1   1 
ATOM   1757 C  CE2   . PHE A 1 221 ? 3.638   12.483  11.017 1.00 24.53 ? 250  PHE A CE2   1 
ATOM   1758 C  CZ    . PHE A 1 221 ? 4.692   13.342  10.724 1.00 23.25 ? 250  PHE A CZ    1 
ATOM   1759 N  N     . ASP A 1 222 ? 1.612   12.441  15.762 1.00 30.30 ? 251  ASP A N     1 
ATOM   1760 C  CA    . ASP A 1 222 ? 0.251   12.878  15.500 1.00 31.03 ? 251  ASP A CA    1 
ATOM   1761 C  C     . ASP A 1 222 ? -0.009  14.244  16.156 1.00 32.54 ? 251  ASP A C     1 
ATOM   1762 O  O     . ASP A 1 222 ? -0.548  15.152  15.517 1.00 29.82 ? 251  ASP A O     1 
ATOM   1763 C  CB    . ASP A 1 222 ? -0.722  11.823  16.037 1.00 32.37 ? 251  ASP A CB    1 
ATOM   1764 C  CG    . ASP A 1 222 ? -2.169  12.144  15.729 1.00 35.67 ? 251  ASP A CG    1 
ATOM   1765 O  OD1   . ASP A 1 222 ? -2.427  13.067  14.928 1.00 37.04 ? 251  ASP A OD1   1 
ATOM   1766 O  OD2   . ASP A 1 222 ? -3.053  11.462  16.286 1.00 37.31 ? 251  ASP A OD2   1 
ATOM   1767 N  N     . SER A 1 223 ? 0.387   14.391  17.422 1.00 32.15 ? 252  SER A N     1 
ATOM   1768 C  CA    . SER A 1 223 ? 0.184   15.649  18.141 1.00 32.81 ? 252  SER A CA    1 
ATOM   1769 C  C     . SER A 1 223 ? 0.986   16.767  17.499 1.00 32.27 ? 252  SER A C     1 
ATOM   1770 O  O     . SER A 1 223 ? 0.487   17.879  17.318 1.00 32.98 ? 252  SER A O     1 
ATOM   1771 C  CB    . SER A 1 223 ? 0.612   15.520  19.609 1.00 34.33 ? 252  SER A CB    1 
ATOM   1772 O  OG    . SER A 1 223 ? 0.003   14.403  20.230 1.00 39.48 ? 252  SER A OG    1 
ATOM   1773 N  N     . ILE A 1 224 ? 2.233   16.465  17.151 1.00 31.36 ? 253  ILE A N     1 
ATOM   1774 C  CA    . ILE A 1 224 ? 3.115   17.448  16.543 1.00 30.97 ? 253  ILE A CA    1 
ATOM   1775 C  C     . ILE A 1 224 ? 2.694   17.998  15.178 1.00 33.80 ? 253  ILE A C     1 
ATOM   1776 O  O     . ILE A 1 224 ? 2.567   19.215  15.010 1.00 34.20 ? 253  ILE A O     1 
ATOM   1777 C  CB    . ILE A 1 224 ? 4.547   16.898  16.381 1.00 30.12 ? 253  ILE A CB    1 
ATOM   1778 C  CG1   . ILE A 1 224 ? 5.144   16.556  17.751 1.00 30.02 ? 253  ILE A CG1   1 
ATOM   1779 C  CG2   . ILE A 1 224 ? 5.402   17.922  15.651 1.00 26.63 ? 253  ILE A CG2   1 
ATOM   1780 C  CD1   . ILE A 1 224 ? 5.225   17.743  18.698 1.00 32.73 ? 253  ILE A CD1   1 
ATOM   1781 N  N     . CYS A 1 225 ? 2.494   17.122  14.197 1.00 35.05 ? 254  CYS A N     1 
ATOM   1782 C  CA    . CYS A 1 225 ? 2.143   17.596  12.860 1.00 36.64 ? 254  CYS A CA    1 
ATOM   1783 C  C     . CYS A 1 225 ? 0.741   18.178  12.721 1.00 35.78 ? 254  CYS A C     1 
ATOM   1784 O  O     . CYS A 1 225 ? 0.493   18.975  11.820 1.00 35.67 ? 254  CYS A O     1 
ATOM   1785 C  CB    . CYS A 1 225 ? 2.353   16.490  11.817 1.00 37.83 ? 254  CYS A CB    1 
ATOM   1786 S  SG    . CYS A 1 225 ? 1.136   15.198  11.860 1.00 47.42 ? 254  CYS A SG    1 
ATOM   1787 N  N     . ASN A 1 226 ? -0.181  17.792  13.595 1.00 34.76 ? 255  ASN A N     1 
ATOM   1788 C  CA    . ASN A 1 226 ? -1.529  18.343  13.510 1.00 37.39 ? 255  ASN A CA    1 
ATOM   1789 C  C     . ASN A 1 226 ? -1.725  19.569  14.408 1.00 38.49 ? 255  ASN A C     1 
ATOM   1790 O  O     . ASN A 1 226 ? -2.764  20.227  14.351 1.00 38.22 ? 255  ASN A O     1 
ATOM   1791 C  CB    . ASN A 1 226 ? -2.569  17.273  13.850 1.00 37.11 ? 255  ASN A CB    1 
ATOM   1792 C  CG    . ASN A 1 226 ? -2.669  16.202  12.777 1.00 38.72 ? 255  ASN A CG    1 
ATOM   1793 O  OD1   . ASN A 1 226 ? -3.049  16.482  11.638 1.00 38.49 ? 255  ASN A OD1   1 
ATOM   1794 N  ND2   . ASN A 1 226 ? -2.319  14.972  13.133 1.00 36.37 ? 255  ASN A ND2   1 
ATOM   1795 N  N     . ASN A 1 227 ? -0.724  19.879  15.228 1.00 40.99 ? 256  ASN A N     1 
ATOM   1796 C  CA    . ASN A 1 227 ? -0.800  21.031  16.122 1.00 43.79 ? 256  ASN A CA    1 
ATOM   1797 C  C     . ASN A 1 227 ? -0.728  22.324  15.314 1.00 44.35 ? 256  ASN A C     1 
ATOM   1798 O  O     . ASN A 1 227 ? 0.256   22.583  14.620 1.00 43.35 ? 256  ASN A O     1 
ATOM   1799 C  CB    . ASN A 1 227 ? 0.336   20.989  17.151 1.00 44.60 ? 256  ASN A CB    1 
ATOM   1800 C  CG    . ASN A 1 227 ? 0.207   22.076  18.213 1.00 46.08 ? 256  ASN A CG    1 
ATOM   1801 O  OD1   . ASN A 1 227 ? 0.277   23.270  17.912 1.00 45.50 ? 256  ASN A OD1   1 
ATOM   1802 N  ND2   . ASN A 1 227 ? 0.015   21.662  19.462 1.00 45.23 ? 256  ASN A ND2   1 
ATOM   1803 N  N     . LYS A 1 228 ? -1.784  23.126  15.423 1.00 46.38 ? 257  LYS A N     1 
ATOM   1804 C  CA    . LYS A 1 228 ? -1.918  24.402  14.713 1.00 47.14 ? 257  LYS A CA    1 
ATOM   1805 C  C     . LYS A 1 228 ? -0.693  25.310  14.805 1.00 44.90 ? 257  LYS A C     1 
ATOM   1806 O  O     . LYS A 1 228 ? -0.377  26.032  13.864 1.00 44.84 ? 257  LYS A O     1 
ATOM   1807 C  CB    . LYS A 1 228 ? -3.140  25.154  15.250 1.00 49.55 ? 257  LYS A CB    1 
ATOM   1808 C  CG    . LYS A 1 228 ? -4.354  24.266  15.481 1.00 52.79 ? 257  LYS A CG    1 
ATOM   1809 C  CD    . LYS A 1 228 ? -5.432  24.997  16.271 1.00 55.68 ? 257  LYS A CD    1 
ATOM   1810 C  CE    . LYS A 1 228 ? -6.586  24.071  16.623 1.00 56.32 ? 257  LYS A CE    1 
ATOM   1811 N  NZ    . LYS A 1 228 ? -7.596  24.745  17.491 1.00 57.41 ? 257  LYS A NZ    1 
ATOM   1812 N  N     . TRP A 1 229 ? -0.004  25.270  15.937 1.00 44.24 ? 258  TRP A N     1 
ATOM   1813 C  CA    . TRP A 1 229 ? 1.172   26.107  16.146 1.00 44.14 ? 258  TRP A CA    1 
ATOM   1814 C  C     . TRP A 1 229 ? 2.298   25.879  15.136 1.00 43.22 ? 258  TRP A C     1 
ATOM   1815 O  O     . TRP A 1 229 ? 3.154   26.749  14.955 1.00 41.99 ? 258  TRP A O     1 
ATOM   1816 C  CB    . TRP A 1 229 ? 1.707   25.896  17.568 1.00 45.55 ? 258  TRP A CB    1 
ATOM   1817 C  CG    . TRP A 1 229 ? 2.369   27.112  18.170 1.00 46.83 ? 258  TRP A CG    1 
ATOM   1818 C  CD1   . TRP A 1 229 ? 2.391   28.379  17.654 1.00 47.08 ? 258  TRP A CD1   1 
ATOM   1819 C  CD2   . TRP A 1 229 ? 3.051   27.182  19.430 1.00 46.81 ? 258  TRP A CD2   1 
ATOM   1820 N  NE1   . TRP A 1 229 ? 3.040   29.231  18.515 1.00 47.25 ? 258  TRP A NE1   1 
ATOM   1821 C  CE2   . TRP A 1 229 ? 3.456   28.523  19.613 1.00 47.78 ? 258  TRP A CE2   1 
ATOM   1822 C  CE3   . TRP A 1 229 ? 3.359   26.242  20.422 1.00 47.26 ? 258  TRP A CE3   1 
ATOM   1823 C  CZ2   . TRP A 1 229 ? 4.153   28.948  20.751 1.00 46.79 ? 258  TRP A CZ2   1 
ATOM   1824 C  CZ3   . TRP A 1 229 ? 4.053   26.667  21.554 1.00 47.51 ? 258  TRP A CZ3   1 
ATOM   1825 C  CH2   . TRP A 1 229 ? 4.441   28.008  21.705 1.00 46.18 ? 258  TRP A CH2   1 
ATOM   1826 N  N     . PHE A 1 230 ? 2.299   24.723  14.473 1.00 42.89 ? 259  PHE A N     1 
ATOM   1827 C  CA    . PHE A 1 230 ? 3.352   24.409  13.506 1.00 42.98 ? 259  PHE A CA    1 
ATOM   1828 C  C     . PHE A 1 230 ? 2.890   24.464  12.048 1.00 44.33 ? 259  PHE A C     1 
ATOM   1829 O  O     . PHE A 1 230 ? 3.617   24.056  11.140 1.00 44.58 ? 259  PHE A O     1 
ATOM   1830 C  CB    . PHE A 1 230 ? 3.931   23.023  13.809 1.00 42.12 ? 259  PHE A CB    1 
ATOM   1831 C  CG    . PHE A 1 230 ? 4.350   22.842  15.242 1.00 40.57 ? 259  PHE A CG    1 
ATOM   1832 C  CD1   . PHE A 1 230 ? 5.295   23.688  15.821 1.00 40.84 ? 259  PHE A CD1   1 
ATOM   1833 C  CD2   . PHE A 1 230 ? 3.796   21.829  16.018 1.00 40.28 ? 259  PHE A CD2   1 
ATOM   1834 C  CE1   . PHE A 1 230 ? 5.684   23.527  17.160 1.00 39.67 ? 259  PHE A CE1   1 
ATOM   1835 C  CE2   . PHE A 1 230 ? 4.177   21.659  17.356 1.00 40.41 ? 259  PHE A CE2   1 
ATOM   1836 C  CZ    . PHE A 1 230 ? 5.123   22.511  17.926 1.00 37.83 ? 259  PHE A CZ    1 
ATOM   1837 N  N     . THR A 1 231 ? 1.683   24.980  11.837 1.00 45.41 ? 260  THR A N     1 
ATOM   1838 C  CA    . THR A 1 231 ? 1.090   25.102  10.509 1.00 45.68 ? 260  THR A CA    1 
ATOM   1839 C  C     . THR A 1 231 ? 2.072   25.543  9.429  1.00 45.70 ? 260  THR A C     1 
ATOM   1840 O  O     . THR A 1 231 ? 2.050   25.026  8.312  1.00 46.29 ? 260  THR A O     1 
ATOM   1841 C  CB    . THR A 1 231 ? -0.093  26.100  10.531 1.00 46.42 ? 260  THR A CB    1 
ATOM   1842 O  OG1   . THR A 1 231 ? -1.134  25.581  11.365 1.00 47.55 ? 260  THR A OG1   1 
ATOM   1843 C  CG2   . THR A 1 231 ? -0.644  26.321  9.126  1.00 46.02 ? 260  THR A CG2   1 
ATOM   1844 N  N     . ASP A 1 232 ? 2.928   26.499  9.768  1.00 46.18 ? 261  ASP A N     1 
ATOM   1845 C  CA    . ASP A 1 232 ? 3.912   27.032  8.832  1.00 46.59 ? 261  ASP A CA    1 
ATOM   1846 C  C     . ASP A 1 232 ? 5.280   26.370  8.950  1.00 45.85 ? 261  ASP A C     1 
ATOM   1847 O  O     . ASP A 1 232 ? 6.130   26.513  8.067  1.00 47.01 ? 261  ASP A O     1 
ATOM   1848 C  CB    . ASP A 1 232 ? 4.060   28.535  9.053  1.00 49.72 ? 261  ASP A CB    1 
ATOM   1849 C  CG    . ASP A 1 232 ? 3.322   29.351  8.018  1.00 52.49 ? 261  ASP A CG    1 
ATOM   1850 O  OD1   . ASP A 1 232 ? 2.180   28.982  7.659  1.00 53.05 ? 261  ASP A OD1   1 
ATOM   1851 O  OD2   . ASP A 1 232 ? 3.889   30.370  7.574  1.00 54.68 ? 261  ASP A OD2   1 
ATOM   1852 N  N     . THR A 1 233 ? 5.493   25.655  10.049 1.00 43.26 ? 262  THR A N     1 
ATOM   1853 C  CA    . THR A 1 233 ? 6.758   24.972  10.283 1.00 40.08 ? 262  THR A CA    1 
ATOM   1854 C  C     . THR A 1 233 ? 6.886   23.742  9.379  1.00 37.67 ? 262  THR A C     1 
ATOM   1855 O  O     . THR A 1 233 ? 5.913   23.017  9.163  1.00 36.86 ? 262  THR A O     1 
ATOM   1856 C  CB    . THR A 1 233 ? 6.861   24.537  11.762 1.00 41.03 ? 262  THR A CB    1 
ATOM   1857 O  OG1   . THR A 1 233 ? 6.794   25.697  12.604 1.00 40.60 ? 262  THR A OG1   1 
ATOM   1858 C  CG2   . THR A 1 233 ? 8.166   23.799  12.020 1.00 39.27 ? 262  THR A CG2   1 
ATOM   1859 N  N     . SER A 1 234 ? 8.083   23.519  8.843  1.00 34.51 ? 263  SER A N     1 
ATOM   1860 C  CA    . SER A 1 234 ? 8.328   22.369  7.982  1.00 35.16 ? 263  SER A CA    1 
ATOM   1861 C  C     . SER A 1 234 ? 8.458   21.099  8.828  1.00 34.14 ? 263  SER A C     1 
ATOM   1862 O  O     . SER A 1 234 ? 9.360   20.983  9.655  1.00 32.43 ? 263  SER A O     1 
ATOM   1863 C  CB    . SER A 1 234 ? 9.616   22.564  7.172  1.00 36.78 ? 263  SER A CB    1 
ATOM   1864 O  OG    . SER A 1 234 ? 9.515   23.667  6.287  1.00 40.21 ? 263  SER A OG    1 
ATOM   1865 N  N     . ILE A 1 235 ? 7.555   20.149  8.615  1.00 31.08 ? 264  ILE A N     1 
ATOM   1866 C  CA    . ILE A 1 235 ? 7.591   18.898  9.360  1.00 29.97 ? 264  ILE A CA    1 
ATOM   1867 C  C     . ILE A 1 235 ? 8.356   17.828  8.569  1.00 28.75 ? 264  ILE A C     1 
ATOM   1868 O  O     . ILE A 1 235 ? 7.823   17.240  7.626  1.00 25.19 ? 264  ILE A O     1 
ATOM   1869 C  CB    . ILE A 1 235 ? 6.160   18.393  9.660  1.00 28.38 ? 264  ILE A CB    1 
ATOM   1870 C  CG1   . ILE A 1 235 ? 5.382   19.452  10.455 1.00 30.81 ? 264  ILE A CG1   1 
ATOM   1871 C  CG2   . ILE A 1 235 ? 6.220   17.084  10.426 1.00 28.01 ? 264  ILE A CG2   1 
ATOM   1872 C  CD1   . ILE A 1 235 ? 5.950   19.764  11.846 1.00 27.37 ? 264  ILE A CD1   1 
ATOM   1873 N  N     . ILE A 1 236 ? 9.612   17.600  8.947  1.00 28.71 ? 265  ILE A N     1 
ATOM   1874 C  CA    . ILE A 1 236 ? 10.447  16.598  8.289  1.00 27.93 ? 265  ILE A CA    1 
ATOM   1875 C  C     . ILE A 1 236 ? 10.392  15.305  9.103  1.00 28.37 ? 265  ILE A C     1 
ATOM   1876 O  O     . ILE A 1 236 ? 10.547  15.328  10.327 1.00 26.90 ? 265  ILE A O     1 
ATOM   1877 C  CB    . ILE A 1 236 ? 11.926  17.050  8.192  1.00 29.13 ? 265  ILE A CB    1 
ATOM   1878 C  CG1   . ILE A 1 236 ? 12.055  18.303  7.323  1.00 30.99 ? 265  ILE A CG1   1 
ATOM   1879 C  CG2   . ILE A 1 236 ? 12.763  15.950  7.579  1.00 26.26 ? 265  ILE A CG2   1 
ATOM   1880 C  CD1   . ILE A 1 236 ? 11.455  19.537  7.927  1.00 36.67 ? 265  ILE A CD1   1 
ATOM   1881 N  N     . LEU A 1 237 ? 10.166  14.182  8.426  1.00 26.19 ? 266  LEU A N     1 
ATOM   1882 C  CA    . LEU A 1 237 ? 10.093  12.893  9.105  1.00 25.00 ? 266  LEU A CA    1 
ATOM   1883 C  C     . LEU A 1 237 ? 11.243  11.988  8.679  1.00 26.29 ? 266  LEU A C     1 
ATOM   1884 O  O     . LEU A 1 237 ? 11.391  11.670  7.494  1.00 25.08 ? 266  LEU A O     1 
ATOM   1885 C  CB    . LEU A 1 237 ? 8.762   12.202  8.796  1.00 23.22 ? 266  LEU A CB    1 
ATOM   1886 C  CG    . LEU A 1 237 ? 8.567   10.787  9.364  1.00 26.69 ? 266  LEU A CG    1 
ATOM   1887 C  CD1   . LEU A 1 237 ? 8.485   10.837  10.900 1.00 24.53 ? 266  LEU A CD1   1 
ATOM   1888 C  CD2   . LEU A 1 237 ? 7.289   10.182  8.801  1.00 23.20 ? 266  LEU A CD2   1 
ATOM   1889 N  N     . PHE A 1 238 ? 12.068  11.589  9.643  1.00 24.96 ? 267  PHE A N     1 
ATOM   1890 C  CA    . PHE A 1 238 ? 13.188  10.695  9.367  1.00 25.35 ? 267  PHE A CA    1 
ATOM   1891 C  C     . PHE A 1 238 ? 12.851  9.283   9.835  1.00 25.82 ? 267  PHE A C     1 
ATOM   1892 O  O     . PHE A 1 238 ? 12.804  9.019   11.040 1.00 26.07 ? 267  PHE A O     1 
ATOM   1893 C  CB    . PHE A 1 238 ? 14.458  11.157  10.100 1.00 27.68 ? 267  PHE A CB    1 
ATOM   1894 C  CG    . PHE A 1 238 ? 15.230  12.232  9.384  1.00 27.69 ? 267  PHE A CG    1 
ATOM   1895 C  CD1   . PHE A 1 238 ? 14.668  12.936  8.321  1.00 28.31 ? 267  PHE A CD1   1 
ATOM   1896 C  CD2   . PHE A 1 238 ? 16.520  12.554  9.792  1.00 27.72 ? 267  PHE A CD2   1 
ATOM   1897 C  CE1   . PHE A 1 238 ? 15.379  13.943  7.675  1.00 28.33 ? 267  PHE A CE1   1 
ATOM   1898 C  CE2   . PHE A 1 238 ? 17.239  13.562  9.154  1.00 29.34 ? 267  PHE A CE2   1 
ATOM   1899 C  CZ    . PHE A 1 238 ? 16.665  14.257  8.092  1.00 28.32 ? 267  PHE A CZ    1 
ATOM   1900 N  N     . LEU A 1 239 ? 12.586  8.387   8.889  1.00 24.05 ? 268  LEU A N     1 
ATOM   1901 C  CA    . LEU A 1 239 ? 12.313  6.993   9.229  1.00 23.27 ? 268  LEU A CA    1 
ATOM   1902 C  C     . LEU A 1 239 ? 13.716  6.426   9.213  1.00 21.06 ? 268  LEU A C     1 
ATOM   1903 O  O     . LEU A 1 239 ? 14.252  6.066   8.163  1.00 20.90 ? 268  LEU A O     1 
ATOM   1904 C  CB    . LEU A 1 239 ? 11.396  6.356   8.178  1.00 19.99 ? 268  LEU A CB    1 
ATOM   1905 C  CG    . LEU A 1 239 ? 10.004  6.983   8.330  1.00 22.12 ? 268  LEU A CG    1 
ATOM   1906 C  CD1   . LEU A 1 239 ? 9.047   6.491   7.258  1.00 18.91 ? 268  LEU A CD1   1 
ATOM   1907 C  CD2   . LEU A 1 239 ? 9.466   6.651   9.741  1.00 21.14 ? 268  LEU A CD2   1 
ATOM   1908 N  N     . ASN A 1 240 ? 14.307  6.400   10.406 1.00 18.23 ? 269  ASN A N     1 
ATOM   1909 C  CA    . ASN A 1 240 ? 15.689  6.000   10.621 1.00 16.16 ? 269  ASN A CA    1 
ATOM   1910 C  C     . ASN A 1 240 ? 15.972  4.514   10.905 1.00 16.52 ? 269  ASN A C     1 
ATOM   1911 O  O     . ASN A 1 240 ? 15.059  3.734   11.123 1.00 16.95 ? 269  ASN A O     1 
ATOM   1912 C  CB    . ASN A 1 240 ? 16.249  6.891   11.740 1.00 15.82 ? 269  ASN A CB    1 
ATOM   1913 C  CG    . ASN A 1 240 ? 17.755  6.848   11.824 1.00 17.95 ? 269  ASN A CG    1 
ATOM   1914 O  OD1   . ASN A 1 240 ? 18.450  7.030   10.821 1.00 20.62 ? 269  ASN A OD1   1 
ATOM   1915 N  ND2   . ASN A 1 240 ? 18.272  6.611   13.023 1.00 16.77 ? 269  ASN A ND2   1 
ATOM   1916 N  N     . LYS A 1 241 ? 17.255  4.148   10.895 1.00 15.80 ? 270  LYS A N     1 
ATOM   1917 C  CA    . LYS A 1 241 ? 17.699  2.772   11.124 1.00 21.03 ? 270  LYS A CA    1 
ATOM   1918 C  C     . LYS A 1 241 ? 17.125  1.843   10.068 1.00 21.17 ? 270  LYS A C     1 
ATOM   1919 O  O     . LYS A 1 241 ? 16.771  0.700   10.356 1.00 18.83 ? 270  LYS A O     1 
ATOM   1920 C  CB    . LYS A 1 241 ? 17.297  2.298   12.528 1.00 19.58 ? 270  LYS A CB    1 
ATOM   1921 C  CG    . LYS A 1 241 ? 18.029  3.065   13.631 1.00 23.07 ? 270  LYS A CG    1 
ATOM   1922 C  CD    . LYS A 1 241 ? 17.775  2.511   15.021 1.00 21.90 ? 270  LYS A CD    1 
ATOM   1923 C  CE    . LYS A 1 241 ? 18.542  3.323   16.053 1.00 23.97 ? 270  LYS A CE    1 
ATOM   1924 N  NZ    . LYS A 1 241 ? 18.371  2.852   17.453 1.00 23.85 ? 270  LYS A NZ    1 
ATOM   1925 N  N     . LYS A 1 242 ? 17.034  2.349   8.840  1.00 22.30 ? 271  LYS A N     1 
ATOM   1926 C  CA    . LYS A 1 242 ? 16.491  1.559   7.740  1.00 23.42 ? 271  LYS A CA    1 
ATOM   1927 C  C     . LYS A 1 242 ? 17.366  0.336   7.511  1.00 22.03 ? 271  LYS A C     1 
ATOM   1928 O  O     . LYS A 1 242 ? 16.881  -0.692  7.066  1.00 24.60 ? 271  LYS A O     1 
ATOM   1929 C  CB    . LYS A 1 242 ? 16.406  2.408   6.466  1.00 24.62 ? 271  LYS A CB    1 
ATOM   1930 C  CG    . LYS A 1 242 ? 17.751  2.859   5.894  1.00 25.33 ? 271  LYS A CG    1 
ATOM   1931 C  CD    . LYS A 1 242 ? 17.510  3.757   4.687  1.00 28.60 ? 271  LYS A CD    1 
ATOM   1932 C  CE    . LYS A 1 242 ? 18.798  4.169   4.004  1.00 28.77 ? 271  LYS A CE    1 
ATOM   1933 N  NZ    . LYS A 1 242 ? 18.481  5.062   2.848  1.00 35.19 ? 271  LYS A NZ    1 
ATOM   1934 N  N     . ASP A 1 243 ? 18.650  0.459   7.840  1.00 20.56 ? 272  ASP A N     1 
ATOM   1935 C  CA    . ASP A 1 243 ? 19.608  -0.631  7.689  1.00 22.59 ? 272  ASP A CA    1 
ATOM   1936 C  C     . ASP A 1 243 ? 19.319  -1.778  8.674  1.00 23.86 ? 272  ASP A C     1 
ATOM   1937 O  O     . ASP A 1 243 ? 19.447  -2.959  8.331  1.00 23.60 ? 272  ASP A O     1 
ATOM   1938 C  CB    . ASP A 1 243 ? 21.049  -0.103  7.880  1.00 20.99 ? 272  ASP A CB    1 
ATOM   1939 C  CG    . ASP A 1 243 ? 21.310  0.444   9.296  1.00 25.58 ? 272  ASP A CG    1 
ATOM   1940 O  OD1   . ASP A 1 243 ? 20.521  1.278   9.792  1.00 22.58 ? 272  ASP A OD1   1 
ATOM   1941 O  OD2   . ASP A 1 243 ? 22.324  0.046   9.912  1.00 24.13 ? 272  ASP A OD2   1 
ATOM   1942 N  N     . LEU A 1 244 ? 18.927  -1.431  9.896  1.00 22.67 ? 273  LEU A N     1 
ATOM   1943 C  CA    . LEU A 1 244 ? 18.607  -2.444  10.906 1.00 21.83 ? 273  LEU A CA    1 
ATOM   1944 C  C     . LEU A 1 244 ? 17.235  -3.043  10.588 1.00 20.30 ? 273  LEU A C     1 
ATOM   1945 O  O     . LEU A 1 244 ? 17.010  -4.246  10.716 1.00 20.07 ? 273  LEU A O     1 
ATOM   1946 C  CB    . LEU A 1 244 ? 18.609  -1.803  12.308 1.00 19.74 ? 273  LEU A CB    1 
ATOM   1947 C  CG    . LEU A 1 244 ? 19.987  -1.321  12.793 1.00 22.64 ? 273  LEU A CG    1 
ATOM   1948 C  CD1   . LEU A 1 244 ? 19.892  -0.668  14.178 1.00 20.56 ? 273  LEU A CD1   1 
ATOM   1949 C  CD2   . LEU A 1 244 ? 20.938  -2.524  12.854 1.00 22.17 ? 273  LEU A CD2   1 
ATOM   1950 N  N     . PHE A 1 245 ? 16.313  -2.191  10.161 1.00 21.80 ? 274  PHE A N     1 
ATOM   1951 C  CA    . PHE A 1 245 ? 14.975  -2.647  9.811  1.00 22.73 ? 274  PHE A CA    1 
ATOM   1952 C  C     . PHE A 1 245 ? 15.088  -3.718  8.719  1.00 24.87 ? 274  PHE A C     1 
ATOM   1953 O  O     . PHE A 1 245 ? 14.492  -4.790  8.820  1.00 22.16 ? 274  PHE A O     1 
ATOM   1954 C  CB    . PHE A 1 245 ? 14.155  -1.467  9.297  1.00 21.25 ? 274  PHE A CB    1 
ATOM   1955 C  CG    . PHE A 1 245 ? 12.735  -1.808  8.960  1.00 21.19 ? 274  PHE A CG    1 
ATOM   1956 C  CD1   . PHE A 1 245 ? 11.793  -1.975  9.960  1.00 18.12 ? 274  PHE A CD1   1 
ATOM   1957 C  CD2   . PHE A 1 245 ? 12.340  -1.952  7.631  1.00 22.84 ? 274  PHE A CD2   1 
ATOM   1958 C  CE1   . PHE A 1 245 ? 10.469  -2.280  9.649  1.00 24.39 ? 274  PHE A CE1   1 
ATOM   1959 C  CE2   . PHE A 1 245 ? 11.021  -2.258  7.306  1.00 23.27 ? 274  PHE A CE2   1 
ATOM   1960 C  CZ    . PHE A 1 245 ? 10.079  -2.422  8.318  1.00 22.42 ? 274  PHE A CZ    1 
ATOM   1961 N  N     . GLU A 1 246 ? 15.872  -3.413  7.685  1.00 25.54 ? 275  GLU A N     1 
ATOM   1962 C  CA    . GLU A 1 246 ? 16.071  -4.320  6.560  1.00 28.33 ? 275  GLU A CA    1 
ATOM   1963 C  C     . GLU A 1 246 ? 16.610  -5.677  7.002  1.00 27.79 ? 275  GLU A C     1 
ATOM   1964 O  O     . GLU A 1 246 ? 16.212  -6.706  6.472  1.00 26.27 ? 275  GLU A O     1 
ATOM   1965 C  CB    . GLU A 1 246 ? 17.040  -3.710  5.542  1.00 30.38 ? 275  GLU A CB    1 
ATOM   1966 C  CG    . GLU A 1 246 ? 17.167  -4.547  4.275  1.00 37.99 ? 275  GLU A CG    1 
ATOM   1967 C  CD    . GLU A 1 246 ? 18.262  -4.059  3.356  1.00 42.19 ? 275  GLU A CD    1 
ATOM   1968 O  OE1   . GLU A 1 246 ? 18.254  -2.863  2.997  1.00 45.60 ? 275  GLU A OE1   1 
ATOM   1969 O  OE2   . GLU A 1 246 ? 19.130  -4.876  2.986  1.00 45.52 ? 275  GLU A OE2   1 
ATOM   1970 N  N     . GLU A 1 247 ? 17.532  -5.668  7.957  1.00 29.63 ? 276  GLU A N     1 
ATOM   1971 C  CA    . GLU A 1 247 ? 18.106  -6.906  8.469  1.00 33.14 ? 276  GLU A CA    1 
ATOM   1972 C  C     . GLU A 1 247 ? 17.084  -7.687  9.284  1.00 31.23 ? 276  GLU A C     1 
ATOM   1973 O  O     . GLU A 1 247 ? 17.051  -8.910  9.231  1.00 32.80 ? 276  GLU A O     1 
ATOM   1974 C  CB    . GLU A 1 247 ? 19.319  -6.608  9.352  1.00 36.46 ? 276  GLU A CB    1 
ATOM   1975 C  CG    . GLU A 1 247 ? 20.573  -6.215  8.597  1.00 44.92 ? 276  GLU A CG    1 
ATOM   1976 C  CD    . GLU A 1 247 ? 21.646  -5.657  9.520  1.00 50.38 ? 276  GLU A CD    1 
ATOM   1977 O  OE1   . GLU A 1 247 ? 21.909  -6.277  10.582 1.00 54.20 ? 276  GLU A OE1   1 
ATOM   1978 O  OE2   . GLU A 1 247 ? 22.228  -4.599  9.185  1.00 51.25 ? 276  GLU A OE2   1 
ATOM   1979 N  N     . LYS A 1 248 ? 16.252  -6.970  10.030 1.00 32.14 ? 277  LYS A N     1 
ATOM   1980 C  CA    . LYS A 1 248 ? 15.237  -7.586  10.887 1.00 32.67 ? 277  LYS A CA    1 
ATOM   1981 C  C     . LYS A 1 248 ? 14.002  -8.120  10.174 1.00 30.95 ? 277  LYS A C     1 
ATOM   1982 O  O     . LYS A 1 248 ? 13.493  -9.189  10.519 1.00 30.29 ? 277  LYS A O     1 
ATOM   1983 C  CB    . LYS A 1 248 ? 14.732  -6.587  11.933 1.00 32.64 ? 277  LYS A CB    1 
ATOM   1984 C  CG    . LYS A 1 248 ? 15.614  -6.351  13.139 1.00 35.29 ? 277  LYS A CG    1 
ATOM   1985 C  CD    . LYS A 1 248 ? 14.880  -5.449  14.135 1.00 35.32 ? 277  LYS A CD    1 
ATOM   1986 C  CE    . LYS A 1 248 ? 15.724  -5.182  15.369 1.00 38.64 ? 277  LYS A CE    1 
ATOM   1987 N  NZ    . LYS A 1 248 ? 15.007  -4.366  16.383 1.00 41.63 ? 277  LYS A NZ    1 
ATOM   1988 N  N     . ILE A 1 249 ? 13.507  -7.357  9.205  1.00 28.76 ? 278  ILE A N     1 
ATOM   1989 C  CA    . ILE A 1 249 ? 12.287  -7.720  8.504  1.00 29.61 ? 278  ILE A CA    1 
ATOM   1990 C  C     . ILE A 1 249 ? 12.307  -9.150  8.001  1.00 32.60 ? 278  ILE A C     1 
ATOM   1991 O  O     . ILE A 1 249 ? 11.260  -9.778  7.850  1.00 33.34 ? 278  ILE A O     1 
ATOM   1992 C  CB    . ILE A 1 249 ? 11.986  -6.734  7.337  1.00 28.74 ? 278  ILE A CB    1 
ATOM   1993 C  CG1   . ILE A 1 249 ? 10.512  -6.855  6.941  1.00 27.00 ? 278  ILE A CG1   1 
ATOM   1994 C  CG2   . ILE A 1 249 ? 12.899  -7.005  6.150  1.00 26.48 ? 278  ILE A CG2   1 
ATOM   1995 C  CD1   . ILE A 1 249 ? 9.558   -6.621  8.115  1.00 27.68 ? 278  ILE A CD1   1 
ATOM   1996 N  N     . LYS A 1 250 ? 13.505  -9.670  7.772  1.00 35.78 ? 279  LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 250 ? 13.660  -11.037 7.309  1.00 40.50 ? 279  LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 250 ? 13.113  -12.050 8.320  1.00 41.24 ? 279  LYS A C     1 
ATOM   1999 O  O     . LYS A 1 250 ? 12.347  -12.945 7.956  1.00 41.96 ? 279  LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 250 ? 15.139  -11.316 7.023  1.00 43.24 ? 279  LYS A CB    1 
ATOM   2001 C  CG    . LYS A 1 250 ? 15.682  -10.476 5.869  1.00 48.22 ? 279  LYS A CG    1 
ATOM   2002 C  CD    . LYS A 1 250 ? 17.084  -10.884 5.431  1.00 48.72 ? 279  LYS A CD    1 
ATOM   2003 C  CE    . LYS A 1 250 ? 18.143  -10.469 6.438  1.00 50.75 ? 279  LYS A CE    1 
ATOM   2004 N  NZ    . LYS A 1 250 ? 19.513  -10.598 5.856  1.00 51.44 ? 279  LYS A NZ    1 
ATOM   2005 N  N     . LYS A 1 251 ? 13.480  -11.892 9.589  1.00 40.42 ? 280  LYS A N     1 
ATOM   2006 C  CA    . LYS A 1 251 ? 13.039  -12.822 10.629 1.00 39.67 ? 280  LYS A CA    1 
ATOM   2007 C  C     . LYS A 1 251 ? 11.824  -12.413 11.470 1.00 36.74 ? 280  LYS A C     1 
ATOM   2008 O  O     . LYS A 1 251 ? 11.033  -13.269 11.860 1.00 38.34 ? 280  LYS A O     1 
ATOM   2009 C  CB    . LYS A 1 251 ? 14.214  -13.138 11.559 1.00 43.31 ? 280  LYS A CB    1 
ATOM   2010 C  CG    . LYS A 1 251 ? 14.931  -11.910 12.098 1.00 48.03 ? 280  LYS A CG    1 
ATOM   2011 C  CD    . LYS A 1 251 ? 15.954  -12.287 13.163 1.00 52.18 ? 280  LYS A CD    1 
ATOM   2012 C  CE    . LYS A 1 251 ? 16.691  -11.057 13.691 1.00 54.24 ? 280  LYS A CE    1 
ATOM   2013 N  NZ    . LYS A 1 251 ? 15.767  -10.078 14.328 1.00 54.48 ? 280  LYS A NZ    1 
ATOM   2014 N  N     . SER A 1 252 ? 11.672  -11.124 11.760 1.00 32.11 ? 281  SER A N     1 
ATOM   2015 C  CA    . SER A 1 252 ? 10.543  -10.671 12.568 1.00 27.67 ? 281  SER A CA    1 
ATOM   2016 C  C     . SER A 1 252 ? 9.498   -9.963  11.718 1.00 24.12 ? 281  SER A C     1 
ATOM   2017 O  O     . SER A 1 252 ? 9.713   -8.850  11.266 1.00 26.31 ? 281  SER A O     1 
ATOM   2018 C  CB    . SER A 1 252 ? 11.023  -9.721  13.672 1.00 26.67 ? 281  SER A CB    1 
ATOM   2019 O  OG    . SER A 1 252 ? 12.063  -10.301 14.436 1.00 32.22 ? 281  SER A OG    1 
ATOM   2020 N  N     . PRO A 1 253 ? 8.338   -10.590 11.517 1.00 23.36 ? 282  PRO A N     1 
ATOM   2021 C  CA    . PRO A 1 253 ? 7.270   -9.990  10.711 1.00 21.35 ? 282  PRO A CA    1 
ATOM   2022 C  C     . PRO A 1 253 ? 6.753   -8.681  11.298 1.00 22.76 ? 282  PRO A C     1 
ATOM   2023 O  O     . PRO A 1 253 ? 6.703   -8.504  12.529 1.00 20.74 ? 282  PRO A O     1 
ATOM   2024 C  CB    . PRO A 1 253 ? 6.201   -11.078 10.702 1.00 22.77 ? 282  PRO A CB    1 
ATOM   2025 C  CG    . PRO A 1 253 ? 6.352   -11.675 12.082 1.00 21.88 ? 282  PRO A CG    1 
ATOM   2026 C  CD    . PRO A 1 253 ? 7.866   -11.821 12.175 1.00 23.60 ? 282  PRO A CD    1 
ATOM   2027 N  N     . LEU A 1 254 ? 6.361   -7.774  10.405 1.00 19.14 ? 283  LEU A N     1 
ATOM   2028 C  CA    . LEU A 1 254 ? 5.853   -6.468  10.781 1.00 20.54 ? 283  LEU A CA    1 
ATOM   2029 C  C     . LEU A 1 254 ? 4.542   -6.624  11.534 1.00 21.35 ? 283  LEU A C     1 
ATOM   2030 O  O     . LEU A 1 254 ? 4.083   -5.718  12.237 1.00 21.22 ? 283  LEU A O     1 
ATOM   2031 C  CB    . LEU A 1 254 ? 5.618   -5.616  9.529  1.00 19.99 ? 283  LEU A CB    1 
ATOM   2032 C  CG    . LEU A 1 254 ? 5.062   -4.229  9.830  1.00 18.34 ? 283  LEU A CG    1 
ATOM   2033 C  CD1   . LEU A 1 254 ? 6.140   -3.415  10.532 1.00 17.70 ? 283  LEU A CD1   1 
ATOM   2034 C  CD2   . LEU A 1 254 ? 4.617   -3.555  8.543  1.00 22.47 ? 283  LEU A CD2   1 
ATOM   2035 N  N     . THR A 1 255 ? 3.944   -7.789  11.365 1.00 21.55 ? 284  THR A N     1 
ATOM   2036 C  CA    . THR A 1 255 ? 2.685   -8.100  12.005 1.00 24.45 ? 284  THR A CA    1 
ATOM   2037 C  C     . THR A 1 255 ? 2.832   -8.054  13.541 1.00 24.38 ? 284  THR A C     1 
ATOM   2038 O  O     . THR A 1 255 ? 1.845   -8.003  14.270 1.00 23.00 ? 284  THR A O     1 
ATOM   2039 C  CB    . THR A 1 255 ? 2.204   -9.468  11.499 1.00 26.24 ? 284  THR A CB    1 
ATOM   2040 O  OG1   . THR A 1 255 ? 0.854   -9.687  11.909 1.00 35.74 ? 284  THR A OG1   1 
ATOM   2041 C  CG2   . THR A 1 255 ? 3.096   -10.564 12.011 1.00 24.40 ? 284  THR A CG2   1 
ATOM   2042 N  N     . ILE A 1 256 ? 4.074   -8.052  14.020 1.00 23.06 ? 285  ILE A N     1 
ATOM   2043 C  CA    . ILE A 1 256 ? 4.358   -7.954  15.449 1.00 24.03 ? 285  ILE A CA    1 
ATOM   2044 C  C     . ILE A 1 256 ? 3.932   -6.567  15.935 1.00 25.38 ? 285  ILE A C     1 
ATOM   2045 O  O     . ILE A 1 256 ? 3.420   -6.403  17.046 1.00 24.30 ? 285  ILE A O     1 
ATOM   2046 C  CB    . ILE A 1 256 ? 5.875   -8.047  15.744 1.00 25.33 ? 285  ILE A CB    1 
ATOM   2047 C  CG1   . ILE A 1 256 ? 6.403   -9.451  15.449 1.00 22.29 ? 285  ILE A CG1   1 
ATOM   2048 C  CG2   . ILE A 1 256 ? 6.147   -7.638  17.206 1.00 24.46 ? 285  ILE A CG2   1 
ATOM   2049 C  CD1   . ILE A 1 256 ? 7.933   -9.522  15.457 1.00 22.84 ? 285  ILE A CD1   1 
ATOM   2050 N  N     . CYS A 1 257 ? 4.162   -5.568  15.087 1.00 23.82 ? 286  CYS A N     1 
ATOM   2051 C  CA    . CYS A 1 257 ? 3.860   -4.183  15.415 1.00 23.96 ? 286  CYS A CA    1 
ATOM   2052 C  C     . CYS A 1 257 ? 2.461   -3.735  14.997 1.00 25.35 ? 286  CYS A C     1 
ATOM   2053 O  O     . CYS A 1 257 ? 1.794   -2.986  15.713 1.00 26.61 ? 286  CYS A O     1 
ATOM   2054 C  CB    . CYS A 1 257 ? 4.907   -3.285  14.755 1.00 23.85 ? 286  CYS A CB    1 
ATOM   2055 S  SG    . CYS A 1 257 ? 4.822   -1.551  15.219 1.00 23.34 ? 286  CYS A SG    1 
ATOM   2056 N  N     . TYR A 1 258 ? 2.043   -4.188  13.820 1.00 26.21 ? 287  TYR A N     1 
ATOM   2057 C  CA    . TYR A 1 258 ? 0.743   -3.865  13.248 1.00 26.07 ? 287  TYR A CA    1 
ATOM   2058 C  C     . TYR A 1 258 ? 0.066   -5.197  12.950 1.00 28.04 ? 287  TYR A C     1 
ATOM   2059 O  O     . TYR A 1 258 ? 0.185   -5.730  11.846 1.00 28.40 ? 287  TYR A O     1 
ATOM   2060 C  CB    . TYR A 1 258 ? 0.922   -3.085  11.942 1.00 24.53 ? 287  TYR A CB    1 
ATOM   2061 C  CG    . TYR A 1 258 ? 1.649   -1.761  12.088 1.00 22.21 ? 287  TYR A CG    1 
ATOM   2062 C  CD1   . TYR A 1 258 ? 0.956   -0.593  12.416 1.00 20.56 ? 287  TYR A CD1   1 
ATOM   2063 C  CD2   . TYR A 1 258 ? 3.023   -1.672  11.870 1.00 21.29 ? 287  TYR A CD2   1 
ATOM   2064 C  CE1   . TYR A 1 258 ? 1.613   0.635   12.516 1.00 21.05 ? 287  TYR A CE1   1 
ATOM   2065 C  CE2   . TYR A 1 258 ? 3.694   -0.447  11.967 1.00 19.70 ? 287  TYR A CE2   1 
ATOM   2066 C  CZ    . TYR A 1 258 ? 2.981   0.699   12.287 1.00 22.14 ? 287  TYR A CZ    1 
ATOM   2067 O  OH    . TYR A 1 258 ? 3.626   1.909   12.362 1.00 21.56 ? 287  TYR A OH    1 
ATOM   2068 N  N     . PRO A 1 259 ? -0.657  -5.752  13.933 1.00 28.83 ? 288  PRO A N     1 
ATOM   2069 C  CA    . PRO A 1 259 ? -1.328  -7.036  13.718 1.00 28.26 ? 288  PRO A CA    1 
ATOM   2070 C  C     . PRO A 1 259 ? -2.188  -7.091  12.467 1.00 28.86 ? 288  PRO A C     1 
ATOM   2071 O  O     . PRO A 1 259 ? -2.462  -8.171  11.957 1.00 28.70 ? 288  PRO A O     1 
ATOM   2072 C  CB    . PRO A 1 259 ? -2.139  -7.231  15.004 1.00 29.65 ? 288  PRO A CB    1 
ATOM   2073 C  CG    . PRO A 1 259 ? -2.362  -5.827  15.499 1.00 30.52 ? 288  PRO A CG    1 
ATOM   2074 C  CD    . PRO A 1 259 ? -1.033  -5.164  15.232 1.00 27.31 ? 288  PRO A CD    1 
ATOM   2075 N  N     . GLU A 1 260 ? -2.588  -5.937  11.944 1.00 29.72 ? 289  GLU A N     1 
ATOM   2076 C  CA    . GLU A 1 260 ? -3.432  -5.945  10.757 1.00 31.10 ? 289  GLU A CA    1 
ATOM   2077 C  C     . GLU A 1 260 ? -2.681  -5.984  9.425  1.00 31.80 ? 289  GLU A C     1 
ATOM   2078 O  O     . GLU A 1 260 ? -3.295  -6.164  8.370  1.00 33.02 ? 289  GLU A O     1 
ATOM   2079 C  CB    . GLU A 1 260 ? -4.412  -4.758  10.785 1.00 32.15 ? 289  GLU A CB    1 
ATOM   2080 C  CG    . GLU A 1 260 ? -3.853  -3.361  10.441 1.00 34.07 ? 289  GLU A CG    1 
ATOM   2081 C  CD    . GLU A 1 260 ? -2.813  -2.833  11.430 1.00 35.30 ? 289  GLU A CD    1 
ATOM   2082 O  OE1   . GLU A 1 260 ? -2.796  -3.263  12.611 1.00 30.12 ? 289  GLU A OE1   1 
ATOM   2083 O  OE2   . GLU A 1 260 ? -2.014  -1.964  11.012 1.00 35.51 ? 289  GLU A OE2   1 
ATOM   2084 N  N     . TYR A 1 261 ? -1.358  -5.841  9.466  1.00 30.26 ? 290  TYR A N     1 
ATOM   2085 C  CA    . TYR A 1 261 ? -0.561  -5.852  8.237  1.00 28.05 ? 290  TYR A CA    1 
ATOM   2086 C  C     . TYR A 1 261 ? -0.730  -7.141  7.449  1.00 28.31 ? 290  TYR A C     1 
ATOM   2087 O  O     . TYR A 1 261 ? -0.444  -8.230  7.950  1.00 25.94 ? 290  TYR A O     1 
ATOM   2088 C  CB    . TYR A 1 261 ? 0.920   -5.656  8.555  1.00 26.07 ? 290  TYR A CB    1 
ATOM   2089 C  CG    . TYR A 1 261 ? 1.806   -5.606  7.324  1.00 23.44 ? 290  TYR A CG    1 
ATOM   2090 C  CD1   . TYR A 1 261 ? 1.636   -4.612  6.352  1.00 23.65 ? 290  TYR A CD1   1 
ATOM   2091 C  CD2   . TYR A 1 261 ? 2.822   -6.541  7.140  1.00 20.91 ? 290  TYR A CD2   1 
ATOM   2092 C  CE1   . TYR A 1 261 ? 2.461   -4.554  5.228  1.00 19.59 ? 290  TYR A CE1   1 
ATOM   2093 C  CE2   . TYR A 1 261 ? 3.654   -6.492  6.024  1.00 22.12 ? 290  TYR A CE2   1 
ATOM   2094 C  CZ    . TYR A 1 261 ? 3.465   -5.495  5.074  1.00 21.52 ? 290  TYR A CZ    1 
ATOM   2095 O  OH    . TYR A 1 261 ? 4.286   -5.455  3.979  1.00 21.28 ? 290  TYR A OH    1 
ATOM   2096 N  N     . ALA A 1 262 ? -1.179  -7.010  6.205  1.00 30.12 ? 291  ALA A N     1 
ATOM   2097 C  CA    . ALA A 1 262 ? -1.384  -8.169  5.341  1.00 32.94 ? 291  ALA A CA    1 
ATOM   2098 C  C     . ALA A 1 262 ? -0.430  -8.179  4.142  1.00 33.80 ? 291  ALA A C     1 
ATOM   2099 O  O     . ALA A 1 262 ? -0.610  -8.961  3.210  1.00 33.90 ? 291  ALA A O     1 
ATOM   2100 C  CB    . ALA A 1 262 ? -2.837  -8.202  4.853  1.00 34.19 ? 291  ALA A CB    1 
ATOM   2101 N  N     . GLY A 1 263 ? 0.585   -7.320  4.166  1.00 33.18 ? 292  GLY A N     1 
ATOM   2102 C  CA    . GLY A 1 263 ? 1.519   -7.271  3.052  1.00 30.74 ? 292  GLY A CA    1 
ATOM   2103 C  C     . GLY A 1 263 ? 2.622   -8.306  3.157  1.00 30.73 ? 292  GLY A C     1 
ATOM   2104 O  O     . GLY A 1 263 ? 2.616   -9.148  4.058  1.00 30.11 ? 292  GLY A O     1 
ATOM   2105 N  N     . SER A 1 264 ? 3.575   -8.249  2.235  1.00 28.64 ? 293  SER A N     1 
ATOM   2106 C  CA    . SER A 1 264 ? 4.684   -9.191  2.250  1.00 28.94 ? 293  SER A CA    1 
ATOM   2107 C  C     . SER A 1 264 ? 5.755   -8.709  3.218  1.00 28.34 ? 293  SER A C     1 
ATOM   2108 O  O     . SER A 1 264 ? 5.774   -7.543  3.617  1.00 27.54 ? 293  SER A O     1 
ATOM   2109 C  CB    . SER A 1 264 ? 5.285   -9.341  0.847  1.00 29.24 ? 293  SER A CB    1 
ATOM   2110 O  OG    . SER A 1 264 ? 6.519   -8.661  0.739  1.00 30.77 ? 293  SER A OG    1 
ATOM   2111 N  N     . ASN A 1 265 ? 6.657   -9.604  3.588  1.00 29.80 ? 294  ASN A N     1 
ATOM   2112 C  CA    . ASN A 1 265 ? 7.712   -9.229  4.504  1.00 31.21 ? 294  ASN A CA    1 
ATOM   2113 C  C     . ASN A 1 265 ? 9.002   -8.799  3.814  1.00 31.59 ? 294  ASN A C     1 
ATOM   2114 O  O     . ASN A 1 265 ? 10.099  -9.183  4.218  1.00 33.12 ? 294  ASN A O     1 
ATOM   2115 C  CB    . ASN A 1 265 ? 7.968   -10.360 5.504  1.00 33.95 ? 294  ASN A CB    1 
ATOM   2116 C  CG    . ASN A 1 265 ? 6.861   -10.465 6.554  1.00 37.17 ? 294  ASN A CG    1 
ATOM   2117 O  OD1   . ASN A 1 265 ? 6.589   -9.506  7.300  1.00 35.37 ? 294  ASN A OD1   1 
ATOM   2118 N  ND2   . ASN A 1 265 ? 6.213   -11.626 6.613  1.00 35.89 ? 294  ASN A ND2   1 
ATOM   2119 N  N     . THR A 1 266 ? 8.864   -8.002  2.760  1.00 29.19 ? 295  THR A N     1 
ATOM   2120 C  CA    . THR A 1 266 ? 10.031  -7.480  2.068  1.00 27.57 ? 295  THR A CA    1 
ATOM   2121 C  C     . THR A 1 266 ? 10.295  -6.119  2.720  1.00 27.87 ? 295  THR A C     1 
ATOM   2122 O  O     . THR A 1 266 ? 9.389   -5.507  3.296  1.00 23.90 ? 295  THR A O     1 
ATOM   2123 C  CB    . THR A 1 266 ? 9.774   -7.260  0.548  1.00 28.30 ? 295  THR A CB    1 
ATOM   2124 O  OG1   . THR A 1 266 ? 8.596   -6.464  0.368  1.00 24.66 ? 295  THR A OG1   1 
ATOM   2125 C  CG2   . THR A 1 266 ? 9.604   -8.598  -0.179 1.00 26.73 ? 295  THR A CG2   1 
ATOM   2126 N  N     . TYR A 1 267 ? 11.539  -5.665  2.649  1.00 26.17 ? 296  TYR A N     1 
ATOM   2127 C  CA    . TYR A 1 267 ? 11.902  -4.377  3.205  1.00 25.53 ? 296  TYR A CA    1 
ATOM   2128 C  C     . TYR A 1 267 ? 10.974  -3.308  2.633  1.00 24.19 ? 296  TYR A C     1 
ATOM   2129 O  O     . TYR A 1 267 ? 10.432  -2.473  3.362  1.00 20.97 ? 296  TYR A O     1 
ATOM   2130 C  CB    . TYR A 1 267 ? 13.351  -4.045  2.831  1.00 24.57 ? 296  TYR A CB    1 
ATOM   2131 C  CG    . TYR A 1 267 ? 13.706  -2.586  3.027  1.00 27.45 ? 296  TYR A CG    1 
ATOM   2132 C  CD1   . TYR A 1 267 ? 13.932  -2.063  4.303  1.00 24.71 ? 296  TYR A CD1   1 
ATOM   2133 C  CD2   . TYR A 1 267 ? 13.761  -1.711  1.934  1.00 26.30 ? 296  TYR A CD2   1 
ATOM   2134 C  CE1   . TYR A 1 267 ? 14.200  -0.698  4.487  1.00 23.40 ? 296  TYR A CE1   1 
ATOM   2135 C  CE2   . TYR A 1 267 ? 14.023  -0.352  2.103  1.00 23.62 ? 296  TYR A CE2   1 
ATOM   2136 C  CZ    . TYR A 1 267 ? 14.241  0.152   3.385  1.00 25.84 ? 296  TYR A CZ    1 
ATOM   2137 O  OH    . TYR A 1 267 ? 14.476  1.504   3.555  1.00 22.73 ? 296  TYR A OH    1 
ATOM   2138 N  N     . GLU A 1 268 ? 10.794  -3.361  1.314  1.00 21.79 ? 297  GLU A N     1 
ATOM   2139 C  CA    . GLU A 1 268 ? 9.977   -2.403  0.575  1.00 20.18 ? 297  GLU A CA    1 
ATOM   2140 C  C     . GLU A 1 268 ? 8.524   -2.225  1.025  1.00 20.08 ? 297  GLU A C     1 
ATOM   2141 O  O     . GLU A 1 268 ? 8.083   -1.101  1.280  1.00 19.45 ? 297  GLU A O     1 
ATOM   2142 C  CB    . GLU A 1 268 ? 10.001  -2.751  -0.923 1.00 20.03 ? 297  GLU A CB    1 
ATOM   2143 C  CG    . GLU A 1 268 ? 11.345  -2.510  -1.631 1.00 20.30 ? 297  GLU A CG    1 
ATOM   2144 C  CD    . GLU A 1 268 ? 12.461  -3.449  -1.188 1.00 23.53 ? 297  GLU A CD    1 
ATOM   2145 O  OE1   . GLU A 1 268 ? 12.174  -4.469  -0.520 1.00 23.38 ? 297  GLU A OE1   1 
ATOM   2146 O  OE2   . GLU A 1 268 ? 13.634  -3.175  -1.530 1.00 24.68 ? 297  GLU A OE2   1 
ATOM   2147 N  N     . GLU A 1 269 ? 7.769   -3.315  1.097  1.00 19.53 ? 298  GLU A N     1 
ATOM   2148 C  CA    . GLU A 1 269 ? 6.378   -3.201  1.500  1.00 22.16 ? 298  GLU A CA    1 
ATOM   2149 C  C     . GLU A 1 269 ? 6.190   -2.876  2.971  1.00 20.32 ? 298  GLU A C     1 
ATOM   2150 O  O     . GLU A 1 269 ? 5.240   -2.186  3.328  1.00 19.11 ? 298  GLU A O     1 
ATOM   2151 C  CB    . GLU A 1 269 ? 5.597   -4.473  1.146  1.00 22.70 ? 298  GLU A CB    1 
ATOM   2152 C  CG    . GLU A 1 269 ? 5.024   -4.426  -0.250 1.00 29.09 ? 298  GLU A CG    1 
ATOM   2153 C  CD    . GLU A 1 269 ? 4.139   -5.611  -0.571 1.00 32.52 ? 298  GLU A CD    1 
ATOM   2154 O  OE1   . GLU A 1 269 ? 3.331   -6.005  0.295  1.00 32.27 ? 298  GLU A OE1   1 
ATOM   2155 O  OE2   . GLU A 1 269 ? 4.237   -6.133  -1.702 1.00 35.37 ? 298  GLU A OE2   1 
ATOM   2156 N  N     . ALA A 1 270 ? 7.093   -3.369  3.815  1.00 20.52 ? 299  ALA A N     1 
ATOM   2157 C  CA    . ALA A 1 270 ? 7.000   -3.128  5.250  1.00 20.90 ? 299  ALA A CA    1 
ATOM   2158 C  C     . ALA A 1 270 ? 7.303   -1.667  5.526  1.00 19.78 ? 299  ALA A C     1 
ATOM   2159 O  O     . ALA A 1 270 ? 6.570   -0.997  6.253  1.00 20.75 ? 299  ALA A O     1 
ATOM   2160 C  CB    . ALA A 1 270 ? 7.971   -4.028  5.999  1.00 16.13 ? 299  ALA A CB    1 
ATOM   2161 N  N     . ALA A 1 271 ? 8.381   -1.174  4.927  1.00 21.69 ? 300  ALA A N     1 
ATOM   2162 C  CA    . ALA A 1 271 ? 8.777   0.222   5.087  1.00 20.10 ? 300  ALA A CA    1 
ATOM   2163 C  C     . ALA A 1 271 ? 7.686   1.141   4.561  1.00 20.77 ? 300  ALA A C     1 
ATOM   2164 O  O     . ALA A 1 271 ? 7.304   2.109   5.227  1.00 21.58 ? 300  ALA A O     1 
ATOM   2165 C  CB    . ALA A 1 271 ? 10.081  0.485   4.347  1.00 23.45 ? 300  ALA A CB    1 
ATOM   2166 N  N     . ALA A 1 272 ? 7.177   0.845   3.366  1.00 19.42 ? 301  ALA A N     1 
ATOM   2167 C  CA    . ALA A 1 272 ? 6.112   1.668   2.785  1.00 19.88 ? 301  ALA A CA    1 
ATOM   2168 C  C     . ALA A 1 272 ? 4.914   1.690   3.725  1.00 20.20 ? 301  ALA A C     1 
ATOM   2169 O  O     . ALA A 1 272 ? 4.295   2.729   3.946  1.00 20.99 ? 301  ALA A O     1 
ATOM   2170 C  CB    . ALA A 1 272 ? 5.677   1.110   1.425  1.00 19.29 ? 301  ALA A CB    1 
ATOM   2171 N  N     . TYR A 1 273 ? 4.579   0.528   4.270  1.00 18.93 ? 302  TYR A N     1 
ATOM   2172 C  CA    . TYR A 1 273 ? 3.440   0.453   5.170  1.00 20.32 ? 302  TYR A CA    1 
ATOM   2173 C  C     . TYR A 1 273 ? 3.654   1.388   6.366  1.00 18.87 ? 302  TYR A C     1 
ATOM   2174 O  O     . TYR A 1 273 ? 2.732   2.072   6.795  1.00 21.26 ? 302  TYR A O     1 
ATOM   2175 C  CB    . TYR A 1 273 ? 3.238   -0.986  5.656  1.00 19.01 ? 302  TYR A CB    1 
ATOM   2176 C  CG    . TYR A 1 273 ? 1.930   -1.171  6.380  1.00 20.20 ? 302  TYR A CG    1 
ATOM   2177 C  CD1   . TYR A 1 273 ? 0.730   -1.285  5.673  1.00 19.48 ? 302  TYR A CD1   1 
ATOM   2178 C  CD2   . TYR A 1 273 ? 1.881   -1.198  7.774  1.00 20.90 ? 302  TYR A CD2   1 
ATOM   2179 C  CE1   . TYR A 1 273 ? -0.485  -1.424  6.338  1.00 18.82 ? 302  TYR A CE1   1 
ATOM   2180 C  CE2   . TYR A 1 273 ? 0.668   -1.337  8.451  1.00 20.95 ? 302  TYR A CE2   1 
ATOM   2181 C  CZ    . TYR A 1 273 ? -0.506  -1.449  7.728  1.00 21.95 ? 302  TYR A CZ    1 
ATOM   2182 O  OH    . TYR A 1 273 ? -1.699  -1.586  8.395  1.00 23.76 ? 302  TYR A OH    1 
ATOM   2183 N  N     . ILE A 1 274 ? 4.870   1.412   6.905  1.00 17.75 ? 303  ILE A N     1 
ATOM   2184 C  CA    . ILE A 1 274 ? 5.170   2.281   8.038  1.00 18.00 ? 303  ILE A CA    1 
ATOM   2185 C  C     . ILE A 1 274 ? 5.125   3.761   7.622  1.00 19.63 ? 303  ILE A C     1 
ATOM   2186 O  O     . ILE A 1 274 ? 4.640   4.602   8.384  1.00 21.04 ? 303  ILE A O     1 
ATOM   2187 C  CB    . ILE A 1 274 ? 6.554   1.928   8.672  1.00 14.36 ? 303  ILE A CB    1 
ATOM   2188 C  CG1   . ILE A 1 274 ? 6.469   0.553   9.363  1.00 12.66 ? 303  ILE A CG1   1 
ATOM   2189 C  CG2   . ILE A 1 274 ? 6.947   2.980   9.696  1.00 17.21 ? 303  ILE A CG2   1 
ATOM   2190 C  CD1   . ILE A 1 274 ? 7.760   0.103   10.006 1.00 12.24 ? 303  ILE A CD1   1 
ATOM   2191 N  N     . GLN A 1 275 ? 5.617   4.081   6.423  1.00 19.43 ? 304  GLN A N     1 
ATOM   2192 C  CA    . GLN A 1 275 ? 5.571   5.466   5.948  1.00 21.45 ? 304  GLN A CA    1 
ATOM   2193 C  C     . GLN A 1 275 ? 4.115   5.937   5.916  1.00 20.88 ? 304  GLN A C     1 
ATOM   2194 O  O     . GLN A 1 275 ? 3.805   7.050   6.354  1.00 22.61 ? 304  GLN A O     1 
ATOM   2195 C  CB    . GLN A 1 275 ? 6.179   5.613   4.542  1.00 21.20 ? 304  GLN A CB    1 
ATOM   2196 C  CG    . GLN A 1 275 ? 6.211   7.079   4.057  1.00 21.98 ? 304  GLN A CG    1 
ATOM   2197 C  CD    . GLN A 1 275 ? 6.780   7.257   2.642  1.00 23.13 ? 304  GLN A CD    1 
ATOM   2198 O  OE1   . GLN A 1 275 ? 7.413   6.355   2.090  1.00 20.77 ? 304  GLN A OE1   1 
ATOM   2199 N  NE2   . GLN A 1 275 ? 6.562   8.438   2.063  1.00 20.42 ? 304  GLN A NE2   1 
ATOM   2200 N  N     . CYS A 1 276 ? 3.225   5.086   5.409  1.00 18.59 ? 305  CYS A N     1 
ATOM   2201 C  CA    . CYS A 1 276 ? 1.807   5.419   5.337  1.00 20.84 ? 305  CYS A CA    1 
ATOM   2202 C  C     . CYS A 1 276 ? 1.150   5.565   6.713  1.00 21.42 ? 305  CYS A C     1 
ATOM   2203 O  O     . CYS A 1 276 ? 0.312   6.444   6.914  1.00 19.60 ? 305  CYS A O     1 
ATOM   2204 C  CB    . CYS A 1 276 ? 1.048   4.365   4.532  1.00 25.54 ? 305  CYS A CB    1 
ATOM   2205 S  SG    . CYS A 1 276 ? 1.403   4.396   2.754  1.00 32.29 ? 305  CYS A SG    1 
ATOM   2206 N  N     . GLN A 1 277 ? 1.514   4.697   7.655  1.00 22.28 ? 306  GLN A N     1 
ATOM   2207 C  CA    . GLN A 1 277 ? 0.944   4.779   8.999  1.00 21.26 ? 306  GLN A CA    1 
ATOM   2208 C  C     . GLN A 1 277 ? 1.208   6.158   9.605  1.00 20.75 ? 306  GLN A C     1 
ATOM   2209 O  O     . GLN A 1 277 ? 0.304   6.781   10.143 1.00 23.47 ? 306  GLN A O     1 
ATOM   2210 C  CB    . GLN A 1 277 ? 1.531   3.687   9.896  1.00 21.83 ? 306  GLN A CB    1 
ATOM   2211 C  CG    . GLN A 1 277 ? 0.943   2.303   9.647  1.00 21.51 ? 306  GLN A CG    1 
ATOM   2212 C  CD    . GLN A 1 277 ? -0.549  2.258   9.932  1.00 24.90 ? 306  GLN A CD    1 
ATOM   2213 O  OE1   . GLN A 1 277 ? -0.999  2.667   11.007 1.00 28.26 ? 306  GLN A OE1   1 
ATOM   2214 N  NE2   . GLN A 1 277 ? -1.324  1.759   8.976  1.00 20.85 ? 306  GLN A NE2   1 
ATOM   2215 N  N     . PHE A 1 278 ? 2.442   6.637   9.511  1.00 21.16 ? 307  PHE A N     1 
ATOM   2216 C  CA    . PHE A 1 278 ? 2.772   7.949   10.042 1.00 21.29 ? 307  PHE A CA    1 
ATOM   2217 C  C     . PHE A 1 278 ? 2.134   9.091   9.231  1.00 24.08 ? 307  PHE A C     1 
ATOM   2218 O  O     . PHE A 1 278 ? 1.448   9.948   9.796  1.00 22.82 ? 307  PHE A O     1 
ATOM   2219 C  CB    . PHE A 1 278 ? 4.288   8.150   10.084 1.00 21.56 ? 307  PHE A CB    1 
ATOM   2220 C  CG    . PHE A 1 278 ? 4.947   7.568   11.300 1.00 22.80 ? 307  PHE A CG    1 
ATOM   2221 C  CD1   . PHE A 1 278 ? 5.255   6.214   11.363 1.00 22.89 ? 307  PHE A CD1   1 
ATOM   2222 C  CD2   . PHE A 1 278 ? 5.222   8.372   12.406 1.00 20.67 ? 307  PHE A CD2   1 
ATOM   2223 C  CE1   . PHE A 1 278 ? 5.830   5.655   12.517 1.00 23.48 ? 307  PHE A CE1   1 
ATOM   2224 C  CE2   . PHE A 1 278 ? 5.792   7.829   13.564 1.00 24.34 ? 307  PHE A CE2   1 
ATOM   2225 C  CZ    . PHE A 1 278 ? 6.097   6.459   13.617 1.00 21.67 ? 307  PHE A CZ    1 
ATOM   2226 N  N     . GLU A 1 279 ? 2.359   9.103   7.916  1.00 22.95 ? 308  GLU A N     1 
ATOM   2227 C  CA    . GLU A 1 279 ? 1.818   10.158  7.059  1.00 23.70 ? 308  GLU A CA    1 
ATOM   2228 C  C     . GLU A 1 279 ? 0.294   10.281  7.084  1.00 25.35 ? 308  GLU A C     1 
ATOM   2229 O  O     . GLU A 1 279 ? -0.237  11.385  6.972  1.00 25.21 ? 308  GLU A O     1 
ATOM   2230 C  CB    . GLU A 1 279 ? 2.317   9.993   5.606  1.00 21.59 ? 308  GLU A CB    1 
ATOM   2231 C  CG    . GLU A 1 279 ? 3.771   10.444  5.407  1.00 21.72 ? 308  GLU A CG    1 
ATOM   2232 C  CD    . GLU A 1 279 ? 4.252   10.350  3.963  1.00 25.99 ? 308  GLU A CD    1 
ATOM   2233 O  OE1   . GLU A 1 279 ? 3.402   10.276  3.047  1.00 25.44 ? 308  GLU A OE1   1 
ATOM   2234 O  OE2   . GLU A 1 279 ? 5.486   10.369  3.742  1.00 24.81 ? 308  GLU A OE2   1 
ATOM   2235 N  N     . ASP A 1 280 ? -0.409  9.166   7.248  1.00 26.62 ? 309  ASP A N     1 
ATOM   2236 C  CA    . ASP A 1 280 ? -1.871  9.199   7.282  1.00 27.87 ? 309  ASP A CA    1 
ATOM   2237 C  C     . ASP A 1 280 ? -2.454  9.853   8.533  1.00 28.21 ? 309  ASP A C     1 
ATOM   2238 O  O     . ASP A 1 280 ? -3.650  10.139  8.585  1.00 29.46 ? 309  ASP A O     1 
ATOM   2239 C  CB    . ASP A 1 280 ? -2.448  7.787   7.133  1.00 30.02 ? 309  ASP A CB    1 
ATOM   2240 C  CG    . ASP A 1 280 ? -2.257  7.222   5.731  1.00 34.53 ? 309  ASP A CG    1 
ATOM   2241 O  OD1   . ASP A 1 280 ? -1.983  8.008   4.796  1.00 37.20 ? 309  ASP A OD1   1 
ATOM   2242 O  OD2   . ASP A 1 280 ? -2.395  5.992   5.559  1.00 36.34 ? 309  ASP A OD2   1 
ATOM   2243 N  N     . LEU A 1 281 ? -1.621  10.078  9.543  1.00 28.97 ? 310  LEU A N     1 
ATOM   2244 C  CA    . LEU A 1 281 ? -2.072  10.725  10.775 1.00 28.93 ? 310  LEU A CA    1 
ATOM   2245 C  C     . LEU A 1 281 ? -2.326  12.215  10.514 1.00 30.21 ? 310  LEU A C     1 
ATOM   2246 O  O     . LEU A 1 281 ? -2.998  12.889  11.295 1.00 30.93 ? 310  LEU A O     1 
ATOM   2247 C  CB    . LEU A 1 281 ? -1.016  10.559  11.872 1.00 28.09 ? 310  LEU A CB    1 
ATOM   2248 C  CG    . LEU A 1 281 ? -0.730  9.111   12.299 1.00 28.67 ? 310  LEU A CG    1 
ATOM   2249 C  CD1   . LEU A 1 281 ? 0.525   9.066   13.165 1.00 25.04 ? 310  LEU A CD1   1 
ATOM   2250 C  CD2   . LEU A 1 281 ? -1.938  8.539   13.041 1.00 24.03 ? 310  LEU A CD2   1 
ATOM   2251 N  N     . ASN A 1 282 ? -1.777  12.724  9.414  1.00 31.55 ? 311  ASN A N     1 
ATOM   2252 C  CA    . ASN A 1 282 ? -1.949  14.124  9.020  1.00 34.08 ? 311  ASN A CA    1 
ATOM   2253 C  C     . ASN A 1 282 ? -3.430  14.385  8.724  1.00 36.70 ? 311  ASN A C     1 
ATOM   2254 O  O     . ASN A 1 282 ? -3.998  13.781  7.816  1.00 36.60 ? 311  ASN A O     1 
ATOM   2255 C  CB    . ASN A 1 282 ? -1.098  14.404  7.781  1.00 32.42 ? 311  ASN A CB    1 
ATOM   2256 C  CG    . ASN A 1 282 ? -1.255  15.815  7.261  1.00 35.30 ? 311  ASN A CG    1 
ATOM   2257 O  OD1   . ASN A 1 282 ? -1.889  16.664  7.892  1.00 36.99 ? 311  ASN A OD1   1 
ATOM   2258 N  ND2   . ASN A 1 282 ? -0.668  16.078  6.098  1.00 32.76 ? 311  ASN A ND2   1 
ATOM   2259 N  N     . LYS A 1 283 ? -4.054  15.280  9.489  1.00 39.24 ? 312  LYS A N     1 
ATOM   2260 C  CA    . LYS A 1 283 ? -5.477  15.572  9.299  1.00 43.00 ? 312  LYS A CA    1 
ATOM   2261 C  C     . LYS A 1 283 ? -5.758  16.689  8.288  1.00 44.21 ? 312  LYS A C     1 
ATOM   2262 O  O     . LYS A 1 283 ? -6.907  17.086  8.104  1.00 44.41 ? 312  LYS A O     1 
ATOM   2263 C  CB    . LYS A 1 283 ? -6.137  15.948  10.633 1.00 45.78 ? 312  LYS A CB    1 
ATOM   2264 C  CG    . LYS A 1 283 ? -5.706  15.128  11.846 1.00 49.76 ? 312  LYS A CG    1 
ATOM   2265 C  CD    . LYS A 1 283 ? -5.895  13.626  11.657 1.00 53.48 ? 312  LYS A CD    1 
ATOM   2266 C  CE    . LYS A 1 283 ? -5.340  12.859  12.864 1.00 55.76 ? 312  LYS A CE    1 
ATOM   2267 N  NZ    . LYS A 1 283 ? -5.209  11.391  12.618 1.00 56.53 ? 312  LYS A NZ    1 
ATOM   2268 N  N     . ARG A 1 284 ? -4.715  17.195  7.639  1.00 45.33 ? 313  ARG A N     1 
ATOM   2269 C  CA    . ARG A 1 284 ? -4.877  18.265  6.656  1.00 46.66 ? 313  ARG A CA    1 
ATOM   2270 C  C     . ARG A 1 284 ? -3.949  18.039  5.470  1.00 46.58 ? 313  ARG A C     1 
ATOM   2271 O  O     . ARG A 1 284 ? -3.123  18.890  5.146  1.00 44.78 ? 313  ARG A O     1 
ATOM   2272 C  CB    . ARG A 1 284 ? -4.562  19.617  7.298  1.00 49.18 ? 313  ARG A CB    1 
ATOM   2273 C  CG    . ARG A 1 284 ? -5.466  19.981  8.456  1.00 52.27 ? 313  ARG A CG    1 
ATOM   2274 C  CD    . ARG A 1 284 ? -4.909  21.155  9.238  1.00 56.43 ? 313  ARG A CD    1 
ATOM   2275 N  NE    . ARG A 1 284 ? -5.777  21.522  10.354 1.00 61.21 ? 313  ARG A NE    1 
ATOM   2276 C  CZ    . ARG A 1 284 ? -5.401  22.291  11.372 1.00 64.27 ? 313  ARG A CZ    1 
ATOM   2277 N  NH1   . ARG A 1 284 ? -4.165  22.778  11.421 1.00 64.82 ? 313  ARG A NH1   1 
ATOM   2278 N  NH2   . ARG A 1 284 ? -6.260  22.573  12.345 1.00 65.07 ? 313  ARG A NH2   1 
ATOM   2279 N  N     . LYS A 1 285 ? -4.087  16.889  4.822  1.00 48.90 ? 314  LYS A N     1 
ATOM   2280 C  CA    . LYS A 1 285 ? -3.244  16.565  3.680  1.00 52.88 ? 314  LYS A CA    1 
ATOM   2281 C  C     . LYS A 1 285 ? -3.269  17.644  2.596  1.00 55.11 ? 314  LYS A C     1 
ATOM   2282 O  O     . LYS A 1 285 ? -2.360  17.719  1.770  1.00 55.79 ? 314  LYS A O     1 
ATOM   2283 C  CB    . LYS A 1 285 ? -3.650  15.214  3.094  1.00 52.41 ? 314  LYS A CB    1 
ATOM   2284 C  CG    . LYS A 1 285 ? -3.387  14.041  4.027  1.00 52.64 ? 314  LYS A CG    1 
ATOM   2285 C  CD    . LYS A 1 285 ? -3.545  12.715  3.298  1.00 54.29 ? 314  LYS A CD    1 
ATOM   2286 C  CE    . LYS A 1 285 ? -3.241  11.533  4.203  1.00 53.64 ? 314  LYS A CE    1 
ATOM   2287 N  NZ    . LYS A 1 285 ? -4.216  11.432  5.323  1.00 54.56 ? 314  LYS A NZ    1 
ATOM   2288 N  N     . ASP A 1 286 ? -4.306  18.479  2.600  1.00 57.87 ? 315  ASP A N     1 
ATOM   2289 C  CA    . ASP A 1 286 ? -4.415  19.558  1.623  1.00 59.27 ? 315  ASP A CA    1 
ATOM   2290 C  C     . ASP A 1 286 ? -3.517  20.714  2.042  1.00 59.33 ? 315  ASP A C     1 
ATOM   2291 O  O     . ASP A 1 286 ? -2.807  21.298  1.221  1.00 60.17 ? 315  ASP A O     1 
ATOM   2292 C  CB    . ASP A 1 286 ? -5.861  20.049  1.519  1.00 61.41 ? 315  ASP A CB    1 
ATOM   2293 C  CG    . ASP A 1 286 ? -6.783  19.016  0.906  1.00 63.81 ? 315  ASP A CG    1 
ATOM   2294 O  OD1   . ASP A 1 286 ? -6.453  18.503  -0.185 1.00 64.99 ? 315  ASP A OD1   1 
ATOM   2295 O  OD2   . ASP A 1 286 ? -7.838  18.722  1.509  1.00 64.92 ? 315  ASP A OD2   1 
ATOM   2296 N  N     . THR A 1 287 ? -3.550  21.031  3.332  1.00 58.23 ? 316  THR A N     1 
ATOM   2297 C  CA    . THR A 1 287 ? -2.747  22.114  3.883  1.00 57.58 ? 316  THR A CA    1 
ATOM   2298 C  C     . THR A 1 287 ? -1.285  21.711  4.059  1.00 55.81 ? 316  THR A C     1 
ATOM   2299 O  O     . THR A 1 287 ? -0.440  22.060  3.237  1.00 56.07 ? 316  THR A O     1 
ATOM   2300 C  CB    . THR A 1 287 ? -3.293  22.563  5.252  1.00 58.55 ? 316  THR A CB    1 
ATOM   2301 O  OG1   . THR A 1 287 ? -4.649  22.997  5.107  1.00 59.86 ? 316  THR A OG1   1 
ATOM   2302 C  CG2   . THR A 1 287 ? -2.447  23.699  5.817  1.00 60.36 ? 316  THR A CG2   1 
ATOM   2303 N  N     . LYS A 1 288 ? -0.995  20.972  5.131  1.00 52.98 ? 317  LYS A N     1 
ATOM   2304 C  CA    . LYS A 1 288 ? 0.371   20.545  5.422  1.00 50.22 ? 317  LYS A CA    1 
ATOM   2305 C  C     . LYS A 1 288 ? 0.902   19.363  4.627  1.00 48.34 ? 317  LYS A C     1 
ATOM   2306 O  O     . LYS A 1 288 ? 0.193   18.402  4.324  1.00 45.76 ? 317  LYS A O     1 
ATOM   2307 C  CB    . LYS A 1 288 ? 0.545   20.229  6.912  1.00 49.93 ? 317  LYS A CB    1 
ATOM   2308 C  CG    . LYS A 1 288 ? 0.581   21.444  7.814  1.00 51.35 ? 317  LYS A CG    1 
ATOM   2309 C  CD    . LYS A 1 288 ? 1.314   21.140  9.115  1.00 50.07 ? 317  LYS A CD    1 
ATOM   2310 C  CE    . LYS A 1 288 ? 2.811   21.013  8.889  1.00 48.55 ? 317  LYS A CE    1 
ATOM   2311 N  NZ    . LYS A 1 288 ? 3.425   22.290  8.415  1.00 46.58 ? 317  LYS A NZ    1 
ATOM   2312 N  N     . GLU A 1 289 ? 2.187   19.458  4.319  1.00 46.75 ? 318  GLU A N     1 
ATOM   2313 C  CA    . GLU A 1 289 ? 2.905   18.437  3.587  1.00 44.96 ? 318  GLU A CA    1 
ATOM   2314 C  C     . GLU A 1 289 ? 3.986   17.887  4.517  1.00 42.20 ? 318  GLU A C     1 
ATOM   2315 O  O     . GLU A 1 289 ? 4.692   18.649  5.177  1.00 40.92 ? 318  GLU A O     1 
ATOM   2316 C  CB    . GLU A 1 289 ? 3.531   19.061  2.341  1.00 46.99 ? 318  GLU A CB    1 
ATOM   2317 C  CG    . GLU A 1 289 ? 4.644   18.259  1.697  1.00 50.53 ? 318  GLU A CG    1 
ATOM   2318 C  CD    . GLU A 1 289 ? 5.084   18.854  0.362  1.00 54.26 ? 318  GLU A CD    1 
ATOM   2319 O  OE1   . GLU A 1 289 ? 5.030   20.099  0.211  1.00 54.92 ? 318  GLU A OE1   1 
ATOM   2320 O  OE2   . GLU A 1 289 ? 5.495   18.080  -0.531 1.00 54.11 ? 318  GLU A OE2   1 
ATOM   2321 N  N     . ILE A 1 290 ? 4.087   16.566  4.598  1.00 38.45 ? 319  ILE A N     1 
ATOM   2322 C  CA    . ILE A 1 290 ? 5.104   15.942  5.436  1.00 34.65 ? 319  ILE A CA    1 
ATOM   2323 C  C     . ILE A 1 290 ? 6.259   15.552  4.519  1.00 33.22 ? 319  ILE A C     1 
ATOM   2324 O  O     . ILE A 1 290 ? 6.037   14.995  3.446  1.00 34.42 ? 319  ILE A O     1 
ATOM   2325 C  CB    . ILE A 1 290 ? 4.542   14.695  6.161  1.00 32.60 ? 319  ILE A CB    1 
ATOM   2326 C  CG1   . ILE A 1 290 ? 3.408   15.123  7.098  1.00 33.01 ? 319  ILE A CG1   1 
ATOM   2327 C  CG2   . ILE A 1 290 ? 5.643   13.999  6.958  1.00 31.10 ? 319  ILE A CG2   1 
ATOM   2328 C  CD1   . ILE A 1 290 ? 2.645   13.972  7.727  1.00 31.92 ? 319  ILE A CD1   1 
ATOM   2329 N  N     . TYR A 1 291 ? 7.483   15.869  4.931  1.00 30.67 ? 320  TYR A N     1 
ATOM   2330 C  CA    . TYR A 1 291 ? 8.673   15.566  4.139  1.00 30.46 ? 320  TYR A CA    1 
ATOM   2331 C  C     . TYR A 1 291 ? 9.390   14.350  4.713  1.00 30.66 ? 320  TYR A C     1 
ATOM   2332 O  O     . TYR A 1 291 ? 10.225  14.463  5.616  1.00 29.03 ? 320  TYR A O     1 
ATOM   2333 C  CB    . TYR A 1 291 ? 9.598   16.786  4.125  1.00 32.02 ? 320  TYR A CB    1 
ATOM   2334 C  CG    . TYR A 1 291 ? 8.917   18.019  3.571  1.00 35.43 ? 320  TYR A CG    1 
ATOM   2335 C  CD1   . TYR A 1 291 ? 8.682   18.154  2.199  1.00 37.08 ? 320  TYR A CD1   1 
ATOM   2336 C  CD2   . TYR A 1 291 ? 8.459   19.028  4.419  1.00 36.99 ? 320  TYR A CD2   1 
ATOM   2337 C  CE1   . TYR A 1 291 ? 8.007   19.263  1.687  1.00 38.60 ? 320  TYR A CE1   1 
ATOM   2338 C  CE2   . TYR A 1 291 ? 7.780   20.144  3.918  1.00 38.85 ? 320  TYR A CE2   1 
ATOM   2339 C  CZ    . TYR A 1 291 ? 7.558   20.252  2.551  1.00 39.90 ? 320  TYR A CZ    1 
ATOM   2340 O  OH    . TYR A 1 291 ? 6.879   21.339  2.049  1.00 39.95 ? 320  TYR A OH    1 
ATOM   2341 N  N     . THR A 1 292 ? 9.061   13.184  4.173  1.00 28.98 ? 321  THR A N     1 
ATOM   2342 C  CA    . THR A 1 292 ? 9.628   11.936  4.650  1.00 27.40 ? 321  THR A CA    1 
ATOM   2343 C  C     . THR A 1 292 ? 10.878  11.467  3.924  1.00 28.21 ? 321  THR A C     1 
ATOM   2344 O  O     . THR A 1 292 ? 10.965  11.532  2.695  1.00 27.58 ? 321  THR A O     1 
ATOM   2345 C  CB    . THR A 1 292 ? 8.583   10.823  4.579  1.00 28.20 ? 321  THR A CB    1 
ATOM   2346 O  OG1   . THR A 1 292 ? 7.398   11.250  5.265  1.00 26.25 ? 321  THR A OG1   1 
ATOM   2347 C  CG2   . THR A 1 292 ? 9.122   9.535   5.216  1.00 25.20 ? 321  THR A CG2   1 
ATOM   2348 N  N     . HIS A 1 293 ? 11.840  10.990  4.708  1.00 25.23 ? 322  HIS A N     1 
ATOM   2349 C  CA    . HIS A 1 293 ? 13.101  10.460  4.199  1.00 26.06 ? 322  HIS A CA    1 
ATOM   2350 C  C     . HIS A 1 293 ? 13.475  9.228   5.020  1.00 26.61 ? 322  HIS A C     1 
ATOM   2351 O  O     . HIS A 1 293 ? 13.387  9.251   6.256  1.00 25.24 ? 322  HIS A O     1 
ATOM   2352 C  CB    . HIS A 1 293 ? 14.217  11.498  4.333  1.00 26.22 ? 322  HIS A CB    1 
ATOM   2353 C  CG    . HIS A 1 293 ? 14.098  12.640  3.374  1.00 32.24 ? 322  HIS A CG    1 
ATOM   2354 N  ND1   . HIS A 1 293 ? 14.500  12.551  2.058  1.00 30.98 ? 322  HIS A ND1   1 
ATOM   2355 C  CD2   . HIS A 1 293 ? 13.581  13.884  3.527  1.00 33.03 ? 322  HIS A CD2   1 
ATOM   2356 C  CE1   . HIS A 1 293 ? 14.233  13.688  1.441  1.00 31.39 ? 322  HIS A CE1   1 
ATOM   2357 N  NE2   . HIS A 1 293 ? 13.675  14.513  2.309  1.00 33.73 ? 322  HIS A NE2   1 
ATOM   2358 N  N     . PHE A 1 294 ? 13.850  8.147   4.337  1.00 24.04 ? 323  PHE A N     1 
ATOM   2359 C  CA    . PHE A 1 294 ? 14.291  6.937   5.013  1.00 22.55 ? 323  PHE A CA    1 
ATOM   2360 C  C     . PHE A 1 294 ? 15.780  7.160   5.233  1.00 24.12 ? 323  PHE A C     1 
ATOM   2361 O  O     . PHE A 1 294 ? 16.513  7.459   4.286  1.00 25.16 ? 323  PHE A O     1 
ATOM   2362 C  CB    . PHE A 1 294 ? 14.048  5.694   4.147  1.00 21.39 ? 323  PHE A CB    1 
ATOM   2363 C  CG    . PHE A 1 294 ? 12.616  5.242   4.141  1.00 19.85 ? 323  PHE A CG    1 
ATOM   2364 C  CD1   . PHE A 1 294 ? 11.688  5.837   3.293  1.00 17.54 ? 323  PHE A CD1   1 
ATOM   2365 C  CD2   . PHE A 1 294 ? 12.176  4.278   5.052  1.00 18.02 ? 323  PHE A CD2   1 
ATOM   2366 C  CE1   . PHE A 1 294 ? 10.340  5.489   3.347  1.00 16.42 ? 323  PHE A CE1   1 
ATOM   2367 C  CE2   . PHE A 1 294 ? 10.839  3.920   5.121  1.00 16.54 ? 323  PHE A CE2   1 
ATOM   2368 C  CZ    . PHE A 1 294 ? 9.912   4.528   4.265  1.00 20.13 ? 323  PHE A CZ    1 
ATOM   2369 N  N     . THR A 1 295 ? 16.235  7.022   6.476  1.00 23.08 ? 324  THR A N     1 
ATOM   2370 C  CA    . THR A 1 295 ? 17.635  7.278   6.772  1.00 21.94 ? 324  THR A CA    1 
ATOM   2371 C  C     . THR A 1 295 ? 18.362  6.213   7.551  1.00 23.09 ? 324  THR A C     1 
ATOM   2372 O  O     . THR A 1 295 ? 17.782  5.248   8.045  1.00 23.41 ? 324  THR A O     1 
ATOM   2373 C  CB    . THR A 1 295 ? 17.817  8.600   7.586  1.00 22.40 ? 324  THR A CB    1 
ATOM   2374 O  OG1   . THR A 1 295 ? 17.201  8.465   8.876  1.00 19.64 ? 324  THR A OG1   1 
ATOM   2375 C  CG2   . THR A 1 295 ? 17.179  9.776   6.868  1.00 23.20 ? 324  THR A CG2   1 
ATOM   2376 N  N     . CYS A 1 296 ? 19.666  6.436   7.634  1.00 25.01 ? 325  CYS A N     1 
ATOM   2377 C  CA    . CYS A 1 296 ? 20.604  5.626   8.381  1.00 25.87 ? 325  CYS A CA    1 
ATOM   2378 C  C     . CYS A 1 296 ? 21.481  6.724   8.964  1.00 26.53 ? 325  CYS A C     1 
ATOM   2379 O  O     . CYS A 1 296 ? 22.498  7.093   8.374  1.00 29.04 ? 325  CYS A O     1 
ATOM   2380 C  CB    . CYS A 1 296 ? 21.436  4.728   7.466  1.00 26.09 ? 325  CYS A CB    1 
ATOM   2381 S  SG    . CYS A 1 296 ? 22.678  3.778   8.402  1.00 26.26 ? 325  CYS A SG    1 
ATOM   2382 N  N     . ALA A 1 297 ? 21.058  7.265   10.104 1.00 25.79 ? 326  ALA A N     1 
ATOM   2383 C  CA    . ALA A 1 297 ? 21.768  8.357   10.764 1.00 25.59 ? 326  ALA A CA    1 
ATOM   2384 C  C     . ALA A 1 297 ? 23.267  8.146   10.935 1.00 25.68 ? 326  ALA A C     1 
ATOM   2385 O  O     . ALA A 1 297 ? 24.022  9.113   11.018 1.00 25.17 ? 326  ALA A O     1 
ATOM   2386 C  CB    . ALA A 1 297 ? 21.126  8.654   12.122 1.00 26.98 ? 326  ALA A CB    1 
ATOM   2387 N  N     . THR A 1 298 ? 23.710  6.894   10.985 1.00 27.19 ? 327  THR A N     1 
ATOM   2388 C  CA    . THR A 1 298 ? 25.136  6.635   11.153 1.00 27.11 ? 327  THR A CA    1 
ATOM   2389 C  C     . THR A 1 298 ? 25.891  6.616   9.825  1.00 29.02 ? 327  THR A C     1 
ATOM   2390 O  O     . THR A 1 298 ? 27.105  6.404   9.792  1.00 29.87 ? 327  THR A O     1 
ATOM   2391 C  CB    . THR A 1 298 ? 25.385  5.314   11.913 1.00 26.00 ? 327  THR A CB    1 
ATOM   2392 O  OG1   . THR A 1 298 ? 24.626  4.258   11.314 1.00 30.31 ? 327  THR A OG1   1 
ATOM   2393 C  CG2   . THR A 1 298 ? 24.976  5.459   13.371 1.00 24.30 ? 327  THR A CG2   1 
ATOM   2394 N  N     . ASP A 1 299 ? 25.174  6.857   8.733  1.00 28.10 ? 328  ASP A N     1 
ATOM   2395 C  CA    . ASP A 1 299 ? 25.788  6.881   7.408  1.00 31.44 ? 328  ASP A CA    1 
ATOM   2396 C  C     . ASP A 1 299 ? 25.943  8.344   6.976  1.00 31.91 ? 328  ASP A C     1 
ATOM   2397 O  O     . ASP A 1 299 ? 24.997  8.954   6.467  1.00 32.15 ? 328  ASP A O     1 
ATOM   2398 C  CB    . ASP A 1 299 ? 24.900  6.139   6.408  1.00 34.71 ? 328  ASP A CB    1 
ATOM   2399 C  CG    . ASP A 1 299 ? 25.520  6.052   5.022  1.00 38.14 ? 328  ASP A CG    1 
ATOM   2400 O  OD1   . ASP A 1 299 ? 26.080  7.061   4.537  1.00 38.89 ? 328  ASP A OD1   1 
ATOM   2401 O  OD2   . ASP A 1 299 ? 25.430  4.970   4.410  1.00 40.46 ? 328  ASP A OD2   1 
ATOM   2402 N  N     . THR A 1 300 ? 27.134  8.899   7.175  1.00 33.07 ? 329  THR A N     1 
ATOM   2403 C  CA    . THR A 1 300 ? 27.397  10.294  6.833  1.00 34.46 ? 329  THR A CA    1 
ATOM   2404 C  C     . THR A 1 300 ? 26.962  10.674  5.421  1.00 35.22 ? 329  THR A C     1 
ATOM   2405 O  O     . THR A 1 300 ? 26.345  11.719  5.213  1.00 35.11 ? 329  THR A O     1 
ATOM   2406 C  CB    . THR A 1 300 ? 28.886  10.627  6.996  1.00 35.23 ? 329  THR A CB    1 
ATOM   2407 O  OG1   . THR A 1 300 ? 29.297  10.330  8.336  1.00 35.97 ? 329  THR A OG1   1 
ATOM   2408 C  CG2   . THR A 1 300 ? 29.129  12.098  6.719  1.00 35.01 ? 329  THR A CG2   1 
ATOM   2409 N  N     . LYS A 1 301 ? 27.284  9.827   4.450  1.00 35.74 ? 330  LYS A N     1 
ATOM   2410 C  CA    . LYS A 1 301 ? 26.913  10.093  3.067  1.00 36.78 ? 330  LYS A CA    1 
ATOM   2411 C  C     . LYS A 1 301 ? 25.397  10.230  2.933  1.00 36.18 ? 330  LYS A C     1 
ATOM   2412 O  O     . LYS A 1 301 ? 24.896  11.177  2.317  1.00 37.16 ? 330  LYS A O     1 
ATOM   2413 C  CB    . LYS A 1 301 ? 27.426  8.969   2.162  1.00 39.62 ? 330  LYS A CB    1 
ATOM   2414 C  CG    . LYS A 1 301 ? 27.046  9.120   0.699  1.00 44.85 ? 330  LYS A CG    1 
ATOM   2415 C  CD    . LYS A 1 301 ? 27.624  7.991   -0.152 1.00 47.97 ? 330  LYS A CD    1 
ATOM   2416 C  CE    . LYS A 1 301 ? 27.129  8.073   -1.597 1.00 49.30 ? 330  LYS A CE    1 
ATOM   2417 N  NZ    . LYS A 1 301 ? 27.686  6.979   -2.451 1.00 50.44 ? 330  LYS A NZ    1 
ATOM   2418 N  N     . ASN A 1 302 ? 24.662  9.288   3.515  1.00 33.71 ? 331  ASN A N     1 
ATOM   2419 C  CA    . ASN A 1 302 ? 23.206  9.329   3.447  1.00 30.01 ? 331  ASN A CA    1 
ATOM   2420 C  C     . ASN A 1 302 ? 22.671  10.579  4.141  1.00 28.54 ? 331  ASN A C     1 
ATOM   2421 O  O     . ASN A 1 302 ? 21.841  11.290  3.589  1.00 29.18 ? 331  ASN A O     1 
ATOM   2422 C  CB    . ASN A 1 302 ? 22.608  8.072   4.085  1.00 27.49 ? 331  ASN A CB    1 
ATOM   2423 C  CG    . ASN A 1 302 ? 21.097  8.085   4.087  1.00 28.01 ? 331  ASN A CG    1 
ATOM   2424 O  OD1   . ASN A 1 302 ? 20.467  7.989   5.139  1.00 28.17 ? 331  ASN A OD1   1 
ATOM   2425 N  ND2   . ASN A 1 302 ? 20.502  8.215   2.906  1.00 26.44 ? 331  ASN A ND2   1 
ATOM   2426 N  N     . VAL A 1 303 ? 23.148  10.850  5.351  1.00 29.88 ? 332  VAL A N     1 
ATOM   2427 C  CA    . VAL A 1 303 ? 22.697  12.030  6.084  1.00 31.13 ? 332  VAL A CA    1 
ATOM   2428 C  C     . VAL A 1 303 ? 22.977  13.310  5.291  1.00 33.32 ? 332  VAL A C     1 
ATOM   2429 O  O     . VAL A 1 303 ? 22.125  14.198  5.202  1.00 32.39 ? 332  VAL A O     1 
ATOM   2430 C  CB    . VAL A 1 303 ? 23.387  12.133  7.461  1.00 30.46 ? 332  VAL A CB    1 
ATOM   2431 C  CG1   . VAL A 1 303 ? 23.082  13.484  8.101  1.00 26.88 ? 332  VAL A CG1   1 
ATOM   2432 C  CG2   . VAL A 1 303 ? 22.897  11.005  8.372  1.00 30.42 ? 332  VAL A CG2   1 
ATOM   2433 N  N     . GLN A 1 304 ? 24.173  13.400  4.718  1.00 34.72 ? 333  GLN A N     1 
ATOM   2434 C  CA    . GLN A 1 304 ? 24.555  14.564  3.929  1.00 36.14 ? 333  GLN A CA    1 
ATOM   2435 C  C     . GLN A 1 304 ? 23.550  14.782  2.802  1.00 34.66 ? 333  GLN A C     1 
ATOM   2436 O  O     . GLN A 1 304 ? 22.998  15.872  2.648  1.00 34.06 ? 333  GLN A O     1 
ATOM   2437 C  CB    . GLN A 1 304 ? 25.962  14.365  3.350  1.00 39.16 ? 333  GLN A CB    1 
ATOM   2438 C  CG    . GLN A 1 304 ? 26.429  15.490  2.435  1.00 43.20 ? 333  GLN A CG    1 
ATOM   2439 C  CD    . GLN A 1 304 ? 27.923  15.440  2.164  1.00 46.29 ? 333  GLN A CD    1 
ATOM   2440 O  OE1   . GLN A 1 304 ? 28.452  16.235  1.390  1.00 46.50 ? 333  GLN A OE1   1 
ATOM   2441 N  NE2   . GLN A 1 304 ? 28.614  14.505  2.812  1.00 48.74 ? 333  GLN A NE2   1 
ATOM   2442 N  N     . PHE A 1 305 ? 23.309  13.730  2.026  1.00 34.25 ? 334  PHE A N     1 
ATOM   2443 C  CA    . PHE A 1 305 ? 22.367  13.791  0.917  1.00 34.79 ? 334  PHE A CA    1 
ATOM   2444 C  C     . PHE A 1 305 ? 20.992  14.239  1.392  1.00 34.96 ? 334  PHE A C     1 
ATOM   2445 O  O     . PHE A 1 305 ? 20.373  15.130  0.798  1.00 34.39 ? 334  PHE A O     1 
ATOM   2446 C  CB    . PHE A 1 305 ? 22.227  12.421  0.254  1.00 36.78 ? 334  PHE A CB    1 
ATOM   2447 C  CG    . PHE A 1 305 ? 21.161  12.376  -0.802 1.00 39.38 ? 334  PHE A CG    1 
ATOM   2448 C  CD1   . PHE A 1 305 ? 21.435  12.779  -2.106 1.00 41.25 ? 334  PHE A CD1   1 
ATOM   2449 C  CD2   . PHE A 1 305 ? 19.863  11.991  -0.478 1.00 40.44 ? 334  PHE A CD2   1 
ATOM   2450 C  CE1   . PHE A 1 305 ? 20.430  12.802  -3.076 1.00 41.09 ? 334  PHE A CE1   1 
ATOM   2451 C  CE2   . PHE A 1 305 ? 18.850  12.012  -1.438 1.00 41.46 ? 334  PHE A CE2   1 
ATOM   2452 C  CZ    . PHE A 1 305 ? 19.136  12.420  -2.741 1.00 41.80 ? 334  PHE A CZ    1 
ATOM   2453 N  N     . VAL A 1 306 ? 20.518  13.611  2.464  1.00 33.04 ? 335  VAL A N     1 
ATOM   2454 C  CA    . VAL A 1 306 ? 19.207  13.925  3.019  1.00 32.09 ? 335  VAL A CA    1 
ATOM   2455 C  C     . VAL A 1 306 ? 19.118  15.325  3.607  1.00 31.99 ? 335  VAL A C     1 
ATOM   2456 O  O     . VAL A 1 306 ? 18.127  16.024  3.385  1.00 30.13 ? 335  VAL A O     1 
ATOM   2457 C  CB    . VAL A 1 306 ? 18.796  12.893  4.098  1.00 32.72 ? 335  VAL A CB    1 
ATOM   2458 C  CG1   . VAL A 1 306 ? 17.528  13.348  4.811  1.00 28.16 ? 335  VAL A CG1   1 
ATOM   2459 C  CG2   . VAL A 1 306 ? 18.572  11.532  3.444  1.00 32.42 ? 335  VAL A CG2   1 
ATOM   2460 N  N     . PHE A 1 307 ? 20.133  15.744  4.359  1.00 33.22 ? 336  PHE A N     1 
ATOM   2461 C  CA    . PHE A 1 307 ? 20.073  17.079  4.936  1.00 36.95 ? 336  PHE A CA    1 
ATOM   2462 C  C     . PHE A 1 307 ? 20.162  18.119  3.831  1.00 38.15 ? 336  PHE A C     1 
ATOM   2463 O  O     . PHE A 1 307 ? 19.715  19.253  3.995  1.00 36.48 ? 336  PHE A O     1 
ATOM   2464 C  CB    . PHE A 1 307 ? 21.191  17.331  5.941  1.00 37.78 ? 336  PHE A CB    1 
ATOM   2465 C  CG    . PHE A 1 307 ? 20.944  18.536  6.795  1.00 40.23 ? 336  PHE A CG    1 
ATOM   2466 C  CD1   . PHE A 1 307 ? 19.966  18.505  7.786  1.00 40.05 ? 336  PHE A CD1   1 
ATOM   2467 C  CD2   . PHE A 1 307 ? 21.631  19.725  6.565  1.00 40.64 ? 336  PHE A CD2   1 
ATOM   2468 C  CE1   . PHE A 1 307 ? 19.669  19.642  8.533  1.00 41.73 ? 336  PHE A CE1   1 
ATOM   2469 C  CE2   . PHE A 1 307 ? 21.342  20.870  7.306  1.00 40.78 ? 336  PHE A CE2   1 
ATOM   2470 C  CZ    . PHE A 1 307 ? 20.359  20.829  8.292  1.00 41.38 ? 336  PHE A CZ    1 
ATOM   2471 N  N     . ASP A 1 308 ? 20.753  17.727  2.710  1.00 39.57 ? 337  ASP A N     1 
ATOM   2472 C  CA    . ASP A 1 308 ? 20.865  18.624  1.575  1.00 43.09 ? 337  ASP A CA    1 
ATOM   2473 C  C     . ASP A 1 308 ? 19.449  18.850  1.044  1.00 42.19 ? 337  ASP A C     1 
ATOM   2474 O  O     . ASP A 1 308 ? 19.052  19.985  0.769  1.00 43.69 ? 337  ASP A O     1 
ATOM   2475 C  CB    . ASP A 1 308 ? 21.746  17.995  0.492  1.00 48.87 ? 337  ASP A CB    1 
ATOM   2476 C  CG    . ASP A 1 308 ? 22.116  18.977  -0.595 1.00 53.78 ? 337  ASP A CG    1 
ATOM   2477 O  OD1   . ASP A 1 308 ? 21.198  19.518  -1.248 1.00 56.99 ? 337  ASP A OD1   1 
ATOM   2478 O  OD2   . ASP A 1 308 ? 23.328  19.209  -0.794 1.00 57.94 ? 337  ASP A OD2   1 
ATOM   2479 N  N     . ALA A 1 309 ? 18.683  17.765  0.931  1.00 39.01 ? 338  ALA A N     1 
ATOM   2480 C  CA    . ALA A 1 309 ? 17.311  17.840  0.437  1.00 37.05 ? 338  ALA A CA    1 
ATOM   2481 C  C     . ALA A 1 309 ? 16.381  18.541  1.424  1.00 37.21 ? 338  ALA A C     1 
ATOM   2482 O  O     . ALA A 1 309 ? 15.404  19.170  1.022  1.00 36.10 ? 338  ALA A O     1 
ATOM   2483 C  CB    . ALA A 1 309 ? 16.786  16.438  0.129  1.00 37.45 ? 338  ALA A CB    1 
ATOM   2484 N  N     . VAL A 1 310 ? 16.668  18.423  2.716  1.00 36.69 ? 339  VAL A N     1 
ATOM   2485 C  CA    . VAL A 1 310 ? 15.837  19.079  3.716  1.00 37.63 ? 339  VAL A CA    1 
ATOM   2486 C  C     . VAL A 1 310 ? 16.043  20.592  3.597  1.00 38.29 ? 339  VAL A C     1 
ATOM   2487 O  O     . VAL A 1 310 ? 15.105  21.372  3.757  1.00 37.16 ? 339  VAL A O     1 
ATOM   2488 C  CB    . VAL A 1 310 ? 16.198  18.616  5.163  1.00 37.57 ? 339  VAL A CB    1 
ATOM   2489 C  CG1   . VAL A 1 310 ? 15.405  19.419  6.190  1.00 35.50 ? 339  VAL A CG1   1 
ATOM   2490 C  CG2   . VAL A 1 310 ? 15.893  17.139  5.326  1.00 35.89 ? 339  VAL A CG2   1 
ATOM   2491 N  N     . THR A 1 311 ? 17.275  20.996  3.306  1.00 39.30 ? 340  THR A N     1 
ATOM   2492 C  CA    . THR A 1 311 ? 17.597  22.406  3.161  1.00 41.48 ? 340  THR A CA    1 
ATOM   2493 C  C     . THR A 1 311 ? 16.851  23.019  1.973  1.00 42.79 ? 340  THR A C     1 
ATOM   2494 O  O     . THR A 1 311 ? 16.305  24.115  2.083  1.00 42.56 ? 340  THR A O     1 
ATOM   2495 C  CB    . THR A 1 311 ? 19.115  22.610  2.985  1.00 43.47 ? 340  THR A CB    1 
ATOM   2496 O  OG1   . THR A 1 311 ? 19.799  22.127  4.150  1.00 43.13 ? 340  THR A OG1   1 
ATOM   2497 C  CG2   . THR A 1 311 ? 19.439  24.084  2.797  1.00 43.27 ? 340  THR A CG2   1 
ATOM   2498 N  N     . ASP A 1 312 ? 16.814  22.317  0.843  1.00 44.47 ? 341  ASP A N     1 
ATOM   2499 C  CA    . ASP A 1 312 ? 16.102  22.840  -0.319 1.00 46.71 ? 341  ASP A CA    1 
ATOM   2500 C  C     . ASP A 1 312 ? 14.643  23.093  0.054  1.00 47.72 ? 341  ASP A C     1 
ATOM   2501 O  O     . ASP A 1 312 ? 14.040  24.077  -0.380 1.00 48.47 ? 341  ASP A O     1 
ATOM   2502 C  CB    . ASP A 1 312 ? 16.178  21.866  -1.498 1.00 48.04 ? 341  ASP A CB    1 
ATOM   2503 C  CG    . ASP A 1 312 ? 17.591  21.705  -2.032 1.00 50.42 ? 341  ASP A CG    1 
ATOM   2504 O  OD1   . ASP A 1 312 ? 18.381  22.670  -1.929 1.00 50.52 ? 341  ASP A OD1   1 
ATOM   2505 O  OD2   . ASP A 1 312 ? 17.909  20.620  -2.568 1.00 51.72 ? 341  ASP A OD2   1 
ATOM   2506 N  N     . VAL A 1 313 ? 14.082  22.208  0.873  1.00 47.33 ? 342  VAL A N     1 
ATOM   2507 C  CA    . VAL A 1 313 ? 12.702  22.351  1.315  1.00 47.43 ? 342  VAL A CA    1 
ATOM   2508 C  C     . VAL A 1 313 ? 12.527  23.574  2.213  1.00 48.84 ? 342  VAL A C     1 
ATOM   2509 O  O     . VAL A 1 313 ? 11.561  24.319  2.065  1.00 49.34 ? 342  VAL A O     1 
ATOM   2510 C  CB    . VAL A 1 313 ? 12.228  21.093  2.073  1.00 47.37 ? 342  VAL A CB    1 
ATOM   2511 C  CG1   . VAL A 1 313 ? 10.893  21.360  2.757  1.00 46.09 ? 342  VAL A CG1   1 
ATOM   2512 C  CG2   . VAL A 1 313 ? 12.097  19.931  1.102  1.00 44.52 ? 342  VAL A CG2   1 
ATOM   2513 N  N     . ILE A 1 314 ? 13.452  23.774  3.148  1.00 50.03 ? 343  ILE A N     1 
ATOM   2514 C  CA    . ILE A 1 314 ? 13.390  24.920  4.054  1.00 51.67 ? 343  ILE A CA    1 
ATOM   2515 C  C     . ILE A 1 314 ? 13.408  26.212  3.234  1.00 53.15 ? 343  ILE A C     1 
ATOM   2516 O  O     . ILE A 1 314 ? 12.644  27.140  3.495  1.00 52.09 ? 343  ILE A O     1 
ATOM   2517 C  CB    . ILE A 1 314 ? 14.605  24.958  5.023  1.00 52.52 ? 343  ILE A CB    1 
ATOM   2518 C  CG1   . ILE A 1 314 ? 14.626  23.706  5.908  1.00 52.77 ? 343  ILE A CG1   1 
ATOM   2519 C  CG2   . ILE A 1 314 ? 14.545  26.220  5.883  1.00 50.99 ? 343  ILE A CG2   1 
ATOM   2520 C  CD1   . ILE A 1 314 ? 13.443  23.591  6.842  1.00 52.53 ? 343  ILE A CD1   1 
ATOM   2521 N  N     . ILE A 1 315 ? 14.298  26.258  2.247  1.00 55.34 ? 344  ILE A N     1 
ATOM   2522 C  CA    . ILE A 1 315 ? 14.435  27.421  1.382  1.00 58.10 ? 344  ILE A CA    1 
ATOM   2523 C  C     . ILE A 1 315 ? 13.139  27.750  0.647  1.00 60.63 ? 344  ILE A C     1 
ATOM   2524 O  O     . ILE A 1 315 ? 12.564  28.822  0.841  1.00 60.69 ? 344  ILE A O     1 
ATOM   2525 C  CB    . ILE A 1 315 ? 15.554  27.205  0.342  1.00 58.00 ? 344  ILE A CB    1 
ATOM   2526 C  CG1   . ILE A 1 315 ? 16.912  27.174  1.042  1.00 57.14 ? 344  ILE A CG1   1 
ATOM   2527 C  CG2   . ILE A 1 315 ? 15.521  28.311  -0.703 1.00 58.22 ? 344  ILE A CG2   1 
ATOM   2528 C  CD1   . ILE A 1 315 ? 18.066  26.882  0.114  1.00 56.64 ? 344  ILE A CD1   1 
ATOM   2529 N  N     . LYS A 1 316 ? 12.675  26.830  -0.193 1.00 62.85 ? 345  LYS A N     1 
ATOM   2530 C  CA    . LYS A 1 316 ? 11.454  27.075  -0.948 1.00 65.63 ? 345  LYS A CA    1 
ATOM   2531 C  C     . LYS A 1 316 ? 10.222  27.201  -0.059 1.00 66.53 ? 345  LYS A C     1 
ATOM   2532 O  O     . LYS A 1 316 ? 9.268   27.890  -0.417 1.00 66.94 ? 345  LYS A O     1 
ATOM   2533 C  CB    . LYS A 1 316 ? 11.242  25.986  -2.010 1.00 66.91 ? 345  LYS A CB    1 
ATOM   2534 C  CG    . LYS A 1 316 ? 11.052  24.582  -1.475 1.00 70.53 ? 345  LYS A CG    1 
ATOM   2535 C  CD    . LYS A 1 316 ? 11.002  23.574  -2.618 1.00 72.87 ? 345  LYS A CD    1 
ATOM   2536 C  CE    . LYS A 1 316 ? 10.862  22.147  -2.099 1.00 74.36 ? 345  LYS A CE    1 
ATOM   2537 N  NZ    . LYS A 1 316 ? 10.883  21.145  -3.203 1.00 75.13 ? 345  LYS A NZ    1 
ATOM   2538 N  N     . ASN A 1 317 ? 10.233  26.550  1.099  1.00 68.33 ? 346  ASN A N     1 
ATOM   2539 C  CA    . ASN A 1 317 ? 9.091   26.646  2.004  1.00 70.88 ? 346  ASN A CA    1 
ATOM   2540 C  C     . ASN A 1 317 ? 9.028   28.058  2.567  1.00 71.82 ? 346  ASN A C     1 
ATOM   2541 O  O     . ASN A 1 317 ? 8.007   28.482  3.104  1.00 72.21 ? 346  ASN A O     1 
ATOM   2542 C  CB    . ASN A 1 317 ? 9.210   25.628  3.142  1.00 71.82 ? 346  ASN A CB    1 
ATOM   2543 C  CG    . ASN A 1 317 ? 8.290   24.433  2.953  1.00 72.78 ? 346  ASN A CG    1 
ATOM   2544 O  OD1   . ASN A 1 317 ? 8.135   23.925  1.841  1.00 73.24 ? 346  ASN A OD1   1 
ATOM   2545 N  ND2   . ASN A 1 317 ? 7.680   23.974  4.043  1.00 72.15 ? 346  ASN A ND2   1 
ATOM   2546 N  N     . ASN A 1 318 ? 10.134  28.781  2.429  1.00 72.90 ? 347  ASN A N     1 
ATOM   2547 C  CA    . ASN A 1 318 ? 10.226  30.155  2.902  1.00 74.56 ? 347  ASN A CA    1 
ATOM   2548 C  C     . ASN A 1 318 ? 9.567   31.052  1.855  1.00 75.21 ? 347  ASN A C     1 
ATOM   2549 O  O     . ASN A 1 318 ? 9.972   32.199  1.664  1.00 74.33 ? 347  ASN A O     1 
ATOM   2550 C  CB    . ASN A 1 318 ? 11.697  30.550  3.073  1.00 75.16 ? 347  ASN A CB    1 
ATOM   2551 C  CG    . ASN A 1 318 ? 11.870  31.915  3.718  1.00 75.82 ? 347  ASN A CG    1 
ATOM   2552 O  OD1   . ASN A 1 318 ? 12.956  32.495  3.684  1.00 75.25 ? 347  ASN A OD1   1 
ATOM   2553 N  ND2   . ASN A 1 318 ? 10.802  32.429  4.318  1.00 76.37 ? 347  ASN A ND2   1 
ATOM   2554 N  N     . LEU A 1 319 ? 8.550   30.512  1.183  1.00 76.39 ? 348  LEU A N     1 
ATOM   2555 C  CA    . LEU A 1 319 ? 7.821   31.227  0.135  1.00 76.63 ? 348  LEU A CA    1 
ATOM   2556 C  C     . LEU A 1 319 ? 8.735   32.172  -0.631 1.00 76.33 ? 348  LEU A C     1 
ATOM   2557 O  O     . LEU A 1 319 ? 8.393   33.331  -0.860 1.00 76.38 ? 348  LEU A O     1 
ATOM   2558 C  CB    . LEU A 1 319 ? 6.643   32.012  0.727  1.00 77.18 ? 348  LEU A CB    1 
ATOM   2559 C  CG    . LEU A 1 319 ? 5.381   31.233  1.116  1.00 77.37 ? 348  LEU A CG    1 
ATOM   2560 C  CD1   . LEU A 1 319 ? 5.690   30.235  2.218  1.00 77.94 ? 348  LEU A CD1   1 
ATOM   2561 C  CD2   . LEU A 1 319 ? 4.315   32.210  1.577  1.00 77.94 ? 348  LEU A CD2   1 
ATOM   2562 N  N     . LYS A 1 320 ? 9.902   31.666  -1.019 1.00 76.17 ? 349  LYS A N     1 
ATOM   2563 C  CA    . LYS A 1 320 ? 10.878  32.453  -1.761 1.00 76.24 ? 349  LYS A CA    1 
ATOM   2564 C  C     . LYS A 1 320 ? 11.981  31.558  -2.312 1.00 76.11 ? 349  LYS A C     1 
ATOM   2565 O  O     . LYS A 1 320 ? 11.878  30.328  -2.142 1.00 76.43 ? 349  LYS A O     1 
ATOM   2566 C  CB    . LYS A 1 320 ? 11.475  33.528  -0.860 1.00 76.65 ? 349  LYS A CB    1 
ATOM   2567 N  N     . ASP B 2 1   ? -3.401  19.473  25.766 1.00 76.51 ? 496  ASP B N     1 
ATOM   2568 C  CA    . ASP B 2 1   ? -3.407  20.748  26.547 1.00 77.36 ? 496  ASP B CA    1 
ATOM   2569 C  C     . ASP B 2 1   ? -2.020  21.367  26.499 1.00 76.55 ? 496  ASP B C     1 
ATOM   2570 O  O     . ASP B 2 1   ? -1.722  22.298  27.250 1.00 76.75 ? 496  ASP B O     1 
ATOM   2571 C  CB    . ASP B 2 1   ? -3.751  20.479  28.014 1.00 78.64 ? 496  ASP B CB    1 
ATOM   2572 C  CG    . ASP B 2 1   ? -4.628  19.262  28.196 1.00 80.30 ? 496  ASP B CG    1 
ATOM   2573 O  OD1   . ASP B 2 1   ? -5.765  19.266  27.679 1.00 81.75 ? 496  ASP B OD1   1 
ATOM   2574 O  OD2   . ASP B 2 1   ? -4.174  18.302  28.858 1.00 80.31 ? 496  ASP B OD2   1 
ATOM   2575 N  N     . ILE B 2 2   ? -1.178  20.843  25.613 1.00 75.16 ? 497  ILE B N     1 
ATOM   2576 C  CA    . ILE B 2 2   ? 0.203   21.298  25.488 1.00 73.68 ? 497  ILE B CA    1 
ATOM   2577 C  C     . ILE B 2 2   ? 0.925   20.777  26.722 1.00 72.47 ? 497  ILE B C     1 
ATOM   2578 O  O     . ILE B 2 2   ? 2.108   20.449  26.673 1.00 72.83 ? 497  ILE B O     1 
ATOM   2579 C  CB    . ILE B 2 2   ? 0.312   22.838  25.414 1.00 73.72 ? 497  ILE B CB    1 
ATOM   2580 C  CG1   . ILE B 2 2   ? -0.291  23.329  24.092 1.00 74.25 ? 497  ILE B CG1   1 
ATOM   2581 C  CG2   . ILE B 2 2   ? 1.771   23.266  25.533 1.00 72.74 ? 497  ILE B CG2   1 
ATOM   2582 C  CD1   . ILE B 2 2   ? -0.191  24.827  23.869 1.00 74.74 ? 497  ILE B CD1   1 
ATOM   2583 N  N     . GLU B 2 3   ? 0.194   20.698  27.830 1.00 70.72 ? 498  GLU B N     1 
ATOM   2584 C  CA    . GLU B 2 3   ? 0.736   20.172  29.072 1.00 69.21 ? 498  GLU B CA    1 
ATOM   2585 C  C     . GLU B 2 3   ? 0.648   18.664  28.888 1.00 67.14 ? 498  GLU B C     1 
ATOM   2586 O  O     . GLU B 2 3   ? 1.413   17.899  29.479 1.00 66.01 ? 498  GLU B O     1 
ATOM   2587 C  CB    . GLU B 2 3   ? -0.118  20.615  30.262 1.00 70.14 ? 498  GLU B CB    1 
ATOM   2588 C  CG    . GLU B 2 3   ? 0.305   20.023  31.602 1.00 72.31 ? 498  GLU B CG    1 
ATOM   2589 C  CD    . GLU B 2 3   ? 1.756   20.323  31.957 1.00 73.77 ? 498  GLU B CD    1 
ATOM   2590 O  OE1   . GLU B 2 3   ? 2.139   21.513  31.967 1.00 75.33 ? 498  GLU B OE1   1 
ATOM   2591 O  OE2   . GLU B 2 3   ? 2.512   19.366  32.234 1.00 73.45 ? 498  GLU B OE2   1 
ATOM   2592 N  N     . GLY B 2 4   ? -0.303  18.253  28.054 1.00 64.96 ? 499  GLY B N     1 
ATOM   2593 C  CA    . GLY B 2 4   ? -0.480  16.846  27.758 1.00 62.38 ? 499  GLY B CA    1 
ATOM   2594 C  C     . GLY B 2 4   ? 0.594   16.443  26.767 1.00 60.74 ? 499  GLY B C     1 
ATOM   2595 O  O     . GLY B 2 4   ? 1.168   15.360  26.865 1.00 61.75 ? 499  GLY B O     1 
ATOM   2596 N  N     . LEU B 2 5   ? 0.867   17.326  25.810 1.00 57.91 ? 500  LEU B N     1 
ATOM   2597 C  CA    . LEU B 2 5   ? 1.892   17.073  24.807 1.00 55.14 ? 500  LEU B CA    1 
ATOM   2598 C  C     . LEU B 2 5   ? 3.250   17.025  25.494 1.00 53.82 ? 500  LEU B C     1 
ATOM   2599 O  O     . LEU B 2 5   ? 4.073   16.155  25.213 1.00 54.39 ? 500  LEU B O     1 
ATOM   2600 C  CB    . LEU B 2 5   ? 1.894   18.180  23.751 1.00 53.93 ? 500  LEU B CB    1 
ATOM   2601 C  CG    . LEU B 2 5   ? 3.078   18.140  22.782 1.00 53.69 ? 500  LEU B CG    1 
ATOM   2602 C  CD1   . LEU B 2 5   ? 3.049   16.846  21.995 1.00 51.39 ? 500  LEU B CD1   1 
ATOM   2603 C  CD2   . LEU B 2 5   ? 3.028   19.341  21.851 1.00 53.79 ? 500  LEU B CD2   1 
ATOM   2604 N  N     . VAL B 2 6   ? 3.477   17.974  26.393 1.00 51.44 ? 501  VAL B N     1 
ATOM   2605 C  CA    . VAL B 2 6   ? 4.726   18.037  27.134 1.00 50.45 ? 501  VAL B CA    1 
ATOM   2606 C  C     . VAL B 2 6   ? 4.940   16.717  27.867 1.00 49.67 ? 501  VAL B C     1 
ATOM   2607 O  O     . VAL B 2 6   ? 6.052   16.182  27.896 1.00 48.84 ? 501  VAL B O     1 
ATOM   2608 C  CB    . VAL B 2 6   ? 4.707   19.207  28.152 1.00 50.57 ? 501  VAL B CB    1 
ATOM   2609 C  CG1   . VAL B 2 6   ? 5.856   19.066  29.154 1.00 48.96 ? 501  VAL B CG1   1 
ATOM   2610 C  CG2   . VAL B 2 6   ? 4.824   20.528  27.410 1.00 49.32 ? 501  VAL B CG2   1 
ATOM   2611 N  N     . GLU B 2 7   ? 3.868   16.192  28.452 1.00 48.64 ? 502  GLU B N     1 
ATOM   2612 C  CA    . GLU B 2 7   ? 3.947   14.931  29.175 1.00 49.31 ? 502  GLU B CA    1 
ATOM   2613 C  C     . GLU B 2 7   ? 4.342   13.834  28.192 1.00 46.53 ? 502  GLU B C     1 
ATOM   2614 O  O     . GLU B 2 7   ? 5.224   13.022  28.471 1.00 45.86 ? 502  GLU B O     1 
ATOM   2615 C  CB    . GLU B 2 7   ? 2.596   14.589  29.813 1.00 53.02 ? 502  GLU B CB    1 
ATOM   2616 C  CG    . GLU B 2 7   ? 2.643   13.393  30.762 1.00 59.37 ? 502  GLU B CG    1 
ATOM   2617 C  CD    . GLU B 2 7   ? 3.295   13.718  32.104 1.00 63.46 ? 502  GLU B CD    1 
ATOM   2618 O  OE1   . GLU B 2 7   ? 4.419   14.272  32.117 1.00 65.75 ? 502  GLU B OE1   1 
ATOM   2619 O  OE2   . GLU B 2 7   ? 2.681   13.412  33.151 1.00 66.11 ? 502  GLU B OE2   1 
ATOM   2620 N  N     . LEU B 2 8   ? 3.688   13.827  27.034 1.00 42.96 ? 503  LEU B N     1 
ATOM   2621 C  CA    . LEU B 2 8   ? 3.967   12.839  26.001 1.00 40.02 ? 503  LEU B CA    1 
ATOM   2622 C  C     . LEU B 2 8   ? 5.421   12.917  25.522 1.00 38.37 ? 503  LEU B C     1 
ATOM   2623 O  O     . LEU B 2 8   ? 6.055   11.890  25.290 1.00 38.19 ? 503  LEU B O     1 
ATOM   2624 C  CB    . LEU B 2 8   ? 3.017   13.041  24.821 1.00 38.46 ? 503  LEU B CB    1 
ATOM   2625 C  CG    . LEU B 2 8   ? 3.077   11.990  23.712 1.00 36.38 ? 503  LEU B CG    1 
ATOM   2626 C  CD1   . LEU B 2 8   ? 2.863   10.601  24.302 1.00 34.33 ? 503  LEU B CD1   1 
ATOM   2627 C  CD2   . LEU B 2 8   ? 2.019   12.296  22.676 1.00 35.40 ? 503  LEU B CD2   1 
ATOM   2628 N  N     . LEU B 2 9   ? 5.944   14.131  25.379 1.00 35.91 ? 504  LEU B N     1 
ATOM   2629 C  CA    . LEU B 2 9   ? 7.322   14.318  24.939 1.00 36.49 ? 504  LEU B CA    1 
ATOM   2630 C  C     . LEU B 2 9   ? 8.319   13.748  25.945 1.00 38.07 ? 504  LEU B C     1 
ATOM   2631 O  O     . LEU B 2 9   ? 9.255   13.035  25.570 1.00 37.05 ? 504  LEU B O     1 
ATOM   2632 C  CB    . LEU B 2 9   ? 7.614   15.804  24.712 1.00 35.33 ? 504  LEU B CB    1 
ATOM   2633 C  CG    . LEU B 2 9   ? 7.074   16.423  23.417 1.00 36.69 ? 504  LEU B CG    1 
ATOM   2634 C  CD1   . LEU B 2 9   ? 7.179   17.946  23.466 1.00 34.63 ? 504  LEU B CD1   1 
ATOM   2635 C  CD2   . LEU B 2 9   ? 7.855   15.872  22.231 1.00 35.13 ? 504  LEU B CD2   1 
ATOM   2636 N  N     . ASN B 2 10  ? 8.125   14.067  27.223 1.00 38.58 ? 505  ASN B N     1 
ATOM   2637 C  CA    . ASN B 2 10  ? 9.021   13.569  28.263 1.00 38.69 ? 505  ASN B CA    1 
ATOM   2638 C  C     . ASN B 2 10  ? 8.957   12.051  28.358 1.00 37.82 ? 505  ASN B C     1 
ATOM   2639 O  O     . ASN B 2 10  ? 9.972   11.392  28.563 1.00 37.95 ? 505  ASN B O     1 
ATOM   2640 C  CB    . ASN B 2 10  ? 8.666   14.178  29.624 1.00 39.22 ? 505  ASN B CB    1 
ATOM   2641 C  CG    . ASN B 2 10  ? 8.826   15.679  29.647 1.00 40.64 ? 505  ASN B CG    1 
ATOM   2642 O  OD1   . ASN B 2 10  ? 9.792   16.222  29.101 1.00 41.10 ? 505  ASN B OD1   1 
ATOM   2643 N  ND2   . ASN B 2 10  ? 7.887   16.363  30.290 1.00 40.71 ? 505  ASN B ND2   1 
ATOM   2644 N  N     . ARG B 2 11  ? 7.755   11.504  28.214 1.00 37.38 ? 506  ARG B N     1 
ATOM   2645 C  CA    . ARG B 2 11  ? 7.559   10.066  28.277 1.00 38.84 ? 506  ARG B CA    1 
ATOM   2646 C  C     . ARG B 2 11  ? 8.229   9.350   27.094 1.00 38.53 ? 506  ARG B C     1 
ATOM   2647 O  O     . ARG B 2 11  ? 8.935   8.359   27.284 1.00 40.11 ? 506  ARG B O     1 
ATOM   2648 C  CB    . ARG B 2 11  ? 6.062   9.754   28.288 1.00 43.05 ? 506  ARG B CB    1 
ATOM   2649 C  CG    . ARG B 2 11  ? 5.710   8.272   28.352 1.00 49.52 ? 506  ARG B CG    1 
ATOM   2650 C  CD    . ARG B 2 11  ? 4.247   8.063   27.964 1.00 55.99 ? 506  ARG B CD    1 
ATOM   2651 N  NE    . ARG B 2 11  ? 3.809   6.670   28.052 1.00 60.05 ? 506  ARG B NE    1 
ATOM   2652 C  CZ    . ARG B 2 11  ? 2.673   6.218   27.524 1.00 62.65 ? 506  ARG B CZ    1 
ATOM   2653 N  NH1   . ARG B 2 11  ? 1.872   7.053   26.871 1.00 63.50 ? 506  ARG B NH1   1 
ATOM   2654 N  NH2   . ARG B 2 11  ? 2.333   4.937   27.647 1.00 62.97 ? 506  ARG B NH2   1 
ATOM   2655 N  N     . VAL B 2 12  ? 8.018   9.857   25.880 1.00 34.79 ? 507  VAL B N     1 
ATOM   2656 C  CA    . VAL B 2 12  ? 8.583   9.240   24.679 1.00 31.71 ? 507  VAL B CA    1 
ATOM   2657 C  C     . VAL B 2 12  ? 10.088  9.448   24.494 1.00 31.31 ? 507  VAL B C     1 
ATOM   2658 O  O     . VAL B 2 12  ? 10.820  8.498   24.227 1.00 30.48 ? 507  VAL B O     1 
ATOM   2659 C  CB    . VAL B 2 12  ? 7.848   9.744   23.413 1.00 30.59 ? 507  VAL B CB    1 
ATOM   2660 C  CG1   . VAL B 2 12  ? 8.582   9.288   22.151 1.00 33.36 ? 507  VAL B CG1   1 
ATOM   2661 C  CG2   . VAL B 2 12  ? 6.429   9.225   23.410 1.00 27.96 ? 507  VAL B CG2   1 
ATOM   2662 N  N     . GLN B 2 13  ? 10.549  10.686  24.645 1.00 31.57 ? 508  GLN B N     1 
ATOM   2663 C  CA    . GLN B 2 13  ? 11.964  11.001  24.476 1.00 30.81 ? 508  GLN B CA    1 
ATOM   2664 C  C     . GLN B 2 13  ? 12.899  10.477  25.574 1.00 31.29 ? 508  GLN B C     1 
ATOM   2665 O  O     . GLN B 2 13  ? 14.122  10.507  25.413 1.00 27.45 ? 508  GLN B O     1 
ATOM   2666 C  CB    . GLN B 2 13  ? 12.151  12.514  24.335 1.00 30.51 ? 508  GLN B CB    1 
ATOM   2667 C  CG    . GLN B 2 13  ? 11.293  13.148  23.258 1.00 31.16 ? 508  GLN B CG    1 
ATOM   2668 C  CD    . GLN B 2 13  ? 12.066  14.137  22.410 1.00 32.12 ? 508  GLN B CD    1 
ATOM   2669 O  OE1   . GLN B 2 13  ? 13.030  14.747  22.870 1.00 35.56 ? 508  GLN B OE1   1 
ATOM   2670 N  NE2   . GLN B 2 13  ? 11.638  14.313  21.169 1.00 30.47 ? 508  GLN B NE2   1 
ATOM   2671 N  N     . SER B 2 14  ? 12.344  9.986   26.680 1.00 33.79 ? 509  SER B N     1 
ATOM   2672 C  CA    . SER B 2 14  ? 13.194  9.479   27.762 1.00 36.28 ? 509  SER B CA    1 
ATOM   2673 C  C     . SER B 2 14  ? 13.324  7.958   27.779 1.00 38.20 ? 509  SER B C     1 
ATOM   2674 O  O     . SER B 2 14  ? 14.143  7.412   28.518 1.00 37.92 ? 509  SER B O     1 
ATOM   2675 C  CB    . SER B 2 14  ? 12.668  9.945   29.120 1.00 37.03 ? 509  SER B CB    1 
ATOM   2676 O  OG    . SER B 2 14  ? 11.428  9.329   29.417 1.00 38.17 ? 509  SER B OG    1 
ATOM   2677 N  N     . SER B 2 15  ? 12.518  7.273   26.974 1.00 40.45 ? 510  SER B N     1 
ATOM   2678 C  CA    . SER B 2 15  ? 12.568  5.812   26.926 1.00 42.11 ? 510  SER B CA    1 
ATOM   2679 C  C     . SER B 2 15  ? 13.845  5.347   26.234 1.00 44.09 ? 510  SER B C     1 
ATOM   2680 O  O     . SER B 2 15  ? 14.555  6.148   25.630 1.00 45.10 ? 510  SER B O     1 
ATOM   2681 C  CB    . SER B 2 15  ? 11.348  5.264   26.175 1.00 42.54 ? 510  SER B CB    1 
ATOM   2682 O  OG    . SER B 2 15  ? 11.327  5.710   24.825 1.00 40.31 ? 510  SER B OG    1 
ATOM   2683 N  N     . GLY B 2 16  ? 14.140  4.054   26.330 1.00 45.74 ? 511  GLY B N     1 
ATOM   2684 C  CA    . GLY B 2 16  ? 15.325  3.530   25.677 1.00 47.20 ? 511  GLY B CA    1 
ATOM   2685 C  C     . GLY B 2 16  ? 16.346  2.856   26.571 1.00 49.01 ? 511  GLY B C     1 
ATOM   2686 O  O     . GLY B 2 16  ? 16.193  2.808   27.794 1.00 49.67 ? 511  GLY B O     1 
ATOM   2687 N  N     . ALA B 2 17  ? 17.397  2.334   25.944 1.00 48.94 ? 512  ALA B N     1 
ATOM   2688 C  CA    . ALA B 2 17  ? 18.475  1.645   26.644 1.00 48.94 ? 512  ALA B CA    1 
ATOM   2689 C  C     . ALA B 2 17  ? 19.015  2.452   27.824 1.00 49.07 ? 512  ALA B C     1 
ATOM   2690 O  O     . ALA B 2 17  ? 19.298  3.641   27.691 1.00 49.17 ? 512  ALA B O     1 
ATOM   2691 C  CB    . ALA B 2 17  ? 19.598  1.337   25.665 1.00 48.69 ? 512  ALA B CB    1 
ATOM   2692 N  N     . HIS B 2 18  ? 19.157  1.794   28.974 1.00 49.14 ? 513  HIS B N     1 
ATOM   2693 C  CA    . HIS B 2 18  ? 19.665  2.433   30.190 1.00 49.58 ? 513  HIS B CA    1 
ATOM   2694 C  C     . HIS B 2 18  ? 21.043  1.877   30.578 1.00 48.91 ? 513  HIS B C     1 
ATOM   2695 O  O     . HIS B 2 18  ? 21.399  0.756   30.200 1.00 48.31 ? 513  HIS B O     1 
ATOM   2696 C  CB    . HIS B 2 18  ? 18.689  2.203   31.348 1.00 50.88 ? 513  HIS B CB    1 
ATOM   2697 C  CG    . HIS B 2 18  ? 17.295  2.678   31.073 1.00 54.84 ? 513  HIS B CG    1 
ATOM   2698 N  ND1   . HIS B 2 18  ? 16.994  4.000   30.820 1.00 55.42 ? 513  HIS B ND1   1 
ATOM   2699 C  CD2   . HIS B 2 18  ? 16.120  2.006   31.011 1.00 54.86 ? 513  HIS B CD2   1 
ATOM   2700 C  CE1   . HIS B 2 18  ? 15.694  4.121   30.615 1.00 56.09 ? 513  HIS B CE1   1 
ATOM   2701 N  NE2   . HIS B 2 18  ? 15.141  2.926   30.725 1.00 56.60 ? 513  HIS B NE2   1 
ATOM   2702 N  N     . ASP B 2 19  ? 21.810  2.661   31.336 1.00 47.07 ? 514  ASP B N     1 
ATOM   2703 C  CA    . ASP B 2 19  ? 23.142  2.249   31.790 1.00 44.59 ? 514  ASP B CA    1 
ATOM   2704 C  C     . ASP B 2 19  ? 24.065  1.878   30.637 1.00 42.91 ? 514  ASP B C     1 
ATOM   2705 O  O     . ASP B 2 19  ? 25.010  1.099   30.810 1.00 40.76 ? 514  ASP B O     1 
ATOM   2706 C  CB    . ASP B 2 19  ? 23.036  1.047   32.736 1.00 47.94 ? 514  ASP B CB    1 
ATOM   2707 C  CG    . ASP B 2 19  ? 22.282  1.367   34.014 1.00 52.07 ? 514  ASP B CG    1 
ATOM   2708 O  OD1   . ASP B 2 19  ? 22.728  2.264   34.765 1.00 56.01 ? 514  ASP B OD1   1 
ATOM   2709 O  OD2   . ASP B 2 19  ? 21.246  0.717   34.272 1.00 53.73 ? 514  ASP B OD2   1 
ATOM   2710 N  N     . GLN B 2 20  ? 23.795  2.438   29.463 1.00 39.18 ? 515  GLN B N     1 
ATOM   2711 C  CA    . GLN B 2 20  ? 24.598  2.144   28.287 1.00 37.44 ? 515  GLN B CA    1 
ATOM   2712 C  C     . GLN B 2 20  ? 25.018  3.424   27.582 1.00 38.33 ? 515  GLN B C     1 
ATOM   2713 O  O     . GLN B 2 20  ? 25.107  3.457   26.355 1.00 36.37 ? 515  GLN B O     1 
ATOM   2714 C  CB    . GLN B 2 20  ? 23.793  1.268   27.320 1.00 34.98 ? 515  GLN B CB    1 
ATOM   2715 C  CG    . GLN B 2 20  ? 23.373  -0.084  27.895 1.00 33.03 ? 515  GLN B CG    1 
ATOM   2716 C  CD    . GLN B 2 20  ? 22.394  -0.825  26.997 1.00 31.09 ? 515  GLN B CD    1 
ATOM   2717 O  OE1   . GLN B 2 20  ? 22.653  -1.028  25.809 1.00 31.92 ? 515  GLN B OE1   1 
ATOM   2718 N  NE2   . GLN B 2 20  ? 21.264  -1.234  27.562 1.00 27.66 ? 515  GLN B NE2   1 
ATOM   2719 N  N     . ARG B 2 21  ? 25.302  4.475   28.341 1.00 39.74 ? 516  ARG B N     1 
ATOM   2720 C  CA    . ARG B 2 21  ? 25.660  5.719   27.686 1.00 43.14 ? 516  ARG B CA    1 
ATOM   2721 C  C     . ARG B 2 21  ? 26.905  6.491   28.128 1.00 44.84 ? 516  ARG B C     1 
ATOM   2722 O  O     . ARG B 2 21  ? 27.630  7.011   27.287 1.00 46.12 ? 516  ARG B O     1 
ATOM   2723 C  CB    . ARG B 2 21  ? 24.445  6.646   27.704 1.00 43.79 ? 516  ARG B CB    1 
ATOM   2724 C  CG    . ARG B 2 21  ? 24.506  7.767   26.687 1.00 46.13 ? 516  ARG B CG    1 
ATOM   2725 C  CD    . ARG B 2 21  ? 23.171  8.497   26.589 1.00 46.35 ? 516  ARG B CD    1 
ATOM   2726 N  NE    . ARG B 2 21  ? 22.219  7.845   25.690 1.00 43.56 ? 516  ARG B NE    1 
ATOM   2727 C  CZ    . ARG B 2 21  ? 22.309  7.860   24.362 1.00 45.05 ? 516  ARG B CZ    1 
ATOM   2728 N  NH1   . ARG B 2 21  ? 23.315  8.491   23.765 1.00 43.79 ? 516  ARG B NH1   1 
ATOM   2729 N  NH2   . ARG B 2 21  ? 21.376  7.268   23.626 1.00 43.92 ? 516  ARG B NH2   1 
ATOM   2730 N  N     . GLY B 2 22  ? 27.184  6.582   29.418 1.00 44.49 ? 517  GLY B N     1 
ATOM   2731 C  CA    . GLY B 2 22  ? 28.354  7.361   29.791 1.00 47.07 ? 517  GLY B CA    1 
ATOM   2732 C  C     . GLY B 2 22  ? 29.617  6.565   30.023 1.00 48.32 ? 517  GLY B C     1 
ATOM   2733 O  O     . GLY B 2 22  ? 29.809  5.490   29.450 1.00 47.72 ? 517  GLY B O     1 
ATOM   2734 N  N     . LEU B 2 23  ? 30.502  7.114   30.848 1.00 49.45 ? 518  LEU B N     1 
ATOM   2735 C  CA    . LEU B 2 23  ? 31.730  6.418   31.189 1.00 50.58 ? 518  LEU B CA    1 
ATOM   2736 C  C     . LEU B 2 23  ? 31.287  5.379   32.199 1.00 52.06 ? 518  LEU B C     1 
ATOM   2737 O  O     . LEU B 2 23  ? 30.230  5.520   32.816 1.00 51.13 ? 518  LEU B O     1 
ATOM   2738 C  CB    . LEU B 2 23  ? 32.742  7.372   31.821 1.00 50.63 ? 518  LEU B CB    1 
ATOM   2739 C  CG    . LEU B 2 23  ? 33.433  8.349   30.871 1.00 50.02 ? 518  LEU B CG    1 
ATOM   2740 C  CD1   . LEU B 2 23  ? 34.246  9.350   31.674 1.00 50.18 ? 518  LEU B CD1   1 
ATOM   2741 C  CD2   . LEU B 2 23  ? 34.319  7.579   29.899 1.00 48.28 ? 518  LEU B CD2   1 
ATOM   2742 N  N     . LEU B 2 24  ? 32.085  4.336   32.366 1.00 55.06 ? 519  LEU B N     1 
ATOM   2743 C  CA    . LEU B 2 24  ? 31.744  3.275   33.295 1.00 58.41 ? 519  LEU B CA    1 
ATOM   2744 C  C     . LEU B 2 24  ? 31.515  3.831   34.700 1.00 60.99 ? 519  LEU B C     1 
ATOM   2745 O  O     . LEU B 2 24  ? 32.266  4.685   35.168 1.00 61.75 ? 519  LEU B O     1 
ATOM   2746 C  CB    . LEU B 2 24  ? 32.862  2.235   33.307 1.00 58.49 ? 519  LEU B CB    1 
ATOM   2747 C  CG    . LEU B 2 24  ? 32.432  0.786   33.532 1.00 59.62 ? 519  LEU B CG    1 
ATOM   2748 C  CD1   . LEU B 2 24  ? 31.389  0.387   32.490 1.00 59.32 ? 519  LEU B CD1   1 
ATOM   2749 C  CD2   . LEU B 2 24  ? 33.651  -0.115  33.446 1.00 59.48 ? 519  LEU B CD2   1 
ATOM   2750 N  N     . ARG B 2 25  ? 30.465  3.357   35.364 1.00 64.39 ? 520  ARG B N     1 
ATOM   2751 C  CA    . ARG B 2 25  ? 30.161  3.809   36.716 1.00 68.49 ? 520  ARG B CA    1 
ATOM   2752 C  C     . ARG B 2 25  ? 29.867  2.626   37.637 1.00 69.90 ? 520  ARG B C     1 
ATOM   2753 O  O     . ARG B 2 25  ? 29.329  1.610   37.198 1.00 69.86 ? 520  ARG B O     1 
ATOM   2754 C  CB    . ARG B 2 25  ? 28.975  4.778   36.705 1.00 70.63 ? 520  ARG B CB    1 
ATOM   2755 C  CG    . ARG B 2 25  ? 28.809  5.518   38.020 1.00 74.46 ? 520  ARG B CG    1 
ATOM   2756 C  CD    . ARG B 2 25  ? 30.138  6.145   38.439 1.00 77.33 ? 520  ARG B CD    1 
ATOM   2757 N  NE    . ARG B 2 25  ? 30.153  6.565   39.837 1.00 79.12 ? 520  ARG B NE    1 
ATOM   2758 C  CZ    . ARG B 2 25  ? 31.257  6.883   40.507 1.00 80.08 ? 520  ARG B CZ    1 
ATOM   2759 N  NH1   . ARG B 2 25  ? 32.438  6.828   39.904 1.00 80.29 ? 520  ARG B NH1   1 
ATOM   2760 N  NH2   . ARG B 2 25  ? 31.182  7.251   41.780 1.00 80.39 ? 520  ARG B NH2   1 
ATOM   2761 N  N     . LYS B 2 26  ? 30.221  2.766   38.913 1.00 71.65 ? 521  LYS B N     1 
ATOM   2762 C  CA    . LYS B 2 26  ? 30.027  1.702   39.899 1.00 72.96 ? 521  LYS B CA    1 
ATOM   2763 C  C     . LYS B 2 26  ? 28.629  1.094   39.871 1.00 73.32 ? 521  LYS B C     1 
ATOM   2764 O  O     . LYS B 2 26  ? 28.429  -0.046  40.287 1.00 73.26 ? 521  LYS B O     1 
ATOM   2765 C  CB    . LYS B 2 26  ? 30.324  2.222   41.311 1.00 73.87 ? 521  LYS B CB    1 
ATOM   2766 C  CG    . LYS B 2 26  ? 29.209  3.055   41.938 1.00 76.00 ? 521  LYS B CG    1 
ATOM   2767 C  CD    . LYS B 2 26  ? 28.906  4.306   41.129 1.00 77.07 ? 521  LYS B CD    1 
ATOM   2768 C  CE    . LYS B 2 26  ? 27.844  5.169   41.801 1.00 77.72 ? 521  LYS B CE    1 
ATOM   2769 N  NZ    . LYS B 2 26  ? 28.250  5.623   43.161 1.00 77.90 ? 521  LYS B NZ    1 
ATOM   2770 N  N     . GLU B 2 27  ? 27.665  1.859   39.379 1.00 74.48 ? 522  GLU B N     1 
ATOM   2771 C  CA    . GLU B 2 27  ? 26.289  1.393   39.305 1.00 76.02 ? 522  GLU B CA    1 
ATOM   2772 C  C     . GLU B 2 27  ? 26.082  0.389   38.174 1.00 75.91 ? 522  GLU B C     1 
ATOM   2773 O  O     . GLU B 2 27  ? 25.279  -0.537  38.297 1.00 76.78 ? 522  GLU B O     1 
ATOM   2774 C  CB    . GLU B 2 27  ? 25.359  2.587   39.119 1.00 78.53 ? 522  GLU B CB    1 
ATOM   2775 C  CG    . GLU B 2 27  ? 25.507  3.627   40.210 1.00 81.36 ? 522  GLU B CG    1 
ATOM   2776 C  CD    . GLU B 2 27  ? 24.729  4.891   39.922 1.00 83.82 ? 522  GLU B CD    1 
ATOM   2777 O  OE1   . GLU B 2 27  ? 23.485  4.815   39.815 1.00 84.25 ? 522  GLU B OE1   1 
ATOM   2778 O  OE2   . GLU B 2 27  ? 25.366  5.962   39.804 1.00 85.24 ? 522  GLU B OE2   1 
ATOM   2779 N  N     . ASP B 2 28  ? 26.806  0.570   37.074 1.00 74.67 ? 523  ASP B N     1 
ATOM   2780 C  CA    . ASP B 2 28  ? 26.685  -0.335  35.937 1.00 73.48 ? 523  ASP B CA    1 
ATOM   2781 C  C     . ASP B 2 28  ? 27.508  -1.596  36.166 1.00 72.11 ? 523  ASP B C     1 
ATOM   2782 O  O     . ASP B 2 28  ? 27.444  -2.535  35.374 1.00 72.01 ? 523  ASP B O     1 
ATOM   2783 C  CB    . ASP B 2 28  ? 27.178  0.335   34.648 1.00 74.83 ? 523  ASP B CB    1 
ATOM   2784 C  CG    . ASP B 2 28  ? 26.640  1.742   34.469 1.00 75.87 ? 523  ASP B CG    1 
ATOM   2785 O  OD1   . ASP B 2 28  ? 25.430  1.957   34.700 1.00 76.15 ? 523  ASP B OD1   1 
ATOM   2786 O  OD2   . ASP B 2 28  ? 27.431  2.630   34.083 1.00 76.23 ? 523  ASP B OD2   1 
ATOM   2787 N  N     . LEU B 2 29  ? 28.275  -1.619  37.252 1.00 70.10 ? 524  LEU B N     1 
ATOM   2788 C  CA    . LEU B 2 29  ? 29.133  -2.760  37.547 1.00 67.99 ? 524  LEU B CA    1 
ATOM   2789 C  C     . LEU B 2 29  ? 28.578  -3.770  38.539 1.00 66.80 ? 524  LEU B C     1 
ATOM   2790 O  O     . LEU B 2 29  ? 29.219  -4.783  38.812 1.00 66.42 ? 524  LEU B O     1 
ATOM   2791 C  CB    . LEU B 2 29  ? 30.493  -2.265  38.034 1.00 67.77 ? 524  LEU B CB    1 
ATOM   2792 C  CG    . LEU B 2 29  ? 31.217  -1.340  37.055 1.00 68.20 ? 524  LEU B CG    1 
ATOM   2793 C  CD1   . LEU B 2 29  ? 32.517  -0.866  37.674 1.00 68.43 ? 524  LEU B CD1   1 
ATOM   2794 C  CD2   . LEU B 2 29  ? 31.476  -2.070  35.747 1.00 68.05 ? 524  LEU B CD2   1 
ATOM   2795 N  N     . VAL B 2 30  ? 27.395  -3.502  39.082 1.00 66.04 ? 525  VAL B N     1 
ATOM   2796 C  CA    . VAL B 2 30  ? 26.787  -4.431  40.029 1.00 65.38 ? 525  VAL B CA    1 
ATOM   2797 C  C     . VAL B 2 30  ? 26.741  -5.803  39.361 1.00 64.91 ? 525  VAL B C     1 
ATOM   2798 O  O     . VAL B 2 30  ? 26.518  -5.900  38.157 1.00 65.29 ? 525  VAL B O     1 
ATOM   2799 C  CB    . VAL B 2 30  ? 25.358  -3.997  40.393 1.00 65.74 ? 525  VAL B CB    1 
ATOM   2800 C  CG1   . VAL B 2 30  ? 24.805  -4.895  41.486 1.00 65.32 ? 525  VAL B CG1   1 
ATOM   2801 C  CG2   . VAL B 2 30  ? 25.358  -2.548  40.840 1.00 66.28 ? 525  VAL B CG2   1 
ATOM   2802 N  N     . LEU B 2 31  ? 26.959  -6.862  40.132 1.00 64.08 ? 526  LEU B N     1 
ATOM   2803 C  CA    . LEU B 2 31  ? 26.956  -8.210  39.571 1.00 63.38 ? 526  LEU B CA    1 
ATOM   2804 C  C     . LEU B 2 31  ? 25.560  -8.821  39.495 1.00 62.96 ? 526  LEU B C     1 
ATOM   2805 O  O     . LEU B 2 31  ? 24.874  -8.942  40.506 1.00 63.52 ? 526  LEU B O     1 
ATOM   2806 C  CB    . LEU B 2 31  ? 27.862  -9.123  40.398 1.00 62.83 ? 526  LEU B CB    1 
ATOM   2807 C  CG    . LEU B 2 31  ? 28.030  -10.559 39.897 1.00 63.03 ? 526  LEU B CG    1 
ATOM   2808 C  CD1   . LEU B 2 31  ? 28.794  -10.560 38.586 1.00 62.62 ? 526  LEU B CD1   1 
ATOM   2809 C  CD2   . LEU B 2 31  ? 28.776  -11.378 40.940 1.00 64.02 ? 526  LEU B CD2   1 
ATOM   2810 N  N     . PRO B 2 32  ? 25.121  -9.222  38.289 1.00 62.79 ? 527  PRO B N     1 
ATOM   2811 C  CA    . PRO B 2 32  ? 23.788  -9.818  38.166 1.00 61.74 ? 527  PRO B CA    1 
ATOM   2812 C  C     . PRO B 2 32  ? 23.637  -10.988 39.131 1.00 61.50 ? 527  PRO B C     1 
ATOM   2813 O  O     . PRO B 2 32  ? 24.540  -11.816 39.270 1.00 60.49 ? 527  PRO B O     1 
ATOM   2814 C  CB    . PRO B 2 32  ? 23.730  -10.241 36.699 1.00 61.63 ? 527  PRO B CB    1 
ATOM   2815 C  CG    . PRO B 2 32  ? 25.159  -10.474 36.347 1.00 61.87 ? 527  PRO B CG    1 
ATOM   2816 C  CD    . PRO B 2 32  ? 25.855  -9.319  37.018 1.00 62.06 ? 527  PRO B CD    1 
ATOM   2817 N  N     . GLU B 2 33  ? 22.487  -11.044 39.795 1.00 61.95 ? 528  GLU B N     1 
ATOM   2818 C  CA    . GLU B 2 33  ? 22.203  -12.080 40.780 1.00 61.57 ? 528  GLU B CA    1 
ATOM   2819 C  C     . GLU B 2 33  ? 22.511  -13.509 40.347 1.00 60.32 ? 528  GLU B C     1 
ATOM   2820 O  O     . GLU B 2 33  ? 23.093  -14.272 41.117 1.00 60.45 ? 528  GLU B O     1 
ATOM   2821 C  CB    . GLU B 2 33  ? 20.739  -11.993 41.224 1.00 63.84 ? 528  GLU B CB    1 
ATOM   2822 C  CG    . GLU B 2 33  ? 20.416  -12.833 42.455 1.00 67.63 ? 528  GLU B CG    1 
ATOM   2823 C  CD    . GLU B 2 33  ? 18.946  -12.776 42.838 1.00 70.77 ? 528  GLU B CD    1 
ATOM   2824 O  OE1   . GLU B 2 33  ? 18.109  -13.284 42.059 1.00 72.45 ? 528  GLU B OE1   1 
ATOM   2825 O  OE2   . GLU B 2 33  ? 18.626  -12.221 43.914 1.00 71.52 ? 528  GLU B OE2   1 
ATOM   2826 N  N     . PHE B 2 34  ? 22.133  -13.880 39.127 1.00 58.67 ? 529  PHE B N     1 
ATOM   2827 C  CA    . PHE B 2 34  ? 22.370  -15.244 38.662 1.00 58.16 ? 529  PHE B CA    1 
ATOM   2828 C  C     . PHE B 2 34  ? 23.851  -15.623 38.593 1.00 59.97 ? 529  PHE B C     1 
ATOM   2829 O  O     . PHE B 2 34  ? 24.189  -16.784 38.363 1.00 59.94 ? 529  PHE B O     1 
ATOM   2830 C  CB    . PHE B 2 34  ? 21.717  -15.472 37.293 1.00 55.25 ? 529  PHE B CB    1 
ATOM   2831 C  CG    . PHE B 2 34  ? 22.533  -14.973 36.129 1.00 53.28 ? 529  PHE B CG    1 
ATOM   2832 C  CD1   . PHE B 2 34  ? 22.741  -13.612 35.933 1.00 52.28 ? 529  PHE B CD1   1 
ATOM   2833 C  CD2   . PHE B 2 34  ? 23.083  -15.872 35.219 1.00 51.89 ? 529  PHE B CD2   1 
ATOM   2834 C  CE1   . PHE B 2 34  ? 23.480  -13.153 34.845 1.00 51.73 ? 529  PHE B CE1   1 
ATOM   2835 C  CE2   . PHE B 2 34  ? 23.826  -15.424 34.126 1.00 52.41 ? 529  PHE B CE2   1 
ATOM   2836 C  CZ    . PHE B 2 34  ? 24.024  -14.062 33.939 1.00 52.08 ? 529  PHE B CZ    1 
ATOM   2837 N  N     . LEU B 2 35  ? 24.734  -14.651 38.797 1.00 61.22 ? 530  LEU B N     1 
ATOM   2838 C  CA    . LEU B 2 35  ? 26.165  -14.924 38.748 1.00 63.03 ? 530  LEU B CA    1 
ATOM   2839 C  C     . LEU B 2 35  ? 26.800  -14.968 40.133 1.00 65.30 ? 530  LEU B C     1 
ATOM   2840 O  O     . LEU B 2 35  ? 28.001  -15.209 40.268 1.00 65.36 ? 530  LEU B O     1 
ATOM   2841 C  CB    . LEU B 2 35  ? 26.878  -13.880 37.882 1.00 61.31 ? 530  LEU B CB    1 
ATOM   2842 C  CG    . LEU B 2 35  ? 26.650  -13.988 36.371 1.00 59.85 ? 530  LEU B CG    1 
ATOM   2843 C  CD1   . LEU B 2 35  ? 27.357  -12.844 35.665 1.00 58.92 ? 530  LEU B CD1   1 
ATOM   2844 C  CD2   . LEU B 2 35  ? 27.168  -15.327 35.870 1.00 57.99 ? 530  LEU B CD2   1 
ATOM   2845 N  N     . GLN B 2 36  ? 25.992  -14.732 41.161 1.00 67.76 ? 531  GLN B N     1 
ATOM   2846 C  CA    . GLN B 2 36  ? 26.483  -14.759 42.533 1.00 69.95 ? 531  GLN B CA    1 
ATOM   2847 C  C     . GLN B 2 36  ? 26.556  -16.207 43.012 1.00 70.54 ? 531  GLN B C     1 
ATOM   2848 O  O     . GLN B 2 36  ? 27.658  -16.654 43.396 1.00 70.65 ? 531  GLN B O     1 
ATOM   2849 C  CB    . GLN B 2 36  ? 25.550  -13.963 43.448 1.00 70.92 ? 531  GLN B CB    1 
ATOM   2850 C  CG    . GLN B 2 36  ? 25.293  -12.540 42.988 1.00 72.56 ? 531  GLN B CG    1 
ATOM   2851 C  CD    . GLN B 2 36  ? 24.421  -11.766 43.959 1.00 74.06 ? 531  GLN B CD    1 
ATOM   2852 O  OE1   . GLN B 2 36  ? 23.331  -12.212 44.327 1.00 74.03 ? 531  GLN B OE1   1 
ATOM   2853 N  NE2   . GLN B 2 36  ? 24.894  -10.597 44.377 1.00 74.91 ? 531  GLN B NE2   1 
ATOM   2854 O  OXT   . GLN B 2 36  ? 25.503  -16.879 42.991 1.00 71.41 ? 531  GLN B OXT   1 
ATOM   2855 N  N     . GLY C 1 1   ? 38.935  59.703  55.114 1.00 73.63 ? 1030 GLY C N     1 
ATOM   2856 C  CA    . GLY C 1 1   ? 38.376  59.618  56.495 1.00 73.81 ? 1030 GLY C CA    1 
ATOM   2857 C  C     . GLY C 1 1   ? 37.239  58.614  56.603 1.00 73.40 ? 1030 GLY C C     1 
ATOM   2858 O  O     . GLY C 1 1   ? 36.582  58.306  55.605 1.00 73.79 ? 1030 GLY C O     1 
ATOM   2859 N  N     . ALA C 1 2   ? 37.012  58.101  57.813 1.00 72.09 ? 1031 ALA C N     1 
ATOM   2860 C  CA    . ALA C 1 2   ? 35.946  57.130  58.060 1.00 70.28 ? 1031 ALA C CA    1 
ATOM   2861 C  C     . ALA C 1 2   ? 34.590  57.753  57.740 1.00 68.98 ? 1031 ALA C C     1 
ATOM   2862 O  O     . ALA C 1 2   ? 33.677  57.078  57.261 1.00 69.54 ? 1031 ALA C O     1 
ATOM   2863 C  CB    . ALA C 1 2   ? 35.976  56.677  59.514 1.00 70.91 ? 1031 ALA C CB    1 
ATOM   2864 N  N     . ARG C 1 3   ? 34.477  59.051  58.001 1.00 66.09 ? 1032 ARG C N     1 
ATOM   2865 C  CA    . ARG C 1 3   ? 33.254  59.807  57.758 1.00 62.98 ? 1032 ARG C CA    1 
ATOM   2866 C  C     . ARG C 1 3   ? 32.113  59.284  58.626 1.00 60.61 ? 1032 ARG C C     1 
ATOM   2867 O  O     . ARG C 1 3   ? 31.492  58.262  58.327 1.00 58.88 ? 1032 ARG C O     1 
ATOM   2868 C  CB    . ARG C 1 3   ? 32.859  59.740  56.278 1.00 64.70 ? 1032 ARG C CB    1 
ATOM   2869 C  CG    . ARG C 1 3   ? 32.169  61.001  55.756 1.00 65.93 ? 1032 ARG C CG    1 
ATOM   2870 C  CD    . ARG C 1 3   ? 31.105  61.507  56.715 1.00 67.49 ? 1032 ARG C CD    1 
ATOM   2871 N  NE    . ARG C 1 3   ? 30.353  62.637  56.177 1.00 68.81 ? 1032 ARG C NE    1 
ATOM   2872 C  CZ    . ARG C 1 3   ? 29.470  62.547  55.186 1.00 69.49 ? 1032 ARG C CZ    1 
ATOM   2873 N  NH1   . ARG C 1 3   ? 29.225  61.376  54.623 1.00 70.35 ? 1032 ARG C NH1   1 
ATOM   2874 N  NH2   . ARG C 1 3   ? 28.832  63.627  54.758 1.00 68.43 ? 1032 ARG C NH2   1 
ATOM   2875 N  N     . GLU C 1 4   ? 31.857  59.998  59.713 1.00 57.06 ? 1033 GLU C N     1 
ATOM   2876 C  CA    . GLU C 1 4   ? 30.805  59.636  60.645 1.00 54.21 ? 1033 GLU C CA    1 
ATOM   2877 C  C     . GLU C 1 4   ? 29.606  60.536  60.369 1.00 51.17 ? 1033 GLU C C     1 
ATOM   2878 O  O     . GLU C 1 4   ? 29.771  61.686  59.967 1.00 49.70 ? 1033 GLU C O     1 
ATOM   2879 C  CB    . GLU C 1 4   ? 31.315  59.826  62.071 1.00 55.87 ? 1033 GLU C CB    1 
ATOM   2880 C  CG    . GLU C 1 4   ? 30.449  59.225  63.148 1.00 59.32 ? 1033 GLU C CG    1 
ATOM   2881 C  CD    . GLU C 1 4   ? 31.194  59.084  64.463 1.00 60.96 ? 1033 GLU C CD    1 
ATOM   2882 O  OE1   . GLU C 1 4   ? 31.624  60.112  65.024 1.00 62.08 ? 1033 GLU C OE1   1 
ATOM   2883 O  OE2   . GLU C 1 4   ? 31.354  57.938  64.931 1.00 62.78 ? 1033 GLU C OE2   1 
ATOM   2884 N  N     . VAL C 1 5   ? 28.401  60.006  60.564 1.00 48.00 ? 1034 VAL C N     1 
ATOM   2885 C  CA    . VAL C 1 5   ? 27.182  60.778  60.328 1.00 44.20 ? 1034 VAL C CA    1 
ATOM   2886 C  C     . VAL C 1 5   ? 26.271  60.785  61.552 1.00 40.50 ? 1034 VAL C C     1 
ATOM   2887 O  O     . VAL C 1 5   ? 25.819  59.736  62.010 1.00 38.95 ? 1034 VAL C O     1 
ATOM   2888 C  CB    . VAL C 1 5   ? 26.385  60.216  59.130 1.00 44.15 ? 1034 VAL C CB    1 
ATOM   2889 C  CG1   . VAL C 1 5   ? 25.102  61.009  58.941 1.00 44.48 ? 1034 VAL C CG1   1 
ATOM   2890 C  CG2   . VAL C 1 5   ? 27.228  60.276  57.872 1.00 45.33 ? 1034 VAL C CG2   1 
ATOM   2891 N  N     . LYS C 1 6   ? 26.006  61.976  62.076 1.00 37.65 ? 1035 LYS C N     1 
ATOM   2892 C  CA    . LYS C 1 6   ? 25.146  62.122  63.245 1.00 36.00 ? 1035 LYS C CA    1 
ATOM   2893 C  C     . LYS C 1 6   ? 23.702  62.398  62.798 1.00 33.23 ? 1035 LYS C C     1 
ATOM   2894 O  O     . LYS C 1 6   ? 23.418  63.414  62.162 1.00 30.84 ? 1035 LYS C O     1 
ATOM   2895 C  CB    . LYS C 1 6   ? 25.666  63.264  64.135 1.00 35.27 ? 1035 LYS C CB    1 
ATOM   2896 C  CG    . LYS C 1 6   ? 24.973  63.400  65.490 1.00 34.24 ? 1035 LYS C CG    1 
ATOM   2897 C  CD    . LYS C 1 6   ? 25.622  64.499  66.352 1.00 33.12 ? 1035 LYS C CD    1 
ATOM   2898 C  CE    . LYS C 1 6   ? 24.894  64.650  67.694 1.00 33.96 ? 1035 LYS C CE    1 
ATOM   2899 N  NZ    . LYS C 1 6   ? 25.408  65.770  68.539 1.00 31.29 ? 1035 LYS C NZ    1 
ATOM   2900 N  N     . LEU C 1 7   ? 22.803  61.475  63.126 1.00 31.82 ? 1036 LEU C N     1 
ATOM   2901 C  CA    . LEU C 1 7   ? 21.385  61.599  62.782 1.00 32.17 ? 1036 LEU C CA    1 
ATOM   2902 C  C     . LEU C 1 7   ? 20.528  61.734  64.047 1.00 30.86 ? 1036 LEU C C     1 
ATOM   2903 O  O     . LEU C 1 7   ? 20.557  60.869  64.929 1.00 29.95 ? 1036 LEU C O     1 
ATOM   2904 C  CB    . LEU C 1 7   ? 20.931  60.364  61.984 1.00 31.42 ? 1036 LEU C CB    1 
ATOM   2905 C  CG    . LEU C 1 7   ? 20.714  60.429  60.460 1.00 32.23 ? 1036 LEU C CG    1 
ATOM   2906 C  CD1   . LEU C 1 7   ? 21.603  61.464  59.806 1.00 29.71 ? 1036 LEU C CD1   1 
ATOM   2907 C  CD2   . LEU C 1 7   ? 20.956  59.051  59.875 1.00 28.00 ? 1036 LEU C CD2   1 
ATOM   2908 N  N     . LEU C 1 8   ? 19.767  62.819  64.142 1.00 28.94 ? 1037 LEU C N     1 
ATOM   2909 C  CA    . LEU C 1 8   ? 18.900  63.012  65.300 1.00 27.33 ? 1037 LEU C CA    1 
ATOM   2910 C  C     . LEU C 1 8   ? 17.419  62.914  64.922 1.00 25.34 ? 1037 LEU C C     1 
ATOM   2911 O  O     . LEU C 1 8   ? 16.924  63.700  64.122 1.00 24.04 ? 1037 LEU C O     1 
ATOM   2912 C  CB    . LEU C 1 8   ? 19.164  64.371  65.951 1.00 25.94 ? 1037 LEU C CB    1 
ATOM   2913 C  CG    . LEU C 1 8   ? 18.154  64.785  67.033 1.00 25.58 ? 1037 LEU C CG    1 
ATOM   2914 C  CD1   . LEU C 1 8   ? 18.176  63.810  68.189 1.00 24.10 ? 1037 LEU C CD1   1 
ATOM   2915 C  CD2   . LEU C 1 8   ? 18.482  66.162  67.519 1.00 25.83 ? 1037 LEU C CD2   1 
ATOM   2916 N  N     . LEU C 1 9   ? 16.729  61.933  65.491 1.00 24.76 ? 1038 LEU C N     1 
ATOM   2917 C  CA    . LEU C 1 9   ? 15.299  61.741  65.251 1.00 25.66 ? 1038 LEU C CA    1 
ATOM   2918 C  C     . LEU C 1 9   ? 14.522  62.612  66.224 1.00 27.50 ? 1038 LEU C C     1 
ATOM   2919 O  O     . LEU C 1 9   ? 14.848  62.657  67.410 1.00 31.04 ? 1038 LEU C O     1 
ATOM   2920 C  CB    . LEU C 1 9   ? 14.904  60.284  65.486 1.00 25.81 ? 1038 LEU C CB    1 
ATOM   2921 C  CG    . LEU C 1 9   ? 15.002  59.235  64.376 1.00 28.56 ? 1038 LEU C CG    1 
ATOM   2922 C  CD1   . LEU C 1 9   ? 16.062  59.599  63.357 1.00 30.78 ? 1038 LEU C CD1   1 
ATOM   2923 C  CD2   . LEU C 1 9   ? 15.300  57.887  65.015 1.00 29.85 ? 1038 LEU C CD2   1 
ATOM   2924 N  N     . LEU C 1 10  ? 13.512  63.314  65.722 1.00 25.67 ? 1039 LEU C N     1 
ATOM   2925 C  CA    . LEU C 1 10  ? 12.660  64.161  66.550 1.00 25.78 ? 1039 LEU C CA    1 
ATOM   2926 C  C     . LEU C 1 10  ? 11.223  63.940  66.092 1.00 26.30 ? 1039 LEU C C     1 
ATOM   2927 O  O     . LEU C 1 10  ? 10.992  63.361  65.031 1.00 24.83 ? 1039 LEU C O     1 
ATOM   2928 C  CB    . LEU C 1 10  ? 13.025  65.643  66.394 1.00 25.95 ? 1039 LEU C CB    1 
ATOM   2929 C  CG    . LEU C 1 10  ? 14.381  66.120  66.923 1.00 29.41 ? 1039 LEU C CG    1 
ATOM   2930 C  CD1   . LEU C 1 10  ? 14.578  67.588  66.583 1.00 26.98 ? 1039 LEU C CD1   1 
ATOM   2931 C  CD2   . LEU C 1 10  ? 14.447  65.903  68.432 1.00 28.38 ? 1039 LEU C CD2   1 
ATOM   2932 N  N     . GLY C 1 11  ? 10.261  64.391  66.893 1.00 25.33 ? 1040 GLY C N     1 
ATOM   2933 C  CA    . GLY C 1 11  ? 8.865   64.224  66.529 1.00 24.23 ? 1040 GLY C CA    1 
ATOM   2934 C  C     . GLY C 1 11  ? 8.001   63.830  67.711 1.00 26.84 ? 1040 GLY C C     1 
ATOM   2935 O  O     . GLY C 1 11  ? 8.498   63.286  68.705 1.00 24.30 ? 1040 GLY C O     1 
ATOM   2936 N  N     . ALA C 1 12  ? 6.702   64.098  67.605 1.00 26.49 ? 1041 ALA C N     1 
ATOM   2937 C  CA    . ALA C 1 12  ? 5.766   63.769  68.673 1.00 26.36 ? 1041 ALA C CA    1 
ATOM   2938 C  C     . ALA C 1 12  ? 5.770   62.283  68.981 1.00 27.05 ? 1041 ALA C C     1 
ATOM   2939 O  O     . ALA C 1 12  ? 6.216   61.464  68.168 1.00 26.87 ? 1041 ALA C O     1 
ATOM   2940 C  CB    . ALA C 1 12  ? 4.363   64.204  68.288 1.00 26.91 ? 1041 ALA C CB    1 
ATOM   2941 N  N     . GLY C 1 13  ? 5.271   61.935  70.163 1.00 25.64 ? 1042 GLY C N     1 
ATOM   2942 C  CA    . GLY C 1 13  ? 5.202   60.537  70.540 1.00 22.68 ? 1042 GLY C CA    1 
ATOM   2943 C  C     . GLY C 1 13  ? 4.310   59.803  69.555 1.00 21.50 ? 1042 GLY C C     1 
ATOM   2944 O  O     . GLY C 1 13  ? 3.393   60.396  68.998 1.00 23.44 ? 1042 GLY C O     1 
ATOM   2945 N  N     . GLU C 1 14  ? 4.577   58.518  69.345 1.00 19.30 ? 1043 GLU C N     1 
ATOM   2946 C  CA    . GLU C 1 14  ? 3.820   57.684  68.418 1.00 21.45 ? 1043 GLU C CA    1 
ATOM   2947 C  C     . GLU C 1 14  ? 4.071   58.024  66.940 1.00 21.41 ? 1043 GLU C C     1 
ATOM   2948 O  O     . GLU C 1 14  ? 3.474   57.408  66.055 1.00 22.00 ? 1043 GLU C O     1 
ATOM   2949 C  CB    . GLU C 1 14  ? 2.316   57.785  68.714 1.00 19.04 ? 1043 GLU C CB    1 
ATOM   2950 C  CG    . GLU C 1 14  ? 1.960   57.604  70.195 1.00 23.23 ? 1043 GLU C CG    1 
ATOM   2951 C  CD    . GLU C 1 14  ? 2.311   56.225  70.732 1.00 24.48 ? 1043 GLU C CD    1 
ATOM   2952 O  OE1   . GLU C 1 14  ? 2.545   56.104  71.949 1.00 29.60 ? 1043 GLU C OE1   1 
ATOM   2953 O  OE2   . GLU C 1 14  ? 2.341   55.257  69.948 1.00 25.85 ? 1043 GLU C OE2   1 
ATOM   2954 N  N     . SER C 1 15  ? 4.959   58.978  66.668 1.00 20.49 ? 1044 SER C N     1 
ATOM   2955 C  CA    . SER C 1 15  ? 5.225   59.374  65.280 1.00 21.37 ? 1044 SER C CA    1 
ATOM   2956 C  C     . SER C 1 15  ? 5.998   58.336  64.470 1.00 20.58 ? 1044 SER C C     1 
ATOM   2957 O  O     . SER C 1 15  ? 5.983   58.368  63.236 1.00 18.77 ? 1044 SER C O     1 
ATOM   2958 C  CB    . SER C 1 15  ? 5.958   60.719  65.228 1.00 18.62 ? 1044 SER C CB    1 
ATOM   2959 O  OG    . SER C 1 15  ? 7.257   60.627  65.775 1.00 20.76 ? 1044 SER C OG    1 
ATOM   2960 N  N     . GLY C 1 16  ? 6.658   57.412  65.159 1.00 17.85 ? 1045 GLY C N     1 
ATOM   2961 C  CA    . GLY C 1 16  ? 7.414   56.381  64.471 1.00 20.00 ? 1045 GLY C CA    1 
ATOM   2962 C  C     . GLY C 1 16  ? 8.907   56.367  64.766 1.00 21.27 ? 1045 GLY C C     1 
ATOM   2963 O  O     . GLY C 1 16  ? 9.640   55.589  64.149 1.00 19.10 ? 1045 GLY C O     1 
ATOM   2964 N  N     . LYS C 1 17  ? 9.359   57.224  65.684 1.00 23.68 ? 1046 LYS C N     1 
ATOM   2965 C  CA    . LYS C 1 17  ? 10.782  57.282  66.069 1.00 28.89 ? 1046 LYS C CA    1 
ATOM   2966 C  C     . LYS C 1 17  ? 10.974  56.155  67.065 1.00 32.85 ? 1046 LYS C C     1 
ATOM   2967 O  O     . LYS C 1 17  ? 10.695  56.329  68.248 1.00 39.50 ? 1046 LYS C O     1 
ATOM   2968 C  CB    . LYS C 1 17  ? 11.138  58.565  66.830 1.00 24.47 ? 1046 LYS C CB    1 
ATOM   2969 C  CG    . LYS C 1 17  ? 10.535  59.859  66.342 1.00 25.77 ? 1046 LYS C CG    1 
ATOM   2970 C  CD    . LYS C 1 17  ? 10.934  60.994  67.294 1.00 21.18 ? 1046 LYS C CD    1 
ATOM   2971 C  CE    . LYS C 1 17  ? 10.539  60.697  68.763 1.00 22.51 ? 1046 LYS C CE    1 
ATOM   2972 N  NZ    . LYS C 1 17  ? 9.060   60.505  68.963 1.00 20.18 ? 1046 LYS C NZ    1 
ATOM   2973 N  N     . SER C 1 18  ? 11.468  55.016  66.626 1.00 33.00 ? 1047 SER C N     1 
ATOM   2974 C  CA    . SER C 1 18  ? 11.636  53.895  67.548 1.00 30.97 ? 1047 SER C CA    1 
ATOM   2975 C  C     . SER C 1 18  ? 11.557  52.738  66.597 1.00 29.24 ? 1047 SER C C     1 
ATOM   2976 O  O     . SER C 1 18  ? 12.411  51.855  66.591 1.00 29.88 ? 1047 SER C O     1 
ATOM   2977 C  CB    . SER C 1 18  ? 10.469  53.840  68.543 1.00 33.76 ? 1047 SER C CB    1 
ATOM   2978 O  OG    . SER C 1 18  ? 10.596  52.767  69.445 1.00 34.06 ? 1047 SER C OG    1 
ATOM   2979 N  N     . THR C 1 19  ? 10.518  52.789  65.770 1.00 25.43 ? 1048 THR C N     1 
ATOM   2980 C  CA    . THR C 1 19  ? 10.293  51.795  64.747 1.00 26.07 ? 1048 THR C CA    1 
ATOM   2981 C  C     . THR C 1 19  ? 11.407  51.996  63.724 1.00 26.07 ? 1048 THR C C     1 
ATOM   2982 O  O     . THR C 1 19  ? 11.928  51.032  63.168 1.00 25.16 ? 1048 THR C O     1 
ATOM   2983 C  CB    . THR C 1 19  ? 8.935   52.018  64.044 1.00 25.00 ? 1048 THR C CB    1 
ATOM   2984 O  OG1   . THR C 1 19  ? 7.884   51.940  65.011 1.00 25.66 ? 1048 THR C OG1   1 
ATOM   2985 C  CG2   . THR C 1 19  ? 8.705   50.969  62.968 1.00 21.79 ? 1048 THR C CG2   1 
ATOM   2986 N  N     . ILE C 1 20  ? 11.747  53.264  63.480 1.00 27.49 ? 1049 ILE C N     1 
ATOM   2987 C  CA    . ILE C 1 20  ? 12.793  53.627  62.524 1.00 27.85 ? 1049 ILE C CA    1 
ATOM   2988 C  C     . ILE C 1 20  ? 14.147  53.157  63.060 1.00 28.64 ? 1049 ILE C C     1 
ATOM   2989 O  O     . ILE C 1 20  ? 14.956  52.595  62.327 1.00 27.87 ? 1049 ILE C O     1 
ATOM   2990 C  CB    . ILE C 1 20  ? 12.838  55.167  62.283 1.00 26.17 ? 1049 ILE C CB    1 
ATOM   2991 C  CG1   . ILE C 1 20  ? 11.591  55.626  61.511 1.00 26.92 ? 1049 ILE C CG1   1 
ATOM   2992 C  CG2   . ILE C 1 20  ? 14.087  55.538  61.494 1.00 25.44 ? 1049 ILE C CG2   1 
ATOM   2993 C  CD1   . ILE C 1 20  ? 11.504  55.082  60.077 1.00 22.17 ? 1049 ILE C CD1   1 
ATOM   2994 N  N     . VAL C 1 21  ? 14.383  53.389  64.346 1.00 30.33 ? 1050 VAL C N     1 
ATOM   2995 C  CA    . VAL C 1 21  ? 15.625  52.963  64.973 1.00 31.76 ? 1050 VAL C CA    1 
ATOM   2996 C  C     . VAL C 1 21  ? 15.720  51.448  64.860 1.00 32.61 ? 1050 VAL C C     1 
ATOM   2997 O  O     . VAL C 1 21  ? 16.770  50.907  64.517 1.00 32.98 ? 1050 VAL C O     1 
ATOM   2998 C  CB    . VAL C 1 21  ? 15.674  53.363  66.464 1.00 31.87 ? 1050 VAL C CB    1 
ATOM   2999 C  CG1   . VAL C 1 21  ? 16.833  52.664  67.154 1.00 34.41 ? 1050 VAL C CG1   1 
ATOM   3000 C  CG2   . VAL C 1 21  ? 15.825  54.867  66.589 1.00 31.62 ? 1050 VAL C CG2   1 
ATOM   3001 N  N     . LYS C 1 22  ? 14.610  50.768  65.128 1.00 33.27 ? 1051 LYS C N     1 
ATOM   3002 C  CA    . LYS C 1 22  ? 14.584  49.313  65.048 1.00 35.27 ? 1051 LYS C CA    1 
ATOM   3003 C  C     . LYS C 1 22  ? 14.695  48.811  63.610 1.00 35.92 ? 1051 LYS C C     1 
ATOM   3004 O  O     . LYS C 1 22  ? 15.174  47.700  63.371 1.00 36.49 ? 1051 LYS C O     1 
ATOM   3005 C  CB    . LYS C 1 22  ? 13.318  48.764  65.720 1.00 37.06 ? 1051 LYS C CB    1 
ATOM   3006 C  CG    . LYS C 1 22  ? 13.312  48.960  67.235 1.00 38.46 ? 1051 LYS C CG    1 
ATOM   3007 C  CD    . LYS C 1 22  ? 12.162  48.226  67.907 1.00 41.34 ? 1051 LYS C CD    1 
ATOM   3008 C  CE    . LYS C 1 22  ? 10.833  48.907  67.643 1.00 42.68 ? 1051 LYS C CE    1 
ATOM   3009 N  NZ    . LYS C 1 22  ? 9.723   48.194  68.324 1.00 44.74 ? 1051 LYS C NZ    1 
ATOM   3010 N  N     . GLN C 1 23  ? 14.266  49.625  62.648 1.00 36.06 ? 1052 GLN C N     1 
ATOM   3011 C  CA    . GLN C 1 23  ? 14.368  49.234  61.244 1.00 34.76 ? 1052 GLN C CA    1 
ATOM   3012 C  C     . GLN C 1 23  ? 15.835  49.306  60.832 1.00 35.67 ? 1052 GLN C C     1 
ATOM   3013 O  O     . GLN C 1 23  ? 16.322  48.462  60.083 1.00 35.65 ? 1052 GLN C O     1 
ATOM   3014 C  CB    . GLN C 1 23  ? 13.521  50.148  60.361 1.00 32.30 ? 1052 GLN C CB    1 
ATOM   3015 C  CG    . GLN C 1 23  ? 12.035  49.828  60.410 1.00 30.89 ? 1052 GLN C CG    1 
ATOM   3016 C  CD    . GLN C 1 23  ? 11.689  48.560  59.651 1.00 29.60 ? 1052 GLN C CD    1 
ATOM   3017 O  OE1   . GLN C 1 23  ? 12.535  47.680  59.476 1.00 31.71 ? 1052 GLN C OE1   1 
ATOM   3018 N  NE2   . GLN C 1 23  ? 10.442  48.455  59.199 1.00 27.58 ? 1052 GLN C NE2   1 
ATOM   3019 N  N     . MET C 1 24  ? 16.543  50.312  61.330 1.00 37.07 ? 1053 MET C N     1 
ATOM   3020 C  CA    . MET C 1 24  ? 17.959  50.443  61.006 1.00 38.90 ? 1053 MET C CA    1 
ATOM   3021 C  C     . MET C 1 24  ? 18.692  49.166  61.403 1.00 39.51 ? 1053 MET C C     1 
ATOM   3022 O  O     . MET C 1 24  ? 19.508  48.652  60.642 1.00 39.64 ? 1053 MET C O     1 
ATOM   3023 C  CB    . MET C 1 24  ? 18.573  51.645  61.728 1.00 36.92 ? 1053 MET C CB    1 
ATOM   3024 C  CG    . MET C 1 24  ? 18.114  52.983  61.188 1.00 36.81 ? 1053 MET C CG    1 
ATOM   3025 S  SD    . MET C 1 24  ? 18.408  53.135  59.415 1.00 39.11 ? 1053 MET C SD    1 
ATOM   3026 C  CE    . MET C 1 24  ? 16.826  52.561  58.725 1.00 37.45 ? 1053 MET C CE    1 
ATOM   3027 N  N     . LYS C 1 25  ? 18.390  48.647  62.589 1.00 41.14 ? 1054 LYS C N     1 
ATOM   3028 C  CA    . LYS C 1 25  ? 19.029  47.423  63.049 1.00 43.04 ? 1054 LYS C CA    1 
ATOM   3029 C  C     . LYS C 1 25  ? 18.696  46.257  62.129 1.00 43.16 ? 1054 LYS C C     1 
ATOM   3030 O  O     . LYS C 1 25  ? 19.565  45.462  61.784 1.00 44.83 ? 1054 LYS C O     1 
ATOM   3031 C  CB    . LYS C 1 25  ? 18.592  47.076  64.472 1.00 45.35 ? 1054 LYS C CB    1 
ATOM   3032 C  CG    . LYS C 1 25  ? 19.245  45.798  64.986 1.00 49.44 ? 1054 LYS C CG    1 
ATOM   3033 C  CD    . LYS C 1 25  ? 18.853  45.447  66.415 1.00 50.89 ? 1054 LYS C CD    1 
ATOM   3034 C  CE    . LYS C 1 25  ? 19.595  44.188  66.861 1.00 54.06 ? 1054 LYS C CE    1 
ATOM   3035 N  NZ    . LYS C 1 25  ? 19.189  43.692  68.206 1.00 55.45 ? 1054 LYS C NZ    1 
ATOM   3036 N  N     . ILE C 1 26  ? 17.433  46.159  61.732 1.00 43.32 ? 1055 ILE C N     1 
ATOM   3037 C  CA    . ILE C 1 26  ? 16.986  45.079  60.860 1.00 42.09 ? 1055 ILE C CA    1 
ATOM   3038 C  C     . ILE C 1 26  ? 17.598  45.140  59.465 1.00 43.06 ? 1055 ILE C C     1 
ATOM   3039 O  O     . ILE C 1 26  ? 17.863  44.108  58.856 1.00 43.20 ? 1055 ILE C O     1 
ATOM   3040 C  CB    . ILE C 1 26  ? 15.444  45.091  60.702 1.00 41.15 ? 1055 ILE C CB    1 
ATOM   3041 C  CG1   . ILE C 1 26  ? 14.776  44.782  62.045 1.00 41.41 ? 1055 ILE C CG1   1 
ATOM   3042 C  CG2   . ILE C 1 26  ? 15.013  44.086  59.640 1.00 38.28 ? 1055 ILE C CG2   1 
ATOM   3043 C  CD1   . ILE C 1 26  ? 13.260  44.796  61.993 1.00 39.92 ? 1055 ILE C CD1   1 
ATOM   3044 N  N     . ILE C 1 27  ? 17.820  46.350  58.963 1.00 43.50 ? 1056 ILE C N     1 
ATOM   3045 C  CA    . ILE C 1 27  ? 18.356  46.533  57.620 1.00 44.17 ? 1056 ILE C CA    1 
ATOM   3046 C  C     . ILE C 1 27  ? 19.877  46.617  57.517 1.00 46.51 ? 1056 ILE C C     1 
ATOM   3047 O  O     . ILE C 1 27  ? 20.475  46.010  56.630 1.00 45.74 ? 1056 ILE C O     1 
ATOM   3048 C  CB    . ILE C 1 27  ? 17.754  47.798  56.971 1.00 43.24 ? 1056 ILE C CB    1 
ATOM   3049 C  CG1   . ILE C 1 27  ? 16.224  47.691  56.971 1.00 43.14 ? 1056 ILE C CG1   1 
ATOM   3050 C  CG2   . ILE C 1 27  ? 18.285  47.967  55.547 1.00 41.36 ? 1056 ILE C CG2   1 
ATOM   3051 C  CD1   . ILE C 1 27  ? 15.507  48.973  56.582 1.00 40.55 ? 1056 ILE C CD1   1 
ATOM   3052 N  N     . HIS C 1 28  ? 20.503  47.364  58.420 1.00 48.96 ? 1057 HIS C N     1 
ATOM   3053 C  CA    . HIS C 1 28  ? 21.951  47.528  58.371 1.00 51.77 ? 1057 HIS C CA    1 
ATOM   3054 C  C     . HIS C 1 28  ? 22.714  46.992  59.574 1.00 53.49 ? 1057 HIS C C     1 
ATOM   3055 O  O     . HIS C 1 28  ? 23.860  47.376  59.797 1.00 54.63 ? 1057 HIS C O     1 
ATOM   3056 C  CB    . HIS C 1 28  ? 22.298  49.003  58.178 1.00 51.45 ? 1057 HIS C CB    1 
ATOM   3057 C  CG    . HIS C 1 28  ? 21.583  49.642  57.030 1.00 52.47 ? 1057 HIS C CG    1 
ATOM   3058 N  ND1   . HIS C 1 28  ? 20.593  50.585  57.202 1.00 52.64 ? 1057 HIS C ND1   1 
ATOM   3059 C  CD2   . HIS C 1 28  ? 21.705  49.463  55.693 1.00 52.47 ? 1057 HIS C CD2   1 
ATOM   3060 C  CE1   . HIS C 1 28  ? 20.136  50.961  56.021 1.00 53.74 ? 1057 HIS C CE1   1 
ATOM   3061 N  NE2   . HIS C 1 28  ? 20.794  50.295  55.088 1.00 53.92 ? 1057 HIS C NE2   1 
ATOM   3062 N  N     . GLU C 1 29  ? 22.084  46.117  60.352 1.00 54.93 ? 1058 GLU C N     1 
ATOM   3063 C  CA    . GLU C 1 29  ? 22.745  45.531  61.509 1.00 56.40 ? 1058 GLU C CA    1 
ATOM   3064 C  C     . GLU C 1 29  ? 22.422  44.043  61.592 1.00 58.14 ? 1058 GLU C C     1 
ATOM   3065 O  O     . GLU C 1 29  ? 21.856  43.468  60.662 1.00 57.60 ? 1058 GLU C O     1 
ATOM   3066 C  CB    . GLU C 1 29  ? 22.314  46.240  62.794 1.00 57.28 ? 1058 GLU C CB    1 
ATOM   3067 C  CG    . GLU C 1 29  ? 22.468  47.750  62.736 1.00 59.34 ? 1058 GLU C CG    1 
ATOM   3068 C  CD    . GLU C 1 29  ? 22.216  48.424  64.072 1.00 60.19 ? 1058 GLU C CD    1 
ATOM   3069 O  OE1   . GLU C 1 29  ? 22.064  49.664  64.089 1.00 59.74 ? 1058 GLU C OE1   1 
ATOM   3070 O  OE2   . GLU C 1 29  ? 22.179  47.719  65.103 1.00 61.53 ? 1058 GLU C OE2   1 
ATOM   3071 N  N     . ALA C 1 30  ? 22.782  43.420  62.708 1.00 60.14 ? 1059 ALA C N     1 
ATOM   3072 C  CA    . ALA C 1 30  ? 22.539  41.993  62.890 1.00 63.22 ? 1059 ALA C CA    1 
ATOM   3073 C  C     . ALA C 1 30  ? 21.086  41.603  62.632 1.00 64.18 ? 1059 ALA C C     1 
ATOM   3074 O  O     . ALA C 1 30  ? 20.809  40.616  61.949 1.00 64.75 ? 1059 ALA C O     1 
ATOM   3075 C  CB    . ALA C 1 30  ? 22.951  41.570  64.305 1.00 63.27 ? 1059 ALA C CB    1 
ATOM   3076 N  N     . GLY C 1 31  ? 20.163  42.392  63.172 1.00 65.19 ? 1060 GLY C N     1 
ATOM   3077 C  CA    . GLY C 1 31  ? 18.751  42.094  63.020 1.00 65.48 ? 1060 GLY C CA    1 
ATOM   3078 C  C     . GLY C 1 31  ? 18.286  41.474  64.324 1.00 65.91 ? 1060 GLY C C     1 
ATOM   3079 O  O     . GLY C 1 31  ? 18.751  41.867  65.394 1.00 65.93 ? 1060 GLY C O     1 
ATOM   3080 N  N     . TYR C 1 32  ? 17.377  40.509  64.254 1.00 66.19 ? 1061 TYR C N     1 
ATOM   3081 C  CA    . TYR C 1 32  ? 16.902  39.859  65.469 1.00 66.83 ? 1061 TYR C CA    1 
ATOM   3082 C  C     . TYR C 1 32  ? 16.959  38.339  65.362 1.00 68.29 ? 1061 TYR C C     1 
ATOM   3083 O  O     . TYR C 1 32  ? 16.223  37.731  64.584 1.00 68.73 ? 1061 TYR C O     1 
ATOM   3084 C  CB    . TYR C 1 32  ? 15.476  40.311  65.799 1.00 65.17 ? 1061 TYR C CB    1 
ATOM   3085 C  CG    . TYR C 1 32  ? 15.374  41.771  66.177 1.00 62.84 ? 1061 TYR C CG    1 
ATOM   3086 C  CD1   . TYR C 1 32  ? 15.209  42.754  65.203 1.00 61.89 ? 1061 TYR C CD1   1 
ATOM   3087 C  CD2   . TYR C 1 32  ? 15.476  42.174  67.510 1.00 62.29 ? 1061 TYR C CD2   1 
ATOM   3088 C  CE1   . TYR C 1 32  ? 15.147  44.106  65.545 1.00 60.90 ? 1061 TYR C CE1   1 
ATOM   3089 C  CE2   . TYR C 1 32  ? 15.417  43.525  67.865 1.00 61.22 ? 1061 TYR C CE2   1 
ATOM   3090 C  CZ    . TYR C 1 32  ? 15.253  44.484  66.876 1.00 60.94 ? 1061 TYR C CZ    1 
ATOM   3091 O  OH    . TYR C 1 32  ? 15.193  45.817  67.215 1.00 59.01 ? 1061 TYR C OH    1 
ATOM   3092 N  N     . SER C 1 33  ? 17.848  37.735  66.148 1.00 69.81 ? 1062 SER C N     1 
ATOM   3093 C  CA    . SER C 1 33  ? 18.019  36.285  66.156 1.00 71.46 ? 1062 SER C CA    1 
ATOM   3094 C  C     . SER C 1 33  ? 16.874  35.620  66.905 1.00 72.78 ? 1062 SER C C     1 
ATOM   3095 O  O     . SER C 1 33  ? 16.289  36.211  67.816 1.00 72.80 ? 1062 SER C O     1 
ATOM   3096 C  CB    . SER C 1 33  ? 19.342  35.909  66.827 1.00 70.83 ? 1062 SER C CB    1 
ATOM   3097 O  OG    . SER C 1 33  ? 19.333  36.265  68.200 1.00 70.34 ? 1062 SER C OG    1 
ATOM   3098 N  N     . GLU C 1 34  ? 16.566  34.385  66.523 1.00 74.03 ? 1063 GLU C N     1 
ATOM   3099 C  CA    . GLU C 1 34  ? 15.488  33.633  67.152 1.00 75.11 ? 1063 GLU C CA    1 
ATOM   3100 C  C     . GLU C 1 34  ? 15.517  33.740  68.673 1.00 74.77 ? 1063 GLU C C     1 
ATOM   3101 O  O     . GLU C 1 34  ? 14.471  33.833  69.314 1.00 74.71 ? 1063 GLU C O     1 
ATOM   3102 C  CB    . GLU C 1 34  ? 15.567  32.163  66.746 1.00 76.71 ? 1063 GLU C CB    1 
ATOM   3103 C  CG    . GLU C 1 34  ? 14.471  31.303  67.347 1.00 79.54 ? 1063 GLU C CG    1 
ATOM   3104 C  CD    . GLU C 1 34  ? 14.609  29.844  66.972 1.00 80.89 ? 1063 GLU C CD    1 
ATOM   3105 O  OE1   . GLU C 1 34  ? 15.639  29.233  67.330 1.00 82.05 ? 1063 GLU C OE1   1 
ATOM   3106 O  OE2   . GLU C 1 34  ? 13.689  29.309  66.318 1.00 81.80 ? 1063 GLU C OE2   1 
ATOM   3107 N  N     . GLU C 1 35  ? 16.714  33.729  69.249 1.00 74.54 ? 1064 GLU C N     1 
ATOM   3108 C  CA    . GLU C 1 35  ? 16.845  33.820  70.696 1.00 74.74 ? 1064 GLU C CA    1 
ATOM   3109 C  C     . GLU C 1 35  ? 16.434  35.195  71.206 1.00 73.91 ? 1064 GLU C C     1 
ATOM   3110 O  O     . GLU C 1 35  ? 15.732  35.306  72.212 1.00 74.11 ? 1064 GLU C O     1 
ATOM   3111 C  CB    . GLU C 1 35  ? 18.280  33.522  71.124 1.00 76.31 ? 1064 GLU C CB    1 
ATOM   3112 C  CG    . GLU C 1 35  ? 18.446  33.399  72.628 1.00 78.90 ? 1064 GLU C CG    1 
ATOM   3113 C  CD    . GLU C 1 35  ? 19.861  33.043  73.030 1.00 81.09 ? 1064 GLU C CD    1 
ATOM   3114 O  OE1   . GLU C 1 35  ? 20.364  31.994  72.569 1.00 81.41 ? 1064 GLU C OE1   1 
ATOM   3115 O  OE2   . GLU C 1 35  ? 20.470  33.810  73.807 1.00 82.23 ? 1064 GLU C OE2   1 
ATOM   3116 N  N     . GLU C 1 36  ? 16.879  36.242  70.518 1.00 72.71 ? 1065 GLU C N     1 
ATOM   3117 C  CA    . GLU C 1 36  ? 16.530  37.600  70.916 1.00 70.78 ? 1065 GLU C CA    1 
ATOM   3118 C  C     . GLU C 1 36  ? 15.022  37.795  70.822 1.00 68.82 ? 1065 GLU C C     1 
ATOM   3119 O  O     . GLU C 1 36  ? 14.407  38.375  71.717 1.00 68.47 ? 1065 GLU C O     1 
ATOM   3120 C  CB    . GLU C 1 36  ? 17.240  38.622  70.028 1.00 71.34 ? 1065 GLU C CB    1 
ATOM   3121 C  CG    . GLU C 1 36  ? 18.735  38.697  70.257 1.00 72.53 ? 1065 GLU C CG    1 
ATOM   3122 C  CD    . GLU C 1 36  ? 19.392  39.789  69.442 1.00 73.25 ? 1065 GLU C CD    1 
ATOM   3123 O  OE1   . GLU C 1 36  ? 19.334  39.717  68.195 1.00 73.65 ? 1065 GLU C OE1   1 
ATOM   3124 O  OE2   . GLU C 1 36  ? 19.966  40.719  70.050 1.00 73.66 ? 1065 GLU C OE2   1 
ATOM   3125 N  N     . CYS C 1 37  ? 14.431  37.302  69.736 1.00 66.10 ? 1066 CYS C N     1 
ATOM   3126 C  CA    . CYS C 1 37  ? 12.992  37.415  69.535 1.00 64.42 ? 1066 CYS C CA    1 
ATOM   3127 C  C     . CYS C 1 37  ? 12.229  36.895  70.748 1.00 63.82 ? 1066 CYS C C     1 
ATOM   3128 O  O     . CYS C 1 37  ? 11.319  37.558  71.245 1.00 62.85 ? 1066 CYS C O     1 
ATOM   3129 C  CB    . CYS C 1 37  ? 12.564  36.634  68.288 1.00 64.14 ? 1066 CYS C CB    1 
ATOM   3130 S  SG    . CYS C 1 37  ? 13.008  37.404  66.710 1.00 63.47 ? 1066 CYS C SG    1 
ATOM   3131 N  N     . LYS C 1 38  ? 12.609  35.710  71.220 1.00 63.63 ? 1067 LYS C N     1 
ATOM   3132 C  CA    . LYS C 1 38  ? 11.961  35.091  72.373 1.00 62.81 ? 1067 LYS C CA    1 
ATOM   3133 C  C     . LYS C 1 38  ? 11.848  36.063  73.543 1.00 62.04 ? 1067 LYS C C     1 
ATOM   3134 O  O     . LYS C 1 38  ? 10.924  35.972  74.354 1.00 62.06 ? 1067 LYS C O     1 
ATOM   3135 C  CB    . LYS C 1 38  ? 12.739  33.851  72.824 1.00 64.31 ? 1067 LYS C CB    1 
ATOM   3136 C  CG    . LYS C 1 38  ? 12.846  32.740  71.788 1.00 66.35 ? 1067 LYS C CG    1 
ATOM   3137 C  CD    . LYS C 1 38  ? 13.553  31.523  72.379 1.00 68.55 ? 1067 LYS C CD    1 
ATOM   3138 C  CE    . LYS C 1 38  ? 13.816  30.447  71.333 1.00 70.35 ? 1067 LYS C CE    1 
ATOM   3139 N  NZ    . LYS C 1 38  ? 12.561  29.935  70.716 1.00 72.19 ? 1067 LYS C NZ    1 
ATOM   3140 N  N     . GLN C 1 39  ? 12.790  36.995  73.626 1.00 60.64 ? 1068 GLN C N     1 
ATOM   3141 C  CA    . GLN C 1 39  ? 12.796  37.972  74.704 1.00 59.13 ? 1068 GLN C CA    1 
ATOM   3142 C  C     . GLN C 1 39  ? 11.641  38.965  74.644 1.00 57.06 ? 1068 GLN C C     1 
ATOM   3143 O  O     . GLN C 1 39  ? 11.226  39.498  75.674 1.00 56.80 ? 1068 GLN C O     1 
ATOM   3144 C  CB    . GLN C 1 39  ? 14.121  38.734  74.714 1.00 61.22 ? 1068 GLN C CB    1 
ATOM   3145 C  CG    . GLN C 1 39  ? 15.288  37.916  75.219 1.00 64.51 ? 1068 GLN C CG    1 
ATOM   3146 C  CD    . GLN C 1 39  ? 15.024  37.343  76.598 1.00 66.76 ? 1068 GLN C CD    1 
ATOM   3147 O  OE1   . GLN C 1 39  ? 14.741  38.080  77.545 1.00 68.02 ? 1068 GLN C OE1   1 
ATOM   3148 N  NE2   . GLN C 1 39  ? 15.114  36.021  76.718 1.00 67.59 ? 1068 GLN C NE2   1 
ATOM   3149 N  N     . TYR C 1 40  ? 11.122  39.214  73.445 1.00 54.04 ? 1069 TYR C N     1 
ATOM   3150 C  CA    . TYR C 1 40  ? 10.025  40.163  73.284 1.00 52.29 ? 1069 TYR C CA    1 
ATOM   3151 C  C     . TYR C 1 40  ? 8.635   39.578  73.505 1.00 51.43 ? 1069 TYR C C     1 
ATOM   3152 O  O     . TYR C 1 40  ? 7.637   40.280  73.357 1.00 50.55 ? 1069 TYR C O     1 
ATOM   3153 C  CB    . TYR C 1 40  ? 10.085  40.818  71.898 1.00 51.26 ? 1069 TYR C CB    1 
ATOM   3154 C  CG    . TYR C 1 40  ? 11.218  41.804  71.745 1.00 50.33 ? 1069 TYR C CG    1 
ATOM   3155 C  CD1   . TYR C 1 40  ? 12.476  41.393  71.308 1.00 49.63 ? 1069 TYR C CD1   1 
ATOM   3156 C  CD2   . TYR C 1 40  ? 11.044  43.145  72.087 1.00 50.22 ? 1069 TYR C CD2   1 
ATOM   3157 C  CE1   . TYR C 1 40  ? 13.536  42.294  71.216 1.00 51.39 ? 1069 TYR C CE1   1 
ATOM   3158 C  CE2   . TYR C 1 40  ? 12.093  44.054  72.002 1.00 51.03 ? 1069 TYR C CE2   1 
ATOM   3159 C  CZ    . TYR C 1 40  ? 13.336  43.623  71.565 1.00 51.98 ? 1069 TYR C CZ    1 
ATOM   3160 O  OH    . TYR C 1 40  ? 14.372  44.523  71.476 1.00 49.84 ? 1069 TYR C OH    1 
ATOM   3161 N  N     . LYS C 1 41  ? 8.564   38.301  73.863 1.00 50.22 ? 1070 LYS C N     1 
ATOM   3162 C  CA    . LYS C 1 41  ? 7.277   37.661  74.095 1.00 49.33 ? 1070 LYS C CA    1 
ATOM   3163 C  C     . LYS C 1 41  ? 6.503   38.345  75.220 1.00 47.62 ? 1070 LYS C C     1 
ATOM   3164 O  O     . LYS C 1 41  ? 5.305   38.606  75.091 1.00 47.91 ? 1070 LYS C O     1 
ATOM   3165 C  CB    . LYS C 1 41  ? 7.470   36.176  74.417 1.00 51.30 ? 1070 LYS C CB    1 
ATOM   3166 C  CG    . LYS C 1 41  ? 6.172   35.444  74.710 1.00 53.75 ? 1070 LYS C CG    1 
ATOM   3167 C  CD    . LYS C 1 41  ? 6.304   33.933  74.553 1.00 55.84 ? 1070 LYS C CD    1 
ATOM   3168 C  CE    . LYS C 1 41  ? 7.289   33.333  75.538 1.00 58.32 ? 1070 LYS C CE    1 
ATOM   3169 N  NZ    . LYS C 1 41  ? 7.277   31.842  75.472 1.00 59.66 ? 1070 LYS C NZ    1 
ATOM   3170 N  N     . ALA C 1 42  ? 7.187   38.641  76.319 1.00 44.20 ? 1071 ALA C N     1 
ATOM   3171 C  CA    . ALA C 1 42  ? 6.539   39.295  77.451 1.00 42.61 ? 1071 ALA C CA    1 
ATOM   3172 C  C     . ALA C 1 42  ? 5.952   40.650  77.061 1.00 40.97 ? 1071 ALA C C     1 
ATOM   3173 O  O     . ALA C 1 42  ? 4.818   40.967  77.421 1.00 39.96 ? 1071 ALA C O     1 
ATOM   3174 C  CB    . ALA C 1 42  ? 7.532   39.467  78.599 1.00 42.19 ? 1071 ALA C CB    1 
ATOM   3175 N  N     . VAL C 1 43  ? 6.722   41.448  76.325 1.00 39.16 ? 1072 VAL C N     1 
ATOM   3176 C  CA    . VAL C 1 43  ? 6.247   42.762  75.909 1.00 37.42 ? 1072 VAL C CA    1 
ATOM   3177 C  C     . VAL C 1 43  ? 5.108   42.623  74.900 1.00 34.85 ? 1072 VAL C C     1 
ATOM   3178 O  O     . VAL C 1 43  ? 4.184   43.437  74.877 1.00 34.39 ? 1072 VAL C O     1 
ATOM   3179 C  CB    . VAL C 1 43  ? 7.390   43.627  75.309 1.00 37.41 ? 1072 VAL C CB    1 
ATOM   3180 C  CG1   . VAL C 1 43  ? 7.889   43.022  74.009 1.00 38.44 ? 1072 VAL C CG1   1 
ATOM   3181 C  CG2   . VAL C 1 43  ? 6.894   45.047  75.081 1.00 38.04 ? 1072 VAL C CG2   1 
ATOM   3182 N  N     . VAL C 1 44  ? 5.165   41.585  74.073 1.00 32.28 ? 1073 VAL C N     1 
ATOM   3183 C  CA    . VAL C 1 44  ? 4.106   41.356  73.103 1.00 31.57 ? 1073 VAL C CA    1 
ATOM   3184 C  C     . VAL C 1 44  ? 2.787   41.131  73.846 1.00 33.63 ? 1073 VAL C C     1 
ATOM   3185 O  O     . VAL C 1 44  ? 1.767   41.750  73.518 1.00 33.96 ? 1073 VAL C O     1 
ATOM   3186 C  CB    . VAL C 1 44  ? 4.395   40.121  72.212 1.00 28.76 ? 1073 VAL C CB    1 
ATOM   3187 C  CG1   . VAL C 1 44  ? 3.133   39.719  71.448 1.00 27.40 ? 1073 VAL C CG1   1 
ATOM   3188 C  CG2   . VAL C 1 44  ? 5.503   40.440  71.227 1.00 25.30 ? 1073 VAL C CG2   1 
ATOM   3189 N  N     . TYR C 1 45  ? 2.810   40.247  74.847 1.00 33.31 ? 1074 TYR C N     1 
ATOM   3190 C  CA    . TYR C 1 45  ? 1.606   39.952  75.618 1.00 33.69 ? 1074 TYR C CA    1 
ATOM   3191 C  C     . TYR C 1 45  ? 1.170   41.165  76.418 1.00 33.48 ? 1074 TYR C C     1 
ATOM   3192 O  O     . TYR C 1 45  ? -0.021  41.468  76.510 1.00 32.05 ? 1074 TYR C O     1 
ATOM   3193 C  CB    . TYR C 1 45  ? 1.840   38.768  76.561 1.00 35.35 ? 1074 TYR C CB    1 
ATOM   3194 C  CG    . TYR C 1 45  ? 2.079   37.463  75.839 1.00 38.51 ? 1074 TYR C CG    1 
ATOM   3195 C  CD1   . TYR C 1 45  ? 1.528   37.236  74.576 1.00 38.86 ? 1074 TYR C CD1   1 
ATOM   3196 C  CD2   . TYR C 1 45  ? 2.830   36.441  76.425 1.00 40.13 ? 1074 TYR C CD2   1 
ATOM   3197 C  CE1   . TYR C 1 45  ? 1.716   36.030  73.913 1.00 39.87 ? 1074 TYR C CE1   1 
ATOM   3198 C  CE2   . TYR C 1 45  ? 3.022   35.227  75.770 1.00 39.17 ? 1074 TYR C CE2   1 
ATOM   3199 C  CZ    . TYR C 1 45  ? 2.462   35.031  74.515 1.00 40.88 ? 1074 TYR C CZ    1 
ATOM   3200 O  OH    . TYR C 1 45  ? 2.642   33.838  73.857 1.00 42.09 ? 1074 TYR C OH    1 
ATOM   3201 N  N     . SER C 1 46  ? 2.138   41.862  76.997 1.00 32.68 ? 1075 SER C N     1 
ATOM   3202 C  CA    . SER C 1 46  ? 1.830   43.050  77.772 1.00 33.62 ? 1075 SER C CA    1 
ATOM   3203 C  C     . SER C 1 46  ? 1.181   44.095  76.864 1.00 31.75 ? 1075 SER C C     1 
ATOM   3204 O  O     . SER C 1 46  ? 0.163   44.692  77.223 1.00 31.24 ? 1075 SER C O     1 
ATOM   3205 C  CB    . SER C 1 46  ? 3.101   43.616  78.405 1.00 35.89 ? 1075 SER C CB    1 
ATOM   3206 O  OG    . SER C 1 46  ? 2.798   44.772  79.160 1.00 41.62 ? 1075 SER C OG    1 
ATOM   3207 N  N     . ASN C 1 47  ? 1.769   44.308  75.688 1.00 30.43 ? 1076 ASN C N     1 
ATOM   3208 C  CA    . ASN C 1 47  ? 1.237   45.271  74.717 1.00 30.39 ? 1076 ASN C CA    1 
ATOM   3209 C  C     . ASN C 1 47  ? -0.189  44.887  74.327 1.00 30.25 ? 1076 ASN C C     1 
ATOM   3210 O  O     . ASN C 1 47  ? -1.078  45.736  74.249 1.00 30.03 ? 1076 ASN C O     1 
ATOM   3211 C  CB    . ASN C 1 47  ? 2.105   45.300  73.450 1.00 29.77 ? 1076 ASN C CB    1 
ATOM   3212 C  CG    . ASN C 1 47  ? 3.413   46.068  73.638 1.00 32.56 ? 1076 ASN C CG    1 
ATOM   3213 O  OD1   . ASN C 1 47  ? 4.333   45.946  72.828 1.00 32.43 ? 1076 ASN C OD1   1 
ATOM   3214 N  ND2   . ASN C 1 47  ? 3.493   46.874  74.699 1.00 32.50 ? 1076 ASN C ND2   1 
ATOM   3215 N  N     . THR C 1 48  ? -0.401  43.599  74.082 1.00 30.88 ? 1077 THR C N     1 
ATOM   3216 C  CA    . THR C 1 48  ? -1.714  43.105  73.687 1.00 31.78 ? 1077 THR C CA    1 
ATOM   3217 C  C     . THR C 1 48  ? -2.770  43.343  74.765 1.00 31.98 ? 1077 THR C C     1 
ATOM   3218 O  O     . THR C 1 48  ? -3.890  43.777  74.472 1.00 32.33 ? 1077 THR C O     1 
ATOM   3219 C  CB    . THR C 1 48  ? -1.651  41.608  73.352 1.00 32.08 ? 1077 THR C CB    1 
ATOM   3220 O  OG1   . THR C 1 48  ? -0.707  41.403  72.292 1.00 33.26 ? 1077 THR C OG1   1 
ATOM   3221 C  CG2   . THR C 1 48  ? -3.020  41.096  72.917 1.00 32.01 ? 1077 THR C CG2   1 
ATOM   3222 N  N     . ILE C 1 49  ? -2.404  43.067  76.011 1.00 32.66 ? 1078 ILE C N     1 
ATOM   3223 C  CA    . ILE C 1 49  ? -3.307  43.257  77.139 1.00 31.30 ? 1078 ILE C CA    1 
ATOM   3224 C  C     . ILE C 1 49  ? -3.571  44.751  77.336 1.00 30.66 ? 1078 ILE C C     1 
ATOM   3225 O  O     . ILE C 1 49  ? -4.721  45.169  77.509 1.00 29.75 ? 1078 ILE C O     1 
ATOM   3226 C  CB    . ILE C 1 49  ? -2.700  42.630  78.423 1.00 32.64 ? 1078 ILE C CB    1 
ATOM   3227 C  CG1   . ILE C 1 49  ? -2.611  41.112  78.246 1.00 35.45 ? 1078 ILE C CG1   1 
ATOM   3228 C  CG2   . ILE C 1 49  ? -3.533  42.990  79.650 1.00 32.82 ? 1078 ILE C CG2   1 
ATOM   3229 C  CD1   . ILE C 1 49  ? -1.905  40.391  79.392 1.00 38.14 ? 1078 ILE C CD1   1 
ATOM   3230 N  N     . GLN C 1 50  ? -2.511  45.555  77.288 1.00 30.47 ? 1079 GLN C N     1 
ATOM   3231 C  CA    . GLN C 1 50  ? -2.646  47.004  77.450 1.00 30.37 ? 1079 GLN C CA    1 
ATOM   3232 C  C     . GLN C 1 50  ? -3.567  47.552  76.365 1.00 30.09 ? 1079 GLN C C     1 
ATOM   3233 O  O     . GLN C 1 50  ? -4.317  48.506  76.597 1.00 29.71 ? 1079 GLN C O     1 
ATOM   3234 C  CB    . GLN C 1 50  ? -1.277  47.703  77.344 1.00 31.89 ? 1079 GLN C CB    1 
ATOM   3235 C  CG    . GLN C 1 50  ? -0.268  47.298  78.407 1.00 33.50 ? 1079 GLN C CG    1 
ATOM   3236 C  CD    . GLN C 1 50  ? 1.159   47.764  78.101 1.00 37.55 ? 1079 GLN C CD    1 
ATOM   3237 O  OE1   . GLN C 1 50  ? 1.617   47.724  76.951 1.00 34.54 ? 1079 GLN C OE1   1 
ATOM   3238 N  NE2   . GLN C 1 50  ? 1.874   48.184  79.141 1.00 37.68 ? 1079 GLN C NE2   1 
ATOM   3239 N  N     . SER C 1 51  ? -3.517  46.943  75.183 1.00 28.33 ? 1080 SER C N     1 
ATOM   3240 C  CA    . SER C 1 51  ? -4.344  47.400  74.069 1.00 27.83 ? 1080 SER C CA    1 
ATOM   3241 C  C     . SER C 1 51  ? -5.826  47.144  74.299 1.00 26.83 ? 1080 SER C C     1 
ATOM   3242 O  O     . SER C 1 51  ? -6.634  48.067  74.243 1.00 24.86 ? 1080 SER C O     1 
ATOM   3243 C  CB    . SER C 1 51  ? -3.902  46.736  72.757 1.00 29.06 ? 1080 SER C CB    1 
ATOM   3244 O  OG    . SER C 1 51  ? -2.595  47.157  72.392 1.00 32.62 ? 1080 SER C OG    1 
ATOM   3245 N  N     . ILE C 1 52  ? -6.184  45.890  74.553 1.00 27.38 ? 1081 ILE C N     1 
ATOM   3246 C  CA    . ILE C 1 52  ? -7.583  45.555  74.780 1.00 28.22 ? 1081 ILE C CA    1 
ATOM   3247 C  C     . ILE C 1 52  ? -8.113  46.330  75.987 1.00 26.76 ? 1081 ILE C C     1 
ATOM   3248 O  O     . ILE C 1 52  ? -9.272  46.739  76.011 1.00 26.19 ? 1081 ILE C O     1 
ATOM   3249 C  CB    . ILE C 1 52  ? -7.771  44.029  74.989 1.00 29.63 ? 1081 ILE C CB    1 
ATOM   3250 C  CG1   . ILE C 1 52  ? -9.263  43.696  75.042 1.00 32.01 ? 1081 ILE C CG1   1 
ATOM   3251 C  CG2   . ILE C 1 52  ? -7.071  43.579  76.268 1.00 29.00 ? 1081 ILE C CG2   1 
ATOM   3252 C  CD1   . ILE C 1 52  ? -10.041 44.184  73.827 1.00 33.61 ? 1081 ILE C CD1   1 
ATOM   3253 N  N     . ILE C 1 53  ? -7.255  46.552  76.977 1.00 27.30 ? 1082 ILE C N     1 
ATOM   3254 C  CA    . ILE C 1 53  ? -7.654  47.299  78.168 1.00 28.60 ? 1082 ILE C CA    1 
ATOM   3255 C  C     . ILE C 1 53  ? -7.965  48.759  77.820 1.00 30.82 ? 1082 ILE C C     1 
ATOM   3256 O  O     . ILE C 1 53  ? -8.958  49.324  78.292 1.00 30.98 ? 1082 ILE C O     1 
ATOM   3257 C  CB    . ILE C 1 53  ? -6.549  47.241  79.251 1.00 28.56 ? 1082 ILE C CB    1 
ATOM   3258 C  CG1   . ILE C 1 53  ? -6.686  45.941  80.051 1.00 28.16 ? 1082 ILE C CG1   1 
ATOM   3259 C  CG2   . ILE C 1 53  ? -6.621  48.473  80.160 1.00 27.81 ? 1082 ILE C CG2   1 
ATOM   3260 C  CD1   . ILE C 1 53  ? -5.608  45.761  81.109 1.00 28.02 ? 1082 ILE C CD1   1 
ATOM   3261 N  N     . ALA C 1 54  ? -7.119  49.370  76.993 1.00 30.01 ? 1083 ALA C N     1 
ATOM   3262 C  CA    . ALA C 1 54  ? -7.338  50.756  76.592 1.00 30.60 ? 1083 ALA C CA    1 
ATOM   3263 C  C     . ALA C 1 54  ? -8.708  50.887  75.913 1.00 30.66 ? 1083 ALA C C     1 
ATOM   3264 O  O     . ALA C 1 54  ? -9.441  51.846  76.154 1.00 32.51 ? 1083 ALA C O     1 
ATOM   3265 C  CB    . ALA C 1 54  ? -6.220  51.216  75.655 1.00 30.17 ? 1083 ALA C CB    1 
ATOM   3266 N  N     . ILE C 1 55  ? -9.057  49.920  75.069 1.00 29.56 ? 1084 ILE C N     1 
ATOM   3267 C  CA    . ILE C 1 55  ? -10.351 49.947  74.393 1.00 30.29 ? 1084 ILE C CA    1 
ATOM   3268 C  C     . ILE C 1 55  ? -11.483 49.795  75.421 1.00 32.96 ? 1084 ILE C C     1 
ATOM   3269 O  O     . ILE C 1 55  ? -12.507 50.477  75.333 1.00 35.55 ? 1084 ILE C O     1 
ATOM   3270 C  CB    . ILE C 1 55  ? -10.460 48.815  73.343 1.00 28.86 ? 1084 ILE C CB    1 
ATOM   3271 C  CG1   . ILE C 1 55  ? -9.381  48.998  72.265 1.00 27.22 ? 1084 ILE C CG1   1 
ATOM   3272 C  CG2   . ILE C 1 55  ? -11.843 48.828  72.705 1.00 26.24 ? 1084 ILE C CG2   1 
ATOM   3273 C  CD1   . ILE C 1 55  ? -9.274  47.835  71.287 1.00 23.20 ? 1084 ILE C CD1   1 
ATOM   3274 N  N     . ILE C 1 56  ? -11.294 48.905  76.394 1.00 34.91 ? 1085 ILE C N     1 
ATOM   3275 C  CA    . ILE C 1 56  ? -12.300 48.685  77.433 1.00 36.14 ? 1085 ILE C CA    1 
ATOM   3276 C  C     . ILE C 1 56  ? -12.538 49.968  78.229 1.00 36.46 ? 1085 ILE C C     1 
ATOM   3277 O  O     . ILE C 1 56  ? -13.684 50.343  78.471 1.00 36.18 ? 1085 ILE C O     1 
ATOM   3278 C  CB    . ILE C 1 56  ? -11.877 47.574  78.434 1.00 36.71 ? 1085 ILE C CB    1 
ATOM   3279 C  CG1   . ILE C 1 56  ? -11.646 46.251  77.703 1.00 35.12 ? 1085 ILE C CG1   1 
ATOM   3280 C  CG2   . ILE C 1 56  ? -12.964 47.406  79.503 1.00 35.24 ? 1085 ILE C CG2   1 
ATOM   3281 C  CD1   . ILE C 1 56  ? -12.897 45.642  77.106 1.00 36.61 ? 1085 ILE C CD1   1 
ATOM   3282 N  N     . ARG C 1 57  ? -11.456 50.628  78.641 1.00 36.74 ? 1086 ARG C N     1 
ATOM   3283 C  CA    . ARG C 1 57  ? -11.562 51.874  79.396 1.00 37.33 ? 1086 ARG C CA    1 
ATOM   3284 C  C     . ARG C 1 57  ? -12.278 52.959  78.600 1.00 38.06 ? 1086 ARG C C     1 
ATOM   3285 O  O     . ARG C 1 57  ? -12.981 53.793  79.169 1.00 39.39 ? 1086 ARG C O     1 
ATOM   3286 C  CB    . ARG C 1 57  ? -10.179 52.389  79.801 1.00 38.17 ? 1086 ARG C CB    1 
ATOM   3287 C  CG    . ARG C 1 57  ? -9.481  51.543  80.844 1.00 40.73 ? 1086 ARG C CG    1 
ATOM   3288 C  CD    . ARG C 1 57  ? -8.413  52.332  81.582 1.00 42.35 ? 1086 ARG C CD    1 
ATOM   3289 N  NE    . ARG C 1 57  ? -8.024  51.659  82.820 1.00 47.55 ? 1086 ARG C NE    1 
ATOM   3290 C  CZ    . ARG C 1 57  ? -6.923  50.929  82.966 1.00 50.15 ? 1086 ARG C CZ    1 
ATOM   3291 N  NH1   . ARG C 1 57  ? -6.079  50.778  81.950 1.00 51.77 ? 1086 ARG C NH1   1 
ATOM   3292 N  NH2   . ARG C 1 57  ? -6.669  50.340  84.128 1.00 48.31 ? 1086 ARG C NH2   1 
ATOM   3293 N  N     . ALA C 1 58  ? -12.100 52.951  77.283 1.00 37.14 ? 1087 ALA C N     1 
ATOM   3294 C  CA    . ALA C 1 58  ? -12.744 53.952  76.436 1.00 37.78 ? 1087 ALA C CA    1 
ATOM   3295 C  C     . ALA C 1 58  ? -14.255 53.729  76.354 1.00 38.33 ? 1087 ALA C C     1 
ATOM   3296 O  O     . ALA C 1 58  ? -15.020 54.681  76.190 1.00 37.05 ? 1087 ALA C O     1 
ATOM   3297 C  CB    . ALA C 1 58  ? -12.137 53.927  75.034 1.00 36.09 ? 1087 ALA C CB    1 
ATOM   3298 N  N     . MET C 1 59  ? -14.679 52.472  76.455 1.00 39.19 ? 1088 MET C N     1 
ATOM   3299 C  CA    . MET C 1 59  ? -16.101 52.150  76.398 1.00 41.11 ? 1088 MET C CA    1 
ATOM   3300 C  C     . MET C 1 59  ? -16.813 52.814  77.569 1.00 41.65 ? 1088 MET C C     1 
ATOM   3301 O  O     . MET C 1 59  ? -17.945 53.276  77.438 1.00 42.14 ? 1088 MET C O     1 
ATOM   3302 C  CB    . MET C 1 59  ? -16.313 50.631  76.450 1.00 41.84 ? 1088 MET C CB    1 
ATOM   3303 C  CG    . MET C 1 59  ? -15.917 49.891  75.172 1.00 41.09 ? 1088 MET C CG    1 
ATOM   3304 S  SD    . MET C 1 59  ? -16.132 48.095  75.301 1.00 41.67 ? 1088 MET C SD    1 
ATOM   3305 C  CE    . MET C 1 59  ? -17.914 47.951  75.032 1.00 39.27 ? 1088 MET C CE    1 
ATOM   3306 N  N     . GLY C 1 60  ? -16.135 52.864  78.711 1.00 42.37 ? 1089 GLY C N     1 
ATOM   3307 C  CA    . GLY C 1 60  ? -16.717 53.482  79.885 1.00 44.75 ? 1089 GLY C CA    1 
ATOM   3308 C  C     . GLY C 1 60  ? -16.870 54.982  79.711 1.00 46.97 ? 1089 GLY C C     1 
ATOM   3309 O  O     . GLY C 1 60  ? -17.931 55.546  79.990 1.00 48.16 ? 1089 GLY C O     1 
ATOM   3310 N  N     . ARG C 1 61  ? -15.808 55.629  79.242 1.00 47.11 ? 1090 ARG C N     1 
ATOM   3311 C  CA    . ARG C 1 61  ? -15.822 57.068  79.035 1.00 47.86 ? 1090 ARG C CA    1 
ATOM   3312 C  C     . ARG C 1 61  ? -16.738 57.500  77.895 1.00 47.88 ? 1090 ARG C C     1 
ATOM   3313 O  O     . ARG C 1 61  ? -17.398 58.533  77.991 1.00 48.99 ? 1090 ARG C O     1 
ATOM   3314 C  CB    . ARG C 1 61  ? -14.403 57.573  78.778 1.00 48.80 ? 1090 ARG C CB    1 
ATOM   3315 C  CG    . ARG C 1 61  ? -13.497 57.495  79.990 1.00 51.70 ? 1090 ARG C CG    1 
ATOM   3316 C  CD    . ARG C 1 61  ? -12.090 57.924  79.629 1.00 56.20 ? 1090 ARG C CD    1 
ATOM   3317 N  NE    . ARG C 1 61  ? -11.518 57.050  78.608 1.00 59.86 ? 1090 ARG C NE    1 
ATOM   3318 C  CZ    . ARG C 1 61  ? -10.394 57.302  77.949 1.00 60.25 ? 1090 ARG C CZ    1 
ATOM   3319 N  NH1   . ARG C 1 61  ? -9.709  58.411  78.197 1.00 62.97 ? 1090 ARG C NH1   1 
ATOM   3320 N  NH2   . ARG C 1 61  ? -9.956  56.447  77.037 1.00 60.79 ? 1090 ARG C NH2   1 
ATOM   3321 N  N     . LEU C 1 62  ? -16.781 56.719  76.820 1.00 47.43 ? 1091 LEU C N     1 
ATOM   3322 C  CA    . LEU C 1 62  ? -17.629 57.053  75.678 1.00 47.02 ? 1091 LEU C CA    1 
ATOM   3323 C  C     . LEU C 1 62  ? -19.047 56.510  75.843 1.00 48.03 ? 1091 LEU C C     1 
ATOM   3324 O  O     . LEU C 1 62  ? -19.900 56.708  74.975 1.00 47.75 ? 1091 LEU C O     1 
ATOM   3325 C  CB    . LEU C 1 62  ? -17.030 56.499  74.380 1.00 45.21 ? 1091 LEU C CB    1 
ATOM   3326 C  CG    . LEU C 1 62  ? -15.603 56.897  73.997 1.00 42.89 ? 1091 LEU C CG    1 
ATOM   3327 C  CD1   . LEU C 1 62  ? -15.295 56.364  72.605 1.00 39.61 ? 1091 LEU C CD1   1 
ATOM   3328 C  CD2   . LEU C 1 62  ? -15.452 58.410  74.031 1.00 42.51 ? 1091 LEU C CD2   1 
ATOM   3329 N  N     . LYS C 1 63  ? -19.291 55.823  76.956 1.00 49.51 ? 1092 LYS C N     1 
ATOM   3330 C  CA    . LYS C 1 63  ? -20.602 55.242  77.240 1.00 50.55 ? 1092 LYS C CA    1 
ATOM   3331 C  C     . LYS C 1 63  ? -21.058 54.277  76.142 1.00 50.25 ? 1092 LYS C C     1 
ATOM   3332 O  O     . LYS C 1 63  ? -22.132 54.441  75.557 1.00 50.08 ? 1092 LYS C O     1 
ATOM   3333 C  CB    . LYS C 1 63  ? -21.645 56.350  77.424 1.00 51.70 ? 1092 LYS C CB    1 
ATOM   3334 C  CG    . LYS C 1 63  ? -21.331 57.309  78.561 1.00 53.79 ? 1092 LYS C CG    1 
ATOM   3335 C  CD    . LYS C 1 63  ? -22.388 58.393  78.675 1.00 55.53 ? 1092 LYS C CD    1 
ATOM   3336 C  CE    . LYS C 1 63  ? -22.050 59.378  79.784 1.00 57.28 ? 1092 LYS C CE    1 
ATOM   3337 N  NZ    . LYS C 1 63  ? -23.066 60.466  79.893 1.00 58.28 ? 1092 LYS C NZ    1 
ATOM   3338 N  N     . ILE C 1 64  ? -20.236 53.271  75.862 1.00 49.27 ? 1093 ILE C N     1 
ATOM   3339 C  CA    . ILE C 1 64  ? -20.573 52.282  74.845 1.00 48.48 ? 1093 ILE C CA    1 
ATOM   3340 C  C     . ILE C 1 64  ? -20.883 50.949  75.515 1.00 48.24 ? 1093 ILE C C     1 
ATOM   3341 O  O     . ILE C 1 64  ? -20.095 50.444  76.312 1.00 47.00 ? 1093 ILE C O     1 
ATOM   3342 C  CB    . ILE C 1 64  ? -19.418 52.093  73.828 1.00 47.64 ? 1093 ILE C CB    1 
ATOM   3343 C  CG1   . ILE C 1 64  ? -19.162 53.411  73.084 1.00 47.25 ? 1093 ILE C CG1   1 
ATOM   3344 C  CG2   . ILE C 1 64  ? -19.770 50.996  72.836 1.00 44.54 ? 1093 ILE C CG2   1 
ATOM   3345 C  CD1   . ILE C 1 64  ? -18.032 53.355  72.072 1.00 45.46 ? 1093 ILE C CD1   1 
ATOM   3346 N  N     . ASP C 1 65  ? -22.049 50.396  75.195 1.00 49.44 ? 1094 ASP C N     1 
ATOM   3347 C  CA    . ASP C 1 65  ? -22.475 49.121  75.759 1.00 49.81 ? 1094 ASP C CA    1 
ATOM   3348 C  C     . ASP C 1 65  ? -21.937 47.945  74.962 1.00 48.39 ? 1094 ASP C C     1 
ATOM   3349 O  O     . ASP C 1 65  ? -21.729 48.044  73.748 1.00 47.17 ? 1094 ASP C O     1 
ATOM   3350 C  CB    . ASP C 1 65  ? -24.008 49.031  75.800 1.00 52.23 ? 1094 ASP C CB    1 
ATOM   3351 C  CG    . ASP C 1 65  ? -24.621 49.888  76.899 1.00 55.18 ? 1094 ASP C CG    1 
ATOM   3352 O  OD1   . ASP C 1 65  ? -24.149 49.806  78.053 1.00 55.20 ? 1094 ASP C OD1   1 
ATOM   3353 O  OD2   . ASP C 1 65  ? -25.585 50.631  76.612 1.00 56.63 ? 1094 ASP C OD2   1 
ATOM   3354 N  N     . PHE C 1 66  ? -21.718 46.831  75.655 1.00 47.32 ? 1095 PHE C N     1 
ATOM   3355 C  CA    . PHE C 1 66  ? -21.233 45.609  75.027 1.00 46.27 ? 1095 PHE C CA    1 
ATOM   3356 C  C     . PHE C 1 66  ? -22.326 45.053  74.116 1.00 47.38 ? 1095 PHE C C     1 
ATOM   3357 O  O     . PHE C 1 66  ? -23.512 45.211  74.393 1.00 46.52 ? 1095 PHE C O     1 
ATOM   3358 C  CB    . PHE C 1 66  ? -20.901 44.564  76.091 1.00 44.39 ? 1095 PHE C CB    1 
ATOM   3359 C  CG    . PHE C 1 66  ? -19.678 44.880  76.897 1.00 42.08 ? 1095 PHE C CG    1 
ATOM   3360 C  CD1   . PHE C 1 66  ? -18.410 44.764  76.335 1.00 40.69 ? 1095 PHE C CD1   1 
ATOM   3361 C  CD2   . PHE C 1 66  ? -19.789 45.281  78.222 1.00 40.13 ? 1095 PHE C CD2   1 
ATOM   3362 C  CE1   . PHE C 1 66  ? -17.272 45.041  77.081 1.00 39.35 ? 1095 PHE C CE1   1 
ATOM   3363 C  CE2   . PHE C 1 66  ? -18.655 45.561  78.980 1.00 39.92 ? 1095 PHE C CE2   1 
ATOM   3364 C  CZ    . PHE C 1 66  ? -17.393 45.439  78.408 1.00 39.20 ? 1095 PHE C CZ    1 
ATOM   3365 N  N     . GLY C 1 67  ? -21.924 44.408  73.028 1.00 48.90 ? 1096 GLY C N     1 
ATOM   3366 C  CA    . GLY C 1 67  ? -22.900 43.827  72.125 1.00 51.93 ? 1096 GLY C CA    1 
ATOM   3367 C  C     . GLY C 1 67  ? -23.599 42.669  72.818 1.00 53.62 ? 1096 GLY C C     1 
ATOM   3368 O  O     . GLY C 1 67  ? -24.725 42.310  72.473 1.00 53.47 ? 1096 GLY C O     1 
ATOM   3369 N  N     . ASP C 1 68  ? -22.914 42.084  73.798 1.00 54.45 ? 1097 ASP C N     1 
ATOM   3370 C  CA    . ASP C 1 68  ? -23.438 40.968  74.579 1.00 54.97 ? 1097 ASP C CA    1 
ATOM   3371 C  C     . ASP C 1 68  ? -23.207 41.234  76.058 1.00 54.45 ? 1097 ASP C C     1 
ATOM   3372 O  O     . ASP C 1 68  ? -22.065 41.341  76.505 1.00 53.62 ? 1097 ASP C O     1 
ATOM   3373 C  CB    . ASP C 1 68  ? -22.743 39.658  74.198 1.00 56.81 ? 1097 ASP C CB    1 
ATOM   3374 C  CG    . ASP C 1 68  ? -23.254 39.078  72.899 1.00 59.64 ? 1097 ASP C CG    1 
ATOM   3375 O  OD1   . ASP C 1 68  ? -22.806 37.972  72.533 1.00 62.97 ? 1097 ASP C OD1   1 
ATOM   3376 O  OD2   . ASP C 1 68  ? -24.100 39.719  72.242 1.00 62.24 ? 1097 ASP C OD2   1 
ATOM   3377 N  N     . SER C 1 69  ? -24.296 41.328  76.812 1.00 53.99 ? 1098 SER C N     1 
ATOM   3378 C  CA    . SER C 1 69  ? -24.231 41.586  78.247 1.00 53.31 ? 1098 SER C CA    1 
ATOM   3379 C  C     . SER C 1 69  ? -23.253 40.668  78.985 1.00 51.71 ? 1098 SER C C     1 
ATOM   3380 O  O     . SER C 1 69  ? -22.752 41.014  80.058 1.00 50.72 ? 1098 SER C O     1 
ATOM   3381 C  CB    . SER C 1 69  ? -25.627 41.444  78.857 1.00 54.24 ? 1098 SER C CB    1 
ATOM   3382 O  OG    . SER C 1 69  ? -25.600 41.677  80.253 1.00 57.51 ? 1098 SER C OG    1 
ATOM   3383 N  N     . ALA C 1 70  ? -22.985 39.498  78.416 1.00 50.31 ? 1099 ALA C N     1 
ATOM   3384 C  CA    . ALA C 1 70  ? -22.072 38.547  79.041 1.00 50.14 ? 1099 ALA C CA    1 
ATOM   3385 C  C     . ALA C 1 70  ? -20.617 39.022  78.978 1.00 49.97 ? 1099 ALA C C     1 
ATOM   3386 O  O     . ALA C 1 70  ? -19.794 38.635  79.806 1.00 49.93 ? 1099 ALA C O     1 
ATOM   3387 C  CB    . ALA C 1 70  ? -22.210 37.179  78.373 1.00 50.77 ? 1099 ALA C CB    1 
ATOM   3388 N  N     . ARG C 1 71  ? -20.308 39.869  78.001 1.00 49.88 ? 1100 ARG C N     1 
ATOM   3389 C  CA    . ARG C 1 71  ? -18.951 40.386  77.832 1.00 49.52 ? 1100 ARG C CA    1 
ATOM   3390 C  C     . ARG C 1 71  ? -18.469 41.211  79.027 1.00 48.51 ? 1100 ARG C C     1 
ATOM   3391 O  O     . ARG C 1 71  ? -17.266 41.375  79.227 1.00 47.83 ? 1100 ARG C O     1 
ATOM   3392 C  CB    . ARG C 1 71  ? -18.861 41.232  76.559 1.00 49.74 ? 1100 ARG C CB    1 
ATOM   3393 C  CG    . ARG C 1 71  ? -19.061 40.463  75.252 1.00 51.38 ? 1100 ARG C CG    1 
ATOM   3394 C  CD    . ARG C 1 71  ? -17.976 39.410  75.028 1.00 53.21 ? 1100 ARG C CD    1 
ATOM   3395 N  NE    . ARG C 1 71  ? -18.274 38.142  75.692 1.00 55.78 ? 1100 ARG C NE    1 
ATOM   3396 C  CZ    . ARG C 1 71  ? -19.235 37.304  75.312 1.00 56.24 ? 1100 ARG C CZ    1 
ATOM   3397 N  NH1   . ARG C 1 71  ? -19.999 37.591  74.266 1.00 56.62 ? 1100 ARG C NH1   1 
ATOM   3398 N  NH2   . ARG C 1 71  ? -19.437 36.179  75.982 1.00 57.10 ? 1100 ARG C NH2   1 
ATOM   3399 N  N     . ALA C 1 72  ? -19.405 41.727  79.818 1.00 47.57 ? 1101 ALA C N     1 
ATOM   3400 C  CA    . ALA C 1 72  ? -19.051 42.525  80.986 1.00 46.71 ? 1101 ALA C CA    1 
ATOM   3401 C  C     . ALA C 1 72  ? -18.294 41.683  82.017 1.00 46.73 ? 1101 ALA C C     1 
ATOM   3402 O  O     . ALA C 1 72  ? -17.354 42.166  82.651 1.00 45.39 ? 1101 ALA C O     1 
ATOM   3403 C  CB    . ALA C 1 72  ? -20.306 43.125  81.610 1.00 47.42 ? 1101 ALA C CB    1 
ATOM   3404 N  N     . ASP C 1 73  ? -18.703 40.427  82.185 1.00 46.95 ? 1102 ASP C N     1 
ATOM   3405 C  CA    . ASP C 1 73  ? -18.030 39.537  83.129 1.00 46.68 ? 1102 ASP C CA    1 
ATOM   3406 C  C     . ASP C 1 73  ? -16.612 39.284  82.630 1.00 45.39 ? 1102 ASP C C     1 
ATOM   3407 O  O     . ASP C 1 73  ? -15.658 39.283  83.407 1.00 43.61 ? 1102 ASP C O     1 
ATOM   3408 C  CB    . ASP C 1 73  ? -18.771 38.198  83.254 1.00 49.40 ? 1102 ASP C CB    1 
ATOM   3409 C  CG    . ASP C 1 73  ? -20.146 38.340  83.889 1.00 51.80 ? 1102 ASP C CG    1 
ATOM   3410 O  OD1   . ASP C 1 73  ? -20.251 39.023  84.933 1.00 52.28 ? 1102 ASP C OD1   1 
ATOM   3411 O  OD2   . ASP C 1 73  ? -21.116 37.756  83.352 1.00 51.79 ? 1102 ASP C OD2   1 
ATOM   3412 N  N     . ASP C 1 74  ? -16.484 39.067  81.325 1.00 44.69 ? 1103 ASP C N     1 
ATOM   3413 C  CA    . ASP C 1 74  ? -15.179 38.827  80.725 1.00 45.44 ? 1103 ASP C CA    1 
ATOM   3414 C  C     . ASP C 1 74  ? -14.269 40.034  80.958 1.00 44.33 ? 1103 ASP C C     1 
ATOM   3415 O  O     . ASP C 1 74  ? -13.100 39.884  81.313 1.00 44.01 ? 1103 ASP C O     1 
ATOM   3416 C  CB    . ASP C 1 74  ? -15.315 38.567  79.219 1.00 46.70 ? 1103 ASP C CB    1 
ATOM   3417 C  CG    . ASP C 1 74  ? -16.123 37.315  78.904 1.00 48.45 ? 1103 ASP C CG    1 
ATOM   3418 O  OD1   . ASP C 1 74  ? -15.882 36.272  79.546 1.00 50.14 ? 1103 ASP C OD1   1 
ATOM   3419 O  OD2   . ASP C 1 74  ? -16.991 37.370  78.005 1.00 48.62 ? 1103 ASP C OD2   1 
ATOM   3420 N  N     . ALA C 1 75  ? -14.819 41.230  80.767 1.00 44.25 ? 1104 ALA C N     1 
ATOM   3421 C  CA    . ALA C 1 75  ? -14.060 42.462  80.950 1.00 44.45 ? 1104 ALA C CA    1 
ATOM   3422 C  C     . ALA C 1 75  ? -13.496 42.566  82.363 1.00 45.03 ? 1104 ALA C C     1 
ATOM   3423 O  O     . ALA C 1 75  ? -12.317 42.883  82.545 1.00 44.96 ? 1104 ALA C O     1 
ATOM   3424 C  CB    . ALA C 1 75  ? -14.940 43.670  80.641 1.00 43.11 ? 1104 ALA C CB    1 
ATOM   3425 N  N     . ARG C 1 76  ? -14.336 42.308  83.363 1.00 45.70 ? 1105 ARG C N     1 
ATOM   3426 C  CA    . ARG C 1 76  ? -13.885 42.363  84.751 1.00 46.21 ? 1105 ARG C CA    1 
ATOM   3427 C  C     . ARG C 1 76  ? -12.838 41.284  84.964 1.00 44.59 ? 1105 ARG C C     1 
ATOM   3428 O  O     . ARG C 1 76  ? -11.817 41.509  85.613 1.00 44.23 ? 1105 ARG C O     1 
ATOM   3429 C  CB    . ARG C 1 76  ? -15.052 42.141  85.726 1.00 47.86 ? 1105 ARG C CB    1 
ATOM   3430 C  CG    . ARG C 1 76  ? -15.878 43.386  86.028 1.00 49.29 ? 1105 ARG C CG    1 
ATOM   3431 C  CD    . ARG C 1 76  ? -16.928 43.109  87.109 1.00 50.70 ? 1105 ARG C CD    1 
ATOM   3432 N  NE    . ARG C 1 76  ? -18.063 42.335  86.607 1.00 51.68 ? 1105 ARG C NE    1 
ATOM   3433 C  CZ    . ARG C 1 76  ? -19.020 42.827  85.827 1.00 52.56 ? 1105 ARG C CZ    1 
ATOM   3434 N  NH1   . ARG C 1 76  ? -18.991 44.099  85.453 1.00 53.49 ? 1105 ARG C NH1   1 
ATOM   3435 N  NH2   . ARG C 1 76  ? -20.011 42.047  85.416 1.00 55.14 ? 1105 ARG C NH2   1 
ATOM   3436 N  N     . GLN C 1 77  ? -13.096 40.108  84.402 1.00 45.47 ? 1106 GLN C N     1 
ATOM   3437 C  CA    . GLN C 1 77  ? -12.176 38.986  84.528 1.00 46.21 ? 1106 GLN C CA    1 
ATOM   3438 C  C     . GLN C 1 77  ? -10.798 39.324  83.940 1.00 46.98 ? 1106 GLN C C     1 
ATOM   3439 O  O     . GLN C 1 77  ? -9.765  38.976  84.527 1.00 47.10 ? 1106 GLN C O     1 
ATOM   3440 C  CB    . GLN C 1 77  ? -12.767 37.750  83.837 1.00 46.87 ? 1106 GLN C CB    1 
ATOM   3441 C  CG    . GLN C 1 77  ? -11.964 36.475  84.040 1.00 49.16 ? 1106 GLN C CG    1 
ATOM   3442 C  CD    . GLN C 1 77  ? -12.665 35.241  83.491 1.00 52.23 ? 1106 GLN C CD    1 
ATOM   3443 O  OE1   . GLN C 1 77  ? -12.138 34.126  83.569 1.00 53.00 ? 1106 GLN C OE1   1 
ATOM   3444 N  NE2   . GLN C 1 77  ? -13.860 35.433  82.935 1.00 52.49 ? 1106 GLN C NE2   1 
ATOM   3445 N  N     . LEU C 1 78  ? -10.789 40.007  82.793 1.00 45.49 ? 1107 LEU C N     1 
ATOM   3446 C  CA    . LEU C 1 78  ? -9.543  40.395  82.128 1.00 44.63 ? 1107 LEU C CA    1 
ATOM   3447 C  C     . LEU C 1 78  ? -8.548  40.990  83.109 1.00 44.52 ? 1107 LEU C C     1 
ATOM   3448 O  O     . LEU C 1 78  ? -7.402  40.546  83.192 1.00 44.20 ? 1107 LEU C O     1 
ATOM   3449 C  CB    . LEU C 1 78  ? -9.818  41.418  81.018 1.00 44.15 ? 1107 LEU C CB    1 
ATOM   3450 C  CG    . LEU C 1 78  ? -8.584  42.068  80.372 1.00 43.41 ? 1107 LEU C CG    1 
ATOM   3451 C  CD1   . LEU C 1 78  ? -7.731  40.998  79.709 1.00 43.07 ? 1107 LEU C CD1   1 
ATOM   3452 C  CD2   . LEU C 1 78  ? -9.015  43.112  79.351 1.00 42.35 ? 1107 LEU C CD2   1 
ATOM   3453 N  N     . PHE C 1 79  ? -8.995  42.000  83.847 1.00 45.60 ? 1108 PHE C N     1 
ATOM   3454 C  CA    . PHE C 1 79  ? -8.155  42.673  84.828 1.00 46.94 ? 1108 PHE C CA    1 
ATOM   3455 C  C     . PHE C 1 79  ? -7.621  41.726  85.893 1.00 48.63 ? 1108 PHE C C     1 
ATOM   3456 O  O     . PHE C 1 79  ? -6.493  41.893  86.361 1.00 49.30 ? 1108 PHE C O     1 
ATOM   3457 C  CB    . PHE C 1 79  ? -8.935  43.814  85.475 1.00 46.79 ? 1108 PHE C CB    1 
ATOM   3458 C  CG    . PHE C 1 79  ? -9.135  44.991  84.564 1.00 47.41 ? 1108 PHE C CG    1 
ATOM   3459 C  CD1   . PHE C 1 79  ? -8.147  45.963  84.441 1.00 46.15 ? 1108 PHE C CD1   1 
ATOM   3460 C  CD2   . PHE C 1 79  ? -10.295 45.111  83.806 1.00 46.02 ? 1108 PHE C CD2   1 
ATOM   3461 C  CE1   . PHE C 1 79  ? -8.310  47.041  83.574 1.00 47.77 ? 1108 PHE C CE1   1 
ATOM   3462 C  CE2   . PHE C 1 79  ? -10.469 46.182  82.936 1.00 46.64 ? 1108 PHE C CE2   1 
ATOM   3463 C  CZ    . PHE C 1 79  ? -9.474  47.151  82.818 1.00 47.10 ? 1108 PHE C CZ    1 
ATOM   3464 N  N     . VAL C 1 80  ? -8.420  40.734  86.278 1.00 49.36 ? 1109 VAL C N     1 
ATOM   3465 C  CA    . VAL C 1 80  ? -7.973  39.771  87.278 1.00 50.92 ? 1109 VAL C CA    1 
ATOM   3466 C  C     . VAL C 1 80  ? -6.903  38.867  86.673 1.00 51.35 ? 1109 VAL C C     1 
ATOM   3467 O  O     . VAL C 1 80  ? -5.811  38.740  87.224 1.00 50.37 ? 1109 VAL C O     1 
ATOM   3468 C  CB    . VAL C 1 80  ? -9.131  38.891  87.800 1.00 51.27 ? 1109 VAL C CB    1 
ATOM   3469 C  CG1   . VAL C 1 80  ? -8.579  37.780  88.689 1.00 50.48 ? 1109 VAL C CG1   1 
ATOM   3470 C  CG2   . VAL C 1 80  ? -10.120 39.743  88.587 1.00 51.97 ? 1109 VAL C CG2   1 
ATOM   3471 N  N     . LEU C 1 81  ? -7.222  38.245  85.539 1.00 52.37 ? 1110 LEU C N     1 
ATOM   3472 C  CA    . LEU C 1 81  ? -6.280  37.360  84.860 1.00 53.88 ? 1110 LEU C CA    1 
ATOM   3473 C  C     . LEU C 1 81  ? -4.975  38.088  84.540 1.00 55.34 ? 1110 LEU C C     1 
ATOM   3474 O  O     . LEU C 1 81  ? -3.891  37.589  84.840 1.00 55.09 ? 1110 LEU C O     1 
ATOM   3475 C  CB    . LEU C 1 81  ? -6.897  36.819  83.569 1.00 53.79 ? 1110 LEU C CB    1 
ATOM   3476 C  CG    . LEU C 1 81  ? -8.119  35.911  83.726 1.00 55.07 ? 1110 LEU C CG    1 
ATOM   3477 C  CD1   . LEU C 1 81  ? -8.701  35.588  82.361 1.00 56.48 ? 1110 LEU C CD1   1 
ATOM   3478 C  CD2   . LEU C 1 81  ? -7.718  34.635  84.449 1.00 55.51 ? 1110 LEU C CD2   1 
ATOM   3479 N  N     . ALA C 1 82  ? -5.083  39.268  83.935 1.00 56.90 ? 1111 ALA C N     1 
ATOM   3480 C  CA    . ALA C 1 82  ? -3.906  40.058  83.584 1.00 59.40 ? 1111 ALA C CA    1 
ATOM   3481 C  C     . ALA C 1 82  ? -3.043  40.311  84.815 1.00 60.84 ? 1111 ALA C C     1 
ATOM   3482 O  O     . ALA C 1 82  ? -1.817  40.213  84.759 1.00 61.20 ? 1111 ALA C O     1 
ATOM   3483 C  CB    . ALA C 1 82  ? -4.330  41.391  82.963 1.00 57.99 ? 1111 ALA C CB    1 
ATOM   3484 N  N     . GLY C 1 83  ? -3.690  40.636  85.929 1.00 62.37 ? 1112 GLY C N     1 
ATOM   3485 C  CA    . GLY C 1 83  ? -2.958  40.896  87.153 1.00 64.26 ? 1112 GLY C CA    1 
ATOM   3486 C  C     . GLY C 1 83  ? -2.398  39.639  87.792 1.00 65.36 ? 1112 GLY C C     1 
ATOM   3487 O  O     . GLY C 1 83  ? -1.585  39.718  88.711 1.00 65.90 ? 1112 GLY C O     1 
ATOM   3488 N  N     . ALA C 1 84  ? -2.826  38.479  87.302 1.00 66.45 ? 1113 ALA C N     1 
ATOM   3489 C  CA    . ALA C 1 84  ? -2.371  37.199  87.841 1.00 67.08 ? 1113 ALA C CA    1 
ATOM   3490 C  C     . ALA C 1 84  ? -1.501  36.443  86.844 1.00 67.21 ? 1113 ALA C C     1 
ATOM   3491 O  O     . ALA C 1 84  ? -0.880  35.435  87.187 1.00 67.04 ? 1113 ALA C O     1 
ATOM   3492 C  CB    . ALA C 1 84  ? -3.577  36.343  88.234 1.00 67.00 ? 1113 ALA C CB    1 
ATOM   3493 N  N     . ALA C 1 85  ? -1.463  36.932  85.609 1.00 67.31 ? 1114 ALA C N     1 
ATOM   3494 C  CA    . ALA C 1 85  ? -0.673  36.300  84.561 1.00 67.12 ? 1114 ALA C CA    1 
ATOM   3495 C  C     . ALA C 1 85  ? 0.813   36.317  84.905 1.00 67.10 ? 1114 ALA C C     1 
ATOM   3496 O  O     . ALA C 1 85  ? 1.249   37.043  85.801 1.00 66.21 ? 1114 ALA C O     1 
ATOM   3497 C  CB    . ALA C 1 85  ? -0.907  37.011  83.231 1.00 66.45 ? 1114 ALA C CB    1 
ATOM   3498 N  N     . GLU C 1 86  ? 1.583   35.506  84.188 1.00 67.19 ? 1115 GLU C N     1 
ATOM   3499 C  CA    . GLU C 1 86  ? 3.021   35.430  84.394 1.00 66.91 ? 1115 GLU C CA    1 
ATOM   3500 C  C     . GLU C 1 86  ? 3.690   35.835  83.084 1.00 65.39 ? 1115 GLU C C     1 
ATOM   3501 O  O     . GLU C 1 86  ? 3.487   35.199  82.049 1.00 64.78 ? 1115 GLU C O     1 
ATOM   3502 C  CB    . GLU C 1 86  ? 3.412   34.006  84.800 1.00 68.95 ? 1115 GLU C CB    1 
ATOM   3503 C  CG    . GLU C 1 86  ? 2.627   33.503  86.015 1.00 72.38 ? 1115 GLU C CG    1 
ATOM   3504 C  CD    . GLU C 1 86  ? 3.033   32.110  86.466 1.00 73.92 ? 1115 GLU C CD    1 
ATOM   3505 O  OE1   . GLU C 1 86  ? 3.033   31.184  85.624 1.00 75.05 ? 1115 GLU C OE1   1 
ATOM   3506 O  OE2   . GLU C 1 86  ? 3.342   31.942  87.668 1.00 74.62 ? 1115 GLU C OE2   1 
ATOM   3507 N  N     . GLU C 1 87  ? 4.478   36.906  83.139 1.00 64.07 ? 1116 GLU C N     1 
ATOM   3508 C  CA    . GLU C 1 87  ? 5.159   37.433  81.962 1.00 62.55 ? 1116 GLU C CA    1 
ATOM   3509 C  C     . GLU C 1 87  ? 5.832   36.394  81.078 1.00 60.38 ? 1116 GLU C C     1 
ATOM   3510 O  O     . GLU C 1 87  ? 6.497   35.477  81.557 1.00 59.06 ? 1116 GLU C O     1 
ATOM   3511 C  CB    . GLU C 1 87  ? 6.175   38.492  82.379 1.00 64.66 ? 1116 GLU C CB    1 
ATOM   3512 C  CG    . GLU C 1 87  ? 5.536   39.658  83.103 1.00 68.12 ? 1116 GLU C CG    1 
ATOM   3513 C  CD    . GLU C 1 87  ? 6.400   40.896  83.088 1.00 70.15 ? 1116 GLU C CD    1 
ATOM   3514 O  OE1   . GLU C 1 87  ? 7.552   40.826  83.567 1.00 70.95 ? 1116 GLU C OE1   1 
ATOM   3515 O  OE2   . GLU C 1 87  ? 5.920   41.939  82.595 1.00 71.91 ? 1116 GLU C OE2   1 
ATOM   3516 N  N     . GLY C 1 88  ? 5.648   36.556  79.772 1.00 58.24 ? 1117 GLY C N     1 
ATOM   3517 C  CA    . GLY C 1 88  ? 6.228   35.628  78.824 1.00 55.99 ? 1117 GLY C CA    1 
ATOM   3518 C  C     . GLY C 1 88  ? 5.329   34.430  78.597 1.00 54.69 ? 1117 GLY C C     1 
ATOM   3519 O  O     . GLY C 1 88  ? 5.700   33.501  77.886 1.00 55.07 ? 1117 GLY C O     1 
ATOM   3520 N  N     . PHE C 1 89  ? 4.142   34.449  79.195 1.00 53.59 ? 1118 PHE C N     1 
ATOM   3521 C  CA    . PHE C 1 89  ? 3.205   33.343  79.049 1.00 52.93 ? 1118 PHE C CA    1 
ATOM   3522 C  C     . PHE C 1 89  ? 1.750   33.771  79.201 1.00 52.04 ? 1118 PHE C C     1 
ATOM   3523 O  O     . PHE C 1 89  ? 1.391   34.479  80.143 1.00 52.23 ? 1118 PHE C O     1 
ATOM   3524 C  CB    . PHE C 1 89  ? 3.521   32.251  80.079 1.00 54.36 ? 1118 PHE C CB    1 
ATOM   3525 C  CG    . PHE C 1 89  ? 2.512   31.137  80.113 1.00 53.99 ? 1118 PHE C CG    1 
ATOM   3526 C  CD1   . PHE C 1 89  ? 2.322   30.317  79.005 1.00 54.63 ? 1118 PHE C CD1   1 
ATOM   3527 C  CD2   . PHE C 1 89  ? 1.743   30.915  81.253 1.00 54.89 ? 1118 PHE C CD2   1 
ATOM   3528 C  CE1   . PHE C 1 89  ? 1.377   29.289  79.028 1.00 55.15 ? 1118 PHE C CE1   1 
ATOM   3529 C  CE2   . PHE C 1 89  ? 0.793   29.890  81.288 1.00 55.06 ? 1118 PHE C CE2   1 
ATOM   3530 C  CZ    . PHE C 1 89  ? 0.611   29.076  80.172 1.00 54.78 ? 1118 PHE C CZ    1 
ATOM   3531 N  N     . MET C 1 90  ? 0.916   33.325  78.269 1.00 50.42 ? 1119 MET C N     1 
ATOM   3532 C  CA    . MET C 1 90  ? -0.508  33.641  78.299 1.00 49.99 ? 1119 MET C CA    1 
ATOM   3533 C  C     . MET C 1 90  ? -1.306  32.343  78.459 1.00 48.80 ? 1119 MET C C     1 
ATOM   3534 O  O     . MET C 1 90  ? -1.196  31.429  77.638 1.00 47.43 ? 1119 MET C O     1 
ATOM   3535 C  CB    . MET C 1 90  ? -0.918  34.356  77.007 1.00 49.14 ? 1119 MET C CB    1 
ATOM   3536 C  CG    . MET C 1 90  ? -2.348  34.867  77.011 1.00 49.03 ? 1119 MET C CG    1 
ATOM   3537 S  SD    . MET C 1 90  ? -2.757  35.762  75.497 1.00 49.37 ? 1119 MET C SD    1 
ATOM   3538 C  CE    . MET C 1 90  ? -1.974  37.355  75.823 1.00 48.24 ? 1119 MET C CE    1 
ATOM   3539 N  N     . THR C 1 91  ? -2.104  32.269  79.520 1.00 48.47 ? 1120 THR C N     1 
ATOM   3540 C  CA    . THR C 1 91  ? -2.902  31.079  79.797 1.00 48.51 ? 1120 THR C CA    1 
ATOM   3541 C  C     . THR C 1 91  ? -4.009  30.900  78.770 1.00 48.13 ? 1120 THR C C     1 
ATOM   3542 O  O     . THR C 1 91  ? -4.510  31.872  78.206 1.00 49.37 ? 1120 THR C O     1 
ATOM   3543 C  CB    . THR C 1 91  ? -3.534  31.149  81.198 1.00 49.52 ? 1120 THR C CB    1 
ATOM   3544 O  OG1   . THR C 1 91  ? -4.578  32.132  81.207 1.00 51.65 ? 1120 THR C OG1   1 
ATOM   3545 C  CG2   . THR C 1 91  ? -2.482  31.529  82.234 1.00 48.59 ? 1120 THR C CG2   1 
ATOM   3546 N  N     . ALA C 1 92  ? -4.388  29.653  78.522 1.00 47.87 ? 1121 ALA C N     1 
ATOM   3547 C  CA    . ALA C 1 92  ? -5.437  29.365  77.554 1.00 46.58 ? 1121 ALA C CA    1 
ATOM   3548 C  C     . ALA C 1 92  ? -6.692  30.173  77.867 1.00 46.21 ? 1121 ALA C C     1 
ATOM   3549 O  O     . ALA C 1 92  ? -7.359  30.669  76.963 1.00 45.52 ? 1121 ALA C O     1 
ATOM   3550 C  CB    . ALA C 1 92  ? -5.756  27.871  77.551 1.00 46.95 ? 1121 ALA C CB    1 
ATOM   3551 N  N     . GLU C 1 93  ? -7.007  30.320  79.149 1.00 45.93 ? 1122 GLU C N     1 
ATOM   3552 C  CA    . GLU C 1 93  ? -8.199  31.067  79.531 1.00 46.59 ? 1122 GLU C CA    1 
ATOM   3553 C  C     . GLU C 1 93  ? -8.097  32.564  79.242 1.00 45.44 ? 1122 GLU C C     1 
ATOM   3554 O  O     . GLU C 1 93  ? -9.080  33.186  78.831 1.00 44.57 ? 1122 GLU C O     1 
ATOM   3555 C  CB    . GLU C 1 93  ? -8.524  30.853  81.010 1.00 48.12 ? 1122 GLU C CB    1 
ATOM   3556 C  CG    . GLU C 1 93  ? -9.831  31.521  81.421 1.00 52.92 ? 1122 GLU C CG    1 
ATOM   3557 C  CD    . GLU C 1 93  ? -10.205 31.263  82.866 1.00 54.87 ? 1122 GLU C CD    1 
ATOM   3558 O  OE1   . GLU C 1 93  ? -9.396  31.594  83.763 1.00 55.05 ? 1122 GLU C OE1   1 
ATOM   3559 O  OE2   . GLU C 1 93  ? -11.313 30.733  83.100 1.00 56.19 ? 1122 GLU C OE2   1 
ATOM   3560 N  N     . LEU C 1 94  ? -6.920  33.146  79.463 1.00 43.45 ? 1123 LEU C N     1 
ATOM   3561 C  CA    . LEU C 1 94  ? -6.733  34.568  79.201 1.00 41.67 ? 1123 LEU C CA    1 
ATOM   3562 C  C     . LEU C 1 94  ? -6.908  34.836  77.709 1.00 40.78 ? 1123 LEU C C     1 
ATOM   3563 O  O     . LEU C 1 94  ? -7.584  35.786  77.312 1.00 41.68 ? 1123 LEU C O     1 
ATOM   3564 C  CB    . LEU C 1 94  ? -5.341  35.032  79.659 1.00 41.01 ? 1123 LEU C CB    1 
ATOM   3565 C  CG    . LEU C 1 94  ? -4.980  36.496  79.355 1.00 39.66 ? 1123 LEU C CG    1 
ATOM   3566 C  CD1   . LEU C 1 94  ? -6.124  37.414  79.753 1.00 38.13 ? 1123 LEU C CD1   1 
ATOM   3567 C  CD2   . LEU C 1 94  ? -3.706  36.874  80.096 1.00 38.45 ? 1123 LEU C CD2   1 
ATOM   3568 N  N     . ALA C 1 95  ? -6.303  33.989  76.884 1.00 39.23 ? 1124 ALA C N     1 
ATOM   3569 C  CA    . ALA C 1 95  ? -6.414  34.143  75.442 1.00 38.90 ? 1124 ALA C CA    1 
ATOM   3570 C  C     . ALA C 1 95  ? -7.891  34.158  75.039 1.00 39.10 ? 1124 ALA C C     1 
ATOM   3571 O  O     . ALA C 1 95  ? -8.324  35.009  74.259 1.00 38.70 ? 1124 ALA C O     1 
ATOM   3572 C  CB    . ALA C 1 95  ? -5.682  33.003  74.738 1.00 36.72 ? 1124 ALA C CB    1 
ATOM   3573 N  N     . GLY C 1 96  ? -8.660  33.216  75.584 1.00 38.42 ? 1125 GLY C N     1 
ATOM   3574 C  CA    . GLY C 1 96  ? -10.077 33.130  75.269 1.00 36.70 ? 1125 GLY C CA    1 
ATOM   3575 C  C     . GLY C 1 96  ? -10.862 34.360  75.678 1.00 36.88 ? 1125 GLY C C     1 
ATOM   3576 O  O     . GLY C 1 96  ? -11.726 34.834  74.935 1.00 38.49 ? 1125 GLY C O     1 
ATOM   3577 N  N     . VAL C 1 97  ? -10.569 34.875  76.867 1.00 35.68 ? 1126 VAL C N     1 
ATOM   3578 C  CA    . VAL C 1 97  ? -11.239 36.064  77.373 1.00 34.74 ? 1126 VAL C CA    1 
ATOM   3579 C  C     . VAL C 1 97  ? -10.960 37.260  76.453 1.00 34.77 ? 1126 VAL C C     1 
ATOM   3580 O  O     . VAL C 1 97  ? -11.872 37.985  76.069 1.00 33.93 ? 1126 VAL C O     1 
ATOM   3581 C  CB    . VAL C 1 97  ? -10.764 36.386  78.808 1.00 33.40 ? 1126 VAL C CB    1 
ATOM   3582 C  CG1   . VAL C 1 97  ? -11.248 37.755  79.234 1.00 31.72 ? 1126 VAL C CG1   1 
ATOM   3583 C  CG2   . VAL C 1 97  ? -11.289 35.334  79.763 1.00 35.44 ? 1126 VAL C CG2   1 
ATOM   3584 N  N     . ILE C 1 98  ? -9.696  37.460  76.099 1.00 35.05 ? 1127 ILE C N     1 
ATOM   3585 C  CA    . ILE C 1 98  ? -9.338  38.562  75.218 1.00 33.93 ? 1127 ILE C CA    1 
ATOM   3586 C  C     . ILE C 1 98  ? -10.066 38.403  73.885 1.00 33.99 ? 1127 ILE C C     1 
ATOM   3587 O  O     . ILE C 1 98  ? -10.590 39.372  73.336 1.00 32.29 ? 1127 ILE C O     1 
ATOM   3588 C  CB    . ILE C 1 98  ? -7.816  38.604  74.955 1.00 33.92 ? 1127 ILE C CB    1 
ATOM   3589 C  CG1   . ILE C 1 98  ? -7.071  38.867  76.269 1.00 33.72 ? 1127 ILE C CG1   1 
ATOM   3590 C  CG2   . ILE C 1 98  ? -7.495  39.689  73.929 1.00 32.23 ? 1127 ILE C CG2   1 
ATOM   3591 C  CD1   . ILE C 1 98  ? -5.566  38.743  76.156 1.00 31.39 ? 1127 ILE C CD1   1 
ATOM   3592 N  N     . LYS C 1 99  ? -10.106 37.169  73.390 1.00 34.32 ? 1128 LYS C N     1 
ATOM   3593 C  CA    . LYS C 1 99  ? -10.745 36.852  72.118 1.00 36.46 ? 1128 LYS C CA    1 
ATOM   3594 C  C     . LYS C 1 99  ? -12.232 37.224  72.111 1.00 36.90 ? 1128 LYS C C     1 
ATOM   3595 O  O     . LYS C 1 99  ? -12.716 37.866  71.177 1.00 36.76 ? 1128 LYS C O     1 
ATOM   3596 C  CB    . LYS C 1 99  ? -10.570 35.358  71.813 1.00 37.72 ? 1128 LYS C CB    1 
ATOM   3597 C  CG    . LYS C 1 99  ? -10.795 34.964  70.362 1.00 38.87 ? 1128 LYS C CG    1 
ATOM   3598 C  CD    . LYS C 1 99  ? -9.671  35.463  69.473 1.00 42.85 ? 1128 LYS C CD    1 
ATOM   3599 C  CE    . LYS C 1 99  ? -9.959  35.213  67.997 1.00 41.65 ? 1128 LYS C CE    1 
ATOM   3600 N  NZ    . LYS C 1 99  ? -10.058 33.771  67.659 1.00 46.05 ? 1128 LYS C NZ    1 
ATOM   3601 N  N     . ARG C 1 100 ? -12.956 36.831  73.152 1.00 37.27 ? 1129 ARG C N     1 
ATOM   3602 C  CA    . ARG C 1 100 ? -14.381 37.144  73.223 1.00 37.23 ? 1129 ARG C CA    1 
ATOM   3603 C  C     . ARG C 1 100 ? -14.616 38.646  73.197 1.00 36.02 ? 1129 ARG C C     1 
ATOM   3604 O  O     . ARG C 1 100 ? -15.526 39.129  72.520 1.00 34.82 ? 1129 ARG C O     1 
ATOM   3605 C  CB    . ARG C 1 100 ? -15.010 36.569  74.500 1.00 37.93 ? 1129 ARG C CB    1 
ATOM   3606 C  CG    . ARG C 1 100 ? -15.077 35.054  74.556 1.00 38.85 ? 1129 ARG C CG    1 
ATOM   3607 C  CD    . ARG C 1 100 ? -15.781 34.608  75.832 1.00 39.29 ? 1129 ARG C CD    1 
ATOM   3608 N  NE    . ARG C 1 100 ? -15.159 33.409  76.371 1.00 41.17 ? 1129 ARG C NE    1 
ATOM   3609 C  CZ    . ARG C 1 100 ? -14.649 33.315  77.592 1.00 41.17 ? 1129 ARG C CZ    1 
ATOM   3610 N  NH1   . ARG C 1 100 ? -14.690 34.354  78.417 1.00 38.16 ? 1129 ARG C NH1   1 
ATOM   3611 N  NH2   . ARG C 1 100 ? -14.083 32.180  77.980 1.00 44.04 ? 1129 ARG C NH2   1 
ATOM   3612 N  N     . LEU C 1 101 ? -13.801 39.377  73.951 1.00 34.96 ? 1130 LEU C N     1 
ATOM   3613 C  CA    . LEU C 1 101 ? -13.926 40.829  74.022 1.00 35.16 ? 1130 LEU C CA    1 
ATOM   3614 C  C     . LEU C 1 101 ? -13.654 41.473  72.663 1.00 35.25 ? 1130 LEU C C     1 
ATOM   3615 O  O     . LEU C 1 101 ? -14.471 42.245  72.163 1.00 36.23 ? 1130 LEU C O     1 
ATOM   3616 C  CB    . LEU C 1 101 ? -12.963 41.387  75.081 1.00 32.79 ? 1130 LEU C CB    1 
ATOM   3617 C  CG    . LEU C 1 101 ? -13.295 41.038  76.541 1.00 34.58 ? 1130 LEU C CG    1 
ATOM   3618 C  CD1   . LEU C 1 101 ? -12.121 41.379  77.452 1.00 32.20 ? 1130 LEU C CD1   1 
ATOM   3619 C  CD2   . LEU C 1 101 ? -14.545 41.797  76.977 1.00 32.55 ? 1130 LEU C CD2   1 
ATOM   3620 N  N     . TRP C 1 102 ? -12.519 41.130  72.061 1.00 34.38 ? 1131 TRP C N     1 
ATOM   3621 C  CA    . TRP C 1 102 ? -12.127 41.680  70.765 1.00 35.30 ? 1131 TRP C CA    1 
ATOM   3622 C  C     . TRP C 1 102 ? -13.154 41.393  69.677 1.00 36.86 ? 1131 TRP C C     1 
ATOM   3623 O  O     . TRP C 1 102 ? -13.313 42.184  68.747 1.00 37.90 ? 1131 TRP C O     1 
ATOM   3624 C  CB    . TRP C 1 102 ? -10.760 41.117  70.354 1.00 31.92 ? 1131 TRP C CB    1 
ATOM   3625 C  CG    . TRP C 1 102 ? -10.234 41.610  69.026 1.00 29.67 ? 1131 TRP C CG    1 
ATOM   3626 C  CD1   . TRP C 1 102 ? -9.816  40.838  67.980 1.00 28.77 ? 1131 TRP C CD1   1 
ATOM   3627 C  CD2   . TRP C 1 102 ? -10.004 42.972  68.633 1.00 27.04 ? 1131 TRP C CD2   1 
ATOM   3628 N  NE1   . TRP C 1 102 ? -9.337  41.627  66.964 1.00 28.66 ? 1131 TRP C NE1   1 
ATOM   3629 C  CE2   . TRP C 1 102 ? -9.439  42.942  67.337 1.00 27.51 ? 1131 TRP C CE2   1 
ATOM   3630 C  CE3   . TRP C 1 102 ? -10.217 44.215  69.252 1.00 27.21 ? 1131 TRP C CE3   1 
ATOM   3631 C  CZ2   . TRP C 1 102 ? -9.084  44.107  66.643 1.00 25.42 ? 1131 TRP C CZ2   1 
ATOM   3632 C  CZ3   . TRP C 1 102 ? -9.864  45.377  68.563 1.00 24.45 ? 1131 TRP C CZ3   1 
ATOM   3633 C  CH2   . TRP C 1 102 ? -9.303  45.311  67.269 1.00 24.81 ? 1131 TRP C CH2   1 
ATOM   3634 N  N     . LYS C 1 103 ? -13.853 40.268  69.798 1.00 38.42 ? 1132 LYS C N     1 
ATOM   3635 C  CA    . LYS C 1 103 ? -14.861 39.880  68.814 1.00 39.86 ? 1132 LYS C CA    1 
ATOM   3636 C  C     . LYS C 1 103 ? -16.200 40.580  69.038 1.00 39.21 ? 1132 LYS C C     1 
ATOM   3637 O  O     . LYS C 1 103 ? -16.980 40.755  68.102 1.00 39.21 ? 1132 LYS C O     1 
ATOM   3638 C  CB    . LYS C 1 103 ? -15.071 38.360  68.843 1.00 42.53 ? 1132 LYS C CB    1 
ATOM   3639 C  CG    . LYS C 1 103 ? -13.869 37.532  68.392 1.00 46.32 ? 1132 LYS C CG    1 
ATOM   3640 C  CD    . LYS C 1 103 ? -13.620 37.652  66.891 1.00 48.80 ? 1132 LYS C CD    1 
ATOM   3641 C  CE    . LYS C 1 103 ? -12.508 36.702  66.438 1.00 50.92 ? 1132 LYS C CE    1 
ATOM   3642 N  NZ    . LYS C 1 103 ? -12.318 36.651  64.948 1.00 51.89 ? 1132 LYS C NZ    1 
ATOM   3643 N  N     . ASP C 1 104 ? -16.457 40.978  70.279 1.00 38.87 ? 1133 ASP C N     1 
ATOM   3644 C  CA    . ASP C 1 104 ? -17.701 41.653  70.644 1.00 40.63 ? 1133 ASP C CA    1 
ATOM   3645 C  C     . ASP C 1 104 ? -18.026 42.859  69.753 1.00 42.59 ? 1133 ASP C C     1 
ATOM   3646 O  O     . ASP C 1 104 ? -17.153 43.674  69.447 1.00 42.14 ? 1133 ASP C O     1 
ATOM   3647 C  CB    . ASP C 1 104 ? -17.631 42.103  72.105 1.00 41.46 ? 1133 ASP C CB    1 
ATOM   3648 C  CG    . ASP C 1 104 ? -18.918 42.738  72.576 1.00 44.65 ? 1133 ASP C CG    1 
ATOM   3649 O  OD1   . ASP C 1 104 ? -19.938 42.019  72.645 1.00 48.22 ? 1133 ASP C OD1   1 
ATOM   3650 O  OD2   . ASP C 1 104 ? -18.915 43.954  72.870 1.00 45.16 ? 1133 ASP C OD2   1 
ATOM   3651 N  N     . SER C 1 105 ? -19.293 42.975  69.356 1.00 43.25 ? 1134 SER C N     1 
ATOM   3652 C  CA    . SER C 1 105 ? -19.740 44.065  68.494 1.00 43.24 ? 1134 SER C CA    1 
ATOM   3653 C  C     . SER C 1 105 ? -19.590 45.434  69.160 1.00 43.59 ? 1134 SER C C     1 
ATOM   3654 O  O     . SER C 1 105 ? -19.350 46.439  68.488 1.00 43.69 ? 1134 SER C O     1 
ATOM   3655 C  CB    . SER C 1 105 ? -21.200 43.848  68.082 1.00 44.20 ? 1134 SER C CB    1 
ATOM   3656 O  OG    . SER C 1 105 ? -22.056 43.884  69.212 1.00 47.62 ? 1134 SER C OG    1 
ATOM   3657 N  N     . GLY C 1 106 ? -19.741 45.473  70.479 1.00 42.61 ? 1135 GLY C N     1 
ATOM   3658 C  CA    . GLY C 1 106 ? -19.592 46.728  71.192 1.00 41.84 ? 1135 GLY C CA    1 
ATOM   3659 C  C     . GLY C 1 106 ? -18.131 47.152  71.214 1.00 41.30 ? 1135 GLY C C     1 
ATOM   3660 O  O     . GLY C 1 106 ? -17.780 48.251  70.773 1.00 41.36 ? 1135 GLY C O     1 
ATOM   3661 N  N     . VAL C 1 107 ? -17.277 46.274  71.730 1.00 39.50 ? 1136 VAL C N     1 
ATOM   3662 C  CA    . VAL C 1 107 ? -15.850 46.545  71.804 1.00 36.93 ? 1136 VAL C CA    1 
ATOM   3663 C  C     . VAL C 1 107 ? -15.340 47.023  70.447 1.00 36.22 ? 1136 VAL C C     1 
ATOM   3664 O  O     . VAL C 1 107 ? -14.527 47.941  70.369 1.00 34.16 ? 1136 VAL C O     1 
ATOM   3665 C  CB    . VAL C 1 107 ? -15.075 45.286  72.222 1.00 35.81 ? 1136 VAL C CB    1 
ATOM   3666 C  CG1   . VAL C 1 107 ? -13.574 45.535  72.126 1.00 36.03 ? 1136 VAL C CG1   1 
ATOM   3667 C  CG2   . VAL C 1 107 ? -15.459 44.901  73.640 1.00 36.13 ? 1136 VAL C CG2   1 
ATOM   3668 N  N     . GLN C 1 108 ? -15.824 46.398  69.381 1.00 36.03 ? 1137 GLN C N     1 
ATOM   3669 C  CA    . GLN C 1 108 ? -15.414 46.784  68.040 1.00 37.29 ? 1137 GLN C CA    1 
ATOM   3670 C  C     . GLN C 1 108 ? -15.948 48.174  67.691 1.00 37.40 ? 1137 GLN C C     1 
ATOM   3671 O  O     . GLN C 1 108 ? -15.306 48.922  66.959 1.00 39.44 ? 1137 GLN C O     1 
ATOM   3672 C  CB    . GLN C 1 108 ? -15.899 45.752  67.016 1.00 37.60 ? 1137 GLN C CB    1 
ATOM   3673 C  CG    . GLN C 1 108 ? -15.053 44.489  66.982 1.00 35.64 ? 1137 GLN C CG    1 
ATOM   3674 C  CD    . GLN C 1 108 ? -13.611 44.779  66.596 1.00 36.83 ? 1137 GLN C CD    1 
ATOM   3675 O  OE1   . GLN C 1 108 ? -13.349 45.401  65.571 1.00 34.28 ? 1137 GLN C OE1   1 
ATOM   3676 N  NE2   . GLN C 1 108 ? -12.670 44.327  67.418 1.00 34.21 ? 1137 GLN C NE2   1 
ATOM   3677 N  N     . ALA C 1 109 ? -17.120 48.518  68.214 1.00 36.53 ? 1138 ALA C N     1 
ATOM   3678 C  CA    . ALA C 1 109 ? -17.693 49.830  67.955 1.00 35.68 ? 1138 ALA C CA    1 
ATOM   3679 C  C     . ALA C 1 109 ? -16.755 50.865  68.564 1.00 35.29 ? 1138 ALA C C     1 
ATOM   3680 O  O     . ALA C 1 109 ? -16.483 51.906  67.969 1.00 35.60 ? 1138 ALA C O     1 
ATOM   3681 C  CB    . ALA C 1 109 ? -19.078 49.939  68.590 1.00 36.15 ? 1138 ALA C CB    1 
ATOM   3682 N  N     . CYS C 1 110 ? -16.268 50.569  69.763 1.00 33.46 ? 1139 CYS C N     1 
ATOM   3683 C  CA    . CYS C 1 110 ? -15.355 51.466  70.449 1.00 32.90 ? 1139 CYS C CA    1 
ATOM   3684 C  C     . CYS C 1 110 ? -14.019 51.516  69.711 1.00 31.59 ? 1139 CYS C C     1 
ATOM   3685 O  O     . CYS C 1 110 ? -13.399 52.574  69.613 1.00 30.03 ? 1139 CYS C O     1 
ATOM   3686 C  CB    . CYS C 1 110 ? -15.131 50.996  71.884 1.00 33.38 ? 1139 CYS C CB    1 
ATOM   3687 S  SG    . CYS C 1 110 ? -14.211 52.171  72.889 1.00 35.76 ? 1139 CYS C SG    1 
ATOM   3688 N  N     . PHE C 1 111 ? -13.584 50.367  69.197 1.00 30.02 ? 1140 PHE C N     1 
ATOM   3689 C  CA    . PHE C 1 111 ? -12.327 50.281  68.461 1.00 28.44 ? 1140 PHE C CA    1 
ATOM   3690 C  C     . PHE C 1 111 ? -12.365 51.162  67.218 1.00 28.76 ? 1140 PHE C C     1 
ATOM   3691 O  O     . PHE C 1 111 ? -11.372 51.800  66.874 1.00 28.46 ? 1140 PHE C O     1 
ATOM   3692 C  CB    . PHE C 1 111 ? -12.038 48.838  68.035 1.00 27.52 ? 1140 PHE C CB    1 
ATOM   3693 C  CG    . PHE C 1 111 ? -10.915 48.717  67.040 1.00 25.56 ? 1140 PHE C CG    1 
ATOM   3694 C  CD1   . PHE C 1 111 ? -9.600  48.986  67.416 1.00 25.32 ? 1140 PHE C CD1   1 
ATOM   3695 C  CD2   . PHE C 1 111 ? -11.179 48.391  65.712 1.00 24.36 ? 1140 PHE C CD2   1 
ATOM   3696 C  CE1   . PHE C 1 111 ? -8.563  48.935  66.479 1.00 25.35 ? 1140 PHE C CE1   1 
ATOM   3697 C  CE2   . PHE C 1 111 ? -10.151 48.339  64.765 1.00 24.93 ? 1140 PHE C CE2   1 
ATOM   3698 C  CZ    . PHE C 1 111 ? -8.842  48.612  65.149 1.00 22.22 ? 1140 PHE C CZ    1 
ATOM   3699 N  N     . ASN C 1 112 ? -13.510 51.183  66.545 1.00 28.27 ? 1141 ASN C N     1 
ATOM   3700 C  CA    . ASN C 1 112 ? -13.659 51.977  65.335 1.00 30.64 ? 1141 ASN C CA    1 
ATOM   3701 C  C     . ASN C 1 112 ? -13.831 53.467  65.635 1.00 30.11 ? 1141 ASN C C     1 
ATOM   3702 O  O     . ASN C 1 112 ? -13.969 54.277  64.725 1.00 28.78 ? 1141 ASN C O     1 
ATOM   3703 C  CB    . ASN C 1 112 ? -14.832 51.454  64.494 1.00 32.27 ? 1141 ASN C CB    1 
ATOM   3704 C  CG    . ASN C 1 112 ? -14.570 50.064  63.941 1.00 35.01 ? 1141 ASN C CG    1 
ATOM   3705 O  OD1   . ASN C 1 112 ? -13.508 49.801  63.371 1.00 34.89 ? 1141 ASN C OD1   1 
ATOM   3706 N  ND2   . ASN C 1 112 ? -15.538 49.167  64.104 1.00 36.55 ? 1141 ASN C ND2   1 
ATOM   3707 N  N     . ARG C 1 113 ? -13.839 53.814  66.917 1.00 29.05 ? 1142 ARG C N     1 
ATOM   3708 C  CA    . ARG C 1 113 ? -13.934 55.209  67.331 1.00 30.11 ? 1142 ARG C CA    1 
ATOM   3709 C  C     . ARG C 1 113 ? -12.655 55.542  68.113 1.00 29.61 ? 1142 ARG C C     1 
ATOM   3710 O  O     . ARG C 1 113 ? -12.640 56.450  68.949 1.00 26.66 ? 1142 ARG C O     1 
ATOM   3711 C  CB    . ARG C 1 113 ? -15.168 55.432  68.216 1.00 32.05 ? 1142 ARG C CB    1 
ATOM   3712 C  CG    . ARG C 1 113 ? -16.503 55.383  67.462 1.00 34.81 ? 1142 ARG C CG    1 
ATOM   3713 C  CD    . ARG C 1 113 ? -17.681 55.486  68.425 1.00 34.87 ? 1142 ARG C CD    1 
ATOM   3714 N  NE    . ARG C 1 113 ? -17.679 56.753  69.149 1.00 38.78 ? 1142 ARG C NE    1 
ATOM   3715 C  CZ    . ARG C 1 113 ? -18.541 57.071  70.111 1.00 40.62 ? 1142 ARG C CZ    1 
ATOM   3716 N  NH1   . ARG C 1 113 ? -19.484 56.210  70.473 1.00 40.16 ? 1142 ARG C NH1   1 
ATOM   3717 N  NH2   . ARG C 1 113 ? -18.465 58.255  70.706 1.00 40.16 ? 1142 ARG C NH2   1 
ATOM   3718 N  N     . SER C 1 114 ? -11.583 54.797  67.832 1.00 27.09 ? 1143 SER C N     1 
ATOM   3719 C  CA    . SER C 1 114 ? -10.313 55.006  68.519 1.00 26.22 ? 1143 SER C CA    1 
ATOM   3720 C  C     . SER C 1 114 ? -9.770  56.433  68.358 1.00 25.15 ? 1143 SER C C     1 
ATOM   3721 O  O     . SER C 1 114 ? -8.991  56.891  69.178 1.00 24.18 ? 1143 SER C O     1 
ATOM   3722 C  CB    . SER C 1 114 ? -9.274  53.988  68.035 1.00 25.22 ? 1143 SER C CB    1 
ATOM   3723 O  OG    . SER C 1 114 ? -8.996  54.158  66.657 1.00 28.56 ? 1143 SER C OG    1 
ATOM   3724 N  N     . ARG C 1 115 ? -10.179 57.139  67.308 1.00 26.06 ? 1144 ARG C N     1 
ATOM   3725 C  CA    . ARG C 1 115 ? -9.715  58.509  67.111 1.00 25.86 ? 1144 ARG C CA    1 
ATOM   3726 C  C     . ARG C 1 115 ? -10.167 59.435  68.256 1.00 27.23 ? 1144 ARG C C     1 
ATOM   3727 O  O     . ARG C 1 115 ? -9.624  60.523  68.428 1.00 25.90 ? 1144 ARG C O     1 
ATOM   3728 C  CB    . ARG C 1 115 ? -10.222 59.066  65.773 1.00 26.15 ? 1144 ARG C CB    1 
ATOM   3729 C  CG    . ARG C 1 115 ? -11.748 59.059  65.598 1.00 27.10 ? 1144 ARG C CG    1 
ATOM   3730 C  CD    . ARG C 1 115 ? -12.148 59.749  64.290 1.00 29.31 ? 1144 ARG C CD    1 
ATOM   3731 N  NE    . ARG C 1 115 ? -11.887 61.177  64.388 1.00 32.66 ? 1144 ARG C NE    1 
ATOM   3732 C  CZ    . ARG C 1 115 ? -12.805 62.097  64.655 1.00 33.50 ? 1144 ARG C CZ    1 
ATOM   3733 N  NH1   . ARG C 1 115 ? -14.076 61.752  64.835 1.00 34.10 ? 1144 ARG C NH1   1 
ATOM   3734 N  NH2   . ARG C 1 115 ? -12.440 63.361  64.791 1.00 31.15 ? 1144 ARG C NH2   1 
ATOM   3735 N  N     . GLU C 1 116 ? -11.148 58.990  69.038 1.00 28.06 ? 1145 GLU C N     1 
ATOM   3736 C  CA    . GLU C 1 116 ? -11.681 59.784  70.144 1.00 28.45 ? 1145 GLU C CA    1 
ATOM   3737 C  C     . GLU C 1 116 ? -10.895 59.650  71.448 1.00 29.92 ? 1145 GLU C C     1 
ATOM   3738 O  O     . GLU C 1 116 ? -11.150 60.367  72.420 1.00 32.58 ? 1145 GLU C O     1 
ATOM   3739 C  CB    . GLU C 1 116 ? -13.161 59.436  70.362 1.00 26.69 ? 1145 GLU C CB    1 
ATOM   3740 C  CG    . GLU C 1 116 ? -14.045 59.823  69.160 1.00 26.96 ? 1145 GLU C CG    1 
ATOM   3741 C  CD    . GLU C 1 116 ? -15.512 59.434  69.330 1.00 28.04 ? 1145 GLU C CD    1 
ATOM   3742 O  OE1   . GLU C 1 116 ? -16.096 59.761  70.384 1.00 28.22 ? 1145 GLU C OE1   1 
ATOM   3743 O  OE2   . GLU C 1 116 ? -16.083 58.811  68.404 1.00 25.97 ? 1145 GLU C OE2   1 
ATOM   3744 N  N     . TYR C 1 117 ? -9.947  58.723  71.473 1.00 28.84 ? 1146 TYR C N     1 
ATOM   3745 C  CA    . TYR C 1 117 ? -9.099  58.542  72.640 1.00 28.15 ? 1146 TYR C CA    1 
ATOM   3746 C  C     . TYR C 1 117 ? -7.698  58.204  72.141 1.00 27.44 ? 1146 TYR C C     1 
ATOM   3747 O  O     . TYR C 1 117 ? -7.347  58.546  71.012 1.00 25.53 ? 1146 TYR C O     1 
ATOM   3748 C  CB    . TYR C 1 117 ? -9.640  57.447  73.587 1.00 28.30 ? 1146 TYR C CB    1 
ATOM   3749 C  CG    . TYR C 1 117 ? -10.042 56.129  72.944 1.00 28.68 ? 1146 TYR C CG    1 
ATOM   3750 C  CD1   . TYR C 1 117 ? -11.277 55.990  72.308 1.00 29.22 ? 1146 TYR C CD1   1 
ATOM   3751 C  CD2   . TYR C 1 117 ? -9.196  55.016  72.992 1.00 27.79 ? 1146 TYR C CD2   1 
ATOM   3752 C  CE1   . TYR C 1 117 ? -11.667 54.775  71.739 1.00 29.26 ? 1146 TYR C CE1   1 
ATOM   3753 C  CE2   . TYR C 1 117 ? -9.573  53.796  72.420 1.00 29.27 ? 1146 TYR C CE2   1 
ATOM   3754 C  CZ    . TYR C 1 117 ? -10.814 53.687  71.795 1.00 29.61 ? 1146 TYR C CZ    1 
ATOM   3755 O  OH    . TYR C 1 117 ? -11.196 52.497  71.210 1.00 30.13 ? 1146 TYR C OH    1 
ATOM   3756 N  N     . GLN C 1 118 ? -6.895  57.542  72.963 1.00 26.77 ? 1147 GLN C N     1 
ATOM   3757 C  CA    . GLN C 1 118 ? -5.544  57.209  72.544 1.00 30.22 ? 1147 GLN C CA    1 
ATOM   3758 C  C     . GLN C 1 118 ? -5.266  55.715  72.526 1.00 29.40 ? 1147 GLN C C     1 
ATOM   3759 O  O     . GLN C 1 118 ? -5.085  55.087  73.567 1.00 27.46 ? 1147 GLN C O     1 
ATOM   3760 C  CB    . GLN C 1 118 ? -4.536  57.937  73.435 1.00 35.10 ? 1147 GLN C CB    1 
ATOM   3761 C  CG    . GLN C 1 118 ? -4.591  59.454  73.255 1.00 43.70 ? 1147 GLN C CG    1 
ATOM   3762 C  CD    . GLN C 1 118 ? -3.592  60.206  74.121 1.00 48.96 ? 1147 GLN C CD    1 
ATOM   3763 O  OE1   . GLN C 1 118 ? -3.444  61.427  73.994 1.00 51.96 ? 1147 GLN C OE1   1 
ATOM   3764 N  NE2   . GLN C 1 118 ? -2.905  59.485  75.010 1.00 50.59 ? 1147 GLN C NE2   1 
ATOM   3765 N  N     . LEU C 1 119 ? -5.243  55.148  71.324 1.00 27.88 ? 1148 LEU C N     1 
ATOM   3766 C  CA    . LEU C 1 119 ? -4.982  53.725  71.161 1.00 26.81 ? 1148 LEU C CA    1 
ATOM   3767 C  C     . LEU C 1 119 ? -3.749  53.556  70.284 1.00 25.50 ? 1148 LEU C C     1 
ATOM   3768 O  O     . LEU C 1 119 ? -3.682  54.104  69.183 1.00 25.87 ? 1148 LEU C O     1 
ATOM   3769 C  CB    . LEU C 1 119 ? -6.192  53.035  70.523 1.00 24.36 ? 1148 LEU C CB    1 
ATOM   3770 C  CG    . LEU C 1 119 ? -6.095  51.507  70.415 1.00 25.66 ? 1148 LEU C CG    1 
ATOM   3771 C  CD1   . LEU C 1 119 ? -6.005  50.894  71.815 1.00 23.73 ? 1148 LEU C CD1   1 
ATOM   3772 C  CD2   . LEU C 1 119 ? -7.302  50.962  69.668 1.00 23.01 ? 1148 LEU C CD2   1 
ATOM   3773 N  N     . ASN C 1 120 ? -2.770  52.808  70.781 1.00 25.04 ? 1149 ASN C N     1 
ATOM   3774 C  CA    . ASN C 1 120 ? -1.524  52.583  70.050 1.00 26.02 ? 1149 ASN C CA    1 
ATOM   3775 C  C     . ASN C 1 120 ? -1.790  51.843  68.739 1.00 27.50 ? 1149 ASN C C     1 
ATOM   3776 O  O     . ASN C 1 120 ? -2.697  51.010  68.652 1.00 26.01 ? 1149 ASN C O     1 
ATOM   3777 C  CB    . ASN C 1 120 ? -0.539  51.781  70.907 1.00 25.15 ? 1149 ASN C CB    1 
ATOM   3778 C  CG    . ASN C 1 120 ? -0.902  50.312  70.988 1.00 26.37 ? 1149 ASN C CG    1 
ATOM   3779 O  OD1   . ASN C 1 120 ? -0.393  49.486  70.226 1.00 24.32 ? 1149 ASN C OD1   1 
ATOM   3780 N  ND2   . ASN C 1 120 ? -1.804  49.979  71.904 1.00 27.75 ? 1149 ASN C ND2   1 
ATOM   3781 N  N     . ASP C 1 121 ? -0.983  52.144  67.727 1.00 27.31 ? 1150 ASP C N     1 
ATOM   3782 C  CA    . ASP C 1 121 ? -1.153  51.530  66.424 1.00 27.20 ? 1150 ASP C CA    1 
ATOM   3783 C  C     . ASP C 1 121 ? -0.635  50.106  66.253 1.00 27.21 ? 1150 ASP C C     1 
ATOM   3784 O  O     . ASP C 1 121 ? -0.456  49.636  65.127 1.00 29.54 ? 1150 ASP C O     1 
ATOM   3785 C  CB    . ASP C 1 121 ? -0.589  52.462  65.345 1.00 25.44 ? 1150 ASP C CB    1 
ATOM   3786 C  CG    . ASP C 1 121 ? -1.569  53.574  64.991 1.00 25.44 ? 1150 ASP C CG    1 
ATOM   3787 O  OD1   . ASP C 1 121 ? -2.762  53.242  64.817 1.00 24.79 ? 1150 ASP C OD1   1 
ATOM   3788 O  OD2   . ASP C 1 121 ? -1.171  54.760  64.890 1.00 23.05 ? 1150 ASP C OD2   1 
ATOM   3789 N  N     . SER C 1 122 ? -0.402  49.415  67.366 1.00 26.95 ? 1151 SER C N     1 
ATOM   3790 C  CA    . SER C 1 122 ? 0.036   48.018  67.317 1.00 27.29 ? 1151 SER C CA    1 
ATOM   3791 C  C     . SER C 1 122 ? -1.109  47.154  67.872 1.00 28.40 ? 1151 SER C C     1 
ATOM   3792 O  O     . SER C 1 122 ? -1.063  45.921  67.833 1.00 28.65 ? 1151 SER C O     1 
ATOM   3793 C  CB    . SER C 1 122 ? 1.304   47.803  68.159 1.00 31.23 ? 1151 SER C CB    1 
ATOM   3794 O  OG    . SER C 1 122 ? 2.446   48.420  67.572 1.00 31.16 ? 1151 SER C OG    1 
ATOM   3795 N  N     . ALA C 1 123 ? -2.149  47.822  68.365 1.00 27.31 ? 1152 ALA C N     1 
ATOM   3796 C  CA    . ALA C 1 123 ? -3.292  47.141  68.958 1.00 27.27 ? 1152 ALA C CA    1 
ATOM   3797 C  C     . ALA C 1 123 ? -3.963  46.114  68.052 1.00 27.06 ? 1152 ALA C C     1 
ATOM   3798 O  O     . ALA C 1 123 ? -3.994  44.931  68.385 1.00 25.78 ? 1152 ALA C O     1 
ATOM   3799 C  CB    . ALA C 1 123 ? -4.311  48.161  69.440 1.00 24.27 ? 1152 ALA C CB    1 
ATOM   3800 N  N     . ALA C 1 124 ? -4.498  46.547  66.913 1.00 25.10 ? 1153 ALA C N     1 
ATOM   3801 C  CA    . ALA C 1 124 ? -5.161  45.608  66.016 1.00 27.37 ? 1153 ALA C CA    1 
ATOM   3802 C  C     . ALA C 1 124 ? -4.185  44.554  65.487 1.00 28.85 ? 1153 ALA C C     1 
ATOM   3803 O  O     . ALA C 1 124 ? -4.551  43.397  65.288 1.00 30.86 ? 1153 ALA C O     1 
ATOM   3804 C  CB    . ALA C 1 124 ? -5.816  46.354  64.857 1.00 28.04 ? 1153 ALA C CB    1 
ATOM   3805 N  N     . TYR C 1 125 ? -2.941  44.960  65.264 1.00 29.22 ? 1154 TYR C N     1 
ATOM   3806 C  CA    . TYR C 1 125 ? -1.917  44.052  64.762 1.00 30.16 ? 1154 TYR C CA    1 
ATOM   3807 C  C     . TYR C 1 125 ? -1.835  42.777  65.615 1.00 30.43 ? 1154 TYR C C     1 
ATOM   3808 O  O     . TYR C 1 125 ? -1.866  41.668  65.092 1.00 30.53 ? 1154 TYR C O     1 
ATOM   3809 C  CB    . TYR C 1 125 ? -0.556  44.755  64.758 1.00 29.01 ? 1154 TYR C CB    1 
ATOM   3810 C  CG    . TYR C 1 125 ? 0.596   43.860  64.359 1.00 32.46 ? 1154 TYR C CG    1 
ATOM   3811 C  CD1   . TYR C 1 125 ? 0.921   43.661  63.016 1.00 31.46 ? 1154 TYR C CD1   1 
ATOM   3812 C  CD2   . TYR C 1 125 ? 1.342   43.184  65.328 1.00 31.86 ? 1154 TYR C CD2   1 
ATOM   3813 C  CE1   . TYR C 1 125 ? 1.956   42.807  62.648 1.00 32.28 ? 1154 TYR C CE1   1 
ATOM   3814 C  CE2   . TYR C 1 125 ? 2.377   42.328  64.973 1.00 33.25 ? 1154 TYR C CE2   1 
ATOM   3815 C  CZ    . TYR C 1 125 ? 2.679   42.140  63.632 1.00 33.87 ? 1154 TYR C CZ    1 
ATOM   3816 O  OH    . TYR C 1 125 ? 3.690   41.270  63.280 1.00 32.85 ? 1154 TYR C OH    1 
ATOM   3817 N  N     . TYR C 1 126 ? -1.726  42.942  66.928 1.00 28.37 ? 1155 TYR C N     1 
ATOM   3818 C  CA    . TYR C 1 126 ? -1.634  41.796  67.825 1.00 28.47 ? 1155 TYR C CA    1 
ATOM   3819 C  C     . TYR C 1 126 ? -2.978  41.126  68.071 1.00 29.07 ? 1155 TYR C C     1 
ATOM   3820 O  O     . TYR C 1 126 ? -3.101  39.901  67.955 1.00 28.68 ? 1155 TYR C O     1 
ATOM   3821 C  CB    . TYR C 1 126 ? -1.029  42.212  69.168 1.00 28.15 ? 1155 TYR C CB    1 
ATOM   3822 C  CG    . TYR C 1 126 ? 0.436   42.586  69.087 1.00 30.46 ? 1155 TYR C CG    1 
ATOM   3823 C  CD1   . TYR C 1 126 ? 1.364   41.720  68.509 1.00 28.81 ? 1155 TYR C CD1   1 
ATOM   3824 C  CD2   . TYR C 1 126 ? 0.899   43.797  69.614 1.00 31.70 ? 1155 TYR C CD2   1 
ATOM   3825 C  CE1   . TYR C 1 126 ? 2.724   42.046  68.460 1.00 30.74 ? 1155 TYR C CE1   1 
ATOM   3826 C  CE2   . TYR C 1 126 ? 2.250   44.133  69.570 1.00 29.69 ? 1155 TYR C CE2   1 
ATOM   3827 C  CZ    . TYR C 1 126 ? 3.156   43.251  68.991 1.00 31.30 ? 1155 TYR C CZ    1 
ATOM   3828 O  OH    . TYR C 1 126 ? 4.491   43.573  68.952 1.00 30.55 ? 1155 TYR C OH    1 
ATOM   3829 N  N     . LEU C 1 127 ? -3.986  41.922  68.410 1.00 26.68 ? 1156 LEU C N     1 
ATOM   3830 C  CA    . LEU C 1 127 ? -5.299  41.364  68.687 1.00 29.45 ? 1156 LEU C CA    1 
ATOM   3831 C  C     . LEU C 1 127 ? -5.869  40.491  67.568 1.00 30.28 ? 1156 LEU C C     1 
ATOM   3832 O  O     . LEU C 1 127 ? -6.510  39.485  67.851 1.00 33.17 ? 1156 LEU C O     1 
ATOM   3833 C  CB    . LEU C 1 127 ? -6.277  42.479  69.059 1.00 28.83 ? 1156 LEU C CB    1 
ATOM   3834 C  CG    . LEU C 1 127 ? -5.989  43.107  70.431 1.00 28.09 ? 1156 LEU C CG    1 
ATOM   3835 C  CD1   . LEU C 1 127 ? -6.878  44.317  70.644 1.00 25.79 ? 1156 LEU C CD1   1 
ATOM   3836 C  CD2   . LEU C 1 127 ? -6.215  42.068  71.530 1.00 26.47 ? 1156 LEU C CD2   1 
ATOM   3837 N  N     . ASN C 1 128 ? -5.637  40.853  66.308 1.00 32.42 ? 1157 ASN C N     1 
ATOM   3838 C  CA    . ASN C 1 128 ? -6.145  40.045  65.196 1.00 33.49 ? 1157 ASN C CA    1 
ATOM   3839 C  C     . ASN C 1 128 ? -5.292  38.796  64.962 1.00 34.32 ? 1157 ASN C C     1 
ATOM   3840 O  O     . ASN C 1 128 ? -5.693  37.893  64.228 1.00 35.62 ? 1157 ASN C O     1 
ATOM   3841 C  CB    . ASN C 1 128 ? -6.205  40.856  63.893 1.00 33.43 ? 1157 ASN C CB    1 
ATOM   3842 C  CG    . ASN C 1 128 ? -7.378  41.814  63.847 1.00 34.28 ? 1157 ASN C CG    1 
ATOM   3843 O  OD1   . ASN C 1 128 ? -8.467  41.503  64.329 1.00 32.27 ? 1157 ASN C OD1   1 
ATOM   3844 N  ND2   . ASN C 1 128 ? -7.166  42.983  63.243 1.00 33.69 ? 1157 ASN C ND2   1 
ATOM   3845 N  N     . ASP C 1 129 ? -4.112  38.760  65.574 1.00 33.85 ? 1158 ASP C N     1 
ATOM   3846 C  CA    . ASP C 1 129 ? -3.196  37.629  65.449 1.00 34.63 ? 1158 ASP C CA    1 
ATOM   3847 C  C     . ASP C 1 129 ? -3.172  36.820  66.753 1.00 36.38 ? 1158 ASP C C     1 
ATOM   3848 O  O     . ASP C 1 129 ? -2.225  36.077  67.004 1.00 36.87 ? 1158 ASP C O     1 
ATOM   3849 C  CB    . ASP C 1 129 ? -1.770  38.120  65.168 1.00 33.55 ? 1158 ASP C CB    1 
ATOM   3850 C  CG    . ASP C 1 129 ? -1.538  38.513  63.713 1.00 32.49 ? 1158 ASP C CG    1 
ATOM   3851 O  OD1   . ASP C 1 129 ? -2.493  38.554  62.909 1.00 28.49 ? 1158 ASP C OD1   1 
ATOM   3852 O  OD2   . ASP C 1 129 ? -0.369  38.785  63.379 1.00 32.96 ? 1158 ASP C OD2   1 
ATOM   3853 N  N     . LEU C 1 130 ? -4.196  36.970  67.585 1.00 37.85 ? 1159 LEU C N     1 
ATOM   3854 C  CA    . LEU C 1 130 ? -4.233  36.248  68.855 1.00 40.44 ? 1159 LEU C CA    1 
ATOM   3855 C  C     . LEU C 1 130 ? -3.953  34.752  68.708 1.00 40.67 ? 1159 LEU C C     1 
ATOM   3856 O  O     . LEU C 1 130 ? -3.097  34.206  69.410 1.00 41.57 ? 1159 LEU C O     1 
ATOM   3857 C  CB    . LEU C 1 130 ? -5.584  36.439  69.554 1.00 41.26 ? 1159 LEU C CB    1 
ATOM   3858 C  CG    . LEU C 1 130 ? -5.615  37.262  70.849 1.00 43.33 ? 1159 LEU C CG    1 
ATOM   3859 C  CD1   . LEU C 1 130 ? -6.973  37.065  71.523 1.00 43.46 ? 1159 LEU C CD1   1 
ATOM   3860 C  CD2   . LEU C 1 130 ? -4.505  36.825  71.800 1.00 43.41 ? 1159 LEU C CD2   1 
ATOM   3861 N  N     . ASP C 1 131 ? -4.666  34.090  67.801 1.00 40.14 ? 1160 ASP C N     1 
ATOM   3862 C  CA    . ASP C 1 131 ? -4.476  32.656  67.596 1.00 40.69 ? 1160 ASP C CA    1 
ATOM   3863 C  C     . ASP C 1 131 ? -3.006  32.259  67.539 1.00 41.32 ? 1160 ASP C C     1 
ATOM   3864 O  O     . ASP C 1 131 ? -2.599  31.282  68.167 1.00 41.93 ? 1160 ASP C O     1 
ATOM   3865 C  CB    . ASP C 1 131 ? -5.173  32.192  66.314 1.00 38.16 ? 1160 ASP C CB    1 
ATOM   3866 C  CG    . ASP C 1 131 ? -6.687  32.176  66.443 1.00 38.83 ? 1160 ASP C CG    1 
ATOM   3867 O  OD1   . ASP C 1 131 ? -7.194  32.333  67.574 1.00 36.83 ? 1160 ASP C OD1   1 
ATOM   3868 O  OD2   . ASP C 1 131 ? -7.370  31.995  65.410 1.00 40.15 ? 1160 ASP C OD2   1 
ATOM   3869 N  N     . ARG C 1 132 ? -2.212  33.029  66.802 1.00 41.22 ? 1161 ARG C N     1 
ATOM   3870 C  CA    . ARG C 1 132 ? -0.790  32.746  66.654 1.00 41.34 ? 1161 ARG C CA    1 
ATOM   3871 C  C     . ARG C 1 132 ? 0.080   33.061  67.870 1.00 42.46 ? 1161 ARG C C     1 
ATOM   3872 O  O     . ARG C 1 132 ? 0.849   32.212  68.319 1.00 43.30 ? 1161 ARG C O     1 
ATOM   3873 C  CB    . ARG C 1 132 ? -0.240  33.492  65.436 1.00 41.31 ? 1161 ARG C CB    1 
ATOM   3874 C  CG    . ARG C 1 132 ? 1.250   33.270  65.178 1.00 43.06 ? 1161 ARG C CG    1 
ATOM   3875 C  CD    . ARG C 1 132 ? 1.677   33.876  63.840 1.00 43.87 ? 1161 ARG C CD    1 
ATOM   3876 N  NE    . ARG C 1 132 ? 1.528   35.331  63.806 1.00 43.73 ? 1161 ARG C NE    1 
ATOM   3877 C  CZ    . ARG C 1 132 ? 2.401   36.190  64.323 1.00 43.29 ? 1161 ARG C CZ    1 
ATOM   3878 N  NH1   . ARG C 1 132 ? 3.502   35.751  64.920 1.00 43.88 ? 1161 ARG C NH1   1 
ATOM   3879 N  NH2   . ARG C 1 132 ? 2.170   37.493  64.245 1.00 44.94 ? 1161 ARG C NH2   1 
ATOM   3880 N  N     . ILE C 1 133 ? -0.036  34.272  68.407 1.00 43.30 ? 1162 ILE C N     1 
ATOM   3881 C  CA    . ILE C 1 133 ? 0.792   34.672  69.544 1.00 43.14 ? 1162 ILE C CA    1 
ATOM   3882 C  C     . ILE C 1 133 ? 0.398   34.066  70.884 1.00 43.96 ? 1162 ILE C C     1 
ATOM   3883 O  O     . ILE C 1 133 ? 1.236   33.941  71.777 1.00 44.07 ? 1162 ILE C O     1 
ATOM   3884 C  CB    . ILE C 1 133 ? 0.830   36.221  69.708 1.00 42.16 ? 1162 ILE C CB    1 
ATOM   3885 C  CG1   . ILE C 1 133 ? -0.541  36.742  70.146 1.00 41.19 ? 1162 ILE C CG1   1 
ATOM   3886 C  CG2   . ILE C 1 133 ? 1.246   36.872  68.396 1.00 42.63 ? 1162 ILE C CG2   1 
ATOM   3887 C  CD1   . ILE C 1 133 ? -0.573  38.232  70.431 1.00 41.97 ? 1162 ILE C CD1   1 
ATOM   3888 N  N     . ALA C 1 134 ? -0.867  33.687  71.029 1.00 44.62 ? 1163 ALA C N     1 
ATOM   3889 C  CA    . ALA C 1 134 ? -1.341  33.118  72.290 1.00 46.83 ? 1163 ALA C CA    1 
ATOM   3890 C  C     . ALA C 1 134 ? -0.875  31.683  72.561 1.00 47.70 ? 1163 ALA C C     1 
ATOM   3891 O  O     . ALA C 1 134 ? -0.908  31.224  73.704 1.00 47.60 ? 1163 ALA C O     1 
ATOM   3892 C  CB    . ALA C 1 134 ? -2.868  33.195  72.356 1.00 45.96 ? 1163 ALA C CB    1 
ATOM   3893 N  N     . GLN C 1 135 ? -0.441  30.975  71.523 1.00 48.83 ? 1164 GLN C N     1 
ATOM   3894 C  CA    . GLN C 1 135 ? 0.014   29.601  71.701 1.00 51.05 ? 1164 GLN C CA    1 
ATOM   3895 C  C     . GLN C 1 135 ? 1.276   29.527  72.562 1.00 52.59 ? 1164 GLN C C     1 
ATOM   3896 O  O     . GLN C 1 135 ? 2.167   30.369  72.455 1.00 52.75 ? 1164 GLN C O     1 
ATOM   3897 C  CB    . GLN C 1 135 ? 0.220   28.936  70.336 1.00 50.97 ? 1164 GLN C CB    1 
ATOM   3898 C  CG    . GLN C 1 135 ? -1.107  28.716  69.607 1.00 53.43 ? 1164 GLN C CG    1 
ATOM   3899 C  CD    . GLN C 1 135 ? -0.951  28.107  68.227 1.00 56.78 ? 1164 GLN C CD    1 
ATOM   3900 O  OE1   . GLN C 1 135 ? -0.424  27.004  68.077 1.00 58.41 ? 1164 GLN C OE1   1 
ATOM   3901 N  NE2   . GLN C 1 135 ? -1.419  28.823  67.208 1.00 56.75 ? 1164 GLN C NE2   1 
ATOM   3902 N  N     . PRO C 1 136 ? 1.356   28.512  73.440 1.00 53.23 ? 1165 PRO C N     1 
ATOM   3903 C  CA    . PRO C 1 136 ? 2.473   28.270  74.361 1.00 53.35 ? 1165 PRO C CA    1 
ATOM   3904 C  C     . PRO C 1 136 ? 3.870   28.209  73.742 1.00 53.83 ? 1165 PRO C C     1 
ATOM   3905 O  O     . PRO C 1 136 ? 4.861   28.506  74.409 1.00 53.08 ? 1165 PRO C O     1 
ATOM   3906 C  CB    . PRO C 1 136 ? 2.082   26.954  75.031 1.00 53.33 ? 1165 PRO C CB    1 
ATOM   3907 C  CG    . PRO C 1 136 ? 1.320   26.249  73.947 1.00 53.81 ? 1165 PRO C CG    1 
ATOM   3908 C  CD    . PRO C 1 136 ? 0.435   27.360  73.438 1.00 52.89 ? 1165 PRO C CD    1 
ATOM   3909 N  N     . ASN C 1 137 ? 3.948   27.825  72.475 1.00 54.06 ? 1166 ASN C N     1 
ATOM   3910 C  CA    . ASN C 1 137 ? 5.232   27.717  71.792 1.00 55.78 ? 1166 ASN C CA    1 
ATOM   3911 C  C     . ASN C 1 137 ? 5.519   28.936  70.914 1.00 55.80 ? 1166 ASN C C     1 
ATOM   3912 O  O     . ASN C 1 137 ? 6.375   28.886  70.027 1.00 55.81 ? 1166 ASN C O     1 
ATOM   3913 C  CB    . ASN C 1 137 ? 5.241   26.446  70.942 1.00 58.48 ? 1166 ASN C CB    1 
ATOM   3914 C  CG    . ASN C 1 137 ? 4.071   26.386  69.981 1.00 60.46 ? 1166 ASN C CG    1 
ATOM   3915 O  OD1   . ASN C 1 137 ? 4.058   27.073  68.961 1.00 63.61 ? 1166 ASN C OD1   1 
ATOM   3916 N  ND2   . ASN C 1 137 ? 3.070   25.574  70.311 1.00 61.39 ? 1166 ASN C ND2   1 
ATOM   3917 N  N     . TYR C 1 138 ? 4.806   30.028  71.180 1.00 54.51 ? 1167 TYR C N     1 
ATOM   3918 C  CA    . TYR C 1 138 ? 4.954   31.267  70.421 1.00 52.62 ? 1167 TYR C CA    1 
ATOM   3919 C  C     . TYR C 1 138 ? 6.356   31.868  70.433 1.00 51.85 ? 1167 TYR C C     1 
ATOM   3920 O  O     . TYR C 1 138 ? 6.963   32.054  71.486 1.00 51.01 ? 1167 TYR C O     1 
ATOM   3921 C  CB    . TYR C 1 138 ? 3.955   32.319  70.928 1.00 51.88 ? 1167 TYR C CB    1 
ATOM   3922 C  CG    . TYR C 1 138 ? 4.157   33.710  70.350 1.00 50.51 ? 1167 TYR C CG    1 
ATOM   3923 C  CD1   . TYR C 1 138 ? 4.091   33.937  68.974 1.00 49.80 ? 1167 TYR C CD1   1 
ATOM   3924 C  CD2   . TYR C 1 138 ? 4.432   34.798  71.183 1.00 50.13 ? 1167 TYR C CD2   1 
ATOM   3925 C  CE1   . TYR C 1 138 ? 4.296   35.213  68.439 1.00 49.52 ? 1167 TYR C CE1   1 
ATOM   3926 C  CE2   . TYR C 1 138 ? 4.638   36.078  70.660 1.00 49.65 ? 1167 TYR C CE2   1 
ATOM   3927 C  CZ    . TYR C 1 138 ? 4.569   36.278  69.290 1.00 49.96 ? 1167 TYR C CZ    1 
ATOM   3928 O  OH    . TYR C 1 138 ? 4.776   37.537  68.774 1.00 48.17 ? 1167 TYR C OH    1 
ATOM   3929 N  N     . ILE C 1 139 ? 6.853   32.165  69.238 1.00 51.75 ? 1168 ILE C N     1 
ATOM   3930 C  CA    . ILE C 1 139 ? 8.157   32.787  69.061 1.00 52.87 ? 1168 ILE C CA    1 
ATOM   3931 C  C     . ILE C 1 139 ? 7.922   34.040  68.219 1.00 52.11 ? 1168 ILE C C     1 
ATOM   3932 O  O     . ILE C 1 139 ? 7.557   33.948  67.045 1.00 51.63 ? 1168 ILE C O     1 
ATOM   3933 C  CB    . ILE C 1 139 ? 9.140   31.862  68.314 1.00 53.98 ? 1168 ILE C CB    1 
ATOM   3934 C  CG1   . ILE C 1 139 ? 9.531   30.683  69.208 1.00 55.72 ? 1168 ILE C CG1   1 
ATOM   3935 C  CG2   . ILE C 1 139 ? 10.381  32.646  67.909 1.00 54.98 ? 1168 ILE C CG2   1 
ATOM   3936 C  CD1   . ILE C 1 139 ? 10.501  29.710  68.553 1.00 54.85 ? 1168 ILE C CD1   1 
ATOM   3937 N  N     . PRO C 1 140 ? 8.112   35.229  68.815 1.00 51.14 ? 1169 PRO C N     1 
ATOM   3938 C  CA    . PRO C 1 140 ? 7.911   36.489  68.092 1.00 50.44 ? 1169 PRO C CA    1 
ATOM   3939 C  C     . PRO C 1 140 ? 8.681   36.541  66.774 1.00 49.67 ? 1169 PRO C C     1 
ATOM   3940 O  O     . PRO C 1 140 ? 9.894   36.335  66.747 1.00 48.62 ? 1169 PRO C O     1 
ATOM   3941 C  CB    . PRO C 1 140 ? 8.397   37.534  69.088 1.00 49.87 ? 1169 PRO C CB    1 
ATOM   3942 C  CG    . PRO C 1 140 ? 8.038   36.915  70.409 1.00 50.66 ? 1169 PRO C CG    1 
ATOM   3943 C  CD    . PRO C 1 140 ? 8.478   35.483  70.220 1.00 49.71 ? 1169 PRO C CD    1 
ATOM   3944 N  N     . THR C 1 141 ? 7.968   36.810  65.686 1.00 49.25 ? 1170 THR C N     1 
ATOM   3945 C  CA    . THR C 1 141 ? 8.589   36.892  64.369 1.00 50.56 ? 1170 THR C CA    1 
ATOM   3946 C  C     . THR C 1 141 ? 9.318   38.218  64.201 1.00 50.91 ? 1170 THR C C     1 
ATOM   3947 O  O     . THR C 1 141 ? 9.411   39.021  65.132 1.00 50.61 ? 1170 THR C O     1 
ATOM   3948 C  CB    . THR C 1 141 ? 7.556   36.815  63.237 1.00 51.64 ? 1170 THR C CB    1 
ATOM   3949 O  OG1   . THR C 1 141 ? 6.809   38.040  63.197 1.00 48.75 ? 1170 THR C OG1   1 
ATOM   3950 C  CG2   . THR C 1 141 ? 6.612   35.639  63.450 1.00 51.47 ? 1170 THR C CG2   1 
ATOM   3951 N  N     . GLN C 1 142 ? 9.822   38.442  62.993 1.00 51.54 ? 1171 GLN C N     1 
ATOM   3952 C  CA    . GLN C 1 142 ? 10.543  39.665  62.679 1.00 51.67 ? 1171 GLN C CA    1 
ATOM   3953 C  C     . GLN C 1 142 ? 9.617   40.860  62.918 1.00 48.66 ? 1171 GLN C C     1 
ATOM   3954 O  O     . GLN C 1 142 ? 9.903   41.732  63.739 1.00 45.88 ? 1171 GLN C O     1 
ATOM   3955 C  CB    . GLN C 1 142 ? 11.001  39.629  61.215 1.00 53.93 ? 1171 GLN C CB    1 
ATOM   3956 C  CG    . GLN C 1 142 ? 11.972  40.733  60.817 1.00 59.13 ? 1171 GLN C CG    1 
ATOM   3957 C  CD    . GLN C 1 142 ? 13.347  40.598  61.466 1.00 62.65 ? 1171 GLN C CD    1 
ATOM   3958 O  OE1   . GLN C 1 142 ? 14.269  41.354  61.150 1.00 63.67 ? 1171 GLN C OE1   1 
ATOM   3959 N  NE2   . GLN C 1 142 ? 13.488  39.636  62.376 1.00 63.71 ? 1171 GLN C NE2   1 
ATOM   3960 N  N     . GLN C 1 143 ? 8.495   40.873  62.207 1.00 46.46 ? 1172 GLN C N     1 
ATOM   3961 C  CA    . GLN C 1 143 ? 7.524   41.949  62.318 1.00 45.17 ? 1172 GLN C CA    1 
ATOM   3962 C  C     . GLN C 1 143 ? 7.023   42.138  63.752 1.00 45.31 ? 1172 GLN C C     1 
ATOM   3963 O  O     . GLN C 1 143 ? 6.955   43.267  64.244 1.00 43.66 ? 1172 GLN C O     1 
ATOM   3964 C  CB    . GLN C 1 143 ? 6.342   41.685  61.382 1.00 44.40 ? 1172 GLN C CB    1 
ATOM   3965 C  CG    . GLN C 1 143 ? 5.483   42.913  61.108 1.00 44.49 ? 1172 GLN C CG    1 
ATOM   3966 C  CD    . GLN C 1 143 ? 6.218   43.995  60.315 1.00 45.28 ? 1172 GLN C CD    1 
ATOM   3967 O  OE1   . GLN C 1 143 ? 5.701   45.093  60.131 1.00 45.17 ? 1172 GLN C OE1   1 
ATOM   3968 N  NE2   . GLN C 1 143 ? 7.421   43.682  59.841 1.00 44.12 ? 1172 GLN C NE2   1 
ATOM   3969 N  N     . ASP C 1 144 ? 6.681   41.038  64.422 1.00 44.15 ? 1173 ASP C N     1 
ATOM   3970 C  CA    . ASP C 1 144 ? 6.182   41.110  65.794 1.00 43.20 ? 1173 ASP C CA    1 
ATOM   3971 C  C     . ASP C 1 144 ? 7.096   41.954  66.679 1.00 42.23 ? 1173 ASP C C     1 
ATOM   3972 O  O     . ASP C 1 144 ? 6.622   42.757  67.486 1.00 41.88 ? 1173 ASP C O     1 
ATOM   3973 C  CB    . ASP C 1 144 ? 6.037   39.706  66.410 1.00 43.35 ? 1173 ASP C CB    1 
ATOM   3974 C  CG    . ASP C 1 144 ? 5.011   38.842  65.685 1.00 44.86 ? 1173 ASP C CG    1 
ATOM   3975 O  OD1   . ASP C 1 144 ? 4.128   39.398  64.999 1.00 42.78 ? 1173 ASP C OD1   1 
ATOM   3976 O  OD2   . ASP C 1 144 ? 5.080   37.597  65.815 1.00 46.39 ? 1173 ASP C OD2   1 
ATOM   3977 N  N     . VAL C 1 145 ? 8.405   41.773  66.531 1.00 40.54 ? 1174 VAL C N     1 
ATOM   3978 C  CA    . VAL C 1 145 ? 9.364   42.531  67.330 1.00 39.36 ? 1174 VAL C CA    1 
ATOM   3979 C  C     . VAL C 1 145 ? 9.311   44.022  66.978 1.00 38.78 ? 1174 VAL C C     1 
ATOM   3980 O  O     . VAL C 1 145 ? 9.354   44.884  67.867 1.00 36.17 ? 1174 VAL C O     1 
ATOM   3981 C  CB    . VAL C 1 145 ? 10.802  42.000  67.123 1.00 40.02 ? 1174 VAL C CB    1 
ATOM   3982 C  CG1   . VAL C 1 145 ? 11.786  42.806  67.963 1.00 37.33 ? 1174 VAL C CG1   1 
ATOM   3983 C  CG2   . VAL C 1 145 ? 10.867  40.521  67.507 1.00 41.54 ? 1174 VAL C CG2   1 
ATOM   3984 N  N     . LEU C 1 146 ? 9.220   44.321  65.684 1.00 38.25 ? 1175 LEU C N     1 
ATOM   3985 C  CA    . LEU C 1 146 ? 9.143   45.709  65.230 1.00 39.15 ? 1175 LEU C CA    1 
ATOM   3986 C  C     . LEU C 1 146 ? 7.972   46.397  65.912 1.00 37.61 ? 1175 LEU C C     1 
ATOM   3987 O  O     . LEU C 1 146 ? 8.080   47.533  66.362 1.00 35.86 ? 1175 LEU C O     1 
ATOM   3988 C  CB    . LEU C 1 146 ? 8.920   45.778  63.716 1.00 40.48 ? 1175 LEU C CB    1 
ATOM   3989 C  CG    . LEU C 1 146 ? 10.109  45.984  62.779 1.00 44.08 ? 1175 LEU C CG    1 
ATOM   3990 C  CD1   . LEU C 1 146 ? 9.595   46.119  61.352 1.00 41.87 ? 1175 LEU C CD1   1 
ATOM   3991 C  CD2   . LEU C 1 146 ? 10.877  47.235  63.178 1.00 42.98 ? 1175 LEU C CD2   1 
ATOM   3992 N  N     . ARG C 1 147 ? 6.858   45.672  65.985 1.00 36.79 ? 1176 ARG C N     1 
ATOM   3993 C  CA    . ARG C 1 147 ? 5.613   46.162  66.565 1.00 35.97 ? 1176 ARG C CA    1 
ATOM   3994 C  C     . ARG C 1 147 ? 5.559   46.310  68.074 1.00 35.19 ? 1176 ARG C C     1 
ATOM   3995 O  O     . ARG C 1 147 ? 4.578   46.828  68.603 1.00 34.48 ? 1176 ARG C O     1 
ATOM   3996 C  CB    . ARG C 1 147 ? 4.462   45.264  66.124 1.00 35.16 ? 1176 ARG C CB    1 
ATOM   3997 C  CG    . ARG C 1 147 ? 4.152   45.347  64.649 1.00 35.70 ? 1176 ARG C CG    1 
ATOM   3998 C  CD    . ARG C 1 147 ? 3.588   46.703  64.326 1.00 37.48 ? 1176 ARG C CD    1 
ATOM   3999 N  NE    . ARG C 1 147 ? 2.959   46.745  63.014 1.00 37.25 ? 1176 ARG C NE    1 
ATOM   4000 C  CZ    . ARG C 1 147 ? 2.159   47.726  62.621 1.00 38.60 ? 1176 ARG C CZ    1 
ATOM   4001 N  NH1   . ARG C 1 147 ? 1.900   48.736  63.448 1.00 39.12 ? 1176 ARG C NH1   1 
ATOM   4002 N  NH2   . ARG C 1 147 ? 1.613   47.698  61.414 1.00 39.49 ? 1176 ARG C NH2   1 
ATOM   4003 N  N     . THR C 1 148 ? 6.587   45.860  68.777 1.00 35.15 ? 1177 THR C N     1 
ATOM   4004 C  CA    . THR C 1 148 ? 6.563   45.988  70.227 1.00 35.40 ? 1177 THR C CA    1 
ATOM   4005 C  C     . THR C 1 148 ? 6.806   47.434  70.634 1.00 36.19 ? 1177 THR C C     1 
ATOM   4006 O  O     . THR C 1 148 ? 7.406   48.207  69.889 1.00 35.25 ? 1177 THR C O     1 
ATOM   4007 C  CB    . THR C 1 148 ? 7.617   45.087  70.894 1.00 34.79 ? 1177 THR C CB    1 
ATOM   4008 O  OG1   . THR C 1 148 ? 8.923   45.433  70.413 1.00 36.35 ? 1177 THR C OG1   1 
ATOM   4009 C  CG2   . THR C 1 148 ? 7.324   43.623  70.591 1.00 34.13 ? 1177 THR C CG2   1 
ATOM   4010 N  N     . ARG C 1 149 ? 6.319   47.796  71.814 1.00 36.59 ? 1178 ARG C N     1 
ATOM   4011 C  CA    . ARG C 1 149 ? 6.486   49.146  72.331 1.00 40.11 ? 1178 ARG C CA    1 
ATOM   4012 C  C     . ARG C 1 149 ? 7.055   49.038  73.738 1.00 43.15 ? 1178 ARG C C     1 
ATOM   4013 O  O     . ARG C 1 149 ? 6.333   48.768  74.697 1.00 42.18 ? 1178 ARG C O     1 
ATOM   4014 C  CB    . ARG C 1 149 ? 5.140   49.878  72.338 1.00 36.56 ? 1178 ARG C CB    1 
ATOM   4015 C  CG    . ARG C 1 149 ? 3.953   48.974  72.078 1.00 39.46 ? 1178 ARG C CG    1 
ATOM   4016 C  CD    . ARG C 1 149 ? 2.641   49.749  72.062 1.00 36.59 ? 1178 ARG C CD    1 
ATOM   4017 N  NE    . ARG C 1 149 ? 2.673   50.759  71.024 1.00 36.30 ? 1178 ARG C NE    1 
ATOM   4018 C  CZ    . ARG C 1 149 ? 2.636   52.067  71.242 1.00 34.47 ? 1178 ARG C CZ    1 
ATOM   4019 N  NH1   . ARG C 1 149 ? 2.552   52.551  72.475 1.00 30.52 ? 1178 ARG C NH1   1 
ATOM   4020 N  NH2   . ARG C 1 149 ? 2.713   52.892  70.212 1.00 30.24 ? 1178 ARG C NH2   1 
ATOM   4021 N  N     . VAL C 1 150 ? 8.361   49.247  73.849 1.00 48.43 ? 1179 VAL C N     1 
ATOM   4022 C  CA    . VAL C 1 150 ? 9.050   49.138  75.128 1.00 53.54 ? 1179 VAL C CA    1 
ATOM   4023 C  C     . VAL C 1 150 ? 9.298   50.467  75.826 1.00 58.02 ? 1179 VAL C C     1 
ATOM   4024 O  O     . VAL C 1 150 ? 8.973   51.537  75.309 1.00 58.09 ? 1179 VAL C O     1 
ATOM   4025 C  CB    . VAL C 1 150 ? 10.413  48.443  74.954 1.00 53.71 ? 1179 VAL C CB    1 
ATOM   4026 C  CG1   . VAL C 1 150 ? 10.233  47.107  74.250 1.00 53.24 ? 1179 VAL C CG1   1 
ATOM   4027 C  CG2   . VAL C 1 150 ? 11.349  49.338  74.160 1.00 53.58 ? 1179 VAL C CG2   1 
ATOM   4028 N  N     . LYS C 1 151 ? 9.888   50.372  77.012 1.00 63.49 ? 1180 LYS C N     1 
ATOM   4029 C  CA    . LYS C 1 151 ? 10.229  51.531  77.827 1.00 68.75 ? 1180 LYS C CA    1 
ATOM   4030 C  C     . LYS C 1 151 ? 11.638  51.957  77.410 1.00 70.97 ? 1180 LYS C C     1 
ATOM   4031 O  O     . LYS C 1 151 ? 12.621  51.327  77.796 1.00 71.43 ? 1180 LYS C O     1 
ATOM   4032 C  CB    . LYS C 1 151 ? 10.213  51.129  79.303 1.00 70.02 ? 1180 LYS C CB    1 
ATOM   4033 C  CG    . LYS C 1 151 ? 8.917   50.456  79.743 1.00 71.56 ? 1180 LYS C CG    1 
ATOM   4034 C  CD    . LYS C 1 151 ? 9.170   49.372  80.792 1.00 73.09 ? 1180 LYS C CD    1 
ATOM   4035 C  CE    . LYS C 1 151 ? 9.949   48.199  80.198 1.00 73.63 ? 1180 LYS C CE    1 
ATOM   4036 N  NZ    . LYS C 1 151 ? 10.288  47.163  81.215 1.00 73.16 ? 1180 LYS C NZ    1 
ATOM   4037 N  N     . THR C 1 152 ? 11.731  53.023  76.620 1.00 74.41 ? 1181 THR C N     1 
ATOM   4038 C  CA    . THR C 1 152 ? 13.020  53.506  76.123 1.00 77.52 ? 1181 THR C CA    1 
ATOM   4039 C  C     . THR C 1 152 ? 13.878  54.268  77.135 1.00 78.78 ? 1181 THR C C     1 
ATOM   4040 O  O     . THR C 1 152 ? 15.093  54.374  76.960 1.00 79.40 ? 1181 THR C O     1 
ATOM   4041 C  CB    . THR C 1 152 ? 12.832  54.404  74.875 1.00 78.45 ? 1181 THR C CB    1 
ATOM   4042 O  OG1   . THR C 1 152 ? 12.041  55.551  75.218 1.00 79.56 ? 1181 THR C OG1   1 
ATOM   4043 C  CG2   . THR C 1 152 ? 12.140  53.628  73.757 1.00 78.46 ? 1181 THR C CG2   1 
ATOM   4044 N  N     . THR C 1 153 ? 13.251  54.795  78.184 1.00 79.75 ? 1182 THR C N     1 
ATOM   4045 C  CA    . THR C 1 153 ? 13.960  55.552  79.217 1.00 80.21 ? 1182 THR C CA    1 
ATOM   4046 C  C     . THR C 1 153 ? 14.934  56.574  78.624 1.00 79.49 ? 1182 THR C C     1 
ATOM   4047 O  O     . THR C 1 153 ? 14.562  57.376  77.765 1.00 80.12 ? 1182 THR C O     1 
ATOM   4048 C  CB    . THR C 1 153 ? 14.755  54.620  80.169 1.00 81.13 ? 1182 THR C CB    1 
ATOM   4049 O  OG1   . THR C 1 153 ? 15.799  53.961  79.441 1.00 82.05 ? 1182 THR C OG1   1 
ATOM   4050 C  CG2   . THR C 1 153 ? 13.835  53.576  80.785 1.00 82.05 ? 1182 THR C CG2   1 
ATOM   4051 N  N     . GLY C 1 154 ? 16.181  56.531  79.086 1.00 78.32 ? 1183 GLY C N     1 
ATOM   4052 C  CA    . GLY C 1 154 ? 17.195  57.456  78.609 1.00 76.69 ? 1183 GLY C CA    1 
ATOM   4053 C  C     . GLY C 1 154 ? 17.536  57.344  77.134 1.00 75.41 ? 1183 GLY C C     1 
ATOM   4054 O  O     . GLY C 1 154 ? 17.441  56.270  76.539 1.00 75.21 ? 1183 GLY C O     1 
ATOM   4055 N  N     . ILE C 1 155 ? 17.941  58.474  76.556 1.00 73.23 ? 1184 ILE C N     1 
ATOM   4056 C  CA    . ILE C 1 155 ? 18.317  58.578  75.147 1.00 71.38 ? 1184 ILE C CA    1 
ATOM   4057 C  C     . ILE C 1 155 ? 18.720  57.256  74.501 1.00 69.57 ? 1184 ILE C C     1 
ATOM   4058 O  O     . ILE C 1 155 ? 19.710  56.648  74.891 1.00 69.70 ? 1184 ILE C O     1 
ATOM   4059 C  CB    . ILE C 1 155 ? 19.486  59.578  74.973 1.00 71.64 ? 1184 ILE C CB    1 
ATOM   4060 C  CG1   . ILE C 1 155 ? 19.045  60.976  75.416 1.00 71.16 ? 1184 ILE C CG1   1 
ATOM   4061 C  CG2   . ILE C 1 155 ? 19.959  59.589  73.525 1.00 71.52 ? 1184 ILE C CG2   1 
ATOM   4062 C  CD1   . ILE C 1 155 ? 20.147  62.014  75.386 1.00 70.93 ? 1184 ILE C CD1   1 
ATOM   4063 N  N     . VAL C 1 156 ? 17.944  56.817  73.514 1.00 67.86 ? 1185 VAL C N     1 
ATOM   4064 C  CA    . VAL C 1 156 ? 18.235  55.575  72.805 1.00 65.44 ? 1185 VAL C CA    1 
ATOM   4065 C  C     . VAL C 1 156 ? 19.171  55.891  71.645 1.00 64.75 ? 1185 VAL C C     1 
ATOM   4066 O  O     . VAL C 1 156 ? 19.199  57.016  71.149 1.00 64.03 ? 1185 VAL C O     1 
ATOM   4067 C  CB    . VAL C 1 156 ? 16.951  54.921  72.245 1.00 65.24 ? 1185 VAL C CB    1 
ATOM   4068 C  CG1   . VAL C 1 156 ? 17.298  53.627  71.526 1.00 63.78 ? 1185 VAL C CG1   1 
ATOM   4069 C  CG2   . VAL C 1 156 ? 15.968  54.644  73.374 1.00 64.78 ? 1185 VAL C CG2   1 
ATOM   4070 N  N     . GLU C 1 157 ? 19.936  54.896  71.213 1.00 64.05 ? 1186 GLU C N     1 
ATOM   4071 C  CA    . GLU C 1 157 ? 20.879  55.092  70.123 1.00 62.82 ? 1186 GLU C CA    1 
ATOM   4072 C  C     . GLU C 1 157 ? 21.245  53.784  69.446 1.00 60.59 ? 1186 GLU C C     1 
ATOM   4073 O  O     . GLU C 1 157 ? 21.203  52.722  70.060 1.00 60.20 ? 1186 GLU C O     1 
ATOM   4074 C  CB    . GLU C 1 157 ? 22.148  55.766  70.650 1.00 65.19 ? 1186 GLU C CB    1 
ATOM   4075 C  CG    . GLU C 1 157 ? 23.317  55.735  69.677 1.00 69.77 ? 1186 GLU C CG    1 
ATOM   4076 C  CD    . GLU C 1 157 ? 24.544  56.459  70.203 1.00 72.08 ? 1186 GLU C CD    1 
ATOM   4077 O  OE1   . GLU C 1 157 ? 24.984  56.150  71.335 1.00 72.94 ? 1186 GLU C OE1   1 
ATOM   4078 O  OE2   . GLU C 1 157 ? 25.073  57.331  69.477 1.00 72.57 ? 1186 GLU C OE2   1 
ATOM   4079 N  N     . THR C 1 158 ? 21.601  53.875  68.170 1.00 58.75 ? 1187 THR C N     1 
ATOM   4080 C  CA    . THR C 1 158 ? 21.993  52.710  67.392 1.00 57.18 ? 1187 THR C CA    1 
ATOM   4081 C  C     . THR C 1 158 ? 23.071  53.108  66.388 1.00 56.96 ? 1187 THR C C     1 
ATOM   4082 O  O     . THR C 1 158 ? 23.064  54.224  65.869 1.00 56.06 ? 1187 THR C O     1 
ATOM   4083 C  CB    . THR C 1 158 ? 20.798  52.120  66.627 1.00 55.34 ? 1187 THR C CB    1 
ATOM   4084 O  OG1   . THR C 1 158 ? 21.186  50.882  66.021 1.00 53.79 ? 1187 THR C OG1   1 
ATOM   4085 C  CG2   . THR C 1 158 ? 20.329  53.080  65.545 1.00 54.81 ? 1187 THR C CG2   1 
ATOM   4086 N  N     . HIS C 1 159 ? 23.998  52.194  66.122 1.00 57.54 ? 1188 HIS C N     1 
ATOM   4087 C  CA    . HIS C 1 159 ? 25.080  52.461  65.180 1.00 58.32 ? 1188 HIS C CA    1 
ATOM   4088 C  C     . HIS C 1 159 ? 25.066  51.413  64.083 1.00 56.48 ? 1188 HIS C C     1 
ATOM   4089 O  O     . HIS C 1 159 ? 24.675  50.274  64.314 1.00 57.09 ? 1188 HIS C O     1 
ATOM   4090 C  CB    . HIS C 1 159 ? 26.442  52.414  65.881 1.00 62.09 ? 1188 HIS C CB    1 
ATOM   4091 C  CG    . HIS C 1 159 ? 26.519  53.242  67.124 1.00 65.32 ? 1188 HIS C CG    1 
ATOM   4092 N  ND1   . HIS C 1 159 ? 25.867  52.897  68.289 1.00 67.05 ? 1188 HIS C ND1   1 
ATOM   4093 C  CD2   . HIS C 1 159 ? 27.176  54.397  67.388 1.00 67.40 ? 1188 HIS C CD2   1 
ATOM   4094 C  CE1   . HIS C 1 159 ? 26.120  53.803  69.217 1.00 68.55 ? 1188 HIS C CE1   1 
ATOM   4095 N  NE2   . HIS C 1 159 ? 26.912  54.724  68.696 1.00 68.38 ? 1188 HIS C NE2   1 
ATOM   4096 N  N     . PHE C 1 160 ? 25.498  51.795  62.890 1.00 54.29 ? 1189 PHE C N     1 
ATOM   4097 C  CA    . PHE C 1 160 ? 25.539  50.859  61.780 1.00 53.08 ? 1189 PHE C CA    1 
ATOM   4098 C  C     . PHE C 1 160 ? 26.350  51.429  60.631 1.00 52.39 ? 1189 PHE C C     1 
ATOM   4099 O  O     . PHE C 1 160 ? 26.519  52.644  60.516 1.00 52.88 ? 1189 PHE C O     1 
ATOM   4100 C  CB    . PHE C 1 160 ? 24.116  50.508  61.317 1.00 52.95 ? 1189 PHE C CB    1 
ATOM   4101 C  CG    . PHE C 1 160 ? 23.346  51.669  60.742 1.00 51.42 ? 1189 PHE C CG    1 
ATOM   4102 C  CD1   . PHE C 1 160 ? 23.470  52.009  59.398 1.00 50.74 ? 1189 PHE C CD1   1 
ATOM   4103 C  CD2   . PHE C 1 160 ? 22.483  52.412  61.543 1.00 50.44 ? 1189 PHE C CD2   1 
ATOM   4104 C  CE1   . PHE C 1 160 ? 22.743  53.072  58.859 1.00 49.90 ? 1189 PHE C CE1   1 
ATOM   4105 C  CE2   . PHE C 1 160 ? 21.752  53.476  61.013 1.00 48.84 ? 1189 PHE C CE2   1 
ATOM   4106 C  CZ    . PHE C 1 160 ? 21.882  53.806  59.669 1.00 48.99 ? 1189 PHE C CZ    1 
ATOM   4107 N  N     . THR C 1 161 ? 26.858  50.539  59.788 1.00 51.84 ? 1190 THR C N     1 
ATOM   4108 C  CA    . THR C 1 161 ? 27.664  50.937  58.645 1.00 51.20 ? 1190 THR C CA    1 
ATOM   4109 C  C     . THR C 1 161 ? 26.890  50.724  57.352 1.00 51.27 ? 1190 THR C C     1 
ATOM   4110 O  O     . THR C 1 161 ? 26.381  49.630  57.099 1.00 51.06 ? 1190 THR C O     1 
ATOM   4111 C  CB    . THR C 1 161 ? 28.975  50.127  58.601 1.00 51.09 ? 1190 THR C CB    1 
ATOM   4112 O  OG1   . THR C 1 161 ? 29.733  50.391  59.788 1.00 49.15 ? 1190 THR C OG1   1 
ATOM   4113 C  CG2   . THR C 1 161 ? 29.801  50.504  57.383 1.00 50.86 ? 1190 THR C CG2   1 
ATOM   4114 N  N     . PHE C 1 162 ? 26.804  51.775  56.541 1.00 50.79 ? 1191 PHE C N     1 
ATOM   4115 C  CA    . PHE C 1 162 ? 26.086  51.712  55.272 1.00 50.55 ? 1191 PHE C CA    1 
ATOM   4116 C  C     . PHE C 1 162 ? 26.773  52.578  54.215 1.00 50.81 ? 1191 PHE C C     1 
ATOM   4117 O  O     . PHE C 1 162 ? 27.067  53.748  54.454 1.00 50.23 ? 1191 PHE C O     1 
ATOM   4118 C  CB    . PHE C 1 162 ? 24.633  52.163  55.474 1.00 47.73 ? 1191 PHE C CB    1 
ATOM   4119 C  CG    . PHE C 1 162 ? 23.782  52.060  54.235 1.00 45.76 ? 1191 PHE C CG    1 
ATOM   4120 C  CD1   . PHE C 1 162 ? 23.771  50.892  53.476 1.00 44.07 ? 1191 PHE C CD1   1 
ATOM   4121 C  CD2   . PHE C 1 162 ? 22.982  53.129  53.834 1.00 45.17 ? 1191 PHE C CD2   1 
ATOM   4122 C  CE1   . PHE C 1 162 ? 22.979  50.790  52.335 1.00 43.06 ? 1191 PHE C CE1   1 
ATOM   4123 C  CE2   . PHE C 1 162 ? 22.184  53.041  52.694 1.00 44.26 ? 1191 PHE C CE2   1 
ATOM   4124 C  CZ    . PHE C 1 162 ? 22.182  51.867  51.941 1.00 45.05 ? 1191 PHE C CZ    1 
ATOM   4125 N  N     . LYS C 1 163 ? 27.015  51.991  53.045 1.00 52.06 ? 1192 LYS C N     1 
ATOM   4126 C  CA    . LYS C 1 163 ? 27.683  52.679  51.945 1.00 53.38 ? 1192 LYS C CA    1 
ATOM   4127 C  C     . LYS C 1 163 ? 28.960  53.382  52.399 1.00 54.63 ? 1192 LYS C C     1 
ATOM   4128 O  O     . LYS C 1 163 ? 29.198  54.548  52.076 1.00 54.15 ? 1192 LYS C O     1 
ATOM   4129 C  CB    . LYS C 1 163 ? 26.732  53.675  51.281 1.00 54.31 ? 1192 LYS C CB    1 
ATOM   4130 C  CG    . LYS C 1 163 ? 25.638  52.997  50.476 1.00 56.33 ? 1192 LYS C CG    1 
ATOM   4131 C  CD    . LYS C 1 163 ? 24.906  53.973  49.580 1.00 58.54 ? 1192 LYS C CD    1 
ATOM   4132 C  CE    . LYS C 1 163 ? 23.923  53.245  48.677 1.00 60.08 ? 1192 LYS C CE    1 
ATOM   4133 N  NZ    . LYS C 1 163 ? 23.202  54.178  47.767 1.00 62.29 ? 1192 LYS C NZ    1 
ATOM   4134 N  N     . ASP C 1 164 ? 29.777  52.649  53.150 1.00 55.84 ? 1193 ASP C N     1 
ATOM   4135 C  CA    . ASP C 1 164 ? 31.046  53.152  53.667 1.00 57.33 ? 1193 ASP C CA    1 
ATOM   4136 C  C     . ASP C 1 164 ? 30.877  54.340  54.608 1.00 56.72 ? 1193 ASP C C     1 
ATOM   4137 O  O     . ASP C 1 164 ? 31.717  55.243  54.643 1.00 56.88 ? 1193 ASP C O     1 
ATOM   4138 C  CB    . ASP C 1 164 ? 31.974  53.533  52.508 1.00 59.68 ? 1193 ASP C CB    1 
ATOM   4139 C  CG    . ASP C 1 164 ? 32.233  52.372  51.565 1.00 62.52 ? 1193 ASP C CG    1 
ATOM   4140 O  OD1   . ASP C 1 164 ? 32.716  51.317  52.034 1.00 62.95 ? 1193 ASP C OD1   1 
ATOM   4141 O  OD2   . ASP C 1 164 ? 31.952  52.512  50.354 1.00 65.44 ? 1193 ASP C OD2   1 
ATOM   4142 N  N     . LEU C 1 165 ? 29.792  54.334  55.374 1.00 55.02 ? 1194 LEU C N     1 
ATOM   4143 C  CA    . LEU C 1 165 ? 29.530  55.408  56.324 1.00 52.57 ? 1194 LEU C CA    1 
ATOM   4144 C  C     . LEU C 1 165 ? 29.220  54.838  57.697 1.00 51.61 ? 1194 LEU C C     1 
ATOM   4145 O  O     . LEU C 1 165 ? 28.598  53.785  57.817 1.00 52.01 ? 1194 LEU C O     1 
ATOM   4146 C  CB    . LEU C 1 165 ? 28.357  56.266  55.850 1.00 50.72 ? 1194 LEU C CB    1 
ATOM   4147 C  CG    . LEU C 1 165 ? 28.577  57.036  54.550 1.00 50.63 ? 1194 LEU C CG    1 
ATOM   4148 C  CD1   . LEU C 1 165 ? 27.277  57.682  54.105 1.00 49.88 ? 1194 LEU C CD1   1 
ATOM   4149 C  CD2   . LEU C 1 165 ? 29.660  58.080  54.756 1.00 50.63 ? 1194 LEU C CD2   1 
ATOM   4150 N  N     . HIS C 1 166 ? 29.675  55.532  58.732 1.00 50.88 ? 1195 HIS C N     1 
ATOM   4151 C  CA    . HIS C 1 166 ? 29.419  55.105  60.097 1.00 50.90 ? 1195 HIS C CA    1 
ATOM   4152 C  C     . HIS C 1 166 ? 28.292  55.977  60.620 1.00 49.83 ? 1195 HIS C C     1 
ATOM   4153 O  O     . HIS C 1 166 ? 28.512  57.124  61.015 1.00 50.16 ? 1195 HIS C O     1 
ATOM   4154 C  CB    . HIS C 1 166 ? 30.673  55.276  60.955 1.00 51.90 ? 1195 HIS C CB    1 
ATOM   4155 C  CG    . HIS C 1 166 ? 31.772  54.319  60.607 1.00 56.01 ? 1195 HIS C CG    1 
ATOM   4156 N  ND1   . HIS C 1 166 ? 31.668  52.959  60.810 1.00 57.59 ? 1195 HIS C ND1   1 
ATOM   4157 C  CD2   . HIS C 1 166 ? 32.989  54.523  60.049 1.00 56.75 ? 1195 HIS C CD2   1 
ATOM   4158 C  CE1   . HIS C 1 166 ? 32.772  52.367  60.392 1.00 56.94 ? 1195 HIS C CE1   1 
ATOM   4159 N  NE2   . HIS C 1 166 ? 33.590  53.293  59.926 1.00 57.71 ? 1195 HIS C NE2   1 
ATOM   4160 N  N     . PHE C 1 167 ? 27.079  55.435  60.597 1.00 48.45 ? 1196 PHE C N     1 
ATOM   4161 C  CA    . PHE C 1 167 ? 25.909  56.170  61.058 1.00 46.60 ? 1196 PHE C CA    1 
ATOM   4162 C  C     . PHE C 1 167 ? 25.666  56.100  62.556 1.00 46.20 ? 1196 PHE C C     1 
ATOM   4163 O  O     . PHE C 1 167 ? 25.739  55.036  63.169 1.00 47.03 ? 1196 PHE C O     1 
ATOM   4164 C  CB    . PHE C 1 167 ? 24.647  55.690  60.338 1.00 43.80 ? 1196 PHE C CB    1 
ATOM   4165 C  CG    . PHE C 1 167 ? 24.535  56.175  58.923 1.00 42.87 ? 1196 PHE C CG    1 
ATOM   4166 C  CD1   . PHE C 1 167 ? 24.950  55.377  57.863 1.00 40.56 ? 1196 PHE C CD1   1 
ATOM   4167 C  CD2   . PHE C 1 167 ? 24.016  57.437  58.650 1.00 40.76 ? 1196 PHE C CD2   1 
ATOM   4168 C  CE1   . PHE C 1 167 ? 24.848  55.829  56.550 1.00 40.78 ? 1196 PHE C CE1   1 
ATOM   4169 C  CE2   . PHE C 1 167 ? 23.912  57.897  57.341 1.00 41.75 ? 1196 PHE C CE2   1 
ATOM   4170 C  CZ    . PHE C 1 167 ? 24.329  57.090  56.287 1.00 39.35 ? 1196 PHE C CZ    1 
ATOM   4171 N  N     . LYS C 1 168 ? 25.363  57.258  63.128 1.00 46.07 ? 1197 LYS C N     1 
ATOM   4172 C  CA    . LYS C 1 168 ? 25.072  57.389  64.545 1.00 45.99 ? 1197 LYS C CA    1 
ATOM   4173 C  C     . LYS C 1 168 ? 23.657  57.992  64.608 1.00 43.15 ? 1197 LYS C C     1 
ATOM   4174 O  O     . LYS C 1 168 ? 23.476  59.177  64.334 1.00 42.43 ? 1197 LYS C O     1 
ATOM   4175 C  CB    . LYS C 1 168 ? 26.095  58.336  65.183 1.00 48.07 ? 1197 LYS C CB    1 
ATOM   4176 C  CG    . LYS C 1 168 ? 26.551  57.951  66.583 1.00 53.22 ? 1197 LYS C CG    1 
ATOM   4177 C  CD    . LYS C 1 168 ? 27.778  58.770  66.998 1.00 55.26 ? 1197 LYS C CD    1 
ATOM   4178 C  CE    . LYS C 1 168 ? 28.338  58.322  68.348 1.00 57.07 ? 1197 LYS C CE    1 
ATOM   4179 N  NZ    . LYS C 1 168 ? 29.584  59.062  68.721 1.00 56.33 ? 1197 LYS C NZ    1 
ATOM   4180 N  N     . MET C 1 169 ? 22.662  57.175  64.953 1.00 41.48 ? 1198 MET C N     1 
ATOM   4181 C  CA    . MET C 1 169 ? 21.273  57.642  65.025 1.00 39.34 ? 1198 MET C CA    1 
ATOM   4182 C  C     . MET C 1 169 ? 20.735  57.737  66.457 1.00 38.45 ? 1198 MET C C     1 
ATOM   4183 O  O     . MET C 1 169 ? 20.592  56.728  67.146 1.00 36.63 ? 1198 MET C O     1 
ATOM   4184 C  CB    . MET C 1 169 ? 20.370  56.721  64.198 1.00 38.45 ? 1198 MET C CB    1 
ATOM   4185 C  CG    . MET C 1 169 ? 18.927  57.205  64.084 1.00 38.21 ? 1198 MET C CG    1 
ATOM   4186 S  SD    . MET C 1 169 ? 17.888  56.101  63.099 1.00 36.99 ? 1198 MET C SD    1 
ATOM   4187 C  CE    . MET C 1 169 ? 18.382  56.555  61.415 1.00 34.56 ? 1198 MET C CE    1 
ATOM   4188 N  N     . PHE C 1 170 ? 20.423  58.955  66.891 1.00 37.23 ? 1199 PHE C N     1 
ATOM   4189 C  CA    . PHE C 1 170 ? 19.909  59.184  68.239 1.00 37.97 ? 1199 PHE C CA    1 
ATOM   4190 C  C     . PHE C 1 170 ? 18.390  59.419  68.274 1.00 37.65 ? 1199 PHE C C     1 
ATOM   4191 O  O     . PHE C 1 170 ? 17.792  59.884  67.301 1.00 35.53 ? 1199 PHE C O     1 
ATOM   4192 C  CB    . PHE C 1 170 ? 20.595  60.404  68.869 1.00 39.01 ? 1199 PHE C CB    1 
ATOM   4193 C  CG    . PHE C 1 170 ? 22.094  60.277  69.007 1.00 41.78 ? 1199 PHE C CG    1 
ATOM   4194 C  CD1   . PHE C 1 170 ? 22.679  60.136  70.263 1.00 41.75 ? 1199 PHE C CD1   1 
ATOM   4195 C  CD2   . PHE C 1 170 ? 22.922  60.346  67.887 1.00 42.03 ? 1199 PHE C CD2   1 
ATOM   4196 C  CE1   . PHE C 1 170 ? 24.071  60.071  70.405 1.00 43.91 ? 1199 PHE C CE1   1 
ATOM   4197 C  CE2   . PHE C 1 170 ? 24.316  60.281  68.016 1.00 42.78 ? 1199 PHE C CE2   1 
ATOM   4198 C  CZ    . PHE C 1 170 ? 24.890  60.144  69.277 1.00 43.13 ? 1199 PHE C CZ    1 
ATOM   4199 N  N     . ASP C 1 171 ? 17.783  59.100  69.414 1.00 35.61 ? 1200 ASP C N     1 
ATOM   4200 C  CA    . ASP C 1 171 ? 16.354  59.302  69.629 1.00 33.73 ? 1200 ASP C CA    1 
ATOM   4201 C  C     . ASP C 1 171 ? 16.097  59.530  71.109 1.00 32.92 ? 1200 ASP C C     1 
ATOM   4202 O  O     . ASP C 1 171 ? 16.101  58.590  71.895 1.00 30.88 ? 1200 ASP C O     1 
ATOM   4203 C  CB    . ASP C 1 171 ? 15.537  58.097  69.149 1.00 31.40 ? 1200 ASP C CB    1 
ATOM   4204 C  CG    . ASP C 1 171 ? 14.053  58.218  69.500 1.00 29.59 ? 1200 ASP C CG    1 
ATOM   4205 O  OD1   . ASP C 1 171 ? 13.541  59.357  69.568 1.00 27.60 ? 1200 ASP C OD1   1 
ATOM   4206 O  OD2   . ASP C 1 171 ? 13.397  57.178  69.697 1.00 25.52 ? 1200 ASP C OD2   1 
ATOM   4207 N  N     . VAL C 1 172 ? 15.884  60.785  71.483 1.00 35.92 ? 1201 VAL C N     1 
ATOM   4208 C  CA    . VAL C 1 172 ? 15.616  61.126  72.874 1.00 38.54 ? 1201 VAL C CA    1 
ATOM   4209 C  C     . VAL C 1 172 ? 14.330  60.454  73.366 1.00 40.92 ? 1201 VAL C C     1 
ATOM   4210 O  O     . VAL C 1 172 ? 14.216  60.091  74.536 1.00 42.70 ? 1201 VAL C O     1 
ATOM   4211 C  CB    . VAL C 1 172 ? 15.500  62.652  73.054 1.00 38.55 ? 1201 VAL C CB    1 
ATOM   4212 C  CG1   . VAL C 1 172 ? 15.245  62.989  74.524 1.00 40.25 ? 1201 VAL C CG1   1 
ATOM   4213 C  CG2   . VAL C 1 172 ? 16.779  63.324  72.584 1.00 38.30 ? 1201 VAL C CG2   1 
ATOM   4214 N  N     . GLY C 1 173 ? 13.364  60.278  72.470 1.00 42.46 ? 1202 GLY C N     1 
ATOM   4215 C  CA    . GLY C 1 173 ? 12.118  59.639  72.857 1.00 44.24 ? 1202 GLY C CA    1 
ATOM   4216 C  C     . GLY C 1 173 ? 11.239  60.501  73.747 1.00 45.63 ? 1202 GLY C C     1 
ATOM   4217 O  O     . GLY C 1 173 ? 11.313  61.733  73.711 1.00 44.63 ? 1202 GLY C O     1 
ATOM   4218 N  N     . GLY C 1 174 ? 10.408  59.852  74.558 1.00 48.16 ? 1203 GLY C N     1 
ATOM   4219 C  CA    . GLY C 1 174 ? 9.507   60.583  75.432 1.00 50.95 ? 1203 GLY C CA    1 
ATOM   4220 C  C     . GLY C 1 174 ? 10.004  60.822  76.845 1.00 53.65 ? 1203 GLY C C     1 
ATOM   4221 O  O     . GLY C 1 174 ? 9.224   60.783  77.798 1.00 54.31 ? 1203 GLY C O     1 
ATOM   4222 N  N     . GLN C 1 175 ? 11.300  61.070  76.994 1.00 55.35 ? 1204 GLN C N     1 
ATOM   4223 C  CA    . GLN C 1 175 ? 11.862  61.322  78.314 1.00 57.08 ? 1204 GLN C CA    1 
ATOM   4224 C  C     . GLN C 1 175 ? 12.177  62.803  78.447 1.00 57.65 ? 1204 GLN C C     1 
ATOM   4225 O  O     . GLN C 1 175 ? 12.921  63.355  77.635 1.00 58.44 ? 1204 GLN C O     1 
ATOM   4226 C  CB    . GLN C 1 175 ? 13.141  60.510  78.510 1.00 59.34 ? 1204 GLN C CB    1 
ATOM   4227 C  CG    . GLN C 1 175 ? 13.690  60.575  79.924 1.00 62.89 ? 1204 GLN C CG    1 
ATOM   4228 C  CD    . GLN C 1 175 ? 15.062  59.946  80.043 1.00 65.34 ? 1204 GLN C CD    1 
ATOM   4229 O  OE1   . GLN C 1 175 ? 16.018  60.393  79.405 1.00 66.54 ? 1204 GLN C OE1   1 
ATOM   4230 N  NE2   . GLN C 1 175 ? 15.168  58.903  80.860 1.00 66.33 ? 1204 GLN C NE2   1 
ATOM   4231 N  N     . ARG C 1 176 ? 11.610  63.447  79.464 1.00 58.04 ? 1205 ARG C N     1 
ATOM   4232 C  CA    . ARG C 1 176 ? 11.848  64.871  79.687 1.00 58.46 ? 1205 ARG C CA    1 
ATOM   4233 C  C     . ARG C 1 176 ? 13.322  65.115  79.985 1.00 57.18 ? 1205 ARG C C     1 
ATOM   4234 O  O     . ARG C 1 176 ? 13.752  65.006  81.129 1.00 58.88 ? 1205 ARG C O     1 
ATOM   4235 C  CB    . ARG C 1 176 ? 11.013  65.382  80.863 1.00 60.89 ? 1205 ARG C CB    1 
ATOM   4236 C  CG    . ARG C 1 176 ? 9.509   65.302  80.661 1.00 65.33 ? 1205 ARG C CG    1 
ATOM   4237 C  CD    . ARG C 1 176 ? 8.780   65.906  81.855 1.00 68.83 ? 1205 ARG C CD    1 
ATOM   4238 N  NE    . ARG C 1 176 ? 7.328   65.820  81.727 1.00 71.79 ? 1205 ARG C NE    1 
ATOM   4239 C  CZ    . ARG C 1 176 ? 6.473   66.235  82.658 1.00 73.34 ? 1205 ARG C CZ    1 
ATOM   4240 N  NH1   . ARG C 1 176 ? 6.926   66.768  83.787 1.00 73.58 ? 1205 ARG C NH1   1 
ATOM   4241 N  NH2   . ARG C 1 176 ? 5.166   66.113  82.464 1.00 73.40 ? 1205 ARG C NH2   1 
ATOM   4242 N  N     . SER C 1 177 ? 14.093  65.449  78.957 1.00 55.17 ? 1206 SER C N     1 
ATOM   4243 C  CA    . SER C 1 177 ? 15.519  65.696  79.119 1.00 51.71 ? 1206 SER C CA    1 
ATOM   4244 C  C     . SER C 1 177 ? 15.808  67.162  79.402 1.00 51.28 ? 1206 SER C C     1 
ATOM   4245 O  O     . SER C 1 177 ? 15.045  68.042  79.010 1.00 49.94 ? 1206 SER C O     1 
ATOM   4246 C  CB    . SER C 1 177 ? 16.270  65.243  77.867 1.00 50.00 ? 1206 SER C CB    1 
ATOM   4247 O  OG    . SER C 1 177 ? 16.086  63.854  77.657 1.00 49.12 ? 1206 SER C OG    1 
ATOM   4248 N  N     . GLU C 1 178 ? 16.917  67.416  80.089 1.00 51.65 ? 1207 GLU C N     1 
ATOM   4249 C  CA    . GLU C 1 178 ? 17.307  68.775  80.443 1.00 52.38 ? 1207 GLU C CA    1 
ATOM   4250 C  C     . GLU C 1 178 ? 18.001  69.510  79.307 1.00 51.29 ? 1207 GLU C C     1 
ATOM   4251 O  O     . GLU C 1 178 ? 18.497  68.898  78.366 1.00 49.87 ? 1207 GLU C O     1 
ATOM   4252 C  CB    . GLU C 1 178 ? 18.229  68.758  81.665 1.00 56.04 ? 1207 GLU C CB    1 
ATOM   4253 C  CG    . GLU C 1 178 ? 17.579  68.231  82.935 1.00 62.24 ? 1207 GLU C CG    1 
ATOM   4254 C  CD    . GLU C 1 178 ? 18.502  68.323  84.141 1.00 66.06 ? 1207 GLU C CD    1 
ATOM   4255 O  OE1   . GLU C 1 178 ? 19.606  67.735  84.090 1.00 67.52 ? 1207 GLU C OE1   1 
ATOM   4256 O  OE2   . GLU C 1 178 ? 18.123  68.983  85.135 1.00 66.87 ? 1207 GLU C OE2   1 
ATOM   4257 N  N     . ARG C 1 179 ? 18.031  70.834  79.416 1.00 51.25 ? 1208 ARG C N     1 
ATOM   4258 C  CA    . ARG C 1 179 ? 18.661  71.689  78.423 1.00 52.47 ? 1208 ARG C CA    1 
ATOM   4259 C  C     . ARG C 1 179 ? 20.078  71.209  78.117 1.00 53.01 ? 1208 ARG C C     1 
ATOM   4260 O  O     . ARG C 1 179 ? 20.616  71.489  77.048 1.00 53.52 ? 1208 ARG C O     1 
ATOM   4261 C  CB    . ARG C 1 179 ? 18.684  73.132  78.936 1.00 54.83 ? 1208 ARG C CB    1 
ATOM   4262 C  CG    . ARG C 1 179 ? 19.318  74.146  77.999 1.00 57.73 ? 1208 ARG C CG    1 
ATOM   4263 C  CD    . ARG C 1 179 ? 19.115  75.561  78.527 1.00 59.49 ? 1208 ARG C CD    1 
ATOM   4264 N  NE    . ARG C 1 179 ? 19.609  76.572  77.597 1.00 61.79 ? 1208 ARG C NE    1 
ATOM   4265 C  CZ    . ARG C 1 179 ? 19.296  77.863  77.663 1.00 64.04 ? 1208 ARG C CZ    1 
ATOM   4266 N  NH1   . ARG C 1 179 ? 18.486  78.302  78.617 1.00 65.11 ? 1208 ARG C NH1   1 
ATOM   4267 N  NH2   . ARG C 1 179 ? 19.789  78.715  76.773 1.00 65.24 ? 1208 ARG C NH2   1 
ATOM   4268 N  N     . LYS C 1 180 ? 20.673  70.479  79.057 1.00 52.71 ? 1209 LYS C N     1 
ATOM   4269 C  CA    . LYS C 1 180 ? 22.026  69.960  78.885 1.00 52.05 ? 1209 LYS C CA    1 
ATOM   4270 C  C     . LYS C 1 180 ? 22.055  68.920  77.776 1.00 49.01 ? 1209 LYS C C     1 
ATOM   4271 O  O     . LYS C 1 180 ? 22.701  69.114  76.745 1.00 47.67 ? 1209 LYS C O     1 
ATOM   4272 C  CB    . LYS C 1 180 ? 22.525  69.309  80.178 1.00 55.25 ? 1209 LYS C CB    1 
ATOM   4273 C  CG    . LYS C 1 180 ? 22.653  70.244  81.370 1.00 58.95 ? 1209 LYS C CG    1 
ATOM   4274 C  CD    . LYS C 1 180 ? 23.097  69.466  82.604 1.00 60.60 ? 1209 LYS C CD    1 
ATOM   4275 C  CE    . LYS C 1 180 ? 23.200  70.359  83.828 1.00 61.47 ? 1209 LYS C CE    1 
ATOM   4276 N  NZ    . LYS C 1 180 ? 23.527  69.570  85.049 1.00 62.74 ? 1209 LYS C NZ    1 
ATOM   4277 N  N     . LYS C 1 181 ? 21.356  67.814  78.011 1.00 46.84 ? 1210 LYS C N     1 
ATOM   4278 C  CA    . LYS C 1 181 ? 21.279  66.712  77.059 1.00 46.94 ? 1210 LYS C CA    1 
ATOM   4279 C  C     . LYS C 1 181 ? 20.868  67.199  75.671 1.00 44.56 ? 1210 LYS C C     1 
ATOM   4280 O  O     . LYS C 1 181 ? 21.564  66.954  74.686 1.00 43.62 ? 1210 LYS C O     1 
ATOM   4281 C  CB    . LYS C 1 181 ? 20.257  65.675  77.532 1.00 48.64 ? 1210 LYS C CB    1 
ATOM   4282 C  CG    . LYS C 1 181 ? 20.377  65.274  78.988 1.00 53.84 ? 1210 LYS C CG    1 
ATOM   4283 C  CD    . LYS C 1 181 ? 21.639  64.469  79.276 1.00 56.96 ? 1210 LYS C CD    1 
ATOM   4284 C  CE    . LYS C 1 181 ? 21.665  64.024  80.737 1.00 57.94 ? 1210 LYS C CE    1 
ATOM   4285 N  NZ    . LYS C 1 181 ? 22.898  63.268  81.086 1.00 60.32 ? 1210 LYS C NZ    1 
ATOM   4286 N  N     . TRP C 1 182 ? 19.730  67.882  75.604 1.00 42.15 ? 1211 TRP C N     1 
ATOM   4287 C  CA    . TRP C 1 182 ? 19.216  68.386  74.336 1.00 41.97 ? 1211 TRP C CA    1 
ATOM   4288 C  C     . TRP C 1 182 ? 20.253  69.143  73.516 1.00 40.92 ? 1211 TRP C C     1 
ATOM   4289 O  O     . TRP C 1 182 ? 20.394  68.899  72.319 1.00 39.50 ? 1211 TRP C O     1 
ATOM   4290 C  CB    . TRP C 1 182 ? 17.985  69.267  74.570 1.00 40.17 ? 1211 TRP C CB    1 
ATOM   4291 C  CG    . TRP C 1 182 ? 16.725  68.480  74.722 1.00 39.27 ? 1211 TRP C CG    1 
ATOM   4292 C  CD1   . TRP C 1 182 ? 15.928  68.408  75.825 1.00 38.63 ? 1211 TRP C CD1   1 
ATOM   4293 C  CD2   . TRP C 1 182 ? 16.115  67.646  73.731 1.00 39.06 ? 1211 TRP C CD2   1 
ATOM   4294 N  NE1   . TRP C 1 182 ? 14.859  67.579  75.585 1.00 36.96 ? 1211 TRP C NE1   1 
ATOM   4295 C  CE2   . TRP C 1 182 ? 14.949  67.099  74.306 1.00 37.57 ? 1211 TRP C CE2   1 
ATOM   4296 C  CE3   . TRP C 1 182 ? 16.441  67.309  72.409 1.00 40.37 ? 1211 TRP C CE3   1 
ATOM   4297 C  CZ2   . TRP C 1 182 ? 14.105  66.231  73.607 1.00 37.69 ? 1211 TRP C CZ2   1 
ATOM   4298 C  CZ3   . TRP C 1 182 ? 15.601  66.447  71.713 1.00 38.75 ? 1211 TRP C CZ3   1 
ATOM   4299 C  CH2   . TRP C 1 182 ? 14.447  65.919  72.315 1.00 38.91 ? 1211 TRP C CH2   1 
ATOM   4300 N  N     . ILE C 1 183 ? 20.973  70.057  74.158 1.00 40.76 ? 1212 ILE C N     1 
ATOM   4301 C  CA    . ILE C 1 183 ? 22.002  70.832  73.472 1.00 40.51 ? 1212 ILE C CA    1 
ATOM   4302 C  C     . ILE C 1 183 ? 23.061  69.915  72.864 1.00 40.91 ? 1212 ILE C C     1 
ATOM   4303 O  O     . ILE C 1 183 ? 23.460  70.092  71.713 1.00 39.87 ? 1212 ILE C O     1 
ATOM   4304 C  CB    . ILE C 1 183 ? 22.690  71.830  74.435 1.00 41.07 ? 1212 ILE C CB    1 
ATOM   4305 C  CG1   . ILE C 1 183 ? 21.714  72.952  74.792 1.00 40.32 ? 1212 ILE C CG1   1 
ATOM   4306 C  CG2   . ILE C 1 183 ? 23.951  72.412  73.792 1.00 39.63 ? 1212 ILE C CG2   1 
ATOM   4307 C  CD1   . ILE C 1 183 ? 21.219  73.727  73.584 1.00 40.42 ? 1212 ILE C CD1   1 
ATOM   4308 N  N     . HIS C 1 184 ? 23.509  68.935  73.639 1.00 41.20 ? 1213 HIS C N     1 
ATOM   4309 C  CA    . HIS C 1 184 ? 24.518  68.003  73.162 1.00 42.40 ? 1213 HIS C CA    1 
ATOM   4310 C  C     . HIS C 1 184 ? 23.984  67.170  72.003 1.00 42.29 ? 1213 HIS C C     1 
ATOM   4311 O  O     . HIS C 1 184 ? 24.735  66.781  71.105 1.00 40.33 ? 1213 HIS C O     1 
ATOM   4312 C  CB    . HIS C 1 184 ? 24.984  67.110  74.311 1.00 44.74 ? 1213 HIS C CB    1 
ATOM   4313 C  CG    . HIS C 1 184 ? 25.843  67.826  75.307 1.00 50.72 ? 1213 HIS C CG    1 
ATOM   4314 N  ND1   . HIS C 1 184 ? 26.235  67.260  76.502 1.00 53.64 ? 1213 HIS C ND1   1 
ATOM   4315 C  CD2   . HIS C 1 184 ? 26.393  69.065  75.281 1.00 52.06 ? 1213 HIS C CD2   1 
ATOM   4316 C  CE1   . HIS C 1 184 ? 26.987  68.118  77.168 1.00 54.31 ? 1213 HIS C CE1   1 
ATOM   4317 N  NE2   . HIS C 1 184 ? 27.099  69.221  76.449 1.00 53.63 ? 1213 HIS C NE2   1 
ATOM   4318 N  N     . CYS C 1 185 ? 22.681  66.907  72.021 1.00 40.26 ? 1214 CYS C N     1 
ATOM   4319 C  CA    . CYS C 1 185 ? 22.054  66.142  70.958 1.00 38.97 ? 1214 CYS C CA    1 
ATOM   4320 C  C     . CYS C 1 185 ? 22.023  66.954  69.666 1.00 37.99 ? 1214 CYS C C     1 
ATOM   4321 O  O     . CYS C 1 185 ? 22.218  66.414  68.589 1.00 37.49 ? 1214 CYS C O     1 
ATOM   4322 C  CB    . CYS C 1 185 ? 20.634  65.739  71.361 1.00 39.06 ? 1214 CYS C CB    1 
ATOM   4323 S  SG    . CYS C 1 185 ? 20.558  64.319  72.478 1.00 43.74 ? 1214 CYS C SG    1 
ATOM   4324 N  N     . PHE C 1 186 ? 21.793  68.257  69.786 1.00 39.35 ? 1215 PHE C N     1 
ATOM   4325 C  CA    . PHE C 1 186 ? 21.733  69.148  68.632 1.00 41.49 ? 1215 PHE C CA    1 
ATOM   4326 C  C     . PHE C 1 186 ? 23.113  69.560  68.109 1.00 42.60 ? 1215 PHE C C     1 
ATOM   4327 O  O     . PHE C 1 186 ? 23.220  70.120  67.019 1.00 44.12 ? 1215 PHE C O     1 
ATOM   4328 C  CB    . PHE C 1 186 ? 20.935  70.411  68.992 1.00 43.51 ? 1215 PHE C CB    1 
ATOM   4329 C  CG    . PHE C 1 186 ? 19.458  70.167  69.212 1.00 46.38 ? 1215 PHE C CG    1 
ATOM   4330 C  CD1   . PHE C 1 186 ? 18.738  70.956  70.105 1.00 47.79 ? 1215 PHE C CD1   1 
ATOM   4331 C  CD2   . PHE C 1 186 ? 18.784  69.170  68.516 1.00 47.35 ? 1215 PHE C CD2   1 
ATOM   4332 C  CE1   . PHE C 1 186 ? 17.370  70.753  70.300 1.00 47.58 ? 1215 PHE C CE1   1 
ATOM   4333 C  CE2   . PHE C 1 186 ? 17.415  68.959  68.703 1.00 47.85 ? 1215 PHE C CE2   1 
ATOM   4334 C  CZ    . PHE C 1 186 ? 16.709  69.752  69.596 1.00 48.22 ? 1215 PHE C CZ    1 
ATOM   4335 N  N     . GLU C 1 187 ? 24.159  69.287  68.885 1.00 42.72 ? 1216 GLU C N     1 
ATOM   4336 C  CA    . GLU C 1 187 ? 25.528  69.646  68.506 1.00 42.86 ? 1216 GLU C CA    1 
ATOM   4337 C  C     . GLU C 1 187 ? 26.002  68.962  67.227 1.00 41.11 ? 1216 GLU C C     1 
ATOM   4338 O  O     . GLU C 1 187 ? 26.069  67.738  67.160 1.00 40.26 ? 1216 GLU C O     1 
ATOM   4339 C  CB    . GLU C 1 187 ? 26.511  69.282  69.626 1.00 45.09 ? 1216 GLU C CB    1 
ATOM   4340 C  CG    . GLU C 1 187 ? 26.199  69.868  70.994 1.00 47.91 ? 1216 GLU C CG    1 
ATOM   4341 C  CD    . GLU C 1 187 ? 26.452  71.354  71.072 1.00 47.00 ? 1216 GLU C CD    1 
ATOM   4342 O  OE1   . GLU C 1 187 ? 25.940  72.091  70.206 1.00 50.41 ? 1216 GLU C OE1   1 
ATOM   4343 O  OE2   . GLU C 1 187 ? 27.157  71.784  72.002 1.00 45.31 ? 1216 GLU C OE2   1 
ATOM   4344 N  N     . GLY C 1 188 ? 26.343  69.772  66.228 1.00 40.47 ? 1217 GLY C N     1 
ATOM   4345 C  CA    . GLY C 1 188 ? 26.840  69.272  64.957 1.00 40.06 ? 1217 GLY C CA    1 
ATOM   4346 C  C     . GLY C 1 188 ? 26.249  67.986  64.403 1.00 40.89 ? 1217 GLY C C     1 
ATOM   4347 O  O     . GLY C 1 188 ? 26.989  67.043  64.122 1.00 40.19 ? 1217 GLY C O     1 
ATOM   4348 N  N     . VAL C 1 189 ? 24.929  67.937  64.238 1.00 41.18 ? 1218 VAL C N     1 
ATOM   4349 C  CA    . VAL C 1 189 ? 24.292  66.744  63.691 1.00 41.22 ? 1218 VAL C CA    1 
ATOM   4350 C  C     . VAL C 1 189 ? 24.254  66.873  62.174 1.00 41.25 ? 1218 VAL C C     1 
ATOM   4351 O  O     . VAL C 1 189 ? 24.051  67.969  61.634 1.00 41.54 ? 1218 VAL C O     1 
ATOM   4352 C  CB    . VAL C 1 189 ? 22.841  66.562  64.209 1.00 43.28 ? 1218 VAL C CB    1 
ATOM   4353 C  CG1   . VAL C 1 189 ? 22.840  66.376  65.710 1.00 43.10 ? 1218 VAL C CG1   1 
ATOM   4354 C  CG2   . VAL C 1 189 ? 22.001  67.749  63.829 1.00 43.14 ? 1218 VAL C CG2   1 
ATOM   4355 N  N     . THR C 1 190 ? 24.465  65.762  61.480 1.00 38.38 ? 1219 THR C N     1 
ATOM   4356 C  CA    . THR C 1 190 ? 24.439  65.801  60.026 1.00 37.24 ? 1219 THR C CA    1 
ATOM   4357 C  C     . THR C 1 190 ? 23.028  66.193  59.613 1.00 34.66 ? 1219 THR C C     1 
ATOM   4358 O  O     . THR C 1 190 ? 22.830  67.096  58.801 1.00 36.09 ? 1219 THR C O     1 
ATOM   4359 C  CB    . THR C 1 190 ? 24.753  64.425  59.410 1.00 36.54 ? 1219 THR C CB    1 
ATOM   4360 O  OG1   . THR C 1 190 ? 25.957  63.911  59.978 1.00 39.04 ? 1219 THR C OG1   1 
ATOM   4361 C  CG2   . THR C 1 190 ? 24.927  64.545  57.908 1.00 38.19 ? 1219 THR C CG2   1 
ATOM   4362 N  N     . ALA C 1 191 ? 22.046  65.507  60.184 1.00 30.56 ? 1220 ALA C N     1 
ATOM   4363 C  CA    . ALA C 1 191 ? 20.667  65.790  59.850 1.00 27.41 ? 1220 ALA C CA    1 
ATOM   4364 C  C     . ALA C 1 191 ? 19.683  65.383  60.923 1.00 25.94 ? 1220 ALA C C     1 
ATOM   4365 O  O     . ALA C 1 191 ? 19.900  64.440  61.682 1.00 24.02 ? 1220 ALA C O     1 
ATOM   4366 C  CB    . ALA C 1 191 ? 20.299  65.109  58.542 1.00 25.23 ? 1220 ALA C CB    1 
ATOM   4367 N  N     . ILE C 1 192 ? 18.603  66.143  60.981 1.00 24.90 ? 1221 ILE C N     1 
ATOM   4368 C  CA    . ILE C 1 192 ? 17.515  65.878  61.892 1.00 25.93 ? 1221 ILE C CA    1 
ATOM   4369 C  C     . ILE C 1 192 ? 16.462  65.176  61.031 1.00 24.34 ? 1221 ILE C C     1 
ATOM   4370 O  O     . ILE C 1 192 ? 16.108  65.671  59.961 1.00 22.23 ? 1221 ILE C O     1 
ATOM   4371 C  CB    . ILE C 1 192 ? 16.892  67.191  62.424 1.00 27.10 ? 1221 ILE C CB    1 
ATOM   4372 C  CG1   . ILE C 1 192 ? 17.822  67.842  63.451 1.00 27.77 ? 1221 ILE C CG1   1 
ATOM   4373 C  CG2   . ILE C 1 192 ? 15.507  66.912  63.024 1.00 26.00 ? 1221 ILE C CG2   1 
ATOM   4374 C  CD1   . ILE C 1 192 ? 17.392  69.253  63.836 1.00 26.40 ? 1221 ILE C CD1   1 
ATOM   4375 N  N     . ILE C 1 193 ? 15.991  64.022  61.483 1.00 23.24 ? 1222 ILE C N     1 
ATOM   4376 C  CA    . ILE C 1 193 ? 14.943  63.312  60.770 1.00 22.62 ? 1222 ILE C CA    1 
ATOM   4377 C  C     . ILE C 1 193 ? 13.676  63.533  61.592 1.00 24.58 ? 1222 ILE C C     1 
ATOM   4378 O  O     . ILE C 1 193 ? 13.448  62.871  62.617 1.00 22.95 ? 1222 ILE C O     1 
ATOM   4379 C  CB    . ILE C 1 193 ? 15.238  61.810  60.655 1.00 22.52 ? 1222 ILE C CB    1 
ATOM   4380 C  CG1   . ILE C 1 193 ? 16.437  61.597  59.724 1.00 18.33 ? 1222 ILE C CG1   1 
ATOM   4381 C  CG2   . ILE C 1 193 ? 14.003  61.075  60.117 1.00 17.34 ? 1222 ILE C CG2   1 
ATOM   4382 C  CD1   . ILE C 1 193 ? 16.800  60.144  59.525 1.00 22.46 ? 1222 ILE C CD1   1 
ATOM   4383 N  N     . PHE C 1 194 ? 12.872  64.489  61.139 1.00 23.41 ? 1223 PHE C N     1 
ATOM   4384 C  CA    . PHE C 1 194 ? 11.636  64.857  61.808 1.00 22.80 ? 1223 PHE C CA    1 
ATOM   4385 C  C     . PHE C 1 194 ? 10.495  63.952  61.368 1.00 23.18 ? 1223 PHE C C     1 
ATOM   4386 O  O     . PHE C 1 194 ? 10.116  63.946  60.194 1.00 22.55 ? 1223 PHE C O     1 
ATOM   4387 C  CB    . PHE C 1 194 ? 11.295  66.315  61.495 1.00 22.16 ? 1223 PHE C CB    1 
ATOM   4388 C  CG    . PHE C 1 194 ? 10.328  66.931  62.469 1.00 24.43 ? 1223 PHE C CG    1 
ATOM   4389 C  CD1   . PHE C 1 194 ? 10.793  67.584  63.606 1.00 22.63 ? 1223 PHE C CD1   1 
ATOM   4390 C  CD2   . PHE C 1 194 ? 8.953   66.837  62.264 1.00 22.53 ? 1223 PHE C CD2   1 
ATOM   4391 C  CE1   . PHE C 1 194 ? 9.906   68.134  64.526 1.00 23.98 ? 1223 PHE C CE1   1 
ATOM   4392 C  CE2   . PHE C 1 194 ? 8.060   67.384  63.181 1.00 23.18 ? 1223 PHE C CE2   1 
ATOM   4393 C  CZ    . PHE C 1 194 ? 8.537   68.035  64.315 1.00 22.20 ? 1223 PHE C CZ    1 
ATOM   4394 N  N     . CYS C 1 195 ? 9.955   63.185  62.311 1.00 21.07 ? 1224 CYS C N     1 
ATOM   4395 C  CA    . CYS C 1 195 ? 8.859   62.263  62.020 1.00 21.96 ? 1224 CYS C CA    1 
ATOM   4396 C  C     . CYS C 1 195 ? 7.481   62.826  62.354 1.00 20.38 ? 1224 CYS C C     1 
ATOM   4397 O  O     . CYS C 1 195 ? 7.274   63.406  63.423 1.00 18.69 ? 1224 CYS C O     1 
ATOM   4398 C  CB    . CYS C 1 195 ? 9.056   60.946  62.786 1.00 21.71 ? 1224 CYS C CB    1 
ATOM   4399 S  SG    . CYS C 1 195 ? 10.587  60.083  62.381 1.00 24.58 ? 1224 CYS C SG    1 
ATOM   4400 N  N     . VAL C 1 196 ? 6.540   62.646  61.427 1.00 18.59 ? 1225 VAL C N     1 
ATOM   4401 C  CA    . VAL C 1 196 ? 5.157   63.101  61.599 1.00 17.74 ? 1225 VAL C CA    1 
ATOM   4402 C  C     . VAL C 1 196 ? 4.259   61.903  61.286 1.00 19.08 ? 1225 VAL C C     1 
ATOM   4403 O  O     . VAL C 1 196 ? 4.474   61.233  60.278 1.00 15.23 ? 1225 VAL C O     1 
ATOM   4404 C  CB    . VAL C 1 196 ? 4.801   64.223  60.611 1.00 19.68 ? 1225 VAL C CB    1 
ATOM   4405 C  CG1   . VAL C 1 196 ? 3.298   64.533  60.695 1.00 13.97 ? 1225 VAL C CG1   1 
ATOM   4406 C  CG2   . VAL C 1 196 ? 5.642   65.463  60.904 1.00 18.82 ? 1225 VAL C CG2   1 
ATOM   4407 N  N     . ALA C 1 197 ? 3.246   61.642  62.111 1.00 15.99 ? 1226 ALA C N     1 
ATOM   4408 C  CA    . ALA C 1 197 ? 2.384   60.481  61.858 1.00 21.69 ? 1226 ALA C CA    1 
ATOM   4409 C  C     . ALA C 1 197 ? 1.412   60.496  60.647 1.00 23.97 ? 1226 ALA C C     1 
ATOM   4410 O  O     . ALA C 1 197 ? 1.078   59.435  60.125 1.00 31.25 ? 1226 ALA C O     1 
ATOM   4411 C  CB    . ALA C 1 197 ? 1.606   60.107  63.145 1.00 16.05 ? 1226 ALA C CB    1 
ATOM   4412 N  N     . LEU C 1 198 ? 0.966   61.656  60.192 1.00 24.20 ? 1227 LEU C N     1 
ATOM   4413 C  CA    . LEU C 1 198 ? 0.012   61.741  59.063 1.00 19.76 ? 1227 LEU C CA    1 
ATOM   4414 C  C     . LEU C 1 198 ? -1.368  61.235  59.474 1.00 16.47 ? 1227 LEU C C     1 
ATOM   4415 O  O     . LEU C 1 198 ? -2.348  61.956  59.358 1.00 17.82 ? 1227 LEU C O     1 
ATOM   4416 C  CB    . LEU C 1 198 ? 0.464   60.951  57.819 1.00 20.40 ? 1227 LEU C CB    1 
ATOM   4417 C  CG    . LEU C 1 198 ? 1.433   61.538  56.777 1.00 22.35 ? 1227 LEU C CG    1 
ATOM   4418 C  CD1   . LEU C 1 198 ? 1.541   60.569  55.596 1.00 21.92 ? 1227 LEU C CD1   1 
ATOM   4419 C  CD2   . LEU C 1 198 ? 0.960   62.890  56.284 1.00 18.81 ? 1227 LEU C CD2   1 
ATOM   4420 N  N     . SER C 1 199 ? -1.446  59.998  59.954 1.00 16.43 ? 1228 SER C N     1 
ATOM   4421 C  CA    . SER C 1 199 ? -2.728  59.433  60.375 1.00 18.36 ? 1228 SER C CA    1 
ATOM   4422 C  C     . SER C 1 199 ? -3.275  60.109  61.635 1.00 19.02 ? 1228 SER C C     1 
ATOM   4423 O  O     . SER C 1 199 ? -4.432  59.909  62.017 1.00 20.35 ? 1228 SER C O     1 
ATOM   4424 C  CB    . SER C 1 199 ? -2.599  57.919  60.590 1.00 19.63 ? 1228 SER C CB    1 
ATOM   4425 O  OG    . SER C 1 199 ? -1.538  57.601  61.474 1.00 20.40 ? 1228 SER C OG    1 
ATOM   4426 N  N     . ASP C 1 200 ? -2.441  60.921  62.276 1.00 19.42 ? 1229 ASP C N     1 
ATOM   4427 C  CA    . ASP C 1 200 ? -2.852  61.644  63.470 1.00 21.11 ? 1229 ASP C CA    1 
ATOM   4428 C  C     . ASP C 1 200 ? -3.857  62.758  63.156 1.00 21.46 ? 1229 ASP C C     1 
ATOM   4429 O  O     . ASP C 1 200 ? -4.526  63.254  64.053 1.00 21.89 ? 1229 ASP C O     1 
ATOM   4430 C  CB    . ASP C 1 200 ? -1.633  62.275  64.146 1.00 22.92 ? 1229 ASP C CB    1 
ATOM   4431 C  CG    . ASP C 1 200 ? -0.990  61.369  65.167 1.00 22.42 ? 1229 ASP C CG    1 
ATOM   4432 O  OD1   . ASP C 1 200 ? -1.285  60.154  65.176 1.00 27.69 ? 1229 ASP C OD1   1 
ATOM   4433 O  OD2   . ASP C 1 200 ? -0.178  61.883  65.963 1.00 26.53 ? 1229 ASP C OD2   1 
ATOM   4434 N  N     . TYR C 1 201 ? -3.971  63.133  61.885 1.00 20.50 ? 1230 TYR C N     1 
ATOM   4435 C  CA    . TYR C 1 201 ? -4.851  64.233  61.485 1.00 19.90 ? 1230 TYR C CA    1 
ATOM   4436 C  C     . TYR C 1 201 ? -6.300  64.190  61.982 1.00 18.43 ? 1230 TYR C C     1 
ATOM   4437 O  O     . TYR C 1 201 ? -6.895  65.241  62.214 1.00 16.24 ? 1230 TYR C O     1 
ATOM   4438 C  CB    . TYR C 1 201 ? -4.862  64.394  59.955 1.00 18.92 ? 1230 TYR C CB    1 
ATOM   4439 C  CG    . TYR C 1 201 ? -5.817  63.444  59.251 1.00 17.07 ? 1230 TYR C CG    1 
ATOM   4440 C  CD1   . TYR C 1 201 ? -5.461  62.125  58.991 1.00 18.17 ? 1230 TYR C CD1   1 
ATOM   4441 C  CD2   . TYR C 1 201 ? -7.086  63.866  58.880 1.00 20.89 ? 1230 TYR C CD2   1 
ATOM   4442 C  CE1   . TYR C 1 201 ? -6.348  61.248  58.379 1.00 19.79 ? 1230 TYR C CE1   1 
ATOM   4443 C  CE2   . TYR C 1 201 ? -7.989  63.000  58.264 1.00 20.56 ? 1230 TYR C CE2   1 
ATOM   4444 C  CZ    . TYR C 1 201 ? -7.614  61.696  58.016 1.00 21.07 ? 1230 TYR C CZ    1 
ATOM   4445 O  OH    . TYR C 1 201 ? -8.498  60.855  57.399 1.00 20.08 ? 1230 TYR C OH    1 
ATOM   4446 N  N     . ASP C 1 202 ? -6.875  63.003  62.150 1.00 19.91 ? 1231 ASP C N     1 
ATOM   4447 C  CA    . ASP C 1 202 ? -8.269  62.929  62.595 1.00 20.57 ? 1231 ASP C CA    1 
ATOM   4448 C  C     . ASP C 1 202 ? -8.480  62.673  64.094 1.00 21.64 ? 1231 ASP C C     1 
ATOM   4449 O  O     . ASP C 1 202 ? -9.610  62.461  64.535 1.00 18.96 ? 1231 ASP C O     1 
ATOM   4450 C  CB    . ASP C 1 202 ? -9.022  61.871  61.774 1.00 22.13 ? 1231 ASP C CB    1 
ATOM   4451 C  CG    . ASP C 1 202 ? -8.677  60.446  62.180 1.00 25.74 ? 1231 ASP C CG    1 
ATOM   4452 O  OD1   . ASP C 1 202 ? -7.620  60.231  62.812 1.00 25.46 ? 1231 ASP C OD1   1 
ATOM   4453 O  OD2   . ASP C 1 202 ? -9.468  59.533  61.852 1.00 28.31 ? 1231 ASP C OD2   1 
ATOM   4454 N  N     . LEU C 1 203 ? -7.407  62.704  64.878 1.00 22.28 ? 1232 LEU C N     1 
ATOM   4455 C  CA    . LEU C 1 203 ? -7.519  62.465  66.321 1.00 24.73 ? 1232 LEU C CA    1 
ATOM   4456 C  C     . LEU C 1 203 ? -8.140  63.645  67.063 1.00 24.44 ? 1232 LEU C C     1 
ATOM   4457 O  O     . LEU C 1 203 ? -7.783  64.796  66.821 1.00 24.91 ? 1232 LEU C O     1 
ATOM   4458 C  CB    . LEU C 1 203 ? -6.141  62.183  66.938 1.00 24.18 ? 1232 LEU C CB    1 
ATOM   4459 C  CG    . LEU C 1 203 ? -5.311  61.016  66.407 1.00 29.83 ? 1232 LEU C CG    1 
ATOM   4460 C  CD1   . LEU C 1 203 ? -3.992  60.934  67.181 1.00 30.15 ? 1232 LEU C CD1   1 
ATOM   4461 C  CD2   . LEU C 1 203 ? -6.097  59.715  66.550 1.00 32.13 ? 1232 LEU C CD2   1 
ATOM   4462 N  N     . VAL C 1 204 ? -9.076  63.358  67.963 1.00 24.30 ? 1233 VAL C N     1 
ATOM   4463 C  CA    . VAL C 1 204 ? -9.700  64.409  68.760 1.00 23.94 ? 1233 VAL C CA    1 
ATOM   4464 C  C     . VAL C 1 204 ? -8.585  64.852  69.702 1.00 23.40 ? 1233 VAL C C     1 
ATOM   4465 O  O     . VAL C 1 204 ? -7.889  64.007  70.261 1.00 25.73 ? 1233 VAL C O     1 
ATOM   4466 C  CB    . VAL C 1 204 ? -10.884 63.847  69.575 1.00 25.57 ? 1233 VAL C CB    1 
ATOM   4467 C  CG1   . VAL C 1 204 ? -11.475 64.933  70.460 1.00 23.92 ? 1233 VAL C CG1   1 
ATOM   4468 C  CG2   . VAL C 1 204 ? -11.945 63.279  68.620 1.00 22.30 ? 1233 VAL C CG2   1 
ATOM   4469 N  N     . LEU C 1 205 ? -8.384  66.153  69.871 1.00 22.73 ? 1234 LEU C N     1 
ATOM   4470 C  CA    . LEU C 1 205 ? -7.296  66.606  70.743 1.00 27.24 ? 1234 LEU C CA    1 
ATOM   4471 C  C     . LEU C 1 205 ? -7.583  66.257  72.204 1.00 26.67 ? 1234 LEU C C     1 
ATOM   4472 O  O     . LEU C 1 205 ? -8.737  66.194  72.625 1.00 26.16 ? 1234 LEU C O     1 
ATOM   4473 C  CB    . LEU C 1 205 ? -7.073  68.117  70.606 1.00 28.20 ? 1234 LEU C CB    1 
ATOM   4474 C  CG    . LEU C 1 205 ? -8.023  69.074  71.333 1.00 28.69 ? 1234 LEU C CG    1 
ATOM   4475 C  CD1   . LEU C 1 205 ? -7.513  70.493  71.158 1.00 31.57 ? 1234 LEU C CD1   1 
ATOM   4476 C  CD2   . LEU C 1 205 ? -9.427  68.940  70.798 1.00 27.73 ? 1234 LEU C CD2   1 
ATOM   4477 N  N     . ALA C 1 206 ? -6.524  66.018  72.963 1.00 28.39 ? 1235 ALA C N     1 
ATOM   4478 C  CA    . ALA C 1 206 ? -6.655  65.664  74.373 1.00 29.74 ? 1235 ALA C CA    1 
ATOM   4479 C  C     . ALA C 1 206 ? -7.298  66.804  75.169 1.00 31.04 ? 1235 ALA C C     1 
ATOM   4480 O  O     . ALA C 1 206 ? -7.189  67.976  74.799 1.00 30.00 ? 1235 ALA C O     1 
ATOM   4481 C  CB    . ALA C 1 206 ? -5.285  65.323  74.951 1.00 27.56 ? 1235 ALA C CB    1 
ATOM   4482 N  N     . GLU C 1 207 ? -7.955  66.438  76.266 1.00 32.35 ? 1236 GLU C N     1 
ATOM   4483 C  CA    . GLU C 1 207 ? -8.643  67.376  77.146 1.00 33.30 ? 1236 GLU C CA    1 
ATOM   4484 C  C     . GLU C 1 207 ? -7.739  68.479  77.700 1.00 32.73 ? 1236 GLU C C     1 
ATOM   4485 O  O     . GLU C 1 207 ? -8.226  69.508  78.163 1.00 30.33 ? 1236 GLU C O     1 
ATOM   4486 C  CB    . GLU C 1 207 ? -9.285  66.600  78.304 1.00 37.48 ? 1236 GLU C CB    1 
ATOM   4487 C  CG    . GLU C 1 207 ? -10.121 67.446  79.263 1.00 44.12 ? 1236 GLU C CG    1 
ATOM   4488 C  CD    . GLU C 1 207 ? -10.727 66.628  80.401 1.00 47.76 ? 1236 GLU C CD    1 
ATOM   4489 O  OE1   . GLU C 1 207 ? -9.967  65.940  81.121 1.00 49.80 ? 1236 GLU C OE1   1 
ATOM   4490 O  OE2   . GLU C 1 207 ? -11.965 66.679  80.576 1.00 49.03 ? 1236 GLU C OE2   1 
ATOM   4491 N  N     . ASP C 1 208 ? -6.427  68.274  77.638 1.00 32.57 ? 1237 ASP C N     1 
ATOM   4492 C  CA    . ASP C 1 208 ? -5.484  69.255  78.161 1.00 34.80 ? 1237 ASP C CA    1 
ATOM   4493 C  C     . ASP C 1 208 ? -4.625  69.909  77.082 1.00 34.25 ? 1237 ASP C C     1 
ATOM   4494 O  O     . ASP C 1 208 ? -3.530  70.394  77.367 1.00 36.08 ? 1237 ASP C O     1 
ATOM   4495 C  CB    . ASP C 1 208 ? -4.564  68.586  79.180 1.00 37.98 ? 1237 ASP C CB    1 
ATOM   4496 C  CG    . ASP C 1 208 ? -3.628  67.578  78.538 1.00 42.32 ? 1237 ASP C CG    1 
ATOM   4497 O  OD1   . ASP C 1 208 ? -4.112  66.703  77.786 1.00 45.27 ? 1237 ASP C OD1   1 
ATOM   4498 O  OD2   . ASP C 1 208 ? -2.407  67.657  78.783 1.00 44.47 ? 1237 ASP C OD2   1 
ATOM   4499 N  N     . GLU C 1 209 ? -5.121  69.940  75.850 1.00 31.85 ? 1238 GLU C N     1 
ATOM   4500 C  CA    . GLU C 1 209 ? -4.360  70.527  74.755 1.00 28.51 ? 1238 GLU C CA    1 
ATOM   4501 C  C     . GLU C 1 209 ? -5.050  71.745  74.176 1.00 24.55 ? 1238 GLU C C     1 
ATOM   4502 O  O     . GLU C 1 209 ? -6.271  71.834  74.208 1.00 21.00 ? 1238 GLU C O     1 
ATOM   4503 C  CB    . GLU C 1 209 ? -4.166  69.482  73.651 1.00 32.54 ? 1238 GLU C CB    1 
ATOM   4504 C  CG    . GLU C 1 209 ? -3.419  68.255  74.112 1.00 37.55 ? 1238 GLU C CG    1 
ATOM   4505 C  CD    . GLU C 1 209 ? -1.931  68.503  74.263 1.00 43.26 ? 1238 GLU C CD    1 
ATOM   4506 O  OE1   . GLU C 1 209 ? -1.534  69.663  74.521 1.00 45.25 ? 1238 GLU C OE1   1 
ATOM   4507 O  OE2   . GLU C 1 209 ? -1.155  67.529  74.134 1.00 47.34 ? 1238 GLU C OE2   1 
ATOM   4508 N  N     . GLU C 1 210 ? -4.267  72.681  73.645 1.00 22.18 ? 1239 GLU C N     1 
ATOM   4509 C  CA    . GLU C 1 210 ? -4.831  73.877  73.031 1.00 22.82 ? 1239 GLU C CA    1 
ATOM   4510 C  C     . GLU C 1 210 ? -4.888  73.754  71.497 1.00 21.48 ? 1239 GLU C C     1 
ATOM   4511 O  O     . GLU C 1 210 ? -5.390  74.652  70.819 1.00 21.45 ? 1239 GLU C O     1 
ATOM   4512 C  CB    . GLU C 1 210 ? -4.018  75.117  73.413 1.00 23.26 ? 1239 GLU C CB    1 
ATOM   4513 C  CG    . GLU C 1 210 ? -2.717  75.272  72.651 1.00 30.73 ? 1239 GLU C CG    1 
ATOM   4514 C  CD    . GLU C 1 210 ? -2.041  76.597  72.937 1.00 32.08 ? 1239 GLU C CD    1 
ATOM   4515 O  OE1   . GLU C 1 210 ? -2.745  77.537  73.355 1.00 34.42 ? 1239 GLU C OE1   1 
ATOM   4516 O  OE2   . GLU C 1 210 ? -0.811  76.705  72.734 1.00 36.51 ? 1239 GLU C OE2   1 
ATOM   4517 N  N     . MET C 1 211 ? -4.379  72.642  70.964 1.00 21.40 ? 1240 MET C N     1 
ATOM   4518 C  CA    . MET C 1 211 ? -4.366  72.387  69.519 1.00 19.65 ? 1240 MET C CA    1 
ATOM   4519 C  C     . MET C 1 211 ? -4.227  70.876  69.306 1.00 21.96 ? 1240 MET C C     1 
ATOM   4520 O  O     . MET C 1 211 ? -3.746  70.164  70.196 1.00 21.95 ? 1240 MET C O     1 
ATOM   4521 C  CB    . MET C 1 211 ? -3.190  73.107  68.866 1.00 19.66 ? 1240 MET C CB    1 
ATOM   4522 C  CG    . MET C 1 211 ? -1.832  72.586  69.324 1.00 19.43 ? 1240 MET C CG    1 
ATOM   4523 S  SD    . MET C 1 211 ? -0.400  73.489  68.685 1.00 26.14 ? 1240 MET C SD    1 
ATOM   4524 C  CE    . MET C 1 211 ? -0.431  74.947  69.749 1.00 26.26 ? 1240 MET C CE    1 
ATOM   4525 N  N     . ASN C 1 212 ? -4.635  70.373  68.141 1.00 22.12 ? 1241 ASN C N     1 
ATOM   4526 C  CA    . ASN C 1 212 ? -4.528  68.936  67.916 1.00 21.85 ? 1241 ASN C CA    1 
ATOM   4527 C  C     . ASN C 1 212 ? -3.068  68.533  67.774 1.00 21.78 ? 1241 ASN C C     1 
ATOM   4528 O  O     . ASN C 1 212 ? -2.188  69.390  67.679 1.00 19.85 ? 1241 ASN C O     1 
ATOM   4529 C  CB    . ASN C 1 212 ? -5.378  68.486  66.713 1.00 26.37 ? 1241 ASN C CB    1 
ATOM   4530 C  CG    . ASN C 1 212 ? -5.028  69.206  65.420 1.00 25.37 ? 1241 ASN C CG    1 
ATOM   4531 O  OD1   . ASN C 1 212 ? -5.916  69.587  64.659 1.00 30.17 ? 1241 ASN C OD1   1 
ATOM   4532 N  ND2   . ASN C 1 212 ? -3.746  69.370  65.156 1.00 20.94 ? 1241 ASN C ND2   1 
ATOM   4533 N  N     . ARG C 1 213 ? -2.810  67.231  67.799 1.00 21.42 ? 1242 ARG C N     1 
ATOM   4534 C  CA    . ARG C 1 213 ? -1.444  66.736  67.722 1.00 22.64 ? 1242 ARG C CA    1 
ATOM   4535 C  C     . ARG C 1 213 ? -0.687  67.133  66.468 1.00 21.93 ? 1242 ARG C C     1 
ATOM   4536 O  O     . ARG C 1 213 ? 0.516   67.379  66.532 1.00 21.79 ? 1242 ARG C O     1 
ATOM   4537 C  CB    . ARG C 1 213 ? -1.426  65.219  67.887 1.00 25.34 ? 1242 ARG C CB    1 
ATOM   4538 C  CG    . ARG C 1 213 ? -1.970  64.761  69.232 1.00 36.10 ? 1242 ARG C CG    1 
ATOM   4539 C  CD    . ARG C 1 213 ? -1.797  63.275  69.397 1.00 42.86 ? 1242 ARG C CD    1 
ATOM   4540 N  NE    . ARG C 1 213 ? -0.384  62.907  69.385 1.00 46.60 ? 1242 ARG C NE    1 
ATOM   4541 C  CZ    . ARG C 1 213 ? 0.071   61.709  69.034 1.00 46.92 ? 1242 ARG C CZ    1 
ATOM   4542 N  NH1   . ARG C 1 213 ? -0.771  60.751  68.657 1.00 42.26 ? 1242 ARG C NH1   1 
ATOM   4543 N  NH2   . ARG C 1 213 ? 1.373   61.471  69.064 1.00 48.85 ? 1242 ARG C NH2   1 
ATOM   4544 N  N     . MET C 1 214 ? -1.377  67.202  65.335 1.00 19.47 ? 1243 MET C N     1 
ATOM   4545 C  CA    . MET C 1 214 ? -0.714  67.587  64.094 1.00 19.87 ? 1243 MET C CA    1 
ATOM   4546 C  C     . MET C 1 214 ? -0.176  69.007  64.252 1.00 20.01 ? 1243 MET C C     1 
ATOM   4547 O  O     . MET C 1 214 ? 0.957   69.312  63.853 1.00 18.24 ? 1243 MET C O     1 
ATOM   4548 C  CB    . MET C 1 214 ? -1.693  67.546  62.919 1.00 20.88 ? 1243 MET C CB    1 
ATOM   4549 C  CG    . MET C 1 214 ? -1.012  67.704  61.555 1.00 22.88 ? 1243 MET C CG    1 
ATOM   4550 S  SD    . MET C 1 214 ? 0.049   66.286  61.182 1.00 22.56 ? 1243 MET C SD    1 
ATOM   4551 C  CE    . MET C 1 214 ? -1.200  65.093  60.686 1.00 24.54 ? 1243 MET C CE    1 
ATOM   4552 N  N     . HIS C 1 215 ? -0.981  69.882  64.842 1.00 17.01 ? 1244 HIS C N     1 
ATOM   4553 C  CA    . HIS C 1 215 ? -0.525  71.252  65.021 1.00 19.78 ? 1244 HIS C CA    1 
ATOM   4554 C  C     . HIS C 1 215 ? 0.600   71.345  66.047 1.00 18.78 ? 1244 HIS C C     1 
ATOM   4555 O  O     . HIS C 1 215 ? 1.483   72.189  65.923 1.00 17.63 ? 1244 HIS C O     1 
ATOM   4556 C  CB    . HIS C 1 215 ? -1.698  72.169  65.362 1.00 19.44 ? 1244 HIS C CB    1 
ATOM   4557 C  CG    . HIS C 1 215 ? -2.561  72.475  64.180 1.00 18.62 ? 1244 HIS C CG    1 
ATOM   4558 N  ND1   . HIS C 1 215 ? -3.487  71.583  63.684 1.00 21.84 ? 1244 HIS C ND1   1 
ATOM   4559 C  CD2   . HIS C 1 215 ? -2.593  73.547  63.355 1.00 19.72 ? 1244 HIS C CD2   1 
ATOM   4560 C  CE1   . HIS C 1 215 ? -4.054  72.093  62.604 1.00 20.37 ? 1244 HIS C CE1   1 
ATOM   4561 N  NE2   . HIS C 1 215 ? -3.528  73.284  62.383 1.00 22.26 ? 1244 HIS C NE2   1 
ATOM   4562 N  N     . GLU C 1 216 ? 0.593   70.450  67.031 1.00 18.10 ? 1245 GLU C N     1 
ATOM   4563 C  CA    . GLU C 1 216 ? 1.665   70.434  68.025 1.00 21.01 ? 1245 GLU C CA    1 
ATOM   4564 C  C     . GLU C 1 216 ? 2.954   70.104  67.277 1.00 21.36 ? 1245 GLU C C     1 
ATOM   4565 O  O     . GLU C 1 216 ? 3.987   70.736  67.487 1.00 20.53 ? 1245 GLU C O     1 
ATOM   4566 C  CB    . GLU C 1 216 ? 1.419   69.356  69.076 1.00 23.12 ? 1245 GLU C CB    1 
ATOM   4567 C  CG    . GLU C 1 216 ? 0.615   69.779  70.282 1.00 25.97 ? 1245 GLU C CG    1 
ATOM   4568 C  CD    . GLU C 1 216 ? 0.747   68.758  71.396 1.00 30.67 ? 1245 GLU C CD    1 
ATOM   4569 O  OE1   . GLU C 1 216 ? -0.010  67.760  71.400 1.00 31.51 ? 1245 GLU C OE1   1 
ATOM   4570 O  OE2   . GLU C 1 216 ? 1.639   68.938  72.253 1.00 33.93 ? 1245 GLU C OE2   1 
ATOM   4571 N  N     . SER C 1 217 ? 2.877   69.096  66.406 1.00 20.60 ? 1246 SER C N     1 
ATOM   4572 C  CA    . SER C 1 217 ? 4.016   68.675  65.598 1.00 20.44 ? 1246 SER C CA    1 
ATOM   4573 C  C     . SER C 1 217 ? 4.488   69.850  64.726 1.00 21.22 ? 1246 SER C C     1 
ATOM   4574 O  O     . SER C 1 217 ? 5.688   70.122  64.630 1.00 22.97 ? 1246 SER C O     1 
ATOM   4575 C  CB    . SER C 1 217 ? 3.614   67.477  64.718 1.00 21.74 ? 1246 SER C CB    1 
ATOM   4576 O  OG    . SER C 1 217 ? 4.740   66.920  64.053 1.00 23.77 ? 1246 SER C OG    1 
ATOM   4577 N  N     . MET C 1 218 ? 3.540   70.548  64.105 1.00 20.42 ? 1247 MET C N     1 
ATOM   4578 C  CA    . MET C 1 218 ? 3.852   71.705  63.258 1.00 22.98 ? 1247 MET C CA    1 
ATOM   4579 C  C     . MET C 1 218 ? 4.531   72.820  64.054 1.00 24.23 ? 1247 MET C C     1 
ATOM   4580 O  O     . MET C 1 218 ? 5.445   73.477  63.567 1.00 23.71 ? 1247 MET C O     1 
ATOM   4581 C  CB    . MET C 1 218 ? 2.575   72.267  62.622 1.00 21.09 ? 1247 MET C CB    1 
ATOM   4582 C  CG    . MET C 1 218 ? 2.024   71.452  61.451 1.00 20.44 ? 1247 MET C CG    1 
ATOM   4583 S  SD    . MET C 1 218 ? 0.301   71.895  61.109 1.00 24.26 ? 1247 MET C SD    1 
ATOM   4584 C  CE    . MET C 1 218 ? 0.491   73.623  60.544 1.00 18.76 ? 1247 MET C CE    1 
ATOM   4585 N  N     . LYS C 1 219 ? 4.070   73.036  65.279 1.00 26.85 ? 1248 LYS C N     1 
ATOM   4586 C  CA    . LYS C 1 219 ? 4.637   74.074  66.125 1.00 28.11 ? 1248 LYS C CA    1 
ATOM   4587 C  C     . LYS C 1 219 ? 6.102   73.745  66.412 1.00 26.88 ? 1248 LYS C C     1 
ATOM   4588 O  O     . LYS C 1 219 ? 6.978   74.603  66.293 1.00 27.55 ? 1248 LYS C O     1 
ATOM   4589 C  CB    . LYS C 1 219 ? 3.839   74.172  67.427 1.00 31.48 ? 1248 LYS C CB    1 
ATOM   4590 C  CG    . LYS C 1 219 ? 4.134   75.407  68.254 1.00 35.31 ? 1248 LYS C CG    1 
ATOM   4591 C  CD    . LYS C 1 219 ? 3.309   75.396  69.534 1.00 40.02 ? 1248 LYS C CD    1 
ATOM   4592 C  CE    . LYS C 1 219 ? 3.607   76.607  70.419 1.00 43.32 ? 1248 LYS C CE    1 
ATOM   4593 N  NZ    . LYS C 1 219 ? 2.854   76.512  71.707 1.00 44.54 ? 1248 LYS C NZ    1 
ATOM   4594 N  N     . LEU C 1 220 ? 6.369   72.495  66.769 1.00 24.92 ? 1249 LEU C N     1 
ATOM   4595 C  CA    . LEU C 1 220 ? 7.732   72.068  67.046 1.00 23.84 ? 1249 LEU C CA    1 
ATOM   4596 C  C     . LEU C 1 220 ? 8.595   72.156  65.780 1.00 26.20 ? 1249 LEU C C     1 
ATOM   4597 O  O     . LEU C 1 220 ? 9.764   72.543  65.845 1.00 25.33 ? 1249 LEU C O     1 
ATOM   4598 C  CB    . LEU C 1 220 ? 7.746   70.636  67.591 1.00 21.96 ? 1249 LEU C CB    1 
ATOM   4599 C  CG    . LEU C 1 220 ? 9.135   69.999  67.747 1.00 24.16 ? 1249 LEU C CG    1 
ATOM   4600 C  CD1   . LEU C 1 220 ? 9.973   70.826  68.723 1.00 22.11 ? 1249 LEU C CD1   1 
ATOM   4601 C  CD2   . LEU C 1 220 ? 8.991   68.560  68.233 1.00 18.91 ? 1249 LEU C CD2   1 
ATOM   4602 N  N     . PHE C 1 221 ? 8.024   71.799  64.630 1.00 26.21 ? 1250 PHE C N     1 
ATOM   4603 C  CA    . PHE C 1 221 ? 8.765   71.863  63.369 1.00 25.78 ? 1250 PHE C CA    1 
ATOM   4604 C  C     . PHE C 1 221 ? 9.049   73.326  63.036 1.00 25.67 ? 1250 PHE C C     1 
ATOM   4605 O  O     . PHE C 1 221 ? 10.107  73.663  62.503 1.00 26.77 ? 1250 PHE C O     1 
ATOM   4606 C  CB    . PHE C 1 221 ? 7.959   71.236  62.227 1.00 24.93 ? 1250 PHE C CB    1 
ATOM   4607 C  CG    . PHE C 1 221 ? 8.699   71.185  60.919 1.00 25.05 ? 1250 PHE C CG    1 
ATOM   4608 C  CD1   . PHE C 1 221 ? 9.684   70.227  60.703 1.00 24.35 ? 1250 PHE C CD1   1 
ATOM   4609 C  CD2   . PHE C 1 221 ? 8.419   72.101  59.906 1.00 22.01 ? 1250 PHE C CD2   1 
ATOM   4610 C  CE1   . PHE C 1 221 ? 10.382  70.176  59.493 1.00 23.64 ? 1250 PHE C CE1   1 
ATOM   4611 C  CE2   . PHE C 1 221 ? 9.111   72.058  58.695 1.00 25.89 ? 1250 PHE C CE2   1 
ATOM   4612 C  CZ    . PHE C 1 221 ? 10.097  71.090  58.490 1.00 22.58 ? 1250 PHE C CZ    1 
ATOM   4613 N  N     . ASP C 1 222 ? 8.098   74.195  63.343 1.00 27.97 ? 1251 ASP C N     1 
ATOM   4614 C  CA    . ASP C 1 222 ? 8.260   75.628  63.084 1.00 29.81 ? 1251 ASP C CA    1 
ATOM   4615 C  C     . ASP C 1 222 ? 9.530   76.141  63.783 1.00 31.21 ? 1251 ASP C C     1 
ATOM   4616 O  O     . ASP C 1 222 ? 10.348  76.846  63.182 1.00 29.11 ? 1251 ASP C O     1 
ATOM   4617 C  CB    . ASP C 1 222 ? 7.050   76.398  63.616 1.00 32.96 ? 1251 ASP C CB    1 
ATOM   4618 C  CG    . ASP C 1 222 ? 6.953   77.817  63.056 1.00 35.36 ? 1251 ASP C CG    1 
ATOM   4619 O  OD1   . ASP C 1 222 ? 7.990   78.418  62.719 1.00 36.34 ? 1251 ASP C OD1   1 
ATOM   4620 O  OD2   . ASP C 1 222 ? 5.825   78.341  62.968 1.00 38.88 ? 1251 ASP C OD2   1 
ATOM   4621 N  N     . SER C 1 223 ? 9.688   75.773  65.051 1.00 32.61 ? 1252 SER C N     1 
ATOM   4622 C  CA    . SER C 1 223 ? 10.840  76.195  65.844 1.00 35.26 ? 1252 SER C CA    1 
ATOM   4623 C  C     . SER C 1 223 ? 12.159  75.654  65.324 1.00 34.95 ? 1252 SER C C     1 
ATOM   4624 O  O     . SER C 1 223 ? 13.095  76.415  65.109 1.00 36.99 ? 1252 SER C O     1 
ATOM   4625 C  CB    . SER C 1 223 ? 10.666  75.772  67.306 1.00 34.70 ? 1252 SER C CB    1 
ATOM   4626 O  OG    . SER C 1 223 ? 9.467   76.303  67.832 1.00 38.00 ? 1252 SER C OG    1 
ATOM   4627 N  N     . ILE C 1 224 ? 12.235  74.343  65.124 1.00 35.58 ? 1253 ILE C N     1 
ATOM   4628 C  CA    . ILE C 1 224 ? 13.459  73.716  64.633 1.00 36.72 ? 1253 ILE C CA    1 
ATOM   4629 C  C     . ILE C 1 224 ? 13.905  74.342  63.317 1.00 38.18 ? 1253 ILE C C     1 
ATOM   4630 O  O     . ILE C 1 224 ? 15.021  74.850  63.187 1.00 38.93 ? 1253 ILE C O     1 
ATOM   4631 C  CB    . ILE C 1 224 ? 13.261  72.205  64.381 1.00 37.42 ? 1253 ILE C CB    1 
ATOM   4632 C  CG1   . ILE C 1 224 ? 12.766  71.509  65.654 1.00 36.57 ? 1253 ILE C CG1   1 
ATOM   4633 C  CG2   . ILE C 1 224 ? 14.563  71.594  63.893 1.00 34.61 ? 1253 ILE C CG2   1 
ATOM   4634 C  CD1   . ILE C 1 224 ? 13.711  71.616  66.827 1.00 40.87 ? 1253 ILE C CD1   1 
ATOM   4635 N  N     . CYS C 1 225 ? 13.009  74.297  62.343 1.00 36.81 ? 1254 CYS C N     1 
ATOM   4636 C  CA    . CYS C 1 225 ? 13.270  74.816  61.017 1.00 38.24 ? 1254 CYS C CA    1 
ATOM   4637 C  C     . CYS C 1 225 ? 13.686  76.290  60.952 1.00 37.62 ? 1254 CYS C C     1 
ATOM   4638 O  O     . CYS C 1 225 ? 14.642  76.640  60.257 1.00 36.53 ? 1254 CYS C O     1 
ATOM   4639 C  CB    . CYS C 1 225 ? 12.036  74.588  60.147 1.00 40.24 ? 1254 CYS C CB    1 
ATOM   4640 S  SG    . CYS C 1 225 ? 12.339  74.888  58.430 1.00 47.22 ? 1254 CYS C SG    1 
ATOM   4641 N  N     . ASN C 1 226 ? 12.978  77.151  61.677 1.00 37.40 ? 1255 ASN C N     1 
ATOM   4642 C  CA    . ASN C 1 226 ? 13.279  78.579  61.659 1.00 37.55 ? 1255 ASN C CA    1 
ATOM   4643 C  C     . ASN C 1 226 ? 14.249  79.080  62.727 1.00 37.83 ? 1255 ASN C C     1 
ATOM   4644 O  O     . ASN C 1 226 ? 14.613  80.256  62.718 1.00 37.90 ? 1255 ASN C O     1 
ATOM   4645 C  CB    . ASN C 1 226 ? 11.985  79.394  61.746 1.00 36.98 ? 1255 ASN C CB    1 
ATOM   4646 C  CG    . ASN C 1 226 ? 11.072  79.162  60.558 1.00 38.84 ? 1255 ASN C CG    1 
ATOM   4647 O  OD1   . ASN C 1 226 ? 11.466  79.363  59.411 1.00 36.56 ? 1255 ASN C OD1   1 
ATOM   4648 N  ND2   . ASN C 1 226 ? 9.844   78.733  60.830 1.00 37.93 ? 1255 ASN C ND2   1 
ATOM   4649 N  N     . ASN C 1 227 ? 14.667  78.225  63.654 1.00 36.40 ? 1256 ASN C N     1 
ATOM   4650 C  CA    . ASN C 1 227 ? 15.604  78.700  64.663 1.00 37.59 ? 1256 ASN C CA    1 
ATOM   4651 C  C     . ASN C 1 227 ? 16.972  78.863  63.994 1.00 38.75 ? 1256 ASN C C     1 
ATOM   4652 O  O     . ASN C 1 227 ? 17.538  77.906  63.458 1.00 36.70 ? 1256 ASN C O     1 
ATOM   4653 C  CB    . ASN C 1 227 ? 15.695  77.732  65.841 1.00 38.59 ? 1256 ASN C CB    1 
ATOM   4654 C  CG    . ASN C 1 227 ? 16.476  78.313  67.008 1.00 41.52 ? 1256 ASN C CG    1 
ATOM   4655 O  OD1   . ASN C 1 227 ? 17.647  78.665  66.869 1.00 41.57 ? 1256 ASN C OD1   1 
ATOM   4656 N  ND2   . ASN C 1 227 ? 15.828  78.423  68.165 1.00 41.35 ? 1256 ASN C ND2   1 
ATOM   4657 N  N     . LYS C 1 228 ? 17.473  80.097  64.014 1.00 39.11 ? 1257 LYS C N     1 
ATOM   4658 C  CA    . LYS C 1 228 ? 18.757  80.468  63.414 1.00 41.14 ? 1257 LYS C CA    1 
ATOM   4659 C  C     . LYS C 1 228 ? 19.917  79.561  63.818 1.00 38.99 ? 1257 LYS C C     1 
ATOM   4660 O  O     . LYS C 1 228 ? 20.879  79.389  63.067 1.00 38.11 ? 1257 LYS C O     1 
ATOM   4661 C  CB    . LYS C 1 228 ? 19.080  81.916  63.794 1.00 44.26 ? 1257 LYS C CB    1 
ATOM   4662 C  CG    . LYS C 1 228 ? 20.324  82.503  63.156 1.00 49.79 ? 1257 LYS C CG    1 
ATOM   4663 C  CD    . LYS C 1 228 ? 20.484  83.963  63.586 1.00 53.23 ? 1257 LYS C CD    1 
ATOM   4664 C  CE    . LYS C 1 228 ? 21.779  84.574  63.080 1.00 55.10 ? 1257 LYS C CE    1 
ATOM   4665 N  NZ    . LYS C 1 228 ? 22.009  85.945  63.633 1.00 56.44 ? 1257 LYS C NZ    1 
ATOM   4666 N  N     . TRP C 1 229 ? 19.812  78.975  65.003 1.00 36.50 ? 1258 TRP C N     1 
ATOM   4667 C  CA    . TRP C 1 229 ? 20.843  78.101  65.529 1.00 37.19 ? 1258 TRP C CA    1 
ATOM   4668 C  C     . TRP C 1 229 ? 20.965  76.773  64.762 1.00 38.45 ? 1258 TRP C C     1 
ATOM   4669 O  O     . TRP C 1 229 ? 21.976  76.076  64.877 1.00 37.25 ? 1258 TRP C O     1 
ATOM   4670 C  CB    . TRP C 1 229 ? 20.555  77.840  67.008 1.00 37.46 ? 1258 TRP C CB    1 
ATOM   4671 C  CG    . TRP C 1 229 ? 21.721  77.317  67.792 1.00 40.47 ? 1258 TRP C CG    1 
ATOM   4672 C  CD1   . TRP C 1 229 ? 22.966  77.870  67.879 1.00 40.66 ? 1258 TRP C CD1   1 
ATOM   4673 C  CD2   . TRP C 1 229 ? 21.732  76.167  68.646 1.00 40.23 ? 1258 TRP C CD2   1 
ATOM   4674 N  NE1   . TRP C 1 229 ? 23.750  77.138  68.737 1.00 42.32 ? 1258 TRP C NE1   1 
ATOM   4675 C  CE2   . TRP C 1 229 ? 23.017  76.088  69.222 1.00 40.39 ? 1258 TRP C CE2   1 
ATOM   4676 C  CE3   . TRP C 1 229 ? 20.779  75.197  68.980 1.00 41.07 ? 1258 TRP C CE3   1 
ATOM   4677 C  CZ2   . TRP C 1 229 ? 23.375  75.077  70.114 1.00 41.01 ? 1258 TRP C CZ2   1 
ATOM   4678 C  CZ3   . TRP C 1 229 ? 21.135  74.192  69.866 1.00 41.81 ? 1258 TRP C CZ3   1 
ATOM   4679 C  CH2   . TRP C 1 229 ? 22.424  74.141  70.423 1.00 41.69 ? 1258 TRP C CH2   1 
ATOM   4680 N  N     . PHE C 1 230 ? 19.942  76.427  63.981 1.00 37.69 ? 1259 PHE C N     1 
ATOM   4681 C  CA    . PHE C 1 230 ? 19.951  75.177  63.219 1.00 38.91 ? 1259 PHE C CA    1 
ATOM   4682 C  C     . PHE C 1 230 ? 20.293  75.365  61.742 1.00 40.36 ? 1259 PHE C C     1 
ATOM   4683 O  O     . PHE C 1 230 ? 20.204  74.424  60.955 1.00 40.62 ? 1259 PHE C O     1 
ATOM   4684 C  CB    . PHE C 1 230 ? 18.588  74.480  63.330 1.00 38.57 ? 1259 PHE C CB    1 
ATOM   4685 C  CG    . PHE C 1 230 ? 18.294  73.925  64.696 1.00 38.35 ? 1259 PHE C CG    1 
ATOM   4686 C  CD1   . PHE C 1 230 ? 19.088  72.921  65.239 1.00 37.94 ? 1259 PHE C CD1   1 
ATOM   4687 C  CD2   . PHE C 1 230 ? 17.225  74.409  65.443 1.00 36.81 ? 1259 PHE C CD2   1 
ATOM   4688 C  CE1   . PHE C 1 230 ? 18.823  72.404  66.512 1.00 38.89 ? 1259 PHE C CE1   1 
ATOM   4689 C  CE2   . PHE C 1 230 ? 16.953  73.901  66.713 1.00 37.61 ? 1259 PHE C CE2   1 
ATOM   4690 C  CZ    . PHE C 1 230 ? 17.754  72.896  67.250 1.00 35.92 ? 1259 PHE C CZ    1 
ATOM   4691 N  N     . THR C 1 231 ? 20.689  76.578  61.376 1.00 42.16 ? 1260 THR C N     1 
ATOM   4692 C  CA    . THR C 1 231 ? 21.028  76.911  59.996 1.00 43.86 ? 1260 THR C CA    1 
ATOM   4693 C  C     . THR C 1 231 ? 21.850  75.879  59.227 1.00 45.98 ? 1260 THR C C     1 
ATOM   4694 O  O     . THR C 1 231 ? 21.524  75.549  58.086 1.00 49.22 ? 1260 THR C O     1 
ATOM   4695 C  CB    . THR C 1 231 ? 21.776  78.252  59.928 1.00 43.06 ? 1260 THR C CB    1 
ATOM   4696 O  OG1   . THR C 1 231 ? 20.936  79.288  60.443 1.00 44.82 ? 1260 THR C OG1   1 
ATOM   4697 C  CG2   . THR C 1 231 ? 22.155  78.586  58.494 1.00 43.54 ? 1260 THR C CG2   1 
ATOM   4698 N  N     . ASP C 1 232 ? 22.914  75.373  59.836 1.00 46.49 ? 1261 ASP C N     1 
ATOM   4699 C  CA    . ASP C 1 232 ? 23.768  74.407  59.151 1.00 47.39 ? 1261 ASP C CA    1 
ATOM   4700 C  C     . ASP C 1 232 ? 23.330  72.960  59.301 1.00 45.20 ? 1261 ASP C C     1 
ATOM   4701 O  O     . ASP C 1 232 ? 23.986  72.054  58.790 1.00 45.46 ? 1261 ASP C O     1 
ATOM   4702 C  CB    . ASP C 1 232 ? 25.210  74.540  59.643 1.00 50.44 ? 1261 ASP C CB    1 
ATOM   4703 C  CG    . ASP C 1 232 ? 25.792  75.910  59.374 1.00 52.91 ? 1261 ASP C CG    1 
ATOM   4704 O  OD1   . ASP C 1 232 ? 25.735  76.356  58.208 1.00 54.06 ? 1261 ASP C OD1   1 
ATOM   4705 O  OD2   . ASP C 1 232 ? 26.313  76.534  60.325 1.00 55.60 ? 1261 ASP C OD2   1 
ATOM   4706 N  N     . THR C 1 233 ? 22.229  72.736  60.006 1.00 42.32 ? 1262 THR C N     1 
ATOM   4707 C  CA    . THR C 1 233 ? 21.738  71.380  60.207 1.00 39.42 ? 1262 THR C CA    1 
ATOM   4708 C  C     . THR C 1 233 ? 20.681  71.048  59.172 1.00 37.05 ? 1262 THR C C     1 
ATOM   4709 O  O     . THR C 1 233 ? 19.729  71.802  58.987 1.00 36.73 ? 1262 THR C O     1 
ATOM   4710 C  CB    . THR C 1 233 ? 21.111  71.210  61.596 1.00 39.38 ? 1262 THR C CB    1 
ATOM   4711 O  OG1   . THR C 1 233 ? 22.069  71.565  62.600 1.00 40.59 ? 1262 THR C OG1   1 
ATOM   4712 C  CG2   . THR C 1 233 ? 20.670  69.766  61.800 1.00 37.71 ? 1262 THR C CG2   1 
ATOM   4713 N  N     . SER C 1 234 ? 20.848  69.920  58.494 1.00 36.35 ? 1263 SER C N     1 
ATOM   4714 C  CA    . SER C 1 234 ? 19.882  69.506  57.487 1.00 34.62 ? 1263 SER C CA    1 
ATOM   4715 C  C     . SER C 1 234 ? 18.616  68.996  58.156 1.00 32.20 ? 1263 SER C C     1 
ATOM   4716 O  O     . SER C 1 234 ? 18.664  68.381  59.218 1.00 30.68 ? 1263 SER C O     1 
ATOM   4717 C  CB    . SER C 1 234 ? 20.461  68.398  56.607 1.00 36.72 ? 1263 SER C CB    1 
ATOM   4718 O  OG    . SER C 1 234 ? 21.510  68.893  55.796 1.00 42.58 ? 1263 SER C OG    1 
ATOM   4719 N  N     . ILE C 1 235 ? 17.479  69.261  57.534 1.00 31.92 ? 1264 ILE C N     1 
ATOM   4720 C  CA    . ILE C 1 235 ? 16.219  68.792  58.077 1.00 29.92 ? 1264 ILE C CA    1 
ATOM   4721 C  C     . ILE C 1 235 ? 15.547  67.861  57.081 1.00 29.85 ? 1264 ILE C C     1 
ATOM   4722 O  O     . ILE C 1 235 ? 15.251  68.239  55.942 1.00 29.50 ? 1264 ILE C O     1 
ATOM   4723 C  CB    . ILE C 1 235 ? 15.280  69.959  58.414 1.00 30.14 ? 1264 ILE C CB    1 
ATOM   4724 C  CG1   . ILE C 1 235 ? 15.918  70.831  59.502 1.00 32.09 ? 1264 ILE C CG1   1 
ATOM   4725 C  CG2   . ILE C 1 235 ? 13.928  69.417  58.887 1.00 29.26 ? 1264 ILE C CG2   1 
ATOM   4726 C  CD1   . ILE C 1 235 ? 15.067  72.001  59.934 1.00 33.62 ? 1264 ILE C CD1   1 
ATOM   4727 N  N     . ILE C 1 236 ? 15.337  66.628  57.519 1.00 28.30 ? 1265 ILE C N     1 
ATOM   4728 C  CA    . ILE C 1 236 ? 14.689  65.612  56.707 1.00 27.21 ? 1265 ILE C CA    1 
ATOM   4729 C  C     . ILE C 1 236 ? 13.314  65.330  57.320 1.00 26.61 ? 1265 ILE C C     1 
ATOM   4730 O  O     . ILE C 1 236 ? 13.212  64.990  58.500 1.00 26.47 ? 1265 ILE C O     1 
ATOM   4731 C  CB    . ILE C 1 236 ? 15.527  64.326  56.686 1.00 26.73 ? 1265 ILE C CB    1 
ATOM   4732 C  CG1   . ILE C 1 236 ? 16.874  64.606  56.001 1.00 28.17 ? 1265 ILE C CG1   1 
ATOM   4733 C  CG2   . ILE C 1 236 ? 14.767  63.215  55.968 1.00 26.19 ? 1265 ILE C CG2   1 
ATOM   4734 C  CD1   . ILE C 1 236 ? 17.901  63.503  56.192 1.00 28.10 ? 1265 ILE C CD1   1 
ATOM   4735 N  N     . LEU C 1 237 ? 12.261  65.486  56.523 1.00 22.43 ? 1266 LEU C N     1 
ATOM   4736 C  CA    . LEU C 1 237 ? 10.907  65.250  57.007 1.00 22.53 ? 1266 LEU C CA    1 
ATOM   4737 C  C     . LEU C 1 237 ? 10.350  63.895  56.556 1.00 24.29 ? 1266 LEU C C     1 
ATOM   4738 O  O     . LEU C 1 237 ? 10.307  63.583  55.359 1.00 23.14 ? 1266 LEU C O     1 
ATOM   4739 C  CB    . LEU C 1 237 ? 9.994   66.383  56.532 1.00 22.74 ? 1266 LEU C CB    1 
ATOM   4740 C  CG    . LEU C 1 237 ? 8.523   66.442  56.951 1.00 24.42 ? 1266 LEU C CG    1 
ATOM   4741 C  CD1   . LEU C 1 237 ? 8.377   66.708  58.451 1.00 21.65 ? 1266 LEU C CD1   1 
ATOM   4742 C  CD2   . LEU C 1 237 ? 7.863   67.572  56.163 1.00 22.79 ? 1266 LEU C CD2   1 
ATOM   4743 N  N     . PHE C 1 238 ? 9.948   63.088  57.530 1.00 21.42 ? 1267 PHE C N     1 
ATOM   4744 C  CA    . PHE C 1 238 ? 9.366   61.780  57.271 1.00 21.19 ? 1267 PHE C CA    1 
ATOM   4745 C  C     . PHE C 1 238 ? 7.870   61.865  57.569 1.00 21.45 ? 1267 PHE C C     1 
ATOM   4746 O  O     . PHE C 1 238 ? 7.468   61.937  58.739 1.00 18.70 ? 1267 PHE C O     1 
ATOM   4747 C  CB    . PHE C 1 238 ? 9.976   60.722  58.196 1.00 21.61 ? 1267 PHE C CB    1 
ATOM   4748 C  CG    . PHE C 1 238 ? 11.218  60.064  57.666 1.00 24.12 ? 1267 PHE C CG    1 
ATOM   4749 C  CD1   . PHE C 1 238 ? 11.933  60.610  56.600 1.00 25.05 ? 1267 PHE C CD1   1 
ATOM   4750 C  CD2   . PHE C 1 238 ? 11.684  58.885  58.254 1.00 23.83 ? 1267 PHE C CD2   1 
ATOM   4751 C  CE1   . PHE C 1 238 ? 13.091  59.994  56.129 1.00 24.31 ? 1267 PHE C CE1   1 
ATOM   4752 C  CE2   . PHE C 1 238 ? 12.839  58.261  57.793 1.00 22.98 ? 1267 PHE C CE2   1 
ATOM   4753 C  CZ    . PHE C 1 238 ? 13.545  58.816  56.727 1.00 24.52 ? 1267 PHE C CZ    1 
ATOM   4754 N  N     . LEU C 1 239 ? 7.045   61.882  56.527 1.00 19.88 ? 1268 LEU C N     1 
ATOM   4755 C  CA    . LEU C 1 239 ? 5.596   61.912  56.726 1.00 18.92 ? 1268 LEU C CA    1 
ATOM   4756 C  C     . LEU C 1 239 ? 5.240   60.436  56.787 1.00 20.41 ? 1268 LEU C C     1 
ATOM   4757 O  O     . LEU C 1 239 ? 5.021   59.778  55.763 1.00 18.29 ? 1268 LEU C O     1 
ATOM   4758 C  CB    . LEU C 1 239 ? 4.918   62.630  55.561 1.00 20.51 ? 1268 LEU C CB    1 
ATOM   4759 C  CG    . LEU C 1 239 ? 5.353   64.108  55.519 1.00 23.01 ? 1268 LEU C CG    1 
ATOM   4760 C  CD1   . LEU C 1 239 ? 4.700   64.815  54.332 1.00 23.07 ? 1268 LEU C CD1   1 
ATOM   4761 C  CD2   . LEU C 1 239 ? 4.961   64.801  56.839 1.00 19.42 ? 1268 LEU C CD2   1 
ATOM   4762 N  N     . ASN C 1 240 ? 5.211   59.933  58.020 1.00 17.76 ? 1269 ASN C N     1 
ATOM   4763 C  CA    . ASN C 1 240 ? 4.996   58.526  58.323 1.00 14.48 ? 1269 ASN C CA    1 
ATOM   4764 C  C     . ASN C 1 240 ? 3.560   58.021  58.453 1.00 15.59 ? 1269 ASN C C     1 
ATOM   4765 O  O     . ASN C 1 240 ? 2.617   58.801  58.450 1.00 14.06 ? 1269 ASN C O     1 
ATOM   4766 C  CB    . ASN C 1 240 ? 5.801   58.213  59.589 1.00 16.48 ? 1269 ASN C CB    1 
ATOM   4767 C  CG    . ASN C 1 240 ? 6.004   56.742  59.804 1.00 16.49 ? 1269 ASN C CG    1 
ATOM   4768 O  OD1   . ASN C 1 240 ? 6.305   56.000  58.864 1.00 18.64 ? 1269 ASN C OD1   1 
ATOM   4769 N  ND2   . ASN C 1 240 ? 5.857   56.304  61.053 1.00 18.63 ? 1269 ASN C ND2   1 
ATOM   4770 N  N     . LYS C 1 241 ? 3.413   56.698  58.556 1.00 14.12 ? 1270 LYS C N     1 
ATOM   4771 C  CA    . LYS C 1 241 ? 2.104   56.051  58.664 1.00 16.25 ? 1270 LYS C CA    1 
ATOM   4772 C  C     . LYS C 1 241 ? 1.236   56.359  57.445 1.00 16.77 ? 1270 LYS C C     1 
ATOM   4773 O  O     . LYS C 1 241 ? 0.007   56.501  57.548 1.00 15.68 ? 1270 LYS C O     1 
ATOM   4774 C  CB    . LYS C 1 241 ? 1.379   56.471  59.965 1.00 14.52 ? 1270 LYS C CB    1 
ATOM   4775 C  CG    . LYS C 1 241 ? 2.146   56.084  61.237 1.00 18.52 ? 1270 LYS C CG    1 
ATOM   4776 C  CD    . LYS C 1 241 ? 1.292   56.179  62.511 1.00 20.29 ? 1270 LYS C CD    1 
ATOM   4777 C  CE    . LYS C 1 241 ? 2.102   55.801  63.747 1.00 20.51 ? 1270 LYS C CE    1 
ATOM   4778 N  NZ    . LYS C 1 241 ? 1.292   55.788  65.011 1.00 20.55 ? 1270 LYS C NZ    1 
ATOM   4779 N  N     . LYS C 1 242 ? 1.874   56.451  56.281 1.00 16.40 ? 1271 LYS C N     1 
ATOM   4780 C  CA    . LYS C 1 242 ? 1.126   56.736  55.055 1.00 19.16 ? 1271 LYS C CA    1 
ATOM   4781 C  C     . LYS C 1 242 ? 0.109   55.624  54.791 1.00 18.81 ? 1271 LYS C C     1 
ATOM   4782 O  O     . LYS C 1 242 ? -0.911  55.852  54.147 1.00 17.62 ? 1271 LYS C O     1 
ATOM   4783 C  CB    . LYS C 1 242 ? 2.074   56.869  53.850 1.00 20.89 ? 1271 LYS C CB    1 
ATOM   4784 C  CG    . LYS C 1 242 ? 2.839   55.594  53.510 1.00 21.81 ? 1271 LYS C CG    1 
ATOM   4785 C  CD    . LYS C 1 242 ? 3.811   55.824  52.349 1.00 21.77 ? 1271 LYS C CD    1 
ATOM   4786 C  CE    . LYS C 1 242 ? 4.378   54.502  51.870 1.00 20.69 ? 1271 LYS C CE    1 
ATOM   4787 N  NZ    . LYS C 1 242 ? 5.147   54.632  50.599 1.00 29.86 ? 1271 LYS C NZ    1 
ATOM   4788 N  N     . ASP C 1 243 ? 0.391   54.421  55.286 1.00 18.95 ? 1272 ASP C N     1 
ATOM   4789 C  CA    . ASP C 1 243 ? -0.525  53.302  55.094 1.00 20.50 ? 1272 ASP C CA    1 
ATOM   4790 C  C     . ASP C 1 243 ? -1.830  53.527  55.871 1.00 21.90 ? 1272 ASP C C     1 
ATOM   4791 O  O     . ASP C 1 243 ? -2.922  53.324  55.333 1.00 20.85 ? 1272 ASP C O     1 
ATOM   4792 C  CB    . ASP C 1 243 ? 0.134   51.988  55.538 1.00 20.77 ? 1272 ASP C CB    1 
ATOM   4793 C  CG    . ASP C 1 243 ? 0.484   51.974  57.023 1.00 22.85 ? 1272 ASP C CG    1 
ATOM   4794 O  OD1   . ASP C 1 243 ? 1.119   52.943  57.503 1.00 21.99 ? 1272 ASP C OD1   1 
ATOM   4795 O  OD2   . ASP C 1 243 ? 0.137   50.985  57.702 1.00 21.25 ? 1272 ASP C OD2   1 
ATOM   4796 N  N     . LEU C 1 244 ? -1.710  53.946  57.133 1.00 20.36 ? 1273 LEU C N     1 
ATOM   4797 C  CA    . LEU C 1 244 ? -2.884  54.207  57.959 1.00 20.00 ? 1273 LEU C CA    1 
ATOM   4798 C  C     . LEU C 1 244 ? -3.621  55.432  57.423 1.00 19.42 ? 1273 LEU C C     1 
ATOM   4799 O  O     . LEU C 1 244 ? -4.852  55.507  57.478 1.00 18.97 ? 1273 LEU C O     1 
ATOM   4800 C  CB    . LEU C 1 244 ? -2.476  54.455  59.424 1.00 19.74 ? 1273 LEU C CB    1 
ATOM   4801 C  CG    . LEU C 1 244 ? -1.766  53.326  60.172 1.00 19.15 ? 1273 LEU C CG    1 
ATOM   4802 C  CD1   . LEU C 1 244 ? -1.560  53.729  61.638 1.00 19.15 ? 1273 LEU C CD1   1 
ATOM   4803 C  CD2   . LEU C 1 244 ? -2.607  52.053  60.102 1.00 20.09 ? 1273 LEU C CD2   1 
ATOM   4804 N  N     . PHE C 1 245 ? -2.866  56.394  56.901 1.00 19.00 ? 1274 PHE C N     1 
ATOM   4805 C  CA    . PHE C 1 245 ? -3.471  57.607  56.363 1.00 20.57 ? 1274 PHE C CA    1 
ATOM   4806 C  C     . PHE C 1 245 ? -4.342  57.268  55.149 1.00 21.95 ? 1274 PHE C C     1 
ATOM   4807 O  O     . PHE C 1 245 ? -5.468  57.751  55.018 1.00 21.95 ? 1274 PHE C O     1 
ATOM   4808 C  CB    . PHE C 1 245 ? -2.394  58.609  55.938 1.00 19.35 ? 1274 PHE C CB    1 
ATOM   4809 C  CG    . PHE C 1 245 ? -2.950  59.919  55.435 1.00 18.61 ? 1274 PHE C CG    1 
ATOM   4810 C  CD1   . PHE C 1 245 ? -3.516  60.832  56.318 1.00 16.17 ? 1274 PHE C CD1   1 
ATOM   4811 C  CD2   . PHE C 1 245 ? -2.912  60.234  54.084 1.00 19.97 ? 1274 PHE C CD2   1 
ATOM   4812 C  CE1   . PHE C 1 245 ? -4.031  62.037  55.860 1.00 19.44 ? 1274 PHE C CE1   1 
ATOM   4813 C  CE2   . PHE C 1 245 ? -3.428  61.443  53.610 1.00 19.03 ? 1274 PHE C CE2   1 
ATOM   4814 C  CZ    . PHE C 1 245 ? -3.987  62.344  54.503 1.00 19.59 ? 1274 PHE C CZ    1 
ATOM   4815 N  N     . GLU C 1 246 ? -3.802  56.436  54.269 1.00 21.27 ? 1275 GLU C N     1 
ATOM   4816 C  CA    . GLU C 1 246 ? -4.501  56.023  53.056 1.00 26.16 ? 1275 GLU C CA    1 
ATOM   4817 C  C     . GLU C 1 246 ? -5.863  55.408  53.381 1.00 25.92 ? 1275 GLU C C     1 
ATOM   4818 O  O     . GLU C 1 246 ? -6.846  55.637  52.673 1.00 26.66 ? 1275 GLU C O     1 
ATOM   4819 C  CB    . GLU C 1 246 ? -3.631  55.028  52.284 1.00 29.52 ? 1275 GLU C CB    1 
ATOM   4820 C  CG    . GLU C 1 246 ? -4.237  54.542  50.975 1.00 36.96 ? 1275 GLU C CG    1 
ATOM   4821 C  CD    . GLU C 1 246 ? -3.197  53.901  50.083 1.00 40.73 ? 1275 GLU C CD    1 
ATOM   4822 O  OE1   . GLU C 1 246 ? -2.288  54.624  49.622 1.00 45.15 ? 1275 GLU C OE1   1 
ATOM   4823 O  OE2   . GLU C 1 246 ? -3.277  52.679  49.847 1.00 44.49 ? 1275 GLU C OE2   1 
ATOM   4824 N  N     . GLU C 1 247 ? -5.919  54.626  54.452 1.00 25.60 ? 1276 GLU C N     1 
ATOM   4825 C  CA    . GLU C 1 247 ? -7.172  54.023  54.861 1.00 28.12 ? 1276 GLU C CA    1 
ATOM   4826 C  C     . GLU C 1 247 ? -8.109  55.033  55.513 1.00 26.49 ? 1276 GLU C C     1 
ATOM   4827 O  O     . GLU C 1 247 ? -9.299  55.078  55.201 1.00 27.02 ? 1276 GLU C O     1 
ATOM   4828 C  CB    . GLU C 1 247 ? -6.921  52.852  55.819 1.00 30.92 ? 1276 GLU C CB    1 
ATOM   4829 C  CG    . GLU C 1 247 ? -6.701  51.546  55.090 1.00 39.76 ? 1276 GLU C CG    1 
ATOM   4830 C  CD    . GLU C 1 247 ? -7.756  51.324  54.011 1.00 43.44 ? 1276 GLU C CD    1 
ATOM   4831 O  OE1   . GLU C 1 247 ? -8.961  51.273  54.348 1.00 44.32 ? 1276 GLU C OE1   1 
ATOM   4832 O  OE2   . GLU C 1 247 ? -7.377  51.214  52.826 1.00 46.82 ? 1276 GLU C OE2   1 
ATOM   4833 N  N     . LYS C 1 248 ? -7.573  55.846  56.416 1.00 26.32 ? 1277 LYS C N     1 
ATOM   4834 C  CA    . LYS C 1 248 ? -8.382  56.838  57.108 1.00 24.68 ? 1277 LYS C CA    1 
ATOM   4835 C  C     . LYS C 1 248 ? -9.002  57.907  56.221 1.00 24.35 ? 1277 LYS C C     1 
ATOM   4836 O  O     . LYS C 1 248 ? -10.161 58.281  56.418 1.00 22.95 ? 1277 LYS C O     1 
ATOM   4837 C  CB    . LYS C 1 248 ? -7.567  57.538  58.192 1.00 24.84 ? 1277 LYS C CB    1 
ATOM   4838 C  CG    . LYS C 1 248 ? -7.414  56.741  59.480 1.00 25.75 ? 1277 LYS C CG    1 
ATOM   4839 C  CD    . LYS C 1 248 ? -6.759  57.594  60.556 1.00 23.57 ? 1277 LYS C CD    1 
ATOM   4840 C  CE    . LYS C 1 248 ? -6.514  56.785  61.821 1.00 24.75 ? 1277 LYS C CE    1 
ATOM   4841 N  NZ    . LYS C 1 248 ? -5.851  57.611  62.857 1.00 26.02 ? 1277 LYS C NZ    1 
ATOM   4842 N  N     . ILE C 1 249 ? -8.241  58.400  55.251 1.00 23.43 ? 1278 ILE C N     1 
ATOM   4843 C  CA    . ILE C 1 249 ? -8.731  59.472  54.389 1.00 25.24 ? 1278 ILE C CA    1 
ATOM   4844 C  C     . ILE C 1 249 ? -10.001 59.156  53.593 1.00 27.71 ? 1278 ILE C C     1 
ATOM   4845 O  O     . ILE C 1 249 ? -10.665 60.064  53.085 1.00 27.59 ? 1278 ILE C O     1 
ATOM   4846 C  CB    . ILE C 1 249 ? -7.638  59.947  53.405 1.00 23.68 ? 1278 ILE C CB    1 
ATOM   4847 C  CG1   . ILE C 1 249 ? -8.023  61.318  52.846 1.00 23.38 ? 1278 ILE C CG1   1 
ATOM   4848 C  CG2   . ILE C 1 249 ? -7.441  58.926  52.296 1.00 24.04 ? 1278 ILE C CG2   1 
ATOM   4849 C  CD1   . ILE C 1 249 ? -8.206  62.382  53.941 1.00 21.74 ? 1278 ILE C CD1   1 
ATOM   4850 N  N     . LYS C 1 250 ? -10.335 57.878  53.477 1.00 28.80 ? 1279 LYS C N     1 
ATOM   4851 C  CA    . LYS C 1 250 ? -11.534 57.484  52.749 1.00 32.94 ? 1279 LYS C CA    1 
ATOM   4852 C  C     . LYS C 1 250 ? -12.798 57.850  53.532 1.00 34.45 ? 1279 LYS C C     1 
ATOM   4853 O  O     . LYS C 1 250 ? -13.825 58.163  52.935 1.00 35.27 ? 1279 LYS C O     1 
ATOM   4854 C  CB    . LYS C 1 250 ? -11.529 55.974  52.488 1.00 31.92 ? 1279 LYS C CB    1 
ATOM   4855 C  CG    . LYS C 1 250 ? -10.454 55.492  51.533 1.00 33.83 ? 1279 LYS C CG    1 
ATOM   4856 C  CD    . LYS C 1 250 ? -10.362 53.968  51.566 1.00 36.58 ? 1279 LYS C CD    1 
ATOM   4857 C  CE    . LYS C 1 250 ? -9.298  53.448  50.621 1.00 38.91 ? 1279 LYS C CE    1 
ATOM   4858 N  NZ    . LYS C 1 250 ? -9.017  52.008  50.891 1.00 41.94 ? 1279 LYS C NZ    1 
ATOM   4859 N  N     . LYS C 1 251 ? -12.712 57.822  54.864 1.00 35.14 ? 1280 LYS C N     1 
ATOM   4860 C  CA    . LYS C 1 251 ? -13.868 58.114  55.715 1.00 37.35 ? 1280 LYS C CA    1 
ATOM   4861 C  C     . LYS C 1 251 ? -13.768 59.324  56.638 1.00 35.40 ? 1280 LYS C C     1 
ATOM   4862 O  O     . LYS C 1 251 ? -14.789 59.839  57.087 1.00 34.62 ? 1280 LYS C O     1 
ATOM   4863 C  CB    . LYS C 1 251 ? -14.212 56.886  56.563 1.00 40.82 ? 1280 LYS C CB    1 
ATOM   4864 C  CG    . LYS C 1 251 ? -14.741 55.704  55.763 1.00 47.20 ? 1280 LYS C CG    1 
ATOM   4865 C  CD    . LYS C 1 251 ? -14.932 54.483  56.651 1.00 51.15 ? 1280 LYS C CD    1 
ATOM   4866 C  CE    . LYS C 1 251 ? -15.368 53.274  55.835 1.00 54.65 ? 1280 LYS C CE    1 
ATOM   4867 N  NZ    . LYS C 1 251 ? -15.504 52.058  56.691 1.00 56.22 ? 1280 LYS C NZ    1 
ATOM   4868 N  N     . SER C 1 252 ? -12.552 59.760  56.948 1.00 32.90 ? 1281 SER C N     1 
ATOM   4869 C  CA    . SER C 1 252 ? -12.375 60.919  57.814 1.00 31.77 ? 1281 SER C CA    1 
ATOM   4870 C  C     . SER C 1 252 ? -11.818 62.063  56.989 1.00 29.14 ? 1281 SER C C     1 
ATOM   4871 O  O     . SER C 1 252 ? -10.676 62.012  56.544 1.00 30.16 ? 1281 SER C O     1 
ATOM   4872 C  CB    . SER C 1 252 ? -11.423 60.594  58.967 1.00 32.58 ? 1281 SER C CB    1 
ATOM   4873 O  OG    . SER C 1 252 ? -11.992 59.628  59.831 1.00 35.27 ? 1281 SER C OG    1 
ATOM   4874 N  N     . PRO C 1 253 ? -12.626 63.108  56.758 1.00 27.23 ? 1282 PRO C N     1 
ATOM   4875 C  CA    . PRO C 1 253 ? -12.176 64.258  55.968 1.00 27.43 ? 1282 PRO C CA    1 
ATOM   4876 C  C     . PRO C 1 253 ? -11.053 65.035  56.645 1.00 27.27 ? 1282 PRO C C     1 
ATOM   4877 O  O     . PRO C 1 253 ? -11.011 65.137  57.872 1.00 27.00 ? 1282 PRO C O     1 
ATOM   4878 C  CB    . PRO C 1 253 ? -13.456 65.079  55.794 1.00 26.94 ? 1282 PRO C CB    1 
ATOM   4879 C  CG    . PRO C 1 253 ? -14.221 64.768  57.025 1.00 27.80 ? 1282 PRO C CG    1 
ATOM   4880 C  CD    . PRO C 1 253 ? -14.023 63.281  57.189 1.00 26.90 ? 1282 PRO C CD    1 
ATOM   4881 N  N     . LEU C 1 254 ? -10.150 65.587  55.838 1.00 26.83 ? 1283 LEU C N     1 
ATOM   4882 C  CA    . LEU C 1 254 ? -9.008  66.335  56.357 1.00 26.67 ? 1283 LEU C CA    1 
ATOM   4883 C  C     . LEU C 1 254 ? -9.426  67.594  57.110 1.00 28.64 ? 1283 LEU C C     1 
ATOM   4884 O  O     . LEU C 1 254 ? -8.676  68.121  57.942 1.00 26.65 ? 1283 LEU C O     1 
ATOM   4885 C  CB    . LEU C 1 254 ? -8.060  66.698  55.216 1.00 24.63 ? 1283 LEU C CB    1 
ATOM   4886 C  CG    . LEU C 1 254 ? -6.736  67.361  55.612 1.00 22.17 ? 1283 LEU C CG    1 
ATOM   4887 C  CD1   . LEU C 1 254 ? -5.958  66.444  56.550 1.00 17.38 ? 1283 LEU C CD1   1 
ATOM   4888 C  CD2   . LEU C 1 254 ? -5.932  67.685  54.348 1.00 18.09 ? 1283 LEU C CD2   1 
ATOM   4889 N  N     . THR C 1 255 ? -10.632 68.067  56.822 1.00 27.33 ? 1284 THR C N     1 
ATOM   4890 C  CA    . THR C 1 255 ? -11.154 69.258  57.474 1.00 29.16 ? 1284 THR C CA    1 
ATOM   4891 C  C     . THR C 1 255 ? -11.208 69.102  58.993 1.00 28.71 ? 1284 THR C C     1 
ATOM   4892 O  O     . THR C 1 255 ? -11.312 70.087  59.716 1.00 30.67 ? 1284 THR C O     1 
ATOM   4893 C  CB    . THR C 1 255 ? -12.555 69.614  56.920 1.00 29.64 ? 1284 THR C CB    1 
ATOM   4894 O  OG1   . THR C 1 255 ? -13.238 68.412  56.545 1.00 31.34 ? 1284 THR C OG1   1 
ATOM   4895 C  CG2   . THR C 1 255 ? -12.430 70.513  55.695 1.00 27.50 ? 1284 THR C CG2   1 
ATOM   4896 N  N     . ILE C 1 256 ? -11.131 67.865  59.475 1.00 27.77 ? 1285 ILE C N     1 
ATOM   4897 C  CA    . ILE C 1 256 ? -11.139 67.616  60.912 1.00 26.58 ? 1285 ILE C CA    1 
ATOM   4898 C  C     . ILE C 1 256 ? -9.879  68.229  61.519 1.00 27.07 ? 1285 ILE C C     1 
ATOM   4899 O  O     . ILE C 1 256 ? -9.889  68.730  62.641 1.00 27.55 ? 1285 ILE C O     1 
ATOM   4900 C  CB    . ILE C 1 256 ? -11.122 66.098  61.229 1.00 27.89 ? 1285 ILE C CB    1 
ATOM   4901 C  CG1   . ILE C 1 256 ? -12.456 65.456  60.830 1.00 29.99 ? 1285 ILE C CG1   1 
ATOM   4902 C  CG2   . ILE C 1 256 ? -10.827 65.874  62.717 1.00 26.37 ? 1285 ILE C CG2   1 
ATOM   4903 C  CD1   . ILE C 1 256 ? -12.527 63.959  61.117 1.00 27.15 ? 1285 ILE C CD1   1 
ATOM   4904 N  N     . CYS C 1 257 ? -8.786  68.174  60.766 1.00 26.63 ? 1286 CYS C N     1 
ATOM   4905 C  CA    . CYS C 1 257 ? -7.509  68.703  61.229 1.00 24.97 ? 1286 CYS C CA    1 
ATOM   4906 C  C     . CYS C 1 257 ? -7.302  70.157  60.804 1.00 24.62 ? 1286 CYS C C     1 
ATOM   4907 O  O     . CYS C 1 257 ? -6.887  70.992  61.606 1.00 23.06 ? 1286 CYS C O     1 
ATOM   4908 C  CB    . CYS C 1 257 ? -6.373  67.842  60.684 1.00 19.57 ? 1286 CYS C CB    1 
ATOM   4909 S  SG    . CYS C 1 257 ? -4.737  68.193  61.378 1.00 18.49 ? 1286 CYS C SG    1 
ATOM   4910 N  N     . TYR C 1 258 ? -7.589  70.439  59.537 1.00 24.50 ? 1287 TYR C N     1 
ATOM   4911 C  CA    . TYR C 1 258 ? -7.441  71.776  58.976 1.00 26.02 ? 1287 TYR C CA    1 
ATOM   4912 C  C     . TYR C 1 258 ? -8.810  72.200  58.447 1.00 29.22 ? 1287 TYR C C     1 
ATOM   4913 O  O     . TYR C 1 258 ? -9.140  71.958  57.280 1.00 29.60 ? 1287 TYR C O     1 
ATOM   4914 C  CB    . TYR C 1 258 ? -6.435  71.759  57.823 1.00 24.37 ? 1287 TYR C CB    1 
ATOM   4915 C  CG    . TYR C 1 258 ? -5.044  71.269  58.181 1.00 24.96 ? 1287 TYR C CG    1 
ATOM   4916 C  CD1   . TYR C 1 258 ? -4.131  72.097  58.846 1.00 24.39 ? 1287 TYR C CD1   1 
ATOM   4917 C  CD2   . TYR C 1 258 ? -4.631  69.982  57.827 1.00 25.63 ? 1287 TYR C CD2   1 
ATOM   4918 C  CE1   . TYR C 1 258 ? -2.827  71.651  59.143 1.00 26.47 ? 1287 TYR C CE1   1 
ATOM   4919 C  CE2   . TYR C 1 258 ? -3.340  69.524  58.119 1.00 26.65 ? 1287 TYR C CE2   1 
ATOM   4920 C  CZ    . TYR C 1 258 ? -2.444  70.359  58.773 1.00 27.66 ? 1287 TYR C CZ    1 
ATOM   4921 O  OH    . TYR C 1 258 ? -1.175  69.892  59.042 1.00 22.82 ? 1287 TYR C OH    1 
ATOM   4922 N  N     . PRO C 1 259 ? -9.625  72.838  59.297 1.00 31.57 ? 1288 PRO C N     1 
ATOM   4923 C  CA    . PRO C 1 259 ? -10.963 73.281  58.888 1.00 33.54 ? 1288 PRO C CA    1 
ATOM   4924 C  C     . PRO C 1 259 ? -11.049 74.146  57.634 1.00 34.25 ? 1288 PRO C C     1 
ATOM   4925 O  O     . PRO C 1 259 ? -12.125 74.287  57.057 1.00 36.26 ? 1288 PRO C O     1 
ATOM   4926 C  CB    . PRO C 1 259 ? -11.500 73.986  60.143 1.00 34.94 ? 1288 PRO C CB    1 
ATOM   4927 C  CG    . PRO C 1 259 ? -10.262 74.349  60.917 1.00 34.80 ? 1288 PRO C CG    1 
ATOM   4928 C  CD    . PRO C 1 259 ? -9.378  73.153  60.713 1.00 32.55 ? 1288 PRO C CD    1 
ATOM   4929 N  N     . GLU C 1 260 ? -9.928  74.706  57.192 1.00 34.99 ? 1289 GLU C N     1 
ATOM   4930 C  CA    . GLU C 1 260 ? -9.944  75.536  55.996 1.00 35.64 ? 1289 GLU C CA    1 
ATOM   4931 C  C     . GLU C 1 260 ? -9.638  74.753  54.711 1.00 36.25 ? 1289 GLU C C     1 
ATOM   4932 O  O     . GLU C 1 260 ? -9.724  75.301  53.610 1.00 35.48 ? 1289 GLU C O     1 
ATOM   4933 C  CB    . GLU C 1 260 ? -8.961  76.709  56.139 1.00 37.56 ? 1289 GLU C CB    1 
ATOM   4934 C  CG    . GLU C 1 260 ? -7.486  76.400  55.824 1.00 40.02 ? 1289 GLU C CG    1 
ATOM   4935 C  CD    . GLU C 1 260 ? -6.796  75.527  56.865 1.00 41.07 ? 1289 GLU C CD    1 
ATOM   4936 O  OE1   . GLU C 1 260 ? -7.403  75.220  57.913 1.00 41.19 ? 1289 GLU C OE1   1 
ATOM   4937 O  OE2   . GLU C 1 260 ? -5.627  75.154  56.630 1.00 42.84 ? 1289 GLU C OE2   1 
ATOM   4938 N  N     . TYR C 1 261 ? -9.283  73.478  54.845 1.00 35.25 ? 1290 TYR C N     1 
ATOM   4939 C  CA    . TYR C 1 261 ? -8.980  72.657  53.670 1.00 34.74 ? 1290 TYR C CA    1 
ATOM   4940 C  C     . TYR C 1 261 ? -10.204 72.579  52.752 1.00 34.64 ? 1290 TYR C C     1 
ATOM   4941 O  O     . TYR C 1 261 ? -11.306 72.290  53.206 1.00 34.01 ? 1290 TYR C O     1 
ATOM   4942 C  CB    . TYR C 1 261 ? -8.574  71.243  54.096 1.00 30.82 ? 1290 TYR C CB    1 
ATOM   4943 C  CG    . TYR C 1 261 ? -8.235  70.323  52.941 1.00 29.84 ? 1290 TYR C CG    1 
ATOM   4944 C  CD1   . TYR C 1 261 ? -7.149  70.590  52.101 1.00 30.16 ? 1290 TYR C CD1   1 
ATOM   4945 C  CD2   . TYR C 1 261 ? -8.983  69.173  52.699 1.00 29.11 ? 1290 TYR C CD2   1 
ATOM   4946 C  CE1   . TYR C 1 261 ? -6.814  69.730  51.054 1.00 29.61 ? 1290 TYR C CE1   1 
ATOM   4947 C  CE2   . TYR C 1 261 ? -8.657  68.306  51.650 1.00 29.25 ? 1290 TYR C CE2   1 
ATOM   4948 C  CZ    . TYR C 1 261 ? -7.573  68.588  50.836 1.00 28.46 ? 1290 TYR C CZ    1 
ATOM   4949 O  OH    . TYR C 1 261 ? -7.242  67.727  49.813 1.00 28.98 ? 1290 TYR C OH    1 
ATOM   4950 N  N     . ALA C 1 262 ? -9.999  72.830  51.464 1.00 35.63 ? 1291 ALA C N     1 
ATOM   4951 C  CA    . ALA C 1 262 ? -11.089 72.792  50.496 1.00 37.52 ? 1291 ALA C CA    1 
ATOM   4952 C  C     . ALA C 1 262 ? -10.843 71.769  49.391 1.00 37.71 ? 1291 ALA C C     1 
ATOM   4953 O  O     . ALA C 1 262 ? -11.628 71.665  48.452 1.00 38.05 ? 1291 ALA C O     1 
ATOM   4954 C  CB    . ALA C 1 262 ? -11.283 74.170  49.884 1.00 38.40 ? 1291 ALA C CB    1 
ATOM   4955 N  N     . GLY C 1 263 ? -9.755  71.015  49.506 1.00 36.79 ? 1292 GLY C N     1 
ATOM   4956 C  CA    . GLY C 1 263 ? -9.442  70.025  48.493 1.00 36.07 ? 1292 GLY C CA    1 
ATOM   4957 C  C     . GLY C 1 263 ? -10.265 68.754  48.607 1.00 35.58 ? 1292 GLY C C     1 
ATOM   4958 O  O     . GLY C 1 263 ? -11.224 68.676  49.378 1.00 34.00 ? 1292 GLY C O     1 
ATOM   4959 N  N     . SER C 1 264 ? -9.885  67.749  47.827 1.00 35.57 ? 1293 SER C N     1 
ATOM   4960 C  CA    . SER C 1 264 ? -10.588 66.473  47.840 1.00 35.58 ? 1293 SER C CA    1 
ATOM   4961 C  C     . SER C 1 264 ? -10.039 65.574  48.940 1.00 33.71 ? 1293 SER C C     1 
ATOM   4962 O  O     . SER C 1 264 ? -8.888  65.714  49.353 1.00 34.05 ? 1293 SER C O     1 
ATOM   4963 C  CB    . SER C 1 264 ? -10.429 65.772  46.485 1.00 37.45 ? 1293 SER C CB    1 
ATOM   4964 O  OG    . SER C 1 264 ? -9.062  65.488  46.200 1.00 38.78 ? 1293 SER C OG    1 
ATOM   4965 N  N     . ASN C 1 265 ? -10.859 64.655  49.428 1.00 31.67 ? 1294 ASN C N     1 
ATOM   4966 C  CA    . ASN C 1 265 ? -10.383 63.739  50.447 1.00 29.20 ? 1294 ASN C CA    1 
ATOM   4967 C  C     . ASN C 1 265 ? -9.812  62.493  49.792 1.00 27.33 ? 1294 ASN C C     1 
ATOM   4968 O  O     . ASN C 1 265 ? -10.335 61.383  49.947 1.00 26.52 ? 1294 ASN C O     1 
ATOM   4969 C  CB    . ASN C 1 265 ? -11.493 63.378  51.434 1.00 28.61 ? 1294 ASN C CB    1 
ATOM   4970 C  CG    . ASN C 1 265 ? -11.804 64.521  52.389 1.00 32.47 ? 1294 ASN C CG    1 
ATOM   4971 O  OD1   . ASN C 1 265 ? -10.905 65.069  53.043 1.00 27.70 ? 1294 ASN C OD1   1 
ATOM   4972 N  ND2   . ASN C 1 265 ? -13.078 64.889  52.473 1.00 29.80 ? 1294 ASN C ND2   1 
ATOM   4973 N  N     . THR C 1 266 ? -8.732  62.705  49.046 1.00 25.05 ? 1295 THR C N     1 
ATOM   4974 C  CA    . THR C 1 266 ? -8.024  61.633  48.369 1.00 24.84 ? 1295 THR C CA    1 
ATOM   4975 C  C     . THR C 1 266 ? -6.651  61.519  49.032 1.00 24.40 ? 1295 THR C C     1 
ATOM   4976 O  O     . THR C 1 266 ? -6.136  62.488  49.588 1.00 24.34 ? 1295 THR C O     1 
ATOM   4977 C  CB    . THR C 1 266 ? -7.818  61.944  46.876 1.00 26.04 ? 1295 THR C CB    1 
ATOM   4978 O  OG1   . THR C 1 266 ? -7.011  63.122  46.741 1.00 27.83 ? 1295 THR C OG1   1 
ATOM   4979 C  CG2   . THR C 1 266 ? -9.161  62.165  46.179 1.00 24.99 ? 1295 THR C CG2   1 
ATOM   4980 N  N     . TYR C 1 267 ? -6.067  60.332  48.972 1.00 23.92 ? 1296 TYR C N     1 
ATOM   4981 C  CA    . TYR C 1 267 ? -4.758  60.088  49.560 1.00 23.23 ? 1296 TYR C CA    1 
ATOM   4982 C  C     . TYR C 1 267 ? -3.718  61.106  49.094 1.00 23.02 ? 1296 TYR C C     1 
ATOM   4983 O  O     . TYR C 1 267 ? -3.065  61.776  49.908 1.00 22.40 ? 1296 TYR C O     1 
ATOM   4984 C  CB    . TYR C 1 267 ? -4.285  58.673  49.203 1.00 20.58 ? 1296 TYR C CB    1 
ATOM   4985 C  CG    . TYR C 1 267 ? -2.843  58.414  49.563 1.00 20.58 ? 1296 TYR C CG    1 
ATOM   4986 C  CD1   . TYR C 1 267 ? -2.460  58.187  50.892 1.00 22.64 ? 1296 TYR C CD1   1 
ATOM   4987 C  CD2   . TYR C 1 267 ? -1.851  58.442  48.584 1.00 17.31 ? 1296 TYR C CD2   1 
ATOM   4988 C  CE1   . TYR C 1 267 ? -1.122  57.997  51.233 1.00 19.71 ? 1296 TYR C CE1   1 
ATOM   4989 C  CE2   . TYR C 1 267 ? -0.520  58.256  48.907 1.00 17.89 ? 1296 TYR C CE2   1 
ATOM   4990 C  CZ    . TYR C 1 267 ? -0.158  58.034  50.237 1.00 20.53 ? 1296 TYR C CZ    1 
ATOM   4991 O  OH    . TYR C 1 267 ? 1.169   57.864  50.556 1.00 18.27 ? 1296 TYR C OH    1 
ATOM   4992 N  N     . GLU C 1 268 ? -3.576  61.227  47.779 1.00 20.30 ? 1297 GLU C N     1 
ATOM   4993 C  CA    . GLU C 1 268 ? -2.601  62.133  47.186 1.00 20.19 ? 1297 GLU C CA    1 
ATOM   4994 C  C     . GLU C 1 268 ? -2.709  63.605  47.586 1.00 20.50 ? 1297 GLU C C     1 
ATOM   4995 O  O     . GLU C 1 268 ? -1.761  64.181  48.115 1.00 20.47 ? 1297 GLU C O     1 
ATOM   4996 C  CB    . GLU C 1 268 ? -2.656  62.042  45.649 1.00 20.97 ? 1297 GLU C CB    1 
ATOM   4997 C  CG    . GLU C 1 268 ? -2.245  60.692  45.061 1.00 19.04 ? 1297 GLU C CG    1 
ATOM   4998 C  CD    . GLU C 1 268 ? -3.309  59.626  45.179 1.00 17.28 ? 1297 GLU C CD    1 
ATOM   4999 O  OE1   . GLU C 1 268 ? -4.426  59.928  45.636 1.00 22.98 ? 1297 GLU C OE1   1 
ATOM   5000 O  OE2   . GLU C 1 268 ? -3.033  58.471  44.806 1.00 21.35 ? 1297 GLU C OE2   1 
ATOM   5001 N  N     . GLU C 1 269 ? -3.857  64.218  47.321 1.00 21.33 ? 1298 GLU C N     1 
ATOM   5002 C  CA    . GLU C 1 269 ? -4.034  65.633  47.619 1.00 22.68 ? 1298 GLU C CA    1 
ATOM   5003 C  C     . GLU C 1 269 ? -3.992  65.971  49.118 1.00 20.78 ? 1298 GLU C C     1 
ATOM   5004 O  O     . GLU C 1 269 ? -3.412  66.978  49.508 1.00 19.78 ? 1298 GLU C O     1 
ATOM   5005 C  CB    . GLU C 1 269 ? -5.353  66.148  47.014 1.00 22.27 ? 1298 GLU C CB    1 
ATOM   5006 C  CG    . GLU C 1 269 ? -5.427  67.672  46.989 1.00 26.68 ? 1298 GLU C CG    1 
ATOM   5007 C  CD    . GLU C 1 269 ? -6.777  68.223  46.555 1.00 30.69 ? 1298 GLU C CD    1 
ATOM   5008 O  OE1   . GLU C 1 269 ? -6.886  69.459  46.463 1.00 33.98 ? 1298 GLU C OE1   1 
ATOM   5009 O  OE2   . GLU C 1 269 ? -7.727  67.445  46.315 1.00 32.42 ? 1298 GLU C OE2   1 
ATOM   5010 N  N     . ALA C 1 270 ? -4.622  65.144  49.947 1.00 21.73 ? 1299 ALA C N     1 
ATOM   5011 C  CA    . ALA C 1 270 ? -4.640  65.396  51.389 1.00 23.03 ? 1299 ALA C CA    1 
ATOM   5012 C  C     . ALA C 1 270 ? -3.244  65.256  51.990 1.00 21.30 ? 1299 ALA C C     1 
ATOM   5013 O  O     . ALA C 1 270 ? -2.835  66.054  52.824 1.00 24.88 ? 1299 ALA C O     1 
ATOM   5014 C  CB    . ALA C 1 270 ? -5.615  64.441  52.081 1.00 20.27 ? 1299 ALA C CB    1 
ATOM   5015 N  N     . ALA C 1 271 ? -2.508  64.247  51.548 1.00 22.38 ? 1300 ALA C N     1 
ATOM   5016 C  CA    . ALA C 1 271 ? -1.163  64.019  52.052 1.00 21.74 ? 1300 ALA C CA    1 
ATOM   5017 C  C     . ALA C 1 271 ? -0.246  65.165  51.654 1.00 22.67 ? 1300 ALA C C     1 
ATOM   5018 O  O     . ALA C 1 271 ? 0.550   65.652  52.462 1.00 21.27 ? 1300 ALA C O     1 
ATOM   5019 C  CB    . ALA C 1 271 ? -0.620  62.696  51.522 1.00 19.92 ? 1300 ALA C CB    1 
ATOM   5020 N  N     . ALA C 1 272 ? -0.359  65.599  50.402 1.00 22.16 ? 1301 ALA C N     1 
ATOM   5021 C  CA    . ALA C 1 272 ? 0.465   66.693  49.918 1.00 21.19 ? 1301 ALA C CA    1 
ATOM   5022 C  C     . ALA C 1 272 ? 0.079   67.989  50.630 1.00 20.80 ? 1301 ALA C C     1 
ATOM   5023 O  O     . ALA C 1 272 ? 0.911   68.873  50.803 1.00 20.57 ? 1301 ALA C O     1 
ATOM   5024 C  CB    . ALA C 1 272 ? 0.309   66.847  48.393 1.00 23.07 ? 1301 ALA C CB    1 
ATOM   5025 N  N     . TYR C 1 273 ? -1.183  68.111  51.028 1.00 19.91 ? 1302 TYR C N     1 
ATOM   5026 C  CA    . TYR C 1 273 ? -1.611  69.313  51.733 1.00 21.69 ? 1302 TYR C CA    1 
ATOM   5027 C  C     . TYR C 1 273 ? -0.949  69.332  53.118 1.00 22.50 ? 1302 TYR C C     1 
ATOM   5028 O  O     . TYR C 1 273 ? -0.534  70.388  53.594 1.00 23.02 ? 1302 TYR C O     1 
ATOM   5029 C  CB    . TYR C 1 273 ? -3.130  69.336  51.901 1.00 23.31 ? 1302 TYR C CB    1 
ATOM   5030 C  CG    . TYR C 1 273 ? -3.658  70.617  52.516 1.00 25.14 ? 1302 TYR C CG    1 
ATOM   5031 C  CD1   . TYR C 1 273 ? -3.847  71.772  51.735 1.00 26.93 ? 1302 TYR C CD1   1 
ATOM   5032 C  CD2   . TYR C 1 273 ? -3.982  70.676  53.870 1.00 22.74 ? 1302 TYR C CD2   1 
ATOM   5033 C  CE1   . TYR C 1 273 ? -4.356  72.952  52.303 1.00 26.87 ? 1302 TYR C CE1   1 
ATOM   5034 C  CE2   . TYR C 1 273 ? -4.484  71.840  54.445 1.00 26.20 ? 1302 TYR C CE2   1 
ATOM   5035 C  CZ    . TYR C 1 273 ? -4.670  72.972  53.660 1.00 28.80 ? 1302 TYR C CZ    1 
ATOM   5036 O  OH    . TYR C 1 273 ? -5.170  74.112  54.243 1.00 30.06 ? 1302 TYR C OH    1 
ATOM   5037 N  N     . ILE C 1 274 ? -0.863  68.168  53.767 1.00 20.92 ? 1303 ILE C N     1 
ATOM   5038 C  CA    . ILE C 1 274 ? -0.221  68.100  55.081 1.00 21.68 ? 1303 ILE C CA    1 
ATOM   5039 C  C     . ILE C 1 274 ? 1.254   68.476  54.923 1.00 22.81 ? 1303 ILE C C     1 
ATOM   5040 O  O     . ILE C 1 274 ? 1.770   69.314  55.665 1.00 25.40 ? 1303 ILE C O     1 
ATOM   5041 C  CB    . ILE C 1 274 ? -0.348  66.687  55.728 1.00 16.95 ? 1303 ILE C CB    1 
ATOM   5042 C  CG1   . ILE C 1 274 ? -1.818  66.417  56.091 1.00 16.70 ? 1303 ILE C CG1   1 
ATOM   5043 C  CG2   . ILE C 1 274 ? 0.495   66.619  57.022 1.00 16.46 ? 1303 ILE C CG2   1 
ATOM   5044 C  CD1   . ILE C 1 274 ? -2.107  64.985  56.609 1.00 16.32 ? 1303 ILE C CD1   1 
ATOM   5045 N  N     . GLN C 1 275 ? 1.931   67.855  53.963 1.00 23.80 ? 1304 GLN C N     1 
ATOM   5046 C  CA    . GLN C 1 275 ? 3.325   68.183  53.707 1.00 25.81 ? 1304 GLN C CA    1 
ATOM   5047 C  C     . GLN C 1 275 ? 3.461   69.705  53.534 1.00 26.90 ? 1304 GLN C C     1 
ATOM   5048 O  O     . GLN C 1 275 ? 4.381   70.329  54.067 1.00 26.21 ? 1304 GLN C O     1 
ATOM   5049 C  CB    . GLN C 1 275 ? 3.816   67.507  52.418 1.00 27.84 ? 1304 GLN C CB    1 
ATOM   5050 C  CG    . GLN C 1 275 ? 5.069   68.184  51.829 1.00 30.20 ? 1304 GLN C CG    1 
ATOM   5051 C  CD    . GLN C 1 275 ? 5.541   67.561  50.530 1.00 30.45 ? 1304 GLN C CD    1 
ATOM   5052 O  OE1   . GLN C 1 275 ? 4.736   67.101  49.727 1.00 31.54 ? 1304 GLN C OE1   1 
ATOM   5053 N  NE2   . GLN C 1 275 ? 6.856   67.559  50.311 1.00 32.15 ? 1304 GLN C NE2   1 
ATOM   5054 N  N     . CYS C 1 276 ? 2.528   70.284  52.787 1.00 26.22 ? 1305 CYS C N     1 
ATOM   5055 C  CA    . CYS C 1 276 ? 2.527   71.710  52.501 1.00 28.65 ? 1305 CYS C CA    1 
ATOM   5056 C  C     . CYS C 1 276 ? 2.420   72.561  53.761 1.00 27.76 ? 1305 CYS C C     1 
ATOM   5057 O  O     . CYS C 1 276 ? 3.131   73.552  53.898 1.00 27.91 ? 1305 CYS C O     1 
ATOM   5058 C  CB    . CYS C 1 276 ? 1.379   72.042  51.537 1.00 32.15 ? 1305 CYS C CB    1 
ATOM   5059 S  SG    . CYS C 1 276 ? 1.490   73.679  50.760 1.00 45.63 ? 1305 CYS C SG    1 
ATOM   5060 N  N     . GLN C 1 277 ? 1.543   72.179  54.686 1.00 26.58 ? 1306 GLN C N     1 
ATOM   5061 C  CA    . GLN C 1 277 ? 1.390   72.951  55.920 1.00 26.26 ? 1306 GLN C CA    1 
ATOM   5062 C  C     . GLN C 1 277 ? 2.690   72.966  56.734 1.00 26.80 ? 1306 GLN C C     1 
ATOM   5063 O  O     . GLN C 1 277 ? 2.984   73.944  57.431 1.00 26.41 ? 1306 GLN C O     1 
ATOM   5064 C  CB    . GLN C 1 277 ? 0.237   72.399  56.768 1.00 23.64 ? 1306 GLN C CB    1 
ATOM   5065 C  CG    . GLN C 1 277 ? -1.073  72.271  56.008 1.00 25.07 ? 1306 GLN C CG    1 
ATOM   5066 C  CD    . GLN C 1 277 ? -1.396  73.507  55.181 1.00 29.92 ? 1306 GLN C CD    1 
ATOM   5067 O  OE1   . GLN C 1 277 ? -1.644  74.583  55.727 1.00 29.89 ? 1306 GLN C OE1   1 
ATOM   5068 N  NE2   . GLN C 1 277 ? -1.381  73.359  53.853 1.00 27.87 ? 1306 GLN C NE2   1 
ATOM   5069 N  N     . PHE C 1 278 ? 3.473   71.893  56.645 1.00 26.76 ? 1307 PHE C N     1 
ATOM   5070 C  CA    . PHE C 1 278 ? 4.737   71.842  57.373 1.00 27.34 ? 1307 PHE C CA    1 
ATOM   5071 C  C     . PHE C 1 278 ? 5.804   72.692  56.673 1.00 29.81 ? 1307 PHE C C     1 
ATOM   5072 O  O     . PHE C 1 278 ? 6.424   73.561  57.291 1.00 30.07 ? 1307 PHE C O     1 
ATOM   5073 C  CB    . PHE C 1 278 ? 5.249   70.399  57.509 1.00 24.00 ? 1307 PHE C CB    1 
ATOM   5074 C  CG    . PHE C 1 278 ? 4.690   69.659  58.696 1.00 23.25 ? 1307 PHE C CG    1 
ATOM   5075 C  CD1   . PHE C 1 278 ? 3.453   69.019  58.620 1.00 20.31 ? 1307 PHE C CD1   1 
ATOM   5076 C  CD2   . PHE C 1 278 ? 5.387   69.633  59.906 1.00 21.49 ? 1307 PHE C CD2   1 
ATOM   5077 C  CE1   . PHE C 1 278 ? 2.911   68.364  59.734 1.00 20.12 ? 1307 PHE C CE1   1 
ATOM   5078 C  CE2   . PHE C 1 278 ? 4.853   68.980  61.036 1.00 19.37 ? 1307 PHE C CE2   1 
ATOM   5079 C  CZ    . PHE C 1 278 ? 3.614   68.346  60.951 1.00 17.32 ? 1307 PHE C CZ    1 
ATOM   5080 N  N     . GLU C 1 279 ? 6.009   72.449  55.382 1.00 30.86 ? 1308 GLU C N     1 
ATOM   5081 C  CA    . GLU C 1 279 ? 7.019   73.187  54.634 1.00 33.76 ? 1308 GLU C CA    1 
ATOM   5082 C  C     . GLU C 1 279 ? 6.752   74.690  54.539 1.00 32.67 ? 1308 GLU C C     1 
ATOM   5083 O  O     . GLU C 1 279 ? 7.687   75.481  54.531 1.00 33.06 ? 1308 GLU C O     1 
ATOM   5084 C  CB    . GLU C 1 279 ? 7.194   72.568  53.245 1.00 36.13 ? 1308 GLU C CB    1 
ATOM   5085 C  CG    . GLU C 1 279 ? 7.568   71.090  53.317 1.00 40.82 ? 1308 GLU C CG    1 
ATOM   5086 C  CD    . GLU C 1 279 ? 8.047   70.517  51.996 1.00 41.69 ? 1308 GLU C CD    1 
ATOM   5087 O  OE1   . GLU C 1 279 ? 7.472   70.862  50.942 1.00 45.97 ? 1308 GLU C OE1   1 
ATOM   5088 O  OE2   . GLU C 1 279 ? 8.989   69.702  52.012 1.00 42.18 ? 1308 GLU C OE2   1 
ATOM   5089 N  N     . ASP C 1 280 ? 5.487   75.086  54.476 1.00 31.82 ? 1309 ASP C N     1 
ATOM   5090 C  CA    . ASP C 1 280 ? 5.145   76.507  54.415 1.00 34.32 ? 1309 ASP C CA    1 
ATOM   5091 C  C     . ASP C 1 280 ? 5.631   77.265  55.658 1.00 33.93 ? 1309 ASP C C     1 
ATOM   5092 O  O     . ASP C 1 280 ? 5.781   78.486  55.629 1.00 33.10 ? 1309 ASP C O     1 
ATOM   5093 C  CB    . ASP C 1 280 ? 3.628   76.683  54.279 1.00 34.97 ? 1309 ASP C CB    1 
ATOM   5094 C  CG    . ASP C 1 280 ? 3.150   76.559  52.842 1.00 38.30 ? 1309 ASP C CG    1 
ATOM   5095 O  OD1   . ASP C 1 280 ? 3.910   76.033  51.999 1.00 40.56 ? 1309 ASP C OD1   1 
ATOM   5096 O  OD2   . ASP C 1 280 ? 2.010   76.979  52.560 1.00 39.25 ? 1309 ASP C OD2   1 
ATOM   5097 N  N     . LEU C 1 281 ? 5.865   76.539  56.748 1.00 33.32 ? 1310 LEU C N     1 
ATOM   5098 C  CA    . LEU C 1 281 ? 6.338   77.156  57.984 1.00 35.28 ? 1310 LEU C CA    1 
ATOM   5099 C  C     . LEU C 1 281 ? 7.781   77.643  57.828 1.00 37.99 ? 1310 LEU C C     1 
ATOM   5100 O  O     . LEU C 1 281 ? 8.219   78.564  58.524 1.00 35.64 ? 1310 LEU C O     1 
ATOM   5101 C  CB    . LEU C 1 281 ? 6.255   76.151  59.139 1.00 32.62 ? 1310 LEU C CB    1 
ATOM   5102 C  CG    . LEU C 1 281 ? 4.853   75.643  59.496 1.00 32.65 ? 1310 LEU C CG    1 
ATOM   5103 C  CD1   . LEU C 1 281 ? 4.957   74.531  60.534 1.00 31.31 ? 1310 LEU C CD1   1 
ATOM   5104 C  CD2   . LEU C 1 281 ? 3.997   76.793  60.017 1.00 29.81 ? 1310 LEU C CD2   1 
ATOM   5105 N  N     . ASN C 1 282 ? 8.508   77.025  56.900 1.00 40.43 ? 1311 ASN C N     1 
ATOM   5106 C  CA    . ASN C 1 282 ? 9.905   77.367  56.648 1.00 45.17 ? 1311 ASN C CA    1 
ATOM   5107 C  C     . ASN C 1 282 ? 10.041  78.733  55.986 1.00 48.49 ? 1311 ASN C C     1 
ATOM   5108 O  O     . ASN C 1 282 ? 9.635   78.920  54.840 1.00 47.89 ? 1311 ASN C O     1 
ATOM   5109 C  CB    . ASN C 1 282 ? 10.548  76.282  55.777 1.00 44.37 ? 1311 ASN C CB    1 
ATOM   5110 C  CG    . ASN C 1 282 ? 11.976  76.608  55.393 1.00 45.80 ? 1311 ASN C CG    1 
ATOM   5111 O  OD1   . ASN C 1 282 ? 12.683  77.304  56.121 1.00 47.29 ? 1311 ASN C OD1   1 
ATOM   5112 N  ND2   . ASN C 1 282 ? 12.416  76.089  54.250 1.00 44.22 ? 1311 ASN C ND2   1 
ATOM   5113 N  N     . LYS C 1 283 ? 10.617  79.685  56.714 1.00 52.54 ? 1312 LYS C N     1 
ATOM   5114 C  CA    . LYS C 1 283 ? 10.789  81.038  56.197 1.00 57.74 ? 1312 LYS C CA    1 
ATOM   5115 C  C     . LYS C 1 283 ? 12.147  81.285  55.550 1.00 61.13 ? 1312 LYS C C     1 
ATOM   5116 O  O     . LYS C 1 283 ? 12.752  82.340  55.733 1.00 61.04 ? 1312 LYS C O     1 
ATOM   5117 C  CB    . LYS C 1 283 ? 10.542  82.062  57.309 1.00 57.43 ? 1312 LYS C CB    1 
ATOM   5118 C  CG    . LYS C 1 283 ? 9.121   82.028  57.860 1.00 59.25 ? 1312 LYS C CG    1 
ATOM   5119 C  CD    . LYS C 1 283 ? 8.085   82.174  56.742 1.00 60.19 ? 1312 LYS C CD    1 
ATOM   5120 C  CE    . LYS C 1 283 ? 6.661   82.040  57.269 1.00 60.30 ? 1312 LYS C CE    1 
ATOM   5121 N  NZ    . LYS C 1 283 ? 5.657   82.120  56.173 1.00 61.28 ? 1312 LYS C NZ    1 
ATOM   5122 N  N     . ARG C 1 284 ? 12.607  80.303  54.784 1.00 66.08 ? 1313 ARG C N     1 
ATOM   5123 C  CA    . ARG C 1 284 ? 13.878  80.382  54.071 1.00 71.07 ? 1313 ARG C CA    1 
ATOM   5124 C  C     . ARG C 1 284 ? 13.838  79.420  52.893 1.00 73.57 ? 1313 ARG C C     1 
ATOM   5125 O  O     . ARG C 1 284 ? 14.863  78.862  52.511 1.00 74.43 ? 1313 ARG C O     1 
ATOM   5126 C  CB    . ARG C 1 284 ? 15.043  79.993  54.985 1.00 73.28 ? 1313 ARG C CB    1 
ATOM   5127 C  CG    . ARG C 1 284 ? 15.436  81.034  56.007 1.00 75.91 ? 1313 ARG C CG    1 
ATOM   5128 C  CD    . ARG C 1 284 ? 16.583  80.517  56.856 1.00 79.00 ? 1313 ARG C CD    1 
ATOM   5129 N  NE    . ARG C 1 284 ? 17.037  81.501  57.832 1.00 81.32 ? 1313 ARG C NE    1 
ATOM   5130 C  CZ    . ARG C 1 284 ? 17.931  81.248  58.781 1.00 82.57 ? 1313 ARG C CZ    1 
ATOM   5131 N  NH1   . ARG C 1 284 ? 18.466  80.038  58.882 1.00 83.02 ? 1313 ARG C NH1   1 
ATOM   5132 N  NH2   . ARG C 1 284 ? 18.287  82.202  59.631 1.00 82.80 ? 1313 ARG C NH2   1 
ATOM   5133 N  N     . LYS C 1 285 ? 12.650  79.222  52.326 1.00 76.10 ? 1314 LYS C N     1 
ATOM   5134 C  CA    . LYS C 1 285 ? 12.478  78.306  51.198 1.00 78.45 ? 1314 LYS C CA    1 
ATOM   5135 C  C     . LYS C 1 285 ? 13.610  78.411  50.173 1.00 79.75 ? 1314 LYS C C     1 
ATOM   5136 O  O     . LYS C 1 285 ? 14.092  77.398  49.661 1.00 79.79 ? 1314 LYS C O     1 
ATOM   5137 C  CB    . LYS C 1 285 ? 11.123  78.553  50.523 1.00 78.63 ? 1314 LYS C CB    1 
ATOM   5138 C  CG    . LYS C 1 285 ? 9.931   78.315  51.446 1.00 78.95 ? 1314 LYS C CG    1 
ATOM   5139 C  CD    . LYS C 1 285 ? 8.603   78.533  50.735 1.00 79.16 ? 1314 LYS C CD    1 
ATOM   5140 C  CE    . LYS C 1 285 ? 7.434   78.321  51.684 1.00 78.46 ? 1314 LYS C CE    1 
ATOM   5141 N  NZ    . LYS C 1 285 ? 7.476   79.268  52.831 1.00 77.15 ? 1314 LYS C NZ    1 
ATOM   5142 N  N     . ASP C 1 286 ? 14.036  79.638  49.886 1.00 80.80 ? 1315 ASP C N     1 
ATOM   5143 C  CA    . ASP C 1 286 ? 15.114  79.873  48.933 1.00 81.45 ? 1315 ASP C CA    1 
ATOM   5144 C  C     . ASP C 1 286 ? 16.450  79.530  49.585 1.00 80.90 ? 1315 ASP C C     1 
ATOM   5145 O  O     . ASP C 1 286 ? 17.377  79.066  48.920 1.00 80.86 ? 1315 ASP C O     1 
ATOM   5146 C  CB    . ASP C 1 286 ? 15.112  81.341  48.491 1.00 83.13 ? 1315 ASP C CB    1 
ATOM   5147 C  CG    . ASP C 1 286 ? 13.797  81.758  47.844 1.00 84.84 ? 1315 ASP C CG    1 
ATOM   5148 O  OD1   . ASP C 1 286 ? 13.470  81.224  46.761 1.00 85.67 ? 1315 ASP C OD1   1 
ATOM   5149 O  OD2   . ASP C 1 286 ? 13.094  82.618  48.418 1.00 85.39 ? 1315 ASP C OD2   1 
ATOM   5150 N  N     . THR C 1 287 ? 16.532  79.758  50.894 1.00 79.76 ? 1316 THR C N     1 
ATOM   5151 C  CA    . THR C 1 287 ? 17.740  79.490  51.669 1.00 78.45 ? 1316 THR C CA    1 
ATOM   5152 C  C     . THR C 1 287 ? 17.818  78.037  52.154 1.00 77.65 ? 1316 THR C C     1 
ATOM   5153 O  O     . THR C 1 287 ? 18.546  77.219  51.584 1.00 77.38 ? 1316 THR C O     1 
ATOM   5154 C  CB    . THR C 1 287 ? 17.817  80.415  52.899 1.00 78.48 ? 1316 THR C CB    1 
ATOM   5155 O  OG1   . THR C 1 287 ? 17.688  81.779  52.482 1.00 78.06 ? 1316 THR C OG1   1 
ATOM   5156 C  CG2   . THR C 1 287 ? 19.145  80.230  53.621 1.00 78.49 ? 1316 THR C CG2   1 
ATOM   5157 N  N     . LYS C 1 288 ? 17.062  77.720  53.204 1.00 76.38 ? 1317 LYS C N     1 
ATOM   5158 C  CA    . LYS C 1 288 ? 17.069  76.375  53.765 1.00 74.95 ? 1317 LYS C CA    1 
ATOM   5159 C  C     . LYS C 1 288 ? 16.260  75.368  52.950 1.00 74.05 ? 1317 LYS C C     1 
ATOM   5160 O  O     . LYS C 1 288 ? 15.299  75.724  52.267 1.00 74.39 ? 1317 LYS C O     1 
ATOM   5161 C  CB    . LYS C 1 288 ? 16.563  76.394  55.210 1.00 73.96 ? 1317 LYS C CB    1 
ATOM   5162 C  CG    . LYS C 1 288 ? 16.816  75.088  55.942 1.00 72.38 ? 1317 LYS C CG    1 
ATOM   5163 C  CD    . LYS C 1 288 ? 16.705  75.249  57.440 1.00 71.18 ? 1317 LYS C CD    1 
ATOM   5164 C  CE    . LYS C 1 288 ? 17.286  74.038  58.141 1.00 70.21 ? 1317 LYS C CE    1 
ATOM   5165 N  NZ    . LYS C 1 288 ? 17.298  74.213  59.618 1.00 70.89 ? 1317 LYS C NZ    1 
ATOM   5166 N  N     . GLU C 1 289 ? 16.661  74.103  53.041 1.00 72.33 ? 1318 GLU C N     1 
ATOM   5167 C  CA    . GLU C 1 289 ? 16.012  73.024  52.305 1.00 70.87 ? 1318 GLU C CA    1 
ATOM   5168 C  C     . GLU C 1 289 ? 15.270  72.064  53.234 1.00 66.88 ? 1318 GLU C C     1 
ATOM   5169 O  O     . GLU C 1 289 ? 15.595  71.945  54.416 1.00 68.11 ? 1318 GLU C O     1 
ATOM   5170 C  CB    . GLU C 1 289 ? 17.058  72.222  51.522 1.00 74.16 ? 1318 GLU C CB    1 
ATOM   5171 C  CG    . GLU C 1 289 ? 17.512  70.934  52.232 1.00 79.05 ? 1318 GLU C CG    1 
ATOM   5172 C  CD    . GLU C 1 289 ? 18.300  71.181  53.522 1.00 81.82 ? 1318 GLU C CD    1 
ATOM   5173 O  OE1   . GLU C 1 289 ? 17.898  72.054  54.320 1.00 82.70 ? 1318 GLU C OE1   1 
ATOM   5174 O  OE2   . GLU C 1 289 ? 19.315  70.482  53.741 1.00 83.81 ? 1318 GLU C OE2   1 
ATOM   5175 N  N     . ILE C 1 290 ? 14.272  71.374  52.699 1.00 61.55 ? 1319 ILE C N     1 
ATOM   5176 C  CA    . ILE C 1 290 ? 13.536  70.403  53.495 1.00 54.42 ? 1319 ILE C CA    1 
ATOM   5177 C  C     . ILE C 1 290 ? 13.274  69.152  52.663 1.00 50.28 ? 1319 ILE C C     1 
ATOM   5178 O  O     . ILE C 1 290 ? 12.341  69.113  51.864 1.00 48.60 ? 1319 ILE C O     1 
ATOM   5179 C  CB    . ILE C 1 290 ? 12.186  70.967  53.994 1.00 53.62 ? 1319 ILE C CB    1 
ATOM   5180 C  CG1   . ILE C 1 290 ? 12.406  72.261  54.788 1.00 52.87 ? 1319 ILE C CG1   1 
ATOM   5181 C  CG2   . ILE C 1 290 ? 11.497  69.942  54.881 1.00 51.42 ? 1319 ILE C CG2   1 
ATOM   5182 C  CD1   . ILE C 1 290 ? 13.222  72.105  56.046 1.00 53.18 ? 1319 ILE C CD1   1 
ATOM   5183 N  N     . TYR C 1 291 ? 14.117  68.141  52.849 1.00 46.40 ? 1320 TYR C N     1 
ATOM   5184 C  CA    . TYR C 1 291 ? 13.984  66.874  52.141 1.00 43.39 ? 1320 TYR C CA    1 
ATOM   5185 C  C     . TYR C 1 291 ? 12.810  66.099  52.741 1.00 39.75 ? 1320 TYR C C     1 
ATOM   5186 O  O     . TYR C 1 291 ? 12.860  65.694  53.900 1.00 40.20 ? 1320 TYR C O     1 
ATOM   5187 C  CB    . TYR C 1 291 ? 15.261  66.049  52.302 1.00 46.00 ? 1320 TYR C CB    1 
ATOM   5188 C  CG    . TYR C 1 291 ? 16.530  66.760  51.877 1.00 52.00 ? 1320 TYR C CG    1 
ATOM   5189 C  CD1   . TYR C 1 291 ? 16.759  67.078  50.538 1.00 53.98 ? 1320 TYR C CD1   1 
ATOM   5190 C  CD2   . TYR C 1 291 ? 17.513  67.099  52.812 1.00 53.98 ? 1320 TYR C CD2   1 
ATOM   5191 C  CE1   . TYR C 1 291 ? 17.932  67.709  50.137 1.00 54.90 ? 1320 TYR C CE1   1 
ATOM   5192 C  CE2   . TYR C 1 291 ? 18.690  67.731  52.422 1.00 56.14 ? 1320 TYR C CE2   1 
ATOM   5193 C  CZ    . TYR C 1 291 ? 18.892  68.031  51.083 1.00 56.77 ? 1320 TYR C CZ    1 
ATOM   5194 O  OH    . TYR C 1 291 ? 20.057  68.646  50.688 1.00 59.08 ? 1320 TYR C OH    1 
ATOM   5195 N  N     . THR C 1 292 ? 11.758  65.892  51.957 1.00 36.69 ? 1321 THR C N     1 
ATOM   5196 C  CA    . THR C 1 292 ? 10.583  65.169  52.439 1.00 32.49 ? 1321 THR C CA    1 
ATOM   5197 C  C     . THR C 1 292 ? 10.408  63.781  51.830 1.00 29.02 ? 1321 THR C C     1 
ATOM   5198 O  O     . THR C 1 292 ? 10.652  63.572  50.643 1.00 29.80 ? 1321 THR C O     1 
ATOM   5199 C  CB    . THR C 1 292 ? 9.300   65.987  52.190 1.00 32.85 ? 1321 THR C CB    1 
ATOM   5200 O  OG1   . THR C 1 292 ? 9.383   67.228  52.905 1.00 35.13 ? 1321 THR C OG1   1 
ATOM   5201 C  CG2   . THR C 1 292 ? 8.074   65.222  52.658 1.00 31.05 ? 1321 THR C CG2   1 
ATOM   5202 N  N     . HIS C 1 293 ? 9.992   62.838  52.671 1.00 26.51 ? 1322 HIS C N     1 
ATOM   5203 C  CA    . HIS C 1 293 ? 9.744   61.452  52.275 1.00 24.41 ? 1322 HIS C CA    1 
ATOM   5204 C  C     . HIS C 1 293 ? 8.435   60.983  52.915 1.00 24.40 ? 1322 HIS C C     1 
ATOM   5205 O  O     . HIS C 1 293 ? 8.137   61.337  54.056 1.00 21.43 ? 1322 HIS C O     1 
ATOM   5206 C  CB    . HIS C 1 293 ? 10.872  60.539  52.766 1.00 26.59 ? 1322 HIS C CB    1 
ATOM   5207 C  CG    . HIS C 1 293 ? 12.194  60.792  52.112 1.00 29.72 ? 1322 HIS C CG    1 
ATOM   5208 N  ND1   . HIS C 1 293 ? 12.515  60.292  50.868 1.00 29.04 ? 1322 HIS C ND1   1 
ATOM   5209 C  CD2   . HIS C 1 293 ? 13.271  61.505  52.521 1.00 30.16 ? 1322 HIS C CD2   1 
ATOM   5210 C  CE1   . HIS C 1 293 ? 13.732  60.686  50.538 1.00 30.09 ? 1322 HIS C CE1   1 
ATOM   5211 N  NE2   . HIS C 1 293 ? 14.213  61.424  51.523 1.00 32.36 ? 1322 HIS C NE2   1 
ATOM   5212 N  N     . PHE C 1 294 ? 7.660   60.196  52.176 1.00 21.13 ? 1323 PHE C N     1 
ATOM   5213 C  CA    . PHE C 1 294 ? 6.413   59.646  52.686 1.00 20.87 ? 1323 PHE C CA    1 
ATOM   5214 C  C     . PHE C 1 294 ? 6.771   58.214  53.063 1.00 21.25 ? 1323 PHE C C     1 
ATOM   5215 O  O     . PHE C 1 294 ? 7.331   57.475  52.251 1.00 20.58 ? 1323 PHE C O     1 
ATOM   5216 C  CB    . PHE C 1 294 ? 5.318   59.703  51.611 1.00 19.63 ? 1323 PHE C CB    1 
ATOM   5217 C  CG    . PHE C 1 294 ? 4.892   61.108  51.281 1.00 19.03 ? 1323 PHE C CG    1 
ATOM   5218 C  CD1   . PHE C 1 294 ? 5.688   61.923  50.486 1.00 18.52 ? 1323 PHE C CD1   1 
ATOM   5219 C  CD2   . PHE C 1 294 ? 3.743   61.643  51.846 1.00 18.19 ? 1323 PHE C CD2   1 
ATOM   5220 C  CE1   . PHE C 1 294 ? 5.344   63.257  50.267 1.00 20.14 ? 1323 PHE C CE1   1 
ATOM   5221 C  CE2   . PHE C 1 294 ? 3.395   62.960  51.637 1.00 16.55 ? 1323 PHE C CE2   1 
ATOM   5222 C  CZ    . PHE C 1 294 ? 4.193   63.773  50.849 1.00 19.96 ? 1323 PHE C CZ    1 
ATOM   5223 N  N     . THR C 1 295 ? 6.452   57.819  54.292 1.00 17.41 ? 1324 THR C N     1 
ATOM   5224 C  CA    . THR C 1 295 ? 6.849   56.500  54.748 1.00 17.46 ? 1324 THR C CA    1 
ATOM   5225 C  C     . THR C 1 295 ? 5.853   55.667  55.527 1.00 19.52 ? 1324 THR C C     1 
ATOM   5226 O  O     . THR C 1 295 ? 4.817   56.146  55.993 1.00 19.05 ? 1324 THR C O     1 
ATOM   5227 C  CB    . THR C 1 295 ? 8.106   56.608  55.662 1.00 19.07 ? 1324 THR C CB    1 
ATOM   5228 O  OG1   . THR C 1 295 ? 7.738   57.230  56.903 1.00 17.82 ? 1324 THR C OG1   1 
ATOM   5229 C  CG2   . THR C 1 295 ? 9.184   57.462  55.009 1.00 19.17 ? 1324 THR C CG2   1 
ATOM   5230 N  N     . CYS C 1 296 ? 6.202   54.391  55.646 1.00 20.33 ? 1325 CYS C N     1 
ATOM   5231 C  CA    . CYS C 1 296 ? 5.455   53.440  56.446 1.00 21.90 ? 1325 CYS C CA    1 
ATOM   5232 C  C     . CYS C 1 296 ? 6.600   52.806  57.228 1.00 21.83 ? 1325 CYS C C     1 
ATOM   5233 O  O     . CYS C 1 296 ? 7.213   51.843  56.769 1.00 23.50 ? 1325 CYS C O     1 
ATOM   5234 C  CB    . CYS C 1 296 ? 4.757   52.381  55.599 1.00 21.47 ? 1325 CYS C CB    1 
ATOM   5235 S  SG    . CYS C 1 296 ? 4.006   51.087  56.648 1.00 21.52 ? 1325 CYS C SG    1 
ATOM   5236 N  N     . ALA C 1 297 ? 6.897   53.372  58.394 1.00 20.91 ? 1326 ALA C N     1 
ATOM   5237 C  CA    . ALA C 1 297 ? 8.005   52.914  59.230 1.00 19.87 ? 1326 ALA C CA    1 
ATOM   5238 C  C     . ALA C 1 297 ? 7.965   51.431  59.575 1.00 21.92 ? 1326 ALA C C     1 
ATOM   5239 O  O     . ALA C 1 297 ? 9.004   50.826  59.868 1.00 22.67 ? 1326 ALA C O     1 
ATOM   5240 C  CB    . ALA C 1 297 ? 8.065   53.756  60.524 1.00 20.36 ? 1326 ALA C CB    1 
ATOM   5241 N  N     . THR C 1 298 ? 6.775   50.843  59.544 1.00 20.85 ? 1327 THR C N     1 
ATOM   5242 C  CA    . THR C 1 298 ? 6.631   49.429  59.871 1.00 24.44 ? 1327 THR C CA    1 
ATOM   5243 C  C     . THR C 1 298 ? 6.892   48.509  58.683 1.00 25.50 ? 1327 THR C C     1 
ATOM   5244 O  O     . THR C 1 298 ? 6.936   47.295  58.835 1.00 25.34 ? 1327 THR C O     1 
ATOM   5245 C  CB    . THR C 1 298 ? 5.224   49.141  60.460 1.00 25.87 ? 1327 THR C CB    1 
ATOM   5246 O  OG1   . THR C 1 298 ? 4.240   49.887  59.732 1.00 25.99 ? 1327 THR C OG1   1 
ATOM   5247 C  CG2   . THR C 1 298 ? 5.178   49.541  61.942 1.00 24.56 ? 1327 THR C CG2   1 
ATOM   5248 N  N     . ASP C 1 299 ? 7.072   49.102  57.507 1.00 26.82 ? 1328 ASP C N     1 
ATOM   5249 C  CA    . ASP C 1 299 ? 7.343   48.363  56.274 1.00 26.53 ? 1328 ASP C CA    1 
ATOM   5250 C  C     . ASP C 1 299 ? 8.850   48.447  55.991 1.00 27.71 ? 1328 ASP C C     1 
ATOM   5251 O  O     . ASP C 1 299 ? 9.336   49.449  55.471 1.00 25.28 ? 1328 ASP C O     1 
ATOM   5252 C  CB    . ASP C 1 299 ? 6.564   48.999  55.126 1.00 28.83 ? 1328 ASP C CB    1 
ATOM   5253 C  CG    . ASP C 1 299 ? 6.731   48.256  53.807 1.00 30.78 ? 1328 ASP C CG    1 
ATOM   5254 O  OD1   . ASP C 1 299 ? 7.754   47.571  53.610 1.00 34.46 ? 1328 ASP C OD1   1 
ATOM   5255 O  OD2   . ASP C 1 299 ? 5.834   48.383  52.952 1.00 30.93 ? 1328 ASP C OD2   1 
ATOM   5256 N  N     . THR C 1 300 ? 9.579   47.392  56.340 1.00 29.74 ? 1329 THR C N     1 
ATOM   5257 C  CA    . THR C 1 300 ? 11.033  47.339  56.159 1.00 30.95 ? 1329 THR C CA    1 
ATOM   5258 C  C     . THR C 1 300 ? 11.478  47.657  54.727 1.00 32.13 ? 1329 THR C C     1 
ATOM   5259 O  O     . THR C 1 300 ? 12.481  48.340  54.518 1.00 31.55 ? 1329 THR C O     1 
ATOM   5260 C  CB    . THR C 1 300 ? 11.573  45.942  56.563 1.00 32.94 ? 1329 THR C CB    1 
ATOM   5261 O  OG1   . THR C 1 300 ? 11.266  45.696  57.942 1.00 31.69 ? 1329 THR C OG1   1 
ATOM   5262 C  CG2   . THR C 1 300 ? 13.084  45.856  56.364 1.00 32.65 ? 1329 THR C CG2   1 
ATOM   5263 N  N     . LYS C 1 301 ? 10.727  47.163  53.749 1.00 31.38 ? 1330 LYS C N     1 
ATOM   5264 C  CA    . LYS C 1 301 ? 11.047  47.389  52.349 1.00 33.16 ? 1330 LYS C CA    1 
ATOM   5265 C  C     . LYS C 1 301 ? 10.951  48.886  52.022 1.00 33.51 ? 1330 LYS C C     1 
ATOM   5266 O  O     . LYS C 1 301 ? 11.821  49.449  51.338 1.00 32.20 ? 1330 LYS C O     1 
ATOM   5267 C  CB    . LYS C 1 301 ? 10.085  46.581  51.470 1.00 35.21 ? 1330 LYS C CB    1 
ATOM   5268 C  CG    . LYS C 1 301 ? 10.307  46.731  49.976 1.00 41.51 ? 1330 LYS C CG    1 
ATOM   5269 C  CD    . LYS C 1 301 ? 9.312   45.884  49.177 1.00 44.60 ? 1330 LYS C CD    1 
ATOM   5270 C  CE    . LYS C 1 301 ? 9.462   46.108  47.674 1.00 46.30 ? 1330 LYS C CE    1 
ATOM   5271 N  NZ    . LYS C 1 301 ? 8.463   45.331  46.874 1.00 48.58 ? 1330 LYS C NZ    1 
ATOM   5272 N  N     . ASN C 1 302 ? 9.899   49.533  52.516 1.00 29.98 ? 1331 ASN C N     1 
ATOM   5273 C  CA    . ASN C 1 302 ? 9.731   50.952  52.272 1.00 27.72 ? 1331 ASN C CA    1 
ATOM   5274 C  C     . ASN C 1 302 ? 10.840  51.732  52.957 1.00 28.52 ? 1331 ASN C C     1 
ATOM   5275 O  O     . ASN C 1 302 ? 11.403  52.662  52.379 1.00 28.76 ? 1331 ASN C O     1 
ATOM   5276 C  CB    . ASN C 1 302 ? 8.377   51.444  52.791 1.00 25.97 ? 1331 ASN C CB    1 
ATOM   5277 C  CG    . ASN C 1 302 ? 8.167   52.938  52.551 1.00 26.71 ? 1331 ASN C CG    1 
ATOM   5278 O  OD1   . ASN C 1 302 ? 8.052   53.723  53.491 1.00 27.14 ? 1331 ASN C OD1   1 
ATOM   5279 N  ND2   . ASN C 1 302 ? 8.124   53.334  51.286 1.00 27.79 ? 1331 ASN C ND2   1 
ATOM   5280 N  N     . VAL C 1 303 ? 11.153  51.353  54.193 1.00 28.41 ? 1332 VAL C N     1 
ATOM   5281 C  CA    . VAL C 1 303 ? 12.180  52.048  54.954 1.00 28.73 ? 1332 VAL C CA    1 
ATOM   5282 C  C     . VAL C 1 303 ? 13.555  51.900  54.323 1.00 30.63 ? 1332 VAL C C     1 
ATOM   5283 O  O     . VAL C 1 303 ? 14.368  52.821  54.370 1.00 32.70 ? 1332 VAL C O     1 
ATOM   5284 C  CB    . VAL C 1 303 ? 12.235  51.552  56.422 1.00 25.20 ? 1332 VAL C CB    1 
ATOM   5285 C  CG1   . VAL C 1 303 ? 13.423  52.180  57.136 1.00 23.38 ? 1332 VAL C CG1   1 
ATOM   5286 C  CG2   . VAL C 1 303 ? 10.949  51.919  57.134 1.00 23.75 ? 1332 VAL C CG2   1 
ATOM   5287 N  N     . GLN C 1 304 ? 13.819  50.738  53.741 1.00 32.25 ? 1333 GLN C N     1 
ATOM   5288 C  CA    . GLN C 1 304 ? 15.099  50.508  53.090 1.00 34.71 ? 1333 GLN C CA    1 
ATOM   5289 C  C     . GLN C 1 304 ? 15.206  51.432  51.878 1.00 32.72 ? 1333 GLN C C     1 
ATOM   5290 O  O     . GLN C 1 304 ? 16.230  52.077  51.674 1.00 34.74 ? 1333 GLN C O     1 
ATOM   5291 C  CB    . GLN C 1 304 ? 15.214  49.050  52.647 1.00 38.14 ? 1333 GLN C CB    1 
ATOM   5292 C  CG    . GLN C 1 304 ? 16.610  48.651  52.205 1.00 42.01 ? 1333 GLN C CG    1 
ATOM   5293 C  CD    . GLN C 1 304 ? 16.699  47.188  51.824 1.00 45.49 ? 1333 GLN C CD    1 
ATOM   5294 O  OE1   . GLN C 1 304 ? 16.207  46.775  50.772 1.00 47.25 ? 1333 GLN C OE1   1 
ATOM   5295 N  NE2   . GLN C 1 304 ? 17.321  46.390  52.686 1.00 47.06 ? 1333 GLN C NE2   1 
ATOM   5296 N  N     . PHE C 1 305 ? 14.142  51.499  51.086 1.00 32.60 ? 1334 PHE C N     1 
ATOM   5297 C  CA    . PHE C 1 305 ? 14.115  52.349  49.894 1.00 33.63 ? 1334 PHE C CA    1 
ATOM   5298 C  C     . PHE C 1 305 ? 14.289  53.823  50.258 1.00 33.88 ? 1334 PHE C C     1 
ATOM   5299 O  O     . PHE C 1 305 ? 15.054  54.552  49.622 1.00 35.11 ? 1334 PHE C O     1 
ATOM   5300 C  CB    . PHE C 1 305 ? 12.791  52.169  49.142 1.00 35.03 ? 1334 PHE C CB    1 
ATOM   5301 C  CG    . PHE C 1 305 ? 12.639  53.079  47.945 1.00 39.74 ? 1334 PHE C CG    1 
ATOM   5302 C  CD1   . PHE C 1 305 ? 13.315  52.811  46.755 1.00 40.44 ? 1334 PHE C CD1   1 
ATOM   5303 C  CD2   . PHE C 1 305 ? 11.823  54.207  48.012 1.00 40.42 ? 1334 PHE C CD2   1 
ATOM   5304 C  CE1   . PHE C 1 305 ? 13.178  53.656  45.650 1.00 40.46 ? 1334 PHE C CE1   1 
ATOM   5305 C  CE2   . PHE C 1 305 ? 11.679  55.058  46.915 1.00 41.81 ? 1334 PHE C CE2   1 
ATOM   5306 C  CZ    . PHE C 1 305 ? 12.357  54.782  45.731 1.00 42.18 ? 1334 PHE C CZ    1 
ATOM   5307 N  N     . VAL C 1 306 ? 13.567  54.265  51.282 1.00 32.13 ? 1335 VAL C N     1 
ATOM   5308 C  CA    . VAL C 1 306 ? 13.655  55.651  51.715 1.00 29.87 ? 1335 VAL C CA    1 
ATOM   5309 C  C     . VAL C 1 306 ? 15.012  55.994  52.311 1.00 29.36 ? 1335 VAL C C     1 
ATOM   5310 O  O     . VAL C 1 306 ? 15.590  57.026  51.983 1.00 28.36 ? 1335 VAL C O     1 
ATOM   5311 C  CB    . VAL C 1 306 ? 12.571  55.986  52.765 1.00 29.25 ? 1335 VAL C CB    1 
ATOM   5312 C  CG1   . VAL C 1 306 ? 12.814  57.382  53.338 1.00 26.66 ? 1335 VAL C CG1   1 
ATOM   5313 C  CG2   . VAL C 1 306 ? 11.193  55.900  52.127 1.00 27.02 ? 1335 VAL C CG2   1 
ATOM   5314 N  N     . PHE C 1 307 ? 15.525  55.138  53.188 1.00 29.23 ? 1336 PHE C N     1 
ATOM   5315 C  CA    . PHE C 1 307 ? 16.802  55.434  53.807 1.00 31.92 ? 1336 PHE C CA    1 
ATOM   5316 C  C     . PHE C 1 307 ? 17.937  55.450  52.790 1.00 33.82 ? 1336 PHE C C     1 
ATOM   5317 O  O     . PHE C 1 307 ? 18.901  56.197  52.939 1.00 33.80 ? 1336 PHE C O     1 
ATOM   5318 C  CB    . PHE C 1 307 ? 17.131  54.442  54.920 1.00 29.22 ? 1336 PHE C CB    1 
ATOM   5319 C  CG    . PHE C 1 307 ? 18.161  54.958  55.874 1.00 30.11 ? 1336 PHE C CG    1 
ATOM   5320 C  CD1   . PHE C 1 307 ? 17.817  55.909  56.831 1.00 32.38 ? 1336 PHE C CD1   1 
ATOM   5321 C  CD2   . PHE C 1 307 ? 19.491  54.567  55.766 1.00 32.01 ? 1336 PHE C CD2   1 
ATOM   5322 C  CE1   . PHE C 1 307 ? 18.780  56.472  57.668 1.00 31.45 ? 1336 PHE C CE1   1 
ATOM   5323 C  CE2   . PHE C 1 307 ? 20.470  55.123  56.595 1.00 32.06 ? 1336 PHE C CE2   1 
ATOM   5324 C  CZ    . PHE C 1 307 ? 20.112  56.079  57.548 1.00 33.27 ? 1336 PHE C CZ    1 
ATOM   5325 N  N     . ASP C 1 308 ? 17.829  54.622  51.758 1.00 36.60 ? 1337 ASP C N     1 
ATOM   5326 C  CA    . ASP C 1 308 ? 18.859  54.590  50.730 1.00 38.18 ? 1337 ASP C CA    1 
ATOM   5327 C  C     . ASP C 1 308 ? 18.847  55.921  49.967 1.00 38.03 ? 1337 ASP C C     1 
ATOM   5328 O  O     . ASP C 1 308 ? 19.897  56.416  49.554 1.00 39.17 ? 1337 ASP C O     1 
ATOM   5329 C  CB    . ASP C 1 308 ? 18.620  53.410  49.786 1.00 41.35 ? 1337 ASP C CB    1 
ATOM   5330 C  CG    . ASP C 1 308 ? 19.484  53.472  48.550 1.00 45.28 ? 1337 ASP C CG    1 
ATOM   5331 O  OD1   . ASP C 1 308 ? 19.185  54.307  47.666 1.00 49.66 ? 1337 ASP C OD1   1 
ATOM   5332 O  OD2   . ASP C 1 308 ? 20.461  52.698  48.460 1.00 46.07 ? 1337 ASP C OD2   1 
ATOM   5333 N  N     . ALA C 1 309 ? 17.660  56.501  49.789 1.00 35.72 ? 1338 ALA C N     1 
ATOM   5334 C  CA    . ALA C 1 309 ? 17.533  57.785  49.096 1.00 34.67 ? 1338 ALA C CA    1 
ATOM   5335 C  C     . ALA C 1 309 ? 18.067  58.915  49.980 1.00 34.79 ? 1338 ALA C C     1 
ATOM   5336 O  O     . ALA C 1 309 ? 18.625  59.894  49.484 1.00 34.60 ? 1338 ALA C O     1 
ATOM   5337 C  CB    . ALA C 1 309 ? 16.073  58.054  48.730 1.00 31.89 ? 1338 ALA C CB    1 
ATOM   5338 N  N     . VAL C 1 310 ? 17.885  58.780  51.289 1.00 34.21 ? 1339 VAL C N     1 
ATOM   5339 C  CA    . VAL C 1 310 ? 18.370  59.784  52.228 1.00 32.50 ? 1339 VAL C CA    1 
ATOM   5340 C  C     . VAL C 1 310 ? 19.899  59.767  52.236 1.00 32.23 ? 1339 VAL C C     1 
ATOM   5341 O  O     . VAL C 1 310 ? 20.543  60.816  52.279 1.00 29.16 ? 1339 VAL C O     1 
ATOM   5342 C  CB    . VAL C 1 310 ? 17.859  59.501  53.665 1.00 32.95 ? 1339 VAL C CB    1 
ATOM   5343 C  CG1   . VAL C 1 310 ? 18.624  60.350  54.673 1.00 29.89 ? 1339 VAL C CG1   1 
ATOM   5344 C  CG2   . VAL C 1 310 ? 16.367  59.801  53.753 1.00 31.75 ? 1339 VAL C CG2   1 
ATOM   5345 N  N     . THR C 1 311 ? 20.465  58.563  52.196 1.00 33.46 ? 1340 THR C N     1 
ATOM   5346 C  CA    . THR C 1 311 ? 21.914  58.375  52.205 1.00 36.45 ? 1340 THR C CA    1 
ATOM   5347 C  C     . THR C 1 311 ? 22.608  58.927  50.962 1.00 38.58 ? 1340 THR C C     1 
ATOM   5348 O  O     . THR C 1 311 ? 23.684  59.515  51.069 1.00 38.80 ? 1340 THR C O     1 
ATOM   5349 C  CB    . THR C 1 311 ? 22.287  56.877  52.354 1.00 36.81 ? 1340 THR C CB    1 
ATOM   5350 O  OG1   . THR C 1 311 ? 21.882  56.404  53.646 1.00 36.97 ? 1340 THR C OG1   1 
ATOM   5351 C  CG2   . THR C 1 311 ? 23.790  56.680  52.211 1.00 37.32 ? 1340 THR C CG2   1 
ATOM   5352 N  N     . ASP C 1 312 ? 22.010  58.736  49.788 1.00 39.79 ? 1341 ASP C N     1 
ATOM   5353 C  CA    . ASP C 1 312 ? 22.620  59.243  48.563 1.00 43.19 ? 1341 ASP C CA    1 
ATOM   5354 C  C     . ASP C 1 312 ? 22.649  60.768  48.586 1.00 44.79 ? 1341 ASP C C     1 
ATOM   5355 O  O     . ASP C 1 312 ? 23.578  61.395  48.065 1.00 45.33 ? 1341 ASP C O     1 
ATOM   5356 C  CB    . ASP C 1 312 ? 21.868  58.745  47.321 1.00 43.68 ? 1341 ASP C CB    1 
ATOM   5357 C  CG    . ASP C 1 312 ? 22.048  57.254  47.089 1.00 45.88 ? 1341 ASP C CG    1 
ATOM   5358 O  OD1   . ASP C 1 312 ? 23.104  56.715  47.482 1.00 46.15 ? 1341 ASP C OD1   1 
ATOM   5359 O  OD2   . ASP C 1 312 ? 21.144  56.619  46.503 1.00 48.65 ? 1341 ASP C OD2   1 
ATOM   5360 N  N     . VAL C 1 313 ? 21.631  61.362  49.197 1.00 44.86 ? 1342 VAL C N     1 
ATOM   5361 C  CA    . VAL C 1 313 ? 21.554  62.810  49.303 1.00 44.63 ? 1342 VAL C CA    1 
ATOM   5362 C  C     . VAL C 1 313 ? 22.631  63.301  50.267 1.00 45.86 ? 1342 VAL C C     1 
ATOM   5363 O  O     . VAL C 1 313 ? 23.282  64.317  50.022 1.00 45.05 ? 1342 VAL C O     1 
ATOM   5364 C  CB    . VAL C 1 313 ? 20.173  63.255  49.820 1.00 44.55 ? 1342 VAL C CB    1 
ATOM   5365 C  CG1   . VAL C 1 313 ? 20.172  64.754  50.088 1.00 42.96 ? 1342 VAL C CG1   1 
ATOM   5366 C  CG2   . VAL C 1 313 ? 19.104  62.898  48.802 1.00 43.27 ? 1342 VAL C CG2   1 
ATOM   5367 N  N     . ILE C 1 314 ? 22.812  62.575  51.365 1.00 46.61 ? 1343 ILE C N     1 
ATOM   5368 C  CA    . ILE C 1 314 ? 23.816  62.938  52.356 1.00 48.26 ? 1343 ILE C CA    1 
ATOM   5369 C  C     . ILE C 1 314 ? 25.202  62.837  51.723 1.00 50.11 ? 1343 ILE C C     1 
ATOM   5370 O  O     . ILE C 1 314 ? 26.117  63.581  52.077 1.00 49.46 ? 1343 ILE C O     1 
ATOM   5371 C  CB    . ILE C 1 314 ? 23.741  62.009  53.605 1.00 46.75 ? 1343 ILE C CB    1 
ATOM   5372 C  CG1   . ILE C 1 314 ? 22.486  62.335  54.421 1.00 44.75 ? 1343 ILE C CG1   1 
ATOM   5373 C  CG2   . ILE C 1 314 ? 24.985  62.178  54.475 1.00 46.32 ? 1343 ILE C CG2   1 
ATOM   5374 C  CD1   . ILE C 1 314 ? 22.355  61.522  55.689 1.00 43.42 ? 1343 ILE C CD1   1 
ATOM   5375 N  N     . ILE C 1 315 ? 25.346  61.919  50.775 1.00 52.35 ? 1344 ILE C N     1 
ATOM   5376 C  CA    . ILE C 1 315 ? 26.619  61.730  50.101 1.00 55.82 ? 1344 ILE C CA    1 
ATOM   5377 C  C     . ILE C 1 315 ? 26.912  62.859  49.116 1.00 58.27 ? 1344 ILE C C     1 
ATOM   5378 O  O     . ILE C 1 315 ? 28.005  63.420  49.135 1.00 58.07 ? 1344 ILE C O     1 
ATOM   5379 C  CB    . ILE C 1 315 ? 26.667  60.368  49.363 1.00 56.09 ? 1344 ILE C CB    1 
ATOM   5380 C  CG1   . ILE C 1 315 ? 26.731  59.229  50.388 1.00 56.62 ? 1344 ILE C CG1   1 
ATOM   5381 C  CG2   . ILE C 1 315 ? 27.875  60.311  48.434 1.00 55.58 ? 1344 ILE C CG2   1 
ATOM   5382 C  CD1   . ILE C 1 315 ? 26.747  57.835  49.780 1.00 55.01 ? 1344 ILE C CD1   1 
ATOM   5383 N  N     . LYS C 1 316 ? 25.949  63.203  48.264 1.00 61.29 ? 1345 LYS C N     1 
ATOM   5384 C  CA    . LYS C 1 316 ? 26.185  64.272  47.299 1.00 65.73 ? 1345 LYS C CA    1 
ATOM   5385 C  C     . LYS C 1 316 ? 26.368  65.605  48.012 1.00 68.26 ? 1345 LYS C C     1 
ATOM   5386 O  O     . LYS C 1 316 ? 27.056  66.495  47.512 1.00 69.05 ? 1345 LYS C O     1 
ATOM   5387 C  CB    . LYS C 1 316 ? 25.045  64.374  46.279 1.00 65.77 ? 1345 LYS C CB    1 
ATOM   5388 C  CG    . LYS C 1 316 ? 23.744  64.952  46.802 1.00 67.26 ? 1345 LYS C CG    1 
ATOM   5389 C  CD    . LYS C 1 316 ? 22.850  65.355  45.637 1.00 67.74 ? 1345 LYS C CD    1 
ATOM   5390 C  CE    . LYS C 1 316 ? 21.468  65.776  46.099 1.00 68.28 ? 1345 LYS C CE    1 
ATOM   5391 N  NZ    . LYS C 1 316 ? 20.686  64.614  46.599 1.00 67.59 ? 1345 LYS C NZ    1 
ATOM   5392 N  N     . ASN C 1 317 ? 25.746  65.741  49.180 1.00 70.64 ? 1346 ASN C N     1 
ATOM   5393 C  CA    . ASN C 1 317 ? 25.872  66.959  49.971 1.00 73.41 ? 1346 ASN C CA    1 
ATOM   5394 C  C     . ASN C 1 317 ? 27.222  66.917  50.675 1.00 75.03 ? 1346 ASN C C     1 
ATOM   5395 O  O     . ASN C 1 317 ? 27.581  67.839  51.407 1.00 75.24 ? 1346 ASN C O     1 
ATOM   5396 C  CB    . ASN C 1 317 ? 24.749  67.043  51.006 1.00 74.58 ? 1346 ASN C CB    1 
ATOM   5397 C  CG    . ASN C 1 317 ? 23.433  67.484  50.401 1.00 76.50 ? 1346 ASN C CG    1 
ATOM   5398 O  OD1   . ASN C 1 317 ? 23.048  67.030  49.323 1.00 78.45 ? 1346 ASN C OD1   1 
ATOM   5399 N  ND2   . ASN C 1 317 ? 22.728  68.367  51.099 1.00 77.26 ? 1346 ASN C ND2   1 
ATOM   5400 N  N     . ASN C 1 318 ? 27.954  65.830  50.432 1.00 77.01 ? 1347 ASN C N     1 
ATOM   5401 C  CA    . ASN C 1 318 ? 29.282  65.582  50.997 1.00 78.60 ? 1347 ASN C CA    1 
ATOM   5402 C  C     . ASN C 1 318 ? 29.641  66.417  52.223 1.00 79.87 ? 1347 ASN C C     1 
ATOM   5403 O  O     . ASN C 1 318 ? 28.764  66.574  53.103 1.00 80.55 ? 1347 ASN C O     1 
ATOM   5404 C  CB    . ASN C 1 318 ? 30.357  65.741  49.906 1.00 78.85 ? 1347 ASN C CB    1 
ATOM   5405 C  CG    . ASN C 1 318 ? 30.403  67.142  49.309 1.00 79.55 ? 1347 ASN C CG    1 
ATOM   5406 O  OD1   . ASN C 1 318 ? 31.006  67.355  48.255 1.00 79.10 ? 1347 ASN C OD1   1 
ATOM   5407 N  ND2   . ASN C 1 318 ? 29.781  68.101  49.983 1.00 79.42 ? 1347 ASN C ND2   1 
ATOM   5408 N  N     . ASP D 2 1   ? 14.966  81.309  71.548 1.00 67.92 ? 1496 ASP D N     1 
ATOM   5409 C  CA    . ASP D 2 1   ? 14.729  80.928  72.971 1.00 66.19 ? 1496 ASP D CA    1 
ATOM   5410 C  C     . ASP D 2 1   ? 14.935  79.425  73.144 1.00 64.43 ? 1496 ASP D C     1 
ATOM   5411 O  O     . ASP D 2 1   ? 13.994  78.641  73.002 1.00 63.60 ? 1496 ASP D O     1 
ATOM   5412 C  CB    . ASP D 2 1   ? 13.301  81.298  73.379 1.00 68.73 ? 1496 ASP D CB    1 
ATOM   5413 C  CG    . ASP D 2 1   ? 13.078  81.199  74.876 1.00 70.91 ? 1496 ASP D CG    1 
ATOM   5414 O  OD1   . ASP D 2 1   ? 13.392  80.144  75.462 1.00 72.12 ? 1496 ASP D OD1   1 
ATOM   5415 O  OD2   . ASP D 2 1   ? 12.585  82.180  75.468 1.00 72.66 ? 1496 ASP D OD2   1 
ATOM   5416 N  N     . ILE D 2 2   ? 16.166  79.027  73.445 1.00 62.23 ? 1497 ILE D N     1 
ATOM   5417 C  CA    . ILE D 2 2   ? 16.476  77.615  73.631 1.00 60.49 ? 1497 ILE D CA    1 
ATOM   5418 C  C     . ILE D 2 2   ? 15.648  77.039  74.767 1.00 58.96 ? 1497 ILE D C     1 
ATOM   5419 O  O     . ILE D 2 2   ? 15.282  75.866  74.747 1.00 58.32 ? 1497 ILE D O     1 
ATOM   5420 C  CB    . ILE D 2 2   ? 17.974  77.400  73.945 1.00 60.64 ? 1497 ILE D CB    1 
ATOM   5421 C  CG1   . ILE D 2 2   ? 18.826  77.855  72.758 1.00 60.57 ? 1497 ILE D CG1   1 
ATOM   5422 C  CG2   . ILE D 2 2   ? 18.240  75.936  74.265 1.00 59.24 ? 1497 ILE D CG2   1 
ATOM   5423 C  CD1   . ILE D 2 2   ? 18.496  77.162  71.446 1.00 60.75 ? 1497 ILE D CD1   1 
ATOM   5424 N  N     . GLU D 2 3   ? 15.357  77.871  75.760 1.00 58.23 ? 1498 GLU D N     1 
ATOM   5425 C  CA    . GLU D 2 3   ? 14.566  77.441  76.906 1.00 57.87 ? 1498 GLU D CA    1 
ATOM   5426 C  C     . GLU D 2 3   ? 13.183  76.972  76.460 1.00 55.00 ? 1498 GLU D C     1 
ATOM   5427 O  O     . GLU D 2 3   ? 12.720  75.901  76.860 1.00 53.50 ? 1498 GLU D O     1 
ATOM   5428 C  CB    . GLU D 2 3   ? 14.422  78.591  77.903 1.00 60.68 ? 1498 GLU D CB    1 
ATOM   5429 C  CG    . GLU D 2 3   ? 13.482  78.296  79.063 1.00 64.71 ? 1498 GLU D CG    1 
ATOM   5430 C  CD    . GLU D 2 3   ? 14.024  77.242  80.009 1.00 67.83 ? 1498 GLU D CD    1 
ATOM   5431 O  OE1   . GLU D 2 3   ? 14.296  76.107  79.558 1.00 68.18 ? 1498 GLU D OE1   1 
ATOM   5432 O  OE2   . GLU D 2 3   ? 14.173  77.551  81.214 1.00 70.79 ? 1498 GLU D OE2   1 
ATOM   5433 N  N     . GLY D 2 4   ? 12.532  77.783  75.631 1.00 52.84 ? 1499 GLY D N     1 
ATOM   5434 C  CA    . GLY D 2 4   ? 11.210  77.441  75.139 1.00 50.27 ? 1499 GLY D CA    1 
ATOM   5435 C  C     . GLY D 2 4   ? 11.248  76.172  74.312 1.00 48.53 ? 1499 GLY D C     1 
ATOM   5436 O  O     . GLY D 2 4   ? 10.406  75.285  74.478 1.00 48.22 ? 1499 GLY D O     1 
ATOM   5437 N  N     . LEU D 2 5   ? 12.236  76.083  73.425 1.00 45.59 ? 1500 LEU D N     1 
ATOM   5438 C  CA    . LEU D 2 5   ? 12.388  74.917  72.567 1.00 41.47 ? 1500 LEU D CA    1 
ATOM   5439 C  C     . LEU D 2 5   ? 12.460  73.637  73.391 1.00 39.50 ? 1500 LEU D C     1 
ATOM   5440 O  O     . LEU D 2 5   ? 11.753  72.668  73.110 1.00 38.23 ? 1500 LEU D O     1 
ATOM   5441 C  CB    . LEU D 2 5   ? 13.646  75.050  71.702 1.00 41.00 ? 1500 LEU D CB    1 
ATOM   5442 C  CG    . LEU D 2 5   ? 13.854  73.926  70.682 1.00 41.18 ? 1500 LEU D CG    1 
ATOM   5443 C  CD1   . LEU D 2 5   ? 12.614  73.794  69.801 1.00 38.84 ? 1500 LEU D CD1   1 
ATOM   5444 C  CD2   . LEU D 2 5   ? 15.083  74.220  69.839 1.00 41.75 ? 1500 LEU D CD2   1 
ATOM   5445 N  N     . VAL D 2 6   ? 13.303  73.637  74.417 1.00 37.32 ? 1501 VAL D N     1 
ATOM   5446 C  CA    . VAL D 2 6   ? 13.441  72.457  75.261 1.00 37.71 ? 1501 VAL D CA    1 
ATOM   5447 C  C     . VAL D 2 6   ? 12.114  72.074  75.900 1.00 37.19 ? 1501 VAL D C     1 
ATOM   5448 O  O     . VAL D 2 6   ? 11.782  70.889  75.986 1.00 36.44 ? 1501 VAL D O     1 
ATOM   5449 C  CB    . VAL D 2 6   ? 14.503  72.669  76.359 1.00 38.98 ? 1501 VAL D CB    1 
ATOM   5450 C  CG1   . VAL D 2 6   ? 14.456  71.525  77.375 1.00 38.31 ? 1501 VAL D CG1   1 
ATOM   5451 C  CG2   . VAL D 2 6   ? 15.878  72.737  75.720 1.00 39.11 ? 1501 VAL D CG2   1 
ATOM   5452 N  N     . GLU D 2 7   ? 11.350  73.069  76.340 1.00 36.49 ? 1502 GLU D N     1 
ATOM   5453 C  CA    . GLU D 2 7   ? 10.054  72.787  76.946 1.00 36.91 ? 1502 GLU D CA    1 
ATOM   5454 C  C     . GLU D 2 7   ? 9.129   72.188  75.893 1.00 33.31 ? 1502 GLU D C     1 
ATOM   5455 O  O     . GLU D 2 7   ? 8.511   71.152  76.116 1.00 33.06 ? 1502 GLU D O     1 
ATOM   5456 C  CB    . GLU D 2 7   ? 9.424   74.063  77.507 1.00 40.51 ? 1502 GLU D CB    1 
ATOM   5457 C  CG    . GLU D 2 7   ? 10.158  74.645  78.692 1.00 48.57 ? 1502 GLU D CG    1 
ATOM   5458 C  CD    . GLU D 2 7   ? 9.425   75.824  79.296 1.00 52.85 ? 1502 GLU D CD    1 
ATOM   5459 O  OE1   . GLU D 2 7   ? 8.266   75.640  79.726 1.00 56.51 ? 1502 GLU D OE1   1 
ATOM   5460 O  OE2   . GLU D 2 7   ? 10.006  76.930  79.339 1.00 54.70 ? 1502 GLU D OE2   1 
ATOM   5461 N  N     . LEU D 2 8   ? 9.049   72.844  74.741 1.00 32.02 ? 1503 LEU D N     1 
ATOM   5462 C  CA    . LEU D 2 8   ? 8.194   72.375  73.655 1.00 30.56 ? 1503 LEU D CA    1 
ATOM   5463 C  C     . LEU D 2 8   ? 8.549   70.937  73.297 1.00 30.12 ? 1503 LEU D C     1 
ATOM   5464 O  O     . LEU D 2 8   ? 7.672   70.087  73.162 1.00 29.60 ? 1503 LEU D O     1 
ATOM   5465 C  CB    . LEU D 2 8   ? 8.353   73.275  72.431 1.00 29.58 ? 1503 LEU D CB    1 
ATOM   5466 C  CG    . LEU D 2 8   ? 7.403   72.999  71.258 1.00 30.41 ? 1503 LEU D CG    1 
ATOM   5467 C  CD1   . LEU D 2 8   ? 5.948   73.205  71.690 1.00 26.25 ? 1503 LEU D CD1   1 
ATOM   5468 C  CD2   . LEU D 2 8   ? 7.755   73.930  70.103 1.00 29.91 ? 1503 LEU D CD2   1 
ATOM   5469 N  N     . LEU D 2 9   ? 9.843   70.668  73.161 1.00 30.15 ? 1504 LEU D N     1 
ATOM   5470 C  CA    . LEU D 2 9   ? 10.317  69.336  72.832 1.00 30.17 ? 1504 LEU D CA    1 
ATOM   5471 C  C     . LEU D 2 9   ? 9.857   68.302  73.843 1.00 31.96 ? 1504 LEU D C     1 
ATOM   5472 O  O     . LEU D 2 9   ? 9.383   67.229  73.470 1.00 31.56 ? 1504 LEU D O     1 
ATOM   5473 C  CB    . LEU D 2 9   ? 11.845  69.328  72.743 1.00 31.43 ? 1504 LEU D CB    1 
ATOM   5474 C  CG    . LEU D 2 9   ? 12.437  69.781  71.400 1.00 32.71 ? 1504 LEU D CG    1 
ATOM   5475 C  CD1   . LEU D 2 9   ? 13.919  70.099  71.555 1.00 29.65 ? 1504 LEU D CD1   1 
ATOM   5476 C  CD2   . LEU D 2 9   ? 12.215  68.684  70.365 1.00 30.17 ? 1504 LEU D CD2   1 
ATOM   5477 N  N     . ASN D 2 10  ? 9.991   68.614  75.129 1.00 33.89 ? 1505 ASN D N     1 
ATOM   5478 C  CA    . ASN D 2 10  ? 9.581   67.656  76.149 1.00 33.65 ? 1505 ASN D CA    1 
ATOM   5479 C  C     . ASN D 2 10  ? 8.072   67.418  76.138 1.00 32.60 ? 1505 ASN D C     1 
ATOM   5480 O  O     . ASN D 2 10  ? 7.626   66.285  76.300 1.00 34.41 ? 1505 ASN D O     1 
ATOM   5481 C  CB    . ASN D 2 10  ? 10.068  68.096  77.541 1.00 34.37 ? 1505 ASN D CB    1 
ATOM   5482 C  CG    . ASN D 2 10  ? 11.590  67.986  77.687 1.00 36.75 ? 1505 ASN D CG    1 
ATOM   5483 O  OD1   . ASN D 2 10  ? 12.195  66.984  77.289 1.00 35.99 ? 1505 ASN D OD1   1 
ATOM   5484 N  ND2   . ASN D 2 10  ? 12.208  69.012  78.262 1.00 34.47 ? 1505 ASN D ND2   1 
ATOM   5485 N  N     . ARG D 2 11  ? 7.284   68.465  75.932 1.00 30.67 ? 1506 ARG D N     1 
ATOM   5486 C  CA    . ARG D 2 11  ? 5.835   68.283  75.888 1.00 32.96 ? 1506 ARG D CA    1 
ATOM   5487 C  C     . ARG D 2 11  ? 5.417   67.456  74.666 1.00 32.56 ? 1506 ARG D C     1 
ATOM   5488 O  O     . ARG D 2 11  ? 4.771   66.413  74.793 1.00 34.36 ? 1506 ARG D O     1 
ATOM   5489 C  CB    . ARG D 2 11  ? 5.094   69.630  75.834 1.00 34.39 ? 1506 ARG D CB    1 
ATOM   5490 C  CG    . ARG D 2 11  ? 4.974   70.371  77.167 1.00 41.52 ? 1506 ARG D CG    1 
ATOM   5491 C  CD    . ARG D 2 11  ? 3.775   71.337  77.166 1.00 41.57 ? 1506 ARG D CD    1 
ATOM   5492 N  NE    . ARG D 2 11  ? 3.893   72.392  76.161 1.00 45.15 ? 1506 ARG D NE    1 
ATOM   5493 C  CZ    . ARG D 2 11  ? 4.672   73.463  76.285 1.00 46.67 ? 1506 ARG D CZ    1 
ATOM   5494 N  NH1   . ARG D 2 11  ? 5.403   73.628  77.380 1.00 48.16 ? 1506 ARG D NH1   1 
ATOM   5495 N  NH2   . ARG D 2 11  ? 4.729   74.364  75.310 1.00 45.72 ? 1506 ARG D NH2   1 
ATOM   5496 N  N     . VAL D 2 12  ? 5.793   67.922  73.482 1.00 29.73 ? 1507 VAL D N     1 
ATOM   5497 C  CA    . VAL D 2 12  ? 5.413   67.234  72.257 1.00 29.56 ? 1507 VAL D CA    1 
ATOM   5498 C  C     . VAL D 2 12  ? 5.881   65.791  72.154 1.00 27.23 ? 1507 VAL D C     1 
ATOM   5499 O  O     . VAL D 2 12  ? 5.091   64.910  71.828 1.00 27.69 ? 1507 VAL D O     1 
ATOM   5500 C  CB    . VAL D 2 12  ? 5.893   68.008  71.014 1.00 28.59 ? 1507 VAL D CB    1 
ATOM   5501 C  CG1   . VAL D 2 12  ? 5.461   67.283  69.749 1.00 31.12 ? 1507 VAL D CG1   1 
ATOM   5502 C  CG2   . VAL D 2 12  ? 5.310   69.405  71.034 1.00 28.18 ? 1507 VAL D CG2   1 
ATOM   5503 N  N     . GLN D 2 13  ? 7.148   65.538  72.456 1.00 26.63 ? 1508 GLN D N     1 
ATOM   5504 C  CA    . GLN D 2 13  ? 7.679   64.185  72.356 1.00 28.62 ? 1508 GLN D CA    1 
ATOM   5505 C  C     . GLN D 2 13  ? 7.169   63.182  73.389 1.00 31.34 ? 1508 GLN D C     1 
ATOM   5506 O  O     . GLN D 2 13  ? 7.320   61.974  73.196 1.00 29.92 ? 1508 GLN D O     1 
ATOM   5507 C  CB    . GLN D 2 13  ? 9.216   64.214  72.382 1.00 28.53 ? 1508 GLN D CB    1 
ATOM   5508 C  CG    . GLN D 2 13  ? 9.819   65.087  71.283 1.00 27.27 ? 1508 GLN D CG    1 
ATOM   5509 C  CD    . GLN D 2 13  ? 10.996  64.441  70.572 1.00 29.57 ? 1508 GLN D CD    1 
ATOM   5510 O  OE1   . GLN D 2 13  ? 11.447  64.930  69.532 1.00 30.10 ? 1508 GLN D OE1   1 
ATOM   5511 N  NE2   . GLN D 2 13  ? 11.504  63.344  71.129 1.00 29.71 ? 1508 GLN D NE2   1 
ATOM   5512 N  N     . SER D 2 14  ? 6.561   63.651  74.478 1.00 34.75 ? 1509 SER D N     1 
ATOM   5513 C  CA    . SER D 2 14  ? 6.077   62.706  75.485 1.00 39.04 ? 1509 SER D CA    1 
ATOM   5514 C  C     . SER D 2 14  ? 4.591   62.375  75.369 1.00 42.08 ? 1509 SER D C     1 
ATOM   5515 O  O     . SER D 2 14  ? 4.068   61.577  76.144 1.00 43.43 ? 1509 SER D O     1 
ATOM   5516 C  CB    . SER D 2 14  ? 6.381   63.224  76.893 1.00 39.77 ? 1509 SER D CB    1 
ATOM   5517 O  OG    . SER D 2 14  ? 5.702   64.439  77.139 1.00 41.37 ? 1509 SER D OG    1 
ATOM   5518 N  N     . SER D 2 15  ? 3.911   62.978  74.401 1.00 46.01 ? 1510 SER D N     1 
ATOM   5519 C  CA    . SER D 2 15  ? 2.487   62.720  74.210 1.00 50.23 ? 1510 SER D CA    1 
ATOM   5520 C  C     . SER D 2 15  ? 2.272   61.322  73.636 1.00 52.53 ? 1510 SER D C     1 
ATOM   5521 O  O     . SER D 2 15  ? 3.222   60.557  73.466 1.00 53.13 ? 1510 SER D O     1 
ATOM   5522 C  CB    . SER D 2 15  ? 1.875   63.763  73.266 1.00 49.40 ? 1510 SER D CB    1 
ATOM   5523 O  OG    . SER D 2 15  ? 2.379   63.631  71.945 1.00 50.18 ? 1510 SER D OG    1 
ATOM   5524 N  N     . GLY D 2 16  ? 1.019   60.986  73.352 1.00 55.52 ? 1511 GLY D N     1 
ATOM   5525 C  CA    . GLY D 2 16  ? 0.725   59.682  72.784 1.00 60.33 ? 1511 GLY D CA    1 
ATOM   5526 C  C     . GLY D 2 16  ? 0.036   58.717  73.728 1.00 63.10 ? 1511 GLY D C     1 
ATOM   5527 O  O     . GLY D 2 16  ? -0.178  59.020  74.903 1.00 64.58 ? 1511 GLY D O     1 
ATOM   5528 N  N     . ALA D 2 17  ? -0.313  57.545  73.205 1.00 64.98 ? 1512 ALA D N     1 
ATOM   5529 C  CA    . ALA D 2 17  ? -0.983  56.516  73.992 1.00 66.23 ? 1512 ALA D CA    1 
ATOM   5530 C  C     . ALA D 2 17  ? -0.284  56.304  75.332 1.00 66.39 ? 1512 ALA D C     1 
ATOM   5531 O  O     . ALA D 2 17  ? 0.898   55.963  75.378 1.00 66.51 ? 1512 ALA D O     1 
ATOM   5532 C  CB    . ALA D 2 17  ? -1.021  55.208  73.207 1.00 65.70 ? 1512 ALA D CB    1 
ATOM   5533 N  N     . HIS D 2 18  ? -1.019  56.509  76.420 1.00 67.08 ? 1513 HIS D N     1 
ATOM   5534 C  CA    . HIS D 2 18  ? -0.461  56.340  77.757 1.00 67.65 ? 1513 HIS D CA    1 
ATOM   5535 C  C     . HIS D 2 18  ? -0.864  55.000  78.374 1.00 66.90 ? 1513 HIS D C     1 
ATOM   5536 O  O     . HIS D 2 18  ? -1.997  54.536  78.197 1.00 67.18 ? 1513 HIS D O     1 
ATOM   5537 C  CB    . HIS D 2 18  ? -0.909  57.491  78.662 1.00 69.69 ? 1513 HIS D CB    1 
ATOM   5538 C  CG    . HIS D 2 18  ? -0.476  58.843  78.181 1.00 72.65 ? 1513 HIS D CG    1 
ATOM   5539 N  ND1   . HIS D 2 18  ? 0.849   59.181  77.999 1.00 73.62 ? 1513 HIS D ND1   1 
ATOM   5540 C  CD2   . HIS D 2 18  ? -1.193  59.942  77.844 1.00 73.39 ? 1513 HIS D CD2   1 
ATOM   5541 C  CE1   . HIS D 2 18  ? 0.929   60.428  77.571 1.00 73.27 ? 1513 HIS D CE1   1 
ATOM   5542 N  NE2   . HIS D 2 18  ? -0.295  60.913  77.469 1.00 74.21 ? 1513 HIS D NE2   1 
ATOM   5543 N  N     . ASP D 2 19  ? 0.078   54.390  79.094 1.00 64.43 ? 1514 ASP D N     1 
ATOM   5544 C  CA    . ASP D 2 19  ? -0.128  53.098  79.751 1.00 61.05 ? 1514 ASP D CA    1 
ATOM   5545 C  C     . ASP D 2 19  ? -0.166  51.955  78.744 1.00 56.70 ? 1514 ASP D C     1 
ATOM   5546 O  O     . ASP D 2 19  ? -0.669  50.871  79.041 1.00 54.73 ? 1514 ASP D O     1 
ATOM   5547 C  CB    . ASP D 2 19  ? -1.430  53.105  80.562 1.00 64.52 ? 1514 ASP D CB    1 
ATOM   5548 C  CG    . ASP D 2 19  ? -1.362  54.017  81.767 1.00 68.34 ? 1514 ASP D CG    1 
ATOM   5549 O  OD1   . ASP D 2 19  ? -0.512  53.775  82.653 1.00 70.07 ? 1514 ASP D OD1   1 
ATOM   5550 O  OD2   . ASP D 2 19  ? -2.161  54.978  81.833 1.00 71.39 ? 1514 ASP D OD2   1 
ATOM   5551 N  N     . GLN D 2 20  ? 0.372   52.201  77.554 1.00 51.27 ? 1515 GLN D N     1 
ATOM   5552 C  CA    . GLN D 2 20  ? 0.385   51.193  76.503 1.00 46.80 ? 1515 GLN D CA    1 
ATOM   5553 C  C     . GLN D 2 20  ? 1.796   50.952  75.990 1.00 45.79 ? 1515 GLN D C     1 
ATOM   5554 O  O     . GLN D 2 20  ? 2.017   50.806  74.787 1.00 42.69 ? 1515 GLN D O     1 
ATOM   5555 C  CB    . GLN D 2 20  ? -0.511  51.631  75.348 1.00 42.31 ? 1515 GLN D CB    1 
ATOM   5556 C  CG    . GLN D 2 20  ? -1.957  51.828  75.742 1.00 38.57 ? 1515 GLN D CG    1 
ATOM   5557 C  CD    . GLN D 2 20  ? -2.762  52.490  74.646 1.00 36.46 ? 1515 GLN D CD    1 
ATOM   5558 O  OE1   . GLN D 2 20  ? -2.884  51.961  73.542 1.00 33.28 ? 1515 GLN D OE1   1 
ATOM   5559 N  NE2   . GLN D 2 20  ? -3.320  53.654  74.947 1.00 33.99 ? 1515 GLN D NE2   1 
ATOM   5560 N  N     . ARG D 2 21  ? 2.748   50.901  76.912 1.00 44.76 ? 1516 ARG D N     1 
ATOM   5561 C  CA    . ARG D 2 21  ? 4.136   50.685  76.543 1.00 45.58 ? 1516 ARG D CA    1 
ATOM   5562 C  C     . ARG D 2 21  ? 4.867   49.936  77.655 1.00 45.26 ? 1516 ARG D C     1 
ATOM   5563 O  O     . ARG D 2 21  ? 4.553   50.094  78.837 1.00 44.34 ? 1516 ARG D O     1 
ATOM   5564 C  CB    . ARG D 2 21  ? 4.805   52.039  76.268 1.00 45.75 ? 1516 ARG D CB    1 
ATOM   5565 C  CG    . ARG D 2 21  ? 6.083   51.966  75.451 1.00 47.77 ? 1516 ARG D CG    1 
ATOM   5566 C  CD    . ARG D 2 21  ? 6.659   53.360  75.170 1.00 47.79 ? 1516 ARG D CD    1 
ATOM   5567 N  NE    . ARG D 2 21  ? 5.984   54.078  74.089 1.00 44.36 ? 1516 ARG D NE    1 
ATOM   5568 C  CZ    . ARG D 2 21  ? 6.158   53.827  72.794 1.00 44.53 ? 1516 ARG D CZ    1 
ATOM   5569 N  NH1   . ARG D 2 21  ? 6.989   52.868  72.404 1.00 44.32 ? 1516 ARG D NH1   1 
ATOM   5570 N  NH2   . ARG D 2 21  ? 5.514   54.547  71.885 1.00 43.71 ? 1516 ARG D NH2   1 
ATOM   5571 N  N     . GLY D 2 22  ? 5.832   49.110  77.267 1.00 44.74 ? 1517 GLY D N     1 
ATOM   5572 C  CA    . GLY D 2 22  ? 6.595   48.350  78.239 1.00 44.21 ? 1517 GLY D CA    1 
ATOM   5573 C  C     . GLY D 2 22  ? 5.818   47.202  78.855 1.00 44.69 ? 1517 GLY D C     1 
ATOM   5574 O  O     . GLY D 2 22  ? 4.744   46.826  78.379 1.00 43.03 ? 1517 GLY D O     1 
ATOM   5575 N  N     . LEU D 2 23  ? 6.366   46.646  79.928 1.00 44.33 ? 1518 LEU D N     1 
ATOM   5576 C  CA    . LEU D 2 23  ? 5.731   45.534  80.615 1.00 46.34 ? 1518 LEU D CA    1 
ATOM   5577 C  C     . LEU D 2 23  ? 4.505   45.972  81.405 1.00 47.32 ? 1518 LEU D C     1 
ATOM   5578 O  O     . LEU D 2 23  ? 4.339   47.146  81.727 1.00 48.36 ? 1518 LEU D O     1 
ATOM   5579 C  CB    . LEU D 2 23  ? 6.737   44.854  81.544 1.00 45.70 ? 1518 LEU D CB    1 
ATOM   5580 C  CG    . LEU D 2 23  ? 7.921   44.199  80.826 1.00 44.74 ? 1518 LEU D CG    1 
ATOM   5581 C  CD1   . LEU D 2 23  ? 8.857   43.578  81.850 1.00 45.01 ? 1518 LEU D CD1   1 
ATOM   5582 C  CD2   . LEU D 2 23  ? 7.411   43.150  79.849 1.00 42.34 ? 1518 LEU D CD2   1 
ATOM   5583 N  N     . LEU D 2 24  ? 3.640   45.014  81.707 1.00 49.35 ? 1519 LEU D N     1 
ATOM   5584 C  CA    . LEU D 2 24  ? 2.426   45.291  82.453 1.00 51.94 ? 1519 LEU D CA    1 
ATOM   5585 C  C     . LEU D 2 24  ? 2.771   45.762  83.868 1.00 54.76 ? 1519 LEU D C     1 
ATOM   5586 O  O     . LEU D 2 24  ? 3.666   45.214  84.513 1.00 54.96 ? 1519 LEU D O     1 
ATOM   5587 C  CB    . LEU D 2 24  ? 1.576   44.026  82.509 1.00 50.96 ? 1519 LEU D CB    1 
ATOM   5588 C  CG    . LEU D 2 24  ? 0.071   44.158  82.271 1.00 52.23 ? 1519 LEU D CG    1 
ATOM   5589 C  CD1   . LEU D 2 24  ? -0.204  44.978  81.015 1.00 48.73 ? 1519 LEU D CD1   1 
ATOM   5590 C  CD2   . LEU D 2 24  ? -0.522  42.757  82.149 1.00 50.61 ? 1519 LEU D CD2   1 
ATOM   5591 N  N     . ARG D 2 25  ? 2.067   46.785  84.342 1.00 57.92 ? 1520 ARG D N     1 
ATOM   5592 C  CA    . ARG D 2 25  ? 2.300   47.316  85.681 1.00 61.72 ? 1520 ARG D CA    1 
ATOM   5593 C  C     . ARG D 2 25  ? 0.970   47.517  86.397 1.00 62.97 ? 1520 ARG D C     1 
ATOM   5594 O  O     . ARG D 2 25  ? -0.016  47.927  85.786 1.00 62.35 ? 1520 ARG D O     1 
ATOM   5595 C  CB    . ARG D 2 25  ? 3.063   48.642  85.605 1.00 63.95 ? 1520 ARG D CB    1 
ATOM   5596 C  CG    . ARG D 2 25  ? 2.380   49.699  84.757 1.00 68.15 ? 1520 ARG D CG    1 
ATOM   5597 C  CD    . ARG D 2 25  ? 3.227   50.953  84.636 1.00 72.30 ? 1520 ARG D CD    1 
ATOM   5598 N  NE    . ARG D 2 25  ? 2.594   51.952  83.776 1.00 75.86 ? 1520 ARG D NE    1 
ATOM   5599 C  CZ    . ARG D 2 25  ? 3.085   53.168  83.552 1.00 77.31 ? 1520 ARG D CZ    1 
ATOM   5600 N  NH1   . ARG D 2 25  ? 4.221   53.543  84.127 1.00 78.13 ? 1520 ARG D NH1   1 
ATOM   5601 N  NH2   . ARG D 2 25  ? 2.441   54.009  82.752 1.00 77.65 ? 1520 ARG D NH2   1 
ATOM   5602 N  N     . LYS D 2 26  ? 0.951   47.218  87.693 1.00 65.33 ? 1521 LYS D N     1 
ATOM   5603 C  CA    . LYS D 2 26  ? -0.252  47.345  88.511 1.00 67.36 ? 1521 LYS D CA    1 
ATOM   5604 C  C     . LYS D 2 26  ? -1.077  48.570  88.144 1.00 67.90 ? 1521 LYS D C     1 
ATOM   5605 O  O     . LYS D 2 26  ? -2.308  48.530  88.149 1.00 68.05 ? 1521 LYS D O     1 
ATOM   5606 C  CB    . LYS D 2 26  ? 0.125   47.415  89.993 1.00 69.18 ? 1521 LYS D CB    1 
ATOM   5607 C  CG    . LYS D 2 26  ? 0.806   46.164  90.522 1.00 71.88 ? 1521 LYS D CG    1 
ATOM   5608 C  CD    . LYS D 2 26  ? 1.065   46.275  92.019 1.00 73.85 ? 1521 LYS D CD    1 
ATOM   5609 C  CE    . LYS D 2 26  ? 1.696   45.004  92.570 1.00 75.24 ? 1521 LYS D CE    1 
ATOM   5610 N  NZ    . LYS D 2 26  ? 1.922   45.085  94.043 1.00 75.66 ? 1521 LYS D NZ    1 
ATOM   5611 N  N     . GLU D 2 27  ? -0.385  49.655  87.819 1.00 68.67 ? 1522 GLU D N     1 
ATOM   5612 C  CA    . GLU D 2 27  ? -1.028  50.909  87.455 1.00 69.24 ? 1522 GLU D CA    1 
ATOM   5613 C  C     . GLU D 2 27  ? -1.980  50.780  86.263 1.00 68.64 ? 1522 GLU D C     1 
ATOM   5614 O  O     . GLU D 2 27  ? -2.997  51.471  86.202 1.00 68.89 ? 1522 GLU D O     1 
ATOM   5615 C  CB    . GLU D 2 27  ? 0.045   51.958  87.164 1.00 71.02 ? 1522 GLU D CB    1 
ATOM   5616 C  CG    . GLU D 2 27  ? 1.120   52.013  88.241 1.00 74.40 ? 1522 GLU D CG    1 
ATOM   5617 C  CD    . GLU D 2 27  ? 2.185   53.057  87.965 1.00 77.15 ? 1522 GLU D CD    1 
ATOM   5618 O  OE1   . GLU D 2 27  ? 2.810   53.001  86.882 1.00 78.10 ? 1522 GLU D OE1   1 
ATOM   5619 O  OE2   . GLU D 2 27  ? 2.399   53.929  88.836 1.00 77.99 ? 1522 GLU D OE2   1 
ATOM   5620 N  N     . ASP D 2 28  ? -1.659  49.895  85.322 1.00 67.28 ? 1523 ASP D N     1 
ATOM   5621 C  CA    . ASP D 2 28  ? -2.506  49.702  84.145 1.00 65.53 ? 1523 ASP D CA    1 
ATOM   5622 C  C     . ASP D 2 28  ? -3.670  48.761  84.427 1.00 63.53 ? 1523 ASP D C     1 
ATOM   5623 O  O     . ASP D 2 28  ? -4.615  48.689  83.643 1.00 62.57 ? 1523 ASP D O     1 
ATOM   5624 C  CB    . ASP D 2 28  ? -1.709  49.108  82.975 1.00 66.40 ? 1523 ASP D CB    1 
ATOM   5625 C  CG    . ASP D 2 28  ? -0.412  49.839  82.705 1.00 67.65 ? 1523 ASP D CG    1 
ATOM   5626 O  OD1   . ASP D 2 28  ? -0.394  51.087  82.782 1.00 67.64 ? 1523 ASP D OD1   1 
ATOM   5627 O  OD2   . ASP D 2 28  ? 0.591   49.154  82.396 1.00 67.31 ? 1523 ASP D OD2   1 
ATOM   5628 N  N     . LEU D 2 29  ? -3.606  48.046  85.547 1.00 61.93 ? 1524 LEU D N     1 
ATOM   5629 C  CA    . LEU D 2 29  ? -4.641  47.073  85.875 1.00 60.29 ? 1524 LEU D CA    1 
ATOM   5630 C  C     . LEU D 2 29  ? -5.758  47.500  86.822 1.00 59.67 ? 1524 LEU D C     1 
ATOM   5631 O  O     . LEU D 2 29  ? -6.602  46.681  87.187 1.00 59.83 ? 1524 LEU D O     1 
ATOM   5632 C  CB    . LEU D 2 29  ? -3.983  45.799  86.403 1.00 59.84 ? 1524 LEU D CB    1 
ATOM   5633 C  CG    . LEU D 2 29  ? -2.906  45.225  85.477 1.00 60.11 ? 1524 LEU D CG    1 
ATOM   5634 C  CD1   . LEU D 2 29  ? -2.297  43.989  86.106 1.00 60.27 ? 1524 LEU D CD1   1 
ATOM   5635 C  CD2   . LEU D 2 29  ? -3.509  44.896  84.120 1.00 59.70 ? 1524 LEU D CD2   1 
ATOM   5636 N  N     . VAL D 2 30  ? -5.779  48.764  87.225 1.00 58.54 ? 1525 VAL D N     1 
ATOM   5637 C  CA    . VAL D 2 30  ? -6.840  49.224  88.112 1.00 58.03 ? 1525 VAL D CA    1 
ATOM   5638 C  C     . VAL D 2 30  ? -8.170  49.192  87.351 1.00 57.81 ? 1525 VAL D C     1 
ATOM   5639 O  O     . VAL D 2 30  ? -8.329  49.861  86.330 1.00 57.49 ? 1525 VAL D O     1 
ATOM   5640 C  CB    . VAL D 2 30  ? -6.567  50.658  88.618 1.00 58.54 ? 1525 VAL D CB    1 
ATOM   5641 C  CG1   . VAL D 2 30  ? -7.706  51.119  89.517 1.00 59.02 ? 1525 VAL D CG1   1 
ATOM   5642 C  CG2   . VAL D 2 30  ? -5.252  50.697  89.378 1.00 57.18 ? 1525 VAL D CG2   1 
ATOM   5643 N  N     . LEU D 2 31  ? -9.117  48.401  87.850 1.00 57.33 ? 1526 LEU D N     1 
ATOM   5644 C  CA    . LEU D 2 31  ? -10.432 48.258  87.223 1.00 57.29 ? 1526 LEU D CA    1 
ATOM   5645 C  C     . LEU D 2 31  ? -11.144 49.590  86.988 1.00 57.90 ? 1526 LEU D C     1 
ATOM   5646 O  O     . LEU D 2 31  ? -11.136 50.464  87.852 1.00 57.42 ? 1526 LEU D O     1 
ATOM   5647 C  CB    . LEU D 2 31  ? -11.322 47.365  88.090 1.00 56.58 ? 1526 LEU D CB    1 
ATOM   5648 C  CG    . LEU D 2 31  ? -12.736 47.067  87.585 1.00 56.62 ? 1526 LEU D CG    1 
ATOM   5649 C  CD1   . LEU D 2 31  ? -12.670 46.045  86.459 1.00 56.06 ? 1526 LEU D CD1   1 
ATOM   5650 C  CD2   . LEU D 2 31  ? -13.589 46.530  88.727 1.00 56.04 ? 1526 LEU D CD2   1 
ATOM   5651 N  N     . PRO D 2 32  ? -11.767 49.762  85.808 1.00 58.62 ? 1527 PRO D N     1 
ATOM   5652 C  CA    . PRO D 2 32  ? -12.486 50.999  85.483 1.00 59.60 ? 1527 PRO D CA    1 
ATOM   5653 C  C     . PRO D 2 32  ? -13.830 51.024  86.209 1.00 61.14 ? 1527 PRO D C     1 
ATOM   5654 O  O     . PRO D 2 32  ? -14.507 50.000  86.308 1.00 61.66 ? 1527 PRO D O     1 
ATOM   5655 C  CB    . PRO D 2 32  ? -12.641 50.916  83.968 1.00 58.90 ? 1527 PRO D CB    1 
ATOM   5656 C  CG    . PRO D 2 32  ? -12.801 49.457  83.741 1.00 58.87 ? 1527 PRO D CG    1 
ATOM   5657 C  CD    . PRO D 2 32  ? -11.742 48.857  84.645 1.00 58.82 ? 1527 PRO D CD    1 
ATOM   5658 N  N     . GLU D 2 33  ? -14.216 52.195  86.703 1.00 61.96 ? 1528 GLU D N     1 
ATOM   5659 C  CA    . GLU D 2 33  ? -15.464 52.340  87.446 1.00 62.72 ? 1528 GLU D CA    1 
ATOM   5660 C  C     . GLU D 2 33  ? -16.719 51.706  86.849 1.00 62.32 ? 1528 GLU D C     1 
ATOM   5661 O  O     . GLU D 2 33  ? -17.487 51.072  87.570 1.00 62.74 ? 1528 GLU D O     1 
ATOM   5662 C  CB    . GLU D 2 33  ? -15.731 53.819  87.734 1.00 63.35 ? 1528 GLU D CB    1 
ATOM   5663 C  CG    . GLU D 2 33  ? -14.773 54.423  88.750 1.00 65.12 ? 1528 GLU D CG    1 
ATOM   5664 C  CD    . GLU D 2 33  ? -15.162 55.835  89.155 1.00 67.23 ? 1528 GLU D CD    1 
ATOM   5665 O  OE1   . GLU D 2 33  ? -16.284 56.018  89.675 1.00 67.95 ? 1528 GLU D OE1   1 
ATOM   5666 O  OE2   . GLU D 2 33  ? -14.346 56.760  88.953 1.00 67.91 ? 1528 GLU D OE2   1 
ATOM   5667 N  N     . PHE D 2 34  ? -16.933 51.858  85.547 1.00 62.02 ? 1529 PHE D N     1 
ATOM   5668 C  CA    . PHE D 2 34  ? -18.131 51.304  84.920 1.00 62.28 ? 1529 PHE D CA    1 
ATOM   5669 C  C     . PHE D 2 34  ? -18.232 49.778  84.983 1.00 63.05 ? 1529 PHE D C     1 
ATOM   5670 O  O     . PHE D 2 34  ? -19.206 49.197  84.502 1.00 62.64 ? 1529 PHE D O     1 
ATOM   5671 C  CB    . PHE D 2 34  ? -18.236 51.781  83.465 1.00 61.98 ? 1529 PHE D CB    1 
ATOM   5672 C  CG    . PHE D 2 34  ? -17.448 50.954  82.486 1.00 62.28 ? 1529 PHE D CG    1 
ATOM   5673 C  CD1   . PHE D 2 34  ? -18.066 49.934  81.765 1.00 61.30 ? 1529 PHE D CD1   1 
ATOM   5674 C  CD2   . PHE D 2 34  ? -16.096 51.205  82.270 1.00 61.64 ? 1529 PHE D CD2   1 
ATOM   5675 C  CE1   . PHE D 2 34  ? -17.350 49.180  80.839 1.00 62.47 ? 1529 PHE D CE1   1 
ATOM   5676 C  CE2   . PHE D 2 34  ? -15.368 50.457  81.346 1.00 61.84 ? 1529 PHE D CE2   1 
ATOM   5677 C  CZ    . PHE D 2 34  ? -15.995 49.443  80.629 1.00 62.04 ? 1529 PHE D CZ    1 
ATOM   5678 N  N     . LEU D 2 35  ? -17.232 49.131  85.574 1.00 64.00 ? 1530 LEU D N     1 
ATOM   5679 C  CA    . LEU D 2 35  ? -17.234 47.675  85.707 1.00 65.19 ? 1530 LEU D CA    1 
ATOM   5680 C  C     . LEU D 2 35  ? -17.217 47.268  87.181 1.00 67.68 ? 1530 LEU D C     1 
ATOM   5681 O  O     . LEU D 2 35  ? -17.190 46.081  87.500 1.00 67.90 ? 1530 LEU D O     1 
ATOM   5682 C  CB    . LEU D 2 35  ? -16.016 47.064  85.001 1.00 62.88 ? 1530 LEU D CB    1 
ATOM   5683 C  CG    . LEU D 2 35  ? -15.910 47.184  83.478 1.00 60.78 ? 1530 LEU D CG    1 
ATOM   5684 C  CD1   . LEU D 2 35  ? -14.569 46.640  83.014 1.00 59.32 ? 1530 LEU D CD1   1 
ATOM   5685 C  CD2   . LEU D 2 35  ? -17.049 46.424  82.823 1.00 59.82 ? 1530 LEU D CD2   1 
ATOM   5686 N  N     . GLN D 2 36  ? -17.233 48.264  88.067 1.00 70.73 ? 1531 GLN D N     1 
ATOM   5687 C  CA    . GLN D 2 36  ? -17.208 48.050  89.515 1.00 73.61 ? 1531 GLN D CA    1 
ATOM   5688 C  C     . GLN D 2 36  ? -17.794 46.704  89.937 1.00 74.96 ? 1531 GLN D C     1 
ATOM   5689 O  O     . GLN D 2 36  ? -17.078 45.941  90.624 1.00 75.77 ? 1531 GLN D O     1 
ATOM   5690 C  CB    . GLN D 2 36  ? -17.970 49.169  90.231 1.00 75.35 ? 1531 GLN D CB    1 
ATOM   5691 C  CG    . GLN D 2 36  ? -19.476 49.161  89.975 1.00 78.20 ? 1531 GLN D CG    1 
ATOM   5692 C  CD    . GLN D 2 36  ? -20.243 50.049  90.943 1.00 80.16 ? 1531 GLN D CD    1 
ATOM   5693 O  OE1   . GLN D 2 36  ? -20.089 51.271  90.941 1.00 81.15 ? 1531 GLN D OE1   1 
ATOM   5694 N  NE2   . GLN D 2 36  ? -21.072 49.432  91.784 1.00 80.47 ? 1531 GLN D NE2   1 
ATOM   5695 O  OXT   . GLN D 2 36  ? -18.964 46.433  89.582 1.00 75.31 ? 1531 GLN D OXT   1 
HETATM 5696 MG MG    . MG  E 3 .   ? 18.509  9.985   24.077 1.00 51.22 ? 800  MG  A MG    1 
HETATM 5697 P  PB    . GDP F 4 .   ? 18.898  9.475   20.581 1.00 31.28 ? 355  GDP A PB    1 
HETATM 5698 O  O1B   . GDP F 4 .   ? 19.094  10.895  20.816 1.00 36.53 ? 355  GDP A O1B   1 
HETATM 5699 O  O2B   . GDP F 4 .   ? 18.992  8.605   21.752 1.00 33.75 ? 355  GDP A O2B   1 
HETATM 5700 O  O3B   . GDP F 4 .   ? 17.573  9.309   19.800 1.00 33.89 ? 355  GDP A O3B   1 
HETATM 5701 O  O3A   . GDP F 4 .   ? 20.043  9.112   19.508 1.00 36.62 ? 355  GDP A O3A   1 
HETATM 5702 P  PA    . GDP F 4 .   ? 21.279  8.099   19.465 1.00 32.75 ? 355  GDP A PA    1 
HETATM 5703 O  O1A   . GDP F 4 .   ? 22.199  8.433   20.585 1.00 34.67 ? 355  GDP A O1A   1 
HETATM 5704 O  O2A   . GDP F 4 .   ? 21.774  8.108   18.120 1.00 38.20 ? 355  GDP A O2A   1 
HETATM 5705 O  "O5'" . GDP F 4 .   ? 20.620  6.653   19.833 1.00 40.68 ? 355  GDP A "O5'" 1 
HETATM 5706 C  "C5'" . GDP F 4 .   ? 20.520  5.613   18.849 1.00 31.32 ? 355  GDP A "C5'" 1 
HETATM 5707 C  "C4'" . GDP F 4 .   ? 21.616  4.508   18.876 1.00 29.49 ? 355  GDP A "C4'" 1 
HETATM 5708 O  "O4'" . GDP F 4 .   ? 21.415  3.877   17.621 1.00 27.03 ? 355  GDP A "O4'" 1 
HETATM 5709 C  "C3'" . GDP F 4 .   ? 23.069  4.960   18.832 1.00 29.61 ? 355  GDP A "C3'" 1 
HETATM 5710 O  "O3'" . GDP F 4 .   ? 23.861  4.023   19.557 1.00 26.13 ? 355  GDP A "O3'" 1 
HETATM 5711 C  "C2'" . GDP F 4 .   ? 23.500  4.964   17.361 1.00 27.30 ? 355  GDP A "C2'" 1 
HETATM 5712 O  "O2'" . GDP F 4 .   ? 24.862  4.605   17.068 1.00 26.68 ? 355  GDP A "O2'" 1 
HETATM 5713 C  "C1'" . GDP F 4 .   ? 22.541  3.978   16.759 1.00 25.02 ? 355  GDP A "C1'" 1 
HETATM 5714 N  N9    . GDP F 4 .   ? 21.968  4.439   15.498 1.00 25.69 ? 355  GDP A N9    1 
HETATM 5715 C  C8    . GDP F 4 .   ? 21.349  5.621   15.179 1.00 24.38 ? 355  GDP A C8    1 
HETATM 5716 N  N7    . GDP F 4 .   ? 20.923  5.724   13.967 1.00 24.67 ? 355  GDP A N7    1 
HETATM 5717 C  C5    . GDP F 4 .   ? 21.289  4.497   13.421 1.00 24.77 ? 355  GDP A C5    1 
HETATM 5718 C  C6    . GDP F 4 .   ? 21.087  3.972   12.094 1.00 23.82 ? 355  GDP A C6    1 
HETATM 5719 O  O6    . GDP F 4 .   ? 20.530  4.515   11.147 1.00 23.99 ? 355  GDP A O6    1 
HETATM 5720 N  N1    . GDP F 4 .   ? 21.621  2.670   11.952 1.00 20.95 ? 355  GDP A N1    1 
HETATM 5721 C  C2    . GDP F 4 .   ? 22.272  1.946   12.953 1.00 24.22 ? 355  GDP A C2    1 
HETATM 5722 N  N2    . GDP F 4 .   ? 22.722  0.725   12.638 1.00 22.37 ? 355  GDP A N2    1 
HETATM 5723 N  N3    . GDP F 4 .   ? 22.455  2.433   14.197 1.00 24.23 ? 355  GDP A N3    1 
HETATM 5724 C  C4    . GDP F 4 .   ? 21.941  3.703   14.355 1.00 25.06 ? 355  GDP A C4    1 
HETATM 5725 MG MG    . MG  G 3 .   ? 10.969  57.509  70.443 1.00 35.33 ? 801  MG  C MG    1 
HETATM 5726 P  PB    . GDP H 4 .   ? 7.658   56.985  68.802 1.00 35.39 ? 356  GDP C PB    1 
HETATM 5727 O  O1B   . GDP H 4 .   ? 8.955   57.117  69.430 1.00 38.00 ? 356  GDP C O1B   1 
HETATM 5728 O  O2B   . GDP H 4 .   ? 6.518   56.849  69.698 1.00 34.26 ? 356  GDP C O2B   1 
HETATM 5729 O  O3B   . GDP H 4 .   ? 7.507   58.156  67.800 1.00 34.43 ? 356  GDP C O3B   1 
HETATM 5730 O  O3A   . GDP H 4 .   ? 7.744   55.690  67.856 1.00 37.29 ? 356  GDP C O3A   1 
HETATM 5731 P  PA    . GDP H 4 .   ? 6.910   54.319  67.742 1.00 34.51 ? 356  GDP C PA    1 
HETATM 5732 O  O1A   . GDP H 4 .   ? 7.127   53.530  68.992 1.00 34.72 ? 356  GDP C O1A   1 
HETATM 5733 O  O2A   . GDP H 4 .   ? 7.230   53.728  66.469 1.00 34.33 ? 356  GDP C O2A   1 
HETATM 5734 O  "O5'" . GDP H 4 .   ? 5.365   54.821  67.804 1.00 39.85 ? 356  GDP C "O5'" 1 
HETATM 5735 C  "C5'" . GDP H 4 .   ? 4.458   54.550  66.735 1.00 30.49 ? 356  GDP C "C5'" 1 
HETATM 5736 C  "C4'" . GDP H 4 .   ? 3.484   53.358  66.930 1.00 25.98 ? 356  GDP C "C4'" 1 
HETATM 5737 O  "O4'" . GDP H 4 .   ? 2.912   53.265  65.639 1.00 22.20 ? 356  GDP C "O4'" 1 
HETATM 5738 C  "C3'" . GDP H 4 .   ? 4.125   51.996  67.134 1.00 25.52 ? 356  GDP C "C3'" 1 
HETATM 5739 O  "O3'" . GDP H 4 .   ? 3.221   51.199  67.884 1.00 25.27 ? 356  GDP C "O3'" 1 
HETATM 5740 C  "C2'" . GDP H 4 .   ? 4.333   51.369  65.754 1.00 21.85 ? 356  GDP C "C2'" 1 
HETATM 5741 O  "O2'" . GDP H 4 .   ? 4.263   49.927  65.663 1.00 20.05 ? 356  GDP C "O2'" 1 
HETATM 5742 C  "C1'" . GDP H 4 .   ? 3.245   52.051  64.954 1.00 19.94 ? 356  GDP C "C1'" 1 
HETATM 5743 N  N9    . GDP H 4 .   ? 3.705   52.545  63.661 1.00 22.62 ? 356  GDP C N9    1 
HETATM 5744 C  C8    . GDP H 4 .   ? 4.803   53.324  63.356 1.00 21.49 ? 356  GDP C C8    1 
HETATM 5745 N  N7    . GDP H 4 .   ? 4.952   53.630  62.125 1.00 20.84 ? 356  GDP C N7    1 
HETATM 5746 C  C5    . GDP H 4 .   ? 3.863   53.010  61.526 1.00 19.32 ? 356  GDP C C5    1 
HETATM 5747 C  C6    . GDP H 4 .   ? 3.468   52.995  60.143 1.00 19.74 ? 356  GDP C C6    1 
HETATM 5748 O  O6    . GDP H 4 .   ? 4.024   53.547  59.202 1.00 20.50 ? 356  GDP C O6    1 
HETATM 5749 N  N1    . GDP H 4 .   ? 2.289   52.236  59.933 1.00 19.51 ? 356  GDP C N1    1 
HETATM 5750 C  C2    . GDP H 4 .   ? 1.566   51.564  60.931 1.00 22.01 ? 356  GDP C C2    1 
HETATM 5751 N  N2    . GDP H 4 .   ? 0.486   50.894  60.538 1.00 18.75 ? 356  GDP C N2    1 
HETATM 5752 N  N3    . GDP H 4 .   ? 1.930   51.585  62.247 1.00 20.10 ? 356  GDP C N3    1 
HETATM 5753 C  C4    . GDP H 4 .   ? 3.088   52.322  62.461 1.00 20.49 ? 356  GDP C C4    1 
HETATM 5754 O  O     . HOH I 5 .   ? 0.932   -9.165  17.021 1.00 52.07 ? 4002 HOH A O     1 
HETATM 5755 O  O     . HOH I 5 .   ? 28.712  -27.869 26.598 1.00 54.06 ? 4004 HOH A O     1 
HETATM 5756 O  O     . HOH I 5 .   ? 19.755  -3.396  19.448 1.00 37.52 ? 4005 HOH A O     1 
HETATM 5757 O  O     . HOH I 5 .   ? -2.752  -9.391  9.307  1.00 47.91 ? 4006 HOH A O     1 
HETATM 5758 O  O     . HOH I 5 .   ? 12.695  -13.535 20.462 1.00 42.91 ? 4007 HOH A O     1 
HETATM 5759 O  O     . HOH I 5 .   ? 7.105   -1.099  18.355 1.00 19.80 ? 4008 HOH A O     1 
HETATM 5760 O  O     . HOH I 5 .   ? 10.292  -6.040  27.707 1.00 45.93 ? 4009 HOH A O     1 
HETATM 5761 O  O     . HOH I 5 .   ? 16.887  -4.024  22.182 1.00 23.58 ? 4013 HOH A O     1 
HETATM 5762 O  O     . HOH I 5 .   ? 6.716   12.673  2.286  1.00 28.86 ? 4014 HOH A O     1 
HETATM 5763 O  O     . HOH I 5 .   ? 20.515  -10.543 35.295 1.00 30.31 ? 4016 HOH A O     1 
HETATM 5764 O  O     . HOH I 5 .   ? 29.467  6.834   7.395  1.00 36.76 ? 4017 HOH A O     1 
HETATM 5765 O  O     . HOH I 5 .   ? 13.388  -7.688  2.453  1.00 29.10 ? 4019 HOH A O     1 
HETATM 5766 O  O     . HOH I 5 .   ? 3.035   -5.573  28.853 1.00 61.29 ? 4021 HOH A O     1 
HETATM 5767 O  O     . HOH I 5 .   ? 9.734   -14.554 26.624 1.00 48.01 ? 4024 HOH A O     1 
HETATM 5768 O  O     . HOH I 5 .   ? 16.389  -3.883  -0.946 1.00 32.88 ? 4029 HOH A O     1 
HETATM 5769 O  O     . HOH I 5 .   ? 12.202  -4.587  24.580 1.00 25.27 ? 4031 HOH A O     1 
HETATM 5770 O  O     . HOH I 5 .   ? 18.951  12.886  22.197 1.00 22.32 ? 4032 HOH A O     1 
HETATM 5771 O  O     . HOH I 5 .   ? 12.884  2.009   22.034 1.00 39.16 ? 4038 HOH A O     1 
HETATM 5772 O  O     . HOH I 5 .   ? 10.415  8.378   17.588 1.00 17.61 ? 4040 HOH A O     1 
HETATM 5773 O  O     . HOH I 5 .   ? 40.748  -4.377  32.813 1.00 98.29 ? 4041 HOH A O     1 
HETATM 5774 O  O     . HOH I 5 .   ? 33.378  -18.377 23.507 1.00 30.17 ? 4049 HOH A O     1 
HETATM 5775 O  O     . HOH I 5 .   ? 8.777   5.342   20.802 1.00 26.96 ? 4051 HOH A O     1 
HETATM 5776 O  O     . HOH I 5 .   ? 18.341  -4.296  15.831 1.00 36.83 ? 4052 HOH A O     1 
HETATM 5777 O  O     . HOH I 5 .   ? 17.409  -22.465 29.803 1.00 53.90 ? 4054 HOH A O     1 
HETATM 5778 O  O     . HOH I 5 .   ? 19.817  2.088   20.182 1.00 18.90 ? 4059 HOH A O     1 
HETATM 5779 O  O     . HOH I 5 .   ? 10.741  -8.708  27.461 1.00 41.81 ? 4060 HOH A O     1 
HETATM 5780 O  O     . HOH I 5 .   ? -0.531  5.320   18.342 1.00 28.99 ? 4061 HOH A O     1 
HETATM 5781 O  O     . HOH I 5 .   ? 19.906  12.341  24.870 1.00 55.39 ? 4062 HOH A O     1 
HETATM 5782 O  O     . HOH I 5 .   ? 14.849  -8.590  16.255 1.00 34.23 ? 4063 HOH A O     1 
HETATM 5783 O  O     . HOH I 5 .   ? 22.460  -3.051  16.244 1.00 37.77 ? 4064 HOH A O     1 
HETATM 5784 O  O     . HOH I 5 .   ? -3.306  6.856   24.102 1.00 61.05 ? 4065 HOH A O     1 
HETATM 5785 O  O     . HOH I 5 .   ? 18.280  -4.056  28.911 1.00 31.12 ? 4066 HOH A O     1 
HETATM 5786 O  O     . HOH I 5 .   ? 32.379  -20.300 25.531 1.00 33.86 ? 4067 HOH A O     1 
HETATM 5787 O  O     . HOH I 5 .   ? 6.171   15.684  0.579  1.00 45.02 ? 4069 HOH A O     1 
HETATM 5788 O  O     . HOH I 5 .   ? 17.630  0.776   20.556 1.00 30.01 ? 4071 HOH A O     1 
HETATM 5789 O  O     . HOH I 5 .   ? 22.269  -21.257 25.203 1.00 41.07 ? 4072 HOH A O     1 
HETATM 5790 O  O     . HOH I 5 .   ? 4.903   -7.226  28.114 1.00 38.26 ? 4074 HOH A O     1 
HETATM 5791 O  O     . HOH I 5 .   ? 4.197   22.994  4.518  1.00 57.37 ? 4076 HOH A O     1 
HETATM 5792 O  O     . HOH I 5 .   ? 34.192  -10.425 15.974 1.00 52.67 ? 4081 HOH A O     1 
HETATM 5793 O  O     . HOH I 5 .   ? 16.145  2.308   18.705 1.00 23.70 ? 4084 HOH A O     1 
HETATM 5794 O  O     . HOH I 5 .   ? 25.740  7.236   16.701 1.00 43.90 ? 4089 HOH A O     1 
HETATM 5795 O  O     . HOH I 5 .   ? 11.722  5.750   17.546 1.00 21.98 ? 4090 HOH A O     1 
HETATM 5796 O  O     . HOH I 5 .   ? 2.846   -1.799  2.166  1.00 24.27 ? 4091 HOH A O     1 
HETATM 5797 O  O     . HOH I 5 .   ? 13.874  4.584   19.404 1.00 26.25 ? 4093 HOH A O     1 
HETATM 5798 O  O     . HOH I 5 .   ? 15.436  -9.979  18.579 1.00 24.18 ? 4096 HOH A O     1 
HETATM 5799 O  O     . HOH I 5 .   ? 6.440   -3.831  18.988 1.00 20.32 ? 4098 HOH A O     1 
HETATM 5800 O  O     . HOH I 5 .   ? 13.832  8.625   1.492  1.00 23.72 ? 4099 HOH A O     1 
HETATM 5801 O  O     . HOH I 5 .   ? 7.184   -2.102  21.923 1.00 20.50 ? 4102 HOH A O     1 
HETATM 5802 O  O     . HOH I 5 .   ? 0.520   -1.042  19.960 1.00 21.11 ? 4103 HOH A O     1 
HETATM 5803 O  O     . HOH I 5 .   ? 1.703   -9.723  6.706  1.00 26.05 ? 4105 HOH A O     1 
HETATM 5804 O  O     . HOH I 5 .   ? 17.268  -1.172  16.575 1.00 29.26 ? 4107 HOH A O     1 
HETATM 5805 O  O     . HOH I 5 .   ? 15.596  -7.277  3.859  1.00 30.62 ? 4111 HOH A O     1 
HETATM 5806 O  O     . HOH I 5 .   ? 20.610  -8.171  18.130 1.00 38.02 ? 4114 HOH A O     1 
HETATM 5807 O  O     . HOH I 5 .   ? 16.722  -4.758  19.262 1.00 38.15 ? 4116 HOH A O     1 
HETATM 5808 O  O     . HOH I 5 .   ? 10.537  -14.400 19.643 1.00 32.54 ? 4119 HOH A O     1 
HETATM 5809 O  O     . HOH I 5 .   ? 24.065  -0.945  14.319 1.00 37.43 ? 4120 HOH A O     1 
HETATM 5810 O  O     . HOH I 5 .   ? 25.100  6.036   1.455  1.00 45.00 ? 4121 HOH A O     1 
HETATM 5811 O  O     . HOH I 5 .   ? 17.783  8.079   1.628  1.00 42.18 ? 4122 HOH A O     1 
HETATM 5812 O  O     . HOH I 5 .   ? 14.312  -6.528  -0.033 1.00 31.30 ? 4123 HOH A O     1 
HETATM 5813 O  O     . HOH I 5 .   ? 5.332   20.761  6.879  1.00 43.84 ? 4124 HOH A O     1 
HETATM 5814 O  O     . HOH I 5 .   ? -1.742  -4.619  4.620  1.00 31.78 ? 4125 HOH A O     1 
HETATM 5815 O  O     . HOH I 5 .   ? 15.904  10.724  0.801  1.00 39.87 ? 4126 HOH A O     1 
HETATM 5816 O  O     . HOH I 5 .   ? 10.904  -11.477 27.027 1.00 36.76 ? 4127 HOH A O     1 
HETATM 5817 O  O     . HOH I 5 .   ? 15.144  -1.712  18.392 1.00 29.60 ? 4132 HOH A O     1 
HETATM 5818 O  O     . HOH I 5 .   ? -0.069  1.828   6.762  1.00 32.93 ? 4136 HOH A O     1 
HETATM 5819 O  O     . HOH I 5 .   ? 10.220  4.069   18.866 1.00 32.28 ? 4137 HOH A O     1 
HETATM 5820 O  O     . HOH I 5 .   ? 41.349  -3.047  30.605 1.00 40.46 ? 4139 HOH A O     1 
HETATM 5821 O  O     . HOH I 5 .   ? 28.284  2.246   11.853 1.00 40.75 ? 4140 HOH A O     1 
HETATM 5822 O  O     . HOH I 5 .   ? 13.915  -12.411 18.404 1.00 37.87 ? 4143 HOH A O     1 
HETATM 5823 O  O     . HOH I 5 .   ? 18.149  -0.399  4.211  1.00 42.31 ? 4145 HOH A O     1 
HETATM 5824 O  O     . HOH I 5 .   ? 26.451  -11.597 16.122 1.00 30.93 ? 4146 HOH A O     1 
HETATM 5825 O  O     . HOH I 5 .   ? 24.470  -14.538 16.076 1.00 44.42 ? 4147 HOH A O     1 
HETATM 5826 O  O     . HOH I 5 .   ? 6.049   -12.400 2.977  1.00 38.00 ? 4149 HOH A O     1 
HETATM 5827 O  O     . HOH I 5 .   ? 18.429  35.016  14.932 1.00 33.77 ? 4152 HOH A O     1 
HETATM 5828 O  O     . HOH I 5 .   ? 20.674  4.726   1.146  1.00 41.42 ? 4160 HOH A O     1 
HETATM 5829 O  O     . HOH I 5 .   ? 9.002   -1.915  24.393 1.00 37.80 ? 4162 HOH A O     1 
HETATM 5830 O  O     . HOH I 5 .   ? -1.256  6.634   16.247 1.00 28.48 ? 4164 HOH A O     1 
HETATM 5831 O  O     . HOH I 5 .   ? 23.837  -3.757  18.469 1.00 31.83 ? 4167 HOH A O     1 
HETATM 5832 O  O     . HOH I 5 .   ? -1.941  -1.658  14.463 1.00 38.80 ? 4168 HOH A O     1 
HETATM 5833 O  O     . HOH I 5 .   ? 16.010  -1.084  21.684 1.00 38.92 ? 4169 HOH A O     1 
HETATM 5834 O  O     . HOH I 5 .   ? 26.184  10.650  21.887 1.00 37.85 ? 4170 HOH A O     1 
HETATM 5835 O  O     . HOH I 5 .   ? 2.357   7.826   2.481  1.00 38.96 ? 4171 HOH A O     1 
HETATM 5836 O  O     . HOH I 5 .   ? 10.582  26.131  6.846  1.00 41.96 ? 4172 HOH A O     1 
HETATM 5837 O  O     . HOH I 5 .   ? 0.383   13.322  5.054  1.00 29.35 ? 4176 HOH A O     1 
HETATM 5838 O  O     . HOH I 5 .   ? -1.869  5.420   11.245 1.00 39.37 ? 4180 HOH A O     1 
HETATM 5839 O  O     . HOH I 5 .   ? -0.351  -2.778  17.917 1.00 37.44 ? 4181 HOH A O     1 
HETATM 5840 O  O     . HOH I 5 .   ? 35.869  6.768   9.922  1.00 39.83 ? 4183 HOH A O     1 
HETATM 5841 O  O     . HOH I 5 .   ? 25.334  -2.063  30.794 1.00 37.18 ? 4184 HOH A O     1 
HETATM 5842 O  O     . HOH I 5 .   ? 34.060  1.470   11.257 1.00 37.74 ? 4186 HOH A O     1 
HETATM 5843 O  O     . HOH I 5 .   ? -0.154  7.745   2.978  1.00 35.58 ? 4189 HOH A O     1 
HETATM 5844 O  O     . HOH I 5 .   ? 29.167  -11.489 15.596 1.00 32.11 ? 4190 HOH A O     1 
HETATM 5845 O  O     . HOH I 5 .   ? 20.003  15.938  -2.008 1.00 50.73 ? 4191 HOH A O     1 
HETATM 5846 O  O     . HOH I 5 .   ? -2.227  3.505   19.214 1.00 42.55 ? 4198 HOH A O     1 
HETATM 5847 O  O     . HOH I 5 .   ? 22.294  34.473  18.398 1.00 51.37 ? 4199 HOH A O     1 
HETATM 5848 O  O     . HOH I 5 .   ? 21.100  -5.766  15.730 1.00 51.37 ? 4203 HOH A O     1 
HETATM 5849 O  O     . HOH I 5 .   ? -2.007  1.290   13.635 1.00 38.10 ? 4209 HOH A O     1 
HETATM 5850 O  O     . HOH I 5 .   ? -2.091  18.692  9.700  1.00 41.88 ? 4211 HOH A O     1 
HETATM 5851 O  O     . HOH I 5 .   ? 29.593  26.323  9.381  1.00 58.12 ? 4216 HOH A O     1 
HETATM 5852 O  O     . HOH I 5 .   ? 36.198  9.394   26.319 1.00 38.16 ? 4219 HOH A O     1 
HETATM 5853 O  O     . HOH I 5 .   ? 0.520   -4.999  0.275  1.00 41.81 ? 4221 HOH A O     1 
HETATM 5854 O  O     . HOH I 5 .   ? 24.526  -2.362  33.696 1.00 36.63 ? 4222 HOH A O     1 
HETATM 5855 O  O     . HOH I 5 .   ? 0.510   21.647  12.179 1.00 44.54 ? 4223 HOH A O     1 
HETATM 5856 O  O     . HOH I 5 .   ? 25.097  14.557  19.652 1.00 48.72 ? 4224 HOH A O     1 
HETATM 5857 O  O     . HOH I 5 .   ? 13.524  -9.052  30.208 1.00 47.98 ? 4225 HOH A O     1 
HETATM 5858 O  O     . HOH I 5 .   ? 18.393  -16.982 20.292 1.00 36.03 ? 4227 HOH A O     1 
HETATM 5859 O  O     . HOH I 5 .   ? -1.922  12.311  20.089 1.00 45.97 ? 4230 HOH A O     1 
HETATM 5860 O  O     . HOH I 5 .   ? 51.900  -1.751  17.379 1.00 45.13 ? 4232 HOH A O     1 
HETATM 5861 O  O     . HOH I 5 .   ? 14.841  16.506  21.347 1.00 31.44 ? 4233 HOH A O     1 
HETATM 5862 O  O     . HOH I 5 .   ? 1.574   0.801   2.202  1.00 30.06 ? 4234 HOH A O     1 
HETATM 5863 O  O     . HOH I 5 .   ? 2.321   -2.819  -0.161 1.00 36.97 ? 4239 HOH A O     1 
HETATM 5864 O  O     . HOH I 5 .   ? 29.537  0.689   10.322 1.00 38.77 ? 4240 HOH A O     1 
HETATM 5865 O  O     . HOH I 5 .   ? 25.557  7.071   19.407 1.00 56.76 ? 4242 HOH A O     1 
HETATM 5866 O  O     . HOH I 5 .   ? 26.731  -9.296  14.976 1.00 38.60 ? 4243 HOH A O     1 
HETATM 5867 O  O     . HOH I 5 .   ? 17.709  -18.566 23.015 1.00 36.73 ? 4245 HOH A O     1 
HETATM 5868 O  O     . HOH I 5 .   ? 21.444  -5.260  18.796 1.00 46.53 ? 4250 HOH A O     1 
HETATM 5869 O  O     . HOH I 5 .   ? 11.701  -3.857  27.450 1.00 47.31 ? 4253 HOH A O     1 
HETATM 5870 O  O     . HOH I 5 .   ? 36.452  3.087   11.267 1.00 46.26 ? 4257 HOH A O     1 
HETATM 5871 O  O     . HOH I 5 .   ? -1.977  0.773   20.146 1.00 48.47 ? 4258 HOH A O     1 
HETATM 5872 O  O     . HOH I 5 .   ? 26.550  3.314   9.464  1.00 41.26 ? 4260 HOH A O     1 
HETATM 5873 O  O     . HOH I 5 .   ? 38.321  9.303   31.734 1.00 46.68 ? 4262 HOH A O     1 
HETATM 5874 O  O     . HOH I 5 .   ? 24.305  18.114  3.946  1.00 36.70 ? 4267 HOH A O     1 
HETATM 5875 O  O     . HOH I 5 .   ? 20.778  -13.416 6.671  1.00 48.28 ? 4269 HOH A O     1 
HETATM 5876 O  O     . HOH I 5 .   ? 2.041   -5.440  31.822 1.00 43.34 ? 4272 HOH A O     1 
HETATM 5877 O  O     . HOH I 5 .   ? 28.789  -5.031  13.215 1.00 48.88 ? 4276 HOH A O     1 
HETATM 5878 O  O     . HOH I 5 .   ? -2.606  17.920  17.545 1.00 47.57 ? 4279 HOH A O     1 
HETATM 5879 O  O     . HOH I 5 .   ? 37.137  2.774   32.966 1.00 55.27 ? 4284 HOH A O     1 
HETATM 5880 O  O     . HOH I 5 .   ? 11.676  -1.984  24.779 1.00 33.82 ? 4285 HOH A O     1 
HETATM 5881 O  O     . HOH I 5 .   ? 12.376  -11.414 31.285 1.00 45.26 ? 4286 HOH A O     1 
HETATM 5882 O  O     . HOH J 5 .   ? 20.019  -12.305 37.374 1.00 50.98 ? 4080 HOH B O     1 
HETATM 5883 O  O     . HOH J 5 .   ? 31.496  -6.847  40.980 1.00 54.53 ? 4082 HOH B O     1 
HETATM 5884 O  O     . HOH J 5 .   ? 20.956  5.761   31.174 1.00 58.55 ? 4083 HOH B O     1 
HETATM 5885 O  O     . HOH J 5 .   ? 8.781   5.807   23.555 1.00 33.45 ? 4130 HOH B O     1 
HETATM 5886 O  O     . HOH J 5 .   ? 20.306  -8.719  38.748 1.00 57.00 ? 4144 HOH B O     1 
HETATM 5887 O  O     . HOH J 5 .   ? 15.818  11.256  23.742 1.00 23.32 ? 4158 HOH B O     1 
HETATM 5888 O  O     . HOH J 5 .   ? 12.869  4.445   22.982 1.00 27.62 ? 4235 HOH B O     1 
HETATM 5889 O  O     . HOH J 5 .   ? 21.891  4.187   27.693 1.00 38.49 ? 4246 HOH B O     1 
HETATM 5890 O  O     . HOH K 5 .   ? 23.806  50.476  69.756 1.00 54.76 ? 4001 HOH C O     1 
HETATM 5891 O  O     . HOH K 5 .   ? -12.844 60.110  50.875 1.00 55.95 ? 4003 HOH C O     1 
HETATM 5892 O  O     . HOH K 5 .   ? 21.938  43.931  58.161 1.00 69.56 ? 4010 HOH C O     1 
HETATM 5893 O  O     . HOH K 5 .   ? -3.970  55.976  45.202 1.00 27.68 ? 4011 HOH C O     1 
HETATM 5894 O  O     . HOH K 5 .   ? 2.041   38.593  80.613 1.00 40.74 ? 4012 HOH C O     1 
HETATM 5895 O  O     . HOH K 5 .   ? 5.670   64.636  65.040 1.00 17.15 ? 4015 HOH C O     1 
HETATM 5896 O  O     . HOH K 5 .   ? -7.501  61.230  70.688 1.00 32.14 ? 4018 HOH C O     1 
HETATM 5897 O  O     . HOH K 5 .   ? 22.961  33.732  74.544 1.00 70.29 ? 4020 HOH C O     1 
HETATM 5898 O  O     . HOH K 5 .   ? -10.674 70.224  77.964 1.00 27.84 ? 4022 HOH C O     1 
HETATM 5899 O  O     . HOH K 5 .   ? -4.124  65.989  64.876 1.00 34.91 ? 4023 HOH C O     1 
HETATM 5900 O  O     . HOH K 5 .   ? 17.448  76.950  60.527 1.00 44.81 ? 4025 HOH C O     1 
HETATM 5901 O  O     . HOH K 5 .   ? 18.703  71.358  49.114 1.00 60.38 ? 4026 HOH C O     1 
HETATM 5902 O  O     . HOH K 5 .   ? -17.810 38.239  71.672 1.00 39.34 ? 4027 HOH C O     1 
HETATM 5903 O  O     . HOH K 5 .   ? -5.646  72.433  66.303 1.00 23.22 ? 4028 HOH C O     1 
HETATM 5904 O  O     . HOH K 5 .   ? 8.598   59.137  49.770 1.00 21.75 ? 4030 HOH C O     1 
HETATM 5905 O  O     . HOH K 5 .   ? 13.036  66.576  48.531 1.00 49.99 ? 4033 HOH C O     1 
HETATM 5906 O  O     . HOH K 5 .   ? -11.819 60.091  76.218 1.00 50.30 ? 4034 HOH C O     1 
HETATM 5907 O  O     . HOH K 5 .   ? -2.973  57.286  64.094 1.00 49.65 ? 4035 HOH C O     1 
HETATM 5908 O  O     . HOH K 5 .   ? 3.283   62.972  64.716 1.00 18.33 ? 4036 HOH C O     1 
HETATM 5909 O  O     . HOH K 5 .   ? -22.873 46.781  69.990 1.00 52.82 ? 4037 HOH C O     1 
HETATM 5910 O  O     . HOH K 5 .   ? -9.530  34.557  64.272 1.00 47.65 ? 4039 HOH C O     1 
HETATM 5911 O  O     . HOH K 5 .   ? -7.845  58.136  48.230 1.00 28.90 ? 4042 HOH C O     1 
HETATM 5912 O  O     . HOH K 5 .   ? -14.700 73.092  57.281 1.00 47.39 ? 4043 HOH C O     1 
HETATM 5913 O  O     . HOH K 5 .   ? 24.394  70.121  53.696 1.00 51.81 ? 4044 HOH C O     1 
HETATM 5914 O  O     . HOH K 5 .   ? -7.217  66.054  64.707 1.00 23.75 ? 4045 HOH C O     1 
HETATM 5915 O  O     . HOH K 5 .   ? -4.801  54.596  63.274 1.00 35.11 ? 4046 HOH C O     1 
HETATM 5916 O  O     . HOH K 5 .   ? -14.512 63.793  49.701 1.00 50.68 ? 4047 HOH C O     1 
HETATM 5917 O  O     . HOH K 5 .   ? -6.298  35.323  65.686 1.00 36.54 ? 4048 HOH C O     1 
HETATM 5918 O  O     . HOH K 5 .   ? -25.528 45.128  76.855 1.00 64.93 ? 4050 HOH C O     1 
HETATM 5919 O  O     . HOH K 5 .   ? -5.508  76.258  51.911 1.00 53.90 ? 4053 HOH C O     1 
HETATM 5920 O  O     . HOH K 5 .   ? 0.737   30.565  76.031 1.00 58.09 ? 4055 HOH C O     1 
HETATM 5921 O  O     . HOH K 5 .   ? -22.496 43.477  84.280 1.00 50.94 ? 4056 HOH C O     1 
HETATM 5922 O  O     . HOH K 5 .   ? -4.470  49.528  66.069 1.00 26.68 ? 4057 HOH C O     1 
HETATM 5923 O  O     . HOH K 5 .   ? 23.122  74.328  62.927 1.00 33.39 ? 4058 HOH C O     1 
HETATM 5924 O  O     . HOH K 5 .   ? -9.312  62.728  73.671 1.00 54.27 ? 4068 HOH C O     1 
HETATM 5925 O  O     . HOH K 5 .   ? -11.517 56.121  64.678 1.00 30.29 ? 4070 HOH C O     1 
HETATM 5926 O  O     . HOH K 5 .   ? -1.269  65.291  72.839 1.00 40.26 ? 4073 HOH C O     1 
HETATM 5927 O  O     . HOH K 5 .   ? 7.978   55.821  50.064 1.00 40.93 ? 4075 HOH C O     1 
HETATM 5928 O  O     . HOH K 5 .   ? 26.515  48.136  53.302 1.00 45.90 ? 4077 HOH C O     1 
HETATM 5929 O  O     . HOH K 5 .   ? 29.462  63.112  63.302 1.00 43.53 ? 4078 HOH C O     1 
HETATM 5930 O  O     . HOH K 5 .   ? 32.214  63.772  62.454 1.00 39.47 ? 4079 HOH C O     1 
HETATM 5931 O  O     . HOH K 5 .   ? 13.917  61.939  69.630 1.00 28.18 ? 4085 HOH C O     1 
HETATM 5932 O  O     . HOH K 5 .   ? 6.886   49.575  65.737 1.00 43.36 ? 4086 HOH C O     1 
HETATM 5933 O  O     . HOH K 5 .   ? -1.224  49.635  62.363 1.00 33.31 ? 4087 HOH C O     1 
HETATM 5934 O  O     . HOH K 5 .   ? 6.008   50.786  35.360 1.00 47.39 ? 4088 HOH C O     1 
HETATM 5935 O  O     . HOH K 5 .   ? 7.825   57.563  72.541 1.00 33.20 ? 4092 HOH C O     1 
HETATM 5936 O  O     . HOH K 5 .   ? -5.972  56.587  68.931 1.00 24.96 ? 4094 HOH C O     1 
HETATM 5937 O  O     . HOH K 5 .   ? -5.378  65.669  68.178 1.00 19.01 ? 4095 HOH C O     1 
HETATM 5938 O  O     . HOH K 5 .   ? 2.241   60.956  66.551 1.00 28.52 ? 4097 HOH C O     1 
HETATM 5939 O  O     . HOH K 5 .   ? -5.897  75.009  60.539 1.00 32.53 ? 4101 HOH C O     1 
HETATM 5940 O  O     . HOH K 5 .   ? 2.558   45.414  60.167 1.00 29.13 ? 4104 HOH C O     1 
HETATM 5941 O  O     . HOH K 5 .   ? -2.022  54.579  45.942 1.00 44.18 ? 4106 HOH C O     1 
HETATM 5942 O  O     . HOH K 5 .   ? 7.230   50.949  69.374 1.00 34.15 ? 4108 HOH C O     1 
HETATM 5943 O  O     . HOH K 5 .   ? 6.830   58.438  47.996 1.00 20.14 ? 4109 HOH C O     1 
HETATM 5944 O  O     . HOH K 5 .   ? 12.366  72.003  50.444 1.00 49.28 ? 4110 HOH C O     1 
HETATM 5945 O  O     . HOH K 5 .   ? 0.192   54.641  67.841 1.00 23.73 ? 4112 HOH C O     1 
HETATM 5946 O  O     . HOH K 5 .   ? -8.712  54.314  76.791 1.00 30.57 ? 4113 HOH C O     1 
HETATM 5947 O  O     . HOH K 5 .   ? -12.326 69.707  51.720 1.00 31.15 ? 4115 HOH C O     1 
HETATM 5948 O  O     . HOH K 5 .   ? -13.179 65.574  65.639 1.00 19.70 ? 4117 HOH C O     1 
HETATM 5949 O  O     . HOH K 5 .   ? 0.289   58.288  65.910 1.00 28.56 ? 4118 HOH C O     1 
HETATM 5950 O  O     . HOH K 5 .   ? 2.605   73.860  72.632 1.00 49.92 ? 4128 HOH C O     1 
HETATM 5951 O  O     . HOH K 5 .   ? -2.638  67.706  70.832 1.00 38.69 ? 4129 HOH C O     1 
HETATM 5952 O  O     . HOH K 5 .   ? -7.144  56.245  49.865 1.00 29.34 ? 4131 HOH C O     1 
HETATM 5953 O  O     . HOH K 5 .   ? 0.872   64.660  65.410 1.00 35.52 ? 4133 HOH C O     1 
HETATM 5954 O  O     . HOH K 5 .   ? -3.162  56.519  66.621 1.00 39.09 ? 4134 HOH C O     1 
HETATM 5955 O  O     . HOH K 5 .   ? 5.752   52.013  49.894 1.00 38.73 ? 4135 HOH C O     1 
HETATM 5956 O  O     . HOH K 5 .   ? -11.981 67.610  54.070 1.00 36.19 ? 4138 HOH C O     1 
HETATM 5957 O  O     . HOH K 5 .   ? 11.426  58.546  49.075 1.00 47.15 ? 4141 HOH C O     1 
HETATM 5958 O  O     . HOH K 5 .   ? 24.012  70.587  64.474 1.00 28.90 ? 4142 HOH C O     1 
HETATM 5959 O  O     . HOH K 5 .   ? 8.312   51.080  49.069 1.00 42.03 ? 4148 HOH C O     1 
HETATM 5960 O  O     . HOH K 5 .   ? 12.876  63.867  48.813 1.00 36.48 ? 4150 HOH C O     1 
HETATM 5961 O  O     . HOH K 5 .   ? 13.739  51.315  68.934 1.00 31.77 ? 4151 HOH C O     1 
HETATM 5962 O  O     . HOH K 5 .   ? -13.949 57.203  63.811 1.00 40.13 ? 4153 HOH C O     1 
HETATM 5963 O  O     . HOH K 5 .   ? 18.520  51.529  53.641 1.00 41.22 ? 4154 HOH C O     1 
HETATM 5964 O  O     . HOH K 5 .   ? -3.550  34.385  64.013 1.00 44.05 ? 4155 HOH C O     1 
HETATM 5965 O  O     . HOH K 5 .   ? 7.974   44.810  57.110 1.00 32.38 ? 4156 HOH C O     1 
HETATM 5966 O  O     . HOH K 5 .   ? -4.921  70.606  47.884 1.00 42.13 ? 4159 HOH C O     1 
HETATM 5967 O  O     . HOH K 5 .   ? -1.396  71.976  72.996 1.00 37.60 ? 4161 HOH C O     1 
HETATM 5968 O  O     . HOH K 5 .   ? -10.695 54.231  83.352 1.00 46.69 ? 4163 HOH C O     1 
HETATM 5969 O  O     . HOH K 5 .   ? -4.501  43.603  61.933 1.00 40.81 ? 4165 HOH C O     1 
HETATM 5970 O  O     . HOH K 5 .   ? -3.431  75.285  60.311 1.00 32.84 ? 4166 HOH C O     1 
HETATM 5971 O  O     . HOH K 5 .   ? 13.157  78.042  68.713 1.00 38.46 ? 4173 HOH C O     1 
HETATM 5972 O  O     . HOH K 5 .   ? 4.479   50.884  52.134 1.00 44.46 ? 4174 HOH C O     1 
HETATM 5973 O  O     . HOH K 5 .   ? -9.808  57.050  62.561 1.00 44.40 ? 4175 HOH C O     1 
HETATM 5974 O  O     . HOH K 5 .   ? 5.067   37.699  61.577 1.00 46.47 ? 4177 HOH C O     1 
HETATM 5975 O  O     . HOH K 5 .   ? -9.232  52.074  65.257 1.00 35.89 ? 4178 HOH C O     1 
HETATM 5976 O  O     . HOH K 5 .   ? -12.510 47.607  61.560 1.00 45.94 ? 4179 HOH C O     1 
HETATM 5977 O  O     . HOH K 5 .   ? 9.386   50.188  71.227 1.00 42.15 ? 4182 HOH C O     1 
HETATM 5978 O  O     . HOH K 5 .   ? -6.726  55.555  66.670 1.00 38.72 ? 4185 HOH C O     1 
HETATM 5979 O  O     . HOH K 5 .   ? 3.530   77.207  64.152 1.00 39.17 ? 4187 HOH C O     1 
HETATM 5980 O  O     . HOH K 5 .   ? 20.499  61.787  45.492 1.00 38.61 ? 4188 HOH C O     1 
HETATM 5981 O  O     . HOH K 5 .   ? -15.000 46.117  63.428 1.00 44.03 ? 4192 HOH C O     1 
HETATM 5982 O  O     . HOH K 5 .   ? -14.398 67.879  58.542 1.00 35.13 ? 4193 HOH C O     1 
HETATM 5983 O  O     . HOH K 5 .   ? -1.265  35.701  63.044 1.00 46.45 ? 4194 HOH C O     1 
HETATM 5984 O  O     . HOH K 5 .   ? -10.317 58.752  49.121 1.00 45.02 ? 4195 HOH C O     1 
HETATM 5985 O  O     . HOH K 5 .   ? -3.329  51.045  63.615 1.00 30.40 ? 4196 HOH C O     1 
HETATM 5986 O  O     . HOH K 5 .   ? -22.481 38.355  70.220 1.00 58.30 ? 4197 HOH C O     1 
HETATM 5987 O  O     . HOH K 5 .   ? -15.418 58.958  65.936 1.00 42.79 ? 4200 HOH C O     1 
HETATM 5988 O  O     . HOH K 5 .   ? -13.437 61.523  53.769 1.00 43.03 ? 4202 HOH C O     1 
HETATM 5989 O  O     . HOH K 5 .   ? 28.991  51.088  62.522 1.00 50.96 ? 4204 HOH C O     1 
HETATM 5990 O  O     . HOH K 5 .   ? -18.220 52.800  66.061 1.00 42.81 ? 4205 HOH C O     1 
HETATM 5991 O  O     . HOH K 5 .   ? 0.059   37.091  80.032 1.00 41.38 ? 4206 HOH C O     1 
HETATM 5992 O  O     . HOH K 5 .   ? -10.091 32.463  61.865 1.00 57.50 ? 4207 HOH C O     1 
HETATM 5993 O  O     . HOH K 5 .   ? 15.031  63.071  80.307 1.00 50.43 ? 4208 HOH C O     1 
HETATM 5994 O  O     . HOH K 5 .   ? 15.991  54.660  47.150 1.00 37.66 ? 4210 HOH C O     1 
HETATM 5995 O  O     . HOH K 5 .   ? 10.344  68.491  49.509 1.00 43.06 ? 4212 HOH C O     1 
HETATM 5996 O  O     . HOH K 5 .   ? -18.225 60.956  67.754 1.00 43.63 ? 4213 HOH C O     1 
HETATM 5997 O  O     . HOH K 5 .   ? -7.580  74.497  50.841 1.00 41.03 ? 4214 HOH C O     1 
HETATM 5998 O  O     . HOH K 5 .   ? 16.780  63.381  51.590 1.00 37.14 ? 4215 HOH C O     1 
HETATM 5999 O  O     . HOH K 5 .   ? 29.132  61.746  65.543 1.00 43.10 ? 4217 HOH C O     1 
HETATM 6000 O  O     . HOH K 5 .   ? -11.578 45.119  63.574 1.00 35.55 ? 4218 HOH C O     1 
HETATM 6001 O  O     . HOH K 5 .   ? -21.229 40.596  69.302 1.00 35.85 ? 4220 HOH C O     1 
HETATM 6002 O  O     . HOH K 5 .   ? -2.300  41.484  62.558 1.00 44.11 ? 4226 HOH C O     1 
HETATM 6003 O  O     . HOH K 5 .   ? -13.289 62.017  72.744 1.00 43.39 ? 4228 HOH C O     1 
HETATM 6004 O  O     . HOH K 5 .   ? -1.102  56.925  67.960 1.00 28.08 ? 4231 HOH C O     1 
HETATM 6005 O  O     . HOH K 5 .   ? 10.957  36.148  61.282 1.00 44.76 ? 4236 HOH C O     1 
HETATM 6006 O  O     . HOH K 5 .   ? -14.555 30.907  74.099 1.00 30.10 ? 4237 HOH C O     1 
HETATM 6007 O  O     . HOH K 5 .   ? -7.772  63.708  77.248 1.00 39.67 ? 4238 HOH C O     1 
HETATM 6008 O  O     . HOH K 5 .   ? 19.101  63.459  52.962 1.00 39.16 ? 4241 HOH C O     1 
HETATM 6009 O  O     . HOH K 5 .   ? -19.873 60.421  65.841 1.00 41.34 ? 4244 HOH C O     1 
HETATM 6010 O  O     . HOH K 5 .   ? 6.981   44.878  52.351 1.00 49.09 ? 4247 HOH C O     1 
HETATM 6011 O  O     . HOH K 5 .   ? -2.541  47.698  64.561 1.00 42.96 ? 4248 HOH C O     1 
HETATM 6012 O  O     . HOH K 5 .   ? -1.049  42.214  60.006 1.00 42.34 ? 4249 HOH C O     1 
HETATM 6013 O  O     . HOH K 5 .   ? -2.798  31.501  63.058 1.00 48.11 ? 4251 HOH C O     1 
HETATM 6014 O  O     . HOH K 5 .   ? -8.306  37.546  67.021 1.00 41.85 ? 4252 HOH C O     1 
HETATM 6015 O  O     . HOH K 5 .   ? 9.465   39.414  82.075 1.00 42.42 ? 4254 HOH C O     1 
HETATM 6016 O  O     . HOH K 5 .   ? 8.740   71.060  48.543 1.00 40.75 ? 4255 HOH C O     1 
HETATM 6017 O  O     . HOH K 5 .   ? 15.638  64.262  49.143 1.00 40.08 ? 4256 HOH C O     1 
HETATM 6018 O  O     . HOH K 5 .   ? -3.614  58.287  69.426 1.00 42.90 ? 4259 HOH C O     1 
HETATM 6019 O  O     . HOH K 5 .   ? -6.505  54.235  48.311 1.00 49.33 ? 4261 HOH C O     1 
HETATM 6020 O  O     . HOH K 5 .   ? -11.060 42.367  63.510 1.00 40.22 ? 4263 HOH C O     1 
HETATM 6021 O  O     . HOH K 5 .   ? -19.583 47.085  66.045 1.00 41.50 ? 4264 HOH C O     1 
HETATM 6022 O  O     . HOH K 5 .   ? 0.229   54.526  51.004 1.00 49.22 ? 4265 HOH C O     1 
HETATM 6023 O  O     . HOH K 5 .   ? -0.387  79.261  72.069 1.00 48.23 ? 4268 HOH C O     1 
HETATM 6024 O  O     . HOH K 5 .   ? -8.904  45.418  63.054 1.00 39.10 ? 4270 HOH C O     1 
HETATM 6025 O  O     . HOH K 5 .   ? 5.194   31.456  67.424 1.00 46.45 ? 4271 HOH C O     1 
HETATM 6026 O  O     . HOH K 5 .   ? -19.716 61.884  69.702 1.00 37.65 ? 4273 HOH C O     1 
HETATM 6027 O  O     . HOH K 5 .   ? 12.189  79.278  66.051 1.00 47.06 ? 4274 HOH C O     1 
HETATM 6028 O  O     . HOH K 5 .   ? -22.236 47.578  79.423 1.00 41.01 ? 4275 HOH C O     1 
HETATM 6029 O  O     . HOH K 5 .   ? -15.771 61.769  71.987 1.00 38.41 ? 4277 HOH C O     1 
HETATM 6030 O  O     . HOH K 5 .   ? 17.925  80.525  69.842 1.00 51.11 ? 4278 HOH C O     1 
HETATM 6031 O  O     . HOH K 5 .   ? 1.310   76.150  57.826 1.00 47.90 ? 4280 HOH C O     1 
HETATM 6032 O  O     . HOH K 5 .   ? 18.415  60.433  46.810 1.00 51.46 ? 4281 HOH C O     1 
HETATM 6033 O  O     . HOH K 5 .   ? 24.955  60.341  46.049 1.00 44.85 ? 4282 HOH C O     1 
HETATM 6034 O  O     . HOH K 5 .   ? 34.618  50.539  49.807 1.00 53.72 ? 4283 HOH C O     1 
HETATM 6035 O  O     . HOH L 5 .   ? 8.707   60.097  71.883 1.00 23.35 ? 4100 HOH D O     1 
HETATM 6036 O  O     . HOH L 5 .   ? 7.804   76.181  74.852 1.00 34.02 ? 4157 HOH D O     1 
HETATM 6037 O  O     . HOH L 5 .   ? 2.222   53.974  75.836 1.00 45.37 ? 4201 HOH D O     1 
HETATM 6038 O  O     . HOH L 5 .   ? -4.987  54.148  78.470 1.00 39.66 ? 4229 HOH D O     1 
HETATM 6039 O  O     . HOH L 5 .   ? 7.549   70.869  78.959 1.00 43.26 ? 4266 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   30   30   GLY GLY A . n 
A 1 2   ALA 2   31   31   ALA ALA A . n 
A 1 3   ARG 3   32   32   ARG ARG A . n 
A 1 4   GLU 4   33   33   GLU GLU A . n 
A 1 5   VAL 5   34   34   VAL VAL A . n 
A 1 6   LYS 6   35   35   LYS LYS A . n 
A 1 7   LEU 7   36   36   LEU LEU A . n 
A 1 8   LEU 8   37   37   LEU LEU A . n 
A 1 9   LEU 9   38   38   LEU LEU A . n 
A 1 10  LEU 10  39   39   LEU LEU A . n 
A 1 11  GLY 11  40   40   GLY GLY A . n 
A 1 12  ALA 12  41   41   ALA ALA A . n 
A 1 13  GLY 13  42   42   GLY GLY A . n 
A 1 14  GLU 14  43   43   GLU GLU A . n 
A 1 15  SER 15  44   44   SER SER A . n 
A 1 16  GLY 16  45   45   GLY GLY A . n 
A 1 17  LYS 17  46   46   LYS LYS A . n 
A 1 18  SER 18  47   47   SER SER A . n 
A 1 19  THR 19  48   48   THR THR A . n 
A 1 20  ILE 20  49   49   ILE ILE A . n 
A 1 21  VAL 21  50   50   VAL VAL A . n 
A 1 22  LYS 22  51   51   LYS LYS A . n 
A 1 23  GLN 23  52   52   GLN GLN A . n 
A 1 24  MET 24  53   53   MET MET A . n 
A 1 25  LYS 25  54   54   LYS LYS A . n 
A 1 26  ILE 26  55   55   ILE ILE A . n 
A 1 27  ILE 27  56   56   ILE ILE A . n 
A 1 28  HIS 28  57   57   HIS HIS A . n 
A 1 29  GLU 29  58   58   GLU GLU A . n 
A 1 30  ALA 30  59   59   ALA ALA A . n 
A 1 31  GLY 31  60   60   GLY GLY A . n 
A 1 32  TYR 32  61   61   TYR TYR A . n 
A 1 33  SER 33  62   62   SER SER A . n 
A 1 34  GLU 34  63   63   GLU GLU A . n 
A 1 35  GLU 35  64   64   GLU GLU A . n 
A 1 36  GLU 36  65   65   GLU GLU A . n 
A 1 37  CYS 37  66   66   CYS CYS A . n 
A 1 38  LYS 38  67   67   LYS LYS A . n 
A 1 39  GLN 39  68   68   GLN GLN A . n 
A 1 40  TYR 40  69   69   TYR TYR A . n 
A 1 41  LYS 41  70   70   LYS LYS A . n 
A 1 42  ALA 42  71   71   ALA ALA A . n 
A 1 43  VAL 43  72   72   VAL VAL A . n 
A 1 44  VAL 44  73   73   VAL VAL A . n 
A 1 45  TYR 45  74   74   TYR TYR A . n 
A 1 46  SER 46  75   75   SER SER A . n 
A 1 47  ASN 47  76   76   ASN ASN A . n 
A 1 48  THR 48  77   77   THR THR A . n 
A 1 49  ILE 49  78   78   ILE ILE A . n 
A 1 50  GLN 50  79   79   GLN GLN A . n 
A 1 51  SER 51  80   80   SER SER A . n 
A 1 52  ILE 52  81   81   ILE ILE A . n 
A 1 53  ILE 53  82   82   ILE ILE A . n 
A 1 54  ALA 54  83   83   ALA ALA A . n 
A 1 55  ILE 55  84   84   ILE ILE A . n 
A 1 56  ILE 56  85   85   ILE ILE A . n 
A 1 57  ARG 57  86   86   ARG ARG A . n 
A 1 58  ALA 58  87   87   ALA ALA A . n 
A 1 59  MET 59  88   88   MET MET A . n 
A 1 60  GLY 60  89   89   GLY GLY A . n 
A 1 61  ARG 61  90   90   ARG ARG A . n 
A 1 62  LEU 62  91   91   LEU LEU A . n 
A 1 63  LYS 63  92   92   LYS LYS A . n 
A 1 64  ILE 64  93   93   ILE ILE A . n 
A 1 65  ASP 65  94   94   ASP ASP A . n 
A 1 66  PHE 66  95   95   PHE PHE A . n 
A 1 67  GLY 67  96   96   GLY GLY A . n 
A 1 68  ASP 68  97   97   ASP ASP A . n 
A 1 69  SER 69  98   98   SER SER A . n 
A 1 70  ALA 70  99   99   ALA ALA A . n 
A 1 71  ARG 71  100  100  ARG ARG A . n 
A 1 72  ALA 72  101  101  ALA ALA A . n 
A 1 73  ASP 73  102  102  ASP ASP A . n 
A 1 74  ASP 74  103  103  ASP ASP A . n 
A 1 75  ALA 75  104  104  ALA ALA A . n 
A 1 76  ARG 76  105  105  ARG ARG A . n 
A 1 77  GLN 77  106  106  GLN GLN A . n 
A 1 78  LEU 78  107  107  LEU LEU A . n 
A 1 79  PHE 79  108  108  PHE PHE A . n 
A 1 80  VAL 80  109  109  VAL VAL A . n 
A 1 81  LEU 81  110  110  LEU LEU A . n 
A 1 82  ALA 82  111  111  ALA ALA A . n 
A 1 83  GLY 83  112  112  GLY GLY A . n 
A 1 84  ALA 84  113  113  ALA ALA A . n 
A 1 85  ALA 85  114  114  ALA ALA A . n 
A 1 86  GLU 86  115  115  GLU GLU A . n 
A 1 87  GLU 87  116  116  GLU GLU A . n 
A 1 88  GLY 88  117  117  GLY GLY A . n 
A 1 89  PHE 89  118  118  PHE PHE A . n 
A 1 90  MET 90  119  119  MET MET A . n 
A 1 91  THR 91  120  120  THR THR A . n 
A 1 92  ALA 92  121  121  ALA ALA A . n 
A 1 93  GLU 93  122  122  GLU GLU A . n 
A 1 94  LEU 94  123  123  LEU LEU A . n 
A 1 95  ALA 95  124  124  ALA ALA A . n 
A 1 96  GLY 96  125  125  GLY GLY A . n 
A 1 97  VAL 97  126  126  VAL VAL A . n 
A 1 98  ILE 98  127  127  ILE ILE A . n 
A 1 99  LYS 99  128  128  LYS LYS A . n 
A 1 100 ARG 100 129  129  ARG ARG A . n 
A 1 101 LEU 101 130  130  LEU LEU A . n 
A 1 102 TRP 102 131  131  TRP TRP A . n 
A 1 103 LYS 103 132  132  LYS LYS A . n 
A 1 104 ASP 104 133  133  ASP ASP A . n 
A 1 105 SER 105 134  134  SER SER A . n 
A 1 106 GLY 106 135  135  GLY GLY A . n 
A 1 107 VAL 107 136  136  VAL VAL A . n 
A 1 108 GLN 108 137  137  GLN GLN A . n 
A 1 109 ALA 109 138  138  ALA ALA A . n 
A 1 110 CYS 110 139  139  CYS CYS A . n 
A 1 111 PHE 111 140  140  PHE PHE A . n 
A 1 112 ASN 112 141  141  ASN ASN A . n 
A 1 113 ARG 113 142  142  ARG ARG A . n 
A 1 114 SER 114 143  143  SER SER A . n 
A 1 115 ARG 115 144  144  ARG ARG A . n 
A 1 116 GLU 116 145  145  GLU GLU A . n 
A 1 117 TYR 117 146  146  TYR TYR A . n 
A 1 118 GLN 118 147  147  GLN GLN A . n 
A 1 119 LEU 119 148  148  LEU LEU A . n 
A 1 120 ASN 120 149  149  ASN ASN A . n 
A 1 121 ASP 121 150  150  ASP ASP A . n 
A 1 122 SER 122 151  151  SER SER A . n 
A 1 123 ALA 123 152  152  ALA ALA A . n 
A 1 124 ALA 124 153  153  ALA ALA A . n 
A 1 125 TYR 125 154  154  TYR TYR A . n 
A 1 126 TYR 126 155  155  TYR TYR A . n 
A 1 127 LEU 127 156  156  LEU LEU A . n 
A 1 128 ASN 128 157  157  ASN ASN A . n 
A 1 129 ASP 129 158  158  ASP ASP A . n 
A 1 130 LEU 130 159  159  LEU LEU A . n 
A 1 131 ASP 131 160  160  ASP ASP A . n 
A 1 132 ARG 132 161  161  ARG ARG A . n 
A 1 133 ILE 133 162  162  ILE ILE A . n 
A 1 134 ALA 134 163  163  ALA ALA A . n 
A 1 135 GLN 135 164  164  GLN GLN A . n 
A 1 136 PRO 136 165  165  PRO PRO A . n 
A 1 137 ASN 137 166  166  ASN ASN A . n 
A 1 138 TYR 138 167  167  TYR TYR A . n 
A 1 139 ILE 139 168  168  ILE ILE A . n 
A 1 140 PRO 140 169  169  PRO PRO A . n 
A 1 141 THR 141 170  170  THR THR A . n 
A 1 142 GLN 142 171  171  GLN GLN A . n 
A 1 143 GLN 143 172  172  GLN GLN A . n 
A 1 144 ASP 144 173  173  ASP ASP A . n 
A 1 145 VAL 145 174  174  VAL VAL A . n 
A 1 146 LEU 146 175  175  LEU LEU A . n 
A 1 147 ARG 147 176  176  ARG ARG A . n 
A 1 148 THR 148 177  177  THR THR A . n 
A 1 149 ARG 149 178  178  ARG ARG A . n 
A 1 150 VAL 150 179  179  VAL VAL A . n 
A 1 151 LYS 151 180  180  LYS LYS A . n 
A 1 152 THR 152 181  181  THR THR A . n 
A 1 153 THR 153 182  182  THR THR A . n 
A 1 154 GLY 154 183  183  GLY GLY A . n 
A 1 155 ILE 155 184  184  ILE ILE A . n 
A 1 156 VAL 156 185  185  VAL VAL A . n 
A 1 157 GLU 157 186  186  GLU GLU A . n 
A 1 158 THR 158 187  187  THR THR A . n 
A 1 159 HIS 159 188  188  HIS HIS A . n 
A 1 160 PHE 160 189  189  PHE PHE A . n 
A 1 161 THR 161 190  190  THR THR A . n 
A 1 162 PHE 162 191  191  PHE PHE A . n 
A 1 163 LYS 163 192  192  LYS LYS A . n 
A 1 164 ASP 164 193  193  ASP ASP A . n 
A 1 165 LEU 165 194  194  LEU LEU A . n 
A 1 166 HIS 166 195  195  HIS HIS A . n 
A 1 167 PHE 167 196  196  PHE PHE A . n 
A 1 168 LYS 168 197  197  LYS LYS A . n 
A 1 169 MET 169 198  198  MET MET A . n 
A 1 170 PHE 170 199  199  PHE PHE A . n 
A 1 171 ASP 171 200  200  ASP ASP A . n 
A 1 172 VAL 172 201  201  VAL VAL A . n 
A 1 173 GLY 173 202  202  GLY GLY A . n 
A 1 174 GLY 174 203  203  GLY GLY A . n 
A 1 175 GLN 175 204  204  GLN GLN A . n 
A 1 176 ARG 176 205  205  ARG ARG A . n 
A 1 177 SER 177 206  206  SER SER A . n 
A 1 178 GLU 178 207  207  GLU GLU A . n 
A 1 179 ARG 179 208  208  ARG ARG A . n 
A 1 180 LYS 180 209  209  LYS LYS A . n 
A 1 181 LYS 181 210  210  LYS LYS A . n 
A 1 182 TRP 182 211  211  TRP TRP A . n 
A 1 183 ILE 183 212  212  ILE ILE A . n 
A 1 184 HIS 184 213  213  HIS HIS A . n 
A 1 185 CYS 185 214  214  CYS CYS A . n 
A 1 186 PHE 186 215  215  PHE PHE A . n 
A 1 187 GLU 187 216  216  GLU GLU A . n 
A 1 188 GLY 188 217  217  GLY GLY A . n 
A 1 189 VAL 189 218  218  VAL VAL A . n 
A 1 190 THR 190 219  219  THR THR A . n 
A 1 191 ALA 191 220  220  ALA ALA A . n 
A 1 192 ILE 192 221  221  ILE ILE A . n 
A 1 193 ILE 193 222  222  ILE ILE A . n 
A 1 194 PHE 194 223  223  PHE PHE A . n 
A 1 195 CYS 195 224  224  CYS CYS A . n 
A 1 196 VAL 196 225  225  VAL VAL A . n 
A 1 197 ALA 197 226  226  ALA ALA A . n 
A 1 198 LEU 198 227  227  LEU LEU A . n 
A 1 199 SER 199 228  228  SER SER A . n 
A 1 200 ASP 200 229  229  ASP ASP A . n 
A 1 201 TYR 201 230  230  TYR TYR A . n 
A 1 202 ASP 202 231  231  ASP ASP A . n 
A 1 203 LEU 203 232  232  LEU LEU A . n 
A 1 204 VAL 204 233  233  VAL VAL A . n 
A 1 205 LEU 205 234  234  LEU LEU A . n 
A 1 206 ALA 206 235  235  ALA ALA A . n 
A 1 207 GLU 207 236  236  GLU GLU A . n 
A 1 208 ASP 208 237  237  ASP ASP A . n 
A 1 209 GLU 209 238  238  GLU GLU A . n 
A 1 210 GLU 210 239  239  GLU GLU A . n 
A 1 211 MET 211 240  240  MET MET A . n 
A 1 212 ASN 212 241  241  ASN ASN A . n 
A 1 213 ARG 213 242  242  ARG ARG A . n 
A 1 214 MET 214 243  243  MET MET A . n 
A 1 215 HIS 215 244  244  HIS HIS A . n 
A 1 216 GLU 216 245  245  GLU GLU A . n 
A 1 217 SER 217 246  246  SER SER A . n 
A 1 218 MET 218 247  247  MET MET A . n 
A 1 219 LYS 219 248  248  LYS LYS A . n 
A 1 220 LEU 220 249  249  LEU LEU A . n 
A 1 221 PHE 221 250  250  PHE PHE A . n 
A 1 222 ASP 222 251  251  ASP ASP A . n 
A 1 223 SER 223 252  252  SER SER A . n 
A 1 224 ILE 224 253  253  ILE ILE A . n 
A 1 225 CYS 225 254  254  CYS CYS A . n 
A 1 226 ASN 226 255  255  ASN ASN A . n 
A 1 227 ASN 227 256  256  ASN ASN A . n 
A 1 228 LYS 228 257  257  LYS LYS A . n 
A 1 229 TRP 229 258  258  TRP TRP A . n 
A 1 230 PHE 230 259  259  PHE PHE A . n 
A 1 231 THR 231 260  260  THR THR A . n 
A 1 232 ASP 232 261  261  ASP ASP A . n 
A 1 233 THR 233 262  262  THR THR A . n 
A 1 234 SER 234 263  263  SER SER A . n 
A 1 235 ILE 235 264  264  ILE ILE A . n 
A 1 236 ILE 236 265  265  ILE ILE A . n 
A 1 237 LEU 237 266  266  LEU LEU A . n 
A 1 238 PHE 238 267  267  PHE PHE A . n 
A 1 239 LEU 239 268  268  LEU LEU A . n 
A 1 240 ASN 240 269  269  ASN ASN A . n 
A 1 241 LYS 241 270  270  LYS LYS A . n 
A 1 242 LYS 242 271  271  LYS LYS A . n 
A 1 243 ASP 243 272  272  ASP ASP A . n 
A 1 244 LEU 244 273  273  LEU LEU A . n 
A 1 245 PHE 245 274  274  PHE PHE A . n 
A 1 246 GLU 246 275  275  GLU GLU A . n 
A 1 247 GLU 247 276  276  GLU GLU A . n 
A 1 248 LYS 248 277  277  LYS LYS A . n 
A 1 249 ILE 249 278  278  ILE ILE A . n 
A 1 250 LYS 250 279  279  LYS LYS A . n 
A 1 251 LYS 251 280  280  LYS LYS A . n 
A 1 252 SER 252 281  281  SER SER A . n 
A 1 253 PRO 253 282  282  PRO PRO A . n 
A 1 254 LEU 254 283  283  LEU LEU A . n 
A 1 255 THR 255 284  284  THR THR A . n 
A 1 256 ILE 256 285  285  ILE ILE A . n 
A 1 257 CYS 257 286  286  CYS CYS A . n 
A 1 258 TYR 258 287  287  TYR TYR A . n 
A 1 259 PRO 259 288  288  PRO PRO A . n 
A 1 260 GLU 260 289  289  GLU GLU A . n 
A 1 261 TYR 261 290  290  TYR TYR A . n 
A 1 262 ALA 262 291  291  ALA ALA A . n 
A 1 263 GLY 263 292  292  GLY GLY A . n 
A 1 264 SER 264 293  293  SER SER A . n 
A 1 265 ASN 265 294  294  ASN ASN A . n 
A 1 266 THR 266 295  295  THR THR A . n 
A 1 267 TYR 267 296  296  TYR TYR A . n 
A 1 268 GLU 268 297  297  GLU GLU A . n 
A 1 269 GLU 269 298  298  GLU GLU A . n 
A 1 270 ALA 270 299  299  ALA ALA A . n 
A 1 271 ALA 271 300  300  ALA ALA A . n 
A 1 272 ALA 272 301  301  ALA ALA A . n 
A 1 273 TYR 273 302  302  TYR TYR A . n 
A 1 274 ILE 274 303  303  ILE ILE A . n 
A 1 275 GLN 275 304  304  GLN GLN A . n 
A 1 276 CYS 276 305  305  CYS CYS A . n 
A 1 277 GLN 277 306  306  GLN GLN A . n 
A 1 278 PHE 278 307  307  PHE PHE A . n 
A 1 279 GLU 279 308  308  GLU GLU A . n 
A 1 280 ASP 280 309  309  ASP ASP A . n 
A 1 281 LEU 281 310  310  LEU LEU A . n 
A 1 282 ASN 282 311  311  ASN ASN A . n 
A 1 283 LYS 283 312  312  LYS LYS A . n 
A 1 284 ARG 284 313  313  ARG ARG A . n 
A 1 285 LYS 285 314  314  LYS LYS A . n 
A 1 286 ASP 286 315  315  ASP ASP A . n 
A 1 287 THR 287 316  316  THR THR A . n 
A 1 288 LYS 288 317  317  LYS LYS A . n 
A 1 289 GLU 289 318  318  GLU GLU A . n 
A 1 290 ILE 290 319  319  ILE ILE A . n 
A 1 291 TYR 291 320  320  TYR TYR A . n 
A 1 292 THR 292 321  321  THR THR A . n 
A 1 293 HIS 293 322  322  HIS HIS A . n 
A 1 294 PHE 294 323  323  PHE PHE A . n 
A 1 295 THR 295 324  324  THR THR A . n 
A 1 296 CYS 296 325  325  CYS CYS A . n 
A 1 297 ALA 297 326  326  ALA ALA A . n 
A 1 298 THR 298 327  327  THR THR A . n 
A 1 299 ASP 299 328  328  ASP ASP A . n 
A 1 300 THR 300 329  329  THR THR A . n 
A 1 301 LYS 301 330  330  LYS LYS A . n 
A 1 302 ASN 302 331  331  ASN ASN A . n 
A 1 303 VAL 303 332  332  VAL VAL A . n 
A 1 304 GLN 304 333  333  GLN GLN A . n 
A 1 305 PHE 305 334  334  PHE PHE A . n 
A 1 306 VAL 306 335  335  VAL VAL A . n 
A 1 307 PHE 307 336  336  PHE PHE A . n 
A 1 308 ASP 308 337  337  ASP ASP A . n 
A 1 309 ALA 309 338  338  ALA ALA A . n 
A 1 310 VAL 310 339  339  VAL VAL A . n 
A 1 311 THR 311 340  340  THR THR A . n 
A 1 312 ASP 312 341  341  ASP ASP A . n 
A 1 313 VAL 313 342  342  VAL VAL A . n 
A 1 314 ILE 314 343  343  ILE ILE A . n 
A 1 315 ILE 315 344  344  ILE ILE A . n 
A 1 316 LYS 316 345  345  LYS LYS A . n 
A 1 317 ASN 317 346  346  ASN ASN A . n 
A 1 318 ASN 318 347  347  ASN ASN A . n 
A 1 319 LEU 319 348  348  LEU LEU A . n 
A 1 320 LYS 320 349  349  LYS ALA A . n 
A 1 321 ASP 321 350  ?    ?   ?   A . n 
A 1 322 CYS 322 351  ?    ?   ?   A . n 
A 1 323 GLY 323 352  ?    ?   ?   A . n 
A 1 324 LEU 324 353  ?    ?   ?   A . n 
A 1 325 PHE 325 354  ?    ?   ?   A . n 
B 2 1   ASP 1   496  496  ASP ASP B . n 
B 2 2   ILE 2   497  497  ILE ILE B . n 
B 2 3   GLU 3   498  498  GLU GLU B . n 
B 2 4   GLY 4   499  499  GLY GLY B . n 
B 2 5   LEU 5   500  500  LEU LEU B . n 
B 2 6   VAL 6   501  501  VAL VAL B . n 
B 2 7   GLU 7   502  502  GLU GLU B . n 
B 2 8   LEU 8   503  503  LEU LEU B . n 
B 2 9   LEU 9   504  504  LEU LEU B . n 
B 2 10  ASN 10  505  505  ASN ASN B . n 
B 2 11  ARG 11  506  506  ARG ARG B . n 
B 2 12  VAL 12  507  507  VAL VAL B . n 
B 2 13  GLN 13  508  508  GLN GLN B . n 
B 2 14  SER 14  509  509  SER SER B . n 
B 2 15  SER 15  510  510  SER SER B . n 
B 2 16  GLY 16  511  511  GLY GLY B . n 
B 2 17  ALA 17  512  512  ALA ALA B . n 
B 2 18  HIS 18  513  513  HIS HIS B . n 
B 2 19  ASP 19  514  514  ASP ASP B . n 
B 2 20  GLN 20  515  515  GLN GLN B . n 
B 2 21  ARG 21  516  516  ARG ARG B . n 
B 2 22  GLY 22  517  517  GLY GLY B . n 
B 2 23  LEU 23  518  518  LEU LEU B . n 
B 2 24  LEU 24  519  519  LEU LEU B . n 
B 2 25  ARG 25  520  520  ARG ARG B . n 
B 2 26  LYS 26  521  521  LYS LYS B . n 
B 2 27  GLU 27  522  522  GLU GLU B . n 
B 2 28  ASP 28  523  523  ASP ASP B . n 
B 2 29  LEU 29  524  524  LEU LEU B . n 
B 2 30  VAL 30  525  525  VAL VAL B . n 
B 2 31  LEU 31  526  526  LEU LEU B . n 
B 2 32  PRO 32  527  527  PRO PRO B . n 
B 2 33  GLU 33  528  528  GLU GLU B . n 
B 2 34  PHE 34  529  529  PHE PHE B . n 
B 2 35  LEU 35  530  530  LEU LEU B . n 
B 2 36  GLN 36  531  531  GLN GLN B . n 
C 1 1   GLY 1   1030 1030 GLY GLY C . n 
C 1 2   ALA 2   1031 1031 ALA ALA C . n 
C 1 3   ARG 3   1032 1032 ARG ARG C . n 
C 1 4   GLU 4   1033 1033 GLU GLU C . n 
C 1 5   VAL 5   1034 1034 VAL VAL C . n 
C 1 6   LYS 6   1035 1035 LYS LYS C . n 
C 1 7   LEU 7   1036 1036 LEU LEU C . n 
C 1 8   LEU 8   1037 1037 LEU LEU C . n 
C 1 9   LEU 9   1038 1038 LEU LEU C . n 
C 1 10  LEU 10  1039 1039 LEU LEU C . n 
C 1 11  GLY 11  1040 1040 GLY GLY C . n 
C 1 12  ALA 12  1041 1041 ALA ALA C . n 
C 1 13  GLY 13  1042 1042 GLY GLY C . n 
C 1 14  GLU 14  1043 1043 GLU GLU C . n 
C 1 15  SER 15  1044 1044 SER SER C . n 
C 1 16  GLY 16  1045 1045 GLY GLY C . n 
C 1 17  LYS 17  1046 1046 LYS LYS C . n 
C 1 18  SER 18  1047 1047 SER SER C . n 
C 1 19  THR 19  1048 1048 THR THR C . n 
C 1 20  ILE 20  1049 1049 ILE ILE C . n 
C 1 21  VAL 21  1050 1050 VAL VAL C . n 
C 1 22  LYS 22  1051 1051 LYS LYS C . n 
C 1 23  GLN 23  1052 1052 GLN GLN C . n 
C 1 24  MET 24  1053 1053 MET MET C . n 
C 1 25  LYS 25  1054 1054 LYS LYS C . n 
C 1 26  ILE 26  1055 1055 ILE ILE C . n 
C 1 27  ILE 27  1056 1056 ILE ILE C . n 
C 1 28  HIS 28  1057 1057 HIS HIS C . n 
C 1 29  GLU 29  1058 1058 GLU GLU C . n 
C 1 30  ALA 30  1059 1059 ALA ALA C . n 
C 1 31  GLY 31  1060 1060 GLY GLY C . n 
C 1 32  TYR 32  1061 1061 TYR TYR C . n 
C 1 33  SER 33  1062 1062 SER SER C . n 
C 1 34  GLU 34  1063 1063 GLU GLU C . n 
C 1 35  GLU 35  1064 1064 GLU GLU C . n 
C 1 36  GLU 36  1065 1065 GLU GLU C . n 
C 1 37  CYS 37  1066 1066 CYS CYS C . n 
C 1 38  LYS 38  1067 1067 LYS LYS C . n 
C 1 39  GLN 39  1068 1068 GLN GLN C . n 
C 1 40  TYR 40  1069 1069 TYR TYR C . n 
C 1 41  LYS 41  1070 1070 LYS LYS C . n 
C 1 42  ALA 42  1071 1071 ALA ALA C . n 
C 1 43  VAL 43  1072 1072 VAL VAL C . n 
C 1 44  VAL 44  1073 1073 VAL VAL C . n 
C 1 45  TYR 45  1074 1074 TYR TYR C . n 
C 1 46  SER 46  1075 1075 SER SER C . n 
C 1 47  ASN 47  1076 1076 ASN ASN C . n 
C 1 48  THR 48  1077 1077 THR THR C . n 
C 1 49  ILE 49  1078 1078 ILE ILE C . n 
C 1 50  GLN 50  1079 1079 GLN GLN C . n 
C 1 51  SER 51  1080 1080 SER SER C . n 
C 1 52  ILE 52  1081 1081 ILE ILE C . n 
C 1 53  ILE 53  1082 1082 ILE ILE C . n 
C 1 54  ALA 54  1083 1083 ALA ALA C . n 
C 1 55  ILE 55  1084 1084 ILE ILE C . n 
C 1 56  ILE 56  1085 1085 ILE ILE C . n 
C 1 57  ARG 57  1086 1086 ARG ARG C . n 
C 1 58  ALA 58  1087 1087 ALA ALA C . n 
C 1 59  MET 59  1088 1088 MET MET C . n 
C 1 60  GLY 60  1089 1089 GLY GLY C . n 
C 1 61  ARG 61  1090 1090 ARG ARG C . n 
C 1 62  LEU 62  1091 1091 LEU LEU C . n 
C 1 63  LYS 63  1092 1092 LYS LYS C . n 
C 1 64  ILE 64  1093 1093 ILE ILE C . n 
C 1 65  ASP 65  1094 1094 ASP ASP C . n 
C 1 66  PHE 66  1095 1095 PHE PHE C . n 
C 1 67  GLY 67  1096 1096 GLY GLY C . n 
C 1 68  ASP 68  1097 1097 ASP ASP C . n 
C 1 69  SER 69  1098 1098 SER SER C . n 
C 1 70  ALA 70  1099 1099 ALA ALA C . n 
C 1 71  ARG 71  1100 1100 ARG ARG C . n 
C 1 72  ALA 72  1101 1101 ALA ALA C . n 
C 1 73  ASP 73  1102 1102 ASP ASP C . n 
C 1 74  ASP 74  1103 1103 ASP ASP C . n 
C 1 75  ALA 75  1104 1104 ALA ALA C . n 
C 1 76  ARG 76  1105 1105 ARG ARG C . n 
C 1 77  GLN 77  1106 1106 GLN GLN C . n 
C 1 78  LEU 78  1107 1107 LEU LEU C . n 
C 1 79  PHE 79  1108 1108 PHE PHE C . n 
C 1 80  VAL 80  1109 1109 VAL VAL C . n 
C 1 81  LEU 81  1110 1110 LEU LEU C . n 
C 1 82  ALA 82  1111 1111 ALA ALA C . n 
C 1 83  GLY 83  1112 1112 GLY GLY C . n 
C 1 84  ALA 84  1113 1113 ALA ALA C . n 
C 1 85  ALA 85  1114 1114 ALA ALA C . n 
C 1 86  GLU 86  1115 1115 GLU GLU C . n 
C 1 87  GLU 87  1116 1116 GLU GLU C . n 
C 1 88  GLY 88  1117 1117 GLY GLY C . n 
C 1 89  PHE 89  1118 1118 PHE PHE C . n 
C 1 90  MET 90  1119 1119 MET MET C . n 
C 1 91  THR 91  1120 1120 THR THR C . n 
C 1 92  ALA 92  1121 1121 ALA ALA C . n 
C 1 93  GLU 93  1122 1122 GLU GLU C . n 
C 1 94  LEU 94  1123 1123 LEU LEU C . n 
C 1 95  ALA 95  1124 1124 ALA ALA C . n 
C 1 96  GLY 96  1125 1125 GLY GLY C . n 
C 1 97  VAL 97  1126 1126 VAL VAL C . n 
C 1 98  ILE 98  1127 1127 ILE ILE C . n 
C 1 99  LYS 99  1128 1128 LYS LYS C . n 
C 1 100 ARG 100 1129 1129 ARG ARG C . n 
C 1 101 LEU 101 1130 1130 LEU LEU C . n 
C 1 102 TRP 102 1131 1131 TRP TRP C . n 
C 1 103 LYS 103 1132 1132 LYS LYS C . n 
C 1 104 ASP 104 1133 1133 ASP ASP C . n 
C 1 105 SER 105 1134 1134 SER SER C . n 
C 1 106 GLY 106 1135 1135 GLY GLY C . n 
C 1 107 VAL 107 1136 1136 VAL VAL C . n 
C 1 108 GLN 108 1137 1137 GLN GLN C . n 
C 1 109 ALA 109 1138 1138 ALA ALA C . n 
C 1 110 CYS 110 1139 1139 CYS CYS C . n 
C 1 111 PHE 111 1140 1140 PHE PHE C . n 
C 1 112 ASN 112 1141 1141 ASN ASN C . n 
C 1 113 ARG 113 1142 1142 ARG ARG C . n 
C 1 114 SER 114 1143 1143 SER SER C . n 
C 1 115 ARG 115 1144 1144 ARG ARG C . n 
C 1 116 GLU 116 1145 1145 GLU GLU C . n 
C 1 117 TYR 117 1146 1146 TYR TYR C . n 
C 1 118 GLN 118 1147 1147 GLN GLN C . n 
C 1 119 LEU 119 1148 1148 LEU LEU C . n 
C 1 120 ASN 120 1149 1149 ASN ASN C . n 
C 1 121 ASP 121 1150 1150 ASP ASP C . n 
C 1 122 SER 122 1151 1151 SER SER C . n 
C 1 123 ALA 123 1152 1152 ALA ALA C . n 
C 1 124 ALA 124 1153 1153 ALA ALA C . n 
C 1 125 TYR 125 1154 1154 TYR TYR C . n 
C 1 126 TYR 126 1155 1155 TYR TYR C . n 
C 1 127 LEU 127 1156 1156 LEU LEU C . n 
C 1 128 ASN 128 1157 1157 ASN ASN C . n 
C 1 129 ASP 129 1158 1158 ASP ASP C . n 
C 1 130 LEU 130 1159 1159 LEU LEU C . n 
C 1 131 ASP 131 1160 1160 ASP ASP C . n 
C 1 132 ARG 132 1161 1161 ARG ARG C . n 
C 1 133 ILE 133 1162 1162 ILE ILE C . n 
C 1 134 ALA 134 1163 1163 ALA ALA C . n 
C 1 135 GLN 135 1164 1164 GLN GLN C . n 
C 1 136 PRO 136 1165 1165 PRO PRO C . n 
C 1 137 ASN 137 1166 1166 ASN ASN C . n 
C 1 138 TYR 138 1167 1167 TYR TYR C . n 
C 1 139 ILE 139 1168 1168 ILE ILE C . n 
C 1 140 PRO 140 1169 1169 PRO PRO C . n 
C 1 141 THR 141 1170 1170 THR THR C . n 
C 1 142 GLN 142 1171 1171 GLN GLN C . n 
C 1 143 GLN 143 1172 1172 GLN GLN C . n 
C 1 144 ASP 144 1173 1173 ASP ASP C . n 
C 1 145 VAL 145 1174 1174 VAL VAL C . n 
C 1 146 LEU 146 1175 1175 LEU LEU C . n 
C 1 147 ARG 147 1176 1176 ARG ARG C . n 
C 1 148 THR 148 1177 1177 THR THR C . n 
C 1 149 ARG 149 1178 1178 ARG ARG C . n 
C 1 150 VAL 150 1179 1179 VAL VAL C . n 
C 1 151 LYS 151 1180 1180 LYS LYS C . n 
C 1 152 THR 152 1181 1181 THR THR C . n 
C 1 153 THR 153 1182 1182 THR THR C . n 
C 1 154 GLY 154 1183 1183 GLY GLY C . n 
C 1 155 ILE 155 1184 1184 ILE ILE C . n 
C 1 156 VAL 156 1185 1185 VAL VAL C . n 
C 1 157 GLU 157 1186 1186 GLU GLU C . n 
C 1 158 THR 158 1187 1187 THR THR C . n 
C 1 159 HIS 159 1188 1188 HIS HIS C . n 
C 1 160 PHE 160 1189 1189 PHE PHE C . n 
C 1 161 THR 161 1190 1190 THR THR C . n 
C 1 162 PHE 162 1191 1191 PHE PHE C . n 
C 1 163 LYS 163 1192 1192 LYS LYS C . n 
C 1 164 ASP 164 1193 1193 ASP ASP C . n 
C 1 165 LEU 165 1194 1194 LEU LEU C . n 
C 1 166 HIS 166 1195 1195 HIS HIS C . n 
C 1 167 PHE 167 1196 1196 PHE PHE C . n 
C 1 168 LYS 168 1197 1197 LYS LYS C . n 
C 1 169 MET 169 1198 1198 MET MET C . n 
C 1 170 PHE 170 1199 1199 PHE PHE C . n 
C 1 171 ASP 171 1200 1200 ASP ASP C . n 
C 1 172 VAL 172 1201 1201 VAL VAL C . n 
C 1 173 GLY 173 1202 1202 GLY GLY C . n 
C 1 174 GLY 174 1203 1203 GLY GLY C . n 
C 1 175 GLN 175 1204 1204 GLN GLN C . n 
C 1 176 ARG 176 1205 1205 ARG ARG C . n 
C 1 177 SER 177 1206 1206 SER SER C . n 
C 1 178 GLU 178 1207 1207 GLU GLU C . n 
C 1 179 ARG 179 1208 1208 ARG ARG C . n 
C 1 180 LYS 180 1209 1209 LYS LYS C . n 
C 1 181 LYS 181 1210 1210 LYS LYS C . n 
C 1 182 TRP 182 1211 1211 TRP TRP C . n 
C 1 183 ILE 183 1212 1212 ILE ILE C . n 
C 1 184 HIS 184 1213 1213 HIS HIS C . n 
C 1 185 CYS 185 1214 1214 CYS CYS C . n 
C 1 186 PHE 186 1215 1215 PHE PHE C . n 
C 1 187 GLU 187 1216 1216 GLU GLU C . n 
C 1 188 GLY 188 1217 1217 GLY GLY C . n 
C 1 189 VAL 189 1218 1218 VAL VAL C . n 
C 1 190 THR 190 1219 1219 THR THR C . n 
C 1 191 ALA 191 1220 1220 ALA ALA C . n 
C 1 192 ILE 192 1221 1221 ILE ILE C . n 
C 1 193 ILE 193 1222 1222 ILE ILE C . n 
C 1 194 PHE 194 1223 1223 PHE PHE C . n 
C 1 195 CYS 195 1224 1224 CYS CYS C . n 
C 1 196 VAL 196 1225 1225 VAL VAL C . n 
C 1 197 ALA 197 1226 1226 ALA ALA C . n 
C 1 198 LEU 198 1227 1227 LEU LEU C . n 
C 1 199 SER 199 1228 1228 SER SER C . n 
C 1 200 ASP 200 1229 1229 ASP ASP C . n 
C 1 201 TYR 201 1230 1230 TYR TYR C . n 
C 1 202 ASP 202 1231 1231 ASP ASP C . n 
C 1 203 LEU 203 1232 1232 LEU LEU C . n 
C 1 204 VAL 204 1233 1233 VAL VAL C . n 
C 1 205 LEU 205 1234 1234 LEU LEU C . n 
C 1 206 ALA 206 1235 1235 ALA ALA C . n 
C 1 207 GLU 207 1236 1236 GLU GLU C . n 
C 1 208 ASP 208 1237 1237 ASP ASP C . n 
C 1 209 GLU 209 1238 1238 GLU GLU C . n 
C 1 210 GLU 210 1239 1239 GLU GLU C . n 
C 1 211 MET 211 1240 1240 MET MET C . n 
C 1 212 ASN 212 1241 1241 ASN ASN C . n 
C 1 213 ARG 213 1242 1242 ARG ARG C . n 
C 1 214 MET 214 1243 1243 MET MET C . n 
C 1 215 HIS 215 1244 1244 HIS HIS C . n 
C 1 216 GLU 216 1245 1245 GLU GLU C . n 
C 1 217 SER 217 1246 1246 SER SER C . n 
C 1 218 MET 218 1247 1247 MET MET C . n 
C 1 219 LYS 219 1248 1248 LYS LYS C . n 
C 1 220 LEU 220 1249 1249 LEU LEU C . n 
C 1 221 PHE 221 1250 1250 PHE PHE C . n 
C 1 222 ASP 222 1251 1251 ASP ASP C . n 
C 1 223 SER 223 1252 1252 SER SER C . n 
C 1 224 ILE 224 1253 1253 ILE ILE C . n 
C 1 225 CYS 225 1254 1254 CYS CYS C . n 
C 1 226 ASN 226 1255 1255 ASN ASN C . n 
C 1 227 ASN 227 1256 1256 ASN ASN C . n 
C 1 228 LYS 228 1257 1257 LYS LYS C . n 
C 1 229 TRP 229 1258 1258 TRP TRP C . n 
C 1 230 PHE 230 1259 1259 PHE PHE C . n 
C 1 231 THR 231 1260 1260 THR THR C . n 
C 1 232 ASP 232 1261 1261 ASP ASP C . n 
C 1 233 THR 233 1262 1262 THR THR C . n 
C 1 234 SER 234 1263 1263 SER SER C . n 
C 1 235 ILE 235 1264 1264 ILE ILE C . n 
C 1 236 ILE 236 1265 1265 ILE ILE C . n 
C 1 237 LEU 237 1266 1266 LEU LEU C . n 
C 1 238 PHE 238 1267 1267 PHE PHE C . n 
C 1 239 LEU 239 1268 1268 LEU LEU C . n 
C 1 240 ASN 240 1269 1269 ASN ASN C . n 
C 1 241 LYS 241 1270 1270 LYS LYS C . n 
C 1 242 LYS 242 1271 1271 LYS LYS C . n 
C 1 243 ASP 243 1272 1272 ASP ASP C . n 
C 1 244 LEU 244 1273 1273 LEU LEU C . n 
C 1 245 PHE 245 1274 1274 PHE PHE C . n 
C 1 246 GLU 246 1275 1275 GLU GLU C . n 
C 1 247 GLU 247 1276 1276 GLU GLU C . n 
C 1 248 LYS 248 1277 1277 LYS LYS C . n 
C 1 249 ILE 249 1278 1278 ILE ILE C . n 
C 1 250 LYS 250 1279 1279 LYS LYS C . n 
C 1 251 LYS 251 1280 1280 LYS LYS C . n 
C 1 252 SER 252 1281 1281 SER SER C . n 
C 1 253 PRO 253 1282 1282 PRO PRO C . n 
C 1 254 LEU 254 1283 1283 LEU LEU C . n 
C 1 255 THR 255 1284 1284 THR THR C . n 
C 1 256 ILE 256 1285 1285 ILE ILE C . n 
C 1 257 CYS 257 1286 1286 CYS CYS C . n 
C 1 258 TYR 258 1287 1287 TYR TYR C . n 
C 1 259 PRO 259 1288 1288 PRO PRO C . n 
C 1 260 GLU 260 1289 1289 GLU GLU C . n 
C 1 261 TYR 261 1290 1290 TYR TYR C . n 
C 1 262 ALA 262 1291 1291 ALA ALA C . n 
C 1 263 GLY 263 1292 1292 GLY GLY C . n 
C 1 264 SER 264 1293 1293 SER SER C . n 
C 1 265 ASN 265 1294 1294 ASN ASN C . n 
C 1 266 THR 266 1295 1295 THR THR C . n 
C 1 267 TYR 267 1296 1296 TYR TYR C . n 
C 1 268 GLU 268 1297 1297 GLU GLU C . n 
C 1 269 GLU 269 1298 1298 GLU GLU C . n 
C 1 270 ALA 270 1299 1299 ALA ALA C . n 
C 1 271 ALA 271 1300 1300 ALA ALA C . n 
C 1 272 ALA 272 1301 1301 ALA ALA C . n 
C 1 273 TYR 273 1302 1302 TYR TYR C . n 
C 1 274 ILE 274 1303 1303 ILE ILE C . n 
C 1 275 GLN 275 1304 1304 GLN GLN C . n 
C 1 276 CYS 276 1305 1305 CYS CYS C . n 
C 1 277 GLN 277 1306 1306 GLN GLN C . n 
C 1 278 PHE 278 1307 1307 PHE PHE C . n 
C 1 279 GLU 279 1308 1308 GLU GLU C . n 
C 1 280 ASP 280 1309 1309 ASP ASP C . n 
C 1 281 LEU 281 1310 1310 LEU LEU C . n 
C 1 282 ASN 282 1311 1311 ASN ASN C . n 
C 1 283 LYS 283 1312 1312 LYS LYS C . n 
C 1 284 ARG 284 1313 1313 ARG ARG C . n 
C 1 285 LYS 285 1314 1314 LYS LYS C . n 
C 1 286 ASP 286 1315 1315 ASP ASP C . n 
C 1 287 THR 287 1316 1316 THR THR C . n 
C 1 288 LYS 288 1317 1317 LYS LYS C . n 
C 1 289 GLU 289 1318 1318 GLU GLU C . n 
C 1 290 ILE 290 1319 1319 ILE ILE C . n 
C 1 291 TYR 291 1320 1320 TYR TYR C . n 
C 1 292 THR 292 1321 1321 THR THR C . n 
C 1 293 HIS 293 1322 1322 HIS HIS C . n 
C 1 294 PHE 294 1323 1323 PHE PHE C . n 
C 1 295 THR 295 1324 1324 THR THR C . n 
C 1 296 CYS 296 1325 1325 CYS CYS C . n 
C 1 297 ALA 297 1326 1326 ALA ALA C . n 
C 1 298 THR 298 1327 1327 THR THR C . n 
C 1 299 ASP 299 1328 1328 ASP ASP C . n 
C 1 300 THR 300 1329 1329 THR THR C . n 
C 1 301 LYS 301 1330 1330 LYS LYS C . n 
C 1 302 ASN 302 1331 1331 ASN ASN C . n 
C 1 303 VAL 303 1332 1332 VAL VAL C . n 
C 1 304 GLN 304 1333 1333 GLN GLN C . n 
C 1 305 PHE 305 1334 1334 PHE PHE C . n 
C 1 306 VAL 306 1335 1335 VAL VAL C . n 
C 1 307 PHE 307 1336 1336 PHE PHE C . n 
C 1 308 ASP 308 1337 1337 ASP ASP C . n 
C 1 309 ALA 309 1338 1338 ALA ALA C . n 
C 1 310 VAL 310 1339 1339 VAL VAL C . n 
C 1 311 THR 311 1340 1340 THR THR C . n 
C 1 312 ASP 312 1341 1341 ASP ASP C . n 
C 1 313 VAL 313 1342 1342 VAL VAL C . n 
C 1 314 ILE 314 1343 1343 ILE ILE C . n 
C 1 315 ILE 315 1344 1344 ILE ILE C . n 
C 1 316 LYS 316 1345 1345 LYS LYS C . n 
C 1 317 ASN 317 1346 1346 ASN ASN C . n 
C 1 318 ASN 318 1347 1347 ASN ASN C . n 
C 1 319 LEU 319 1348 ?    ?   ?   C . n 
C 1 320 LYS 320 1349 ?    ?   ?   C . n 
C 1 321 ASP 321 1350 ?    ?   ?   C . n 
C 1 322 CYS 322 1351 ?    ?   ?   C . n 
C 1 323 GLY 323 1352 ?    ?   ?   C . n 
C 1 324 LEU 324 1353 ?    ?   ?   C . n 
C 1 325 PHE 325 1354 ?    ?   ?   C . n 
D 2 1   ASP 1   1496 1496 ASP ASP D . n 
D 2 2   ILE 2   1497 1497 ILE ILE D . n 
D 2 3   GLU 3   1498 1498 GLU GLU D . n 
D 2 4   GLY 4   1499 1499 GLY GLY D . n 
D 2 5   LEU 5   1500 1500 LEU LEU D . n 
D 2 6   VAL 6   1501 1501 VAL VAL D . n 
D 2 7   GLU 7   1502 1502 GLU GLU D . n 
D 2 8   LEU 8   1503 1503 LEU LEU D . n 
D 2 9   LEU 9   1504 1504 LEU LEU D . n 
D 2 10  ASN 10  1505 1505 ASN ASN D . n 
D 2 11  ARG 11  1506 1506 ARG ARG D . n 
D 2 12  VAL 12  1507 1507 VAL VAL D . n 
D 2 13  GLN 13  1508 1508 GLN GLN D . n 
D 2 14  SER 14  1509 1509 SER SER D . n 
D 2 15  SER 15  1510 1510 SER SER D . n 
D 2 16  GLY 16  1511 1511 GLY GLY D . n 
D 2 17  ALA 17  1512 1512 ALA ALA D . n 
D 2 18  HIS 18  1513 1513 HIS HIS D . n 
D 2 19  ASP 19  1514 1514 ASP ASP D . n 
D 2 20  GLN 20  1515 1515 GLN GLN D . n 
D 2 21  ARG 21  1516 1516 ARG ARG D . n 
D 2 22  GLY 22  1517 1517 GLY GLY D . n 
D 2 23  LEU 23  1518 1518 LEU LEU D . n 
D 2 24  LEU 24  1519 1519 LEU LEU D . n 
D 2 25  ARG 25  1520 1520 ARG ARG D . n 
D 2 26  LYS 26  1521 1521 LYS LYS D . n 
D 2 27  GLU 27  1522 1522 GLU GLU D . n 
D 2 28  ASP 28  1523 1523 ASP ASP D . n 
D 2 29  LEU 29  1524 1524 LEU LEU D . n 
D 2 30  VAL 30  1525 1525 VAL VAL D . n 
D 2 31  LEU 31  1526 1526 LEU LEU D . n 
D 2 32  PRO 32  1527 1527 PRO PRO D . n 
D 2 33  GLU 33  1528 1528 GLU GLU D . n 
D 2 34  PHE 34  1529 1529 PHE PHE D . n 
D 2 35  LEU 35  1530 1530 LEU LEU D . n 
D 2 36  GLN 36  1531 1531 GLN GLN D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 MG  1   800  800  MG  MG  A . 
F 4 GDP 1   355  355  GDP GDP A . 
G 3 MG  1   801  801  MG  MG  C . 
H 4 GDP 1   356  356  GDP GDP C . 
I 5 HOH 1   4002 4002 HOH WAT A . 
I 5 HOH 2   4004 4004 HOH WAT A . 
I 5 HOH 3   4005 4005 HOH WAT A . 
I 5 HOH 4   4006 4006 HOH WAT A . 
I 5 HOH 5   4007 4007 HOH WAT A . 
I 5 HOH 6   4008 4008 HOH WAT A . 
I 5 HOH 7   4009 4009 HOH WAT A . 
I 5 HOH 8   4013 4013 HOH WAT A . 
I 5 HOH 9   4014 4014 HOH WAT A . 
I 5 HOH 10  4016 4016 HOH WAT A . 
I 5 HOH 11  4017 4017 HOH WAT A . 
I 5 HOH 12  4019 4019 HOH WAT A . 
I 5 HOH 13  4021 4021 HOH WAT A . 
I 5 HOH 14  4024 4024 HOH WAT A . 
I 5 HOH 15  4029 4029 HOH WAT A . 
I 5 HOH 16  4031 4031 HOH WAT A . 
I 5 HOH 17  4032 4032 HOH WAT A . 
I 5 HOH 18  4038 4038 HOH WAT A . 
I 5 HOH 19  4040 4040 HOH WAT A . 
I 5 HOH 20  4041 4041 HOH WAT A . 
I 5 HOH 21  4049 4049 HOH WAT A . 
I 5 HOH 22  4051 4051 HOH WAT A . 
I 5 HOH 23  4052 4052 HOH WAT A . 
I 5 HOH 24  4054 4054 HOH WAT A . 
I 5 HOH 25  4059 4059 HOH WAT A . 
I 5 HOH 26  4060 4060 HOH WAT A . 
I 5 HOH 27  4061 4061 HOH WAT A . 
I 5 HOH 28  4062 4062 HOH WAT A . 
I 5 HOH 29  4063 4063 HOH WAT A . 
I 5 HOH 30  4064 4064 HOH WAT A . 
I 5 HOH 31  4065 4065 HOH WAT A . 
I 5 HOH 32  4066 4066 HOH WAT A . 
I 5 HOH 33  4067 4067 HOH WAT A . 
I 5 HOH 34  4069 4069 HOH WAT A . 
I 5 HOH 35  4071 4071 HOH WAT A . 
I 5 HOH 36  4072 4072 HOH WAT A . 
I 5 HOH 37  4074 4074 HOH WAT A . 
I 5 HOH 38  4076 4076 HOH WAT A . 
I 5 HOH 39  4081 4081 HOH WAT A . 
I 5 HOH 40  4084 4084 HOH WAT A . 
I 5 HOH 41  4089 4089 HOH WAT A . 
I 5 HOH 42  4090 4090 HOH WAT A . 
I 5 HOH 43  4091 4091 HOH WAT A . 
I 5 HOH 44  4093 4093 HOH WAT A . 
I 5 HOH 45  4096 4096 HOH WAT A . 
I 5 HOH 46  4098 4098 HOH WAT A . 
I 5 HOH 47  4099 4099 HOH WAT A . 
I 5 HOH 48  4102 4102 HOH WAT A . 
I 5 HOH 49  4103 4103 HOH WAT A . 
I 5 HOH 50  4105 4105 HOH WAT A . 
I 5 HOH 51  4107 4107 HOH WAT A . 
I 5 HOH 52  4111 4111 HOH WAT A . 
I 5 HOH 53  4114 4114 HOH WAT A . 
I 5 HOH 54  4116 4116 HOH WAT A . 
I 5 HOH 55  4119 4119 HOH WAT A . 
I 5 HOH 56  4120 4120 HOH WAT A . 
I 5 HOH 57  4121 4121 HOH WAT A . 
I 5 HOH 58  4122 4122 HOH WAT A . 
I 5 HOH 59  4123 4123 HOH WAT A . 
I 5 HOH 60  4124 4124 HOH WAT A . 
I 5 HOH 61  4125 4125 HOH WAT A . 
I 5 HOH 62  4126 4126 HOH WAT A . 
I 5 HOH 63  4127 4127 HOH WAT A . 
I 5 HOH 64  4132 4132 HOH WAT A . 
I 5 HOH 65  4136 4136 HOH WAT A . 
I 5 HOH 66  4137 4137 HOH WAT A . 
I 5 HOH 67  4139 4139 HOH WAT A . 
I 5 HOH 68  4140 4140 HOH WAT A . 
I 5 HOH 69  4143 4143 HOH WAT A . 
I 5 HOH 70  4145 4145 HOH WAT A . 
I 5 HOH 71  4146 4146 HOH WAT A . 
I 5 HOH 72  4147 4147 HOH WAT A . 
I 5 HOH 73  4149 4149 HOH WAT A . 
I 5 HOH 74  4152 4152 HOH WAT A . 
I 5 HOH 75  4160 4160 HOH WAT A . 
I 5 HOH 76  4162 4162 HOH WAT A . 
I 5 HOH 77  4164 4164 HOH WAT A . 
I 5 HOH 78  4167 4167 HOH WAT A . 
I 5 HOH 79  4168 4168 HOH WAT A . 
I 5 HOH 80  4169 4169 HOH WAT A . 
I 5 HOH 81  4170 4170 HOH WAT A . 
I 5 HOH 82  4171 4171 HOH WAT A . 
I 5 HOH 83  4172 4172 HOH WAT A . 
I 5 HOH 84  4176 4176 HOH WAT A . 
I 5 HOH 85  4180 4180 HOH WAT A . 
I 5 HOH 86  4181 4181 HOH WAT A . 
I 5 HOH 87  4183 4183 HOH WAT A . 
I 5 HOH 88  4184 4184 HOH WAT A . 
I 5 HOH 89  4186 4186 HOH WAT A . 
I 5 HOH 90  4189 4189 HOH WAT A . 
I 5 HOH 91  4190 4190 HOH WAT A . 
I 5 HOH 92  4191 4191 HOH WAT A . 
I 5 HOH 93  4198 4198 HOH WAT A . 
I 5 HOH 94  4199 4199 HOH WAT A . 
I 5 HOH 95  4203 4203 HOH WAT A . 
I 5 HOH 96  4209 4209 HOH WAT A . 
I 5 HOH 97  4211 4211 HOH WAT A . 
I 5 HOH 98  4216 4216 HOH WAT A . 
I 5 HOH 99  4219 4219 HOH WAT A . 
I 5 HOH 100 4221 4221 HOH WAT A . 
I 5 HOH 101 4222 4222 HOH WAT A . 
I 5 HOH 102 4223 4223 HOH WAT A . 
I 5 HOH 103 4224 4224 HOH WAT A . 
I 5 HOH 104 4225 4225 HOH WAT A . 
I 5 HOH 105 4227 4227 HOH WAT A . 
I 5 HOH 106 4230 4230 HOH WAT A . 
I 5 HOH 107 4232 4232 HOH WAT A . 
I 5 HOH 108 4233 4233 HOH WAT A . 
I 5 HOH 109 4234 4234 HOH WAT A . 
I 5 HOH 110 4239 4239 HOH WAT A . 
I 5 HOH 111 4240 4240 HOH WAT A . 
I 5 HOH 112 4242 4242 HOH WAT A . 
I 5 HOH 113 4243 4243 HOH WAT A . 
I 5 HOH 114 4245 4245 HOH WAT A . 
I 5 HOH 115 4250 4250 HOH WAT A . 
I 5 HOH 116 4253 4253 HOH WAT A . 
I 5 HOH 117 4257 4257 HOH WAT A . 
I 5 HOH 118 4258 4258 HOH WAT A . 
I 5 HOH 119 4260 4260 HOH WAT A . 
I 5 HOH 120 4262 4262 HOH WAT A . 
I 5 HOH 121 4267 4267 HOH WAT A . 
I 5 HOH 122 4269 4269 HOH WAT A . 
I 5 HOH 123 4272 4272 HOH WAT A . 
I 5 HOH 124 4276 4276 HOH WAT A . 
I 5 HOH 125 4279 4279 HOH WAT A . 
I 5 HOH 126 4284 4284 HOH WAT A . 
I 5 HOH 127 4285 4285 HOH WAT A . 
I 5 HOH 128 4286 4286 HOH WAT A . 
J 5 HOH 1   4080 4080 HOH WAT B . 
J 5 HOH 2   4082 4082 HOH WAT B . 
J 5 HOH 3   4083 4083 HOH WAT B . 
J 5 HOH 4   4130 4130 HOH WAT B . 
J 5 HOH 5   4144 4144 HOH WAT B . 
J 5 HOH 6   4158 4158 HOH WAT B . 
J 5 HOH 7   4235 4235 HOH WAT B . 
J 5 HOH 8   4246 4246 HOH WAT B . 
K 5 HOH 1   4001 4001 HOH WAT C . 
K 5 HOH 2   4003 4003 HOH WAT C . 
K 5 HOH 3   4010 4010 HOH WAT C . 
K 5 HOH 4   4011 4011 HOH WAT C . 
K 5 HOH 5   4012 4012 HOH WAT C . 
K 5 HOH 6   4015 4015 HOH WAT C . 
K 5 HOH 7   4018 4018 HOH WAT C . 
K 5 HOH 8   4020 4020 HOH WAT C . 
K 5 HOH 9   4022 4022 HOH WAT C . 
K 5 HOH 10  4023 4023 HOH WAT C . 
K 5 HOH 11  4025 4025 HOH WAT C . 
K 5 HOH 12  4026 4026 HOH WAT C . 
K 5 HOH 13  4027 4027 HOH WAT C . 
K 5 HOH 14  4028 4028 HOH WAT C . 
K 5 HOH 15  4030 4030 HOH WAT C . 
K 5 HOH 16  4033 4033 HOH WAT C . 
K 5 HOH 17  4034 4034 HOH WAT C . 
K 5 HOH 18  4035 4035 HOH WAT C . 
K 5 HOH 19  4036 4036 HOH WAT C . 
K 5 HOH 20  4037 4037 HOH WAT C . 
K 5 HOH 21  4039 4039 HOH WAT C . 
K 5 HOH 22  4042 4042 HOH WAT C . 
K 5 HOH 23  4043 4043 HOH WAT C . 
K 5 HOH 24  4044 4044 HOH WAT C . 
K 5 HOH 25  4045 4045 HOH WAT C . 
K 5 HOH 26  4046 4046 HOH WAT C . 
K 5 HOH 27  4047 4047 HOH WAT C . 
K 5 HOH 28  4048 4048 HOH WAT C . 
K 5 HOH 29  4050 4050 HOH WAT C . 
K 5 HOH 30  4053 4053 HOH WAT C . 
K 5 HOH 31  4055 4055 HOH WAT C . 
K 5 HOH 32  4056 4056 HOH WAT C . 
K 5 HOH 33  4057 4057 HOH WAT C . 
K 5 HOH 34  4058 4058 HOH WAT C . 
K 5 HOH 35  4068 4068 HOH WAT C . 
K 5 HOH 36  4070 4070 HOH WAT C . 
K 5 HOH 37  4073 4073 HOH WAT C . 
K 5 HOH 38  4075 4075 HOH WAT C . 
K 5 HOH 39  4077 4077 HOH WAT C . 
K 5 HOH 40  4078 4078 HOH WAT C . 
K 5 HOH 41  4079 4079 HOH WAT C . 
K 5 HOH 42  4085 4085 HOH WAT C . 
K 5 HOH 43  4086 4086 HOH WAT C . 
K 5 HOH 44  4087 4087 HOH WAT C . 
K 5 HOH 45  4088 4088 HOH WAT C . 
K 5 HOH 46  4092 4092 HOH WAT C . 
K 5 HOH 47  4094 4094 HOH WAT C . 
K 5 HOH 48  4095 4095 HOH WAT C . 
K 5 HOH 49  4097 4097 HOH WAT C . 
K 5 HOH 50  4101 4101 HOH WAT C . 
K 5 HOH 51  4104 4104 HOH WAT C . 
K 5 HOH 52  4106 4106 HOH WAT C . 
K 5 HOH 53  4108 4108 HOH WAT C . 
K 5 HOH 54  4109 4109 HOH WAT C . 
K 5 HOH 55  4110 4110 HOH WAT C . 
K 5 HOH 56  4112 4112 HOH WAT C . 
K 5 HOH 57  4113 4113 HOH WAT C . 
K 5 HOH 58  4115 4115 HOH WAT C . 
K 5 HOH 59  4117 4117 HOH WAT C . 
K 5 HOH 60  4118 4118 HOH WAT C . 
K 5 HOH 61  4128 4128 HOH WAT C . 
K 5 HOH 62  4129 4129 HOH WAT C . 
K 5 HOH 63  4131 4131 HOH WAT C . 
K 5 HOH 64  4133 4133 HOH WAT C . 
K 5 HOH 65  4134 4134 HOH WAT C . 
K 5 HOH 66  4135 4135 HOH WAT C . 
K 5 HOH 67  4138 4138 HOH WAT C . 
K 5 HOH 68  4141 4141 HOH WAT C . 
K 5 HOH 69  4142 4142 HOH WAT C . 
K 5 HOH 70  4148 4148 HOH WAT C . 
K 5 HOH 71  4150 4150 HOH WAT C . 
K 5 HOH 72  4151 4151 HOH WAT C . 
K 5 HOH 73  4153 4153 HOH WAT C . 
K 5 HOH 74  4154 4154 HOH WAT C . 
K 5 HOH 75  4155 4155 HOH WAT C . 
K 5 HOH 76  4156 4156 HOH WAT C . 
K 5 HOH 77  4159 4159 HOH WAT C . 
K 5 HOH 78  4161 4161 HOH WAT C . 
K 5 HOH 79  4163 4163 HOH WAT C . 
K 5 HOH 80  4165 4165 HOH WAT C . 
K 5 HOH 81  4166 4166 HOH WAT C . 
K 5 HOH 82  4173 4173 HOH WAT C . 
K 5 HOH 83  4174 4174 HOH WAT C . 
K 5 HOH 84  4175 4175 HOH WAT C . 
K 5 HOH 85  4177 4177 HOH WAT C . 
K 5 HOH 86  4178 4178 HOH WAT C . 
K 5 HOH 87  4179 4179 HOH WAT C . 
K 5 HOH 88  4182 4182 HOH WAT C . 
K 5 HOH 89  4185 4185 HOH WAT C . 
K 5 HOH 90  4187 4187 HOH WAT C . 
K 5 HOH 91  4188 4188 HOH WAT C . 
K 5 HOH 92  4192 4192 HOH WAT C . 
K 5 HOH 93  4193 4193 HOH WAT C . 
K 5 HOH 94  4194 4194 HOH WAT C . 
K 5 HOH 95  4195 4195 HOH WAT C . 
K 5 HOH 96  4196 4196 HOH WAT C . 
K 5 HOH 97  4197 4197 HOH WAT C . 
K 5 HOH 98  4200 4200 HOH WAT C . 
K 5 HOH 99  4202 4202 HOH WAT C . 
K 5 HOH 100 4204 4204 HOH WAT C . 
K 5 HOH 101 4205 4205 HOH WAT C . 
K 5 HOH 102 4206 4206 HOH WAT C . 
K 5 HOH 103 4207 4207 HOH WAT C . 
K 5 HOH 104 4208 4208 HOH WAT C . 
K 5 HOH 105 4210 4210 HOH WAT C . 
K 5 HOH 106 4212 4212 HOH WAT C . 
K 5 HOH 107 4213 4213 HOH WAT C . 
K 5 HOH 108 4214 4214 HOH WAT C . 
K 5 HOH 109 4215 4215 HOH WAT C . 
K 5 HOH 110 4217 4217 HOH WAT C . 
K 5 HOH 111 4218 4218 HOH WAT C . 
K 5 HOH 112 4220 4220 HOH WAT C . 
K 5 HOH 113 4226 4226 HOH WAT C . 
K 5 HOH 114 4228 4228 HOH WAT C . 
K 5 HOH 115 4231 4231 HOH WAT C . 
K 5 HOH 116 4236 4236 HOH WAT C . 
K 5 HOH 117 4237 4237 HOH WAT C . 
K 5 HOH 118 4238 4238 HOH WAT C . 
K 5 HOH 119 4241 4241 HOH WAT C . 
K 5 HOH 120 4244 4244 HOH WAT C . 
K 5 HOH 121 4247 4247 HOH WAT C . 
K 5 HOH 122 4248 4248 HOH WAT C . 
K 5 HOH 123 4249 4249 HOH WAT C . 
K 5 HOH 124 4251 4251 HOH WAT C . 
K 5 HOH 125 4252 4252 HOH WAT C . 
K 5 HOH 126 4254 4254 HOH WAT C . 
K 5 HOH 127 4255 4255 HOH WAT C . 
K 5 HOH 128 4256 4256 HOH WAT C . 
K 5 HOH 129 4259 4259 HOH WAT C . 
K 5 HOH 130 4261 4261 HOH WAT C . 
K 5 HOH 131 4263 4263 HOH WAT C . 
K 5 HOH 132 4264 4264 HOH WAT C . 
K 5 HOH 133 4265 4265 HOH WAT C . 
K 5 HOH 134 4268 4268 HOH WAT C . 
K 5 HOH 135 4270 4270 HOH WAT C . 
K 5 HOH 136 4271 4271 HOH WAT C . 
K 5 HOH 137 4273 4273 HOH WAT C . 
K 5 HOH 138 4274 4274 HOH WAT C . 
K 5 HOH 139 4275 4275 HOH WAT C . 
K 5 HOH 140 4277 4277 HOH WAT C . 
K 5 HOH 141 4278 4278 HOH WAT C . 
K 5 HOH 142 4280 4280 HOH WAT C . 
K 5 HOH 143 4281 4281 HOH WAT C . 
K 5 HOH 144 4282 4282 HOH WAT C . 
K 5 HOH 145 4283 4283 HOH WAT C . 
L 5 HOH 1   4100 4100 HOH WAT D . 
L 5 HOH 2   4157 4157 HOH WAT D . 
L 5 HOH 3   4201 4201 HOH WAT D . 
L 5 HOH 4   4229 4229 HOH WAT D . 
L 5 HOH 5   4266 4266 HOH WAT D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,I,J 
2 1 C,D,G,H,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4720  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  16150 ? 
2 'ABSA (A^2)' 4550  ? 
2 MORE         -36   ? 
2 'SSA (A^2)'  16270 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O2B ? F GDP .   ? A GDP 355  ? 1_555 MG ? E MG . ? A MG 800 ? 1_555 O   ? J HOH .   ? B HOH 4158 ? 1_555 106.1 ? 
2 O2B ? F GDP .   ? A GDP 355  ? 1_555 MG ? E MG . ? A MG 800 ? 1_555 O   ? I HOH .   ? A HOH 4062 ? 1_555 124.4 ? 
3 O   ? J HOH .   ? B HOH 4158 ? 1_555 MG ? E MG . ? A MG 800 ? 1_555 O   ? I HOH .   ? A HOH 4062 ? 1_555 96.9  ? 
4 O1B ? H GDP .   ? C GDP 356  ? 1_555 MG ? G MG . ? C MG 801 ? 1_555 OD2 ? C ASP 171 ? C ASP 1200 ? 1_555 133.1 ? 
5 O1B ? H GDP .   ? C GDP 356  ? 1_555 MG ? G MG . ? C MG 801 ? 1_555 O   ? C LYS 17  ? C LYS 1046 ? 1_555 55.6  ? 
6 OD2 ? C ASP 171 ? C ASP 1200 ? 1_555 MG ? G MG . ? C MG 801 ? 1_555 O   ? C LYS 17  ? C LYS 1046 ? 1_555 77.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-07-10 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
CNS         .     ?                package 'Axel T. Brunger' axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/    Fortran_77 ? 1 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB               sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/ C++        ? 2 
HKL-2000    .     ?                ?       ?                 ?                        'data collection' ? ?          ? 3 
DENZO       .     ?                ?       ?                 ?                        'data reduction'  ? ?          ? 4 
SCALEPACK   .     ?                ?       ?                 ?                        'data scaling'    ? ?          ? 5 
CNS         .     ?                ?       ?                 ?                        phasing           ? ?          ? 6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    178 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    516 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 31   ? ? -68.80  86.03   
2  1 GLU A 58   ? ? -132.66 -158.43 
3  1 ASP A 158  ? ? -99.78  30.06   
4  1 PHE A 189  ? ? -177.68 146.21  
5  1 GLN A 204  ? ? -54.97  108.31  
6  1 ASN A 294  ? ? -94.20  43.06   
7  1 ARG A 313  ? ? -140.91 57.65   
8  1 THR A 316  ? ? -77.19  -79.17  
9  1 ASN A 347  ? ? -80.70  31.99   
10 1 LEU A 348  ? ? 33.20   46.73   
11 1 ILE B 497  ? ? 72.08   -32.71  
12 1 ARG B 516  ? ? -131.12 -40.38  
13 1 ARG C 1032 ? ? 63.26   100.45  
14 1 SER C 1047 ? ? 154.01  -49.14  
15 1 TYR C 1146 ? ? -142.80 -156.25 
16 1 THR C 1182 ? ? 46.07   -128.32 
17 1 ILE C 1184 ? ? -21.88  115.98  
18 1 ARG C 1205 ? ? -63.07  94.57   
19 1 LEU C 1227 ? ? 70.20   -56.70  
20 1 LYS C 1312 ? ? -94.27  41.51   
21 1 ARG C 1313 ? ? -156.82 31.68   
22 1 THR C 1316 ? ? -85.86  -77.52  
23 1 LYS D 1521 ? ? -38.07  -37.41  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 349 ? CG ? A LYS 320 CG 
2 1 Y 1 A LYS 349 ? CD ? A LYS 320 CD 
3 1 Y 1 A LYS 349 ? CE ? A LYS 320 CE 
4 1 Y 1 A LYS 349 ? NZ ? A LYS 320 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 350  ? A ASP 321 
2  1 Y 1 A CYS 351  ? A CYS 322 
3  1 Y 1 A GLY 352  ? A GLY 323 
4  1 Y 1 A LEU 353  ? A LEU 324 
5  1 Y 1 A PHE 354  ? A PHE 325 
6  1 Y 1 C LEU 1348 ? C LEU 319 
7  1 Y 1 C LYS 1349 ? C LYS 320 
8  1 Y 1 C ASP 1350 ? C ASP 321 
9  1 Y 1 C CYS 1351 ? C CYS 322 
10 1 Y 1 C GLY 1352 ? C GLY 323 
11 1 Y 1 C LEU 1353 ? C LEU 324 
12 1 Y 1 C PHE 1354 ? C PHE 325 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'            MG  
4 "GUANOSINE-5'-DIPHOSPHATE" GDP 
5 water                      HOH 
#