data_2OM5
# 
_entry.id   2OM5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OM5         
RCSB  RCSB041307   
WWPDB D_1000041307 
# 
_pdbx_database_status.entry_id                        2OM5 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moertl, M.'      1 
'Sonderegger, P.' 2 
'Diederichs, K.'  3 
'Welte, W.'       4 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of the ligand-binding module of human TAG-1 suggests a new mode of homophilic interaction' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            16 
_citation.page_first                2174 
_citation.page_last                 2183 
_citation.year                      2007 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17766378 
_citation.pdbx_database_id_DOI      10.1110/ps.072802707 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mortl, M.'       1 
primary 'Sonderegger, P.' 2 
primary 'Diederichs, K.'  3 
primary 'Welte, W.'       4 
# 
_cell.entry_id           2OM5 
_cell.length_a           46.804 
_cell.length_b           106.916 
_cell.length_c           161.366 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OM5 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Contactin 2' 
_entity.formula_weight             42213.488 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'N TERMINAL FOUR IG DOMAINS' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TAX1; Axonin-1; Axonal glycoprotein TAG-1; Transient axonal glycoprotein 1; TAX-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLA
SNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLY
IARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKW
RKVDGSLSPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGK
PRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLA
SNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLY
IARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKW
RKVDGSLSPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGK
PRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   PHE n 
1 3   GLY n 
1 4   PRO n 
1 5   VAL n 
1 6   PHE n 
1 7   GLU n 
1 8   ASP n 
1 9   GLN n 
1 10  PRO n 
1 11  LEU n 
1 12  SER n 
1 13  VAL n 
1 14  LEU n 
1 15  PHE n 
1 16  PRO n 
1 17  GLU n 
1 18  GLU n 
1 19  SER n 
1 20  THR n 
1 21  GLU n 
1 22  GLU n 
1 23  GLN n 
1 24  VAL n 
1 25  LEU n 
1 26  LEU n 
1 27  ALA n 
1 28  CYS n 
1 29  ARG n 
1 30  ALA n 
1 31  ARG n 
1 32  ALA n 
1 33  SER n 
1 34  PRO n 
1 35  PRO n 
1 36  ALA n 
1 37  THR n 
1 38  TYR n 
1 39  ARG n 
1 40  TRP n 
1 41  LYS n 
1 42  MET n 
1 43  ASN n 
1 44  GLY n 
1 45  THR n 
1 46  GLU n 
1 47  MET n 
1 48  LYS n 
1 49  LEU n 
1 50  GLU n 
1 51  PRO n 
1 52  GLY n 
1 53  SER n 
1 54  ARG n 
1 55  HIS n 
1 56  GLN n 
1 57  LEU n 
1 58  VAL n 
1 59  GLY n 
1 60  GLY n 
1 61  ASN n 
1 62  LEU n 
1 63  VAL n 
1 64  ILE n 
1 65  MET n 
1 66  ASN n 
1 67  PRO n 
1 68  THR n 
1 69  LYS n 
1 70  ALA n 
1 71  GLN n 
1 72  ASP n 
1 73  ALA n 
1 74  GLY n 
1 75  VAL n 
1 76  TYR n 
1 77  GLN n 
1 78  CYS n 
1 79  LEU n 
1 80  ALA n 
1 81  SER n 
1 82  ASN n 
1 83  PRO n 
1 84  VAL n 
1 85  GLY n 
1 86  THR n 
1 87  VAL n 
1 88  VAL n 
1 89  SER n 
1 90  ARG n 
1 91  GLU n 
1 92  ALA n 
1 93  ILE n 
1 94  LEU n 
1 95  ARG n 
1 96  PHE n 
1 97  GLY n 
1 98  PHE n 
1 99  LEU n 
1 100 GLN n 
1 101 GLU n 
1 102 PHE n 
1 103 SER n 
1 104 LYS n 
1 105 GLU n 
1 106 GLU n 
1 107 ARG n 
1 108 ASP n 
1 109 PRO n 
1 110 VAL n 
1 111 LYS n 
1 112 ALA n 
1 113 HIS n 
1 114 GLU n 
1 115 GLY n 
1 116 TRP n 
1 117 GLY n 
1 118 VAL n 
1 119 MET n 
1 120 LEU n 
1 121 PRO n 
1 122 CYS n 
1 123 ASN n 
1 124 PRO n 
1 125 PRO n 
1 126 ALA n 
1 127 HIS n 
1 128 TYR n 
1 129 PRO n 
1 130 GLY n 
1 131 LEU n 
1 132 SER n 
1 133 TYR n 
1 134 ARG n 
1 135 TRP n 
1 136 LEU n 
1 137 LEU n 
1 138 ASN n 
1 139 GLU n 
1 140 PHE n 
1 141 PRO n 
1 142 ASN n 
1 143 PHE n 
1 144 ILE n 
1 145 PRO n 
1 146 THR n 
1 147 ASP n 
1 148 GLY n 
1 149 ARG n 
1 150 HIS n 
1 151 PHE n 
1 152 VAL n 
1 153 SER n 
1 154 GLN n 
1 155 THR n 
1 156 THR n 
1 157 GLY n 
1 158 ASN n 
1 159 LEU n 
1 160 TYR n 
1 161 ILE n 
1 162 ALA n 
1 163 ARG n 
1 164 THR n 
1 165 ASN n 
1 166 ALA n 
1 167 SER n 
1 168 ASP n 
1 169 LEU n 
1 170 GLY n 
1 171 ASN n 
1 172 TYR n 
1 173 SER n 
1 174 CYS n 
1 175 LEU n 
1 176 ALA n 
1 177 THR n 
1 178 SER n 
1 179 HIS n 
1 180 MET n 
1 181 ASP n 
1 182 PHE n 
1 183 SER n 
1 184 THR n 
1 185 LYS n 
1 186 SER n 
1 187 VAL n 
1 188 PHE n 
1 189 SER n 
1 190 LYS n 
1 191 PHE n 
1 192 ALA n 
1 193 GLN n 
1 194 LEU n 
1 195 ASN n 
1 196 LEU n 
1 197 ALA n 
1 198 ALA n 
1 199 GLU n 
1 200 ASP n 
1 201 THR n 
1 202 ARG n 
1 203 LEU n 
1 204 PHE n 
1 205 ALA n 
1 206 PRO n 
1 207 SER n 
1 208 ILE n 
1 209 LYS n 
1 210 ALA n 
1 211 ARG n 
1 212 PHE n 
1 213 PRO n 
1 214 ALA n 
1 215 GLU n 
1 216 THR n 
1 217 TYR n 
1 218 ALA n 
1 219 LEU n 
1 220 VAL n 
1 221 GLY n 
1 222 GLN n 
1 223 GLN n 
1 224 VAL n 
1 225 THR n 
1 226 LEU n 
1 227 GLU n 
1 228 CYS n 
1 229 PHE n 
1 230 ALA n 
1 231 PHE n 
1 232 GLY n 
1 233 ASN n 
1 234 PRO n 
1 235 VAL n 
1 236 PRO n 
1 237 ARG n 
1 238 ILE n 
1 239 LYS n 
1 240 TRP n 
1 241 ARG n 
1 242 LYS n 
1 243 VAL n 
1 244 ASP n 
1 245 GLY n 
1 246 SER n 
1 247 LEU n 
1 248 SER n 
1 249 PRO n 
1 250 GLN n 
1 251 TRP n 
1 252 THR n 
1 253 THR n 
1 254 ALA n 
1 255 GLU n 
1 256 PRO n 
1 257 THR n 
1 258 LEU n 
1 259 GLN n 
1 260 ILE n 
1 261 PRO n 
1 262 SER n 
1 263 VAL n 
1 264 SER n 
1 265 PHE n 
1 266 GLU n 
1 267 ASP n 
1 268 GLU n 
1 269 GLY n 
1 270 THR n 
1 271 TYR n 
1 272 GLU n 
1 273 CYS n 
1 274 GLU n 
1 275 ALA n 
1 276 GLU n 
1 277 ASN n 
1 278 SER n 
1 279 LYS n 
1 280 GLY n 
1 281 ARG n 
1 282 ASP n 
1 283 THR n 
1 284 VAL n 
1 285 GLN n 
1 286 GLY n 
1 287 ARG n 
1 288 ILE n 
1 289 ILE n 
1 290 VAL n 
1 291 GLN n 
1 292 ALA n 
1 293 GLN n 
1 294 PRO n 
1 295 GLU n 
1 296 TRP n 
1 297 LEU n 
1 298 LYS n 
1 299 VAL n 
1 300 ILE n 
1 301 SER n 
1 302 ASP n 
1 303 THR n 
1 304 GLU n 
1 305 ALA n 
1 306 ASP n 
1 307 ILE n 
1 308 GLY n 
1 309 SER n 
1 310 ASN n 
1 311 LEU n 
1 312 ARG n 
1 313 TRP n 
1 314 GLY n 
1 315 CYS n 
1 316 ALA n 
1 317 ALA n 
1 318 ALA n 
1 319 GLY n 
1 320 LYS n 
1 321 PRO n 
1 322 ARG n 
1 323 PRO n 
1 324 THR n 
1 325 VAL n 
1 326 ARG n 
1 327 TRP n 
1 328 LEU n 
1 329 ARG n 
1 330 ASN n 
1 331 GLY n 
1 332 GLU n 
1 333 PRO n 
1 334 LEU n 
1 335 ALA n 
1 336 SER n 
1 337 GLN n 
1 338 ASN n 
1 339 ARG n 
1 340 VAL n 
1 341 GLU n 
1 342 VAL n 
1 343 LEU n 
1 344 ALA n 
1 345 GLY n 
1 346 ASP n 
1 347 LEU n 
1 348 ARG n 
1 349 PHE n 
1 350 SER n 
1 351 LYS n 
1 352 LEU n 
1 353 SER n 
1 354 LEU n 
1 355 GLU n 
1 356 ASP n 
1 357 SER n 
1 358 GLY n 
1 359 MET n 
1 360 TYR n 
1 361 GLN n 
1 362 CYS n 
1 363 VAL n 
1 364 ALA n 
1 365 GLU n 
1 366 ASN n 
1 367 LYS n 
1 368 HIS n 
1 369 GLY n 
1 370 THR n 
1 371 ILE n 
1 372 TYR n 
1 373 ALA n 
1 374 SER n 
1 375 ALA n 
1 376 GLU n 
1 377 LEU n 
1 378 ALA n 
1 379 VAL n 
1 380 GLN n 
1 381 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CNTN2, TAG1, TAX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CNTN2_HUMAN 
_struct_ref.pdbx_db_accession          Q02246 
_struct_ref.pdbx_align_begin           34 
_struct_ref.pdbx_seq_one_letter_code   
;TFGPVFEDQPLSVLFPEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLVGGNLVIMNPTKAQDAGVYQCLA
SNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYPGLSYRWLLNEFPNFIPTDGRHFVSQTTGNLY
IARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFPAETYALVGQQVTLECFAFGNPVPRIKW
RKVDGSLSPQWTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRIIVQAQPEWLKVISDTEADIGSNLRWGCAAAGK
PRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYASAELAVQA
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2OM5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 381 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q02246 
_struct_ref_seq.db_align_beg                  34 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  414 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       4 
_struct_ref_seq.pdbx_auth_seq_align_end       384 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2OM5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.53 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 20k, potassium chloride, tris, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2004-10-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'LN2 COOLED FIXED-EXIT SI(111) MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07068 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.07068 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2OM5 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             19.500 
_reflns.d_resolution_high            3.070 
_reflns.number_obs                   7518 
_reflns.number_all                   7518 
_reflns.percent_possible_obs         94.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.07 
_reflns_shell.d_res_low              3.26 
_reflns_shell.percent_possible_all   76.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OM5 
_refine.ls_number_reflns_obs                     7090 
_refine.ls_number_reflns_all                     7518 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.50 
_refine.ls_d_res_high                            3.07 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.238 
_refine.ls_R_factor_all                          0.238 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.000 
_refine.ls_number_reflns_R_free                  452 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.898 
_refine.correlation_coeff_Fo_to_Fc_free          0.867 
_refine.B_iso_mean                               21.96 
_refine.aniso_B[1][1]                            -1.95000 
_refine.aniso_B[2][2]                            -2.19000 
_refine.aniso_B[3][3]                            4.14000 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.558 
_refine.overall_SU_ML                            0.503 
_refine.overall_SU_B                             65.157 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2895 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2895 
_refine_hist.d_res_high                       3.07 
_refine_hist.d_res_low                        19.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.022  ? 2970 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.078  1.954  ? 4039 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.277  5.000  ? 369  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.349 23.885 ? 139  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.562 15.000 ? 476  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.291 15.000 ? 22   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.072  0.200  ? 436  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.002  0.020  ? 2306 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.191  0.200  ? 1154 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.304  0.200  ? 1918 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.148  0.200  ? 88   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.157  0.200  ? 43   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.149  0.200  ? 8    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.155  1.500  ? 1903 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 0.270  2.000  ? 2985 'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.364  3.000  ? 1216 'X-RAY DIFFRACTION' ? 
r_scangle_it                 0.631  4.500  ? 1054 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.07 
_refine_ls_shell.d_res_low                        ? 
_refine_ls_shell.number_reflns_R_work             323 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OM5 
_struct.title                     'N-Terminal Fragment of Human TAX1' 
_struct.pdbx_descriptor           'Contactin 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OM5 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
'x-ray crystallography; Ig-like C2-type; immunoglobulin superfamily; fibronectin; membrane protein, CELL ADHESION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 68  ? ALA A 73  ? THR A 71  ALA A 76  1 ? 6 
HELX_P HELX_P2 2 SER A 264 ? GLU A 268 ? SER A 267 GLU A 271 5 ? 5 
HELX_P HELX_P3 3 SER A 353 ? SER A 357 ? SER A 356 SER A 360 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 28  SG ? ? ? 1_555 A CYS 78  SG ? ? A CYS 31  A CYS 81  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 174 SG ? ? A CYS 125 A CYS 177 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ? ? A CYS 228 SG ? ? ? 1_555 A CYS 273 SG ? ? A CYS 231 A CYS 276 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf4 disulf ? ? A CYS 315 SG ? ? ? 1_555 A CYS 362 SG ? ? A CYS 318 A CYS 365 1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 33  A . ? SER 36  A PRO 34  A ? PRO 37  A 1 1.22  
2 TYR 128 A . ? TYR 131 A PRO 129 A ? PRO 132 A 1 -1.50 
3 PHE 140 A . ? PHE 143 A PRO 141 A ? PRO 144 A 1 -7.71 
4 ASN 233 A . ? ASN 236 A PRO 234 A ? PRO 237 A 1 0.51  
5 LYS 320 A . ? LYS 323 A PRO 321 A ? PRO 324 A 1 -3.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 5 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 3 ? 
H ? 3 ? 
I ? 2 ? 
J ? 4 ? 
K ? 2 ? 
L ? 2 ? 
M ? 4 ? 
N ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 2   ? ASP A 8   ? PHE A 5   ASP A 11  
A 2 ARG A 29  ? SER A 33  ? ARG A 32  SER A 36  
B 1 VAL A 13  ? PRO A 16  ? VAL A 16  PRO A 19  
B 2 ALA A 92  ? LEU A 99  ? ALA A 95  LEU A 102 
B 3 GLY A 74  ? ASN A 82  ? GLY A 77  ASN A 85  
B 4 GLY A 85  ? VAL A 88  ? GLY A 88  VAL A 91  
C 1 THR A 45  ? GLU A 46  ? THR A 48  GLU A 49  
C 2 THR A 37  ? MET A 42  ? THR A 40  MET A 45  
C 3 GLY A 74  ? ASN A 82  ? GLY A 77  ASN A 85  
C 4 ALA A 92  ? LEU A 99  ? ALA A 95  LEU A 102 
C 5 HIS A 127 ? TYR A 128 ? HIS A 130 TYR A 131 
D 1 GLN A 23  ? LEU A 26  ? GLN A 26  LEU A 29  
D 2 ASN A 61  ? MET A 65  ? ASN A 64  MET A 68  
D 3 HIS A 55  ? VAL A 58  ? HIS A 58  VAL A 61  
E 1 ALA A 112 ? HIS A 113 ? ALA A 115 HIS A 116 
E 2 LEU A 196 ? ALA A 197 ? LEU A 199 ALA A 200 
F 1 VAL A 118 ? LEU A 120 ? VAL A 121 LEU A 123 
F 2 LEU A 159 ? ILE A 161 ? LEU A 162 ILE A 164 
F 3 HIS A 150 ? VAL A 152 ? HIS A 153 VAL A 155 
G 1 SER A 132 ? LEU A 137 ? SER A 135 LEU A 140 
G 2 GLY A 170 ? MET A 180 ? GLY A 173 MET A 183 
G 3 SER A 183 ? PHE A 188 ? SER A 186 PHE A 191 
H 1 SER A 132 ? LEU A 137 ? SER A 135 LEU A 140 
H 2 GLY A 170 ? MET A 180 ? GLY A 173 MET A 183 
H 3 ALA A 192 ? LEU A 194 ? ALA A 195 LEU A 197 
I 1 PHE A 204 ? ALA A 210 ? PHE A 207 ALA A 213 
I 2 PHE A 229 ? ASN A 233 ? PHE A 232 ASN A 236 
J 1 GLU A 215 ? LEU A 219 ? GLU A 218 LEU A 222 
J 2 GLY A 280 ? GLN A 291 ? GLY A 283 GLN A 294 
J 3 GLY A 269 ? ASN A 277 ? GLY A 272 ASN A 280 
J 4 ARG A 237 ? LYS A 242 ? ARG A 240 LYS A 245 
K 1 VAL A 224 ? GLU A 227 ? VAL A 227 GLU A 230 
K 2 THR A 257 ? ILE A 260 ? THR A 260 ILE A 263 
L 1 TRP A 296 ? LYS A 298 ? TRP A 299 LYS A 301 
L 2 ALA A 316 ? ALA A 317 ? ALA A 319 ALA A 320 
M 1 THR A 303 ? ASP A 306 ? THR A 306 ASP A 309 
M 2 THR A 370 ? GLN A 380 ? THR A 373 GLN A 383 
M 3 MET A 359 ? GLU A 365 ? MET A 362 GLU A 368 
M 4 THR A 324 ? ARG A 329 ? THR A 327 ARG A 332 
N 1 LEU A 311 ? GLY A 314 ? LEU A 314 GLY A 317 
N 2 ASP A 346 ? PHE A 349 ? ASP A 349 PHE A 352 
N 3 VAL A 340 ? LEU A 343 ? VAL A 343 LEU A 346 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 7   ? N GLU A 10  O ARG A 29  ? O ARG A 32  
B 1 2 N VAL A 13  ? N VAL A 16  O ARG A 95  ? O ARG A 98  
B 2 3 O LEU A 94  ? O LEU A 97  N GLY A 74  ? N GLY A 77  
B 3 4 N ALA A 80  ? N ALA A 83  O VAL A 87  ? O VAL A 90  
C 1 2 O THR A 45  ? O THR A 48  N MET A 42  ? N MET A 45  
C 2 3 N ARG A 39  ? N ARG A 42  O LEU A 79  ? O LEU A 82  
C 3 4 N GLY A 74  ? N GLY A 77  O LEU A 94  ? O LEU A 97  
C 4 5 N PHE A 98  ? N PHE A 101 O TYR A 128 ? O TYR A 131 
D 1 2 N LEU A 26  ? N LEU A 29  O LEU A 62  ? O LEU A 65  
D 2 3 O ASN A 61  ? O ASN A 64  N VAL A 58  ? N VAL A 61  
E 1 2 N ALA A 112 ? N ALA A 115 O ALA A 197 ? O ALA A 200 
F 1 2 N LEU A 120 ? N LEU A 123 O LEU A 159 ? O LEU A 162 
F 2 3 O TYR A 160 ? O TYR A 163 N PHE A 151 ? N PHE A 154 
G 1 2 N ARG A 134 ? N ARG A 137 O LEU A 175 ? O LEU A 178 
G 2 3 N ALA A 176 ? N ALA A 179 O VAL A 187 ? O VAL A 190 
H 1 2 N ARG A 134 ? N ARG A 137 O LEU A 175 ? O LEU A 178 
H 2 3 N TYR A 172 ? N TYR A 175 O ALA A 192 ? O ALA A 195 
I 1 2 N SER A 207 ? N SER A 210 O PHE A 231 ? O PHE A 234 
J 1 2 N ALA A 218 ? N ALA A 221 O GLN A 291 ? O GLN A 294 
J 2 3 O ASP A 282 ? O ASP A 285 N ALA A 275 ? N ALA A 278 
J 3 4 O GLU A 274 ? O GLU A 277 N LYS A 239 ? N LYS A 242 
K 1 2 N VAL A 224 ? N VAL A 227 O ILE A 260 ? O ILE A 263 
L 1 2 N LEU A 297 ? N LEU A 300 O ALA A 316 ? O ALA A 319 
M 1 2 N ALA A 305 ? N ALA A 308 O GLN A 380 ? O GLN A 383 
M 2 3 O ALA A 373 ? O ALA A 376 N CYS A 362 ? N CYS A 365 
M 3 4 O VAL A 363 ? O VAL A 366 N ARG A 326 ? N ARG A 329 
N 1 2 N TRP A 313 ? N TRP A 316 O LEU A 347 ? O LEU A 350 
N 2 3 O ASP A 346 ? O ASP A 349 N LEU A 343 ? N LEU A 346 
# 
_atom_sites.entry_id                    2OM5 
_atom_sites.fract_transf_matrix[1][1]   0.021366 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009353 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006197 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . THR A 1 1   ? 24.134  -24.882 -23.406 1.00 19.49 ? 4   THR A N   1 
ATOM 2    C CA  . THR A 1 1   ? 22.723  -25.308 -23.654 1.00 19.64 ? 4   THR A CA  1 
ATOM 3    C C   . THR A 1 1   ? 21.800  -24.838 -22.531 1.00 19.82 ? 4   THR A C   1 
ATOM 4    O O   . THR A 1 1   ? 22.262  -24.574 -21.420 1.00 19.87 ? 4   THR A O   1 
ATOM 5    C CB  . THR A 1 1   ? 22.603  -26.833 -23.820 1.00 19.63 ? 4   THR A CB  1 
ATOM 6    O OG1 . THR A 1 1   ? 23.180  -27.485 -22.682 1.00 19.33 ? 4   THR A OG1 1 
ATOM 7    C CG2 . THR A 1 1   ? 23.306  -27.298 -25.101 1.00 19.49 ? 4   THR A CG2 1 
ATOM 8    N N   . PHE A 1 2   ? 20.500  -24.748 -22.827 1.00 20.09 ? 5   PHE A N   1 
ATOM 9    C CA  . PHE A 1 2   ? 19.522  -24.089 -21.939 1.00 20.30 ? 5   PHE A CA  1 
ATOM 10   C C   . PHE A 1 2   ? 18.077  -24.559 -22.153 1.00 20.43 ? 5   PHE A C   1 
ATOM 11   O O   . PHE A 1 2   ? 17.767  -25.223 -23.145 1.00 20.51 ? 5   PHE A O   1 
ATOM 12   C CB  . PHE A 1 2   ? 19.597  -22.565 -22.113 1.00 20.21 ? 5   PHE A CB  1 
ATOM 13   C CG  . PHE A 1 2   ? 19.253  -22.093 -23.500 1.00 20.08 ? 5   PHE A CG  1 
ATOM 14   C CD1 . PHE A 1 2   ? 18.068  -21.416 -23.739 1.00 20.21 ? 5   PHE A CD1 1 
ATOM 15   C CD2 . PHE A 1 2   ? 20.114  -22.332 -24.571 1.00 20.10 ? 5   PHE A CD2 1 
ATOM 16   C CE1 . PHE A 1 2   ? 17.741  -20.980 -25.022 1.00 20.60 ? 5   PHE A CE1 1 
ATOM 17   C CE2 . PHE A 1 2   ? 19.798  -21.902 -25.857 1.00 20.21 ? 5   PHE A CE2 1 
ATOM 18   C CZ  . PHE A 1 2   ? 18.609  -21.226 -26.084 1.00 20.43 ? 5   PHE A CZ  1 
ATOM 19   N N   . GLY A 1 3   ? 17.200  -24.199 -21.218 1.00 20.54 ? 6   GLY A N   1 
ATOM 20   C CA  . GLY A 1 3   ? 15.788  -24.576 -21.277 1.00 20.87 ? 6   GLY A CA  1 
ATOM 21   C C   . GLY A 1 3   ? 14.925  -23.541 -21.976 1.00 21.07 ? 6   GLY A C   1 
ATOM 22   O O   . GLY A 1 3   ? 15.401  -22.439 -22.263 1.00 21.40 ? 6   GLY A O   1 
ATOM 23   N N   . PRO A 1 4   ? 13.634  -23.866 -22.209 1.00 21.01 ? 7   PRO A N   1 
ATOM 24   C CA  . PRO A 1 4   ? 12.780  -23.113 -23.134 1.00 20.79 ? 7   PRO A CA  1 
ATOM 25   C C   . PRO A 1 4   ? 12.488  -21.695 -22.677 1.00 20.57 ? 7   PRO A C   1 
ATOM 26   O O   . PRO A 1 4   ? 12.106  -21.472 -21.528 1.00 20.54 ? 7   PRO A O   1 
ATOM 27   C CB  . PRO A 1 4   ? 11.480  -23.931 -23.175 1.00 20.81 ? 7   PRO A CB  1 
ATOM 28   C CG  . PRO A 1 4   ? 11.810  -25.244 -22.550 1.00 21.10 ? 7   PRO A CG  1 
ATOM 29   C CD  . PRO A 1 4   ? 12.891  -24.959 -21.562 1.00 21.06 ? 7   PRO A CD  1 
ATOM 30   N N   . VAL A 1 5   ? 12.687  -20.746 -23.584 1.00 20.43 ? 8   VAL A N   1 
ATOM 31   C CA  . VAL A 1 5   ? 12.343  -19.353 -23.333 1.00 20.39 ? 8   VAL A CA  1 
ATOM 32   C C   . VAL A 1 5   ? 11.299  -18.928 -24.370 1.00 20.28 ? 8   VAL A C   1 
ATOM 33   O O   . VAL A 1 5   ? 11.566  -18.980 -25.569 1.00 20.21 ? 8   VAL A O   1 
ATOM 34   C CB  . VAL A 1 5   ? 13.590  -18.430 -23.401 1.00 20.39 ? 8   VAL A CB  1 
ATOM 35   C CG1 . VAL A 1 5   ? 13.231  -17.013 -22.960 1.00 20.24 ? 8   VAL A CG1 1 
ATOM 36   C CG2 . VAL A 1 5   ? 14.736  -18.993 -22.557 1.00 19.97 ? 8   VAL A CG2 1 
ATOM 37   N N   . PHE A 1 6   ? 10.117  -18.522 -23.905 1.00 20.11 ? 9   PHE A N   1 
ATOM 38   C CA  . PHE A 1 6   ? 9.006   -18.197 -24.802 1.00 20.06 ? 9   PHE A CA  1 
ATOM 39   C C   . PHE A 1 6   ? 9.295   -16.974 -25.666 1.00 20.12 ? 9   PHE A C   1 
ATOM 40   O O   . PHE A 1 6   ? 9.647   -15.919 -25.147 1.00 20.39 ? 9   PHE A O   1 
ATOM 41   C CB  . PHE A 1 6   ? 7.701   -17.999 -24.018 1.00 19.85 ? 9   PHE A CB  1 
ATOM 42   C CG  . PHE A 1 6   ? 6.952   -19.274 -23.748 1.00 19.60 ? 9   PHE A CG  1 
ATOM 43   C CD1 . PHE A 1 6   ? 6.769   -19.724 -22.440 1.00 19.10 ? 9   PHE A CD1 1 
ATOM 44   C CD2 . PHE A 1 6   ? 6.434   -20.034 -24.800 1.00 19.26 ? 9   PHE A CD2 1 
ATOM 45   C CE1 . PHE A 1 6   ? 6.076   -20.911 -22.175 1.00 18.61 ? 9   PHE A CE1 1 
ATOM 46   C CE2 . PHE A 1 6   ? 5.743   -21.222 -24.548 1.00 19.31 ? 9   PHE A CE2 1 
ATOM 47   C CZ  . PHE A 1 6   ? 5.562   -21.660 -23.226 1.00 19.07 ? 9   PHE A CZ  1 
ATOM 48   N N   . GLU A 1 7   ? 9.147   -17.122 -26.980 1.00 20.18 ? 10  GLU A N   1 
ATOM 49   C CA  . GLU A 1 7   ? 9.356   -16.011 -27.911 1.00 20.26 ? 10  GLU A CA  1 
ATOM 50   C C   . GLU A 1 7   ? 8.044   -15.434 -28.424 1.00 20.37 ? 10  GLU A C   1 
ATOM 51   O O   . GLU A 1 7   ? 7.996   -14.287 -28.862 1.00 20.41 ? 10  GLU A O   1 
ATOM 52   C CB  . GLU A 1 7   ? 10.260  -16.427 -29.073 1.00 20.32 ? 10  GLU A CB  1 
ATOM 53   C CG  . GLU A 1 7   ? 11.743  -16.351 -28.744 1.00 19.94 ? 10  GLU A CG  1 
ATOM 54   C CD  . GLU A 1 7   ? 12.624  -16.995 -29.796 1.00 19.61 ? 10  GLU A CD  1 
ATOM 55   O OE1 . GLU A 1 7   ? 12.217  -18.030 -30.367 1.00 19.66 ? 10  GLU A OE1 1 
ATOM 56   O OE2 . GLU A 1 7   ? 13.731  -16.471 -30.044 1.00 19.55 ? 10  GLU A OE2 1 
ATOM 57   N N   . ASP A 1 8   ? 6.996   -16.251 -28.391 1.00 20.56 ? 11  ASP A N   1 
ATOM 58   C CA  . ASP A 1 8   ? 5.618   -15.788 -28.572 1.00 21.03 ? 11  ASP A CA  1 
ATOM 59   C C   . ASP A 1 8   ? 4.648   -16.813 -28.008 1.00 20.87 ? 11  ASP A C   1 
ATOM 60   O O   . ASP A 1 8   ? 4.923   -18.021 -28.019 1.00 20.83 ? 11  ASP A O   1 
ATOM 61   C CB  . ASP A 1 8   ? 5.277   -15.442 -30.035 1.00 21.33 ? 11  ASP A CB  1 
ATOM 62   C CG  . ASP A 1 8   ? 6.040   -16.290 -31.029 1.00 22.73 ? 11  ASP A CG  1 
ATOM 63   O OD1 . ASP A 1 8   ? 6.665   -15.720 -31.954 1.00 23.20 ? 11  ASP A OD1 1 
ATOM 64   O OD2 . ASP A 1 8   ? 6.027   -17.530 -30.868 1.00 25.18 ? 11  ASP A OD2 1 
ATOM 65   N N   . GLN A 1 9   ? 3.519   -16.300 -27.520 1.00 20.73 ? 12  GLN A N   1 
ATOM 66   C CA  . GLN A 1 9   ? 2.532   -17.052 -26.753 1.00 20.49 ? 12  GLN A CA  1 
ATOM 67   C C   . GLN A 1 9   ? 1.133   -16.779 -27.308 1.00 20.34 ? 12  GLN A C   1 
ATOM 68   O O   . GLN A 1 9   ? 0.917   -15.736 -27.930 1.00 20.50 ? 12  GLN A O   1 
ATOM 69   C CB  . GLN A 1 9   ? 2.603   -16.620 -25.283 1.00 20.54 ? 12  GLN A CB  1 
ATOM 70   C CG  . GLN A 1 9   ? 3.950   -16.892 -24.621 1.00 20.62 ? 12  GLN A CG  1 
ATOM 71   C CD  . GLN A 1 9   ? 4.149   -16.116 -23.340 1.00 20.52 ? 12  GLN A CD  1 
ATOM 72   O OE1 . GLN A 1 9   ? 3.495   -16.379 -22.328 1.00 20.30 ? 12  GLN A OE1 1 
ATOM 73   N NE2 . GLN A 1 9   ? 5.073   -15.160 -23.370 1.00 20.58 ? 12  GLN A NE2 1 
ATOM 74   N N   . PRO A 1 10  ? 0.175   -17.701 -27.085 1.00 20.11 ? 13  PRO A N   1 
ATOM 75   C CA  . PRO A 1 10  ? -1.184  -17.510 -27.594 1.00 19.97 ? 13  PRO A CA  1 
ATOM 76   C C   . PRO A 1 10  ? -1.928  -16.366 -26.915 1.00 19.85 ? 13  PRO A C   1 
ATOM 77   O O   . PRO A 1 10  ? -1.941  -16.277 -25.690 1.00 19.97 ? 13  PRO A O   1 
ATOM 78   C CB  . PRO A 1 10  ? -1.864  -18.844 -27.274 1.00 19.85 ? 13  PRO A CB  1 
ATOM 79   C CG  . PRO A 1 10  ? -1.125  -19.360 -26.114 1.00 20.08 ? 13  PRO A CG  1 
ATOM 80   C CD  . PRO A 1 10  ? 0.297   -18.977 -26.362 1.00 20.26 ? 13  PRO A CD  1 
ATOM 81   N N   . LEU A 1 11  ? -2.521  -15.488 -27.718 1.00 19.89 ? 14  LEU A N   1 
ATOM 82   C CA  . LEU A 1 11  ? -3.411  -14.451 -27.196 1.00 19.85 ? 14  LEU A CA  1 
ATOM 83   C C   . LEU A 1 11  ? -4.861  -14.748 -27.548 1.00 19.79 ? 14  LEU A C   1 
ATOM 84   O O   . LEU A 1 11  ? -5.157  -15.320 -28.600 1.00 19.59 ? 14  LEU A O   1 
ATOM 85   C CB  . LEU A 1 11  ? -3.010  -13.041 -27.658 1.00 19.70 ? 14  LEU A CB  1 
ATOM 86   C CG  . LEU A 1 11  ? -2.897  -12.666 -29.137 1.00 19.78 ? 14  LEU A CG  1 
ATOM 87   C CD1 . LEU A 1 11  ? -3.218  -11.190 -29.322 1.00 19.77 ? 14  LEU A CD1 1 
ATOM 88   C CD2 . LEU A 1 11  ? -1.509  -12.989 -29.712 1.00 20.41 ? 14  LEU A CD2 1 
ATOM 89   N N   . SER A 1 12  ? -5.755  -14.357 -26.644 1.00 19.82 ? 15  SER A N   1 
ATOM 90   C CA  . SER A 1 12  ? -7.182  -14.607 -26.783 1.00 19.65 ? 15  SER A CA  1 
ATOM 91   C C   . SER A 1 12  ? -7.667  -14.144 -28.144 1.00 19.56 ? 15  SER A C   1 
ATOM 92   O O   . SER A 1 12  ? -7.207  -13.121 -28.662 1.00 19.46 ? 15  SER A O   1 
ATOM 93   C CB  . SER A 1 12  ? -7.955  -13.898 -25.676 1.00 19.58 ? 15  SER A CB  1 
ATOM 94   O OG  . SER A 1 12  ? -7.241  -13.953 -24.453 1.00 19.91 ? 15  SER A OG  1 
ATOM 95   N N   . VAL A 1 13  ? -8.582  -14.914 -28.724 1.00 19.48 ? 16  VAL A N   1 
ATOM 96   C CA  . VAL A 1 13  ? -9.051  -14.660 -30.080 1.00 19.46 ? 16  VAL A CA  1 
ATOM 97   C C   . VAL A 1 13  ? -10.575 -14.674 -30.139 1.00 19.25 ? 16  VAL A C   1 
ATOM 98   O O   . VAL A 1 13  ? -11.217 -15.568 -29.582 1.00 19.37 ? 16  VAL A O   1 
ATOM 99   C CB  . VAL A 1 13  ? -8.417  -15.670 -31.084 1.00 19.48 ? 16  VAL A CB  1 
ATOM 100  C CG1 . VAL A 1 13  ? -9.256  -15.831 -32.334 1.00 19.57 ? 16  VAL A CG1 1 
ATOM 101  C CG2 . VAL A 1 13  ? -7.008  -15.224 -31.459 1.00 20.11 ? 16  VAL A CG2 1 
ATOM 102  N N   . LEU A 1 14  ? -11.140 -13.666 -30.801 1.00 18.90 ? 17  LEU A N   1 
ATOM 103  C CA  . LEU A 1 14  ? -12.569 -13.620 -31.077 1.00 18.51 ? 17  LEU A CA  1 
ATOM 104  C C   . LEU A 1 14  ? -12.819 -13.947 -32.546 1.00 18.43 ? 17  LEU A C   1 
ATOM 105  O O   . LEU A 1 14  ? -12.868 -13.054 -33.394 1.00 18.32 ? 17  LEU A O   1 
ATOM 106  C CB  . LEU A 1 14  ? -13.147 -12.251 -30.713 1.00 18.37 ? 17  LEU A CB  1 
ATOM 107  C CG  . LEU A 1 14  ? -14.664 -12.063 -30.813 1.00 18.44 ? 17  LEU A CG  1 
ATOM 108  C CD1 . LEU A 1 14  ? -15.427 -13.052 -29.934 1.00 18.86 ? 17  LEU A CD1 1 
ATOM 109  C CD2 . LEU A 1 14  ? -15.048 -10.637 -30.467 1.00 18.60 ? 17  LEU A CD2 1 
ATOM 110  N N   . PHE A 1 15  ? -12.959 -15.237 -32.835 1.00 18.48 ? 18  PHE A N   1 
ATOM 111  C CA  . PHE A 1 15  ? -13.184 -15.718 -34.194 1.00 18.69 ? 18  PHE A CA  1 
ATOM 112  C C   . PHE A 1 15  ? -14.622 -15.424 -34.576 1.00 18.90 ? 18  PHE A C   1 
ATOM 113  O O   . PHE A 1 15  ? -15.537 -15.939 -33.940 1.00 19.04 ? 18  PHE A O   1 
ATOM 114  C CB  . PHE A 1 15  ? -12.920 -17.227 -34.257 1.00 18.75 ? 18  PHE A CB  1 
ATOM 115  C CG  . PHE A 1 15  ? -13.162 -17.849 -35.614 1.00 18.95 ? 18  PHE A CG  1 
ATOM 116  C CD1 . PHE A 1 15  ? -12.117 -17.990 -36.527 1.00 19.09 ? 18  PHE A CD1 1 
ATOM 117  C CD2 . PHE A 1 15  ? -14.427 -18.327 -35.966 1.00 18.92 ? 18  PHE A CD2 1 
ATOM 118  C CE1 . PHE A 1 15  ? -12.336 -18.579 -37.779 1.00 18.89 ? 18  PHE A CE1 1 
ATOM 119  C CE2 . PHE A 1 15  ? -14.656 -18.913 -37.212 1.00 18.69 ? 18  PHE A CE2 1 
ATOM 120  C CZ  . PHE A 1 15  ? -13.609 -19.039 -38.120 1.00 18.78 ? 18  PHE A CZ  1 
ATOM 121  N N   . PRO A 1 16  ? -14.834 -14.584 -35.606 1.00 19.11 ? 19  PRO A N   1 
ATOM 122  C CA  . PRO A 1 16  ? -16.216 -14.298 -35.978 1.00 19.27 ? 19  PRO A CA  1 
ATOM 123  C C   . PRO A 1 16  ? -16.873 -15.465 -36.710 1.00 19.43 ? 19  PRO A C   1 
ATOM 124  O O   . PRO A 1 16  ? -16.343 -15.955 -37.708 1.00 19.58 ? 19  PRO A O   1 
ATOM 125  C CB  . PRO A 1 16  ? -16.105 -13.066 -36.887 1.00 19.12 ? 19  PRO A CB  1 
ATOM 126  C CG  . PRO A 1 16  ? -14.737 -13.075 -37.399 1.00 19.29 ? 19  PRO A CG  1 
ATOM 127  C CD  . PRO A 1 16  ? -13.867 -13.867 -36.455 1.00 19.22 ? 19  PRO A CD  1 
ATOM 128  N N   . GLU A 1 17  ? -18.005 -15.918 -36.178 1.00 19.58 ? 20  GLU A N   1 
ATOM 129  C CA  . GLU A 1 17  ? -18.872 -16.852 -36.867 1.00 19.81 ? 20  GLU A CA  1 
ATOM 130  C C   . GLU A 1 17  ? -19.133 -16.232 -38.232 1.00 20.16 ? 20  GLU A C   1 
ATOM 131  O O   . GLU A 1 17  ? -19.433 -15.042 -38.322 1.00 20.24 ? 20  GLU A O   1 
ATOM 132  C CB  . GLU A 1 17  ? -20.167 -17.004 -36.077 1.00 19.71 ? 20  GLU A CB  1 
ATOM 133  C CG  . GLU A 1 17  ? -20.961 -18.253 -36.370 1.00 19.54 ? 20  GLU A CG  1 
ATOM 134  C CD  . GLU A 1 17  ? -21.875 -18.629 -35.222 1.00 19.40 ? 20  GLU A CD  1 
ATOM 135  O OE1 . GLU A 1 17  ? -21.426 -18.546 -34.060 1.00 19.24 ? 20  GLU A OE1 1 
ATOM 136  O OE2 . GLU A 1 17  ? -23.037 -19.017 -35.479 1.00 19.53 ? 20  GLU A OE2 1 
ATOM 137  N N   . GLU A 1 18  ? -18.995 -17.035 -39.284 1.00 20.67 ? 21  GLU A N   1 
ATOM 138  C CA  . GLU A 1 18  ? -18.942 -16.555 -40.672 1.00 21.31 ? 21  GLU A CA  1 
ATOM 139  C C   . GLU A 1 18  ? -17.499 -16.744 -41.131 1.00 21.60 ? 21  GLU A C   1 
ATOM 140  O O   . GLU A 1 18  ? -16.979 -17.863 -41.069 1.00 21.85 ? 21  GLU A O   1 
ATOM 141  C CB  . GLU A 1 18  ? -19.365 -15.086 -40.785 1.00 21.19 ? 21  GLU A CB  1 
ATOM 142  C CG  . GLU A 1 18  ? -20.519 -14.842 -41.734 1.00 22.27 ? 21  GLU A CG  1 
ATOM 143  C CD  . GLU A 1 18  ? -21.610 -13.954 -41.125 1.00 23.67 ? 21  GLU A CD  1 
ATOM 144  O OE1 . GLU A 1 18  ? -21.495 -13.588 -39.930 1.00 23.72 ? 21  GLU A OE1 1 
ATOM 145  O OE2 . GLU A 1 18  ? -22.588 -13.624 -41.840 1.00 23.80 ? 21  GLU A OE2 1 
ATOM 146  N N   . SER A 1 19  ? -16.849 -15.666 -41.570 1.00 21.82 ? 22  SER A N   1 
ATOM 147  C CA  . SER A 1 19  ? -15.416 -15.687 -41.913 1.00 22.14 ? 22  SER A CA  1 
ATOM 148  C C   . SER A 1 19  ? -15.051 -16.502 -43.149 1.00 22.26 ? 22  SER A C   1 
ATOM 149  O O   . SER A 1 19  ? -15.714 -17.484 -43.490 1.00 22.31 ? 22  SER A O   1 
ATOM 150  C CB  . SER A 1 19  ? -14.562 -16.154 -40.729 1.00 22.14 ? 22  SER A CB  1 
ATOM 151  O OG  . SER A 1 19  ? -14.082 -15.050 -39.987 1.00 22.63 ? 22  SER A OG  1 
ATOM 152  N N   . THR A 1 20  ? -13.978 -16.083 -43.809 1.00 22.41 ? 23  THR A N   1 
ATOM 153  C CA  . THR A 1 20  ? -13.490 -16.765 -44.992 1.00 22.64 ? 23  THR A CA  1 
ATOM 154  C C   . THR A 1 20  ? -12.511 -17.852 -44.565 1.00 22.81 ? 23  THR A C   1 
ATOM 155  O O   . THR A 1 20  ? -12.516 -18.953 -45.113 1.00 22.79 ? 23  THR A O   1 
ATOM 156  C CB  . THR A 1 20  ? -12.865 -15.759 -45.998 1.00 22.68 ? 23  THR A CB  1 
ATOM 157  O OG1 . THR A 1 20  ? -13.909 -14.974 -46.596 1.00 22.59 ? 23  THR A OG1 1 
ATOM 158  C CG2 . THR A 1 20  ? -12.093 -16.474 -47.104 1.00 22.79 ? 23  THR A CG2 1 
ATOM 159  N N   . GLU A 1 21  ? -11.698 -17.541 -43.561 1.00 23.26 ? 24  GLU A N   1 
ATOM 160  C CA  . GLU A 1 21  ? -10.687 -18.469 -43.044 1.00 23.62 ? 24  GLU A CA  1 
ATOM 161  C C   . GLU A 1 21  ? -11.380 -19.707 -42.484 1.00 23.68 ? 24  GLU A C   1 
ATOM 162  O O   . GLU A 1 21  ? -12.331 -19.599 -41.709 1.00 23.83 ? 24  GLU A O   1 
ATOM 163  C CB  . GLU A 1 21  ? -9.801  -17.803 -41.975 1.00 23.53 ? 24  GLU A CB  1 
ATOM 164  C CG  . GLU A 1 21  ? -9.576  -16.293 -42.161 1.00 24.20 ? 24  GLU A CG  1 
ATOM 165  C CD  . GLU A 1 21  ? -10.770 -15.453 -41.681 1.00 25.72 ? 24  GLU A CD  1 
ATOM 166  O OE1 . GLU A 1 21  ? -11.453 -14.815 -42.525 1.00 25.67 ? 24  GLU A OE1 1 
ATOM 167  O OE2 . GLU A 1 21  ? -11.041 -15.449 -40.458 1.00 26.38 ? 24  GLU A OE2 1 
ATOM 168  N N   . GLU A 1 22  ? -10.915 -20.876 -42.909 1.00 23.82 ? 25  GLU A N   1 
ATOM 169  C CA  . GLU A 1 22  ? -11.497 -22.146 -42.485 1.00 23.90 ? 25  GLU A CA  1 
ATOM 170  C C   . GLU A 1 22  ? -10.669 -22.750 -41.353 1.00 23.77 ? 25  GLU A C   1 
ATOM 171  O O   . GLU A 1 22  ? -10.742 -23.953 -41.082 1.00 23.92 ? 25  GLU A O   1 
ATOM 172  C CB  . GLU A 1 22  ? -11.572 -23.109 -43.672 1.00 24.10 ? 25  GLU A CB  1 
ATOM 173  C CG  . GLU A 1 22  ? -12.472 -22.634 -44.811 1.00 24.64 ? 25  GLU A CG  1 
ATOM 174  C CD  . GLU A 1 22  ? -13.938 -22.921 -44.552 1.00 25.26 ? 25  GLU A CD  1 
ATOM 175  O OE1 . GLU A 1 22  ? -14.347 -24.091 -44.716 1.00 25.49 ? 25  GLU A OE1 1 
ATOM 176  O OE2 . GLU A 1 22  ? -14.678 -21.978 -44.192 1.00 25.48 ? 25  GLU A OE2 1 
ATOM 177  N N   . GLN A 1 23  ? -9.883  -21.898 -40.699 1.00 23.45 ? 26  GLN A N   1 
ATOM 178  C CA  . GLN A 1 23  ? -8.975  -22.311 -39.641 1.00 23.07 ? 26  GLN A CA  1 
ATOM 179  C C   . GLN A 1 23  ? -8.721  -21.157 -38.685 1.00 22.91 ? 26  GLN A C   1 
ATOM 180  O O   . GLN A 1 23  ? -9.096  -20.021 -38.963 1.00 22.98 ? 26  GLN A O   1 
ATOM 181  C CB  . GLN A 1 23  ? -7.649  -22.794 -40.238 1.00 23.13 ? 26  GLN A CB  1 
ATOM 182  C CG  . GLN A 1 23  ? -6.765  -21.690 -40.811 1.00 23.04 ? 26  GLN A CG  1 
ATOM 183  C CD  . GLN A 1 23  ? -5.472  -22.224 -41.390 1.00 22.96 ? 26  GLN A CD  1 
ATOM 184  O OE1 . GLN A 1 23  ? -5.480  -22.990 -42.353 1.00 22.82 ? 26  GLN A OE1 1 
ATOM 185  N NE2 . GLN A 1 23  ? -4.349  -21.817 -40.809 1.00 22.90 ? 26  GLN A NE2 1 
ATOM 186  N N   . VAL A 1 24  ? -8.078  -21.458 -37.562 1.00 22.76 ? 27  VAL A N   1 
ATOM 187  C CA  . VAL A 1 24  ? -7.703  -20.444 -36.573 1.00 22.60 ? 27  VAL A CA  1 
ATOM 188  C C   . VAL A 1 24  ? -6.387  -20.819 -35.887 1.00 22.37 ? 27  VAL A C   1 
ATOM 189  O O   . VAL A 1 24  ? -6.226  -21.931 -35.378 1.00 22.45 ? 27  VAL A O   1 
ATOM 190  C CB  . VAL A 1 24  ? -8.846  -20.166 -35.539 1.00 22.53 ? 27  VAL A CB  1 
ATOM 191  C CG1 . VAL A 1 24  ? -9.296  -21.442 -34.850 1.00 22.69 ? 27  VAL A CG1 1 
ATOM 192  C CG2 . VAL A 1 24  ? -8.417  -19.129 -34.511 1.00 22.63 ? 27  VAL A CG2 1 
ATOM 193  N N   . LEU A 1 25  ? -5.446  -19.886 -35.899 1.00 22.11 ? 28  LEU A N   1 
ATOM 194  C CA  . LEU A 1 25  ? -4.127  -20.125 -35.338 1.00 21.92 ? 28  LEU A CA  1 
ATOM 195  C C   . LEU A 1 25  ? -4.085  -19.737 -33.877 1.00 21.64 ? 28  LEU A C   1 
ATOM 196  O O   . LEU A 1 25  ? -4.737  -18.787 -33.462 1.00 21.79 ? 28  LEU A O   1 
ATOM 197  C CB  . LEU A 1 25  ? -3.075  -19.315 -36.098 1.00 22.10 ? 28  LEU A CB  1 
ATOM 198  C CG  . LEU A 1 25  ? -1.626  -19.411 -35.622 1.00 21.96 ? 28  LEU A CG  1 
ATOM 199  C CD1 . LEU A 1 25  ? -0.903  -20.523 -36.371 1.00 22.10 ? 28  LEU A CD1 1 
ATOM 200  C CD2 . LEU A 1 25  ? -0.933  -18.078 -35.825 1.00 22.44 ? 28  LEU A CD2 1 
ATOM 201  N N   . LEU A 1 26  ? -3.317  -20.489 -33.105 1.00 21.38 ? 29  LEU A N   1 
ATOM 202  C CA  . LEU A 1 26  ? -2.911  -20.067 -31.777 1.00 21.06 ? 29  LEU A CA  1 
ATOM 203  C C   . LEU A 1 26  ? -1.396  -20.201 -31.690 1.00 20.98 ? 29  LEU A C   1 
ATOM 204  O O   . LEU A 1 26  ? -0.860  -21.306 -31.558 1.00 20.91 ? 29  LEU A O   1 
ATOM 205  C CB  . LEU A 1 26  ? -3.626  -20.870 -30.692 1.00 20.91 ? 29  LEU A CB  1 
ATOM 206  C CG  . LEU A 1 26  ? -5.112  -20.538 -30.524 1.00 20.76 ? 29  LEU A CG  1 
ATOM 207  C CD1 . LEU A 1 26  ? -5.756  -21.446 -29.501 1.00 20.85 ? 29  LEU A CD1 1 
ATOM 208  C CD2 . LEU A 1 26  ? -5.326  -19.084 -30.138 1.00 20.72 ? 29  LEU A CD2 1 
ATOM 209  N N   . ALA A 1 27  ? -0.722  -19.057 -31.791 1.00 20.81 ? 30  ALA A N   1 
ATOM 210  C CA  . ALA A 1 27  ? 0.733   -18.987 -31.840 1.00 20.67 ? 30  ALA A CA  1 
ATOM 211  C C   . ALA A 1 27  ? 1.431   -19.498 -30.576 1.00 20.78 ? 30  ALA A C   1 
ATOM 212  O O   . ALA A 1 27  ? 0.909   -19.373 -29.462 1.00 20.64 ? 30  ALA A O   1 
ATOM 213  C CB  . ALA A 1 27  ? 1.170   -17.571 -32.148 1.00 20.63 ? 30  ALA A CB  1 
ATOM 214  N N   . CYS A 1 28  ? 2.613   -20.083 -30.765 1.00 20.89 ? 31  CYS A N   1 
ATOM 215  C CA  . CYS A 1 28  ? 3.461   -20.487 -29.650 1.00 20.92 ? 31  CYS A CA  1 
ATOM 216  C C   . CYS A 1 28  ? 4.837   -20.897 -30.129 1.00 20.95 ? 31  CYS A C   1 
ATOM 217  O O   . CYS A 1 28  ? 4.955   -21.770 -30.986 1.00 21.21 ? 31  CYS A O   1 
ATOM 218  C CB  . CYS A 1 28  ? 2.832   -21.639 -28.864 1.00 20.86 ? 31  CYS A CB  1 
ATOM 219  S SG  . CYS A 1 28  ? 3.845   -22.144 -27.474 1.00 21.05 ? 31  CYS A SG  1 
ATOM 220  N N   . ARG A 1 29  ? 5.872   -20.269 -29.577 1.00 21.07 ? 32  ARG A N   1 
ATOM 221  C CA  . ARG A 1 29  ? 7.251   -20.693 -29.840 1.00 21.59 ? 32  ARG A CA  1 
ATOM 222  C C   . ARG A 1 29  ? 8.206   -20.403 -28.683 1.00 21.56 ? 32  ARG A C   1 
ATOM 223  O O   . ARG A 1 29  ? 7.993   -19.470 -27.903 1.00 21.63 ? 32  ARG A O   1 
ATOM 224  C CB  . ARG A 1 29  ? 7.783   -20.074 -31.131 1.00 21.48 ? 32  ARG A CB  1 
ATOM 225  C CG  . ARG A 1 29  ? 9.106   -20.655 -31.596 1.00 22.15 ? 32  ARG A CG  1 
ATOM 226  C CD  . ARG A 1 29  ? 9.583   -20.045 -32.901 1.00 22.52 ? 32  ARG A CD  1 
ATOM 227  N NE  . ARG A 1 29  ? 9.401   -18.599 -32.924 1.00 24.90 ? 32  ARG A NE  1 
ATOM 228  C CZ  . ARG A 1 29  ? 8.594   -17.959 -33.765 1.00 26.97 ? 32  ARG A CZ  1 
ATOM 229  N NH1 . ARG A 1 29  ? 8.489   -16.638 -33.704 1.00 27.91 ? 32  ARG A NH1 1 
ATOM 230  N NH2 . ARG A 1 29  ? 7.894   -18.633 -34.675 1.00 28.28 ? 32  ARG A NH2 1 
ATOM 231  N N   . ALA A 1 30  ? 9.258   -21.215 -28.589 1.00 21.63 ? 33  ALA A N   1 
ATOM 232  C CA  . ALA A 1 30  ? 10.273  -21.074 -27.549 1.00 21.72 ? 33  ALA A CA  1 
ATOM 233  C C   . ALA A 1 30  ? 11.673  -21.479 -28.022 1.00 21.82 ? 33  ALA A C   1 
ATOM 234  O O   . ALA A 1 30  ? 11.856  -22.555 -28.590 1.00 21.92 ? 33  ALA A O   1 
ATOM 235  C CB  . ALA A 1 30  ? 9.881   -21.878 -26.326 1.00 21.69 ? 33  ALA A CB  1 
ATOM 236  N N   . ARG A 1 31  ? 12.654  -20.609 -27.780 1.00 21.92 ? 34  ARG A N   1 
ATOM 237  C CA  . ARG A 1 31  ? 14.066  -20.918 -28.040 1.00 22.08 ? 34  ARG A CA  1 
ATOM 238  C C   . ARG A 1 31  ? 14.644  -21.792 -26.918 1.00 22.00 ? 34  ARG A C   1 
ATOM 239  O O   . ARG A 1 31  ? 14.517  -21.459 -25.732 1.00 22.08 ? 34  ARG A O   1 
ATOM 240  C CB  . ARG A 1 31  ? 14.896  -19.631 -28.217 1.00 22.04 ? 34  ARG A CB  1 
ATOM 241  C CG  . ARG A 1 31  ? 14.687  -18.585 -27.118 1.00 22.53 ? 34  ARG A CG  1 
ATOM 242  C CD  . ARG A 1 31  ? 15.471  -17.294 -27.341 1.00 22.39 ? 34  ARG A CD  1 
ATOM 243  N NE  . ARG A 1 31  ? 14.584  -16.136 -27.206 1.00 22.91 ? 34  ARG A NE  1 
ATOM 244  C CZ  . ARG A 1 31  ? 14.975  -14.886 -26.976 1.00 22.82 ? 34  ARG A CZ  1 
ATOM 245  N NH1 . ARG A 1 31  ? 14.067  -13.919 -26.885 1.00 22.33 ? 34  ARG A NH1 1 
ATOM 246  N NH2 . ARG A 1 31  ? 16.262  -14.598 -26.831 1.00 23.02 ? 34  ARG A NH2 1 
ATOM 247  N N   . ALA A 1 32  ? 15.263  -22.910 -27.299 1.00 21.83 ? 35  ALA A N   1 
ATOM 248  C CA  . ALA A 1 32  ? 15.841  -23.850 -26.337 1.00 21.72 ? 35  ALA A CA  1 
ATOM 249  C C   . ALA A 1 32  ? 16.908  -24.725 -26.977 1.00 21.62 ? 35  ALA A C   1 
ATOM 250  O O   . ALA A 1 32  ? 16.901  -24.933 -28.188 1.00 21.71 ? 35  ALA A O   1 
ATOM 251  C CB  . ALA A 1 32  ? 14.754  -24.721 -25.725 1.00 21.85 ? 35  ALA A CB  1 
ATOM 252  N N   . SER A 1 33  ? 17.817  -25.245 -26.160 1.00 21.51 ? 36  SER A N   1 
ATOM 253  C CA  . SER A 1 33  ? 18.870  -26.121 -26.660 1.00 21.52 ? 36  SER A CA  1 
ATOM 254  C C   . SER A 1 33  ? 19.010  -27.372 -25.788 1.00 21.40 ? 36  SER A C   1 
ATOM 255  O O   . SER A 1 33  ? 19.374  -27.274 -24.614 1.00 21.52 ? 36  SER A O   1 
ATOM 256  C CB  . SER A 1 33  ? 20.200  -25.372 -26.774 1.00 21.60 ? 36  SER A CB  1 
ATOM 257  O OG  . SER A 1 33  ? 20.962  -25.851 -27.872 1.00 21.65 ? 36  SER A OG  1 
ATOM 258  N N   . PRO A 1 34  ? 18.713  -28.554 -26.359 1.00 21.17 ? 37  PRO A N   1 
ATOM 259  C CA  . PRO A 1 34  ? 18.289  -28.778 -27.748 1.00 21.15 ? 37  PRO A CA  1 
ATOM 260  C C   . PRO A 1 34  ? 16.899  -28.189 -28.075 1.00 21.12 ? 37  PRO A C   1 
ATOM 261  O O   . PRO A 1 34  ? 16.151  -27.844 -27.150 1.00 21.26 ? 37  PRO A O   1 
ATOM 262  C CB  . PRO A 1 34  ? 18.274  -30.305 -27.859 1.00 21.15 ? 37  PRO A CB  1 
ATOM 263  C CG  . PRO A 1 34  ? 18.050  -30.773 -26.482 1.00 21.06 ? 37  PRO A CG  1 
ATOM 264  C CD  . PRO A 1 34  ? 18.779  -29.816 -25.603 1.00 21.02 ? 37  PRO A CD  1 
ATOM 265  N N   . PRO A 1 35  ? 16.566  -28.052 -29.380 1.00 20.96 ? 38  PRO A N   1 
ATOM 266  C CA  . PRO A 1 35  ? 15.273  -27.562 -29.852 1.00 20.93 ? 38  PRO A CA  1 
ATOM 267  C C   . PRO A 1 35  ? 14.079  -28.077 -29.052 1.00 20.92 ? 38  PRO A C   1 
ATOM 268  O O   . PRO A 1 35  ? 14.016  -29.263 -28.711 1.00 20.89 ? 38  PRO A O   1 
ATOM 269  C CB  . PRO A 1 35  ? 15.217  -28.086 -31.282 1.00 21.00 ? 38  PRO A CB  1 
ATOM 270  C CG  . PRO A 1 35  ? 16.617  -28.007 -31.727 1.00 21.04 ? 38  PRO A CG  1 
ATOM 271  C CD  . PRO A 1 35  ? 17.458  -28.346 -30.518 1.00 21.04 ? 38  PRO A CD  1 
ATOM 272  N N   . ALA A 1 36  ? 13.144  -27.173 -28.772 1.00 20.91 ? 39  ALA A N   1 
ATOM 273  C CA  . ALA A 1 36  ? 12.025  -27.443 -27.878 1.00 20.92 ? 39  ALA A CA  1 
ATOM 274  C C   . ALA A 1 36  ? 10.852  -28.127 -28.570 1.00 20.95 ? 39  ALA A C   1 
ATOM 275  O O   . ALA A 1 36  ? 10.467  -27.755 -29.680 1.00 20.96 ? 39  ALA A O   1 
ATOM 276  C CB  . ALA A 1 36  ? 11.566  -26.161 -27.228 1.00 20.96 ? 39  ALA A CB  1 
ATOM 277  N N   . THR A 1 37  ? 10.297  -29.132 -27.898 1.00 20.93 ? 40  THR A N   1 
ATOM 278  C CA  . THR A 1 37  ? 9.090   -29.805 -28.357 1.00 21.03 ? 40  THR A CA  1 
ATOM 279  C C   . THR A 1 37  ? 7.884   -29.132 -27.709 1.00 21.18 ? 40  THR A C   1 
ATOM 280  O O   . THR A 1 37  ? 8.015   -28.493 -26.658 1.00 21.26 ? 40  THR A O   1 
ATOM 281  C CB  . THR A 1 37  ? 9.094   -31.309 -28.009 1.00 20.98 ? 40  THR A CB  1 
ATOM 282  O OG1 . THR A 1 37  ? 8.828   -31.484 -26.612 1.00 21.13 ? 40  THR A OG1 1 
ATOM 283  C CG2 . THR A 1 37  ? 10.433  -31.947 -28.358 1.00 20.94 ? 40  THR A CG2 1 
ATOM 284  N N   . TYR A 1 38  ? 6.717   -29.281 -28.334 1.00 21.27 ? 41  TYR A N   1 
ATOM 285  C CA  . TYR A 1 38  ? 5.507   -28.584 -27.893 1.00 21.22 ? 41  TYR A CA  1 
ATOM 286  C C   . TYR A 1 38  ? 4.324   -29.512 -27.615 1.00 21.15 ? 41  TYR A C   1 
ATOM 287  O O   . TYR A 1 38  ? 4.180   -30.577 -28.230 1.00 20.96 ? 41  TYR A O   1 
ATOM 288  C CB  . TYR A 1 38  ? 5.088   -27.538 -28.924 1.00 21.30 ? 41  TYR A CB  1 
ATOM 289  C CG  . TYR A 1 38  ? 6.121   -26.475 -29.226 1.00 21.58 ? 41  TYR A CG  1 
ATOM 290  C CD1 . TYR A 1 38  ? 7.078   -26.668 -30.221 1.00 21.65 ? 41  TYR A CD1 1 
ATOM 291  C CD2 . TYR A 1 38  ? 6.116   -25.257 -28.544 1.00 22.16 ? 41  TYR A CD2 1 
ATOM 292  C CE1 . TYR A 1 38  ? 8.013   -25.686 -30.519 1.00 21.79 ? 41  TYR A CE1 1 
ATOM 293  C CE2 . TYR A 1 38  ? 7.048   -24.266 -28.835 1.00 22.04 ? 41  TYR A CE2 1 
ATOM 294  C CZ  . TYR A 1 38  ? 7.993   -24.490 -29.823 1.00 21.99 ? 41  TYR A CZ  1 
ATOM 295  O OH  . TYR A 1 38  ? 8.920   -23.519 -30.117 1.00 22.07 ? 41  TYR A OH  1 
ATOM 296  N N   . ARG A 1 39  ? 3.482   -29.081 -26.678 1.00 21.11 ? 42  ARG A N   1 
ATOM 297  C CA  . ARG A 1 39  ? 2.247   -29.772 -26.319 1.00 21.12 ? 42  ARG A CA  1 
ATOM 298  C C   . ARG A 1 39  ? 1.177   -28.721 -26.025 1.00 21.15 ? 42  ARG A C   1 
ATOM 299  O O   . ARG A 1 39  ? 1.497   -27.562 -25.753 1.00 21.20 ? 42  ARG A O   1 
ATOM 300  C CB  . ARG A 1 39  ? 2.455   -30.644 -25.080 1.00 21.17 ? 42  ARG A CB  1 
ATOM 301  C CG  . ARG A 1 39  ? 3.571   -31.683 -25.166 1.00 21.12 ? 42  ARG A CG  1 
ATOM 302  C CD  . ARG A 1 39  ? 3.986   -32.122 -23.775 1.00 21.50 ? 42  ARG A CD  1 
ATOM 303  N NE  . ARG A 1 39  ? 2.820   -32.432 -22.948 1.00 22.29 ? 42  ARG A NE  1 
ATOM 304  C CZ  . ARG A 1 39  ? 2.806   -32.415 -21.618 1.00 22.88 ? 42  ARG A CZ  1 
ATOM 305  N NH1 . ARG A 1 39  ? 1.688   -32.708 -20.967 1.00 22.86 ? 42  ARG A NH1 1 
ATOM 306  N NH2 . ARG A 1 39  ? 3.901   -32.101 -20.936 1.00 23.57 ? 42  ARG A NH2 1 
ATOM 307  N N   . TRP A 1 40  ? -0.090  -29.124 -26.067 1.00 21.28 ? 43  TRP A N   1 
ATOM 308  C CA  . TRP A 1 40  ? -1.196  -28.189 -25.843 1.00 21.34 ? 43  TRP A CA  1 
ATOM 309  C C   . TRP A 1 40  ? -2.251  -28.701 -24.864 1.00 21.41 ? 43  TRP A C   1 
ATOM 310  O O   . TRP A 1 40  ? -2.478  -29.912 -24.751 1.00 21.45 ? 43  TRP A O   1 
ATOM 311  C CB  . TRP A 1 40  ? -1.853  -27.817 -27.169 1.00 21.31 ? 43  TRP A CB  1 
ATOM 312  C CG  . TRP A 1 40  ? -1.160  -26.710 -27.891 1.00 21.37 ? 43  TRP A CG  1 
ATOM 313  C CD1 . TRP A 1 40  ? -0.164  -26.832 -28.813 1.00 21.53 ? 43  TRP A CD1 1 
ATOM 314  C CD2 . TRP A 1 40  ? -1.417  -25.305 -27.758 1.00 21.31 ? 43  TRP A CD2 1 
ATOM 315  N NE1 . TRP A 1 40  ? 0.219   -25.588 -29.265 1.00 21.45 ? 43  TRP A NE1 1 
ATOM 316  C CE2 . TRP A 1 40  ? -0.532  -24.634 -28.631 1.00 21.13 ? 43  TRP A CE2 1 
ATOM 317  C CE3 . TRP A 1 40  ? -2.310  -24.548 -26.986 1.00 21.36 ? 43  TRP A CE3 1 
ATOM 318  C CZ2 . TRP A 1 40  ? -0.511  -23.241 -28.755 1.00 21.64 ? 43  TRP A CZ2 1 
ATOM 319  C CZ3 . TRP A 1 40  ? -2.289  -23.162 -27.104 1.00 21.53 ? 43  TRP A CZ3 1 
ATOM 320  C CH2 . TRP A 1 40  ? -1.394  -22.521 -27.987 1.00 21.69 ? 43  TRP A CH2 1 
ATOM 321  N N   . LYS A 1 41  ? -2.894  -27.764 -24.166 1.00 21.40 ? 44  LYS A N   1 
ATOM 322  C CA  . LYS A 1 41  ? -3.964  -28.084 -23.224 1.00 21.39 ? 44  LYS A CA  1 
ATOM 323  C C   . LYS A 1 41  ? -5.222  -27.273 -23.513 1.00 21.51 ? 44  LYS A C   1 
ATOM 324  O O   . LYS A 1 41  ? -5.160  -26.064 -23.724 1.00 21.34 ? 44  LYS A O   1 
ATOM 325  C CB  . LYS A 1 41  ? -3.515  -27.836 -21.782 1.00 21.35 ? 44  LYS A CB  1 
ATOM 326  C CG  . LYS A 1 41  ? -2.477  -28.815 -21.256 1.00 21.18 ? 44  LYS A CG  1 
ATOM 327  C CD  . LYS A 1 41  ? -2.202  -28.571 -19.780 1.00 21.04 ? 44  LYS A CD  1 
ATOM 328  C CE  . LYS A 1 41  ? -1.267  -29.622 -19.204 1.00 21.00 ? 44  LYS A CE  1 
ATOM 329  N NZ  . LYS A 1 41  ? -1.241  -29.603 -17.712 1.00 20.96 ? 44  LYS A NZ  1 
ATOM 330  N N   . MET A 1 42  ? -6.363  -27.949 -23.519 1.00 21.78 ? 45  MET A N   1 
ATOM 331  C CA  . MET A 1 42  ? -7.643  -27.279 -23.665 1.00 22.32 ? 45  MET A CA  1 
ATOM 332  C C   . MET A 1 42  ? -8.487  -27.455 -22.413 1.00 22.39 ? 45  MET A C   1 
ATOM 333  O O   . MET A 1 42  ? -8.722  -28.582 -21.973 1.00 22.57 ? 45  MET A O   1 
ATOM 334  C CB  . MET A 1 42  ? -8.391  -27.817 -24.875 1.00 22.16 ? 45  MET A CB  1 
ATOM 335  C CG  . MET A 1 42  ? -9.867  -27.488 -24.869 1.00 22.37 ? 45  MET A CG  1 
ATOM 336  S SD  . MET A 1 42  ? -10.672 -28.056 -26.363 1.00 23.34 ? 45  MET A SD  1 
ATOM 337  C CE  . MET A 1 42  ? -10.543 -29.850 -26.215 1.00 23.25 ? 45  MET A CE  1 
ATOM 338  N N   . ASN A 1 43  ? -8.937  -26.335 -21.848 1.00 22.60 ? 46  ASN A N   1 
ATOM 339  C CA  . ASN A 1 43  ? -9.765  -26.324 -20.637 1.00 22.79 ? 46  ASN A CA  1 
ATOM 340  C C   . ASN A 1 43  ? -9.220  -27.169 -19.482 1.00 22.95 ? 46  ASN A C   1 
ATOM 341  O O   . ASN A 1 43  ? -9.972  -27.572 -18.592 1.00 22.87 ? 46  ASN A O   1 
ATOM 342  C CB  . ASN A 1 43  ? -11.212 -26.724 -20.964 1.00 22.78 ? 46  ASN A CB  1 
ATOM 343  C CG  . ASN A 1 43  ? -12.002 -25.597 -21.606 1.00 22.81 ? 46  ASN A CG  1 
ATOM 344  O OD1 . ASN A 1 43  ? -11.456 -24.543 -21.927 1.00 23.17 ? 46  ASN A OD1 1 
ATOM 345  N ND2 . ASN A 1 43  ? -13.298 -25.814 -21.790 1.00 22.63 ? 46  ASN A ND2 1 
ATOM 346  N N   . GLY A 1 44  ? -7.914  -27.429 -19.507 1.00 23.23 ? 47  GLY A N   1 
ATOM 347  C CA  . GLY A 1 44  ? -7.264  -28.251 -18.488 1.00 23.71 ? 47  GLY A CA  1 
ATOM 348  C C   . GLY A 1 44  ? -6.932  -29.669 -18.926 1.00 24.00 ? 47  GLY A C   1 
ATOM 349  O O   . GLY A 1 44  ? -6.119  -30.341 -18.286 1.00 24.02 ? 47  GLY A O   1 
ATOM 350  N N   . THR A 1 45  ? -7.567  -30.128 -20.005 1.00 24.29 ? 48  THR A N   1 
ATOM 351  C CA  . THR A 1 45  ? -7.286  -31.448 -20.580 1.00 24.67 ? 48  THR A CA  1 
ATOM 352  C C   . THR A 1 45  ? -6.218  -31.325 -21.666 1.00 24.81 ? 48  THR A C   1 
ATOM 353  O O   . THR A 1 45  ? -6.170  -30.321 -22.382 1.00 24.96 ? 48  THR A O   1 
ATOM 354  C CB  . THR A 1 45  ? -8.557  -32.101 -21.176 1.00 24.68 ? 48  THR A CB  1 
ATOM 355  O OG1 . THR A 1 45  ? -9.672  -31.871 -20.306 1.00 25.07 ? 48  THR A OG1 1 
ATOM 356  C CG2 . THR A 1 45  ? -8.367  -33.608 -21.348 1.00 24.73 ? 48  THR A CG2 1 
ATOM 357  N N   . GLU A 1 46  ? -5.360  -32.337 -21.784 1.00 24.92 ? 49  GLU A N   1 
ATOM 358  C CA  . GLU A 1 46  ? -4.299  -32.313 -22.787 1.00 25.07 ? 49  GLU A CA  1 
ATOM 359  C C   . GLU A 1 46  ? -4.843  -32.633 -24.176 1.00 25.22 ? 49  GLU A C   1 
ATOM 360  O O   . GLU A 1 46  ? -5.882  -33.283 -24.307 1.00 25.26 ? 49  GLU A O   1 
ATOM 361  C CB  . GLU A 1 46  ? -3.170  -33.270 -22.426 1.00 24.98 ? 49  GLU A CB  1 
ATOM 362  C CG  . GLU A 1 46  ? -1.805  -32.676 -22.706 1.00 25.17 ? 49  GLU A CG  1 
ATOM 363  C CD  . GLU A 1 46  ? -0.865  -33.635 -23.398 1.00 25.59 ? 49  GLU A CD  1 
ATOM 364  O OE1 . GLU A 1 46  ? -0.971  -34.859 -23.170 1.00 26.01 ? 49  GLU A OE1 1 
ATOM 365  O OE2 . GLU A 1 46  ? -0.009  -33.156 -24.172 1.00 25.89 ? 49  GLU A OE2 1 
ATOM 366  N N   . MET A 1 47  ? -4.130  -32.180 -25.204 1.00 25.41 ? 50  MET A N   1 
ATOM 367  C CA  . MET A 1 47  ? -4.604  -32.272 -26.587 1.00 25.52 ? 50  MET A CA  1 
ATOM 368  C C   . MET A 1 47  ? -3.954  -33.403 -27.373 1.00 25.52 ? 50  MET A C   1 
ATOM 369  O O   . MET A 1 47  ? -2.738  -33.602 -27.320 1.00 25.58 ? 50  MET A O   1 
ATOM 370  C CB  . MET A 1 47  ? -4.351  -30.954 -27.310 1.00 25.53 ? 50  MET A CB  1 
ATOM 371  C CG  . MET A 1 47  ? -5.021  -29.771 -26.664 1.00 25.82 ? 50  MET A CG  1 
ATOM 372  S SD  . MET A 1 47  ? -6.211  -28.989 -27.741 1.00 26.32 ? 50  MET A SD  1 
ATOM 373  C CE  . MET A 1 47  ? -5.127  -28.018 -28.759 1.00 25.95 ? 50  MET A CE  1 
ATOM 374  N N   . LYS A 1 48  ? -4.785  -34.134 -28.105 1.00 25.52 ? 51  LYS A N   1 
ATOM 375  C CA  . LYS A 1 48  ? -4.318  -35.141 -29.039 1.00 25.59 ? 51  LYS A CA  1 
ATOM 376  C C   . LYS A 1 48  ? -4.173  -34.409 -30.367 1.00 25.63 ? 51  LYS A C   1 
ATOM 377  O O   . LYS A 1 48  ? -5.131  -33.801 -30.851 1.00 25.52 ? 51  LYS A O   1 
ATOM 378  C CB  . LYS A 1 48  ? -5.348  -36.273 -29.138 1.00 25.65 ? 51  LYS A CB  1 
ATOM 379  C CG  . LYS A 1 48  ? -4.770  -37.677 -29.268 1.00 25.54 ? 51  LYS A CG  1 
ATOM 380  C CD  . LYS A 1 48  ? -5.887  -38.721 -29.268 1.00 25.54 ? 51  LYS A CD  1 
ATOM 381  C CE  . LYS A 1 48  ? -5.358  -40.132 -29.530 1.00 25.50 ? 51  LYS A CE  1 
ATOM 382  N NZ  . LYS A 1 48  ? -6.439  -41.166 -29.570 1.00 24.80 ? 51  LYS A NZ  1 
ATOM 383  N N   . LEU A 1 49  ? -2.975  -34.441 -30.944 1.00 25.72 ? 52  LEU A N   1 
ATOM 384  C CA  . LEU A 1 49  ? -2.705  -33.650 -32.145 1.00 25.98 ? 52  LEU A CA  1 
ATOM 385  C C   . LEU A 1 49  ? -2.408  -34.473 -33.410 1.00 26.21 ? 52  LEU A C   1 
ATOM 386  O O   . LEU A 1 49  ? -2.439  -33.936 -34.517 1.00 26.27 ? 52  LEU A O   1 
ATOM 387  C CB  . LEU A 1 49  ? -1.616  -32.604 -31.867 1.00 26.01 ? 52  LEU A CB  1 
ATOM 388  C CG  . LEU A 1 49  ? -1.945  -31.532 -30.807 1.00 26.24 ? 52  LEU A CG  1 
ATOM 389  C CD1 . LEU A 1 49  ? -0.685  -30.919 -30.215 1.00 26.13 ? 52  LEU A CD1 1 
ATOM 390  C CD2 . LEU A 1 49  ? -2.869  -30.427 -31.329 1.00 26.14 ? 52  LEU A CD2 1 
ATOM 391  N N   . GLU A 1 50  ? -2.112  -35.761 -33.215 1.00 26.46 ? 53  GLU A N   1 
ATOM 392  C CA  . GLU A 1 50  ? -2.047  -36.832 -34.249 1.00 26.77 ? 53  GLU A CA  1 
ATOM 393  C C   . GLU A 1 50  ? -1.900  -36.518 -35.771 1.00 26.79 ? 53  GLU A C   1 
ATOM 394  O O   . GLU A 1 50  ? -2.155  -35.393 -36.206 1.00 26.68 ? 53  GLU A O   1 
ATOM 395  C CB  . GLU A 1 50  ? -3.210  -37.814 -34.025 1.00 26.81 ? 53  GLU A CB  1 
ATOM 396  C CG  . GLU A 1 50  ? -2.932  -38.874 -32.958 1.00 26.97 ? 53  GLU A CG  1 
ATOM 397  C CD  . GLU A 1 50  ? -4.011  -39.940 -32.893 1.00 26.98 ? 53  GLU A CD  1 
ATOM 398  O OE1 . GLU A 1 50  ? -5.210  -39.580 -32.880 1.00 27.14 ? 53  GLU A OE1 1 
ATOM 399  O OE2 . GLU A 1 50  ? -3.662  -41.141 -32.847 1.00 27.45 ? 53  GLU A OE2 1 
ATOM 400  N N   . PRO A 1 51  ? -1.464  -37.528 -36.574 1.00 26.90 ? 54  PRO A N   1 
ATOM 401  C CA  . PRO A 1 51  ? -1.379  -37.454 -38.052 1.00 26.90 ? 54  PRO A CA  1 
ATOM 402  C C   . PRO A 1 51  ? -2.609  -36.862 -38.782 1.00 26.85 ? 54  PRO A C   1 
ATOM 403  O O   . PRO A 1 51  ? -2.724  -35.634 -38.886 1.00 26.92 ? 54  PRO A O   1 
ATOM 404  C CB  . PRO A 1 51  ? -1.119  -38.918 -38.479 1.00 26.88 ? 54  PRO A CB  1 
ATOM 405  C CG  . PRO A 1 51  ? -1.233  -39.749 -37.231 1.00 26.81 ? 54  PRO A CG  1 
ATOM 406  C CD  . PRO A 1 51  ? -0.952  -38.826 -36.088 1.00 26.90 ? 54  PRO A CD  1 
ATOM 407  N N   . GLY A 1 52  ? -3.495  -37.721 -39.292 1.00 26.71 ? 55  GLY A N   1 
ATOM 408  C CA  . GLY A 1 52  ? -4.674  -37.285 -40.056 1.00 26.58 ? 55  GLY A CA  1 
ATOM 409  C C   . GLY A 1 52  ? -5.720  -36.599 -39.195 1.00 26.42 ? 55  GLY A C   1 
ATOM 410  O O   . GLY A 1 52  ? -6.836  -37.103 -39.039 1.00 26.49 ? 55  GLY A O   1 
ATOM 411  N N   . SER A 1 53  ? -5.356  -35.428 -38.672 1.00 26.14 ? 56  SER A N   1 
ATOM 412  C CA  . SER A 1 53  ? -6.079  -34.777 -37.581 1.00 25.78 ? 56  SER A CA  1 
ATOM 413  C C   . SER A 1 53  ? -6.680  -33.423 -37.947 1.00 25.67 ? 56  SER A C   1 
ATOM 414  O O   . SER A 1 53  ? -6.331  -32.819 -38.962 1.00 25.54 ? 56  SER A O   1 
ATOM 415  C CB  . SER A 1 53  ? -5.152  -34.635 -36.364 1.00 25.75 ? 56  SER A CB  1 
ATOM 416  O OG  . SER A 1 53  ? -5.425  -33.463 -35.616 1.00 25.28 ? 56  SER A OG  1 
ATOM 417  N N   . ARG A 1 54  ? -7.575  -32.963 -37.077 1.00 25.58 ? 57  ARG A N   1 
ATOM 418  C CA  . ARG A 1 54  ? -8.303  -31.710 -37.230 1.00 25.39 ? 57  ARG A CA  1 
ATOM 419  C C   . ARG A 1 54  ? -7.753  -30.638 -36.283 1.00 25.37 ? 57  ARG A C   1 
ATOM 420  O O   . ARG A 1 54  ? -7.928  -29.434 -36.511 1.00 25.36 ? 57  ARG A O   1 
ATOM 421  C CB  . ARG A 1 54  ? -9.777  -31.976 -36.950 1.00 25.30 ? 57  ARG A CB  1 
ATOM 422  C CG  . ARG A 1 54  ? -10.717 -30.858 -37.291 1.00 25.26 ? 57  ARG A CG  1 
ATOM 423  C CD  . ARG A 1 54  ? -11.187 -30.186 -36.032 1.00 25.59 ? 57  ARG A CD  1 
ATOM 424  N NE  . ARG A 1 54  ? -12.637 -30.282 -35.914 1.00 25.90 ? 57  ARG A NE  1 
ATOM 425  C CZ  . ARG A 1 54  ? -13.357 -29.690 -34.968 1.00 26.48 ? 57  ARG A CZ  1 
ATOM 426  N NH1 . ARG A 1 54  ? -14.674 -29.854 -34.956 1.00 26.90 ? 57  ARG A NH1 1 
ATOM 427  N NH2 . ARG A 1 54  ? -12.771 -28.934 -34.043 1.00 26.44 ? 57  ARG A NH2 1 
ATOM 428  N N   . HIS A 1 55  ? -7.102  -31.088 -35.215 1.00 25.22 ? 58  HIS A N   1 
ATOM 429  C CA  . HIS A 1 55  ? -6.368  -30.203 -34.320 1.00 25.14 ? 58  HIS A CA  1 
ATOM 430  C C   . HIS A 1 55  ? -4.882  -30.347 -34.637 1.00 25.00 ? 58  HIS A C   1 
ATOM 431  O O   . HIS A 1 55  ? -4.224  -31.285 -34.182 1.00 25.21 ? 58  HIS A O   1 
ATOM 432  C CB  . HIS A 1 55  ? -6.670  -30.547 -32.858 1.00 25.09 ? 58  HIS A CB  1 
ATOM 433  C CG  . HIS A 1 55  ? -8.059  -30.190 -32.432 1.00 25.35 ? 58  HIS A CG  1 
ATOM 434  N ND1 . HIS A 1 55  ? -9.179  -30.811 -32.945 1.00 25.55 ? 58  HIS A ND1 1 
ATOM 435  C CD2 . HIS A 1 55  ? -8.512  -29.272 -31.545 1.00 25.66 ? 58  HIS A CD2 1 
ATOM 436  C CE1 . HIS A 1 55  ? -10.260 -30.290 -32.392 1.00 25.68 ? 58  HIS A CE1 1 
ATOM 437  N NE2 . HIS A 1 55  ? -9.883  -29.354 -31.539 1.00 25.79 ? 58  HIS A NE2 1 
ATOM 438  N N   . GLN A 1 56  ? -4.358  -29.420 -35.434 1.00 24.67 ? 59  GLN A N   1 
ATOM 439  C CA  . GLN A 1 56  ? -3.036  -29.600 -36.030 1.00 24.29 ? 59  GLN A CA  1 
ATOM 440  C C   . GLN A 1 56  ? -1.937  -28.821 -35.320 1.00 23.87 ? 59  GLN A C   1 
ATOM 441  O O   . GLN A 1 56  ? -2.100  -27.640 -35.007 1.00 24.06 ? 59  GLN A O   1 
ATOM 442  C CB  . GLN A 1 56  ? -3.077  -29.233 -37.518 1.00 24.33 ? 59  GLN A CB  1 
ATOM 443  C CG  . GLN A 1 56  ? -2.012  -29.915 -38.363 1.00 24.40 ? 59  GLN A CG  1 
ATOM 444  C CD  . GLN A 1 56  ? -2.308  -29.849 -39.853 1.00 25.02 ? 59  GLN A CD  1 
ATOM 445  O OE1 . GLN A 1 56  ? -3.080  -29.002 -40.316 1.00 25.29 ? 59  GLN A OE1 1 
ATOM 446  N NE2 . GLN A 1 56  ? -1.691  -30.748 -40.617 1.00 25.05 ? 59  GLN A NE2 1 
ATOM 447  N N   . LEU A 1 57  ? -0.820  -29.496 -35.067 1.00 23.29 ? 60  LEU A N   1 
ATOM 448  C CA  . LEU A 1 57  ? 0.378   -28.839 -34.554 1.00 22.76 ? 60  LEU A CA  1 
ATOM 449  C C   . LEU A 1 57  ? 1.273   -28.482 -35.733 1.00 22.44 ? 60  LEU A C   1 
ATOM 450  O O   . LEU A 1 57  ? 1.608   -29.343 -36.550 1.00 22.55 ? 60  LEU A O   1 
ATOM 451  C CB  . LEU A 1 57  ? 1.127   -29.763 -33.588 1.00 22.75 ? 60  LEU A CB  1 
ATOM 452  C CG  . LEU A 1 57  ? 2.039   -29.211 -32.483 1.00 22.52 ? 60  LEU A CG  1 
ATOM 453  C CD1 . LEU A 1 57  ? 2.550   -30.366 -31.651 1.00 22.36 ? 60  LEU A CD1 1 
ATOM 454  C CD2 . LEU A 1 57  ? 3.212   -28.397 -33.004 1.00 22.20 ? 60  LEU A CD2 1 
ATOM 455  N N   . VAL A 1 58  ? 1.640   -27.209 -35.829 1.00 22.01 ? 61  VAL A N   1 
ATOM 456  C CA  . VAL A 1 58  ? 2.556   -26.750 -36.864 1.00 21.76 ? 61  VAL A CA  1 
ATOM 457  C C   . VAL A 1 58  ? 3.745   -26.085 -36.178 1.00 21.65 ? 61  VAL A C   1 
ATOM 458  O O   . VAL A 1 58  ? 3.779   -24.862 -36.015 1.00 21.46 ? 61  VAL A O   1 
ATOM 459  C CB  . VAL A 1 58  ? 1.872   -25.775 -37.857 1.00 21.75 ? 61  VAL A CB  1 
ATOM 460  C CG1 . VAL A 1 58  ? 2.857   -25.298 -38.919 1.00 21.86 ? 61  VAL A CG1 1 
ATOM 461  C CG2 . VAL A 1 58  ? 0.667   -26.430 -38.521 1.00 21.73 ? 61  VAL A CG2 1 
ATOM 462  N N   . GLY A 1 59  ? 4.705   -26.915 -35.770 1.00 21.57 ? 62  GLY A N   1 
ATOM 463  C CA  . GLY A 1 59  ? 5.883   -26.481 -35.024 1.00 21.60 ? 62  GLY A CA  1 
ATOM 464  C C   . GLY A 1 59  ? 5.573   -25.491 -33.915 1.00 21.68 ? 62  GLY A C   1 
ATOM 465  O O   . GLY A 1 59  ? 5.855   -24.293 -34.047 1.00 22.01 ? 62  GLY A O   1 
ATOM 466  N N   . GLY A 1 60  ? 4.985   -25.975 -32.824 1.00 21.39 ? 63  GLY A N   1 
ATOM 467  C CA  . GLY A 1 60  ? 4.570   -25.091 -31.732 1.00 21.01 ? 63  GLY A CA  1 
ATOM 468  C C   . GLY A 1 60  ? 3.209   -24.438 -31.902 1.00 20.64 ? 63  GLY A C   1 
ATOM 469  O O   . GLY A 1 60  ? 2.491   -24.231 -30.926 1.00 20.65 ? 63  GLY A O   1 
ATOM 470  N N   . ASN A 1 61  ? 2.858   -24.116 -33.143 1.00 20.22 ? 64  ASN A N   1 
ATOM 471  C CA  . ASN A 1 61  ? 1.597   -23.460 -33.446 1.00 20.00 ? 64  ASN A CA  1 
ATOM 472  C C   . ASN A 1 61  ? 0.409   -24.416 -33.533 1.00 19.82 ? 64  ASN A C   1 
ATOM 473  O O   . ASN A 1 61  ? 0.455   -25.432 -34.229 1.00 19.92 ? 64  ASN A O   1 
ATOM 474  C CB  . ASN A 1 61  ? 1.724   -22.644 -34.729 1.00 20.07 ? 64  ASN A CB  1 
ATOM 475  C CG  . ASN A 1 61  ? 2.493   -21.365 -34.520 1.00 20.06 ? 64  ASN A CG  1 
ATOM 476  O OD1 . ASN A 1 61  ? 2.005   -20.446 -33.872 1.00 20.94 ? 64  ASN A OD1 1 
ATOM 477  N ND2 . ASN A 1 61  ? 3.704   -21.300 -35.062 1.00 20.63 ? 64  ASN A ND2 1 
ATOM 478  N N   . LEU A 1 62  ? -0.652  -24.081 -32.808 1.00 19.44 ? 65  LEU A N   1 
ATOM 479  C CA  . LEU A 1 62  ? -1.877  -24.854 -32.841 1.00 18.97 ? 65  LEU A CA  1 
ATOM 480  C C   . LEU A 1 62  ? -2.802  -24.256 -33.879 1.00 18.77 ? 65  LEU A C   1 
ATOM 481  O O   . LEU A 1 62  ? -3.079  -23.058 -33.865 1.00 18.91 ? 65  LEU A O   1 
ATOM 482  C CB  . LEU A 1 62  ? -2.552  -24.851 -31.473 1.00 18.94 ? 65  LEU A CB  1 
ATOM 483  C CG  . LEU A 1 62  ? -4.005  -25.324 -31.434 1.00 18.94 ? 65  LEU A CG  1 
ATOM 484  C CD1 . LEU A 1 62  ? -4.125  -26.823 -31.697 1.00 18.52 ? 65  LEU A CD1 1 
ATOM 485  C CD2 . LEU A 1 62  ? -4.641  -24.941 -30.110 1.00 19.09 ? 65  LEU A CD2 1 
ATOM 486  N N   . VAL A 1 63  ? -3.270  -25.102 -34.784 1.00 18.43 ? 66  VAL A N   1 
ATOM 487  C CA  . VAL A 1 63  ? -4.147  -24.671 -35.854 1.00 18.02 ? 66  VAL A CA  1 
ATOM 488  C C   . VAL A 1 63  ? -5.349  -25.586 -35.801 1.00 17.89 ? 66  VAL A C   1 
ATOM 489  O O   . VAL A 1 63  ? -5.206  -26.804 -35.952 1.00 17.95 ? 66  VAL A O   1 
ATOM 490  C CB  . VAL A 1 63  ? -3.463  -24.786 -37.237 1.00 17.99 ? 66  VAL A CB  1 
ATOM 491  C CG1 . VAL A 1 63  ? -4.403  -24.316 -38.336 1.00 18.19 ? 66  VAL A CG1 1 
ATOM 492  C CG2 . VAL A 1 63  ? -2.149  -23.996 -37.278 1.00 17.61 ? 66  VAL A CG2 1 
ATOM 493  N N   . ILE A 1 64  ? -6.525  -25.009 -35.564 1.00 17.65 ? 67  ILE A N   1 
ATOM 494  C CA  . ILE A 1 64  ? -7.749  -25.800 -35.467 1.00 17.47 ? 67  ILE A CA  1 
ATOM 495  C C   . ILE A 1 64  ? -8.567  -25.655 -36.740 1.00 17.58 ? 67  ILE A C   1 
ATOM 496  O O   . ILE A 1 64  ? -8.967  -24.546 -37.106 1.00 17.92 ? 67  ILE A O   1 
ATOM 497  C CB  . ILE A 1 64  ? -8.610  -25.400 -34.264 1.00 17.23 ? 67  ILE A CB  1 
ATOM 498  C CG1 . ILE A 1 64  ? -7.725  -25.142 -33.046 1.00 17.19 ? 67  ILE A CG1 1 
ATOM 499  C CG2 . ILE A 1 64  ? -9.635  -26.491 -33.977 1.00 17.01 ? 67  ILE A CG2 1 
ATOM 500  C CD1 . ILE A 1 64  ? -8.409  -24.381 -31.930 1.00 17.70 ? 67  ILE A CD1 1 
ATOM 501  N N   . MET A 1 65  ? -8.815  -26.778 -37.407 1.00 17.39 ? 68  MET A N   1 
ATOM 502  C CA  . MET A 1 65  ? -9.564  -26.780 -38.664 1.00 17.13 ? 68  MET A CA  1 
ATOM 503  C C   . MET A 1 65  ? -11.059 -26.605 -38.429 1.00 16.93 ? 68  MET A C   1 
ATOM 504  O O   . MET A 1 65  ? -11.632 -27.235 -37.544 1.00 16.96 ? 68  MET A O   1 
ATOM 505  C CB  . MET A 1 65  ? -9.288  -28.066 -39.450 1.00 17.13 ? 68  MET A CB  1 
ATOM 506  C CG  . MET A 1 65  ? -7.830  -28.235 -39.867 1.00 16.88 ? 68  MET A CG  1 
ATOM 507  S SD  . MET A 1 65  ? -7.246  -26.912 -40.945 1.00 16.09 ? 68  MET A SD  1 
ATOM 508  C CE  . MET A 1 65  ? -7.874  -27.484 -42.523 1.00 16.60 ? 68  MET A CE  1 
ATOM 509  N N   . ASN A 1 66  ? -11.678 -25.741 -39.223 1.00 16.78 ? 69  ASN A N   1 
ATOM 510  C CA  . ASN A 1 66  ? -13.115 -25.478 -39.136 1.00 16.81 ? 69  ASN A CA  1 
ATOM 511  C C   . ASN A 1 66  ? -13.646 -25.409 -37.699 1.00 16.84 ? 69  ASN A C   1 
ATOM 512  O O   . ASN A 1 66  ? -14.253 -26.362 -37.208 1.00 16.83 ? 69  ASN A O   1 
ATOM 513  C CB  . ASN A 1 66  ? -13.892 -26.496 -39.970 1.00 16.70 ? 69  ASN A CB  1 
ATOM 514  C CG  . ASN A 1 66  ? -13.512 -26.452 -41.432 1.00 16.76 ? 69  ASN A CG  1 
ATOM 515  O OD1 . ASN A 1 66  ? -13.530 -25.391 -42.061 1.00 16.26 ? 69  ASN A OD1 1 
ATOM 516  N ND2 . ASN A 1 66  ? -13.162 -27.608 -41.986 1.00 17.25 ? 69  ASN A ND2 1 
ATOM 517  N N   . PRO A 1 67  ? -13.401 -24.278 -37.017 1.00 16.86 ? 70  PRO A N   1 
ATOM 518  C CA  . PRO A 1 67  ? -13.763 -24.099 -35.616 1.00 16.85 ? 70  PRO A CA  1 
ATOM 519  C C   . PRO A 1 67  ? -15.244 -23.808 -35.424 1.00 16.97 ? 70  PRO A C   1 
ATOM 520  O O   . PRO A 1 67  ? -15.864 -23.166 -36.280 1.00 17.21 ? 70  PRO A O   1 
ATOM 521  C CB  . PRO A 1 67  ? -12.929 -22.884 -35.188 1.00 16.82 ? 70  PRO A CB  1 
ATOM 522  C CG  . PRO A 1 67  ? -12.027 -22.573 -36.355 1.00 16.90 ? 70  PRO A CG  1 
ATOM 523  C CD  . PRO A 1 67  ? -12.732 -23.082 -37.548 1.00 16.92 ? 70  PRO A CD  1 
ATOM 524  N N   . THR A 1 68  ? -15.796 -24.284 -34.304 1.00 16.96 ? 71  THR A N   1 
ATOM 525  C CA  . THR A 1 68  ? -17.208 -24.083 -33.955 1.00 16.72 ? 71  THR A CA  1 
ATOM 526  C C   . THR A 1 68  ? -17.365 -23.838 -32.458 1.00 16.77 ? 71  THR A C   1 
ATOM 527  O O   . THR A 1 68  ? -16.699 -24.484 -31.650 1.00 16.74 ? 71  THR A O   1 
ATOM 528  C CB  . THR A 1 68  ? -18.063 -25.306 -34.330 1.00 16.52 ? 71  THR A CB  1 
ATOM 529  O OG1 . THR A 1 68  ? -17.669 -25.789 -35.616 1.00 15.95 ? 71  THR A OG1 1 
ATOM 530  C CG2 . THR A 1 68  ? -19.545 -24.943 -34.364 1.00 16.87 ? 71  THR A CG2 1 
ATOM 531  N N   . LYS A 1 69  ? -18.250 -22.907 -32.101 1.00 16.95 ? 72  LYS A N   1 
ATOM 532  C CA  . LYS A 1 69  ? -18.619 -22.656 -30.703 1.00 17.11 ? 72  LYS A CA  1 
ATOM 533  C C   . LYS A 1 69  ? -18.873 -23.973 -29.970 1.00 17.18 ? 72  LYS A C   1 
ATOM 534  O O   . LYS A 1 69  ? -18.311 -24.216 -28.901 1.00 17.14 ? 72  LYS A O   1 
ATOM 535  C CB  . LYS A 1 69  ? -19.869 -21.764 -30.613 1.00 17.15 ? 72  LYS A CB  1 
ATOM 536  C CG  . LYS A 1 69  ? -20.153 -21.217 -29.207 1.00 17.34 ? 72  LYS A CG  1 
ATOM 537  C CD  . LYS A 1 69  ? -21.653 -21.030 -28.943 1.00 17.54 ? 72  LYS A CD  1 
ATOM 538  C CE  . LYS A 1 69  ? -21.944 -20.492 -27.525 1.00 17.33 ? 72  LYS A CE  1 
ATOM 539  N NZ  . LYS A 1 69  ? -21.441 -21.352 -26.404 1.00 17.01 ? 72  LYS A NZ  1 
ATOM 540  N N   . ALA A 1 70  ? -19.704 -24.821 -30.575 1.00 17.33 ? 73  ALA A N   1 
ATOM 541  C CA  . ALA A 1 70  ? -20.154 -26.074 -29.965 1.00 17.38 ? 73  ALA A CA  1 
ATOM 542  C C   . ALA A 1 70  ? -19.035 -27.084 -29.694 1.00 17.43 ? 73  ALA A C   1 
ATOM 543  O O   . ALA A 1 70  ? -19.234 -28.040 -28.940 1.00 17.51 ? 73  ALA A O   1 
ATOM 544  C CB  . ALA A 1 70  ? -21.249 -26.708 -30.824 1.00 17.34 ? 73  ALA A CB  1 
ATOM 545  N N   . GLN A 1 71  ? -17.866 -26.865 -30.292 1.00 17.46 ? 74  GLN A N   1 
ATOM 546  C CA  . GLN A 1 71  ? -16.777 -27.838 -30.227 1.00 17.56 ? 74  GLN A CA  1 
ATOM 547  C C   . GLN A 1 71  ? -15.433 -27.278 -29.789 1.00 17.64 ? 74  GLN A C   1 
ATOM 548  O O   . GLN A 1 71  ? -14.593 -28.017 -29.276 1.00 17.89 ? 74  GLN A O   1 
ATOM 549  C CB  . GLN A 1 71  ? -16.594 -28.509 -31.585 1.00 17.55 ? 74  GLN A CB  1 
ATOM 550  C CG  . GLN A 1 71  ? -17.549 -29.651 -31.845 1.00 17.94 ? 74  GLN A CG  1 
ATOM 551  C CD  . GLN A 1 71  ? -17.293 -30.327 -33.176 1.00 18.27 ? 74  GLN A CD  1 
ATOM 552  O OE1 . GLN A 1 71  ? -16.934 -29.674 -34.161 1.00 17.70 ? 74  GLN A OE1 1 
ATOM 553  N NE2 . GLN A 1 71  ? -17.482 -31.644 -33.216 1.00 18.45 ? 74  GLN A NE2 1 
ATOM 554  N N   . ASP A 1 72  ? -15.224 -25.982 -29.992 1.00 17.59 ? 75  ASP A N   1 
ATOM 555  C CA  . ASP A 1 72  ? -13.883 -25.418 -29.906 1.00 17.44 ? 75  ASP A CA  1 
ATOM 556  C C   . ASP A 1 72  ? -13.718 -24.268 -28.922 1.00 17.38 ? 75  ASP A C   1 
ATOM 557  O O   . ASP A 1 72  ? -12.598 -23.958 -28.521 1.00 17.50 ? 75  ASP A O   1 
ATOM 558  C CB  . ASP A 1 72  ? -13.425 -25.001 -31.302 1.00 17.46 ? 75  ASP A CB  1 
ATOM 559  C CG  . ASP A 1 72  ? -13.346 -26.178 -32.254 1.00 17.63 ? 75  ASP A CG  1 
ATOM 560  O OD1 . ASP A 1 72  ? -12.661 -27.169 -31.917 1.00 17.84 ? 75  ASP A OD1 1 
ATOM 561  O OD2 . ASP A 1 72  ? -13.972 -26.118 -33.331 1.00 17.60 ? 75  ASP A OD2 1 
ATOM 562  N N   . ALA A 1 73  ? -14.824 -23.635 -28.539 1.00 17.22 ? 76  ALA A N   1 
ATOM 563  C CA  . ALA A 1 73  ? -14.787 -22.555 -27.561 1.00 17.00 ? 76  ALA A CA  1 
ATOM 564  C C   . ALA A 1 73  ? -14.141 -23.054 -26.277 1.00 17.05 ? 76  ALA A C   1 
ATOM 565  O O   . ALA A 1 73  ? -14.426 -24.164 -25.822 1.00 17.12 ? 76  ALA A O   1 
ATOM 566  C CB  . ALA A 1 73  ? -16.181 -22.037 -27.287 1.00 16.87 ? 76  ALA A CB  1 
ATOM 567  N N   . GLY A 1 74  ? -13.248 -22.244 -25.714 1.00 17.05 ? 77  GLY A N   1 
ATOM 568  C CA  . GLY A 1 74  ? -12.588 -22.593 -24.464 1.00 16.97 ? 77  GLY A CA  1 
ATOM 569  C C   . GLY A 1 74  ? -11.230 -21.959 -24.228 1.00 17.00 ? 77  GLY A C   1 
ATOM 570  O O   . GLY A 1 74  ? -10.864 -20.959 -24.856 1.00 16.79 ? 77  GLY A O   1 
ATOM 571  N N   . VAL A 1 75  ? -10.489 -22.573 -23.308 1.00 17.15 ? 78  VAL A N   1 
ATOM 572  C CA  . VAL A 1 75  ? -9.225  -22.056 -22.801 1.00 17.25 ? 78  VAL A CA  1 
ATOM 573  C C   . VAL A 1 75  ? -8.082  -22.944 -23.277 1.00 17.50 ? 78  VAL A C   1 
ATOM 574  O O   . VAL A 1 75  ? -8.062  -24.146 -23.010 1.00 17.63 ? 78  VAL A O   1 
ATOM 575  C CB  . VAL A 1 75  ? -9.227  -22.006 -21.254 1.00 17.07 ? 78  VAL A CB  1 
ATOM 576  C CG1 . VAL A 1 75  ? -7.939  -21.405 -20.737 1.00 17.13 ? 78  VAL A CG1 1 
ATOM 577  C CG2 . VAL A 1 75  ? -10.418 -21.217 -20.743 1.00 16.92 ? 78  VAL A CG2 1 
ATOM 578  N N   . TYR A 1 76  ? -7.131  -22.344 -23.981 1.00 17.72 ? 79  TYR A N   1 
ATOM 579  C CA  . TYR A 1 76  ? -5.997  -23.081 -24.510 1.00 17.90 ? 79  TYR A CA  1 
ATOM 580  C C   . TYR A 1 76  ? -4.696  -22.600 -23.892 1.00 18.36 ? 79  TYR A C   1 
ATOM 581  O O   . TYR A 1 76  ? -4.564  -21.430 -23.517 1.00 18.53 ? 79  TYR A O   1 
ATOM 582  C CB  . TYR A 1 76  ? -5.931  -22.945 -26.023 1.00 17.65 ? 79  TYR A CB  1 
ATOM 583  C CG  . TYR A 1 76  ? -7.131  -23.496 -26.747 1.00 17.28 ? 79  TYR A CG  1 
ATOM 584  C CD1 . TYR A 1 76  ? -8.313  -22.766 -26.832 1.00 17.05 ? 79  TYR A CD1 1 
ATOM 585  C CD2 . TYR A 1 76  ? -7.083  -24.743 -27.358 1.00 17.31 ? 79  TYR A CD2 1 
ATOM 586  C CE1 . TYR A 1 76  ? -9.419  -23.265 -27.503 1.00 17.23 ? 79  TYR A CE1 1 
ATOM 587  C CE2 . TYR A 1 76  ? -8.185  -25.252 -28.032 1.00 17.58 ? 79  TYR A CE2 1 
ATOM 588  C CZ  . TYR A 1 76  ? -9.348  -24.505 -28.102 1.00 17.27 ? 79  TYR A CZ  1 
ATOM 589  O OH  . TYR A 1 76  ? -10.441 -24.998 -28.770 1.00 17.43 ? 79  TYR A OH  1 
ATOM 590  N N   . GLN A 1 77  ? -3.735  -23.515 -23.801 1.00 18.82 ? 80  GLN A N   1 
ATOM 591  C CA  . GLN A 1 77  ? -2.451  -23.237 -23.184 1.00 19.27 ? 80  GLN A CA  1 
ATOM 592  C C   . GLN A 1 77  ? -1.359  -24.072 -23.840 1.00 19.55 ? 80  GLN A C   1 
ATOM 593  O O   . GLN A 1 77  ? -1.520  -25.273 -24.055 1.00 19.72 ? 80  GLN A O   1 
ATOM 594  C CB  . GLN A 1 77  ? -2.521  -23.522 -21.684 1.00 19.21 ? 80  GLN A CB  1 
ATOM 595  C CG  . GLN A 1 77  ? -1.363  -22.960 -20.873 1.00 19.46 ? 80  GLN A CG  1 
ATOM 596  C CD  . GLN A 1 77  ? -1.498  -23.238 -19.386 1.00 19.42 ? 80  GLN A CD  1 
ATOM 597  O OE1 . GLN A 1 77  ? -2.279  -24.103 -18.968 1.00 19.64 ? 80  GLN A OE1 1 
ATOM 598  N NE2 . GLN A 1 77  ? -0.732  -22.507 -18.577 1.00 19.06 ? 80  GLN A NE2 1 
ATOM 599  N N   . CYS A 1 78  ? -0.250  -23.420 -24.157 1.00 20.13 ? 81  CYS A N   1 
ATOM 600  C CA  . CYS A 1 78  ? 0.885   -24.071 -24.793 1.00 20.27 ? 81  CYS A CA  1 
ATOM 601  C C   . CYS A 1 78  ? 1.876   -24.581 -23.752 1.00 20.17 ? 81  CYS A C   1 
ATOM 602  O O   . CYS A 1 78  ? 2.042   -23.971 -22.697 1.00 20.21 ? 81  CYS A O   1 
ATOM 603  C CB  . CYS A 1 78  ? 1.576   -23.074 -25.718 1.00 20.53 ? 81  CYS A CB  1 
ATOM 604  S SG  . CYS A 1 78  ? 2.904   -23.772 -26.699 1.00 21.16 ? 81  CYS A SG  1 
ATOM 605  N N   . LEU A 1 79  ? 2.533   -25.696 -24.057 1.00 20.12 ? 82  LEU A N   1 
ATOM 606  C CA  . LEU A 1 79  ? 3.542   -26.283 -23.171 1.00 20.15 ? 82  LEU A CA  1 
ATOM 607  C C   . LEU A 1 79  ? 4.854   -26.530 -23.904 1.00 20.25 ? 82  LEU A C   1 
ATOM 608  O O   . LEU A 1 79  ? 4.929   -27.367 -24.811 1.00 20.50 ? 82  LEU A O   1 
ATOM 609  C CB  . LEU A 1 79  ? 3.043   -27.596 -22.562 1.00 20.09 ? 82  LEU A CB  1 
ATOM 610  C CG  . LEU A 1 79  ? 2.404   -27.536 -21.177 1.00 20.06 ? 82  LEU A CG  1 
ATOM 611  C CD1 . LEU A 1 79  ? 0.926   -27.231 -21.283 1.00 20.36 ? 82  LEU A CD1 1 
ATOM 612  C CD2 . LEU A 1 79  ? 2.633   -28.844 -20.431 1.00 19.86 ? 82  LEU A CD2 1 
ATOM 613  N N   . ALA A 1 80  ? 5.894   -25.814 -23.496 1.00 20.14 ? 83  ALA A N   1 
ATOM 614  C CA  . ALA A 1 80  ? 7.168   -25.871 -24.194 1.00 20.08 ? 83  ALA A CA  1 
ATOM 615  C C   . ALA A 1 80  ? 8.207   -26.544 -23.332 1.00 19.97 ? 83  ALA A C   1 
ATOM 616  O O   . ALA A 1 80  ? 8.581   -26.012 -22.289 1.00 20.38 ? 83  ALA A O   1 
ATOM 617  C CB  . ALA A 1 80  ? 7.622   -24.473 -24.559 1.00 20.27 ? 83  ALA A CB  1 
ATOM 618  N N   . SER A 1 81  ? 8.677   -27.712 -23.760 1.00 19.66 ? 84  SER A N   1 
ATOM 619  C CA  . SER A 1 81  ? 9.687   -28.442 -22.992 1.00 19.18 ? 84  SER A CA  1 
ATOM 620  C C   . SER A 1 81  ? 10.823  -28.989 -23.833 1.00 18.86 ? 84  SER A C   1 
ATOM 621  O O   . SER A 1 81  ? 10.713  -29.106 -25.052 1.00 18.91 ? 84  SER A O   1 
ATOM 622  C CB  . SER A 1 81  ? 9.062   -29.569 -22.159 1.00 19.10 ? 84  SER A CB  1 
ATOM 623  O OG  . SER A 1 81  ? 8.062   -30.274 -22.868 1.00 19.06 ? 84  SER A OG  1 
ATOM 624  N N   . ASN A 1 82  ? 11.919  -29.293 -23.148 1.00 18.58 ? 85  ASN A N   1 
ATOM 625  C CA  . ASN A 1 82  ? 13.079  -29.968 -23.708 1.00 18.38 ? 85  ASN A CA  1 
ATOM 626  C C   . ASN A 1 82  ? 13.801  -30.657 -22.545 1.00 18.16 ? 85  ASN A C   1 
ATOM 627  O O   . ASN A 1 82  ? 13.420  -30.449 -21.392 1.00 18.14 ? 85  ASN A O   1 
ATOM 628  C CB  . ASN A 1 82  ? 13.984  -28.971 -24.447 1.00 18.38 ? 85  ASN A CB  1 
ATOM 629  C CG  . ASN A 1 82  ? 14.881  -28.178 -23.515 1.00 18.68 ? 85  ASN A CG  1 
ATOM 630  O OD1 . ASN A 1 82  ? 14.452  -27.703 -22.459 1.00 18.76 ? 85  ASN A OD1 1 
ATOM 631  N ND2 . ASN A 1 82  ? 16.140  -28.020 -23.912 1.00 18.95 ? 85  ASN A ND2 1 
ATOM 632  N N   . PRO A 1 83  ? 14.818  -31.495 -22.830 1.00 18.04 ? 86  PRO A N   1 
ATOM 633  C CA  . PRO A 1 83  ? 15.597  -32.157 -21.783 1.00 18.03 ? 86  PRO A CA  1 
ATOM 634  C C   . PRO A 1 83  ? 15.754  -31.394 -20.460 1.00 18.02 ? 86  PRO A C   1 
ATOM 635  O O   . PRO A 1 83  ? 15.788  -32.021 -19.401 1.00 18.09 ? 86  PRO A O   1 
ATOM 636  C CB  . PRO A 1 83  ? 16.954  -32.349 -22.455 1.00 18.01 ? 86  PRO A CB  1 
ATOM 637  C CG  . PRO A 1 83  ? 16.600  -32.615 -23.879 1.00 17.96 ? 86  PRO A CG  1 
ATOM 638  C CD  . PRO A 1 83  ? 15.284  -31.915 -24.165 1.00 18.06 ? 86  PRO A CD  1 
ATOM 639  N N   . VAL A 1 84  ? 15.837  -30.064 -20.524 1.00 17.99 ? 87  VAL A N   1 
ATOM 640  C CA  . VAL A 1 84  ? 15.997  -29.226 -19.332 1.00 17.90 ? 87  VAL A CA  1 
ATOM 641  C C   . VAL A 1 84  ? 14.700  -29.111 -18.520 1.00 18.17 ? 87  VAL A C   1 
ATOM 642  O O   . VAL A 1 84  ? 14.733  -29.188 -17.289 1.00 18.30 ? 87  VAL A O   1 
ATOM 643  C CB  . VAL A 1 84  ? 16.546  -27.818 -19.686 1.00 17.79 ? 87  VAL A CB  1 
ATOM 644  C CG1 . VAL A 1 84  ? 16.650  -26.937 -18.445 1.00 17.37 ? 87  VAL A CG1 1 
ATOM 645  C CG2 . VAL A 1 84  ? 17.903  -27.927 -20.371 1.00 17.44 ? 87  VAL A CG2 1 
ATOM 646  N N   . GLY A 1 85  ? 13.571  -28.931 -19.203 1.00 18.37 ? 88  GLY A N   1 
ATOM 647  C CA  . GLY A 1 85  ? 12.268  -28.860 -18.534 1.00 18.72 ? 88  GLY A CA  1 
ATOM 648  C C   . GLY A 1 85  ? 11.151  -28.178 -19.312 1.00 19.07 ? 88  GLY A C   1 
ATOM 649  O O   . GLY A 1 85  ? 11.334  -27.756 -20.456 1.00 19.13 ? 88  GLY A O   1 
ATOM 650  N N   . THR A 1 86  ? 9.989   -28.064 -18.676 1.00 19.30 ? 89  THR A N   1 
ATOM 651  C CA  . THR A 1 86  ? 8.806   -27.466 -19.295 1.00 19.41 ? 89  THR A CA  1 
ATOM 652  C C   . THR A 1 86  ? 8.536   -26.052 -18.770 1.00 19.64 ? 89  THR A C   1 
ATOM 653  O O   . THR A 1 86  ? 8.860   -25.725 -17.628 1.00 19.81 ? 89  THR A O   1 
ATOM 654  C CB  . THR A 1 86  ? 7.552   -28.364 -19.071 1.00 19.28 ? 89  THR A CB  1 
ATOM 655  O OG1 . THR A 1 86  ? 7.776   -29.654 -19.645 1.00 19.27 ? 89  THR A OG1 1 
ATOM 656  C CG2 . THR A 1 86  ? 6.310   -27.772 -19.704 1.00 19.18 ? 89  THR A CG2 1 
ATOM 657  N N   . VAL A 1 87  ? 7.958   -25.216 -19.624 1.00 19.84 ? 90  VAL A N   1 
ATOM 658  C CA  . VAL A 1 87  ? 7.315   -23.976 -19.196 1.00 20.20 ? 90  VAL A CA  1 
ATOM 659  C C   . VAL A 1 87  ? 5.938   -23.873 -19.861 1.00 20.31 ? 90  VAL A C   1 
ATOM 660  O O   . VAL A 1 87  ? 5.688   -24.513 -20.891 1.00 20.37 ? 90  VAL A O   1 
ATOM 661  C CB  . VAL A 1 87  ? 8.171   -22.719 -19.499 1.00 20.24 ? 90  VAL A CB  1 
ATOM 662  C CG1 . VAL A 1 87  ? 9.142   -22.450 -18.372 1.00 20.32 ? 90  VAL A CG1 1 
ATOM 663  C CG2 . VAL A 1 87  ? 8.914   -22.862 -20.821 1.00 20.74 ? 90  VAL A CG2 1 
ATOM 664  N N   . VAL A 1 88  ? 5.044   -23.088 -19.265 1.00 20.41 ? 91  VAL A N   1 
ATOM 665  C CA  . VAL A 1 88  ? 3.686   -22.957 -19.788 1.00 20.63 ? 91  VAL A CA  1 
ATOM 666  C C   . VAL A 1 88  ? 3.338   -21.518 -20.156 1.00 20.82 ? 91  VAL A C   1 
ATOM 667  O O   . VAL A 1 88  ? 3.672   -20.578 -19.422 1.00 20.85 ? 91  VAL A O   1 
ATOM 668  C CB  . VAL A 1 88  ? 2.618   -23.538 -18.820 1.00 20.62 ? 91  VAL A CB  1 
ATOM 669  C CG1 . VAL A 1 88  ? 2.871   -25.017 -18.564 1.00 20.64 ? 91  VAL A CG1 1 
ATOM 670  C CG2 . VAL A 1 88  ? 2.580   -22.768 -17.510 1.00 20.78 ? 91  VAL A CG2 1 
ATOM 671  N N   . SER A 1 89  ? 2.662   -21.363 -21.294 1.00 20.97 ? 92  SER A N   1 
ATOM 672  C CA  . SER A 1 89  ? 2.279   -20.053 -21.815 1.00 21.24 ? 92  SER A CA  1 
ATOM 673  C C   . SER A 1 89  ? 1.093   -19.478 -21.052 1.00 21.35 ? 92  SER A C   1 
ATOM 674  O O   . SER A 1 89  ? 0.482   -20.173 -20.239 1.00 21.39 ? 92  SER A O   1 
ATOM 675  C CB  . SER A 1 89  ? 1.918   -20.168 -23.296 1.00 21.33 ? 92  SER A CB  1 
ATOM 676  O OG  . SER A 1 89  ? 0.610   -20.698 -23.462 1.00 21.46 ? 92  SER A OG  1 
ATOM 677  N N   . ARG A 1 90  ? 0.768   -18.213 -21.323 1.00 21.51 ? 93  ARG A N   1 
ATOM 678  C CA  . ARG A 1 90  ? -0.464  -17.610 -20.821 1.00 21.65 ? 93  ARG A CA  1 
ATOM 679  C C   . ARG A 1 90  ? -1.623  -18.377 -21.420 1.00 21.55 ? 93  ARG A C   1 
ATOM 680  O O   . ARG A 1 90  ? -1.494  -18.968 -22.502 1.00 21.42 ? 93  ARG A O   1 
ATOM 681  C CB  . ARG A 1 90  ? -0.610  -16.155 -21.266 1.00 21.85 ? 93  ARG A CB  1 
ATOM 682  C CG  . ARG A 1 90  ? 0.644   -15.491 -21.776 1.00 22.96 ? 93  ARG A CG  1 
ATOM 683  C CD  . ARG A 1 90  ? 0.326   -14.205 -22.541 1.00 24.86 ? 93  ARG A CD  1 
ATOM 684  N NE  . ARG A 1 90  ? 0.109   -14.426 -23.974 1.00 25.79 ? 93  ARG A NE  1 
ATOM 685  C CZ  . ARG A 1 90  ? 0.223   -13.482 -24.915 1.00 26.57 ? 93  ARG A CZ  1 
ATOM 686  N NH1 . ARG A 1 90  ? 0.003   -13.792 -26.187 1.00 27.24 ? 93  ARG A NH1 1 
ATOM 687  N NH2 . ARG A 1 90  ? 0.558   -12.231 -24.599 1.00 25.78 ? 93  ARG A NH2 1 
ATOM 688  N N   . GLU A 1 91  ? -2.756  -18.355 -20.728 1.00 21.49 ? 94  GLU A N   1 
ATOM 689  C CA  . GLU A 1 91  ? -3.985  -18.906 -21.276 1.00 21.62 ? 94  GLU A CA  1 
ATOM 690  C C   . GLU A 1 91  ? -4.558  -17.946 -22.311 1.00 21.70 ? 94  GLU A C   1 
ATOM 691  O O   . GLU A 1 91  ? -4.533  -16.723 -22.118 1.00 21.84 ? 94  GLU A O   1 
ATOM 692  C CB  . GLU A 1 91  ? -5.003  -19.130 -20.173 1.00 21.46 ? 94  GLU A CB  1 
ATOM 693  C CG  . GLU A 1 91  ? -4.507  -20.013 -19.068 1.00 22.35 ? 94  GLU A CG  1 
ATOM 694  C CD  . GLU A 1 91  ? -5.503  -20.114 -17.947 1.00 23.49 ? 94  GLU A CD  1 
ATOM 695  O OE1 . GLU A 1 91  ? -5.576  -19.173 -17.125 1.00 23.89 ? 94  GLU A OE1 1 
ATOM 696  O OE2 . GLU A 1 91  ? -6.214  -21.140 -17.888 1.00 24.44 ? 94  GLU A OE2 1 
ATOM 697  N N   . ALA A 1 92  ? -5.058  -18.498 -23.412 1.00 21.55 ? 95  ALA A N   1 
ATOM 698  C CA  . ALA A 1 92  ? -5.761  -17.700 -24.403 1.00 21.51 ? 95  ALA A CA  1 
ATOM 699  C C   . ALA A 1 92  ? -7.185  -18.205 -24.530 1.00 21.52 ? 95  ALA A C   1 
ATOM 700  O O   . ALA A 1 92  ? -7.419  -19.410 -24.631 1.00 21.51 ? 95  ALA A O   1 
ATOM 701  C CB  . ALA A 1 92  ? -5.048  -17.748 -25.745 1.00 21.56 ? 95  ALA A CB  1 
ATOM 702  N N   . ILE A 1 93  ? -8.136  -17.278 -24.523 1.00 21.60 ? 96  ILE A N   1 
ATOM 703  C CA  . ILE A 1 93  ? -9.545  -17.629 -24.640 1.00 21.73 ? 96  ILE A CA  1 
ATOM 704  C C   . ILE A 1 93  ? -10.020 -17.556 -26.095 1.00 21.86 ? 96  ILE A C   1 
ATOM 705  O O   . ILE A 1 93  ? -9.894  -16.518 -26.749 1.00 22.00 ? 96  ILE A O   1 
ATOM 706  C CB  . ILE A 1 93  ? -10.419 -16.750 -23.718 1.00 21.60 ? 96  ILE A CB  1 
ATOM 707  C CG1 . ILE A 1 93  ? -10.094 -17.048 -22.249 1.00 21.55 ? 96  ILE A CG1 1 
ATOM 708  C CG2 . ILE A 1 93  ? -11.891 -16.996 -23.993 1.00 22.02 ? 96  ILE A CG2 1 
ATOM 709  C CD1 . ILE A 1 93  ? -10.802 -16.159 -21.246 1.00 21.58 ? 96  ILE A CD1 1 
ATOM 710  N N   . LEU A 1 94  ? -10.547 -18.670 -26.598 1.00 22.02 ? 97  LEU A N   1 
ATOM 711  C CA  . LEU A 1 94  ? -11.117 -18.711 -27.943 1.00 22.14 ? 97  LEU A CA  1 
ATOM 712  C C   . LEU A 1 94  ? -12.628 -18.555 -27.876 1.00 22.25 ? 97  LEU A C   1 
ATOM 713  O O   . LEU A 1 94  ? -13.329 -19.452 -27.418 1.00 22.45 ? 97  LEU A O   1 
ATOM 714  C CB  . LEU A 1 94  ? -10.730 -20.013 -28.663 1.00 22.20 ? 97  LEU A CB  1 
ATOM 715  C CG  . LEU A 1 94  ? -11.364 -20.396 -30.014 1.00 22.26 ? 97  LEU A CG  1 
ATOM 716  C CD1 . LEU A 1 94  ? -11.170 -19.323 -31.095 1.00 22.44 ? 97  LEU A CD1 1 
ATOM 717  C CD2 . LEU A 1 94  ? -10.837 -21.753 -30.494 1.00 22.08 ? 97  LEU A CD2 1 
ATOM 718  N N   . ARG A 1 95  ? -13.118 -17.406 -28.325 1.00 22.47 ? 98  ARG A N   1 
ATOM 719  C CA  . ARG A 1 95  ? -14.554 -17.113 -28.325 1.00 22.65 ? 98  ARG A CA  1 
ATOM 720  C C   . ARG A 1 95  ? -15.055 -16.866 -29.744 1.00 22.65 ? 98  ARG A C   1 
ATOM 721  O O   . ARG A 1 95  ? -14.270 -16.523 -30.636 1.00 22.85 ? 98  ARG A O   1 
ATOM 722  C CB  . ARG A 1 95  ? -14.867 -15.910 -27.423 1.00 22.70 ? 98  ARG A CB  1 
ATOM 723  C CG  . ARG A 1 95  ? -14.815 -16.217 -25.934 1.00 22.96 ? 98  ARG A CG  1 
ATOM 724  C CD  . ARG A 1 95  ? -16.110 -16.850 -25.449 1.00 23.51 ? 98  ARG A CD  1 
ATOM 725  N NE  . ARG A 1 95  ? -15.866 -18.043 -24.638 1.00 23.99 ? 98  ARG A NE  1 
ATOM 726  C CZ  . ARG A 1 95  ? -16.751 -18.590 -23.805 1.00 23.81 ? 98  ARG A CZ  1 
ATOM 727  N NH1 . ARG A 1 95  ? -16.428 -19.680 -23.121 1.00 23.71 ? 98  ARG A NH1 1 
ATOM 728  N NH2 . ARG A 1 95  ? -17.953 -18.049 -23.644 1.00 23.25 ? 98  ARG A NH2 1 
ATOM 729  N N   . PHE A 1 96  ? -16.360 -17.040 -29.945 1.00 22.54 ? 99  PHE A N   1 
ATOM 730  C CA  . PHE A 1 96  ? -16.960 -16.917 -31.267 1.00 22.41 ? 99  PHE A CA  1 
ATOM 731  C C   . PHE A 1 96  ? -17.923 -15.748 -31.357 1.00 22.40 ? 99  PHE A C   1 
ATOM 732  O O   . PHE A 1 96  ? -18.866 -15.649 -30.573 1.00 22.42 ? 99  PHE A O   1 
ATOM 733  C CB  . PHE A 1 96  ? -17.629 -18.228 -31.672 1.00 22.43 ? 99  PHE A CB  1 
ATOM 734  C CG  . PHE A 1 96  ? -16.653 -19.333 -31.928 1.00 22.75 ? 99  PHE A CG  1 
ATOM 735  C CD1 . PHE A 1 96  ? -16.108 -20.060 -30.871 1.00 23.45 ? 99  PHE A CD1 1 
ATOM 736  C CD2 . PHE A 1 96  ? -16.250 -19.632 -33.224 1.00 23.07 ? 99  PHE A CD2 1 
ATOM 737  C CE1 . PHE A 1 96  ? -15.183 -21.083 -31.102 1.00 23.70 ? 99  PHE A CE1 1 
ATOM 738  C CE2 . PHE A 1 96  ? -15.329 -20.647 -33.469 1.00 23.37 ? 99  PHE A CE2 1 
ATOM 739  C CZ  . PHE A 1 96  ? -14.794 -21.377 -32.404 1.00 23.47 ? 99  PHE A CZ  1 
ATOM 740  N N   . GLY A 1 97  ? -17.664 -14.863 -32.318 1.00 22.49 ? 100 GLY A N   1 
ATOM 741  C CA  . GLY A 1 97  ? -18.457 -13.648 -32.510 1.00 22.65 ? 100 GLY A CA  1 
ATOM 742  C C   . GLY A 1 97  ? -19.592 -13.803 -33.505 1.00 22.68 ? 100 GLY A C   1 
ATOM 743  O O   . GLY A 1 97  ? -19.360 -14.006 -34.696 1.00 22.72 ? 100 GLY A O   1 
ATOM 744  N N   . PHE A 1 98  ? -20.823 -13.700 -33.016 1.00 22.74 ? 101 PHE A N   1 
ATOM 745  C CA  . PHE A 1 98  ? -21.998 -13.871 -33.864 1.00 22.92 ? 101 PHE A CA  1 
ATOM 746  C C   . PHE A 1 98  ? -23.086 -12.828 -33.582 1.00 23.11 ? 101 PHE A C   1 
ATOM 747  O O   . PHE A 1 98  ? -23.114 -12.211 -32.514 1.00 23.21 ? 101 PHE A O   1 
ATOM 748  C CB  . PHE A 1 98  ? -22.558 -15.300 -33.734 1.00 22.82 ? 101 PHE A CB  1 
ATOM 749  C CG  . PHE A 1 98  ? -23.069 -15.641 -32.353 1.00 23.07 ? 101 PHE A CG  1 
ATOM 750  C CD1 . PHE A 1 98  ? -24.420 -15.489 -32.034 1.00 23.14 ? 101 PHE A CD1 1 
ATOM 751  C CD2 . PHE A 1 98  ? -22.201 -16.123 -31.368 1.00 23.17 ? 101 PHE A CD2 1 
ATOM 752  C CE1 . PHE A 1 98  ? -24.897 -15.806 -30.747 1.00 23.04 ? 101 PHE A CE1 1 
ATOM 753  C CE2 . PHE A 1 98  ? -22.669 -16.440 -30.081 1.00 22.94 ? 101 PHE A CE2 1 
ATOM 754  C CZ  . PHE A 1 98  ? -24.020 -16.279 -29.772 1.00 22.70 ? 101 PHE A CZ  1 
ATOM 755  N N   . LEU A 1 99  ? -23.963 -12.629 -34.563 1.00 23.41 ? 102 LEU A N   1 
ATOM 756  C CA  . LEU A 1 99  ? -25.207 -11.875 -34.383 1.00 23.57 ? 102 LEU A CA  1 
ATOM 757  C C   . LEU A 1 99  ? -26.304 -12.429 -35.300 1.00 23.71 ? 102 LEU A C   1 
ATOM 758  O O   . LEU A 1 99  ? -26.165 -12.392 -36.528 1.00 23.60 ? 102 LEU A O   1 
ATOM 759  C CB  . LEU A 1 99  ? -24.989 -10.377 -34.639 1.00 23.51 ? 102 LEU A CB  1 
ATOM 760  C CG  . LEU A 1 99  ? -26.225 -9.472  -34.724 1.00 23.31 ? 102 LEU A CG  1 
ATOM 761  C CD1 . LEU A 1 99  ? -26.975 -9.396  -33.392 1.00 23.10 ? 102 LEU A CD1 1 
ATOM 762  C CD2 . LEU A 1 99  ? -25.817 -8.090  -35.184 1.00 23.53 ? 102 LEU A CD2 1 
ATOM 763  N N   . GLN A 1 100 ? -27.375 -12.951 -34.695 1.00 23.91 ? 103 GLN A N   1 
ATOM 764  C CA  . GLN A 1 100 ? -28.553 -13.427 -35.438 1.00 24.18 ? 103 GLN A CA  1 
ATOM 765  C C   . GLN A 1 100 ? -29.442 -12.252 -35.834 1.00 24.32 ? 103 GLN A C   1 
ATOM 766  O O   . GLN A 1 100 ? -29.243 -11.131 -35.369 1.00 24.54 ? 103 GLN A O   1 
ATOM 767  C CB  . GLN A 1 100 ? -29.380 -14.405 -34.595 1.00 24.16 ? 103 GLN A CB  1 
ATOM 768  C CG  . GLN A 1 100 ? -28.597 -15.500 -33.891 1.00 24.26 ? 103 GLN A CG  1 
ATOM 769  C CD  . GLN A 1 100 ? -28.184 -16.634 -34.806 1.00 24.55 ? 103 GLN A CD  1 
ATOM 770  O OE1 . GLN A 1 100 ? -28.299 -16.545 -36.031 1.00 24.97 ? 103 GLN A OE1 1 
ATOM 771  N NE2 . GLN A 1 100 ? -27.692 -17.716 -34.210 1.00 24.76 ? 103 GLN A NE2 1 
ATOM 772  N N   . GLU A 1 101 ? -30.427 -12.498 -36.684 1.00 24.50 ? 104 GLU A N   1 
ATOM 773  C CA  . GLU A 1 101 ? -31.418 -11.464 -36.977 1.00 24.86 ? 104 GLU A CA  1 
ATOM 774  C C   . GLU A 1 101 ? -32.634 -11.631 -36.066 1.00 24.89 ? 104 GLU A C   1 
ATOM 775  O O   . GLU A 1 101 ? -32.830 -12.699 -35.481 1.00 24.88 ? 104 GLU A O   1 
ATOM 776  C CB  . GLU A 1 101 ? -31.821 -11.481 -38.454 1.00 24.91 ? 104 GLU A CB  1 
ATOM 777  C CG  . GLU A 1 101 ? -30.630 -11.573 -39.399 1.00 25.59 ? 104 GLU A CG  1 
ATOM 778  C CD  . GLU A 1 101 ? -30.688 -10.582 -40.545 1.00 26.26 ? 104 GLU A CD  1 
ATOM 779  O OE1 . GLU A 1 101 ? -31.803 -10.192 -40.959 1.00 26.72 ? 104 GLU A OE1 1 
ATOM 780  O OE2 . GLU A 1 101 ? -29.604 -10.196 -41.032 1.00 26.27 ? 104 GLU A OE2 1 
ATOM 781  N N   . PHE A 1 102 ? -33.431 -10.571 -35.932 1.00 24.97 ? 105 PHE A N   1 
ATOM 782  C CA  . PHE A 1 102 ? -34.671 -10.630 -35.157 1.00 25.09 ? 105 PHE A CA  1 
ATOM 783  C C   . PHE A 1 102 ? -35.603 -11.658 -35.785 1.00 25.04 ? 105 PHE A C   1 
ATOM 784  O O   . PHE A 1 102 ? -35.431 -12.020 -36.951 1.00 25.09 ? 105 PHE A O   1 
ATOM 785  C CB  . PHE A 1 102 ? -35.361 -9.262  -35.122 1.00 25.25 ? 105 PHE A CB  1 
ATOM 786  C CG  . PHE A 1 102 ? -34.796 -8.312  -34.100 1.00 25.48 ? 105 PHE A CG  1 
ATOM 787  C CD1 . PHE A 1 102 ? -33.747 -7.459  -34.425 1.00 25.85 ? 105 PHE A CD1 1 
ATOM 788  C CD2 . PHE A 1 102 ? -35.327 -8.254  -32.816 1.00 25.98 ? 105 PHE A CD2 1 
ATOM 789  C CE1 . PHE A 1 102 ? -33.225 -6.570  -33.486 1.00 25.86 ? 105 PHE A CE1 1 
ATOM 790  C CE2 . PHE A 1 102 ? -34.807 -7.365  -31.866 1.00 26.18 ? 105 PHE A CE2 1 
ATOM 791  C CZ  . PHE A 1 102 ? -33.756 -6.526  -32.204 1.00 25.74 ? 105 PHE A CZ  1 
ATOM 792  N N   . SER A 1 103 ? -36.580 -12.132 -35.018 1.00 24.98 ? 106 SER A N   1 
ATOM 793  C CA  . SER A 1 103 ? -37.551 -13.082 -35.550 1.00 25.08 ? 106 SER A CA  1 
ATOM 794  C C   . SER A 1 103 ? -38.454 -12.400 -36.573 1.00 25.07 ? 106 SER A C   1 
ATOM 795  O O   . SER A 1 103 ? -38.844 -11.244 -36.397 1.00 25.13 ? 106 SER A O   1 
ATOM 796  C CB  . SER A 1 103 ? -38.385 -13.712 -34.430 1.00 25.05 ? 106 SER A CB  1 
ATOM 797  O OG  . SER A 1 103 ? -39.515 -12.925 -34.101 1.00 25.13 ? 106 SER A OG  1 
ATOM 798  N N   . LYS A 1 104 ? -38.771 -13.113 -37.646 1.00 25.02 ? 107 LYS A N   1 
ATOM 799  C CA  . LYS A 1 104 ? -39.710 -12.607 -38.629 1.00 25.22 ? 107 LYS A CA  1 
ATOM 800  C C   . LYS A 1 104 ? -41.135 -12.665 -38.062 1.00 25.25 ? 107 LYS A C   1 
ATOM 801  O O   . LYS A 1 104 ? -42.093 -12.239 -38.714 1.00 25.29 ? 107 LYS A O   1 
ATOM 802  C CB  . LYS A 1 104 ? -39.602 -13.399 -39.933 1.00 25.34 ? 107 LYS A CB  1 
ATOM 803  C CG  . LYS A 1 104 ? -38.294 -13.210 -40.706 1.00 25.47 ? 107 LYS A CG  1 
ATOM 804  C CD  . LYS A 1 104 ? -38.242 -14.161 -41.911 1.00 25.50 ? 107 LYS A CD  1 
ATOM 805  C CE  . LYS A 1 104 ? -36.960 -14.004 -42.727 1.00 25.63 ? 107 LYS A CE  1 
ATOM 806  N NZ  . LYS A 1 104 ? -36.839 -15.084 -43.749 1.00 25.32 ? 107 LYS A NZ  1 
ATOM 807  N N   . GLU A 1 105 ? -41.258 -13.197 -36.844 1.00 25.22 ? 108 GLU A N   1 
ATOM 808  C CA  . GLU A 1 105 ? -42.516 -13.208 -36.095 1.00 25.15 ? 108 GLU A CA  1 
ATOM 809  C C   . GLU A 1 105 ? -42.811 -11.810 -35.538 1.00 25.04 ? 108 GLU A C   1 
ATOM 810  O O   . GLU A 1 105 ? -41.943 -11.175 -34.936 1.00 24.93 ? 108 GLU A O   1 
ATOM 811  C CB  . GLU A 1 105 ? -42.469 -14.275 -34.984 1.00 25.14 ? 108 GLU A CB  1 
ATOM 812  C CG  . GLU A 1 105 ? -43.436 -14.079 -33.803 1.00 25.51 ? 108 GLU A CG  1 
ATOM 813  C CD  . GLU A 1 105 ? -44.915 -14.231 -34.170 1.00 25.89 ? 108 GLU A CD  1 
ATOM 814  O OE1 . GLU A 1 105 ? -45.269 -15.166 -34.927 1.00 26.07 ? 108 GLU A OE1 1 
ATOM 815  O OE2 . GLU A 1 105 ? -45.729 -13.416 -33.678 1.00 25.41 ? 108 GLU A OE2 1 
ATOM 816  N N   . GLU A 1 106 ? -44.043 -11.350 -35.752 1.00 25.01 ? 109 GLU A N   1 
ATOM 817  C CA  . GLU A 1 106 ? -44.458 -9.982  -35.422 1.00 25.01 ? 109 GLU A CA  1 
ATOM 818  C C   . GLU A 1 106 ? -44.413 -9.661  -33.930 1.00 24.79 ? 109 GLU A C   1 
ATOM 819  O O   . GLU A 1 106 ? -44.513 -10.554 -33.087 1.00 24.83 ? 109 GLU A O   1 
ATOM 820  C CB  . GLU A 1 106 ? -45.853 -9.702  -35.979 1.00 24.86 ? 109 GLU A CB  1 
ATOM 821  C CG  . GLU A 1 106 ? -45.893 -9.564  -37.491 1.00 25.09 ? 109 GLU A CG  1 
ATOM 822  C CD  . GLU A 1 106 ? -47.288 -9.292  -38.013 1.00 25.50 ? 109 GLU A CD  1 
ATOM 823  O OE1 . GLU A 1 106 ? -47.995 -8.445  -37.424 1.00 26.50 ? 109 GLU A OE1 1 
ATOM 824  O OE2 . GLU A 1 106 ? -47.683 -9.923  -39.018 1.00 26.39 ? 109 GLU A OE2 1 
ATOM 825  N N   . ARG A 1 107 ? -44.266 -8.377  -33.619 1.00 24.54 ? 110 ARG A N   1 
ATOM 826  C CA  . ARG A 1 107 ? -44.080 -7.928  -32.243 1.00 24.34 ? 110 ARG A CA  1 
ATOM 827  C C   . ARG A 1 107 ? -45.378 -7.899  -31.444 1.00 24.26 ? 110 ARG A C   1 
ATOM 828  O O   . ARG A 1 107 ? -46.462 -7.700  -32.000 1.00 24.24 ? 110 ARG A O   1 
ATOM 829  C CB  . ARG A 1 107 ? -43.423 -6.543  -32.210 1.00 24.36 ? 110 ARG A CB  1 
ATOM 830  C CG  . ARG A 1 107 ? -41.999 -6.471  -32.757 1.00 24.26 ? 110 ARG A CG  1 
ATOM 831  C CD  . ARG A 1 107 ? -41.179 -7.649  -32.286 1.00 24.53 ? 110 ARG A CD  1 
ATOM 832  N NE  . ARG A 1 107 ? -39.843 -7.267  -31.850 1.00 24.89 ? 110 ARG A NE  1 
ATOM 833  C CZ  . ARG A 1 107 ? -39.090 -8.002  -31.036 1.00 25.03 ? 110 ARG A CZ  1 
ATOM 834  N NH1 . ARG A 1 107 ? -37.880 -7.586  -30.694 1.00 24.59 ? 110 ARG A NH1 1 
ATOM 835  N NH2 . ARG A 1 107 ? -39.545 -9.157  -30.561 1.00 25.34 ? 110 ARG A NH2 1 
ATOM 836  N N   . ASP A 1 108 ? -45.250 -8.098  -30.135 1.00 24.15 ? 111 ASP A N   1 
ATOM 837  C CA  . ASP A 1 108 ? -46.376 -7.995  -29.214 1.00 24.08 ? 111 ASP A CA  1 
ATOM 838  C C   . ASP A 1 108 ? -46.835 -6.545  -29.144 1.00 23.98 ? 111 ASP A C   1 
ATOM 839  O O   . ASP A 1 108 ? -46.012 -5.648  -28.966 1.00 24.06 ? 111 ASP A O   1 
ATOM 840  C CB  . ASP A 1 108 ? -45.978 -8.472  -27.814 1.00 24.11 ? 111 ASP A CB  1 
ATOM 841  C CG  . ASP A 1 108 ? -45.486 -9.911  -27.798 1.00 24.36 ? 111 ASP A CG  1 
ATOM 842  O OD1 . ASP A 1 108 ? -46.319 -10.835 -27.934 1.00 23.93 ? 111 ASP A OD1 1 
ATOM 843  O OD2 . ASP A 1 108 ? -44.262 -10.117 -27.636 1.00 24.89 ? 111 ASP A OD2 1 
ATOM 844  N N   . PRO A 1 109 ? -48.150 -6.306  -29.294 1.00 23.97 ? 112 PRO A N   1 
ATOM 845  C CA  . PRO A 1 109 ? -48.637 -4.938  -29.160 1.00 23.89 ? 112 PRO A CA  1 
ATOM 846  C C   . PRO A 1 109 ? -48.306 -4.396  -27.777 1.00 23.87 ? 112 PRO A C   1 
ATOM 847  O O   . PRO A 1 109 ? -48.425 -5.119  -26.785 1.00 23.89 ? 112 PRO A O   1 
ATOM 848  C CB  . PRO A 1 109 ? -50.154 -5.081  -29.337 1.00 23.84 ? 112 PRO A CB  1 
ATOM 849  C CG  . PRO A 1 109 ? -50.446 -6.524  -29.093 1.00 23.81 ? 112 PRO A CG  1 
ATOM 850  C CD  . PRO A 1 109 ? -49.243 -7.251  -29.585 1.00 23.96 ? 112 PRO A CD  1 
ATOM 851  N N   . VAL A 1 110 ? -47.853 -3.148  -27.726 1.00 23.89 ? 113 VAL A N   1 
ATOM 852  C CA  . VAL A 1 110 ? -47.587 -2.474  -26.457 1.00 23.90 ? 113 VAL A CA  1 
ATOM 853  C C   . VAL A 1 110 ? -48.411 -1.184  -26.402 1.00 23.92 ? 113 VAL A C   1 
ATOM 854  O O   . VAL A 1 110 ? -48.007 -0.144  -26.933 1.00 23.87 ? 113 VAL A O   1 
ATOM 855  C CB  . VAL A 1 110 ? -46.068 -2.216  -26.230 1.00 23.96 ? 113 VAL A CB  1 
ATOM 856  C CG1 . VAL A 1 110 ? -45.819 -1.571  -24.863 1.00 23.89 ? 113 VAL A CG1 1 
ATOM 857  C CG2 . VAL A 1 110 ? -45.268 -3.521  -26.358 1.00 23.68 ? 113 VAL A CG2 1 
ATOM 858  N N   . LYS A 1 111 ? -49.582 -1.286  -25.772 1.00 23.99 ? 114 LYS A N   1 
ATOM 859  C CA  . LYS A 1 111 ? -50.540 -0.187  -25.675 1.00 23.97 ? 114 LYS A CA  1 
ATOM 860  C C   . LYS A 1 111 ? -50.466 0.493   -24.309 1.00 24.10 ? 114 LYS A C   1 
ATOM 861  O O   . LYS A 1 111 ? -50.487 -0.175  -23.271 1.00 24.12 ? 114 LYS A O   1 
ATOM 862  C CB  . LYS A 1 111 ? -51.969 -0.690  -25.944 1.00 23.92 ? 114 LYS A CB  1 
ATOM 863  C CG  . LYS A 1 111 ? -53.038 0.405   -25.886 1.00 23.96 ? 114 LYS A CG  1 
ATOM 864  C CD  . LYS A 1 111 ? -54.369 -0.028  -26.484 1.00 23.81 ? 114 LYS A CD  1 
ATOM 865  C CE  . LYS A 1 111 ? -55.233 1.187   -26.795 1.00 23.32 ? 114 LYS A CE  1 
ATOM 866  N NZ  . LYS A 1 111 ? -56.624 0.831   -27.179 1.00 23.06 ? 114 LYS A NZ  1 
ATOM 867  N N   . ALA A 1 112 ? -50.378 1.822   -24.321 1.00 24.24 ? 115 ALA A N   1 
ATOM 868  C CA  . ALA A 1 112 ? -50.418 2.615   -23.096 1.00 24.41 ? 115 ALA A CA  1 
ATOM 869  C C   . ALA A 1 112 ? -51.400 3.788   -23.214 1.00 24.62 ? 115 ALA A C   1 
ATOM 870  O O   . ALA A 1 112 ? -52.251 3.814   -24.112 1.00 24.68 ? 115 ALA A O   1 
ATOM 871  C CB  . ALA A 1 112 ? -49.025 3.102   -22.733 1.00 24.35 ? 115 ALA A CB  1 
ATOM 872  N N   . HIS A 1 113 ? -51.286 4.742   -22.291 1.00 24.82 ? 116 HIS A N   1 
ATOM 873  C CA  . HIS A 1 113 ? -52.118 5.944   -22.286 1.00 24.96 ? 116 HIS A CA  1 
ATOM 874  C C   . HIS A 1 113 ? -51.253 7.171   -22.524 1.00 25.01 ? 116 HIS A C   1 
ATOM 875  O O   . HIS A 1 113 ? -50.049 7.143   -22.272 1.00 25.09 ? 116 HIS A O   1 
ATOM 876  C CB  . HIS A 1 113 ? -52.842 6.081   -20.949 1.00 24.98 ? 116 HIS A CB  1 
ATOM 877  C CG  . HIS A 1 113 ? -53.753 4.938   -20.635 1.00 25.19 ? 116 HIS A CG  1 
ATOM 878  N ND1 . HIS A 1 113 ? -53.287 3.689   -20.285 1.00 25.30 ? 116 HIS A ND1 1 
ATOM 879  C CD2 . HIS A 1 113 ? -55.104 4.854   -20.618 1.00 25.39 ? 116 HIS A CD2 1 
ATOM 880  C CE1 . HIS A 1 113 ? -54.311 2.885   -20.068 1.00 25.51 ? 116 HIS A CE1 1 
ATOM 881  N NE2 . HIS A 1 113 ? -55.426 3.568   -20.259 1.00 25.46 ? 116 HIS A NE2 1 
ATOM 882  N N   . GLU A 1 114 ? -51.863 8.247   -23.011 1.00 25.03 ? 117 GLU A N   1 
ATOM 883  C CA  . GLU A 1 114 ? -51.135 9.490   -23.214 1.00 25.12 ? 117 GLU A CA  1 
ATOM 884  C C   . GLU A 1 114 ? -50.824 10.124  -21.858 1.00 25.15 ? 117 GLU A C   1 
ATOM 885  O O   . GLU A 1 114 ? -51.711 10.259  -21.014 1.00 25.13 ? 117 GLU A O   1 
ATOM 886  C CB  . GLU A 1 114 ? -51.927 10.443  -24.105 1.00 25.06 ? 117 GLU A CB  1 
ATOM 887  C CG  . GLU A 1 114 ? -51.060 11.442  -24.851 1.00 25.17 ? 117 GLU A CG  1 
ATOM 888  C CD  . GLU A 1 114 ? -51.862 12.408  -25.703 1.00 25.28 ? 117 GLU A CD  1 
ATOM 889  O OE1 . GLU A 1 114 ? -53.111 12.427  -25.597 1.00 25.31 ? 117 GLU A OE1 1 
ATOM 890  O OE2 . GLU A 1 114 ? -51.236 13.157  -26.483 1.00 25.68 ? 117 GLU A OE2 1 
ATOM 891  N N   . GLY A 1 115 ? -49.559 10.487  -21.651 1.00 25.22 ? 118 GLY A N   1 
ATOM 892  C CA  . GLY A 1 115 ? -49.104 11.029  -20.368 1.00 25.30 ? 118 GLY A CA  1 
ATOM 893  C C   . GLY A 1 115 ? -48.469 9.971   -19.482 1.00 25.36 ? 118 GLY A C   1 
ATOM 894  O O   . GLY A 1 115 ? -47.556 10.264  -18.706 1.00 25.36 ? 118 GLY A O   1 
ATOM 895  N N   . TRP A 1 116 ? -48.976 8.743   -19.593 1.00 25.46 ? 119 TRP A N   1 
ATOM 896  C CA  . TRP A 1 116 ? -48.392 7.561   -18.957 1.00 25.54 ? 119 TRP A CA  1 
ATOM 897  C C   . TRP A 1 116 ? -46.969 7.331   -19.453 1.00 25.57 ? 119 TRP A C   1 
ATOM 898  O O   . TRP A 1 116 ? -46.654 7.611   -20.614 1.00 25.65 ? 119 TRP A O   1 
ATOM 899  C CB  . TRP A 1 116 ? -49.222 6.320   -19.311 1.00 25.60 ? 119 TRP A CB  1 
ATOM 900  C CG  . TRP A 1 116 ? -50.333 5.961   -18.356 1.00 25.71 ? 119 TRP A CG  1 
ATOM 901  C CD1 . TRP A 1 116 ? -51.161 6.818   -17.681 1.00 25.77 ? 119 TRP A CD1 1 
ATOM 902  C CD2 . TRP A 1 116 ? -50.757 4.636   -18.004 1.00 25.64 ? 119 TRP A CD2 1 
ATOM 903  N NE1 . TRP A 1 116 ? -52.058 6.107   -16.915 1.00 25.61 ? 119 TRP A NE1 1 
ATOM 904  C CE2 . TRP A 1 116 ? -51.833 4.767   -17.095 1.00 25.64 ? 119 TRP A CE2 1 
ATOM 905  C CE3 . TRP A 1 116 ? -50.324 3.349   -18.361 1.00 25.54 ? 119 TRP A CE3 1 
ATOM 906  C CZ2 . TRP A 1 116 ? -52.484 3.660   -16.538 1.00 25.62 ? 119 TRP A CZ2 1 
ATOM 907  C CZ3 . TRP A 1 116 ? -50.972 2.248   -17.807 1.00 25.59 ? 119 TRP A CZ3 1 
ATOM 908  C CH2 . TRP A 1 116 ? -52.041 2.413   -16.906 1.00 25.69 ? 119 TRP A CH2 1 
ATOM 909  N N   . GLY A 1 117 ? -46.113 6.816   -18.577 1.00 25.58 ? 120 GLY A N   1 
ATOM 910  C CA  . GLY A 1 117 ? -44.791 6.347   -18.993 1.00 25.51 ? 120 GLY A CA  1 
ATOM 911  C C   . GLY A 1 117 ? -44.910 4.952   -19.579 1.00 25.48 ? 120 GLY A C   1 
ATOM 912  O O   . GLY A 1 117 ? -45.734 4.153   -19.117 1.00 25.60 ? 120 GLY A O   1 
ATOM 913  N N   . VAL A 1 118 ? -44.105 4.653   -20.598 1.00 25.36 ? 121 VAL A N   1 
ATOM 914  C CA  . VAL A 1 118 ? -44.152 3.334   -21.247 1.00 25.24 ? 121 VAL A CA  1 
ATOM 915  C C   . VAL A 1 118 ? -42.773 2.814   -21.680 1.00 25.13 ? 121 VAL A C   1 
ATOM 916  O O   . VAL A 1 118 ? -41.939 3.574   -22.178 1.00 25.12 ? 121 VAL A O   1 
ATOM 917  C CB  . VAL A 1 118 ? -45.181 3.303   -22.425 1.00 25.20 ? 121 VAL A CB  1 
ATOM 918  C CG1 . VAL A 1 118 ? -44.695 4.128   -23.617 1.00 25.17 ? 121 VAL A CG1 1 
ATOM 919  C CG2 . VAL A 1 118 ? -45.507 1.866   -22.834 1.00 25.09 ? 121 VAL A CG2 1 
ATOM 920  N N   . MET A 1 119 ? -42.542 1.520   -21.461 1.00 25.02 ? 122 MET A N   1 
ATOM 921  C CA  . MET A 1 119 ? -41.322 0.864   -21.917 1.00 25.06 ? 122 MET A CA  1 
ATOM 922  C C   . MET A 1 119 ? -41.607 -0.091  -23.070 1.00 24.78 ? 122 MET A C   1 
ATOM 923  O O   . MET A 1 119 ? -42.550 -0.887  -23.009 1.00 24.83 ? 122 MET A O   1 
ATOM 924  C CB  . MET A 1 119 ? -40.647 0.094   -20.783 1.00 25.12 ? 122 MET A CB  1 
ATOM 925  C CG  . MET A 1 119 ? -39.490 -0.796  -21.264 1.00 25.38 ? 122 MET A CG  1 
ATOM 926  S SD  . MET A 1 119 ? -39.411 -2.446  -20.520 1.00 25.61 ? 122 MET A SD  1 
ATOM 927  C CE  . MET A 1 119 ? -41.140 -2.957  -20.528 1.00 25.60 ? 122 MET A CE  1 
ATOM 928  N N   . LEU A 1 120 ? -40.772 -0.012  -24.104 1.00 24.46 ? 123 LEU A N   1 
ATOM 929  C CA  . LEU A 1 120 ? -40.869 -0.894  -25.261 1.00 24.15 ? 123 LEU A CA  1 
ATOM 930  C C   . LEU A 1 120 ? -39.689 -1.861  -25.287 1.00 23.93 ? 123 LEU A C   1 
ATOM 931  O O   . LEU A 1 120 ? -38.537 -1.430  -25.363 1.00 23.92 ? 123 LEU A O   1 
ATOM 932  C CB  . LEU A 1 120 ? -40.916 -0.076  -26.550 1.00 24.19 ? 123 LEU A CB  1 
ATOM 933  C CG  . LEU A 1 120 ? -42.174 0.763   -26.788 1.00 24.16 ? 123 LEU A CG  1 
ATOM 934  C CD1 . LEU A 1 120 ? -41.831 2.055   -27.508 1.00 24.35 ? 123 LEU A CD1 1 
ATOM 935  C CD2 . LEU A 1 120 ? -43.206 -0.033  -27.564 1.00 24.25 ? 123 LEU A CD2 1 
ATOM 936  N N   . PRO A 1 121 ? -39.970 -3.177  -25.239 1.00 23.70 ? 124 PRO A N   1 
ATOM 937  C CA  . PRO A 1 121 ? -38.877 -4.133  -25.101 1.00 23.52 ? 124 PRO A CA  1 
ATOM 938  C C   . PRO A 1 121 ? -38.162 -4.367  -26.427 1.00 23.36 ? 124 PRO A C   1 
ATOM 939  O O   . PRO A 1 121 ? -38.812 -4.489  -27.470 1.00 23.49 ? 124 PRO A O   1 
ATOM 940  C CB  . PRO A 1 121 ? -39.587 -5.409  -24.634 1.00 23.49 ? 124 PRO A CB  1 
ATOM 941  C CG  . PRO A 1 121 ? -40.966 -5.308  -25.192 1.00 23.31 ? 124 PRO A CG  1 
ATOM 942  C CD  . PRO A 1 121 ? -41.285 -3.842  -25.342 1.00 23.64 ? 124 PRO A CD  1 
ATOM 943  N N   . CYS A 1 122 ? -36.835 -4.410  -26.392 1.00 23.01 ? 125 CYS A N   1 
ATOM 944  C CA  . CYS A 1 122 ? -36.079 -4.791  -27.576 1.00 22.74 ? 125 CYS A CA  1 
ATOM 945  C C   . CYS A 1 122 ? -36.215 -6.285  -27.788 1.00 22.53 ? 125 CYS A C   1 
ATOM 946  O O   . CYS A 1 122 ? -36.691 -6.720  -28.830 1.00 22.48 ? 125 CYS A O   1 
ATOM 947  C CB  . CYS A 1 122 ? -34.604 -4.415  -27.454 1.00 22.74 ? 125 CYS A CB  1 
ATOM 948  S SG  . CYS A 1 122 ? -33.681 -4.654  -28.999 1.00 22.70 ? 125 CYS A SG  1 
ATOM 949  N N   . ASN A 1 123 ? -35.814 -7.055  -26.777 1.00 22.37 ? 126 ASN A N   1 
ATOM 950  C CA  . ASN A 1 123 ? -35.793 -8.518  -26.835 1.00 22.16 ? 126 ASN A CA  1 
ATOM 951  C C   . ASN A 1 123 ? -35.033 -9.008  -28.070 1.00 21.89 ? 126 ASN A C   1 
ATOM 952  O O   . ASN A 1 123 ? -35.647 -9.543  -29.000 1.00 21.84 ? 126 ASN A O   1 
ATOM 953  C CB  . ASN A 1 123 ? -37.216 -9.077  -26.806 1.00 22.25 ? 126 ASN A CB  1 
ATOM 954  C CG  . ASN A 1 123 ? -37.425 -10.081 -25.697 1.00 22.75 ? 126 ASN A CG  1 
ATOM 955  O OD1 . ASN A 1 123 ? -36.774 -10.012 -24.649 1.00 23.08 ? 126 ASN A OD1 1 
ATOM 956  N ND2 . ASN A 1 123 ? -38.354 -11.012 -25.909 1.00 23.44 ? 126 ASN A ND2 1 
ATOM 957  N N   . PRO A 1 124 ? -33.691 -8.829  -28.071 1.00 21.59 ? 127 PRO A N   1 
ATOM 958  C CA  . PRO A 1 124 ? -32.833 -8.948  -29.250 1.00 21.30 ? 127 PRO A CA  1 
ATOM 959  C C   . PRO A 1 124 ? -32.385 -10.380 -29.554 1.00 21.01 ? 127 PRO A C   1 
ATOM 960  O O   . PRO A 1 124 ? -32.465 -11.246 -28.678 1.00 20.94 ? 127 PRO A O   1 
ATOM 961  C CB  . PRO A 1 124 ? -31.621 -8.095  -28.869 1.00 21.40 ? 127 PRO A CB  1 
ATOM 962  C CG  . PRO A 1 124 ? -31.503 -8.265  -27.400 1.00 21.47 ? 127 PRO A CG  1 
ATOM 963  C CD  . PRO A 1 124 ? -32.898 -8.518  -26.864 1.00 21.53 ? 127 PRO A CD  1 
ATOM 964  N N   . PRO A 1 125 ? -31.915 -10.625 -30.794 1.00 20.80 ? 128 PRO A N   1 
ATOM 965  C CA  . PRO A 1 125 ? -31.410 -11.928 -31.245 1.00 20.70 ? 128 PRO A CA  1 
ATOM 966  C C   . PRO A 1 125 ? -30.148 -12.374 -30.510 1.00 20.56 ? 128 PRO A C   1 
ATOM 967  O O   . PRO A 1 125 ? -29.494 -11.559 -29.863 1.00 20.42 ? 128 PRO A O   1 
ATOM 968  C CB  . PRO A 1 125 ? -31.084 -11.681 -32.719 1.00 20.75 ? 128 PRO A CB  1 
ATOM 969  C CG  . PRO A 1 125 ? -30.870 -10.208 -32.822 1.00 20.76 ? 128 PRO A CG  1 
ATOM 970  C CD  . PRO A 1 125 ? -31.860 -9.624  -31.875 1.00 20.78 ? 128 PRO A CD  1 
ATOM 971  N N   . ALA A 1 126 ? -29.823 -13.662 -30.616 1.00 20.55 ? 129 ALA A N   1 
ATOM 972  C CA  . ALA A 1 126 ? -28.632 -14.230 -29.980 1.00 20.61 ? 129 ALA A CA  1 
ATOM 973  C C   . ALA A 1 126 ? -27.369 -13.555 -30.516 1.00 20.74 ? 129 ALA A C   1 
ATOM 974  O O   . ALA A 1 126 ? -27.233 -13.358 -31.728 1.00 21.00 ? 129 ALA A O   1 
ATOM 975  C CB  . ALA A 1 126 ? -28.578 -15.734 -30.202 1.00 20.49 ? 129 ALA A CB  1 
ATOM 976  N N   . HIS A 1 127 ? -26.450 -13.204 -29.615 1.00 20.67 ? 130 HIS A N   1 
ATOM 977  C CA  . HIS A 1 127 ? -25.316 -12.348 -29.969 1.00 20.62 ? 130 HIS A CA  1 
ATOM 978  C C   . HIS A 1 127 ? -24.084 -12.561 -29.085 1.00 20.64 ? 130 HIS A C   1 
ATOM 979  O O   . HIS A 1 127 ? -24.204 -12.953 -27.921 1.00 20.99 ? 130 HIS A O   1 
ATOM 980  C CB  . HIS A 1 127 ? -25.744 -10.880 -29.867 1.00 20.62 ? 130 HIS A CB  1 
ATOM 981  C CG  . HIS A 1 127 ? -25.986 -10.429 -28.462 1.00 20.66 ? 130 HIS A CG  1 
ATOM 982  N ND1 . HIS A 1 127 ? -27.109 -10.786 -27.751 1.00 21.22 ? 130 HIS A ND1 1 
ATOM 983  C CD2 . HIS A 1 127 ? -25.230 -9.683  -27.623 1.00 21.34 ? 130 HIS A CD2 1 
ATOM 984  C CE1 . HIS A 1 127 ? -27.046 -10.264 -26.539 1.00 21.84 ? 130 HIS A CE1 1 
ATOM 985  N NE2 . HIS A 1 127 ? -25.914 -9.590  -26.435 1.00 22.27 ? 130 HIS A NE2 1 
ATOM 986  N N   . TYR A 1 128 ? -22.906 -12.288 -29.642 1.00 20.33 ? 131 TYR A N   1 
ATOM 987  C CA  . TYR A 1 128 ? -21.680 -12.140 -28.856 1.00 20.01 ? 131 TYR A CA  1 
ATOM 988  C C   . TYR A 1 128 ? -20.617 -11.394 -29.664 1.00 20.08 ? 131 TYR A C   1 
ATOM 989  O O   . TYR A 1 128 ? -20.359 -11.751 -30.817 1.00 19.85 ? 131 TYR A O   1 
ATOM 990  C CB  . TYR A 1 128 ? -21.131 -13.489 -28.378 1.00 19.75 ? 131 TYR A CB  1 
ATOM 991  C CG  . TYR A 1 128 ? -20.028 -13.347 -27.354 1.00 19.32 ? 131 TYR A CG  1 
ATOM 992  C CD1 . TYR A 1 128 ? -20.320 -13.251 -25.998 1.00 19.15 ? 131 TYR A CD1 1 
ATOM 993  C CD2 . TYR A 1 128 ? -18.693 -13.291 -27.739 1.00 19.32 ? 131 TYR A CD2 1 
ATOM 994  C CE1 . TYR A 1 128 ? -19.315 -13.112 -25.048 1.00 18.52 ? 131 TYR A CE1 1 
ATOM 995  C CE2 . TYR A 1 128 ? -17.676 -13.153 -26.794 1.00 19.21 ? 131 TYR A CE2 1 
ATOM 996  C CZ  . TYR A 1 128 ? -17.999 -13.065 -25.451 1.00 18.98 ? 131 TYR A CZ  1 
ATOM 997  O OH  . TYR A 1 128 ? -17.005 -12.929 -24.512 1.00 19.26 ? 131 TYR A OH  1 
ATOM 998  N N   . PRO A 1 129 ? -19.995 -10.357 -29.063 1.00 20.11 ? 132 PRO A N   1 
ATOM 999  C CA  . PRO A 1 129 ? -20.243 -9.834  -27.716 1.00 20.03 ? 132 PRO A CA  1 
ATOM 1000 C C   . PRO A 1 129 ? -21.308 -8.745  -27.707 1.00 19.98 ? 132 PRO A C   1 
ATOM 1001 O O   . PRO A 1 129 ? -22.059 -8.618  -28.678 1.00 20.05 ? 132 PRO A O   1 
ATOM 1002 C CB  . PRO A 1 129 ? -18.894 -9.241  -27.329 1.00 20.15 ? 132 PRO A CB  1 
ATOM 1003 C CG  . PRO A 1 129 ? -18.277 -8.809  -28.644 1.00 20.20 ? 132 PRO A CG  1 
ATOM 1004 C CD  . PRO A 1 129 ? -18.922 -9.610  -29.747 1.00 20.18 ? 132 PRO A CD  1 
ATOM 1005 N N   . GLY A 1 130 ? -21.346 -7.964  -26.626 1.00 19.83 ? 133 GLY A N   1 
ATOM 1006 C CA  . GLY A 1 130 ? -22.358 -6.922  -26.400 1.00 19.72 ? 133 GLY A CA  1 
ATOM 1007 C C   . GLY A 1 130 ? -22.616 -5.958  -27.545 1.00 19.60 ? 133 GLY A C   1 
ATOM 1008 O O   . GLY A 1 130 ? -21.751 -5.749  -28.403 1.00 19.79 ? 133 GLY A O   1 
ATOM 1009 N N   . LEU A 1 131 ? -23.803 -5.352  -27.539 1.00 19.39 ? 134 LEU A N   1 
ATOM 1010 C CA  . LEU A 1 131 ? -24.290 -4.558  -28.675 1.00 19.09 ? 134 LEU A CA  1 
ATOM 1011 C C   . LEU A 1 131 ? -24.598 -3.096  -28.343 1.00 18.98 ? 134 LEU A C   1 
ATOM 1012 O O   . LEU A 1 131 ? -24.807 -2.738  -27.186 1.00 18.91 ? 134 LEU A O   1 
ATOM 1013 C CB  . LEU A 1 131 ? -25.551 -5.209  -29.266 1.00 19.03 ? 134 LEU A CB  1 
ATOM 1014 C CG  . LEU A 1 131 ? -25.606 -6.735  -29.395 1.00 18.75 ? 134 LEU A CG  1 
ATOM 1015 C CD1 . LEU A 1 131 ? -27.018 -7.230  -29.676 1.00 18.00 ? 134 LEU A CD1 1 
ATOM 1016 C CD2 . LEU A 1 131 ? -24.643 -7.214  -30.462 1.00 19.22 ? 134 LEU A CD2 1 
ATOM 1017 N N   . SER A 1 132 ? -24.608 -2.261  -29.378 1.00 18.97 ? 135 SER A N   1 
ATOM 1018 C CA  . SER A 1 132 ? -25.193 -0.931  -29.310 1.00 19.17 ? 135 SER A CA  1 
ATOM 1019 C C   . SER A 1 132 ? -26.690 -1.052  -29.565 1.00 19.46 ? 135 SER A C   1 
ATOM 1020 O O   . SER A 1 132 ? -27.144 -1.986  -30.240 1.00 19.75 ? 135 SER A O   1 
ATOM 1021 C CB  . SER A 1 132 ? -24.589 -0.024  -30.377 1.00 19.09 ? 135 SER A CB  1 
ATOM 1022 O OG  . SER A 1 132 ? -23.365 0.526   -29.944 1.00 19.32 ? 135 SER A OG  1 
ATOM 1023 N N   . TYR A 1 133 ? -27.464 -0.107  -29.045 1.00 19.48 ? 136 TYR A N   1 
ATOM 1024 C CA  . TYR A 1 133 ? -28.893 -0.113  -29.308 1.00 19.44 ? 136 TYR A CA  1 
ATOM 1025 C C   . TYR A 1 133 ? -29.410 1.263   -29.684 1.00 19.40 ? 136 TYR A C   1 
ATOM 1026 O O   . TYR A 1 133 ? -29.161 2.245   -28.980 1.00 19.37 ? 136 TYR A O   1 
ATOM 1027 C CB  . TYR A 1 133 ? -29.665 -0.667  -28.110 1.00 19.62 ? 136 TYR A CB  1 
ATOM 1028 C CG  . TYR A 1 133 ? -29.306 -2.089  -27.736 1.00 19.62 ? 136 TYR A CG  1 
ATOM 1029 C CD1 . TYR A 1 133 ? -28.341 -2.347  -26.764 1.00 19.59 ? 136 TYR A CD1 1 
ATOM 1030 C CD2 . TYR A 1 133 ? -29.939 -3.175  -28.345 1.00 19.39 ? 136 TYR A CD2 1 
ATOM 1031 C CE1 . TYR A 1 133 ? -28.010 -3.648  -26.410 1.00 19.85 ? 136 TYR A CE1 1 
ATOM 1032 C CE2 . TYR A 1 133 ? -29.617 -4.483  -27.996 1.00 19.52 ? 136 TYR A CE2 1 
ATOM 1033 C CZ  . TYR A 1 133 ? -28.650 -4.709  -27.027 1.00 19.79 ? 136 TYR A CZ  1 
ATOM 1034 O OH  . TYR A 1 133 ? -28.317 -5.992  -26.665 1.00 20.02 ? 136 TYR A OH  1 
ATOM 1035 N N   . ARG A 1 134 ? -30.104 1.315   -30.819 1.00 19.33 ? 137 ARG A N   1 
ATOM 1036 C CA  . ARG A 1 134 ? -30.855 2.488   -31.258 1.00 19.36 ? 137 ARG A CA  1 
ATOM 1037 C C   . ARG A 1 134 ? -32.259 2.007   -31.625 1.00 19.14 ? 137 ARG A C   1 
ATOM 1038 O O   . ARG A 1 134 ? -32.447 0.830   -31.946 1.00 19.22 ? 137 ARG A O   1 
ATOM 1039 C CB  . ARG A 1 134 ? -30.204 3.147   -32.482 1.00 19.50 ? 137 ARG A CB  1 
ATOM 1040 C CG  . ARG A 1 134 ? -28.701 3.357   -32.418 1.00 20.60 ? 137 ARG A CG  1 
ATOM 1041 C CD  . ARG A 1 134 ? -28.324 4.441   -31.423 1.00 23.38 ? 137 ARG A CD  1 
ATOM 1042 N NE  . ARG A 1 134 ? -26.870 4.592   -31.292 1.00 25.69 ? 137 ARG A NE  1 
ATOM 1043 C CZ  . ARG A 1 134 ? -26.109 3.975   -30.384 1.00 26.22 ? 137 ARG A CZ  1 
ATOM 1044 N NH1 . ARG A 1 134 ? -24.798 4.198   -30.364 1.00 26.84 ? 137 ARG A NH1 1 
ATOM 1045 N NH2 . ARG A 1 134 ? -26.644 3.139   -29.499 1.00 26.17 ? 137 ARG A NH2 1 
ATOM 1046 N N   . TRP A 1 135 ? -33.241 2.904   -31.576 1.00 18.73 ? 138 TRP A N   1 
ATOM 1047 C CA  . TRP A 1 135 ? -34.597 2.563   -31.996 1.00 18.28 ? 138 TRP A CA  1 
ATOM 1048 C C   . TRP A 1 135 ? -35.011 3.369   -33.217 1.00 18.26 ? 138 TRP A C   1 
ATOM 1049 O O   . TRP A 1 135 ? -34.482 4.459   -33.460 1.00 18.34 ? 138 TRP A O   1 
ATOM 1050 C CB  . TRP A 1 135 ? -35.589 2.774   -30.860 1.00 18.11 ? 138 TRP A CB  1 
ATOM 1051 C CG  . TRP A 1 135 ? -35.684 1.621   -29.917 1.00 17.92 ? 138 TRP A CG  1 
ATOM 1052 C CD1 . TRP A 1 135 ? -34.810 1.309   -28.919 1.00 17.84 ? 138 TRP A CD1 1 
ATOM 1053 C CD2 . TRP A 1 135 ? -36.723 0.633   -29.865 1.00 17.83 ? 138 TRP A CD2 1 
ATOM 1054 N NE1 . TRP A 1 135 ? -35.233 0.183   -28.254 1.00 17.95 ? 138 TRP A NE1 1 
ATOM 1055 C CE2 . TRP A 1 135 ? -36.406 -0.250  -28.813 1.00 17.89 ? 138 TRP A CE2 1 
ATOM 1056 C CE3 . TRP A 1 135 ? -37.892 0.411   -30.605 1.00 17.68 ? 138 TRP A CE3 1 
ATOM 1057 C CZ2 . TRP A 1 135 ? -37.217 -1.342  -28.480 1.00 17.83 ? 138 TRP A CZ2 1 
ATOM 1058 C CZ3 . TRP A 1 135 ? -38.692 -0.678  -30.278 1.00 17.78 ? 138 TRP A CZ3 1 
ATOM 1059 C CH2 . TRP A 1 135 ? -38.350 -1.538  -29.224 1.00 17.77 ? 138 TRP A CH2 1 
ATOM 1060 N N   . LEU A 1 136 ? -35.963 2.828   -33.976 1.00 18.14 ? 139 LEU A N   1 
ATOM 1061 C CA  . LEU A 1 136 ? -36.365 3.410   -35.254 1.00 17.93 ? 139 LEU A CA  1 
ATOM 1062 C C   . LEU A 1 136 ? -37.861 3.665   -35.340 1.00 17.92 ? 139 LEU A C   1 
ATOM 1063 O O   . LEU A 1 136 ? -38.664 2.789   -35.015 1.00 17.88 ? 139 LEU A O   1 
ATOM 1064 C CB  . LEU A 1 136 ? -35.919 2.509   -36.408 1.00 17.86 ? 139 LEU A CB  1 
ATOM 1065 C CG  . LEU A 1 136 ? -34.412 2.470   -36.682 1.00 17.67 ? 139 LEU A CG  1 
ATOM 1066 C CD1 . LEU A 1 136 ? -34.019 1.132   -37.260 1.00 17.70 ? 139 LEU A CD1 1 
ATOM 1067 C CD2 . LEU A 1 136 ? -33.978 3.609   -37.597 1.00 17.26 ? 139 LEU A CD2 1 
ATOM 1068 N N   . LEU A 1 137 ? -38.217 4.871   -35.783 1.00 17.96 ? 140 LEU A N   1 
ATOM 1069 C CA  . LEU A 1 137 ? -39.610 5.259   -35.994 1.00 18.08 ? 140 LEU A CA  1 
ATOM 1070 C C   . LEU A 1 137 ? -40.053 4.965   -37.433 1.00 18.30 ? 140 LEU A C   1 
ATOM 1071 O O   . LEU A 1 137 ? -39.511 5.533   -38.386 1.00 18.27 ? 140 LEU A O   1 
ATOM 1072 C CB  . LEU A 1 137 ? -39.811 6.743   -35.651 1.00 18.01 ? 140 LEU A CB  1 
ATOM 1073 C CG  . LEU A 1 137 ? -41.220 7.358   -35.634 1.00 17.94 ? 140 LEU A CG  1 
ATOM 1074 C CD1 . LEU A 1 137 ? -42.059 6.864   -34.458 1.00 17.44 ? 140 LEU A CD1 1 
ATOM 1075 C CD2 . LEU A 1 137 ? -41.135 8.879   -35.614 1.00 17.92 ? 140 LEU A CD2 1 
ATOM 1076 N N   . ASN A 1 138 ? -41.025 4.058   -37.566 1.00 18.54 ? 141 ASN A N   1 
ATOM 1077 C CA  . ASN A 1 138 ? -41.662 3.689   -38.846 1.00 18.83 ? 141 ASN A CA  1 
ATOM 1078 C C   . ASN A 1 138 ? -40.777 2.994   -39.893 1.00 19.12 ? 141 ASN A C   1 
ATOM 1079 O O   . ASN A 1 138 ? -41.144 1.945   -40.434 1.00 19.17 ? 141 ASN A O   1 
ATOM 1080 C CB  . ASN A 1 138 ? -42.387 4.889   -39.478 1.00 18.77 ? 141 ASN A CB  1 
ATOM 1081 C CG  . ASN A 1 138 ? -43.447 5.479   -38.572 1.00 18.54 ? 141 ASN A CG  1 
ATOM 1082 O OD1 . ASN A 1 138 ? -43.752 4.937   -37.508 1.00 18.48 ? 141 ASN A OD1 1 
ATOM 1083 N ND2 . ASN A 1 138 ? -44.017 6.601   -38.992 1.00 18.15 ? 141 ASN A ND2 1 
ATOM 1084 N N   . GLU A 1 139 ? -39.619 3.584   -40.171 1.00 19.42 ? 142 GLU A N   1 
ATOM 1085 C CA  . GLU A 1 139 ? -38.782 3.173   -41.293 1.00 19.82 ? 142 GLU A CA  1 
ATOM 1086 C C   . GLU A 1 139 ? -37.302 3.235   -40.933 1.00 20.01 ? 142 GLU A C   1 
ATOM 1087 O O   . GLU A 1 139 ? -36.940 3.514   -39.790 1.00 19.99 ? 142 GLU A O   1 
ATOM 1088 C CB  . GLU A 1 139 ? -39.070 4.065   -42.510 1.00 19.77 ? 142 GLU A CB  1 
ATOM 1089 C CG  . GLU A 1 139 ? -39.180 5.560   -42.167 1.00 20.04 ? 142 GLU A CG  1 
ATOM 1090 C CD  . GLU A 1 139 ? -39.163 6.474   -43.383 1.00 20.03 ? 142 GLU A CD  1 
ATOM 1091 O OE1 . GLU A 1 139 ? -39.741 6.106   -44.430 1.00 20.36 ? 142 GLU A OE1 1 
ATOM 1092 O OE2 . GLU A 1 139 ? -38.575 7.574   -43.281 1.00 20.01 ? 142 GLU A OE2 1 
ATOM 1093 N N   . PHE A 1 140 ? -36.455 2.972   -41.923 1.00 20.38 ? 143 PHE A N   1 
ATOM 1094 C CA  . PHE A 1 140 ? -35.009 3.046   -41.761 1.00 20.80 ? 143 PHE A CA  1 
ATOM 1095 C C   . PHE A 1 140 ? -34.453 4.094   -42.726 1.00 20.98 ? 143 PHE A C   1 
ATOM 1096 O O   . PHE A 1 140 ? -34.909 4.181   -43.868 1.00 20.94 ? 143 PHE A O   1 
ATOM 1097 C CB  . PHE A 1 140 ? -34.383 1.673   -42.038 1.00 20.84 ? 143 PHE A CB  1 
ATOM 1098 C CG  . PHE A 1 140 ? -32.892 1.617   -41.828 1.00 21.09 ? 143 PHE A CG  1 
ATOM 1099 C CD1 . PHE A 1 140 ? -32.361 1.317   -40.574 1.00 21.75 ? 143 PHE A CD1 1 
ATOM 1100 C CD2 . PHE A 1 140 ? -32.016 1.843   -42.886 1.00 21.30 ? 143 PHE A CD2 1 
ATOM 1101 C CE1 . PHE A 1 140 ? -30.971 1.252   -40.372 1.00 21.47 ? 143 PHE A CE1 1 
ATOM 1102 C CE2 . PHE A 1 140 ? -30.628 1.785   -42.696 1.00 21.34 ? 143 PHE A CE2 1 
ATOM 1103 C CZ  . PHE A 1 140 ? -30.107 1.488   -41.437 1.00 21.12 ? 143 PHE A CZ  1 
ATOM 1104 N N   . PRO A 1 141 ? -33.472 4.900   -42.274 1.00 21.18 ? 144 PRO A N   1 
ATOM 1105 C CA  . PRO A 1 141 ? -32.946 5.026   -40.918 1.00 21.34 ? 144 PRO A CA  1 
ATOM 1106 C C   . PRO A 1 141 ? -33.521 6.230   -40.150 1.00 21.52 ? 144 PRO A C   1 
ATOM 1107 O O   . PRO A 1 141 ? -32.809 7.209   -39.901 1.00 21.55 ? 144 PRO A O   1 
ATOM 1108 C CB  . PRO A 1 141 ? -31.442 5.213   -41.161 1.00 21.35 ? 144 PRO A CB  1 
ATOM 1109 C CG  . PRO A 1 141 ? -31.324 5.728   -42.611 1.00 21.21 ? 144 PRO A CG  1 
ATOM 1110 C CD  . PRO A 1 141 ? -32.712 5.749   -43.204 1.00 21.21 ? 144 PRO A CD  1 
ATOM 1111 N N   . ASN A 1 142 ? -34.796 6.145   -39.777 1.00 21.64 ? 145 ASN A N   1 
ATOM 1112 C CA  . ASN A 1 142 ? -35.477 7.223   -39.059 1.00 21.77 ? 145 ASN A CA  1 
ATOM 1113 C C   . ASN A 1 142 ? -35.362 7.056   -37.538 1.00 21.74 ? 145 ASN A C   1 
ATOM 1114 O O   . ASN A 1 142 ? -36.271 6.531   -36.893 1.00 21.75 ? 145 ASN A O   1 
ATOM 1115 C CB  . ASN A 1 142 ? -36.945 7.274   -39.493 1.00 21.90 ? 145 ASN A CB  1 
ATOM 1116 C CG  . ASN A 1 142 ? -37.592 8.618   -39.227 1.00 22.41 ? 145 ASN A CG  1 
ATOM 1117 O OD1 . ASN A 1 142 ? -37.046 9.665   -39.580 1.00 23.00 ? 145 ASN A OD1 1 
ATOM 1118 N ND2 . ASN A 1 142 ? -38.776 8.595   -38.620 1.00 22.94 ? 145 ASN A ND2 1 
ATOM 1119 N N   . PHE A 1 143 ? -34.241 7.514   -36.978 1.00 21.79 ? 146 PHE A N   1 
ATOM 1120 C CA  . PHE A 1 143 ? -33.887 7.279   -35.565 1.00 21.78 ? 146 PHE A CA  1 
ATOM 1121 C C   . PHE A 1 143 ? -34.652 8.122   -34.552 1.00 21.96 ? 146 PHE A C   1 
ATOM 1122 O O   . PHE A 1 143 ? -34.963 9.289   -34.805 1.00 22.08 ? 146 PHE A O   1 
ATOM 1123 C CB  . PHE A 1 143 ? -32.392 7.517   -35.338 1.00 21.54 ? 146 PHE A CB  1 
ATOM 1124 C CG  . PHE A 1 143 ? -31.516 6.467   -35.932 1.00 21.42 ? 146 PHE A CG  1 
ATOM 1125 C CD1 . PHE A 1 143 ? -30.831 6.708   -37.115 1.00 21.27 ? 146 PHE A CD1 1 
ATOM 1126 C CD2 . PHE A 1 143 ? -31.370 5.231   -35.311 1.00 21.40 ? 146 PHE A CD2 1 
ATOM 1127 C CE1 . PHE A 1 143 ? -30.012 5.730   -37.675 1.00 21.21 ? 146 PHE A CE1 1 
ATOM 1128 C CE2 . PHE A 1 143 ? -30.555 4.248   -35.862 1.00 21.08 ? 146 PHE A CE2 1 
ATOM 1129 C CZ  . PHE A 1 143 ? -29.874 4.498   -37.046 1.00 21.16 ? 146 PHE A CZ  1 
ATOM 1130 N N   . ILE A 1 144 ? -34.930 7.524   -33.396 1.00 22.08 ? 147 ILE A N   1 
ATOM 1131 C CA  . ILE A 1 144 ? -35.432 8.260   -32.238 1.00 22.25 ? 147 ILE A CA  1 
ATOM 1132 C C   . ILE A 1 144 ? -34.252 9.001   -31.600 1.00 22.38 ? 147 ILE A C   1 
ATOM 1133 O O   . ILE A 1 144 ? -33.215 8.389   -31.328 1.00 22.53 ? 147 ILE A O   1 
ATOM 1134 C CB  . ILE A 1 144 ? -36.051 7.312   -31.166 1.00 22.33 ? 147 ILE A CB  1 
ATOM 1135 C CG1 . ILE A 1 144 ? -36.878 6.178   -31.802 1.00 22.17 ? 147 ILE A CG1 1 
ATOM 1136 C CG2 . ILE A 1 144 ? -36.831 8.114   -30.098 1.00 22.38 ? 147 ILE A CG2 1 
ATOM 1137 C CD1 . ILE A 1 144 ? -38.260 6.572   -32.291 1.00 22.51 ? 147 ILE A CD1 1 
ATOM 1138 N N   . PRO A 1 145 ? -34.389 10.320  -31.369 1.00 22.42 ? 148 PRO A N   1 
ATOM 1139 C CA  . PRO A 1 145 ? -33.299 10.996  -30.666 1.00 22.39 ? 148 PRO A CA  1 
ATOM 1140 C C   . PRO A 1 145 ? -33.440 10.861  -29.149 1.00 22.39 ? 148 PRO A C   1 
ATOM 1141 O O   . PRO A 1 145 ? -34.545 11.011  -28.616 1.00 22.34 ? 148 PRO A O   1 
ATOM 1142 C CB  . PRO A 1 145 ? -33.449 12.465  -31.099 1.00 22.37 ? 148 PRO A CB  1 
ATOM 1143 C CG  . PRO A 1 145 ? -34.736 12.542  -31.920 1.00 22.40 ? 148 PRO A CG  1 
ATOM 1144 C CD  . PRO A 1 145 ? -35.470 11.252  -31.732 1.00 22.41 ? 148 PRO A CD  1 
ATOM 1145 N N   . THR A 1 146 ? -32.333 10.561  -28.469 1.00 22.38 ? 149 THR A N   1 
ATOM 1146 C CA  . THR A 1 146 ? -32.311 10.540  -27.002 1.00 22.40 ? 149 THR A CA  1 
ATOM 1147 C C   . THR A 1 146 ? -32.212 11.968  -26.460 1.00 22.25 ? 149 THR A C   1 
ATOM 1148 O O   . THR A 1 146 ? -31.186 12.639  -26.623 1.00 22.27 ? 149 THR A O   1 
ATOM 1149 C CB  . THR A 1 146 ? -31.174 9.644   -26.447 1.00 22.49 ? 149 THR A CB  1 
ATOM 1150 O OG1 . THR A 1 146 ? -31.470 8.275   -26.751 1.00 22.67 ? 149 THR A OG1 1 
ATOM 1151 C CG2 . THR A 1 146 ? -31.020 9.803   -24.919 1.00 22.35 ? 149 THR A CG2 1 
ATOM 1152 N N   . ASP A 1 147 ? -33.288 12.418  -25.817 1.00 21.96 ? 150 ASP A N   1 
ATOM 1153 C CA  . ASP A 1 147 ? -33.416 13.817  -25.418 1.00 21.64 ? 150 ASP A CA  1 
ATOM 1154 C C   . ASP A 1 147 ? -33.846 14.042  -23.965 1.00 21.40 ? 150 ASP A C   1 
ATOM 1155 O O   . ASP A 1 147 ? -33.606 15.115  -23.409 1.00 21.49 ? 150 ASP A O   1 
ATOM 1156 C CB  . ASP A 1 147 ? -34.360 14.561  -26.377 1.00 21.63 ? 150 ASP A CB  1 
ATOM 1157 C CG  . ASP A 1 147 ? -35.789 14.056  -26.310 1.00 21.40 ? 150 ASP A CG  1 
ATOM 1158 O OD1 . ASP A 1 147 ? -36.003 12.827  -26.320 1.00 21.24 ? 150 ASP A OD1 1 
ATOM 1159 O OD2 . ASP A 1 147 ? -36.706 14.899  -26.256 1.00 21.51 ? 150 ASP A OD2 1 
ATOM 1160 N N   . GLY A 1 148 ? -34.473 13.042  -23.354 1.00 21.01 ? 151 GLY A N   1 
ATOM 1161 C CA  . GLY A 1 148 ? -34.993 13.195  -21.998 1.00 20.64 ? 151 GLY A CA  1 
ATOM 1162 C C   . GLY A 1 148 ? -36.428 12.728  -21.856 1.00 20.40 ? 151 GLY A C   1 
ATOM 1163 O O   . GLY A 1 148 ? -36.844 12.325  -20.770 1.00 20.38 ? 151 GLY A O   1 
ATOM 1164 N N   . ARG A 1 149 ? -37.187 12.807  -22.949 1.00 20.12 ? 152 ARG A N   1 
ATOM 1165 C CA  . ARG A 1 149 ? -38.500 12.170  -23.035 1.00 19.94 ? 152 ARG A CA  1 
ATOM 1166 C C   . ARG A 1 149 ? -38.323 10.748  -23.545 1.00 19.63 ? 152 ARG A C   1 
ATOM 1167 O O   . ARG A 1 149 ? -39.252 9.937   -23.498 1.00 19.60 ? 152 ARG A O   1 
ATOM 1168 C CB  . ARG A 1 149 ? -39.440 12.938  -23.971 1.00 20.13 ? 152 ARG A CB  1 
ATOM 1169 C CG  . ARG A 1 149 ? -39.930 14.273  -23.427 1.00 20.85 ? 152 ARG A CG  1 
ATOM 1170 C CD  . ARG A 1 149 ? -41.354 14.602  -23.886 1.00 21.62 ? 152 ARG A CD  1 
ATOM 1171 N NE  . ARG A 1 149 ? -41.820 15.869  -23.309 1.00 22.15 ? 152 ARG A NE  1 
ATOM 1172 C CZ  . ARG A 1 149 ? -43.097 16.209  -23.125 1.00 22.17 ? 152 ARG A CZ  1 
ATOM 1173 N NH1 . ARG A 1 149 ? -43.397 17.386  -22.591 1.00 22.02 ? 152 ARG A NH1 1 
ATOM 1174 N NH2 . ARG A 1 149 ? -44.077 15.379  -23.462 1.00 22.32 ? 152 ARG A NH2 1 
ATOM 1175 N N   . HIS A 1 150 ? -37.119 10.464  -24.038 1.00 19.31 ? 153 HIS A N   1 
ATOM 1176 C CA  . HIS A 1 150 ? -36.770 9.161   -24.599 1.00 18.81 ? 153 HIS A CA  1 
ATOM 1177 C C   . HIS A 1 150 ? -35.455 8.639   -24.031 1.00 18.55 ? 153 HIS A C   1 
ATOM 1178 O O   . HIS A 1 150 ? -34.529 9.409   -23.764 1.00 18.44 ? 153 HIS A O   1 
ATOM 1179 C CB  . HIS A 1 150 ? -36.667 9.246   -26.121 1.00 18.76 ? 153 HIS A CB  1 
ATOM 1180 C CG  . HIS A 1 150 ? -37.919 9.721   -26.788 1.00 18.36 ? 153 HIS A CG  1 
ATOM 1181 N ND1 . HIS A 1 150 ? -39.007 8.901   -26.995 1.00 17.98 ? 153 HIS A ND1 1 
ATOM 1182 C CD2 . HIS A 1 150 ? -38.255 10.928  -27.300 1.00 17.95 ? 153 HIS A CD2 1 
ATOM 1183 C CE1 . HIS A 1 150 ? -39.960 9.582   -27.605 1.00 17.93 ? 153 HIS A CE1 1 
ATOM 1184 N NE2 . HIS A 1 150 ? -39.528 10.815  -27.802 1.00 18.08 ? 153 HIS A NE2 1 
ATOM 1185 N N   . PHE A 1 151 ? -35.387 7.322   -23.850 1.00 18.37 ? 154 PHE A N   1 
ATOM 1186 C CA  . PHE A 1 151 ? -34.164 6.658   -23.407 1.00 18.23 ? 154 PHE A CA  1 
ATOM 1187 C C   . PHE A 1 151 ? -34.076 5.219   -23.902 1.00 18.19 ? 154 PHE A C   1 
ATOM 1188 O O   . PHE A 1 151 ? -35.009 4.431   -23.740 1.00 18.02 ? 154 PHE A O   1 
ATOM 1189 C CB  . PHE A 1 151 ? -34.048 6.696   -21.882 1.00 18.09 ? 154 PHE A CB  1 
ATOM 1190 C CG  . PHE A 1 151 ? -32.804 6.041   -21.344 1.00 17.76 ? 154 PHE A CG  1 
ATOM 1191 C CD1 . PHE A 1 151 ? -31.601 6.734   -21.299 1.00 17.73 ? 154 PHE A CD1 1 
ATOM 1192 C CD2 . PHE A 1 151 ? -32.842 4.732   -20.868 1.00 17.41 ? 154 PHE A CD2 1 
ATOM 1193 C CE1 . PHE A 1 151 ? -30.455 6.130   -20.796 1.00 17.70 ? 154 PHE A CE1 1 
ATOM 1194 C CE2 . PHE A 1 151 ? -31.703 4.117   -20.366 1.00 17.02 ? 154 PHE A CE2 1 
ATOM 1195 C CZ  . PHE A 1 151 ? -30.508 4.815   -20.330 1.00 17.69 ? 154 PHE A CZ  1 
ATOM 1196 N N   . VAL A 1 152 ? -32.937 4.896   -24.503 1.00 18.24 ? 155 VAL A N   1 
ATOM 1197 C CA  . VAL A 1 152 ? -32.628 3.536   -24.905 1.00 18.34 ? 155 VAL A CA  1 
ATOM 1198 C C   . VAL A 1 152 ? -31.526 3.016   -23.993 1.00 18.45 ? 155 VAL A C   1 
ATOM 1199 O O   . VAL A 1 152 ? -30.440 3.597   -23.933 1.00 18.59 ? 155 VAL A O   1 
ATOM 1200 C CB  . VAL A 1 152 ? -32.150 3.471   -26.369 1.00 18.29 ? 155 VAL A CB  1 
ATOM 1201 C CG1 . VAL A 1 152 ? -31.930 2.028   -26.789 1.00 18.34 ? 155 VAL A CG1 1 
ATOM 1202 C CG2 . VAL A 1 152 ? -33.156 4.143   -27.290 1.00 18.35 ? 155 VAL A CG2 1 
ATOM 1203 N N   . SER A 1 153 ? -31.821 1.936   -23.276 1.00 18.56 ? 156 SER A N   1 
ATOM 1204 C CA  . SER A 1 153 ? -30.842 1.250   -22.436 1.00 18.80 ? 156 SER A CA  1 
ATOM 1205 C C   . SER A 1 153 ? -29.773 0.567   -23.291 1.00 18.86 ? 156 SER A C   1 
ATOM 1206 O O   . SER A 1 153 ? -30.071 0.084   -24.384 1.00 18.98 ? 156 SER A O   1 
ATOM 1207 C CB  . SER A 1 153 ? -31.552 0.206   -21.568 1.00 18.89 ? 156 SER A CB  1 
ATOM 1208 O OG  . SER A 1 153 ? -30.631 -0.714  -20.991 1.00 19.31 ? 156 SER A OG  1 
ATOM 1209 N N   . GLN A 1 154 ? -28.536 0.522   -22.801 1.00 18.85 ? 157 GLN A N   1 
ATOM 1210 C CA  . GLN A 1 154 ? -27.481 -0.235  -23.487 1.00 18.96 ? 157 GLN A CA  1 
ATOM 1211 C C   . GLN A 1 154 ? -27.210 -1.594  -22.836 1.00 19.13 ? 157 GLN A C   1 
ATOM 1212 O O   . GLN A 1 154 ? -26.257 -2.288  -23.187 1.00 19.10 ? 157 GLN A O   1 
ATOM 1213 C CB  . GLN A 1 154 ? -26.192 0.584   -23.633 1.00 18.84 ? 157 GLN A CB  1 
ATOM 1214 C CG  . GLN A 1 154 ? -26.333 1.855   -24.465 1.00 18.38 ? 157 GLN A CG  1 
ATOM 1215 C CD  . GLN A 1 154 ? -27.171 1.666   -25.713 1.00 18.02 ? 157 GLN A CD  1 
ATOM 1216 O OE1 . GLN A 1 154 ? -27.006 0.697   -26.453 1.00 18.18 ? 157 GLN A OE1 1 
ATOM 1217 N NE2 . GLN A 1 154 ? -28.081 2.600   -25.952 1.00 18.13 ? 157 GLN A NE2 1 
ATOM 1218 N N   . THR A 1 155 ? -28.061 -1.963  -21.887 1.00 19.42 ? 158 THR A N   1 
ATOM 1219 C CA  . THR A 1 155 ? -28.072 -3.313  -21.352 1.00 19.71 ? 158 THR A CA  1 
ATOM 1220 C C   . THR A 1 155 ? -29.157 -4.115  -22.072 1.00 19.99 ? 158 THR A C   1 
ATOM 1221 O O   . THR A 1 155 ? -28.851 -4.988  -22.888 1.00 20.11 ? 158 THR A O   1 
ATOM 1222 C CB  . THR A 1 155 ? -28.295 -3.305  -19.829 1.00 19.61 ? 158 THR A CB  1 
ATOM 1223 O OG1 . THR A 1 155 ? -27.160 -2.702  -19.201 1.00 19.72 ? 158 THR A OG1 1 
ATOM 1224 C CG2 . THR A 1 155 ? -28.482 -4.725  -19.281 1.00 19.48 ? 158 THR A CG2 1 
ATOM 1225 N N   . THR A 1 156 ? -30.417 -3.798  -21.786 1.00 20.08 ? 159 THR A N   1 
ATOM 1226 C CA  . THR A 1 156 ? -31.542 -4.510  -22.376 1.00 20.41 ? 159 THR A CA  1 
ATOM 1227 C C   . THR A 1 156 ? -31.876 -3.998  -23.771 1.00 20.31 ? 159 THR A C   1 
ATOM 1228 O O   . THR A 1 156 ? -32.460 -4.720  -24.579 1.00 20.42 ? 159 THR A O   1 
ATOM 1229 C CB  . THR A 1 156 ? -32.805 -4.371  -21.519 1.00 20.62 ? 159 THR A CB  1 
ATOM 1230 O OG1 . THR A 1 156 ? -33.096 -2.980  -21.320 1.00 21.32 ? 159 THR A OG1 1 
ATOM 1231 C CG2 . THR A 1 156 ? -32.635 -5.070  -20.164 1.00 21.18 ? 159 THR A CG2 1 
ATOM 1232 N N   . GLY A 1 157 ? -31.528 -2.744  -24.042 1.00 20.24 ? 160 GLY A N   1 
ATOM 1233 C CA  . GLY A 1 157 ? -31.845 -2.126  -25.325 1.00 20.08 ? 160 GLY A CA  1 
ATOM 1234 C C   . GLY A 1 157 ? -33.300 -1.714  -25.427 1.00 20.04 ? 160 GLY A C   1 
ATOM 1235 O O   . GLY A 1 157 ? -33.783 -1.390  -26.515 1.00 20.12 ? 160 GLY A O   1 
ATOM 1236 N N   . ASN A 1 158 ? -33.996 -1.729  -24.292 1.00 19.84 ? 161 ASN A N   1 
ATOM 1237 C CA  . ASN A 1 158 ? -35.399 -1.340  -24.226 1.00 19.66 ? 161 ASN A CA  1 
ATOM 1238 C C   . ASN A 1 158 ? -35.573 0.158   -24.353 1.00 19.61 ? 161 ASN A C   1 
ATOM 1239 O O   . ASN A 1 158 ? -34.808 0.924   -23.770 1.00 19.78 ? 161 ASN A O   1 
ATOM 1240 C CB  . ASN A 1 158 ? -36.019 -1.806  -22.909 1.00 19.61 ? 161 ASN A CB  1 
ATOM 1241 C CG  . ASN A 1 158 ? -35.991 -3.306  -22.752 1.00 19.44 ? 161 ASN A CG  1 
ATOM 1242 O OD1 . ASN A 1 158 ? -35.823 -4.039  -23.727 1.00 20.17 ? 161 ASN A OD1 1 
ATOM 1243 N ND2 . ASN A 1 158 ? -36.154 -3.775  -21.522 1.00 18.59 ? 161 ASN A ND2 1 
ATOM 1244 N N   . LEU A 1 159 ? -36.576 0.574   -25.118 1.00 19.56 ? 162 LEU A N   1 
ATOM 1245 C CA  . LEU A 1 159 ? -36.920 1.988   -25.202 1.00 19.55 ? 162 LEU A CA  1 
ATOM 1246 C C   . LEU A 1 159 ? -37.791 2.404   -24.022 1.00 19.42 ? 162 LEU A C   1 
ATOM 1247 O O   . LEU A 1 159 ? -38.643 1.641   -23.556 1.00 19.42 ? 162 LEU A O   1 
ATOM 1248 C CB  . LEU A 1 159 ? -37.608 2.330   -26.530 1.00 19.56 ? 162 LEU A CB  1 
ATOM 1249 C CG  . LEU A 1 159 ? -38.013 3.794   -26.783 1.00 19.58 ? 162 LEU A CG  1 
ATOM 1250 C CD1 . LEU A 1 159 ? -36.834 4.765   -26.660 1.00 19.54 ? 162 LEU A CD1 1 
ATOM 1251 C CD2 . LEU A 1 159 ? -38.685 3.950   -28.143 1.00 19.70 ? 162 LEU A CD2 1 
ATOM 1252 N N   . TYR A 1 160 ? -37.550 3.622   -23.549 1.00 19.21 ? 163 TYR A N   1 
ATOM 1253 C CA  . TYR A 1 160 ? -38.294 4.206   -22.455 1.00 18.92 ? 163 TYR A CA  1 
ATOM 1254 C C   . TYR A 1 160 ? -38.800 5.568   -22.883 1.00 18.89 ? 163 TYR A C   1 
ATOM 1255 O O   . TYR A 1 160 ? -38.040 6.369   -23.430 1.00 18.88 ? 163 TYR A O   1 
ATOM 1256 C CB  . TYR A 1 160 ? -37.387 4.371   -21.236 1.00 18.80 ? 163 TYR A CB  1 
ATOM 1257 C CG  . TYR A 1 160 ? -37.000 3.074   -20.572 1.00 18.58 ? 163 TYR A CG  1 
ATOM 1258 C CD1 . TYR A 1 160 ? -35.918 2.324   -21.037 1.00 18.11 ? 163 TYR A CD1 1 
ATOM 1259 C CD2 . TYR A 1 160 ? -37.712 2.599   -19.471 1.00 18.48 ? 163 TYR A CD2 1 
ATOM 1260 C CE1 . TYR A 1 160 ? -35.559 1.129   -20.429 1.00 18.09 ? 163 TYR A CE1 1 
ATOM 1261 C CE2 . TYR A 1 160 ? -37.363 1.405   -18.853 1.00 18.47 ? 163 TYR A CE2 1 
ATOM 1262 C CZ  . TYR A 1 160 ? -36.286 0.676   -19.338 1.00 18.51 ? 163 TYR A CZ  1 
ATOM 1263 O OH  . TYR A 1 160 ? -35.940 -0.503  -18.725 1.00 18.53 ? 163 TYR A OH  1 
ATOM 1264 N N   . ILE A 1 161 ? -40.088 5.812   -22.658 1.00 18.79 ? 164 ILE A N   1 
ATOM 1265 C CA  . ILE A 1 161 ? -40.639 7.162   -22.708 1.00 18.70 ? 164 ILE A CA  1 
ATOM 1266 C C   . ILE A 1 161 ? -41.193 7.478   -21.323 1.00 18.72 ? 164 ILE A C   1 
ATOM 1267 O O   . ILE A 1 161 ? -41.932 6.675   -20.750 1.00 18.77 ? 164 ILE A O   1 
ATOM 1268 C CB  . ILE A 1 161 ? -41.737 7.324   -23.786 1.00 18.66 ? 164 ILE A CB  1 
ATOM 1269 C CG1 . ILE A 1 161 ? -41.168 7.109   -25.187 1.00 18.78 ? 164 ILE A CG1 1 
ATOM 1270 C CG2 . ILE A 1 161 ? -42.337 8.708   -23.739 1.00 18.70 ? 164 ILE A CG2 1 
ATOM 1271 C CD1 . ILE A 1 161 ? -41.739 5.913   -25.907 1.00 19.01 ? 164 ILE A CD1 1 
ATOM 1272 N N   . ALA A 1 162 ? -40.816 8.633   -20.780 1.00 18.72 ? 165 ALA A N   1 
ATOM 1273 C CA  . ALA A 1 162 ? -41.269 9.043   -19.453 1.00 18.79 ? 165 ALA A CA  1 
ATOM 1274 C C   . ALA A 1 162 ? -42.693 9.601   -19.480 1.00 19.05 ? 165 ALA A C   1 
ATOM 1275 O O   . ALA A 1 162 ? -43.414 9.516   -18.483 1.00 19.15 ? 165 ALA A O   1 
ATOM 1276 C CB  . ALA A 1 162 ? -40.312 10.048  -18.857 1.00 18.67 ? 165 ALA A CB  1 
ATOM 1277 N N   . ARG A 1 163 ? -43.083 10.170  -20.621 1.00 19.25 ? 166 ARG A N   1 
ATOM 1278 C CA  . ARG A 1 163 ? -44.435 10.694  -20.843 1.00 19.47 ? 166 ARG A CA  1 
ATOM 1279 C C   . ARG A 1 163 ? -44.742 10.685  -22.341 1.00 19.53 ? 166 ARG A C   1 
ATOM 1280 O O   . ARG A 1 163 ? -43.961 11.202  -23.143 1.00 19.68 ? 166 ARG A O   1 
ATOM 1281 C CB  . ARG A 1 163 ? -44.587 12.109  -20.252 1.00 19.44 ? 166 ARG A CB  1 
ATOM 1282 C CG  . ARG A 1 163 ? -45.864 12.865  -20.674 1.00 19.66 ? 166 ARG A CG  1 
ATOM 1283 C CD  . ARG A 1 163 ? -46.096 14.163  -19.880 1.00 19.69 ? 166 ARG A CD  1 
ATOM 1284 N NE  . ARG A 1 163 ? -44.930 15.055  -19.868 1.00 20.23 ? 166 ARG A NE  1 
ATOM 1285 C CZ  . ARG A 1 163 ? -44.914 16.290  -19.362 1.00 20.26 ? 166 ARG A CZ  1 
ATOM 1286 N NH1 . ARG A 1 163 ? -43.796 17.006  -19.403 1.00 20.06 ? 166 ARG A NH1 1 
ATOM 1287 N NH2 . ARG A 1 163 ? -46.006 16.821  -18.821 1.00 20.23 ? 166 ARG A NH2 1 
ATOM 1288 N N   . THR A 1 164 ? -45.874 10.090  -22.710 1.00 19.65 ? 167 THR A N   1 
ATOM 1289 C CA  . THR A 1 164 ? -46.271 9.975   -24.118 1.00 19.71 ? 167 THR A CA  1 
ATOM 1290 C C   . THR A 1 164 ? -47.066 11.178  -24.631 1.00 19.77 ? 167 THR A C   1 
ATOM 1291 O O   . THR A 1 164 ? -47.701 11.901  -23.856 1.00 19.63 ? 167 THR A O   1 
ATOM 1292 C CB  . THR A 1 164 ? -47.058 8.675   -24.399 1.00 19.69 ? 167 THR A CB  1 
ATOM 1293 O OG1 . THR A 1 164 ? -47.982 8.429   -23.334 1.00 19.60 ? 167 THR A OG1 1 
ATOM 1294 C CG2 . THR A 1 164 ? -46.109 7.497   -24.522 1.00 19.78 ? 167 THR A CG2 1 
ATOM 1295 N N   . ASN A 1 165 ? -47.023 11.363  -25.949 1.00 19.88 ? 168 ASN A N   1 
ATOM 1296 C CA  . ASN A 1 165 ? -47.613 12.519  -26.612 1.00 20.01 ? 168 ASN A CA  1 
ATOM 1297 C C   . ASN A 1 165 ? -48.542 12.128  -27.752 1.00 20.04 ? 168 ASN A C   1 
ATOM 1298 O O   . ASN A 1 165 ? -48.986 10.982  -27.848 1.00 20.03 ? 168 ASN A O   1 
ATOM 1299 C CB  . ASN A 1 165 ? -46.500 13.412  -27.164 1.00 20.03 ? 168 ASN A CB  1 
ATOM 1300 C CG  . ASN A 1 165 ? -45.624 13.989  -26.078 1.00 20.42 ? 168 ASN A CG  1 
ATOM 1301 O OD1 . ASN A 1 165 ? -46.105 14.697  -25.191 1.00 20.94 ? 168 ASN A OD1 1 
ATOM 1302 N ND2 . ASN A 1 165 ? -44.326 13.695  -26.140 1.00 20.56 ? 168 ASN A ND2 1 
ATOM 1303 N N   . ALA A 1 166 ? -48.843 13.105  -28.602 1.00 20.08 ? 169 ALA A N   1 
ATOM 1304 C CA  . ALA A 1 166 ? -49.484 12.862  -29.885 1.00 20.07 ? 169 ALA A CA  1 
ATOM 1305 C C   . ALA A 1 166 ? -48.408 12.630  -30.945 1.00 20.11 ? 169 ALA A C   1 
ATOM 1306 O O   . ALA A 1 166 ? -48.697 12.130  -32.034 1.00 20.13 ? 169 ALA A O   1 
ATOM 1307 C CB  . ALA A 1 166 ? -50.362 14.044  -30.267 1.00 20.05 ? 169 ALA A CB  1 
ATOM 1308 N N   . SER A 1 167 ? -47.170 12.990  -30.607 1.00 20.15 ? 170 SER A N   1 
ATOM 1309 C CA  . SER A 1 167 ? -46.030 12.864  -31.517 1.00 20.18 ? 170 SER A CA  1 
ATOM 1310 C C   . SER A 1 167 ? -45.422 11.462  -31.506 1.00 20.18 ? 170 SER A C   1 
ATOM 1311 O O   . SER A 1 167 ? -44.731 11.070  -32.449 1.00 20.07 ? 170 SER A O   1 
ATOM 1312 C CB  . SER A 1 167 ? -44.959 13.904  -31.176 1.00 20.15 ? 170 SER A CB  1 
ATOM 1313 O OG  . SER A 1 167 ? -44.493 13.735  -29.850 1.00 20.16 ? 170 SER A OG  1 
ATOM 1314 N N   . ASP A 1 168 ? -45.693 10.712  -30.441 1.00 20.28 ? 171 ASP A N   1 
ATOM 1315 C CA  . ASP A 1 168 ? -45.128 9.374   -30.258 1.00 20.40 ? 171 ASP A CA  1 
ATOM 1316 C C   . ASP A 1 168 ? -45.939 8.266   -30.956 1.00 20.41 ? 171 ASP A C   1 
ATOM 1317 O O   . ASP A 1 168 ? -45.589 7.085   -30.873 1.00 20.25 ? 171 ASP A O   1 
ATOM 1318 C CB  . ASP A 1 168 ? -44.963 9.070   -28.759 1.00 20.45 ? 171 ASP A CB  1 
ATOM 1319 C CG  . ASP A 1 168 ? -44.005 10.038  -28.055 1.00 20.77 ? 171 ASP A CG  1 
ATOM 1320 O OD1 . ASP A 1 168 ? -42.997 10.457  -28.669 1.00 20.72 ? 171 ASP A OD1 1 
ATOM 1321 O OD2 . ASP A 1 168 ? -44.259 10.372  -26.875 1.00 21.01 ? 171 ASP A OD2 1 
ATOM 1322 N N   . LEU A 1 169 ? -47.011 8.653   -31.648 1.00 20.56 ? 172 LEU A N   1 
ATOM 1323 C CA  . LEU A 1 169 ? -47.884 7.695   -32.335 1.00 20.61 ? 172 LEU A CA  1 
ATOM 1324 C C   . LEU A 1 169 ? -47.254 7.230   -33.645 1.00 20.65 ? 172 LEU A C   1 
ATOM 1325 O O   . LEU A 1 169 ? -46.970 8.035   -34.538 1.00 20.56 ? 172 LEU A O   1 
ATOM 1326 C CB  . LEU A 1 169 ? -49.278 8.290   -32.588 1.00 20.58 ? 172 LEU A CB  1 
ATOM 1327 C CG  . LEU A 1 169 ? -50.465 7.319   -32.531 1.00 20.58 ? 172 LEU A CG  1 
ATOM 1328 C CD1 . LEU A 1 169 ? -51.103 7.328   -31.148 1.00 20.27 ? 172 LEU A CD1 1 
ATOM 1329 C CD2 . LEU A 1 169 ? -51.507 7.656   -33.589 1.00 20.65 ? 172 LEU A CD2 1 
ATOM 1330 N N   . GLY A 1 170 ? -47.036 5.923   -33.741 1.00 20.73 ? 173 GLY A N   1 
ATOM 1331 C CA  . GLY A 1 170 ? -46.388 5.320   -34.898 1.00 20.82 ? 173 GLY A CA  1 
ATOM 1332 C C   . GLY A 1 170 ? -45.924 3.914   -34.584 1.00 20.91 ? 173 GLY A C   1 
ATOM 1333 O O   . GLY A 1 170 ? -46.345 3.318   -33.590 1.00 20.87 ? 173 GLY A O   1 
ATOM 1334 N N   . ASN A 1 171 ? -45.058 3.379   -35.437 1.00 21.05 ? 174 ASN A N   1 
ATOM 1335 C CA  . ASN A 1 171 ? -44.543 2.026   -35.252 1.00 21.21 ? 174 ASN A CA  1 
ATOM 1336 C C   . ASN A 1 171 ? -43.048 2.001   -34.937 1.00 21.34 ? 174 ASN A C   1 
ATOM 1337 O O   . ASN A 1 171 ? -42.275 2.795   -35.478 1.00 21.34 ? 174 ASN A O   1 
ATOM 1338 C CB  . ASN A 1 171 ? -44.889 1.145   -36.458 1.00 21.14 ? 174 ASN A CB  1 
ATOM 1339 C CG  . ASN A 1 171 ? -46.388 0.882   -36.582 1.00 21.16 ? 174 ASN A CG  1 
ATOM 1340 O OD1 . ASN A 1 171 ? -47.189 1.354   -35.773 1.00 21.04 ? 174 ASN A OD1 1 
ATOM 1341 N ND2 . ASN A 1 171 ? -46.770 0.120   -37.599 1.00 21.38 ? 174 ASN A ND2 1 
ATOM 1342 N N   . TYR A 1 172 ? -42.654 1.079   -34.061 1.00 21.49 ? 175 TYR A N   1 
ATOM 1343 C CA  . TYR A 1 172 ? -41.320 1.090   -33.466 1.00 21.65 ? 175 TYR A CA  1 
ATOM 1344 C C   . TYR A 1 172 ? -40.543 -0.201  -33.682 1.00 21.76 ? 175 TYR A C   1 
ATOM 1345 O O   . TYR A 1 172 ? -41.107 -1.296  -33.625 1.00 21.80 ? 175 TYR A O   1 
ATOM 1346 C CB  . TYR A 1 172 ? -41.418 1.397   -31.968 1.00 21.69 ? 175 TYR A CB  1 
ATOM 1347 C CG  . TYR A 1 172 ? -41.905 2.796   -31.672 1.00 21.68 ? 175 TYR A CG  1 
ATOM 1348 C CD1 . TYR A 1 172 ? -43.267 3.075   -31.562 1.00 21.73 ? 175 TYR A CD1 1 
ATOM 1349 C CD2 . TYR A 1 172 ? -41.005 3.842   -31.509 1.00 21.84 ? 175 TYR A CD2 1 
ATOM 1350 C CE1 . TYR A 1 172 ? -43.714 4.362   -31.298 1.00 21.90 ? 175 TYR A CE1 1 
ATOM 1351 C CE2 . TYR A 1 172 ? -41.440 5.129   -31.241 1.00 21.94 ? 175 TYR A CE2 1 
ATOM 1352 C CZ  . TYR A 1 172 ? -42.793 5.383   -31.138 1.00 21.99 ? 175 TYR A CZ  1 
ATOM 1353 O OH  . TYR A 1 172 ? -43.217 6.663   -30.873 1.00 22.14 ? 175 TYR A OH  1 
ATOM 1354 N N   . SER A 1 173 ? -39.240 -0.052  -33.914 1.00 21.90 ? 176 SER A N   1 
ATOM 1355 C CA  . SER A 1 173 ? -38.333 -1.179  -34.153 1.00 22.00 ? 176 SER A CA  1 
ATOM 1356 C C   . SER A 1 173 ? -36.996 -0.975  -33.452 1.00 21.97 ? 176 SER A C   1 
ATOM 1357 O O   . SER A 1 173 ? -36.445 0.130   -33.450 1.00 22.10 ? 176 SER A O   1 
ATOM 1358 C CB  . SER A 1 173 ? -38.120 -1.391  -35.659 1.00 22.05 ? 176 SER A CB  1 
ATOM 1359 O OG  . SER A 1 173 ? -36.818 -1.868  -35.960 1.00 21.99 ? 176 SER A OG  1 
ATOM 1360 N N   . CYS A 1 174 ? -36.483 -2.050  -32.861 1.00 21.80 ? 177 CYS A N   1 
ATOM 1361 C CA  . CYS A 1 174 ? -35.199 -2.017  -32.174 1.00 21.75 ? 177 CYS A CA  1 
ATOM 1362 C C   . CYS A 1 174 ? -34.084 -2.365  -33.144 1.00 21.72 ? 177 CYS A C   1 
ATOM 1363 O O   . CYS A 1 174 ? -34.152 -3.382  -33.839 1.00 21.62 ? 177 CYS A O   1 
ATOM 1364 C CB  . CYS A 1 174 ? -35.194 -2.994  -31.001 1.00 21.80 ? 177 CYS A CB  1 
ATOM 1365 S SG  . CYS A 1 174 ? -33.777 -2.839  -29.910 1.00 21.34 ? 177 CYS A SG  1 
ATOM 1366 N N   . LEU A 1 175 ? -33.070 -1.503  -33.190 1.00 21.71 ? 178 LEU A N   1 
ATOM 1367 C CA  . LEU A 1 175 ? -31.895 -1.716  -34.024 1.00 21.77 ? 178 LEU A CA  1 
ATOM 1368 C C   . LEU A 1 175 ? -30.706 -2.060  -33.136 1.00 21.94 ? 178 LEU A C   1 
ATOM 1369 O O   . LEU A 1 175 ? -30.210 -1.208  -32.386 1.00 22.17 ? 178 LEU A O   1 
ATOM 1370 C CB  . LEU A 1 175 ? -31.584 -0.471  -34.863 1.00 21.68 ? 178 LEU A CB  1 
ATOM 1371 C CG  . LEU A 1 175 ? -30.331 -0.504  -35.745 1.00 21.50 ? 178 LEU A CG  1 
ATOM 1372 C CD1 . LEU A 1 175 ? -30.701 -0.715  -37.199 1.00 21.39 ? 178 LEU A CD1 1 
ATOM 1373 C CD2 . LEU A 1 175 ? -29.536 0.779   -35.586 1.00 21.18 ? 178 LEU A CD2 1 
ATOM 1374 N N   . ALA A 1 176 ? -30.265 -3.313  -33.220 1.00 21.87 ? 179 ALA A N   1 
ATOM 1375 C CA  . ALA A 1 176 ? -29.087 -3.774  -32.498 1.00 21.78 ? 179 ALA A CA  1 
ATOM 1376 C C   . ALA A 1 176 ? -27.880 -3.752  -33.428 1.00 21.83 ? 179 ALA A C   1 
ATOM 1377 O O   . ALA A 1 176 ? -27.972 -4.188  -34.580 1.00 21.93 ? 179 ALA A O   1 
ATOM 1378 C CB  . ALA A 1 176 ? -29.319 -5.167  -31.957 1.00 21.72 ? 179 ALA A CB  1 
ATOM 1379 N N   . THR A 1 177 ? -26.757 -3.235  -32.931 1.00 21.76 ? 180 THR A N   1 
ATOM 1380 C CA  . THR A 1 177 ? -25.523 -3.168  -33.713 1.00 21.61 ? 180 THR A CA  1 
ATOM 1381 C C   . THR A 1 177 ? -24.377 -3.827  -32.971 1.00 21.50 ? 180 THR A C   1 
ATOM 1382 O O   . THR A 1 177 ? -24.141 -3.530  -31.801 1.00 21.53 ? 180 THR A O   1 
ATOM 1383 C CB  . THR A 1 177 ? -25.138 -1.713  -34.044 1.00 21.58 ? 180 THR A CB  1 
ATOM 1384 O OG1 . THR A 1 177 ? -26.155 -1.125  -34.855 1.00 22.13 ? 180 THR A OG1 1 
ATOM 1385 C CG2 . THR A 1 177 ? -23.842 -1.659  -34.808 1.00 21.55 ? 180 THR A CG2 1 
ATOM 1386 N N   . SER A 1 178 ? -23.670 -4.721  -33.655 1.00 21.46 ? 181 SER A N   1 
ATOM 1387 C CA  . SER A 1 178 ? -22.452 -5.307  -33.110 1.00 21.44 ? 181 SER A CA  1 
ATOM 1388 C C   . SER A 1 178 ? -21.204 -4.712  -33.743 1.00 21.29 ? 181 SER A C   1 
ATOM 1389 O O   . SER A 1 178 ? -21.074 -4.680  -34.970 1.00 21.28 ? 181 SER A O   1 
ATOM 1390 C CB  . SER A 1 178 ? -22.433 -6.818  -33.293 1.00 21.55 ? 181 SER A CB  1 
ATOM 1391 O OG  . SER A 1 178 ? -21.281 -7.361  -32.667 1.00 21.86 ? 181 SER A OG  1 
ATOM 1392 N N   . HIS A 1 179 ? -20.296 -4.250  -32.885 1.00 21.14 ? 182 HIS A N   1 
ATOM 1393 C CA  . HIS A 1 179 ? -18.983 -3.758  -33.289 1.00 20.95 ? 182 HIS A CA  1 
ATOM 1394 C C   . HIS A 1 179 ? -17.935 -4.809  -32.959 1.00 20.52 ? 182 HIS A C   1 
ATOM 1395 O O   . HIS A 1 179 ? -17.747 -5.151  -31.794 1.00 20.55 ? 182 HIS A O   1 
ATOM 1396 C CB  . HIS A 1 179 ? -18.643 -2.451  -32.556 1.00 21.06 ? 182 HIS A CB  1 
ATOM 1397 C CG  . HIS A 1 179 ? -19.557 -1.311  -32.889 1.00 22.31 ? 182 HIS A CG  1 
ATOM 1398 N ND1 . HIS A 1 179 ? -20.811 -1.173  -32.329 1.00 22.78 ? 182 HIS A ND1 1 
ATOM 1399 C CD2 . HIS A 1 179 ? -19.399 -0.256  -33.726 1.00 23.12 ? 182 HIS A CD2 1 
ATOM 1400 C CE1 . HIS A 1 179 ? -21.387 -0.084  -32.810 1.00 23.23 ? 182 HIS A CE1 1 
ATOM 1401 N NE2 . HIS A 1 179 ? -20.553 0.489   -33.661 1.00 23.38 ? 182 HIS A NE2 1 
ATOM 1402 N N   . MET A 1 180 ? -17.267 -5.338  -33.979 1.00 20.14 ? 183 MET A N   1 
ATOM 1403 C CA  . MET A 1 180 ? -16.087 -6.173  -33.747 1.00 19.93 ? 183 MET A CA  1 
ATOM 1404 C C   . MET A 1 180 ? -14.907 -5.798  -34.672 1.00 19.52 ? 183 MET A C   1 
ATOM 1405 O O   . MET A 1 180 ? -15.012 -4.861  -35.467 1.00 19.49 ? 183 MET A O   1 
ATOM 1406 C CB  . MET A 1 180 ? -16.444 -7.669  -33.754 1.00 19.86 ? 183 MET A CB  1 
ATOM 1407 C CG  . MET A 1 180 ? -16.478 -8.346  -35.113 1.00 20.14 ? 183 MET A CG  1 
ATOM 1408 S SD  . MET A 1 180 ? -17.264 -9.971  -35.036 1.00 20.41 ? 183 MET A SD  1 
ATOM 1409 C CE  . MET A 1 180 ? -16.265 -10.818 -33.822 1.00 20.29 ? 183 MET A CE  1 
ATOM 1410 N N   . ASP A 1 181 ? -13.794 -6.518  -34.553 1.00 19.07 ? 184 ASP A N   1 
ATOM 1411 C CA  . ASP A 1 181 ? -12.509 -6.066  -35.104 1.00 18.71 ? 184 ASP A CA  1 
ATOM 1412 C C   . ASP A 1 181 ? -12.491 -5.613  -36.561 1.00 18.25 ? 184 ASP A C   1 
ATOM 1413 O O   . ASP A 1 181 ? -11.875 -4.597  -36.888 1.00 18.12 ? 184 ASP A O   1 
ATOM 1414 C CB  . ASP A 1 181 ? -11.428 -7.115  -34.861 1.00 18.88 ? 184 ASP A CB  1 
ATOM 1415 C CG  . ASP A 1 181 ? -11.069 -7.237  -33.398 1.00 19.34 ? 184 ASP A CG  1 
ATOM 1416 O OD1 . ASP A 1 181 ? -9.868  -7.098  -33.077 1.00 18.17 ? 184 ASP A OD1 1 
ATOM 1417 O OD2 . ASP A 1 181 ? -11.998 -7.457  -32.576 1.00 20.45 ? 184 ASP A OD2 1 
ATOM 1418 N N   . PHE A 1 182 ? -13.162 -6.369  -37.424 1.00 17.77 ? 185 PHE A N   1 
ATOM 1419 C CA  . PHE A 1 182 ? -13.132 -6.113  -38.862 1.00 17.30 ? 185 PHE A CA  1 
ATOM 1420 C C   . PHE A 1 182 ? -14.532 -5.993  -39.456 1.00 17.03 ? 185 PHE A C   1 
ATOM 1421 O O   . PHE A 1 182 ? -14.710 -6.153  -40.665 1.00 16.88 ? 185 PHE A O   1 
ATOM 1422 C CB  . PHE A 1 182 ? -12.357 -7.229  -39.579 1.00 17.26 ? 185 PHE A CB  1 
ATOM 1423 C CG  . PHE A 1 182 ? -10.856 -7.093  -39.495 1.00 16.94 ? 185 PHE A CG  1 
ATOM 1424 C CD1 . PHE A 1 182 ? -10.111 -6.827  -40.638 1.00 17.04 ? 185 PHE A CD1 1 
ATOM 1425 C CD2 . PHE A 1 182 ? -10.187 -7.249  -38.282 1.00 16.49 ? 185 PHE A CD2 1 
ATOM 1426 C CE1 . PHE A 1 182 ? -8.724  -6.707  -40.573 1.00 17.20 ? 185 PHE A CE1 1 
ATOM 1427 C CE2 . PHE A 1 182 ? -8.803  -7.128  -38.204 1.00 16.32 ? 185 PHE A CE2 1 
ATOM 1428 C CZ  . PHE A 1 182 ? -8.069  -6.858  -39.350 1.00 16.90 ? 185 PHE A CZ  1 
ATOM 1429 N N   . SER A 1 183 ? -15.519 -5.706  -38.608 1.00 16.91 ? 186 SER A N   1 
ATOM 1430 C CA  . SER A 1 183 ? -16.923 -5.687  -39.036 1.00 16.94 ? 186 SER A CA  1 
ATOM 1431 C C   . SER A 1 183 ? -17.914 -5.103  -38.024 1.00 17.01 ? 186 SER A C   1 
ATOM 1432 O O   . SER A 1 183 ? -17.943 -5.504  -36.857 1.00 16.98 ? 186 SER A O   1 
ATOM 1433 C CB  . SER A 1 183 ? -17.387 -7.098  -39.426 1.00 16.89 ? 186 SER A CB  1 
ATOM 1434 O OG  . SER A 1 183 ? -17.323 -7.985  -38.322 1.00 16.36 ? 186 SER A OG  1 
ATOM 1435 N N   . THR A 1 184 ? -18.728 -4.158  -38.494 1.00 17.07 ? 187 THR A N   1 
ATOM 1436 C CA  . THR A 1 184 ? -19.926 -3.733  -37.775 1.00 17.05 ? 187 THR A CA  1 
ATOM 1437 C C   . THR A 1 184 ? -21.093 -4.445  -38.432 1.00 17.16 ? 187 THR A C   1 
ATOM 1438 O O   . THR A 1 184 ? -21.085 -4.675  -39.646 1.00 17.22 ? 187 THR A O   1 
ATOM 1439 C CB  . THR A 1 184 ? -20.186 -2.217  -37.876 1.00 16.92 ? 187 THR A CB  1 
ATOM 1440 O OG1 . THR A 1 184 ? -18.953 -1.514  -38.049 1.00 17.27 ? 187 THR A OG1 1 
ATOM 1441 C CG2 . THR A 1 184 ? -20.866 -1.714  -36.628 1.00 16.53 ? 187 THR A CG2 1 
ATOM 1442 N N   . LYS A 1 185 ? -22.091 -4.801  -37.635 1.00 17.28 ? 188 LYS A N   1 
ATOM 1443 C CA  . LYS A 1 185 ? -23.310 -5.373  -38.176 1.00 17.50 ? 188 LYS A CA  1 
ATOM 1444 C C   . LYS A 1 185 ? -24.511 -4.873  -37.402 1.00 17.82 ? 188 LYS A C   1 
ATOM 1445 O O   . LYS A 1 185 ? -24.586 -5.034  -36.183 1.00 17.99 ? 188 LYS A O   1 
ATOM 1446 C CB  . LYS A 1 185 ? -23.261 -6.900  -38.151 1.00 17.45 ? 188 LYS A CB  1 
ATOM 1447 C CG  . LYS A 1 185 ? -24.513 -7.541  -38.702 1.00 17.07 ? 188 LYS A CG  1 
ATOM 1448 C CD  . LYS A 1 185 ? -24.449 -9.040  -38.632 1.00 16.93 ? 188 LYS A CD  1 
ATOM 1449 C CE  . LYS A 1 185 ? -25.842 -9.609  -38.706 1.00 17.23 ? 188 LYS A CE  1 
ATOM 1450 N NZ  . LYS A 1 185 ? -25.871 -10.919 -39.391 1.00 18.13 ? 188 LYS A NZ  1 
ATOM 1451 N N   . SER A 1 186 ? -25.447 -4.261  -38.117 1.00 18.20 ? 189 SER A N   1 
ATOM 1452 C CA  . SER A 1 186 ? -26.679 -3.776  -37.509 1.00 18.53 ? 189 SER A CA  1 
ATOM 1453 C C   . SER A 1 186 ? -27.851 -4.632  -37.963 1.00 18.64 ? 189 SER A C   1 
ATOM 1454 O O   . SER A 1 186 ? -28.046 -4.836  -39.166 1.00 18.54 ? 189 SER A O   1 
ATOM 1455 C CB  . SER A 1 186 ? -26.923 -2.304  -37.866 1.00 18.56 ? 189 SER A CB  1 
ATOM 1456 O OG  . SER A 1 186 ? -25.845 -1.482  -37.443 1.00 18.92 ? 189 SER A OG  1 
ATOM 1457 N N   . VAL A 1 187 ? -28.606 -5.148  -36.995 1.00 18.83 ? 190 VAL A N   1 
ATOM 1458 C CA  . VAL A 1 187 ? -29.863 -5.850  -37.269 1.00 19.14 ? 190 VAL A CA  1 
ATOM 1459 C C   . VAL A 1 187 ? -31.032 -5.163  -36.574 1.00 19.37 ? 190 VAL A C   1 
ATOM 1460 O O   . VAL A 1 187 ? -30.891 -4.673  -35.450 1.00 19.54 ? 190 VAL A O   1 
ATOM 1461 C CB  . VAL A 1 187 ? -29.822 -7.343  -36.848 1.00 19.12 ? 190 VAL A CB  1 
ATOM 1462 C CG1 . VAL A 1 187 ? -28.749 -8.092  -37.623 1.00 19.42 ? 190 VAL A CG1 1 
ATOM 1463 C CG2 . VAL A 1 187 ? -29.619 -7.503  -35.341 1.00 19.04 ? 190 VAL A CG2 1 
ATOM 1464 N N   . PHE A 1 188 ? -32.182 -5.122  -37.238 1.00 19.64 ? 191 PHE A N   1 
ATOM 1465 C CA  . PHE A 1 188 ? -33.373 -4.543  -36.620 1.00 19.81 ? 191 PHE A CA  1 
ATOM 1466 C C   . PHE A 1 188 ? -34.636 -5.375  -36.783 1.00 19.88 ? 191 PHE A C   1 
ATOM 1467 O O   . PHE A 1 188 ? -34.712 -6.248  -37.650 1.00 19.84 ? 191 PHE A O   1 
ATOM 1468 C CB  . PHE A 1 188 ? -33.589 -3.083  -37.044 1.00 19.97 ? 191 PHE A CB  1 
ATOM 1469 C CG  . PHE A 1 188 ? -33.876 -2.892  -38.511 1.00 20.20 ? 191 PHE A CG  1 
ATOM 1470 C CD1 . PHE A 1 188 ? -35.185 -2.756  -38.962 1.00 20.17 ? 191 PHE A CD1 1 
ATOM 1471 C CD2 . PHE A 1 188 ? -32.836 -2.799  -39.434 1.00 20.57 ? 191 PHE A CD2 1 
ATOM 1472 C CE1 . PHE A 1 188 ? -35.458 -2.560  -40.315 1.00 20.52 ? 191 PHE A CE1 1 
ATOM 1473 C CE2 . PHE A 1 188 ? -33.102 -2.602  -40.790 1.00 20.93 ? 191 PHE A CE2 1 
ATOM 1474 C CZ  . PHE A 1 188 ? -34.416 -2.482  -41.230 1.00 20.39 ? 191 PHE A CZ  1 
ATOM 1475 N N   . SER A 1 189 ? -35.616 -5.081  -35.929 1.00 20.10 ? 192 SER A N   1 
ATOM 1476 C CA  . SER A 1 189 ? -36.813 -5.908  -35.733 1.00 20.09 ? 192 SER A CA  1 
ATOM 1477 C C   . SER A 1 189 ? -38.012 -5.553  -36.605 1.00 19.97 ? 192 SER A C   1 
ATOM 1478 O O   . SER A 1 189 ? -38.019 -4.542  -37.308 1.00 19.78 ? 192 SER A O   1 
ATOM 1479 C CB  . SER A 1 189 ? -37.250 -5.837  -34.263 1.00 20.11 ? 192 SER A CB  1 
ATOM 1480 O OG  . SER A 1 189 ? -37.947 -4.630  -33.989 1.00 20.06 ? 192 SER A OG  1 
ATOM 1481 N N   . LYS A 1 190 ? -39.027 -6.410  -36.533 1.00 20.07 ? 193 LYS A N   1 
ATOM 1482 C CA  . LYS A 1 190 ? -40.358 -6.081  -37.013 1.00 20.30 ? 193 LYS A CA  1 
ATOM 1483 C C   . LYS A 1 190 ? -40.898 -4.912  -36.193 1.00 20.47 ? 193 LYS A C   1 
ATOM 1484 O O   . LYS A 1 190 ? -40.527 -4.728  -35.026 1.00 20.35 ? 193 LYS A O   1 
ATOM 1485 C CB  . LYS A 1 190 ? -41.289 -7.287  -36.881 1.00 20.31 ? 193 LYS A CB  1 
ATOM 1486 C CG  . LYS A 1 190 ? -41.145 -8.329  -37.975 1.00 20.27 ? 193 LYS A CG  1 
ATOM 1487 C CD  . LYS A 1 190 ? -42.015 -7.989  -39.169 1.00 20.48 ? 193 LYS A CD  1 
ATOM 1488 C CE  . LYS A 1 190 ? -42.193 -9.192  -40.076 1.00 20.50 ? 193 LYS A CE  1 
ATOM 1489 N NZ  . LYS A 1 190 ? -43.380 -9.039  -40.964 1.00 20.36 ? 193 LYS A NZ  1 
ATOM 1490 N N   . PHE A 1 191 ? -41.776 -4.129  -36.811 1.00 20.70 ? 194 PHE A N   1 
ATOM 1491 C CA  . PHE A 1 191 ? -42.282 -2.904  -36.196 1.00 20.85 ? 194 PHE A CA  1 
ATOM 1492 C C   . PHE A 1 191 ? -43.492 -3.123  -35.286 1.00 20.85 ? 194 PHE A C   1 
ATOM 1493 O O   . PHE A 1 191 ? -44.572 -3.516  -35.741 1.00 20.72 ? 194 PHE A O   1 
ATOM 1494 C CB  . PHE A 1 191 ? -42.569 -1.841  -37.264 1.00 20.94 ? 194 PHE A CB  1 
ATOM 1495 C CG  . PHE A 1 191 ? -41.330 -1.169  -37.791 1.00 20.97 ? 194 PHE A CG  1 
ATOM 1496 C CD1 . PHE A 1 191 ? -40.530 -1.796  -38.744 1.00 20.93 ? 194 PHE A CD1 1 
ATOM 1497 C CD2 . PHE A 1 191 ? -40.958 0.088   -37.324 1.00 21.15 ? 194 PHE A CD2 1 
ATOM 1498 C CE1 . PHE A 1 191 ? -39.380 -1.181  -39.228 1.00 21.07 ? 194 PHE A CE1 1 
ATOM 1499 C CE2 . PHE A 1 191 ? -39.809 0.713   -37.801 1.00 21.38 ? 194 PHE A CE2 1 
ATOM 1500 C CZ  . PHE A 1 191 ? -39.020 0.078   -38.760 1.00 21.29 ? 194 PHE A CZ  1 
ATOM 1501 N N   . ALA A 1 192 ? -43.277 -2.875  -33.994 1.00 20.84 ? 195 ALA A N   1 
ATOM 1502 C CA  . ALA A 1 192 ? -44.326 -2.956  -32.982 1.00 20.76 ? 195 ALA A CA  1 
ATOM 1503 C C   . ALA A 1 192 ? -45.220 -1.734  -33.081 1.00 20.72 ? 195 ALA A C   1 
ATOM 1504 O O   . ALA A 1 192 ? -44.732 -0.622  -33.300 1.00 20.78 ? 195 ALA A O   1 
ATOM 1505 C CB  . ALA A 1 192 ? -43.716 -3.047  -31.590 1.00 20.67 ? 195 ALA A CB  1 
ATOM 1506 N N   . GLN A 1 193 ? -46.525 -1.940  -32.926 1.00 20.59 ? 196 GLN A N   1 
ATOM 1507 C CA  . GLN A 1 193 ? -47.457 -0.822  -32.921 1.00 20.43 ? 196 GLN A CA  1 
ATOM 1508 C C   . GLN A 1 193 ? -47.708 -0.312  -31.504 1.00 20.41 ? 196 GLN A C   1 
ATOM 1509 O O   . GLN A 1 193 ? -48.185 -1.074  -30.612 1.00 20.43 ? 196 GLN A O   1 
ATOM 1510 C CB  . GLN A 1 193 ? -48.779 -1.189  -33.606 1.00 20.46 ? 196 GLN A CB  1 
ATOM 1511 C CG  . GLN A 1 193 ? -49.770 -0.042  -33.598 1.00 20.28 ? 196 GLN A CG  1 
ATOM 1512 C CD  . GLN A 1 193 ? -50.509 0.101   -34.902 1.00 20.05 ? 196 GLN A CD  1 
ATOM 1513 O OE1 . GLN A 1 193 ? -51.367 -0.714  -35.234 1.00 20.41 ? 196 GLN A OE1 1 
ATOM 1514 N NE2 . GLN A 1 193 ? -50.189 1.151   -35.648 1.00 19.86 ? 196 GLN A NE2 1 
ATOM 1515 N N   . LEU A 1 194 ? -47.380 0.982   -31.312 1.00 20.42 ? 197 LEU A N   1 
ATOM 1516 C CA  . LEU A 1 194 ? -47.659 1.649   -30.045 1.00 20.39 ? 197 LEU A CA  1 
ATOM 1517 C C   . LEU A 1 194 ? -49.012 2.335   -30.132 1.00 20.33 ? 197 LEU A C   1 
ATOM 1518 O O   . LEU A 1 194 ? -49.157 3.374   -30.783 1.00 20.22 ? 197 LEU A O   1 
ATOM 1519 C CB  . LEU A 1 194 ? -46.563 2.670   -29.707 1.00 20.44 ? 197 LEU A CB  1 
ATOM 1520 C CG  . LEU A 1 194 ? -46.694 3.455   -28.395 1.00 20.28 ? 197 LEU A CG  1 
ATOM 1521 C CD1 . LEU A 1 194 ? -46.071 2.691   -27.232 1.00 20.14 ? 197 LEU A CD1 1 
ATOM 1522 C CD2 . LEU A 1 194 ? -46.061 4.829   -28.527 1.00 19.83 ? 197 LEU A CD2 1 
ATOM 1523 N N   . ASN A 1 195 ? -50.002 1.735   -29.483 1.00 20.46 ? 198 ASN A N   1 
ATOM 1524 C CA  . ASN A 1 195 ? -51.346 2.298   -29.437 1.00 20.66 ? 198 ASN A CA  1 
ATOM 1525 C C   . ASN A 1 195 ? -51.485 3.189   -28.207 1.00 20.84 ? 198 ASN A C   1 
ATOM 1526 O O   . ASN A 1 195 ? -51.075 2.806   -27.109 1.00 20.91 ? 198 ASN A O   1 
ATOM 1527 C CB  . ASN A 1 195 ? -52.399 1.182   -29.423 1.00 20.57 ? 198 ASN A CB  1 
ATOM 1528 C CG  . ASN A 1 195 ? -52.129 0.101   -30.473 1.00 20.14 ? 198 ASN A CG  1 
ATOM 1529 O OD1 . ASN A 1 195 ? -52.316 0.321   -31.670 1.00 19.77 ? 198 ASN A OD1 1 
ATOM 1530 N ND2 . ASN A 1 195 ? -51.691 -1.071  -30.018 1.00 19.38 ? 198 ASN A ND2 1 
ATOM 1531 N N   . LEU A 1 196 ? -52.042 4.381   -28.391 1.00 21.02 ? 199 LEU A N   1 
ATOM 1532 C CA  . LEU A 1 196 ? -52.186 5.316   -27.279 1.00 21.26 ? 199 LEU A CA  1 
ATOM 1533 C C   . LEU A 1 196 ? -53.642 5.660   -26.996 1.00 21.44 ? 199 LEU A C   1 
ATOM 1534 O O   . LEU A 1 196 ? -54.249 6.491   -27.681 1.00 21.50 ? 199 LEU A O   1 
ATOM 1535 C CB  . LEU A 1 196 ? -51.343 6.577   -27.504 1.00 21.23 ? 199 LEU A CB  1 
ATOM 1536 C CG  . LEU A 1 196 ? -49.826 6.370   -27.412 1.00 21.23 ? 199 LEU A CG  1 
ATOM 1537 C CD1 . LEU A 1 196 ? -49.079 7.581   -27.942 1.00 21.33 ? 199 LEU A CD1 1 
ATOM 1538 C CD2 . LEU A 1 196 ? -49.393 6.051   -25.982 1.00 21.16 ? 199 LEU A CD2 1 
ATOM 1539 N N   . ALA A 1 197 ? -54.190 5.006   -25.974 1.00 21.63 ? 200 ALA A N   1 
ATOM 1540 C CA  . ALA A 1 197 ? -55.581 5.198   -25.572 1.00 21.81 ? 200 ALA A CA  1 
ATOM 1541 C C   . ALA A 1 197 ? -55.793 6.543   -24.879 1.00 21.90 ? 200 ALA A C   1 
ATOM 1542 O O   . ALA A 1 197 ? -54.891 7.391   -24.858 1.00 21.89 ? 200 ALA A O   1 
ATOM 1543 C CB  . ALA A 1 197 ? -56.040 4.049   -24.674 1.00 21.82 ? 200 ALA A CB  1 
ATOM 1544 N N   . ALA A 1 198 ? -56.989 6.716   -24.313 1.00 21.99 ? 201 ALA A N   1 
ATOM 1545 C CA  . ALA A 1 198 ? -57.418 7.959   -23.659 1.00 22.03 ? 201 ALA A CA  1 
ATOM 1546 C C   . ALA A 1 198 ? -56.348 8.622   -22.781 1.00 22.07 ? 201 ALA A C   1 
ATOM 1547 O O   . ALA A 1 198 ? -55.682 7.960   -21.976 1.00 22.02 ? 201 ALA A O   1 
ATOM 1548 C CB  . ALA A 1 198 ? -58.696 7.719   -22.861 1.00 21.99 ? 201 ALA A CB  1 
ATOM 1549 N N   . GLU A 1 199 ? -56.201 9.934   -22.959 1.00 22.08 ? 202 GLU A N   1 
ATOM 1550 C CA  . GLU A 1 199 ? -55.213 10.735  -22.243 1.00 22.05 ? 202 GLU A CA  1 
ATOM 1551 C C   . GLU A 1 199 ? -55.495 10.768  -20.744 1.00 22.04 ? 202 GLU A C   1 
ATOM 1552 O O   . GLU A 1 199 ? -56.613 11.065  -20.316 1.00 22.11 ? 202 GLU A O   1 
ATOM 1553 C CB  . GLU A 1 199 ? -55.185 12.165  -22.802 1.00 22.05 ? 202 GLU A CB  1 
ATOM 1554 C CG  . GLU A 1 199 ? -54.150 13.087  -22.150 1.00 22.16 ? 202 GLU A CG  1 
ATOM 1555 C CD  . GLU A 1 199 ? -54.570 14.552  -22.138 1.00 22.19 ? 202 GLU A CD  1 
ATOM 1556 O OE1 . GLU A 1 199 ? -55.747 14.847  -21.824 1.00 22.10 ? 202 GLU A OE1 1 
ATOM 1557 O OE2 . GLU A 1 199 ? -53.713 15.412  -22.427 1.00 22.27 ? 202 GLU A OE2 1 
ATOM 1558 N N   . ASP A 1 200 ? -54.472 10.449  -19.959 1.00 22.03 ? 203 ASP A N   1 
ATOM 1559 C CA  . ASP A 1 200 ? -54.514 10.627  -18.516 1.00 22.01 ? 203 ASP A CA  1 
ATOM 1560 C C   . ASP A 1 200 ? -54.163 12.087  -18.218 1.00 22.03 ? 203 ASP A C   1 
ATOM 1561 O O   . ASP A 1 200 ? -53.201 12.626  -18.770 1.00 22.06 ? 203 ASP A O   1 
ATOM 1562 C CB  . ASP A 1 200 ? -53.520 9.680   -17.840 1.00 21.98 ? 203 ASP A CB  1 
ATOM 1563 C CG  . ASP A 1 200 ? -53.931 9.296   -16.428 1.00 21.92 ? 203 ASP A CG  1 
ATOM 1564 O OD1 . ASP A 1 200 ? -54.682 10.059  -15.775 1.00 21.99 ? 203 ASP A OD1 1 
ATOM 1565 O OD2 . ASP A 1 200 ? -53.490 8.220   -15.968 1.00 21.72 ? 203 ASP A OD2 1 
ATOM 1566 N N   . THR A 1 201 ? -54.952 12.729  -17.364 1.00 22.06 ? 204 THR A N   1 
ATOM 1567 C CA  . THR A 1 201 ? -54.732 14.140  -17.049 1.00 22.11 ? 204 THR A CA  1 
ATOM 1568 C C   . THR A 1 201 ? -53.828 14.299  -15.826 1.00 22.08 ? 204 THR A C   1 
ATOM 1569 O O   . THR A 1 201 ? -53.199 15.341  -15.643 1.00 22.02 ? 204 THR A O   1 
ATOM 1570 C CB  . THR A 1 201 ? -56.073 14.923  -16.848 1.00 22.22 ? 204 THR A CB  1 
ATOM 1571 O OG1 . THR A 1 201 ? -56.650 14.614  -15.570 1.00 22.27 ? 204 THR A OG1 1 
ATOM 1572 C CG2 . THR A 1 201 ? -57.083 14.607  -17.969 1.00 22.16 ? 204 THR A CG2 1 
ATOM 1573 N N   . ARG A 1 202 ? -53.759 13.246  -15.014 1.00 22.15 ? 205 ARG A N   1 
ATOM 1574 C CA  . ARG A 1 202 ? -53.069 13.265  -13.720 1.00 22.32 ? 205 ARG A CA  1 
ATOM 1575 C C   . ARG A 1 202 ? -51.546 13.424  -13.790 1.00 22.37 ? 205 ARG A C   1 
ATOM 1576 O O   . ARG A 1 202 ? -50.936 13.279  -14.854 1.00 22.44 ? 205 ARG A O   1 
ATOM 1577 C CB  . ARG A 1 202 ? -53.424 12.005  -12.919 1.00 22.33 ? 205 ARG A CB  1 
ATOM 1578 C CG  . ARG A 1 202 ? -54.669 12.151  -12.066 1.00 22.67 ? 205 ARG A CG  1 
ATOM 1579 C CD  . ARG A 1 202 ? -55.259 10.806  -11.688 1.00 23.01 ? 205 ARG A CD  1 
ATOM 1580 N NE  . ARG A 1 202 ? -55.916 10.157  -12.823 1.00 23.29 ? 205 ARG A NE  1 
ATOM 1581 C CZ  . ARG A 1 202 ? -57.042 9.454   -12.735 1.00 23.71 ? 205 ARG A CZ  1 
ATOM 1582 N NH1 . ARG A 1 202 ? -57.566 8.898   -13.820 1.00 23.92 ? 205 ARG A NH1 1 
ATOM 1583 N NH2 . ARG A 1 202 ? -57.653 9.315   -11.565 1.00 23.58 ? 205 ARG A NH2 1 
ATOM 1584 N N   . LEU A 1 203 ? -50.952 13.726  -12.636 1.00 22.34 ? 206 LEU A N   1 
ATOM 1585 C CA  . LEU A 1 203 ? -49.510 13.877  -12.496 1.00 22.25 ? 206 LEU A CA  1 
ATOM 1586 C C   . LEU A 1 203 ? -48.954 12.775  -11.598 1.00 22.32 ? 206 LEU A C   1 
ATOM 1587 O O   . LEU A 1 203 ? -49.616 12.341  -10.653 1.00 22.22 ? 206 LEU A O   1 
ATOM 1588 C CB  . LEU A 1 203 ? -49.180 15.252  -11.912 1.00 22.26 ? 206 LEU A CB  1 
ATOM 1589 C CG  . LEU A 1 203 ? -49.615 16.483  -12.717 1.00 22.13 ? 206 LEU A CG  1 
ATOM 1590 C CD1 . LEU A 1 203 ? -49.894 17.654  -11.796 1.00 21.92 ? 206 LEU A CD1 1 
ATOM 1591 C CD2 . LEU A 1 203 ? -48.582 16.855  -13.775 1.00 22.09 ? 206 LEU A CD2 1 
ATOM 1592 N N   . PHE A 1 204 ? -47.738 12.327  -11.902 1.00 22.53 ? 207 PHE A N   1 
ATOM 1593 C CA  . PHE A 1 204 ? -47.093 11.246  -11.154 1.00 22.71 ? 207 PHE A CA  1 
ATOM 1594 C C   . PHE A 1 204 ? -45.674 11.616  -10.740 1.00 22.74 ? 207 PHE A C   1 
ATOM 1595 O O   . PHE A 1 204 ? -44.866 12.027  -11.576 1.00 22.67 ? 207 PHE A O   1 
ATOM 1596 C CB  . PHE A 1 204 ? -47.055 9.949   -11.980 1.00 22.82 ? 207 PHE A CB  1 
ATOM 1597 C CG  . PHE A 1 204 ? -48.361 9.605   -12.645 1.00 22.94 ? 207 PHE A CG  1 
ATOM 1598 C CD1 . PHE A 1 204 ? -48.550 9.859   -14.002 1.00 23.19 ? 207 PHE A CD1 1 
ATOM 1599 C CD2 . PHE A 1 204 ? -49.401 9.029   -11.919 1.00 22.97 ? 207 PHE A CD2 1 
ATOM 1600 C CE1 . PHE A 1 204 ? -49.761 9.547   -14.628 1.00 23.28 ? 207 PHE A CE1 1 
ATOM 1601 C CE2 . PHE A 1 204 ? -50.615 8.711   -12.535 1.00 23.24 ? 207 PHE A CE2 1 
ATOM 1602 C CZ  . PHE A 1 204 ? -50.795 8.970   -13.893 1.00 23.15 ? 207 PHE A CZ  1 
ATOM 1603 N N   . ALA A 1 205 ? -45.382 11.471  -9.447  1.00 22.88 ? 208 ALA A N   1 
ATOM 1604 C CA  . ALA A 1 205 ? -44.012 11.554  -8.940  1.00 22.95 ? 208 ALA A CA  1 
ATOM 1605 C C   . ALA A 1 205 ? -43.190 10.474  -9.643  1.00 23.08 ? 208 ALA A C   1 
ATOM 1606 O O   . ALA A 1 205 ? -43.712 9.390   -9.914  1.00 23.23 ? 208 ALA A O   1 
ATOM 1607 C CB  . ALA A 1 205 ? -43.991 11.355  -7.433  1.00 22.87 ? 208 ALA A CB  1 
ATOM 1608 N N   . PRO A 1 206 ? -41.908 10.755  -9.945  1.00 23.19 ? 209 PRO A N   1 
ATOM 1609 C CA  . PRO A 1 206 ? -41.167 9.853   -10.828 1.00 23.20 ? 209 PRO A CA  1 
ATOM 1610 C C   . PRO A 1 206 ? -40.949 8.472   -10.227 1.00 23.25 ? 209 PRO A C   1 
ATOM 1611 O O   . PRO A 1 206 ? -40.704 8.351   -9.030  1.00 23.37 ? 209 PRO A O   1 
ATOM 1612 C CB  . PRO A 1 206 ? -39.823 10.569  -11.020 1.00 23.06 ? 209 PRO A CB  1 
ATOM 1613 C CG  . PRO A 1 206 ? -39.676 11.428  -9.828  1.00 23.14 ? 209 PRO A CG  1 
ATOM 1614 C CD  . PRO A 1 206 ? -41.067 11.871  -9.477  1.00 23.31 ? 209 PRO A CD  1 
ATOM 1615 N N   . SER A 1 207 ? -41.072 7.440   -11.053 1.00 23.39 ? 210 SER A N   1 
ATOM 1616 C CA  . SER A 1 207 ? -40.659 6.101   -10.660 1.00 23.57 ? 210 SER A CA  1 
ATOM 1617 C C   . SER A 1 207 ? -39.536 5.646   -11.589 1.00 23.60 ? 210 SER A C   1 
ATOM 1618 O O   . SER A 1 207 ? -39.716 5.608   -12.807 1.00 23.67 ? 210 SER A O   1 
ATOM 1619 C CB  . SER A 1 207 ? -41.841 5.128   -10.702 1.00 23.56 ? 210 SER A CB  1 
ATOM 1620 O OG  . SER A 1 207 ? -41.414 3.792   -10.481 1.00 23.81 ? 210 SER A OG  1 
ATOM 1621 N N   . ILE A 1 208 ? -38.375 5.337   -11.013 1.00 23.61 ? 211 ILE A N   1 
ATOM 1622 C CA  . ILE A 1 208 ? -37.239 4.813   -11.779 1.00 23.61 ? 211 ILE A CA  1 
ATOM 1623 C C   . ILE A 1 208 ? -37.534 3.367   -12.167 1.00 23.61 ? 211 ILE A C   1 
ATOM 1624 O O   . ILE A 1 208 ? -37.893 2.551   -11.314 1.00 23.78 ? 211 ILE A O   1 
ATOM 1625 C CB  . ILE A 1 208 ? -35.898 4.913   -10.995 1.00 23.57 ? 211 ILE A CB  1 
ATOM 1626 C CG1 . ILE A 1 208 ? -35.623 6.365   -10.589 1.00 23.61 ? 211 ILE A CG1 1 
ATOM 1627 C CG2 . ILE A 1 208 ? -34.737 4.371   -11.827 1.00 23.39 ? 211 ILE A CG2 1 
ATOM 1628 C CD1 . ILE A 1 208 ? -34.555 6.540   -9.525  1.00 23.65 ? 211 ILE A CD1 1 
ATOM 1629 N N   . LYS A 1 209 ? -37.411 3.066   -13.458 1.00 23.45 ? 212 LYS A N   1 
ATOM 1630 C CA  . LYS A 1 209 ? -37.726 1.737   -13.973 1.00 23.38 ? 212 LYS A CA  1 
ATOM 1631 C C   . LYS A 1 209 ? -36.552 1.181   -14.768 1.00 23.43 ? 212 LYS A C   1 
ATOM 1632 O O   . LYS A 1 209 ? -36.563 0.026   -15.199 1.00 23.48 ? 212 LYS A O   1 
ATOM 1633 C CB  . LYS A 1 209 ? -39.004 1.777   -14.815 1.00 23.25 ? 212 LYS A CB  1 
ATOM 1634 C CG  . LYS A 1 209 ? -40.173 2.517   -14.150 1.00 23.43 ? 212 LYS A CG  1 
ATOM 1635 C CD  . LYS A 1 209 ? -40.886 1.700   -13.070 1.00 23.66 ? 212 LYS A CD  1 
ATOM 1636 C CE  . LYS A 1 209 ? -42.035 0.890   -13.659 1.00 24.16 ? 212 LYS A CE  1 
ATOM 1637 N NZ  . LYS A 1 209 ? -42.662 -0.030  -12.668 1.00 24.36 ? 212 LYS A NZ  1 
ATOM 1638 N N   . ALA A 1 210 ? -35.541 2.021   -14.955 1.00 23.52 ? 213 ALA A N   1 
ATOM 1639 C CA  . ALA A 1 210 ? -34.276 1.608   -15.535 1.00 23.66 ? 213 ALA A CA  1 
ATOM 1640 C C   . ALA A 1 210 ? -33.179 1.901   -14.518 1.00 23.88 ? 213 ALA A C   1 
ATOM 1641 O O   . ALA A 1 210 ? -32.656 3.015   -14.446 1.00 23.81 ? 213 ALA A O   1 
ATOM 1642 C CB  . ALA A 1 210 ? -34.024 2.343   -16.837 1.00 23.59 ? 213 ALA A CB  1 
ATOM 1643 N N   . ARG A 1 211 ? -32.856 0.898   -13.710 1.00 24.22 ? 214 ARG A N   1 
ATOM 1644 C CA  . ARG A 1 211 ? -31.884 1.063   -12.634 1.00 24.57 ? 214 ARG A CA  1 
ATOM 1645 C C   . ARG A 1 211 ? -30.489 0.632   -13.079 1.00 24.64 ? 214 ARG A C   1 
ATOM 1646 O O   . ARG A 1 211 ? -30.278 0.242   -14.227 1.00 24.75 ? 214 ARG A O   1 
ATOM 1647 C CB  . ARG A 1 211 ? -32.308 0.289   -11.370 1.00 24.67 ? 214 ARG A CB  1 
ATOM 1648 C CG  . ARG A 1 211 ? -33.822 0.198   -11.141 1.00 25.43 ? 214 ARG A CG  1 
ATOM 1649 C CD  . ARG A 1 211 ? -34.256 0.786   -9.794  1.00 26.40 ? 214 ARG A CD  1 
ATOM 1650 N NE  . ARG A 1 211 ? -33.791 0.017   -8.638  1.00 26.88 ? 214 ARG A NE  1 
ATOM 1651 C CZ  . ARG A 1 211 ? -34.140 0.266   -7.376  1.00 27.14 ? 214 ARG A CZ  1 
ATOM 1652 N NH1 . ARG A 1 211 ? -33.665 -0.490  -6.396  1.00 27.27 ? 214 ARG A NH1 1 
ATOM 1653 N NH2 . ARG A 1 211 ? -34.963 1.267   -7.085  1.00 27.19 ? 214 ARG A NH2 1 
ATOM 1654 N N   . PHE A 1 212 ? -29.539 0.731   -12.159 1.00 24.73 ? 215 PHE A N   1 
ATOM 1655 C CA  . PHE A 1 212 ? -28.197 0.220   -12.360 1.00 24.77 ? 215 PHE A CA  1 
ATOM 1656 C C   . PHE A 1 212 ? -27.843 -0.628  -11.141 1.00 24.78 ? 215 PHE A C   1 
ATOM 1657 O O   . PHE A 1 212 ? -28.288 -0.323  -10.030 1.00 24.77 ? 215 PHE A O   1 
ATOM 1658 C CB  . PHE A 1 212 ? -27.203 1.365   -12.558 1.00 24.99 ? 215 PHE A CB  1 
ATOM 1659 C CG  . PHE A 1 212 ? -27.234 2.403   -11.467 1.00 25.19 ? 215 PHE A CG  1 
ATOM 1660 C CD1 . PHE A 1 212 ? -26.426 2.270   -10.336 1.00 25.25 ? 215 PHE A CD1 1 
ATOM 1661 C CD2 . PHE A 1 212 ? -28.057 3.521   -11.578 1.00 25.25 ? 215 PHE A CD2 1 
ATOM 1662 C CE1 . PHE A 1 212 ? -26.446 3.226   -9.330  1.00 25.36 ? 215 PHE A CE1 1 
ATOM 1663 C CE2 . PHE A 1 212 ? -28.086 4.484   -10.577 1.00 25.79 ? 215 PHE A CE2 1 
ATOM 1664 C CZ  . PHE A 1 212 ? -27.279 4.337   -9.448  1.00 25.73 ? 215 PHE A CZ  1 
ATOM 1665 N N   . PRO A 1 213 ? -27.046 -1.694  -11.342 1.00 24.77 ? 216 PRO A N   1 
ATOM 1666 C CA  . PRO A 1 213 ? -26.834 -2.734  -10.332 1.00 24.76 ? 216 PRO A CA  1 
ATOM 1667 C C   . PRO A 1 213 ? -26.494 -2.232  -8.933  1.00 24.81 ? 216 PRO A C   1 
ATOM 1668 O O   . PRO A 1 213 ? -25.939 -1.140  -8.773  1.00 24.85 ? 216 PRO A O   1 
ATOM 1669 C CB  . PRO A 1 213 ? -25.656 -3.522  -10.898 1.00 24.72 ? 216 PRO A CB  1 
ATOM 1670 C CG  . PRO A 1 213 ? -25.805 -3.378  -12.362 1.00 24.80 ? 216 PRO A CG  1 
ATOM 1671 C CD  . PRO A 1 213 ? -26.282 -1.976  -12.572 1.00 24.73 ? 216 PRO A CD  1 
ATOM 1672 N N   . ALA A 1 214 ? -26.845 -3.040  -7.936  1.00 24.82 ? 217 ALA A N   1 
ATOM 1673 C CA  . ALA A 1 214 ? -26.468 -2.801  -6.548  1.00 24.72 ? 217 ALA A CA  1 
ATOM 1674 C C   . ALA A 1 214 ? -24.963 -2.586  -6.444  1.00 24.66 ? 217 ALA A C   1 
ATOM 1675 O O   . ALA A 1 214 ? -24.505 -1.658  -5.776  1.00 24.69 ? 217 ALA A O   1 
ATOM 1676 C CB  . ALA A 1 214 ? -26.903 -3.971  -5.676  1.00 24.71 ? 217 ALA A CB  1 
ATOM 1677 N N   . GLU A 1 215 ? -24.203 -3.445  -7.119  1.00 24.58 ? 218 GLU A N   1 
ATOM 1678 C CA  . GLU A 1 215 ? -22.755 -3.302  -7.200  1.00 24.52 ? 218 GLU A CA  1 
ATOM 1679 C C   . GLU A 1 215 ? -22.279 -3.469  -8.636  1.00 24.50 ? 218 GLU A C   1 
ATOM 1680 O O   . GLU A 1 215 ? -22.793 -4.309  -9.369  1.00 24.56 ? 218 GLU A O   1 
ATOM 1681 C CB  . GLU A 1 215 ? -22.061 -4.302  -6.272  1.00 24.47 ? 218 GLU A CB  1 
ATOM 1682 C CG  . GLU A 1 215 ? -22.107 -3.900  -4.795  1.00 24.27 ? 218 GLU A CG  1 
ATOM 1683 C CD  . GLU A 1 215 ? -21.803 -5.046  -3.846  1.00 23.82 ? 218 GLU A CD  1 
ATOM 1684 O OE1 . GLU A 1 215 ? -21.535 -6.169  -4.322  1.00 23.77 ? 218 GLU A OE1 1 
ATOM 1685 O OE2 . GLU A 1 215 ? -21.837 -4.822  -2.616  1.00 23.44 ? 218 GLU A OE2 1 
ATOM 1686 N N   . THR A 1 216 ? -21.311 -2.652  -9.034  1.00 24.50 ? 219 THR A N   1 
ATOM 1687 C CA  . THR A 1 216 ? -20.743 -2.724  -10.375 1.00 24.56 ? 219 THR A CA  1 
ATOM 1688 C C   . THR A 1 216 ? -19.240 -2.939  -10.279 1.00 24.70 ? 219 THR A C   1 
ATOM 1689 O O   . THR A 1 216 ? -18.539 -2.170  -9.620  1.00 24.87 ? 219 THR A O   1 
ATOM 1690 C CB  . THR A 1 216 ? -21.083 -1.461  -11.204 1.00 24.47 ? 219 THR A CB  1 
ATOM 1691 O OG1 . THR A 1 216 ? -22.479 -1.464  -11.509 1.00 24.75 ? 219 THR A OG1 1 
ATOM 1692 C CG2 . THR A 1 216 ? -20.310 -1.420  -12.512 1.00 24.17 ? 219 THR A CG2 1 
ATOM 1693 N N   . TYR A 1 217 ? -18.758 -3.990  -10.936 1.00 24.78 ? 220 TYR A N   1 
ATOM 1694 C CA  . TYR A 1 217 ? -17.348 -4.363  -10.881 1.00 24.87 ? 220 TYR A CA  1 
ATOM 1695 C C   . TYR A 1 217 ? -16.634 -3.975  -12.166 1.00 25.01 ? 220 TYR A C   1 
ATOM 1696 O O   . TYR A 1 217 ? -17.031 -4.394  -13.258 1.00 25.12 ? 220 TYR A O   1 
ATOM 1697 C CB  . TYR A 1 217 ? -17.203 -5.864  -10.604 1.00 24.80 ? 220 TYR A CB  1 
ATOM 1698 C CG  . TYR A 1 217 ? -17.828 -6.286  -9.293  1.00 24.74 ? 220 TYR A CG  1 
ATOM 1699 C CD1 . TYR A 1 217 ? -19.194 -6.571  -9.209  1.00 24.67 ? 220 TYR A CD1 1 
ATOM 1700 C CD2 . TYR A 1 217 ? -17.060 -6.383  -8.131  1.00 24.46 ? 220 TYR A CD2 1 
ATOM 1701 C CE1 . TYR A 1 217 ? -19.776 -6.947  -8.004  1.00 24.66 ? 220 TYR A CE1 1 
ATOM 1702 C CE2 . TYR A 1 217 ? -17.634 -6.758  -6.921  1.00 24.34 ? 220 TYR A CE2 1 
ATOM 1703 C CZ  . TYR A 1 217 ? -18.991 -7.039  -6.865  1.00 24.50 ? 220 TYR A CZ  1 
ATOM 1704 O OH  . TYR A 1 217 ? -19.566 -7.412  -5.674  1.00 24.44 ? 220 TYR A OH  1 
ATOM 1705 N N   . ALA A 1 218 ? -15.584 -3.168  -12.026 1.00 25.10 ? 221 ALA A N   1 
ATOM 1706 C CA  . ALA A 1 218 ? -14.821 -2.675  -13.172 1.00 25.19 ? 221 ALA A CA  1 
ATOM 1707 C C   . ALA A 1 218 ? -13.327 -2.611  -12.879 1.00 25.28 ? 221 ALA A C   1 
ATOM 1708 O O   . ALA A 1 218 ? -12.921 -2.422  -11.729 1.00 25.27 ? 221 ALA A O   1 
ATOM 1709 C CB  . ALA A 1 218 ? -15.325 -1.312  -13.581 1.00 25.25 ? 221 ALA A CB  1 
ATOM 1710 N N   . LEU A 1 219 ? -12.517 -2.765  -13.928 1.00 25.34 ? 222 LEU A N   1 
ATOM 1711 C CA  . LEU A 1 219 ? -11.059 -2.651  -13.820 1.00 25.26 ? 222 LEU A CA  1 
ATOM 1712 C C   . LEU A 1 219 ? -10.599 -1.203  -13.987 1.00 25.24 ? 222 LEU A C   1 
ATOM 1713 O O   . LEU A 1 219 ? -11.313 -0.379  -14.564 1.00 25.35 ? 222 LEU A O   1 
ATOM 1714 C CB  . LEU A 1 219 ? -10.364 -3.536  -14.862 1.00 25.19 ? 222 LEU A CB  1 
ATOM 1715 C CG  . LEU A 1 219 ? -10.454 -5.062  -14.764 1.00 25.29 ? 222 LEU A CG  1 
ATOM 1716 C CD1 . LEU A 1 219 ? -9.938  -5.698  -16.050 1.00 25.41 ? 222 LEU A CD1 1 
ATOM 1717 C CD2 . LEU A 1 219 ? -9.688  -5.601  -13.562 1.00 25.35 ? 222 LEU A CD2 1 
ATOM 1718 N N   . VAL A 1 220 ? -9.410  -0.899  -13.470 1.00 25.15 ? 223 VAL A N   1 
ATOM 1719 C CA  . VAL A 1 220 ? -8.768  0.396   -13.695 1.00 25.07 ? 223 VAL A CA  1 
ATOM 1720 C C   . VAL A 1 220 ? -8.624  0.643   -15.199 1.00 25.08 ? 223 VAL A C   1 
ATOM 1721 O O   . VAL A 1 220 ? -8.119  -0.211  -15.931 1.00 25.19 ? 223 VAL A O   1 
ATOM 1722 C CB  . VAL A 1 220 ? -7.390  0.477   -12.981 1.00 25.02 ? 223 VAL A CB  1 
ATOM 1723 C CG1 . VAL A 1 220 ? -6.507  1.566   -13.578 1.00 24.93 ? 223 VAL A CG1 1 
ATOM 1724 C CG2 . VAL A 1 220 ? -7.584  0.720   -11.501 1.00 25.03 ? 223 VAL A CG2 1 
ATOM 1725 N N   . GLY A 1 221 ? -9.101  1.798   -15.654 1.00 24.99 ? 224 GLY A N   1 
ATOM 1726 C CA  . GLY A 1 221 ? -9.008  2.158   -17.064 1.00 24.85 ? 224 GLY A CA  1 
ATOM 1727 C C   . GLY A 1 221 ? -10.260 1.884   -17.875 1.00 24.81 ? 224 GLY A C   1 
ATOM 1728 O O   . GLY A 1 221 ? -10.452 2.482   -18.936 1.00 24.82 ? 224 GLY A O   1 
ATOM 1729 N N   . GLN A 1 222 ? -11.112 0.983   -17.384 1.00 24.71 ? 225 GLN A N   1 
ATOM 1730 C CA  . GLN A 1 222 ? -12.370 0.656   -18.062 1.00 24.58 ? 225 GLN A CA  1 
ATOM 1731 C C   . GLN A 1 222 ? -13.285 1.871   -18.141 1.00 24.40 ? 225 GLN A C   1 
ATOM 1732 O O   . GLN A 1 222 ? -13.258 2.735   -17.260 1.00 24.38 ? 225 GLN A O   1 
ATOM 1733 C CB  . GLN A 1 222 ? -13.116 -0.473  -17.336 1.00 24.67 ? 225 GLN A CB  1 
ATOM 1734 C CG  . GLN A 1 222 ? -12.398 -1.819  -17.287 1.00 25.15 ? 225 GLN A CG  1 
ATOM 1735 C CD  . GLN A 1 222 ? -12.374 -2.544  -18.620 1.00 25.89 ? 225 GLN A CD  1 
ATOM 1736 O OE1 . GLN A 1 222 ? -13.188 -2.275  -19.505 1.00 26.96 ? 225 GLN A OE1 1 
ATOM 1737 N NE2 . GLN A 1 222 ? -11.439 -3.477  -18.766 1.00 25.94 ? 225 GLN A NE2 1 
ATOM 1738 N N   . GLN A 1 223 ? -14.079 1.941   -19.206 1.00 24.12 ? 226 GLN A N   1 
ATOM 1739 C CA  . GLN A 1 223 ? -15.204 2.862   -19.248 1.00 23.80 ? 226 GLN A CA  1 
ATOM 1740 C C   . GLN A 1 223 ? -16.307 2.293   -18.368 1.00 23.49 ? 226 GLN A C   1 
ATOM 1741 O O   . GLN A 1 223 ? -16.479 1.073   -18.296 1.00 23.45 ? 226 GLN A O   1 
ATOM 1742 C CB  . GLN A 1 223 ? -15.718 3.038   -20.674 1.00 23.97 ? 226 GLN A CB  1 
ATOM 1743 C CG  . GLN A 1 223 ? -15.359 4.372   -21.321 1.00 24.29 ? 226 GLN A CG  1 
ATOM 1744 C CD  . GLN A 1 223 ? -16.476 4.912   -22.218 1.00 24.36 ? 226 GLN A CD  1 
ATOM 1745 O OE1 . GLN A 1 223 ? -17.646 4.544   -22.071 1.00 23.61 ? 226 GLN A OE1 1 
ATOM 1746 N NE2 . GLN A 1 223 ? -16.115 5.795   -23.145 1.00 24.36 ? 226 GLN A NE2 1 
ATOM 1747 N N   . VAL A 1 224 ? -17.040 3.171   -17.692 1.00 23.11 ? 227 VAL A N   1 
ATOM 1748 C CA  . VAL A 1 224 ? -18.123 2.751   -16.801 1.00 22.81 ? 227 VAL A CA  1 
ATOM 1749 C C   . VAL A 1 224 ? -19.380 3.576   -17.048 1.00 22.65 ? 227 VAL A C   1 
ATOM 1750 O O   . VAL A 1 224 ? -19.334 4.805   -17.048 1.00 22.70 ? 227 VAL A O   1 
ATOM 1751 C CB  . VAL A 1 224 ? -17.683 2.794   -15.311 1.00 22.79 ? 227 VAL A CB  1 
ATOM 1752 C CG1 . VAL A 1 224 ? -18.856 3.052   -14.374 1.00 22.80 ? 227 VAL A CG1 1 
ATOM 1753 C CG2 . VAL A 1 224 ? -16.994 1.505   -14.937 1.00 22.63 ? 227 VAL A CG2 1 
ATOM 1754 N N   . THR A 1 225 ? -20.496 2.889   -17.267 1.00 22.47 ? 228 THR A N   1 
ATOM 1755 C CA  . THR A 1 225 ? -21.763 3.546   -17.576 1.00 22.35 ? 228 THR A CA  1 
ATOM 1756 C C   . THR A 1 225 ? -22.882 3.011   -16.686 1.00 22.38 ? 228 THR A C   1 
ATOM 1757 O O   . THR A 1 225 ? -23.330 1.875   -16.851 1.00 22.51 ? 228 THR A O   1 
ATOM 1758 C CB  . THR A 1 225 ? -22.136 3.380   -19.079 1.00 22.23 ? 228 THR A CB  1 
ATOM 1759 O OG1 . THR A 1 225 ? -21.150 4.024   -19.891 1.00 21.83 ? 228 THR A OG1 1 
ATOM 1760 C CG2 . THR A 1 225 ? -23.487 3.998   -19.384 1.00 22.35 ? 228 THR A CG2 1 
ATOM 1761 N N   . LEU A 1 226 ? -23.318 3.830   -15.734 1.00 22.36 ? 229 LEU A N   1 
ATOM 1762 C CA  . LEU A 1 226 ? -24.487 3.501   -14.923 1.00 22.39 ? 229 LEU A CA  1 
ATOM 1763 C C   . LEU A 1 226 ? -25.727 4.142   -15.537 1.00 22.46 ? 229 LEU A C   1 
ATOM 1764 O O   . LEU A 1 226 ? -25.737 5.345   -15.831 1.00 22.50 ? 229 LEU A O   1 
ATOM 1765 C CB  . LEU A 1 226 ? -24.312 3.960   -13.468 1.00 22.29 ? 229 LEU A CB  1 
ATOM 1766 C CG  . LEU A 1 226 ? -23.226 3.328   -12.587 1.00 22.04 ? 229 LEU A CG  1 
ATOM 1767 C CD1 . LEU A 1 226 ? -23.236 3.982   -11.227 1.00 21.87 ? 229 LEU A CD1 1 
ATOM 1768 C CD2 . LEU A 1 226 ? -23.391 1.826   -12.434 1.00 21.91 ? 229 LEU A CD2 1 
ATOM 1769 N N   . GLU A 1 227 ? -26.767 3.336   -15.736 1.00 22.40 ? 230 GLU A N   1 
ATOM 1770 C CA  . GLU A 1 227 ? -28.009 3.836   -16.322 1.00 22.33 ? 230 GLU A CA  1 
ATOM 1771 C C   . GLU A 1 227 ? -29.053 4.160   -15.255 1.00 22.31 ? 230 GLU A C   1 
ATOM 1772 O O   . GLU A 1 227 ? -29.220 3.414   -14.285 1.00 22.38 ? 230 GLU A O   1 
ATOM 1773 C CB  . GLU A 1 227 ? -28.561 2.844   -17.348 1.00 22.16 ? 230 GLU A CB  1 
ATOM 1774 C CG  . GLU A 1 227 ? -27.582 2.549   -18.476 1.00 22.26 ? 230 GLU A CG  1 
ATOM 1775 C CD  . GLU A 1 227 ? -28.168 1.713   -19.599 1.00 22.37 ? 230 GLU A CD  1 
ATOM 1776 O OE1 . GLU A 1 227 ? -29.298 1.202   -19.450 1.00 22.41 ? 230 GLU A OE1 1 
ATOM 1777 O OE2 . GLU A 1 227 ? -27.484 1.560   -20.635 1.00 22.15 ? 230 GLU A OE2 1 
ATOM 1778 N N   . CYS A 1 228 ? -29.744 5.282   -15.437 1.00 22.23 ? 231 CYS A N   1 
ATOM 1779 C CA  . CYS A 1 228 ? -30.847 5.655   -14.557 1.00 22.03 ? 231 CYS A CA  1 
ATOM 1780 C C   . CYS A 1 228 ? -31.876 6.536   -15.266 1.00 21.89 ? 231 CYS A C   1 
ATOM 1781 O O   . CYS A 1 228 ? -31.657 7.735   -15.461 1.00 21.90 ? 231 CYS A O   1 
ATOM 1782 C CB  . CYS A 1 228 ? -30.316 6.345   -13.303 1.00 22.03 ? 231 CYS A CB  1 
ATOM 1783 S SG  . CYS A 1 228 ? -31.525 6.526   -11.990 1.00 22.55 ? 231 CYS A SG  1 
ATOM 1784 N N   . PHE A 1 229 ? -32.996 5.929   -15.652 1.00 21.78 ? 232 PHE A N   1 
ATOM 1785 C CA  . PHE A 1 229 ? -34.098 6.652   -16.299 1.00 21.79 ? 232 PHE A CA  1 
ATOM 1786 C C   . PHE A 1 229 ? -35.448 6.309   -15.662 1.00 21.77 ? 232 PHE A C   1 
ATOM 1787 O O   . PHE A 1 229 ? -35.690 5.156   -15.273 1.00 21.66 ? 232 PHE A O   1 
ATOM 1788 C CB  . PHE A 1 229 ? -34.119 6.370   -17.800 1.00 21.77 ? 232 PHE A CB  1 
ATOM 1789 C CG  . PHE A 1 229 ? -34.999 7.304   -18.593 1.00 21.61 ? 232 PHE A CG  1 
ATOM 1790 C CD1 . PHE A 1 229 ? -34.516 8.540   -19.023 1.00 21.57 ? 232 PHE A CD1 1 
ATOM 1791 C CD2 . PHE A 1 229 ? -36.298 6.932   -18.939 1.00 21.43 ? 232 PHE A CD2 1 
ATOM 1792 C CE1 . PHE A 1 229 ? -35.317 9.397   -19.776 1.00 21.80 ? 232 PHE A CE1 1 
ATOM 1793 C CE2 . PHE A 1 229 ? -37.110 7.780   -19.691 1.00 21.51 ? 232 PHE A CE2 1 
ATOM 1794 C CZ  . PHE A 1 229 ? -36.620 9.015   -20.112 1.00 21.88 ? 232 PHE A CZ  1 
ATOM 1795 N N   . ALA A 1 230 ? -36.323 7.314   -15.578 1.00 21.69 ? 233 ALA A N   1 
ATOM 1796 C CA  . ALA A 1 230 ? -37.542 7.216   -14.779 1.00 21.62 ? 233 ALA A CA  1 
ATOM 1797 C C   . ALA A 1 230 ? -38.806 7.626   -15.517 1.00 21.60 ? 233 ALA A C   1 
ATOM 1798 O O   . ALA A 1 230 ? -38.796 8.591   -16.288 1.00 21.67 ? 233 ALA A O   1 
ATOM 1799 C CB  . ALA A 1 230 ? -37.399 8.046   -13.525 1.00 21.57 ? 233 ALA A CB  1 
ATOM 1800 N N   . PHE A 1 231 ? -39.884 6.878   -15.266 1.00 21.45 ? 234 PHE A N   1 
ATOM 1801 C CA  . PHE A 1 231 ? -41.238 7.261   -15.655 1.00 21.23 ? 234 PHE A CA  1 
ATOM 1802 C C   . PHE A 1 231 ? -41.660 8.428   -14.789 1.00 21.18 ? 234 PHE A C   1 
ATOM 1803 O O   . PHE A 1 231 ? -41.341 8.456   -13.602 1.00 21.04 ? 234 PHE A O   1 
ATOM 1804 C CB  . PHE A 1 231 ? -42.224 6.125   -15.382 1.00 21.22 ? 234 PHE A CB  1 
ATOM 1805 C CG  . PHE A 1 231 ? -42.171 4.997   -16.367 1.00 21.13 ? 234 PHE A CG  1 
ATOM 1806 C CD1 . PHE A 1 231 ? -41.728 5.194   -17.669 1.00 21.46 ? 234 PHE A CD1 1 
ATOM 1807 C CD2 . PHE A 1 231 ? -42.620 3.733   -15.998 1.00 21.08 ? 234 PHE A CD2 1 
ATOM 1808 C CE1 . PHE A 1 231 ? -41.700 4.135   -18.579 1.00 21.83 ? 234 PHE A CE1 1 
ATOM 1809 C CE2 . PHE A 1 231 ? -42.599 2.668   -16.898 1.00 21.25 ? 234 PHE A CE2 1 
ATOM 1810 C CZ  . PHE A 1 231 ? -42.141 2.868   -18.192 1.00 21.39 ? 234 PHE A CZ  1 
ATOM 1811 N N   . GLY A 1 232 ? -42.393 9.375   -15.367 1.00 21.25 ? 235 GLY A N   1 
ATOM 1812 C CA  . GLY A 1 232 ? -42.928 10.492  -14.592 1.00 21.44 ? 235 GLY A CA  1 
ATOM 1813 C C   . GLY A 1 232 ? -43.647 11.571  -15.379 1.00 21.57 ? 235 GLY A C   1 
ATOM 1814 O O   . GLY A 1 232 ? -43.484 11.690  -16.597 1.00 21.65 ? 235 GLY A O   1 
ATOM 1815 N N   . ASN A 1 233 ? -44.449 12.357  -14.662 1.00 21.61 ? 236 ASN A N   1 
ATOM 1816 C CA  . ASN A 1 233 ? -45.136 13.519  -15.217 1.00 21.55 ? 236 ASN A CA  1 
ATOM 1817 C C   . ASN A 1 233 ? -45.174 14.656  -14.183 1.00 21.50 ? 236 ASN A C   1 
ATOM 1818 O O   . ASN A 1 233 ? -45.682 14.465  -13.078 1.00 21.36 ? 236 ASN A O   1 
ATOM 1819 C CB  . ASN A 1 233 ? -46.545 13.135  -15.690 1.00 21.59 ? 236 ASN A CB  1 
ATOM 1820 C CG  . ASN A 1 233 ? -47.326 14.313  -16.263 1.00 21.68 ? 236 ASN A CG  1 
ATOM 1821 O OD1 . ASN A 1 233 ? -46.755 15.259  -16.805 1.00 21.62 ? 236 ASN A OD1 1 
ATOM 1822 N ND2 . ASN A 1 233 ? -48.647 14.249  -16.148 1.00 21.88 ? 236 ASN A ND2 1 
ATOM 1823 N N   . PRO A 1 234 ? -44.617 15.835  -14.530 1.00 21.59 ? 237 PRO A N   1 
ATOM 1824 C CA  . PRO A 1 234 ? -43.977 16.162  -15.810 1.00 21.70 ? 237 PRO A CA  1 
ATOM 1825 C C   . PRO A 1 234 ? -42.640 15.448  -15.991 1.00 21.78 ? 237 PRO A C   1 
ATOM 1826 O O   . PRO A 1 234 ? -42.093 14.913  -15.024 1.00 21.77 ? 237 PRO A O   1 
ATOM 1827 C CB  . PRO A 1 234 ? -43.776 17.681  -15.726 1.00 21.72 ? 237 PRO A CB  1 
ATOM 1828 C CG  . PRO A 1 234 ? -43.681 17.967  -14.279 1.00 21.58 ? 237 PRO A CG  1 
ATOM 1829 C CD  . PRO A 1 234 ? -44.588 16.979  -13.598 1.00 21.61 ? 237 PRO A CD  1 
ATOM 1830 N N   . VAL A 1 235 ? -42.135 15.445  -17.225 1.00 21.84 ? 238 VAL A N   1 
ATOM 1831 C CA  . VAL A 1 235 ? -40.912 14.721  -17.592 1.00 21.83 ? 238 VAL A CA  1 
ATOM 1832 C C   . VAL A 1 235 ? -39.787 14.943  -16.572 1.00 21.79 ? 238 VAL A C   1 
ATOM 1833 O O   . VAL A 1 235 ? -39.260 16.055  -16.459 1.00 21.90 ? 238 VAL A O   1 
ATOM 1834 C CB  . VAL A 1 235 ? -40.458 15.073  -19.037 1.00 21.82 ? 238 VAL A CB  1 
ATOM 1835 C CG1 . VAL A 1 235 ? -39.092 14.487  -19.344 1.00 21.96 ? 238 VAL A CG1 1 
ATOM 1836 C CG2 . VAL A 1 235 ? -41.476 14.566  -20.047 1.00 21.95 ? 238 VAL A CG2 1 
ATOM 1837 N N   . PRO A 1 236 ? -39.441 13.886  -15.810 1.00 21.76 ? 239 PRO A N   1 
ATOM 1838 C CA  . PRO A 1 236 ? -38.431 13.953  -14.739 1.00 21.80 ? 239 PRO A CA  1 
ATOM 1839 C C   . PRO A 1 236 ? -37.023 14.335  -15.212 1.00 21.78 ? 239 PRO A C   1 
ATOM 1840 O O   . PRO A 1 236 ? -36.682 14.132  -16.377 1.00 21.73 ? 239 PRO A O   1 
ATOM 1841 C CB  . PRO A 1 236 ? -38.439 12.534  -14.148 1.00 21.79 ? 239 PRO A CB  1 
ATOM 1842 C CG  . PRO A 1 236 ? -39.078 11.675  -15.183 1.00 21.72 ? 239 PRO A CG  1 
ATOM 1843 C CD  . PRO A 1 236 ? -40.037 12.541  -15.924 1.00 21.64 ? 239 PRO A CD  1 
ATOM 1844 N N   . ARG A 1 237 ? -36.230 14.900  -14.302 1.00 21.89 ? 240 ARG A N   1 
ATOM 1845 C CA  . ARG A 1 237 ? -34.855 15.310  -14.599 1.00 22.01 ? 240 ARG A CA  1 
ATOM 1846 C C   . ARG A 1 237 ? -33.877 14.460  -13.812 1.00 22.03 ? 240 ARG A C   1 
ATOM 1847 O O   . ARG A 1 237 ? -34.015 14.312  -12.595 1.00 21.95 ? 240 ARG A O   1 
ATOM 1848 C CB  . ARG A 1 237 ? -34.629 16.792  -14.280 1.00 22.02 ? 240 ARG A CB  1 
ATOM 1849 C CG  . ARG A 1 237 ? -35.411 17.752  -15.164 1.00 22.27 ? 240 ARG A CG  1 
ATOM 1850 C CD  . ARG A 1 237 ? -34.704 19.089  -15.283 1.00 22.41 ? 240 ARG A CD  1 
ATOM 1851 N NE  . ARG A 1 237 ? -35.253 19.899  -16.370 1.00 22.63 ? 240 ARG A NE  1 
ATOM 1852 C CZ  . ARG A 1 237 ? -34.602 20.888  -16.980 1.00 22.71 ? 240 ARG A CZ  1 
ATOM 1853 N NH1 . ARG A 1 237 ? -35.193 21.560  -17.959 1.00 22.46 ? 240 ARG A NH1 1 
ATOM 1854 N NH2 . ARG A 1 237 ? -33.360 21.205  -16.624 1.00 22.78 ? 240 ARG A NH2 1 
ATOM 1855 N N   . ILE A 1 238 ? -32.889 13.910  -14.512 1.00 22.17 ? 241 ILE A N   1 
ATOM 1856 C CA  . ILE A 1 238 ? -31.932 12.994  -13.899 1.00 22.25 ? 241 ILE A CA  1 
ATOM 1857 C C   . ILE A 1 238 ? -30.763 13.745  -13.274 1.00 22.33 ? 241 ILE A C   1 
ATOM 1858 O O   . ILE A 1 238 ? -30.119 14.573  -13.925 1.00 22.34 ? 241 ILE A O   1 
ATOM 1859 C CB  . ILE A 1 238 ? -31.419 11.935  -14.901 1.00 22.31 ? 241 ILE A CB  1 
ATOM 1860 C CG1 . ILE A 1 238 ? -32.576 11.375  -15.750 1.00 22.38 ? 241 ILE A CG1 1 
ATOM 1861 C CG2 . ILE A 1 238 ? -30.644 10.825  -14.172 1.00 22.38 ? 241 ILE A CG2 1 
ATOM 1862 C CD1 . ILE A 1 238 ? -33.643 10.596  -14.974 1.00 22.27 ? 241 ILE A CD1 1 
ATOM 1863 N N   . LYS A 1 239 ? -30.518 13.449  -12.000 1.00 22.41 ? 242 LYS A N   1 
ATOM 1864 C CA  . LYS A 1 239 ? -29.463 14.078  -11.213 1.00 22.41 ? 242 LYS A CA  1 
ATOM 1865 C C   . LYS A 1 239 ? -28.587 12.991  -10.613 1.00 22.37 ? 242 LYS A C   1 
ATOM 1866 O O   . LYS A 1 239 ? -29.091 11.980  -10.124 1.00 22.30 ? 242 LYS A O   1 
ATOM 1867 C CB  . LYS A 1 239 ? -30.068 14.923  -10.084 1.00 22.63 ? 242 LYS A CB  1 
ATOM 1868 C CG  . LYS A 1 239 ? -30.973 16.080  -10.528 1.00 22.98 ? 242 LYS A CG  1 
ATOM 1869 C CD  . LYS A 1 239 ? -30.156 17.310  -10.912 1.00 23.56 ? 242 LYS A CD  1 
ATOM 1870 C CE  . LYS A 1 239 ? -30.992 18.327  -11.671 1.00 23.56 ? 242 LYS A CE  1 
ATOM 1871 N NZ  . LYS A 1 239 ? -30.134 19.422  -12.207 1.00 23.72 ? 242 LYS A NZ  1 
ATOM 1872 N N   . TRP A 1 240 ? -27.276 13.205  -10.649 1.00 22.48 ? 243 TRP A N   1 
ATOM 1873 C CA  . TRP A 1 240 ? -26.310 12.236  -10.132 1.00 22.46 ? 243 TRP A CA  1 
ATOM 1874 C C   . TRP A 1 240 ? -25.417 12.821  -9.047  1.00 22.50 ? 243 TRP A C   1 
ATOM 1875 O O   . TRP A 1 240 ? -25.076 14.005  -9.087  1.00 22.43 ? 243 TRP A O   1 
ATOM 1876 C CB  . TRP A 1 240 ? -25.415 11.741  -11.257 1.00 22.42 ? 243 TRP A CB  1 
ATOM 1877 C CG  . TRP A 1 240 ? -26.103 10.939  -12.297 1.00 22.44 ? 243 TRP A CG  1 
ATOM 1878 C CD1 . TRP A 1 240 ? -26.750 11.412  -13.403 1.00 22.67 ? 243 TRP A CD1 1 
ATOM 1879 C CD2 . TRP A 1 240 ? -26.189 9.512   -12.360 1.00 22.33 ? 243 TRP A CD2 1 
ATOM 1880 N NE1 . TRP A 1 240 ? -27.243 10.364  -14.146 1.00 22.87 ? 243 TRP A NE1 1 
ATOM 1881 C CE2 . TRP A 1 240 ? -26.909 9.187   -13.528 1.00 22.63 ? 243 TRP A CE2 1 
ATOM 1882 C CE3 . TRP A 1 240 ? -25.734 8.475   -11.537 1.00 22.44 ? 243 TRP A CE3 1 
ATOM 1883 C CZ2 . TRP A 1 240 ? -27.181 7.869   -13.897 1.00 22.76 ? 243 TRP A CZ2 1 
ATOM 1884 C CZ3 . TRP A 1 240 ? -26.009 7.163   -11.903 1.00 22.55 ? 243 TRP A CZ3 1 
ATOM 1885 C CH2 . TRP A 1 240 ? -26.725 6.873   -13.072 1.00 22.72 ? 243 TRP A CH2 1 
ATOM 1886 N N   . ARG A 1 241 ? -25.032 11.980  -8.088  1.00 22.66 ? 244 ARG A N   1 
ATOM 1887 C CA  . ARG A 1 241 ? -24.024 12.354  -7.093  1.00 22.95 ? 244 ARG A CA  1 
ATOM 1888 C C   . ARG A 1 241 ? -23.291 11.152  -6.487  1.00 22.92 ? 244 ARG A C   1 
ATOM 1889 O O   . ARG A 1 241 ? -23.752 10.011  -6.579  1.00 22.79 ? 244 ARG A O   1 
ATOM 1890 C CB  . ARG A 1 241 ? -24.626 13.240  -5.987  1.00 23.01 ? 244 ARG A CB  1 
ATOM 1891 C CG  . ARG A 1 241 ? -25.446 12.496  -4.939  1.00 23.65 ? 244 ARG A CG  1 
ATOM 1892 C CD  . ARG A 1 241 ? -25.614 13.334  -3.684  1.00 24.56 ? 244 ARG A CD  1 
ATOM 1893 N NE  . ARG A 1 241 ? -26.257 12.584  -2.607  1.00 25.30 ? 244 ARG A NE  1 
ATOM 1894 C CZ  . ARG A 1 241 ? -25.622 12.078  -1.551  1.00 25.83 ? 244 ARG A CZ  1 
ATOM 1895 N NH1 . ARG A 1 241 ? -26.308 11.414  -0.630  1.00 25.89 ? 244 ARG A NH1 1 
ATOM 1896 N NH2 . ARG A 1 241 ? -24.309 12.236  -1.409  1.00 26.17 ? 244 ARG A NH2 1 
ATOM 1897 N N   . LYS A 1 242 ? -22.148 11.436  -5.867  1.00 23.02 ? 245 LYS A N   1 
ATOM 1898 C CA  . LYS A 1 242 ? -21.377 10.451  -5.121  1.00 23.15 ? 245 LYS A CA  1 
ATOM 1899 C C   . LYS A 1 242 ? -21.689 10.570  -3.625  1.00 23.19 ? 245 LYS A C   1 
ATOM 1900 O O   . LYS A 1 242 ? -21.703 11.672  -3.069  1.00 23.25 ? 245 LYS A O   1 
ATOM 1901 C CB  . LYS A 1 242 ? -19.884 10.679  -5.369  1.00 23.21 ? 245 LYS A CB  1 
ATOM 1902 C CG  . LYS A 1 242 ? -18.981 9.495   -5.049  1.00 23.42 ? 245 LYS A CG  1 
ATOM 1903 C CD  . LYS A 1 242 ? -17.537 9.827   -5.382  1.00 23.56 ? 245 LYS A CD  1 
ATOM 1904 C CE  . LYS A 1 242 ? -16.699 8.575   -5.502  1.00 23.74 ? 245 LYS A CE  1 
ATOM 1905 N NZ  . LYS A 1 242 ? -15.369 8.885   -6.088  1.00 24.05 ? 245 LYS A NZ  1 
ATOM 1906 N N   . VAL A 1 243 ? -21.942 9.434   -2.980  1.00 23.16 ? 246 VAL A N   1 
ATOM 1907 C CA  . VAL A 1 243 ? -22.207 9.404   -1.541  1.00 23.03 ? 246 VAL A CA  1 
ATOM 1908 C C   . VAL A 1 243 ? -20.914 9.162   -0.767  1.00 22.98 ? 246 VAL A C   1 
ATOM 1909 O O   . VAL A 1 243 ? -20.389 10.071  -0.125  1.00 22.90 ? 246 VAL A O   1 
ATOM 1910 C CB  . VAL A 1 243 ? -23.250 8.324   -1.175  1.00 23.05 ? 246 VAL A CB  1 
ATOM 1911 C CG1 . VAL A 1 243 ? -23.432 8.235   0.342   1.00 22.96 ? 246 VAL A CG1 1 
ATOM 1912 C CG2 . VAL A 1 243 ? -24.581 8.607   -1.871  1.00 22.87 ? 246 VAL A CG2 1 
ATOM 1913 N N   . ALA A 1 254 ? -26.172 15.786  -15.805 1.00 24.81 ? 257 ALA A N   1 
ATOM 1914 C CA  . ALA A 1 254 ? -27.631 15.844  -15.831 1.00 24.98 ? 257 ALA A CA  1 
ATOM 1915 C C   . ALA A 1 254 ? -28.239 14.986  -16.956 1.00 24.99 ? 257 ALA A C   1 
ATOM 1916 O O   . ALA A 1 254 ? -29.329 15.278  -17.460 1.00 24.96 ? 257 ALA A O   1 
ATOM 1917 C CB  . ALA A 1 254 ? -28.109 17.301  -15.922 1.00 24.94 ? 257 ALA A CB  1 
ATOM 1918 N N   . GLU A 1 255 ? -27.520 13.931  -17.337 1.00 24.97 ? 258 GLU A N   1 
ATOM 1919 C CA  . GLU A 1 255 ? -27.996 12.951  -18.313 1.00 24.99 ? 258 GLU A CA  1 
ATOM 1920 C C   . GLU A 1 255 ? -28.448 11.678  -17.597 1.00 24.81 ? 258 GLU A C   1 
ATOM 1921 O O   . GLU A 1 255 ? -28.075 11.455  -16.442 1.00 24.89 ? 258 GLU A O   1 
ATOM 1922 C CB  . GLU A 1 255 ? -26.893 12.616  -19.318 1.00 24.99 ? 258 GLU A CB  1 
ATOM 1923 C CG  . GLU A 1 255 ? -26.752 13.618  -20.451 1.00 25.26 ? 258 GLU A CG  1 
ATOM 1924 C CD  . GLU A 1 255 ? -25.515 13.373  -21.306 1.00 25.39 ? 258 GLU A CD  1 
ATOM 1925 O OE1 . GLU A 1 255 ? -24.665 12.538  -20.912 1.00 25.61 ? 258 GLU A OE1 1 
ATOM 1926 O OE2 . GLU A 1 255 ? -25.392 14.021  -22.373 1.00 25.82 ? 258 GLU A OE2 1 
ATOM 1927 N N   . PRO A 1 256 ? -29.256 10.838  -18.274 1.00 24.62 ? 259 PRO A N   1 
ATOM 1928 C CA  . PRO A 1 256 ? -29.726 9.599   -17.645 1.00 24.40 ? 259 PRO A CA  1 
ATOM 1929 C C   . PRO A 1 256 ? -28.620 8.552   -17.448 1.00 24.21 ? 259 PRO A C   1 
ATOM 1930 O O   . PRO A 1 256 ? -28.792 7.612   -16.666 1.00 24.35 ? 259 PRO A O   1 
ATOM 1931 C CB  . PRO A 1 256 ? -30.786 9.082   -18.628 1.00 24.43 ? 259 PRO A CB  1 
ATOM 1932 C CG  . PRO A 1 256 ? -31.064 10.228  -19.568 1.00 24.55 ? 259 PRO A CG  1 
ATOM 1933 C CD  . PRO A 1 256 ? -29.793 10.991  -19.638 1.00 24.61 ? 259 PRO A CD  1 
ATOM 1934 N N   . THR A 1 257 ? -27.502 8.713   -18.153 1.00 23.83 ? 260 THR A N   1 
ATOM 1935 C CA  . THR A 1 257 ? -26.357 7.814   -17.996 1.00 23.40 ? 260 THR A CA  1 
ATOM 1936 C C   . THR A 1 257 ? -25.092 8.572   -17.596 1.00 23.06 ? 260 THR A C   1 
ATOM 1937 O O   . THR A 1 257 ? -24.703 9.547   -18.251 1.00 23.02 ? 260 THR A O   1 
ATOM 1938 C CB  . THR A 1 257 ? -26.085 6.990   -19.272 1.00 23.34 ? 260 THR A CB  1 
ATOM 1939 O OG1 . THR A 1 257 ? -26.230 7.827   -20.423 1.00 23.71 ? 260 THR A OG1 1 
ATOM 1940 C CG2 . THR A 1 257 ? -27.064 5.848   -19.385 1.00 23.41 ? 260 THR A CG2 1 
ATOM 1941 N N   . LEU A 1 258 ? -24.468 8.119   -16.508 1.00 22.55 ? 261 LEU A N   1 
ATOM 1942 C CA  . LEU A 1 258 ? -23.206 8.677   -16.034 1.00 21.95 ? 261 LEU A CA  1 
ATOM 1943 C C   . LEU A 1 258 ? -22.045 7.881   -16.628 1.00 21.70 ? 261 LEU A C   1 
ATOM 1944 O O   . LEU A 1 258 ? -21.887 6.695   -16.342 1.00 21.54 ? 261 LEU A O   1 
ATOM 1945 C CB  . LEU A 1 258 ? -23.157 8.660   -14.498 1.00 22.05 ? 261 LEU A CB  1 
ATOM 1946 C CG  . LEU A 1 258 ? -22.027 9.370   -13.734 1.00 21.71 ? 261 LEU A CG  1 
ATOM 1947 C CD1 . LEU A 1 258 ? -22.162 10.885  -13.808 1.00 21.37 ? 261 LEU A CD1 1 
ATOM 1948 C CD2 . LEU A 1 258 ? -21.999 8.913   -12.281 1.00 21.54 ? 261 LEU A CD2 1 
ATOM 1949 N N   . GLN A 1 259 ? -21.254 8.538   -17.472 1.00 21.50 ? 262 GLN A N   1 
ATOM 1950 C CA  . GLN A 1 259 ? -20.096 7.911   -18.105 1.00 21.41 ? 262 GLN A CA  1 
ATOM 1951 C C   . GLN A 1 259 ? -18.823 8.200   -17.330 1.00 21.32 ? 262 GLN A C   1 
ATOM 1952 O O   . GLN A 1 259 ? -18.577 9.340   -16.944 1.00 21.39 ? 262 GLN A O   1 
ATOM 1953 C CB  . GLN A 1 259 ? -19.923 8.406   -19.543 1.00 21.45 ? 262 GLN A CB  1 
ATOM 1954 C CG  . GLN A 1 259 ? -20.636 7.578   -20.602 1.00 21.60 ? 262 GLN A CG  1 
ATOM 1955 C CD  . GLN A 1 259 ? -19.941 7.651   -21.955 1.00 21.91 ? 262 GLN A CD  1 
ATOM 1956 O OE1 . GLN A 1 259 ? -18.774 7.276   -22.092 1.00 22.20 ? 262 GLN A OE1 1 
ATOM 1957 N NE2 . GLN A 1 259 ? -20.660 8.129   -22.961 1.00 22.22 ? 262 GLN A NE2 1 
ATOM 1958 N N   . ILE A 1 260 ? -18.020 7.166   -17.103 1.00 21.27 ? 263 ILE A N   1 
ATOM 1959 C CA  . ILE A 1 260 ? -16.701 7.327   -16.501 1.00 21.26 ? 263 ILE A CA  1 
ATOM 1960 C C   . ILE A 1 260 ? -15.657 6.906   -17.530 1.00 21.38 ? 263 ILE A C   1 
ATOM 1961 O O   . ILE A 1 260 ? -15.342 5.717   -17.653 1.00 21.43 ? 263 ILE A O   1 
ATOM 1962 C CB  . ILE A 1 260 ? -16.535 6.506   -15.192 1.00 21.23 ? 263 ILE A CB  1 
ATOM 1963 C CG1 . ILE A 1 260 ? -17.690 6.779   -14.203 1.00 21.30 ? 263 ILE A CG1 1 
ATOM 1964 C CG2 . ILE A 1 260 ? -15.139 6.729   -14.572 1.00 21.01 ? 263 ILE A CG2 1 
ATOM 1965 C CD1 . ILE A 1 260 ? -17.574 8.059   -13.363 1.00 20.98 ? 263 ILE A CD1 1 
ATOM 1966 N N   . PRO A 1 261 ? -15.143 7.877   -18.304 1.00 21.48 ? 264 PRO A N   1 
ATOM 1967 C CA  . PRO A 1 261 ? -14.077 7.577   -19.249 1.00 21.55 ? 264 PRO A CA  1 
ATOM 1968 C C   . PRO A 1 261 ? -12.787 7.286   -18.487 1.00 21.71 ? 264 PRO A C   1 
ATOM 1969 O O   . PRO A 1 261 ? -12.117 8.211   -18.021 1.00 21.84 ? 264 PRO A O   1 
ATOM 1970 C CB  . PRO A 1 261 ? -13.963 8.864   -20.069 1.00 21.54 ? 264 PRO A CB  1 
ATOM 1971 C CG  . PRO A 1 261 ? -14.495 9.933   -19.185 1.00 21.54 ? 264 PRO A CG  1 
ATOM 1972 C CD  . PRO A 1 261 ? -15.543 9.297   -18.340 1.00 21.46 ? 264 PRO A CD  1 
ATOM 1973 N N   . SER A 1 262 ? -12.472 5.999   -18.348 1.00 21.77 ? 265 SER A N   1 
ATOM 1974 C CA  . SER A 1 262 ? -11.327 5.524   -17.564 1.00 21.80 ? 265 SER A CA  1 
ATOM 1975 C C   . SER A 1 262 ? -11.493 5.750   -16.062 1.00 21.83 ? 265 SER A C   1 
ATOM 1976 O O   . SER A 1 262 ? -11.589 6.885   -15.589 1.00 21.76 ? 265 SER A O   1 
ATOM 1977 C CB  . SER A 1 262 ? -10.008 6.124   -18.060 1.00 21.82 ? 265 SER A CB  1 
ATOM 1978 O OG  . SER A 1 262 ? -8.899  5.495   -17.438 1.00 22.15 ? 265 SER A OG  1 
ATOM 1979 N N   . VAL A 1 263 ? -11.515 4.648   -15.322 1.00 22.04 ? 266 VAL A N   1 
ATOM 1980 C CA  . VAL A 1 263 ? -11.663 4.681   -13.871 1.00 22.19 ? 266 VAL A CA  1 
ATOM 1981 C C   . VAL A 1 263 ? -10.302 4.577   -13.181 1.00 22.24 ? 266 VAL A C   1 
ATOM 1982 O O   . VAL A 1 263 ? -9.463  3.758   -13.567 1.00 22.12 ? 266 VAL A O   1 
ATOM 1983 C CB  . VAL A 1 263 ? -12.554 3.514   -13.367 1.00 22.20 ? 266 VAL A CB  1 
ATOM 1984 C CG1 . VAL A 1 263 ? -13.191 3.867   -12.044 1.00 22.26 ? 266 VAL A CG1 1 
ATOM 1985 C CG2 . VAL A 1 263 ? -13.632 3.171   -14.375 1.00 22.16 ? 266 VAL A CG2 1 
ATOM 1986 N N   . SER A 1 264 ? -10.083 5.418   -12.174 1.00 22.41 ? 267 SER A N   1 
ATOM 1987 C CA  . SER A 1 264 ? -8.990  5.208   -11.224 1.00 22.64 ? 267 SER A CA  1 
ATOM 1988 C C   . SER A 1 264 ? -9.600  4.709   -9.915  1.00 22.65 ? 267 SER A C   1 
ATOM 1989 O O   . SER A 1 264 ? -10.821 4.573   -9.810  1.00 22.63 ? 267 SER A O   1 
ATOM 1990 C CB  . SER A 1 264 ? -8.161  6.482   -11.012 1.00 22.67 ? 267 SER A CB  1 
ATOM 1991 O OG  . SER A 1 264 ? -8.610  7.221   -9.888  1.00 23.03 ? 267 SER A OG  1 
ATOM 1992 N N   . PHE A 1 265 ? -8.765  4.435   -8.919  1.00 22.73 ? 268 PHE A N   1 
ATOM 1993 C CA  . PHE A 1 265 ? -9.263  3.855   -7.676  1.00 22.85 ? 268 PHE A CA  1 
ATOM 1994 C C   . PHE A 1 265 ? -10.102 4.808   -6.845  1.00 22.97 ? 268 PHE A C   1 
ATOM 1995 O O   . PHE A 1 265 ? -10.927 4.369   -6.044  1.00 23.07 ? 268 PHE A O   1 
ATOM 1996 C CB  . PHE A 1 265 ? -8.128  3.258   -6.851  1.00 22.88 ? 268 PHE A CB  1 
ATOM 1997 C CG  . PHE A 1 265 ? -7.718  1.895   -7.309  1.00 22.92 ? 268 PHE A CG  1 
ATOM 1998 C CD1 . PHE A 1 265 ? -6.543  1.715   -8.026  1.00 22.66 ? 268 PHE A CD1 1 
ATOM 1999 C CD2 . PHE A 1 265 ? -8.525  0.790   -7.047  1.00 22.98 ? 268 PHE A CD2 1 
ATOM 2000 C CE1 . PHE A 1 265 ? -6.167  0.454   -8.458  1.00 22.74 ? 268 PHE A CE1 1 
ATOM 2001 C CE2 . PHE A 1 265 ? -8.157  -0.475  -7.480  1.00 22.98 ? 268 PHE A CE2 1 
ATOM 2002 C CZ  . PHE A 1 265 ? -6.978  -0.644  -8.186  1.00 22.91 ? 268 PHE A CZ  1 
ATOM 2003 N N   . GLU A 1 266 ? -9.895  6.107   -7.057  1.00 23.07 ? 269 GLU A N   1 
ATOM 2004 C CA  . GLU A 1 266 ? -10.668 7.157   -6.389  1.00 23.15 ? 269 GLU A CA  1 
ATOM 2005 C C   . GLU A 1 266 ? -12.175 7.107   -6.671  1.00 23.03 ? 269 GLU A C   1 
ATOM 2006 O O   . GLU A 1 266 ? -12.983 7.474   -5.816  1.00 22.97 ? 269 GLU A O   1 
ATOM 2007 C CB  . GLU A 1 266 ? -10.127 8.540   -6.760  1.00 23.22 ? 269 GLU A CB  1 
ATOM 2008 C CG  . GLU A 1 266 ? -8.901  8.962   -5.970  1.00 23.78 ? 269 GLU A CG  1 
ATOM 2009 C CD  . GLU A 1 266 ? -8.969  10.416  -5.507  1.00 24.57 ? 269 GLU A CD  1 
ATOM 2010 O OE1 . GLU A 1 266 ? -10.080 10.999  -5.490  1.00 24.60 ? 269 GLU A OE1 1 
ATOM 2011 O OE2 . GLU A 1 266 ? -7.909  10.974  -5.143  1.00 25.07 ? 269 GLU A OE2 1 
ATOM 2012 N N   . ASP A 1 267 ? -12.546 6.650   -7.865  1.00 22.96 ? 270 ASP A N   1 
ATOM 2013 C CA  . ASP A 1 267 ? -13.948 6.631   -8.287  1.00 22.90 ? 270 ASP A CA  1 
ATOM 2014 C C   . ASP A 1 267 ? -14.777 5.520   -7.631  1.00 22.76 ? 270 ASP A C   1 
ATOM 2015 O O   . ASP A 1 267 ? -15.932 5.300   -8.006  1.00 22.82 ? 270 ASP A O   1 
ATOM 2016 C CB  . ASP A 1 267 ? -14.053 6.532   -9.813  1.00 23.00 ? 270 ASP A CB  1 
ATOM 2017 C CG  . ASP A 1 267 ? -13.373 7.688   -10.530 1.00 23.32 ? 270 ASP A CG  1 
ATOM 2018 O OD1 . ASP A 1 267 ? -13.463 8.837   -10.047 1.00 23.30 ? 270 ASP A OD1 1 
ATOM 2019 O OD2 . ASP A 1 267 ? -12.754 7.443   -11.591 1.00 23.91 ? 270 ASP A OD2 1 
ATOM 2020 N N   . GLU A 1 268 ? -14.190 4.824   -6.660  1.00 22.42 ? 271 GLU A N   1 
ATOM 2021 C CA  . GLU A 1 268 ? -14.916 3.818   -5.890  1.00 22.08 ? 271 GLU A CA  1 
ATOM 2022 C C   . GLU A 1 268 ? -15.847 4.507   -4.895  1.00 21.90 ? 271 GLU A C   1 
ATOM 2023 O O   . GLU A 1 268 ? -15.558 5.609   -4.435  1.00 21.85 ? 271 GLU A O   1 
ATOM 2024 C CB  . GLU A 1 268 ? -13.934 2.894   -5.170  1.00 22.08 ? 271 GLU A CB  1 
ATOM 2025 C CG  . GLU A 1 268 ? -14.581 1.735   -4.425  1.00 21.96 ? 271 GLU A CG  1 
ATOM 2026 C CD  . GLU A 1 268 ? -13.701 0.505   -4.364  1.00 21.87 ? 271 GLU A CD  1 
ATOM 2027 O OE1 . GLU A 1 268 ? -12.500 0.597   -4.699  1.00 21.85 ? 271 GLU A OE1 1 
ATOM 2028 O OE2 . GLU A 1 268 ? -14.216 -0.564  -3.980  1.00 22.00 ? 271 GLU A OE2 1 
ATOM 2029 N N   . GLY A 1 269 ? -16.967 3.862   -4.582  1.00 21.73 ? 272 GLY A N   1 
ATOM 2030 C CA  . GLY A 1 269 ? -17.921 4.397   -3.614  1.00 21.64 ? 272 GLY A CA  1 
ATOM 2031 C C   . GLY A 1 269 ? -19.364 4.309   -4.070  1.00 21.59 ? 272 GLY A C   1 
ATOM 2032 O O   . GLY A 1 269 ? -19.652 3.820   -5.167  1.00 21.60 ? 272 GLY A O   1 
ATOM 2033 N N   . THR A 1 270 ? -20.273 4.780   -3.218  1.00 21.51 ? 273 THR A N   1 
ATOM 2034 C CA  . THR A 1 270 ? -21.700 4.743   -3.513  1.00 21.46 ? 273 THR A CA  1 
ATOM 2035 C C   . THR A 1 270 ? -22.099 5.937   -4.368  1.00 21.56 ? 273 THR A C   1 
ATOM 2036 O O   . THR A 1 270 ? -21.783 7.084   -4.043  1.00 21.53 ? 273 THR A O   1 
ATOM 2037 C CB  . THR A 1 270 ? -22.555 4.701   -2.226  1.00 21.45 ? 273 THR A CB  1 
ATOM 2038 O OG1 . THR A 1 270 ? -22.199 3.548   -1.457  1.00 21.49 ? 273 THR A OG1 1 
ATOM 2039 C CG2 . THR A 1 270 ? -24.043 4.629   -2.555  1.00 21.32 ? 273 THR A CG2 1 
ATOM 2040 N N   . TYR A 1 271 ? -22.787 5.646   -5.469  1.00 21.62 ? 274 TYR A N   1 
ATOM 2041 C CA  . TYR A 1 271 ? -23.314 6.671   -6.358  1.00 21.62 ? 274 TYR A CA  1 
ATOM 2042 C C   . TYR A 1 271 ? -24.829 6.697   -6.262  1.00 21.69 ? 274 TYR A C   1 
ATOM 2043 O O   . TYR A 1 271 ? -25.466 5.657   -6.078  1.00 21.72 ? 274 TYR A O   1 
ATOM 2044 C CB  . TYR A 1 271 ? -22.867 6.417   -7.797  1.00 21.59 ? 274 TYR A CB  1 
ATOM 2045 C CG  . TYR A 1 271 ? -21.405 6.710   -8.029  1.00 21.59 ? 274 TYR A CG  1 
ATOM 2046 C CD1 . TYR A 1 271 ? -20.417 5.877   -7.505  1.00 21.77 ? 274 TYR A CD1 1 
ATOM 2047 C CD2 . TYR A 1 271 ? -21.005 7.819   -8.769  1.00 21.72 ? 274 TYR A CD2 1 
ATOM 2048 C CE1 . TYR A 1 271 ? -19.069 6.140   -7.706  1.00 21.94 ? 274 TYR A CE1 1 
ATOM 2049 C CE2 . TYR A 1 271 ? -19.651 8.092   -8.980  1.00 21.97 ? 274 TYR A CE2 1 
ATOM 2050 C CZ  . TYR A 1 271 ? -18.692 7.245   -8.444  1.00 22.00 ? 274 TYR A CZ  1 
ATOM 2051 O OH  . TYR A 1 271 ? -17.354 7.497   -8.639  1.00 22.24 ? 274 TYR A OH  1 
ATOM 2052 N N   . GLU A 1 272 ? -25.397 7.891   -6.382  1.00 21.72 ? 275 GLU A N   1 
ATOM 2053 C CA  . GLU A 1 272 ? -26.828 8.077   -6.212  1.00 21.82 ? 275 GLU A CA  1 
ATOM 2054 C C   . GLU A 1 272 ? -27.448 8.795   -7.401  1.00 21.84 ? 275 GLU A C   1 
ATOM 2055 O O   . GLU A 1 272 ? -26.954 9.837   -7.840  1.00 21.82 ? 275 GLU A O   1 
ATOM 2056 C CB  . GLU A 1 272 ? -27.107 8.847   -4.919  1.00 21.90 ? 275 GLU A CB  1 
ATOM 2057 C CG  . GLU A 1 272 ? -28.582 9.138   -4.659  1.00 21.89 ? 275 GLU A CG  1 
ATOM 2058 C CD  . GLU A 1 272 ? -28.841 9.586   -3.240  1.00 21.75 ? 275 GLU A CD  1 
ATOM 2059 O OE1 . GLU A 1 272 ? -28.261 10.611  -2.821  1.00 21.86 ? 275 GLU A OE1 1 
ATOM 2060 O OE2 . GLU A 1 272 ? -29.627 8.909   -2.544  1.00 21.45 ? 275 GLU A OE2 1 
ATOM 2061 N N   . CYS A 1 273 ? -28.538 8.225   -7.907  1.00 21.89 ? 276 CYS A N   1 
ATOM 2062 C CA  . CYS A 1 273 ? -29.299 8.824   -8.990  1.00 21.78 ? 276 CYS A CA  1 
ATOM 2063 C C   . CYS A 1 273 ? -30.627 9.363   -8.495  1.00 21.68 ? 276 CYS A C   1 
ATOM 2064 O O   . CYS A 1 273 ? -31.367 8.673   -7.797  1.00 21.66 ? 276 CYS A O   1 
ATOM 2065 C CB  . CYS A 1 273 ? -29.561 7.807   -10.092 1.00 21.85 ? 276 CYS A CB  1 
ATOM 2066 S SG  . CYS A 1 273 ? -30.986 8.263   -11.091 1.00 22.31 ? 276 CYS A SG  1 
ATOM 2067 N N   . GLU A 1 274 ? -30.934 10.593  -8.884  1.00 21.65 ? 277 GLU A N   1 
ATOM 2068 C CA  . GLU A 1 274 ? -32.172 11.233  -8.479  1.00 21.66 ? 277 GLU A CA  1 
ATOM 2069 C C   . GLU A 1 274 ? -33.052 11.513  -9.671  1.00 21.70 ? 277 GLU A C   1 
ATOM 2070 O O   . GLU A 1 274 ? -32.740 12.372  -10.503 1.00 21.83 ? 277 GLU A O   1 
ATOM 2071 C CB  . GLU A 1 274 ? -31.905 12.547  -7.749  1.00 21.66 ? 277 GLU A CB  1 
ATOM 2072 C CG  . GLU A 1 274 ? -31.742 12.411  -6.259  1.00 21.89 ? 277 GLU A CG  1 
ATOM 2073 C CD  . GLU A 1 274 ? -32.419 13.532  -5.504  1.00 22.34 ? 277 GLU A CD  1 
ATOM 2074 O OE1 . GLU A 1 274 ? -32.904 14.484  -6.153  1.00 22.59 ? 277 GLU A OE1 1 
ATOM 2075 O OE2 . GLU A 1 274 ? -32.475 13.458  -4.260  1.00 22.71 ? 277 GLU A OE2 1 
ATOM 2076 N N   . ALA A 1 275 ? -34.148 10.769  -9.757  1.00 21.65 ? 278 ALA A N   1 
ATOM 2077 C CA  . ALA A 1 275 ? -35.232 11.119  -10.648 1.00 21.42 ? 278 ALA A CA  1 
ATOM 2078 C C   . ALA A 1 275 ? -36.123 12.034  -9.837  1.00 21.42 ? 278 ALA A C   1 
ATOM 2079 O O   . ALA A 1 275 ? -36.568 11.671  -8.747  1.00 21.25 ? 278 ALA A O   1 
ATOM 2080 C CB  . ALA A 1 275 ? -35.977 9.891   -11.087 1.00 21.30 ? 278 ALA A CB  1 
ATOM 2081 N N   . GLU A 1 276 ? -36.348 13.235  -10.357 1.00 21.58 ? 279 GLU A N   1 
ATOM 2082 C CA  . GLU A 1 276 ? -37.112 14.253  -9.648  1.00 21.65 ? 279 GLU A CA  1 
ATOM 2083 C C   . GLU A 1 276 ? -37.844 15.171  -10.616 1.00 21.76 ? 279 GLU A C   1 
ATOM 2084 O O   . GLU A 1 276 ? -37.231 16.024  -11.261 1.00 21.83 ? 279 GLU A O   1 
ATOM 2085 C CB  . GLU A 1 276 ? -36.188 15.079  -8.747  1.00 21.58 ? 279 GLU A CB  1 
ATOM 2086 C CG  . GLU A 1 276 ? -36.882 16.178  -7.962  1.00 21.36 ? 279 GLU A CG  1 
ATOM 2087 C CD  . GLU A 1 276 ? -35.983 17.371  -7.727  1.00 21.27 ? 279 GLU A CD  1 
ATOM 2088 O OE1 . GLU A 1 276 ? -35.401 17.880  -8.713  1.00 20.99 ? 279 GLU A OE1 1 
ATOM 2089 O OE2 . GLU A 1 276 ? -35.864 17.805  -6.558  1.00 21.43 ? 279 GLU A OE2 1 
ATOM 2090 N N   . ASN A 1 277 ? -39.152 14.984  -10.729 1.00 21.91 ? 280 ASN A N   1 
ATOM 2091 C CA  . ASN A 1 277 ? -39.983 15.998  -11.355 1.00 22.15 ? 280 ASN A CA  1 
ATOM 2092 C C   . ASN A 1 277 ? -40.520 16.897  -10.252 1.00 22.17 ? 280 ASN A C   1 
ATOM 2093 O O   . ASN A 1 277 ? -40.070 16.808  -9.110  1.00 22.37 ? 280 ASN A O   1 
ATOM 2094 C CB  . ASN A 1 277 ? -41.100 15.380  -12.202 1.00 22.24 ? 280 ASN A CB  1 
ATOM 2095 C CG  . ASN A 1 277 ? -42.084 14.562  -11.386 1.00 22.66 ? 280 ASN A CG  1 
ATOM 2096 O OD1 . ASN A 1 277 ? -42.407 14.899  -10.244 1.00 22.82 ? 280 ASN A OD1 1 
ATOM 2097 N ND2 . ASN A 1 277 ? -42.580 13.478  -11.981 1.00 22.86 ? 280 ASN A ND2 1 
ATOM 2098 N N   . SER A 1 278 ? -41.477 17.753  -10.574 1.00 22.11 ? 281 SER A N   1 
ATOM 2099 C CA  . SER A 1 278 ? -41.965 18.710  -9.592  1.00 22.24 ? 281 SER A CA  1 
ATOM 2100 C C   . SER A 1 278 ? -42.859 18.097  -8.507  1.00 22.22 ? 281 SER A C   1 
ATOM 2101 O O   . SER A 1 278 ? -43.118 18.732  -7.482  1.00 22.27 ? 281 SER A O   1 
ATOM 2102 C CB  . SER A 1 278 ? -42.654 19.884  -10.289 1.00 22.28 ? 281 SER A CB  1 
ATOM 2103 O OG  . SER A 1 278 ? -43.210 19.476  -11.526 1.00 22.56 ? 281 SER A OG  1 
ATOM 2104 N N   . LYS A 1 279 ? -43.299 16.858  -8.722  1.00 22.22 ? 282 LYS A N   1 
ATOM 2105 C CA  . LYS A 1 279 ? -44.213 16.179  -7.793  1.00 22.31 ? 282 LYS A CA  1 
ATOM 2106 C C   . LYS A 1 279 ? -43.532 15.263  -6.770  1.00 22.31 ? 282 LYS A C   1 
ATOM 2107 O O   . LYS A 1 279 ? -44.162 14.829  -5.805  1.00 22.34 ? 282 LYS A O   1 
ATOM 2108 C CB  . LYS A 1 279 ? -45.283 15.396  -8.565  1.00 22.34 ? 282 LYS A CB  1 
ATOM 2109 C CG  . LYS A 1 279 ? -46.517 16.212  -8.938  1.00 22.37 ? 282 LYS A CG  1 
ATOM 2110 C CD  . LYS A 1 279 ? -47.538 16.272  -7.802  1.00 22.50 ? 282 LYS A CD  1 
ATOM 2111 C CE  . LYS A 1 279 ? -48.436 15.035  -7.773  1.00 22.49 ? 282 LYS A CE  1 
ATOM 2112 N NZ  . LYS A 1 279 ? -49.630 15.231  -6.894  1.00 22.34 ? 282 LYS A NZ  1 
ATOM 2113 N N   . GLY A 1 280 ? -42.254 14.966  -6.981  1.00 22.37 ? 283 GLY A N   1 
ATOM 2114 C CA  . GLY A 1 280 ? -41.506 14.122  -6.051  1.00 22.43 ? 283 GLY A CA  1 
ATOM 2115 C C   . GLY A 1 280 ? -40.168 13.649  -6.586  1.00 22.46 ? 283 GLY A C   1 
ATOM 2116 O O   . GLY A 1 280 ? -39.771 13.995  -7.705  1.00 22.31 ? 283 GLY A O   1 
ATOM 2117 N N   . ARG A 1 281 ? -39.468 12.856  -5.780  1.00 22.52 ? 284 ARG A N   1 
ATOM 2118 C CA  . ARG A 1 281 ? -38.183 12.305  -6.196  1.00 22.65 ? 284 ARG A CA  1 
ATOM 2119 C C   . ARG A 1 281 ? -37.971 10.826  -5.855  1.00 22.70 ? 284 ARG A C   1 
ATOM 2120 O O   . ARG A 1 281 ? -38.070 10.419  -4.693  1.00 22.78 ? 284 ARG A O   1 
ATOM 2121 C CB  . ARG A 1 281 ? -37.002 13.173  -5.715  1.00 22.67 ? 284 ARG A CB  1 
ATOM 2122 C CG  . ARG A 1 281 ? -36.959 13.534  -4.235  1.00 22.57 ? 284 ARG A CG  1 
ATOM 2123 C CD  . ARG A 1 281 ? -35.665 14.284  -3.939  1.00 22.62 ? 284 ARG A CD  1 
ATOM 2124 N NE  . ARG A 1 281 ? -35.590 14.799  -2.571  1.00 22.89 ? 284 ARG A NE  1 
ATOM 2125 C CZ  . ARG A 1 281 ? -34.531 15.424  -2.057  1.00 22.72 ? 284 ARG A CZ  1 
ATOM 2126 N NH1 . ARG A 1 281 ? -34.557 15.859  -0.801  1.00 22.59 ? 284 ARG A NH1 1 
ATOM 2127 N NH2 . ARG A 1 281 ? -33.441 15.617  -2.792  1.00 22.24 ? 284 ARG A NH2 1 
ATOM 2128 N N   . ASP A 1 282 ? -37.702 10.035  -6.894  1.00 22.61 ? 285 ASP A N   1 
ATOM 2129 C CA  . ASP A 1 282 ? -37.268 8.651   -6.748  1.00 22.50 ? 285 ASP A CA  1 
ATOM 2130 C C   . ASP A 1 282 ? -35.752 8.645   -6.830  1.00 22.38 ? 285 ASP A C   1 
ATOM 2131 O O   . ASP A 1 282 ? -35.165 9.322   -7.674  1.00 22.43 ? 285 ASP A O   1 
ATOM 2132 C CB  . ASP A 1 282 ? -37.859 7.768   -7.855  1.00 22.57 ? 285 ASP A CB  1 
ATOM 2133 C CG  . ASP A 1 282 ? -37.748 6.271   -7.557  1.00 22.71 ? 285 ASP A CG  1 
ATOM 2134 O OD1 . ASP A 1 282 ? -37.321 5.895   -6.445  1.00 23.23 ? 285 ASP A OD1 1 
ATOM 2135 O OD2 . ASP A 1 282 ? -38.103 5.459   -8.439  1.00 22.51 ? 285 ASP A OD2 1 
ATOM 2136 N N   . THR A 1 283 ? -35.120 7.892   -5.938  1.00 22.27 ? 286 THR A N   1 
ATOM 2137 C CA  . THR A 1 283 ? -33.665 7.806   -5.892  1.00 22.10 ? 286 THR A CA  1 
ATOM 2138 C C   . THR A 1 283 ? -33.211 6.347   -5.932  1.00 22.03 ? 286 THR A C   1 
ATOM 2139 O O   . THR A 1 283 ? -33.942 5.449   -5.516  1.00 22.11 ? 286 THR A O   1 
ATOM 2140 C CB  . THR A 1 283 ? -33.096 8.492   -4.630  1.00 22.05 ? 286 THR A CB  1 
ATOM 2141 O OG1 . THR A 1 283 ? -33.635 7.863   -3.461  1.00 22.10 ? 286 THR A OG1 1 
ATOM 2142 C CG2 . THR A 1 283 ? -33.457 9.966   -4.605  1.00 21.82 ? 286 THR A CG2 1 
ATOM 2143 N N   . VAL A 1 284 ? -32.006 6.114   -6.438  1.00 21.85 ? 287 VAL A N   1 
ATOM 2144 C CA  . VAL A 1 284 ? -31.449 4.770   -6.489  1.00 21.75 ? 287 VAL A CA  1 
ATOM 2145 C C   . VAL A 1 284 ? -29.935 4.811   -6.273  1.00 21.80 ? 287 VAL A C   1 
ATOM 2146 O O   . VAL A 1 284 ? -29.226 5.630   -6.866  1.00 21.79 ? 287 VAL A O   1 
ATOM 2147 C CB  . VAL A 1 284 ? -31.849 4.027   -7.801  1.00 21.74 ? 287 VAL A CB  1 
ATOM 2148 C CG1 . VAL A 1 284 ? -31.356 4.772   -9.029  1.00 21.71 ? 287 VAL A CG1 1 
ATOM 2149 C CG2 . VAL A 1 284 ? -31.353 2.575   -7.798  1.00 21.84 ? 287 VAL A CG2 1 
ATOM 2150 N N   . GLN A 1 285 ? -29.455 3.930   -5.402  1.00 21.85 ? 288 GLN A N   1 
ATOM 2151 C CA  . GLN A 1 285 ? -28.046 3.893   -5.040  1.00 21.84 ? 288 GLN A CA  1 
ATOM 2152 C C   . GLN A 1 285 ? -27.385 2.579   -5.427  1.00 21.90 ? 288 GLN A C   1 
ATOM 2153 O O   . GLN A 1 285 ? -27.937 1.500   -5.202  1.00 21.94 ? 288 GLN A O   1 
ATOM 2154 C CB  . GLN A 1 285 ? -27.867 4.149   -3.544  1.00 21.74 ? 288 GLN A CB  1 
ATOM 2155 C CG  . GLN A 1 285 ? -28.211 5.562   -3.116  1.00 21.62 ? 288 GLN A CG  1 
ATOM 2156 C CD  . GLN A 1 285 ? -27.714 5.890   -1.726  1.00 21.54 ? 288 GLN A CD  1 
ATOM 2157 O OE1 . GLN A 1 285 ? -27.323 5.005   -0.964  1.00 21.49 ? 288 GLN A OE1 1 
ATOM 2158 N NE2 . GLN A 1 285 ? -27.723 7.171   -1.386  1.00 21.69 ? 288 GLN A NE2 1 
ATOM 2159 N N   . GLY A 1 286 ? -26.201 2.690   -6.022  1.00 21.93 ? 289 GLY A N   1 
ATOM 2160 C CA  . GLY A 1 286 ? -25.364 1.541   -6.345  1.00 21.96 ? 289 GLY A CA  1 
ATOM 2161 C C   . GLY A 1 286 ? -23.933 1.848   -5.953  1.00 22.03 ? 289 GLY A C   1 
ATOM 2162 O O   . GLY A 1 286 ? -23.582 3.012   -5.734  1.00 22.06 ? 289 GLY A O   1 
ATOM 2163 N N   . ARG A 1 287 ? -23.106 0.810   -5.860  1.00 22.06 ? 290 ARG A N   1 
ATOM 2164 C CA  . ARG A 1 287 ? -21.715 0.980   -5.453  1.00 22.11 ? 290 ARG A CA  1 
ATOM 2165 C C   . ARG A 1 287 ? -20.746 0.500   -6.534  1.00 22.22 ? 290 ARG A C   1 
ATOM 2166 O O   . ARG A 1 287 ? -20.860 -0.622  -7.040  1.00 22.25 ? 290 ARG A O   1 
ATOM 2167 C CB  . ARG A 1 287 ? -21.442 0.257   -4.128  1.00 22.08 ? 290 ARG A CB  1 
ATOM 2168 C CG  . ARG A 1 287 ? -20.562 1.052   -3.167  1.00 21.94 ? 290 ARG A CG  1 
ATOM 2169 C CD  . ARG A 1 287 ? -19.564 0.176   -2.438  1.00 21.57 ? 290 ARG A CD  1 
ATOM 2170 N NE  . ARG A 1 287 ? -20.202 -0.723  -1.483  1.00 21.85 ? 290 ARG A NE  1 
ATOM 2171 C CZ  . ARG A 1 287 ? -19.576 -1.710  -0.846  1.00 22.33 ? 290 ARG A CZ  1 
ATOM 2172 N NH1 . ARG A 1 287 ? -20.240 -2.477  0.008   1.00 22.46 ? 290 ARG A NH1 1 
ATOM 2173 N NH2 . ARG A 1 287 ? -18.285 -1.937  -1.060  1.00 22.43 ? 290 ARG A NH2 1 
ATOM 2174 N N   . ILE A 1 288 ? -19.802 1.366   -6.891  1.00 22.28 ? 291 ILE A N   1 
ATOM 2175 C CA  . ILE A 1 288 ? -18.748 1.010   -7.836  1.00 22.28 ? 291 ILE A CA  1 
ATOM 2176 C C   . ILE A 1 288 ? -17.564 0.453   -7.051  1.00 22.33 ? 291 ILE A C   1 
ATOM 2177 O O   . ILE A 1 288 ? -17.093 1.082   -6.095  1.00 22.39 ? 291 ILE A O   1 
ATOM 2178 C CB  . ILE A 1 288 ? -18.263 2.233   -8.662  1.00 22.25 ? 291 ILE A CB  1 
ATOM 2179 C CG1 . ILE A 1 288 ? -19.444 3.023   -9.255  1.00 22.23 ? 291 ILE A CG1 1 
ATOM 2180 C CG2 . ILE A 1 288 ? -17.255 1.800   -9.727  1.00 22.21 ? 291 ILE A CG2 1 
ATOM 2181 C CD1 . ILE A 1 288 ? -19.663 2.873   -10.751 1.00 21.84 ? 291 ILE A CD1 1 
ATOM 2182 N N   . ILE A 1 289 ? -17.104 -0.733  -7.447  1.00 22.25 ? 292 ILE A N   1 
ATOM 2183 C CA  . ILE A 1 289 ? -15.876 -1.318  -6.912  1.00 22.12 ? 292 ILE A CA  1 
ATOM 2184 C C   . ILE A 1 289 ? -14.820 -1.236  -8.007  1.00 22.10 ? 292 ILE A C   1 
ATOM 2185 O O   . ILE A 1 289 ? -15.060 -1.690  -9.127  1.00 22.29 ? 292 ILE A O   1 
ATOM 2186 C CB  . ILE A 1 289 ? -16.066 -2.808  -6.482  1.00 22.06 ? 292 ILE A CB  1 
ATOM 2187 C CG1 . ILE A 1 289 ? -17.393 -3.030  -5.732  1.00 21.96 ? 292 ILE A CG1 1 
ATOM 2188 C CG2 . ILE A 1 289 ? -14.860 -3.308  -5.677  1.00 21.99 ? 292 ILE A CG2 1 
ATOM 2189 C CD1 . ILE A 1 289 ? -17.485 -2.384  -4.351  1.00 21.89 ? 292 ILE A CD1 1 
ATOM 2190 N N   . VAL A 1 290 ? -13.665 -0.649  -7.698  1.00 22.07 ? 293 VAL A N   1 
ATOM 2191 C CA  . VAL A 1 290 ? -12.570 -0.563  -8.672  1.00 22.13 ? 293 VAL A CA  1 
ATOM 2192 C C   . VAL A 1 290 ? -11.533 -1.668  -8.428  1.00 22.23 ? 293 VAL A C   1 
ATOM 2193 O O   . VAL A 1 290 ? -10.909 -1.729  -7.365  1.00 22.24 ? 293 VAL A O   1 
ATOM 2194 C CB  . VAL A 1 290 ? -11.895 0.837   -8.700  1.00 22.09 ? 293 VAL A CB  1 
ATOM 2195 C CG1 . VAL A 1 290 ? -10.991 0.971   -9.917  1.00 21.99 ? 293 VAL A CG1 1 
ATOM 2196 C CG2 . VAL A 1 290 ? -12.939 1.937   -8.720  1.00 22.21 ? 293 VAL A CG2 1 
ATOM 2197 N N   . GLN A 1 291 ? -11.374 -2.537  -9.426  1.00 22.32 ? 294 GLN A N   1 
ATOM 2198 C CA  . GLN A 1 291 ? -10.467 -3.686  -9.359  1.00 22.34 ? 294 GLN A CA  1 
ATOM 2199 C C   . GLN A 1 291 ? -9.279  -3.470  -10.294 1.00 22.37 ? 294 GLN A C   1 
ATOM 2200 O O   . GLN A 1 291 ? -9.254  -2.501  -11.057 1.00 22.49 ? 294 GLN A O   1 
ATOM 2201 C CB  . GLN A 1 291 ? -11.200 -4.977  -9.749  1.00 22.29 ? 294 GLN A CB  1 
ATOM 2202 C CG  . GLN A 1 291 ? -12.597 -5.150  -9.140  1.00 22.38 ? 294 GLN A CG  1 
ATOM 2203 C CD  . GLN A 1 291 ? -12.627 -6.050  -7.914  1.00 22.35 ? 294 GLN A CD  1 
ATOM 2204 O OE1 . GLN A 1 291 ? -13.471 -6.941  -7.813  1.00 22.35 ? 294 GLN A OE1 1 
ATOM 2205 N NE2 . GLN A 1 291 ? -11.714 -5.819  -6.975  1.00 22.44 ? 294 GLN A NE2 1 
ATOM 2206 N N   . ALA A 1 292 ? -8.299  -4.371  -10.231 1.00 22.33 ? 295 ALA A N   1 
ATOM 2207 C CA  . ALA A 1 292 ? -7.121  -4.299  -11.092 1.00 22.34 ? 295 ALA A CA  1 
ATOM 2208 C C   . ALA A 1 292 ? -6.546  -5.682  -11.373 1.00 22.42 ? 295 ALA A C   1 
ATOM 2209 O O   . ALA A 1 292 ? -6.631  -6.586  -10.536 1.00 22.41 ? 295 ALA A O   1 
ATOM 2210 C CB  . ALA A 1 292 ? -6.058  -3.393  -10.479 1.00 22.34 ? 295 ALA A CB  1 
ATOM 2211 N N   . GLN A 1 293 ? -5.962  -5.830  -12.560 1.00 22.47 ? 296 GLN A N   1 
ATOM 2212 C CA  . GLN A 1 293 ? -5.319  -7.074  -12.974 1.00 22.48 ? 296 GLN A CA  1 
ATOM 2213 C C   . GLN A 1 293 ? -4.040  -7.338  -12.185 1.00 22.33 ? 296 GLN A C   1 
ATOM 2214 O O   . GLN A 1 293 ? -3.383  -6.392  -11.741 1.00 22.43 ? 296 GLN A O   1 
ATOM 2215 C CB  . GLN A 1 293 ? -4.973  -7.019  -14.461 1.00 22.58 ? 296 GLN A CB  1 
ATOM 2216 C CG  . GLN A 1 293 ? -6.167  -7.102  -15.390 1.00 23.27 ? 296 GLN A CG  1 
ATOM 2217 C CD  . GLN A 1 293 ? -5.843  -7.826  -16.685 1.00 23.95 ? 296 GLN A CD  1 
ATOM 2218 O OE1 . GLN A 1 293 ? -5.205  -8.886  -16.681 1.00 24.65 ? 296 GLN A OE1 1 
ATOM 2219 N NE2 . GLN A 1 293 ? -6.289  -7.262  -17.801 1.00 23.84 ? 296 GLN A NE2 1 
ATOM 2220 N N   . PRO A 1 294 ? -3.680  -8.625  -12.006 1.00 22.15 ? 297 PRO A N   1 
ATOM 2221 C CA  . PRO A 1 294 ? -2.359  -8.930  -11.465 1.00 21.92 ? 297 PRO A CA  1 
ATOM 2222 C C   . PRO A 1 294 ? -1.271  -8.470  -12.433 1.00 21.82 ? 297 PRO A C   1 
ATOM 2223 O O   . PRO A 1 294 ? -1.299  -8.839  -13.610 1.00 21.91 ? 297 PRO A O   1 
ATOM 2224 C CB  . PRO A 1 294 ? -2.356  -10.461 -11.366 1.00 21.80 ? 297 PRO A CB  1 
ATOM 2225 C CG  . PRO A 1 294 ? -3.776  -10.871 -11.440 1.00 21.96 ? 297 PRO A CG  1 
ATOM 2226 C CD  . PRO A 1 294 ? -4.457  -9.846  -12.282 1.00 22.18 ? 297 PRO A CD  1 
ATOM 2227 N N   . GLU A 1 295 ? -0.347  -7.642  -11.948 1.00 21.60 ? 298 GLU A N   1 
ATOM 2228 C CA  . GLU A 1 295 ? 0.850   -7.270  -12.717 1.00 21.32 ? 298 GLU A CA  1 
ATOM 2229 C C   . GLU A 1 295 ? 2.128   -7.484  -11.903 1.00 21.04 ? 298 GLU A C   1 
ATOM 2230 O O   . GLU A 1 295 ? 2.168   -7.207  -10.700 1.00 20.98 ? 298 GLU A O   1 
ATOM 2231 C CB  . GLU A 1 295 ? 0.762   -5.847  -13.296 1.00 21.28 ? 298 GLU A CB  1 
ATOM 2232 C CG  . GLU A 1 295 ? -0.134  -4.873  -12.533 1.00 21.40 ? 298 GLU A CG  1 
ATOM 2233 C CD  . GLU A 1 295 ? -0.575  -3.677  -13.376 1.00 21.44 ? 298 GLU A CD  1 
ATOM 2234 O OE1 . GLU A 1 295 ? -0.754  -3.827  -14.608 1.00 21.01 ? 298 GLU A OE1 1 
ATOM 2235 O OE2 . GLU A 1 295 ? -0.754  -2.583  -12.797 1.00 21.76 ? 298 GLU A OE2 1 
ATOM 2236 N N   . TRP A 1 296 ? 3.163   -7.981  -12.574 1.00 20.74 ? 299 TRP A N   1 
ATOM 2237 C CA  . TRP A 1 296 ? 4.400   -8.397  -11.916 1.00 20.49 ? 299 TRP A CA  1 
ATOM 2238 C C   . TRP A 1 296 ? 5.208   -7.262  -11.294 1.00 20.49 ? 299 TRP A C   1 
ATOM 2239 O O   . TRP A 1 296 ? 5.746   -6.406  -12.001 1.00 20.43 ? 299 TRP A O   1 
ATOM 2240 C CB  . TRP A 1 296 ? 5.282   -9.216  -12.871 1.00 20.34 ? 299 TRP A CB  1 
ATOM 2241 C CG  . TRP A 1 296 ? 4.832   -10.642 -13.042 1.00 20.12 ? 299 TRP A CG  1 
ATOM 2242 C CD1 . TRP A 1 296 ? 4.634   -11.302 -14.220 1.00 20.09 ? 299 TRP A CD1 1 
ATOM 2243 C CD2 . TRP A 1 296 ? 4.517   -11.578 -12.000 1.00 19.69 ? 299 TRP A CD2 1 
ATOM 2244 N NE1 . TRP A 1 296 ? 4.215   -12.589 -13.978 1.00 19.97 ? 299 TRP A NE1 1 
ATOM 2245 C CE2 . TRP A 1 296 ? 4.133   -12.783 -12.625 1.00 19.80 ? 299 TRP A CE2 1 
ATOM 2246 C CE3 . TRP A 1 296 ? 4.518   -11.513 -10.600 1.00 19.64 ? 299 TRP A CE3 1 
ATOM 2247 C CZ2 . TRP A 1 296 ? 3.754   -13.913 -11.900 1.00 20.12 ? 299 TRP A CZ2 1 
ATOM 2248 C CZ3 . TRP A 1 296 ? 4.143   -12.635 -9.881  1.00 19.91 ? 299 TRP A CZ3 1 
ATOM 2249 C CH2 . TRP A 1 296 ? 3.767   -13.820 -10.532 1.00 20.07 ? 299 TRP A CH2 1 
ATOM 2250 N N   . LEU A 1 297 ? 5.287   -7.271  -9.963  1.00 20.53 ? 300 LEU A N   1 
ATOM 2251 C CA  . LEU A 1 297 ? 6.128   -6.328  -9.222  1.00 20.56 ? 300 LEU A CA  1 
ATOM 2252 C C   . LEU A 1 297 ? 7.572   -6.831  -9.122  1.00 20.61 ? 300 LEU A C   1 
ATOM 2253 O O   . LEU A 1 297 ? 8.516   -6.062  -9.320  1.00 20.75 ? 300 LEU A O   1 
ATOM 2254 C CB  . LEU A 1 297 ? 5.554   -6.040  -7.827  1.00 20.47 ? 300 LEU A CB  1 
ATOM 2255 C CG  . LEU A 1 297 ? 4.133   -5.474  -7.702  1.00 20.36 ? 300 LEU A CG  1 
ATOM 2256 C CD1 . LEU A 1 297 ? 3.766   -5.289  -6.237  1.00 19.91 ? 300 LEU A CD1 1 
ATOM 2257 C CD2 . LEU A 1 297 ? 3.971   -4.163  -8.464  1.00 20.25 ? 300 LEU A CD2 1 
ATOM 2258 N N   . LYS A 1 298 ? 7.740   -8.118  -8.816  1.00 20.56 ? 301 LYS A N   1 
ATOM 2259 C CA  . LYS A 1 298 ? 9.065   -8.736  -8.793  1.00 20.50 ? 301 LYS A CA  1 
ATOM 2260 C C   . LYS A 1 298 ? 9.004   -10.189 -9.259  1.00 20.39 ? 301 LYS A C   1 
ATOM 2261 O O   . LYS A 1 298 ? 8.071   -10.920 -8.917  1.00 20.33 ? 301 LYS A O   1 
ATOM 2262 C CB  . LYS A 1 298 ? 9.698   -8.647  -7.399  1.00 20.60 ? 301 LYS A CB  1 
ATOM 2263 C CG  . LYS A 1 298 ? 11.165  -8.236  -7.436  1.00 20.78 ? 301 LYS A CG  1 
ATOM 2264 C CD  . LYS A 1 298 ? 12.033  -9.085  -6.521  1.00 20.54 ? 301 LYS A CD  1 
ATOM 2265 C CE  . LYS A 1 298 ? 13.505  -8.835  -6.808  1.00 20.34 ? 301 LYS A CE  1 
ATOM 2266 N NZ  . LYS A 1 298 ? 14.371  -9.912  -6.264  1.00 20.33 ? 301 LYS A NZ  1 
ATOM 2267 N N   . VAL A 1 299 ? 10.004  -10.596 -10.040 1.00 20.26 ? 302 VAL A N   1 
ATOM 2268 C CA  . VAL A 1 299 ? 10.032  -11.935 -10.640 1.00 20.06 ? 302 VAL A CA  1 
ATOM 2269 C C   . VAL A 1 299 ? 11.398  -12.619 -10.538 1.00 20.04 ? 302 VAL A C   1 
ATOM 2270 O O   . VAL A 1 299 ? 12.435  -11.959 -10.447 1.00 20.07 ? 302 VAL A O   1 
ATOM 2271 C CB  . VAL A 1 299 ? 9.561   -11.924 -12.126 1.00 20.00 ? 302 VAL A CB  1 
ATOM 2272 C CG1 . VAL A 1 299 ? 8.123   -11.461 -12.229 1.00 19.71 ? 302 VAL A CG1 1 
ATOM 2273 C CG2 . VAL A 1 299 ? 10.469  -11.055 -13.001 1.00 19.91 ? 302 VAL A CG2 1 
ATOM 2274 N N   . ILE A 1 300 ? 11.373  -13.949 -10.556 1.00 20.00 ? 303 ILE A N   1 
ATOM 2275 C CA  . ILE A 1 300 ? 12.572  -14.788 -10.511 1.00 19.97 ? 303 ILE A CA  1 
ATOM 2276 C C   . ILE A 1 300 ? 13.396  -14.671 -11.796 1.00 20.09 ? 303 ILE A C   1 
ATOM 2277 O O   . ILE A 1 300 ? 12.849  -14.382 -12.860 1.00 20.27 ? 303 ILE A O   1 
ATOM 2278 C CB  . ILE A 1 300 ? 12.191  -16.262 -10.278 1.00 19.87 ? 303 ILE A CB  1 
ATOM 2279 C CG1 . ILE A 1 300 ? 11.153  -16.715 -11.313 1.00 19.61 ? 303 ILE A CG1 1 
ATOM 2280 C CG2 . ILE A 1 300 ? 11.639  -16.433 -8.873  1.00 20.06 ? 303 ILE A CG2 1 
ATOM 2281 C CD1 . ILE A 1 300 ? 10.808  -18.186 -11.271 1.00 19.89 ? 303 ILE A CD1 1 
ATOM 2282 N N   . SER A 1 301 ? 14.705  -14.892 -11.692 1.00 20.10 ? 304 SER A N   1 
ATOM 2283 C CA  . SER A 1 301 ? 15.599  -14.817 -12.851 1.00 20.15 ? 304 SER A CA  1 
ATOM 2284 C C   . SER A 1 301 ? 16.407  -16.096 -12.989 1.00 20.32 ? 304 SER A C   1 
ATOM 2285 O O   . SER A 1 301 ? 16.554  -16.848 -12.018 1.00 20.36 ? 304 SER A O   1 
ATOM 2286 C CB  . SER A 1 301 ? 16.547  -13.630 -12.722 1.00 20.04 ? 304 SER A CB  1 
ATOM 2287 O OG  . SER A 1 301 ? 15.835  -12.457 -12.382 1.00 20.30 ? 304 SER A OG  1 
ATOM 2288 N N   . ASP A 1 302 ? 16.923  -16.342 -14.196 1.00 20.41 ? 305 ASP A N   1 
ATOM 2289 C CA  . ASP A 1 302 ? 17.789  -17.497 -14.444 1.00 20.47 ? 305 ASP A CA  1 
ATOM 2290 C C   . ASP A 1 302 ? 18.944  -17.493 -13.448 1.00 20.51 ? 305 ASP A C   1 
ATOM 2291 O O   . ASP A 1 302 ? 19.828  -16.632 -13.501 1.00 20.52 ? 305 ASP A O   1 
ATOM 2292 C CB  . ASP A 1 302 ? 18.327  -17.501 -15.881 1.00 20.40 ? 305 ASP A CB  1 
ATOM 2293 C CG  . ASP A 1 302 ? 17.229  -17.573 -16.917 1.00 20.45 ? 305 ASP A CG  1 
ATOM 2294 O OD1 . ASP A 1 302 ? 17.257  -18.496 -17.759 1.00 20.17 ? 305 ASP A OD1 1 
ATOM 2295 O OD2 . ASP A 1 302 ? 16.333  -16.704 -16.889 1.00 21.20 ? 305 ASP A OD2 1 
ATOM 2296 N N   . THR A 1 303 ? 18.915  -18.444 -12.523 1.00 20.50 ? 306 THR A N   1 
ATOM 2297 C CA  . THR A 1 303 ? 19.932  -18.503 -11.491 1.00 20.61 ? 306 THR A CA  1 
ATOM 2298 C C   . THR A 1 303 ? 20.894  -19.655 -11.740 1.00 20.67 ? 306 THR A C   1 
ATOM 2299 O O   . THR A 1 303 ? 20.487  -20.758 -12.115 1.00 20.65 ? 306 THR A O   1 
ATOM 2300 C CB  . THR A 1 303 ? 19.315  -18.594 -10.081 1.00 20.61 ? 306 THR A CB  1 
ATOM 2301 O OG1 . THR A 1 303 ? 18.169  -17.736 -10.010 1.00 20.64 ? 306 THR A OG1 1 
ATOM 2302 C CG2 . THR A 1 303 ? 20.326  -18.159 -9.024  1.00 20.52 ? 306 THR A CG2 1 
ATOM 2303 N N   . GLU A 1 304 ? 22.175  -19.364 -11.547 1.00 20.74 ? 307 GLU A N   1 
ATOM 2304 C CA  . GLU A 1 304 ? 23.239  -20.345 -11.647 1.00 20.78 ? 307 GLU A CA  1 
ATOM 2305 C C   . GLU A 1 304 ? 23.744  -20.555 -10.228 1.00 20.98 ? 307 GLU A C   1 
ATOM 2306 O O   . GLU A 1 304 ? 24.251  -19.620 -9.606  1.00 20.96 ? 307 GLU A O   1 
ATOM 2307 C CB  . GLU A 1 304 ? 24.350  -19.803 -12.549 1.00 20.72 ? 307 GLU A CB  1 
ATOM 2308 C CG  . GLU A 1 304 ? 25.017  -20.838 -13.437 1.00 20.16 ? 307 GLU A CG  1 
ATOM 2309 C CD  . GLU A 1 304 ? 25.591  -20.233 -14.709 1.00 19.55 ? 307 GLU A CD  1 
ATOM 2310 O OE1 . GLU A 1 304 ? 24.819  -19.648 -15.505 1.00 18.89 ? 307 GLU A OE1 1 
ATOM 2311 O OE2 . GLU A 1 304 ? 26.815  -20.352 -14.920 1.00 19.41 ? 307 GLU A OE2 1 
ATOM 2312 N N   . ALA A 1 305 ? 23.582  -21.771 -9.712  1.00 21.22 ? 308 ALA A N   1 
ATOM 2313 C CA  . ALA A 1 305 ? 23.881  -22.053 -8.307  1.00 21.59 ? 308 ALA A CA  1 
ATOM 2314 C C   . ALA A 1 305 ? 24.812  -23.246 -8.117  1.00 21.84 ? 308 ALA A C   1 
ATOM 2315 O O   . ALA A 1 305 ? 24.774  -24.201 -8.898  1.00 22.02 ? 308 ALA A O   1 
ATOM 2316 C CB  . ALA A 1 305 ? 22.589  -22.263 -7.529  1.00 21.54 ? 308 ALA A CB  1 
ATOM 2317 N N   . ASP A 1 306 ? 25.647  -23.184 -7.079  1.00 22.02 ? 309 ASP A N   1 
ATOM 2318 C CA  . ASP A 1 306 ? 26.494  -24.315 -6.703  1.00 22.24 ? 309 ASP A CA  1 
ATOM 2319 C C   . ASP A 1 306 ? 25.664  -25.421 -6.054  1.00 22.45 ? 309 ASP A C   1 
ATOM 2320 O O   . ASP A 1 306 ? 24.577  -25.162 -5.528  1.00 22.48 ? 309 ASP A O   1 
ATOM 2321 C CB  . ASP A 1 306 ? 27.616  -23.873 -5.758  1.00 22.24 ? 309 ASP A CB  1 
ATOM 2322 C CG  . ASP A 1 306 ? 28.913  -23.563 -6.486  1.00 22.12 ? 309 ASP A CG  1 
ATOM 2323 O OD1 . ASP A 1 306 ? 28.878  -22.840 -7.507  1.00 21.98 ? 309 ASP A OD1 1 
ATOM 2324 O OD2 . ASP A 1 306 ? 29.974  -24.039 -6.026  1.00 21.91 ? 309 ASP A OD2 1 
ATOM 2325 N N   . ILE A 1 307 ? 26.181  -26.648 -6.101  1.00 22.68 ? 310 ILE A N   1 
ATOM 2326 C CA  . ILE A 1 307 ? 25.512  -27.805 -5.504  1.00 22.90 ? 310 ILE A CA  1 
ATOM 2327 C C   . ILE A 1 307 ? 25.630  -27.774 -3.977  1.00 23.09 ? 310 ILE A C   1 
ATOM 2328 O O   . ILE A 1 307 ? 26.710  -27.537 -3.428  1.00 23.17 ? 310 ILE A O   1 
ATOM 2329 C CB  . ILE A 1 307 ? 26.015  -29.157 -6.128  1.00 22.89 ? 310 ILE A CB  1 
ATOM 2330 C CG1 . ILE A 1 307 ? 25.047  -30.322 -5.832  1.00 22.99 ? 310 ILE A CG1 1 
ATOM 2331 C CG2 . ILE A 1 307 ? 27.490  -29.447 -5.773  1.00 23.06 ? 310 ILE A CG2 1 
ATOM 2332 C CD1 . ILE A 1 307 ? 25.290  -31.097 -4.529  1.00 23.22 ? 310 ILE A CD1 1 
ATOM 2333 N N   . GLY A 1 308 ? 24.503  -27.989 -3.302  1.00 23.28 ? 311 GLY A N   1 
ATOM 2334 C CA  . GLY A 1 308 ? 24.447  -27.935 -1.843  1.00 23.49 ? 311 GLY A CA  1 
ATOM 2335 C C   . GLY A 1 308 ? 24.157  -26.544 -1.302  1.00 23.68 ? 311 GLY A C   1 
ATOM 2336 O O   . GLY A 1 308 ? 23.944  -26.373 -0.099  1.00 23.67 ? 311 GLY A O   1 
ATOM 2337 N N   . SER A 1 309 ? 24.148  -25.551 -2.193  1.00 23.86 ? 312 SER A N   1 
ATOM 2338 C CA  . SER A 1 309 ? 23.854  -24.160 -1.827  1.00 24.04 ? 312 SER A CA  1 
ATOM 2339 C C   . SER A 1 309 ? 22.368  -23.949 -1.537  1.00 24.05 ? 312 SER A C   1 
ATOM 2340 O O   . SER A 1 309 ? 21.544  -24.865 -1.728  1.00 24.11 ? 312 SER A O   1 
ATOM 2341 C CB  . SER A 1 309 ? 24.306  -23.201 -2.934  1.00 24.04 ? 312 SER A CB  1 
ATOM 2342 O OG  . SER A 1 309 ? 25.711  -23.242 -3.105  1.00 24.36 ? 312 SER A OG  1 
ATOM 2343 N N   . ASN A 1 310 ? 22.035  -22.740 -1.067  1.00 23.99 ? 313 ASN A N   1 
ATOM 2344 C CA  . ASN A 1 310 ? 20.646  -22.379 -0.835  1.00 24.06 ? 313 ASN A CA  1 
ATOM 2345 C C   . ASN A 1 310 ? 20.154  -21.298 -1.790  1.00 24.25 ? 313 ASN A C   1 
ATOM 2346 O O   . ASN A 1 310 ? 20.953  -20.536 -2.340  1.00 24.41 ? 313 ASN A O   1 
ATOM 2347 C CB  . ASN A 1 310 ? 20.438  -21.953 0.615   1.00 23.95 ? 313 ASN A CB  1 
ATOM 2348 C CG  . ASN A 1 310 ? 20.090  -23.117 1.511   1.00 23.96 ? 313 ASN A CG  1 
ATOM 2349 O OD1 . ASN A 1 310 ? 20.907  -24.010 1.738   1.00 24.42 ? 313 ASN A OD1 1 
ATOM 2350 N ND2 . ASN A 1 310 ? 18.866  -23.120 2.026   1.00 23.92 ? 313 ASN A ND2 1 
ATOM 2351 N N   . LEU A 1 311 ? 18.841  -21.243 -1.996  1.00 24.29 ? 314 LEU A N   1 
ATOM 2352 C CA  . LEU A 1 311 ? 18.254  -20.182 -2.801  1.00 24.37 ? 314 LEU A CA  1 
ATOM 2353 C C   . LEU A 1 311 ? 16.971  -19.592 -2.229  1.00 24.48 ? 314 LEU A C   1 
ATOM 2354 O O   . LEU A 1 311 ? 16.042  -20.316 -1.846  1.00 24.46 ? 314 LEU A O   1 
ATOM 2355 C CB  . LEU A 1 311 ? 18.033  -20.627 -4.250  1.00 24.36 ? 314 LEU A CB  1 
ATOM 2356 C CG  . LEU A 1 311 ? 19.138  -20.339 -5.270  1.00 24.45 ? 314 LEU A CG  1 
ATOM 2357 C CD1 . LEU A 1 311 ? 18.567  -20.495 -6.671  1.00 24.45 ? 314 LEU A CD1 1 
ATOM 2358 C CD2 . LEU A 1 311 ? 19.752  -18.944 -5.100  1.00 24.64 ? 314 LEU A CD2 1 
ATOM 2359 N N   . ARG A 1 312 ? 16.953  -18.263 -2.175  1.00 24.51 ? 315 ARG A N   1 
ATOM 2360 C CA  . ARG A 1 312 ? 15.768  -17.492 -1.845  1.00 24.42 ? 315 ARG A CA  1 
ATOM 2361 C C   . ARG A 1 312 ? 15.206  -16.958 -3.155  1.00 24.35 ? 315 ARG A C   1 
ATOM 2362 O O   . ARG A 1 312 ? 15.766  -16.033 -3.747  1.00 24.36 ? 315 ARG A O   1 
ATOM 2363 C CB  . ARG A 1 312 ? 16.119  -16.330 -0.906  1.00 24.45 ? 315 ARG A CB  1 
ATOM 2364 C CG  . ARG A 1 312 ? 16.859  -16.722 0.375   1.00 24.46 ? 315 ARG A CG  1 
ATOM 2365 C CD  . ARG A 1 312 ? 17.212  -15.487 1.194   1.00 24.48 ? 315 ARG A CD  1 
ATOM 2366 N NE  . ARG A 1 312 ? 17.779  -15.817 2.501   1.00 24.79 ? 315 ARG A NE  1 
ATOM 2367 C CZ  . ARG A 1 312 ? 17.995  -14.933 3.477   1.00 25.23 ? 315 ARG A CZ  1 
ATOM 2368 N NH1 . ARG A 1 312 ? 18.515  -15.332 4.630   1.00 25.32 ? 315 ARG A NH1 1 
ATOM 2369 N NH2 . ARG A 1 312 ? 17.693  -13.651 3.311   1.00 25.52 ? 315 ARG A NH2 1 
ATOM 2370 N N   . TRP A 1 313 ? 14.120  -17.566 -3.622  1.00 24.29 ? 316 TRP A N   1 
ATOM 2371 C CA  . TRP A 1 313 ? 13.412  -17.085 -4.807  1.00 24.25 ? 316 TRP A CA  1 
ATOM 2372 C C   . TRP A 1 313 ? 12.071  -16.453 -4.441  1.00 24.09 ? 316 TRP A C   1 
ATOM 2373 O O   . TRP A 1 313 ? 11.409  -16.895 -3.497  1.00 24.28 ? 316 TRP A O   1 
ATOM 2374 C CB  . TRP A 1 313 ? 13.194  -18.215 -5.807  1.00 24.37 ? 316 TRP A CB  1 
ATOM 2375 C CG  . TRP A 1 313 ? 14.064  -18.138 -7.036  1.00 24.63 ? 316 TRP A CG  1 
ATOM 2376 C CD1 . TRP A 1 313 ? 14.846  -17.082 -7.439  1.00 24.62 ? 316 TRP A CD1 1 
ATOM 2377 C CD2 . TRP A 1 313 ? 14.191  -19.141 -8.051  1.00 24.62 ? 316 TRP A CD2 1 
ATOM 2378 N NE1 . TRP A 1 313 ? 15.468  -17.384 -8.628  1.00 24.67 ? 316 TRP A NE1 1 
ATOM 2379 C CE2 . TRP A 1 313 ? 15.083  -18.639 -9.026  1.00 24.75 ? 316 TRP A CE2 1 
ATOM 2380 C CE3 . TRP A 1 313 ? 13.647  -20.421 -8.225  1.00 24.15 ? 316 TRP A CE3 1 
ATOM 2381 C CZ2 . TRP A 1 313 ? 15.444  -19.376 -10.159 1.00 24.78 ? 316 TRP A CZ2 1 
ATOM 2382 C CZ3 . TRP A 1 313 ? 14.004  -21.149 -9.349  1.00 24.43 ? 316 TRP A CZ3 1 
ATOM 2383 C CH2 . TRP A 1 313 ? 14.896  -20.626 -10.301 1.00 24.58 ? 316 TRP A CH2 1 
ATOM 2384 N N   . GLY A 1 314 ? 11.669  -15.427 -5.189  1.00 23.68 ? 317 GLY A N   1 
ATOM 2385 C CA  . GLY A 1 314 ? 10.445  -14.709 -4.866  1.00 23.27 ? 317 GLY A CA  1 
ATOM 2386 C C   . GLY A 1 314 ? 9.712   -14.077 -6.028  1.00 23.10 ? 317 GLY A C   1 
ATOM 2387 O O   . GLY A 1 314 ? 10.312  -13.725 -7.047  1.00 23.10 ? 317 GLY A O   1 
ATOM 2388 N N   . CYS A 1 315 ? 8.397   -13.951 -5.862  1.00 22.89 ? 318 CYS A N   1 
ATOM 2389 C CA  . CYS A 1 315 ? 7.537   -13.200 -6.775  1.00 22.69 ? 318 CYS A CA  1 
ATOM 2390 C C   . CYS A 1 315 ? 6.494   -12.436 -5.968  1.00 22.57 ? 318 CYS A C   1 
ATOM 2391 O O   . CYS A 1 315 ? 6.111   -12.862 -4.875  1.00 22.62 ? 318 CYS A O   1 
ATOM 2392 C CB  . CYS A 1 315 ? 6.834   -14.127 -7.774  1.00 22.68 ? 318 CYS A CB  1 
ATOM 2393 S SG  . CYS A 1 315 ? 7.921   -14.983 -8.935  1.00 22.56 ? 318 CYS A SG  1 
ATOM 2394 N N   . ALA A 1 316 ? 6.045   -11.305 -6.508  1.00 22.41 ? 319 ALA A N   1 
ATOM 2395 C CA  . ALA A 1 316 ? 4.962   -10.519 -5.915  1.00 22.16 ? 319 ALA A CA  1 
ATOM 2396 C C   . ALA A 1 316 ? 4.172   -9.809  -7.010  1.00 22.06 ? 319 ALA A C   1 
ATOM 2397 O O   . ALA A 1 316 ? 4.736   -9.416  -8.033  1.00 22.02 ? 319 ALA A O   1 
ATOM 2398 C CB  . ALA A 1 316 ? 5.517   -9.519  -4.929  1.00 22.21 ? 319 ALA A CB  1 
ATOM 2399 N N   . ALA A 1 317 ? 2.869   -9.645  -6.796  1.00 21.98 ? 320 ALA A N   1 
ATOM 2400 C CA  . ALA A 1 317 ? 1.996   -9.036  -7.807  1.00 21.94 ? 320 ALA A CA  1 
ATOM 2401 C C   . ALA A 1 317 ? 0.985   -8.032  -7.243  1.00 21.90 ? 320 ALA A C   1 
ATOM 2402 O O   . ALA A 1 317 ? 0.493   -8.179  -6.120  1.00 21.79 ? 320 ALA A O   1 
ATOM 2403 C CB  . ALA A 1 317 ? 1.283   -10.113 -8.611  1.00 21.80 ? 320 ALA A CB  1 
ATOM 2404 N N   . ALA A 1 318 ? 0.682   -7.014  -8.042  1.00 21.93 ? 321 ALA A N   1 
ATOM 2405 C CA  . ALA A 1 318 ? -0.277  -5.986  -7.660  1.00 22.03 ? 321 ALA A CA  1 
ATOM 2406 C C   . ALA A 1 318 ? -1.687  -6.350  -8.117  1.00 22.05 ? 321 ALA A C   1 
ATOM 2407 O O   . ALA A 1 318 ? -1.918  -7.444  -8.631  1.00 22.02 ? 321 ALA A O   1 
ATOM 2408 C CB  . ALA A 1 318 ? 0.143   -4.638  -8.228  1.00 22.10 ? 321 ALA A CB  1 
ATOM 2409 N N   . GLY A 1 319 ? -2.627  -5.431  -7.911  1.00 22.16 ? 322 GLY A N   1 
ATOM 2410 C CA  . GLY A 1 319 ? -3.994  -5.605  -8.385  1.00 22.24 ? 322 GLY A CA  1 
ATOM 2411 C C   . GLY A 1 319 ? -4.974  -5.994  -7.299  1.00 22.28 ? 322 GLY A C   1 
ATOM 2412 O O   . GLY A 1 319 ? -4.617  -6.694  -6.349  1.00 22.26 ? 322 GLY A O   1 
ATOM 2413 N N   . LYS A 1 320 ? -6.213  -5.527  -7.454  1.00 22.32 ? 323 LYS A N   1 
ATOM 2414 C CA  . LYS A 1 320 ? -7.313  -5.835  -6.541  1.00 22.18 ? 323 LYS A CA  1 
ATOM 2415 C C   . LYS A 1 320 ? -8.207  -6.934  -7.146  1.00 22.21 ? 323 LYS A C   1 
ATOM 2416 O O   . LYS A 1 320 ? -8.579  -6.851  -8.323  1.00 22.27 ? 323 LYS A O   1 
ATOM 2417 C CB  . LYS A 1 320 ? -8.122  -4.565  -6.244  1.00 22.13 ? 323 LYS A CB  1 
ATOM 2418 C CG  . LYS A 1 320 ? -9.063  -4.664  -5.046  1.00 22.17 ? 323 LYS A CG  1 
ATOM 2419 C CD  . LYS A 1 320 ? -9.795  -3.351  -4.801  1.00 21.99 ? 323 LYS A CD  1 
ATOM 2420 C CE  . LYS A 1 320 ? -10.936 -3.530  -3.816  1.00 21.49 ? 323 LYS A CE  1 
ATOM 2421 N NZ  . LYS A 1 320 ? -11.771 -2.306  -3.723  1.00 21.06 ? 323 LYS A NZ  1 
ATOM 2422 N N   . PRO A 1 321 ? -8.521  -7.986  -6.360  1.00 22.18 ? 324 PRO A N   1 
ATOM 2423 C CA  . PRO A 1 321 ? -8.028  -8.221  -5.003  1.00 22.13 ? 324 PRO A CA  1 
ATOM 2424 C C   . PRO A 1 321 ? -6.595  -8.715  -5.059  1.00 22.11 ? 324 PRO A C   1 
ATOM 2425 O O   . PRO A 1 321 ? -6.125  -9.115  -6.131  1.00 22.13 ? 324 PRO A O   1 
ATOM 2426 C CB  . PRO A 1 321 ? -8.945  -9.334  -4.470  1.00 22.12 ? 324 PRO A CB  1 
ATOM 2427 C CG  . PRO A 1 321 ? -9.992  -9.560  -5.525  1.00 22.27 ? 324 PRO A CG  1 
ATOM 2428 C CD  . PRO A 1 321 ? -9.412  -9.070  -6.804  1.00 22.22 ? 324 PRO A CD  1 
ATOM 2429 N N   . ARG A 1 322 ? -5.904  -8.675  -3.921  1.00 22.09 ? 325 ARG A N   1 
ATOM 2430 C CA  . ARG A 1 322 ? -4.521  -9.123  -3.853  1.00 22.12 ? 325 ARG A CA  1 
ATOM 2431 C C   . ARG A 1 322 ? -4.449  -10.554 -4.389  1.00 22.19 ? 325 ARG A C   1 
ATOM 2432 O O   . ARG A 1 322 ? -5.078  -11.458 -3.832  1.00 22.30 ? 325 ARG A O   1 
ATOM 2433 C CB  . ARG A 1 322 ? -3.999  -9.048  -2.419  1.00 22.05 ? 325 ARG A CB  1 
ATOM 2434 C CG  . ARG A 1 322 ? -2.533  -8.653  -2.316  1.00 22.04 ? 325 ARG A CG  1 
ATOM 2435 C CD  . ARG A 1 322 ? -1.891  -9.147  -1.016  1.00 22.15 ? 325 ARG A CD  1 
ATOM 2436 N NE  . ARG A 1 322 ? -2.762  -8.987  0.150   1.00 22.51 ? 325 ARG A NE  1 
ATOM 2437 C CZ  . ARG A 1 322 ? -2.965  -7.842  0.803   1.00 22.71 ? 325 ARG A CZ  1 
ATOM 2438 N NH1 . ARG A 1 322 ? -3.778  -7.818  1.848   1.00 22.68 ? 325 ARG A NH1 1 
ATOM 2439 N NH2 . ARG A 1 322 ? -2.366  -6.720  0.418   1.00 22.77 ? 325 ARG A NH2 1 
ATOM 2440 N N   . PRO A 1 323 ? -3.708  -10.758 -5.495  1.00 22.16 ? 326 PRO A N   1 
ATOM 2441 C CA  . PRO A 1 323 ? -3.711  -12.061 -6.161  1.00 22.15 ? 326 PRO A CA  1 
ATOM 2442 C C   . PRO A 1 323 ? -2.985  -13.138 -5.363  1.00 22.13 ? 326 PRO A C   1 
ATOM 2443 O O   . PRO A 1 323 ? -2.220  -12.825 -4.447  1.00 22.11 ? 326 PRO A O   1 
ATOM 2444 C CB  . PRO A 1 323 ? -2.982  -11.786 -7.483  1.00 22.16 ? 326 PRO A CB  1 
ATOM 2445 C CG  . PRO A 1 323 ? -2.116  -10.619 -7.203  1.00 22.19 ? 326 PRO A CG  1 
ATOM 2446 C CD  . PRO A 1 323 ? -2.832  -9.787  -6.176  1.00 22.21 ? 326 PRO A CD  1 
ATOM 2447 N N   . THR A 1 324 ? -3.240  -14.394 -5.719  1.00 22.11 ? 327 THR A N   1 
ATOM 2448 C CA  . THR A 1 324 ? -2.623  -15.542 -5.070  1.00 22.01 ? 327 THR A CA  1 
ATOM 2449 C C   . THR A 1 324 ? -1.459  -16.048 -5.911  1.00 21.91 ? 327 THR A C   1 
ATOM 2450 O O   . THR A 1 324 ? -1.631  -16.369 -7.089  1.00 21.76 ? 327 THR A O   1 
ATOM 2451 C CB  . THR A 1 324 ? -3.645  -16.686 -4.861  1.00 22.06 ? 327 THR A CB  1 
ATOM 2452 O OG1 . THR A 1 324 ? -4.817  -16.170 -4.215  1.00 22.07 ? 327 THR A OG1 1 
ATOM 2453 C CG2 . THR A 1 324 ? -3.050  -17.804 -4.002  1.00 22.26 ? 327 THR A CG2 1 
ATOM 2454 N N   . VAL A 1 325 ? -0.280  -16.117 -5.295  1.00 21.93 ? 328 VAL A N   1 
ATOM 2455 C CA  . VAL A 1 325 ? 0.916   -16.641 -5.959  1.00 21.97 ? 328 VAL A CA  1 
ATOM 2456 C C   . VAL A 1 325 ? 1.025   -18.169 -5.819  1.00 21.99 ? 328 VAL A C   1 
ATOM 2457 O O   . VAL A 1 325 ? 1.246   -18.688 -4.720  1.00 21.99 ? 328 VAL A O   1 
ATOM 2458 C CB  . VAL A 1 325 ? 2.218   -15.937 -5.471  1.00 21.84 ? 328 VAL A CB  1 
ATOM 2459 C CG1 . VAL A 1 325 ? 3.432   -16.501 -6.184  1.00 21.88 ? 328 VAL A CG1 1 
ATOM 2460 C CG2 . VAL A 1 325 ? 2.140   -14.442 -5.719  1.00 21.72 ? 328 VAL A CG2 1 
ATOM 2461 N N   . ARG A 1 326 ? 0.839   -18.865 -6.943  1.00 21.93 ? 329 ARG A N   1 
ATOM 2462 C CA  . ARG A 1 326 ? 1.063   -20.305 -7.061  1.00 21.91 ? 329 ARG A CA  1 
ATOM 2463 C C   . ARG A 1 326 ? 2.528   -20.545 -7.405  1.00 21.91 ? 329 ARG A C   1 
ATOM 2464 O O   . ARG A 1 326 ? 3.306   -19.592 -7.525  1.00 21.95 ? 329 ARG A O   1 
ATOM 2465 C CB  . ARG A 1 326 ? 0.233   -20.888 -8.203  1.00 21.98 ? 329 ARG A CB  1 
ATOM 2466 C CG  . ARG A 1 326 ? -1.269  -20.880 -8.052  1.00 22.42 ? 329 ARG A CG  1 
ATOM 2467 C CD  . ARG A 1 326 ? -1.891  -21.122 -9.432  1.00 22.98 ? 329 ARG A CD  1 
ATOM 2468 N NE  . ARG A 1 326 ? -2.794  -22.270 -9.436  1.00 23.65 ? 329 ARG A NE  1 
ATOM 2469 C CZ  . ARG A 1 326 ? -2.408  -23.534 -9.609  1.00 23.90 ? 329 ARG A CZ  1 
ATOM 2470 N NH1 . ARG A 1 326 ? -3.307  -24.510 -9.589  1.00 24.05 ? 329 ARG A NH1 1 
ATOM 2471 N NH2 . ARG A 1 326 ? -1.127  -23.831 -9.801  1.00 23.71 ? 329 ARG A NH2 1 
ATOM 2472 N N   . TRP A 1 327 ? 2.888   -21.819 -7.584  1.00 21.85 ? 330 TRP A N   1 
ATOM 2473 C CA  . TRP A 1 327 ? 4.214   -22.212 -8.079  1.00 21.75 ? 330 TRP A CA  1 
ATOM 2474 C C   . TRP A 1 327 ? 4.134   -23.425 -8.993  1.00 21.53 ? 330 TRP A C   1 
ATOM 2475 O O   . TRP A 1 327 ? 3.367   -24.355 -8.736  1.00 21.46 ? 330 TRP A O   1 
ATOM 2476 C CB  . TRP A 1 327 ? 5.181   -22.488 -6.926  1.00 21.97 ? 330 TRP A CB  1 
ATOM 2477 C CG  . TRP A 1 327 ? 5.742   -21.239 -6.330  1.00 22.19 ? 330 TRP A CG  1 
ATOM 2478 C CD1 . TRP A 1 327 ? 5.236   -20.539 -5.275  1.00 22.47 ? 330 TRP A CD1 1 
ATOM 2479 C CD2 . TRP A 1 327 ? 6.906   -20.524 -6.767  1.00 22.48 ? 330 TRP A CD2 1 
ATOM 2480 N NE1 . TRP A 1 327 ? 6.014   -19.433 -5.022  1.00 22.83 ? 330 TRP A NE1 1 
ATOM 2481 C CE2 . TRP A 1 327 ? 7.047   -19.400 -5.921  1.00 22.67 ? 330 TRP A CE2 1 
ATOM 2482 C CE3 . TRP A 1 327 ? 7.847   -20.727 -7.785  1.00 22.59 ? 330 TRP A CE3 1 
ATOM 2483 C CZ2 . TRP A 1 327 ? 8.094   -18.478 -6.062  1.00 22.40 ? 330 TRP A CZ2 1 
ATOM 2484 C CZ3 . TRP A 1 327 ? 8.888   -19.806 -7.927  1.00 22.58 ? 330 TRP A CZ3 1 
ATOM 2485 C CH2 . TRP A 1 327 ? 9.000   -18.697 -7.067  1.00 22.36 ? 330 TRP A CH2 1 
ATOM 2486 N N   . LEU A 1 328 ? 4.930   -23.404 -10.059 1.00 21.34 ? 331 LEU A N   1 
ATOM 2487 C CA  . LEU A 1 328 ? 4.988   -24.511 -11.015 1.00 21.21 ? 331 LEU A CA  1 
ATOM 2488 C C   . LEU A 1 328 ? 6.417   -25.007 -11.232 1.00 21.19 ? 331 LEU A C   1 
ATOM 2489 O O   . LEU A 1 328 ? 7.346   -24.206 -11.364 1.00 21.26 ? 331 LEU A O   1 
ATOM 2490 C CB  . LEU A 1 328 ? 4.379   -24.106 -12.365 1.00 21.04 ? 331 LEU A CB  1 
ATOM 2491 C CG  . LEU A 1 328 ? 2.876   -23.830 -12.504 1.00 20.72 ? 331 LEU A CG  1 
ATOM 2492 C CD1 . LEU A 1 328 ? 2.584   -23.255 -13.867 1.00 20.06 ? 331 LEU A CD1 1 
ATOM 2493 C CD2 . LEU A 1 328 ? 2.046   -25.077 -12.299 1.00 20.78 ? 331 LEU A CD2 1 
ATOM 2494 N N   . ARG A 1 329 ? 6.586   -26.326 -11.257 1.00 21.09 ? 332 ARG A N   1 
ATOM 2495 C CA  . ARG A 1 329 ? 7.838   -26.924 -11.705 1.00 21.05 ? 332 ARG A CA  1 
ATOM 2496 C C   . ARG A 1 329 ? 7.582   -27.796 -12.919 1.00 21.09 ? 332 ARG A C   1 
ATOM 2497 O O   . ARG A 1 329 ? 6.830   -28.776 -12.852 1.00 20.99 ? 332 ARG A O   1 
ATOM 2498 C CB  . ARG A 1 329 ? 8.516   -27.742 -10.608 1.00 21.10 ? 332 ARG A CB  1 
ATOM 2499 C CG  . ARG A 1 329 ? 9.940   -28.090 -10.976 1.00 20.92 ? 332 ARG A CG  1 
ATOM 2500 C CD  . ARG A 1 329 ? 10.543  -29.173 -10.121 1.00 20.65 ? 332 ARG A CD  1 
ATOM 2501 N NE  . ARG A 1 329 ? 11.789  -29.616 -10.742 1.00 21.42 ? 332 ARG A NE  1 
ATOM 2502 C CZ  . ARG A 1 329 ? 12.691  -30.412 -10.177 1.00 21.76 ? 332 ARG A CZ  1 
ATOM 2503 N NH1 . ARG A 1 329 ? 13.788  -30.740 -10.851 1.00 21.47 ? 332 ARG A NH1 1 
ATOM 2504 N NH2 . ARG A 1 329 ? 12.509  -30.873 -8.943  1.00 22.23 ? 332 ARG A NH2 1 
ATOM 2505 N N   . ASN A 1 330 ? 8.226   -27.432 -14.025 1.00 21.22 ? 333 ASN A N   1 
ATOM 2506 C CA  . ASN A 1 330 ? 7.982   -28.051 -15.329 1.00 21.29 ? 333 ASN A CA  1 
ATOM 2507 C C   . ASN A 1 330 ? 6.493   -28.098 -15.662 1.00 21.28 ? 333 ASN A C   1 
ATOM 2508 O O   . ASN A 1 330 ? 5.980   -29.110 -16.135 1.00 21.23 ? 333 ASN A O   1 
ATOM 2509 C CB  . ASN A 1 330 ? 8.614   -29.445 -15.406 1.00 21.32 ? 333 ASN A CB  1 
ATOM 2510 C CG  . ASN A 1 330 ? 10.104  -29.428 -15.123 1.00 21.34 ? 333 ASN A CG  1 
ATOM 2511 O OD1 . ASN A 1 330 ? 10.830  -28.534 -15.572 1.00 21.31 ? 333 ASN A OD1 1 
ATOM 2512 N ND2 . ASN A 1 330 ? 10.571  -30.425 -14.379 1.00 21.24 ? 333 ASN A ND2 1 
ATOM 2513 N N   . GLY A 1 331 ? 5.809   -26.989 -15.399 1.00 21.41 ? 334 GLY A N   1 
ATOM 2514 C CA  . GLY A 1 331 ? 4.380   -26.884 -15.644 1.00 21.72 ? 334 GLY A CA  1 
ATOM 2515 C C   . GLY A 1 331 ? 3.566   -27.869 -14.829 1.00 21.96 ? 334 GLY A C   1 
ATOM 2516 O O   . GLY A 1 331 ? 2.657   -28.514 -15.355 1.00 22.00 ? 334 GLY A O   1 
ATOM 2517 N N   . GLU A 1 332 ? 3.901   -27.990 -13.546 1.00 22.17 ? 335 GLU A N   1 
ATOM 2518 C CA  . GLU A 1 332 ? 3.163   -28.857 -12.629 1.00 22.30 ? 335 GLU A CA  1 
ATOM 2519 C C   . GLU A 1 332 ? 2.997   -28.234 -11.247 1.00 22.45 ? 335 GLU A C   1 
ATOM 2520 O O   . GLU A 1 332 ? 3.990   -27.838 -10.624 1.00 22.46 ? 335 GLU A O   1 
ATOM 2521 C CB  . GLU A 1 332 ? 3.819   -30.232 -12.516 1.00 22.22 ? 335 GLU A CB  1 
ATOM 2522 C CG  . GLU A 1 332 ? 3.258   -31.244 -13.489 1.00 22.17 ? 335 GLU A CG  1 
ATOM 2523 C CD  . GLU A 1 332 ? 3.093   -32.615 -12.872 1.00 22.22 ? 335 GLU A CD  1 
ATOM 2524 O OE1 . GLU A 1 332 ? 2.678   -32.700 -11.695 1.00 21.87 ? 335 GLU A OE1 1 
ATOM 2525 O OE2 . GLU A 1 332 ? 3.369   -33.611 -13.572 1.00 22.57 ? 335 GLU A OE2 1 
ATOM 2526 N N   . PRO A 1 333 ? 1.738   -28.146 -10.764 1.00 22.60 ? 336 PRO A N   1 
ATOM 2527 C CA  . PRO A 1 333 ? 1.430   -27.496 -9.489  1.00 22.64 ? 336 PRO A CA  1 
ATOM 2528 C C   . PRO A 1 333 ? 2.378   -27.958 -8.393  1.00 22.71 ? 336 PRO A C   1 
ATOM 2529 O O   . PRO A 1 333 ? 2.362   -29.129 -8.008  1.00 22.75 ? 336 PRO A O   1 
ATOM 2530 C CB  . PRO A 1 333 ? -0.004  -27.948 -9.201  1.00 22.63 ? 336 PRO A CB  1 
ATOM 2531 C CG  . PRO A 1 333 ? -0.597  -28.167 -10.549 1.00 22.63 ? 336 PRO A CG  1 
ATOM 2532 C CD  . PRO A 1 333 ? 0.522   -28.676 -11.417 1.00 22.59 ? 336 PRO A CD  1 
ATOM 2533 N N   . LEU A 1 334 ? 3.222   -27.044 -7.929  1.00 22.88 ? 337 LEU A N   1 
ATOM 2534 C CA  . LEU A 1 334 ? 4.178   -27.352 -6.873  1.00 23.01 ? 337 LEU A CA  1 
ATOM 2535 C C   . LEU A 1 334 ? 3.631   -26.964 -5.503  1.00 23.33 ? 337 LEU A C   1 
ATOM 2536 O O   . LEU A 1 334 ? 3.182   -25.835 -5.296  1.00 23.52 ? 337 LEU A O   1 
ATOM 2537 C CB  . LEU A 1 334 ? 5.530   -26.665 -7.134  1.00 22.94 ? 337 LEU A CB  1 
ATOM 2538 C CG  . LEU A 1 334 ? 6.737   -27.046 -6.259  1.00 22.49 ? 337 LEU A CG  1 
ATOM 2539 C CD1 . LEU A 1 334 ? 6.999   -28.540 -6.281  1.00 21.74 ? 337 LEU A CD1 1 
ATOM 2540 C CD2 . LEU A 1 334 ? 7.987   -26.292 -6.688  1.00 22.56 ? 337 LEU A CD2 1 
ATOM 2541 N N   . ALA A 1 335 ? 3.653   -27.920 -4.581  1.00 23.59 ? 338 ALA A N   1 
ATOM 2542 C CA  . ALA A 1 335 ? 3.386   -27.655 -3.173  1.00 23.85 ? 338 ALA A CA  1 
ATOM 2543 C C   . ALA A 1 335 ? 4.621   -28.053 -2.366  1.00 24.00 ? 338 ALA A C   1 
ATOM 2544 O O   . ALA A 1 335 ? 5.439   -28.851 -2.838  1.00 24.11 ? 338 ALA A O   1 
ATOM 2545 C CB  . ALA A 1 335 ? 2.159   -28.424 -2.710  1.00 23.92 ? 338 ALA A CB  1 
ATOM 2546 N N   . SER A 1 336 ? 4.755   -27.499 -1.160  1.00 24.10 ? 339 SER A N   1 
ATOM 2547 C CA  . SER A 1 336 ? 5.932   -27.730 -0.305  1.00 24.15 ? 339 SER A CA  1 
ATOM 2548 C C   . SER A 1 336 ? 6.245   -29.217 -0.102  1.00 24.11 ? 339 SER A C   1 
ATOM 2549 O O   . SER A 1 336 ? 5.356   -30.008 0.226   1.00 24.09 ? 339 SER A O   1 
ATOM 2550 C CB  . SER A 1 336 ? 5.759   -27.026 1.048   1.00 24.16 ? 339 SER A CB  1 
ATOM 2551 O OG  . SER A 1 336 ? 6.984   -26.964 1.760   1.00 24.14 ? 339 SER A OG  1 
ATOM 2552 N N   . GLN A 1 337 ? 7.510   -29.583 -0.315  1.00 24.12 ? 340 GLN A N   1 
ATOM 2553 C CA  . GLN A 1 337 ? 7.962   -30.977 -0.191  1.00 24.27 ? 340 GLN A CA  1 
ATOM 2554 C C   . GLN A 1 337 ? 9.375   -31.083 0.389   1.00 24.17 ? 340 GLN A C   1 
ATOM 2555 O O   . GLN A 1 337 ? 10.120  -30.106 0.398   1.00 24.17 ? 340 GLN A O   1 
ATOM 2556 C CB  . GLN A 1 337 ? 7.865   -31.710 -1.536  1.00 24.25 ? 340 GLN A CB  1 
ATOM 2557 C CG  . GLN A 1 337 ? 8.399   -30.924 -2.734  1.00 24.57 ? 340 GLN A CG  1 
ATOM 2558 C CD  . GLN A 1 337 ? 8.360   -31.723 -4.025  1.00 24.60 ? 340 GLN A CD  1 
ATOM 2559 O OE1 . GLN A 1 337 ? 9.111   -32.685 -4.199  1.00 25.34 ? 340 GLN A OE1 1 
ATOM 2560 N NE2 . GLN A 1 337 ? 7.486   -31.323 -4.940  1.00 24.85 ? 340 GLN A NE2 1 
ATOM 2561 N N   . ASN A 1 338 ? 9.730   -32.279 0.854   1.00 24.15 ? 341 ASN A N   1 
ATOM 2562 C CA  . ASN A 1 338 ? 10.965  -32.531 1.619   1.00 24.17 ? 341 ASN A CA  1 
ATOM 2563 C C   . ASN A 1 338 ? 12.107  -31.514 1.467   1.00 24.12 ? 341 ASN A C   1 
ATOM 2564 O O   . ASN A 1 338 ? 12.501  -30.868 2.442   1.00 24.09 ? 341 ASN A O   1 
ATOM 2565 C CB  . ASN A 1 338 ? 11.478  -33.954 1.355   1.00 24.15 ? 341 ASN A CB  1 
ATOM 2566 C CG  . ASN A 1 338 ? 12.522  -34.394 2.365   1.00 24.14 ? 341 ASN A CG  1 
ATOM 2567 O OD1 . ASN A 1 338 ? 12.264  -34.434 3.571   1.00 24.06 ? 341 ASN A OD1 1 
ATOM 2568 N ND2 . ASN A 1 338 ? 13.708  -34.731 1.876   1.00 24.18 ? 341 ASN A ND2 1 
ATOM 2569 N N   . ARG A 1 339 ? 12.624  -31.380 0.248   1.00 24.06 ? 342 ARG A N   1 
ATOM 2570 C CA  . ARG A 1 339 ? 13.721  -30.455 -0.054  1.00 24.00 ? 342 ARG A CA  1 
ATOM 2571 C C   . ARG A 1 339 ? 13.282  -28.988 -0.128  1.00 24.02 ? 342 ARG A C   1 
ATOM 2572 O O   . ARG A 1 339 ? 14.002  -28.091 0.317   1.00 23.98 ? 342 ARG A O   1 
ATOM 2573 C CB  . ARG A 1 339 ? 14.393  -30.859 -1.373  1.00 23.96 ? 342 ARG A CB  1 
ATOM 2574 C CG  . ARG A 1 339 ? 15.667  -31.652 -1.205  1.00 23.64 ? 342 ARG A CG  1 
ATOM 2575 C CD  . ARG A 1 339 ? 15.680  -32.878 -2.105  1.00 23.19 ? 342 ARG A CD  1 
ATOM 2576 N NE  . ARG A 1 339 ? 16.893  -33.678 -1.925  1.00 23.29 ? 342 ARG A NE  1 
ATOM 2577 C CZ  . ARG A 1 339 ? 17.184  -34.406 -0.843  1.00 23.17 ? 342 ARG A CZ  1 
ATOM 2578 N NH1 . ARG A 1 339 ? 18.318  -35.093 -0.797  1.00 22.86 ? 342 ARG A NH1 1 
ATOM 2579 N NH2 . ARG A 1 339 ? 16.359  -34.450 0.199   1.00 22.88 ? 342 ARG A NH2 1 
ATOM 2580 N N   . VAL A 1 340 ? 12.097  -28.761 -0.686  1.00 24.02 ? 343 VAL A N   1 
ATOM 2581 C CA  . VAL A 1 340 ? 11.646  -27.425 -1.059  1.00 24.10 ? 343 VAL A CA  1 
ATOM 2582 C C   . VAL A 1 340 ? 10.610  -26.864 -0.083  1.00 24.27 ? 343 VAL A C   1 
ATOM 2583 O O   . VAL A 1 340 ? 9.675   -27.564 0.316   1.00 24.28 ? 343 VAL A O   1 
ATOM 2584 C CB  . VAL A 1 340 ? 11.073  -27.426 -2.503  1.00 24.05 ? 343 VAL A CB  1 
ATOM 2585 C CG1 . VAL A 1 340 ? 10.573  -26.045 -2.903  1.00 24.01 ? 343 VAL A CG1 1 
ATOM 2586 C CG2 . VAL A 1 340 ? 12.125  -27.908 -3.494  1.00 24.05 ? 343 VAL A CG2 1 
ATOM 2587 N N   . GLU A 1 341 ? 10.790  -25.595 0.285   1.00 24.41 ? 344 GLU A N   1 
ATOM 2588 C CA  . GLU A 1 341 ? 9.854   -24.863 1.137   1.00 24.46 ? 344 GLU A CA  1 
ATOM 2589 C C   . GLU A 1 341 ? 9.009   -23.891 0.302   1.00 24.66 ? 344 GLU A C   1 
ATOM 2590 O O   . GLU A 1 341 ? 9.534   -23.186 -0.570  1.00 24.72 ? 344 GLU A O   1 
ATOM 2591 C CB  . GLU A 1 341 ? 10.627  -24.096 2.210   1.00 24.38 ? 344 GLU A CB  1 
ATOM 2592 C CG  . GLU A 1 341 ? 9.772   -23.582 3.354   1.00 24.29 ? 344 GLU A CG  1 
ATOM 2593 C CD  . GLU A 1 341 ? 10.266  -22.256 3.900   1.00 23.89 ? 344 GLU A CD  1 
ATOM 2594 O OE1 . GLU A 1 341 ? 10.216  -21.252 3.157   1.00 23.59 ? 344 GLU A OE1 1 
ATOM 2595 O OE2 . GLU A 1 341 ? 10.697  -22.215 5.073   1.00 23.42 ? 344 GLU A OE2 1 
ATOM 2596 N N   . VAL A 1 342 ? 7.704   -23.853 0.572   1.00 24.85 ? 345 VAL A N   1 
ATOM 2597 C CA  . VAL A 1 342 ? 6.781   -22.966 -0.152  1.00 25.00 ? 345 VAL A CA  1 
ATOM 2598 C C   . VAL A 1 342 ? 5.952   -22.069 0.780   1.00 25.10 ? 345 VAL A C   1 
ATOM 2599 O O   . VAL A 1 342 ? 5.290   -22.547 1.706   1.00 25.31 ? 345 VAL A O   1 
ATOM 2600 C CB  . VAL A 1 342 ? 5.861   -23.764 -1.116  1.00 25.00 ? 345 VAL A CB  1 
ATOM 2601 C CG1 . VAL A 1 342 ? 4.582   -22.995 -1.440  1.00 25.02 ? 345 VAL A CG1 1 
ATOM 2602 C CG2 . VAL A 1 342 ? 6.615   -24.123 -2.393  1.00 25.13 ? 345 VAL A CG2 1 
ATOM 2603 N N   . LEU A 1 343 ? 6.016   -20.765 0.525   1.00 25.11 ? 346 LEU A N   1 
ATOM 2604 C CA  . LEU A 1 343 ? 5.217   -19.775 1.236   1.00 25.08 ? 346 LEU A CA  1 
ATOM 2605 C C   . LEU A 1 343 ? 4.706   -18.779 0.213   1.00 25.01 ? 346 LEU A C   1 
ATOM 2606 O O   . LEU A 1 343 ? 5.479   -18.296 -0.609  1.00 24.94 ? 346 LEU A O   1 
ATOM 2607 C CB  . LEU A 1 343 ? 6.063   -19.059 2.298   1.00 25.15 ? 346 LEU A CB  1 
ATOM 2608 C CG  . LEU A 1 343 ? 5.471   -17.895 3.110   1.00 25.19 ? 346 LEU A CG  1 
ATOM 2609 C CD1 . LEU A 1 343 ? 4.426   -18.371 4.121   1.00 25.38 ? 346 LEU A CD1 1 
ATOM 2610 C CD2 . LEU A 1 343 ? 6.579   -17.127 3.822   1.00 25.19 ? 346 LEU A CD2 1 
ATOM 2611 N N   . ALA A 1 344 ? 3.408   -18.483 0.262   1.00 25.03 ? 347 ALA A N   1 
ATOM 2612 C CA  . ALA A 1 344 ? 2.770   -17.549 -0.671  1.00 25.05 ? 347 ALA A CA  1 
ATOM 2613 C C   . ALA A 1 344 ? 3.592   -17.377 -1.953  1.00 25.06 ? 347 ALA A C   1 
ATOM 2614 O O   . ALA A 1 344 ? 3.501   -18.199 -2.863  1.00 25.05 ? 347 ALA A O   1 
ATOM 2615 C CB  . ALA A 1 344 ? 2.509   -16.200 0.009   1.00 25.07 ? 347 ALA A CB  1 
ATOM 2616 N N   . GLY A 1 345 ? 4.414   -16.330 -2.004  1.00 25.10 ? 348 GLY A N   1 
ATOM 2617 C CA  . GLY A 1 345 ? 5.290   -16.088 -3.146  1.00 25.19 ? 348 GLY A CA  1 
ATOM 2618 C C   . GLY A 1 345 ? 6.763   -16.250 -2.826  1.00 25.28 ? 348 GLY A C   1 
ATOM 2619 O O   . GLY A 1 345 ? 7.572   -15.383 -3.165  1.00 25.39 ? 348 GLY A O   1 
ATOM 2620 N N   . ASP A 1 346 ? 7.109   -17.365 -2.180  1.00 25.21 ? 349 ASP A N   1 
ATOM 2621 C CA  . ASP A 1 346 ? 8.487   -17.648 -1.770  1.00 25.10 ? 349 ASP A CA  1 
ATOM 2622 C C   . ASP A 1 346 ? 8.906   -19.098 -2.003  1.00 25.12 ? 349 ASP A C   1 
ATOM 2623 O O   . ASP A 1 346 ? 8.241   -20.039 -1.555  1.00 25.11 ? 349 ASP A O   1 
ATOM 2624 C CB  . ASP A 1 346 ? 8.707   -17.271 -0.304  1.00 25.04 ? 349 ASP A CB  1 
ATOM 2625 C CG  . ASP A 1 346 ? 9.061   -15.813 -0.124  1.00 25.04 ? 349 ASP A CG  1 
ATOM 2626 O OD1 . ASP A 1 346 ? 9.617   -15.206 -1.065  1.00 24.78 ? 349 ASP A OD1 1 
ATOM 2627 O OD2 . ASP A 1 346 ? 8.793   -15.272 0.970   1.00 25.36 ? 349 ASP A OD2 1 
ATOM 2628 N N   . LEU A 1 347 ? 10.022  -19.260 -2.708  1.00 25.10 ? 350 LEU A N   1 
ATOM 2629 C CA  . LEU A 1 347 ? 10.591  -20.569 -2.980  1.00 24.99 ? 350 LEU A CA  1 
ATOM 2630 C C   . LEU A 1 347 ? 11.955  -20.664 -2.319  1.00 25.07 ? 350 LEU A C   1 
ATOM 2631 O O   . LEU A 1 347 ? 12.931  -20.068 -2.790  1.00 25.17 ? 350 LEU A O   1 
ATOM 2632 C CB  . LEU A 1 347 ? 10.708  -20.802 -4.486  1.00 24.93 ? 350 LEU A CB  1 
ATOM 2633 C CG  . LEU A 1 347 ? 10.715  -22.253 -4.967  1.00 24.83 ? 350 LEU A CG  1 
ATOM 2634 C CD1 . LEU A 1 347 ? 9.364   -22.914 -4.718  1.00 24.74 ? 350 LEU A CD1 1 
ATOM 2635 C CD2 . LEU A 1 347 ? 11.070  -22.309 -6.442  1.00 24.94 ? 350 LEU A CD2 1 
ATOM 2636 N N   . ARG A 1 348 ? 12.003  -21.409 -1.218  1.00 25.01 ? 351 ARG A N   1 
ATOM 2637 C CA  . ARG A 1 348 ? 13.213  -21.581 -0.426  1.00 24.89 ? 351 ARG A CA  1 
ATOM 2638 C C   . ARG A 1 348 ? 13.740  -23.001 -0.583  1.00 24.71 ? 351 ARG A C   1 
ATOM 2639 O O   . ARG A 1 348 ? 13.095  -23.966 -0.164  1.00 24.60 ? 351 ARG A O   1 
ATOM 2640 C CB  . ARG A 1 348 ? 12.912  -21.278 1.044   1.00 24.99 ? 351 ARG A CB  1 
ATOM 2641 C CG  . ARG A 1 348 ? 14.063  -21.508 2.021   1.00 25.34 ? 351 ARG A CG  1 
ATOM 2642 C CD  . ARG A 1 348 ? 13.520  -21.484 3.441   1.00 25.70 ? 351 ARG A CD  1 
ATOM 2643 N NE  . ARG A 1 348 ? 14.527  -21.163 4.466   1.00 25.79 ? 351 ARG A NE  1 
ATOM 2644 C CZ  . ARG A 1 348 ? 14.248  -20.353 5.512   1.00 25.94 ? 351 ARG A CZ  1 
ATOM 2645 N NH1 . ARG A 1 348 ? 15.223  -20.121 6.402   1.00 26.02 ? 351 ARG A NH1 1 
ATOM 2646 N NH2 . ARG A 1 348 ? 12.994  -19.762 5.666   1.00 25.83 ? 351 ARG A NH2 1 
ATOM 2647 N N   . PHE A 1 349 ? 14.913  -23.119 -1.196  1.00 24.61 ? 352 PHE A N   1 
ATOM 2648 C CA  . PHE A 1 349 ? 15.565  -24.412 -1.360  1.00 24.51 ? 352 PHE A CA  1 
ATOM 2649 C C   . PHE A 1 349 ? 16.466  -24.716 -0.180  1.00 24.43 ? 352 PHE A C   1 
ATOM 2650 O O   . PHE A 1 349 ? 17.532  -24.114 -0.027  1.00 24.30 ? 352 PHE A O   1 
ATOM 2651 C CB  . PHE A 1 349 ? 16.380  -24.453 -2.649  1.00 24.53 ? 352 PHE A CB  1 
ATOM 2652 C CG  . PHE A 1 349 ? 15.549  -24.402 -3.891  1.00 24.49 ? 352 PHE A CG  1 
ATOM 2653 C CD1 . PHE A 1 349 ? 15.402  -23.215 -4.591  1.00 24.36 ? 352 PHE A CD1 1 
ATOM 2654 C CD2 . PHE A 1 349 ? 14.916  -25.546 -4.365  1.00 24.74 ? 352 PHE A CD2 1 
ATOM 2655 C CE1 . PHE A 1 349 ? 14.636  -23.168 -5.747  1.00 24.65 ? 352 PHE A CE1 1 
ATOM 2656 C CE2 . PHE A 1 349 ? 14.145  -25.508 -5.520  1.00 24.51 ? 352 PHE A CE2 1 
ATOM 2657 C CZ  . PHE A 1 349 ? 14.008  -24.320 -6.212  1.00 24.55 ? 352 PHE A CZ  1 
ATOM 2658 N N   . SER A 1 350 ? 16.023  -25.652 0.652   1.00 24.42 ? 353 SER A N   1 
ATOM 2659 C CA  . SER A 1 350 ? 16.814  -26.118 1.781   1.00 24.34 ? 353 SER A CA  1 
ATOM 2660 C C   . SER A 1 350 ? 17.866  -27.115 1.287   1.00 24.28 ? 353 SER A C   1 
ATOM 2661 O O   . SER A 1 350 ? 17.661  -28.334 1.329   1.00 24.26 ? 353 SER A O   1 
ATOM 2662 C CB  . SER A 1 350 ? 15.913  -26.730 2.857   1.00 24.29 ? 353 SER A CB  1 
ATOM 2663 O OG  . SER A 1 350 ? 16.607  -26.861 4.086   1.00 24.49 ? 353 SER A OG  1 
ATOM 2664 N N   . LYS A 1 351 ? 18.978  -26.564 0.795   1.00 24.18 ? 354 LYS A N   1 
ATOM 2665 C CA  . LYS A 1 351 ? 20.145  -27.320 0.305   1.00 24.02 ? 354 LYS A CA  1 
ATOM 2666 C C   . LYS A 1 351 ? 19.893  -28.089 -1.005  1.00 23.90 ? 354 LYS A C   1 
ATOM 2667 O O   . LYS A 1 351 ? 19.137  -29.074 -1.044  1.00 23.84 ? 354 LYS A O   1 
ATOM 2668 C CB  . LYS A 1 351 ? 20.759  -28.182 1.421   1.00 24.00 ? 354 LYS A CB  1 
ATOM 2669 C CG  . LYS A 1 351 ? 21.355  -27.327 2.552   1.00 24.15 ? 354 LYS A CG  1 
ATOM 2670 C CD  . LYS A 1 351 ? 21.331  -28.016 3.915   1.00 24.18 ? 354 LYS A CD  1 
ATOM 2671 C CE  . LYS A 1 351 ? 21.775  -27.060 5.022   1.00 23.84 ? 354 LYS A CE  1 
ATOM 2672 N NZ  . LYS A 1 351 ? 21.880  -27.735 6.348   1.00 23.69 ? 354 LYS A NZ  1 
ATOM 2673 N N   . LEU A 1 352 ? 20.554  -27.615 -2.068  1.00 23.73 ? 355 LEU A N   1 
ATOM 2674 C CA  . LEU A 1 352 ? 20.236  -27.989 -3.451  1.00 23.61 ? 355 LEU A CA  1 
ATOM 2675 C C   . LEU A 1 352 ? 20.786  -29.337 -3.922  1.00 23.63 ? 355 LEU A C   1 
ATOM 2676 O O   . LEU A 1 352 ? 21.940  -29.685 -3.648  1.00 23.69 ? 355 LEU A O   1 
ATOM 2677 C CB  . LEU A 1 352 ? 20.712  -26.888 -4.413  1.00 23.54 ? 355 LEU A CB  1 
ATOM 2678 C CG  . LEU A 1 352 ? 19.952  -25.552 -4.480  1.00 23.24 ? 355 LEU A CG  1 
ATOM 2679 C CD1 . LEU A 1 352 ? 20.805  -24.464 -5.142  1.00 22.74 ? 355 LEU A CD1 1 
ATOM 2680 C CD2 . LEU A 1 352 ? 18.631  -25.714 -5.218  1.00 22.58 ? 355 LEU A CD2 1 
ATOM 2681 N N   . SER A 1 353 ? 19.945  -30.077 -4.647  1.00 23.59 ? 356 SER A N   1 
ATOM 2682 C CA  . SER A 1 353 ? 20.350  -31.298 -5.346  1.00 23.55 ? 356 SER A CA  1 
ATOM 2683 C C   . SER A 1 353 ? 20.423  -31.017 -6.848  1.00 23.51 ? 356 SER A C   1 
ATOM 2684 O O   . SER A 1 353 ? 20.097  -29.916 -7.290  1.00 23.54 ? 356 SER A O   1 
ATOM 2685 C CB  . SER A 1 353 ? 19.343  -32.424 -5.086  1.00 23.56 ? 356 SER A CB  1 
ATOM 2686 O OG  . SER A 1 353 ? 19.173  -32.669 -3.703  1.00 23.63 ? 356 SER A OG  1 
ATOM 2687 N N   . LEU A 1 354 ? 20.850  -32.007 -7.630  1.00 23.44 ? 357 LEU A N   1 
ATOM 2688 C CA  . LEU A 1 354 ? 20.794  -31.901 -9.090  1.00 23.33 ? 357 LEU A CA  1 
ATOM 2689 C C   . LEU A 1 354 ? 19.371  -32.066 -9.613  1.00 23.23 ? 357 LEU A C   1 
ATOM 2690 O O   . LEU A 1 354 ? 19.038  -31.570 -10.689 1.00 23.15 ? 357 LEU A O   1 
ATOM 2691 C CB  . LEU A 1 354 ? 21.707  -32.928 -9.754  1.00 23.37 ? 357 LEU A CB  1 
ATOM 2692 C CG  . LEU A 1 354 ? 23.115  -32.501 -10.170 1.00 23.42 ? 357 LEU A CG  1 
ATOM 2693 C CD1 . LEU A 1 354 ? 23.867  -33.724 -10.656 1.00 23.61 ? 357 LEU A CD1 1 
ATOM 2694 C CD2 . LEU A 1 354 ? 23.090  -31.423 -11.253 1.00 23.15 ? 357 LEU A CD2 1 
ATOM 2695 N N   . GLU A 1 355 ? 18.541  -32.769 -8.845  1.00 23.22 ? 358 GLU A N   1 
ATOM 2696 C CA  . GLU A 1 355 ? 17.125  -32.948 -9.163  1.00 23.26 ? 358 GLU A CA  1 
ATOM 2697 C C   . GLU A 1 355 ? 16.345  -31.649 -8.951  1.00 23.27 ? 358 GLU A C   1 
ATOM 2698 O O   . GLU A 1 355 ? 15.122  -31.664 -8.800  1.00 23.28 ? 358 GLU A O   1 
ATOM 2699 C CB  . GLU A 1 355 ? 16.511  -34.069 -8.313  1.00 23.26 ? 358 GLU A CB  1 
ATOM 2700 C CG  . GLU A 1 355 ? 17.043  -35.460 -8.607  1.00 23.34 ? 358 GLU A CG  1 
ATOM 2701 C CD  . GLU A 1 355 ? 18.431  -35.697 -8.028  1.00 23.67 ? 358 GLU A CD  1 
ATOM 2702 O OE1 . GLU A 1 355 ? 18.772  -35.075 -6.982  1.00 24.00 ? 358 GLU A OE1 1 
ATOM 2703 O OE2 . GLU A 1 355 ? 19.181  -36.510 -8.624  1.00 23.77 ? 358 GLU A OE2 1 
ATOM 2704 N N   . ASP A 1 356 ? 17.066  -30.531 -8.925  1.00 23.23 ? 359 ASP A N   1 
ATOM 2705 C CA  . ASP A 1 356 ? 16.464  -29.209 -8.832  1.00 23.12 ? 359 ASP A CA  1 
ATOM 2706 C C   . ASP A 1 356 ? 16.715  -28.437 -10.126 1.00 23.05 ? 359 ASP A C   1 
ATOM 2707 O O   . ASP A 1 356 ? 16.032  -27.455 -10.408 1.00 23.13 ? 359 ASP A O   1 
ATOM 2708 C CB  . ASP A 1 356 ? 17.023  -28.440 -7.624  1.00 23.12 ? 359 ASP A CB  1 
ATOM 2709 C CG  . ASP A 1 356 ? 16.693  -29.106 -6.283  1.00 23.08 ? 359 ASP A CG  1 
ATOM 2710 O OD1 . ASP A 1 356 ? 15.623  -29.741 -6.157  1.00 23.29 ? 359 ASP A OD1 1 
ATOM 2711 O OD2 . ASP A 1 356 ? 17.506  -28.979 -5.343  1.00 22.62 ? 359 ASP A OD2 1 
ATOM 2712 N N   . SER A 1 357 ? 17.689  -28.896 -10.910 1.00 22.97 ? 360 SER A N   1 
ATOM 2713 C CA  . SER A 1 357 ? 18.054  -28.262 -12.177 1.00 22.93 ? 360 SER A CA  1 
ATOM 2714 C C   . SER A 1 357 ? 16.928  -28.373 -13.203 1.00 22.92 ? 360 SER A C   1 
ATOM 2715 O O   . SER A 1 357 ? 16.903  -29.295 -14.025 1.00 23.03 ? 360 SER A O   1 
ATOM 2716 C CB  . SER A 1 357 ? 19.335  -28.883 -12.746 1.00 22.99 ? 360 SER A CB  1 
ATOM 2717 O OG  . SER A 1 357 ? 20.373  -28.919 -11.786 1.00 23.11 ? 360 SER A OG  1 
ATOM 2718 N N   . GLY A 1 358 ? 15.995  -27.430 -13.150 1.00 22.78 ? 361 GLY A N   1 
ATOM 2719 C CA  . GLY A 1 358 ? 14.858  -27.435 -14.058 1.00 22.60 ? 361 GLY A CA  1 
ATOM 2720 C C   . GLY A 1 358 ? 14.233  -26.066 -14.203 1.00 22.52 ? 361 GLY A C   1 
ATOM 2721 O O   . GLY A 1 358 ? 14.780  -25.071 -13.712 1.00 22.58 ? 361 GLY A O   1 
ATOM 2722 N N   . MET A 1 359 ? 13.087  -26.025 -14.888 1.00 22.29 ? 362 MET A N   1 
ATOM 2723 C CA  . MET A 1 359 ? 12.319  -24.796 -15.082 1.00 21.86 ? 362 MET A CA  1 
ATOM 2724 C C   . MET A 1 359 ? 11.307  -24.615 -13.959 1.00 21.67 ? 362 MET A C   1 
ATOM 2725 O O   . MET A 1 359 ? 10.636  -25.570 -13.543 1.00 21.66 ? 362 MET A O   1 
ATOM 2726 C CB  . MET A 1 359 ? 11.582  -24.812 -16.422 1.00 21.82 ? 362 MET A CB  1 
ATOM 2727 C CG  . MET A 1 359 ? 12.448  -25.037 -17.646 1.00 21.72 ? 362 MET A CG  1 
ATOM 2728 S SD  . MET A 1 359 ? 13.745  -23.809 -17.847 1.00 21.68 ? 362 MET A SD  1 
ATOM 2729 C CE  . MET A 1 359 ? 12.814  -22.336 -18.258 1.00 22.51 ? 362 MET A CE  1 
ATOM 2730 N N   . TYR A 1 360 ? 11.202  -23.383 -13.478 1.00 21.31 ? 363 TYR A N   1 
ATOM 2731 C CA  . TYR A 1 360 ? 10.248  -23.040 -12.439 1.00 21.03 ? 363 TYR A CA  1 
ATOM 2732 C C   . TYR A 1 360 ? 9.458   -21.804 -12.850 1.00 21.01 ? 363 TYR A C   1 
ATOM 2733 O O   . TYR A 1 360 ? 9.956   -20.958 -13.593 1.00 20.86 ? 363 TYR A O   1 
ATOM 2734 C CB  . TYR A 1 360 ? 10.971  -22.773 -11.121 1.00 20.86 ? 363 TYR A CB  1 
ATOM 2735 C CG  . TYR A 1 360 ? 11.661  -23.971 -10.505 1.00 20.56 ? 363 TYR A CG  1 
ATOM 2736 C CD1 . TYR A 1 360 ? 12.954  -24.329 -10.886 1.00 20.39 ? 363 TYR A CD1 1 
ATOM 2737 C CD2 . TYR A 1 360 ? 11.033  -24.728 -9.513  1.00 20.26 ? 363 TYR A CD2 1 
ATOM 2738 C CE1 . TYR A 1 360 ? 13.597  -25.422 -10.311 1.00 20.27 ? 363 TYR A CE1 1 
ATOM 2739 C CE2 . TYR A 1 360 ? 11.670  -25.821 -8.928  1.00 19.81 ? 363 TYR A CE2 1 
ATOM 2740 C CZ  . TYR A 1 360 ? 12.949  -26.163 -9.333  1.00 20.17 ? 363 TYR A CZ  1 
ATOM 2741 O OH  . TYR A 1 360 ? 13.585  -27.241 -8.760  1.00 20.45 ? 363 TYR A OH  1 
ATOM 2742 N N   . GLN A 1 361 ? 8.226   -21.707 -12.363 1.00 21.08 ? 364 GLN A N   1 
ATOM 2743 C CA  . GLN A 1 361 ? 7.366   -20.565 -12.650 1.00 21.27 ? 364 GLN A CA  1 
ATOM 2744 C C   . GLN A 1 361 ? 6.541   -20.179 -11.439 1.00 21.55 ? 364 GLN A C   1 
ATOM 2745 O O   . GLN A 1 361 ? 6.152   -21.041 -10.642 1.00 21.63 ? 364 GLN A O   1 
ATOM 2746 C CB  . GLN A 1 361 ? 6.421   -20.876 -13.808 1.00 21.23 ? 364 GLN A CB  1 
ATOM 2747 C CG  . GLN A 1 361 ? 7.049   -20.760 -15.170 1.00 20.86 ? 364 GLN A CG  1 
ATOM 2748 C CD  . GLN A 1 361 ? 6.177   -21.313 -16.263 1.00 20.70 ? 364 GLN A CD  1 
ATOM 2749 O OE1 . GLN A 1 361 ? 5.573   -22.374 -16.115 1.00 20.93 ? 364 GLN A OE1 1 
ATOM 2750 N NE2 . GLN A 1 361 ? 6.115   -20.604 -17.381 1.00 20.94 ? 364 GLN A NE2 1 
ATOM 2751 N N   . CYS A 1 362 ? 6.280   -18.881 -11.306 1.00 21.77 ? 365 CYS A N   1 
ATOM 2752 C CA  . CYS A 1 362 ? 5.345   -18.387 -10.301 1.00 22.11 ? 365 CYS A CA  1 
ATOM 2753 C C   . CYS A 1 362 ? 4.074   -17.900 -11.001 1.00 22.09 ? 365 CYS A C   1 
ATOM 2754 O O   . CYS A 1 362 ? 4.131   -17.357 -12.109 1.00 22.10 ? 365 CYS A O   1 
ATOM 2755 C CB  . CYS A 1 362 ? 5.983   -17.307 -9.403  1.00 22.17 ? 365 CYS A CB  1 
ATOM 2756 S SG  . CYS A 1 362 ? 6.643   -15.848 -10.266 1.00 22.83 ? 365 CYS A SG  1 
ATOM 2757 N N   . VAL A 1 363 ? 2.931   -18.125 -10.358 1.00 22.08 ? 366 VAL A N   1 
ATOM 2758 C CA  . VAL A 1 363 ? 1.628   -17.896 -10.977 1.00 22.00 ? 366 VAL A CA  1 
ATOM 2759 C C   . VAL A 1 363 ? 0.712   -17.074 -10.069 1.00 22.13 ? 366 VAL A C   1 
ATOM 2760 O O   . VAL A 1 363 ? 0.132   -17.599 -9.116  1.00 22.25 ? 366 VAL A O   1 
ATOM 2761 C CB  . VAL A 1 363 ? 0.951   -19.239 -11.318 1.00 21.92 ? 366 VAL A CB  1 
ATOM 2762 C CG1 . VAL A 1 363 ? -0.399  -19.022 -11.967 1.00 21.80 ? 366 VAL A CG1 1 
ATOM 2763 C CG2 . VAL A 1 363 ? 1.846   -20.066 -12.218 1.00 22.07 ? 366 VAL A CG2 1 
ATOM 2764 N N   . ALA A 1 364 ? 0.586   -15.784 -10.371 1.00 22.16 ? 367 ALA A N   1 
ATOM 2765 C CA  . ALA A 1 364 ? -0.280  -14.890 -9.602  1.00 22.12 ? 367 ALA A CA  1 
ATOM 2766 C C   . ALA A 1 364 ? -1.661  -14.785 -10.243 1.00 22.13 ? 367 ALA A C   1 
ATOM 2767 O O   . ALA A 1 364 ? -1.769  -14.659 -11.465 1.00 22.04 ? 367 ALA A O   1 
ATOM 2768 C CB  . ALA A 1 364 ? 0.354   -13.529 -9.478  1.00 22.17 ? 367 ALA A CB  1 
ATOM 2769 N N   . GLU A 1 365 ? -2.709  -14.842 -9.419  1.00 22.19 ? 368 GLU A N   1 
ATOM 2770 C CA  . GLU A 1 365 ? -4.086  -14.870 -9.929  1.00 22.39 ? 368 GLU A CA  1 
ATOM 2771 C C   . GLU A 1 365 ? -5.172  -14.432 -8.943  1.00 22.43 ? 368 GLU A C   1 
ATOM 2772 O O   . GLU A 1 365 ? -5.097  -14.704 -7.745  1.00 22.29 ? 368 GLU A O   1 
ATOM 2773 C CB  . GLU A 1 365 ? -4.436  -16.254 -10.499 1.00 22.33 ? 368 GLU A CB  1 
ATOM 2774 C CG  . GLU A 1 365 ? -4.311  -17.403 -9.508  1.00 22.48 ? 368 GLU A CG  1 
ATOM 2775 C CD  . GLU A 1 365 ? -5.070  -18.646 -9.936  1.00 22.55 ? 368 GLU A CD  1 
ATOM 2776 O OE1 . GLU A 1 365 ? -6.015  -18.530 -10.752 1.00 22.47 ? 368 GLU A OE1 1 
ATOM 2777 O OE2 . GLU A 1 365 ? -4.723  -19.742 -9.441  1.00 22.88 ? 368 GLU A OE2 1 
ATOM 2778 N N   . ASN A 1 366 ? -6.186  -13.761 -9.487  1.00 22.66 ? 369 ASN A N   1 
ATOM 2779 C CA  . ASN A 1 366 ? -7.384  -13.363 -8.748  1.00 22.79 ? 369 ASN A CA  1 
ATOM 2780 C C   . ASN A 1 366 ? -8.630  -13.700 -9.570  1.00 22.81 ? 369 ASN A C   1 
ATOM 2781 O O   . ASN A 1 366 ? -8.606  -14.639 -10.372 1.00 22.74 ? 369 ASN A O   1 
ATOM 2782 C CB  . ASN A 1 366 ? -7.335  -11.866 -8.391  1.00 22.82 ? 369 ASN A CB  1 
ATOM 2783 C CG  . ASN A 1 366 ? -7.083  -10.968 -9.604  1.00 22.99 ? 369 ASN A CG  1 
ATOM 2784 O OD1 . ASN A 1 366 ? -6.958  -11.439 -10.741 1.00 22.89 ? 369 ASN A OD1 1 
ATOM 2785 N ND2 . ASN A 1 366 ? -7.008  -9.662  -9.360  1.00 23.08 ? 369 ASN A ND2 1 
ATOM 2786 N N   . LYS A 1 367 ? -9.707  -12.937 -9.379  1.00 22.87 ? 370 LYS A N   1 
ATOM 2787 C CA  . LYS A 1 367 ? -10.933 -13.123 -10.163 1.00 22.86 ? 370 LYS A CA  1 
ATOM 2788 C C   . LYS A 1 367 ? -10.782 -12.605 -11.588 1.00 22.92 ? 370 LYS A C   1 
ATOM 2789 O O   . LYS A 1 367 ? -11.513 -13.030 -12.480 1.00 22.97 ? 370 LYS A O   1 
ATOM 2790 C CB  . LYS A 1 367 ? -12.143 -12.459 -9.487  1.00 22.78 ? 370 LYS A CB  1 
ATOM 2791 C CG  . LYS A 1 367 ? -12.159 -10.935 -9.550  1.00 22.74 ? 370 LYS A CG  1 
ATOM 2792 C CD  . LYS A 1 367 ? -13.337 -10.336 -8.790  1.00 22.83 ? 370 LYS A CD  1 
ATOM 2793 C CE  . LYS A 1 367 ? -14.563 -10.174 -9.678  1.00 23.00 ? 370 LYS A CE  1 
ATOM 2794 N NZ  . LYS A 1 367 ? -15.716 -9.559  -8.954  1.00 22.85 ? 370 LYS A NZ  1 
ATOM 2795 N N   . HIS A 1 368 ? -9.827  -11.700 -11.797 1.00 22.99 ? 371 HIS A N   1 
ATOM 2796 C CA  . HIS A 1 368 ? -9.707  -10.991 -13.071 1.00 22.99 ? 371 HIS A CA  1 
ATOM 2797 C C   . HIS A 1 368 ? -8.670  -11.533 -14.046 1.00 22.95 ? 371 HIS A C   1 
ATOM 2798 O O   . HIS A 1 368 ? -8.841  -11.395 -15.253 1.00 23.03 ? 371 HIS A O   1 
ATOM 2799 C CB  . HIS A 1 368 ? -9.506  -9.494  -12.841 1.00 23.00 ? 371 HIS A CB  1 
ATOM 2800 C CG  . HIS A 1 368 ? -10.764 -8.784  -12.462 1.00 23.03 ? 371 HIS A CG  1 
ATOM 2801 N ND1 . HIS A 1 368 ? -11.855 -8.711  -13.300 1.00 23.03 ? 371 HIS A ND1 1 
ATOM 2802 C CD2 . HIS A 1 368 ? -11.111 -8.126  -11.332 1.00 23.37 ? 371 HIS A CD2 1 
ATOM 2803 C CE1 . HIS A 1 368 ? -12.819 -8.033  -12.705 1.00 23.28 ? 371 HIS A CE1 1 
ATOM 2804 N NE2 . HIS A 1 368 ? -12.394 -7.667  -11.509 1.00 23.49 ? 371 HIS A NE2 1 
ATOM 2805 N N   . GLY A 1 369 ? -7.602  -12.136 -13.538 1.00 23.02 ? 372 GLY A N   1 
ATOM 2806 C CA  . GLY A 1 369 ? -6.574  -12.680 -14.422 1.00 23.03 ? 372 GLY A CA  1 
ATOM 2807 C C   . GLY A 1 369 ? -5.499  -13.537 -13.780 1.00 23.01 ? 372 GLY A C   1 
ATOM 2808 O O   . GLY A 1 369 ? -5.389  -13.613 -12.549 1.00 22.94 ? 372 GLY A O   1 
ATOM 2809 N N   . THR A 1 370 ? -4.706  -14.173 -14.642 1.00 22.85 ? 373 THR A N   1 
ATOM 2810 C CA  . THR A 1 370 ? -3.595  -15.021 -14.238 1.00 22.74 ? 373 THR A CA  1 
ATOM 2811 C C   . THR A 1 370 ? -2.363  -14.698 -15.085 1.00 22.70 ? 373 THR A C   1 
ATOM 2812 O O   . THR A 1 370 ? -2.390  -14.839 -16.311 1.00 22.77 ? 373 THR A O   1 
ATOM 2813 C CB  . THR A 1 370 ? -3.953  -16.512 -14.402 1.00 22.74 ? 373 THR A CB  1 
ATOM 2814 O OG1 . THR A 1 370 ? -5.208  -16.782 -13.765 1.00 22.75 ? 373 THR A OG1 1 
ATOM 2815 C CG2 . THR A 1 370 ? -2.885  -17.390 -13.789 1.00 22.63 ? 373 THR A CG2 1 
ATOM 2816 N N   . ILE A 1 371 ? -1.290  -14.269 -14.428 1.00 22.55 ? 374 ILE A N   1 
ATOM 2817 C CA  . ILE A 1 371 ? -0.035  -13.954 -15.114 1.00 22.54 ? 374 ILE A CA  1 
ATOM 2818 C C   . ILE A 1 371 ? 1.071   -14.933 -14.751 1.00 22.53 ? 374 ILE A C   1 
ATOM 2819 O O   . ILE A 1 371 ? 1.021   -15.569 -13.700 1.00 22.68 ? 374 ILE A O   1 
ATOM 2820 C CB  . ILE A 1 371 ? 0.436   -12.523 -14.821 1.00 22.56 ? 374 ILE A CB  1 
ATOM 2821 C CG1 . ILE A 1 371 ? 0.578   -12.299 -13.307 1.00 22.68 ? 374 ILE A CG1 1 
ATOM 2822 C CG2 . ILE A 1 371 ? -0.516  -11.526 -15.469 1.00 22.71 ? 374 ILE A CG2 1 
ATOM 2823 C CD1 . ILE A 1 371 ? 1.203   -10.973 -12.916 1.00 22.53 ? 374 ILE A CD1 1 
ATOM 2824 N N   . TYR A 1 372 ? 2.074   -15.036 -15.620 1.00 22.53 ? 375 TYR A N   1 
ATOM 2825 C CA  . TYR A 1 372 ? 3.139   -16.026 -15.462 1.00 22.50 ? 375 TYR A CA  1 
ATOM 2826 C C   . TYR A 1 372 ? 4.544   -15.420 -15.547 1.00 22.46 ? 375 TYR A C   1 
ATOM 2827 O O   . TYR A 1 372 ? 4.787   -14.492 -16.318 1.00 22.58 ? 375 TYR A O   1 
ATOM 2828 C CB  . TYR A 1 372 ? 2.984   -17.122 -16.516 1.00 22.51 ? 375 TYR A CB  1 
ATOM 2829 C CG  . TYR A 1 372 ? 1.708   -17.940 -16.415 1.00 22.55 ? 375 TYR A CG  1 
ATOM 2830 C CD1 . TYR A 1 372 ? 0.502   -17.467 -16.935 1.00 22.77 ? 375 TYR A CD1 1 
ATOM 2831 C CD2 . TYR A 1 372 ? 1.715   -19.201 -15.824 1.00 22.70 ? 375 TYR A CD2 1 
ATOM 2832 C CE1 . TYR A 1 372 ? -0.669  -18.227 -16.851 1.00 23.14 ? 375 TYR A CE1 1 
ATOM 2833 C CE2 . TYR A 1 372 ? 0.553   -19.969 -15.737 1.00 22.62 ? 375 TYR A CE2 1 
ATOM 2834 C CZ  . TYR A 1 372 ? -0.633  -19.480 -16.251 1.00 22.87 ? 375 TYR A CZ  1 
ATOM 2835 O OH  . TYR A 1 372 ? -1.778  -20.245 -16.163 1.00 22.70 ? 375 TYR A OH  1 
ATOM 2836 N N   . ALA A 1 373 ? 5.462   -15.950 -14.745 1.00 22.42 ? 376 ALA A N   1 
ATOM 2837 C CA  . ALA A 1 373 ? 6.869   -15.554 -14.788 1.00 22.45 ? 376 ALA A CA  1 
ATOM 2838 C C   . ALA A 1 373 ? 7.758   -16.765 -14.545 1.00 22.55 ? 376 ALA A C   1 
ATOM 2839 O O   . ALA A 1 373 ? 7.571   -17.493 -13.569 1.00 22.59 ? 376 ALA A O   1 
ATOM 2840 C CB  . ALA A 1 373 ? 7.149   -14.490 -13.767 1.00 22.43 ? 376 ALA A CB  1 
ATOM 2841 N N   . SER A 1 374 ? 8.732   -16.959 -15.431 1.00 22.71 ? 377 SER A N   1 
ATOM 2842 C CA  . SER A 1 374 ? 9.536   -18.181 -15.469 1.00 22.86 ? 377 SER A CA  1 
ATOM 2843 C C   . SER A 1 374 ? 11.041  -17.924 -15.480 1.00 23.01 ? 377 SER A C   1 
ATOM 2844 O O   . SER A 1 374 ? 11.490  -16.856 -15.904 1.00 23.02 ? 377 SER A O   1 
ATOM 2845 C CB  . SER A 1 374 ? 9.158   -19.006 -16.697 1.00 22.76 ? 377 SER A CB  1 
ATOM 2846 O OG  . SER A 1 374 ? 9.278   -18.229 -17.873 1.00 23.14 ? 377 SER A OG  1 
ATOM 2847 N N   . ALA A 1 375 ? 11.802  -18.921 -15.018 1.00 23.22 ? 378 ALA A N   1 
ATOM 2848 C CA  . ALA A 1 375 ? 13.270  -18.881 -14.973 1.00 23.38 ? 378 ALA A CA  1 
ATOM 2849 C C   . ALA A 1 375 ? 13.858  -20.290 -14.918 1.00 23.56 ? 378 ALA A C   1 
ATOM 2850 O O   . ALA A 1 375 ? 13.172  -21.242 -14.531 1.00 23.64 ? 378 ALA A O   1 
ATOM 2851 C CB  . ALA A 1 375 ? 13.747  -18.073 -13.777 1.00 23.33 ? 378 ALA A CB  1 
ATOM 2852 N N   . GLU A 1 376 ? 15.128  -20.418 -15.299 1.00 23.78 ? 379 GLU A N   1 
ATOM 2853 C CA  . GLU A 1 376 ? 15.827  -21.707 -15.253 1.00 23.95 ? 379 GLU A CA  1 
ATOM 2854 C C   . GLU A 1 376 ? 16.782  -21.802 -14.062 1.00 24.05 ? 379 GLU A C   1 
ATOM 2855 O O   . GLU A 1 376 ? 17.543  -20.870 -13.778 1.00 24.17 ? 379 GLU A O   1 
ATOM 2856 C CB  . GLU A 1 376 ? 16.591  -21.969 -16.556 1.00 23.86 ? 379 GLU A CB  1 
ATOM 2857 C CG  . GLU A 1 376 ? 17.242  -23.350 -16.630 1.00 23.87 ? 379 GLU A CG  1 
ATOM 2858 C CD  . GLU A 1 376 ? 18.079  -23.554 -17.882 1.00 24.12 ? 379 GLU A CD  1 
ATOM 2859 O OE1 . GLU A 1 376 ? 17.669  -23.080 -18.963 1.00 24.33 ? 379 GLU A OE1 1 
ATOM 2860 O OE2 . GLU A 1 376 ? 19.147  -24.201 -17.786 1.00 24.63 ? 379 GLU A OE2 1 
ATOM 2861 N N   . LEU A 1 377 ? 16.729  -22.935 -13.369 1.00 24.03 ? 380 LEU A N   1 
ATOM 2862 C CA  . LEU A 1 377 ? 17.692  -23.235 -12.324 1.00 24.02 ? 380 LEU A CA  1 
ATOM 2863 C C   . LEU A 1 377 ? 18.725  -24.231 -12.860 1.00 24.08 ? 380 LEU A C   1 
ATOM 2864 O O   . LEU A 1 377 ? 18.372  -25.226 -13.504 1.00 24.13 ? 380 LEU A O   1 
ATOM 2865 C CB  . LEU A 1 377 ? 16.984  -23.766 -11.071 1.00 24.01 ? 380 LEU A CB  1 
ATOM 2866 C CG  . LEU A 1 377 ? 17.804  -24.167 -9.835  1.00 24.01 ? 380 LEU A CG  1 
ATOM 2867 C CD1 . LEU A 1 377 ? 18.817  -23.098 -9.421  1.00 23.68 ? 380 LEU A CD1 1 
ATOM 2868 C CD2 . LEU A 1 377 ? 16.872  -24.502 -8.676  1.00 23.91 ? 380 LEU A CD2 1 
ATOM 2869 N N   . ALA A 1 378 ? 19.998  -23.942 -12.605 1.00 23.99 ? 381 ALA A N   1 
ATOM 2870 C CA  . ALA A 1 378 ? 21.095  -24.778 -13.079 1.00 23.93 ? 381 ALA A CA  1 
ATOM 2871 C C   . ALA A 1 378 ? 22.080  -25.079 -11.948 1.00 23.93 ? 381 ALA A C   1 
ATOM 2872 O O   . ALA A 1 378 ? 22.973  -24.281 -11.651 1.00 24.09 ? 381 ALA A O   1 
ATOM 2873 C CB  . ALA A 1 378 ? 21.799  -24.117 -14.264 1.00 23.86 ? 381 ALA A CB  1 
ATOM 2874 N N   . VAL A 1 379 ? 21.899  -26.234 -11.315 1.00 23.75 ? 382 VAL A N   1 
ATOM 2875 C CA  . VAL A 1 379 ? 22.739  -26.649 -10.198 1.00 23.53 ? 382 VAL A CA  1 
ATOM 2876 C C   . VAL A 1 379 ? 24.049  -27.214 -10.746 1.00 23.49 ? 382 VAL A C   1 
ATOM 2877 O O   . VAL A 1 379 ? 24.038  -28.103 -11.603 1.00 23.56 ? 382 VAL A O   1 
ATOM 2878 C CB  . VAL A 1 379 ? 22.010  -27.679 -9.302  1.00 23.53 ? 382 VAL A CB  1 
ATOM 2879 C CG1 . VAL A 1 379 ? 22.816  -27.979 -8.048  1.00 23.50 ? 382 VAL A CG1 1 
ATOM 2880 C CG2 . VAL A 1 379 ? 20.618  -27.169 -8.933  1.00 23.43 ? 382 VAL A CG2 1 
ATOM 2881 N N   . GLN A 1 380 ? 25.169  -26.685 -10.255 1.00 23.34 ? 383 GLN A N   1 
ATOM 2882 C CA  . GLN A 1 380 ? 26.494  -27.002 -10.800 1.00 23.18 ? 383 GLN A CA  1 
ATOM 2883 C C   . GLN A 1 380 ? 27.481  -27.455 -9.722  1.00 23.12 ? 383 GLN A C   1 
ATOM 2884 O O   . GLN A 1 380 ? 27.337  -27.095 -8.552  1.00 23.19 ? 383 GLN A O   1 
ATOM 2885 C CB  . GLN A 1 380 ? 27.059  -25.792 -11.556 1.00 23.21 ? 383 GLN A CB  1 
ATOM 2886 C CG  . GLN A 1 380 ? 26.213  -25.336 -12.753 1.00 23.20 ? 383 GLN A CG  1 
ATOM 2887 C CD  . GLN A 1 380 ? 26.701  -24.040 -13.386 1.00 23.10 ? 383 GLN A CD  1 
ATOM 2888 O OE1 . GLN A 1 380 ? 27.360  -23.223 -12.739 1.00 23.03 ? 383 GLN A OE1 1 
ATOM 2889 N NE2 . GLN A 1 380 ? 26.368  -23.844 -14.659 1.00 22.70 ? 383 GLN A NE2 1 
ATOM 2890 N N   . ALA A 1 381 ? 28.479  -28.241 -10.129 1.00 22.95 ? 384 ALA A N   1 
ATOM 2891 C CA  . ALA A 1 381 ? 29.521  -28.725 -9.222  1.00 22.79 ? 384 ALA A CA  1 
ATOM 2892 C C   . ALA A 1 381 ? 30.854  -28.022 -9.473  1.00 22.71 ? 384 ALA A C   1 
ATOM 2893 O O   . ALA A 1 381 ? 31.322  -27.242 -8.645  1.00 22.66 ? 384 ALA A O   1 
ATOM 2894 C CB  . ALA A 1 381 ? 29.676  -30.238 -9.338  1.00 22.79 ? 384 ALA A CB  1 
ATOM 2895 O OXT . ALA A 1 381 ? 31.499  -28.208 -10.507 1.00 22.65 ? 384 ALA A OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   4   4   THR THR A . n 
A 1 2   PHE 2   5   5   PHE PHE A . n 
A 1 3   GLY 3   6   6   GLY GLY A . n 
A 1 4   PRO 4   7   7   PRO PRO A . n 
A 1 5   VAL 5   8   8   VAL VAL A . n 
A 1 6   PHE 6   9   9   PHE PHE A . n 
A 1 7   GLU 7   10  10  GLU GLU A . n 
A 1 8   ASP 8   11  11  ASP ASP A . n 
A 1 9   GLN 9   12  12  GLN GLN A . n 
A 1 10  PRO 10  13  13  PRO PRO A . n 
A 1 11  LEU 11  14  14  LEU LEU A . n 
A 1 12  SER 12  15  15  SER SER A . n 
A 1 13  VAL 13  16  16  VAL VAL A . n 
A 1 14  LEU 14  17  17  LEU LEU A . n 
A 1 15  PHE 15  18  18  PHE PHE A . n 
A 1 16  PRO 16  19  19  PRO PRO A . n 
A 1 17  GLU 17  20  20  GLU GLU A . n 
A 1 18  GLU 18  21  21  GLU GLU A . n 
A 1 19  SER 19  22  22  SER SER A . n 
A 1 20  THR 20  23  23  THR THR A . n 
A 1 21  GLU 21  24  24  GLU GLU A . n 
A 1 22  GLU 22  25  25  GLU GLU A . n 
A 1 23  GLN 23  26  26  GLN GLN A . n 
A 1 24  VAL 24  27  27  VAL VAL A . n 
A 1 25  LEU 25  28  28  LEU LEU A . n 
A 1 26  LEU 26  29  29  LEU LEU A . n 
A 1 27  ALA 27  30  30  ALA ALA A . n 
A 1 28  CYS 28  31  31  CYS CYS A . n 
A 1 29  ARG 29  32  32  ARG ARG A . n 
A 1 30  ALA 30  33  33  ALA ALA A . n 
A 1 31  ARG 31  34  34  ARG ARG A . n 
A 1 32  ALA 32  35  35  ALA ALA A . n 
A 1 33  SER 33  36  36  SER SER A . n 
A 1 34  PRO 34  37  37  PRO PRO A . n 
A 1 35  PRO 35  38  38  PRO PRO A . n 
A 1 36  ALA 36  39  39  ALA ALA A . n 
A 1 37  THR 37  40  40  THR THR A . n 
A 1 38  TYR 38  41  41  TYR TYR A . n 
A 1 39  ARG 39  42  42  ARG ARG A . n 
A 1 40  TRP 40  43  43  TRP TRP A . n 
A 1 41  LYS 41  44  44  LYS LYS A . n 
A 1 42  MET 42  45  45  MET MET A . n 
A 1 43  ASN 43  46  46  ASN ASN A . n 
A 1 44  GLY 44  47  47  GLY GLY A . n 
A 1 45  THR 45  48  48  THR THR A . n 
A 1 46  GLU 46  49  49  GLU GLU A . n 
A 1 47  MET 47  50  50  MET MET A . n 
A 1 48  LYS 48  51  51  LYS LYS A . n 
A 1 49  LEU 49  52  52  LEU LEU A . n 
A 1 50  GLU 50  53  53  GLU GLU A . n 
A 1 51  PRO 51  54  54  PRO PRO A . n 
A 1 52  GLY 52  55  55  GLY GLY A . n 
A 1 53  SER 53  56  56  SER SER A . n 
A 1 54  ARG 54  57  57  ARG ARG A . n 
A 1 55  HIS 55  58  58  HIS HIS A . n 
A 1 56  GLN 56  59  59  GLN GLN A . n 
A 1 57  LEU 57  60  60  LEU LEU A . n 
A 1 58  VAL 58  61  61  VAL VAL A . n 
A 1 59  GLY 59  62  62  GLY GLY A . n 
A 1 60  GLY 60  63  63  GLY GLY A . n 
A 1 61  ASN 61  64  64  ASN ASN A . n 
A 1 62  LEU 62  65  65  LEU LEU A . n 
A 1 63  VAL 63  66  66  VAL VAL A . n 
A 1 64  ILE 64  67  67  ILE ILE A . n 
A 1 65  MET 65  68  68  MET MET A . n 
A 1 66  ASN 66  69  69  ASN ASN A . n 
A 1 67  PRO 67  70  70  PRO PRO A . n 
A 1 68  THR 68  71  71  THR THR A . n 
A 1 69  LYS 69  72  72  LYS LYS A . n 
A 1 70  ALA 70  73  73  ALA ALA A . n 
A 1 71  GLN 71  74  74  GLN GLN A . n 
A 1 72  ASP 72  75  75  ASP ASP A . n 
A 1 73  ALA 73  76  76  ALA ALA A . n 
A 1 74  GLY 74  77  77  GLY GLY A . n 
A 1 75  VAL 75  78  78  VAL VAL A . n 
A 1 76  TYR 76  79  79  TYR TYR A . n 
A 1 77  GLN 77  80  80  GLN GLN A . n 
A 1 78  CYS 78  81  81  CYS CYS A . n 
A 1 79  LEU 79  82  82  LEU LEU A . n 
A 1 80  ALA 80  83  83  ALA ALA A . n 
A 1 81  SER 81  84  84  SER SER A . n 
A 1 82  ASN 82  85  85  ASN ASN A . n 
A 1 83  PRO 83  86  86  PRO PRO A . n 
A 1 84  VAL 84  87  87  VAL VAL A . n 
A 1 85  GLY 85  88  88  GLY GLY A . n 
A 1 86  THR 86  89  89  THR THR A . n 
A 1 87  VAL 87  90  90  VAL VAL A . n 
A 1 88  VAL 88  91  91  VAL VAL A . n 
A 1 89  SER 89  92  92  SER SER A . n 
A 1 90  ARG 90  93  93  ARG ARG A . n 
A 1 91  GLU 91  94  94  GLU GLU A . n 
A 1 92  ALA 92  95  95  ALA ALA A . n 
A 1 93  ILE 93  96  96  ILE ILE A . n 
A 1 94  LEU 94  97  97  LEU LEU A . n 
A 1 95  ARG 95  98  98  ARG ARG A . n 
A 1 96  PHE 96  99  99  PHE PHE A . n 
A 1 97  GLY 97  100 100 GLY GLY A . n 
A 1 98  PHE 98  101 101 PHE PHE A . n 
A 1 99  LEU 99  102 102 LEU LEU A . n 
A 1 100 GLN 100 103 103 GLN GLN A . n 
A 1 101 GLU 101 104 104 GLU GLU A . n 
A 1 102 PHE 102 105 105 PHE PHE A . n 
A 1 103 SER 103 106 106 SER SER A . n 
A 1 104 LYS 104 107 107 LYS LYS A . n 
A 1 105 GLU 105 108 108 GLU GLU A . n 
A 1 106 GLU 106 109 109 GLU GLU A . n 
A 1 107 ARG 107 110 110 ARG ARG A . n 
A 1 108 ASP 108 111 111 ASP ASP A . n 
A 1 109 PRO 109 112 112 PRO PRO A . n 
A 1 110 VAL 110 113 113 VAL VAL A . n 
A 1 111 LYS 111 114 114 LYS LYS A . n 
A 1 112 ALA 112 115 115 ALA ALA A . n 
A 1 113 HIS 113 116 116 HIS HIS A . n 
A 1 114 GLU 114 117 117 GLU GLU A . n 
A 1 115 GLY 115 118 118 GLY GLY A . n 
A 1 116 TRP 116 119 119 TRP TRP A . n 
A 1 117 GLY 117 120 120 GLY GLY A . n 
A 1 118 VAL 118 121 121 VAL VAL A . n 
A 1 119 MET 119 122 122 MET MET A . n 
A 1 120 LEU 120 123 123 LEU LEU A . n 
A 1 121 PRO 121 124 124 PRO PRO A . n 
A 1 122 CYS 122 125 125 CYS CYS A . n 
A 1 123 ASN 123 126 126 ASN ASN A . n 
A 1 124 PRO 124 127 127 PRO PRO A . n 
A 1 125 PRO 125 128 128 PRO PRO A . n 
A 1 126 ALA 126 129 129 ALA ALA A . n 
A 1 127 HIS 127 130 130 HIS HIS A . n 
A 1 128 TYR 128 131 131 TYR TYR A . n 
A 1 129 PRO 129 132 132 PRO PRO A . n 
A 1 130 GLY 130 133 133 GLY GLY A . n 
A 1 131 LEU 131 134 134 LEU LEU A . n 
A 1 132 SER 132 135 135 SER SER A . n 
A 1 133 TYR 133 136 136 TYR TYR A . n 
A 1 134 ARG 134 137 137 ARG ARG A . n 
A 1 135 TRP 135 138 138 TRP TRP A . n 
A 1 136 LEU 136 139 139 LEU LEU A . n 
A 1 137 LEU 137 140 140 LEU LEU A . n 
A 1 138 ASN 138 141 141 ASN ASN A . n 
A 1 139 GLU 139 142 142 GLU GLU A . n 
A 1 140 PHE 140 143 143 PHE PHE A . n 
A 1 141 PRO 141 144 144 PRO PRO A . n 
A 1 142 ASN 142 145 145 ASN ASN A . n 
A 1 143 PHE 143 146 146 PHE PHE A . n 
A 1 144 ILE 144 147 147 ILE ILE A . n 
A 1 145 PRO 145 148 148 PRO PRO A . n 
A 1 146 THR 146 149 149 THR THR A . n 
A 1 147 ASP 147 150 150 ASP ASP A . n 
A 1 148 GLY 148 151 151 GLY GLY A . n 
A 1 149 ARG 149 152 152 ARG ARG A . n 
A 1 150 HIS 150 153 153 HIS HIS A . n 
A 1 151 PHE 151 154 154 PHE PHE A . n 
A 1 152 VAL 152 155 155 VAL VAL A . n 
A 1 153 SER 153 156 156 SER SER A . n 
A 1 154 GLN 154 157 157 GLN GLN A . n 
A 1 155 THR 155 158 158 THR THR A . n 
A 1 156 THR 156 159 159 THR THR A . n 
A 1 157 GLY 157 160 160 GLY GLY A . n 
A 1 158 ASN 158 161 161 ASN ASN A . n 
A 1 159 LEU 159 162 162 LEU LEU A . n 
A 1 160 TYR 160 163 163 TYR TYR A . n 
A 1 161 ILE 161 164 164 ILE ILE A . n 
A 1 162 ALA 162 165 165 ALA ALA A . n 
A 1 163 ARG 163 166 166 ARG ARG A . n 
A 1 164 THR 164 167 167 THR THR A . n 
A 1 165 ASN 165 168 168 ASN ASN A . n 
A 1 166 ALA 166 169 169 ALA ALA A . n 
A 1 167 SER 167 170 170 SER SER A . n 
A 1 168 ASP 168 171 171 ASP ASP A . n 
A 1 169 LEU 169 172 172 LEU LEU A . n 
A 1 170 GLY 170 173 173 GLY GLY A . n 
A 1 171 ASN 171 174 174 ASN ASN A . n 
A 1 172 TYR 172 175 175 TYR TYR A . n 
A 1 173 SER 173 176 176 SER SER A . n 
A 1 174 CYS 174 177 177 CYS CYS A . n 
A 1 175 LEU 175 178 178 LEU LEU A . n 
A 1 176 ALA 176 179 179 ALA ALA A . n 
A 1 177 THR 177 180 180 THR THR A . n 
A 1 178 SER 178 181 181 SER SER A . n 
A 1 179 HIS 179 182 182 HIS HIS A . n 
A 1 180 MET 180 183 183 MET MET A . n 
A 1 181 ASP 181 184 184 ASP ASP A . n 
A 1 182 PHE 182 185 185 PHE PHE A . n 
A 1 183 SER 183 186 186 SER SER A . n 
A 1 184 THR 184 187 187 THR THR A . n 
A 1 185 LYS 185 188 188 LYS LYS A . n 
A 1 186 SER 186 189 189 SER SER A . n 
A 1 187 VAL 187 190 190 VAL VAL A . n 
A 1 188 PHE 188 191 191 PHE PHE A . n 
A 1 189 SER 189 192 192 SER SER A . n 
A 1 190 LYS 190 193 193 LYS LYS A . n 
A 1 191 PHE 191 194 194 PHE PHE A . n 
A 1 192 ALA 192 195 195 ALA ALA A . n 
A 1 193 GLN 193 196 196 GLN GLN A . n 
A 1 194 LEU 194 197 197 LEU LEU A . n 
A 1 195 ASN 195 198 198 ASN ASN A . n 
A 1 196 LEU 196 199 199 LEU LEU A . n 
A 1 197 ALA 197 200 200 ALA ALA A . n 
A 1 198 ALA 198 201 201 ALA ALA A . n 
A 1 199 GLU 199 202 202 GLU GLU A . n 
A 1 200 ASP 200 203 203 ASP ASP A . n 
A 1 201 THR 201 204 204 THR THR A . n 
A 1 202 ARG 202 205 205 ARG ARG A . n 
A 1 203 LEU 203 206 206 LEU LEU A . n 
A 1 204 PHE 204 207 207 PHE PHE A . n 
A 1 205 ALA 205 208 208 ALA ALA A . n 
A 1 206 PRO 206 209 209 PRO PRO A . n 
A 1 207 SER 207 210 210 SER SER A . n 
A 1 208 ILE 208 211 211 ILE ILE A . n 
A 1 209 LYS 209 212 212 LYS LYS A . n 
A 1 210 ALA 210 213 213 ALA ALA A . n 
A 1 211 ARG 211 214 214 ARG ARG A . n 
A 1 212 PHE 212 215 215 PHE PHE A . n 
A 1 213 PRO 213 216 216 PRO PRO A . n 
A 1 214 ALA 214 217 217 ALA ALA A . n 
A 1 215 GLU 215 218 218 GLU GLU A . n 
A 1 216 THR 216 219 219 THR THR A . n 
A 1 217 TYR 217 220 220 TYR TYR A . n 
A 1 218 ALA 218 221 221 ALA ALA A . n 
A 1 219 LEU 219 222 222 LEU LEU A . n 
A 1 220 VAL 220 223 223 VAL VAL A . n 
A 1 221 GLY 221 224 224 GLY GLY A . n 
A 1 222 GLN 222 225 225 GLN GLN A . n 
A 1 223 GLN 223 226 226 GLN GLN A . n 
A 1 224 VAL 224 227 227 VAL VAL A . n 
A 1 225 THR 225 228 228 THR THR A . n 
A 1 226 LEU 226 229 229 LEU LEU A . n 
A 1 227 GLU 227 230 230 GLU GLU A . n 
A 1 228 CYS 228 231 231 CYS CYS A . n 
A 1 229 PHE 229 232 232 PHE PHE A . n 
A 1 230 ALA 230 233 233 ALA ALA A . n 
A 1 231 PHE 231 234 234 PHE PHE A . n 
A 1 232 GLY 232 235 235 GLY GLY A . n 
A 1 233 ASN 233 236 236 ASN ASN A . n 
A 1 234 PRO 234 237 237 PRO PRO A . n 
A 1 235 VAL 235 238 238 VAL VAL A . n 
A 1 236 PRO 236 239 239 PRO PRO A . n 
A 1 237 ARG 237 240 240 ARG ARG A . n 
A 1 238 ILE 238 241 241 ILE ILE A . n 
A 1 239 LYS 239 242 242 LYS LYS A . n 
A 1 240 TRP 240 243 243 TRP TRP A . n 
A 1 241 ARG 241 244 244 ARG ARG A . n 
A 1 242 LYS 242 245 245 LYS LYS A . n 
A 1 243 VAL 243 246 246 VAL VAL A . n 
A 1 244 ASP 244 247 ?   ?   ?   A . n 
A 1 245 GLY 245 248 ?   ?   ?   A . n 
A 1 246 SER 246 249 ?   ?   ?   A . n 
A 1 247 LEU 247 250 ?   ?   ?   A . n 
A 1 248 SER 248 251 ?   ?   ?   A . n 
A 1 249 PRO 249 252 ?   ?   ?   A . n 
A 1 250 GLN 250 253 ?   ?   ?   A . n 
A 1 251 TRP 251 254 ?   ?   ?   A . n 
A 1 252 THR 252 255 ?   ?   ?   A . n 
A 1 253 THR 253 256 ?   ?   ?   A . n 
A 1 254 ALA 254 257 257 ALA ALA A . n 
A 1 255 GLU 255 258 258 GLU GLU A . n 
A 1 256 PRO 256 259 259 PRO PRO A . n 
A 1 257 THR 257 260 260 THR THR A . n 
A 1 258 LEU 258 261 261 LEU LEU A . n 
A 1 259 GLN 259 262 262 GLN GLN A . n 
A 1 260 ILE 260 263 263 ILE ILE A . n 
A 1 261 PRO 261 264 264 PRO PRO A . n 
A 1 262 SER 262 265 265 SER SER A . n 
A 1 263 VAL 263 266 266 VAL VAL A . n 
A 1 264 SER 264 267 267 SER SER A . n 
A 1 265 PHE 265 268 268 PHE PHE A . n 
A 1 266 GLU 266 269 269 GLU GLU A . n 
A 1 267 ASP 267 270 270 ASP ASP A . n 
A 1 268 GLU 268 271 271 GLU GLU A . n 
A 1 269 GLY 269 272 272 GLY GLY A . n 
A 1 270 THR 270 273 273 THR THR A . n 
A 1 271 TYR 271 274 274 TYR TYR A . n 
A 1 272 GLU 272 275 275 GLU GLU A . n 
A 1 273 CYS 273 276 276 CYS CYS A . n 
A 1 274 GLU 274 277 277 GLU GLU A . n 
A 1 275 ALA 275 278 278 ALA ALA A . n 
A 1 276 GLU 276 279 279 GLU GLU A . n 
A 1 277 ASN 277 280 280 ASN ASN A . n 
A 1 278 SER 278 281 281 SER SER A . n 
A 1 279 LYS 279 282 282 LYS LYS A . n 
A 1 280 GLY 280 283 283 GLY GLY A . n 
A 1 281 ARG 281 284 284 ARG ARG A . n 
A 1 282 ASP 282 285 285 ASP ASP A . n 
A 1 283 THR 283 286 286 THR THR A . n 
A 1 284 VAL 284 287 287 VAL VAL A . n 
A 1 285 GLN 285 288 288 GLN GLN A . n 
A 1 286 GLY 286 289 289 GLY GLY A . n 
A 1 287 ARG 287 290 290 ARG ARG A . n 
A 1 288 ILE 288 291 291 ILE ILE A . n 
A 1 289 ILE 289 292 292 ILE ILE A . n 
A 1 290 VAL 290 293 293 VAL VAL A . n 
A 1 291 GLN 291 294 294 GLN GLN A . n 
A 1 292 ALA 292 295 295 ALA ALA A . n 
A 1 293 GLN 293 296 296 GLN GLN A . n 
A 1 294 PRO 294 297 297 PRO PRO A . n 
A 1 295 GLU 295 298 298 GLU GLU A . n 
A 1 296 TRP 296 299 299 TRP TRP A . n 
A 1 297 LEU 297 300 300 LEU LEU A . n 
A 1 298 LYS 298 301 301 LYS LYS A . n 
A 1 299 VAL 299 302 302 VAL VAL A . n 
A 1 300 ILE 300 303 303 ILE ILE A . n 
A 1 301 SER 301 304 304 SER SER A . n 
A 1 302 ASP 302 305 305 ASP ASP A . n 
A 1 303 THR 303 306 306 THR THR A . n 
A 1 304 GLU 304 307 307 GLU GLU A . n 
A 1 305 ALA 305 308 308 ALA ALA A . n 
A 1 306 ASP 306 309 309 ASP ASP A . n 
A 1 307 ILE 307 310 310 ILE ILE A . n 
A 1 308 GLY 308 311 311 GLY GLY A . n 
A 1 309 SER 309 312 312 SER SER A . n 
A 1 310 ASN 310 313 313 ASN ASN A . n 
A 1 311 LEU 311 314 314 LEU LEU A . n 
A 1 312 ARG 312 315 315 ARG ARG A . n 
A 1 313 TRP 313 316 316 TRP TRP A . n 
A 1 314 GLY 314 317 317 GLY GLY A . n 
A 1 315 CYS 315 318 318 CYS CYS A . n 
A 1 316 ALA 316 319 319 ALA ALA A . n 
A 1 317 ALA 317 320 320 ALA ALA A . n 
A 1 318 ALA 318 321 321 ALA ALA A . n 
A 1 319 GLY 319 322 322 GLY GLY A . n 
A 1 320 LYS 320 323 323 LYS LYS A . n 
A 1 321 PRO 321 324 324 PRO PRO A . n 
A 1 322 ARG 322 325 325 ARG ARG A . n 
A 1 323 PRO 323 326 326 PRO PRO A . n 
A 1 324 THR 324 327 327 THR THR A . n 
A 1 325 VAL 325 328 328 VAL VAL A . n 
A 1 326 ARG 326 329 329 ARG ARG A . n 
A 1 327 TRP 327 330 330 TRP TRP A . n 
A 1 328 LEU 328 331 331 LEU LEU A . n 
A 1 329 ARG 329 332 332 ARG ARG A . n 
A 1 330 ASN 330 333 333 ASN ASN A . n 
A 1 331 GLY 331 334 334 GLY GLY A . n 
A 1 332 GLU 332 335 335 GLU GLU A . n 
A 1 333 PRO 333 336 336 PRO PRO A . n 
A 1 334 LEU 334 337 337 LEU LEU A . n 
A 1 335 ALA 335 338 338 ALA ALA A . n 
A 1 336 SER 336 339 339 SER SER A . n 
A 1 337 GLN 337 340 340 GLN GLN A . n 
A 1 338 ASN 338 341 341 ASN ASN A . n 
A 1 339 ARG 339 342 342 ARG ARG A . n 
A 1 340 VAL 340 343 343 VAL VAL A . n 
A 1 341 GLU 341 344 344 GLU GLU A . n 
A 1 342 VAL 342 345 345 VAL VAL A . n 
A 1 343 LEU 343 346 346 LEU LEU A . n 
A 1 344 ALA 344 347 347 ALA ALA A . n 
A 1 345 GLY 345 348 348 GLY GLY A . n 
A 1 346 ASP 346 349 349 ASP ASP A . n 
A 1 347 LEU 347 350 350 LEU LEU A . n 
A 1 348 ARG 348 351 351 ARG ARG A . n 
A 1 349 PHE 349 352 352 PHE PHE A . n 
A 1 350 SER 350 353 353 SER SER A . n 
A 1 351 LYS 351 354 354 LYS LYS A . n 
A 1 352 LEU 352 355 355 LEU LEU A . n 
A 1 353 SER 353 356 356 SER SER A . n 
A 1 354 LEU 354 357 357 LEU LEU A . n 
A 1 355 GLU 355 358 358 GLU GLU A . n 
A 1 356 ASP 356 359 359 ASP ASP A . n 
A 1 357 SER 357 360 360 SER SER A . n 
A 1 358 GLY 358 361 361 GLY GLY A . n 
A 1 359 MET 359 362 362 MET MET A . n 
A 1 360 TYR 360 363 363 TYR TYR A . n 
A 1 361 GLN 361 364 364 GLN GLN A . n 
A 1 362 CYS 362 365 365 CYS CYS A . n 
A 1 363 VAL 363 366 366 VAL VAL A . n 
A 1 364 ALA 364 367 367 ALA ALA A . n 
A 1 365 GLU 365 368 368 GLU GLU A . n 
A 1 366 ASN 366 369 369 ASN ASN A . n 
A 1 367 LYS 367 370 370 LYS LYS A . n 
A 1 368 HIS 368 371 371 HIS HIS A . n 
A 1 369 GLY 369 372 372 GLY GLY A . n 
A 1 370 THR 370 373 373 THR THR A . n 
A 1 371 ILE 371 374 374 ILE ILE A . n 
A 1 372 TYR 372 375 375 TYR TYR A . n 
A 1 373 ALA 373 376 376 ALA ALA A . n 
A 1 374 SER 374 377 377 SER SER A . n 
A 1 375 ALA 375 378 378 ALA ALA A . n 
A 1 376 GLU 376 379 379 GLU GLU A . n 
A 1 377 LEU 377 380 380 LEU LEU A . n 
A 1 378 ALA 378 381 381 ALA ALA A . n 
A 1 379 VAL 379 382 382 VAL VAL A . n 
A 1 380 GLN 380 383 383 GLN GLN A . n 
A 1 381 ALA 381 384 384 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-11-20 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification' 
2 3 'Structure model' '_software.name'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -2.1870  -23.9150 -29.3980 0.3580 0.0675 0.1392 -0.0416 -0.0383 0.0561  11.1874 4.2100 7.6665 
-2.8685 3.8919  1.2201 0.0798  0.1317  -0.2116 0.3654  -0.2769 0.1910  0.3751  0.9853  -0.1870 
'X-RAY DIFFRACTION' 2 ? refined -36.6370 0.0160   -30.0680 0.0745 0.6751 0.6164 -0.0154 -0.1367 -0.2009 3.5150  7.5623 5.8455 
-3.9262 -2.8695 2.8731 0.0722  -0.6130 0.5407  0.4917  0.0772  1.4203  -0.3622 -0.4730 -0.6964 
'X-RAY DIFFRACTION' 3 ? refined -27.0280 7.8440   -10.5530 0.4482 0.3732 0.3734 0.0777  -0.0535 -0.2295 23.0537 5.9530 5.2116 
-5.5194 2.1413  1.6927 -0.7290 0.3892  0.3398  -0.7551 1.0229  -0.1056 0.9614  0.4720  0.1354  
'X-RAY DIFFRACTION' 4 ? refined 9.0970   -20.0780 -7.7900  1.1576 0.3620 0.2709 0.3767  -0.3633 -0.1126 6.0594  5.0230 6.1540 
-1.5531 0.4856  1.6768 -0.5084 0.2864  0.2219  -0.6382 0.2335  -0.6298 1.4955  0.7200  0.2832  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 4   A 100 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 A 101 A 203 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 A 204 A 295 ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 A 296 A 384 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOLREP phasing           .   ? 1 
REFMAC refinement        5.2 ? 2 
MAR345 'data collection' .   ? 3 
XDS    'data scaling'    .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 21  ? ? 108.73  -123.03 
2  1 SER A 22  ? ? 68.41   150.93  
3  1 PRO A 38  ? ? -39.99  137.34  
4  1 ASN A 46  ? ? 49.66   22.05   
5  1 GLU A 53  ? ? 18.98   161.30  
6  1 PRO A 54  ? ? -45.93  -97.66  
7  1 ASN A 69  ? ? 40.25   77.30   
8  1 PRO A 86  ? ? -30.81  -34.12  
9  1 ASN A 126 ? ? 52.34   70.40   
10 1 ASN A 141 ? ? 65.50   -50.53  
11 1 THR A 158 ? ? -96.83  -70.90  
12 1 ASN A 168 ? ? -128.01 -163.72 
13 1 PRO A 216 ? ? -48.58  152.75  
14 1 SER A 265 ? ? 68.30   117.67  
15 1 ASP A 305 ? ? -53.66  109.85  
16 1 ASN A 341 ? ? -21.46  -62.18  
17 1 ALA A 347 ? ? 20.90   -96.19  
18 1 LYS A 354 ? ? 69.52   111.38  
19 1 SER A 360 ? ? -66.03  85.67   
20 1 ASN A 369 ? ? -133.76 -151.43 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 247 ? A ASP 244 
2  1 Y 1 A GLY 248 ? A GLY 245 
3  1 Y 1 A SER 249 ? A SER 246 
4  1 Y 1 A LEU 250 ? A LEU 247 
5  1 Y 1 A SER 251 ? A SER 248 
6  1 Y 1 A PRO 252 ? A PRO 249 
7  1 Y 1 A GLN 253 ? A GLN 250 
8  1 Y 1 A TRP 254 ? A TRP 251 
9  1 Y 1 A THR 255 ? A THR 252 
10 1 Y 1 A THR 256 ? A THR 253 
#