data_2OOQ
# 
_entry.id   2OOQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OOQ         
RCSB  RCSB041398   
WWPDB D_1000041398 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1RPM 'HUMAN RECEPTOR PROTEIN TYROSINE PHOSPHATASE MU, DOMAIN 1'        unspecified 
PDB 2C7S 'CRYSTAL STRUCTURE OF HUMAN PROTEIN TYROSINE PHOSPHATASE KAPPA'   unspecified 
PDB 1LAR 'CRYSTAL STRUCTURE OF THE TANDEM PHOSPHATASE DOMAINS OF RPTP LAR' unspecified 
PDB 2FH7 'CRYSTAL STRUCTURE OF THE PHOSPHATASE DOMAINS OF HUMAN PTP SIGMA' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OOQ 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ugochukwu, E.'                        1  
'Alfano, I.'                           2  
'Barr, A.'                             3  
'Keates, T.'                           4  
'Eswaran, J.'                          5  
'Salah, E.'                            6  
'Savitsky, P.'                         7  
'Bunkoczi, G.'                         8  
'Edwards, A.'                          9  
'Arrowsmith, C.H.'                     10 
'Weigelt, J.'                          11 
'Sundstrom, M.'                        12 
'von Delft, F.'                        13 
'Knapp, S.'                            14 
'Structural Genomics Consortium (SGC)' 15 
# 
_citation.id                        primary 
_citation.title                     'Large-scale structural analysis of the classical human protein tyrosine phosphatome.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            136 
_citation.page_first                352 
_citation.page_last                 363 
_citation.year                      2009 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19167335 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2008.11.038 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barr, A.J.'          1  
primary 'Ugochukwu, E.'       2  
primary 'Lee, W.H.'           3  
primary 'King, O.N.'          4  
primary 'Filippakopoulos, P.' 5  
primary 'Alfano, I.'          6  
primary 'Savitsky, P.'        7  
primary 'Burgess-Brown, N.A.' 8  
primary 'Muller, S.'          9  
primary 'Knapp, S.'           10 
# 
_cell.entry_id           2OOQ 
_cell.length_a           37.186 
_cell.length_b           86.697 
_cell.length_c           91.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.89 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OOQ 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Receptor-type tyrosine-protein phosphatase T'                                                  32763.082 2   
3.1.3.48 ? PTPRT ? 
2 non-polymer syn '2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 282.334   2   ? 
? ?     ? 
3 non-polymer syn 'SODIUM ION'                                                                                    22.990    1   ? 
? ?     ? 
4 non-polymer syn 1,2-ETHANEDIOL                                                                                  62.068    1   ? 
? ?     ? 
5 water       nat water                                                                                           18.015    436 ? 
? ?     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'R-PTP-T, RPTP-rho' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINA
NYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYV
IRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAE
NEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINA
NYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYV
IRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAE
NEGVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAI
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ALA n 
1 4   ILE n 
1 5   ARG n 
1 6   VAL n 
1 7   ALA n 
1 8   ASP n 
1 9   LEU n 
1 10  LEU n 
1 11  GLN n 
1 12  HIS n 
1 13  ILE n 
1 14  THR n 
1 15  GLN n 
1 16  MET n 
1 17  LYS n 
1 18  ARG n 
1 19  GLY n 
1 20  GLN n 
1 21  GLY n 
1 22  TYR n 
1 23  GLY n 
1 24  PHE n 
1 25  LYS n 
1 26  GLU n 
1 27  GLU n 
1 28  TYR n 
1 29  GLU n 
1 30  ALA n 
1 31  LEU n 
1 32  PRO n 
1 33  GLU n 
1 34  GLY n 
1 35  GLN n 
1 36  THR n 
1 37  ALA n 
1 38  SER n 
1 39  TRP n 
1 40  ASP n 
1 41  THR n 
1 42  ALA n 
1 43  LYS n 
1 44  GLU n 
1 45  ASP n 
1 46  GLU n 
1 47  ASN n 
1 48  ARG n 
1 49  ASN n 
1 50  LYS n 
1 51  ASN n 
1 52  ARG n 
1 53  TYR n 
1 54  GLY n 
1 55  ASN n 
1 56  ILE n 
1 57  ILE n 
1 58  SER n 
1 59  TYR n 
1 60  ASP n 
1 61  HIS n 
1 62  SER n 
1 63  ARG n 
1 64  VAL n 
1 65  ARG n 
1 66  LEU n 
1 67  LEU n 
1 68  VAL n 
1 69  LEU n 
1 70  ASP n 
1 71  GLY n 
1 72  ASP n 
1 73  PRO n 
1 74  HIS n 
1 75  SER n 
1 76  ASP n 
1 77  TYR n 
1 78  ILE n 
1 79  ASN n 
1 80  ALA n 
1 81  ASN n 
1 82  TYR n 
1 83  ILE n 
1 84  ASP n 
1 85  GLY n 
1 86  TYR n 
1 87  HIS n 
1 88  ARG n 
1 89  PRO n 
1 90  ARG n 
1 91  HIS n 
1 92  TYR n 
1 93  ILE n 
1 94  ALA n 
1 95  THR n 
1 96  GLN n 
1 97  GLY n 
1 98  PRO n 
1 99  MET n 
1 100 GLN n 
1 101 GLU n 
1 102 THR n 
1 103 VAL n 
1 104 LYS n 
1 105 ASP n 
1 106 PHE n 
1 107 TRP n 
1 108 ARG n 
1 109 MET n 
1 110 ILE n 
1 111 TRP n 
1 112 GLN n 
1 113 GLU n 
1 114 ASN n 
1 115 SER n 
1 116 ALA n 
1 117 SER n 
1 118 ILE n 
1 119 VAL n 
1 120 MET n 
1 121 VAL n 
1 122 THR n 
1 123 ASN n 
1 124 LEU n 
1 125 VAL n 
1 126 GLU n 
1 127 VAL n 
1 128 GLY n 
1 129 ARG n 
1 130 VAL n 
1 131 LYS n 
1 132 CYS n 
1 133 VAL n 
1 134 ARG n 
1 135 TYR n 
1 136 TRP n 
1 137 PRO n 
1 138 ASP n 
1 139 ASP n 
1 140 THR n 
1 141 GLU n 
1 142 VAL n 
1 143 TYR n 
1 144 GLY n 
1 145 ASP n 
1 146 ILE n 
1 147 LYS n 
1 148 VAL n 
1 149 THR n 
1 150 LEU n 
1 151 ILE n 
1 152 GLU n 
1 153 THR n 
1 154 GLU n 
1 155 PRO n 
1 156 LEU n 
1 157 ALA n 
1 158 GLU n 
1 159 TYR n 
1 160 VAL n 
1 161 ILE n 
1 162 ARG n 
1 163 THR n 
1 164 PHE n 
1 165 THR n 
1 166 VAL n 
1 167 GLN n 
1 168 LYS n 
1 169 LYS n 
1 170 GLY n 
1 171 TYR n 
1 172 HIS n 
1 173 GLU n 
1 174 ILE n 
1 175 ARG n 
1 176 GLU n 
1 177 LEU n 
1 178 ARG n 
1 179 LEU n 
1 180 PHE n 
1 181 HIS n 
1 182 PHE n 
1 183 THR n 
1 184 SER n 
1 185 TRP n 
1 186 PRO n 
1 187 ASP n 
1 188 HIS n 
1 189 GLY n 
1 190 VAL n 
1 191 PRO n 
1 192 CYS n 
1 193 TYR n 
1 194 ALA n 
1 195 THR n 
1 196 GLY n 
1 197 LEU n 
1 198 LEU n 
1 199 GLY n 
1 200 PHE n 
1 201 VAL n 
1 202 ARG n 
1 203 GLN n 
1 204 VAL n 
1 205 LYS n 
1 206 PHE n 
1 207 LEU n 
1 208 ASN n 
1 209 PRO n 
1 210 PRO n 
1 211 GLU n 
1 212 ALA n 
1 213 GLY n 
1 214 PRO n 
1 215 ILE n 
1 216 VAL n 
1 217 VAL n 
1 218 HIS n 
1 219 CYS n 
1 220 SER n 
1 221 ALA n 
1 222 GLY n 
1 223 ALA n 
1 224 GLY n 
1 225 ARG n 
1 226 THR n 
1 227 GLY n 
1 228 CYS n 
1 229 PHE n 
1 230 ILE n 
1 231 ALA n 
1 232 ILE n 
1 233 ASP n 
1 234 THR n 
1 235 MET n 
1 236 LEU n 
1 237 ASP n 
1 238 MET n 
1 239 ALA n 
1 240 GLU n 
1 241 ASN n 
1 242 GLU n 
1 243 GLY n 
1 244 VAL n 
1 245 VAL n 
1 246 ASP n 
1 247 ILE n 
1 248 PHE n 
1 249 ASN n 
1 250 CYS n 
1 251 VAL n 
1 252 ARG n 
1 253 GLU n 
1 254 LEU n 
1 255 ARG n 
1 256 ALA n 
1 257 GLN n 
1 258 ARG n 
1 259 VAL n 
1 260 ASN n 
1 261 LEU n 
1 262 VAL n 
1 263 GLN n 
1 264 THR n 
1 265 GLU n 
1 266 GLU n 
1 267 GLN n 
1 268 TYR n 
1 269 VAL n 
1 270 PHE n 
1 271 VAL n 
1 272 HIS n 
1 273 ASP n 
1 274 ALA n 
1 275 ILE n 
1 276 LEU n 
1 277 GLU n 
1 278 ALA n 
1 279 CYS n 
1 280 LEU n 
1 281 CYS n 
1 282 GLY n 
1 283 ASN n 
1 284 THR n 
1 285 ALA n 
1 286 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'PTPRT, KIAA0283' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 Rosetta (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PTPRT_HUMAN 
_struct_ref.pdbx_db_accession          O14522 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANY
IDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIR
TFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENE
GVVDIFNCVRELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAI
;
_struct_ref.pdbx_align_begin           890 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OOQ A 3 ? 286 ? O14522 890 ? 1173 ? 890 1173 
2 1 2OOQ B 3 ? 286 ? O14522 890 ? 1173 ? 890 1173 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OOQ SER A 1 ? UNP O14522 ? ? 'CLONING ARTIFACT' 888 1 
1 2OOQ MET A 2 ? UNP O14522 ? ? 'CLONING ARTIFACT' 889 2 
2 2OOQ SER B 1 ? UNP O14522 ? ? 'CLONING ARTIFACT' 888 3 
2 2OOQ MET B 2 ? UNP O14522 ? ? 'CLONING ARTIFACT' 889 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                         ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                        ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                      ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                 ? 
'C4 H7 N O4'     133.103 
B3P non-polymer         . '2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' ? 
'C11 H26 N2 O6'  282.334 
CYS 'L-peptide linking' y CYSTEINE                                                                                        ? 
'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                                                                                  
'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                                                                       ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                 ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                         ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                       ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                           ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                      ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                         ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                          ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                      ? 
'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                                                                                    ? 'Na 1' 
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                   ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                         ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                          ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                       ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                      ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                        ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                          ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2OOQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'0.2M LiCl, 0.1M HEPES, 20.0% PEG 6000, 10.0% Ethylene glycol, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS HTC' 
_diffrn_detector.pdbx_collection_date   2007-01-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54180 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54180 
# 
_reflns.entry_id                     2OOQ 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.8 
_reflns.d_resolution_low             89.77 
_reflns.number_all                   ? 
_reflns.number_obs                   52802 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            0.092 
_reflns.pdbx_Rsym_value              0.092 
_reflns.pdbx_netI_over_sigmaI        16 
_reflns.B_iso_Wilson_estimate        18.6 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.9 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           0.595 
_reflns_shell.pdbx_Rsym_value        0.595 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OOQ 
_refine.ls_number_reflns_obs                     50081 
_refine.ls_number_reflns_all                     50081 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             89.77 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_R_factor_obs                          0.14709 
_refine.ls_R_factor_all                          0.14709 
_refine.ls_R_factor_R_work                       0.14488 
_refine.ls_R_factor_R_free                       0.18758 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2688 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.B_iso_mean                               22.417 
_refine.aniso_B[1][1]                            0.09 
_refine.aniso_B[2][2]                            0.30 
_refine.aniso_B[3][3]                            -0.51 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.35 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entries 1RPM, 2C7S, 1LAR, 2FH7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.107 
_refine.pdbx_overall_ESU_R_Free                  0.108 
_refine.overall_SU_ML                            0.075 
_refine.overall_SU_B                             4.669 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4421 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             436 
_refine_hist.number_atoms_total               4892 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        89.77 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015  0.022  ? 4602 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.002  0.020  ? 3082 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.453  1.941  ? 6257 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.909  3.002  ? 7431 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.400  5.000  ? 562  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   32.446 23.612 ? 227  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   12.178 15.000 ? 742  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   18.286 15.000 ? 35   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.089  0.200  ? 690  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.006  0.020  ? 5141 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.001  0.020  ? 968  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.217  0.200  ? 899  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.202  0.200  ? 3230 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.182  0.200  ? 2262 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.085  0.200  ? 2349 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.162  0.200  ? 339  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.093  0.200  ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.260  0.200  ? 61   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.174  0.200  ? 11   'X-RAY DIFFRACTION' ? 
r_mcbond_it              3.651  5.000  ? 2791 'X-RAY DIFFRACTION' ? 
r_mcbond_other           1.839  5.000  ? 1134 'X-RAY DIFFRACTION' ? 
r_mcangle_it             4.816  7.000  ? 4524 'X-RAY DIFFRACTION' ? 
r_scbond_it              7.122  9.000  ? 1884 'X-RAY DIFFRACTION' ? 
r_scangle_it             8.471  11.000 ? 1730 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1571 0.17 0.50  'medium positional' 1 'X-RAY DIFFRACTION' 1 ? ? ? 
1 A 1858 0.38 5.00  'loose positional'  1 'X-RAY DIFFRACTION' 2 ? ? ? 
1 A 1571 1.43 2.00  'medium thermal'    1 'X-RAY DIFFRACTION' 3 ? ? ? 
1 A 1858 2.65 10.00 'loose thermal'     1 'X-RAY DIFFRACTION' 4 ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.85 
_refine_ls_shell.number_reflns_R_work             3729 
_refine_ls_shell.R_factor_R_work                  0.193 
_refine_ls_shell.percent_reflns_obs               99.75 
_refine_ls_shell.R_factor_R_free                  0.284 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             196 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
1 3 A 
1 4 B 
1 5 A 
1 6 B 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 889  A 905  1 5 A MET 2   ? A ARG 18  ? 1 ? 
2 B 889  B 905  1 5 B MET 2   ? B ARG 18  ? 1 ? 
3 A 911  A 1071 2 5 A PHE 24  ? A SER 184 ? 1 ? 
4 B 911  B 1071 2 5 B PHE 24  ? B SER 184 ? 1 ? 
5 A 1078 A 1168 3 5 A PRO 191 ? A CYS 281 ? 1 ? 
6 B 1078 B 1168 3 5 B PRO 191 ? B CYS 281 ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2OOQ 
_struct.title                     'Crystal Structure of the Human Receptor Phosphatase PTPRT' 
_struct.pdbx_descriptor           'Receptor-type tyrosine-protein phosphatase T (E.C.3.1.3.48)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OOQ 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'Protein Tyrosine Phosphatase, receptor, Human, Structural Genomics, Structural Genomics Consortium, SGC, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? ARG A 18  ? ASP A 895  ARG A 905  1 ? 11 
HELX_P HELX_P2  2  GLY A 23  ? LEU A 31  ? GLY A 910  LEU A 918  1 ? 9  
HELX_P HELX_P3  3  GLU A 44  ? ASN A 51  ? GLU A 931  ASN A 938  5 ? 8  
HELX_P HELX_P4  4  TYR A 59  ? ARG A 63  ? TYR A 946  ARG A 950  5 ? 5  
HELX_P HELX_P5  5  ASP A 72  ? TYR A 77  ? ASP A 959  TYR A 964  5 ? 6  
HELX_P HELX_P6  6  THR A 102 ? ASN A 114 ? THR A 989  ASN A 1001 1 ? 13 
HELX_P HELX_P7  7  ALA A 194 ? ASN A 208 ? ALA A 1081 ASN A 1095 1 ? 15 
HELX_P HELX_P8  8  ALA A 223 ? GLY A 243 ? ALA A 1110 GLY A 1130 1 ? 21 
HELX_P HELX_P9  9  ASP A 246 ? ARG A 258 ? ASP A 1133 ARG A 1145 1 ? 13 
HELX_P HELX_P10 10 THR A 264 ? CYS A 281 ? THR A 1151 CYS A 1168 1 ? 18 
HELX_P HELX_P11 11 ASP B 8   ? ALA B 30  ? ASP B 895  ALA B 917  1 ? 23 
HELX_P HELX_P12 12 GLU B 44  ? ASN B 51  ? GLU B 931  ASN B 938  5 ? 8  
HELX_P HELX_P13 13 TYR B 59  ? ARG B 63  ? TYR B 946  ARG B 950  5 ? 5  
HELX_P HELX_P14 14 MET B 99  ? GLU B 101 ? MET B 986  GLU B 988  5 ? 3  
HELX_P HELX_P15 15 THR B 102 ? ASN B 114 ? THR B 989  ASN B 1001 1 ? 13 
HELX_P HELX_P16 16 ALA B 194 ? ASN B 208 ? ALA B 1081 ASN B 1095 1 ? 15 
HELX_P HELX_P17 17 ALA B 223 ? GLY B 243 ? ALA B 1110 GLY B 1130 1 ? 21 
HELX_P HELX_P18 18 ASP B 246 ? ARG B 258 ? ASP B 1133 ARG B 1145 1 ? 13 
HELX_P HELX_P19 19 THR B 264 ? CYS B 281 ? THR B 1151 CYS B 1168 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           B 
_struct_conn.ptnr1_label_comp_id           HIS 
_struct_conn.ptnr1_label_seq_id            91 
_struct_conn.ptnr1_label_atom_id           NE2 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           D 
_struct_conn.ptnr2_label_comp_id           NA 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           NA 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            B 
_struct_conn.ptnr1_auth_comp_id            HIS 
_struct_conn.ptnr1_auth_seq_id             978 
_struct_conn.ptnr2_auth_asym_id            B 
_struct_conn.ptnr2_auth_comp_id            NA 
_struct_conn.ptnr2_auth_seq_id             501 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.999 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
C ? 2 ? 
D ? 2 ? 
E ? 8 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
E 3 4 ? parallel      
E 4 5 ? parallel      
E 5 6 ? anti-parallel 
E 6 7 ? anti-parallel 
E 7 8 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 4   ? ARG A 5   ? ILE A 891  ARG A 892  
A 2 VAL A 244 ? VAL A 245 ? VAL A 1131 VAL A 1132 
B 1 ALA A 80  ? ILE A 83  ? ALA A 967  ILE A 970  
B 2 TYR A 92  ? THR A 95  ? TYR A 979  THR A 982  
B 3 ILE A 215 ? HIS A 218 ? ILE A 1102 HIS A 1105 
B 4 SER A 117 ? MET A 120 ? SER A 1004 MET A 1007 
B 5 ARG A 175 ? PHE A 182 ? ARG A 1062 PHE A 1069 
B 6 TYR A 159 ? LYS A 168 ? TYR A 1046 LYS A 1055 
B 7 ILE A 146 ? PRO A 155 ? ILE A 1033 PRO A 1042 
B 8 THR A 140 ? TYR A 143 ? THR A 1027 TYR A 1030 
C 1 VAL A 125 ? GLU A 126 ? VAL A 1012 GLU A 1013 
C 2 ARG A 129 ? VAL A 130 ? ARG A 1016 VAL A 1017 
D 1 ILE B 4   ? ARG B 5   ? ILE B 891  ARG B 892  
D 2 VAL B 244 ? VAL B 245 ? VAL B 1131 VAL B 1132 
E 1 ALA B 80  ? ILE B 83  ? ALA B 967  ILE B 970  
E 2 TYR B 92  ? THR B 95  ? TYR B 979  THR B 982  
E 3 ILE B 215 ? HIS B 218 ? ILE B 1102 HIS B 1105 
E 4 SER B 117 ? MET B 120 ? SER B 1004 MET B 1007 
E 5 ILE B 174 ? PHE B 182 ? ILE B 1061 PHE B 1069 
E 6 TYR B 159 ? LYS B 168 ? TYR B 1046 LYS B 1055 
E 7 ILE B 146 ? PRO B 155 ? ILE B 1033 PRO B 1042 
E 8 THR B 140 ? TYR B 143 ? THR B 1027 TYR B 1030 
F 1 VAL B 125 ? GLU B 126 ? VAL B 1012 GLU B 1013 
F 2 ARG B 129 ? VAL B 130 ? ARG B 1016 VAL B 1017 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 4   ? N ILE A 891  O VAL A 245 ? O VAL A 1132 
B 1 2 N ILE A 83  ? N ILE A 970  O TYR A 92  ? O TYR A 979  
B 2 3 N ILE A 93  ? N ILE A 980  O VAL A 217 ? O VAL A 1104 
B 3 4 O VAL A 216 ? O VAL A 1103 N VAL A 119 ? N VAL A 1006 
B 4 5 N ILE A 118 ? N ILE A 1005 O PHE A 180 ? O PHE A 1067 
B 5 6 O LEU A 179 ? O LEU A 1066 N ARG A 162 ? N ARG A 1049 
B 6 7 O GLN A 167 ? O GLN A 1054 N LYS A 147 ? N LYS A 1034 
B 7 8 O VAL A 148 ? O VAL A 1035 N GLU A 141 ? N GLU A 1028 
C 1 2 N GLU A 126 ? N GLU A 1013 O ARG A 129 ? O ARG A 1016 
D 1 2 N ILE B 4   ? N ILE B 891  O VAL B 245 ? O VAL B 1132 
E 1 2 N ILE B 83  ? N ILE B 970  O TYR B 92  ? O TYR B 979  
E 2 3 N ILE B 93  ? N ILE B 980  O VAL B 217 ? O VAL B 1104 
E 3 4 O VAL B 216 ? O VAL B 1103 N VAL B 119 ? N VAL B 1006 
E 4 5 N ILE B 118 ? N ILE B 1005 O PHE B 180 ? O PHE B 1067 
E 5 6 O ARG B 175 ? O ARG B 1062 N VAL B 166 ? N VAL B 1053 
E 6 7 O GLN B 167 ? O GLN B 1054 N LYS B 147 ? N LYS B 1034 
E 7 8 O VAL B 148 ? O VAL B 1035 N GLU B 141 ? N GLU B 1028 
F 1 2 N GLU B 126 ? N GLU B 1013 O ARG B 129 ? O ARG B 1016 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE NA B 501'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE B3P A 301' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE B3P B 301' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE EDO B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 3  HIS B 91  ? HIS B 978  . ? 1_555 ? 
2  AC1 3  ILE B 215 ? ILE B 1102 . ? 1_555 ? 
3  AC1 3  ASP B 233 ? ASP B 1120 . ? 1_555 ? 
4  AC2 6  HOH G .   ? HOH A 86   . ? 1_555 ? 
5  AC2 6  HOH G .   ? HOH A 294  . ? 1_555 ? 
6  AC2 6  GLU A 152 ? GLU A 1039 . ? 1_555 ? 
7  AC2 6  GLU A 154 ? GLU A 1041 . ? 1_555 ? 
8  AC2 6  THR A 163 ? THR A 1050 . ? 1_555 ? 
9  AC2 6  ARG A 178 ? ARG A 1065 . ? 1_555 ? 
10 AC3 10 GLU B 152 ? GLU B 1039 . ? 1_555 ? 
11 AC3 10 GLU B 154 ? GLU B 1041 . ? 1_555 ? 
12 AC3 10 THR B 163 ? THR B 1050 . ? 1_555 ? 
13 AC3 10 ARG B 178 ? ARG B 1065 . ? 1_555 ? 
14 AC3 10 HOH H .   ? HOH B 1191 . ? 1_555 ? 
15 AC3 10 HOH H .   ? HOH B 1256 . ? 1_555 ? 
16 AC3 10 HOH H .   ? HOH B 1371 . ? 1_555 ? 
17 AC3 10 HOH H .   ? HOH B 1390 . ? 1_555 ? 
18 AC3 10 HOH H .   ? HOH B 1439 . ? 1_555 ? 
19 AC3 10 HOH H .   ? HOH B 1441 . ? 1_555 ? 
20 AC4 7  TRP B 185 ? TRP B 1072 . ? 1_555 ? 
21 AC4 7  GLY B 189 ? GLY B 1076 . ? 1_555 ? 
22 AC4 7  ARG B 225 ? ARG B 1112 . ? 1_555 ? 
23 AC4 7  GLN B 267 ? GLN B 1154 . ? 1_555 ? 
24 AC4 7  HOH H .   ? HOH B 1229 . ? 1_555 ? 
25 AC4 7  HOH H .   ? HOH B 1301 . ? 1_555 ? 
26 AC4 7  HOH H .   ? HOH B 1442 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OOQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OOQ 
_atom_sites.fract_transf_matrix[1][1]   0.026892 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004689 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011534 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011140 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 2   ? 27.765  20.171  105.798 1.00 50.72 ? 889  MET A N   1 
ATOM   2    C  CA  . MET A 1 2   ? 26.932  19.336  106.723 1.00 44.37 ? 889  MET A CA  1 
ATOM   3    C  C   . MET A 1 2   ? 27.153  17.820  106.497 1.00 35.80 ? 889  MET A C   1 
ATOM   4    O  O   . MET A 1 2   ? 26.374  16.984  106.976 1.00 33.13 ? 889  MET A O   1 
ATOM   5    C  CB  . MET A 1 2   ? 25.447  19.668  106.543 1.00 43.21 ? 889  MET A CB  1 
ATOM   6    C  CG  . MET A 1 2   ? 25.156  20.927  105.735 1.00 40.22 ? 889  MET A CG  1 
ATOM   7    S  SD  . MET A 1 2   ? 23.417  21.406  105.826 1.00 59.50 ? 889  MET A SD  1 
ATOM   8    C  CE  . MET A 1 2   ? 22.597  19.798  105.773 1.00 34.13 ? 889  MET A CE  1 
ATOM   9    N  N   . ALA A 1 3   ? 28.211  17.470  105.773 1.00 34.35 ? 890  ALA A N   1 
ATOM   10   C  CA  . ALA A 1 3   ? 28.520  16.084  105.512 1.00 34.18 ? 890  ALA A CA  1 
ATOM   11   C  C   . ALA A 1 3   ? 28.954  15.391  106.793 1.00 33.10 ? 890  ALA A C   1 
ATOM   12   O  O   . ALA A 1 3   ? 29.473  16.017  107.713 1.00 31.34 ? 890  ALA A O   1 
ATOM   13   C  CB  . ALA A 1 3   ? 29.609  15.960  104.440 1.00 34.59 ? 890  ALA A CB  1 
ATOM   14   N  N   . ILE A 1 4   ? 28.743  14.083  106.828 1.00 24.85 ? 891  ILE A N   1 
ATOM   15   C  CA  . ILE A 1 4   ? 29.072  13.260  107.972 1.00 24.00 ? 891  ILE A CA  1 
ATOM   16   C  C   . ILE A 1 4   ? 30.168  12.307  107.554 1.00 22.56 ? 891  ILE A C   1 
ATOM   17   O  O   . ILE A 1 4   ? 30.022  11.586  106.548 1.00 27.13 ? 891  ILE A O   1 
ATOM   18   C  CB  . ILE A 1 4   ? 27.834  12.399  108.416 1.00 25.52 ? 891  ILE A CB  1 
ATOM   19   C  CG1 . ILE A 1 4   ? 26.586  13.269  108.670 1.00 33.52 ? 891  ILE A CG1 1 
ATOM   20   C  CG2 . ILE A 1 4   ? 28.189  11.515  109.609 1.00 27.08 ? 891  ILE A CG2 1 
ATOM   21   C  CD1 . ILE A 1 4   ? 26.685  14.234  109.856 1.00 36.82 ? 891  ILE A CD1 1 
ATOM   22   N  N   . ARG A 1 5   ? 31.233  12.252  108.343 1.00 26.69 ? 892  ARG A N   1 
ATOM   23   C  CA  . ARG A 1 5   ? 32.307  11.287  108.110 1.00 25.27 ? 892  ARG A CA  1 
ATOM   24   C  C   . ARG A 1 5   ? 31.760  9.865   108.233 1.00 27.74 ? 892  ARG A C   1 
ATOM   25   O  O   . ARG A 1 5   ? 30.990  9.572   109.137 1.00 23.03 ? 892  ARG A O   1 
ATOM   26   C  CB  . ARG A 1 5   ? 33.441  11.481  109.125 1.00 24.97 ? 892  ARG A CB  1 
ATOM   27   C  CG  . ARG A 1 5   ? 34.148  12.835  109.057 1.00 32.23 ? 892  ARG A CG  1 
ATOM   28   C  CD  . ARG A 1 5   ? 35.544  12.734  109.646 1.00 40.39 ? 892  ARG A CD  1 
ATOM   29   N  NE  . ARG A 1 5   ? 35.521  12.070  110.947 1.00 40.83 ? 892  ARG A NE  1 
ATOM   30   C  CZ  . ARG A 1 5   ? 36.428  11.192  111.379 1.00 63.68 ? 892  ARG A CZ  1 
ATOM   31   N  NH1 . ARG A 1 5   ? 36.288  10.649  112.586 1.00 64.77 ? 892  ARG A NH1 1 
ATOM   32   N  NH2 . ARG A 1 5   ? 37.472  10.843  110.629 1.00 65.25 ? 892  ARG A NH2 1 
ATOM   33   N  N   . VAL A 1 6   ? 32.160  8.975   107.328 1.00 28.57 ? 893  VAL A N   1 
ATOM   34   C  CA  . VAL A 1 6   ? 31.707  7.582   107.402 1.00 28.40 ? 893  VAL A CA  1 
ATOM   35   C  C   . VAL A 1 6   ? 32.045  6.968   108.761 1.00 33.56 ? 893  VAL A C   1 
ATOM   36   O  O   . VAL A 1 6   ? 31.211  6.287   109.379 1.00 24.97 ? 893  VAL A O   1 
ATOM   37   C  CB  . VAL A 1 6   ? 32.313  6.752   106.254 1.00 30.43 ? 893  VAL A CB  1 
ATOM   38   C  CG1 . VAL A 1 6   ? 32.113  5.271   106.488 1.00 33.59 ? 893  VAL A CG1 1 
ATOM   39   C  CG2 . VAL A 1 6   ? 31.712  7.209   104.922 1.00 24.43 ? 893  VAL A CG2 1 
ATOM   40   N  N   . ALA A 1 7   ? 33.254  7.264   109.238 1.00 28.39 ? 894  ALA A N   1 
ATOM   41   C  CA  . ALA A 1 7   ? 33.708  6.909   110.584 1.00 28.60 ? 894  ALA A CA  1 
ATOM   42   C  C   . ALA A 1 7   ? 32.770  7.335   111.713 1.00 31.12 ? 894  ALA A C   1 
ATOM   43   O  O   . ALA A 1 7   ? 32.824  6.744   112.794 1.00 34.96 ? 894  ALA A O   1 
ATOM   44   C  CB  . ALA A 1 7   ? 35.131  7.499   110.826 1.00 31.32 ? 894  ALA A CB  1 
ATOM   45   N  N   . ASP A 1 8   ? 31.957  8.371   111.478 1.00 24.02 ? 895  ASP A N   1 
ATOM   46   C  CA  . ASP A 1 8   ? 31.050  8.945   112.495 1.00 27.09 ? 895  ASP A CA  1 
ATOM   47   C  C   . ASP A 1 8   ? 29.585  8.606   112.243 1.00 30.30 ? 895  ASP A C   1 
ATOM   48   O  O   . ASP A 1 8   ? 28.707  9.102   112.951 1.00 24.84 ? 895  ASP A O   1 
ATOM   49   C  CB  . ASP A 1 8   ? 31.136  10.472  112.507 1.00 25.83 ? 895  ASP A CB  1 
ATOM   50   C  CG  . ASP A 1 8   ? 32.477  10.992  112.969 1.00 27.53 ? 895  ASP A CG  1 
ATOM   51   O  OD1 . ASP A 1 8   ? 33.107  10.346  113.825 1.00 28.33 ? 895  ASP A OD1 1 
ATOM   52   O  OD2 . ASP A 1 8   ? 32.873  12.074  112.494 1.00 31.55 ? 895  ASP A OD2 1 
ATOM   53   N  N   . LEU A 1 9   ? 29.318  7.765   111.242 1.00 27.81 ? 896  LEU A N   1 
ATOM   54   C  CA  . LEU A 1 9   ? 27.962  7.532   110.782 1.00 26.59 ? 896  LEU A CA  1 
ATOM   55   C  C   . LEU A 1 9   ? 27.113  6.786   111.793 1.00 20.61 ? 896  LEU A C   1 
ATOM   56   O  O   . LEU A 1 9   ? 25.947  7.136   111.980 1.00 25.89 ? 896  LEU A O   1 
ATOM   57   C  CB  . LEU A 1 9   ? 27.977  6.768   109.449 1.00 31.29 ? 896  LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 9   ? 26.665  6.689   108.668 1.00 37.78 ? 896  LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 9   ? 25.921  8.016   108.656 1.00 27.24 ? 896  LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 9   ? 26.950  6.211   107.241 1.00 25.82 ? 896  LEU A CD2 1 
ATOM   61   N  N   . LEU A 1 10  ? 27.680  5.763   112.431 1.00 25.43 ? 897  LEU A N   1 
ATOM   62   C  CA  . LEU A 1 10  ? 26.946  5.022   113.486 1.00 26.30 ? 897  LEU A CA  1 
ATOM   63   C  C   . LEU A 1 10  ? 26.511  5.963   114.598 1.00 26.08 ? 897  LEU A C   1 
ATOM   64   O  O   . LEU A 1 10  ? 25.335  5.985   114.973 1.00 26.80 ? 897  LEU A O   1 
ATOM   65   C  CB  . LEU A 1 10  ? 27.776  3.877   114.061 1.00 34.40 ? 897  LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 10  ? 26.980  2.883   114.936 1.00 31.15 ? 897  LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 10  ? 27.354  1.469   114.612 1.00 34.61 ? 897  LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 10  ? 27.155  3.142   116.438 1.00 37.26 ? 897  LEU A CD2 1 
ATOM   69   N  N   . GLN A 1 11  ? 27.454  6.760   115.098 1.00 24.12 ? 898  GLN A N   1 
ATOM   70   C  CA  . GLN A 1 11  ? 27.166  7.745   116.144 1.00 31.03 ? 898  GLN A CA  1 
ATOM   71   C  C   . GLN A 1 11  ? 26.116  8.750   115.708 1.00 25.61 ? 898  GLN A C   1 
ATOM   72   O  O   . GLN A 1 11  ? 25.231  9.089   116.474 1.00 24.77 ? 898  GLN A O   1 
ATOM   73   C  CB  . GLN A 1 11  ? 28.442  8.482   116.582 1.00 27.27 ? 898  GLN A CB  1 
ATOM   74   N  N   . HIS A 1 12  ? 26.221  9.230   114.473 1.00 25.63 ? 899  HIS A N   1 
ATOM   75   C  CA  . HIS A 1 12  ? 25.222  10.144  113.915 1.00 23.78 ? 899  HIS A CA  1 
ATOM   76   C  C   . HIS A 1 12  ? 23.807  9.520   113.921 1.00 16.59 ? 899  HIS A C   1 
ATOM   77   O  O   . HIS A 1 12  ? 22.858  10.145  114.371 1.00 22.22 ? 899  HIS A O   1 
ATOM   78   C  CB  . HIS A 1 12  ? 25.608  10.516  112.473 1.00 28.69 ? 899  HIS A CB  1 
ATOM   79   C  CG  . HIS A 1 12  ? 24.614  11.404  111.799 1.00 20.80 ? 899  HIS A CG  1 
ATOM   80   N  ND1 . HIS A 1 12  ? 24.364  12.685  112.222 1.00 19.80 ? 899  HIS A ND1 1 
ATOM   81   C  CD2 . HIS A 1 12  ? 23.823  11.206  110.718 1.00 22.33 ? 899  HIS A CD2 1 
ATOM   82   C  CE1 . HIS A 1 12  ? 23.446  13.237  111.447 1.00 29.03 ? 899  HIS A CE1 1 
ATOM   83   N  NE2 . HIS A 1 12  ? 23.098  12.358  110.528 1.00 18.26 ? 899  HIS A NE2 1 
ATOM   84   N  N   . ILE A 1 13  ? 23.694  8.308   113.404 1.00 20.42 ? 900  ILE A N   1 
ATOM   85   C  CA  . ILE A 1 13  ? 22.391  7.639   113.269 1.00 18.99 ? 900  ILE A CA  1 
ATOM   86   C  C   . ILE A 1 13  ? 21.780  7.405   114.674 1.00 19.63 ? 900  ILE A C   1 
ATOM   87   O  O   . ILE A 1 13  ? 20.591  7.636   114.901 1.00 19.97 ? 900  ILE A O   1 
ATOM   88   C  CB  . ILE A 1 13  ? 22.523  6.377   112.419 1.00 19.24 ? 900  ILE A CB  1 
ATOM   89   C  CG1 . ILE A 1 13  ? 22.865  6.740   110.972 1.00 25.37 ? 900  ILE A CG1 1 
ATOM   90   C  CG2 . ILE A 1 13  ? 21.233  5.510   112.410 1.00 27.93 ? 900  ILE A CG2 1 
ATOM   91   C  CD1 . ILE A 1 13  ? 23.244  5.539   110.145 1.00 29.87 ? 900  ILE A CD1 1 
ATOM   92   N  N   . THR A 1 14  ? 22.627  7.031   115.620 1.00 24.33 ? 901  THR A N   1 
ATOM   93   C  CA  . THR A 1 14  ? 22.200  6.822   117.003 1.00 23.62 ? 901  THR A CA  1 
ATOM   94   C  C   . THR A 1 14  ? 21.644  8.108   117.597 1.00 29.24 ? 901  THR A C   1 
ATOM   95   O  O   . THR A 1 14  ? 20.523  8.143   118.146 1.00 26.07 ? 901  THR A O   1 
ATOM   96   C  CB  . THR A 1 14  ? 23.399  6.338   117.861 1.00 34.10 ? 901  THR A CB  1 
ATOM   97   O  OG1 . THR A 1 14  ? 23.750  4.996   117.472 1.00 27.73 ? 901  THR A OG1 1 
ATOM   98   C  CG2 . THR A 1 14  ? 23.061  6.386   119.356 1.00 30.40 ? 901  THR A CG2 1 
ATOM   99   N  N   . GLN A 1 15  ? 22.437  9.173   117.496 1.00 20.93 ? 902  GLN A N   1 
ATOM   100  C  CA  . GLN A 1 15  ? 22.037  10.457  118.053 1.00 22.97 ? 902  GLN A CA  1 
ATOM   101  C  C   . GLN A 1 15  ? 20.697  10.826  117.446 1.00 20.11 ? 902  GLN A C   1 
ATOM   102  O  O   . GLN A 1 15  ? 19.823  11.333  118.144 1.00 20.14 ? 902  GLN A O   1 
ATOM   103  C  CB  . GLN A 1 15  ? 23.080  11.550  117.769 1.00 25.16 ? 902  GLN A CB  1 
ATOM   104  N  N   . MET A 1 16  ? 20.576  10.589  116.139 1.00 22.00 ? 903  MET A N   1 
ATOM   105  C  CA  . MET A 1 16  ? 19.393  10.944  115.364 1.00 23.93 ? 903  MET A CA  1 
ATOM   106  C  C   . MET A 1 16  ? 18.164  10.101  115.741 1.00 26.47 ? 903  MET A C   1 
ATOM   107  O  O   . MET A 1 16  ? 17.038  10.562  115.598 1.00 22.11 ? 903  MET A O   1 
ATOM   108  C  CB  . MET A 1 16  ? 19.672  10.822  113.867 1.00 26.62 ? 903  MET A CB  1 
ATOM   109  C  CG  . MET A 1 16  ? 20.637  11.856  113.308 1.00 23.04 ? 903  MET A CG  1 
ATOM   110  S  SD  . MET A 1 16  ? 19.930  13.523  113.254 1.00 25.98 ? 903  MET A SD  1 
ATOM   111  C  CE  . MET A 1 16  ? 18.935  13.312  111.801 1.00 21.42 ? 903  MET A CE  1 
ATOM   112  N  N   . LYS A 1 17  ? 18.394  8.891   116.261 1.00 20.87 ? 904  LYS A N   1 
ATOM   113  C  CA  . LYS A 1 17  ? 17.303  8.025   116.781 1.00 20.07 ? 904  LYS A CA  1 
ATOM   114  C  C   . LYS A 1 17  ? 16.912  8.255   118.228 1.00 20.36 ? 904  LYS A C   1 
ATOM   115  O  O   . LYS A 1 17  ? 15.791  7.912   118.618 1.00 21.77 ? 904  LYS A O   1 
ATOM   116  C  CB  . LYS A 1 17  ? 17.685  6.549   116.573 1.00 17.22 ? 904  LYS A CB  1 
ATOM   117  C  CG  . LYS A 1 17  ? 17.562  6.082   115.120 1.00 22.97 ? 904  LYS A CG  1 
ATOM   118  C  CD  . LYS A 1 17  ? 18.230  4.728   114.907 1.00 19.74 ? 904  LYS A CD  1 
ATOM   119  C  CE  . LYS A 1 17  ? 18.032  4.146   113.519 1.00 27.73 ? 904  LYS A CE  1 
ATOM   120  N  NZ  . LYS A 1 17  ? 18.748  2.818   113.383 1.00 25.82 ? 904  LYS A NZ  1 
ATOM   121  N  N   . ARG A 1 18  ? 17.810  8.841   119.028 1.00 22.73 ? 905  ARG A N   1 
ATOM   122  C  CA  . ARG A 1 18  ? 17.487  9.258   120.405 1.00 25.83 ? 905  ARG A CA  1 
ATOM   123  C  C   . ARG A 1 18  ? 16.517  10.437  120.347 1.00 32.02 ? 905  ARG A C   1 
ATOM   124  O  O   . ARG A 1 18  ? 16.799  11.472  119.712 1.00 36.39 ? 905  ARG A O   1 
ATOM   125  C  CB  . ARG A 1 18  ? 18.725  9.755   121.159 1.00 29.42 ? 905  ARG A CB  1 
ATOM   126  C  CG  . ARG A 1 18  ? 19.775  8.733   121.488 1.00 34.23 ? 905  ARG A CG  1 
ATOM   127  C  CD  . ARG A 1 18  ? 20.828  9.287   122.459 1.00 37.82 ? 905  ARG A CD  1 
ATOM   128  N  NE  . ARG A 1 18  ? 22.190  9.093   121.941 1.00 55.72 ? 905  ARG A NE  1 
ATOM   129  C  CZ  . ARG A 1 18  ? 23.115  8.244   122.406 1.00 60.97 ? 905  ARG A CZ  1 
ATOM   130  N  NH1 . ARG A 1 18  ? 24.296  8.198   121.799 1.00 81.89 ? 905  ARG A NH1 1 
ATOM   131  N  NH2 . ARG A 1 18  ? 22.901  7.441   123.446 1.00 34.24 ? 905  ARG A NH2 1 
ATOM   132  N  N   . GLY A 1 19  ? 15.395  10.323  121.024 1.00 31.24 ? 906  GLY A N   1 
ATOM   133  C  CA  . GLY A 1 19  ? 14.390  11.378  120.938 1.00 41.93 ? 906  GLY A CA  1 
ATOM   134  C  C   . GLY A 1 19  ? 14.730  12.724  121.575 1.00 36.76 ? 906  GLY A C   1 
ATOM   135  O  O   . GLY A 1 19  ? 13.900  13.620  121.538 1.00 42.49 ? 906  GLY A O   1 
ATOM   136  N  N   . GLN A 1 20  ? 15.937  12.885  122.124 1.00 22.35 ? 907  GLN A N   1 
ATOM   137  C  CA  . GLN A 1 20  ? 16.191  13.943  123.082 1.00 17.93 ? 907  GLN A CA  1 
ATOM   138  C  C   . GLN A 1 20  ? 16.644  15.274  122.475 1.00 18.49 ? 907  GLN A C   1 
ATOM   139  O  O   . GLN A 1 20  ? 16.270  16.328  122.999 1.00 14.76 ? 907  GLN A O   1 
ATOM   140  C  CB  . GLN A 1 20  ? 17.182  13.480  124.163 1.00 32.77 ? 907  GLN A CB  1 
ATOM   141  C  CG  . GLN A 1 20  ? 16.696  12.227  124.930 1.00 45.77 ? 907  GLN A CG  1 
ATOM   142  C  CD  . GLN A 1 20  ? 17.442  10.935  124.535 1.00 46.03 ? 907  GLN A CD  1 
ATOM   143  O  OE1 . GLN A 1 20  ? 18.658  10.945  124.333 1.00 70.31 ? 907  GLN A OE1 1 
ATOM   144  N  NE2 . GLN A 1 20  ? 16.714  9.820   124.453 1.00 39.69 ? 907  GLN A NE2 1 
ATOM   145  N  N   . GLY A 1 21  ? 17.447  15.217  121.420 1.00 22.91 ? 908  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 21  ? 17.803  16.396  120.635 1.00 26.49 ? 908  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 21  ? 17.324  16.242  119.201 1.00 17.07 ? 908  GLY A C   1 
ATOM   148  O  O   . GLY A 1 21  ? 16.451  15.409  118.903 1.00 26.88 ? 908  GLY A O   1 
ATOM   149  N  N   . TYR A 1 22  ? 17.916  17.028  118.308 1.00 16.18 ? 909  TYR A N   1 
ATOM   150  C  CA  . TYR A 1 22  ? 17.637  16.964  116.868 1.00 14.35 ? 909  TYR A CA  1 
ATOM   151  C  C   . TYR A 1 22  ? 17.725  15.519  116.421 1.00 24.65 ? 909  TYR A C   1 
ATOM   152  O  O   . TYR A 1 22  ? 18.712  14.849  116.732 1.00 23.69 ? 909  TYR A O   1 
ATOM   153  C  CB  . TYR A 1 22  ? 18.681  17.789  116.138 1.00 20.46 ? 909  TYR A CB  1 
ATOM   154  C  CG  . TYR A 1 22  ? 18.564  17.805  114.641 1.00 13.78 ? 909  TYR A CG  1 
ATOM   155  C  CD1 . TYR A 1 22  ? 17.506  18.456  114.022 1.00 28.68 ? 909  TYR A CD1 1 
ATOM   156  C  CD2 . TYR A 1 22  ? 19.523  17.196  113.842 1.00 21.27 ? 909  TYR A CD2 1 
ATOM   157  C  CE1 . TYR A 1 22  ? 17.397  18.496  112.654 1.00 20.50 ? 909  TYR A CE1 1 
ATOM   158  C  CE2 . TYR A 1 22  ? 19.428  17.224  112.470 1.00 17.53 ? 909  TYR A CE2 1 
ATOM   159  C  CZ  . TYR A 1 22  ? 18.352  17.886  111.879 1.00 22.14 ? 909  TYR A CZ  1 
ATOM   160  O  OH  . TYR A 1 22  ? 18.240  17.945  110.516 1.00 20.99 ? 909  TYR A OH  1 
ATOM   161  N  N   . GLY A 1 23  ? 16.684  15.058  115.713 1.00 20.85 ? 910  GLY A N   1 
ATOM   162  C  CA  . GLY A 1 23  ? 16.588  13.692  115.210 1.00 21.92 ? 910  GLY A CA  1 
ATOM   163  C  C   . GLY A 1 23  ? 15.914  13.614  113.848 1.00 29.93 ? 910  GLY A C   1 
ATOM   164  O  O   . GLY A 1 23  ? 15.719  14.629  113.179 1.00 21.78 ? 910  GLY A O   1 
ATOM   165  N  N   . PHE A 1 24  ? 15.540  12.394  113.454 1.00 22.46 ? 911  PHE A N   1 
ATOM   166  C  CA  . PHE A 1 24  ? 15.026  12.130  112.126 1.00 22.10 ? 911  PHE A CA  1 
ATOM   167  C  C   . PHE A 1 24  ? 13.659  12.709  111.821 1.00 15.11 ? 911  PHE A C   1 
ATOM   168  O  O   . PHE A 1 24  ? 13.389  13.036  110.672 1.00 27.30 ? 911  PHE A O   1 
ATOM   169  C  CB  . PHE A 1 24  ? 14.959  10.628  111.906 1.00 20.01 ? 911  PHE A CB  1 
ATOM   170  C  CG  . PHE A 1 24  ? 16.276  10.002  111.643 1.00 20.66 ? 911  PHE A CG  1 
ATOM   171  C  CD1 . PHE A 1 24  ? 17.065  10.443  110.585 1.00 21.31 ? 911  PHE A CD1 1 
ATOM   172  C  CD2 . PHE A 1 24  ? 16.725  8.940   112.429 1.00 26.48 ? 911  PHE A CD2 1 
ATOM   173  C  CE1 . PHE A 1 24  ? 18.287  9.850   110.317 1.00 26.15 ? 911  PHE A CE1 1 
ATOM   174  C  CE2 . PHE A 1 24  ? 17.949  8.328   112.151 1.00 23.08 ? 911  PHE A CE2 1 
ATOM   175  C  CZ  . PHE A 1 24  ? 18.731  8.786   111.104 1.00 32.10 ? 911  PHE A CZ  1 
ATOM   176  N  N   . LYS A 1 25  ? 12.771  12.792  112.805 1.00 24.44 ? 912  LYS A N   1 
ATOM   177  C  CA  . LYS A 1 25  ? 11.471  13.441  112.546 1.00 21.78 ? 912  LYS A CA  1 
ATOM   178  C  C   . LYS A 1 25  ? 11.656  14.890  112.070 1.00 20.23 ? 912  LYS A C   1 
ATOM   179  O  O   . LYS A 1 25  ? 11.093  15.297  111.046 1.00 23.01 ? 912  LYS A O   1 
ATOM   180  C  CB  . LYS A 1 25  ? 10.589  13.422  113.785 1.00 29.61 ? 912  LYS A CB  1 
ATOM   181  C  CG  . LYS A 1 25  ? 9.152   13.875  113.527 1.00 33.45 ? 912  LYS A CG  1 
ATOM   182  N  N   . GLU A 1 26  ? 12.453  15.657  112.806 1.00 19.93 ? 913  GLU A N   1 
ATOM   183  C  CA  . GLU A 1 26  ? 12.659  17.055  112.455 1.00 22.15 ? 913  GLU A CA  1 
ATOM   184  C  C   . GLU A 1 26  ? 13.381  17.164  111.146 1.00 21.66 ? 913  GLU A C   1 
ATOM   185  O  O   . GLU A 1 26  ? 13.024  18.005  110.301 1.00 24.84 ? 913  GLU A O   1 
ATOM   186  C  CB  . GLU A 1 26  ? 13.450  17.809  113.508 1.00 23.05 ? 913  GLU A CB  1 
ATOM   187  C  CG  . GLU A 1 26  ? 13.370  19.323  113.277 1.00 33.34 ? 913  GLU A CG  1 
ATOM   188  C  CD  . GLU A 1 26  ? 14.246  20.120  114.222 1.00 25.07 ? 913  GLU A CD  1 
ATOM   189  O  OE1 . GLU A 1 26  ? 14.615  21.229  113.841 1.00 14.01 ? 913  GLU A OE1 1 
ATOM   190  O  OE2 . GLU A 1 26  ? 14.560  19.632  115.316 1.00 36.68 ? 913  GLU A OE2 1 
ATOM   191  N  N   . GLU A 1 27  ? 14.389  16.316  110.958 1.00 20.30 ? 914  GLU A N   1 
ATOM   192  C  CA  . GLU A 1 27  ? 15.181  16.394  109.745 1.00 20.13 ? 914  GLU A CA  1 
ATOM   193  C  C   . GLU A 1 27  ? 14.310  16.086  108.529 1.00 21.53 ? 914  GLU A C   1 
ATOM   194  O  O   . GLU A 1 27  ? 14.304  16.842  107.562 1.00 24.22 ? 914  GLU A O   1 
ATOM   195  C  CB  . GLU A 1 27  ? 16.422  15.494  109.815 1.00 21.20 ? 914  GLU A CB  1 
ATOM   196  C  CG  . GLU A 1 27  ? 17.296  15.624  108.587 1.00 18.26 ? 914  GLU A CG  1 
ATOM   197  C  CD  . GLU A 1 27  ? 18.727  15.156  108.795 1.00 19.16 ? 914  GLU A CD  1 
ATOM   198  O  OE1 . GLU A 1 27  ? 19.478  15.887  109.495 1.00 20.88 ? 914  GLU A OE1 1 
ATOM   199  O  OE2 . GLU A 1 27  ? 19.089  14.069  108.236 1.00 20.33 ? 914  GLU A OE2 1 
ATOM   200  N  N   . TYR A 1 28  ? 13.555  14.991  108.599 1.00 25.79 ? 915  TYR A N   1 
ATOM   201  C  CA  . TYR A 1 28  ? 12.617  14.649  107.536 1.00 26.35 ? 915  TYR A CA  1 
ATOM   202  C  C   . TYR A 1 28  ? 11.620  15.798  107.281 1.00 23.24 ? 915  TYR A C   1 
ATOM   203  O  O   . TYR A 1 28  ? 11.319  16.123  106.133 1.00 22.88 ? 915  TYR A O   1 
ATOM   204  C  CB  . TYR A 1 28  ? 11.855  13.357  107.868 1.00 28.40 ? 915  TYR A CB  1 
ATOM   205  C  CG  . TYR A 1 28  ? 10.969  12.895  106.737 1.00 19.69 ? 915  TYR A CG  1 
ATOM   206  C  CD1 . TYR A 1 28  ? 11.531  12.407  105.579 1.00 21.84 ? 915  TYR A CD1 1 
ATOM   207  C  CD2 . TYR A 1 28  ? 9.570   12.963  106.820 1.00 33.84 ? 915  TYR A CD2 1 
ATOM   208  C  CE1 . TYR A 1 28  ? 10.758  11.958  104.535 1.00 30.72 ? 915  TYR A CE1 1 
ATOM   209  C  CE2 . TYR A 1 28  ? 8.772   12.520  105.735 1.00 25.49 ? 915  TYR A CE2 1 
ATOM   210  C  CZ  . TYR A 1 28  ? 9.390   12.032  104.613 1.00 28.15 ? 915  TYR A CZ  1 
ATOM   211  O  OH  . TYR A 1 28  ? 8.680   11.593  103.514 1.00 44.16 ? 915  TYR A OH  1 
ATOM   212  N  N   . GLU A 1 29  ? 11.133  16.418  108.348 1.00 25.82 ? 916  GLU A N   1 
ATOM   213  C  CA  . GLU A 1 29  ? 10.169  17.506  108.205 1.00 27.67 ? 916  GLU A CA  1 
ATOM   214  C  C   . GLU A 1 29  ? 10.776  18.746  107.552 1.00 27.77 ? 916  GLU A C   1 
ATOM   215  O  O   . GLU A 1 29  ? 10.046  19.605  107.071 1.00 29.73 ? 916  GLU A O   1 
ATOM   216  C  CB  . GLU A 1 29  ? 9.509   17.827  109.549 1.00 27.78 ? 916  GLU A CB  1 
ATOM   217  C  CG  . GLU A 1 29  ? 8.452   16.765  109.925 1.00 28.45 ? 916  GLU A CG  1 
ATOM   218  C  CD  . GLU A 1 29  ? 7.848   16.934  111.304 1.00 36.23 ? 916  GLU A CD  1 
ATOM   219  O  OE1 . GLU A 1 29  ? 8.143   17.932  111.989 1.00 31.80 ? 916  GLU A OE1 1 
ATOM   220  O  OE2 . GLU A 1 29  ? 7.071   16.041  111.707 1.00 52.25 ? 916  GLU A OE2 1 
ATOM   221  N  N   . ALA A 1 30  ? 12.104  18.805  107.489 1.00 30.00 ? 917  ALA A N   1 
ATOM   222  C  CA  . ALA A 1 30  ? 12.802  19.918  106.861 1.00 26.93 ? 917  ALA A CA  1 
ATOM   223  C  C   . ALA A 1 30  ? 12.967  19.737  105.361 1.00 26.60 ? 917  ALA A C   1 
ATOM   224  O  O   . ALA A 1 30  ? 13.256  20.702  104.674 1.00 26.08 ? 917  ALA A O   1 
ATOM   225  C  CB  . ALA A 1 30  ? 14.155  20.133  107.521 1.00 19.82 ? 917  ALA A CB  1 
ATOM   226  N  N   . LEU A 1 31  ? 12.802  18.513  104.845 1.00 22.17 ? 918  LEU A N   1 
ATOM   227  C  CA  . LEU A 1 31  ? 12.862  18.278  103.400 1.00 24.57 ? 918  LEU A CA  1 
ATOM   228  C  C   . LEU A 1 31  ? 11.703  19.013  102.705 1.00 32.97 ? 918  LEU A C   1 
ATOM   229  O  O   . LEU A 1 31  ? 10.622  19.163  103.280 1.00 32.88 ? 918  LEU A O   1 
ATOM   230  C  CB  . LEU A 1 31  ? 12.822  16.760  103.106 1.00 25.15 ? 918  LEU A CB  1 
ATOM   231  C  CG  . LEU A 1 31  ? 14.030  15.960  103.622 1.00 29.08 ? 918  LEU A CG  1 
ATOM   232  C  CD1 . LEU A 1 31  ? 13.763  14.463  103.708 1.00 22.16 ? 918  LEU A CD1 1 
ATOM   233  C  CD2 . LEU A 1 31  ? 15.274  16.224  102.778 1.00 27.05 ? 918  LEU A CD2 1 
ATOM   234  N  N   . PRO A 1 32  ? 11.917  19.496  101.473 1.00 32.51 ? 919  PRO A N   1 
ATOM   235  C  CA  . PRO A 1 32  ? 10.803  20.232  100.842 1.00 31.25 ? 919  PRO A CA  1 
ATOM   236  C  C   . PRO A 1 32  ? 9.711   19.265  100.432 1.00 35.35 ? 919  PRO A C   1 
ATOM   237  O  O   . PRO A 1 32  ? 9.997   18.299  99.728  1.00 34.80 ? 919  PRO A O   1 
ATOM   238  C  CB  . PRO A 1 32  ? 11.449  20.866  99.614  1.00 32.90 ? 919  PRO A CB  1 
ATOM   239  C  CG  . PRO A 1 32  ? 12.616  19.977  99.283  1.00 45.43 ? 919  PRO A CG  1 
ATOM   240  C  CD  . PRO A 1 32  ? 13.109  19.426  100.606 1.00 35.43 ? 919  PRO A CD  1 
ATOM   241  N  N   . GLU A 1 33  ? 8.479   19.500  100.878 1.00 33.63 ? 920  GLU A N   1 
ATOM   242  C  CA  . GLU A 1 33  ? 7.366   18.576  100.598 1.00 37.71 ? 920  GLU A CA  1 
ATOM   243  C  C   . GLU A 1 33  ? 6.549   19.095  99.429  1.00 32.26 ? 920  GLU A C   1 
ATOM   244  O  O   . GLU A 1 33  ? 6.352   20.301  99.283  1.00 27.67 ? 920  GLU A O   1 
ATOM   245  C  CB  . GLU A 1 33  ? 6.465   18.418  101.832 1.00 45.06 ? 920  GLU A CB  1 
ATOM   246  N  N   . GLY A 1 34  ? 6.098   18.195  98.568  1.00 31.78 ? 921  GLY A N   1 
ATOM   247  C  CA  . GLY A 1 34  ? 5.191   18.578  97.486  1.00 32.12 ? 921  GLY A CA  1 
ATOM   248  C  C   . GLY A 1 34  ? 5.870   19.393  96.399  1.00 33.36 ? 921  GLY A C   1 
ATOM   249  O  O   . GLY A 1 34  ? 7.108   19.368  96.252  1.00 30.60 ? 921  GLY A O   1 
ATOM   250  N  N   . GLN A 1 35  ? 5.054   20.132  95.649  1.00 33.88 ? 922  GLN A N   1 
ATOM   251  C  CA  . GLN A 1 35  ? 5.504   20.801  94.442  1.00 33.57 ? 922  GLN A CA  1 
ATOM   252  C  C   . GLN A 1 35  ? 6.432   21.962  94.799  1.00 32.67 ? 922  GLN A C   1 
ATOM   253  O  O   . GLN A 1 35  ? 6.054   22.857  95.561  1.00 32.22 ? 922  GLN A O   1 
ATOM   254  C  CB  . GLN A 1 35  ? 4.302   21.308  93.641  1.00 37.70 ? 922  GLN A CB  1 
ATOM   255  C  CG  . GLN A 1 35  ? 4.658   21.900  92.272  1.00 25.79 ? 922  GLN A CG  1 
ATOM   256  C  CD  . GLN A 1 35  ? 3.454   22.475  91.553  1.00 35.24 ? 922  GLN A CD  1 
ATOM   257  O  OE1 . GLN A 1 35  ? 2.337   22.460  92.075  1.00 37.64 ? 922  GLN A OE1 1 
ATOM   258  N  NE2 . GLN A 1 35  ? 3.674   22.990  90.351  1.00 26.34 ? 922  GLN A NE2 1 
ATOM   259  N  N   . THR A 1 36  ? 7.637   21.932  94.240  1.00 27.24 ? 923  THR A N   1 
ATOM   260  C  CA  . THR A 1 36  ? 8.624   22.992  94.437  1.00 27.18 ? 923  THR A CA  1 
ATOM   261  C  C   . THR A 1 36  ? 9.056   23.634  93.111  1.00 29.56 ? 923  THR A C   1 
ATOM   262  O  O   . THR A 1 36  ? 9.890   24.550  93.108  1.00 31.73 ? 923  THR A O   1 
ATOM   263  C  CB  . THR A 1 36  ? 9.877   22.425  95.133  1.00 40.35 ? 923  THR A CB  1 
ATOM   264  O  OG1 . THR A 1 36  ? 10.571  21.548  94.231  1.00 33.88 ? 923  THR A OG1 1 
ATOM   265  C  CG2 . THR A 1 36  ? 9.487   21.661  96.420  1.00 32.80 ? 923  THR A CG2 1 
ATOM   266  N  N   . ALA A 1 37  ? 8.493   23.145  91.999  1.00 27.36 ? 924  ALA A N   1 
ATOM   267  C  CA  . ALA A 1 37  ? 8.800   23.627  90.651  1.00 29.09 ? 924  ALA A CA  1 
ATOM   268  C  C   . ALA A 1 37  ? 7.605   23.351  89.739  1.00 28.07 ? 924  ALA A C   1 
ATOM   269  O  O   . ALA A 1 37  ? 6.687   22.609  90.110  1.00 25.88 ? 924  ALA A O   1 
ATOM   270  C  CB  . ALA A 1 37  ? 10.046  22.944  90.095  1.00 28.33 ? 924  ALA A CB  1 
ATOM   271  N  N   . SER A 1 38  ? 7.635   23.959  88.556  1.00 25.27 ? 925  SER A N   1 
ATOM   272  C  CA  . SER A 1 38  ? 6.542   23.877  87.594  1.00 26.06 ? 925  SER A CA  1 
ATOM   273  C  C   . SER A 1 38  ? 6.468   22.501  86.982  1.00 27.54 ? 925  SER A C   1 
ATOM   274  O  O   . SER A 1 38  ? 7.499   21.849  86.765  1.00 29.36 ? 925  SER A O   1 
ATOM   275  C  CB  . SER A 1 38  ? 6.714   24.917  86.458  1.00 31.38 ? 925  SER A CB  1 
ATOM   276  O  OG  . SER A 1 38  ? 7.734   24.529  85.542  1.00 33.14 ? 925  SER A OG  1 
ATOM   277  N  N   . TRP A 1 39  ? 5.237   22.073  86.703  1.00 25.76 ? 926  TRP A N   1 
ATOM   278  C  CA  . TRP A 1 39  ? 4.963   20.868  85.936  1.00 23.55 ? 926  TRP A CA  1 
ATOM   279  C  C   . TRP A 1 39  ? 3.817   21.087  84.933  1.00 28.75 ? 926  TRP A C   1 
ATOM   280  O  O   . TRP A 1 39  ? 2.866   20.290  84.851  1.00 29.62 ? 926  TRP A O   1 
ATOM   281  C  CB  . TRP A 1 39  ? 4.695   19.667  86.865  1.00 27.13 ? 926  TRP A CB  1 
ATOM   282  C  CG  . TRP A 1 39  ? 3.712   19.846  87.965  1.00 32.34 ? 926  TRP A CG  1 
ATOM   283  C  CD1 . TRP A 1 39  ? 2.561   20.601  87.959  1.00 20.84 ? 926  TRP A CD1 1 
ATOM   284  C  CD2 . TRP A 1 39  ? 3.764   19.208  89.242  1.00 26.61 ? 926  TRP A CD2 1 
ATOM   285  N  NE1 . TRP A 1 39  ? 1.913   20.473  89.164  1.00 34.21 ? 926  TRP A NE1 1 
ATOM   286  C  CE2 . TRP A 1 39  ? 2.631   19.629  89.971  1.00 39.05 ? 926  TRP A CE2 1 
ATOM   287  C  CE3 . TRP A 1 39  ? 4.676   18.339  89.851  1.00 25.93 ? 926  TRP A CE3 1 
ATOM   288  C  CZ2 . TRP A 1 39  ? 2.379   19.201  91.280  1.00 38.13 ? 926  TRP A CZ2 1 
ATOM   289  C  CZ3 . TRP A 1 39  ? 4.421   17.908  91.150  1.00 36.57 ? 926  TRP A CZ3 1 
ATOM   290  C  CH2 . TRP A 1 39  ? 3.281   18.341  91.848  1.00 40.57 ? 926  TRP A CH2 1 
ATOM   291  N  N   . ASP A 1 40  ? 3.934   22.164  84.156  1.00 27.31 ? 927  ASP A N   1 
ATOM   292  C  CA  . ASP A 1 40  ? 2.860   22.584  83.259  1.00 30.00 ? 927  ASP A CA  1 
ATOM   293  C  C   . ASP A 1 40  ? 2.503   21.481  82.252  1.00 31.67 ? 927  ASP A C   1 
ATOM   294  O  O   . ASP A 1 40  ? 1.325   21.197  82.033  1.00 27.11 ? 927  ASP A O   1 
ATOM   295  C  CB  . ASP A 1 40  ? 3.238   23.869  82.509  1.00 34.85 ? 927  ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 40  ? 3.476   25.052  83.436  1.00 32.02 ? 927  ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 40  ? 2.755   25.197  84.455  1.00 30.05 ? 927  ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 40  ? 4.388   25.849  83.126  1.00 47.63 ? 927  ASP A OD2 1 
ATOM   299  N  N   . THR A 1 41  ? 3.506   20.842  81.656  1.00 27.83 ? 928  THR A N   1 
ATOM   300  C  CA  . THR A 1 41  ? 3.229   19.834  80.639  1.00 29.15 ? 928  THR A CA  1 
ATOM   301  C  C   . THR A 1 41  ? 2.514   18.628  81.243  1.00 28.34 ? 928  THR A C   1 
ATOM   302  O  O   . THR A 1 41  ? 1.533   18.150  80.670  1.00 24.02 ? 928  THR A O   1 
ATOM   303  C  CB  . THR A 1 41  ? 4.508   19.393  79.887  1.00 34.16 ? 928  THR A CB  1 
ATOM   304  O  OG1 . THR A 1 41  ? 4.971   20.485  79.084  1.00 33.07 ? 928  THR A OG1 1 
ATOM   305  C  CG2 . THR A 1 41  ? 4.232   18.196  78.988  1.00 29.97 ? 928  THR A CG2 1 
ATOM   306  N  N   . ALA A 1 42  ? 2.993   18.183  82.408  1.00 29.63 ? 929  ALA A N   1 
ATOM   307  C  CA  . ALA A 1 42  ? 2.457   17.000  83.111  1.00 31.87 ? 929  ALA A CA  1 
ATOM   308  C  C   . ALA A 1 42  ? 0.980   17.167  83.413  1.00 33.23 ? 929  ALA A C   1 
ATOM   309  O  O   . ALA A 1 42  ? 0.224   16.195  83.336  1.00 34.18 ? 929  ALA A O   1 
ATOM   310  C  CB  . ALA A 1 42  ? 3.229   16.736  84.419  1.00 29.95 ? 929  ALA A CB  1 
ATOM   311  N  N   . LYS A 1 43  ? 0.591   18.404  83.749  1.00 28.40 ? 930  LYS A N   1 
ATOM   312  C  CA  . LYS A 1 43  ? -0.781  18.741  84.157  1.00 23.62 ? 930  LYS A CA  1 
ATOM   313  C  C   . LYS A 1 43  ? -1.656  19.162  82.973  1.00 26.84 ? 930  LYS A C   1 
ATOM   314  O  O   . LYS A 1 43  ? -2.780  19.622  83.167  1.00 28.29 ? 930  LYS A O   1 
ATOM   315  C  CB  . LYS A 1 43  ? -0.752  19.839  85.222  1.00 21.90 ? 930  LYS A CB  1 
ATOM   316  C  CG  . LYS A 1 43  ? -0.070  21.110  84.777  1.00 36.35 ? 930  LYS A CG  1 
ATOM   317  N  N   . GLU A 1 44  ? -1.154  18.995  81.747  1.00 27.15 ? 931  GLU A N   1 
ATOM   318  C  CA  . GLU A 1 44  ? -1.988  19.170  80.549  1.00 30.27 ? 931  GLU A CA  1 
ATOM   319  C  C   . GLU A 1 44  ? -3.089  18.106  80.541  1.00 28.31 ? 931  GLU A C   1 
ATOM   320  O  O   . GLU A 1 44  ? -2.823  16.933  80.794  1.00 28.63 ? 931  GLU A O   1 
ATOM   321  C  CB  . GLU A 1 44  ? -1.163  19.057  79.258  1.00 32.64 ? 931  GLU A CB  1 
ATOM   322  C  CG  . GLU A 1 44  ? -0.316  20.291  78.919  1.00 22.92 ? 931  GLU A CG  1 
ATOM   323  C  CD  . GLU A 1 44  ? -1.130  21.350  78.232  1.00 41.36 ? 931  GLU A CD  1 
ATOM   324  O  OE1 . GLU A 1 44  ? -1.757  22.160  78.940  1.00 49.79 ? 931  GLU A OE1 1 
ATOM   325  O  OE2 . GLU A 1 44  ? -1.159  21.363  76.982  1.00 53.03 ? 931  GLU A OE2 1 
ATOM   326  N  N   . ASP A 1 45  ? -4.315  18.535  80.240  1.00 29.52 ? 932  ASP A N   1 
ATOM   327  C  CA  . ASP A 1 45  ? -5.474  17.648  80.160  1.00 27.30 ? 932  ASP A CA  1 
ATOM   328  C  C   . ASP A 1 45  ? -5.144  16.396  79.372  1.00 28.40 ? 932  ASP A C   1 
ATOM   329  O  O   . ASP A 1 45  ? -5.444  15.283  79.813  1.00 31.99 ? 932  ASP A O   1 
ATOM   330  C  CB  . ASP A 1 45  ? -6.671  18.390  79.531  1.00 26.74 ? 932  ASP A CB  1 
ATOM   331  C  CG  . ASP A 1 45  ? -7.293  19.412  80.480  1.00 23.47 ? 932  ASP A CG  1 
ATOM   332  O  OD1 . ASP A 1 45  ? -7.041  19.335  81.700  1.00 38.67 ? 932  ASP A OD1 1 
ATOM   333  O  OD2 . ASP A 1 45  ? -8.048  20.289  80.018  1.00 29.79 ? 932  ASP A OD2 1 
ATOM   334  N  N   . GLU A 1 46  ? -4.457  16.576  78.245  1.00 31.28 ? 933  GLU A N   1 
ATOM   335  C  CA  . GLU A 1 46  ? -4.107  15.474  77.343  1.00 26.30 ? 933  GLU A CA  1 
ATOM   336  C  C   . GLU A 1 46  ? -3.123  14.460  77.934  1.00 28.65 ? 933  GLU A C   1 
ATOM   337  O  O   . GLU A 1 46  ? -2.925  13.398  77.353  1.00 30.95 ? 933  GLU A O   1 
ATOM   338  C  CB  . GLU A 1 46  ? -3.540  16.025  76.033  1.00 27.75 ? 933  GLU A CB  1 
ATOM   339  N  N   . ASN A 1 47  ? -2.504  14.804  79.070  1.00 25.90 ? 934  ASN A N   1 
ATOM   340  C  CA  . ASN A 1 47  ? -1.547  13.932  79.752  1.00 26.95 ? 934  ASN A CA  1 
ATOM   341  C  C   . ASN A 1 47  ? -2.051  13.385  81.080  1.00 25.77 ? 934  ASN A C   1 
ATOM   342  O  O   . ASN A 1 47  ? -1.345  12.613  81.727  1.00 24.04 ? 934  ASN A O   1 
ATOM   343  C  CB  . ASN A 1 47  ? -0.225  14.672  79.978  1.00 34.07 ? 934  ASN A CB  1 
ATOM   344  C  CG  . ASN A 1 47  ? 0.480   15.005  78.676  1.00 20.96 ? 934  ASN A CG  1 
ATOM   345  O  OD1 . ASN A 1 47  ? 0.485   14.201  77.742  1.00 28.48 ? 934  ASN A OD1 1 
ATOM   346  N  ND2 . ASN A 1 47  ? 1.068   16.199  78.605  1.00 36.80 ? 934  ASN A ND2 1 
ATOM   347  N  N   . ARG A 1 48  ? -3.272  13.750  81.481  1.00 22.55 ? 935  ARG A N   1 
ATOM   348  C  CA  . ARG A 1 48  ? -3.832  13.269  82.753  1.00 28.90 ? 935  ARG A CA  1 
ATOM   349  C  C   . ARG A 1 48  ? -3.827  11.737  82.861  1.00 28.24 ? 935  ARG A C   1 
ATOM   350  O  O   . ARG A 1 48  ? -3.542  11.191  83.926  1.00 32.84 ? 935  ARG A O   1 
ATOM   351  C  CB  . ARG A 1 48  ? -5.258  13.792  82.946  1.00 24.27 ? 935  ARG A CB  1 
ATOM   352  C  CG  . ARG A 1 48  ? -5.859  13.503  84.319  1.00 36.63 ? 935  ARG A CG  1 
ATOM   353  N  N   . ASN A 1 49  ? -4.135  11.054  81.759  1.00 27.57 ? 936  ASN A N   1 
ATOM   354  C  CA  . ASN A 1 49  ? -4.274  9.595   81.768  1.00 25.13 ? 936  ASN A CA  1 
ATOM   355  C  C   . ASN A 1 49  ? -2.955  8.879   81.622  1.00 30.74 ? 936  ASN A C   1 
ATOM   356  O  O   . ASN A 1 49  ? -2.905  7.641   81.604  1.00 31.19 ? 936  ASN A O   1 
ATOM   357  C  CB  . ASN A 1 49  ? -5.225  9.150   80.657  1.00 29.85 ? 936  ASN A CB  1 
ATOM   358  C  CG  . ASN A 1 49  ? -6.564  9.874   80.719  1.00 35.54 ? 936  ASN A CG  1 
ATOM   359  O  OD1 . ASN A 1 49  ? -7.024  10.259  81.800  1.00 33.44 ? 936  ASN A OD1 1 
ATOM   360  N  ND2 . ASN A 1 49  ? -7.186  10.078  79.563  1.00 54.30 ? 936  ASN A ND2 1 
ATOM   361  N  N   . LYS A 1 50  ? -1.880  9.655   81.524  1.00 26.52 ? 937  LYS A N   1 
ATOM   362  C  CA  . LYS A 1 50  ? -0.525  9.097   81.503  1.00 24.13 ? 937  LYS A CA  1 
ATOM   363  C  C   . LYS A 1 50  ? 0.165   9.169   82.867  1.00 24.18 ? 937  LYS A C   1 
ATOM   364  O  O   . LYS A 1 50  ? 1.343   8.772   82.995  1.00 22.63 ? 937  LYS A O   1 
ATOM   365  C  CB  . LYS A 1 50  ? 0.307   9.854   80.461  1.00 26.32 ? 937  LYS A CB  1 
ATOM   366  C  CG  . LYS A 1 50  ? -0.281  9.829   79.043  1.00 32.11 ? 937  LYS A CG  1 
ATOM   367  C  CD  . LYS A 1 50  ? 0.516   10.743  78.107  1.00 35.90 ? 937  LYS A CD  1 
ATOM   368  C  CE  . LYS A 1 50  ? -0.188  10.938  76.772  1.00 29.16 ? 937  LYS A CE  1 
ATOM   369  N  NZ  . LYS A 1 50  ? 0.554   11.851  75.872  1.00 23.55 ? 937  LYS A NZ  1 
ATOM   370  N  N   . ASN A 1 51  ? -0.544  9.705   83.866  1.00 26.87 ? 938  ASN A N   1 
ATOM   371  C  CA  . ASN A 1 51  ? -0.031  9.856   85.211  1.00 24.77 ? 938  ASN A CA  1 
ATOM   372  C  C   . ASN A 1 51  ? -0.775  8.953   86.150  1.00 27.59 ? 938  ASN A C   1 
ATOM   373  O  O   . ASN A 1 51  ? -1.995  9.043   86.255  1.00 25.33 ? 938  ASN A O   1 
ATOM   374  C  CB  . ASN A 1 51  ? -0.183  11.294  85.710  1.00 31.29 ? 938  ASN A CB  1 
ATOM   375  C  CG  . ASN A 1 51  ? 0.655   12.276  84.926  1.00 43.01 ? 938  ASN A CG  1 
ATOM   376  O  OD1 . ASN A 1 51  ? 1.813   11.997  84.628  1.00 26.98 ? 938  ASN A OD1 1 
ATOM   377  N  ND2 . ASN A 1 51  ? 0.076   13.435  84.585  1.00 27.80 ? 938  ASN A ND2 1 
ATOM   378  N  N   . ARG A 1 52  ? -0.038  8.124   86.874  1.00 28.08 ? 939  ARG A N   1 
ATOM   379  C  CA  . ARG A 1 52  ? -0.651  7.154   87.792  1.00 34.44 ? 939  ARG A CA  1 
ATOM   380  C  C   . ARG A 1 52  ? -1.185  7.834   89.052  1.00 27.77 ? 939  ARG A C   1 
ATOM   381  O  O   . ARG A 1 52  ? -2.342  7.628   89.428  1.00 30.37 ? 939  ARG A O   1 
ATOM   382  C  CB  . ARG A 1 52  ? 0.362   6.062   88.153  1.00 29.70 ? 939  ARG A CB  1 
ATOM   383  C  CG  . ARG A 1 52  ? -0.195  4.970   89.067  1.00 37.26 ? 939  ARG A CG  1 
ATOM   384  C  CD  . ARG A 1 52  ? 0.887   3.939   89.378  1.00 49.66 ? 939  ARG A CD  1 
ATOM   385  N  NE  . ARG A 1 52  ? 1.110   3.027   88.257  1.00 34.64 ? 939  ARG A NE  1 
ATOM   386  C  CZ  . ARG A 1 52  ? 0.268   2.045   87.935  1.00 41.22 ? 939  ARG A CZ  1 
ATOM   387  N  NH1 . ARG A 1 52  ? -0.824  1.839   88.648  1.00 32.60 ? 939  ARG A NH1 1 
ATOM   388  N  NH2 . ARG A 1 52  ? 0.520   1.256   86.901  1.00 34.18 ? 939  ARG A NH2 1 
ATOM   389  N  N   . TYR A 1 53  ? -0.336  8.641   89.702  1.00 31.96 ? 940  TYR A N   1 
ATOM   390  C  CA  . TYR A 1 53  ? -0.729  9.412   90.888  1.00 30.03 ? 940  TYR A CA  1 
ATOM   391  C  C   . TYR A 1 53  ? -0.645  10.922  90.592  1.00 33.28 ? 940  TYR A C   1 
ATOM   392  O  O   . TYR A 1 53  ? 0.435   11.452  90.287  1.00 30.56 ? 940  TYR A O   1 
ATOM   393  C  CB  . TYR A 1 53  ? 0.168   9.044   92.072  1.00 42.51 ? 940  TYR A CB  1 
ATOM   394  N  N   . GLY A 1 54  ? -1.780  11.620  90.710  1.00 35.72 ? 941  GLY A N   1 
ATOM   395  C  CA  . GLY A 1 54  ? -1.873  13.048  90.351  1.00 30.37 ? 941  GLY A CA  1 
ATOM   396  C  C   . GLY A 1 54  ? -0.897  13.979  91.065  1.00 33.20 ? 941  GLY A C   1 
ATOM   397  O  O   . GLY A 1 54  ? -0.589  15.080  90.565  1.00 36.45 ? 941  GLY A O   1 
ATOM   398  N  N   . ASN A 1 55  ? -0.399  13.532  92.216  1.00 31.73 ? 942  ASN A N   1 
ATOM   399  C  CA  . ASN A 1 55  ? 0.481   14.333  93.067  1.00 35.68 ? 942  ASN A CA  1 
ATOM   400  C  C   . ASN A 1 55  ? 1.951   14.145  92.749  1.00 28.04 ? 942  ASN A C   1 
ATOM   401  O  O   . ASN A 1 55  ? 2.767   15.002  93.086  1.00 28.51 ? 942  ASN A O   1 
ATOM   402  C  CB  . ASN A 1 55  ? 0.246   13.996  94.554  1.00 40.33 ? 942  ASN A CB  1 
ATOM   403  C  CG  . ASN A 1 55  ? -0.829  14.865  95.196  1.00 53.57 ? 942  ASN A CG  1 
ATOM   404  O  OD1 . ASN A 1 55  ? -1.622  15.521  94.507  1.00 48.73 ? 942  ASN A OD1 1 
ATOM   405  N  ND2 . ASN A 1 55  ? -0.863  14.868  96.531  1.00 47.52 ? 942  ASN A ND2 1 
ATOM   406  N  N   . ILE A 1 56  ? 2.282   13.009  92.137  1.00 27.84 ? 943  ILE A N   1 
ATOM   407  C  CA  . ILE A 1 56  ? 3.651   12.672  91.804  1.00 26.30 ? 943  ILE A CA  1 
ATOM   408  C  C   . ILE A 1 56  ? 3.722   12.690  90.304  1.00 27.61 ? 943  ILE A C   1 
ATOM   409  O  O   . ILE A 1 56  ? 3.578   11.660  89.640  1.00 27.33 ? 943  ILE A O   1 
ATOM   410  C  CB  . ILE A 1 56  ? 4.068   11.279  92.346  1.00 29.94 ? 943  ILE A CB  1 
ATOM   411  C  CG1 . ILE A 1 56  ? 3.715   11.154  93.841  1.00 42.83 ? 943  ILE A CG1 1 
ATOM   412  C  CG2 . ILE A 1 56  ? 5.553   11.044  92.097  1.00 28.20 ? 943  ILE A CG2 1 
ATOM   413  C  CD1 . ILE A 1 56  ? 4.362   12.209  94.728  1.00 39.99 ? 943  ILE A CD1 1 
ATOM   414  N  N   . ILE A 1 57  ? 3.881   13.891  89.763  1.00 28.37 ? 944  ILE A N   1 
ATOM   415  C  CA  . ILE A 1 57  ? 3.984   14.065  88.323  1.00 24.10 ? 944  ILE A CA  1 
ATOM   416  C  C   . ILE A 1 57  ? 5.260   14.846  87.992  1.00 29.15 ? 944  ILE A C   1 
ATOM   417  O  O   . ILE A 1 57  ? 5.954   15.355  88.887  1.00 32.87 ? 944  ILE A O   1 
ATOM   418  C  CB  . ILE A 1 57  ? 2.685   14.668  87.726  1.00 36.22 ? 944  ILE A CB  1 
ATOM   419  C  CG1 . ILE A 1 57  ? 2.428   16.094  88.238  1.00 33.13 ? 944  ILE A CG1 1 
ATOM   420  C  CG2 . ILE A 1 57  ? 1.498   13.736  88.059  1.00 27.36 ? 944  ILE A CG2 1 
ATOM   421  C  CD1 . ILE A 1 57  ? 1.137   16.747  87.697  1.00 29.46 ? 944  ILE A CD1 1 
ATOM   422  N  N   . SER A 1 58  ? 5.564   14.946  86.704  1.00 29.11 ? 945  SER A N   1 
ATOM   423  C  CA  . SER A 1 58  ? 6.905   15.300  86.281  1.00 29.29 ? 945  SER A CA  1 
ATOM   424  C  C   . SER A 1 58  ? 7.158   16.821  86.186  1.00 27.64 ? 945  SER A C   1 
ATOM   425  O  O   . SER A 1 58  ? 6.472   17.533  85.446  1.00 27.53 ? 945  SER A O   1 
ATOM   426  C  CB  . SER A 1 58  ? 7.196   14.588  84.955  1.00 28.68 ? 945  SER A CB  1 
ATOM   427  O  OG  . SER A 1 58  ? 8.530   14.790  84.565  1.00 43.05 ? 945  SER A OG  1 
ATOM   428  N  N   . TYR A 1 59  ? 8.159   17.308  86.930  1.00 26.08 ? 946  TYR A N   1 
ATOM   429  C  CA  . TYR A 1 59  ? 8.609   18.711  86.806  1.00 22.93 ? 946  TYR A CA  1 
ATOM   430  C  C   . TYR A 1 59  ? 9.181   18.977  85.417  1.00 26.89 ? 946  TYR A C   1 
ATOM   431  O  O   . TYR A 1 59  ? 9.942   18.182  84.901  1.00 28.65 ? 946  TYR A O   1 
ATOM   432  C  CB  . TYR A 1 59  ? 9.715   19.065  87.803  1.00 26.13 ? 946  TYR A CB  1 
ATOM   433  C  CG  . TYR A 1 59  ? 9.352   19.065  89.273  1.00 20.90 ? 946  TYR A CG  1 
ATOM   434  C  CD1 . TYR A 1 59  ? 8.158   19.628  89.717  1.00 27.59 ? 946  TYR A CD1 1 
ATOM   435  C  CD2 . TYR A 1 59  ? 10.238  18.547  90.224  1.00 27.50 ? 946  TYR A CD2 1 
ATOM   436  C  CE1 . TYR A 1 59  ? 7.838   19.653  91.039  1.00 27.23 ? 946  TYR A CE1 1 
ATOM   437  C  CE2 . TYR A 1 59  ? 9.929   18.568  91.568  1.00 29.42 ? 946  TYR A CE2 1 
ATOM   438  C  CZ  . TYR A 1 59  ? 8.716   19.124  91.972  1.00 29.48 ? 946  TYR A CZ  1 
ATOM   439  O  OH  . TYR A 1 59  ? 8.372   19.168  93.301  1.00 32.31 ? 946  TYR A OH  1 
ATOM   440  N  N   . ASP A 1 60  ? 8.858   20.137  84.863  1.00 23.98 ? 947  ASP A N   1 
ATOM   441  C  CA  . ASP A 1 60  ? 9.233   20.507  83.492  1.00 27.47 ? 947  ASP A CA  1 
ATOM   442  C  C   . ASP A 1 60  ? 10.741  20.524  83.302  1.00 25.67 ? 947  ASP A C   1 
ATOM   443  O  O   . ASP A 1 60  ? 11.245  20.034  82.277  1.00 30.09 ? 947  ASP A O   1 
ATOM   444  C  CB  . ASP A 1 60  ? 8.681   21.896  83.145  1.00 34.64 ? 947  ASP A CB  1 
ATOM   445  C  CG  . ASP A 1 60  ? 7.167   21.922  83.032  1.00 40.10 ? 947  ASP A CG  1 
ATOM   446  O  OD1 . ASP A 1 60  ? 6.615   21.103  82.260  1.00 35.93 ? 947  ASP A OD1 1 
ATOM   447  O  OD2 . ASP A 1 60  ? 6.536   22.780  83.699  1.00 44.32 ? 947  ASP A OD2 1 
ATOM   448  N  N   . HIS A 1 61  ? 11.461  21.053  84.292  1.00 27.34 ? 948  HIS A N   1 
ATOM   449  C  CA  . HIS A 1 61  ? 12.896  21.300  84.118  1.00 27.26 ? 948  HIS A CA  1 
ATOM   450  C  C   . HIS A 1 61  ? 13.653  19.999  83.890  1.00 28.61 ? 948  HIS A C   1 
ATOM   451  O  O   . HIS A 1 61  ? 14.579  19.964  83.093  1.00 29.30 ? 948  HIS A O   1 
ATOM   452  C  CB  . HIS A 1 61  ? 13.503  22.138  85.264  1.00 25.92 ? 948  HIS A CB  1 
ATOM   453  C  CG  . HIS A 1 61  ? 13.531  21.453  86.596  1.00 30.75 ? 948  HIS A CG  1 
ATOM   454  N  ND1 . HIS A 1 61  ? 12.475  21.497  87.480  1.00 29.88 ? 948  HIS A ND1 1 
ATOM   455  C  CD2 . HIS A 1 61  ? 14.501  20.731  87.207  1.00 42.27 ? 948  HIS A CD2 1 
ATOM   456  C  CE1 . HIS A 1 61  ? 12.789  20.826  88.575  1.00 39.04 ? 948  HIS A CE1 1 
ATOM   457  N  NE2 . HIS A 1 61  ? 14.013  20.350  88.436  1.00 43.97 ? 948  HIS A NE2 1 
ATOM   458  N  N   . SER A 1 62  ? 13.183  18.919  84.520  1.00 25.86 ? 949  SER A N   1 
ATOM   459  C  CA  . SER A 1 62  ? 13.907  17.667  84.563  1.00 24.27 ? 949  SER A CA  1 
ATOM   460  C  C   . SER A 1 62  ? 13.209  16.538  83.805  1.00 26.28 ? 949  SER A C   1 
ATOM   461  O  O   . SER A 1 62  ? 13.706  15.415  83.786  1.00 25.69 ? 949  SER A O   1 
ATOM   462  C  CB  . SER A 1 62  ? 14.072  17.265  86.017  1.00 22.94 ? 949  SER A CB  1 
ATOM   463  O  OG  . SER A 1 62  ? 12.806  17.099  86.616  1.00 21.85 ? 949  SER A OG  1 
ATOM   464  N  N   . ARG A 1 63  ? 12.073  16.815  83.157  1.00 25.59 ? 950  ARG A N   1 
ATOM   465  C  CA  . ARG A 1 63  ? 11.277  15.712  82.617  1.00 29.24 ? 950  ARG A CA  1 
ATOM   466  C  C   . ARG A 1 63  ? 11.944  15.103  81.385  1.00 29.94 ? 950  ARG A C   1 
ATOM   467  O  O   . ARG A 1 63  ? 12.636  15.800  80.629  1.00 26.20 ? 950  ARG A O   1 
ATOM   468  C  CB  . ARG A 1 63  ? 9.839   16.126  82.310  1.00 27.30 ? 950  ARG A CB  1 
ATOM   469  C  CG  . ARG A 1 63  ? 9.660   16.899  81.084  1.00 24.85 ? 950  ARG A CG  1 
ATOM   470  C  CD  . ARG A 1 63  ? 8.167   17.078  80.766  1.00 36.59 ? 950  ARG A CD  1 
ATOM   471  N  NE  . ARG A 1 63  ? 7.993   17.909  79.573  1.00 29.73 ? 950  ARG A NE  1 
ATOM   472  C  CZ  . ARG A 1 63  ? 7.701   17.469  78.348  1.00 24.54 ? 950  ARG A CZ  1 
ATOM   473  N  NH1 . ARG A 1 63  ? 7.505   16.182  78.100  1.00 32.85 ? 950  ARG A NH1 1 
ATOM   474  N  NH2 . ARG A 1 63  ? 7.595   18.332  77.353  1.00 26.08 ? 950  ARG A NH2 1 
ATOM   475  N  N   . VAL A 1 64  ? 11.729  13.800  81.199  1.00 25.55 ? 951  VAL A N   1 
ATOM   476  C  CA  . VAL A 1 64  ? 12.254  13.072  80.039  1.00 28.40 ? 951  VAL A CA  1 
ATOM   477  C  C   . VAL A 1 64  ? 11.290  13.367  78.894  1.00 30.34 ? 951  VAL A C   1 
ATOM   478  O  O   . VAL A 1 64  ? 10.121  13.011  78.957  1.00 26.93 ? 951  VAL A O   1 
ATOM   479  C  CB  . VAL A 1 64  ? 12.343  11.534  80.304  1.00 24.35 ? 951  VAL A CB  1 
ATOM   480  C  CG1 . VAL A 1 64  ? 12.859  10.761  79.072  1.00 22.30 ? 951  VAL A CG1 1 
ATOM   481  C  CG2 . VAL A 1 64  ? 13.235  11.242  81.516  1.00 23.49 ? 951  VAL A CG2 1 
ATOM   482  N  N   . ARG A 1 65  ? 11.762  14.066  77.866  1.00 27.06 ? 952  ARG A N   1 
ATOM   483  C  CA  . ARG A 1 65  ? 10.918  14.358  76.709  1.00 26.42 ? 952  ARG A CA  1 
ATOM   484  C  C   . ARG A 1 65  ? 11.047  13.274  75.640  1.00 28.72 ? 952  ARG A C   1 
ATOM   485  O  O   . ARG A 1 65  ? 12.153  12.970  75.212  1.00 27.65 ? 952  ARG A O   1 
ATOM   486  C  CB  . ARG A 1 65  ? 11.301  15.709  76.105  1.00 22.80 ? 952  ARG A CB  1 
ATOM   487  C  CG  . ARG A 1 65  ? 11.086  16.864  77.083  1.00 38.84 ? 952  ARG A CG  1 
ATOM   488  N  N   . LEU A 1 66  ? 9.918   12.720  75.197  1.00 25.54 ? 953  LEU A N   1 
ATOM   489  C  CA  . LEU A 1 66  ? 9.900   11.779  74.061  1.00 27.32 ? 953  LEU A CA  1 
ATOM   490  C  C   . LEU A 1 66  ? 9.790   12.493  72.697  1.00 32.32 ? 953  LEU A C   1 
ATOM   491  O  O   . LEU A 1 66  ? 9.127   13.528  72.567  1.00 29.11 ? 953  LEU A O   1 
ATOM   492  C  CB  . LEU A 1 66  ? 8.727   10.787  74.199  1.00 26.97 ? 953  LEU A CB  1 
ATOM   493  C  CG  . LEU A 1 66  ? 8.617   9.919   75.467  1.00 35.44 ? 953  LEU A CG  1 
ATOM   494  C  CD1 . LEU A 1 66  ? 7.586   8.851   75.251  1.00 29.97 ? 953  LEU A CD1 1 
ATOM   495  C  CD2 . LEU A 1 66  ? 9.941   9.279   75.838  1.00 25.57 ? 953  LEU A CD2 1 
ATOM   496  N  N   . LEU A 1 67  ? 10.449  11.940  71.677  1.00 24.10 ? 954  LEU A N   1 
ATOM   497  C  CA  . LEU A 1 67  ? 10.265  12.389  70.308  1.00 33.33 ? 954  LEU A CA  1 
ATOM   498  C  C   . LEU A 1 67  ? 8.765   12.475  70.056  1.00 35.41 ? 954  LEU A C   1 
ATOM   499  O  O   . LEU A 1 67  ? 8.002   11.619  70.489  1.00 35.75 ? 954  LEU A O   1 
ATOM   500  C  CB  . LEU A 1 67  ? 10.916  11.397  69.334  1.00 34.99 ? 954  LEU A CB  1 
ATOM   501  C  CG  . LEU A 1 67  ? 12.452  11.386  69.280  1.00 36.62 ? 954  LEU A CG  1 
ATOM   502  N  N   . VAL A 1 68  ? 8.331   13.532  69.390  1.00 34.62 ? 955  VAL A N   1 
ATOM   503  C  CA  . VAL A 1 68  ? 6.910   13.706  69.103  1.00 34.81 ? 955  VAL A CA  1 
ATOM   504  C  C   . VAL A 1 68  ? 6.565   12.859  67.890  1.00 43.55 ? 955  VAL A C   1 
ATOM   505  O  O   . VAL A 1 68  ? 7.302   12.879  66.901  1.00 38.69 ? 955  VAL A O   1 
ATOM   506  C  CB  . VAL A 1 68  ? 6.576   15.187  68.843  1.00 29.35 ? 955  VAL A CB  1 
ATOM   507  C  CG1 . VAL A 1 68  ? 5.212   15.338  68.160  1.00 35.00 ? 955  VAL A CG1 1 
ATOM   508  C  CG2 . VAL A 1 68  ? 6.606   15.963  70.151  1.00 33.92 ? 955  VAL A CG2 1 
ATOM   509  N  N   . LEU A 1 69  ? 5.461   12.117  67.970  1.00 34.45 ? 956  LEU A N   1 
ATOM   510  C  CA  . LEU A 1 69  ? 5.048   11.231  66.885  1.00 33.76 ? 956  LEU A CA  1 
ATOM   511  C  C   . LEU A 1 69  ? 3.986   11.891  66.008  1.00 40.65 ? 956  LEU A C   1 
ATOM   512  O  O   . LEU A 1 69  ? 2.785   11.732  66.252  1.00 41.73 ? 956  LEU A O   1 
ATOM   513  C  CB  . LEU A 1 69  ? 4.513   9.915   67.446  1.00 39.94 ? 956  LEU A CB  1 
ATOM   514  C  CG  . LEU A 1 69  ? 5.489   9.142   68.332  1.00 37.82 ? 956  LEU A CG  1 
ATOM   515  C  CD1 . LEU A 1 69  ? 4.845   7.846   68.820  1.00 58.83 ? 956  LEU A CD1 1 
ATOM   516  C  CD2 . LEU A 1 69  ? 6.790   8.881   67.587  1.00 29.11 ? 956  LEU A CD2 1 
ATOM   517  N  N   . ASP A 1 72  ? 0.542   14.174  66.946  1.00 45.85 ? 959  ASP A N   1 
ATOM   518  C  CA  . ASP A 1 72  ? 0.163   14.267  68.349  1.00 42.27 ? 959  ASP A CA  1 
ATOM   519  C  C   . ASP A 1 72  ? 1.174   15.095  69.161  1.00 43.21 ? 959  ASP A C   1 
ATOM   520  O  O   . ASP A 1 72  ? 2.193   14.565  69.637  1.00 29.72 ? 959  ASP A O   1 
ATOM   521  C  CB  . ASP A 1 72  ? 0.026   12.877  68.965  1.00 41.75 ? 959  ASP A CB  1 
ATOM   522  C  CG  . ASP A 1 72  ? -0.406  12.930  70.413  1.00 42.44 ? 959  ASP A CG  1 
ATOM   523  O  OD1 . ASP A 1 72  ? -1.077  13.918  70.806  1.00 39.74 ? 959  ASP A OD1 1 
ATOM   524  O  OD2 . ASP A 1 72  ? -0.078  11.976  71.150  1.00 42.64 ? 959  ASP A OD2 1 
ATOM   525  N  N   . PRO A 1 73  ? 0.887   16.398  69.338  1.00 39.63 ? 960  PRO A N   1 
ATOM   526  C  CA  . PRO A 1 73  ? 1.760   17.288  70.093  1.00 35.13 ? 960  PRO A CA  1 
ATOM   527  C  C   . PRO A 1 73  ? 1.977   16.855  71.525  1.00 37.75 ? 960  PRO A C   1 
ATOM   528  O  O   . PRO A 1 73  ? 3.015   17.157  72.097  1.00 46.63 ? 960  PRO A O   1 
ATOM   529  C  CB  . PRO A 1 73  ? 1.001   18.618  70.065  1.00 44.11 ? 960  PRO A CB  1 
ATOM   530  C  CG  . PRO A 1 73  ? 0.181   18.542  68.821  1.00 44.08 ? 960  PRO A CG  1 
ATOM   531  C  CD  . PRO A 1 73  ? -0.278  17.124  68.803  1.00 43.43 ? 960  PRO A CD  1 
ATOM   532  N  N   . HIS A 1 74  ? 1.028   16.127  72.100  1.00 32.00 ? 961  HIS A N   1 
ATOM   533  C  CA  . HIS A 1 74  ? 1.214   15.616  73.454  1.00 26.70 ? 961  HIS A CA  1 
ATOM   534  C  C   . HIS A 1 74  ? 1.886   14.250  73.526  1.00 33.84 ? 961  HIS A C   1 
ATOM   535  O  O   . HIS A 1 74  ? 1.982   13.684  74.625  1.00 26.02 ? 961  HIS A O   1 
ATOM   536  C  CB  . HIS A 1 74  ? -0.116  15.593  74.212  1.00 36.66 ? 961  HIS A CB  1 
ATOM   537  C  CG  . HIS A 1 74  ? -0.634  16.954  74.543  1.00 37.26 ? 961  HIS A CG  1 
ATOM   538  N  ND1 . HIS A 1 74  ? -1.377  17.700  73.652  1.00 34.38 ? 961  HIS A ND1 1 
ATOM   539  C  CD2 . HIS A 1 74  ? -0.505  17.713  75.658  1.00 35.05 ? 961  HIS A CD2 1 
ATOM   540  C  CE1 . HIS A 1 74  ? -1.690  18.857  74.208  1.00 29.05 ? 961  HIS A CE1 1 
ATOM   541  N  NE2 . HIS A 1 74  ? -1.177  18.889  75.426  1.00 43.01 ? 961  HIS A NE2 1 
ATOM   542  N  N   . SER A 1 75  ? 2.388   13.728  72.399  1.00 25.56 ? 962  SER A N   1 
ATOM   543  C  CA  . SER A 1 75  ? 3.146   12.451  72.445  1.00 23.24 ? 962  SER A CA  1 
ATOM   544  C  C   . SER A 1 75  ? 4.549   12.589  73.027  1.00 25.68 ? 962  SER A C   1 
ATOM   545  O  O   . SER A 1 75  ? 5.318   11.610  73.083  1.00 28.19 ? 962  SER A O   1 
ATOM   546  C  CB  . SER A 1 75  ? 3.250   11.824  71.039  1.00 38.17 ? 962  SER A CB  1 
ATOM   547  O  OG  . SER A 1 75  ? 3.819   12.738  70.114  1.00 26.20 ? 962  SER A OG  1 
ATOM   548  N  N   . ASP A 1 76  ? 4.926   13.776  73.476  1.00 23.96 ? 963  ASP A N   1 
ATOM   549  C  CA  . ASP A 1 76  ? 6.259   13.933  74.047  1.00 22.17 ? 963  ASP A CA  1 
ATOM   550  C  C   . ASP A 1 76  ? 6.315   13.647  75.555  1.00 24.51 ? 963  ASP A C   1 
ATOM   551  O  O   . ASP A 1 76  ? 7.374   13.802  76.168  1.00 28.58 ? 963  ASP A O   1 
ATOM   552  C  CB  . ASP A 1 76  ? 6.802   15.332  73.749  1.00 25.92 ? 963  ASP A CB  1 
ATOM   553  C  CG  . ASP A 1 76  ? 6.227   16.399  74.677  1.00 37.89 ? 963  ASP A CG  1 
ATOM   554  O  OD1 . ASP A 1 76  ? 5.218   16.143  75.383  1.00 40.56 ? 963  ASP A OD1 1 
ATOM   555  O  OD2 . ASP A 1 76  ? 6.804   17.504  74.694  1.00 45.79 ? 963  ASP A OD2 1 
ATOM   556  N  N   . TYR A 1 77  ? 5.179   13.278  76.156  1.00 26.13 ? 964  TYR A N   1 
ATOM   557  C  CA  . TYR A 1 77  ? 5.077   13.168  77.619  1.00 22.93 ? 964  TYR A CA  1 
ATOM   558  C  C   . TYR A 1 77  ? 5.179   11.727  78.154  1.00 29.36 ? 964  TYR A C   1 
ATOM   559  O  O   . TYR A 1 77  ? 4.490   10.804  77.670  1.00 26.35 ? 964  TYR A O   1 
ATOM   560  C  CB  . TYR A 1 77  ? 3.759   13.803  78.136  1.00 23.52 ? 964  TYR A CB  1 
ATOM   561  C  CG  . TYR A 1 77  ? 3.710   13.743  79.646  1.00 25.19 ? 964  TYR A CG  1 
ATOM   562  C  CD1 . TYR A 1 77  ? 4.533   14.585  80.406  1.00 33.11 ? 964  TYR A CD1 1 
ATOM   563  C  CD2 . TYR A 1 77  ? 2.923   12.799  80.317  1.00 24.97 ? 964  TYR A CD2 1 
ATOM   564  C  CE1 . TYR A 1 77  ? 4.559   14.524  81.774  1.00 28.54 ? 964  TYR A CE1 1 
ATOM   565  C  CE2 . TYR A 1 77  ? 2.943   12.708  81.713  1.00 25.76 ? 964  TYR A CE2 1 
ATOM   566  C  CZ  . TYR A 1 77  ? 3.766   13.575  82.436  1.00 29.64 ? 964  TYR A CZ  1 
ATOM   567  O  OH  . TYR A 1 77  ? 3.810   13.546  83.796  1.00 26.18 ? 964  TYR A OH  1 
ATOM   568  N  N   . ILE A 1 78  ? 6.031   11.550  79.164  1.00 27.03 ? 965  ILE A N   1 
ATOM   569  C  CA  . ILE A 1 78  ? 5.978   10.390  80.042  1.00 25.65 ? 965  ILE A CA  1 
ATOM   570  C  C   . ILE A 1 78  ? 6.213   10.918  81.449  1.00 25.20 ? 965  ILE A C   1 
ATOM   571  O  O   . ILE A 1 78  ? 6.957   11.904  81.646  1.00 25.81 ? 965  ILE A O   1 
ATOM   572  C  CB  . ILE A 1 78  ? 7.044   9.339   79.660  1.00 26.38 ? 965  ILE A CB  1 
ATOM   573  C  CG1 . ILE A 1 78  ? 6.955   8.063   80.536  1.00 25.49 ? 965  ILE A CG1 1 
ATOM   574  C  CG2 . ILE A 1 78  ? 8.421   9.968   79.699  1.00 26.70 ? 965  ILE A CG2 1 
ATOM   575  C  CD1 . ILE A 1 78  ? 7.455   6.834   79.815  1.00 22.41 ? 965  ILE A CD1 1 
ATOM   576  N  N   . ASN A 1 79  ? 5.560   10.300  82.422  1.00 25.38 ? 966  ASN A N   1 
ATOM   577  C  CA  . ASN A 1 79  ? 5.807   10.643  83.819  1.00 26.44 ? 966  ASN A CA  1 
ATOM   578  C  C   . ASN A 1 79  ? 7.161   10.096  84.295  1.00 28.00 ? 966  ASN A C   1 
ATOM   579  O  O   . ASN A 1 79  ? 7.241   9.065   84.977  1.00 26.44 ? 966  ASN A O   1 
ATOM   580  C  CB  . ASN A 1 79  ? 4.684   10.130  84.726  1.00 23.88 ? 966  ASN A CB  1 
ATOM   581  C  CG  . ASN A 1 79  ? 4.804   10.683  86.147  1.00 28.04 ? 966  ASN A CG  1 
ATOM   582  O  OD1 . ASN A 1 79  ? 5.548   11.640  86.385  1.00 26.82 ? 966  ASN A OD1 1 
ATOM   583  N  ND2 . ASN A 1 79  ? 4.106   10.079  87.084  1.00 28.56 ? 966  ASN A ND2 1 
ATOM   584  N  N   . ALA A 1 80  ? 8.226   10.803  83.921  1.00 23.79 ? 967  ALA A N   1 
ATOM   585  C  CA  . ALA A 1 80  ? 9.580   10.419  84.249  1.00 24.20 ? 967  ALA A CA  1 
ATOM   586  C  C   . ALA A 1 80  ? 10.459  11.657  84.317  1.00 20.29 ? 967  ALA A C   1 
ATOM   587  O  O   . ALA A 1 80  ? 10.224  12.644  83.600  1.00 20.95 ? 967  ALA A O   1 
ATOM   588  C  CB  . ALA A 1 80  ? 10.119  9.443   83.164  1.00 25.06 ? 967  ALA A CB  1 
ATOM   589  N  N   . ASN A 1 81  ? 11.484  11.600  85.159  1.00 22.95 ? 968  ASN A N   1 
ATOM   590  C  CA  . ASN A 1 81  ? 12.463  12.681  85.269  1.00 18.77 ? 968  ASN A CA  1 
ATOM   591  C  C   . ASN A 1 81  ? 13.866  12.131  85.306  1.00 23.03 ? 968  ASN A C   1 
ATOM   592  O  O   . ASN A 1 81  ? 14.108  11.123  85.961  1.00 23.52 ? 968  ASN A O   1 
ATOM   593  C  CB  . ASN A 1 81  ? 12.236  13.439  86.566  1.00 19.62 ? 968  ASN A CB  1 
ATOM   594  C  CG  . ASN A 1 81  ? 10.887  14.119  86.613  1.00 32.40 ? 968  ASN A CG  1 
ATOM   595  O  OD1 . ASN A 1 81  ? 9.890   13.516  86.960  1.00 20.63 ? 968  ASN A OD1 1 
ATOM   596  N  ND2 . ASN A 1 81  ? 10.861  15.376  86.280  1.00 24.47 ? 968  ASN A ND2 1 
ATOM   597  N  N   . TYR A 1 82  ? 14.794  12.824  84.643  1.00 20.68 ? 969  TYR A N   1 
ATOM   598  C  CA  . TYR A 1 82  ? 16.214  12.579  84.840  1.00 22.49 ? 969  TYR A CA  1 
ATOM   599  C  C   . TYR A 1 82  ? 16.595  12.890  86.287  1.00 26.34 ? 969  TYR A C   1 
ATOM   600  O  O   . TYR A 1 82  ? 16.093  13.860  86.878  1.00 24.77 ? 969  TYR A O   1 
ATOM   601  C  CB  . TYR A 1 82  ? 17.040  13.453  83.911  1.00 20.26 ? 969  TYR A CB  1 
ATOM   602  C  CG  . TYR A 1 82  ? 16.836  13.172  82.447  1.00 23.52 ? 969  TYR A CG  1 
ATOM   603  C  CD1 . TYR A 1 82  ? 17.281  11.983  81.884  1.00 24.40 ? 969  TYR A CD1 1 
ATOM   604  C  CD2 . TYR A 1 82  ? 16.273  14.123  81.600  1.00 28.82 ? 969  TYR A CD2 1 
ATOM   605  C  CE1 . TYR A 1 82  ? 17.144  11.748  80.495  1.00 32.08 ? 969  TYR A CE1 1 
ATOM   606  C  CE2 . TYR A 1 82  ? 16.105  13.879  80.245  1.00 25.49 ? 969  TYR A CE2 1 
ATOM   607  C  CZ  . TYR A 1 82  ? 16.544  12.700  79.695  1.00 27.19 ? 969  TYR A CZ  1 
ATOM   608  O  OH  . TYR A 1 82  ? 16.389  12.481  78.329  1.00 23.45 ? 969  TYR A OH  1 
ATOM   609  N  N   . ILE A 1 83  ? 17.474  12.052  86.847  1.00 24.05 ? 970  ILE A N   1 
ATOM   610  C  CA  . ILE A 1 83  ? 18.025  12.271  88.162  1.00 19.00 ? 970  ILE A CA  1 
ATOM   611  C  C   . ILE A 1 83  ? 19.542  12.152  88.087  1.00 26.28 ? 970  ILE A C   1 
ATOM   612  O  O   . ILE A 1 83  ? 20.044  11.126  87.679  1.00 23.24 ? 970  ILE A O   1 
ATOM   613  C  CB  . ILE A 1 83  ? 17.533  11.228  89.169  1.00 17.78 ? 970  ILE A CB  1 
ATOM   614  C  CG1 . ILE A 1 83  ? 15.998  11.068  89.144  1.00 23.81 ? 970  ILE A CG1 1 
ATOM   615  C  CG2 . ILE A 1 83  ? 18.028  11.561  90.554  1.00 21.21 ? 970  ILE A CG2 1 
ATOM   616  C  CD1 . ILE A 1 83  ? 15.242  12.172  89.856  1.00 19.74 ? 970  ILE A CD1 1 
ATOM   617  N  N   . ASP A 1 84  ? 20.247  13.179  88.532  1.00 22.19 ? 971  ASP A N   1 
ATOM   618  C  CA  . ASP A 1 84  ? 21.694  13.158  88.560  1.00 23.69 ? 971  ASP A CA  1 
ATOM   619  C  C   . ASP A 1 84  ? 22.158  12.102  89.538  1.00 27.78 ? 971  ASP A C   1 
ATOM   620  O  O   . ASP A 1 84  ? 21.556  11.917  90.580  1.00 26.70 ? 971  ASP A O   1 
ATOM   621  C  CB  . ASP A 1 84  ? 22.287  14.530  88.963  1.00 24.50 ? 971  ASP A CB  1 
ATOM   622  C  CG  . ASP A 1 84  ? 22.065  15.575  87.924  1.00 35.08 ? 971  ASP A CG  1 
ATOM   623  O  OD1 . ASP A 1 84  ? 21.768  15.230  86.761  1.00 24.61 ? 971  ASP A OD1 1 
ATOM   624  O  OD2 . ASP A 1 84  ? 22.167  16.756  88.285  1.00 33.82 ? 971  ASP A OD2 1 
ATOM   625  N  N   . GLY A 1 85  ? 23.243  11.419  89.189  1.00 30.55 ? 972  GLY A N   1 
ATOM   626  C  CA  . GLY A 1 85  ? 23.902  10.529  90.127  1.00 29.02 ? 972  GLY A CA  1 
ATOM   627  C  C   . GLY A 1 85  ? 25.096  11.233  90.700  1.00 27.06 ? 972  GLY A C   1 
ATOM   628  O  O   . GLY A 1 85  ? 25.351  12.394  90.395  1.00 33.34 ? 972  GLY A O   1 
ATOM   629  N  N   . TYR A 1 86  ? 25.856  10.514  91.517  1.00 23.62 ? 973  TYR A N   1 
ATOM   630  C  CA  . TYR A 1 86  ? 26.975  11.103  92.197  1.00 25.91 ? 973  TYR A CA  1 
ATOM   631  C  C   . TYR A 1 86  ? 27.994  11.573  91.160  1.00 30.83 ? 973  TYR A C   1 
ATOM   632  O  O   . TYR A 1 86  ? 28.365  12.722  91.142  1.00 32.98 ? 973  TYR A O   1 
ATOM   633  C  CB  . TYR A 1 86  ? 27.602  10.092  93.119  1.00 29.16 ? 973  TYR A CB  1 
ATOM   634  C  CG  . TYR A 1 86  ? 28.820  10.642  93.771  1.00 30.06 ? 973  TYR A CG  1 
ATOM   635  C  CD1 . TYR A 1 86  ? 28.710  11.624  94.743  1.00 32.42 ? 973  TYR A CD1 1 
ATOM   636  C  CD2 . TYR A 1 86  ? 30.081  10.199  93.417  1.00 32.94 ? 973  TYR A CD2 1 
ATOM   637  C  CE1 . TYR A 1 86  ? 29.828  12.152  95.349  1.00 26.59 ? 973  TYR A CE1 1 
ATOM   638  C  CE2 . TYR A 1 86  ? 31.211  10.704  94.036  1.00 28.00 ? 973  TYR A CE2 1 
ATOM   639  C  CZ  . TYR A 1 86  ? 31.073  11.685  95.002  1.00 28.07 ? 973  TYR A CZ  1 
ATOM   640  O  OH  . TYR A 1 86  ? 32.187  12.219  95.616  1.00 31.03 ? 973  TYR A OH  1 
ATOM   641  N  N   . HIS A 1 87  ? 28.413  10.668  90.291  1.00 27.25 ? 974  HIS A N   1 
ATOM   642  C  CA  . HIS A 1 87  ? 29.484  10.952  89.350  1.00 44.16 ? 974  HIS A CA  1 
ATOM   643  C  C   . HIS A 1 87  ? 29.024  11.707  88.080  1.00 40.91 ? 974  HIS A C   1 
ATOM   644  O  O   . HIS A 1 87  ? 29.833  12.320  87.382  1.00 35.38 ? 974  HIS A O   1 
ATOM   645  C  CB  . HIS A 1 87  ? 30.152  9.622   88.961  1.00 53.69 ? 974  HIS A CB  1 
ATOM   646  N  N   . ARG A 1 88  ? 27.725  11.673  87.810  1.00 31.89 ? 975  ARG A N   1 
ATOM   647  C  CA  . ARG A 1 88  ? 27.232  11.725  86.448  1.00 37.03 ? 975  ARG A CA  1 
ATOM   648  C  C   . ARG A 1 88  ? 25.824  12.308  86.353  1.00 34.52 ? 975  ARG A C   1 
ATOM   649  O  O   . ARG A 1 88  ? 24.889  11.766  86.948  1.00 25.98 ? 975  ARG A O   1 
ATOM   650  C  CB  . ARG A 1 88  ? 27.207  10.297  85.878  1.00 50.66 ? 975  ARG A CB  1 
ATOM   651  N  N   . PRO A 1 89  ? 25.661  13.388  85.571  1.00 29.01 ? 976  PRO A N   1 
ATOM   652  C  CA  . PRO A 1 89  ? 24.325  13.934  85.389  1.00 25.22 ? 976  PRO A CA  1 
ATOM   653  C  C   . PRO A 1 89  ? 23.429  12.998  84.585  1.00 31.20 ? 976  PRO A C   1 
ATOM   654  O  O   . PRO A 1 89  ? 23.926  12.172  83.794  1.00 25.66 ? 976  PRO A O   1 
ATOM   655  C  CB  . PRO A 1 89  ? 24.580  15.230  84.618  1.00 21.73 ? 976  PRO A CB  1 
ATOM   656  C  CG  . PRO A 1 89  ? 25.833  14.979  83.904  1.00 37.48 ? 976  PRO A CG  1 
ATOM   657  C  CD  . PRO A 1 89  ? 26.666  14.164  84.818  1.00 29.46 ? 976  PRO A CD  1 
ATOM   658  N  N   . ARG A 1 90  ? 22.125  13.090  84.814  1.00 27.93 ? 977  ARG A N   1 
ATOM   659  C  CA  . ARG A 1 90  ? 21.193  12.240  84.123  1.00 27.84 ? 977  ARG A CA  1 
ATOM   660  C  C   . ARG A 1 90  ? 21.587  10.764  84.236  1.00 27.64 ? 977  ARG A C   1 
ATOM   661  O  O   . ARG A 1 90  ? 21.397  9.979   83.292  1.00 28.39 ? 977  ARG A O   1 
ATOM   662  C  CB  . ARG A 1 90  ? 21.097  12.643  82.644  1.00 30.69 ? 977  ARG A CB  1 
ATOM   663  C  CG  . ARG A 1 90  ? 20.547  14.056  82.432  1.00 35.55 ? 977  ARG A CG  1 
ATOM   664  C  CD  . ARG A 1 90  ? 20.221  14.325  80.968  1.00 39.49 ? 977  ARG A CD  1 
ATOM   665  N  NE  . ARG A 1 90  ? 19.294  15.446  80.795  1.00 52.33 ? 977  ARG A NE  1 
ATOM   666  C  CZ  . ARG A 1 90  ? 18.739  15.811  79.631  1.00 57.45 ? 977  ARG A CZ  1 
ATOM   667  N  NH1 . ARG A 1 90  ? 19.003  15.162  78.498  1.00 38.84 ? 977  ARG A NH1 1 
ATOM   668  N  NH2 . ARG A 1 90  ? 17.909  16.846  79.597  1.00 53.26 ? 977  ARG A NH2 1 
ATOM   669  N  N   . HIS A 1 91  ? 22.112  10.377  85.391  1.00 24.84 ? 978  HIS A N   1 
ATOM   670  C  CA  . HIS A 1 91  ? 22.494  8.971   85.613  1.00 28.82 ? 978  HIS A CA  1 
ATOM   671  C  C   . HIS A 1 91  ? 21.290  8.023   85.702  1.00 28.00 ? 978  HIS A C   1 
ATOM   672  O  O   . HIS A 1 91  ? 21.373  6.862   85.284  1.00 26.61 ? 978  HIS A O   1 
ATOM   673  C  CB  . HIS A 1 91  ? 23.345  8.806   86.870  1.00 25.05 ? 978  HIS A CB  1 
ATOM   674  C  CG  . HIS A 1 91  ? 23.979  7.462   86.986  1.00 30.50 ? 978  HIS A CG  1 
ATOM   675  N  ND1 . HIS A 1 91  ? 23.677  6.571   87.993  1.00 36.79 ? 978  HIS A ND1 1 
ATOM   676  C  CD2 . HIS A 1 91  ? 24.876  6.838   86.187  1.00 33.51 ? 978  HIS A CD2 1 
ATOM   677  C  CE1 . HIS A 1 91  ? 24.389  5.469   87.826  1.00 28.86 ? 978  HIS A CE1 1 
ATOM   678  N  NE2 . HIS A 1 91  ? 25.116  5.604   86.735  1.00 40.72 ? 978  HIS A NE2 1 
ATOM   679  N  N   . TYR A 1 92  ? 20.181  8.489   86.270  1.00 25.49 ? 979  TYR A N   1 
ATOM   680  C  CA  . TYR A 1 92  ? 18.974  7.654   86.346  1.00 18.24 ? 979  TYR A CA  1 
ATOM   681  C  C   . TYR A 1 92  ? 17.830  8.399   85.692  1.00 25.11 ? 979  TYR A C   1 
ATOM   682  O  O   . TYR A 1 92  ? 17.863  9.628   85.573  1.00 27.14 ? 979  TYR A O   1 
ATOM   683  C  CB  . TYR A 1 92  ? 18.506  7.418   87.791  1.00 22.21 ? 979  TYR A CB  1 
ATOM   684  C  CG  . TYR A 1 92  ? 19.551  7.106   88.792  1.00 23.58 ? 979  TYR A CG  1 
ATOM   685  C  CD1 . TYR A 1 92  ? 19.908  5.774   89.081  1.00 21.05 ? 979  TYR A CD1 1 
ATOM   686  C  CD2 . TYR A 1 92  ? 20.157  8.114   89.508  1.00 23.47 ? 979  TYR A CD2 1 
ATOM   687  C  CE1 . TYR A 1 92  ? 20.924  5.491   90.022  1.00 19.55 ? 979  TYR A CE1 1 
ATOM   688  C  CE2 . TYR A 1 92  ? 21.141  7.842   90.479  1.00 29.64 ? 979  TYR A CE2 1 
ATOM   689  C  CZ  . TYR A 1 92  ? 21.512  6.539   90.732  1.00 23.80 ? 979  TYR A CZ  1 
ATOM   690  O  OH  . TYR A 1 92  ? 22.483  6.314   91.668  1.00 27.16 ? 979  TYR A OH  1 
ATOM   691  N  N   . ILE A 1 93  ? 16.795  7.648   85.333  1.00 27.16 ? 980  ILE A N   1 
ATOM   692  C  CA  . ILE A 1 93  ? 15.457  8.172   85.108  1.00 23.14 ? 980  ILE A CA  1 
ATOM   693  C  C   . ILE A 1 93  ? 14.563  7.582   86.195  1.00 24.74 ? 980  ILE A C   1 
ATOM   694  O  O   . ILE A 1 93  ? 14.442  6.362   86.306  1.00 27.89 ? 980  ILE A O   1 
ATOM   695  C  CB  . ILE A 1 93  ? 14.905  7.804   83.693  1.00 24.63 ? 980  ILE A CB  1 
ATOM   696  C  CG1 . ILE A 1 93  ? 15.659  8.601   82.597  1.00 26.43 ? 980  ILE A CG1 1 
ATOM   697  C  CG2 . ILE A 1 93  ? 13.430  8.107   83.606  1.00 20.59 ? 980  ILE A CG2 1 
ATOM   698  C  CD1 . ILE A 1 93  ? 15.589  8.005   81.208  1.00 29.09 ? 980  ILE A CD1 1 
ATOM   699  N  N   . ALA A 1 94  ? 13.967  8.443   87.013  1.00 23.06 ? 981  ALA A N   1 
ATOM   700  C  CA  . ALA A 1 94  ? 12.942  8.024   87.969  1.00 20.95 ? 981  ALA A CA  1 
ATOM   701  C  C   . ALA A 1 94  ? 11.597  8.126   87.289  1.00 27.87 ? 981  ALA A C   1 
ATOM   702  O  O   . ALA A 1 94  ? 11.253  9.176   86.757  1.00 25.89 ? 981  ALA A O   1 
ATOM   703  C  CB  . ALA A 1 94  ? 12.963  8.915   89.229  1.00 20.07 ? 981  ALA A CB  1 
ATOM   704  N  N   . THR A 1 95  ? 10.808  7.055   87.337  1.00 20.93 ? 982  THR A N   1 
ATOM   705  C  CA  . THR A 1 95  ? 9.507   7.089   86.668  1.00 23.96 ? 982  THR A CA  1 
ATOM   706  C  C   . THR A 1 95  ? 8.494   6.238   87.434  1.00 22.07 ? 982  THR A C   1 
ATOM   707  O  O   . THR A 1 95  ? 8.836   5.496   88.353  1.00 23.26 ? 982  THR A O   1 
ATOM   708  C  CB  . THR A 1 95  ? 9.635   6.656   85.163  1.00 26.25 ? 982  THR A CB  1 
ATOM   709  O  OG1 . THR A 1 95  ? 8.399   6.881   84.471  1.00 26.85 ? 982  THR A OG1 1 
ATOM   710  C  CG2 . THR A 1 95  ? 10.022  5.193   85.037  1.00 25.12 ? 982  THR A CG2 1 
ATOM   711  N  N   . GLN A 1 96  ? 7.234   6.389   87.067  1.00 20.97 ? 983  GLN A N   1 
ATOM   712  C  CA  . GLN A 1 96  ? 6.165   5.596   87.652  1.00 22.05 ? 983  GLN A CA  1 
ATOM   713  C  C   . GLN A 1 96  ? 6.218   4.187   87.071  1.00 22.62 ? 983  GLN A C   1 
ATOM   714  O  O   . GLN A 1 96  ? 6.785   3.988   85.995  1.00 25.13 ? 983  GLN A O   1 
ATOM   715  C  CB  . GLN A 1 96  ? 4.838   6.251   87.345  1.00 24.62 ? 983  GLN A CB  1 
ATOM   716  C  CG  . GLN A 1 96  ? 4.457   6.190   85.893  1.00 24.34 ? 983  GLN A CG  1 
ATOM   717  C  CD  . GLN A 1 96  ? 3.120   6.819   85.610  1.00 23.39 ? 983  GLN A CD  1 
ATOM   718  O  OE1 . GLN A 1 96  ? 2.639   7.705   86.361  1.00 28.67 ? 983  GLN A OE1 1 
ATOM   719  N  NE2 . GLN A 1 96  ? 2.512   6.394   84.505  1.00 25.19 ? 983  GLN A NE2 1 
ATOM   720  N  N   . GLY A 1 97  ? 5.597   3.221   87.746  1.00 23.44 ? 984  GLY A N   1 
ATOM   721  C  CA  . GLY A 1 97  ? 5.433   1.887   87.149  1.00 26.19 ? 984  GLY A CA  1 
ATOM   722  C  C   . GLY A 1 97  ? 4.489   2.044   85.962  1.00 28.33 ? 984  GLY A C   1 
ATOM   723  O  O   . GLY A 1 97  ? 3.513   2.764   86.066  1.00 23.01 ? 984  GLY A O   1 
ATOM   724  N  N   . PRO A 1 98  ? 4.805   1.453   84.807  1.00 27.63 ? 985  PRO A N   1 
ATOM   725  C  CA  . PRO A 1 98  ? 3.916   1.605   83.651  1.00 27.27 ? 985  PRO A CA  1 
ATOM   726  C  C   . PRO A 1 98  ? 2.439   1.341   83.919  1.00 26.31 ? 985  PRO A C   1 
ATOM   727  O  O   . PRO A 1 98  ? 2.081   0.487   84.751  1.00 24.70 ? 985  PRO A O   1 
ATOM   728  C  CB  . PRO A 1 98  ? 4.473   0.567   82.657  1.00 24.46 ? 985  PRO A CB  1 
ATOM   729  C  CG  . PRO A 1 98  ? 5.922   0.613   82.935  1.00 25.19 ? 985  PRO A CG  1 
ATOM   730  C  CD  . PRO A 1 98  ? 6.038   0.723   84.442  1.00 29.25 ? 985  PRO A CD  1 
ATOM   731  N  N   . MET A 1 99  ? 1.608   2.122   83.248  1.00 23.33 ? 986  MET A N   1 
ATOM   732  C  CA  . MET A 1 99  ? 0.182   1.881   83.193  1.00 26.68 ? 986  MET A CA  1 
ATOM   733  C  C   . MET A 1 99  ? -0.158  1.162   81.878  1.00 25.08 ? 986  MET A C   1 
ATOM   734  O  O   . MET A 1 99  ? 0.609   1.207   80.922  1.00 23.81 ? 986  MET A O   1 
ATOM   735  C  CB  . MET A 1 99  ? -0.562  3.225   83.289  1.00 28.72 ? 986  MET A CB  1 
ATOM   736  C  CG  . MET A 1 99  ? -0.163  4.086   84.502  1.00 41.99 ? 986  MET A CG  1 
ATOM   737  S  SD  . MET A 1 99  ? -0.810  5.770   84.423  1.00 35.26 ? 986  MET A SD  1 
ATOM   738  C  CE  . MET A 1 99  ? -2.568  5.422   84.450  1.00 39.03 ? 986  MET A CE  1 
ATOM   739  N  N   . GLN A 1 100 ? -1.324  0.518   81.823  1.00 27.00 ? 987  GLN A N   1 
ATOM   740  C  CA  . GLN A 1 100 ? -1.795  -0.118  80.579  1.00 26.16 ? 987  GLN A CA  1 
ATOM   741  C  C   . GLN A 1 100 ? -1.570  0.782   79.361  1.00 27.49 ? 987  GLN A C   1 
ATOM   742  O  O   . GLN A 1 100 ? -1.041  0.331   78.324  1.00 25.20 ? 987  GLN A O   1 
ATOM   743  C  CB  . GLN A 1 100 ? -3.274  -0.477  80.676  1.00 29.69 ? 987  GLN A CB  1 
ATOM   744  C  CG  . GLN A 1 100 ? -3.753  -1.322  79.537  1.00 39.77 ? 987  GLN A CG  1 
ATOM   745  C  CD  . GLN A 1 100 ? -3.031  -2.651  79.456  1.00 48.79 ? 987  GLN A CD  1 
ATOM   746  O  OE1 . GLN A 1 100 ? -2.478  -3.131  80.449  1.00 40.45 ? 987  GLN A OE1 1 
ATOM   747  N  NE2 . GLN A 1 100 ? -3.034  -3.258  78.271  1.00 50.38 ? 987  GLN A NE2 1 
ATOM   748  N  N   . GLU A 1 101 ? -1.908  2.059   79.536  1.00 25.23 ? 988  GLU A N   1 
ATOM   749  C  CA  . GLU A 1 101 ? -1.848  3.044   78.465  1.00 35.40 ? 988  GLU A CA  1 
ATOM   750  C  C   . GLU A 1 101 ? -0.416  3.381   78.112  1.00 31.15 ? 988  GLU A C   1 
ATOM   751  O  O   . GLU A 1 101 ? -0.120  3.587   76.933  1.00 38.76 ? 988  GLU A O   1 
ATOM   752  C  CB  . GLU A 1 101 ? -2.598  4.329   78.854  1.00 42.12 ? 988  GLU A CB  1 
ATOM   753  C  CG  . GLU A 1 101 ? -4.045  4.121   79.264  1.00 46.12 ? 988  GLU A CG  1 
ATOM   754  C  CD  . GLU A 1 101 ? -4.279  4.178   80.782  1.00 57.37 ? 988  GLU A CD  1 
ATOM   755  O  OE1 . GLU A 1 101 ? -3.731  3.323   81.524  1.00 27.79 ? 988  GLU A OE1 1 
ATOM   756  O  OE2 . GLU A 1 101 ? -5.041  5.064   81.229  1.00 45.27 ? 988  GLU A OE2 1 
ATOM   757  N  N   . THR A 1 102 ? 0.482   3.375   79.103  1.00 26.34 ? 989  THR A N   1 
ATOM   758  C  CA  . THR A 1 102 ? 1.837   3.905   78.903  1.00 22.56 ? 989  THR A CA  1 
ATOM   759  C  C   . THR A 1 102 ? 2.955   2.906   78.650  1.00 22.87 ? 989  THR A C   1 
ATOM   760  O  O   . THR A 1 102 ? 4.110   3.313   78.556  1.00 26.57 ? 989  THR A O   1 
ATOM   761  C  CB  . THR A 1 102 ? 2.226   4.807   80.086  1.00 25.78 ? 989  THR A CB  1 
ATOM   762  O  OG1 . THR A 1 102 ? 2.503   4.018   81.267  1.00 24.99 ? 989  THR A OG1 1 
ATOM   763  C  CG2 . THR A 1 102 ? 1.081   5.815   80.358  1.00 24.43 ? 989  THR A CG2 1 
ATOM   764  N  N   . VAL A 1 103 ? 2.629   1.619   78.615  1.00 22.06 ? 990  VAL A N   1 
ATOM   765  C  CA  . VAL A 1 103 ? 3.624   0.580   78.362  1.00 19.21 ? 990  VAL A CA  1 
ATOM   766  C  C   . VAL A 1 103 ? 4.414   0.861   77.087  1.00 22.09 ? 990  VAL A C   1 
ATOM   767  O  O   . VAL A 1 103 ? 5.637   0.803   77.069  1.00 23.71 ? 990  VAL A O   1 
ATOM   768  C  CB  . VAL A 1 103 ? 3.016   -0.828  78.276  1.00 25.74 ? 990  VAL A CB  1 
ATOM   769  C  CG1 . VAL A 1 103 ? 4.063   -1.837  77.753  1.00 25.63 ? 990  VAL A CG1 1 
ATOM   770  C  CG2 . VAL A 1 103 ? 2.473   -1.276  79.671  1.00 21.33 ? 990  VAL A CG2 1 
ATOM   771  N  N   . LYS A 1 104 ? 3.698   1.191   76.013  1.00 23.27 ? 991  LYS A N   1 
ATOM   772  C  CA  . LYS A 1 104 ? 4.405   1.526   74.757  1.00 26.36 ? 991  LYS A CA  1 
ATOM   773  C  C   . LYS A 1 104 ? 5.328   2.756   74.916  1.00 27.08 ? 991  LYS A C   1 
ATOM   774  O  O   . LYS A 1 104 ? 6.482   2.755   74.430  1.00 24.35 ? 991  LYS A O   1 
ATOM   775  C  CB  . LYS A 1 104 ? 3.391   1.637   73.576  1.00 29.88 ? 991  LYS A CB  1 
ATOM   776  C  CG  . LYS A 1 104 ? 2.229   2.530   73.749  1.00 43.92 ? 991  LYS A CG  1 
ATOM   777  C  CD  . LYS A 1 104 ? 1.242   2.418   72.564  1.00 34.85 ? 991  LYS A CD  1 
ATOM   778  C  CE  . LYS A 1 104 ? -0.199  2.464   73.046  1.00 48.05 ? 991  LYS A CE  1 
ATOM   779  N  NZ  . LYS A 1 104 ? -0.665  1.132   73.583  1.00 41.10 ? 991  LYS A NZ  1 
ATOM   780  N  N   . ASP A 1 105 ? 4.859   3.776   75.651  1.00 25.77 ? 992  ASP A N   1 
ATOM   781  C  CA  . ASP A 1 105 ? 5.662   4.991   75.883  1.00 23.36 ? 992  ASP A CA  1 
ATOM   782  C  C   . ASP A 1 105 ? 6.898   4.661   76.682  1.00 28.04 ? 992  ASP A C   1 
ATOM   783  O  O   . ASP A 1 105 ? 7.976   5.205   76.445  1.00 25.78 ? 992  ASP A O   1 
ATOM   784  C  CB  . ASP A 1 105 ? 4.871   6.045   76.648  1.00 28.47 ? 992  ASP A CB  1 
ATOM   785  C  CG  . ASP A 1 105 ? 3.612   6.480   75.917  1.00 45.13 ? 992  ASP A CG  1 
ATOM   786  O  OD1 . ASP A 1 105 ? 3.625   6.425   74.658  1.00 32.04 ? 992  ASP A OD1 1 
ATOM   787  O  OD2 . ASP A 1 105 ? 2.623   6.848   76.610  1.00 34.60 ? 992  ASP A OD2 1 
ATOM   788  N  N   . PHE A 1 106 ? 6.719   3.769   77.643  1.00 23.67 ? 993  PHE A N   1 
ATOM   789  C  CA  . PHE A 1 106 ? 7.818   3.332   78.495  1.00 23.07 ? 993  PHE A CA  1 
ATOM   790  C  C   . PHE A 1 106 ? 8.936   2.676   77.678  1.00 24.31 ? 993  PHE A C   1 
ATOM   791  O  O   . PHE A 1 106 ? 10.117  3.016   77.822  1.00 22.32 ? 993  PHE A O   1 
ATOM   792  C  CB  . PHE A 1 106 ? 7.255   2.392   79.555  1.00 23.83 ? 993  PHE A CB  1 
ATOM   793  C  CG  . PHE A 1 106 ? 8.269   1.820   80.459  1.00 23.50 ? 993  PHE A CG  1 
ATOM   794  C  CD1 . PHE A 1 106 ? 8.637   2.482   81.612  1.00 24.43 ? 993  PHE A CD1 1 
ATOM   795  C  CD2 . PHE A 1 106 ? 8.796   0.577   80.204  1.00 24.90 ? 993  PHE A CD2 1 
ATOM   796  C  CE1 . PHE A 1 106 ? 9.567   1.910   82.477  1.00 23.62 ? 993  PHE A CE1 1 
ATOM   797  C  CE2 . PHE A 1 106 ? 9.711   -0.008  81.064  1.00 28.38 ? 993  PHE A CE2 1 
ATOM   798  C  CZ  . PHE A 1 106 ? 10.097  0.657   82.217  1.00 29.00 ? 993  PHE A CZ  1 
ATOM   799  N  N   . TRP A 1 107 ? 8.564   1.785   76.779  1.00 23.25 ? 994  TRP A N   1 
ATOM   800  C  CA  . TRP A 1 107 ? 9.563   1.124   75.931  1.00 23.05 ? 994  TRP A CA  1 
ATOM   801  C  C   . TRP A 1 107 ? 10.185  2.067   74.893  1.00 19.83 ? 994  TRP A C   1 
ATOM   802  O  O   . TRP A 1 107 ? 11.352  1.922   74.556  1.00 24.13 ? 994  TRP A O   1 
ATOM   803  C  CB  . TRP A 1 107 ? 8.969   -0.121  75.270  1.00 24.13 ? 994  TRP A CB  1 
ATOM   804  C  CG  . TRP A 1 107 ? 8.921   -1.249  76.214  1.00 22.07 ? 994  TRP A CG  1 
ATOM   805  C  CD1 . TRP A 1 107 ? 7.823   -1.748  76.828  1.00 23.54 ? 994  TRP A CD1 1 
ATOM   806  C  CD2 . TRP A 1 107 ? 10.034  -2.004  76.710  1.00 24.28 ? 994  TRP A CD2 1 
ATOM   807  N  NE1 . TRP A 1 107 ? 8.169   -2.784  77.642  1.00 23.74 ? 994  TRP A NE1 1 
ATOM   808  C  CE2 . TRP A 1 107 ? 9.521   -2.953  77.609  1.00 26.65 ? 994  TRP A CE2 1 
ATOM   809  C  CE3 . TRP A 1 107 ? 11.412  -1.976  76.482  1.00 23.20 ? 994  TRP A CE3 1 
ATOM   810  C  CZ2 . TRP A 1 107 ? 10.334  -3.872  78.270  1.00 21.35 ? 994  TRP A CZ2 1 
ATOM   811  C  CZ3 . TRP A 1 107 ? 12.221  -2.893  77.144  1.00 26.42 ? 994  TRP A CZ3 1 
ATOM   812  C  CH2 . TRP A 1 107 ? 11.677  -3.829  78.024  1.00 26.57 ? 994  TRP A CH2 1 
ATOM   813  N  N   . ARG A 1 108 ? 9.393   3.008   74.382  1.00 20.96 ? 995  ARG A N   1 
ATOM   814  C  CA  . ARG A 1 108 ? 9.917   4.032   73.524  1.00 21.46 ? 995  ARG A CA  1 
ATOM   815  C  C   . ARG A 1 108 ? 10.980  4.855   74.229  1.00 26.56 ? 995  ARG A C   1 
ATOM   816  O  O   . ARG A 1 108 ? 12.017  5.141   73.632  1.00 22.88 ? 995  ARG A O   1 
ATOM   817  C  CB  . ARG A 1 108 ? 8.789   4.912   72.993  1.00 26.03 ? 995  ARG A CB  1 
ATOM   818  C  CG  . ARG A 1 108 ? 9.251   5.897   71.978  1.00 36.65 ? 995  ARG A CG  1 
ATOM   819  C  CD  . ARG A 1 108 ? 8.122   6.181   71.016  1.00 36.54 ? 995  ARG A CD  1 
ATOM   820  N  NE  . ARG A 1 108 ? 7.055   6.951   71.639  1.00 23.62 ? 995  ARG A NE  1 
ATOM   821  C  CZ  . ARG A 1 108 ? 6.983   8.281   71.613  1.00 42.00 ? 995  ARG A CZ  1 
ATOM   822  N  NH1 . ARG A 1 108 ? 5.950   8.900   72.167  1.00 35.01 ? 995  ARG A NH1 1 
ATOM   823  N  NH2 . ARG A 1 108 ? 7.947   9.010   71.057  1.00 41.99 ? 995  ARG A NH2 1 
ATOM   824  N  N   . MET A 1 109 ? 10.750  5.222   75.497  1.00 23.80 ? 996  MET A N   1 
ATOM   825  C  CA  . MET A 1 109 ? 11.756  5.974   76.284  1.00 24.92 ? 996  MET A CA  1 
ATOM   826  C  C   . MET A 1 109 ? 13.026  5.175   76.475  1.00 20.89 ? 996  MET A C   1 
ATOM   827  O  O   . MET A 1 109 ? 14.133  5.683   76.288  1.00 23.29 ? 996  MET A O   1 
ATOM   828  C  CB  . MET A 1 109 ? 11.208  6.303   77.696  1.00 24.04 ? 996  MET A CB  1 
ATOM   829  C  CG  . MET A 1 109 ? 12.197  7.090   78.574  1.00 23.93 ? 996  MET A CG  1 
ATOM   830  S  SD  . MET A 1 109 ? 11.485  7.477   80.226  1.00 26.56 ? 996  MET A SD  1 
ATOM   831  C  CE  . MET A 1 109 ? 11.408  5.826   80.939  1.00 22.91 ? 996  MET A CE  1 
ATOM   832  N  N   . ILE A 1 110 ? 12.873  3.922   76.908  1.00 18.64 ? 997  ILE A N   1 
ATOM   833  C  CA  . ILE A 1 110 ? 13.994  2.965   76.982  1.00 20.31 ? 997  ILE A CA  1 
ATOM   834  C  C   . ILE A 1 110 ? 14.806  2.951   75.682  1.00 20.29 ? 997  ILE A C   1 
ATOM   835  O  O   . ILE A 1 110 ? 16.018  3.092   75.714  1.00 22.69 ? 997  ILE A O   1 
ATOM   836  C  CB  . ILE A 1 110 ? 13.504  1.545   77.329  1.00 21.62 ? 997  ILE A CB  1 
ATOM   837  C  CG1 . ILE A 1 110 ? 13.121  1.477   78.835  1.00 28.92 ? 997  ILE A CG1 1 
ATOM   838  C  CG2 . ILE A 1 110 ? 14.606  0.500   77.108  1.00 23.87 ? 997  ILE A CG2 1 
ATOM   839  C  CD1 . ILE A 1 110 ? 12.219  0.352   79.183  1.00 33.09 ? 997  ILE A CD1 1 
ATOM   840  N  N   . TRP A 1 111 ? 14.136  2.825   74.537  1.00 23.70 ? 998  TRP A N   1 
ATOM   841  C  CA  . TRP A 1 111 ? 14.861  2.770   73.237  1.00 18.01 ? 998  TRP A CA  1 
ATOM   842  C  C   . TRP A 1 111 ? 15.550  4.120   73.004  1.00 23.67 ? 998  TRP A C   1 
ATOM   843  O  O   . TRP A 1 111 ? 16.745  4.222   72.688  1.00 25.26 ? 998  TRP A O   1 
ATOM   844  C  CB  . TRP A 1 111 ? 13.927  2.419   72.067  1.00 25.32 ? 998  TRP A CB  1 
ATOM   845  C  CG  . TRP A 1 111 ? 14.778  2.196   70.825  1.00 22.70 ? 998  TRP A CG  1 
ATOM   846  C  CD1 . TRP A 1 111 ? 15.063  3.085   69.849  1.00 23.02 ? 998  TRP A CD1 1 
ATOM   847  C  CD2 . TRP A 1 111 ? 15.587  1.046   70.586  1.00 21.14 ? 998  TRP A CD2 1 
ATOM   848  N  NE1 . TRP A 1 111 ? 15.964  2.530   68.949  1.00 23.72 ? 998  TRP A NE1 1 
ATOM   849  C  CE2 . TRP A 1 111 ? 16.308  1.280   69.384  1.00 21.58 ? 998  TRP A CE2 1 
ATOM   850  C  CE3 . TRP A 1 111 ? 15.704  -0.188  71.223  1.00 22.69 ? 998  TRP A CE3 1 
ATOM   851  C  CZ2 . TRP A 1 111 ? 17.155  0.332   68.827  1.00 28.28 ? 998  TRP A CZ2 1 
ATOM   852  C  CZ3 . TRP A 1 111 ? 16.576  -1.134  70.691  1.00 22.31 ? 998  TRP A CZ3 1 
ATOM   853  C  CH2 . TRP A 1 111 ? 17.288  -0.865  69.499  1.00 22.79 ? 998  TRP A CH2 1 
ATOM   854  N  N   . GLN A 1 112 ? 14.768  5.180   73.137  1.00 22.34 ? 999  GLN A N   1 
ATOM   855  C  CA  . GLN A 1 112 ? 15.264  6.538   72.877  1.00 24.36 ? 999  GLN A CA  1 
ATOM   856  C  C   . GLN A 1 112 ? 16.482  6.862   73.714  1.00 18.34 ? 999  GLN A C   1 
ATOM   857  O  O   . GLN A 1 112 ? 17.418  7.527   73.230  1.00 23.98 ? 999  GLN A O   1 
ATOM   858  C  CB  . GLN A 1 112 ? 14.190  7.548   73.208  1.00 26.10 ? 999  GLN A CB  1 
ATOM   859  C  CG  . GLN A 1 112 ? 14.555  8.998   72.912  1.00 31.40 ? 999  GLN A CG  1 
ATOM   860  C  CD  . GLN A 1 112 ? 13.410  9.930   73.262  1.00 36.37 ? 999  GLN A CD  1 
ATOM   861  O  OE1 . GLN A 1 112 ? 12.405  9.978   72.546  1.00 36.18 ? 999  GLN A OE1 1 
ATOM   862  N  NE2 . GLN A 1 112 ? 13.541  10.650  74.387  1.00 26.81 ? 999  GLN A NE2 1 
ATOM   863  N  N   . GLU A 1 113 ? 16.451  6.460   74.978  1.00 20.94 ? 1000 GLU A N   1 
ATOM   864  C  CA  . GLU A 1 113 ? 17.474  6.851   75.920  1.00 23.43 ? 1000 GLU A CA  1 
ATOM   865  C  C   . GLU A 1 113 ? 18.672  5.915   75.986  1.00 25.47 ? 1000 GLU A C   1 
ATOM   866  O  O   . GLU A 1 113 ? 19.641  6.199   76.671  1.00 22.04 ? 1000 GLU A O   1 
ATOM   867  C  CB  . GLU A 1 113 ? 16.849  6.990   77.308  1.00 26.33 ? 1000 GLU A CB  1 
ATOM   868  C  CG  . GLU A 1 113 ? 15.779  8.080   77.372  1.00 29.22 ? 1000 GLU A CG  1 
ATOM   869  C  CD  . GLU A 1 113 ? 16.327  9.453   77.112  1.00 42.32 ? 1000 GLU A CD  1 
ATOM   870  O  OE1 . GLU A 1 113 ? 17.214  9.874   77.876  1.00 30.96 ? 1000 GLU A OE1 1 
ATOM   871  O  OE2 . GLU A 1 113 ? 15.891  10.080  76.120  1.00 31.29 ? 1000 GLU A OE2 1 
ATOM   872  N  N   . ASN A 1 114 ? 18.625  4.806   75.260  1.00 26.61 ? 1001 ASN A N   1 
ATOM   873  C  CA  . ASN A 1 114 ? 19.715  3.808   75.280  1.00 21.45 ? 1001 ASN A CA  1 
ATOM   874  C  C   . ASN A 1 114 ? 19.937  3.179   76.644  1.00 20.79 ? 1001 ASN A C   1 
ATOM   875  O  O   . ASN A 1 114 ? 21.061  2.770   77.000  1.00 23.79 ? 1001 ASN A O   1 
ATOM   876  C  CB  . ASN A 1 114 ? 21.032  4.389   74.714  1.00 24.94 ? 1001 ASN A CB  1 
ATOM   877  C  CG  . ASN A 1 114 ? 22.036  3.285   74.314  1.00 27.76 ? 1001 ASN A CG  1 
ATOM   878  O  OD1 . ASN A 1 114 ? 21.639  2.207   73.847  1.00 24.26 ? 1001 ASN A OD1 1 
ATOM   879  N  ND2 . ASN A 1 114 ? 23.331  3.550   74.512  1.00 26.32 ? 1001 ASN A ND2 1 
ATOM   880  N  N   . SER A 1 115 ? 18.855  3.036   77.399  1.00 21.96 ? 1002 SER A N   1 
ATOM   881  C  CA  . SER A 1 115 ? 18.925  2.405   78.701  1.00 21.14 ? 1002 SER A CA  1 
ATOM   882  C  C   . SER A 1 115 ? 19.186  0.922   78.593  1.00 27.55 ? 1002 SER A C   1 
ATOM   883  O  O   . SER A 1 115 ? 18.631  0.254   77.727  1.00 29.33 ? 1002 SER A O   1 
ATOM   884  C  CB  . SER A 1 115 ? 17.622  2.659   79.473  1.00 23.82 ? 1002 SER A CB  1 
ATOM   885  O  OG  . SER A 1 115 ? 17.425  4.043   79.673  1.00 26.16 ? 1002 SER A OG  1 
ATOM   886  N  N   . ALA A 1 116 ? 20.051  0.418   79.470  1.00 23.00 ? 1003 ALA A N   1 
ATOM   887  C  CA  . ALA A 1 116 ? 20.446  -1.012  79.492  1.00 23.48 ? 1003 ALA A CA  1 
ATOM   888  C  C   . ALA A 1 116 ? 19.911  -1.669  80.756  1.00 27.81 ? 1003 ALA A C   1 
ATOM   889  O  O   . ALA A 1 116 ? 19.933  -2.886  80.844  1.00 22.07 ? 1003 ALA A O   1 
ATOM   890  C  CB  . ALA A 1 116 ? 21.973  -1.164  79.463  1.00 26.26 ? 1003 ALA A CB  1 
ATOM   891  N  N   . SER A 1 117 ? 19.476  -0.875  81.745  1.00 26.14 ? 1004 SER A N   1 
ATOM   892  C  CA  . SER A 1 117 ? 19.020  -1.427  83.044  1.00 23.48 ? 1004 SER A CA  1 
ATOM   893  C  C   . SER A 1 117 ? 17.708  -0.773  83.459  1.00 23.49 ? 1004 SER A C   1 
ATOM   894  O  O   . SER A 1 117 ? 17.528  0.451   83.329  1.00 22.36 ? 1004 SER A O   1 
ATOM   895  C  CB  . SER A 1 117 ? 20.045  -1.192  84.157  1.00 21.48 ? 1004 SER A CB  1 
ATOM   896  O  OG  . SER A 1 117 ? 21.273  -1.865  83.886  1.00 23.34 ? 1004 SER A OG  1 
ATOM   897  N  N   . ILE A 1 118 ? 16.795  -1.618  83.939  1.00 22.39 ? 1005 ILE A N   1 
ATOM   898  C  CA  . ILE A 1 118 ? 15.580  -1.209  84.589  1.00 19.36 ? 1005 ILE A CA  1 
ATOM   899  C  C   . ILE A 1 118 ? 15.639  -1.746  86.022  1.00 22.64 ? 1005 ILE A C   1 
ATOM   900  O  O   . ILE A 1 118 ? 15.932  -2.917  86.232  1.00 22.47 ? 1005 ILE A O   1 
ATOM   901  C  CB  . ILE A 1 118 ? 14.314  -1.766  83.903  1.00 20.21 ? 1005 ILE A CB  1 
ATOM   902  C  CG1 . ILE A 1 118 ? 14.202  -1.277  82.464  1.00 25.09 ? 1005 ILE A CG1 1 
ATOM   903  C  CG2 . ILE A 1 118 ? 13.029  -1.350  84.656  1.00 25.28 ? 1005 ILE A CG2 1 
ATOM   904  C  CD1 . ILE A 1 118 ? 13.172  -2.034  81.648  1.00 25.97 ? 1005 ILE A CD1 1 
ATOM   905  N  N   . VAL A 1 119 ? 15.380  -0.873  87.004  1.00 22.23 ? 1006 VAL A N   1 
ATOM   906  C  CA  . VAL A 1 119 ? 15.338  -1.245  88.404  1.00 24.57 ? 1006 VAL A CA  1 
ATOM   907  C  C   . VAL A 1 119 ? 13.903  -1.071  88.856  1.00 24.92 ? 1006 VAL A C   1 
ATOM   908  O  O   . VAL A 1 119 ? 13.388  0.028   88.909  1.00 24.30 ? 1006 VAL A O   1 
ATOM   909  C  CB  . VAL A 1 119 ? 16.322  -0.385  89.243  1.00 24.36 ? 1006 VAL A CB  1 
ATOM   910  C  CG1 . VAL A 1 119 ? 16.097  -0.567  90.785  1.00 22.49 ? 1006 VAL A CG1 1 
ATOM   911  C  CG2 . VAL A 1 119 ? 17.800  -0.633  88.782  1.00 23.44 ? 1006 VAL A CG2 1 
ATOM   912  N  N   . MET A 1 120 ? 13.262  -2.195  89.169  1.00 23.37 ? 1007 MET A N   1 
ATOM   913  C  CA  . MET A 1 120 ? 11.876  -2.262  89.565  1.00 22.66 ? 1007 MET A CA  1 
ATOM   914  C  C   . MET A 1 120 ? 11.801  -2.610  91.056  1.00 23.83 ? 1007 MET A C   1 
ATOM   915  O  O   . MET A 1 120 ? 12.215  -3.704  91.484  1.00 23.36 ? 1007 MET A O   1 
ATOM   916  C  CB  . MET A 1 120 ? 11.173  -3.328  88.714  1.00 22.12 ? 1007 MET A CB  1 
ATOM   917  C  CG  . MET A 1 120 ? 9.744   -3.524  89.092  1.00 31.33 ? 1007 MET A CG  1 
ATOM   918  S  SD  . MET A 1 120 ? 8.920   -4.565  87.902  1.00 25.25 ? 1007 MET A SD  1 
ATOM   919  C  CE  . MET A 1 120 ? 7.338   -4.809  88.705  1.00 21.62 ? 1007 MET A CE  1 
ATOM   920  N  N   . VAL A 1 121 ? 11.328  -1.665  91.857  1.00 22.49 ? 1008 VAL A N   1 
ATOM   921  C  CA  . VAL A 1 121 ? 11.266  -1.863  93.324  1.00 23.49 ? 1008 VAL A CA  1 
ATOM   922  C  C   . VAL A 1 121 ? 9.820   -1.899  93.812  1.00 29.24 ? 1008 VAL A C   1 
ATOM   923  O  O   . VAL A 1 121 ? 9.398   -1.174  94.717  1.00 32.68 ? 1008 VAL A O   1 
ATOM   924  C  CB  A VAL A 1 121 ? 12.199  -0.890  94.128  0.50 26.40 ? 1008 VAL A CB  1 
ATOM   925  C  CB  B VAL A 1 121 ? 12.054  -0.755  94.070  0.50 22.65 ? 1008 VAL A CB  1 
ATOM   926  C  CG1 A VAL A 1 121 ? 13.682  -1.377  94.030  0.50 17.33 ? 1008 VAL A CG1 1 
ATOM   927  C  CG1 B VAL A 1 121 ? 12.352  -1.201  95.488  0.50 23.61 ? 1008 VAL A CG1 1 
ATOM   928  C  CG2 A VAL A 1 121 ? 12.068  0.543   93.649  0.50 17.82 ? 1008 VAL A CG2 1 
ATOM   929  C  CG2 B VAL A 1 121 ? 13.355  -0.401  93.295  0.50 14.36 ? 1008 VAL A CG2 1 
ATOM   930  N  N   . THR A 1 122 ? 9.048   -2.757  93.168  1.00 30.29 ? 1009 THR A N   1 
ATOM   931  C  CA  . THR A 1 122 ? 7.642   -2.965  93.529  1.00 25.13 ? 1009 THR A CA  1 
ATOM   932  C  C   . THR A 1 122 ? 7.284   -4.339  93.002  1.00 23.00 ? 1009 THR A C   1 
ATOM   933  O  O   . THR A 1 122 ? 7.918   -4.818  92.031  1.00 25.42 ? 1009 THR A O   1 
ATOM   934  C  CB  . THR A 1 122 ? 6.700   -1.893  92.893  1.00 29.54 ? 1009 THR A CB  1 
ATOM   935  O  OG1 . THR A 1 122 ? 5.349   -2.034  93.399  1.00 25.25 ? 1009 THR A OG1 1 
ATOM   936  C  CG2 . THR A 1 122 ? 6.688   -2.016  91.344  1.00 26.98 ? 1009 THR A CG2 1 
ATOM   937  N  N   . ASN A 1 123 ? 6.275   -4.958  93.613  1.00 25.61 ? 1010 ASN A N   1 
ATOM   938  C  CA  . ASN A 1 123 ? 5.533   -6.040  92.956  1.00 21.86 ? 1010 ASN A CA  1 
ATOM   939  C  C   . ASN A 1 123 ? 4.400   -5.458  92.134  1.00 29.11 ? 1010 ASN A C   1 
ATOM   940  O  O   . ASN A 1 123 ? 4.021   -4.296  92.308  1.00 23.47 ? 1010 ASN A O   1 
ATOM   941  C  CB  . ASN A 1 123 ? 5.053   -7.073  93.980  1.00 32.22 ? 1010 ASN A CB  1 
ATOM   942  C  CG  . ASN A 1 123 ? 6.194   -7.967  94.482  1.00 38.41 ? 1010 ASN A CG  1 
ATOM   943  O  OD1 . ASN A 1 123 ? 6.803   -8.679  93.693  1.00 40.48 ? 1010 ASN A OD1 1 
ATOM   944  N  ND2 . ASN A 1 123 ? 6.504   -7.901  95.791  1.00 27.70 ? 1010 ASN A ND2 1 
ATOM   945  N  N   . LEU A 1 124 ? 3.884   -6.251  91.206  1.00 26.07 ? 1011 LEU A N   1 
ATOM   946  C  CA  . LEU A 1 124 ? 2.808   -5.807  90.345  1.00 23.54 ? 1011 LEU A CA  1 
ATOM   947  C  C   . LEU A 1 124 ? 1.520   -5.585  91.102  1.00 24.19 ? 1011 LEU A C   1 
ATOM   948  O  O   . LEU A 1 124 ? 0.804   -4.653  90.817  1.00 28.17 ? 1011 LEU A O   1 
ATOM   949  C  CB  . LEU A 1 124 ? 2.559   -6.814  89.255  1.00 21.33 ? 1011 LEU A CB  1 
ATOM   950  C  CG  . LEU A 1 124 ? 3.700   -7.007  88.236  1.00 25.92 ? 1011 LEU A CG  1 
ATOM   951  C  CD1 . LEU A 1 124 ? 3.338   -8.169  87.354  1.00 32.65 ? 1011 LEU A CD1 1 
ATOM   952  C  CD2 . LEU A 1 124 ? 4.023   -5.752  87.369  1.00 20.08 ? 1011 LEU A CD2 1 
ATOM   953  N  N   . VAL A 1 125 ? 1.215   -6.490  92.021  1.00 25.09 ? 1012 VAL A N   1 
ATOM   954  C  CA  . VAL A 1 125 ? 0.045   -6.366  92.888  1.00 26.90 ? 1012 VAL A CA  1 
ATOM   955  C  C   . VAL A 1 125 ? 0.536   -6.466  94.331  1.00 23.96 ? 1012 VAL A C   1 
ATOM   956  O  O   . VAL A 1 125 ? 1.348   -7.331  94.646  1.00 25.82 ? 1012 VAL A O   1 
ATOM   957  C  CB  . VAL A 1 125 ? -0.990  -7.476  92.568  1.00 27.87 ? 1012 VAL A CB  1 
ATOM   958  C  CG1 . VAL A 1 125 ? -2.184  -7.431  93.537  1.00 27.23 ? 1012 VAL A CG1 1 
ATOM   959  C  CG2 . VAL A 1 125 ? -1.417  -7.362  91.093  1.00 33.20 ? 1012 VAL A CG2 1 
ATOM   960  N  N   . GLU A 1 126 ? 0.066   -5.571  95.186  1.00 23.84 ? 1013 GLU A N   1 
ATOM   961  C  CA  . GLU A 1 126 ? 0.404   -5.597  96.618  1.00 28.30 ? 1013 GLU A CA  1 
ATOM   962  C  C   . GLU A 1 126 ? -0.869  -5.404  97.434  1.00 30.77 ? 1013 GLU A C   1 
ATOM   963  O  O   . GLU A 1 126 ? -1.612  -4.449  97.209  1.00 31.11 ? 1013 GLU A O   1 
ATOM   964  C  CB  . GLU A 1 126 ? 1.449   -4.537  96.960  1.00 34.34 ? 1013 GLU A CB  1 
ATOM   965  C  CG  . GLU A 1 126 ? 2.742   -4.738  96.185  1.00 39.83 ? 1013 GLU A CG  1 
ATOM   966  C  CD  . GLU A 1 126 ? 3.857   -3.749  96.520  1.00 33.74 ? 1013 GLU A CD  1 
ATOM   967  O  OE1 . GLU A 1 126 ? 3.678   -2.787  97.294  1.00 27.03 ? 1013 GLU A OE1 1 
ATOM   968  O  OE2 . GLU A 1 126 ? 4.952   -3.925  95.981  1.00 25.17 ? 1013 GLU A OE2 1 
ATOM   969  N  N   . VAL A 1 127 ? -1.136  -6.345  98.332  1.00 35.51 ? 1014 VAL A N   1 
ATOM   970  C  CA  . VAL A 1 127 ? -2.373  -6.352  99.130  1.00 37.94 ? 1014 VAL A CA  1 
ATOM   971  C  C   . VAL A 1 127 ? -3.580  -5.974  98.279  1.00 37.43 ? 1014 VAL A C   1 
ATOM   972  O  O   . VAL A 1 127 ? -4.308  -5.045  98.592  1.00 41.43 ? 1014 VAL A O   1 
ATOM   973  C  CB  . VAL A 1 127 ? -2.283  -5.419  100.353 1.00 44.85 ? 1014 VAL A CB  1 
ATOM   974  N  N   . GLY A 1 128 ? -3.743  -6.680  97.165  1.00 38.76 ? 1015 GLY A N   1 
ATOM   975  C  CA  . GLY A 1 128 ? -4.961  -6.589  96.363  1.00 39.12 ? 1015 GLY A CA  1 
ATOM   976  C  C   . GLY A 1 128 ? -5.108  -5.369  95.472  1.00 41.85 ? 1015 GLY A C   1 
ATOM   977  O  O   . GLY A 1 128 ? -6.180  -5.173  94.881  1.00 43.42 ? 1015 GLY A O   1 
ATOM   978  N  N   . ARG A 1 129 ? -4.047  -4.566  95.348  1.00 37.20 ? 1016 ARG A N   1 
ATOM   979  C  CA  . ARG A 1 129 ? -4.074  -3.343  94.540  1.00 28.72 ? 1016 ARG A CA  1 
ATOM   980  C  C   . ARG A 1 129 ? -3.011  -3.432  93.466  1.00 34.89 ? 1016 ARG A C   1 
ATOM   981  O  O   . ARG A 1 129 ? -1.875  -3.739  93.767  1.00 26.68 ? 1016 ARG A O   1 
ATOM   982  C  CB  . ARG A 1 129 ? -3.775  -2.141  95.419  1.00 29.54 ? 1016 ARG A CB  1 
ATOM   983  N  N   . VAL A 1 130 ? -3.368  -3.140  92.224  1.00 33.24 ? 1017 VAL A N   1 
ATOM   984  C  CA  . VAL A 1 130 ? -2.374  -3.078  91.159  1.00 32.71 ? 1017 VAL A CA  1 
ATOM   985  C  C   . VAL A 1 130 ? -1.479  -1.857  91.348  1.00 29.19 ? 1017 VAL A C   1 
ATOM   986  O  O   . VAL A 1 130 ? -1.948  -0.720  91.465  1.00 28.62 ? 1017 VAL A O   1 
ATOM   987  C  CB  . VAL A 1 130 ? -2.997  -3.004  89.752  1.00 41.56 ? 1017 VAL A CB  1 
ATOM   988  C  CG1 . VAL A 1 130 ? -1.885  -2.998  88.692  1.00 30.46 ? 1017 VAL A CG1 1 
ATOM   989  C  CG2 . VAL A 1 130 ? -3.955  -4.155  89.548  1.00 39.79 ? 1017 VAL A CG2 1 
ATOM   990  N  N   . LYS A 1 131 ? -0.186  -2.125  91.342  1.00 24.29 ? 1018 LYS A N   1 
ATOM   991  C  CA  . LYS A 1 131 ? 0.842   -1.121  91.532  1.00 26.07 ? 1018 LYS A CA  1 
ATOM   992  C  C   . LYS A 1 131 ? 1.556   -0.790  90.216  1.00 24.93 ? 1018 LYS A C   1 
ATOM   993  O  O   . LYS A 1 131 ? 2.152   0.270   90.094  1.00 21.69 ? 1018 LYS A O   1 
ATOM   994  C  CB  . LYS A 1 131 ? 1.850   -1.625  92.557  1.00 26.57 ? 1018 LYS A CB  1 
ATOM   995  C  CG  . LYS A 1 131 ? 1.283   -1.923  93.931  1.00 31.95 ? 1018 LYS A CG  1 
ATOM   996  C  CD  . LYS A 1 131 ? 0.882   -0.643  94.649  1.00 26.11 ? 1018 LYS A CD  1 
ATOM   997  C  CE  . LYS A 1 131 ? 0.628   -0.898  96.131  1.00 34.69 ? 1018 LYS A CE  1 
ATOM   998  N  NZ  . LYS A 1 131 ? 0.338   0.353   96.879  1.00 59.90 ? 1018 LYS A NZ  1 
ATOM   999  N  N   . CYS A 1 132 ? 1.487   -1.693  89.240  1.00 24.61 ? 1019 CYS A N   1 
ATOM   1000 C  CA  . CYS A 1 132 ? 2.296   -1.615  88.019  1.00 24.49 ? 1019 CYS A CA  1 
ATOM   1001 C  C   . CYS A 1 132 ? 1.725   -2.668  87.078  1.00 27.74 ? 1019 CYS A C   1 
ATOM   1002 O  O   . CYS A 1 132 ? 1.350   -3.732  87.519  1.00 25.16 ? 1019 CYS A O   1 
ATOM   1003 C  CB  . CYS A 1 132 ? 3.778   -1.924  88.341  1.00 22.10 ? 1019 CYS A CB  1 
ATOM   1004 S  SG  . CYS A 1 132 ? 4.889   -1.818  86.964  1.00 28.06 ? 1019 CYS A SG  1 
ATOM   1005 N  N   . VAL A 1 133 ? 1.621   -2.375  85.787  1.00 22.73 ? 1020 VAL A N   1 
ATOM   1006 C  CA  . VAL A 1 133 ? 1.202   -3.420  84.845  1.00 27.55 ? 1020 VAL A CA  1 
ATOM   1007 C  C   . VAL A 1 133 ? 2.451   -4.181  84.398  1.00 31.74 ? 1020 VAL A C   1 
ATOM   1008 O  O   . VAL A 1 133 ? 3.542   -3.615  84.347  1.00 32.29 ? 1020 VAL A O   1 
ATOM   1009 C  CB  . VAL A 1 133 ? 0.474   -2.824  83.626  1.00 25.18 ? 1020 VAL A CB  1 
ATOM   1010 C  CG1 . VAL A 1 133 ? -0.708  -1.981  84.111  1.00 29.03 ? 1020 VAL A CG1 1 
ATOM   1011 C  CG2 . VAL A 1 133 ? 1.426   -2.017  82.792  1.00 31.54 ? 1020 VAL A CG2 1 
ATOM   1012 N  N   . ARG A 1 134 ? 2.285   -5.464  84.092  1.00 24.04 ? 1021 ARG A N   1 
ATOM   1013 C  CA  . ARG A 1 134 ? 3.374   -6.273  83.588  1.00 27.55 ? 1021 ARG A CA  1 
ATOM   1014 C  C   . ARG A 1 134 ? 3.709   -5.726  82.211  1.00 28.41 ? 1021 ARG A C   1 
ATOM   1015 O  O   . ARG A 1 134 ? 2.830   -5.550  81.353  1.00 25.37 ? 1021 ARG A O   1 
ATOM   1016 C  CB  . ARG A 1 134 ? 2.931   -7.729  83.494  1.00 36.54 ? 1021 ARG A CB  1 
ATOM   1017 C  CG  . ARG A 1 134 ? 4.055   -8.669  83.118  1.00 51.32 ? 1021 ARG A CG  1 
ATOM   1018 C  CD  . ARG A 1 134 ? 3.865   -10.060 83.715  1.00 57.73 ? 1021 ARG A CD  1 
ATOM   1019 N  NE  . ARG A 1 134 ? 4.955   -10.902 83.261  1.00 58.29 ? 1021 ARG A NE  1 
ATOM   1020 C  CZ  . ARG A 1 134 ? 5.010   -11.474 82.063  1.00 59.88 ? 1021 ARG A CZ  1 
ATOM   1021 N  NH1 . ARG A 1 134 ? 4.012   -11.339 81.197  1.00 79.05 ? 1021 ARG A NH1 1 
ATOM   1022 N  NH2 . ARG A 1 134 ? 6.061   -12.203 81.727  1.00 49.83 ? 1021 ARG A NH2 1 
ATOM   1023 N  N   . TYR A 1 135 ? 4.960   -5.386  82.014  1.00 22.60 ? 1022 TYR A N   1 
ATOM   1024 C  CA  . TYR A 1 135 ? 5.405   -4.724  80.778  1.00 20.33 ? 1022 TYR A CA  1 
ATOM   1025 C  C   . TYR A 1 135 ? 6.533   -5.479  80.089  1.00 24.43 ? 1022 TYR A C   1 
ATOM   1026 O  O   . TYR A 1 135 ? 7.126   -4.997  79.155  1.00 24.86 ? 1022 TYR A O   1 
ATOM   1027 C  CB  . TYR A 1 135 ? 5.844   -3.287  81.104  1.00 25.04 ? 1022 TYR A CB  1 
ATOM   1028 C  CG  . TYR A 1 135 ? 6.983   -3.182  82.121  1.00 22.50 ? 1022 TYR A CG  1 
ATOM   1029 C  CD1 . TYR A 1 135 ? 8.277   -3.290  81.747  1.00 21.03 ? 1022 TYR A CD1 1 
ATOM   1030 C  CD2 . TYR A 1 135 ? 6.718   -2.970  83.472  1.00 20.85 ? 1022 TYR A CD2 1 
ATOM   1031 C  CE1 . TYR A 1 135 ? 9.327   -3.170  82.675  1.00 20.33 ? 1022 TYR A CE1 1 
ATOM   1032 C  CE2 . TYR A 1 135 ? 7.752   -2.863  84.400  1.00 21.79 ? 1022 TYR A CE2 1 
ATOM   1033 C  CZ  . TYR A 1 135 ? 9.047   -2.961  83.989  1.00 23.42 ? 1022 TYR A CZ  1 
ATOM   1034 O  OH  . TYR A 1 135 ? 10.061  -2.831  84.917  1.00 25.41 ? 1022 TYR A OH  1 
ATOM   1035 N  N   . TRP A 1 136 ? 6.813   -6.695  80.532  1.00 24.77 ? 1023 TRP A N   1 
ATOM   1036 C  CA  . TRP A 1 136 ? 7.876   -7.502  79.975  1.00 22.92 ? 1023 TRP A CA  1 
ATOM   1037 C  C   . TRP A 1 136 ? 7.281   -8.858  79.593  1.00 23.62 ? 1023 TRP A C   1 
ATOM   1038 O  O   . TRP A 1 136 ? 6.298   -9.311  80.196  1.00 26.37 ? 1023 TRP A O   1 
ATOM   1039 C  CB  . TRP A 1 136 ? 9.064   -7.645  80.980  1.00 24.85 ? 1023 TRP A CB  1 
ATOM   1040 C  CG  . TRP A 1 136 ? 8.707   -8.443  82.204  1.00 26.15 ? 1023 TRP A CG  1 
ATOM   1041 C  CD1 . TRP A 1 136 ? 8.820   -9.790  82.351  1.00 24.71 ? 1023 TRP A CD1 1 
ATOM   1042 C  CD2 . TRP A 1 136 ? 8.164   -7.949  83.432  1.00 24.09 ? 1023 TRP A CD2 1 
ATOM   1043 N  NE1 . TRP A 1 136 ? 8.368   -10.177 83.584  1.00 26.40 ? 1023 TRP A NE1 1 
ATOM   1044 C  CE2 . TRP A 1 136 ? 7.962   -9.061  84.273  1.00 28.54 ? 1023 TRP A CE2 1 
ATOM   1045 C  CE3 . TRP A 1 136 ? 7.816   -6.687  83.895  1.00 24.50 ? 1023 TRP A CE3 1 
ATOM   1046 C  CZ2 . TRP A 1 136 ? 7.448   -8.940  85.553  1.00 29.37 ? 1023 TRP A CZ2 1 
ATOM   1047 C  CZ3 . TRP A 1 136 ? 7.296   -6.569  85.179  1.00 29.07 ? 1023 TRP A CZ3 1 
ATOM   1048 C  CH2 . TRP A 1 136 ? 7.112   -7.686  85.981  1.00 26.30 ? 1023 TRP A CH2 1 
ATOM   1049 N  N   . PRO A 1 137 ? 7.861   -9.515  78.578  1.00 23.16 ? 1024 PRO A N   1 
ATOM   1050 C  CA  . PRO A 1 137 ? 7.320   -10.753 78.093  1.00 26.91 ? 1024 PRO A CA  1 
ATOM   1051 C  C   . PRO A 1 137 ? 7.760   -12.024 78.818  1.00 30.04 ? 1024 PRO A C   1 
ATOM   1052 O  O   . PRO A 1 137 ? 8.860   -12.100 79.341  1.00 25.46 ? 1024 PRO A O   1 
ATOM   1053 C  CB  . PRO A 1 137 ? 7.846   -10.776 76.650  1.00 25.08 ? 1024 PRO A CB  1 
ATOM   1054 C  CG  . PRO A 1 137 ? 9.188   -10.216 76.791  1.00 27.42 ? 1024 PRO A CG  1 
ATOM   1055 C  CD  . PRO A 1 137 ? 9.009   -9.077  77.758  1.00 26.65 ? 1024 PRO A CD  1 
ATOM   1056 N  N   . ASP A 1 138 ? 6.914   -13.036 78.777  1.00 23.79 ? 1025 ASP A N   1 
ATOM   1057 C  CA  . ASP A 1 138 ? 7.342   -14.401 79.150  1.00 30.07 ? 1025 ASP A CA  1 
ATOM   1058 C  C   . ASP A 1 138 ? 8.259   -15.017 78.127  1.00 29.72 ? 1025 ASP A C   1 
ATOM   1059 O  O   . ASP A 1 138 ? 9.065   -15.884 78.438  1.00 33.70 ? 1025 ASP A O   1 
ATOM   1060 C  CB  . ASP A 1 138 ? 6.137   -15.363 79.242  1.00 39.21 ? 1025 ASP A CB  1 
ATOM   1061 C  CG  . ASP A 1 138 ? 5.404   -15.280 80.550  1.00 48.78 ? 1025 ASP A CG  1 
ATOM   1062 O  OD1 . ASP A 1 138 ? 5.989   -14.837 81.561  1.00 46.52 ? 1025 ASP A OD1 1 
ATOM   1063 O  OD2 . ASP A 1 138 ? 4.225   -15.685 80.552  1.00 52.81 ? 1025 ASP A OD2 1 
ATOM   1064 N  N   . ASP A 1 139 ? 8.069   -14.620 76.874  1.00 28.66 ? 1026 ASP A N   1 
ATOM   1065 C  CA  . ASP A 1 139 ? 8.846   -15.113 75.772  1.00 24.95 ? 1026 ASP A CA  1 
ATOM   1066 C  C   . ASP A 1 139 ? 9.218   -13.895 74.917  1.00 25.28 ? 1026 ASP A C   1 
ATOM   1067 O  O   . ASP A 1 139 ? 10.277  -13.341 75.114  1.00 25.61 ? 1026 ASP A O   1 
ATOM   1068 C  CB  . ASP A 1 139 ? 8.068   -16.154 74.955  1.00 31.98 ? 1026 ASP A CB  1 
ATOM   1069 C  CG  . ASP A 1 139 ? 8.846   -16.644 73.750  1.00 36.66 ? 1026 ASP A CG  1 
ATOM   1070 O  OD1 . ASP A 1 139 ? 9.987   -16.199 73.530  1.00 33.84 ? 1026 ASP A OD1 1 
ATOM   1071 O  OD2 . ASP A 1 139 ? 8.318   -17.492 73.020  1.00 35.20 ? 1026 ASP A OD2 1 
ATOM   1072 N  N   . THR A 1 140 ? 8.352   -13.478 73.992  1.00 23.70 ? 1027 THR A N   1 
ATOM   1073 C  CA  . THR A 1 140 ? 8.626   -12.316 73.131  1.00 23.04 ? 1027 THR A CA  1 
ATOM   1074 C  C   . THR A 1 140 ? 7.341   -11.465 72.956  1.00 28.32 ? 1027 THR A C   1 
ATOM   1075 O  O   . THR A 1 140 ? 6.241   -12.009 72.854  1.00 23.66 ? 1027 THR A O   1 
ATOM   1076 C  CB  . THR A 1 140 ? 9.208   -12.734 71.769  1.00 26.39 ? 1027 THR A CB  1 
ATOM   1077 O  OG1 . THR A 1 140 ? 9.722   -11.581 71.077  1.00 34.04 ? 1027 THR A OG1 1 
ATOM   1078 C  CG2 . THR A 1 140 ? 8.131   -13.383 70.892  1.00 35.31 ? 1027 THR A CG2 1 
ATOM   1079 N  N   . GLU A 1 141 ? 7.474   -10.146 72.904  1.00 22.82 ? 1028 GLU A N   1 
ATOM   1080 C  CA  . GLU A 1 141 ? 6.297   -9.248  72.724  1.00 18.53 ? 1028 GLU A CA  1 
ATOM   1081 C  C   . GLU A 1 141 ? 6.776   -7.936  72.108  1.00 20.74 ? 1028 GLU A C   1 
ATOM   1082 O  O   . GLU A 1 141 ? 7.973   -7.616  72.200  1.00 23.52 ? 1028 GLU A O   1 
ATOM   1083 C  CB  A GLU A 1 141 ? 5.520   -9.021  74.026  0.50 21.12 ? 1028 GLU A CB  1 
ATOM   1084 C  CB  B GLU A 1 141 ? 5.582   -8.988  74.072  0.50 23.83 ? 1028 GLU A CB  1 
ATOM   1085 C  CG  A GLU A 1 141 ? 4.134   -8.379  73.782  0.50 18.26 ? 1028 GLU A CG  1 
ATOM   1086 C  CG  B GLU A 1 141 ? 4.889   -10.219 74.729  0.50 24.43 ? 1028 GLU A CG  1 
ATOM   1087 C  CD  A GLU A 1 141 ? 3.136   -8.530  74.919  0.50 23.43 ? 1028 GLU A CD  1 
ATOM   1088 C  CD  B GLU A 1 141 ? 3.971   -9.876  75.910  0.50 50.04 ? 1028 GLU A CD  1 
ATOM   1089 O  OE1 A GLU A 1 141 ? 2.250   -7.649  75.041  0.50 33.56 ? 1028 GLU A OE1 1 
ATOM   1090 O  OE1 B GLU A 1 141 ? 4.098   -8.787  76.527  0.50 28.03 ? 1028 GLU A OE1 1 
ATOM   1091 O  OE2 A GLU A 1 141 ? 3.210   -9.524  75.671  0.50 49.36 ? 1028 GLU A OE2 1 
ATOM   1092 O  OE2 B GLU A 1 141 ? 3.112   -10.727 76.230  0.50 46.27 ? 1028 GLU A OE2 1 
ATOM   1093 N  N   . VAL A 1 142 ? 5.874   -7.241  71.415  1.00 20.27 ? 1029 VAL A N   1 
ATOM   1094 C  CA  . VAL A 1 142 ? 6.185   -5.984  70.755  1.00 16.77 ? 1029 VAL A CA  1 
ATOM   1095 C  C   . VAL A 1 142 ? 5.380   -4.899  71.414  1.00 21.27 ? 1029 VAL A C   1 
ATOM   1096 O  O   . VAL A 1 142 ? 4.149   -5.016  71.543  1.00 23.75 ? 1029 VAL A O   1 
ATOM   1097 C  CB  . VAL A 1 142 ? 5.935   -6.006  69.223  1.00 21.25 ? 1029 VAL A CB  1 
ATOM   1098 C  CG1 . VAL A 1 142 ? 6.327   -4.634  68.616  1.00 21.13 ? 1029 VAL A CG1 1 
ATOM   1099 C  CG2 . VAL A 1 142 ? 6.748   -7.131  68.550  1.00 19.25 ? 1029 VAL A CG2 1 
ATOM   1100 N  N   . TYR A 1 143 ? 6.094   -3.909  71.952  1.00 18.53 ? 1030 TYR A N   1 
ATOM   1101 C  CA  . TYR A 1 143 ? 5.460   -2.780  72.620  1.00 21.94 ? 1030 TYR A CA  1 
ATOM   1102 C  C   . TYR A 1 143 ? 5.695   -1.559  71.722  1.00 21.98 ? 1030 TYR A C   1 
ATOM   1103 O  O   . TYR A 1 143 ? 6.839   -1.094  71.530  1.00 23.09 ? 1030 TYR A O   1 
ATOM   1104 C  CB  . TYR A 1 143 ? 6.054   -2.626  74.021  1.00 19.33 ? 1030 TYR A CB  1 
ATOM   1105 C  CG  . TYR A 1 143 ? 6.059   -3.907  74.835  1.00 24.59 ? 1030 TYR A CG  1 
ATOM   1106 C  CD1 . TYR A 1 143 ? 4.918   -4.365  75.461  1.00 25.10 ? 1030 TYR A CD1 1 
ATOM   1107 C  CD2 . TYR A 1 143 ? 7.233   -4.639  75.015  1.00 27.19 ? 1030 TYR A CD2 1 
ATOM   1108 C  CE1 . TYR A 1 143 ? 4.947   -5.546  76.258  1.00 20.84 ? 1030 TYR A CE1 1 
ATOM   1109 C  CE2 . TYR A 1 143 ? 7.248   -5.817  75.772  1.00 29.83 ? 1030 TYR A CE2 1 
ATOM   1110 C  CZ  . TYR A 1 143 ? 6.102   -6.254  76.399  1.00 21.99 ? 1030 TYR A CZ  1 
ATOM   1111 O  OH  . TYR A 1 143 ? 6.137   -7.408  77.152  1.00 25.13 ? 1030 TYR A OH  1 
ATOM   1112 N  N   . GLY A 1 144 ? 4.615   -1.115  71.081  1.00 22.10 ? 1031 GLY A N   1 
ATOM   1113 C  CA  . GLY A 1 144 ? 4.731   -0.173  69.986  1.00 22.29 ? 1031 GLY A CA  1 
ATOM   1114 C  C   . GLY A 1 144 ? 5.386   -0.882  68.805  1.00 22.29 ? 1031 GLY A C   1 
ATOM   1115 O  O   . GLY A 1 144 ? 4.784   -1.745  68.184  1.00 20.89 ? 1031 GLY A O   1 
ATOM   1116 N  N   . ASP A 1 145 ? 6.642   -0.544  68.553  1.00 22.36 ? 1032 ASP A N   1 
ATOM   1117 C  CA  . ASP A 1 145 ? 7.457   -1.251  67.575  1.00 19.84 ? 1032 ASP A CA  1 
ATOM   1118 C  C   . ASP A 1 145 ? 8.724   -1.791  68.214  1.00 26.60 ? 1032 ASP A C   1 
ATOM   1119 O  O   . ASP A 1 145 ? 9.650   -2.149  67.510  1.00 24.32 ? 1032 ASP A O   1 
ATOM   1120 C  CB  . ASP A 1 145 ? 7.785   -0.328  66.414  1.00 19.64 ? 1032 ASP A CB  1 
ATOM   1121 C  CG  . ASP A 1 145 ? 8.626   0.889   66.826  1.00 23.83 ? 1032 ASP A CG  1 
ATOM   1122 O  OD1 . ASP A 1 145 ? 8.852   1.126   68.031  1.00 21.82 ? 1032 ASP A OD1 1 
ATOM   1123 O  OD2 . ASP A 1 145 ? 9.060   1.622   65.922  1.00 27.64 ? 1032 ASP A OD2 1 
ATOM   1124 N  N   . ILE A 1 146 ? 8.736   -1.885  69.546  1.00 21.00 ? 1033 ILE A N   1 
ATOM   1125 C  CA  . ILE A 1 146 ? 9.899   -2.371  70.271  1.00 18.07 ? 1033 ILE A CA  1 
ATOM   1126 C  C   . ILE A 1 146 ? 9.693   -3.842  70.624  1.00 25.75 ? 1033 ILE A C   1 
ATOM   1127 O  O   . ILE A 1 146 ? 8.862   -4.159  71.462  1.00 22.10 ? 1033 ILE A O   1 
ATOM   1128 C  CB  . ILE A 1 146 ? 10.223  -1.553  71.575  1.00 20.17 ? 1033 ILE A CB  1 
ATOM   1129 C  CG1 . ILE A 1 146 ? 10.413  -0.054  71.282  1.00 24.58 ? 1033 ILE A CG1 1 
ATOM   1130 C  CG2 . ILE A 1 146 ? 11.520  -2.131  72.259  1.00 16.73 ? 1033 ILE A CG2 1 
ATOM   1131 C  CD1 . ILE A 1 146 ? 11.397  0.225   70.232  1.00 26.23 ? 1033 ILE A CD1 1 
ATOM   1132 N  N   . LYS A 1 147 ? 10.502  -4.705  69.999  1.00 19.77 ? 1034 LYS A N   1 
ATOM   1133 C  CA  . LYS A 1 147 ? 10.462  -6.136  70.200  1.00 23.22 ? 1034 LYS A CA  1 
ATOM   1134 C  C   . LYS A 1 147 ? 11.386  -6.576  71.310  1.00 23.41 ? 1034 LYS A C   1 
ATOM   1135 O  O   . LYS A 1 147 ? 12.591  -6.374  71.261  1.00 27.23 ? 1034 LYS A O   1 
ATOM   1136 C  CB  . LYS A 1 147 ? 10.807  -6.864  68.887  1.00 21.38 ? 1034 LYS A CB  1 
ATOM   1137 C  CG  . LYS A 1 147 ? 10.752  -8.373  68.999  1.00 24.39 ? 1034 LYS A CG  1 
ATOM   1138 C  CD  . LYS A 1 147 ? 11.222  -8.991  67.697  1.00 29.54 ? 1034 LYS A CD  1 
ATOM   1139 C  CE  . LYS A 1 147 ? 11.571  -10.446 67.843  1.00 43.76 ? 1034 LYS A CE  1 
ATOM   1140 N  NZ  . LYS A 1 147 ? 11.918  -10.999 66.487  1.00 45.65 ? 1034 LYS A NZ  1 
ATOM   1141 N  N   . VAL A 1 148 ? 10.794  -7.194  72.312  1.00 21.50 ? 1035 VAL A N   1 
ATOM   1142 C  CA  . VAL A 1 148 ? 11.509  -7.560  73.558  1.00 22.57 ? 1035 VAL A CA  1 
ATOM   1143 C  C   . VAL A 1 148 ? 11.358  -9.083  73.672  1.00 23.21 ? 1035 VAL A C   1 
ATOM   1144 O  O   . VAL A 1 148 ? 10.248  -9.601  73.521  1.00 24.76 ? 1035 VAL A O   1 
ATOM   1145 C  CB  . VAL A 1 148 ? 10.927  -6.816  74.805  1.00 28.49 ? 1035 VAL A CB  1 
ATOM   1146 C  CG1 . VAL A 1 148 ? 11.640  -7.277  76.094  1.00 23.76 ? 1035 VAL A CG1 1 
ATOM   1147 C  CG2 . VAL A 1 148 ? 11.016  -5.240  74.612  1.00 22.51 ? 1035 VAL A CG2 1 
ATOM   1148 N  N   . THR A 1 149 ? 12.490  -9.764  73.877  1.00 20.86 ? 1036 THR A N   1 
ATOM   1149 C  CA  . THR A 1 149 ? 12.578  -11.206 73.993  1.00 21.96 ? 1036 THR A CA  1 
ATOM   1150 C  C   . THR A 1 149 ? 13.338  -11.588 75.238  1.00 22.23 ? 1036 THR A C   1 
ATOM   1151 O  O   . THR A 1 149 ? 14.460  -11.146 75.449  1.00 20.73 ? 1036 THR A O   1 
ATOM   1152 C  CB  . THR A 1 149 ? 13.334  -11.823 72.815  1.00 27.48 ? 1036 THR A CB  1 
ATOM   1153 O  OG1 . THR A 1 149 ? 12.731  -11.407 71.576  1.00 25.68 ? 1036 THR A OG1 1 
ATOM   1154 C  CG2 . THR A 1 149 ? 13.384  -13.339 72.942  1.00 24.83 ? 1036 THR A CG2 1 
ATOM   1155 N  N   . LEU A 1 150 ? 12.741  -12.438 76.059  1.00 23.25 ? 1037 LEU A N   1 
ATOM   1156 C  CA  . LEU A 1 150 ? 13.378  -12.892 77.285  1.00 21.73 ? 1037 LEU A CA  1 
ATOM   1157 C  C   . LEU A 1 150 ? 14.457  -13.886 76.911  1.00 25.72 ? 1037 LEU A C   1 
ATOM   1158 O  O   . LEU A 1 150 ? 14.185  -14.859 76.196  1.00 23.38 ? 1037 LEU A O   1 
ATOM   1159 C  CB  . LEU A 1 150 ? 12.340  -13.575 78.173  1.00 21.36 ? 1037 LEU A CB  1 
ATOM   1160 C  CG  . LEU A 1 150 ? 12.796  -14.156 79.504  1.00 30.40 ? 1037 LEU A CG  1 
ATOM   1161 C  CD1 . LEU A 1 150 ? 13.340  -13.075 80.462  1.00 23.90 ? 1037 LEU A CD1 1 
ATOM   1162 C  CD2 . LEU A 1 150 ? 11.631  -14.928 80.127  1.00 23.10 ? 1037 LEU A CD2 1 
ATOM   1163 N  N   . ILE A 1 151 ? 15.662  -13.678 77.413  1.00 20.17 ? 1038 ILE A N   1 
ATOM   1164 C  CA  . ILE A 1 151 ? 16.737  -14.656 77.199  1.00 22.37 ? 1038 ILE A CA  1 
ATOM   1165 C  C   . ILE A 1 151 ? 17.298  -15.319 78.464  1.00 27.60 ? 1038 ILE A C   1 
ATOM   1166 O  O   . ILE A 1 151 ? 17.973  -16.336 78.366  1.00 26.68 ? 1038 ILE A O   1 
ATOM   1167 C  CB  . ILE A 1 151 ? 17.886  -14.081 76.308  1.00 23.09 ? 1038 ILE A CB  1 
ATOM   1168 C  CG1 . ILE A 1 151 ? 18.654  -12.972 77.035  1.00 30.23 ? 1038 ILE A CG1 1 
ATOM   1169 C  CG2 . ILE A 1 151 ? 17.323  -13.642 74.902  1.00 27.15 ? 1038 ILE A CG2 1 
ATOM   1170 C  CD1 . ILE A 1 151 ? 19.927  -12.479 76.292  1.00 29.06 ? 1038 ILE A CD1 1 
ATOM   1171 N  N   . GLU A 1 152 ? 17.055  -14.756 79.643  1.00 22.39 ? 1039 GLU A N   1 
ATOM   1172 C  CA  . GLU A 1 152 ? 17.501  -15.400 80.894  1.00 22.83 ? 1039 GLU A CA  1 
ATOM   1173 C  C   . GLU A 1 152 ? 16.691  -14.909 82.079  1.00 25.81 ? 1039 GLU A C   1 
ATOM   1174 O  O   . GLU A 1 152 ? 16.334  -13.723 82.143  1.00 26.62 ? 1039 GLU A O   1 
ATOM   1175 C  CB  . GLU A 1 152 ? 19.001  -15.157 81.135  1.00 29.81 ? 1039 GLU A CB  1 
ATOM   1176 C  CG  . GLU A 1 152 ? 19.585  -15.949 82.319  1.00 26.73 ? 1039 GLU A CG  1 
ATOM   1177 C  CD  . GLU A 1 152 ? 21.094  -15.669 82.550  1.00 42.47 ? 1039 GLU A CD  1 
ATOM   1178 O  OE1 . GLU A 1 152 ? 21.820  -15.267 81.619  1.00 32.90 ? 1039 GLU A OE1 1 
ATOM   1179 O  OE2 . GLU A 1 152 ? 21.565  -15.860 83.680  1.00 38.77 ? 1039 GLU A OE2 1 
ATOM   1180 N  N   . THR A 1 153 ? 16.385  -15.817 83.003  1.00 24.25 ? 1040 THR A N   1 
ATOM   1181 C  CA  . THR A 1 153 ? 15.809  -15.422 84.327  1.00 25.43 ? 1040 THR A CA  1 
ATOM   1182 C  C   . THR A 1 153 ? 16.711  -15.966 85.441  1.00 24.48 ? 1040 THR A C   1 
ATOM   1183 O  O   . THR A 1 153 ? 17.035  -17.149 85.450  1.00 26.19 ? 1040 THR A O   1 
ATOM   1184 C  CB  . THR A 1 153 ? 14.412  -15.933 84.484  1.00 30.17 ? 1040 THR A CB  1 
ATOM   1185 O  OG1 . THR A 1 153 ? 13.619  -15.517 83.363  1.00 26.24 ? 1040 THR A OG1 1 
ATOM   1186 C  CG2 . THR A 1 153 ? 13.799  -15.400 85.770  1.00 30.03 ? 1040 THR A CG2 1 
ATOM   1187 N  N   . GLU A 1 154 ? 17.135  -15.104 86.357  1.00 21.78 ? 1041 GLU A N   1 
ATOM   1188 C  CA  . GLU A 1 154 ? 17.985  -15.501 87.482  1.00 23.62 ? 1041 GLU A CA  1 
ATOM   1189 C  C   . GLU A 1 154 ? 17.287  -15.130 88.782  1.00 26.65 ? 1041 GLU A C   1 
ATOM   1190 O  O   . GLU A 1 154 ? 17.349  -13.979 89.217  1.00 22.48 ? 1041 GLU A O   1 
ATOM   1191 C  CB  . GLU A 1 154 ? 19.375  -14.844 87.402  1.00 30.98 ? 1041 GLU A CB  1 
ATOM   1192 C  CG  . GLU A 1 154 ? 20.363  -15.374 88.463  1.00 25.98 ? 1041 GLU A CG  1 
ATOM   1193 C  CD  . GLU A 1 154 ? 21.645  -14.555 88.593  1.00 33.57 ? 1041 GLU A CD  1 
ATOM   1194 O  OE1 . GLU A 1 154 ? 21.829  -13.558 87.867  1.00 33.75 ? 1041 GLU A OE1 1 
ATOM   1195 O  OE2 . GLU A 1 154 ? 22.493  -14.936 89.429  1.00 39.18 ? 1041 GLU A OE2 1 
ATOM   1196 N  N   . PRO A 1 155 ? 16.574  -16.093 89.381  1.00 24.50 ? 1042 PRO A N   1 
ATOM   1197 C  CA  . PRO A 1 155 ? 15.908  -15.835 90.656  1.00 25.36 ? 1042 PRO A CA  1 
ATOM   1198 C  C   . PRO A 1 155 ? 16.827  -15.954 91.846  1.00 30.69 ? 1042 PRO A C   1 
ATOM   1199 O  O   . PRO A 1 155 ? 17.601  -16.903 91.960  1.00 28.76 ? 1042 PRO A O   1 
ATOM   1200 C  CB  . PRO A 1 155 ? 14.829  -16.920 90.709  1.00 30.80 ? 1042 PRO A CB  1 
ATOM   1201 C  CG  . PRO A 1 155 ? 15.369  -18.044 89.901  1.00 32.81 ? 1042 PRO A CG  1 
ATOM   1202 C  CD  . PRO A 1 155 ? 16.267  -17.429 88.850  1.00 30.57 ? 1042 PRO A CD  1 
ATOM   1203 N  N   . LEU A 1 156 ? 16.730  -14.986 92.741  1.00 26.86 ? 1043 LEU A N   1 
ATOM   1204 C  CA  . LEU A 1 156 ? 17.482  -15.018 93.968  1.00 29.33 ? 1043 LEU A CA  1 
ATOM   1205 C  C   . LEU A 1 156 ? 16.468  -14.805 95.079  1.00 30.68 ? 1043 LEU A C   1 
ATOM   1206 O  O   . LEU A 1 156 ? 15.246  -14.687 94.802  1.00 30.88 ? 1043 LEU A O   1 
ATOM   1207 C  CB  . LEU A 1 156 ? 18.559  -13.950 93.925  1.00 35.17 ? 1043 LEU A CB  1 
ATOM   1208 C  CG  . LEU A 1 156 ? 19.753  -14.341 93.041  1.00 50.37 ? 1043 LEU A CG  1 
ATOM   1209 C  CD1 . LEU A 1 156 ? 20.088  -13.264 92.038  1.00 47.44 ? 1043 LEU A CD1 1 
ATOM   1210 C  CD2 . LEU A 1 156 ? 20.964  -14.678 93.911  1.00 57.42 ? 1043 LEU A CD2 1 
ATOM   1211 N  N   . ALA A 1 157 ? 16.943  -14.756 96.321  1.00 31.17 ? 1044 ALA A N   1 
ATOM   1212 C  CA  . ALA A 1 157 ? 16.023  -14.754 97.458  1.00 29.81 ? 1044 ALA A CA  1 
ATOM   1213 C  C   . ALA A 1 157 ? 15.079  -13.545 97.508  1.00 28.37 ? 1044 ALA A C   1 
ATOM   1214 O  O   . ALA A 1 157 ? 13.885  -13.703 97.777  1.00 28.59 ? 1044 ALA A O   1 
ATOM   1215 C  CB  . ALA A 1 157 ? 16.805  -14.923 98.794  1.00 29.12 ? 1044 ALA A CB  1 
ATOM   1216 N  N   . GLU A 1 158 ? 15.600  -12.336 97.294  1.00 20.71 ? 1045 GLU A N   1 
ATOM   1217 C  CA  . GLU A 1 158 ? 14.788  -11.116 97.457  1.00 20.44 ? 1045 GLU A CA  1 
ATOM   1218 C  C   . GLU A 1 158 ? 14.590  -10.354 96.140  1.00 25.41 ? 1045 GLU A C   1 
ATOM   1219 O  O   . GLU A 1 158 ? 14.007  -9.273  96.110  1.00 23.70 ? 1045 GLU A O   1 
ATOM   1220 C  CB  . GLU A 1 158 ? 15.421  -10.210 98.489  1.00 26.06 ? 1045 GLU A CB  1 
ATOM   1221 C  CG  . GLU A 1 158 ? 15.373  -10.820 99.881  1.00 30.08 ? 1045 GLU A CG  1 
ATOM   1222 C  CD  . GLU A 1 158 ? 15.757  -9.869  100.973 1.00 27.87 ? 1045 GLU A CD  1 
ATOM   1223 O  OE1 . GLU A 1 158 ? 15.240  -8.727  100.962 1.00 29.40 ? 1045 GLU A OE1 1 
ATOM   1224 O  OE2 . GLU A 1 158 ? 16.555  -10.287 101.844 1.00 27.97 ? 1045 GLU A OE2 1 
ATOM   1225 N  N   . TYR A 1 159 ? 15.130  -10.892 95.066  1.00 21.70 ? 1046 TYR A N   1 
ATOM   1226 C  CA  . TYR A 1 159 ? 14.994  -10.263 93.783  1.00 22.07 ? 1046 TYR A CA  1 
ATOM   1227 C  C   . TYR A 1 159 ? 15.261  -11.254 92.663  1.00 26.51 ? 1046 TYR A C   1 
ATOM   1228 O  O   . TYR A 1 159 ? 15.745  -12.353 92.907  1.00 21.93 ? 1046 TYR A O   1 
ATOM   1229 C  CB  . TYR A 1 159 ? 15.932  -9.073  93.675  1.00 25.17 ? 1046 TYR A CB  1 
ATOM   1230 C  CG  . TYR A 1 159 ? 17.407  -9.417  93.800  1.00 24.41 ? 1046 TYR A CG  1 
ATOM   1231 C  CD1 . TYR A 1 159 ? 18.156  -9.702  92.667  1.00 33.05 ? 1046 TYR A CD1 1 
ATOM   1232 C  CD2 . TYR A 1 159 ? 18.048  -9.436  95.031  1.00 30.31 ? 1046 TYR A CD2 1 
ATOM   1233 C  CE1 . TYR A 1 159 ? 19.486  -9.998  92.748  1.00 37.59 ? 1046 TYR A CE1 1 
ATOM   1234 C  CE2 . TYR A 1 159 ? 19.382  -9.763  95.122  1.00 27.29 ? 1046 TYR A CE2 1 
ATOM   1235 C  CZ  . TYR A 1 159 ? 20.096  -10.028 93.967  1.00 29.68 ? 1046 TYR A CZ  1 
ATOM   1236 O  OH  . TYR A 1 159 ? 21.431  -10.318 93.999  1.00 41.03 ? 1046 TYR A OH  1 
ATOM   1237 N  N   . VAL A 1 160 ? 14.940  -10.824 91.443  1.00 21.10 ? 1047 VAL A N   1 
ATOM   1238 C  CA  . VAL A 1 160 ? 15.086  -11.638 90.216  1.00 23.52 ? 1047 VAL A CA  1 
ATOM   1239 C  C   . VAL A 1 160 ? 15.627  -10.724 89.128  1.00 20.89 ? 1047 VAL A C   1 
ATOM   1240 O  O   . VAL A 1 160 ? 15.139  -9.605  88.943  1.00 25.14 ? 1047 VAL A O   1 
ATOM   1241 C  CB  . VAL A 1 160 ? 13.770  -12.298 89.732  1.00 33.41 ? 1047 VAL A CB  1 
ATOM   1242 C  CG1 . VAL A 1 160 ? 12.670  -11.270 89.506  1.00 39.32 ? 1047 VAL A CG1 1 
ATOM   1243 C  CG2 . VAL A 1 160 ? 13.998  -13.160 88.428  1.00 22.76 ? 1047 VAL A CG2 1 
ATOM   1244 N  N   . ILE A 1 161 ? 16.644  -11.207 88.420  1.00 20.26 ? 1048 ILE A N   1 
ATOM   1245 C  CA  . ILE A 1 161 ? 17.173  -10.497 87.248  1.00 21.52 ? 1048 ILE A CA  1 
ATOM   1246 C  C   . ILE A 1 161 ? 16.741  -11.221 85.989  1.00 24.50 ? 1048 ILE A C   1 
ATOM   1247 O  O   . ILE A 1 161 ? 16.987  -12.432 85.809  1.00 24.48 ? 1048 ILE A O   1 
ATOM   1248 C  CB  . ILE A 1 161 ? 18.694  -10.431 87.247  1.00 23.56 ? 1048 ILE A CB  1 
ATOM   1249 C  CG1 . ILE A 1 161 ? 19.172  -9.890  88.587  1.00 27.29 ? 1048 ILE A CG1 1 
ATOM   1250 C  CG2 . ILE A 1 161 ? 19.199  -9.554  86.070  1.00 23.10 ? 1048 ILE A CG2 1 
ATOM   1251 C  CD1 . ILE A 1 161 ? 20.708  -10.006 88.750  1.00 29.72 ? 1048 ILE A CD1 1 
ATOM   1252 N  N   . ARG A 1 162 ? 16.061  -10.469 85.138  1.00 26.92 ? 1049 ARG A N   1 
ATOM   1253 C  CA  A ARG A 1 162 ? 15.651  -10.973 83.855  0.50 20.76 ? 1049 ARG A CA  1 
ATOM   1254 C  CA  B ARG A 1 162 ? 15.610  -10.955 83.856  0.50 22.84 ? 1049 ARG A CA  1 
ATOM   1255 C  C   . ARG A 1 162 ? 16.400  -10.215 82.774  1.00 28.45 ? 1049 ARG A C   1 
ATOM   1256 O  O   . ARG A 1 162 ? 16.518  -8.975  82.807  1.00 23.60 ? 1049 ARG A O   1 
ATOM   1257 C  CB  A ARG A 1 162 ? 14.159  -10.768 83.679  0.50 20.49 ? 1049 ARG A CB  1 
ATOM   1258 C  CB  B ARG A 1 162 ? 14.120  -10.650 83.685  0.50 20.12 ? 1049 ARG A CB  1 
ATOM   1259 C  CG  A ARG A 1 162 ? 13.319  -11.571 84.631  0.50 21.31 ? 1049 ARG A CG  1 
ATOM   1260 C  CG  B ARG A 1 162 ? 13.239  -10.914 84.909  0.50 26.50 ? 1049 ARG A CG  1 
ATOM   1261 C  CD  A ARG A 1 162 ? 11.854  -11.440 84.285  0.50 28.04 ? 1049 ARG A CD  1 
ATOM   1262 C  CD  B ARG A 1 162 ? 11.769  -10.529 84.634  0.50 17.47 ? 1049 ARG A CD  1 
ATOM   1263 N  NE  A ARG A 1 162 ? 11.001  -12.071 85.278  0.50 23.81 ? 1049 ARG A NE  1 
ATOM   1264 N  NE  B ARG A 1 162 ? 10.992  -10.421 85.859  0.50 35.75 ? 1049 ARG A NE  1 
ATOM   1265 C  CZ  A ARG A 1 162 ? 10.550  -11.488 86.384  0.50 27.04 ? 1049 ARG A CZ  1 
ATOM   1266 C  CZ  B ARG A 1 162 ? 10.576  -11.449 86.589  0.50 35.61 ? 1049 ARG A CZ  1 
ATOM   1267 N  NH1 A ARG A 1 162 ? 10.847  -10.224 86.682  0.50 26.55 ? 1049 ARG A NH1 1 
ATOM   1268 N  NH1 B ARG A 1 162 ? 10.850  -12.699 86.225  0.50 30.84 ? 1049 ARG A NH1 1 
ATOM   1269 N  NH2 A ARG A 1 162 ? 9.773   -12.188 87.204  0.50 39.93 ? 1049 ARG A NH2 1 
ATOM   1270 N  NH2 B ARG A 1 162 ? 9.879   -11.221 87.699  0.50 36.26 ? 1049 ARG A NH2 1 
ATOM   1271 N  N   . THR A 1 163 ? 16.919  -10.948 81.811  1.00 22.36 ? 1050 THR A N   1 
ATOM   1272 C  CA  . THR A 1 163 ? 17.713  -10.344 80.760  1.00 20.07 ? 1050 THR A CA  1 
ATOM   1273 C  C   . THR A 1 163 ? 16.955  -10.521 79.452  1.00 19.93 ? 1050 THR A C   1 
ATOM   1274 O  O   . THR A 1 163 ? 16.400  -11.591 79.216  1.00 22.32 ? 1050 THR A O   1 
ATOM   1275 C  CB  . THR A 1 163 ? 19.087  -11.043 80.638  1.00 26.84 ? 1050 THR A CB  1 
ATOM   1276 O  OG1 . THR A 1 163 ? 19.786  -11.003 81.896  1.00 23.62 ? 1050 THR A OG1 1 
ATOM   1277 C  CG2 . THR A 1 163 ? 19.975  -10.395 79.587  1.00 25.59 ? 1050 THR A CG2 1 
ATOM   1278 N  N   . PHE A 1 164 ? 16.947  -9.486  78.609  1.00 22.45 ? 1051 PHE A N   1 
ATOM   1279 C  CA  . PHE A 1 164 ? 16.183  -9.478  77.365  1.00 20.25 ? 1051 PHE A CA  1 
ATOM   1280 C  C   . PHE A 1 164 ? 17.035  -8.983  76.223  1.00 25.13 ? 1051 PHE A C   1 
ATOM   1281 O  O   . PHE A 1 164 ? 17.935  -8.184  76.444  1.00 24.09 ? 1051 PHE A O   1 
ATOM   1282 C  CB  . PHE A 1 164 ? 14.994  -8.495  77.425  1.00 25.18 ? 1051 PHE A CB  1 
ATOM   1283 C  CG  . PHE A 1 164 ? 14.050  -8.740  78.552  1.00 29.37 ? 1051 PHE A CG  1 
ATOM   1284 C  CD1 . PHE A 1 164 ? 12.988  -9.605  78.393  1.00 26.13 ? 1051 PHE A CD1 1 
ATOM   1285 C  CD2 . PHE A 1 164 ? 14.238  -8.098  79.781  1.00 23.33 ? 1051 PHE A CD2 1 
ATOM   1286 C  CE1 . PHE A 1 164 ? 12.104  -9.881  79.435  1.00 25.81 ? 1051 PHE A CE1 1 
ATOM   1287 C  CE2 . PHE A 1 164 ? 13.377  -8.345  80.841  1.00 21.17 ? 1051 PHE A CE2 1 
ATOM   1288 C  CZ  . PHE A 1 164 ? 12.285  -9.246  80.675  1.00 24.46 ? 1051 PHE A CZ  1 
ATOM   1289 N  N   . THR A 1 165 ? 16.657  -9.324  74.989  1.00 21.45 ? 1052 THR A N   1 
ATOM   1290 C  CA  . THR A 1 165 ? 17.121  -8.577  73.829  1.00 24.25 ? 1052 THR A CA  1 
ATOM   1291 C  C   . THR A 1 165 ? 16.027  -7.561  73.488  1.00 23.22 ? 1052 THR A C   1 
ATOM   1292 O  O   . THR A 1 165 ? 14.840  -7.789  73.740  1.00 23.37 ? 1052 THR A O   1 
ATOM   1293 C  CB  . THR A 1 165 ? 17.449  -9.465  72.616  1.00 27.57 ? 1052 THR A CB  1 
ATOM   1294 O  OG1 . THR A 1 165 ? 16.265  -10.169 72.204  1.00 26.42 ? 1052 THR A OG1 1 
ATOM   1295 C  CG2 . THR A 1 165 ? 18.639  -10.441 72.913  1.00 25.13 ? 1052 THR A CG2 1 
ATOM   1296 N  N   . VAL A 1 166 ? 16.438  -6.409  72.980  1.00 21.17 ? 1053 VAL A N   1 
ATOM   1297 C  CA  . VAL A 1 166 ? 15.508  -5.305  72.692  1.00 22.87 ? 1053 VAL A CA  1 
ATOM   1298 C  C   . VAL A 1 166 ? 15.899  -4.771  71.300  1.00 25.69 ? 1053 VAL A C   1 
ATOM   1299 O  O   . VAL A 1 166 ? 17.059  -4.552  71.028  1.00 20.40 ? 1053 VAL A O   1 
ATOM   1300 C  CB  . VAL A 1 166 ? 15.590  -4.164  73.704  1.00 27.47 ? 1053 VAL A CB  1 
ATOM   1301 C  CG1 . VAL A 1 166 ? 14.533  -3.069  73.373  1.00 23.86 ? 1053 VAL A CG1 1 
ATOM   1302 C  CG2 . VAL A 1 166 ? 15.424  -4.680  75.144  1.00 27.28 ? 1053 VAL A CG2 1 
ATOM   1303 N  N   . GLN A 1 167 ? 14.919  -4.619  70.432  1.00 21.59 ? 1054 GLN A N   1 
ATOM   1304 C  CA  . GLN A 1 167 ? 15.167  -4.196  69.037  1.00 20.35 ? 1054 GLN A CA  1 
ATOM   1305 C  C   . GLN A 1 167 ? 13.968  -3.380  68.568  1.00 29.80 ? 1054 GLN A C   1 
ATOM   1306 O  O   . GLN A 1 167 ? 12.812  -3.782  68.777  1.00 22.44 ? 1054 GLN A O   1 
ATOM   1307 C  CB  . GLN A 1 167 ? 15.311  -5.428  68.141  1.00 24.74 ? 1054 GLN A CB  1 
ATOM   1308 C  CG  . GLN A 1 167 ? 15.500  -5.060  66.616  1.00 27.78 ? 1054 GLN A CG  1 
ATOM   1309 C  CD  . GLN A 1 167 ? 15.642  -6.270  65.727  1.00 42.18 ? 1054 GLN A CD  1 
ATOM   1310 O  OE1 . GLN A 1 167 ? 15.375  -7.411  66.156  1.00 29.28 ? 1054 GLN A OE1 1 
ATOM   1311 N  NE2 . GLN A 1 167 ? 16.086  -6.042  64.487  1.00 29.68 ? 1054 GLN A NE2 1 
ATOM   1312 N  N   . LYS A 1 168 ? 14.251  -2.251  67.927  1.00 22.29 ? 1055 LYS A N   1 
ATOM   1313 C  CA  . LYS A 1 168 ? 13.215  -1.457  67.270  1.00 22.34 ? 1055 LYS A CA  1 
ATOM   1314 C  C   . LYS A 1 168 ? 13.039  -2.064  65.887  1.00 25.59 ? 1055 LYS A C   1 
ATOM   1315 O  O   . LYS A 1 168 ? 14.002  -2.140  65.063  1.00 19.90 ? 1055 LYS A O   1 
ATOM   1316 C  CB  . LYS A 1 168 ? 13.652  0.013   67.144  1.00 27.10 ? 1055 LYS A CB  1 
ATOM   1317 C  CG  . LYS A 1 168 ? 12.628  0.918   66.523  1.00 25.94 ? 1055 LYS A CG  1 
ATOM   1318 C  CD  . LYS A 1 168 ? 13.105  2.361   66.483  1.00 28.50 ? 1055 LYS A CD  1 
ATOM   1319 C  CE  . LYS A 1 168 ? 12.056  3.305   65.910  1.00 40.11 ? 1055 LYS A CE  1 
ATOM   1320 N  NZ  . LYS A 1 168 ? 10.881  3.429   66.815  1.00 42.31 ? 1055 LYS A NZ  1 
ATOM   1321 N  N   . LYS A 1 169 ? 11.821  -2.502  65.628  1.00 26.79 ? 1056 LYS A N   1 
ATOM   1322 C  CA  . LYS A 1 169 ? 11.534  -3.247  64.403  1.00 27.88 ? 1056 LYS A CA  1 
ATOM   1323 C  C   . LYS A 1 169 ? 11.814  -2.389  63.182  1.00 23.77 ? 1056 LYS A C   1 
ATOM   1324 O  O   . LYS A 1 169 ? 11.605  -1.162  63.181  1.00 24.12 ? 1056 LYS A O   1 
ATOM   1325 C  CB  . LYS A 1 169 ? 10.114  -3.811  64.428  1.00 32.45 ? 1056 LYS A CB  1 
ATOM   1326 C  CG  . LYS A 1 169 ? 9.959   -4.861  65.572  1.00 27.70 ? 1056 LYS A CG  1 
ATOM   1327 C  CD  . LYS A 1 169 ? 8.618   -5.610  65.518  1.00 28.87 ? 1056 LYS A CD  1 
ATOM   1328 C  CE  . LYS A 1 169 ? 8.537   -6.570  64.327  1.00 46.93 ? 1056 LYS A CE  1 
ATOM   1329 N  NZ  . LYS A 1 169 ? 7.197   -7.248  64.241  1.00 39.46 ? 1056 LYS A NZ  1 
ATOM   1330 N  N   . GLY A 1 170 ? 12.358  -3.018  62.138  1.00 24.13 ? 1057 GLY A N   1 
ATOM   1331 C  CA  . GLY A 1 170 ? 12.728  -2.278  60.946  1.00 23.66 ? 1057 GLY A CA  1 
ATOM   1332 C  C   . GLY A 1 170 ? 14.116  -1.672  60.975  1.00 27.34 ? 1057 GLY A C   1 
ATOM   1333 O  O   . GLY A 1 170 ? 14.553  -1.099  59.978  1.00 24.88 ? 1057 GLY A O   1 
ATOM   1334 N  N   . TYR A 1 171 ? 14.796  -1.773  62.115  1.00 24.33 ? 1058 TYR A N   1 
ATOM   1335 C  CA  . TYR A 1 171 ? 16.185  -1.306  62.257  1.00 26.77 ? 1058 TYR A CA  1 
ATOM   1336 C  C   . TYR A 1 171 ? 17.012  -2.464  62.757  1.00 23.11 ? 1058 TYR A C   1 
ATOM   1337 O  O   . TYR A 1 171 ? 16.446  -3.419  63.291  1.00 21.20 ? 1058 TYR A O   1 
ATOM   1338 C  CB  . TYR A 1 171 ? 16.239  -0.116  63.208  1.00 22.36 ? 1058 TYR A CB  1 
ATOM   1339 C  CG  . TYR A 1 171 ? 15.488  1.049   62.569  1.00 25.70 ? 1058 TYR A CG  1 
ATOM   1340 C  CD1 . TYR A 1 171 ? 16.140  1.920   61.700  1.00 34.23 ? 1058 TYR A CD1 1 
ATOM   1341 C  CD2 . TYR A 1 171 ? 14.122  1.210   62.764  1.00 31.55 ? 1058 TYR A CD2 1 
ATOM   1342 C  CE1 . TYR A 1 171 ? 15.468  2.969   61.085  1.00 56.26 ? 1058 TYR A CE1 1 
ATOM   1343 C  CE2 . TYR A 1 171 ? 13.422  2.265   62.126  1.00 35.05 ? 1058 TYR A CE2 1 
ATOM   1344 C  CZ  . TYR A 1 171 ? 14.114  3.129   61.295  1.00 45.79 ? 1058 TYR A CZ  1 
ATOM   1345 O  OH  . TYR A 1 171 ? 13.477  4.159   60.662  1.00 51.79 ? 1058 TYR A OH  1 
ATOM   1346 N  N   . HIS A 1 172 ? 18.342  -2.354  62.633  1.00 21.01 ? 1059 HIS A N   1 
ATOM   1347 C  CA  . HIS A 1 172 ? 19.231  -3.508  62.757  1.00 22.25 ? 1059 HIS A CA  1 
ATOM   1348 C  C   . HIS A 1 172 ? 19.907  -3.694  64.124  1.00 20.73 ? 1059 HIS A C   1 
ATOM   1349 O  O   . HIS A 1 172 ? 20.525  -4.723  64.386  1.00 18.01 ? 1059 HIS A O   1 
ATOM   1350 C  CB  . HIS A 1 172 ? 20.295  -3.444  61.653  1.00 18.23 ? 1059 HIS A CB  1 
ATOM   1351 C  CG  . HIS A 1 172 ? 19.734  -3.432  60.268  1.00 16.36 ? 1059 HIS A CG  1 
ATOM   1352 N  ND1 . HIS A 1 172 ? 18.957  -4.461  59.780  1.00 20.06 ? 1059 HIS A ND1 1 
ATOM   1353 C  CD2 . HIS A 1 172 ? 19.737  -2.475  59.310  1.00 18.46 ? 1059 HIS A CD2 1 
ATOM   1354 C  CE1 . HIS A 1 172 ? 18.569  -4.165  58.551  1.00 17.06 ? 1059 HIS A CE1 1 
ATOM   1355 N  NE2 . HIS A 1 172 ? 19.018  -2.962  58.242  1.00 20.23 ? 1059 HIS A NE2 1 
ATOM   1356 N  N   . GLU A 1 173 ? 19.771  -2.716  65.007  1.00 23.05 ? 1060 GLU A N   1 
ATOM   1357 C  CA  . GLU A 1 173 ? 20.477  -2.768  66.276  1.00 19.21 ? 1060 GLU A CA  1 
ATOM   1358 C  C   . GLU A 1 173 ? 19.736  -3.674  67.226  1.00 21.12 ? 1060 GLU A C   1 
ATOM   1359 O  O   . GLU A 1 173 ? 18.518  -3.515  67.423  1.00 19.77 ? 1060 GLU A O   1 
ATOM   1360 C  CB  . GLU A 1 173 ? 20.573  -1.374  66.874  1.00 23.93 ? 1060 GLU A CB  1 
ATOM   1361 C  CG  . GLU A 1 173 ? 21.310  -1.389  68.192  1.00 21.18 ? 1060 GLU A CG  1 
ATOM   1362 C  CD  . GLU A 1 173 ? 21.557  0.009   68.765  1.00 32.05 ? 1060 GLU A CD  1 
ATOM   1363 O  OE1 . GLU A 1 173 ? 21.032  1.005   68.237  1.00 23.24 ? 1060 GLU A OE1 1 
ATOM   1364 O  OE2 . GLU A 1 173 ? 22.311  0.094   69.740  1.00 23.96 ? 1060 GLU A OE2 1 
ATOM   1365 N  N   . ILE A 1 174 ? 20.448  -4.606  67.860  1.00 19.53 ? 1061 ILE A N   1 
ATOM   1366 C  CA  . ILE A 1 174 ? 19.846  -5.433  68.932  1.00 20.49 ? 1061 ILE A CA  1 
ATOM   1367 C  C   . ILE A 1 174 ? 20.605  -5.257  70.239  1.00 24.24 ? 1061 ILE A C   1 
ATOM   1368 O  O   . ILE A 1 174 ? 21.786  -5.551  70.316  1.00 21.68 ? 1061 ILE A O   1 
ATOM   1369 C  CB  . ILE A 1 174 ? 19.858  -6.921  68.590  1.00 24.59 ? 1061 ILE A CB  1 
ATOM   1370 C  CG1 . ILE A 1 174 ? 19.052  -7.169  67.297  1.00 27.65 ? 1061 ILE A CG1 1 
ATOM   1371 C  CG2 . ILE A 1 174 ? 19.242  -7.747  69.767  1.00 23.36 ? 1061 ILE A CG2 1 
ATOM   1372 C  CD1 . ILE A 1 174 ? 19.175  -8.555  66.770  1.00 25.46 ? 1061 ILE A CD1 1 
ATOM   1373 N  N   . ARG A 1 175 ? 19.915  -4.782  71.260  1.00 18.66 ? 1062 ARG A N   1 
ATOM   1374 C  CA  . ARG A 1 175 ? 20.524  -4.400  72.531  1.00 20.63 ? 1062 ARG A CA  1 
ATOM   1375 C  C   . ARG A 1 175 ? 20.178  -5.438  73.570  1.00 22.13 ? 1062 ARG A C   1 
ATOM   1376 O  O   . ARG A 1 175 ? 19.235  -6.195  73.438  1.00 26.65 ? 1062 ARG A O   1 
ATOM   1377 C  CB  . ARG A 1 175 ? 19.925  -3.048  72.982  1.00 18.31 ? 1062 ARG A CB  1 
ATOM   1378 C  CG  . ARG A 1 175 ? 20.218  -1.932  72.035  1.00 22.08 ? 1062 ARG A CG  1 
ATOM   1379 C  CD  . ARG A 1 175 ? 19.710  -0.594  72.579  1.00 25.73 ? 1062 ARG A CD  1 
ATOM   1380 N  NE  . ARG A 1 175 ? 19.981  0.444   71.583  1.00 21.79 ? 1062 ARG A NE  1 
ATOM   1381 C  CZ  . ARG A 1 175 ? 19.339  1.600   71.512  1.00 22.34 ? 1062 ARG A CZ  1 
ATOM   1382 N  NH1 . ARG A 1 175 ? 18.438  1.932   72.433  1.00 23.29 ? 1062 ARG A NH1 1 
ATOM   1383 N  NH2 . ARG A 1 175 ? 19.647  2.441   70.553  1.00 24.87 ? 1062 ARG A NH2 1 
ATOM   1384 N  N   . GLU A 1 176 ? 20.961  -5.466  74.630  1.00 21.21 ? 1063 GLU A N   1 
ATOM   1385 C  CA  . GLU A 1 176 ? 20.691  -6.329  75.774  1.00 21.98 ? 1063 GLU A CA  1 
ATOM   1386 C  C   . GLU A 1 176 ? 20.261  -5.398  76.896  1.00 22.83 ? 1063 GLU A C   1 
ATOM   1387 O  O   . GLU A 1 176 ? 20.856  -4.345  77.098  1.00 27.53 ? 1063 GLU A O   1 
ATOM   1388 C  CB  . GLU A 1 176 ? 21.967  -7.104  76.182  1.00 30.92 ? 1063 GLU A CB  1 
ATOM   1389 C  CG  . GLU A 1 176 ? 21.707  -8.140  77.265  1.00 31.07 ? 1063 GLU A CG  1 
ATOM   1390 C  CD  . GLU A 1 176 ? 22.885  -9.042  77.532  1.00 38.53 ? 1063 GLU A CD  1 
ATOM   1391 O  OE1 . GLU A 1 176 ? 23.907  -8.564  78.093  1.00 41.21 ? 1063 GLU A OE1 1 
ATOM   1392 O  OE2 . GLU A 1 176 ? 22.773  -10.230 77.167  1.00 38.84 ? 1063 GLU A OE2 1 
ATOM   1393 N  N   . LEU A 1 177 ? 19.224  -5.791  77.613  1.00 20.68 ? 1064 LEU A N   1 
ATOM   1394 C  CA  . LEU A 1 177 ? 18.683  -5.021  78.726  1.00 22.08 ? 1064 LEU A CA  1 
ATOM   1395 C  C   . LEU A 1 177 ? 18.449  -5.984  79.882  1.00 27.14 ? 1064 LEU A C   1 
ATOM   1396 O  O   . LEU A 1 177 ? 18.015  -7.118  79.665  1.00 22.09 ? 1064 LEU A O   1 
ATOM   1397 C  CB  . LEU A 1 177 ? 17.377  -4.343  78.335  1.00 25.96 ? 1064 LEU A CB  1 
ATOM   1398 C  CG  . LEU A 1 177 ? 16.704  -3.517  79.433  1.00 28.21 ? 1064 LEU A CG  1 
ATOM   1399 C  CD1 . LEU A 1 177 ? 16.169  -2.166  78.899  1.00 28.52 ? 1064 LEU A CD1 1 
ATOM   1400 C  CD2 . LEU A 1 177 ? 15.625  -4.335  80.102  1.00 33.90 ? 1064 LEU A CD2 1 
ATOM   1401 N  N   . ARG A 1 178 ? 18.715  -5.515  81.094  1.00 20.86 ? 1065 ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 178 ? 18.372  -6.258  82.303  1.00 24.44 ? 1065 ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 178 ? 17.355  -5.537  83.132  1.00 22.93 ? 1065 ARG A C   1 
ATOM   1404 O  O   . ARG A 1 178 ? 17.459  -4.312  83.353  1.00 23.99 ? 1065 ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 178 ? 19.633  -6.497  83.145  1.00 24.21 ? 1065 ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 178 ? 20.694  -7.345  82.443  1.00 24.35 ? 1065 ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 178 ? 21.957  -7.445  83.293  1.00 28.60 ? 1065 ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 178 ? 23.034  -8.142  82.572  1.00 31.64 ? 1065 ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 178 ? 24.111  -7.560  82.072  1.00 36.35 ? 1065 ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 178 ? 24.323  -6.260  82.206  1.00 32.46 ? 1065 ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 178 ? 24.999  -8.303  81.445  1.00 41.95 ? 1065 ARG A NH2 1 
ATOM   1412 N  N   . LEU A 1 179 ? 16.371  -6.301  83.593  1.00 25.61 ? 1066 LEU A N   1 
ATOM   1413 C  CA  . LEU A 1 179 ? 15.378  -5.864  84.557  1.00 23.26 ? 1066 LEU A CA  1 
ATOM   1414 C  C   . LEU A 1 179 ? 15.704  -6.452  85.916  1.00 20.75 ? 1066 LEU A C   1 
ATOM   1415 O  O   . LEU A 1 179 ? 15.680  -7.680  86.119  1.00 22.50 ? 1066 LEU A O   1 
ATOM   1416 C  CB  . LEU A 1 179 ? 13.979  -6.260  84.070  1.00 25.38 ? 1066 LEU A CB  1 
ATOM   1417 C  CG  . LEU A 1 179 ? 12.767  -6.195  84.998  1.00 36.59 ? 1066 LEU A CG  1 
ATOM   1418 C  CD1 . LEU A 1 179 ? 12.693  -4.865  85.742  1.00 23.78 ? 1066 LEU A CD1 1 
ATOM   1419 C  CD2 . LEU A 1 179 ? 11.483  -6.496  84.172  1.00 35.76 ? 1066 LEU A CD2 1 
ATOM   1420 N  N   . PHE A 1 180 ? 16.133  -5.574  86.815  1.00 22.22 ? 1067 PHE A N   1 
ATOM   1421 C  CA  . PHE A 1 180 ? 16.442  -5.929  88.166  1.00 22.30 ? 1067 PHE A CA  1 
ATOM   1422 C  C   . PHE A 1 180 ? 15.162  -5.729  88.978  1.00 22.49 ? 1067 PHE A C   1 
ATOM   1423 O  O   . PHE A 1 180 ? 14.725  -4.625  89.209  1.00 21.56 ? 1067 PHE A O   1 
ATOM   1424 C  CB  . PHE A 1 180 ? 17.576  -5.030  88.689  1.00 25.51 ? 1067 PHE A CB  1 
ATOM   1425 C  CG  . PHE A 1 180 ? 18.864  -5.167  87.934  1.00 24.81 ? 1067 PHE A CG  1 
ATOM   1426 C  CD1 . PHE A 1 180 ? 19.814  -6.092  88.324  1.00 24.50 ? 1067 PHE A CD1 1 
ATOM   1427 C  CD2 . PHE A 1 180 ? 19.134  -4.377  86.821  1.00 26.11 ? 1067 PHE A CD2 1 
ATOM   1428 C  CE1 . PHE A 1 180 ? 21.008  -6.226  87.626  1.00 25.09 ? 1067 PHE A CE1 1 
ATOM   1429 C  CE2 . PHE A 1 180 ? 20.354  -4.523  86.124  1.00 25.08 ? 1067 PHE A CE2 1 
ATOM   1430 C  CZ  . PHE A 1 180 ? 21.268  -5.441  86.523  1.00 26.29 ? 1067 PHE A CZ  1 
ATOM   1431 N  N   . HIS A 1 181 ? 14.555  -6.817  89.408  1.00 20.27 ? 1068 HIS A N   1 
ATOM   1432 C  CA  . HIS A 1 181 ? 13.254  -6.736  90.052  1.00 20.43 ? 1068 HIS A CA  1 
ATOM   1433 C  C   . HIS A 1 181 ? 13.385  -7.159  91.505  1.00 22.75 ? 1068 HIS A C   1 
ATOM   1434 O  O   . HIS A 1 181 ? 13.534  -8.352  91.785  1.00 23.54 ? 1068 HIS A O   1 
ATOM   1435 C  CB  . HIS A 1 181 ? 12.240  -7.613  89.320  1.00 23.62 ? 1068 HIS A CB  1 
ATOM   1436 C  CG  . HIS A 1 181 ? 10.849  -7.534  89.868  1.00 26.62 ? 1068 HIS A CG  1 
ATOM   1437 N  ND1 . HIS A 1 181 ? 9.824   -8.363  89.443  1.00 28.98 ? 1068 HIS A ND1 1 
ATOM   1438 C  CD2 . HIS A 1 181 ? 10.312  -6.726  90.814  1.00 24.97 ? 1068 HIS A CD2 1 
ATOM   1439 C  CE1 . HIS A 1 181 ? 8.720   -8.059  90.100  1.00 31.47 ? 1068 HIS A CE1 1 
ATOM   1440 N  NE2 . HIS A 1 181 ? 8.987   -7.061  90.930  1.00 27.93 ? 1068 HIS A NE2 1 
ATOM   1441 N  N   . PHE A 1 182 ? 13.299  -6.177  92.408  1.00 24.60 ? 1069 PHE A N   1 
ATOM   1442 C  CA  . PHE A 1 182 ? 13.344  -6.418  93.850  1.00 20.70 ? 1069 PHE A CA  1 
ATOM   1443 C  C   . PHE A 1 182 ? 11.958  -6.707  94.337  1.00 23.09 ? 1069 PHE A C   1 
ATOM   1444 O  O   . PHE A 1 182 ? 11.052  -5.903  94.150  1.00 27.57 ? 1069 PHE A O   1 
ATOM   1445 C  CB  . PHE A 1 182 ? 13.865  -5.213  94.593  1.00 25.44 ? 1069 PHE A CB  1 
ATOM   1446 C  CG  . PHE A 1 182 ? 14.254  -5.505  96.024  1.00 20.48 ? 1069 PHE A CG  1 
ATOM   1447 C  CD1 . PHE A 1 182 ? 15.445  -6.167  96.308  1.00 23.39 ? 1069 PHE A CD1 1 
ATOM   1448 C  CD2 . PHE A 1 182 ? 13.458  -5.075  97.083  1.00 26.13 ? 1069 PHE A CD2 1 
ATOM   1449 C  CE1 . PHE A 1 182 ? 15.816  -6.400  97.589  1.00 24.03 ? 1069 PHE A CE1 1 
ATOM   1450 C  CE2 . PHE A 1 182 ? 13.826  -5.327  98.396  1.00 23.92 ? 1069 PHE A CE2 1 
ATOM   1451 C  CZ  . PHE A 1 182 ? 15.016  -5.980  98.651  1.00 25.09 ? 1069 PHE A CZ  1 
ATOM   1452 N  N   . THR A 1 183 ? 11.804  -7.841  95.009  1.00 22.34 ? 1070 THR A N   1 
ATOM   1453 C  CA  . THR A 1 183 ? 10.478  -8.406  95.253  1.00 23.03 ? 1070 THR A CA  1 
ATOM   1454 C  C   . THR A 1 183 ? 10.054  -8.407  96.725  1.00 24.89 ? 1070 THR A C   1 
ATOM   1455 O  O   . THR A 1 183 ? 8.951   -8.835  97.022  1.00 29.07 ? 1070 THR A O   1 
ATOM   1456 C  CB  . THR A 1 183 ? 10.342  -9.832  94.637  1.00 28.64 ? 1070 THR A CB  1 
ATOM   1457 O  OG1 . THR A 1 183 ? 11.375  -10.684 95.122  1.00 32.42 ? 1070 THR A OG1 1 
ATOM   1458 C  CG2 . THR A 1 183 ? 10.421  -9.782  93.098  1.00 24.64 ? 1070 THR A CG2 1 
ATOM   1459 N  N   . SER A 1 184 ? 10.885  -7.871  97.620  1.00 30.35 ? 1071 SER A N   1 
ATOM   1460 C  CA  A SER A 1 184 ? 10.588  -7.945  99.061  0.50 28.29 ? 1071 SER A CA  1 
ATOM   1461 C  CA  B SER A 1 184 ? 10.677  -7.948  99.070  0.50 28.94 ? 1071 SER A CA  1 
ATOM   1462 C  C   . SER A 1 184 ? 10.434  -6.586  99.747  1.00 32.27 ? 1071 SER A C   1 
ATOM   1463 O  O   . SER A 1 184 ? 10.612  -6.468  100.967 1.00 31.53 ? 1071 SER A O   1 
ATOM   1464 C  CB  A SER A 1 184 ? 11.679  -8.751  99.759  0.50 37.55 ? 1071 SER A CB  1 
ATOM   1465 C  CB  B SER A 1 184 ? 11.913  -8.613  99.717  0.50 34.42 ? 1071 SER A CB  1 
ATOM   1466 O  OG  A SER A 1 184 ? 12.883  -8.031  99.727  0.50 17.14 ? 1071 SER A OG  1 
ATOM   1467 O  OG  B SER A 1 184 ? 12.152  -9.916  99.199  0.50 31.82 ? 1071 SER A OG  1 
ATOM   1468 N  N   . TRP A 1 185 ? 10.090  -5.544  98.982  1.00 30.38 ? 1072 TRP A N   1 
ATOM   1469 C  CA  . TRP A 1 185 ? 9.947   -4.156  99.514  1.00 34.24 ? 1072 TRP A CA  1 
ATOM   1470 C  C   . TRP A 1 185 ? 8.532   -3.659  99.355  1.00 51.72 ? 1072 TRP A C   1 
ATOM   1471 O  O   . TRP A 1 185 ? 8.151   -3.255  98.259  1.00 41.13 ? 1072 TRP A O   1 
ATOM   1472 C  CB  . TRP A 1 185 ? 10.827  -3.168  98.758  1.00 37.39 ? 1072 TRP A CB  1 
ATOM   1473 C  CG  . TRP A 1 185 ? 11.074  -1.769  99.424  1.00 25.47 ? 1072 TRP A CG  1 
ATOM   1474 C  CD1 . TRP A 1 185 ? 10.259  -1.056  100.258 1.00 28.43 ? 1072 TRP A CD1 1 
ATOM   1475 C  CD2 . TRP A 1 185 ? 12.246  -0.968  99.221  1.00 23.85 ? 1072 TRP A CD2 1 
ATOM   1476 N  NE1 . TRP A 1 185 ? 10.892  0.144   100.624 1.00 27.15 ? 1072 TRP A NE1 1 
ATOM   1477 C  CE2 . TRP A 1 185 ? 12.093  0.219   99.968  1.00 29.10 ? 1072 TRP A CE2 1 
ATOM   1478 C  CE3 . TRP A 1 185 ? 13.397  -1.135  98.452  1.00 50.32 ? 1072 TRP A CE3 1 
ATOM   1479 C  CZ2 . TRP A 1 185 ? 13.055  1.208   99.984  1.00 39.32 ? 1072 TRP A CZ2 1 
ATOM   1480 C  CZ3 . TRP A 1 185 ? 14.350  -0.144  98.457  1.00 52.02 ? 1072 TRP A CZ3 1 
ATOM   1481 C  CH2 . TRP A 1 185 ? 14.185  1.006   99.224  1.00 50.67 ? 1072 TRP A CH2 1 
ATOM   1482 N  N   . PRO A 1 186 ? 7.743   -3.692  100.431 1.00 39.93 ? 1073 PRO A N   1 
ATOM   1483 C  CA  . PRO A 1 186 ? 6.361   -3.165  100.345 1.00 41.35 ? 1073 PRO A CA  1 
ATOM   1484 C  C   . PRO A 1 186 ? 6.208   -1.641  100.113 1.00 48.58 ? 1073 PRO A C   1 
ATOM   1485 O  O   . PRO A 1 186 ? 6.858   -0.848  100.808 1.00 40.25 ? 1073 PRO A O   1 
ATOM   1486 C  CB  . PRO A 1 186 ? 5.764   -3.544  101.688 1.00 26.97 ? 1073 PRO A CB  1 
ATOM   1487 C  CG  . PRO A 1 186 ? 6.694   -4.554  102.304 1.00 46.87 ? 1073 PRO A CG  1 
ATOM   1488 C  CD  . PRO A 1 186 ? 8.046   -4.285  101.748 1.00 40.60 ? 1073 PRO A CD  1 
ATOM   1489 N  N   . ASP A 1 187 ? 5.348   -1.241  99.156  1.00 37.56 ? 1074 ASP A N   1 
ATOM   1490 C  CA  . ASP A 1 187 ? 4.959   0.178   98.995  1.00 50.21 ? 1074 ASP A CA  1 
ATOM   1491 C  C   . ASP A 1 187 ? 4.689   0.874   100.341 1.00 47.57 ? 1074 ASP A C   1 
ATOM   1492 O  O   . ASP A 1 187 ? 4.075   0.292   101.238 1.00 36.69 ? 1074 ASP A O   1 
ATOM   1493 C  CB  . ASP A 1 187 ? 3.694   0.318   98.123  1.00 54.60 ? 1074 ASP A CB  1 
ATOM   1494 C  CG  . ASP A 1 187 ? 3.491   1.746   97.578  1.00 58.44 ? 1074 ASP A CG  1 
ATOM   1495 O  OD1 . ASP A 1 187 ? 4.388   2.615   97.725  1.00 43.41 ? 1074 ASP A OD1 1 
ATOM   1496 O  OD2 . ASP A 1 187 ? 2.424   1.991   96.974  1.00 55.24 ? 1074 ASP A OD2 1 
ATOM   1497 N  N   . HIS A 1 188 ? 5.149   2.123   100.457 1.00 47.94 ? 1075 HIS A N   1 
ATOM   1498 C  CA  . HIS A 1 188 ? 5.013   2.920   101.690 1.00 45.10 ? 1075 HIS A CA  1 
ATOM   1499 C  C   . HIS A 1 188 ? 5.720   2.307   102.890 1.00 47.07 ? 1075 HIS A C   1 
ATOM   1500 O  O   . HIS A 1 188 ? 5.544   2.794   104.006 1.00 40.96 ? 1075 HIS A O   1 
ATOM   1501 C  CB  . HIS A 1 188 ? 3.536   3.144   102.069 1.00 53.75 ? 1075 HIS A CB  1 
ATOM   1502 C  CG  . HIS A 1 188 ? 2.673   3.603   100.935 1.00 63.62 ? 1075 HIS A CG  1 
ATOM   1503 N  ND1 . HIS A 1 188 ? 1.700   2.804   100.371 1.00 64.52 ? 1075 HIS A ND1 1 
ATOM   1504 C  CD2 . HIS A 1 188 ? 2.631   4.779   100.266 1.00 63.56 ? 1075 HIS A CD2 1 
ATOM   1505 C  CE1 . HIS A 1 188 ? 1.100   3.467   99.399  1.00 51.36 ? 1075 HIS A CE1 1 
ATOM   1506 N  NE2 . HIS A 1 188 ? 1.646   4.667   99.314  1.00 65.57 ? 1075 HIS A NE2 1 
ATOM   1507 N  N   . GLY A 1 189 ? 6.507   1.253   102.659 1.00 36.65 ? 1076 GLY A N   1 
ATOM   1508 C  CA  . GLY A 1 189 ? 7.078   0.431   103.732 1.00 40.75 ? 1076 GLY A CA  1 
ATOM   1509 C  C   . GLY A 1 189 ? 8.570   0.323   103.585 1.00 44.13 ? 1076 GLY A C   1 
ATOM   1510 O  O   . GLY A 1 189 ? 9.171   1.000   102.732 1.00 42.95 ? 1076 GLY A O   1 
ATOM   1511 N  N   . VAL A 1 190 ? 9.178   -0.491  104.440 1.00 35.42 ? 1077 VAL A N   1 
ATOM   1512 C  CA  . VAL A 1 190 ? 10.582  -0.796  104.304 1.00 34.26 ? 1077 VAL A CA  1 
ATOM   1513 C  C   . VAL A 1 190 ? 10.859  -2.255  104.615 1.00 37.27 ? 1077 VAL A C   1 
ATOM   1514 O  O   . VAL A 1 190 ? 10.194  -2.857  105.463 1.00 34.90 ? 1077 VAL A O   1 
ATOM   1515 C  CB  . VAL A 1 190 ? 11.446  0.061   105.228 1.00 36.95 ? 1077 VAL A CB  1 
ATOM   1516 C  CG1 . VAL A 1 190 ? 11.122  1.522   105.042 1.00 23.62 ? 1077 VAL A CG1 1 
ATOM   1517 C  CG2 . VAL A 1 190 ? 11.269  -0.352  106.667 1.00 29.85 ? 1077 VAL A CG2 1 
ATOM   1518 N  N   . PRO A 1 191 ? 11.880  -2.811  103.962 1.00 29.43 ? 1078 PRO A N   1 
ATOM   1519 C  CA  . PRO A 1 191 ? 12.318  -4.159  104.282 1.00 33.58 ? 1078 PRO A CA  1 
ATOM   1520 C  C   . PRO A 1 191 ? 12.753  -4.299  105.730 1.00 23.96 ? 1078 PRO A C   1 
ATOM   1521 O  O   . PRO A 1 191 ? 13.220  -3.345  106.349 1.00 30.81 ? 1078 PRO A O   1 
ATOM   1522 C  CB  . PRO A 1 191 ? 13.501  -4.384  103.345 1.00 32.16 ? 1078 PRO A CB  1 
ATOM   1523 C  CG  . PRO A 1 191 ? 13.463  -3.310  102.370 1.00 30.96 ? 1078 PRO A CG  1 
ATOM   1524 C  CD  . PRO A 1 191 ? 12.685  -2.196  102.894 1.00 28.33 ? 1078 PRO A CD  1 
ATOM   1525 N  N   . CYS A 1 192 ? 12.564  -5.499  106.286 1.00 37.52 ? 1079 CYS A N   1 
ATOM   1526 C  CA  A CYS A 1 192 ? 12.988  -5.753  107.659 0.75 37.22 ? 1079 CYS A CA  1 
ATOM   1527 C  CA  B CYS A 1 192 ? 12.981  -5.786  107.658 0.25 32.88 ? 1079 CYS A CA  1 
ATOM   1528 C  C   . CYS A 1 192 ? 14.479  -5.561  107.819 1.00 26.09 ? 1079 CYS A C   1 
ATOM   1529 O  O   . CYS A 1 192 ? 14.925  -5.057  108.828 1.00 32.59 ? 1079 CYS A O   1 
ATOM   1530 C  CB  A CYS A 1 192 ? 12.623  -7.154  108.124 0.75 45.17 ? 1079 CYS A CB  1 
ATOM   1531 C  CB  B CYS A 1 192 ? 12.616  -7.223  108.040 0.25 36.07 ? 1079 CYS A CB  1 
ATOM   1532 S  SG  A CYS A 1 192 ? 12.859  -7.259  109.895 0.75 54.50 ? 1079 CYS A SG  1 
ATOM   1533 S  SG  B CYS A 1 192 ? 12.799  -8.400  106.695 0.25 37.05 ? 1079 CYS A SG  1 
ATOM   1534 N  N   . TYR A 1 193 ? 15.246  -5.937  106.791 1.00 26.93 ? 1080 TYR A N   1 
ATOM   1535 C  CA  . TYR A 1 193 ? 16.710  -5.720  106.792 1.00 29.00 ? 1080 TYR A CA  1 
ATOM   1536 C  C   . TYR A 1 193 ? 17.157  -5.049  105.508 1.00 24.11 ? 1080 TYR A C   1 
ATOM   1537 O  O   . TYR A 1 193 ? 16.536  -5.206  104.433 1.00 25.29 ? 1080 TYR A O   1 
ATOM   1538 C  CB  . TYR A 1 193 ? 17.454  -7.062  106.929 1.00 29.52 ? 1080 TYR A CB  1 
ATOM   1539 C  CG  . TYR A 1 193 ? 16.996  -7.879  108.114 1.00 18.63 ? 1080 TYR A CG  1 
ATOM   1540 C  CD1 . TYR A 1 193 ? 17.266  -7.439  109.407 1.00 20.65 ? 1080 TYR A CD1 1 
ATOM   1541 C  CD2 . TYR A 1 193 ? 16.288  -9.047  107.961 1.00 21.86 ? 1080 TYR A CD2 1 
ATOM   1542 C  CE1 . TYR A 1 193 ? 16.859  -8.163  110.498 1.00 27.60 ? 1080 TYR A CE1 1 
ATOM   1543 C  CE2 . TYR A 1 193 ? 15.854  -9.791  109.062 1.00 28.47 ? 1080 TYR A CE2 1 
ATOM   1544 C  CZ  . TYR A 1 193 ? 16.160  -9.348  110.324 1.00 24.05 ? 1080 TYR A CZ  1 
ATOM   1545 O  OH  . TYR A 1 193 ? 15.743  -10.036 111.431 1.00 22.45 ? 1080 TYR A OH  1 
ATOM   1546 N  N   . ALA A 1 194 ? 18.265  -4.336  105.601 1.00 25.78 ? 1081 ALA A N   1 
ATOM   1547 C  CA  . ALA A 1 194 ? 18.838  -3.678  104.404 1.00 26.88 ? 1081 ALA A CA  1 
ATOM   1548 C  C   . ALA A 1 194 ? 19.648  -4.650  103.561 1.00 28.23 ? 1081 ALA A C   1 
ATOM   1549 O  O   . ALA A 1 194 ? 19.892  -4.384  102.389 1.00 25.59 ? 1081 ALA A O   1 
ATOM   1550 C  CB  . ALA A 1 194 ? 19.675  -2.493  104.778 1.00 27.41 ? 1081 ALA A CB  1 
ATOM   1551 N  N   . THR A 1 195 ? 20.032  -5.781  104.147 1.00 21.62 ? 1082 THR A N   1 
ATOM   1552 C  CA  . THR A 1 195 ? 21.029  -6.681  103.536 1.00 26.01 ? 1082 THR A CA  1 
ATOM   1553 C  C   . THR A 1 195 ? 20.675  -7.126  102.096 1.00 24.46 ? 1082 THR A C   1 
ATOM   1554 O  O   . THR A 1 195 ? 21.510  -7.067  101.202 1.00 21.25 ? 1082 THR A O   1 
ATOM   1555 C  CB  . THR A 1 195 ? 21.244  -7.938  104.443 1.00 23.30 ? 1082 THR A CB  1 
ATOM   1556 O  OG1 . THR A 1 195 ? 21.392  -7.522  105.816 1.00 21.40 ? 1082 THR A OG1 1 
ATOM   1557 C  CG2 . THR A 1 195 ? 22.488  -8.769  103.962 1.00 24.21 ? 1082 THR A CG2 1 
ATOM   1558 N  N   . GLY A 1 196 ? 19.456  -7.591  101.868 1.00 26.76 ? 1083 GLY A N   1 
ATOM   1559 C  CA  . GLY A 1 196 ? 19.070  -8.054  100.518 1.00 28.04 ? 1083 GLY A CA  1 
ATOM   1560 C  C   . GLY A 1 196 ? 19.092  -6.936  99.480  1.00 20.11 ? 1083 GLY A C   1 
ATOM   1561 O  O   . GLY A 1 196 ? 19.601  -7.106  98.360  1.00 22.26 ? 1083 GLY A O   1 
ATOM   1562 N  N   . LEU A 1 197 ? 18.550  -5.790  99.877  1.00 22.90 ? 1084 LEU A N   1 
ATOM   1563 C  CA  . LEU A 1 197 ? 18.530  -4.614  99.013  1.00 23.99 ? 1084 LEU A CA  1 
ATOM   1564 C  C   . LEU A 1 197 ? 19.963  -4.187  98.685  1.00 23.30 ? 1084 LEU A C   1 
ATOM   1565 O  O   . LEU A 1 197 ? 20.268  -3.802  97.561  1.00 22.96 ? 1084 LEU A O   1 
ATOM   1566 C  CB  . LEU A 1 197 ? 17.755  -3.464  99.678  1.00 22.22 ? 1084 LEU A CB  1 
ATOM   1567 C  CG  . LEU A 1 197 ? 17.615  -2.194  98.826  1.00 28.79 ? 1084 LEU A CG  1 
ATOM   1568 C  CD1 . LEU A 1 197 ? 16.828  -2.507  97.577  1.00 23.43 ? 1084 LEU A CD1 1 
ATOM   1569 C  CD2 . LEU A 1 197 ? 16.988  -1.111  99.617  1.00 30.83 ? 1084 LEU A CD2 1 
ATOM   1570 N  N   . LEU A 1 198 ? 20.870  -4.285  99.640  1.00 22.62 ? 1085 LEU A N   1 
ATOM   1571 C  CA  . LEU A 1 198 ? 22.262  -3.921  99.351  1.00 24.26 ? 1085 LEU A CA  1 
ATOM   1572 C  C   . LEU A 1 198 ? 22.915  -4.865  98.346  1.00 24.26 ? 1085 LEU A C   1 
ATOM   1573 O  O   . LEU A 1 198 ? 23.692  -4.425  97.477  1.00 23.55 ? 1085 LEU A O   1 
ATOM   1574 C  CB  . LEU A 1 198 ? 23.067  -3.902  100.645 1.00 19.11 ? 1085 LEU A CB  1 
ATOM   1575 C  CG  . LEU A 1 198 ? 22.660  -2.758  101.585 1.00 22.84 ? 1085 LEU A CG  1 
ATOM   1576 C  CD1 . LEU A 1 198 ? 23.412  -2.842  102.939 1.00 27.56 ? 1085 LEU A CD1 1 
ATOM   1577 C  CD2 . LEU A 1 198 ? 22.933  -1.412  100.902 1.00 25.37 ? 1085 LEU A CD2 1 
ATOM   1578 N  N   . GLY A 1 199 ? 22.582  -6.155  98.418  1.00 24.48 ? 1086 GLY A N   1 
ATOM   1579 C  CA  . GLY A 1 199 ? 23.059  -7.111  97.411  1.00 22.11 ? 1086 GLY A CA  1 
ATOM   1580 C  C   . GLY A 1 199 ? 22.563  -6.756  96.025  1.00 21.20 ? 1086 GLY A C   1 
ATOM   1581 O  O   . GLY A 1 199 ? 23.289  -6.804  95.027  1.00 23.61 ? 1086 GLY A O   1 
ATOM   1582 N  N   . PHE A 1 200 ? 21.301  -6.368  95.972  1.00 21.49 ? 1087 PHE A N   1 
ATOM   1583 C  CA  . PHE A 1 200 ? 20.626  -5.965  94.767  1.00 21.13 ? 1087 PHE A CA  1 
ATOM   1584 C  C   . PHE A 1 200 ? 21.288  -4.740  94.157  1.00 25.57 ? 1087 PHE A C   1 
ATOM   1585 O  O   . PHE A 1 200 ? 21.563  -4.708  92.967  1.00 22.18 ? 1087 PHE A O   1 
ATOM   1586 C  CB  . PHE A 1 200 ? 19.189  -5.641  95.175  1.00 23.86 ? 1087 PHE A CB  1 
ATOM   1587 C  CG  . PHE A 1 200 ? 18.322  -5.101  94.079  1.00 22.73 ? 1087 PHE A CG  1 
ATOM   1588 C  CD1 . PHE A 1 200 ? 17.730  -5.954  93.164  1.00 23.26 ? 1087 PHE A CD1 1 
ATOM   1589 C  CD2 . PHE A 1 200 ? 17.992  -3.755  94.052  1.00 25.70 ? 1087 PHE A CD2 1 
ATOM   1590 C  CE1 . PHE A 1 200 ? 16.868  -5.464  92.198  1.00 24.60 ? 1087 PHE A CE1 1 
ATOM   1591 C  CE2 . PHE A 1 200 ? 17.143  -3.257  93.082  1.00 31.39 ? 1087 PHE A CE2 1 
ATOM   1592 C  CZ  . PHE A 1 200 ? 16.557  -4.110  92.175  1.00 23.93 ? 1087 PHE A CZ  1 
ATOM   1593 N  N   . VAL A 1 201 ? 21.556  -3.743  94.985  1.00 21.88 ? 1088 VAL A N   1 
ATOM   1594 C  CA  . VAL A 1 201 ? 22.284  -2.560  94.572  1.00 25.79 ? 1088 VAL A CA  1 
ATOM   1595 C  C   . VAL A 1 201 ? 23.657  -2.921  94.005  1.00 27.73 ? 1088 VAL A C   1 
ATOM   1596 O  O   . VAL A 1 201 ? 24.085  -2.428  92.946  1.00 24.81 ? 1088 VAL A O   1 
ATOM   1597 C  CB  . VAL A 1 201 ? 22.430  -1.559  95.752  1.00 25.23 ? 1088 VAL A CB  1 
ATOM   1598 C  CG1 . VAL A 1 201 ? 23.422  -0.407  95.366  1.00 23.89 ? 1088 VAL A CG1 1 
ATOM   1599 C  CG2 . VAL A 1 201 ? 21.058  -1.009  96.178  1.00 23.19 ? 1088 VAL A CG2 1 
ATOM   1600 N  N   . ARG A 1 202 ? 24.342  -3.812  94.701  1.00 23.46 ? 1089 ARG A N   1 
ATOM   1601 C  CA  . ARG A 1 202 ? 25.650  -4.310  94.259  1.00 24.19 ? 1089 ARG A CA  1 
ATOM   1602 C  C   . ARG A 1 202 ? 25.577  -4.941  92.867  1.00 22.93 ? 1089 ARG A C   1 
ATOM   1603 O  O   . ARG A 1 202 ? 26.455  -4.686  92.029  1.00 27.23 ? 1089 ARG A O   1 
ATOM   1604 C  CB  . ARG A 1 202 ? 26.186  -5.326  95.278  1.00 33.24 ? 1089 ARG A CB  1 
ATOM   1605 C  CG  . ARG A 1 202 ? 27.704  -5.352  95.471  1.00 53.60 ? 1089 ARG A CG  1 
ATOM   1606 C  CD  . ARG A 1 202 ? 28.080  -5.725  96.938  1.00 51.73 ? 1089 ARG A CD  1 
ATOM   1607 N  NE  . ARG A 1 202 ? 27.505  -7.019  97.312  1.00 50.72 ? 1089 ARG A NE  1 
ATOM   1608 C  CZ  . ARG A 1 202 ? 26.690  -7.266  98.346  1.00 61.48 ? 1089 ARG A CZ  1 
ATOM   1609 N  NH1 . ARG A 1 202 ? 26.233  -8.507  98.513  1.00 51.90 ? 1089 ARG A NH1 1 
ATOM   1610 N  NH2 . ARG A 1 202 ? 26.325  -6.317  99.218  1.00 37.24 ? 1089 ARG A NH2 1 
ATOM   1611 N  N   . GLN A 1 203 ? 24.534  -5.744  92.588  1.00 23.25 ? 1090 GLN A N   1 
ATOM   1612 C  CA  . GLN A 1 203 ? 24.342  -6.325  91.240  1.00 24.47 ? 1090 GLN A CA  1 
ATOM   1613 C  C   . GLN A 1 203 ? 24.183  -5.283  90.130  1.00 21.81 ? 1090 GLN A C   1 
ATOM   1614 O  O   . GLN A 1 203 ? 24.756  -5.424  89.038  1.00 23.85 ? 1090 GLN A O   1 
ATOM   1615 C  CB  . GLN A 1 203 ? 23.086  -7.224  91.212  1.00 30.45 ? 1090 GLN A CB  1 
ATOM   1616 C  CG  . GLN A 1 203 ? 23.193  -8.443  92.092  1.00 36.60 ? 1090 GLN A CG  1 
ATOM   1617 C  CD  . GLN A 1 203 ? 23.578  -9.706  91.328  1.00 37.08 ? 1090 GLN A CD  1 
ATOM   1618 O  OE1 . GLN A 1 203 ? 24.237  -9.644  90.295  1.00 42.05 ? 1090 GLN A OE1 1 
ATOM   1619 N  NE2 . GLN A 1 203 ? 23.196  -10.866 91.871  1.00 34.35 ? 1090 GLN A NE2 1 
ATOM   1620 N  N   . VAL A 1 204 ? 23.389  -4.266  90.402  1.00 20.61 ? 1091 VAL A N   1 
ATOM   1621 C  CA  . VAL A 1 204 ? 23.153  -3.208  89.431  1.00 22.75 ? 1091 VAL A CA  1 
ATOM   1622 C  C   . VAL A 1 204 ? 24.443  -2.464  89.141  1.00 27.61 ? 1091 VAL A C   1 
ATOM   1623 O  O   . VAL A 1 204 ? 24.761  -2.170  87.999  1.00 27.18 ? 1091 VAL A O   1 
ATOM   1624 C  CB  . VAL A 1 204 ? 22.072  -2.218  89.952  1.00 24.94 ? 1091 VAL A CB  1 
ATOM   1625 C  CG1 . VAL A 1 204 ? 21.843  -1.071  89.000  1.00 23.17 ? 1091 VAL A CG1 1 
ATOM   1626 C  CG2 . VAL A 1 204 ? 20.711  -2.974  90.183  1.00 26.28 ? 1091 VAL A CG2 1 
ATOM   1627 N  N   . LYS A 1 205 ? 25.197  -2.147  90.194  1.00 21.65 ? 1092 LYS A N   1 
ATOM   1628 C  CA  . LYS A 1 205 ? 26.439  -1.419  90.032  1.00 26.63 ? 1092 LYS A CA  1 
ATOM   1629 C  C   . LYS A 1 205 ? 27.422  -2.280  89.226  1.00 28.88 ? 1092 LYS A C   1 
ATOM   1630 O  O   . LYS A 1 205 ? 28.163  -1.766  88.400  1.00 25.23 ? 1092 LYS A O   1 
ATOM   1631 C  CB  . LYS A 1 205 ? 27.022  -1.055  91.409  1.00 26.93 ? 1092 LYS A CB  1 
ATOM   1632 C  CG  . LYS A 1 205 ? 26.297  0.075   92.182  1.00 32.10 ? 1092 LYS A CG  1 
ATOM   1633 C  CD  . LYS A 1 205 ? 27.116  0.420   93.476  1.00 38.82 ? 1092 LYS A CD  1 
ATOM   1634 C  CE  . LYS A 1 205 ? 26.574  1.590   94.325  1.00 35.69 ? 1092 LYS A CE  1 
ATOM   1635 N  NZ  . LYS A 1 205 ? 26.623  2.881   93.576  1.00 38.95 ? 1092 LYS A NZ  1 
ATOM   1636 N  N   . PHE A 1 206 ? 27.454  -3.581  89.514  1.00 25.02 ? 1093 PHE A N   1 
ATOM   1637 C  CA  . PHE A 1 206 ? 28.354  -4.514  88.809  1.00 25.50 ? 1093 PHE A CA  1 
ATOM   1638 C  C   . PHE A 1 206 ? 27.968  -4.696  87.353  1.00 29.56 ? 1093 PHE A C   1 
ATOM   1639 O  O   . PHE A 1 206 ? 28.821  -4.755  86.480  1.00 28.72 ? 1093 PHE A O   1 
ATOM   1640 C  CB  . PHE A 1 206 ? 28.304  -5.889  89.471  1.00 26.37 ? 1093 PHE A CB  1 
ATOM   1641 C  CG  . PHE A 1 206 ? 29.350  -6.834  88.965  1.00 40.64 ? 1093 PHE A CG  1 
ATOM   1642 C  CD1 . PHE A 1 206 ? 30.665  -6.718  89.398  1.00 52.26 ? 1093 PHE A CD1 1 
ATOM   1643 C  CD2 . PHE A 1 206 ? 29.023  -7.846  88.071  1.00 50.62 ? 1093 PHE A CD2 1 
ATOM   1644 C  CE1 . PHE A 1 206 ? 31.641  -7.589  88.930  1.00 61.00 ? 1093 PHE A CE1 1 
ATOM   1645 C  CE2 . PHE A 1 206 ? 29.988  -8.721  87.595  1.00 57.80 ? 1093 PHE A CE2 1 
ATOM   1646 C  CZ  . PHE A 1 206 ? 31.299  -8.595  88.020  1.00 63.33 ? 1093 PHE A CZ  1 
ATOM   1647 N  N   . LEU A 1 207 ? 26.681  -4.826  87.087  1.00 25.10 ? 1094 LEU A N   1 
ATOM   1648 C  CA  . LEU A 1 207 ? 26.238  -5.287  85.765  1.00 26.31 ? 1094 LEU A CA  1 
ATOM   1649 C  C   . LEU A 1 207 ? 25.837  -4.176  84.800  1.00 29.16 ? 1094 LEU A C   1 
ATOM   1650 O  O   . LEU A 1 207 ? 25.885  -4.377  83.586  1.00 29.34 ? 1094 LEU A O   1 
ATOM   1651 C  CB  . LEU A 1 207 ? 25.093  -6.291  85.921  1.00 25.17 ? 1094 LEU A CB  1 
ATOM   1652 C  CG  . LEU A 1 207 ? 25.438  -7.670  86.483  1.00 30.01 ? 1094 LEU A CG  1 
ATOM   1653 C  CD1 . LEU A 1 207 ? 24.207  -8.512  86.713  1.00 28.73 ? 1094 LEU A CD1 1 
ATOM   1654 C  CD2 . LEU A 1 207 ? 26.401  -8.411  85.527  1.00 28.57 ? 1094 LEU A CD2 1 
ATOM   1655 N  N   . ASN A 1 208 ? 25.404  -3.026  85.305  1.00 25.67 ? 1095 ASN A N   1 
ATOM   1656 C  CA  . ASN A 1 208 ? 24.983  -1.969  84.430  1.00 23.10 ? 1095 ASN A CA  1 
ATOM   1657 C  C   . ASN A 1 208 ? 26.119  -1.488  83.547  1.00 25.17 ? 1095 ASN A C   1 
ATOM   1658 O  O   . ASN A 1 208 ? 27.140  -1.067  84.049  1.00 28.58 ? 1095 ASN A O   1 
ATOM   1659 C  CB  . ASN A 1 208 ? 24.446  -0.746  85.160  1.00 22.55 ? 1095 ASN A CB  1 
ATOM   1660 C  CG  . ASN A 1 208 ? 23.992  0.339   84.179  1.00 25.79 ? 1095 ASN A CG  1 
ATOM   1661 O  OD1 . ASN A 1 208 ? 23.050  0.122   83.370  1.00 25.96 ? 1095 ASN A OD1 1 
ATOM   1662 N  ND2 . ASN A 1 208 ? 24.652  1.515   84.230  1.00 25.42 ? 1095 ASN A ND2 1 
ATOM   1663 N  N   . PRO A 1 209 ? 25.927  -1.513  82.219  1.00 25.27 ? 1096 PRO A N   1 
ATOM   1664 C  CA  . PRO A 1 209 ? 27.084  -1.073  81.408  1.00 25.55 ? 1096 PRO A CA  1 
ATOM   1665 C  C   . PRO A 1 209 ? 27.258  0.451   81.452  1.00 27.13 ? 1096 PRO A C   1 
ATOM   1666 O  O   . PRO A 1 209 ? 26.377  1.204   81.054  1.00 25.63 ? 1096 PRO A O   1 
ATOM   1667 C  CB  . PRO A 1 209 ? 26.736  -1.559  80.006  1.00 34.49 ? 1096 PRO A CB  1 
ATOM   1668 C  CG  . PRO A 1 209 ? 25.471  -2.326  80.118  1.00 36.53 ? 1096 PRO A CG  1 
ATOM   1669 C  CD  . PRO A 1 209 ? 24.794  -1.902  81.370  1.00 27.30 ? 1096 PRO A CD  1 
ATOM   1670 N  N   . PRO A 1 210 ? 28.417  0.926   81.918  1.00 29.01 ? 1097 PRO A N   1 
ATOM   1671 C  CA  . PRO A 1 210 ? 28.470  2.371   82.165  1.00 32.04 ? 1097 PRO A CA  1 
ATOM   1672 C  C   . PRO A 1 210 ? 28.395  3.250   80.901  1.00 27.35 ? 1097 PRO A C   1 
ATOM   1673 O  O   . PRO A 1 210 ? 28.058  4.432   80.985  1.00 30.61 ? 1097 PRO A O   1 
ATOM   1674 C  CB  . PRO A 1 210 ? 29.787  2.550   82.931  1.00 35.51 ? 1097 PRO A CB  1 
ATOM   1675 C  CG  . PRO A 1 210 ? 30.621  1.343   82.551  1.00 42.32 ? 1097 PRO A CG  1 
ATOM   1676 C  CD  . PRO A 1 210 ? 29.687  0.236   82.214  1.00 39.89 ? 1097 PRO A CD  1 
ATOM   1677 N  N   . GLU A 1 211 ? 28.650  2.670   79.741  1.00 29.00 ? 1098 GLU A N   1 
ATOM   1678 C  CA  . GLU A 1 211 ? 28.547  3.391   78.463  1.00 29.79 ? 1098 GLU A CA  1 
ATOM   1679 C  C   . GLU A 1 211 ? 27.101  3.601   78.015  1.00 31.98 ? 1098 GLU A C   1 
ATOM   1680 O  O   . GLU A 1 211 ? 26.859  4.410   77.144  1.00 29.60 ? 1098 GLU A O   1 
ATOM   1681 C  CB  . GLU A 1 211 ? 29.320  2.626   77.377  1.00 38.58 ? 1098 GLU A CB  1 
ATOM   1682 C  CG  . GLU A 1 211 ? 30.824  2.696   77.611  1.00 53.62 ? 1098 GLU A CG  1 
ATOM   1683 C  CD  . GLU A 1 211 ? 31.657  1.734   76.750  1.00 67.93 ? 1098 GLU A CD  1 
ATOM   1684 O  OE1 . GLU A 1 211 ? 31.412  0.511   76.827  1.00 63.53 ? 1098 GLU A OE1 1 
ATOM   1685 O  OE2 . GLU A 1 211 ? 32.584  2.194   76.033  1.00 45.10 ? 1098 GLU A OE2 1 
ATOM   1686 N  N   . ALA A 1 212 ? 26.167  2.856   78.613  1.00 27.57 ? 1099 ALA A N   1 
ATOM   1687 C  CA  . ALA A 1 212 ? 24.723  2.932   78.285  1.00 24.64 ? 1099 ALA A CA  1 
ATOM   1688 C  C   . ALA A 1 212 ? 24.079  4.227   78.827  1.00 24.10 ? 1099 ALA A C   1 
ATOM   1689 O  O   . ALA A 1 212 ? 24.744  5.056   79.472  1.00 24.36 ? 1099 ALA A O   1 
ATOM   1690 C  CB  . ALA A 1 212 ? 23.977  1.723   78.836  1.00 27.28 ? 1099 ALA A CB  1 
ATOM   1691 N  N   . GLY A 1 213 ? 22.809  4.399   78.483  1.00 24.71 ? 1100 GLY A N   1 
ATOM   1692 C  CA  . GLY A 1 213 ? 22.026  5.526   78.912  1.00 21.96 ? 1100 GLY A CA  1 
ATOM   1693 C  C   . GLY A 1 213 ? 21.579  5.382   80.360  1.00 26.54 ? 1100 GLY A C   1 
ATOM   1694 O  O   . GLY A 1 213 ? 22.016  4.487   81.100  1.00 22.74 ? 1100 GLY A O   1 
ATOM   1695 N  N   . PRO A 1 214 ? 20.677  6.260   80.770  1.00 23.59 ? 1101 PRO A N   1 
ATOM   1696 C  CA  . PRO A 1 214 ? 20.274  6.255   82.180  1.00 25.00 ? 1101 PRO A CA  1 
ATOM   1697 C  C   . PRO A 1 214 ? 19.664  4.906   82.641  1.00 20.21 ? 1101 PRO A C   1 
ATOM   1698 O  O   . PRO A 1 214 ? 18.887  4.273   81.917  1.00 24.21 ? 1101 PRO A O   1 
ATOM   1699 C  CB  . PRO A 1 214 ? 19.247  7.394   82.253  1.00 28.93 ? 1101 PRO A CB  1 
ATOM   1700 C  CG  . PRO A 1 214 ? 19.500  8.243   81.023  1.00 33.03 ? 1101 PRO A CG  1 
ATOM   1701 C  CD  . PRO A 1 214 ? 20.036  7.325   79.978  1.00 22.84 ? 1101 PRO A CD  1 
ATOM   1702 N  N   . ILE A 1 215 ? 19.966  4.533   83.885  1.00 24.69 ? 1102 ILE A N   1 
ATOM   1703 C  CA  . ILE A 1 215 ? 19.287  3.451   84.567  1.00 23.39 ? 1102 ILE A CA  1 
ATOM   1704 C  C   . ILE A 1 215 ? 17.846  3.893   84.885  1.00 21.54 ? 1102 ILE A C   1 
ATOM   1705 O  O   . ILE A 1 215 ? 17.616  4.924   85.536  1.00 25.15 ? 1102 ILE A O   1 
ATOM   1706 C  CB  . ILE A 1 215 ? 20.016  3.063   85.880  1.00 24.35 ? 1102 ILE A CB  1 
ATOM   1707 C  CG1 . ILE A 1 215 ? 21.436  2.573   85.624  1.00 23.62 ? 1102 ILE A CG1 1 
ATOM   1708 C  CG2 . ILE A 1 215 ? 19.226  1.957   86.592  1.00 21.97 ? 1102 ILE A CG2 1 
ATOM   1709 C  CD1 . ILE A 1 215 ? 22.236  2.352   86.933  1.00 25.70 ? 1102 ILE A CD1 1 
ATOM   1710 N  N   . VAL A 1 216 ? 16.865  3.140   84.408  1.00 25.42 ? 1103 VAL A N   1 
ATOM   1711 C  CA  . VAL A 1 216 ? 15.479  3.489   84.658  1.00 23.94 ? 1103 VAL A CA  1 
ATOM   1712 C  C   . VAL A 1 216 ? 15.070  2.882   86.007  1.00 25.09 ? 1103 VAL A C   1 
ATOM   1713 O  O   . VAL A 1 216 ? 15.111  1.679   86.176  1.00 27.04 ? 1103 VAL A O   1 
ATOM   1714 C  CB  . VAL A 1 216 ? 14.558  3.023   83.498  1.00 21.38 ? 1103 VAL A CB  1 
ATOM   1715 C  CG1 . VAL A 1 216 ? 13.049  3.148   83.873  1.00 22.10 ? 1103 VAL A CG1 1 
ATOM   1716 C  CG2 . VAL A 1 216 ? 14.911  3.793   82.220  1.00 21.32 ? 1103 VAL A CG2 1 
ATOM   1717 N  N   . VAL A 1 217 ? 14.645  3.730   86.944  1.00 22.44 ? 1104 VAL A N   1 
ATOM   1718 C  CA  . VAL A 1 217 ? 14.202  3.258   88.261  1.00 21.67 ? 1104 VAL A CA  1 
ATOM   1719 C  C   . VAL A 1 217 ? 12.742  3.579   88.448  1.00 25.11 ? 1104 VAL A C   1 
ATOM   1720 O  O   . VAL A 1 217 ? 12.310  4.719   88.222  1.00 22.73 ? 1104 VAL A O   1 
ATOM   1721 C  CB  . VAL A 1 217 ? 15.028  3.888   89.407  1.00 20.55 ? 1104 VAL A CB  1 
ATOM   1722 C  CG1 . VAL A 1 217 ? 14.646  3.286   90.785  1.00 23.18 ? 1104 VAL A CG1 1 
ATOM   1723 C  CG2 . VAL A 1 217 ? 16.552  3.756   89.157  1.00 24.51 ? 1104 VAL A CG2 1 
ATOM   1724 N  N   . HIS A 1 218 ? 11.970  2.577   88.870  1.00 22.14 ? 1105 HIS A N   1 
ATOM   1725 C  CA  . HIS A 1 218 ? 10.558  2.775   89.094  1.00 23.41 ? 1105 HIS A CA  1 
ATOM   1726 C  C   . HIS A 1 218 ? 10.008  1.901   90.231  1.00 27.12 ? 1105 HIS A C   1 
ATOM   1727 O  O   . HIS A 1 218 ? 10.565  0.879   90.579  1.00 23.85 ? 1105 HIS A O   1 
ATOM   1728 C  CB  . HIS A 1 218 ? 9.781   2.541   87.797  1.00 24.01 ? 1105 HIS A CB  1 
ATOM   1729 C  CG  . HIS A 1 218 ? 9.462   1.093   87.502  1.00 23.00 ? 1105 HIS A CG  1 
ATOM   1730 N  ND1 . HIS A 1 218 ? 8.391   0.426   88.076  1.00 24.16 ? 1105 HIS A ND1 1 
ATOM   1731 C  CD2 . HIS A 1 218 ? 10.050  0.204   86.661  1.00 25.22 ? 1105 HIS A CD2 1 
ATOM   1732 C  CE1 . HIS A 1 218 ? 8.356   -0.815  87.612  1.00 28.10 ? 1105 HIS A CE1 1 
ATOM   1733 N  NE2 . HIS A 1 218 ? 9.355   -0.973  86.757  1.00 23.34 ? 1105 HIS A NE2 1 
ATOM   1734 N  N   . CYS A 1 219 ? 8.915   2.362   90.818  1.00 20.48 ? 1106 CYS A N   1 
ATOM   1735 C  CA  . CYS A 1 219 ? 8.172   1.606   91.803  1.00 20.44 ? 1106 CYS A CA  1 
ATOM   1736 C  C   . CYS A 1 219 ? 6.727   1.657   91.317  1.00 23.50 ? 1106 CYS A C   1 
ATOM   1737 O  O   . CYS A 1 219 ? 6.458   1.298   90.168  1.00 25.37 ? 1106 CYS A O   1 
ATOM   1738 C  CB  . CYS A 1 219 ? 8.395   2.162   93.214  1.00 28.51 ? 1106 CYS A CB  1 
ATOM   1739 S  SG  . CYS A 1 219 ? 8.292   3.954   93.472  1.00 26.91 ? 1106 CYS A SG  1 
ATOM   1740 N  N   . SER A 1 220 ? 5.816   2.150   92.141  1.00 21.92 ? 1107 SER A N   1 
ATOM   1741 C  CA  . SER A 1 220 ? 4.434   2.381   91.660  1.00 25.70 ? 1107 SER A CA  1 
ATOM   1742 C  C   . SER A 1 220 ? 4.314   3.840   91.198  1.00 26.45 ? 1107 SER A C   1 
ATOM   1743 O  O   . SER A 1 220 ? 4.133   4.084   90.015  1.00 24.09 ? 1107 SER A O   1 
ATOM   1744 C  CB  . SER A 1 220 ? 3.420   2.056   92.742  1.00 28.73 ? 1107 SER A CB  1 
ATOM   1745 O  OG  . SER A 1 220 ? 2.092   2.062   92.212  1.00 27.97 ? 1107 SER A OG  1 
ATOM   1746 N  N   . ALA A 1 221 ? 4.424   4.799   92.120  1.00 25.23 ? 1108 ALA A N   1 
ATOM   1747 C  CA  . ALA A 1 221 ? 4.318   6.228   91.759  1.00 30.22 ? 1108 ALA A CA  1 
ATOM   1748 C  C   . ALA A 1 221 ? 5.647   6.802   91.257  1.00 25.88 ? 1108 ALA A C   1 
ATOM   1749 O  O   . ALA A 1 221 ? 5.657   7.847   90.620  1.00 30.51 ? 1108 ALA A O   1 
ATOM   1750 C  CB  . ALA A 1 221 ? 3.803   7.056   92.923  1.00 23.93 ? 1108 ALA A CB  1 
ATOM   1751 N  N   . GLY A 1 222 ? 6.754   6.147   91.580  1.00 26.42 ? 1109 GLY A N   1 
ATOM   1752 C  CA  . GLY A 1 222 ? 8.100   6.632   91.212  1.00 29.27 ? 1109 GLY A CA  1 
ATOM   1753 C  C   . GLY A 1 222 ? 8.613   7.707   92.170  1.00 30.79 ? 1109 GLY A C   1 
ATOM   1754 O  O   . GLY A 1 222 ? 9.325   8.622   91.762  1.00 31.06 ? 1109 GLY A O   1 
ATOM   1755 N  N   . ALA A 1 223 ? 8.276   7.584   93.450  1.00 27.06 ? 1110 ALA A N   1 
ATOM   1756 C  CA  . ALA A 1 223 ? 8.800   8.494   94.456  1.00 29.17 ? 1110 ALA A CA  1 
ATOM   1757 C  C   . ALA A 1 223 ? 9.491   7.799   95.629  1.00 23.68 ? 1110 ALA A C   1 
ATOM   1758 O  O   . ALA A 1 223 ? 10.676  8.032   95.868  1.00 27.85 ? 1110 ALA A O   1 
ATOM   1759 C  CB  . ALA A 1 223 ? 7.709   9.422   94.952  1.00 30.73 ? 1110 ALA A CB  1 
ATOM   1760 N  N   . GLY A 1 224 ? 8.743   6.992   96.383  1.00 27.11 ? 1111 GLY A N   1 
ATOM   1761 C  CA  . GLY A 1 224 ? 9.192   6.504   97.690  1.00 25.40 ? 1111 GLY A CA  1 
ATOM   1762 C  C   . GLY A 1 224 ? 10.318  5.489   97.567  1.00 27.98 ? 1111 GLY A C   1 
ATOM   1763 O  O   . GLY A 1 224 ? 11.477  5.761   97.896  1.00 25.16 ? 1111 GLY A O   1 
ATOM   1764 N  N   . ARG A 1 225 ? 9.984   4.293   97.105  1.00 22.51 ? 1112 ARG A N   1 
ATOM   1765 C  CA  . ARG A 1 225 ? 10.982  3.235   96.967  1.00 20.47 ? 1112 ARG A CA  1 
ATOM   1766 C  C   . ARG A 1 225 ? 11.985  3.610   95.896  1.00 23.20 ? 1112 ARG A C   1 
ATOM   1767 O  O   . ARG A 1 225 ? 13.151  3.368   96.048  1.00 22.05 ? 1112 ARG A O   1 
ATOM   1768 C  CB  . ARG A 1 225 ? 10.292  1.907   96.642  1.00 24.34 ? 1112 ARG A CB  1 
ATOM   1769 C  CG  . ARG A 1 225 ? 9.371   1.492   97.764  1.00 22.86 ? 1112 ARG A CG  1 
ATOM   1770 C  CD  . ARG A 1 225 ? 8.588   0.262   97.451  1.00 25.93 ? 1112 ARG A CD  1 
ATOM   1771 N  NE  . ARG A 1 225 ? 7.443   0.572   96.606  1.00 38.38 ? 1112 ARG A NE  1 
ATOM   1772 C  CZ  . ARG A 1 225 ? 6.557   -0.332  96.207  1.00 48.69 ? 1112 ARG A CZ  1 
ATOM   1773 N  NH1 . ARG A 1 225 ? 6.699   -1.595  96.606  1.00 24.31 ? 1112 ARG A NH1 1 
ATOM   1774 N  NH2 . ARG A 1 225 ? 5.522   0.033   95.428  1.00 36.66 ? 1112 ARG A NH2 1 
ATOM   1775 N  N   . THR A 1 226 ? 11.528  4.189   94.789  1.00 21.67 ? 1113 THR A N   1 
ATOM   1776 C  CA  . THR A 1 226 ? 12.459  4.708   93.747  1.00 20.10 ? 1113 THR A CA  1 
ATOM   1777 C  C   . THR A 1 226 ? 13.486  5.651   94.365  1.00 22.15 ? 1113 THR A C   1 
ATOM   1778 O  O   . THR A 1 226 ? 14.698  5.468   94.218  1.00 23.14 ? 1113 THR A O   1 
ATOM   1779 C  CB  . THR A 1 226 ? 11.675  5.421   92.649  1.00 21.62 ? 1113 THR A CB  1 
ATOM   1780 O  OG1 . THR A 1 226 ? 10.867  4.453   91.973  1.00 25.39 ? 1113 THR A OG1 1 
ATOM   1781 C  CG2 . THR A 1 226 ? 12.600  6.157   91.648  1.00 21.27 ? 1113 THR A CG2 1 
ATOM   1782 N  N   . GLY A 1 227 ? 13.003  6.684   95.067  1.00 23.45 ? 1114 GLY A N   1 
ATOM   1783 C  CA  . GLY A 1 227 ? 13.910  7.590   95.753  1.00 22.30 ? 1114 GLY A CA  1 
ATOM   1784 C  C   . GLY A 1 227 ? 14.850  6.897   96.733  1.00 21.46 ? 1114 GLY A C   1 
ATOM   1785 O  O   . GLY A 1 227 ? 16.017  7.281   96.827  1.00 25.38 ? 1114 GLY A O   1 
ATOM   1786 N  N   . CYS A 1 228 ? 14.372  5.893   97.488  1.00 25.24 ? 1115 CYS A N   1 
ATOM   1787 C  CA  . CYS A 1 228 ? 15.271  5.191   98.422  1.00 19.65 ? 1115 CYS A CA  1 
ATOM   1788 C  C   . CYS A 1 228 ? 16.390  4.500   97.669  1.00 18.41 ? 1115 CYS A C   1 
ATOM   1789 O  O   . CYS A 1 228 ? 17.554  4.634   98.042  1.00 22.57 ? 1115 CYS A O   1 
ATOM   1790 C  CB  . CYS A 1 228 ? 14.545  4.173   99.290  1.00 22.46 ? 1115 CYS A CB  1 
ATOM   1791 S  SG  . CYS A 1 228 ? 13.399  4.946   100.440 1.00 23.61 ? 1115 CYS A SG  1 
ATOM   1792 N  N   . PHE A 1 229 ? 16.062  3.795   96.591  1.00 22.41 ? 1116 PHE A N   1 
ATOM   1793 C  CA  . PHE A 1 229 ? 17.100  3.096   95.839  1.00 24.47 ? 1116 PHE A CA  1 
ATOM   1794 C  C   . PHE A 1 229 ? 18.159  4.085   95.322  1.00 24.54 ? 1116 PHE A C   1 
ATOM   1795 O  O   . PHE A 1 229 ? 19.380  3.853   95.452  1.00 23.37 ? 1116 PHE A O   1 
ATOM   1796 C  CB  . PHE A 1 229 ? 16.507  2.319   94.664  1.00 22.84 ? 1116 PHE A CB  1 
ATOM   1797 C  CG  . PHE A 1 229 ? 17.549  1.742   93.760  1.00 21.83 ? 1116 PHE A CG  1 
ATOM   1798 C  CD1 . PHE A 1 229 ? 18.031  0.461   93.980  1.00 28.52 ? 1116 PHE A CD1 1 
ATOM   1799 C  CD2 . PHE A 1 229 ? 18.062  2.484   92.696  1.00 23.46 ? 1116 PHE A CD2 1 
ATOM   1800 C  CE1 . PHE A 1 229 ? 18.996  -0.082  93.156  1.00 28.52 ? 1116 PHE A CE1 1 
ATOM   1801 C  CE2 . PHE A 1 229 ? 19.036  1.961   91.886  1.00 27.60 ? 1116 PHE A CE2 1 
ATOM   1802 C  CZ  . PHE A 1 229 ? 19.516  0.668   92.115  1.00 25.22 ? 1116 PHE A CZ  1 
ATOM   1803 N  N   . ILE A 1 230 ? 17.691  5.199   94.782  1.00 22.38 ? 1117 ILE A N   1 
ATOM   1804 C  CA  . ILE A 1 230 ? 18.597  6.198   94.222  1.00 23.19 ? 1117 ILE A CA  1 
ATOM   1805 C  C   . ILE A 1 230 ? 19.464  6.846   95.315  1.00 23.59 ? 1117 ILE A C   1 
ATOM   1806 O  O   . ILE A 1 230 ? 20.664  7.018   95.139  1.00 25.27 ? 1117 ILE A O   1 
ATOM   1807 C  CB  . ILE A 1 230 ? 17.844  7.271   93.398  1.00 25.71 ? 1117 ILE A CB  1 
ATOM   1808 C  CG1 . ILE A 1 230 ? 17.214  6.634   92.151  1.00 25.06 ? 1117 ILE A CG1 1 
ATOM   1809 C  CG2 . ILE A 1 230 ? 18.829  8.404   93.002  1.00 20.13 ? 1117 ILE A CG2 1 
ATOM   1810 C  CD1 . ILE A 1 230 ? 16.343  7.557   91.308  1.00 24.74 ? 1117 ILE A CD1 1 
ATOM   1811 N  N   . ALA A 1 231 ? 18.863  7.172   96.452  1.00 23.33 ? 1118 ALA A N   1 
ATOM   1812 C  CA  . ALA A 1 231 ? 19.617  7.750   97.550  1.00 17.62 ? 1118 ALA A CA  1 
ATOM   1813 C  C   . ALA A 1 231 ? 20.734  6.829   98.040  1.00 23.90 ? 1118 ALA A C   1 
ATOM   1814 O  O   . ALA A 1 231 ? 21.882  7.251   98.200  1.00 22.07 ? 1118 ALA A O   1 
ATOM   1815 C  CB  . ALA A 1 231 ? 18.661  8.151   98.709  1.00 24.06 ? 1118 ALA A CB  1 
ATOM   1816 N  N   . ILE A 1 232 ? 20.401  5.566   98.261  1.00 22.03 ? 1119 ILE A N   1 
ATOM   1817 C  CA  . ILE A 1 232 ? 21.366  4.573   98.721  1.00 24.95 ? 1119 ILE A CA  1 
ATOM   1818 C  C   . ILE A 1 232 ? 22.467  4.410   97.701  1.00 24.72 ? 1119 ILE A C   1 
ATOM   1819 O  O   . ILE A 1 232 ? 23.656  4.567   98.036  1.00 24.95 ? 1119 ILE A O   1 
ATOM   1820 C  CB  . ILE A 1 232 ? 20.694  3.213   99.052  1.00 24.47 ? 1119 ILE A CB  1 
ATOM   1821 C  CG1 . ILE A 1 232 ? 19.733  3.362   100.267 1.00 19.28 ? 1119 ILE A CG1 1 
ATOM   1822 C  CG2 . ILE A 1 232 ? 21.772  2.136   99.340  1.00 21.16 ? 1119 ILE A CG2 1 
ATOM   1823 C  CD1 . ILE A 1 232 ? 18.704  2.202   100.417 1.00 20.83 ? 1119 ILE A CD1 1 
ATOM   1824 N  N   . ASP A 1 233 ? 22.084  4.177   96.447  1.00 26.65 ? 1120 ASP A N   1 
ATOM   1825 C  CA  . ASP A 1 233 ? 23.064  3.989   95.382  1.00 25.96 ? 1120 ASP A CA  1 
ATOM   1826 C  C   . ASP A 1 233 ? 24.044  5.150   95.266  1.00 24.37 ? 1120 ASP A C   1 
ATOM   1827 O  O   . ASP A 1 233 ? 25.260  4.966   95.148  1.00 25.28 ? 1120 ASP A O   1 
ATOM   1828 C  CB  . ASP A 1 233 ? 22.339  3.831   94.046  1.00 24.85 ? 1120 ASP A CB  1 
ATOM   1829 C  CG  . ASP A 1 233 ? 23.268  3.355   92.945  1.00 26.33 ? 1120 ASP A CG  1 
ATOM   1830 O  OD1 . ASP A 1 233 ? 24.016  2.410   93.204  1.00 28.37 ? 1120 ASP A OD1 1 
ATOM   1831 O  OD2 . ASP A 1 233 ? 23.244  3.913   91.839  1.00 29.68 ? 1120 ASP A OD2 1 
ATOM   1832 N  N   . THR A 1 234 ? 23.503  6.362   95.287  1.00 20.48 ? 1121 THR A N   1 
ATOM   1833 C  CA  . THR A 1 234 ? 24.324  7.562   95.184  1.00 23.07 ? 1121 THR A CA  1 
ATOM   1834 C  C   . THR A 1 234 ? 25.250  7.788   96.371  1.00 23.87 ? 1121 THR A C   1 
ATOM   1835 O  O   . THR A 1 234 ? 26.413  8.249   96.215  1.00 26.79 ? 1121 THR A O   1 
ATOM   1836 C  CB  . THR A 1 234 ? 23.387  8.770   95.066  1.00 20.40 ? 1121 THR A CB  1 
ATOM   1837 O  OG1 . THR A 1 234 ? 22.619  8.631   93.852  1.00 26.74 ? 1121 THR A OG1 1 
ATOM   1838 C  CG2 . THR A 1 234 ? 24.153  10.117  95.091  1.00 32.67 ? 1121 THR A CG2 1 
ATOM   1839 N  N   . MET A 1 235 ? 24.737  7.498   97.579  1.00 24.34 ? 1122 MET A N   1 
ATOM   1840 C  CA  . MET A 1 235 ? 25.481  7.761   98.803  1.00 19.78 ? 1122 MET A CA  1 
ATOM   1841 C  C   . MET A 1 235 ? 26.599  6.741   98.991  1.00 24.22 ? 1122 MET A C   1 
ATOM   1842 O  O   . MET A 1 235 ? 27.656  7.063   99.485  1.00 26.04 ? 1122 MET A O   1 
ATOM   1843 C  CB  . MET A 1 235 ? 24.551  7.820   100.021 1.00 25.00 ? 1122 MET A CB  1 
ATOM   1844 C  CG  . MET A 1 235 ? 23.724  9.093   100.060 1.00 22.48 ? 1122 MET A CG  1 
ATOM   1845 S  SD  . MET A 1 235 ? 24.696  10.598  100.264 1.00 25.50 ? 1122 MET A SD  1 
ATOM   1846 C  CE  . MET A 1 235 ? 24.896  11.188  98.569  1.00 30.15 ? 1122 MET A CE  1 
ATOM   1847 N  N   . LEU A 1 236 ? 26.388  5.518   98.535  1.00 21.78 ? 1123 LEU A N   1 
ATOM   1848 C  CA  . LEU A 1 236 ? 27.466  4.579   98.544  1.00 27.16 ? 1123 LEU A CA  1 
ATOM   1849 C  C   . LEU A 1 236 ? 28.607  5.051   97.633  1.00 26.22 ? 1123 LEU A C   1 
ATOM   1850 O  O   . LEU A 1 236 ? 29.778  4.906   97.987  1.00 27.62 ? 1123 LEU A O   1 
ATOM   1851 C  CB  . LEU A 1 236 ? 26.987  3.196   98.151  1.00 27.49 ? 1123 LEU A CB  1 
ATOM   1852 C  CG  . LEU A 1 236 ? 25.926  2.517   99.018  1.00 38.28 ? 1123 LEU A CG  1 
ATOM   1853 C  CD1 . LEU A 1 236 ? 25.728  1.064   98.510  1.00 26.88 ? 1123 LEU A CD1 1 
ATOM   1854 C  CD2 . LEU A 1 236 ? 26.226  2.570   100.486 1.00 37.64 ? 1123 LEU A CD2 1 
ATOM   1855 N  N   . ASP A 1 237 ? 28.271  5.624   96.485  1.00 27.85 ? 1124 ASP A N   1 
ATOM   1856 C  CA  . ASP A 1 237 ? 29.317  6.227   95.613  1.00 25.62 ? 1124 ASP A CA  1 
ATOM   1857 C  C   . ASP A 1 237 ? 30.055  7.369   96.325  1.00 30.97 ? 1124 ASP A C   1 
ATOM   1858 O  O   . ASP A 1 237 ? 31.280  7.386   96.383  1.00 30.95 ? 1124 ASP A O   1 
ATOM   1859 C  CB  . ASP A 1 237 ? 28.701  6.726   94.299  1.00 26.81 ? 1124 ASP A CB  1 
ATOM   1860 C  CG  . ASP A 1 237 ? 28.314  5.584   93.357  1.00 39.63 ? 1124 ASP A CG  1 
ATOM   1861 O  OD1 . ASP A 1 237 ? 28.749  4.433   93.618  1.00 29.71 ? 1124 ASP A OD1 1 
ATOM   1862 O  OD2 . ASP A 1 237 ? 27.585  5.840   92.361  1.00 34.32 ? 1124 ASP A OD2 1 
ATOM   1863 N  N   . MET A 1 238 ? 29.305  8.305   96.894  1.00 30.83 ? 1125 MET A N   1 
ATOM   1864 C  CA  . MET A 1 238 ? 29.901  9.383   97.683  1.00 26.30 ? 1125 MET A CA  1 
ATOM   1865 C  C   . MET A 1 238 ? 30.774  8.880   98.819  1.00 27.14 ? 1125 MET A C   1 
ATOM   1866 O  O   . MET A 1 238 ? 31.887  9.373   98.993  1.00 27.85 ? 1125 MET A O   1 
ATOM   1867 C  CB  . MET A 1 238 ? 28.833  10.303  98.252  1.00 29.78 ? 1125 MET A CB  1 
ATOM   1868 C  CG  . MET A 1 238 ? 29.420  11.557  98.865  1.00 27.33 ? 1125 MET A CG  1 
ATOM   1869 S  SD  . MET A 1 238 ? 28.110  12.581  99.521  1.00 28.96 ? 1125 MET A SD  1 
ATOM   1870 C  CE  . MET A 1 238 ? 27.421  13.271  98.021  1.00 38.38 ? 1125 MET A CE  1 
ATOM   1871 N  N   . ALA A 1 239 ? 30.268  7.920   99.609  1.00 27.35 ? 1126 ALA A N   1 
ATOM   1872 C  CA  . ALA A 1 239 ? 31.057  7.342   100.707 1.00 25.44 ? 1126 ALA A CA  1 
ATOM   1873 C  C   . ALA A 1 239 ? 32.364  6.767   100.179 1.00 30.79 ? 1126 ALA A C   1 
ATOM   1874 O  O   . ALA A 1 239 ? 33.425  7.034   100.739 1.00 28.28 ? 1126 ALA A O   1 
ATOM   1875 C  CB  . ALA A 1 239 ? 30.303  6.276   101.439 1.00 22.70 ? 1126 ALA A CB  1 
ATOM   1876 N  N   . GLU A 1 240 ? 32.265  5.965   99.112  1.00 34.89 ? 1127 GLU A N   1 
ATOM   1877 C  CA  . GLU A 1 240 ? 33.435  5.257   98.564  1.00 30.44 ? 1127 GLU A CA  1 
ATOM   1878 C  C   . GLU A 1 240 ? 34.533  6.235   98.147  1.00 33.42 ? 1127 GLU A C   1 
ATOM   1879 O  O   . GLU A 1 240 ? 35.740  5.975   98.369  1.00 31.54 ? 1127 GLU A O   1 
ATOM   1880 C  CB  . GLU A 1 240 ? 33.045  4.361   97.385  1.00 35.84 ? 1127 GLU A CB  1 
ATOM   1881 C  CG  . GLU A 1 240 ? 34.170  3.411   96.947  1.00 35.56 ? 1127 GLU A CG  1 
ATOM   1882 N  N   . ASN A 1 241 ? 34.098  7.369   97.598  1.00 28.07 ? 1128 ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 241 ? 34.969  8.397   97.044  1.00 26.76 ? 1128 ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 241 ? 35.451  9.506   97.999  1.00 36.28 ? 1128 ASN A C   1 
ATOM   1885 O  O   . ASN A 1 241 ? 36.592  9.965   97.886  1.00 34.24 ? 1128 ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 241 ? 34.246  9.083   95.885  1.00 22.41 ? 1128 ASN A CB  1 
ATOM   1887 N  N   . GLU A 1 242 ? 34.583  9.980   98.888  1.00 29.30 ? 1129 GLU A N   1 
ATOM   1888 C  CA  . GLU A 1 242 ? 34.927  11.113  99.740  1.00 29.97 ? 1129 GLU A CA  1 
ATOM   1889 C  C   . GLU A 1 242 ? 35.122  10.744  101.195 1.00 28.75 ? 1129 GLU A C   1 
ATOM   1890 O  O   . GLU A 1 242 ? 35.580  11.573  101.960 1.00 27.87 ? 1129 GLU A O   1 
ATOM   1891 C  CB  . GLU A 1 242 ? 33.854  12.197  99.672  1.00 32.33 ? 1129 GLU A CB  1 
ATOM   1892 C  CG  . GLU A 1 242 ? 33.489  12.642  98.285  1.00 32.57 ? 1129 GLU A CG  1 
ATOM   1893 C  CD  . GLU A 1 242 ? 32.590  13.873  98.282  1.00 42.18 ? 1129 GLU A CD  1 
ATOM   1894 O  OE1 . GLU A 1 242 ? 32.713  14.726  99.198  1.00 40.96 ? 1129 GLU A OE1 1 
ATOM   1895 O  OE2 . GLU A 1 242 ? 31.764  13.994  97.354  1.00 32.04 ? 1129 GLU A OE2 1 
ATOM   1896 N  N   . GLY A 1 243 ? 34.720  9.541   101.608 1.00 27.14 ? 1130 GLY A N   1 
ATOM   1897 C  CA  . GLY A 1 243 ? 34.773  9.185   103.032 1.00 29.13 ? 1130 GLY A CA  1 
ATOM   1898 C  C   . GLY A 1 243 ? 33.785  9.991   103.870 1.00 28.70 ? 1130 GLY A C   1 
ATOM   1899 O  O   . GLY A 1 243 ? 33.881  10.036  105.117 1.00 26.27 ? 1130 GLY A O   1 
ATOM   1900 N  N   . VAL A 1 244 ? 32.822  10.614  103.186 1.00 29.26 ? 1131 VAL A N   1 
ATOM   1901 C  CA  . VAL A 1 244 ? 31.707  11.316  103.824 1.00 28.35 ? 1131 VAL A CA  1 
ATOM   1902 C  C   . VAL A 1 244 ? 30.410  10.982  103.080 1.00 32.68 ? 1131 VAL A C   1 
ATOM   1903 O  O   . VAL A 1 244 ? 30.446  10.542  101.946 1.00 31.35 ? 1131 VAL A O   1 
ATOM   1904 C  CB  . VAL A 1 244 ? 31.913  12.860  103.846 1.00 28.88 ? 1131 VAL A CB  1 
ATOM   1905 C  CG1 . VAL A 1 244 ? 33.278  13.224  104.412 1.00 27.30 ? 1131 VAL A CG1 1 
ATOM   1906 C  CG2 . VAL A 1 244 ? 31.768  13.459  102.457 1.00 37.86 ? 1131 VAL A CG2 1 
ATOM   1907 N  N   . VAL A 1 245 ? 29.278  11.169  103.750 1.00 27.25 ? 1132 VAL A N   1 
ATOM   1908 C  CA  . VAL A 1 245 ? 27.961  11.148  103.123 1.00 27.00 ? 1132 VAL A CA  1 
ATOM   1909 C  C   . VAL A 1 245 ? 27.175  12.347  103.631 1.00 30.64 ? 1132 VAL A C   1 
ATOM   1910 O  O   . VAL A 1 245 ? 27.367  12.784  104.765 1.00 27.98 ? 1132 VAL A O   1 
ATOM   1911 C  CB  . VAL A 1 245 ? 27.172  9.868   103.445 1.00 30.41 ? 1132 VAL A CB  1 
ATOM   1912 C  CG1 . VAL A 1 245 ? 27.864  8.647   102.864 1.00 29.99 ? 1132 VAL A CG1 1 
ATOM   1913 C  CG2 . VAL A 1 245 ? 26.977  9.727   104.952 1.00 29.09 ? 1132 VAL A CG2 1 
ATOM   1914 N  N   . ASP A 1 246 ? 26.325  12.896  102.775 1.00 29.42 ? 1133 ASP A N   1 
ATOM   1915 C  CA  . ASP A 1 246 ? 25.398  13.960  103.153 1.00 29.33 ? 1133 ASP A CA  1 
ATOM   1916 C  C   . ASP A 1 246 ? 24.028  13.560  102.645 1.00 23.99 ? 1133 ASP A C   1 
ATOM   1917 O  O   . ASP A 1 246 ? 23.583  13.967  101.557 1.00 24.15 ? 1133 ASP A O   1 
ATOM   1918 C  CB  . ASP A 1 246 ? 25.827  15.301  102.574 1.00 29.91 ? 1133 ASP A CB  1 
ATOM   1919 C  CG  . ASP A 1 246 ? 24.891  16.442  102.974 1.00 31.04 ? 1133 ASP A CG  1 
ATOM   1920 O  OD1 . ASP A 1 246 ? 23.837  16.184  103.587 1.00 34.69 ? 1133 ASP A OD1 1 
ATOM   1921 O  OD2 . ASP A 1 246 ? 25.209  17.607  102.650 1.00 45.22 ? 1133 ASP A OD2 1 
ATOM   1922 N  N   . ILE A 1 247 ? 23.361  12.749  103.447 1.00 22.64 ? 1134 ILE A N   1 
ATOM   1923 C  CA  . ILE A 1 247 ? 22.125  12.103  102.999 1.00 21.64 ? 1134 ILE A CA  1 
ATOM   1924 C  C   . ILE A 1 247 ? 20.991  13.127  102.950 1.00 21.49 ? 1134 ILE A C   1 
ATOM   1925 O  O   . ILE A 1 247 ? 20.133  13.074  102.077 1.00 24.10 ? 1134 ILE A O   1 
ATOM   1926 C  CB  . ILE A 1 247 ? 21.754  10.903  103.912 1.00 24.90 ? 1134 ILE A CB  1 
ATOM   1927 C  CG1 . ILE A 1 247 ? 22.865  9.825   103.895 1.00 22.98 ? 1134 ILE A CG1 1 
ATOM   1928 C  CG2 . ILE A 1 247 ? 20.434  10.278  103.470 1.00 24.56 ? 1134 ILE A CG2 1 
ATOM   1929 C  CD1 . ILE A 1 247 ? 22.743  8.738   104.998 1.00 27.35 ? 1134 ILE A CD1 1 
ATOM   1930 N  N   . PHE A 1 248 ? 20.981  14.077  103.880 1.00 21.05 ? 1135 PHE A N   1 
ATOM   1931 C  CA  . PHE A 1 248 ? 19.944  15.113  103.850 1.00 24.50 ? 1135 PHE A CA  1 
ATOM   1932 C  C   . PHE A 1 248 ? 19.981  15.952  102.559 1.00 27.66 ? 1135 PHE A C   1 
ATOM   1933 O  O   . PHE A 1 248 ? 18.940  16.188  101.944 1.00 21.42 ? 1135 PHE A O   1 
ATOM   1934 C  CB  . PHE A 1 248 ? 20.036  16.048  105.062 1.00 24.51 ? 1135 PHE A CB  1 
ATOM   1935 C  CG  . PHE A 1 248 ? 19.020  17.157  105.041 1.00 25.17 ? 1135 PHE A CG  1 
ATOM   1936 C  CD1 . PHE A 1 248 ? 17.726  16.943  105.502 1.00 22.73 ? 1135 PHE A CD1 1 
ATOM   1937 C  CD2 . PHE A 1 248 ? 19.352  18.422  104.552 1.00 42.91 ? 1135 PHE A CD2 1 
ATOM   1938 C  CE1 . PHE A 1 248 ? 16.776  17.989  105.492 1.00 21.72 ? 1135 PHE A CE1 1 
ATOM   1939 C  CE2 . PHE A 1 248 ? 18.415  19.461  104.531 1.00 32.74 ? 1135 PHE A CE2 1 
ATOM   1940 C  CZ  . PHE A 1 248 ? 17.129  19.240  104.995 1.00 43.28 ? 1135 PHE A CZ  1 
ATOM   1941 N  N   . ASN A 1 249 ? 21.159  16.439  102.167 1.00 20.52 ? 1136 ASN A N   1 
ATOM   1942 C  CA  . ASN A 1 249 ? 21.219  17.211  100.918 1.00 27.36 ? 1136 ASN A CA  1 
ATOM   1943 C  C   . ASN A 1 249 ? 21.049  16.339  99.696  1.00 29.39 ? 1136 ASN A C   1 
ATOM   1944 O  O   . ASN A 1 249 ? 20.545  16.798  98.677  1.00 22.32 ? 1136 ASN A O   1 
ATOM   1945 C  CB  . ASN A 1 249 ? 22.457  18.070  100.858 1.00 31.81 ? 1136 ASN A CB  1 
ATOM   1946 C  CG  . ASN A 1 249 ? 22.374  19.229  101.849 1.00 40.93 ? 1136 ASN A CG  1 
ATOM   1947 O  OD1 . ASN A 1 249 ? 23.118  19.280  102.829 1.00 33.75 ? 1136 ASN A OD1 1 
ATOM   1948 N  ND2 . ASN A 1 249 ? 21.400  20.123  101.632 1.00 25.25 ? 1136 ASN A ND2 1 
ATOM   1949 N  N   . CYS A 1 250 ? 21.388  15.061  99.821  1.00 23.53 ? 1137 CYS A N   1 
ATOM   1950 C  CA  . CYS A 1 250 ? 21.131  14.135  98.727  1.00 21.89 ? 1137 CYS A CA  1 
ATOM   1951 C  C   . CYS A 1 250 ? 19.637  14.079  98.447  1.00 22.71 ? 1137 CYS A C   1 
ATOM   1952 O  O   . CYS A 1 250 ? 19.217  14.255  97.311  1.00 23.59 ? 1137 CYS A O   1 
ATOM   1953 C  CB  . CYS A 1 250 ? 21.623  12.737  99.050  1.00 22.95 ? 1137 CYS A CB  1 
ATOM   1954 S  SG  . CYS A 1 250 ? 21.197  11.547  97.755  1.00 27.23 ? 1137 CYS A SG  1 
ATOM   1955 N  N   . VAL A 1 251 ? 18.845  13.853  99.488  1.00 25.63 ? 1138 VAL A N   1 
ATOM   1956 C  CA  . VAL A 1 251 ? 17.385  13.699  99.350  1.00 26.42 ? 1138 VAL A CA  1 
ATOM   1957 C  C   . VAL A 1 251 ? 16.691  15.026  99.027  1.00 25.14 ? 1138 VAL A C   1 
ATOM   1958 O  O   . VAL A 1 251 ? 15.716  15.067  98.264  1.00 29.59 ? 1138 VAL A O   1 
ATOM   1959 C  CB  . VAL A 1 251 ? 16.774  13.091  100.630 1.00 26.37 ? 1138 VAL A CB  1 
ATOM   1960 C  CG1 . VAL A 1 251 ? 15.222  13.143  100.592 1.00 27.54 ? 1138 VAL A CG1 1 
ATOM   1961 C  CG2 . VAL A 1 251 ? 17.280  11.729  100.806 1.00 18.74 ? 1138 VAL A CG2 1 
ATOM   1962 N  N   . ARG A 1 252 ? 17.188  16.107  99.621  1.00 25.75 ? 1139 ARG A N   1 
ATOM   1963 C  CA  . ARG A 1 252 ? 16.839  17.446  99.146  1.00 28.32 ? 1139 ARG A CA  1 
ATOM   1964 C  C   . ARG A 1 252 ? 17.073  17.594  97.629  1.00 27.10 ? 1139 ARG A C   1 
ATOM   1965 O  O   . ARG A 1 252 ? 16.175  18.017  96.896  1.00 21.93 ? 1139 ARG A O   1 
ATOM   1966 C  CB  . ARG A 1 252 ? 17.643  18.504  99.910  1.00 26.45 ? 1139 ARG A CB  1 
ATOM   1967 N  N   . GLU A 1 253 ? 18.276  17.263  97.151  1.00 30.75 ? 1140 GLU A N   1 
ATOM   1968 C  CA  . GLU A 1 253 ? 18.563  17.379  95.701  1.00 28.53 ? 1140 GLU A CA  1 
ATOM   1969 C  C   . GLU A 1 253 ? 17.663  16.439  94.893  1.00 25.41 ? 1140 GLU A C   1 
ATOM   1970 O  O   . GLU A 1 253 ? 17.222  16.805  93.792  1.00 30.30 ? 1140 GLU A O   1 
ATOM   1971 C  CB  . GLU A 1 253 ? 20.033  17.091  95.386  1.00 28.57 ? 1140 GLU A CB  1 
ATOM   1972 C  CG  . GLU A 1 253 ? 21.004  18.235  95.734  1.00 37.55 ? 1140 GLU A CG  1 
ATOM   1973 C  CD  . GLU A 1 253 ? 22.460  17.777  95.715  1.00 47.46 ? 1140 GLU A CD  1 
ATOM   1974 O  OE1 . GLU A 1 253 ? 22.721  16.635  95.292  1.00 46.31 ? 1140 GLU A OE1 1 
ATOM   1975 O  OE2 . GLU A 1 253 ? 23.340  18.549  96.140  1.00 64.28 ? 1140 GLU A OE2 1 
ATOM   1976 N  N   . LEU A 1 254 ? 17.412  15.232  95.416  1.00 26.90 ? 1141 LEU A N   1 
ATOM   1977 C  CA  . LEU A 1 254 ? 16.474  14.305  94.764  1.00 27.02 ? 1141 LEU A CA  1 
ATOM   1978 C  C   . LEU A 1 254 ? 15.100  14.942  94.555  1.00 34.72 ? 1141 LEU A C   1 
ATOM   1979 O  O   . LEU A 1 254 ? 14.540  14.920  93.434  1.00 33.17 ? 1141 LEU A O   1 
ATOM   1980 C  CB  . LEU A 1 254 ? 16.320  12.979  95.524  1.00 28.13 ? 1141 LEU A CB  1 
ATOM   1981 C  CG  . LEU A 1 254 ? 17.577  12.101  95.491  1.00 27.27 ? 1141 LEU A CG  1 
ATOM   1982 C  CD1 . LEU A 1 254 ? 17.348  10.812  96.220  1.00 24.62 ? 1141 LEU A CD1 1 
ATOM   1983 C  CD2 . LEU A 1 254 ? 18.024  11.871  94.036  1.00 23.96 ? 1141 LEU A CD2 1 
ATOM   1984 N  N   . ARG A 1 255 ? 14.582  15.558  95.610  1.00 32.12 ? 1142 ARG A N   1 
ATOM   1985 C  CA  . ARG A 1 255 ? 13.270  16.200  95.517  1.00 34.10 ? 1142 ARG A CA  1 
ATOM   1986 C  C   . ARG A 1 255 ? 13.218  17.402  94.564  1.00 31.80 ? 1142 ARG A C   1 
ATOM   1987 O  O   . ARG A 1 255 ? 12.164  17.696  94.012  1.00 31.35 ? 1142 ARG A O   1 
ATOM   1988 C  CB  . ARG A 1 255 ? 12.765  16.563  96.899  1.00 41.08 ? 1142 ARG A CB  1 
ATOM   1989 C  CG  . ARG A 1 255 ? 12.381  15.323  97.638  1.00 41.14 ? 1142 ARG A CG  1 
ATOM   1990 C  CD  . ARG A 1 255 ? 11.859  15.619  98.972  1.00 44.72 ? 1142 ARG A CD  1 
ATOM   1991 N  NE  . ARG A 1 255 ? 11.320  14.426  99.622  1.00 29.55 ? 1142 ARG A NE  1 
ATOM   1992 C  CZ  . ARG A 1 255 ? 10.540  14.487  100.690 1.00 29.64 ? 1142 ARG A CZ  1 
ATOM   1993 N  NH1 . ARG A 1 255 ? 10.200  15.654  101.201 1.00 35.51 ? 1142 ARG A NH1 1 
ATOM   1994 N  NH2 . ARG A 1 255 ? 10.067  13.391  101.232 1.00 29.55 ? 1142 ARG A NH2 1 
ATOM   1995 N  N   . ALA A 1 256 ? 14.353  18.071  94.346  1.00 33.22 ? 1143 ALA A N   1 
ATOM   1996 C  CA  . ALA A 1 256 ? 14.399  19.196  93.409  1.00 32.98 ? 1143 ALA A CA  1 
ATOM   1997 C  C   . ALA A 1 256 ? 14.166  18.706  91.988  1.00 31.13 ? 1143 ALA A C   1 
ATOM   1998 O  O   . ALA A 1 256 ? 13.622  19.430  91.171  1.00 31.45 ? 1143 ALA A O   1 
ATOM   1999 C  CB  . ALA A 1 256 ? 15.735  19.941  93.503  1.00 35.64 ? 1143 ALA A CB  1 
ATOM   2000 N  N   . GLN A 1 257 ? 14.540  17.452  91.712  1.00 26.62 ? 1144 GLN A N   1 
ATOM   2001 C  CA  . GLN A 1 257 ? 14.467  16.890  90.367  1.00 30.18 ? 1144 GLN A CA  1 
ATOM   2002 C  C   . GLN A 1 257 ? 13.143  16.133  90.114  1.00 29.37 ? 1144 GLN A C   1 
ATOM   2003 O  O   . GLN A 1 257 ? 12.676  16.033  88.977  1.00 28.31 ? 1144 GLN A O   1 
ATOM   2004 C  CB  . GLN A 1 257 ? 15.671  15.971  90.153  1.00 23.85 ? 1144 GLN A CB  1 
ATOM   2005 C  CG  . GLN A 1 257 ? 16.998  16.719  90.310  1.00 32.60 ? 1144 GLN A CG  1 
ATOM   2006 C  CD  . GLN A 1 257 ? 18.187  15.785  90.353  1.00 37.79 ? 1144 GLN A CD  1 
ATOM   2007 O  OE1 . GLN A 1 257 ? 18.692  15.376  89.314  1.00 26.81 ? 1144 GLN A OE1 1 
ATOM   2008 N  NE2 . GLN A 1 257 ? 18.627  15.432  91.563  1.00 24.22 ? 1144 GLN A NE2 1 
ATOM   2009 N  N   . ARG A 1 258 ? 12.564  15.595  91.179  1.00 28.44 ? 1145 ARG A N   1 
ATOM   2010 C  CA  . ARG A 1 258 ? 11.288  14.913  91.098  1.00 19.18 ? 1145 ARG A CA  1 
ATOM   2011 C  C   . ARG A 1 258 ? 10.638  14.903  92.479  1.00 26.52 ? 1145 ARG A C   1 
ATOM   2012 O  O   . ARG A 1 258 ? 11.278  14.587  93.499  1.00 21.72 ? 1145 ARG A O   1 
ATOM   2013 C  CB  . ARG A 1 258 ? 11.467  13.473  90.586  1.00 24.16 ? 1145 ARG A CB  1 
ATOM   2014 C  CG  . ARG A 1 258 ? 10.149  12.743  90.346  1.00 23.78 ? 1145 ARG A CG  1 
ATOM   2015 C  CD  . ARG A 1 258 ? 10.349  11.412  89.599  1.00 27.03 ? 1145 ARG A CD  1 
ATOM   2016 N  NE  . ARG A 1 258 ? 9.115   10.607  89.584  1.00 25.30 ? 1145 ARG A NE  1 
ATOM   2017 C  CZ  . ARG A 1 258 ? 8.150   10.695  88.670  1.00 26.23 ? 1145 ARG A CZ  1 
ATOM   2018 N  NH1 . ARG A 1 258 ? 8.242   11.532  87.639  1.00 26.78 ? 1145 ARG A NH1 1 
ATOM   2019 N  NH2 . ARG A 1 258 ? 7.077   9.930   88.795  1.00 23.61 ? 1145 ARG A NH2 1 
ATOM   2020 N  N   . VAL A 1 259 ? 9.362   15.275  92.499  1.00 23.43 ? 1146 VAL A N   1 
ATOM   2021 C  CA  . VAL A 1 259 ? 8.631   15.547  93.730  1.00 24.48 ? 1146 VAL A CA  1 
ATOM   2022 C  C   . VAL A 1 259 ? 8.636   14.340  94.686  1.00 25.05 ? 1146 VAL A C   1 
ATOM   2023 O  O   . VAL A 1 259 ? 8.464   13.205  94.267  1.00 29.47 ? 1146 VAL A O   1 
ATOM   2024 C  CB  . VAL A 1 259 ? 7.165   15.986  93.395  1.00 29.78 ? 1146 VAL A CB  1 
ATOM   2025 C  CG1 . VAL A 1 259 ? 6.432   14.869  92.689  1.00 27.00 ? 1146 VAL A CG1 1 
ATOM   2026 C  CG2 . VAL A 1 259 ? 6.402   16.438  94.642  1.00 28.10 ? 1146 VAL A CG2 1 
ATOM   2027 N  N   . ASN A 1 260 ? 8.844   14.612  95.982  1.00 26.60 ? 1147 ASN A N   1 
ATOM   2028 C  CA  . ASN A 1 260 ? 8.665   13.616  97.063  1.00 29.80 ? 1147 ASN A CA  1 
ATOM   2029 C  C   . ASN A 1 260 ? 9.454   12.316  97.023  1.00 30.90 ? 1147 ASN A C   1 
ATOM   2030 O  O   . ASN A 1 260 ? 9.054   11.346  97.681  1.00 33.29 ? 1147 ASN A O   1 
ATOM   2031 C  CB  . ASN A 1 260 ? 7.184   13.248  97.216  1.00 32.21 ? 1147 ASN A CB  1 
ATOM   2032 C  CG  . ASN A 1 260 ? 6.355   14.390  97.763  1.00 42.56 ? 1147 ASN A CG  1 
ATOM   2033 O  OD1 . ASN A 1 260 ? 6.882   15.415  98.201  1.00 38.70 ? 1147 ASN A OD1 1 
ATOM   2034 N  ND2 . ASN A 1 260 ? 5.046   14.226  97.712  1.00 36.70 ? 1147 ASN A ND2 1 
ATOM   2035 N  N   . LEU A 1 261 ? 10.554  12.273  96.268  1.00 34.13 ? 1148 LEU A N   1 
ATOM   2036 C  CA  . LEU A 1 261 ? 11.405  11.093  96.278  1.00 29.22 ? 1148 LEU A CA  1 
ATOM   2037 C  C   . LEU A 1 261 ? 11.861  10.887  97.730  1.00 32.44 ? 1148 LEU A C   1 
ATOM   2038 O  O   . LEU A 1 261 ? 12.296  11.851  98.409  1.00 30.51 ? 1148 LEU A O   1 
ATOM   2039 C  CB  . LEU A 1 261 ? 12.606  11.235  95.341  1.00 24.06 ? 1148 LEU A CB  1 
ATOM   2040 C  CG  . LEU A 1 261 ? 12.397  11.094  93.827  1.00 27.15 ? 1148 LEU A CG  1 
ATOM   2041 C  CD1 . LEU A 1 261 ? 13.783  11.026  93.167  1.00 22.62 ? 1148 LEU A CD1 1 
ATOM   2042 C  CD2 . LEU A 1 261 ? 11.583  9.915   93.403  1.00 43.36 ? 1148 LEU A CD2 1 
ATOM   2043 N  N   . VAL A 1 262 ? 11.724  9.642   98.191  1.00 29.47 ? 1149 VAL A N   1 
ATOM   2044 C  CA  . VAL A 1 262 ? 11.814  9.252   99.605  1.00 23.86 ? 1149 VAL A CA  1 
ATOM   2045 C  C   . VAL A 1 262 ? 10.634  9.834   100.339 1.00 27.68 ? 1149 VAL A C   1 
ATOM   2046 O  O   . VAL A 1 262 ? 10.699  10.938  100.868 1.00 33.39 ? 1149 VAL A O   1 
ATOM   2047 C  CB  . VAL A 1 262 ? 13.094  9.671   100.301 1.00 23.75 ? 1149 VAL A CB  1 
ATOM   2048 C  CG1 . VAL A 1 262 ? 13.065  9.137   101.768 1.00 25.29 ? 1149 VAL A CG1 1 
ATOM   2049 C  CG2 . VAL A 1 262 ? 14.302  9.170   99.518  1.00 26.25 ? 1149 VAL A CG2 1 
ATOM   2050 N  N   . GLN A 1 263 ? 9.559   9.052   100.385 1.00 28.96 ? 1150 GLN A N   1 
ATOM   2051 C  CA  . GLN A 1 263 ? 8.237   9.565   100.635 1.00 29.94 ? 1150 GLN A CA  1 
ATOM   2052 C  C   . GLN A 1 263 ? 7.758   9.476   102.093 1.00 32.02 ? 1150 GLN A C   1 
ATOM   2053 O  O   . GLN A 1 263 ? 6.739   10.075  102.410 1.00 35.35 ? 1150 GLN A O   1 
ATOM   2054 C  CB  . GLN A 1 263 ? 7.240   8.824   99.730  1.00 34.74 ? 1150 GLN A CB  1 
ATOM   2055 C  CG  . GLN A 1 263 ? 5.969   9.591   99.432  1.00 42.23 ? 1150 GLN A CG  1 
ATOM   2056 N  N   . THR A 1 264 ? 8.451   8.727   102.958 1.00 28.34 ? 1151 THR A N   1 
ATOM   2057 C  CA  . THR A 1 264 ? 8.124   8.671   104.382 1.00 26.71 ? 1151 THR A CA  1 
ATOM   2058 C  C   . THR A 1 264 ? 9.355   8.777   105.275 1.00 26.02 ? 1151 THR A C   1 
ATOM   2059 O  O   . THR A 1 264 ? 10.474  8.489   104.848 1.00 22.15 ? 1151 THR A O   1 
ATOM   2060 C  CB  . THR A 1 264 ? 7.416   7.369   104.802 1.00 31.81 ? 1151 THR A CB  1 
ATOM   2061 O  OG1 . THR A 1 264 ? 8.377   6.298   104.842 1.00 25.49 ? 1151 THR A OG1 1 
ATOM   2062 C  CG2 . THR A 1 264 ? 6.264   7.050   103.873 1.00 32.64 ? 1151 THR A CG2 1 
ATOM   2063 N  N   . GLU A 1 265 ? 9.125   9.171   106.528 1.00 27.14 ? 1152 GLU A N   1 
ATOM   2064 C  CA  . GLU A 1 265 ? 10.190  9.215   107.526 1.00 25.99 ? 1152 GLU A CA  1 
ATOM   2065 C  C   . GLU A 1 265 ? 10.843  7.850   107.713 1.00 28.93 ? 1152 GLU A C   1 
ATOM   2066 O  O   . GLU A 1 265 ? 12.068  7.765   107.812 1.00 22.35 ? 1152 GLU A O   1 
ATOM   2067 C  CB  . GLU A 1 265 ? 9.669   9.700   108.888 1.00 25.53 ? 1152 GLU A CB  1 
ATOM   2068 C  CG  . GLU A 1 265 ? 10.763  9.819   109.957 1.00 29.05 ? 1152 GLU A CG  1 
ATOM   2069 C  CD  . GLU A 1 265 ? 10.232  10.113  111.347 1.00 33.05 ? 1152 GLU A CD  1 
ATOM   2070 O  OE1 . GLU A 1 265 ? 9.180   10.772  111.452 1.00 26.93 ? 1152 GLU A OE1 1 
ATOM   2071 O  OE2 . GLU A 1 265 ? 10.871  9.704   112.334 1.00 35.34 ? 1152 GLU A OE2 1 
ATOM   2072 N  N   . GLU A 1 266 ? 10.037  6.792   107.796 1.00 21.78 ? 1153 GLU A N   1 
ATOM   2073 C  CA  . GLU A 1 266 ? 10.598  5.454   107.989 1.00 25.98 ? 1153 GLU A CA  1 
ATOM   2074 C  C   . GLU A 1 266 ? 11.568  5.140   106.855 1.00 21.30 ? 1153 GLU A C   1 
ATOM   2075 O  O   . GLU A 1 266 ? 12.662  4.678   107.098 1.00 25.73 ? 1153 GLU A O   1 
ATOM   2076 C  CB  . GLU A 1 266 ? 9.492   4.386   108.044 1.00 21.54 ? 1153 GLU A CB  1 
ATOM   2077 C  CG  . GLU A 1 266 ? 10.005  2.976   108.355 1.00 46.92 ? 1153 GLU A CG  1 
ATOM   2078 C  CD  . GLU A 1 266 ? 8.888   1.944   108.497 1.00 54.96 ? 1153 GLU A CD  1 
ATOM   2079 O  OE1 . GLU A 1 266 ? 7.933   1.968   107.685 1.00 38.00 ? 1153 GLU A OE1 1 
ATOM   2080 O  OE2 . GLU A 1 266 ? 8.979   1.102   109.417 1.00 49.29 ? 1153 GLU A OE2 1 
ATOM   2081 N  N   . GLN A 1 267 ? 11.161  5.411   105.612 1.00 26.44 ? 1154 GLN A N   1 
ATOM   2082 C  CA  . GLN A 1 267 ? 12.054  5.273   104.438 1.00 26.68 ? 1154 GLN A CA  1 
ATOM   2083 C  C   . GLN A 1 267 ? 13.342  6.083   104.570 1.00 26.02 ? 1154 GLN A C   1 
ATOM   2084 O  O   . GLN A 1 267 ? 14.425  5.573   104.267 1.00 25.74 ? 1154 GLN A O   1 
ATOM   2085 C  CB  . GLN A 1 267 ? 11.311  5.678   103.171 1.00 24.75 ? 1154 GLN A CB  1 
ATOM   2086 C  CG  . GLN A 1 267 ? 10.324  4.603   102.722 1.00 24.80 ? 1154 GLN A CG  1 
ATOM   2087 C  CD  . GLN A 1 267 ? 9.491   4.963   101.487 1.00 30.27 ? 1154 GLN A CD  1 
ATOM   2088 O  OE1 . GLN A 1 267 ? 9.642   6.031   100.885 1.00 31.77 ? 1154 GLN A OE1 1 
ATOM   2089 N  NE2 . GLN A 1 267 ? 8.617   4.043   101.096 1.00 29.84 ? 1154 GLN A NE2 1 
ATOM   2090 N  N   . TYR A 1 268 ? 13.226  7.341   105.012 1.00 22.86 ? 1155 TYR A N   1 
ATOM   2091 C  CA  . TYR A 1 268 ? 14.393  8.213   105.210 1.00 21.46 ? 1155 TYR A CA  1 
ATOM   2092 C  C   . TYR A 1 268 ? 15.356  7.548   106.210 1.00 21.61 ? 1155 TYR A C   1 
ATOM   2093 O  O   . TYR A 1 268 ? 16.556  7.449   105.961 1.00 22.89 ? 1155 TYR A O   1 
ATOM   2094 C  CB  . TYR A 1 268 ? 13.954  9.608   105.714 1.00 22.33 ? 1155 TYR A CB  1 
ATOM   2095 C  CG  . TYR A 1 268 ? 15.068  10.617  105.826 1.00 16.81 ? 1155 TYR A CG  1 
ATOM   2096 C  CD1 . TYR A 1 268 ? 15.728  11.069  104.685 1.00 19.77 ? 1155 TYR A CD1 1 
ATOM   2097 C  CD2 . TYR A 1 268 ? 15.444  11.164  107.062 1.00 19.13 ? 1155 TYR A CD2 1 
ATOM   2098 C  CE1 . TYR A 1 268 ? 16.751  11.999  104.758 1.00 21.54 ? 1155 TYR A CE1 1 
ATOM   2099 C  CE2 . TYR A 1 268 ? 16.467  12.154  107.145 1.00 23.36 ? 1155 TYR A CE2 1 
ATOM   2100 C  CZ  . TYR A 1 268 ? 17.110  12.560  105.981 1.00 16.72 ? 1155 TYR A CZ  1 
ATOM   2101 O  OH  . TYR A 1 268 ? 18.144  13.473  106.000 1.00 23.83 ? 1155 TYR A OH  1 
ATOM   2102 N  N   . VAL A 1 269 ? 14.813  7.042   107.309 1.00 20.33 ? 1156 VAL A N   1 
ATOM   2103 C  CA  . VAL A 1 269 ? 15.618  6.333   108.294 1.00 18.22 ? 1156 VAL A CA  1 
ATOM   2104 C  C   . VAL A 1 269 ? 16.247  5.059   107.689 1.00 24.29 ? 1156 VAL A C   1 
ATOM   2105 O  O   . VAL A 1 269 ? 17.421  4.776   107.894 1.00 22.58 ? 1156 VAL A O   1 
ATOM   2106 C  CB  . VAL A 1 269 ? 14.779  6.020   109.554 1.00 20.98 ? 1156 VAL A CB  1 
ATOM   2107 C  CG1 . VAL A 1 269 ? 15.580  5.216   110.569 1.00 27.35 ? 1156 VAL A CG1 1 
ATOM   2108 C  CG2 . VAL A 1 269 ? 14.279  7.330   110.228 1.00 25.57 ? 1156 VAL A CG2 1 
ATOM   2109 N  N   . PHE A 1 270 ? 15.453  4.311   106.943 1.00 21.43 ? 1157 PHE A N   1 
ATOM   2110 C  CA  . PHE A 1 270 ? 15.906  3.106   106.275 1.00 24.33 ? 1157 PHE A CA  1 
ATOM   2111 C  C   . PHE A 1 270 ? 17.084  3.377   105.344 1.00 21.80 ? 1157 PHE A C   1 
ATOM   2112 O  O   . PHE A 1 270 ? 18.055  2.623   105.319 1.00 18.87 ? 1157 PHE A O   1 
ATOM   2113 C  CB  . PHE A 1 270 ? 14.789  2.489   105.484 1.00 24.57 ? 1157 PHE A CB  1 
ATOM   2114 C  CG  . PHE A 1 270 ? 15.231  1.288   104.698 1.00 22.79 ? 1157 PHE A CG  1 
ATOM   2115 C  CD1 . PHE A 1 270 ? 15.461  0.076   105.329 1.00 27.86 ? 1157 PHE A CD1 1 
ATOM   2116 C  CD2 . PHE A 1 270 ? 15.453  1.396   103.343 1.00 25.67 ? 1157 PHE A CD2 1 
ATOM   2117 C  CE1 . PHE A 1 270 ? 15.882  -1.019  104.617 1.00 25.99 ? 1157 PHE A CE1 1 
ATOM   2118 C  CE2 . PHE A 1 270 ? 15.891  0.325   102.614 1.00 23.44 ? 1157 PHE A CE2 1 
ATOM   2119 C  CZ  . PHE A 1 270 ? 16.085  -0.899  103.239 1.00 22.42 ? 1157 PHE A CZ  1 
ATOM   2120 N  N   . VAL A 1 271 ? 17.012  4.484   104.596 1.00 21.25 ? 1158 VAL A N   1 
ATOM   2121 C  CA  . VAL A 1 271 ? 18.127  4.887   103.749 1.00 19.24 ? 1158 VAL A CA  1 
ATOM   2122 C  C   . VAL A 1 271 ? 19.400  5.012   104.602 1.00 21.29 ? 1158 VAL A C   1 
ATOM   2123 O  O   . VAL A 1 271 ? 20.441  4.531   104.209 1.00 21.84 ? 1158 VAL A O   1 
ATOM   2124 C  CB  . VAL A 1 271 ? 17.802  6.233   102.986 1.00 25.22 ? 1158 VAL A CB  1 
ATOM   2125 C  CG1 . VAL A 1 271 ? 19.053  6.823   102.315 1.00 21.61 ? 1158 VAL A CG1 1 
ATOM   2126 C  CG2 . VAL A 1 271 ? 16.694  5.992   101.951 1.00 24.71 ? 1158 VAL A CG2 1 
ATOM   2127 N  N   . HIS A 1 272 ? 19.300  5.642   105.777 1.00 20.95 ? 1159 HIS A N   1 
ATOM   2128 C  CA  . HIS A 1 272 ? 20.440  5.760   106.700 1.00 23.66 ? 1159 HIS A CA  1 
ATOM   2129 C  C   . HIS A 1 272 ? 20.965  4.385   107.156 1.00 23.21 ? 1159 HIS A C   1 
ATOM   2130 O  O   . HIS A 1 272 ? 22.158  4.113   107.050 1.00 20.41 ? 1159 HIS A O   1 
ATOM   2131 C  CB  . HIS A 1 272 ? 20.063  6.627   107.911 1.00 18.78 ? 1159 HIS A CB  1 
ATOM   2132 C  CG  . HIS A 1 272 ? 20.011  8.084   107.609 1.00 25.42 ? 1159 HIS A CG  1 
ATOM   2133 N  ND1 . HIS A 1 272 ? 18.966  8.665   106.925 1.00 20.92 ? 1159 HIS A ND1 1 
ATOM   2134 C  CD2 . HIS A 1 272 ? 20.891  9.079   107.883 1.00 24.90 ? 1159 HIS A CD2 1 
ATOM   2135 C  CE1 . HIS A 1 272 ? 19.201  9.965   106.808 1.00 23.79 ? 1159 HIS A CE1 1 
ATOM   2136 N  NE2 . HIS A 1 272 ? 20.358  10.242  107.385 1.00 23.02 ? 1159 HIS A NE2 1 
ATOM   2137 N  N   . ASP A 1 273 ? 20.065  3.522   107.630 1.00 24.26 ? 1160 ASP A N   1 
ATOM   2138 C  CA  . ASP A 1 273 ? 20.441  2.174   108.097 1.00 26.44 ? 1160 ASP A CA  1 
ATOM   2139 C  C   . ASP A 1 273 ? 21.125  1.368   107.003 1.00 22.65 ? 1160 ASP A C   1 
ATOM   2140 O  O   . ASP A 1 273 ? 22.126  0.688   107.262 1.00 23.60 ? 1160 ASP A O   1 
ATOM   2141 C  CB  . ASP A 1 273 ? 19.234  1.406   108.553 1.00 19.33 ? 1160 ASP A CB  1 
ATOM   2142 C  CG  . ASP A 1 273 ? 18.650  1.935   109.832 1.00 36.56 ? 1160 ASP A CG  1 
ATOM   2143 O  OD1 . ASP A 1 273 ? 19.407  2.494   110.629 1.00 29.67 ? 1160 ASP A OD1 1 
ATOM   2144 O  OD2 . ASP A 1 273 ? 17.433  1.786   110.027 1.00 39.93 ? 1160 ASP A OD2 1 
ATOM   2145 N  N   . ALA A 1 274 ? 20.624  1.493   105.774 1.00 25.48 ? 1161 ALA A N   1 
ATOM   2146 C  CA  . ALA A 1 274 ? 21.184  0.738   104.647 1.00 22.06 ? 1161 ALA A CA  1 
ATOM   2147 C  C   . ALA A 1 274 ? 22.591  1.250   104.304 1.00 20.58 ? 1161 ALA A C   1 
ATOM   2148 O  O   . ALA A 1 274 ? 23.508  0.449   104.100 1.00 22.63 ? 1161 ALA A O   1 
ATOM   2149 C  CB  . ALA A 1 274 ? 20.256  0.812   103.423 1.00 21.93 ? 1161 ALA A CB  1 
ATOM   2150 N  N   . ILE A 1 275 ? 22.775  2.571   104.321 1.00 21.89 ? 1162 ILE A N   1 
ATOM   2151 C  CA  . ILE A 1 275 ? 24.088  3.147   104.023 1.00 19.14 ? 1162 ILE A CA  1 
ATOM   2152 C  C   . ILE A 1 275 ? 25.118  2.750   105.104 1.00 25.07 ? 1162 ILE A C   1 
ATOM   2153 O  O   . ILE A 1 275 ? 26.265  2.389   104.791 1.00 24.77 ? 1162 ILE A O   1 
ATOM   2154 C  CB  . ILE A 1 275 ? 24.021  4.706   103.825 1.00 22.51 ? 1162 ILE A CB  1 
ATOM   2155 C  CG1 . ILE A 1 275 ? 23.259  5.050   102.521 1.00 20.99 ? 1162 ILE A CG1 1 
ATOM   2156 C  CG2 . ILE A 1 275 ? 25.427  5.315   103.834 1.00 24.05 ? 1162 ILE A CG2 1 
ATOM   2157 C  CD1 . ILE A 1 275 ? 22.750  6.506   102.428 1.00 24.09 ? 1162 ILE A CD1 1 
ATOM   2158 N  N   . LEU A 1 276 ? 24.686  2.780   106.359 1.00 21.59 ? 1163 LEU A N   1 
ATOM   2159 C  CA  . LEU A 1 276 ? 25.555  2.387   107.476 1.00 24.81 ? 1163 LEU A CA  1 
ATOM   2160 C  C   . LEU A 1 276 ? 26.019  0.948   107.323 1.00 25.62 ? 1163 LEU A C   1 
ATOM   2161 O  O   . LEU A 1 276 ? 27.204  0.664   107.419 1.00 26.19 ? 1163 LEU A O   1 
ATOM   2162 C  CB  . LEU A 1 276 ? 24.845  2.538   108.812 1.00 24.72 ? 1163 LEU A CB  1 
ATOM   2163 C  CG  . LEU A 1 276 ? 25.713  2.180   110.022 1.00 22.70 ? 1163 LEU A CG  1 
ATOM   2164 C  CD1 . LEU A 1 276 ? 27.007  3.032   110.069 1.00 29.06 ? 1163 LEU A CD1 1 
ATOM   2165 C  CD2 . LEU A 1 276 ? 24.879  2.340   111.289 1.00 31.19 ? 1163 LEU A CD2 1 
ATOM   2166 N  N   . GLU A 1 277 ? 25.082  0.045   107.065 1.00 24.32 ? 1164 GLU A N   1 
ATOM   2167 C  CA  . GLU A 1 277 ? 25.447  -1.349  106.913 1.00 27.94 ? 1164 GLU A CA  1 
ATOM   2168 C  C   . GLU A 1 277 ? 26.482  -1.537  105.793 1.00 23.34 ? 1164 GLU A C   1 
ATOM   2169 O  O   . GLU A 1 277 ? 27.444  -2.267  105.947 1.00 28.36 ? 1164 GLU A O   1 
ATOM   2170 C  CB  . GLU A 1 277 ? 24.210  -2.186  106.613 1.00 24.56 ? 1164 GLU A CB  1 
ATOM   2171 C  CG  . GLU A 1 277 ? 24.562  -3.643  106.318 1.00 29.39 ? 1164 GLU A CG  1 
ATOM   2172 C  CD  . GLU A 1 277 ? 23.365  -4.590  106.362 1.00 34.97 ? 1164 GLU A CD  1 
ATOM   2173 O  OE1 . GLU A 1 277 ? 22.363  -4.289  107.044 1.00 40.17 ? 1164 GLU A OE1 1 
ATOM   2174 O  OE2 . GLU A 1 277 ? 23.437  -5.638  105.693 1.00 26.45 ? 1164 GLU A OE2 1 
ATOM   2175 N  N   . ALA A 1 278 ? 26.242  -0.915  104.654 1.00 23.29 ? 1165 ALA A N   1 
ATOM   2176 C  CA  . ALA A 1 278 ? 27.153  -0.997  103.529 1.00 27.84 ? 1165 ALA A CA  1 
ATOM   2177 C  C   . ALA A 1 278 ? 28.545  -0.488  103.913 1.00 30.77 ? 1165 ALA A C   1 
ATOM   2178 O  O   . ALA A 1 278 ? 29.556  -1.086  103.528 1.00 29.57 ? 1165 ALA A O   1 
ATOM   2179 C  CB  . ALA A 1 278 ? 26.618  -0.207  102.370 1.00 24.26 ? 1165 ALA A CB  1 
ATOM   2180 N  N   . CYS A 1 279 ? 28.583  0.613   104.667 1.00 29.63 ? 1166 CYS A N   1 
ATOM   2181 C  CA  . CYS A 1 279 ? 29.841  1.217   105.129 1.00 32.11 ? 1166 CYS A CA  1 
ATOM   2182 C  C   . CYS A 1 279 ? 30.574  0.360   106.153 1.00 36.61 ? 1166 CYS A C   1 
ATOM   2183 O  O   . CYS A 1 279 ? 31.808  0.326   106.159 1.00 36.09 ? 1166 CYS A O   1 
ATOM   2184 C  CB  . CYS A 1 279 ? 29.584  2.625   105.701 1.00 30.21 ? 1166 CYS A CB  1 
ATOM   2185 S  SG  . CYS A 1 279 ? 29.203  3.793   104.403 1.00 30.62 ? 1166 CYS A SG  1 
ATOM   2186 N  N   . LEU A 1 280 ? 29.833  -0.317  107.029 1.00 32.59 ? 1167 LEU A N   1 
ATOM   2187 C  CA  . LEU A 1 280 ? 30.463  -1.261  107.931 1.00 32.10 ? 1167 LEU A CA  1 
ATOM   2188 C  C   . LEU A 1 280 ? 31.101  -2.387  107.117 1.00 45.95 ? 1167 LEU A C   1 
ATOM   2189 O  O   . LEU A 1 280 ? 32.219  -2.800  107.408 1.00 46.88 ? 1167 LEU A O   1 
ATOM   2190 C  CB  . LEU A 1 280 ? 29.458  -1.816  108.928 1.00 31.57 ? 1167 LEU A CB  1 
ATOM   2191 C  CG  . LEU A 1 280 ? 28.831  -0.761  109.848 1.00 34.56 ? 1167 LEU A CG  1 
ATOM   2192 C  CD1 . LEU A 1 280 ? 27.773  -1.397  110.725 1.00 28.98 ? 1167 LEU A CD1 1 
ATOM   2193 C  CD2 . LEU A 1 280 ? 29.892  -0.059  110.691 1.00 36.49 ? 1167 LEU A CD2 1 
ATOM   2194 N  N   . CYS A 1 281 ? 30.383  -2.853  106.094 1.00 39.58 ? 1168 CYS A N   1 
ATOM   2195 C  CA  . CYS A 1 281 ? 30.825  -3.951  105.235 1.00 48.90 ? 1168 CYS A CA  1 
ATOM   2196 C  C   . CYS A 1 281 ? 31.695  -3.440  104.091 1.00 49.94 ? 1168 CYS A C   1 
ATOM   2197 O  O   . CYS A 1 281 ? 32.660  -2.709  104.292 1.00 61.70 ? 1168 CYS A O   1 
ATOM   2198 C  CB  . CYS A 1 281 ? 29.627  -4.678  104.623 1.00 43.32 ? 1168 CYS A CB  1 
ATOM   2199 S  SG  . CYS A 1 281 ? 28.314  -5.351  105.735 1.00 47.36 ? 1168 CYS A SG  1 
ATOM   2200 N  N   . SER B 1 1   ? 12.153  -23.514 29.405  1.00 54.49 ? 888  SER B N   1 
ATOM   2201 C  CA  . SER B 1 1   ? 12.256  -24.189 28.077  1.00 63.48 ? 888  SER B CA  1 
ATOM   2202 C  C   . SER B 1 1   ? 11.106  -23.700 27.211  1.00 58.77 ? 888  SER B C   1 
ATOM   2203 O  O   . SER B 1 1   ? 11.300  -23.306 26.060  1.00 66.59 ? 888  SER B O   1 
ATOM   2204 C  CB  . SER B 1 1   ? 12.222  -25.718 28.223  1.00 69.41 ? 888  SER B CB  1 
ATOM   2205 O  OG  . SER B 1 1   ? 10.956  -26.271 27.877  1.00 81.17 ? 888  SER B OG  1 
ATOM   2206 N  N   . MET B 1 2   ? 9.902   -23.730 27.780  1.00 52.56 ? 889  MET B N   1 
ATOM   2207 C  CA  . MET B 1 2   ? 8.782   -22.944 27.254  1.00 44.64 ? 889  MET B CA  1 
ATOM   2208 C  C   . MET B 1 2   ? 9.000   -21.461 27.579  1.00 28.74 ? 889  MET B C   1 
ATOM   2209 O  O   . MET B 1 2   ? 8.255   -20.612 27.112  1.00 29.53 ? 889  MET B O   1 
ATOM   2210 C  CB  . MET B 1 2   ? 7.460   -23.391 27.881  1.00 41.83 ? 889  MET B CB  1 
ATOM   2211 C  CG  . MET B 1 2   ? 7.031   -24.762 27.480  1.00 50.55 ? 889  MET B CG  1 
ATOM   2212 S  SD  . MET B 1 2   ? 5.521   -25.310 28.285  1.00 51.01 ? 889  MET B SD  1 
ATOM   2213 C  CE  . MET B 1 2   ? 4.303   -24.167 27.616  1.00 39.78 ? 889  MET B CE  1 
ATOM   2214 N  N   . ALA B 1 3   ? 9.998   -21.145 28.397  1.00 35.15 ? 890  ALA B N   1 
ATOM   2215 C  CA  . ALA B 1 3   ? 10.247  -19.761 28.716  1.00 29.10 ? 890  ALA B CA  1 
ATOM   2216 C  C   . ALA B 1 3   ? 10.657  -19.023 27.448  1.00 33.27 ? 890  ALA B C   1 
ATOM   2217 O  O   . ALA B 1 3   ? 11.249  -19.603 26.532  1.00 31.15 ? 890  ALA B O   1 
ATOM   2218 C  CB  . ALA B 1 3   ? 11.324  -19.612 29.797  1.00 39.39 ? 890  ALA B CB  1 
ATOM   2219 N  N   . ILE B 1 4   ? 10.326  -17.736 27.423  1.00 29.53 ? 891  ILE B N   1 
ATOM   2220 C  CA  . ILE B 1 4   ? 10.621  -16.839 26.321  1.00 26.23 ? 891  ILE B CA  1 
ATOM   2221 C  C   . ILE B 1 4   ? 11.697  -15.830 26.748  1.00 26.84 ? 891  ILE B C   1 
ATOM   2222 O  O   . ILE B 1 4   ? 11.513  -15.098 27.697  1.00 27.17 ? 891  ILE B O   1 
ATOM   2223 C  CB  . ILE B 1 4   ? 9.336   -16.040 25.940  1.00 30.77 ? 891  ILE B CB  1 
ATOM   2224 C  CG1 . ILE B 1 4   ? 8.160   -16.984 25.590  1.00 31.72 ? 891  ILE B CG1 1 
ATOM   2225 C  CG2 . ILE B 1 4   ? 9.620   -15.025 24.817  1.00 26.81 ? 891  ILE B CG2 1 
ATOM   2226 C  CD1 . ILE B 1 4   ? 8.426   -17.911 24.410  1.00 37.63 ? 891  ILE B CD1 1 
ATOM   2227 N  N   . ARG B 1 5   ? 12.782  -15.732 25.991  1.00 23.87 ? 892  ARG B N   1 
ATOM   2228 C  CA  . ARG B 1 5   ? 13.789  -14.712 26.259  1.00 27.33 ? 892  ARG B CA  1 
ATOM   2229 C  C   . ARG B 1 5   ? 13.144  -13.322 26.190  1.00 24.42 ? 892  ARG B C   1 
ATOM   2230 O  O   . ARG B 1 5   ? 12.319  -13.063 25.325  1.00 27.65 ? 892  ARG B O   1 
ATOM   2231 C  CB  . ARG B 1 5   ? 14.964  -14.815 25.273  1.00 25.54 ? 892  ARG B CB  1 
ATOM   2232 C  CG  . ARG B 1 5   ? 15.725  -16.106 25.374  1.00 33.64 ? 892  ARG B CG  1 
ATOM   2233 C  CD  . ARG B 1 5   ? 17.058  -16.074 24.604  1.00 33.09 ? 892  ARG B CD  1 
ATOM   2234 N  NE  . ARG B 1 5   ? 16.936  -15.574 23.237  1.00 55.19 ? 892  ARG B NE  1 
ATOM   2235 C  CZ  . ARG B 1 5   ? 17.390  -14.399 22.797  1.00 67.50 ? 892  ARG B CZ  1 
ATOM   2236 N  NH1 . ARG B 1 5   ? 18.024  -13.556 23.608  1.00 64.40 ? 892  ARG B NH1 1 
ATOM   2237 N  NH2 . ARG B 1 5   ? 17.219  -14.069 21.516  1.00 54.89 ? 892  ARG B NH2 1 
ATOM   2238 N  N   . VAL B 1 6   ? 13.507  -12.423 27.107  1.00 27.27 ? 893  VAL B N   1 
ATOM   2239 C  CA  . VAL B 1 6   ? 12.998  -11.037 27.058  1.00 26.24 ? 893  VAL B CA  1 
ATOM   2240 C  C   . VAL B 1 6   ? 13.282  -10.398 25.709  1.00 34.21 ? 893  VAL B C   1 
ATOM   2241 O  O   . VAL B 1 6   ? 12.426  -9.711  25.157  1.00 26.22 ? 893  VAL B O   1 
ATOM   2242 C  CB  . VAL B 1 6   ? 13.578  -10.133 28.184  1.00 30.06 ? 893  VAL B CB  1 
ATOM   2243 C  CG1 . VAL B 1 6   ? 13.377  -8.651  27.879  1.00 34.33 ? 893  VAL B CG1 1 
ATOM   2244 C  CG2 . VAL B 1 6   ? 12.909  -10.505 29.518  1.00 29.45 ? 893  VAL B CG2 1 
ATOM   2245 N  N   . ALA B 1 7   ? 14.472  -10.657 25.171  1.00 24.85 ? 894  ALA B N   1 
ATOM   2246 C  CA  . ALA B 1 7   ? 14.817  -10.203 23.824  1.00 29.93 ? 894  ALA B CA  1 
ATOM   2247 C  C   . ALA B 1 7   ? 13.841  -10.728 22.753  1.00 30.50 ? 894  ALA B C   1 
ATOM   2248 O  O   . ALA B 1 7   ? 13.700  -10.098 21.698  1.00 33.19 ? 894  ALA B O   1 
ATOM   2249 C  CB  . ALA B 1 7   ? 16.263  -10.641 23.463  1.00 28.19 ? 894  ALA B CB  1 
ATOM   2250 N  N   . ASP B 1 8   ? 13.212  -11.881 22.990  1.00 22.57 ? 895  ASP B N   1 
ATOM   2251 C  CA  . ASP B 1 8   ? 12.264  -12.483 21.996  1.00 26.13 ? 895  ASP B CA  1 
ATOM   2252 C  C   . ASP B 1 8   ? 10.771  -12.212 22.274  1.00 29.10 ? 895  ASP B C   1 
ATOM   2253 O  O   . ASP B 1 8   ? 9.879   -12.677 21.536  1.00 22.29 ? 895  ASP B O   1 
ATOM   2254 C  CB  . ASP B 1 8   ? 12.480  -14.004 21.930  1.00 31.69 ? 895  ASP B CB  1 
ATOM   2255 C  CG  . ASP B 1 8   ? 13.876  -14.370 21.436  1.00 36.93 ? 895  ASP B CG  1 
ATOM   2256 O  OD1 . ASP B 1 8   ? 14.456  -13.534 20.731  1.00 29.96 ? 895  ASP B OD1 1 
ATOM   2257 O  OD2 . ASP B 1 8   ? 14.379  -15.462 21.767  1.00 30.55 ? 895  ASP B OD2 1 
ATOM   2258 N  N   . LEU B 1 9   ? 10.515  -11.493 23.354  1.00 26.66 ? 896  LEU B N   1 
ATOM   2259 C  CA  . LEU B 1 9   ? 9.135   -11.245 23.829  1.00 27.04 ? 896  LEU B CA  1 
ATOM   2260 C  C   . LEU B 1 9   ? 8.250   -10.466 22.829  1.00 25.66 ? 896  LEU B C   1 
ATOM   2261 O  O   . LEU B 1 9   ? 7.086   -10.820 22.595  1.00 26.37 ? 896  LEU B O   1 
ATOM   2262 C  CB  . LEU B 1 9   ? 9.159   -10.520 25.187  1.00 28.64 ? 896  LEU B CB  1 
ATOM   2263 C  CG  . LEU B 1 9   ? 7.808   -10.399 25.909  1.00 29.60 ? 896  LEU B CG  1 
ATOM   2264 C  CD1 . LEU B 1 9   ? 7.112   -11.768 25.996  1.00 26.19 ? 896  LEU B CD1 1 
ATOM   2265 C  CD2 . LEU B 1 9   ? 7.980   -9.797  27.285  1.00 24.27 ? 896  LEU B CD2 1 
ATOM   2266 N  N   . LEU B 1 10  ? 8.797   -9.414  22.247  1.00 24.73 ? 897  LEU B N   1 
ATOM   2267 C  CA  . LEU B 1 10  ? 8.057   -8.635  21.258  1.00 27.59 ? 897  LEU B CA  1 
ATOM   2268 C  C   . LEU B 1 10  ? 7.635   -9.517  20.077  1.00 28.17 ? 897  LEU B C   1 
ATOM   2269 O  O   . LEU B 1 10  ? 6.434   -9.564  19.673  1.00 26.10 ? 897  LEU B O   1 
ATOM   2270 C  CB  . LEU B 1 10  ? 8.876   -7.432  20.779  1.00 27.27 ? 897  LEU B CB  1 
ATOM   2271 C  CG  . LEU B 1 10  ? 8.222   -6.576  19.668  1.00 37.77 ? 897  LEU B CG  1 
ATOM   2272 C  CD1 . LEU B 1 10  ? 6.895   -6.013  20.112  1.00 32.33 ? 897  LEU B CD1 1 
ATOM   2273 C  CD2 . LEU B 1 10  ? 9.135   -5.471  19.197  1.00 32.57 ? 897  LEU B CD2 1 
ATOM   2274 N  N   . GLN B 1 11  ? 8.592   -10.271 19.544  1.00 26.07 ? 898  GLN B N   1 
ATOM   2275 C  CA  . GLN B 1 11  ? 8.282   -11.147 18.417  1.00 28.54 ? 898  GLN B CA  1 
ATOM   2276 C  C   . GLN B 1 11  ? 7.267   -12.245 18.804  1.00 27.18 ? 898  GLN B C   1 
ATOM   2277 O  O   . GLN B 1 11  ? 6.314   -12.515 18.065  1.00 25.41 ? 898  GLN B O   1 
ATOM   2278 C  CB  . GLN B 1 11  ? 9.545   -11.739 17.806  1.00 31.07 ? 898  GLN B CB  1 
ATOM   2279 C  CG  . GLN B 1 11  ? 9.236   -12.515 16.528  1.00 34.22 ? 898  GLN B CG  1 
ATOM   2280 N  N   . HIS B 1 12  ? 7.419   -12.820 19.996  1.00 25.59 ? 899  HIS B N   1 
ATOM   2281 C  CA  . HIS B 1 12  ? 6.448   -13.784 20.510  1.00 22.05 ? 899  HIS B CA  1 
ATOM   2282 C  C   . HIS B 1 12  ? 5.023   -13.185 20.544  1.00 24.94 ? 899  HIS B C   1 
ATOM   2283 O  O   . HIS B 1 12  ? 4.050   -13.809 20.104  1.00 25.06 ? 899  HIS B O   1 
ATOM   2284 C  CB  . HIS B 1 12  ? 6.810   -14.185 21.951  1.00 24.49 ? 899  HIS B CB  1 
ATOM   2285 C  CG  . HIS B 1 12  ? 5.856   -15.175 22.547  1.00 18.48 ? 899  HIS B CG  1 
ATOM   2286 N  ND1 . HIS B 1 12  ? 5.591   -16.385 21.952  1.00 22.07 ? 899  HIS B ND1 1 
ATOM   2287 C  CD2 . HIS B 1 12  ? 5.057   -15.116 23.642  1.00 21.70 ? 899  HIS B CD2 1 
ATOM   2288 C  CE1 . HIS B 1 12  ? 4.711   -17.052 22.672  1.00 32.64 ? 899  HIS B CE1 1 
ATOM   2289 N  NE2 . HIS B 1 12  ? 4.378   -16.311 23.710  1.00 30.94 ? 899  HIS B NE2 1 
ATOM   2290 N  N   . ILE B 1 13  ? 4.912   -11.993 21.124  1.00 23.84 ? 900  ILE B N   1 
ATOM   2291 C  CA  . ILE B 1 13  ? 3.598   -11.310 21.292  1.00 24.42 ? 900  ILE B CA  1 
ATOM   2292 C  C   . ILE B 1 13  ? 2.968   -10.979 19.916  1.00 23.18 ? 900  ILE B C   1 
ATOM   2293 O  O   . ILE B 1 13  ? 1.790   -11.274 19.673  1.00 25.18 ? 900  ILE B O   1 
ATOM   2294 C  CB  . ILE B 1 13  ? 3.740   -10.089 22.195  1.00 25.04 ? 900  ILE B CB  1 
ATOM   2295 C  CG1 . ILE B 1 13  ? 3.990   -10.563 23.633  1.00 27.36 ? 900  ILE B CG1 1 
ATOM   2296 C  CG2 . ILE B 1 13  ? 2.463   -9.180  22.112  1.00 23.44 ? 900  ILE B CG2 1 
ATOM   2297 C  CD1 . ILE B 1 13  ? 4.387   -9.459  24.595  1.00 20.69 ? 900  ILE B CD1 1 
ATOM   2298 N  N   . THR B 1 14  ? 3.787   -10.457 19.003  1.00 23.32 ? 901  THR B N   1 
ATOM   2299 C  CA  . THR B 1 14  ? 3.376   -10.240 17.597  1.00 25.55 ? 901  THR B CA  1 
ATOM   2300 C  C   . THR B 1 14  ? 2.773   -11.492 16.992  1.00 24.63 ? 901  THR B C   1 
ATOM   2301 O  O   . THR B 1 14  ? 1.651   -11.479 16.452  1.00 23.02 ? 901  THR B O   1 
ATOM   2302 C  CB  . THR B 1 14  ? 4.589   -9.794  16.741  1.00 24.53 ? 901  THR B CB  1 
ATOM   2303 O  OG1 . THR B 1 14  ? 5.091   -8.565  17.279  1.00 32.40 ? 901  THR B OG1 1 
ATOM   2304 C  CG2 . THR B 1 14  ? 4.170   -9.597  15.290  1.00 33.26 ? 901  THR B CG2 1 
ATOM   2305 N  N   . GLN B 1 15  ? 3.507   -12.600 17.056  1.00 25.02 ? 902  GLN B N   1 
ATOM   2306 C  CA  . GLN B 1 15  ? 3.034   -13.840 16.444  1.00 26.63 ? 902  GLN B CA  1 
ATOM   2307 C  C   . GLN B 1 15  ? 1.692   -14.239 17.007  1.00 21.61 ? 902  GLN B C   1 
ATOM   2308 O  O   . GLN B 1 15  ? 0.816   -14.734 16.300  1.00 25.42 ? 902  GLN B O   1 
ATOM   2309 C  CB  . GLN B 1 15  ? 4.048   -14.991 16.647  1.00 26.23 ? 902  GLN B CB  1 
ATOM   2310 C  CG  . GLN B 1 15  ? 5.286   -14.835 15.773  1.00 43.72 ? 902  GLN B CG  1 
ATOM   2311 N  N   . MET B 1 16  ? 1.542   -14.030 18.303  1.00 24.32 ? 903  MET B N   1 
ATOM   2312 C  CA  . MET B 1 16  ? 0.338   -14.417 18.996  1.00 23.95 ? 903  MET B CA  1 
ATOM   2313 C  C   . MET B 1 16  ? -0.889  -13.540 18.711  1.00 22.42 ? 903  MET B C   1 
ATOM   2314 O  O   . MET B 1 16  ? -2.030  -13.977 18.936  1.00 23.03 ? 903  MET B O   1 
ATOM   2315 C  CB  . MET B 1 16  ? 0.635   -14.425 20.484  1.00 23.81 ? 903  MET B CB  1 
ATOM   2316 C  CG  . MET B 1 16  ? 1.712   -15.423 20.866  1.00 31.46 ? 903  MET B CG  1 
ATOM   2317 S  SD  . MET B 1 16  ? 1.028   -17.053 21.027  1.00 31.52 ? 903  MET B SD  1 
ATOM   2318 C  CE  . MET B 1 16  ? 0.451   -16.795 22.713  1.00 28.29 ? 903  MET B CE  1 
ATOM   2319 N  N   . LYS B 1 17  ? -0.650  -12.310 18.237  1.00 22.09 ? 904  LYS B N   1 
ATOM   2320 C  CA  . LYS B 1 17  ? -1.696  -11.388 17.818  1.00 24.85 ? 904  LYS B CA  1 
ATOM   2321 C  C   . LYS B 1 17  ? -2.111  -11.551 16.338  1.00 21.92 ? 904  LYS B C   1 
ATOM   2322 O  O   . LYS B 1 17  ? -3.154  -11.060 15.924  1.00 24.82 ? 904  LYS B O   1 
ATOM   2323 C  CB  . LYS B 1 17  ? -1.235  -9.945  18.085  1.00 27.70 ? 904  LYS B CB  1 
ATOM   2324 C  CG  . LYS B 1 17  ? -1.119  -9.654  19.599  1.00 23.16 ? 904  LYS B CG  1 
ATOM   2325 C  CD  . LYS B 1 17  ? -0.709  -8.222  19.827  1.00 21.71 ? 904  LYS B CD  1 
ATOM   2326 C  CE  . LYS B 1 17  ? -0.729  -7.827  21.323  1.00 25.72 ? 904  LYS B CE  1 
ATOM   2327 N  NZ  . LYS B 1 17  ? -0.214  -6.424  21.562  1.00 27.14 ? 904  LYS B NZ  1 
ATOM   2328 N  N   . ARG B 1 18  ? -1.291  -12.224 15.531  1.00 22.45 ? 905  ARG B N   1 
ATOM   2329 C  CA  . ARG B 1 18  ? -1.630  -12.475 14.142  1.00 27.05 ? 905  ARG B CA  1 
ATOM   2330 C  C   . ARG B 1 18  ? -2.906  -13.299 14.038  1.00 27.74 ? 905  ARG B C   1 
ATOM   2331 O  O   . ARG B 1 18  ? -3.261  -14.018 14.970  1.00 26.26 ? 905  ARG B O   1 
ATOM   2332 C  CB  . ARG B 1 18  ? -0.493  -13.187 13.440  1.00 19.20 ? 905  ARG B CB  1 
ATOM   2333 C  CG  . ARG B 1 18  ? 0.762   -12.325 13.284  1.00 27.06 ? 905  ARG B CG  1 
ATOM   2334 C  CD  . ARG B 1 18  ? 1.865   -13.043 12.481  1.00 40.71 ? 905  ARG B CD  1 
ATOM   2335 N  N   . GLY B 1 19  ? -3.608  -13.169 12.911  1.00 25.89 ? 906  GLY B N   1 
ATOM   2336 C  CA  . GLY B 1 19  ? -4.896  -13.856 12.724  1.00 26.90 ? 906  GLY B CA  1 
ATOM   2337 C  C   . GLY B 1 19  ? -5.912  -13.486 13.768  1.00 27.95 ? 906  GLY B C   1 
ATOM   2338 O  O   . GLY B 1 19  ? -6.562  -14.365 14.348  1.00 27.39 ? 906  GLY B O   1 
ATOM   2339 N  N   . GLN B 1 20  ? -6.026  -12.181 14.059  1.00 24.84 ? 907  GLN B N   1 
ATOM   2340 C  CA  . GLN B 1 20  ? -6.955  -11.691 15.064  1.00 29.94 ? 907  GLN B CA  1 
ATOM   2341 C  C   . GLN B 1 20  ? -6.734  -12.335 16.436  1.00 31.49 ? 907  GLN B C   1 
ATOM   2342 O  O   . GLN B 1 20  ? -7.672  -12.680 17.120  1.00 28.23 ? 907  GLN B O   1 
ATOM   2343 C  CB  . GLN B 1 20  ? -8.396  -11.907 14.572  1.00 30.08 ? 907  GLN B CB  1 
ATOM   2344 C  CG  . GLN B 1 20  ? -8.619  -11.270 13.231  1.00 36.71 ? 907  GLN B CG  1 
ATOM   2345 C  CD  . GLN B 1 20  ? -10.059 -11.283 12.801  1.00 41.94 ? 907  GLN B CD  1 
ATOM   2346 O  OE1 . GLN B 1 20  ? -10.866 -10.474 13.276  1.00 38.32 ? 907  GLN B OE1 1 
ATOM   2347 N  NE2 . GLN B 1 20  ? -10.392 -12.180 11.881  1.00 34.80 ? 907  GLN B NE2 1 
ATOM   2348 N  N   . GLY B 1 21  ? -5.481  -12.486 16.839  1.00 25.17 ? 908  GLY B N   1 
ATOM   2349 C  CA  . GLY B 1 21  ? -5.164  -13.041 18.177  1.00 32.14 ? 908  GLY B CA  1 
ATOM   2350 C  C   . GLY B 1 21  ? -5.327  -14.549 18.279  1.00 30.58 ? 908  GLY B C   1 
ATOM   2351 O  O   . GLY B 1 21  ? -5.561  -15.084 19.363  1.00 26.70 ? 908  GLY B O   1 
ATOM   2352 N  N   . TYR B 1 22  ? -5.219  -15.243 17.155  1.00 28.44 ? 909  TYR B N   1 
ATOM   2353 C  CA  . TYR B 1 22  ? -5.372  -16.696 17.138  1.00 30.64 ? 909  TYR B CA  1 
ATOM   2354 C  C   . TYR B 1 22  ? -4.512  -17.403 18.201  1.00 27.41 ? 909  TYR B C   1 
ATOM   2355 O  O   . TYR B 1 22  ? -5.023  -18.208 18.972  1.00 27.83 ? 909  TYR B O   1 
ATOM   2356 C  CB  . TYR B 1 22  ? -4.999  -17.251 15.790  1.00 29.11 ? 909  TYR B CB  1 
ATOM   2357 C  CG  . TYR B 1 22  ? -5.223  -18.746 15.708  1.00 33.51 ? 909  TYR B CG  1 
ATOM   2358 C  CD1 . TYR B 1 22  ? -6.502  -19.275 15.516  1.00 45.25 ? 909  TYR B CD1 1 
ATOM   2359 C  CD2 . TYR B 1 22  ? -4.154  -19.636 15.835  1.00 35.48 ? 909  TYR B CD2 1 
ATOM   2360 C  CE1 . TYR B 1 22  ? -6.709  -20.659 15.456  1.00 46.36 ? 909  TYR B CE1 1 
ATOM   2361 C  CE2 . TYR B 1 22  ? -4.350  -21.015 15.768  1.00 42.90 ? 909  TYR B CE2 1 
ATOM   2362 C  CZ  . TYR B 1 22  ? -5.629  -21.512 15.579  1.00 49.69 ? 909  TYR B CZ  1 
ATOM   2363 O  OH  . TYR B 1 22  ? -5.811  -22.865 15.502  1.00 49.36 ? 909  TYR B OH  1 
ATOM   2364 N  N   . GLY B 1 23  ? -3.222  -17.091 18.217  1.00 23.24 ? 910  GLY B N   1 
ATOM   2365 C  CA  . GLY B 1 23  ? -2.286  -17.711 19.134  1.00 26.12 ? 910  GLY B CA  1 
ATOM   2366 C  C   . GLY B 1 23  ? -2.617  -17.437 20.592  1.00 22.91 ? 910  GLY B C   1 
ATOM   2367 O  O   . GLY B 1 23  ? -2.529  -18.344 21.428  1.00 25.29 ? 910  GLY B O   1 
ATOM   2368 N  N   . PHE B 1 24  ? -3.017  -16.197 20.912  1.00 20.98 ? 911  PHE B N   1 
ATOM   2369 C  CA  . PHE B 1 24  ? -3.410  -15.860 22.283  1.00 19.30 ? 911  PHE B CA  1 
ATOM   2370 C  C   . PHE B 1 24  ? -4.683  -16.626 22.662  1.00 22.08 ? 911  PHE B C   1 
ATOM   2371 O  O   . PHE B 1 24  ? -4.764  -17.177 23.736  1.00 24.92 ? 911  PHE B O   1 
ATOM   2372 C  CB  . PHE B 1 24  ? -3.633  -14.356 22.450  1.00 25.46 ? 911  PHE B CB  1 
ATOM   2373 C  CG  . PHE B 1 24  ? -2.392  -13.597 22.854  1.00 23.87 ? 911  PHE B CG  1 
ATOM   2374 C  CD1 . PHE B 1 24  ? -1.665  -13.991 23.960  1.00 27.52 ? 911  PHE B CD1 1 
ATOM   2375 C  CD2 . PHE B 1 24  ? -1.959  -12.475 22.132  1.00 22.67 ? 911  PHE B CD2 1 
ATOM   2376 C  CE1 . PHE B 1 24  ? -0.537  -13.302 24.357  1.00 26.10 ? 911  PHE B CE1 1 
ATOM   2377 C  CE2 . PHE B 1 24  ? -0.867  -11.768 22.536  1.00 26.66 ? 911  PHE B CE2 1 
ATOM   2378 C  CZ  . PHE B 1 24  ? -0.147  -12.182 23.668  1.00 23.66 ? 911  PHE B CZ  1 
ATOM   2379 N  N   . LYS B 1 25  ? -5.640  -16.725 21.745  1.00 22.77 ? 912  LYS B N   1 
ATOM   2380 C  CA  . LYS B 1 25  ? -6.895  -17.430 22.062  1.00 28.53 ? 912  LYS B CA  1 
ATOM   2381 C  C   . LYS B 1 25  ? -6.641  -18.899 22.359  1.00 26.07 ? 912  LYS B C   1 
ATOM   2382 O  O   . LYS B 1 25  ? -7.196  -19.474 23.305  1.00 25.84 ? 912  LYS B O   1 
ATOM   2383 C  CB  . LYS B 1 25  ? -7.878  -17.317 20.914  1.00 29.19 ? 912  LYS B CB  1 
ATOM   2384 C  CG  . LYS B 1 25  ? -9.191  -18.131 21.098  1.00 34.60 ? 912  LYS B CG  1 
ATOM   2385 N  N   . GLU B 1 26  ? -5.821  -19.510 21.520  1.00 25.03 ? 913  GLU B N   1 
ATOM   2386 C  CA  . GLU B 1 26  ? -5.522  -20.927 21.641  1.00 27.42 ? 913  GLU B CA  1 
ATOM   2387 C  C   . GLU B 1 26  ? -4.764  -21.222 22.934  1.00 26.99 ? 913  GLU B C   1 
ATOM   2388 O  O   . GLU B 1 26  ? -5.094  -22.176 23.652  1.00 28.80 ? 913  GLU B O   1 
ATOM   2389 C  CB  . GLU B 1 26  ? -4.723  -21.368 20.436  1.00 27.15 ? 913  GLU B CB  1 
ATOM   2390 C  CG  . GLU B 1 26  ? -4.378  -22.843 20.453  1.00 43.46 ? 913  GLU B CG  1 
ATOM   2391 C  CD  . GLU B 1 26  ? -4.176  -23.391 19.069  1.00 54.27 ? 913  GLU B CD  1 
ATOM   2392 O  OE1 . GLU B 1 26  ? -5.193  -23.650 18.387  1.00 74.31 ? 913  GLU B OE1 1 
ATOM   2393 O  OE2 . GLU B 1 26  ? -3.005  -23.565 18.668  1.00 57.37 ? 913  GLU B OE2 1 
ATOM   2394 N  N   . GLU B 1 27  ? -3.758  -20.404 23.230  1.00 24.05 ? 914  GLU B N   1 
ATOM   2395 C  CA  . GLU B 1 27  ? -2.985  -20.563 24.449  1.00 26.36 ? 914  GLU B CA  1 
ATOM   2396 C  C   . GLU B 1 27  ? -3.854  -20.320 25.687  1.00 24.63 ? 914  GLU B C   1 
ATOM   2397 O  O   . GLU B 1 27  ? -3.792  -21.119 26.634  1.00 26.04 ? 914  GLU B O   1 
ATOM   2398 C  CB  . GLU B 1 27  ? -1.782  -19.638 24.476  1.00 28.54 ? 914  GLU B CB  1 
ATOM   2399 C  CG  . GLU B 1 27  ? -0.914  -19.842 25.701  1.00 28.75 ? 914  GLU B CG  1 
ATOM   2400 C  CD  . GLU B 1 27  ? 0.474   -19.245 25.565  1.00 30.06 ? 914  GLU B CD  1 
ATOM   2401 O  OE1 . GLU B 1 27  ? 1.316   -19.817 24.837  1.00 26.00 ? 914  GLU B OE1 1 
ATOM   2402 O  OE2 . GLU B 1 27  ? 0.713   -18.188 26.170  1.00 28.27 ? 914  GLU B OE2 1 
ATOM   2403 N  N   . TYR B 1 28  ? -4.666  -19.253 25.682  1.00 23.04 ? 915  TYR B N   1 
ATOM   2404 C  CA  . TYR B 1 28  ? -5.571  -18.959 26.814  1.00 26.71 ? 915  TYR B CA  1 
ATOM   2405 C  C   . TYR B 1 28  ? -6.531  -20.139 27.075  1.00 24.46 ? 915  TYR B C   1 
ATOM   2406 O  O   . TYR B 1 28  ? -6.814  -20.535 28.235  1.00 24.51 ? 915  TYR B O   1 
ATOM   2407 C  CB  . TYR B 1 28  ? -6.403  -17.692 26.561  1.00 24.89 ? 915  TYR B CB  1 
ATOM   2408 C  CG  . TYR B 1 28  ? -7.226  -17.343 27.780  1.00 24.73 ? 915  TYR B CG  1 
ATOM   2409 C  CD1 . TYR B 1 28  ? -6.581  -16.878 28.925  1.00 32.89 ? 915  TYR B CD1 1 
ATOM   2410 C  CD2 . TYR B 1 28  ? -8.599  -17.513 27.817  1.00 29.98 ? 915  TYR B CD2 1 
ATOM   2411 C  CE1 . TYR B 1 28  ? -7.272  -16.586 30.059  1.00 30.63 ? 915  TYR B CE1 1 
ATOM   2412 C  CE2 . TYR B 1 28  ? -9.322  -17.218 28.989  1.00 26.30 ? 915  TYR B CE2 1 
ATOM   2413 C  CZ  . TYR B 1 28  ? -8.629  -16.742 30.096  1.00 31.39 ? 915  TYR B CZ  1 
ATOM   2414 O  OH  . TYR B 1 28  ? -9.259  -16.422 31.285  1.00 40.61 ? 915  TYR B OH  1 
ATOM   2415 N  N   . GLU B 1 29  ? -7.024  -20.723 26.002  1.00 26.61 ? 916  GLU B N   1 
ATOM   2416 C  CA  . GLU B 1 29  ? -7.967  -21.847 26.127  1.00 26.49 ? 916  GLU B CA  1 
ATOM   2417 C  C   . GLU B 1 29  ? -7.293  -23.128 26.651  1.00 23.20 ? 916  GLU B C   1 
ATOM   2418 O  O   . GLU B 1 29  ? -7.985  -24.065 27.107  1.00 29.85 ? 916  GLU B O   1 
ATOM   2419 C  CB  . GLU B 1 29  ? -8.712  -22.067 24.774  1.00 30.86 ? 916  GLU B CB  1 
ATOM   2420 C  CG  . GLU B 1 29  ? -9.861  -21.045 24.615  1.00 38.45 ? 916  GLU B CG  1 
ATOM   2421 C  CD  . GLU B 1 29  ? -10.491 -21.007 23.233  1.00 48.04 ? 916  GLU B CD  1 
ATOM   2422 O  OE1 . GLU B 1 29  ? -10.248 -21.925 22.425  1.00 49.51 ? 916  GLU B OE1 1 
ATOM   2423 O  OE2 . GLU B 1 29  ? -11.230 -20.036 22.945  1.00 52.50 ? 916  GLU B OE2 1 
ATOM   2424 N  N   . ALA B 1 30  ? -5.963  -23.198 26.570  1.00 24.85 ? 917  ALA B N   1 
ATOM   2425 C  CA  . ALA B 1 30  ? -5.211  -24.311 27.145  1.00 28.75 ? 917  ALA B CA  1 
ATOM   2426 C  C   . ALA B 1 30  ? -5.029  -24.192 28.677  1.00 29.91 ? 917  ALA B C   1 
ATOM   2427 O  O   . ALA B 1 30  ? -4.621  -25.153 29.335  1.00 29.30 ? 917  ALA B O   1 
ATOM   2428 C  CB  . ALA B 1 30  ? -3.853  -24.425 26.464  1.00 27.33 ? 917  ALA B CB  1 
ATOM   2429 N  N   . LEU B 1 31  ? -5.310  -23.027 29.256  1.00 25.46 ? 918  LEU B N   1 
ATOM   2430 C  CA  . LEU B 1 31  ? -5.221  -22.891 30.721  1.00 26.32 ? 918  LEU B CA  1 
ATOM   2431 C  C   . LEU B 1 31  ? -6.375  -23.675 31.396  1.00 29.66 ? 918  LEU B C   1 
ATOM   2432 O  O   . LEU B 1 31  ? -7.454  -23.766 30.821  1.00 29.39 ? 918  LEU B O   1 
ATOM   2433 C  CB  . LEU B 1 31  ? -5.303  -21.423 31.117  1.00 23.44 ? 918  LEU B CB  1 
ATOM   2434 C  CG  . LEU B 1 31  ? -4.116  -20.526 30.757  1.00 30.96 ? 918  LEU B CG  1 
ATOM   2435 C  CD1 . LEU B 1 31  ? -4.480  -19.002 30.877  1.00 25.93 ? 918  LEU B CD1 1 
ATOM   2436 C  CD2 . LEU B 1 31  ? -2.869  -20.979 31.594  1.00 25.11 ? 918  LEU B CD2 1 
ATOM   2437 N  N   . PRO B 1 32  ? -6.177  -24.184 32.631  1.00 24.70 ? 919  PRO B N   1 
ATOM   2438 C  CA  . PRO B 1 32  ? -7.258  -24.916 33.277  1.00 31.30 ? 919  PRO B CA  1 
ATOM   2439 C  C   . PRO B 1 32  ? -8.308  -23.976 33.804  1.00 32.09 ? 919  PRO B C   1 
ATOM   2440 O  O   . PRO B 1 32  ? -7.991  -23.110 34.620  1.00 30.49 ? 919  PRO B O   1 
ATOM   2441 C  CB  . PRO B 1 32  ? -6.547  -25.678 34.414  1.00 36.28 ? 919  PRO B CB  1 
ATOM   2442 C  CG  . PRO B 1 32  ? -5.372  -24.866 34.740  1.00 37.49 ? 919  PRO B CG  1 
ATOM   2443 C  CD  . PRO B 1 32  ? -4.953  -24.175 33.455  1.00 34.84 ? 919  PRO B CD  1 
ATOM   2444 N  N   . GLU B 1 33  ? -9.550  -24.142 33.368  1.00 29.59 ? 920  GLU B N   1 
ATOM   2445 C  CA  . GLU B 1 33  ? -10.598 -23.198 33.760  1.00 36.98 ? 920  GLU B CA  1 
ATOM   2446 C  C   . GLU B 1 33  ? -11.475 -23.844 34.808  1.00 30.76 ? 920  GLU B C   1 
ATOM   2447 O  O   . GLU B 1 33  ? -11.708 -25.069 34.786  1.00 26.10 ? 920  GLU B O   1 
ATOM   2448 C  CB  . GLU B 1 33  ? -11.469 -22.796 32.562  1.00 39.57 ? 920  GLU B CB  1 
ATOM   2449 C  CG  . GLU B 1 33  ? -12.509 -21.679 32.871  1.00 45.80 ? 920  GLU B CG  1 
ATOM   2450 C  CD  . GLU B 1 33  ? -13.727 -22.137 33.709  1.00 62.12 ? 920  GLU B CD  1 
ATOM   2451 O  OE1 . GLU B 1 33  ? -14.074 -23.345 33.673  1.00 63.32 ? 920  GLU B OE1 1 
ATOM   2452 O  OE2 . GLU B 1 33  ? -14.332 -21.287 34.417  1.00 43.04 ? 920  GLU B OE2 1 
ATOM   2453 N  N   . GLY B 1 34  ? -11.997 -23.023 35.708  1.00 28.13 ? 921  GLY B N   1 
ATOM   2454 C  CA  . GLY B 1 34  ? -12.901 -23.528 36.725  1.00 30.79 ? 921  GLY B CA  1 
ATOM   2455 C  C   . GLY B 1 34  ? -12.209 -24.363 37.794  1.00 28.49 ? 921  GLY B C   1 
ATOM   2456 O  O   . GLY B 1 34  ? -10.982 -24.268 38.006  1.00 26.08 ? 921  GLY B O   1 
ATOM   2457 N  N   . GLN B 1 35  ? -13.011 -25.184 38.460  1.00 26.81 ? 922  GLN B N   1 
ATOM   2458 C  CA  . GLN B 1 35  ? -12.587 -25.840 39.681  1.00 26.77 ? 922  GLN B CA  1 
ATOM   2459 C  C   . GLN B 1 35  ? -11.611 -26.966 39.373  1.00 23.52 ? 922  GLN B C   1 
ATOM   2460 O  O   . GLN B 1 35  ? -11.968 -27.919 38.701  1.00 27.08 ? 922  GLN B O   1 
ATOM   2461 C  CB  . GLN B 1 35  ? -13.789 -26.383 40.472  1.00 22.83 ? 922  GLN B CB  1 
ATOM   2462 C  CG  . GLN B 1 35  ? -13.418 -26.980 41.836  1.00 22.83 ? 922  GLN B CG  1 
ATOM   2463 C  CD  . GLN B 1 35  ? -14.538 -27.703 42.538  1.00 23.47 ? 922  GLN B CD  1 
ATOM   2464 O  OE1 . GLN B 1 35  ? -15.590 -27.962 41.958  1.00 28.14 ? 922  GLN B OE1 1 
ATOM   2465 N  NE2 . GLN B 1 35  ? -14.324 -28.025 43.778  1.00 20.87 ? 922  GLN B NE2 1 
ATOM   2466 N  N   . THR B 1 36  ? -10.388 -26.864 39.899  1.00 25.98 ? 923  THR B N   1 
ATOM   2467 C  CA  . THR B 1 36  ? -9.433  -27.947 39.787  1.00 26.91 ? 923  THR B CA  1 
ATOM   2468 C  C   . THR B 1 36  ? -9.054  -28.620 41.108  1.00 28.01 ? 923  THR B C   1 
ATOM   2469 O  O   . THR B 1 36  ? -8.238  -29.515 41.093  1.00 24.47 ? 923  THR B O   1 
ATOM   2470 C  CB  . THR B 1 36  ? -8.154  -27.460 39.135  1.00 30.82 ? 923  THR B CB  1 
ATOM   2471 O  OG1 . THR B 1 36  ? -7.558  -26.482 39.973  1.00 28.25 ? 923  THR B OG1 1 
ATOM   2472 C  CG2 . THR B 1 36  ? -8.443  -26.900 37.758  1.00 35.52 ? 923  THR B CG2 1 
ATOM   2473 N  N   . ALA B 1 37  ? -9.596  -28.155 42.241  1.00 23.50 ? 924  ALA B N   1 
ATOM   2474 C  CA  . ALA B 1 37  ? -9.258  -28.708 43.552  1.00 24.10 ? 924  ALA B CA  1 
ATOM   2475 C  C   . ALA B 1 37  ? -10.455 -28.505 44.447  1.00 21.37 ? 924  ALA B C   1 
ATOM   2476 O  O   . ALA B 1 37  ? -11.355 -27.696 44.122  1.00 20.12 ? 924  ALA B O   1 
ATOM   2477 C  CB  . ALA B 1 37  ? -7.992  -27.980 44.154  1.00 16.85 ? 924  ALA B CB  1 
ATOM   2478 N  N   . SER B 1 38  ? -10.499 -29.267 45.531  1.00 18.98 ? 925  SER B N   1 
ATOM   2479 C  CA  . SER B 1 38  ? -11.629 -29.222 46.438  1.00 18.09 ? 925  SER B CA  1 
ATOM   2480 C  C   . SER B 1 38  ? -11.748 -27.843 47.109  1.00 21.96 ? 925  SER B C   1 
ATOM   2481 O  O   . SER B 1 38  ? -10.718 -27.169 47.353  1.00 19.03 ? 925  SER B O   1 
ATOM   2482 C  CB  . SER B 1 38  ? -11.505 -30.292 47.524  1.00 16.60 ? 925  SER B CB  1 
ATOM   2483 O  OG  . SER B 1 38  ? -10.458 -30.060 48.443  1.00 22.20 ? 925  SER B OG  1 
ATOM   2484 N  N   . TRP B 1 39  ? -12.995 -27.452 47.403  1.00 21.15 ? 926  TRP B N   1 
ATOM   2485 C  CA  . TRP B 1 39  ? -13.286 -26.245 48.198  1.00 20.34 ? 926  TRP B CA  1 
ATOM   2486 C  C   . TRP B 1 39  ? -14.471 -26.506 49.168  1.00 24.91 ? 926  TRP B C   1 
ATOM   2487 O  O   . TRP B 1 39  ? -15.456 -25.754 49.213  1.00 22.26 ? 926  TRP B O   1 
ATOM   2488 C  CB  . TRP B 1 39  ? -13.523 -25.029 47.265  1.00 18.86 ? 926  TRP B CB  1 
ATOM   2489 C  CG  . TRP B 1 39  ? -14.541 -25.191 46.141  1.00 22.80 ? 926  TRP B CG  1 
ATOM   2490 C  CD1 . TRP B 1 39  ? -15.693 -25.949 46.131  1.00 26.94 ? 926  TRP B CD1 1 
ATOM   2491 C  CD2 . TRP B 1 39  ? -14.488 -24.532 44.883  1.00 24.47 ? 926  TRP B CD2 1 
ATOM   2492 N  NE1 . TRP B 1 39  ? -16.362 -25.792 44.920  1.00 27.15 ? 926  TRP B NE1 1 
ATOM   2493 C  CE2 . TRP B 1 39  ? -15.633 -24.916 44.146  1.00 28.18 ? 926  TRP B CE2 1 
ATOM   2494 C  CE3 . TRP B 1 39  ? -13.568 -23.643 44.294  1.00 21.62 ? 926  TRP B CE3 1 
ATOM   2495 C  CZ2 . TRP B 1 39  ? -15.865 -24.451 42.841  1.00 27.95 ? 926  TRP B CZ2 1 
ATOM   2496 C  CZ3 . TRP B 1 39  ? -13.817 -23.183 43.018  1.00 25.68 ? 926  TRP B CZ3 1 
ATOM   2497 C  CH2 . TRP B 1 39  ? -14.940 -23.582 42.307  1.00 29.80 ? 926  TRP B CH2 1 
ATOM   2498 N  N   . ASP B 1 40  ? -14.355 -27.635 49.876  1.00 23.19 ? 927  ASP B N   1 
ATOM   2499 C  CA  . ASP B 1 40  ? -15.406 -28.162 50.741  1.00 25.85 ? 927  ASP B CA  1 
ATOM   2500 C  C   . ASP B 1 40  ? -15.768 -27.110 51.812  1.00 27.74 ? 927  ASP B C   1 
ATOM   2501 O  O   . ASP B 1 40  ? -16.960 -26.900 52.108  1.00 23.35 ? 927  ASP B O   1 
ATOM   2502 C  CB  . ASP B 1 40  ? -14.956 -29.450 51.456  1.00 26.75 ? 927  ASP B CB  1 
ATOM   2503 C  CG  . ASP B 1 40  ? -15.079 -30.734 50.565  1.00 24.47 ? 927  ASP B CG  1 
ATOM   2504 O  OD1 . ASP B 1 40  ? -15.125 -30.619 49.350  1.00 31.68 ? 927  ASP B OD1 1 
ATOM   2505 O  OD2 . ASP B 1 40  ? -15.139 -31.844 51.133  1.00 28.99 ? 927  ASP B OD2 1 
ATOM   2506 N  N   . THR B 1 41  ? -14.753 -26.519 52.438  1.00 21.72 ? 928  THR B N   1 
ATOM   2507 C  CA  . THR B 1 41  ? -15.017 -25.536 53.526  1.00 22.08 ? 928  THR B CA  1 
ATOM   2508 C  C   . THR B 1 41  ? -15.766 -24.330 52.948  1.00 24.51 ? 928  THR B C   1 
ATOM   2509 O  O   . THR B 1 41  ? -16.844 -23.943 53.444  1.00 20.10 ? 928  THR B O   1 
ATOM   2510 C  CB  . THR B 1 41  ? -13.754 -25.166 54.348  1.00 22.04 ? 928  THR B CB  1 
ATOM   2511 O  OG1 . THR B 1 41  ? -13.154 -26.364 54.890  1.00 23.03 ? 928  THR B OG1 1 
ATOM   2512 C  CG2 . THR B 1 41  ? -14.147 -24.265 55.534  1.00 22.18 ? 928  THR B CG2 1 
ATOM   2513 N  N   . ALA B 1 42  ? -15.290 -23.852 51.809  1.00 25.50 ? 929  ALA B N   1 
ATOM   2514 C  CA  . ALA B 1 42  ? -15.863 -22.696 51.132  1.00 25.65 ? 929  ALA B CA  1 
ATOM   2515 C  C   . ALA B 1 42  ? -17.356 -22.897 50.776  1.00 27.48 ? 929  ALA B C   1 
ATOM   2516 O  O   . ALA B 1 42  ? -18.134 -21.941 50.748  1.00 22.16 ? 929  ALA B O   1 
ATOM   2517 C  CB  . ALA B 1 42  ? -15.039 -22.379 49.843  1.00 24.40 ? 929  ALA B CB  1 
ATOM   2518 N  N   . LYS B 1 43  ? -17.742 -24.148 50.536  1.00 25.06 ? 930  LYS B N   1 
ATOM   2519 C  CA  . LYS B 1 43  ? -19.112 -24.509 50.148  1.00 22.07 ? 930  LYS B CA  1 
ATOM   2520 C  C   . LYS B 1 43  ? -20.023 -24.802 51.302  1.00 27.58 ? 930  LYS B C   1 
ATOM   2521 O  O   . LYS B 1 43  ? -21.204 -25.076 51.056  1.00 25.68 ? 930  LYS B O   1 
ATOM   2522 C  CB  . LYS B 1 43  ? -19.101 -25.744 49.201  1.00 25.19 ? 930  LYS B CB  1 
ATOM   2523 C  CG  . LYS B 1 43  ? -18.690 -25.428 47.793  1.00 31.66 ? 930  LYS B CG  1 
ATOM   2524 N  N   . GLU B 1 44  ? -19.521 -24.824 52.546  1.00 21.85 ? 931  GLU B N   1 
ATOM   2525 C  CA  . GLU B 1 44  ? -20.408 -25.065 53.715  1.00 23.53 ? 931  GLU B CA  1 
ATOM   2526 C  C   . GLU B 1 44  ? -21.534 -24.033 53.717  1.00 26.47 ? 931  GLU B C   1 
ATOM   2527 O  O   . GLU B 1 44  ? -21.302 -22.855 53.429  1.00 24.89 ? 931  GLU B O   1 
ATOM   2528 C  CB  . GLU B 1 44  ? -19.620 -24.932 55.010  1.00 22.54 ? 931  GLU B CB  1 
ATOM   2529 C  CG  . GLU B 1 44  ? -18.621 -26.056 55.260  1.00 32.24 ? 931  GLU B CG  1 
ATOM   2530 C  CD  . GLU B 1 44  ? -19.319 -27.299 55.730  1.00 38.90 ? 931  GLU B CD  1 
ATOM   2531 O  OE1 . GLU B 1 44  ? -19.779 -27.305 56.899  1.00 45.54 ? 931  GLU B OE1 1 
ATOM   2532 O  OE2 . GLU B 1 44  ? -19.412 -28.253 54.935  1.00 55.43 ? 931  GLU B OE2 1 
ATOM   2533 N  N   . ASP B 1 45  ? -22.735 -24.471 54.045  1.00 24.37 ? 932  ASP B N   1 
ATOM   2534 C  CA  . ASP B 1 45  ? -23.872 -23.560 54.114  1.00 26.78 ? 932  ASP B CA  1 
ATOM   2535 C  C   . ASP B 1 45  ? -23.562 -22.322 54.942  1.00 27.49 ? 932  ASP B C   1 
ATOM   2536 O  O   . ASP B 1 45  ? -23.913 -21.201 54.558  1.00 25.78 ? 932  ASP B O   1 
ATOM   2537 C  CB  . ASP B 1 45  ? -25.102 -24.245 54.701  1.00 27.03 ? 932  ASP B CB  1 
ATOM   2538 C  CG  . ASP B 1 45  ? -25.693 -25.277 53.787  1.00 31.31 ? 932  ASP B CG  1 
ATOM   2539 O  OD1 . ASP B 1 45  ? -25.332 -25.362 52.596  1.00 34.83 ? 932  ASP B OD1 1 
ATOM   2540 O  OD2 . ASP B 1 45  ? -26.579 -25.994 54.268  1.00 32.05 ? 932  ASP B OD2 1 
ATOM   2541 N  N   . GLU B 1 46  ? -22.867 -22.517 56.066  1.00 25.02 ? 933  GLU B N   1 
ATOM   2542 C  CA  . GLU B 1 46  ? -22.591 -21.453 57.002  1.00 29.74 ? 933  GLU B CA  1 
ATOM   2543 C  C   . GLU B 1 46  ? -21.616 -20.427 56.434  1.00 26.23 ? 933  GLU B C   1 
ATOM   2544 O  O   . GLU B 1 46  ? -21.443 -19.351 57.004  1.00 26.95 ? 933  GLU B O   1 
ATOM   2545 C  CB  . GLU B 1 46  ? -22.045 -22.012 58.310  1.00 27.43 ? 933  GLU B CB  1 
ATOM   2546 C  CG  . GLU B 1 46  ? -23.023 -22.926 59.144  1.00 36.53 ? 933  GLU B CG  1 
ATOM   2547 C  CD  . GLU B 1 46  ? -23.057 -24.375 58.664  1.00 38.99 ? 933  GLU B CD  1 
ATOM   2548 O  OE1 . GLU B 1 46  ? -22.467 -24.657 57.604  1.00 30.25 ? 933  GLU B OE1 1 
ATOM   2549 O  OE2 . GLU B 1 46  ? -23.690 -25.231 59.326  1.00 38.89 ? 933  GLU B OE2 1 
ATOM   2550 N  N   . ASN B 1 47  ? -20.940 -20.763 55.327  1.00 24.07 ? 934  ASN B N   1 
ATOM   2551 C  CA  . ASN B 1 47  ? -20.028 -19.832 54.706  1.00 20.40 ? 934  ASN B CA  1 
ATOM   2552 C  C   . ASN B 1 47  ? -20.572 -19.154 53.431  1.00 22.56 ? 934  ASN B C   1 
ATOM   2553 O  O   . ASN B 1 47  ? -19.897 -18.317 52.836  1.00 22.39 ? 934  ASN B O   1 
ATOM   2554 C  CB  . ASN B 1 47  ? -18.679 -20.509 54.425  1.00 22.59 ? 934  ASN B CB  1 
ATOM   2555 C  CG  . ASN B 1 47  ? -17.924 -20.872 55.698  1.00 22.80 ? 934  ASN B CG  1 
ATOM   2556 O  OD1 . ASN B 1 47  ? -18.072 -20.218 56.732  1.00 22.78 ? 934  ASN B OD1 1 
ATOM   2557 N  ND2 . ASN B 1 47  ? -17.160 -21.968 55.644  1.00 19.32 ? 934  ASN B ND2 1 
ATOM   2558 N  N   . ARG B 1 48  ? -21.806 -19.457 53.063  1.00 23.15 ? 935  ARG B N   1 
ATOM   2559 C  CA  . ARG B 1 48  ? -22.293 -18.955 51.789  1.00 27.35 ? 935  ARG B CA  1 
ATOM   2560 C  C   . ARG B 1 48  ? -22.281 -17.429 51.760  1.00 26.40 ? 935  ARG B C   1 
ATOM   2561 O  O   . ARG B 1 48  ? -21.895 -16.842 50.775  1.00 28.12 ? 935  ARG B O   1 
ATOM   2562 C  CB  . ARG B 1 48  ? -23.704 -19.416 51.516  1.00 32.38 ? 935  ARG B CB  1 
ATOM   2563 C  CG  . ARG B 1 48  ? -24.046 -19.243 50.057  1.00 33.76 ? 935  ARG B CG  1 
ATOM   2564 C  CD  . ARG B 1 48  ? -25.458 -19.641 49.752  1.00 34.32 ? 935  ARG B CD  1 
ATOM   2565 N  NE  . ARG B 1 48  ? -25.712 -21.073 49.874  1.00 54.22 ? 935  ARG B NE  1 
ATOM   2566 C  CZ  . ARG B 1 48  ? -26.122 -21.691 50.985  1.00 58.41 ? 935  ARG B CZ  1 
ATOM   2567 N  NH1 . ARG B 1 48  ? -26.318 -21.031 52.128  1.00 50.25 ? 935  ARG B NH1 1 
ATOM   2568 N  NH2 . ARG B 1 48  ? -26.349 -22.999 50.940  1.00 49.43 ? 935  ARG B NH2 1 
ATOM   2569 N  N   . ASN B 1 49  ? -22.676 -16.807 52.861  1.00 23.01 ? 936  ASN B N   1 
ATOM   2570 C  CA  . ASN B 1 49  ? -22.744 -15.323 52.913  1.00 22.99 ? 936  ASN B CA  1 
ATOM   2571 C  C   . ASN B 1 49  ? -21.388 -14.686 53.135  1.00 24.22 ? 936  ASN B C   1 
ATOM   2572 O  O   . ASN B 1 49  ? -21.295 -13.475 53.370  1.00 28.12 ? 936  ASN B O   1 
ATOM   2573 C  CB  . ASN B 1 49  ? -23.758 -14.859 53.957  1.00 24.60 ? 936  ASN B CB  1 
ATOM   2574 C  CG  . ASN B 1 49  ? -25.193 -15.309 53.620  1.00 39.51 ? 936  ASN B CG  1 
ATOM   2575 O  OD1 . ASN B 1 49  ? -25.436 -15.906 52.579  1.00 32.71 ? 936  ASN B OD1 1 
ATOM   2576 N  ND2 . ASN B 1 49  ? -26.136 -15.012 54.502  1.00 48.57 ? 936  ASN B ND2 1 
ATOM   2577 N  N   . LYS B 1 50  ? -20.313 -15.478 53.070  1.00 21.88 ? 937  LYS B N   1 
ATOM   2578 C  CA  . LYS B 1 50  ? -18.983 -14.920 53.152  1.00 19.78 ? 937  LYS B CA  1 
ATOM   2579 C  C   . LYS B 1 50  ? -18.252 -14.919 51.791  1.00 23.27 ? 937  LYS B C   1 
ATOM   2580 O  O   . LYS B 1 50  ? -17.091 -14.507 51.700  1.00 21.94 ? 937  LYS B O   1 
ATOM   2581 C  CB  . LYS B 1 50  ? -18.178 -15.776 54.138  1.00 24.02 ? 937  LYS B CB  1 
ATOM   2582 C  CG  . LYS B 1 50  ? -18.784 -15.841 55.530  1.00 24.12 ? 937  LYS B CG  1 
ATOM   2583 C  CD  . LYS B 1 50  ? -17.945 -16.759 56.447  1.00 23.23 ? 937  LYS B CD  1 
ATOM   2584 C  CE  . LYS B 1 50  ? -18.685 -17.083 57.757  1.00 22.49 ? 937  LYS B CE  1 
ATOM   2585 N  NZ  . LYS B 1 50  ? -18.001 -18.037 58.680  1.00 23.79 ? 937  LYS B NZ  1 
ATOM   2586 N  N   . ASN B 1 51  ? -18.918 -15.440 50.759  1.00 25.17 ? 938  ASN B N   1 
ATOM   2587 C  CA  . ASN B 1 51  ? -18.351 -15.494 49.416  1.00 21.88 ? 938  ASN B CA  1 
ATOM   2588 C  C   . ASN B 1 51  ? -19.095 -14.536 48.515  1.00 25.92 ? 938  ASN B C   1 
ATOM   2589 O  O   . ASN B 1 51  ? -20.306 -14.590 48.467  1.00 20.79 ? 938  ASN B O   1 
ATOM   2590 C  CB  . ASN B 1 51  ? -18.514 -16.877 48.812  1.00 21.63 ? 938  ASN B CB  1 
ATOM   2591 C  CG  . ASN B 1 51  ? -17.732 -17.936 49.530  1.00 24.36 ? 938  ASN B CG  1 
ATOM   2592 O  OD1 . ASN B 1 51  ? -16.592 -17.717 49.889  1.00 25.46 ? 938  ASN B OD1 1 
ATOM   2593 N  ND2 . ASN B 1 51  ? -18.329 -19.136 49.677  1.00 23.47 ? 938  ASN B ND2 1 
ATOM   2594 N  N   . ARG B 1 52  ? -18.377 -13.683 47.791  1.00 24.90 ? 939  ARG B N   1 
ATOM   2595 C  CA  . ARG B 1 52  ? -19.060 -12.680 46.967  1.00 26.18 ? 939  ARG B CA  1 
ATOM   2596 C  C   . ARG B 1 52  ? -19.664 -13.303 45.707  1.00 26.31 ? 939  ARG B C   1 
ATOM   2597 O  O   . ARG B 1 52  ? -20.838 -13.069 45.355  1.00 28.43 ? 939  ARG B O   1 
ATOM   2598 C  CB  . ARG B 1 52  ? -18.013 -11.615 46.618  1.00 26.14 ? 939  ARG B CB  1 
ATOM   2599 C  CG  . ARG B 1 52  ? -18.486 -10.451 45.868  1.00 36.77 ? 939  ARG B CG  1 
ATOM   2600 C  CD  . ARG B 1 52  ? -17.325 -9.430  45.761  1.00 39.88 ? 939  ARG B CD  1 
ATOM   2601 N  NE  . ARG B 1 52  ? -17.206 -8.560  46.924  1.00 29.79 ? 939  ARG B NE  1 
ATOM   2602 C  CZ  . ARG B 1 52  ? -18.109 -7.653  47.221  1.00 30.68 ? 939  ARG B CZ  1 
ATOM   2603 N  NH1 . ARG B 1 52  ? -19.193 -7.479  46.467  1.00 32.10 ? 939  ARG B NH1 1 
ATOM   2604 N  NH2 . ARG B 1 52  ? -17.959 -6.894  48.278  1.00 30.65 ? 939  ARG B NH2 1 
ATOM   2605 N  N   . TYR B 1 53  ? -18.859 -14.115 45.016  1.00 27.43 ? 940  TYR B N   1 
ATOM   2606 C  CA  . TYR B 1 53  ? -19.278 -14.861 43.814  1.00 28.87 ? 940  TYR B CA  1 
ATOM   2607 C  C   . TYR B 1 53  ? -18.974 -16.334 44.049  1.00 31.58 ? 940  TYR B C   1 
ATOM   2608 O  O   . TYR B 1 53  ? -17.822 -16.731 44.225  1.00 27.42 ? 940  TYR B O   1 
ATOM   2609 C  CB  . TYR B 1 53  ? -18.546 -14.309 42.594  1.00 31.55 ? 940  TYR B CB  1 
ATOM   2610 C  CG  . TYR B 1 53  ? -18.752 -15.035 41.282  1.00 44.35 ? 940  TYR B CG  1 
ATOM   2611 C  CD1 . TYR B 1 53  ? -19.974 -15.623 40.943  1.00 39.70 ? 940  TYR B CD1 1 
ATOM   2612 C  CD2 . TYR B 1 53  ? -17.711 -15.088 40.347  1.00 60.95 ? 940  TYR B CD2 1 
ATOM   2613 C  CE1 . TYR B 1 53  ? -20.128 -16.278 39.716  1.00 40.31 ? 940  TYR B CE1 1 
ATOM   2614 C  CE2 . TYR B 1 53  ? -17.857 -15.732 39.130  1.00 53.79 ? 940  TYR B CE2 1 
ATOM   2615 C  CZ  . TYR B 1 53  ? -19.058 -16.321 38.818  1.00 59.87 ? 940  TYR B CZ  1 
ATOM   2616 O  OH  . TYR B 1 53  ? -19.157 -16.955 37.602  1.00 51.18 ? 940  TYR B OH  1 
ATOM   2617 N  N   . GLY B 1 54  ? -20.008 -17.146 44.066  1.00 27.98 ? 941  GLY B N   1 
ATOM   2618 C  CA  . GLY B 1 54  ? -19.875 -18.552 44.498  1.00 28.30 ? 941  GLY B CA  1 
ATOM   2619 C  C   . GLY B 1 54  ? -19.050 -19.473 43.579  1.00 27.35 ? 941  GLY B C   1 
ATOM   2620 O  O   . GLY B 1 54  ? -18.733 -20.580 43.972  1.00 30.85 ? 941  GLY B O   1 
ATOM   2621 N  N   . ASN B 1 55  ? -18.720 -19.018 42.358  1.00 29.47 ? 942  ASN B N   1 
ATOM   2622 C  CA  . ASN B 1 55  ? -17.827 -19.734 41.443  1.00 25.95 ? 942  ASN B CA  1 
ATOM   2623 C  C   . ASN B 1 55  ? -16.346 -19.382 41.665  1.00 26.75 ? 942  ASN B C   1 
ATOM   2624 O  O   . ASN B 1 55  ? -15.445 -20.036 41.123  1.00 24.67 ? 942  ASN B O   1 
ATOM   2625 C  CB  . ASN B 1 55  ? -18.195 -19.438 39.979  1.00 30.33 ? 942  ASN B CB  1 
ATOM   2626 C  CG  . ASN B 1 55  ? -19.512 -20.079 39.568  1.00 48.43 ? 942  ASN B CG  1 
ATOM   2627 O  OD1 . ASN B 1 55  ? -19.879 -21.130 40.090  1.00 53.27 ? 942  ASN B OD1 1 
ATOM   2628 N  ND2 . ASN B 1 55  ? -20.229 -19.448 38.619  1.00 35.68 ? 942  ASN B ND2 1 
ATOM   2629 N  N   . ILE B 1 56  ? -16.090 -18.332 42.430  1.00 25.68 ? 943  ILE B N   1 
ATOM   2630 C  CA  . ILE B 1 56  ? -14.724 -17.933 42.724  1.00 25.49 ? 943  ILE B CA  1 
ATOM   2631 C  C   . ILE B 1 56  ? -14.546 -17.977 44.246  1.00 26.18 ? 943  ILE B C   1 
ATOM   2632 O  O   . ILE B 1 56  ? -14.694 -16.955 44.953  1.00 23.13 ? 943  ILE B O   1 
ATOM   2633 C  CB  . ILE B 1 56  ? -14.364 -16.515 42.168  1.00 26.27 ? 943  ILE B CB  1 
ATOM   2634 C  CG1 . ILE B 1 56  ? -14.638 -16.413 40.642  1.00 29.95 ? 943  ILE B CG1 1 
ATOM   2635 C  CG2 . ILE B 1 56  ? -12.916 -16.220 42.513  1.00 23.92 ? 943  ILE B CG2 1 
ATOM   2636 C  CD1 . ILE B 1 56  ? -13.705 -17.238 39.722  1.00 28.54 ? 943  ILE B CD1 1 
ATOM   2637 N  N   . ILE B 1 57  ? -14.300 -19.179 44.762  1.00 20.73 ? 944  ILE B N   1 
ATOM   2638 C  CA  . ILE B 1 57  ? -14.206 -19.430 46.215  1.00 19.71 ? 944  ILE B CA  1 
ATOM   2639 C  C   . ILE B 1 57  ? -12.922 -20.217 46.475  1.00 24.63 ? 944  ILE B C   1 
ATOM   2640 O  O   . ILE B 1 57  ? -12.274 -20.685 45.511  1.00 23.77 ? 944  ILE B O   1 
ATOM   2641 C  CB  . ILE B 1 57  ? -15.482 -20.118 46.775  1.00 21.71 ? 944  ILE B CB  1 
ATOM   2642 C  CG1 . ILE B 1 57  ? -15.637 -21.543 46.225  1.00 25.77 ? 944  ILE B CG1 1 
ATOM   2643 C  CG2 . ILE B 1 57  ? -16.714 -19.259 46.417  1.00 24.03 ? 944  ILE B CG2 1 
ATOM   2644 C  CD1 . ILE B 1 57  ? -16.901 -22.288 46.738  1.00 26.31 ? 944  ILE B CD1 1 
ATOM   2645 N  N   . SER B 1 58  ? -12.556 -20.290 47.757  1.00 24.05 ? 945  SER B N   1 
ATOM   2646 C  CA  . SER B 1 58  ? -11.218 -20.664 48.186  1.00 25.76 ? 945  SER B CA  1 
ATOM   2647 C  C   . SER B 1 58  ? -10.980 -22.181 48.180  1.00 23.76 ? 945  SER B C   1 
ATOM   2648 O  O   . SER B 1 58  ? -11.615 -22.898 48.902  1.00 21.66 ? 945  SER B O   1 
ATOM   2649 C  CB  . SER B 1 58  ? -11.001 -20.130 49.591  1.00 25.22 ? 945  SER B CB  1 
ATOM   2650 O  OG  . SER B 1 58  ? -9.743  -20.525 50.063  1.00 27.40 ? 945  SER B OG  1 
ATOM   2651 N  N   . TYR B 1 59  ? -9.986  -22.664 47.447  1.00 21.41 ? 946  TYR B N   1 
ATOM   2652 C  CA  . TYR B 1 59  ? -9.575  -24.073 47.569  1.00 21.38 ? 946  TYR B CA  1 
ATOM   2653 C  C   . TYR B 1 59  ? -9.082  -24.422 48.986  1.00 22.17 ? 946  TYR B C   1 
ATOM   2654 O  O   . TYR B 1 59  ? -8.365  -23.651 49.622  1.00 24.08 ? 946  TYR B O   1 
ATOM   2655 C  CB  . TYR B 1 59  ? -8.454  -24.397 46.602  1.00 24.92 ? 946  TYR B CB  1 
ATOM   2656 C  CG  . TYR B 1 59  ? -8.806  -24.310 45.134  1.00 22.23 ? 946  TYR B CG  1 
ATOM   2657 C  CD1 . TYR B 1 59  ? -10.036 -24.768 44.657  1.00 19.84 ? 946  TYR B CD1 1 
ATOM   2658 C  CD2 . TYR B 1 59  ? -7.882  -23.842 44.195  1.00 21.53 ? 946  TYR B CD2 1 
ATOM   2659 C  CE1 . TYR B 1 59  ? -10.342 -24.762 43.297  1.00 22.36 ? 946  TYR B CE1 1 
ATOM   2660 C  CE2 . TYR B 1 59  ? -8.173  -23.849 42.838  1.00 23.50 ? 946  TYR B CE2 1 
ATOM   2661 C  CZ  . TYR B 1 59  ? -9.404  -24.288 42.398  1.00 23.92 ? 946  TYR B CZ  1 
ATOM   2662 O  OH  . TYR B 1 59  ? -9.712  -24.271 41.068  1.00 21.21 ? 946  TYR B OH  1 
ATOM   2663 N  N   . ASP B 1 60  ? -9.460  -25.616 49.457  1.00 20.68 ? 947  ASP B N   1 
ATOM   2664 C  CA  . ASP B 1 60  ? -9.067  -26.121 50.789  1.00 25.06 ? 947  ASP B CA  1 
ATOM   2665 C  C   . ASP B 1 60  ? -7.543  -26.085 50.966  1.00 25.38 ? 947  ASP B C   1 
ATOM   2666 O  O   . ASP B 1 60  ? -7.022  -25.595 51.970  1.00 24.55 ? 947  ASP B O   1 
ATOM   2667 C  CB  . ASP B 1 60  ? -9.543  -27.577 50.973  1.00 24.22 ? 947  ASP B CB  1 
ATOM   2668 C  CG  . ASP B 1 60  ? -11.048 -27.707 50.959  1.00 19.37 ? 947  ASP B CG  1 
ATOM   2669 O  OD1 . ASP B 1 60  ? -11.690 -26.924 51.694  1.00 23.68 ? 947  ASP B OD1 1 
ATOM   2670 O  OD2 . ASP B 1 60  ? -11.589 -28.608 50.237  1.00 23.60 ? 947  ASP B OD2 1 
ATOM   2671 N  N   . HIS B 1 61  ? -6.821  -26.606 49.977  1.00 22.46 ? 948  HIS B N   1 
ATOM   2672 C  CA  . HIS B 1 61  ? -5.380  -26.820 50.120  1.00 24.18 ? 948  HIS B CA  1 
ATOM   2673 C  C   . HIS B 1 61  ? -4.526  -25.559 50.281  1.00 23.67 ? 948  HIS B C   1 
ATOM   2674 O  O   . HIS B 1 61  ? -3.446  -25.631 50.891  1.00 26.08 ? 948  HIS B O   1 
ATOM   2675 C  CB  . HIS B 1 61  ? -4.827  -27.700 48.976  1.00 25.50 ? 948  HIS B CB  1 
ATOM   2676 C  CG  . HIS B 1 61  ? -4.632  -26.983 47.681  1.00 23.64 ? 948  HIS B CG  1 
ATOM   2677 N  ND1 . HIS B 1 61  ? -5.653  -26.825 46.764  1.00 28.07 ? 948  HIS B ND1 1 
ATOM   2678 C  CD2 . HIS B 1 61  ? -3.526  -26.431 47.113  1.00 28.33 ? 948  HIS B CD2 1 
ATOM   2679 C  CE1 . HIS B 1 61  ? -5.201  -26.163 45.712  1.00 30.80 ? 948  HIS B CE1 1 
ATOM   2680 N  NE2 . HIS B 1 61  ? -3.915  -25.908 45.894  1.00 26.48 ? 948  HIS B NE2 1 
ATOM   2681 N  N   . SER B 1 62  ? -5.018  -24.416 49.804  1.00 19.19 ? 949  SER B N   1 
ATOM   2682 C  CA  . SER B 1 62  ? -4.250  -23.173 49.821  1.00 24.14 ? 949  SER B CA  1 
ATOM   2683 C  C   . SER B 1 62  ? -4.980  -22.106 50.602  1.00 20.82 ? 949  SER B C   1 
ATOM   2684 O  O   . SER B 1 62  ? -4.598  -20.940 50.612  1.00 21.75 ? 949  SER B O   1 
ATOM   2685 C  CB  . SER B 1 62  ? -4.019  -22.695 48.387  1.00 24.66 ? 949  SER B CB  1 
ATOM   2686 O  OG  . SER B 1 62  ? -5.267  -22.547 47.719  1.00 22.47 ? 949  SER B OG  1 
ATOM   2687 N  N   . ARG B 1 63  ? -6.053  -22.514 51.283  1.00 22.44 ? 950  ARG B N   1 
ATOM   2688 C  CA  . ARG B 1 63  ? -6.896  -21.544 51.921  1.00 25.14 ? 950  ARG B CA  1 
ATOM   2689 C  C   . ARG B 1 63  ? -6.204  -20.934 53.150  1.00 23.98 ? 950  ARG B C   1 
ATOM   2690 O  O   . ARG B 1 63  ? -5.381  -21.582 53.832  1.00 22.51 ? 950  ARG B O   1 
ATOM   2691 C  CB  . ARG B 1 63  ? -8.237  -22.207 52.240  1.00 28.44 ? 950  ARG B CB  1 
ATOM   2692 C  CG  . ARG B 1 63  ? -8.824  -22.015 53.508  1.00 34.44 ? 950  ARG B CG  1 
ATOM   2693 C  CD  . ARG B 1 63  ? -10.181 -22.717 53.482  1.00 26.41 ? 950  ARG B CD  1 
ATOM   2694 N  NE  . ARG B 1 63  ? -10.288 -23.609 54.599  1.00 24.75 ? 950  ARG B NE  1 
ATOM   2695 C  CZ  . ARG B 1 63  ? -10.592 -23.238 55.839  1.00 25.99 ? 950  ARG B CZ  1 
ATOM   2696 N  NH1 . ARG B 1 63  ? -10.710 -24.174 56.761  1.00 27.25 ? 950  ARG B NH1 1 
ATOM   2697 N  NH2 . ARG B 1 63  ? -10.811 -21.961 56.149  1.00 24.83 ? 950  ARG B NH2 1 
ATOM   2698 N  N   . VAL B 1 64  ? -6.492  -19.660 53.368  1.00 25.24 ? 951  VAL B N   1 
ATOM   2699 C  CA  . VAL B 1 64  ? -5.979  -18.949 54.550  1.00 23.78 ? 951  VAL B CA  1 
ATOM   2700 C  C   . VAL B 1 64  ? -6.944  -19.245 55.699  1.00 23.39 ? 951  VAL B C   1 
ATOM   2701 O  O   . VAL B 1 64  ? -8.067  -18.736 55.721  1.00 26.32 ? 951  VAL B O   1 
ATOM   2702 C  CB  . VAL B 1 64  ? -5.860  -17.430 54.390  1.00 21.63 ? 951  VAL B CB  1 
ATOM   2703 C  CG1 . VAL B 1 64  ? -5.227  -16.786 55.657  1.00 26.64 ? 951  VAL B CG1 1 
ATOM   2704 C  CG2 . VAL B 1 64  ? -5.049  -17.039 53.138  1.00 21.49 ? 951  VAL B CG2 1 
ATOM   2705 N  N   . ARG B 1 65  ? -6.516  -20.075 56.621  1.00 22.63 ? 952  ARG B N   1 
ATOM   2706 C  CA  . ARG B 1 65  ? -7.386  -20.440 57.755  1.00 22.84 ? 952  ARG B CA  1 
ATOM   2707 C  C   . ARG B 1 65  ? -7.231  -19.453 58.919  1.00 26.27 ? 952  ARG B C   1 
ATOM   2708 O  O   . ARG B 1 65  ? -6.101  -19.168 59.379  1.00 31.98 ? 952  ARG B O   1 
ATOM   2709 C  CB  . ARG B 1 65  ? -7.065  -21.840 58.250  1.00 22.83 ? 952  ARG B CB  1 
ATOM   2710 C  CG  . ARG B 1 65  ? -7.095  -22.915 57.227  1.00 34.06 ? 952  ARG B CG  1 
ATOM   2711 C  CD  . ARG B 1 65  ? -6.790  -24.177 57.963  1.00 41.21 ? 952  ARG B CD  1 
ATOM   2712 N  NE  . ARG B 1 65  ? -6.865  -25.344 57.135  1.00 51.34 ? 952  ARG B NE  1 
ATOM   2713 C  CZ  . ARG B 1 65  ? -7.409  -26.483 57.535  1.00 54.76 ? 952  ARG B CZ  1 
ATOM   2714 N  NH1 . ARG B 1 65  ? -7.987  -26.593 58.746  1.00 54.16 ? 952  ARG B NH1 1 
ATOM   2715 N  NH2 . ARG B 1 65  ? -7.416  -27.497 56.697  1.00 57.99 ? 952  ARG B NH2 1 
ATOM   2716 N  N   . LEU B 1 66  ? -8.359  -18.937 59.405  1.00 21.75 ? 953  LEU B N   1 
ATOM   2717 C  CA  . LEU B 1 66  ? -8.382  -18.073 60.571  1.00 26.74 ? 953  LEU B CA  1 
ATOM   2718 C  C   . LEU B 1 66  ? -8.545  -18.903 61.873  1.00 25.38 ? 953  LEU B C   1 
ATOM   2719 O  O   . LEU B 1 66  ? -9.292  -19.892 61.929  1.00 23.71 ? 953  LEU B O   1 
ATOM   2720 C  CB  . LEU B 1 66  ? -9.537  -17.083 60.439  1.00 25.51 ? 953  LEU B CB  1 
ATOM   2721 C  CG  . LEU B 1 66  ? -9.478  -16.218 59.155  1.00 29.47 ? 953  LEU B CG  1 
ATOM   2722 C  CD1 . LEU B 1 66  ? -10.508 -15.138 59.228  1.00 29.79 ? 953  LEU B CD1 1 
ATOM   2723 C  CD2 . LEU B 1 66  ? -8.094  -15.616 58.941  1.00 28.71 ? 953  LEU B CD2 1 
ATOM   2724 N  N   . LEU B 1 67  ? -7.839  -18.490 62.916  1.00 25.61 ? 954  LEU B N   1 
ATOM   2725 C  CA  . LEU B 1 67  ? -8.060  -19.055 64.237  1.00 33.81 ? 954  LEU B CA  1 
ATOM   2726 C  C   . LEU B 1 67  ? -9.504  -18.834 64.626  1.00 32.35 ? 954  LEU B C   1 
ATOM   2727 O  O   . LEU B 1 67  ? -10.050 -17.766 64.400  1.00 35.39 ? 954  LEU B O   1 
ATOM   2728 C  CB  . LEU B 1 67  ? -7.115  -18.424 65.246  1.00 33.13 ? 954  LEU B CB  1 
ATOM   2729 C  CG  . LEU B 1 67  ? -5.663  -18.894 65.092  1.00 41.08 ? 954  LEU B CG  1 
ATOM   2730 C  CD1 . LEU B 1 67  ? -4.723  -18.064 65.992  1.00 47.03 ? 954  LEU B CD1 1 
ATOM   2731 C  CD2 . LEU B 1 67  ? -5.572  -20.382 65.435  1.00 37.15 ? 954  LEU B CD2 1 
ATOM   2732 N  N   . VAL B 1 68  ? -10.133 -19.849 65.205  1.00 30.69 ? 955  VAL B N   1 
ATOM   2733 C  CA  . VAL B 1 68  ? -11.586 -19.797 65.442  1.00 34.71 ? 955  VAL B CA  1 
ATOM   2734 C  C   . VAL B 1 68  ? -12.001 -18.826 66.565  1.00 45.88 ? 955  VAL B C   1 
ATOM   2735 O  O   . VAL B 1 68  ? -11.298 -18.695 67.574  1.00 39.48 ? 955  VAL B O   1 
ATOM   2736 C  CB  . VAL B 1 68  ? -12.128 -21.240 65.701  1.00 36.49 ? 955  VAL B CB  1 
ATOM   2737 C  CG1 . VAL B 1 68  ? -13.296 -21.242 66.668  1.00 40.78 ? 955  VAL B CG1 1 
ATOM   2738 C  CG2 . VAL B 1 68  ? -12.501 -21.910 64.343  1.00 33.10 ? 955  VAL B CG2 1 
ATOM   2739 N  N   . LEU B 1 69  ? -13.125 -18.124 66.365  1.00 37.11 ? 956  LEU B N   1 
ATOM   2740 C  CA  . LEU B 1 69  ? -13.702 -17.293 67.405  1.00 31.12 ? 956  LEU B CA  1 
ATOM   2741 C  C   . LEU B 1 69  ? -14.506 -18.197 68.324  1.00 38.83 ? 956  LEU B C   1 
ATOM   2742 O  O   . LEU B 1 69  ? -15.207 -19.107 67.873  1.00 32.87 ? 956  LEU B O   1 
ATOM   2743 C  CB  . LEU B 1 69  ? -14.612 -16.227 66.819  1.00 39.12 ? 956  LEU B CB  1 
ATOM   2744 C  CG  . LEU B 1 69  ? -13.902 -15.254 65.879  1.00 45.31 ? 956  LEU B CG  1 
ATOM   2745 C  CD1 . LEU B 1 69  ? -14.935 -14.342 65.220  1.00 34.95 ? 956  LEU B CD1 1 
ATOM   2746 C  CD2 . LEU B 1 69  ? -12.858 -14.460 66.656  1.00 50.41 ? 956  LEU B CD2 1 
ATOM   2747 N  N   . ASP B 1 70  ? -14.411 -17.934 69.619  1.00 40.64 ? 957  ASP B N   1 
ATOM   2748 C  CA  . ASP B 1 70  ? -15.108 -18.735 70.595  1.00 41.50 ? 957  ASP B CA  1 
ATOM   2749 C  C   . ASP B 1 70  ? -16.558 -18.946 70.232  1.00 40.87 ? 957  ASP B C   1 
ATOM   2750 O  O   . ASP B 1 70  ? -17.290 -17.991 69.971  1.00 48.45 ? 957  ASP B O   1 
ATOM   2751 C  CB  . ASP B 1 70  ? -15.033 -18.074 71.983  1.00 56.52 ? 957  ASP B CB  1 
ATOM   2752 C  CG  . ASP B 1 70  ? -13.811 -18.485 72.745  1.00 64.90 ? 957  ASP B CG  1 
ATOM   2753 O  OD1 . ASP B 1 70  ? -13.773 -19.663 73.164  1.00 77.71 ? 957  ASP B OD1 1 
ATOM   2754 O  OD2 . ASP B 1 70  ? -12.900 -17.640 72.922  1.00 75.71 ? 957  ASP B OD2 1 
ATOM   2755 N  N   . GLY B 1 71  ? -16.970 -20.204 70.196  1.00 36.25 ? 958  GLY B N   1 
ATOM   2756 C  CA  . GLY B 1 71  ? -18.365 -20.526 69.973  1.00 39.25 ? 958  GLY B CA  1 
ATOM   2757 C  C   . GLY B 1 71  ? -18.811 -20.604 68.526  1.00 47.11 ? 958  GLY B C   1 
ATOM   2758 O  O   . GLY B 1 71  ? -19.970 -20.917 68.276  1.00 47.17 ? 958  GLY B O   1 
ATOM   2759 N  N   . ASP B 1 72  ? -17.915 -20.327 67.569  1.00 43.39 ? 959  ASP B N   1 
ATOM   2760 C  CA  . ASP B 1 72  ? -18.273 -20.415 66.150  1.00 41.60 ? 959  ASP B CA  1 
ATOM   2761 C  C   . ASP B 1 72  ? -17.249 -21.242 65.359  1.00 41.07 ? 959  ASP B C   1 
ATOM   2762 O  O   . ASP B 1 72  ? -16.192 -20.728 64.942  1.00 31.55 ? 959  ASP B O   1 
ATOM   2763 C  CB  . ASP B 1 72  ? -18.440 -19.031 65.536  1.00 27.91 ? 959  ASP B CB  1 
ATOM   2764 C  CG  . ASP B 1 72  ? -18.940 -19.097 64.107  1.00 40.88 ? 959  ASP B CG  1 
ATOM   2765 O  OD1 . ASP B 1 72  ? -19.286 -20.202 63.621  1.00 38.30 ? 959  ASP B OD1 1 
ATOM   2766 O  OD2 . ASP B 1 72  ? -18.979 -18.037 63.460  1.00 43.52 ? 959  ASP B OD2 1 
ATOM   2767 N  N   . PRO B 1 73  ? -17.559 -22.529 65.144  1.00 40.02 ? 960  PRO B N   1 
ATOM   2768 C  CA  . PRO B 1 73  ? -16.639 -23.435 64.443  1.00 36.38 ? 960  PRO B CA  1 
ATOM   2769 C  C   . PRO B 1 73  ? -16.496 -23.134 62.944  1.00 40.68 ? 960  PRO B C   1 
ATOM   2770 O  O   . PRO B 1 73  ? -15.586 -23.657 62.295  1.00 43.86 ? 960  PRO B O   1 
ATOM   2771 C  CB  . PRO B 1 73  ? -17.270 -24.818 64.673  1.00 41.23 ? 960  PRO B CB  1 
ATOM   2772 C  CG  . PRO B 1 73  ? -18.696 -24.557 64.867  1.00 43.95 ? 960  PRO B CG  1 
ATOM   2773 C  CD  . PRO B 1 73  ? -18.807 -23.215 65.541  1.00 42.73 ? 960  PRO B CD  1 
ATOM   2774 N  N   . HIS B 1 74  ? -17.375 -22.301 62.385  1.00 30.10 ? 961  HIS B N   1 
ATOM   2775 C  CA  . HIS B 1 74  ? -17.200 -21.869 61.008  1.00 26.05 ? 961  HIS B CA  1 
ATOM   2776 C  C   . HIS B 1 74  ? -16.509 -20.522 60.901  1.00 31.92 ? 961  HIS B C   1 
ATOM   2777 O  O   . HIS B 1 74  ? -16.333 -20.004 59.799  1.00 28.83 ? 961  HIS B O   1 
ATOM   2778 C  CB  . HIS B 1 74  ? -18.529 -21.856 60.271  1.00 35.92 ? 961  HIS B CB  1 
ATOM   2779 C  CG  . HIS B 1 74  ? -18.989 -23.215 59.847  1.00 34.06 ? 961  HIS B CG  1 
ATOM   2780 N  ND1 . HIS B 1 74  ? -19.858 -23.966 60.604  1.00 33.31 ? 961  HIS B ND1 1 
ATOM   2781 C  CD2 . HIS B 1 74  ? -18.693 -23.962 58.753  1.00 36.03 ? 961  HIS B CD2 1 
ATOM   2782 C  CE1 . HIS B 1 74  ? -20.078 -25.121 60.002  1.00 43.82 ? 961  HIS B CE1 1 
ATOM   2783 N  NE2 . HIS B 1 74  ? -19.398 -25.138 58.868  1.00 44.68 ? 961  HIS B NE2 1 
ATOM   2784 N  N   . SER B 1 75  ? -16.027 -19.993 62.032  1.00 26.78 ? 962  SER B N   1 
ATOM   2785 C  CA  . SER B 1 75  ? -15.339 -18.698 62.008  1.00 23.22 ? 962  SER B CA  1 
ATOM   2786 C  C   . SER B 1 75  ? -13.856 -18.767 61.538  1.00 23.74 ? 962  SER B C   1 
ATOM   2787 O  O   . SER B 1 75  ? -13.088 -17.768 61.615  1.00 26.12 ? 962  SER B O   1 
ATOM   2788 C  CB  . SER B 1 75  ? -15.473 -18.022 63.373  1.00 33.38 ? 962  SER B CB  1 
ATOM   2789 O  OG  . SER B 1 75  ? -14.759 -18.721 64.363  1.00 30.17 ? 962  SER B OG  1 
ATOM   2790 N  N   . ASP B 1 76  ? -13.459 -19.910 60.981  1.00 24.39 ? 963  ASP B N   1 
ATOM   2791 C  CA  . ASP B 1 76  ? -12.124 -20.069 60.418  1.00 19.41 ? 963  ASP B CA  1 
ATOM   2792 C  C   . ASP B 1 76  ? -12.041 -19.692 58.949  1.00 24.59 ? 963  ASP B C   1 
ATOM   2793 O  O   . ASP B 1 76  ? -10.970 -19.781 58.358  1.00 26.65 ? 963  ASP B O   1 
ATOM   2794 C  CB  . ASP B 1 76  ? -11.606 -21.514 60.584  1.00 25.08 ? 963  ASP B CB  1 
ATOM   2795 C  CG  . ASP B 1 76  ? -12.339 -22.514 59.714  1.00 28.97 ? 963  ASP B CG  1 
ATOM   2796 O  OD1 . ASP B 1 76  ? -13.559 -22.326 59.457  1.00 33.58 ? 963  ASP B OD1 1 
ATOM   2797 O  OD2 . ASP B 1 76  ? -11.702 -23.544 59.360  1.00 25.97 ? 963  ASP B OD2 1 
ATOM   2798 N  N   . TYR B 1 77  ? -13.166 -19.264 58.372  1.00 24.16 ? 964  TYR B N   1 
ATOM   2799 C  CA  . TYR B 1 77  ? -13.263 -19.095 56.931  1.00 22.69 ? 964  TYR B CA  1 
ATOM   2800 C  C   . TYR B 1 77  ? -13.199 -17.645 56.474  1.00 25.30 ? 964  TYR B C   1 
ATOM   2801 O  O   . TYR B 1 77  ? -13.998 -16.790 56.919  1.00 22.44 ? 964  TYR B O   1 
ATOM   2802 C  CB  . TYR B 1 77  ? -14.551 -19.677 56.383  1.00 27.47 ? 964  TYR B CB  1 
ATOM   2803 C  CG  . TYR B 1 77  ? -14.576 -19.605 54.864  1.00 22.47 ? 964  TYR B CG  1 
ATOM   2804 C  CD1 . TYR B 1 77  ? -13.713 -20.407 54.081  1.00 21.83 ? 964  TYR B CD1 1 
ATOM   2805 C  CD2 . TYR B 1 77  ? -15.366 -18.674 54.219  1.00 25.49 ? 964  TYR B CD2 1 
ATOM   2806 C  CE1 . TYR B 1 77  ? -13.738 -20.319 52.665  1.00 20.13 ? 964  TYR B CE1 1 
ATOM   2807 C  CE2 . TYR B 1 77  ? -15.377 -18.562 52.831  1.00 21.45 ? 964  TYR B CE2 1 
ATOM   2808 C  CZ  . TYR B 1 77  ? -14.567 -19.363 52.057  1.00 24.90 ? 964  TYR B CZ  1 
ATOM   2809 O  OH  . TYR B 1 77  ? -14.600 -19.216 50.689  1.00 23.93 ? 964  TYR B OH  1 
ATOM   2810 N  N   . ILE B 1 78  ? -12.334 -17.440 55.473  1.00 21.57 ? 965  ILE B N   1 
ATOM   2811 C  CA  . ILE B 1 78  ? -12.381 -16.283 54.609  1.00 21.48 ? 965  ILE B CA  1 
ATOM   2812 C  C   . ILE B 1 78  ? -12.073 -16.724 53.180  1.00 22.57 ? 965  ILE B C   1 
ATOM   2813 O  O   . ILE B 1 78  ? -11.289 -17.663 52.931  1.00 22.89 ? 965  ILE B O   1 
ATOM   2814 C  CB  . ILE B 1 78  ? -11.398 -15.199 55.125  1.00 20.78 ? 965  ILE B CB  1 
ATOM   2815 C  CG1 . ILE B 1 78  ? -11.473 -13.904 54.299  1.00 25.47 ? 965  ILE B CG1 1 
ATOM   2816 C  CG2 . ILE B 1 78  ? -9.926  -15.733 55.168  1.00 19.78 ? 965  ILE B CG2 1 
ATOM   2817 C  CD1 . ILE B 1 78  ? -10.843 -12.691 54.958  1.00 23.27 ? 965  ILE B CD1 1 
ATOM   2818 N  N   . ASN B 1 79  ? -12.717 -16.078 52.219  1.00 21.05 ? 966  ASN B N   1 
ATOM   2819 C  CA  . ASN B 1 79  ? -12.508 -16.408 50.840  1.00 22.77 ? 966  ASN B CA  1 
ATOM   2820 C  C   . ASN B 1 79  ? -11.163 -15.843 50.375  1.00 21.68 ? 966  ASN B C   1 
ATOM   2821 O  O   . ASN B 1 79  ? -11.114 -14.816 49.665  1.00 22.98 ? 966  ASN B O   1 
ATOM   2822 C  CB  . ASN B 1 79  ? -13.654 -15.893 49.933  1.00 21.32 ? 966  ASN B CB  1 
ATOM   2823 C  CG  . ASN B 1 79  ? -13.519 -16.396 48.529  1.00 25.40 ? 966  ASN B CG  1 
ATOM   2824 O  OD1 . ASN B 1 79  ? -12.702 -17.286 48.286  1.00 25.17 ? 966  ASN B OD1 1 
ATOM   2825 N  ND2 . ASN B 1 79  ? -14.310 -15.851 47.598  1.00 22.90 ? 966  ASN B ND2 1 
ATOM   2826 N  N   . ALA B 1 80  ? -10.098 -16.560 50.713  1.00 24.12 ? 967  ALA B N   1 
ATOM   2827 C  CA  . ALA B 1 80  ? -8.728  -16.100 50.457  1.00 25.28 ? 967  ALA B CA  1 
ATOM   2828 C  C   . ALA B 1 80  ? -7.836  -17.313 50.301  1.00 22.44 ? 967  ALA B C   1 
ATOM   2829 O  O   . ALA B 1 80  ? -8.083  -18.341 50.935  1.00 23.32 ? 967  ALA B O   1 
ATOM   2830 C  CB  . ALA B 1 80  ? -8.214  -15.257 51.635  1.00 23.22 ? 967  ALA B CB  1 
ATOM   2831 N  N   . ASN B 1 81  ? -6.789  -17.190 49.475  1.00 20.34 ? 968  ASN B N   1 
ATOM   2832 C  CA  . ASN B 1 81  ? -5.831  -18.285 49.279  1.00 17.13 ? 968  ASN B CA  1 
ATOM   2833 C  C   . ASN B 1 81  ? -4.422  -17.739 49.249  1.00 20.93 ? 968  ASN B C   1 
ATOM   2834 O  O   . ASN B 1 81  ? -4.197  -16.679 48.653  1.00 21.87 ? 968  ASN B O   1 
ATOM   2835 C  CB  . ASN B 1 81  ? -6.113  -19.003 47.949  1.00 20.48 ? 968  ASN B CB  1 
ATOM   2836 C  CG  . ASN B 1 81  ? -7.408  -19.698 47.968  1.00 25.52 ? 968  ASN B CG  1 
ATOM   2837 O  OD1 . ASN B 1 81  ? -8.437  -19.068 47.666  1.00 22.82 ? 968  ASN B OD1 1 
ATOM   2838 N  ND2 . ASN B 1 81  ? -7.419  -20.945 48.437  1.00 21.44 ? 968  ASN B ND2 1 
ATOM   2839 N  N   . TYR B 1 82  ? -3.505  -18.429 49.878  1.00 22.36 ? 969  TYR B N   1 
ATOM   2840 C  CA  . TYR B 1 82  ? -2.094  -18.134 49.708  1.00 22.36 ? 969  TYR B CA  1 
ATOM   2841 C  C   . TYR B 1 82  ? -1.707  -18.357 48.241  1.00 29.05 ? 969  TYR B C   1 
ATOM   2842 O  O   . TYR B 1 82  ? -2.124  -19.339 47.618  1.00 23.84 ? 969  TYR B O   1 
ATOM   2843 C  CB  . TYR B 1 82  ? -1.255  -19.046 50.553  1.00 27.94 ? 969  TYR B CB  1 
ATOM   2844 C  CG  . TYR B 1 82  ? -1.465  -18.889 52.041  1.00 24.34 ? 969  TYR B CG  1 
ATOM   2845 C  CD1 . TYR B 1 82  ? -1.051  -17.726 52.708  1.00 23.96 ? 969  TYR B CD1 1 
ATOM   2846 C  CD2 . TYR B 1 82  ? -2.065  -19.919 52.789  1.00 22.84 ? 969  TYR B CD2 1 
ATOM   2847 C  CE1 . TYR B 1 82  ? -1.182  -17.632 54.086  1.00 24.90 ? 969  TYR B CE1 1 
ATOM   2848 C  CE2 . TYR B 1 82  ? -2.231  -19.817 54.178  1.00 24.90 ? 969  TYR B CE2 1 
ATOM   2849 C  CZ  . TYR B 1 82  ? -1.825  -18.656 54.816  1.00 22.70 ? 969  TYR B CZ  1 
ATOM   2850 O  OH  . TYR B 1 82  ? -1.962  -18.532 56.197  1.00 25.16 ? 969  TYR B OH  1 
ATOM   2851 N  N   . ILE B 1 83  ? -0.849  -17.492 47.729  1.00 21.61 ? 970  ILE B N   1 
ATOM   2852 C  CA  . ILE B 1 83  ? -0.276  -17.659 46.401  1.00 19.69 ? 970  ILE B CA  1 
ATOM   2853 C  C   . ILE B 1 83  ? 1.241   -17.479 46.490  1.00 24.88 ? 970  ILE B C   1 
ATOM   2854 O  O   . ILE B 1 83  ? 1.732   -16.501 47.078  1.00 26.26 ? 970  ILE B O   1 
ATOM   2855 C  CB  . ILE B 1 83  ? -0.869  -16.588 45.442  1.00 17.66 ? 970  ILE B CB  1 
ATOM   2856 C  CG1 . ILE B 1 83  ? -2.399  -16.503 45.498  1.00 22.43 ? 970  ILE B CG1 1 
ATOM   2857 C  CG2 . ILE B 1 83  ? -0.384  -16.815 43.997  1.00 21.16 ? 970  ILE B CG2 1 
ATOM   2858 C  CD1 . ILE B 1 83  ? -3.159  -17.693 44.944  1.00 28.79 ? 970  ILE B CD1 1 
ATOM   2859 N  N   . ASP B 1 84  ? 1.980   -18.401 45.891  1.00 22.93 ? 971  ASP B N   1 
ATOM   2860 C  CA  . ASP B 1 84  ? 3.435   -18.389 45.855  1.00 18.28 ? 971  ASP B CA  1 
ATOM   2861 C  C   . ASP B 1 84  ? 3.918   -17.268 44.955  1.00 25.84 ? 971  ASP B C   1 
ATOM   2862 O  O   . ASP B 1 84  ? 3.274   -16.935 43.978  1.00 25.56 ? 971  ASP B O   1 
ATOM   2863 C  CB  . ASP B 1 84  ? 4.016   -19.739 45.368  1.00 23.86 ? 971  ASP B CB  1 
ATOM   2864 C  CG  . ASP B 1 84  ? 3.788   -20.878 46.341  1.00 26.72 ? 971  ASP B CG  1 
ATOM   2865 O  OD1 . ASP B 1 84  ? 3.343   -20.633 47.474  1.00 25.71 ? 971  ASP B OD1 1 
ATOM   2866 O  OD2 . ASP B 1 84  ? 4.026   -22.045 45.945  1.00 29.24 ? 971  ASP B OD2 1 
ATOM   2867 N  N   . GLY B 1 85  ? 5.026   -16.644 45.355  1.00 24.84 ? 972  GLY B N   1 
ATOM   2868 C  CA  . GLY B 1 85  ? 5.696   -15.662 44.528  1.00 28.77 ? 972  GLY B CA  1 
ATOM   2869 C  C   . GLY B 1 85  ? 6.801   -16.273 43.738  1.00 27.00 ? 972  GLY B C   1 
ATOM   2870 O  O   . GLY B 1 85  ? 7.072   -17.493 43.833  1.00 25.02 ? 972  GLY B O   1 
ATOM   2871 N  N   . TYR B 1 86  ? 7.469   -15.430 42.944  1.00 23.81 ? 973  TYR B N   1 
ATOM   2872 C  CA  . TYR B 1 86  ? 8.623   -15.872 42.214  1.00 23.20 ? 973  TYR B CA  1 
ATOM   2873 C  C   . TYR B 1 86  ? 9.721   -16.372 43.149  1.00 27.96 ? 973  TYR B C   1 
ATOM   2874 O  O   . TYR B 1 86  ? 10.355  -17.373 42.831  1.00 26.11 ? 973  TYR B O   1 
ATOM   2875 C  CB  . TYR B 1 86  ? 9.225   -14.735 41.366  1.00 27.46 ? 973  TYR B CB  1 
ATOM   2876 C  CG  . TYR B 1 86  ? 10.483  -15.145 40.646  1.00 21.47 ? 973  TYR B CG  1 
ATOM   2877 C  CD1 . TYR B 1 86  ? 10.432  -16.027 39.564  1.00 25.51 ? 973  TYR B CD1 1 
ATOM   2878 C  CD2 . TYR B 1 86  ? 11.733  -14.659 41.037  1.00 25.15 ? 973  TYR B CD2 1 
ATOM   2879 C  CE1 . TYR B 1 86  ? 11.583  -16.434 38.906  1.00 25.20 ? 973  TYR B CE1 1 
ATOM   2880 C  CE2 . TYR B 1 86  ? 12.880  -15.046 40.383  1.00 30.93 ? 973  TYR B CE2 1 
ATOM   2881 C  CZ  . TYR B 1 86  ? 12.805  -15.923 39.318  1.00 27.73 ? 973  TYR B CZ  1 
ATOM   2882 O  OH  . TYR B 1 86  ? 13.930  -16.327 38.652  1.00 29.98 ? 973  TYR B OH  1 
ATOM   2883 N  N   . HIS B 1 87  ? 9.968   -15.654 44.238  1.00 29.74 ? 974  HIS B N   1 
ATOM   2884 C  CA  . HIS B 1 87  ? 11.059  -15.998 45.170  1.00 38.34 ? 974  HIS B CA  1 
ATOM   2885 C  C   . HIS B 1 87  ? 10.600  -16.906 46.348  1.00 31.41 ? 974  HIS B C   1 
ATOM   2886 O  O   . HIS B 1 87  ? 11.324  -17.779 46.766  1.00 35.12 ? 974  HIS B O   1 
ATOM   2887 C  CB  . HIS B 1 87  ? 11.707  -14.710 45.764  1.00 38.35 ? 974  HIS B CB  1 
ATOM   2888 C  CG  . HIS B 1 87  ? 12.319  -13.768 44.752  1.00 39.29 ? 974  HIS B CG  1 
ATOM   2889 N  ND1 . HIS B 1 87  ? 13.566  -13.976 44.182  1.00 33.25 ? 974  HIS B ND1 1 
ATOM   2890 C  CD2 . HIS B 1 87  ? 11.885  -12.572 44.277  1.00 38.40 ? 974  HIS B CD2 1 
ATOM   2891 C  CE1 . HIS B 1 87  ? 13.847  -12.973 43.368  1.00 42.40 ? 974  HIS B CE1 1 
ATOM   2892 N  NE2 . HIS B 1 87  ? 12.845  -12.107 43.408  1.00 36.56 ? 974  HIS B NE2 1 
ATOM   2893 N  N   . ARG B 1 88  ? 9.403   -16.679 46.858  1.00 27.62 ? 975  ARG B N   1 
ATOM   2894 C  CA  . ARG B 1 88  ? 8.971   -17.165 48.147  1.00 26.82 ? 975  ARG B CA  1 
ATOM   2895 C  C   . ARG B 1 88  ? 7.592   -17.756 48.120  1.00 28.89 ? 975  ARG B C   1 
ATOM   2896 O  O   . ARG B 1 88  ? 6.683   -17.185 47.507  1.00 25.63 ? 975  ARG B O   1 
ATOM   2897 C  CB  . ARG B 1 88  ? 8.909   -15.998 49.152  1.00 31.14 ? 975  ARG B CB  1 
ATOM   2898 C  CG  . ARG B 1 88  ? 10.244  -15.384 49.457  1.00 36.75 ? 975  ARG B CG  1 
ATOM   2899 C  CD  . ARG B 1 88  ? 10.143  -14.230 50.461  1.00 42.77 ? 975  ARG B CD  1 
ATOM   2900 N  NE  . ARG B 1 88  ? 11.478  -13.645 50.685  1.00 42.79 ? 975  ARG B NE  1 
ATOM   2901 C  CZ  . ARG B 1 88  ? 11.753  -12.666 51.554  1.00 48.48 ? 975  ARG B CZ  1 
ATOM   2902 N  NH1 . ARG B 1 88  ? 10.804  -12.163 52.342  1.00 41.17 ? 975  ARG B NH1 1 
ATOM   2903 N  NH2 . ARG B 1 88  ? 12.996  -12.216 51.647  1.00 37.15 ? 975  ARG B NH2 1 
ATOM   2904 N  N   . PRO B 1 89  ? 7.403   -18.881 48.834  1.00 25.56 ? 976  PRO B N   1 
ATOM   2905 C  CA  . PRO B 1 89  ? 6.057   -19.439 48.876  1.00 25.72 ? 976  PRO B CA  1 
ATOM   2906 C  C   . PRO B 1 89  ? 5.143   -18.559 49.721  1.00 31.38 ? 976  PRO B C   1 
ATOM   2907 O  O   . PRO B 1 89  ? 5.646   -17.867 50.595  1.00 25.74 ? 976  PRO B O   1 
ATOM   2908 C  CB  . PRO B 1 89  ? 6.280   -20.821 49.512  1.00 28.54 ? 976  PRO B CB  1 
ATOM   2909 C  CG  . PRO B 1 89  ? 7.488   -20.650 50.367  1.00 32.32 ? 976  PRO B CG  1 
ATOM   2910 C  CD  . PRO B 1 89  ? 8.372   -19.682 49.611  1.00 32.20 ? 976  PRO B CD  1 
ATOM   2911 N  N   . ARG B 1 90  ? 3.828   -18.570 49.456  1.00 26.99 ? 977  ARG B N   1 
ATOM   2912 C  CA  . ARG B 1 90  ? 2.900   -17.804 50.272  1.00 25.16 ? 977  ARG B CA  1 
ATOM   2913 C  C   . ARG B 1 90  ? 3.290   -16.341 50.333  1.00 22.93 ? 977  ARG B C   1 
ATOM   2914 O  O   . ARG B 1 90  ? 3.130   -15.685 51.350  1.00 28.49 ? 977  ARG B O   1 
ATOM   2915 C  CB  A ARG B 1 90  ? 2.875   -18.422 51.691  0.50 30.37 ? 977  ARG B CB  1 
ATOM   2916 C  CB  B ARG B 1 90  ? 2.807   -18.332 51.690  0.50 22.86 ? 977  ARG B CB  1 
ATOM   2917 C  CG  A ARG B 1 90  ? 1.784   -19.457 52.021  0.50 45.04 ? 977  ARG B CG  1 
ATOM   2918 C  CG  B ARG B 1 90  ? 2.378   -19.737 51.753  0.50 20.80 ? 977  ARG B CG  1 
ATOM   2919 C  CD  A ARG B 1 90  ? 1.611   -20.708 51.126  0.50 49.34 ? 977  ARG B CD  1 
ATOM   2920 C  CD  B ARG B 1 90  ? 2.400   -20.207 53.219  0.50 29.15 ? 977  ARG B CD  1 
ATOM   2921 N  NE  A ARG B 1 90  ? 0.811   -21.726 51.853  0.50 32.44 ? 977  ARG B NE  1 
ATOM   2922 N  NE  B ARG B 1 90  ? 1.403   -21.227 53.423  0.50 35.10 ? 977  ARG B NE  1 
ATOM   2923 C  CZ  A ARG B 1 90  ? -0.012  -22.640 51.317  0.50 32.97 ? 977  ARG B CZ  1 
ATOM   2924 C  CZ  B ARG B 1 90  ? 0.872   -21.575 54.599  0.50 42.13 ? 977  ARG B CZ  1 
ATOM   2925 N  NH1 A ARG B 1 90  ? -0.657  -23.478 52.127  0.50 43.85 ? 977  ARG B NH1 1 
ATOM   2926 N  NH1 B ARG B 1 90  ? 1.227   -20.980 55.739  0.50 42.30 ? 977  ARG B NH1 1 
ATOM   2927 N  NH2 A ARG B 1 90  ? -0.221  -22.730 49.999  0.50 32.96 ? 977  ARG B NH2 1 
ATOM   2928 N  NH2 B ARG B 1 90  ? -0.044  -22.526 54.621  0.50 29.16 ? 977  ARG B NH2 1 
ATOM   2929 N  N   . HIS B 1 91  ? 3.833   -15.836 49.237  1.00 24.08 ? 978  HIS B N   1 
ATOM   2930 C  CA  . HIS B 1 91  ? 4.178   -14.450 49.102  1.00 24.06 ? 978  HIS B CA  1 
ATOM   2931 C  C   . HIS B 1 91  ? 2.963   -13.514 49.102  1.00 25.58 ? 978  HIS B C   1 
ATOM   2932 O  O   . HIS B 1 91  ? 3.071   -12.377 49.586  1.00 24.17 ? 978  HIS B O   1 
ATOM   2933 C  CB  . HIS B 1 91  ? 5.030   -14.225 47.853  1.00 24.09 ? 978  HIS B CB  1 
ATOM   2934 C  CG  . HIS B 1 91  ? 5.560   -12.836 47.747  1.00 32.00 ? 978  HIS B CG  1 
ATOM   2935 N  ND1 . HIS B 1 91  ? 6.494   -12.333 48.626  1.00 34.85 ? 978  HIS B ND1 1 
ATOM   2936 C  CD2 . HIS B 1 91  ? 5.271   -11.833 46.892  1.00 31.93 ? 978  HIS B CD2 1 
ATOM   2937 C  CE1 . HIS B 1 91  ? 6.791   -11.092 48.282  1.00 48.08 ? 978  HIS B CE1 1 
ATOM   2938 N  NE2 . HIS B 1 91  ? 6.060   -10.764 47.235  1.00 32.18 ? 978  HIS B NE2 1 
ATOM   2939 N  N   . TYR B 1 92  ? 1.847   -13.936 48.493  1.00 20.14 ? 979  TYR B N   1 
ATOM   2940 C  CA  . TYR B 1 92  ? 0.632   -13.151 48.468  1.00 21.50 ? 979  TYR B CA  1 
ATOM   2941 C  C   . TYR B 1 92  ? -0.519  -13.930 49.111  1.00 23.69 ? 979  TYR B C   1 
ATOM   2942 O  O   . TYR B 1 92  ? -0.457  -15.177 49.272  1.00 24.02 ? 979  TYR B O   1 
ATOM   2943 C  CB  . TYR B 1 92  ? 0.190   -12.807 47.050  1.00 22.74 ? 979  TYR B CB  1 
ATOM   2944 C  CG  . TYR B 1 92  ? 1.231   -12.428 46.042  1.00 23.28 ? 979  TYR B CG  1 
ATOM   2945 C  CD1 . TYR B 1 92  ? 1.590   -11.107 45.859  1.00 22.29 ? 979  TYR B CD1 1 
ATOM   2946 C  CD2 . TYR B 1 92  ? 1.852   -13.384 45.267  1.00 24.34 ? 979  TYR B CD2 1 
ATOM   2947 C  CE1 . TYR B 1 92  ? 2.511   -10.740 44.888  1.00 25.82 ? 979  TYR B CE1 1 
ATOM   2948 C  CE2 . TYR B 1 92  ? 2.804   -13.018 44.322  1.00 21.19 ? 979  TYR B CE2 1 
ATOM   2949 C  CZ  . TYR B 1 92  ? 3.121   -11.691 44.137  1.00 28.78 ? 979  TYR B CZ  1 
ATOM   2950 O  OH  . TYR B 1 92  ? 4.090   -11.302 43.210  1.00 28.85 ? 979  TYR B OH  1 
ATOM   2951 N  N   . ILE B 1 93  ? -1.563  -13.191 49.458  1.00 24.52 ? 980  ILE B N   1 
ATOM   2952 C  CA  . ILE B 1 93  ? -2.861  -13.741 49.704  1.00 22.65 ? 980  ILE B CA  1 
ATOM   2953 C  C   . ILE B 1 93  ? -3.788  -13.088 48.677  1.00 24.52 ? 980  ILE B C   1 
ATOM   2954 O  O   . ILE B 1 93  ? -3.909  -11.863 48.608  1.00 30.47 ? 980  ILE B O   1 
ATOM   2955 C  CB  . ILE B 1 93  ? -3.362  -13.527 51.150  1.00 22.18 ? 980  ILE B CB  1 
ATOM   2956 C  CG1 . ILE B 1 93  ? -2.566  -14.351 52.181  1.00 24.19 ? 980  ILE B CG1 1 
ATOM   2957 C  CG2 . ILE B 1 93  ? -4.875  -13.824 51.183  1.00 22.54 ? 980  ILE B CG2 1 
ATOM   2958 C  CD1 . ILE B 1 93  ? -2.799  -13.945 53.636  1.00 25.13 ? 980  ILE B CD1 1 
ATOM   2959 N  N   . ALA B 1 94  ? -4.452  -13.922 47.865  1.00 23.22 ? 981  ALA B N   1 
ATOM   2960 C  CA  . ALA B 1 94  ? -5.417  -13.464 46.870  1.00 23.33 ? 981  ALA B CA  1 
ATOM   2961 C  C   . ALA B 1 94  ? -6.790  -13.656 47.467  1.00 26.77 ? 981  ALA B C   1 
ATOM   2962 O  O   . ALA B 1 94  ? -7.134  -14.746 47.940  1.00 24.57 ? 981  ALA B O   1 
ATOM   2963 C  CB  . ALA B 1 94  ? -5.236  -14.300 45.603  1.00 22.71 ? 981  ALA B CB  1 
ATOM   2964 N  N   . THR B 1 95  ? -7.568  -12.594 47.518  1.00 23.08 ? 982  THR B N   1 
ATOM   2965 C  CA  . THR B 1 95  ? -8.870  -12.618 48.138  1.00 22.38 ? 982  THR B CA  1 
ATOM   2966 C  C   . THR B 1 95  ? -9.881  -11.703 47.424  1.00 22.19 ? 982  THR B C   1 
ATOM   2967 O  O   . THR B 1 95  ? -9.559  -10.917 46.566  1.00 22.89 ? 982  THR B O   1 
ATOM   2968 C  CB  . THR B 1 95  ? -8.704  -12.279 49.637  1.00 25.46 ? 982  THR B CB  1 
ATOM   2969 O  OG1 . THR B 1 95  ? -9.886  -12.561 50.392  1.00 25.68 ? 982  THR B OG1 1 
ATOM   2970 C  CG2 . THR B 1 95  ? -8.230  -10.830 49.861  1.00 21.93 ? 982  THR B CG2 1 
ATOM   2971 N  N   . GLN B 1 96  ? -11.119 -11.844 47.815  1.00 21.55 ? 983  GLN B N   1 
ATOM   2972 C  CA  . GLN B 1 96  ? -12.210 -11.040 47.291  1.00 21.84 ? 983  GLN B CA  1 
ATOM   2973 C  C   . GLN B 1 96  ? -12.227 -9.675  48.003  1.00 23.14 ? 983  GLN B C   1 
ATOM   2974 O  O   . GLN B 1 96  ? -11.650 -9.513  49.085  1.00 24.89 ? 983  GLN B O   1 
ATOM   2975 C  CB  . GLN B 1 96  ? -13.544 -11.765 47.495  1.00 21.81 ? 983  GLN B CB  1 
ATOM   2976 C  CG  . GLN B 1 96  ? -13.976 -11.739 48.981  1.00 23.75 ? 983  GLN B CG  1 
ATOM   2977 C  CD  . GLN B 1 96  ? -15.239 -12.496 49.260  1.00 27.05 ? 983  GLN B CD  1 
ATOM   2978 O  OE1 . GLN B 1 96  ? -15.658 -13.373 48.481  1.00 23.29 ? 983  GLN B OE1 1 
ATOM   2979 N  NE2 . GLN B 1 96  ? -15.853 -12.173 50.383  1.00 21.30 ? 983  GLN B NE2 1 
ATOM   2980 N  N   . GLY B 1 97  ? -12.892 -8.706  47.383  1.00 24.69 ? 984  GLY B N   1 
ATOM   2981 C  CA  . GLY B 1 97  ? -13.166 -7.419  48.028  1.00 22.09 ? 984  GLY B CA  1 
ATOM   2982 C  C   . GLY B 1 97  ? -14.063 -7.727  49.216  1.00 27.02 ? 984  GLY B C   1 
ATOM   2983 O  O   . GLY B 1 97  ? -15.024 -8.496  49.078  1.00 26.61 ? 984  GLY B O   1 
ATOM   2984 N  N   . PRO B 1 98  ? -13.718 -7.224  50.400  1.00 24.12 ? 985  PRO B N   1 
ATOM   2985 C  CA  . PRO B 1 98  ? -14.604 -7.484  51.530  1.00 23.69 ? 985  PRO B CA  1 
ATOM   2986 C  C   . PRO B 1 98  ? -16.078 -7.167  51.286  1.00 21.26 ? 985  PRO B C   1 
ATOM   2987 O  O   . PRO B 1 98  ? -16.442 -6.228  50.511  1.00 22.78 ? 985  PRO B O   1 
ATOM   2988 C  CB  . PRO B 1 98  ? -14.025 -6.609  52.623  1.00 24.01 ? 985  PRO B CB  1 
ATOM   2989 C  CG  . PRO B 1 98  ? -12.560 -6.552  52.306  1.00 26.09 ? 985  PRO B CG  1 
ATOM   2990 C  CD  . PRO B 1 98  ? -12.489 -6.508  50.819  1.00 25.57 ? 985  PRO B CD  1 
ATOM   2991 N  N   . MET B 1 99  ? -16.909 -7.923  51.982  1.00 21.98 ? 986  MET B N   1 
ATOM   2992 C  CA  . MET B 1 99  ? -18.337 -7.736  51.996  1.00 24.45 ? 986  MET B CA  1 
ATOM   2993 C  C   . MET B 1 99  ? -18.695 -7.187  53.350  1.00 22.84 ? 986  MET B C   1 
ATOM   2994 O  O   . MET B 1 99  ? -17.943 -7.298  54.292  1.00 23.85 ? 986  MET B O   1 
ATOM   2995 C  CB  . MET B 1 99  ? -19.064 -9.069  51.774  1.00 28.56 ? 986  MET B CB  1 
ATOM   2996 C  CG  . MET B 1 99  ? -18.720 -9.784  50.441  1.00 28.53 ? 986  MET B CG  1 
ATOM   2997 S  SD  . MET B 1 99  ? -19.217 -11.519 50.479  1.00 29.26 ? 986  MET B SD  1 
ATOM   2998 C  CE  . MET B 1 99  ? -20.946 -11.344 50.420  1.00 28.72 ? 986  MET B CE  1 
ATOM   2999 N  N   . GLN B 1 100 ? -19.879 -6.646  53.458  1.00 23.14 ? 987  GLN B N   1 
ATOM   3000 C  CA  . GLN B 1 100 ? -20.318 -6.127  54.747  1.00 24.70 ? 987  GLN B CA  1 
ATOM   3001 C  C   . GLN B 1 100 ? -20.153 -7.200  55.859  1.00 23.64 ? 987  GLN B C   1 
ATOM   3002 O  O   . GLN B 1 100 ? -19.645 -6.877  56.960  1.00 26.42 ? 987  GLN B O   1 
ATOM   3003 C  CB  . GLN B 1 100 ? -21.743 -5.601  54.659  1.00 29.28 ? 987  GLN B CB  1 
ATOM   3004 C  CG  . GLN B 1 100 ? -22.194 -4.952  55.916  1.00 35.35 ? 987  GLN B CG  1 
ATOM   3005 C  CD  . GLN B 1 100 ? -21.596 -3.594  56.113  1.00 43.20 ? 987  GLN B CD  1 
ATOM   3006 O  OE1 . GLN B 1 100 ? -21.000 -3.012  55.185  1.00 36.60 ? 987  GLN B OE1 1 
ATOM   3007 N  NE2 . GLN B 1 100 ? -21.769 -3.053  57.320  1.00 36.77 ? 987  GLN B NE2 1 
ATOM   3008 N  N   . GLU B 1 101 ? -20.499 -8.464  55.555  1.00 23.75 ? 988  GLU B N   1 
ATOM   3009 C  CA  . GLU B 1 101 ? -20.409 -9.555  56.539  1.00 30.04 ? 988  GLU B CA  1 
ATOM   3010 C  C   . GLU B 1 101 ? -18.984 -10.002 56.861  1.00 24.02 ? 988  GLU B C   1 
ATOM   3011 O  O   . GLU B 1 101 ? -18.777 -10.758 57.847  1.00 26.92 ? 988  GLU B O   1 
ATOM   3012 C  CB  . GLU B 1 101 ? -21.142 -10.805 56.034  1.00 38.44 ? 988  GLU B CB  1 
ATOM   3013 C  CG  . GLU B 1 101 ? -22.594 -10.581 55.757  1.00 52.35 ? 988  GLU B CG  1 
ATOM   3014 C  CD  . GLU B 1 101 ? -22.943 -10.243 54.294  1.00 62.31 ? 988  GLU B CD  1 
ATOM   3015 O  OE1 . GLU B 1 101 ? -22.297 -9.370  53.601  1.00 27.55 ? 988  GLU B OE1 1 
ATOM   3016 O  OE2 . GLU B 1 101 ? -23.956 -10.846 53.883  1.00 32.21 ? 988  GLU B OE2 1 
ATOM   3017 N  N   . THR B 1 102 ? -18.025 -9.607  56.036  1.00 23.02 ? 989  THR B N   1 
ATOM   3018 C  CA  . THR B 1 102 ? -16.644 -10.119 56.153  1.00 22.15 ? 989  THR B CA  1 
ATOM   3019 C  C   . THR B 1 102 ? -15.570 -9.123  56.530  1.00 22.46 ? 989  THR B C   1 
ATOM   3020 O  O   . THR B 1 102 ? -14.373 -9.500  56.673  1.00 21.82 ? 989  THR B O   1 
ATOM   3021 C  CB  . THR B 1 102 ? -16.201 -10.883 54.886  1.00 25.03 ? 989  THR B CB  1 
ATOM   3022 O  OG1 . THR B 1 102 ? -15.992 -9.972  53.796  1.00 21.40 ? 989  THR B OG1 1 
ATOM   3023 C  CG2 . THR B 1 102 ? -17.254 -11.987 54.495  1.00 23.14 ? 989  THR B CG2 1 
ATOM   3024 N  N   . VAL B 1 103 ? -15.942 -7.853  56.729  1.00 21.46 ? 990  VAL B N   1 
ATOM   3025 C  CA  . VAL B 1 103 ? -14.907 -6.837  57.043  1.00 21.59 ? 990  VAL B CA  1 
ATOM   3026 C  C   . VAL B 1 103 ? -14.085 -7.184  58.339  1.00 20.80 ? 990  VAL B C   1 
ATOM   3027 O  O   . VAL B 1 103 ? -12.853 -7.091  58.352  1.00 22.38 ? 990  VAL B O   1 
ATOM   3028 C  CB  . VAL B 1 103 ? -15.554 -5.435  57.132  1.00 27.95 ? 990  VAL B CB  1 
ATOM   3029 C  CG1 . VAL B 1 103 ? -14.577 -4.404  57.769  1.00 22.82 ? 990  VAL B CG1 1 
ATOM   3030 C  CG2 . VAL B 1 103 ? -16.086 -4.998  55.721  1.00 21.26 ? 990  VAL B CG2 1 
ATOM   3031 N  N   . LYS B 1 104 ? -14.777 -7.619  59.400  1.00 22.67 ? 991  LYS B N   1 
ATOM   3032 C  CA  . LYS B 1 104 ? -14.096 -8.065  60.618  1.00 25.31 ? 991  LYS B CA  1 
ATOM   3033 C  C   . LYS B 1 104 ? -13.163 -9.212  60.328  1.00 24.45 ? 991  LYS B C   1 
ATOM   3034 O  O   . LYS B 1 104 ? -12.028 -9.211  60.785  1.00 22.31 ? 991  LYS B O   1 
ATOM   3035 C  CB  . LYS B 1 104 ? -15.099 -8.456  61.724  1.00 22.65 ? 991  LYS B CB  1 
ATOM   3036 C  CG  . LYS B 1 104 ? -16.043 -7.329  62.121  1.00 29.72 ? 991  LYS B CG  1 
ATOM   3037 C  CD  . LYS B 1 104 ? -17.050 -7.697  63.216  1.00 35.27 ? 991  LYS B CD  1 
ATOM   3038 C  CE  . LYS B 1 104 ? -17.903 -8.937  62.896  1.00 42.23 ? 991  LYS B CE  1 
ATOM   3039 N  NZ  . LYS B 1 104 ? -18.700 -8.911  61.612  1.00 35.55 ? 991  LYS B NZ  1 
ATOM   3040 N  N   . ASP B 1 105 ? -13.638 -10.186 59.547  1.00 22.59 ? 992  ASP B N   1 
ATOM   3041 C  CA  . ASP B 1 105 ? -12.827 -11.350 59.154  1.00 25.46 ? 992  ASP B CA  1 
ATOM   3042 C  C   . ASP B 1 105 ? -11.550 -10.907 58.397  1.00 24.44 ? 992  ASP B C   1 
ATOM   3043 O  O   . ASP B 1 105 ? -10.450 -11.449 58.607  1.00 24.59 ? 992  ASP B O   1 
ATOM   3044 C  CB  . ASP B 1 105 ? -13.619 -12.311 58.237  1.00 27.57 ? 992  ASP B CB  1 
ATOM   3045 C  CG  . ASP B 1 105 ? -14.819 -13.000 58.924  1.00 34.45 ? 992  ASP B CG  1 
ATOM   3046 O  OD1 . ASP B 1 105 ? -14.801 -13.165 60.151  1.00 28.70 ? 992  ASP B OD1 1 
ATOM   3047 O  OD2 . ASP B 1 105 ? -15.784 -13.373 58.199  1.00 36.93 ? 992  ASP B OD2 1 
ATOM   3048 N  N   . PHE B 1 106 ? -11.723 -9.952  57.506  1.00 25.17 ? 993  PHE B N   1 
ATOM   3049 C  CA  . PHE B 1 106 ? -10.621 -9.474  56.671  1.00 22.77 ? 993  PHE B CA  1 
ATOM   3050 C  C   . PHE B 1 106 ? -9.528  -8.872  57.562  1.00 22.48 ? 993  PHE B C   1 
ATOM   3051 O  O   . PHE B 1 106 ? -8.357  -9.228  57.442  1.00 23.54 ? 993  PHE B O   1 
ATOM   3052 C  CB  . PHE B 1 106 ? -11.149 -8.435  55.707  1.00 23.26 ? 993  PHE B CB  1 
ATOM   3053 C  CG  . PHE B 1 106 ? -10.093 -7.817  54.866  1.00 22.83 ? 993  PHE B CG  1 
ATOM   3054 C  CD1 . PHE B 1 106 ? -9.714  -8.442  53.686  1.00 21.74 ? 993  PHE B CD1 1 
ATOM   3055 C  CD2 . PHE B 1 106 ? -9.504  -6.613  55.224  1.00 25.24 ? 993  PHE B CD2 1 
ATOM   3056 C  CE1 . PHE B 1 106 ? -8.763  -7.879  52.858  1.00 26.58 ? 993  PHE B CE1 1 
ATOM   3057 C  CE2 . PHE B 1 106 ? -8.558  -6.047  54.390  1.00 25.74 ? 993  PHE B CE2 1 
ATOM   3058 C  CZ  . PHE B 1 106 ? -8.177  -6.683  53.216  1.00 24.32 ? 993  PHE B CZ  1 
ATOM   3059 N  N   . TRP B 1 107 ? -9.924  -8.008  58.489  1.00 23.62 ? 994  TRP B N   1 
ATOM   3060 C  CA  . TRP B 1 107 ? -8.948  -7.435  59.420  1.00 24.96 ? 994  TRP B CA  1 
ATOM   3061 C  C   . TRP B 1 107 ? -8.347  -8.477  60.366  1.00 23.48 ? 994  TRP B C   1 
ATOM   3062 O  O   . TRP B 1 107 ? -7.179  -8.381  60.708  1.00 24.58 ? 994  TRP B O   1 
ATOM   3063 C  CB  . TRP B 1 107 ? -9.534  -6.254  60.179  1.00 25.38 ? 994  TRP B CB  1 
ATOM   3064 C  CG  . TRP B 1 107 ? -9.625  -5.043  59.291  1.00 25.71 ? 994  TRP B CG  1 
ATOM   3065 C  CD1 . TRP B 1 107 ? -10.737 -4.542  58.707  1.00 26.00 ? 994  TRP B CD1 1 
ATOM   3066 C  CD2 . TRP B 1 107 ? -8.523  -4.258  58.807  1.00 23.06 ? 994  TRP B CD2 1 
ATOM   3067 N  NE1 . TRP B 1 107 ? -10.416 -3.443  57.935  1.00 24.80 ? 994  TRP B NE1 1 
ATOM   3068 C  CE2 . TRP B 1 107 ? -9.064  -3.243  57.984  1.00 26.96 ? 994  TRP B CE2 1 
ATOM   3069 C  CE3 . TRP B 1 107 ? -7.151  -4.261  59.047  1.00 23.40 ? 994  TRP B CE3 1 
ATOM   3070 C  CZ2 . TRP B 1 107 ? -8.263  -2.303  57.365  1.00 24.29 ? 994  TRP B CZ2 1 
ATOM   3071 C  CZ3 . TRP B 1 107 ? -6.378  -3.363  58.441  1.00 24.34 ? 994  TRP B CZ3 1 
ATOM   3072 C  CH2 . TRP B 1 107 ? -6.923  -2.366  57.603  1.00 27.22 ? 994  TRP B CH2 1 
ATOM   3073 N  N   . ARG B 1 108 ? -9.124  -9.475  60.767  1.00 23.22 ? 995  ARG B N   1 
ATOM   3074 C  CA  . ARG B 1 108 ? -8.612  -10.573 61.552  1.00 23.07 ? 995  ARG B CA  1 
ATOM   3075 C  C   . ARG B 1 108 ? -7.489  -11.284 60.813  1.00 24.57 ? 995  ARG B C   1 
ATOM   3076 O  O   . ARG B 1 108 ? -6.437  -11.577 61.402  1.00 22.64 ? 995  ARG B O   1 
ATOM   3077 C  CB  . ARG B 1 108 ? -9.731  -11.594 61.868  1.00 24.58 ? 995  ARG B CB  1 
ATOM   3078 C  CG  . ARG B 1 108 ? -10.363 -11.377 63.201  1.00 44.99 ? 995  ARG B CG  1 
ATOM   3079 C  CD  . ARG B 1 108 ? -10.763 -12.717 63.783  1.00 39.80 ? 995  ARG B CD  1 
ATOM   3080 N  NE  . ARG B 1 108 ? -11.858 -13.262 63.024  1.00 29.25 ? 995  ARG B NE  1 
ATOM   3081 C  CZ  . ARG B 1 108 ? -12.091 -14.556 62.772  1.00 36.40 ? 995  ARG B CZ  1 
ATOM   3082 N  NH1 . ARG B 1 108 ? -13.153 -14.877 62.058  1.00 39.65 ? 995  ARG B NH1 1 
ATOM   3083 N  NH2 . ARG B 1 108 ? -11.291 -15.505 63.186  1.00 32.36 ? 995  ARG B NH2 1 
ATOM   3084 N  N   . MET B 1 109 ? -7.732  -11.513 59.518  1.00 24.29 ? 996  MET B N   1 
ATOM   3085 C  CA  . MET B 1 109 ? -6.750  -12.081 58.610  1.00 23.05 ? 996  MET B CA  1 
ATOM   3086 C  C   . MET B 1 109 ? -5.476  -11.251 58.562  1.00 20.58 ? 996  MET B C   1 
ATOM   3087 O  O   . MET B 1 109 ? -4.342  -11.762 58.689  1.00 21.93 ? 996  MET B O   1 
ATOM   3088 C  CB  . MET B 1 109 ? -7.319  -12.243 57.182  1.00 22.08 ? 996  MET B CB  1 
ATOM   3089 C  CG  . MET B 1 109 ? -6.360  -13.002 56.314  1.00 25.51 ? 996  MET B CG  1 
ATOM   3090 S  SD  . MET B 1 109 ? -6.887  -13.250 54.594  1.00 26.12 ? 996  MET B SD  1 
ATOM   3091 C  CE  . MET B 1 109 ? -7.037  -11.507 54.101  1.00 25.07 ? 996  MET B CE  1 
ATOM   3092 N  N   . ILE B 1 110 ? -5.656  -9.959  58.325  1.00 19.04 ? 997  ILE B N   1 
ATOM   3093 C  CA  . ILE B 1 110 ? -4.505  -9.022  58.268  1.00 22.15 ? 997  ILE B CA  1 
ATOM   3094 C  C   . ILE B 1 110 ? -3.637  -9.125  59.506  1.00 20.89 ? 997  ILE B C   1 
ATOM   3095 O  O   . ILE B 1 110 ? -2.422  -9.292  59.431  1.00 24.55 ? 997  ILE B O   1 
ATOM   3096 C  CB  . ILE B 1 110 ? -5.026  -7.562  58.130  1.00 23.71 ? 997  ILE B CB  1 
ATOM   3097 C  CG1 . ILE B 1 110 ? -5.724  -7.341  56.792  1.00 25.69 ? 997  ILE B CG1 1 
ATOM   3098 C  CG2 . ILE B 1 110 ? -3.882  -6.520  58.231  1.00 23.26 ? 997  ILE B CG2 1 
ATOM   3099 C  CD1 . ILE B 1 110 ? -4.873  -7.653  55.638  1.00 28.58 ? 997  ILE B CD1 1 
ATOM   3100 N  N   . TRP B 1 111 ? -4.285  -9.078  60.661  1.00 22.61 ? 998  TRP B N   1 
ATOM   3101 C  CA  . TRP B 1 111 ? -3.533  -9.148  61.936  1.00 19.07 ? 998  TRP B CA  1 
ATOM   3102 C  C   . TRP B 1 111 ? -2.871  -10.507 62.079  1.00 21.94 ? 998  TRP B C   1 
ATOM   3103 O  O   . TRP B 1 111 ? -1.659  -10.608 62.364  1.00 23.08 ? 998  TRP B O   1 
ATOM   3104 C  CB  . TRP B 1 111 ? -4.482  -8.897  63.107  1.00 19.18 ? 998  TRP B CB  1 
ATOM   3105 C  CG  . TRP B 1 111 ? -3.667  -8.717  64.368  1.00 24.62 ? 998  TRP B CG  1 
ATOM   3106 C  CD1 . TRP B 1 111 ? -3.422  -9.668  65.300  1.00 28.31 ? 998  TRP B CD1 1 
ATOM   3107 C  CD2 . TRP B 1 111 ? -2.921  -7.561  64.740  1.00 26.33 ? 998  TRP B CD2 1 
ATOM   3108 N  NE1 . TRP B 1 111 ? -2.577  -9.179  66.259  1.00 24.83 ? 998  TRP B NE1 1 
ATOM   3109 C  CE2 . TRP B 1 111 ? -2.261  -7.873  65.954  1.00 26.89 ? 998  TRP B CE2 1 
ATOM   3110 C  CE3 . TRP B 1 111 ? -2.763  -6.282  64.178  1.00 21.61 ? 998  TRP B CE3 1 
ATOM   3111 C  CZ2 . TRP B 1 111 ? -1.450  -6.955  66.625  1.00 27.12 ? 998  TRP B CZ2 1 
ATOM   3112 C  CZ3 . TRP B 1 111 ? -1.957  -5.334  64.843  1.00 25.44 ? 998  TRP B CZ3 1 
ATOM   3113 C  CH2 . TRP B 1 111 ? -1.293  -5.693  66.067  1.00 24.32 ? 998  TRP B CH2 1 
ATOM   3114 N  N   . GLN B 1 112 ? -3.648  -11.567 61.920  1.00 21.07 ? 999  GLN B N   1 
ATOM   3115 C  CA  . GLN B 1 112 ? -3.110  -12.917 62.038  1.00 21.48 ? 999  GLN B CA  1 
ATOM   3116 C  C   . GLN B 1 112 ? -1.900  -13.177 61.166  1.00 21.73 ? 999  GLN B C   1 
ATOM   3117 O  O   . GLN B 1 112 ? -0.889  -13.727 61.639  1.00 23.75 ? 999  GLN B O   1 
ATOM   3118 C  CB  . GLN B 1 112 ? -4.161  -13.941 61.761  1.00 26.97 ? 999  GLN B CB  1 
ATOM   3119 C  CG  . GLN B 1 112 ? -3.712  -15.343 61.960  1.00 35.02 ? 999  GLN B CG  1 
ATOM   3120 C  CD  . GLN B 1 112 ? -4.786  -16.274 61.479  1.00 34.69 ? 999  GLN B CD  1 
ATOM   3121 O  OE1 . GLN B 1 112 ? -5.840  -16.365 62.100  1.00 29.11 ? 999  GLN B OE1 1 
ATOM   3122 N  NE2 . GLN B 1 112 ? -4.553  -16.901 60.335  1.00 25.85 ? 999  GLN B NE2 1 
ATOM   3123 N  N   . GLU B 1 113 ? -1.952  -12.725 59.926  1.00 21.37 ? 1000 GLU B N   1 
ATOM   3124 C  CA  . GLU B 1 113 ? -0.928  -13.069 58.946  1.00 25.67 ? 1000 GLU B CA  1 
ATOM   3125 C  C   . GLU B 1 113 ? 0.240   -12.078 58.933  1.00 26.44 ? 1000 GLU B C   1 
ATOM   3126 O  O   . GLU B 1 113 ? 1.210   -12.234 58.184  1.00 25.70 ? 1000 GLU B O   1 
ATOM   3127 C  CB  . GLU B 1 113 ? -1.571  -13.178 57.564  1.00 22.05 ? 1000 GLU B CB  1 
ATOM   3128 C  CG  . GLU B 1 113 ? -2.605  -14.251 57.445  1.00 26.79 ? 1000 GLU B CG  1 
ATOM   3129 C  CD  . GLU B 1 113 ? -2.027  -15.632 57.652  1.00 31.05 ? 1000 GLU B CD  1 
ATOM   3130 O  OE1 . GLU B 1 113 ? -1.151  -16.003 56.864  1.00 30.14 ? 1000 GLU B OE1 1 
ATOM   3131 O  OE2 . GLU B 1 113 ? -2.407  -16.288 58.650  1.00 32.14 ? 1000 GLU B OE2 1 
ATOM   3132 N  N   . ASN B 1 114 ? 0.144   -11.058 59.775  1.00 22.46 ? 1001 ASN B N   1 
ATOM   3133 C  CA  . ASN B 1 114 ? 1.165   -10.000 59.877  1.00 20.37 ? 1001 ASN B CA  1 
ATOM   3134 C  C   . ASN B 1 114 ? 1.379   -9.266  58.523  1.00 22.00 ? 1001 ASN B C   1 
ATOM   3135 O  O   . ASN B 1 114 ? 2.491   -8.884  58.193  1.00 25.67 ? 1001 ASN B O   1 
ATOM   3136 C  CB  . ASN B 1 114 ? 2.495   -10.570 60.405  1.00 22.76 ? 1001 ASN B CB  1 
ATOM   3137 C  CG  . ASN B 1 114 ? 3.460   -9.477  60.849  1.00 24.77 ? 1001 ASN B CG  1 
ATOM   3138 O  OD1 . ASN B 1 114 ? 3.048   -8.440  61.376  1.00 24.73 ? 1001 ASN B OD1 1 
ATOM   3139 N  ND2 . ASN B 1 114 ? 4.746   -9.717  60.628  1.00 26.93 ? 1001 ASN B ND2 1 
ATOM   3140 N  N   . SER B 1 115 ? 0.308   -9.051  57.764  1.00 22.06 ? 1002 SER B N   1 
ATOM   3141 C  CA  . SER B 1 115 ? 0.456   -8.432  56.471  1.00 23.97 ? 1002 SER B CA  1 
ATOM   3142 C  C   . SER B 1 115 ? 0.694   -6.949  56.698  1.00 25.28 ? 1002 SER B C   1 
ATOM   3143 O  O   . SER B 1 115 ? 0.104   -6.372  57.594  1.00 28.87 ? 1002 SER B O   1 
ATOM   3144 C  CB  . SER B 1 115 ? -0.799  -8.625  55.630  1.00 21.98 ? 1002 SER B CB  1 
ATOM   3145 O  OG  . SER B 1 115 ? -1.041  -10.006 55.365  1.00 24.13 ? 1002 SER B OG  1 
ATOM   3146 N  N   . ALA B 1 116 ? 1.583   -6.358  55.906  1.00 23.40 ? 1003 ALA B N   1 
ATOM   3147 C  CA  . ALA B 1 116 ? 1.876   -4.940  55.928  1.00 24.91 ? 1003 ALA B CA  1 
ATOM   3148 C  C   . ALA B 1 116 ? 1.373   -4.185  54.704  1.00 23.54 ? 1003 ALA B C   1 
ATOM   3149 O  O   . ALA B 1 116 ? 1.405   -2.943  54.672  1.00 22.99 ? 1003 ALA B O   1 
ATOM   3150 C  CB  . ALA B 1 116 ? 3.402   -4.721  56.041  1.00 26.02 ? 1003 ALA B CB  1 
ATOM   3151 N  N   . SER B 1 117 ? 0.894   -4.915  53.682  1.00 24.26 ? 1004 SER B N   1 
ATOM   3152 C  CA  . SER B 1 117 ? 0.521   -4.287  52.430  1.00 22.51 ? 1004 SER B CA  1 
ATOM   3153 C  C   . SER B 1 117 ? -0.755  -4.922  51.922  1.00 24.74 ? 1004 SER B C   1 
ATOM   3154 O  O   . SER B 1 117 ? -0.882  -6.161  51.922  1.00 23.38 ? 1004 SER B O   1 
ATOM   3155 C  CB  . SER B 1 117 ? 1.609   -4.477  51.374  1.00 19.53 ? 1004 SER B CB  1 
ATOM   3156 O  OG  . SER B 1 117 ? 2.808   -3.771  51.680  1.00 21.91 ? 1004 SER B OG  1 
ATOM   3157 N  N   . ILE B 1 118 ? -1.702  -4.066  51.532  1.00 21.41 ? 1005 ILE B N   1 
ATOM   3158 C  CA  . ILE B 1 118 ? -2.937  -4.481  50.873  1.00 24.07 ? 1005 ILE B CA  1 
ATOM   3159 C  C   . ILE B 1 118 ? -2.937  -3.799  49.479  1.00 23.36 ? 1005 ILE B C   1 
ATOM   3160 O  O   . ILE B 1 118 ? -2.659  -2.596  49.322  1.00 23.53 ? 1005 ILE B O   1 
ATOM   3161 C  CB  . ILE B 1 118 ? -4.228  -4.090  51.621  1.00 26.11 ? 1005 ILE B CB  1 
ATOM   3162 C  CG1 . ILE B 1 118 ? -4.341  -4.719  53.023  1.00 23.82 ? 1005 ILE B CG1 1 
ATOM   3163 C  CG2 . ILE B 1 118 ? -5.460  -4.487  50.782  1.00 23.24 ? 1005 ILE B CG2 1 
ATOM   3164 C  CD1 . ILE B 1 118 ? -5.330  -3.997  53.981  1.00 23.89 ? 1005 ILE B CD1 1 
ATOM   3165 N  N   . VAL B 1 119 ? -3.185  -4.593  48.453  1.00 22.79 ? 1006 VAL B N   1 
ATOM   3166 C  CA  . VAL B 1 119 ? -3.185  -4.122  47.062  1.00 22.52 ? 1006 VAL B CA  1 
ATOM   3167 C  C   . VAL B 1 119 ? -4.605  -4.328  46.546  1.00 25.76 ? 1006 VAL B C   1 
ATOM   3168 O  O   . VAL B 1 119 ? -5.090  -5.473  46.450  1.00 24.12 ? 1006 VAL B O   1 
ATOM   3169 C  CB  . VAL B 1 119 ? -2.223  -4.956  46.203  1.00 22.31 ? 1006 VAL B CB  1 
ATOM   3170 C  CG1 . VAL B 1 119 ? -2.314  -4.567  44.759  1.00 25.82 ? 1006 VAL B CG1 1 
ATOM   3171 C  CG2 . VAL B 1 119 ? -0.741  -4.787  46.736  1.00 24.39 ? 1006 VAL B CG2 1 
ATOM   3172 N  N   . MET B 1 120 ? -5.287  -3.213  46.348  1.00 21.12 ? 1007 MET B N   1 
ATOM   3173 C  CA  . MET B 1 120 ? -6.723  -3.145  45.996  1.00 22.30 ? 1007 MET B CA  1 
ATOM   3174 C  C   . MET B 1 120 ? -6.841  -2.695  44.556  1.00 21.53 ? 1007 MET B C   1 
ATOM   3175 O  O   . MET B 1 120 ? -6.491  -1.552  44.215  1.00 24.24 ? 1007 MET B O   1 
ATOM   3176 C  CB  . MET B 1 120 ? -7.494  -2.207  46.903  1.00 25.82 ? 1007 MET B CB  1 
ATOM   3177 C  CG  . MET B 1 120 ? -8.905  -1.901  46.443  1.00 23.49 ? 1007 MET B CG  1 
ATOM   3178 S  SD  . MET B 1 120 ? -9.766  -1.053  47.802  1.00 24.33 ? 1007 MET B SD  1 
ATOM   3179 C  CE  . MET B 1 120 ? -11.415 -0.774  47.074  1.00 23.44 ? 1007 MET B CE  1 
ATOM   3180 N  N   . VAL B 1 121 ? -7.368  -3.567  43.710  1.00 23.81 ? 1008 VAL B N   1 
ATOM   3181 C  CA  . VAL B 1 121 ? -7.405  -3.315  42.272  1.00 22.00 ? 1008 VAL B CA  1 
ATOM   3182 C  C   . VAL B 1 121 ? -8.858  -3.225  41.782  1.00 23.45 ? 1008 VAL B C   1 
ATOM   3183 O  O   . VAL B 1 121 ? -9.280  -3.914  40.841  1.00 28.18 ? 1008 VAL B O   1 
ATOM   3184 C  CB  . VAL B 1 121 ? -6.588  -4.321  41.445  1.00 22.92 ? 1008 VAL B CB  1 
ATOM   3185 C  CG1 . VAL B 1 121 ? -6.298  -3.708  40.046  1.00 29.90 ? 1008 VAL B CG1 1 
ATOM   3186 C  CG2 . VAL B 1 121 ? -5.255  -4.629  42.077  1.00 25.29 ? 1008 VAL B CG2 1 
ATOM   3187 N  N   . THR B 1 122 ? -9.626  -2.386  42.446  1.00 27.13 ? 1009 THR B N   1 
ATOM   3188 C  CA  . THR B 1 122 ? -11.005 -2.119  42.041  1.00 22.10 ? 1009 THR B CA  1 
ATOM   3189 C  C   . THR B 1 122 ? -11.398 -0.780  42.650  1.00 26.38 ? 1009 THR B C   1 
ATOM   3190 O  O   . THR B 1 122 ? -10.779 -0.353  43.621  1.00 25.91 ? 1009 THR B O   1 
ATOM   3191 C  CB  . THR B 1 122 ? -11.918 -3.231  42.566  1.00 26.16 ? 1009 THR B CB  1 
ATOM   3192 O  OG1 . THR B 1 122 ? -13.262 -3.062  42.103  1.00 27.28 ? 1009 THR B OG1 1 
ATOM   3193 C  CG2 . THR B 1 122 ? -11.848 -3.335  44.115  1.00 26.02 ? 1009 THR B CG2 1 
ATOM   3194 N  N   . ASN B 1 123 ? -12.407 -0.155  42.064  1.00 23.64 ? 1010 ASN B N   1 
ATOM   3195 C  CA  . ASN B 1 123 ? -13.143 0.904   42.729  1.00 24.81 ? 1010 ASN B CA  1 
ATOM   3196 C  C   . ASN B 1 123 ? -14.267 0.252   43.525  1.00 27.52 ? 1010 ASN B C   1 
ATOM   3197 O  O   . ASN B 1 123 ? -14.602 -0.920  43.310  1.00 25.27 ? 1010 ASN B O   1 
ATOM   3198 C  CB  . ASN B 1 123 ? -13.628 1.959   41.732  1.00 25.73 ? 1010 ASN B CB  1 
ATOM   3199 C  CG  . ASN B 1 123 ? -12.521 2.949   41.378  1.00 34.20 ? 1010 ASN B CG  1 
ATOM   3200 O  OD1 . ASN B 1 123 ? -11.989 2.952   40.258  1.00 32.86 ? 1010 ASN B OD1 1 
ATOM   3201 N  ND2 . ASN B 1 123 ? -12.136 3.751   42.355  1.00 27.30 ? 1010 ASN B ND2 1 
ATOM   3202 N  N   . LEU B 1 124 ? -14.787 0.987   44.496  1.00 29.62 ? 1011 LEU B N   1 
ATOM   3203 C  CA  . LEU B 1 124 ? -15.833 0.470   45.359  1.00 27.23 ? 1011 LEU B CA  1 
ATOM   3204 C  C   . LEU B 1 124 ? -17.127 0.249   44.559  1.00 26.58 ? 1011 LEU B C   1 
ATOM   3205 O  O   . LEU B 1 124 ? -17.852 -0.738  44.779  1.00 24.67 ? 1011 LEU B O   1 
ATOM   3206 C  CB  . LEU B 1 124 ? -16.089 1.460   46.498  1.00 29.92 ? 1011 LEU B CB  1 
ATOM   3207 C  CG  . LEU B 1 124 ? -14.973 1.580   47.542  1.00 25.19 ? 1011 LEU B CG  1 
ATOM   3208 C  CD1 . LEU B 1 124 ? -15.268 2.801   48.450  1.00 31.02 ? 1011 LEU B CD1 1 
ATOM   3209 C  CD2 . LEU B 1 124 ? -14.770 0.280   48.337  1.00 22.92 ? 1011 LEU B CD2 1 
ATOM   3210 N  N   . VAL B 1 125 ? -17.391 1.191   43.657  1.00 21.66 ? 1012 VAL B N   1 
ATOM   3211 C  CA  . VAL B 1 125 ? -18.530 1.133   42.763  1.00 22.73 ? 1012 VAL B CA  1 
ATOM   3212 C  C   . VAL B 1 125 ? -18.091 1.283   41.321  1.00 27.53 ? 1012 VAL B C   1 
ATOM   3213 O  O   . VAL B 1 125 ? -17.337 2.184   41.004  1.00 25.48 ? 1012 VAL B O   1 
ATOM   3214 C  CB  . VAL B 1 125 ? -19.606 2.228   43.087  1.00 26.29 ? 1012 VAL B CB  1 
ATOM   3215 C  CG1 . VAL B 1 125 ? -20.751 2.150   42.060  1.00 24.69 ? 1012 VAL B CG1 1 
ATOM   3216 C  CG2 . VAL B 1 125 ? -20.095 2.110   44.539  1.00 33.44 ? 1012 VAL B CG2 1 
ATOM   3217 N  N   . GLU B 1 126 ? -18.552 0.383   40.459  1.00 25.20 ? 1013 GLU B N   1 
ATOM   3218 C  CA  . GLU B 1 126 ? -18.255 0.425   39.028  1.00 26.87 ? 1013 GLU B CA  1 
ATOM   3219 C  C   . GLU B 1 126 ? -19.524 0.090   38.243  1.00 29.25 ? 1013 GLU B C   1 
ATOM   3220 O  O   . GLU B 1 126 ? -20.185 -0.872  38.546  1.00 28.82 ? 1013 GLU B O   1 
ATOM   3221 C  CB  . GLU B 1 126 ? -17.183 -0.616  38.668  1.00 26.46 ? 1013 GLU B CB  1 
ATOM   3222 C  CG  . GLU B 1 126 ? -15.855 -0.342  39.358  1.00 28.06 ? 1013 GLU B CG  1 
ATOM   3223 C  CD  . GLU B 1 126 ? -14.736 -1.352  39.071  1.00 30.19 ? 1013 GLU B CD  1 
ATOM   3224 O  OE1 . GLU B 1 126 ? -14.957 -2.369  38.368  1.00 27.42 ? 1013 GLU B OE1 1 
ATOM   3225 O  OE2 . GLU B 1 126 ? -13.607 -1.142  39.581  1.00 23.89 ? 1013 GLU B OE2 1 
ATOM   3226 N  N   . VAL B 1 127 ? -19.812 0.874   37.224  1.00 35.57 ? 1014 VAL B N   1 
ATOM   3227 C  CA  . VAL B 1 127 ? -20.958 0.610   36.350  1.00 41.53 ? 1014 VAL B CA  1 
ATOM   3228 C  C   . VAL B 1 127 ? -22.213 0.342   37.187  1.00 37.67 ? 1014 VAL B C   1 
ATOM   3229 O  O   . VAL B 1 127 ? -22.906 -0.649  36.994  1.00 42.48 ? 1014 VAL B O   1 
ATOM   3230 C  CB  . VAL B 1 127 ? -20.683 -0.593  35.388  1.00 37.87 ? 1014 VAL B CB  1 
ATOM   3231 C  CG1 . VAL B 1 127 ? -19.431 -0.329  34.556  1.00 57.75 ? 1014 VAL B CG1 1 
ATOM   3232 C  CG2 . VAL B 1 127 ? -20.539 -1.924  36.137  1.00 68.84 ? 1014 VAL B CG2 1 
ATOM   3233 N  N   . GLY B 1 128 ? -22.452 1.203   38.159  1.00 30.13 ? 1015 GLY B N   1 
ATOM   3234 C  CA  . GLY B 1 128 ? -23.681 1.125   38.950  1.00 35.04 ? 1015 GLY B CA  1 
ATOM   3235 C  C   . GLY B 1 128 ? -23.817 -0.054  39.893  1.00 38.34 ? 1015 GLY B C   1 
ATOM   3236 O  O   . GLY B 1 128 ? -24.919 -0.341  40.343  1.00 28.73 ? 1015 GLY B O   1 
ATOM   3237 N  N   . ARG B 1 129 ? -22.702 -0.722  40.225  1.00 30.44 ? 1016 ARG B N   1 
ATOM   3238 C  CA  . ARG B 1 129 ? -22.713 -1.896  41.085  1.00 30.55 ? 1016 ARG B CA  1 
ATOM   3239 C  C   . ARG B 1 129 ? -21.607 -1.792  42.116  1.00 31.38 ? 1016 ARG B C   1 
ATOM   3240 O  O   . ARG B 1 129 ? -20.499 -1.417  41.755  1.00 26.11 ? 1016 ARG B O   1 
ATOM   3241 C  CB  . ARG B 1 129 ? -22.473 -3.149  40.256  1.00 32.41 ? 1016 ARG B CB  1 
ATOM   3242 C  CG  . ARG B 1 129 ? -23.356 -4.328  40.642  1.00 63.33 ? 1016 ARG B CG  1 
ATOM   3243 N  N   . VAL B 1 130 ? -21.911 -2.144  43.370  1.00 29.26 ? 1017 VAL B N   1 
ATOM   3244 C  CA  . VAL B 1 130 ? -20.939 -2.158  44.441  1.00 27.28 ? 1017 VAL B CA  1 
ATOM   3245 C  C   . VAL B 1 130 ? -20.066 -3.387  44.222  1.00 28.50 ? 1017 VAL B C   1 
ATOM   3246 O  O   . VAL B 1 130 ? -20.551 -4.513  44.189  1.00 29.41 ? 1017 VAL B O   1 
ATOM   3247 C  CB  . VAL B 1 130 ? -21.597 -2.241  45.876  1.00 36.31 ? 1017 VAL B CB  1 
ATOM   3248 C  CG1 . VAL B 1 130 ? -20.524 -2.429  46.971  1.00 28.40 ? 1017 VAL B CG1 1 
ATOM   3249 C  CG2 . VAL B 1 130 ? -22.467 -0.999  46.171  1.00 31.22 ? 1017 VAL B CG2 1 
ATOM   3250 N  N   . LYS B 1 131 ? -18.769 -3.150  44.088  1.00 25.47 ? 1018 LYS B N   1 
ATOM   3251 C  CA  . LYS B 1 131 ? -17.793 -4.196  43.841  1.00 27.05 ? 1018 LYS B CA  1 
ATOM   3252 C  C   . LYS B 1 131 ? -17.033 -4.612  45.113  1.00 27.72 ? 1018 LYS B C   1 
ATOM   3253 O  O   . LYS B 1 131 ? -16.482 -5.713  45.184  1.00 24.32 ? 1018 LYS B O   1 
ATOM   3254 C  CB  . LYS B 1 131 ? -16.810 -3.676  42.792  1.00 24.85 ? 1018 LYS B CB  1 
ATOM   3255 C  CG  . LYS B 1 131 ? -17.466 -3.312  41.477  1.00 27.16 ? 1018 LYS B CG  1 
ATOM   3256 C  CD  . LYS B 1 131 ? -18.127 -4.516  40.879  1.00 32.25 ? 1018 LYS B CD  1 
ATOM   3257 C  CE  . LYS B 1 131 ? -18.138 -4.551  39.409  1.00 55.87 ? 1018 LYS B CE  1 
ATOM   3258 N  NZ  . LYS B 1 131 ? -18.967 -5.726  39.027  1.00 39.84 ? 1018 LYS B NZ  1 
ATOM   3259 N  N   . CYS B 1 132 ? -17.046 -3.740  46.121  1.00 23.22 ? 1019 CYS B N   1 
ATOM   3260 C  CA  . CYS B 1 132 ? -16.295 -3.969  47.359  1.00 25.97 ? 1019 CYS B CA  1 
ATOM   3261 C  C   . CYS B 1 132 ? -16.891 -2.995  48.366  1.00 26.33 ? 1019 CYS B C   1 
ATOM   3262 O  O   . CYS B 1 132 ? -17.333 -1.909  47.949  1.00 26.95 ? 1019 CYS B O   1 
ATOM   3263 C  CB  . CYS B 1 132 ? -14.809 -3.646  47.087  1.00 21.93 ? 1019 CYS B CB  1 
ATOM   3264 S  SG  . CYS B 1 132 ? -13.674 -3.881  48.483  1.00 26.13 ? 1019 CYS B SG  1 
ATOM   3265 N  N   . VAL B 1 133 ? -16.937 -3.335  49.661  1.00 22.59 ? 1020 VAL B N   1 
ATOM   3266 C  CA  . VAL B 1 133 ? -17.368 -2.340  50.666  1.00 25.44 ? 1020 VAL B CA  1 
ATOM   3267 C  C   . VAL B 1 133 ? -16.148 -1.554  51.181  1.00 27.15 ? 1020 VAL B C   1 
ATOM   3268 O  O   . VAL B 1 133 ? -15.025 -2.034  51.102  1.00 29.11 ? 1020 VAL B O   1 
ATOM   3269 C  CB  . VAL B 1 133 ? -18.162 -2.966  51.829  1.00 27.85 ? 1020 VAL B CB  1 
ATOM   3270 C  CG1 . VAL B 1 133 ? -19.434 -3.722  51.267  1.00 27.83 ? 1020 VAL B CG1 1 
ATOM   3271 C  CG2 . VAL B 1 133 ? -17.262 -3.852  52.710  1.00 34.14 ? 1020 VAL B CG2 1 
ATOM   3272 N  N   . ARG B 1 134 ? -16.375 -0.349  51.685  1.00 24.43 ? 1021 ARG B N   1 
ATOM   3273 C  CA  . ARG B 1 134 ? -15.284 0.466   52.245  1.00 24.49 ? 1021 ARG B CA  1 
ATOM   3274 C  C   . ARG B 1 134 ? -14.884 -0.153  53.600  1.00 32.10 ? 1021 ARG B C   1 
ATOM   3275 O  O   . ARG B 1 134 ? -15.637 -0.097  54.565  1.00 34.84 ? 1021 ARG B O   1 
ATOM   3276 C  CB  A ARG B 1 134 ? -15.673 1.948   52.398  0.50 35.34 ? 1021 ARG B CB  1 
ATOM   3277 C  CB  B ARG B 1 134 ? -15.759 1.903   52.424  0.50 33.72 ? 1021 ARG B CB  1 
ATOM   3278 C  CG  A ARG B 1 134 ? -14.455 2.896   52.414  0.50 35.24 ? 1021 ARG B CG  1 
ATOM   3279 C  CG  B ARG B 1 134 ? -14.732 2.780   53.056  0.50 37.10 ? 1021 ARG B CG  1 
ATOM   3280 C  CD  A ARG B 1 134 ? -14.851 4.390   52.414  0.50 56.52 ? 1021 ARG B CD  1 
ATOM   3281 C  CD  B ARG B 1 134 ? -15.132 4.220   52.998  0.50 38.43 ? 1021 ARG B CD  1 
ATOM   3282 N  NE  A ARG B 1 134 ? -13.953 5.184   51.557  0.50 49.38 ? 1021 ARG B NE  1 
ATOM   3283 N  NE  B ARG B 1 134 ? -13.931 5.007   53.224  0.50 55.47 ? 1021 ARG B NE  1 
ATOM   3284 C  CZ  A ARG B 1 134 ? -14.310 5.864   50.462  0.50 44.25 ? 1021 ARG B CZ  1 
ATOM   3285 C  CZ  B ARG B 1 134 ? -13.440 5.298   54.422  0.50 24.85 ? 1021 ARG B CZ  1 
ATOM   3286 N  NH1 A ARG B 1 134 ? -15.577 5.919   50.056  0.50 37.94 ? 1021 ARG B NH1 1 
ATOM   3287 N  NH1 B ARG B 1 134 ? -12.342 5.997   54.507  0.50 34.80 ? 1021 ARG B NH1 1 
ATOM   3288 N  NH2 A ARG B 1 134 ? -13.381 6.513   49.764  0.50 56.18 ? 1021 ARG B NH2 1 
ATOM   3289 N  NH2 B ARG B 1 134 ? -14.068 4.923   55.532  0.50 35.72 ? 1021 ARG B NH2 1 
ATOM   3290 N  N   . TYR B 1 135 ? -13.704 -0.733  53.675  1.00 23.30 ? 1022 TYR B N   1 
ATOM   3291 C  CA  . TYR B 1 135 ? -13.261 -1.452  54.860  1.00 23.49 ? 1022 TYR B CA  1 
ATOM   3292 C  C   . TYR B 1 135 ? -12.146 -0.728  55.622  1.00 23.96 ? 1022 TYR B C   1 
ATOM   3293 O  O   . TYR B 1 135 ? -11.537 -1.302  56.528  1.00 24.10 ? 1022 TYR B O   1 
ATOM   3294 C  CB  . TYR B 1 135 ? -12.774 -2.848  54.484  1.00 28.50 ? 1022 TYR B CB  1 
ATOM   3295 C  CG  . TYR B 1 135 ? -11.653 -2.867  53.468  1.00 23.31 ? 1022 TYR B CG  1 
ATOM   3296 C  CD1 . TYR B 1 135 ? -10.346 -2.830  53.861  1.00 23.00 ? 1022 TYR B CD1 1 
ATOM   3297 C  CD2 . TYR B 1 135 ? -11.922 -3.030  52.105  1.00 22.98 ? 1022 TYR B CD2 1 
ATOM   3298 C  CE1 . TYR B 1 135 ? -9.304  -2.850  52.930  1.00 24.96 ? 1022 TYR B CE1 1 
ATOM   3299 C  CE2 . TYR B 1 135 ? -10.863 -3.055  51.142  1.00 24.54 ? 1022 TYR B CE2 1 
ATOM   3300 C  CZ  . TYR B 1 135 ? -9.562  -2.983  51.589  1.00 25.87 ? 1022 TYR B CZ  1 
ATOM   3301 O  OH  . TYR B 1 135 ? -8.514  -3.035  50.714  1.00 25.07 ? 1022 TYR B OH  1 
ATOM   3302 N  N   . TRP B 1 136 ? -11.853 0.507   55.229  1.00 26.23 ? 1023 TRP B N   1 
ATOM   3303 C  CA  . TRP B 1 136 ? -10.792 1.256   55.851  1.00 24.86 ? 1023 TRP B CA  1 
ATOM   3304 C  C   . TRP B 1 136 ? -11.331 2.629   56.317  1.00 28.99 ? 1023 TRP B C   1 
ATOM   3305 O  O   . TRP B 1 136 ? -12.325 3.139   55.762  1.00 25.80 ? 1023 TRP B O   1 
ATOM   3306 C  CB  . TRP B 1 136 ? -9.620  1.430   54.862  1.00 26.46 ? 1023 TRP B CB  1 
ATOM   3307 C  CG  . TRP B 1 136 ? -9.960  2.337   53.720  1.00 26.32 ? 1023 TRP B CG  1 
ATOM   3308 C  CD1 . TRP B 1 136 ? -9.816  3.683   53.676  1.00 25.22 ? 1023 TRP B CD1 1 
ATOM   3309 C  CD2 . TRP B 1 136 ? -10.518 1.947   52.467  1.00 23.33 ? 1023 TRP B CD2 1 
ATOM   3310 N  NE1 . TRP B 1 136 ? -10.271 4.177   52.458  1.00 24.97 ? 1023 TRP B NE1 1 
ATOM   3311 C  CE2 . TRP B 1 136 ? -10.692 3.119   51.699  1.00 31.71 ? 1023 TRP B CE2 1 
ATOM   3312 C  CE3 . TRP B 1 136 ? -10.880 0.705   51.907  1.00 25.54 ? 1023 TRP B CE3 1 
ATOM   3313 C  CZ2 . TRP B 1 136 ? -11.190 3.093   50.390  1.00 29.37 ? 1023 TRP B CZ2 1 
ATOM   3314 C  CZ3 . TRP B 1 136 ? -11.398 0.690   50.616  1.00 25.14 ? 1023 TRP B CZ3 1 
ATOM   3315 C  CH2 . TRP B 1 136 ? -11.574 1.890   49.893  1.00 25.46 ? 1023 TRP B CH2 1 
ATOM   3316 N  N   . PRO B 1 137 ? -10.692 3.218   57.345  1.00 26.67 ? 1024 PRO B N   1 
ATOM   3317 C  CA  . PRO B 1 137 ? -11.212 4.421   58.000  1.00 25.37 ? 1024 PRO B CA  1 
ATOM   3318 C  C   . PRO B 1 137 ? -10.849 5.737   57.316  1.00 26.59 ? 1024 PRO B C   1 
ATOM   3319 O  O   . PRO B 1 137 ? -9.747  5.857   56.757  1.00 24.41 ? 1024 PRO B O   1 
ATOM   3320 C  CB  . PRO B 1 137 ? -10.589 4.334   59.401  1.00 33.74 ? 1024 PRO B CB  1 
ATOM   3321 C  CG  . PRO B 1 137 ? -9.288  3.710   59.191  1.00 27.23 ? 1024 PRO B CG  1 
ATOM   3322 C  CD  . PRO B 1 137 ? -9.469  2.731   58.013  1.00 29.37 ? 1024 PRO B CD  1 
ATOM   3323 N  N   . ASP B 1 138 ? -11.757 6.723   57.387  1.00 27.19 ? 1025 ASP B N   1 
ATOM   3324 C  CA  . ASP B 1 138 ? -11.429 8.113   57.053  1.00 27.63 ? 1025 ASP B CA  1 
ATOM   3325 C  C   . ASP B 1 138 ? -10.479 8.670   58.076  1.00 25.75 ? 1025 ASP B C   1 
ATOM   3326 O  O   . ASP B 1 138 ? -9.653  9.492   57.754  1.00 28.11 ? 1025 ASP B O   1 
ATOM   3327 C  CB  . ASP B 1 138 ? -12.657 9.046   57.122  1.00 36.05 ? 1025 ASP B CB  1 
ATOM   3328 C  CG  . ASP B 1 138 ? -13.662 8.829   56.005  1.00 49.32 ? 1025 ASP B CG  1 
ATOM   3329 O  OD1 . ASP B 1 138 ? -13.346 8.180   54.990  1.00 41.46 ? 1025 ASP B OD1 1 
ATOM   3330 O  OD2 . ASP B 1 138 ? -14.794 9.353   56.153  1.00 47.96 ? 1025 ASP B OD2 1 
ATOM   3331 N  N   . ASP B 1 139 ? -10.660 8.276   59.339  1.00 24.63 ? 1026 ASP B N   1 
ATOM   3332 C  CA  . ASP B 1 139 ? -9.858  8.754   60.440  1.00 22.81 ? 1026 ASP B CA  1 
ATOM   3333 C  C   . ASP B 1 139 ? -9.466  7.526   61.294  1.00 25.36 ? 1026 ASP B C   1 
ATOM   3334 O  O   . ASP B 1 139 ? -8.354  7.017   61.177  1.00 26.97 ? 1026 ASP B O   1 
ATOM   3335 C  CB  . ASP B 1 139 ? -10.632 9.806   61.265  1.00 21.30 ? 1026 ASP B CB  1 
ATOM   3336 C  CG  . ASP B 1 139 ? -9.953  10.164  62.578  1.00 31.30 ? 1026 ASP B CG  1 
ATOM   3337 O  OD1 . ASP B 1 139 ? -8.810  9.760   62.864  1.00 29.11 ? 1026 ASP B OD1 1 
ATOM   3338 O  OD2 . ASP B 1 139 ? -10.583 10.891  63.353  1.00 35.90 ? 1026 ASP B OD2 1 
ATOM   3339 N  N   . THR B 1 140 ? -10.386 7.020   62.107  1.00 22.35 ? 1027 THR B N   1 
ATOM   3340 C  CA  . THR B 1 140 ? -10.105 5.824   62.913  1.00 24.29 ? 1027 THR B CA  1 
ATOM   3341 C  C   . THR B 1 140 ? -11.377 5.032   63.080  1.00 29.85 ? 1027 THR B C   1 
ATOM   3342 O  O   . THR B 1 140 ? -12.438 5.616   63.197  1.00 23.32 ? 1027 THR B O   1 
ATOM   3343 C  CB  . THR B 1 140 ? -9.506  6.165   64.340  1.00 25.96 ? 1027 THR B CB  1 
ATOM   3344 O  OG1 . THR B 1 140 ? -9.093  4.944   64.987  1.00 30.19 ? 1027 THR B OG1 1 
ATOM   3345 C  CG2 . THR B 1 140 ? -10.522 6.880   65.224  1.00 29.20 ? 1027 THR B CG2 1 
ATOM   3346 N  N   . GLU B 1 141 ? -11.259 3.713   63.037  1.00 21.11 ? 1028 GLU B N   1 
ATOM   3347 C  CA  . GLU B 1 141 ? -12.399 2.795   63.228  1.00 21.26 ? 1028 GLU B CA  1 
ATOM   3348 C  C   . GLU B 1 141 ? -11.846 1.491   63.813  1.00 24.12 ? 1028 GLU B C   1 
ATOM   3349 O  O   . GLU B 1 141 ? -10.672 1.179   63.654  1.00 24.93 ? 1028 GLU B O   1 
ATOM   3350 C  CB  . GLU B 1 141 ? -13.076 2.434   61.899  1.00 22.59 ? 1028 GLU B CB  1 
ATOM   3351 C  CG  . GLU B 1 141 ? -13.492 3.600   60.971  1.00 36.42 ? 1028 GLU B CG  1 
ATOM   3352 C  CD  . GLU B 1 141 ? -14.784 4.293   61.371  1.00 53.54 ? 1028 GLU B CD  1 
ATOM   3353 O  OE1 . GLU B 1 141 ? -15.387 3.886   62.384  1.00 48.43 ? 1028 GLU B OE1 1 
ATOM   3354 O  OE2 . GLU B 1 141 ? -15.193 5.253   60.667  1.00 48.16 ? 1028 GLU B OE2 1 
ATOM   3355 N  N   . VAL B 1 142 ? -12.727 0.729   64.450  1.00 22.04 ? 1029 VAL B N   1 
ATOM   3356 C  CA  . VAL B 1 142 ? -12.363 -0.564  64.986  1.00 21.95 ? 1029 VAL B CA  1 
ATOM   3357 C  C   . VAL B 1 142 ? -13.193 -1.658  64.338  1.00 21.59 ? 1029 VAL B C   1 
ATOM   3358 O  O   . VAL B 1 142 ? -14.433 -1.590  64.340  1.00 23.35 ? 1029 VAL B O   1 
ATOM   3359 C  CB  . VAL B 1 142 ? -12.576 -0.614  66.527  1.00 23.05 ? 1029 VAL B CB  1 
ATOM   3360 C  CG1 . VAL B 1 142 ? -12.152 -1.942  67.082  1.00 22.60 ? 1029 VAL B CG1 1 
ATOM   3361 C  CG2 . VAL B 1 142 ? -11.848 0.572   67.229  1.00 25.78 ? 1029 VAL B CG2 1 
ATOM   3362 N  N   . TYR B 1 143 ? -12.509 -2.654  63.784  1.00 23.29 ? 1030 TYR B N   1 
ATOM   3363 C  CA  . TYR B 1 143 ? -13.122 -3.749  63.083  1.00 24.35 ? 1030 TYR B CA  1 
ATOM   3364 C  C   . TYR B 1 143 ? -12.871 -5.014  63.969  1.00 22.91 ? 1030 TYR B C   1 
ATOM   3365 O  O   . TYR B 1 143 ? -11.768 -5.523  64.047  1.00 24.40 ? 1030 TYR B O   1 
ATOM   3366 C  CB  . TYR B 1 143 ? -12.510 -3.896  61.676  1.00 25.29 ? 1030 TYR B CB  1 
ATOM   3367 C  CG  . TYR B 1 143 ? -12.518 -2.607  60.877  1.00 22.87 ? 1030 TYR B CG  1 
ATOM   3368 C  CD1 . TYR B 1 143 ? -13.680 -2.149  60.248  1.00 19.82 ? 1030 TYR B CD1 1 
ATOM   3369 C  CD2 . TYR B 1 143 ? -11.370 -1.863  60.732  1.00 29.01 ? 1030 TYR B CD2 1 
ATOM   3370 C  CE1 . TYR B 1 143 ? -13.689 -0.923  59.517  1.00 21.45 ? 1030 TYR B CE1 1 
ATOM   3371 C  CE2 . TYR B 1 143 ? -11.364 -0.688  60.004  1.00 23.07 ? 1030 TYR B CE2 1 
ATOM   3372 C  CZ  . TYR B 1 143 ? -12.514 -0.207  59.428  1.00 23.59 ? 1030 TYR B CZ  1 
ATOM   3373 O  OH  . TYR B 1 143 ? -12.428 0.977   58.703  1.00 23.27 ? 1030 TYR B OH  1 
ATOM   3374 N  N   . GLY B 1 144 ? -13.934 -5.485  64.599  1.00 24.81 ? 1031 GLY B N   1 
ATOM   3375 C  CA  . GLY B 1 144 ? -13.872 -6.494  65.648  1.00 22.44 ? 1031 GLY B CA  1 
ATOM   3376 C  C   . GLY B 1 144 ? -13.176 -5.854  66.836  1.00 23.98 ? 1031 GLY B C   1 
ATOM   3377 O  O   . GLY B 1 144 ? -13.781 -5.043  67.553  1.00 22.97 ? 1031 GLY B O   1 
ATOM   3378 N  N   . ASP B 1 145 ? -11.895 -6.192  67.006  1.00 25.97 ? 1032 ASP B N   1 
ATOM   3379 C  CA  . ASP B 1 145 ? -11.030 -5.559  68.002  1.00 26.57 ? 1032 ASP B CA  1 
ATOM   3380 C  C   . ASP B 1 145 ? -9.770  -4.961  67.376  1.00 24.39 ? 1032 ASP B C   1 
ATOM   3381 O  O   . ASP B 1 145 ? -8.827  -4.623  68.092  1.00 24.92 ? 1032 ASP B O   1 
ATOM   3382 C  CB  . ASP B 1 145 ? -10.661 -6.537  69.117  1.00 28.25 ? 1032 ASP B CB  1 
ATOM   3383 C  CG  . ASP B 1 145 ? -9.862  -7.722  68.625  1.00 24.63 ? 1032 ASP B CG  1 
ATOM   3384 O  OD1 . ASP B 1 145 ? -9.669  -7.845  67.402  1.00 27.61 ? 1032 ASP B OD1 1 
ATOM   3385 O  OD2 . ASP B 1 145 ? -9.407  -8.522  69.448  1.00 32.52 ? 1032 ASP B OD2 1 
ATOM   3386 N  N   . ILE B 1 146 ? -9.766  -4.804  66.057  1.00 22.65 ? 1033 ILE B N   1 
ATOM   3387 C  CA  . ILE B 1 146 ? -8.581  -4.272  65.385  1.00 20.91 ? 1033 ILE B CA  1 
ATOM   3388 C  C   . ILE B 1 146 ? -8.803  -2.775  65.100  1.00 21.77 ? 1033 ILE B C   1 
ATOM   3389 O  O   . ILE B 1 146 ? -9.685  -2.421  64.320  1.00 23.66 ? 1033 ILE B O   1 
ATOM   3390 C  CB  . ILE B 1 146 ? -8.284  -4.996  64.070  1.00 21.91 ? 1033 ILE B CB  1 
ATOM   3391 C  CG1 . ILE B 1 146 ? -8.044  -6.499  64.268  1.00 30.15 ? 1033 ILE B CG1 1 
ATOM   3392 C  CG2 . ILE B 1 146 ? -7.091  -4.333  63.387  1.00 20.34 ? 1033 ILE B CG2 1 
ATOM   3393 C  CD1 . ILE B 1 146 ? -6.926  -6.828  65.227  1.00 28.59 ? 1033 ILE B CD1 1 
ATOM   3394 N  N   . LYS B 1 147 ? -8.013  -1.932  65.758  1.00 22.57 ? 1034 LYS B N   1 
ATOM   3395 C  CA  . LYS B 1 147 ? -8.089  -0.486  65.619  1.00 20.07 ? 1034 LYS B CA  1 
ATOM   3396 C  C   . LYS B 1 147 ? -7.170  -0.028  64.502  1.00 25.45 ? 1034 LYS B C   1 
ATOM   3397 O  O   . LYS B 1 147 ? -5.957  -0.218  64.564  1.00 24.83 ? 1034 LYS B O   1 
ATOM   3398 C  CB  . LYS B 1 147 ? -7.712  0.213   66.906  1.00 27.41 ? 1034 LYS B CB  1 
ATOM   3399 C  CG  . LYS B 1 147 ? -7.859  1.719   66.838  1.00 26.09 ? 1034 LYS B CG  1 
ATOM   3400 C  CD  . LYS B 1 147 ? -7.503  2.379   68.155  1.00 33.46 ? 1034 LYS B CD  1 
ATOM   3401 C  CE  . LYS B 1 147 ? -7.384  3.874   68.014  1.00 48.61 ? 1034 LYS B CE  1 
ATOM   3402 N  NZ  . LYS B 1 147 ? -6.623  4.466   69.170  1.00 54.35 ? 1034 LYS B NZ  1 
ATOM   3403 N  N   . VAL B 1 148 ? -7.759  0.623   63.514  1.00 23.78 ? 1035 VAL B N   1 
ATOM   3404 C  CA  . VAL B 1 148 ? -7.047  1.118   62.314  1.00 22.32 ? 1035 VAL B CA  1 
ATOM   3405 C  C   . VAL B 1 148 ? -7.214  2.651   62.275  1.00 21.47 ? 1035 VAL B C   1 
ATOM   3406 O  O   . VAL B 1 148 ? -8.315  3.183   62.376  1.00 24.91 ? 1035 VAL B O   1 
ATOM   3407 C  CB  . VAL B 1 148 ? -7.601  0.467   61.025  1.00 23.55 ? 1035 VAL B CB  1 
ATOM   3408 C  CG1 . VAL B 1 148 ? -6.830  0.935   59.713  1.00 21.82 ? 1035 VAL B CG1 1 
ATOM   3409 C  CG2 . VAL B 1 148 ? -7.573  -1.119  61.127  1.00 23.88 ? 1035 VAL B CG2 1 
ATOM   3410 N  N   . THR B 1 149 ? -6.101  3.345   62.094  1.00 21.42 ? 1036 THR B N   1 
ATOM   3411 C  CA  . THR B 1 149 ? -6.058  4.773   62.092  1.00 22.03 ? 1036 THR B CA  1 
ATOM   3412 C  C   . THR B 1 149 ? -5.251  5.260   60.870  1.00 21.47 ? 1036 THR B C   1 
ATOM   3413 O  O   . THR B 1 149 ? -4.102  4.878   60.671  1.00 23.28 ? 1036 THR B O   1 
ATOM   3414 C  CB  . THR B 1 149 ? -5.378  5.302   63.373  1.00 28.97 ? 1036 THR B CB  1 
ATOM   3415 O  OG1 . THR B 1 149 ? -6.080  4.821   64.540  1.00 25.41 ? 1036 THR B OG1 1 
ATOM   3416 C  CG2 . THR B 1 149 ? -5.338  6.811   63.357  1.00 24.73 ? 1036 THR B CG2 1 
ATOM   3417 N  N   . LEU B 1 150 ? -5.877  6.101   60.081  1.00 24.14 ? 1037 LEU B N   1 
ATOM   3418 C  CA  . LEU B 1 150 ? -5.237  6.700   58.944  1.00 22.81 ? 1037 LEU B CA  1 
ATOM   3419 C  C   . LEU B 1 150 ? -4.170  7.673   59.423  1.00 23.42 ? 1037 LEU B C   1 
ATOM   3420 O  O   . LEU B 1 150 ? -4.451  8.554   60.214  1.00 22.45 ? 1037 LEU B O   1 
ATOM   3421 C  CB  . LEU B 1 150 ? -6.259  7.441   58.091  1.00 25.16 ? 1037 LEU B CB  1 
ATOM   3422 C  CG  . LEU B 1 150 ? -5.768  8.084   56.790  1.00 28.76 ? 1037 LEU B CG  1 
ATOM   3423 C  CD1 . LEU B 1 150 ? -5.186  7.039   55.812  1.00 22.30 ? 1037 LEU B CD1 1 
ATOM   3424 C  CD2 . LEU B 1 150 ? -6.978  8.894   56.152  1.00 25.58 ? 1037 LEU B CD2 1 
ATOM   3425 N  N   . ILE B 1 151 ? -2.948  7.523   58.914  1.00 21.89 ? 1038 ILE B N   1 
ATOM   3426 C  CA  . ILE B 1 151 ? -1.865  8.489   59.213  1.00 23.02 ? 1038 ILE B CA  1 
ATOM   3427 C  C   . ILE B 1 151 ? -1.264  9.225   58.019  1.00 25.07 ? 1038 ILE B C   1 
ATOM   3428 O  O   . ILE B 1 151 ? -0.654  10.281  58.203  1.00 28.16 ? 1038 ILE B O   1 
ATOM   3429 C  CB  . ILE B 1 151 ? -0.732  7.882   60.070  1.00 26.88 ? 1038 ILE B CB  1 
ATOM   3430 C  CG1 . ILE B 1 151 ? -0.001  6.735   59.342  1.00 36.46 ? 1038 ILE B CG1 1 
ATOM   3431 C  CG2 . ILE B 1 151 ? -1.287  7.397   61.429  1.00 30.58 ? 1038 ILE B CG2 1 
ATOM   3432 C  CD1 . ILE B 1 151 ? 1.279   6.244   60.101  1.00 31.57 ? 1038 ILE B CD1 1 
ATOM   3433 N  N   . GLU B 1 152 ? -1.501  8.748   56.796  1.00 22.34 ? 1039 GLU B N   1 
ATOM   3434 C  CA  . GLU B 1 152 ? -1.029  9.461   55.621  1.00 20.38 ? 1039 GLU B CA  1 
ATOM   3435 C  C   . GLU B 1 152 ? -1.825  9.025   54.400  1.00 23.81 ? 1039 GLU B C   1 
ATOM   3436 O  O   . GLU B 1 152 ? -2.197  7.857   54.282  1.00 22.10 ? 1039 GLU B O   1 
ATOM   3437 C  CB  . GLU B 1 152 ? 0.459   9.217   55.381  1.00 23.27 ? 1039 GLU B CB  1 
ATOM   3438 C  CG  . GLU B 1 152 ? 0.974   10.009  54.164  1.00 30.53 ? 1039 GLU B CG  1 
ATOM   3439 C  CD  . GLU B 1 152 ? 2.438   9.833   53.910  1.00 34.80 ? 1039 GLU B CD  1 
ATOM   3440 O  OE1 . GLU B 1 152 ? 3.209   9.631   54.874  1.00 30.54 ? 1039 GLU B OE1 1 
ATOM   3441 O  OE2 . GLU B 1 152 ? 2.806   9.912   52.709  1.00 32.52 ? 1039 GLU B OE2 1 
ATOM   3442 N  N   . THR B 1 153 ? -2.074  9.965   53.492  1.00 23.67 ? 1040 THR B N   1 
ATOM   3443 C  CA  . THR B 1 153 ? -2.680  9.677   52.148  1.00 21.27 ? 1040 THR B CA  1 
ATOM   3444 C  C   . THR B 1 153 ? -1.767  10.273  51.090  1.00 22.91 ? 1040 THR B C   1 
ATOM   3445 O  O   . THR B 1 153 ? -1.387  11.428  51.202  1.00 23.83 ? 1040 THR B O   1 
ATOM   3446 C  CB  . THR B 1 153 ? -4.076  10.279  52.045  1.00 32.71 ? 1040 THR B CB  1 
ATOM   3447 O  OG1 . THR B 1 153 ? -4.882  9.731   53.085  1.00 26.86 ? 1040 THR B OG1 1 
ATOM   3448 C  CG2 . THR B 1 153 ? -4.735  9.977   50.692  1.00 32.33 ? 1040 THR B CG2 1 
ATOM   3449 N  N   . GLU B 1 154 ? -1.321  9.450   50.144  1.00 21.39 ? 1041 GLU B N   1 
ATOM   3450 C  CA  . GLU B 1 154 ? -0.531  9.896   49.019  1.00 24.48 ? 1041 GLU B CA  1 
ATOM   3451 C  C   . GLU B 1 154 ? -1.338  9.644   47.735  1.00 27.76 ? 1041 GLU B C   1 
ATOM   3452 O  O   . GLU B 1 154 ? -1.243  8.548   47.129  1.00 23.70 ? 1041 GLU B O   1 
ATOM   3453 C  CB  . GLU B 1 154 ? 0.799   9.156   48.947  1.00 26.56 ? 1041 GLU B CB  1 
ATOM   3454 C  CG  . GLU B 1 154 ? 1.730   9.732   47.814  1.00 29.30 ? 1041 GLU B CG  1 
ATOM   3455 C  CD  . GLU B 1 154 ? 3.033   8.948   47.606  1.00 34.21 ? 1041 GLU B CD  1 
ATOM   3456 O  OE1 . GLU B 1 154 ? 3.250   7.935   48.305  1.00 26.23 ? 1041 GLU B OE1 1 
ATOM   3457 O  OE2 . GLU B 1 154 ? 3.831   9.352   46.726  1.00 25.66 ? 1041 GLU B OE2 1 
ATOM   3458 N  N   . PRO B 1 155 ? -2.140  10.644  47.323  1.00 23.04 ? 1042 PRO B N   1 
ATOM   3459 C  CA  . PRO B 1 155 ? -3.001  10.461  46.184  1.00 18.50 ? 1042 PRO B CA  1 
ATOM   3460 C  C   . PRO B 1 155 ? -2.310  10.827  44.903  1.00 22.99 ? 1042 PRO B C   1 
ATOM   3461 O  O   . PRO B 1 155 ? -1.880  11.965  44.753  1.00 20.10 ? 1042 PRO B O   1 
ATOM   3462 C  CB  . PRO B 1 155 ? -4.139  11.426  46.450  1.00 20.87 ? 1042 PRO B CB  1 
ATOM   3463 C  CG  . PRO B 1 155 ? -3.535  12.531  47.193  1.00 20.26 ? 1042 PRO B CG  1 
ATOM   3464 C  CD  . PRO B 1 155 ? -2.339  11.960  47.933  1.00 23.19 ? 1042 PRO B CD  1 
ATOM   3465 N  N   . LEU B 1 156 ? -2.254  9.893   43.960  1.00 20.21 ? 1043 LEU B N   1 
ATOM   3466 C  CA  . LEU B 1 156 ? -1.774  10.186  42.613  1.00 24.56 ? 1043 LEU B CA  1 
ATOM   3467 C  C   . LEU B 1 156 ? -2.957  10.071  41.651  1.00 23.92 ? 1043 LEU B C   1 
ATOM   3468 O  O   . LEU B 1 156 ? -4.012  9.559   42.016  1.00 22.57 ? 1043 LEU B O   1 
ATOM   3469 C  CB  . LEU B 1 156 ? -0.641  9.220   42.199  1.00 19.07 ? 1043 LEU B CB  1 
ATOM   3470 C  CG  . LEU B 1 156 ? 0.683   9.357   42.963  1.00 32.20 ? 1043 LEU B CG  1 
ATOM   3471 C  CD1 . LEU B 1 156 ? 0.611   8.770   44.375  1.00 35.30 ? 1043 LEU B CD1 1 
ATOM   3472 C  CD2 . LEU B 1 156 ? 1.757   8.658   42.177  1.00 46.44 ? 1043 LEU B CD2 1 
ATOM   3473 N  N   . ALA B 1 157 ? -2.772  10.453  40.396  1.00 21.77 ? 1044 ALA B N   1 
ATOM   3474 C  CA  . ALA B 1 157 ? -3.910  10.407  39.446  1.00 25.92 ? 1044 ALA B CA  1 
ATOM   3475 C  C   . ALA B 1 157 ? -4.428  8.971   39.193  1.00 21.99 ? 1044 ALA B C   1 
ATOM   3476 O  O   . ALA B 1 157 ? -5.636  8.733   39.128  1.00 26.31 ? 1044 ALA B O   1 
ATOM   3477 C  CB  . ALA B 1 157 ? -3.554  11.098  38.128  1.00 29.28 ? 1044 ALA B CB  1 
ATOM   3478 N  N   . GLU B 1 158 ? -3.507  8.010   39.114  1.00 20.10 ? 1045 GLU B N   1 
ATOM   3479 C  CA  . GLU B 1 158 ? -3.841  6.599   38.792  1.00 22.01 ? 1045 GLU B CA  1 
ATOM   3480 C  C   . GLU B 1 158 ? -4.111  5.656   39.953  1.00 24.95 ? 1045 GLU B C   1 
ATOM   3481 O  O   . GLU B 1 158 ? -4.646  4.568   39.747  1.00 23.71 ? 1045 GLU B O   1 
ATOM   3482 C  CB  . GLU B 1 158 ? -2.688  6.036   37.979  1.00 22.33 ? 1045 GLU B CB  1 
ATOM   3483 C  CG  . GLU B 1 158 ? -2.606  6.762   36.606  1.00 28.87 ? 1045 GLU B CG  1 
ATOM   3484 C  CD  . GLU B 1 158 ? -1.233  6.765   35.989  1.00 37.94 ? 1045 GLU B CD  1 
ATOM   3485 O  OE1 . GLU B 1 158 ? -1.143  6.567   34.764  1.00 37.57 ? 1045 GLU B OE1 1 
ATOM   3486 O  OE2 . GLU B 1 158 ? -0.241  6.994   36.716  1.00 36.50 ? 1045 GLU B OE2 1 
ATOM   3487 N  N   . TYR B 1 159 ? -3.689  6.067   41.139  1.00 21.66 ? 1046 TYR B N   1 
ATOM   3488 C  CA  . TYR B 1 159 ? -3.740  5.271   42.339  1.00 21.34 ? 1046 TYR B CA  1 
ATOM   3489 C  C   . TYR B 1 159 ? -3.473  6.119   43.564  1.00 21.35 ? 1046 TYR B C   1 
ATOM   3490 O  O   . TYR B 1 159 ? -2.968  7.235   43.474  1.00 22.21 ? 1046 TYR B O   1 
ATOM   3491 C  CB  . TYR B 1 159 ? -2.771  4.090   42.285  1.00 20.68 ? 1046 TYR B CB  1 
ATOM   3492 C  CG  . TYR B 1 159 ? -1.309  4.442   42.129  1.00 23.37 ? 1046 TYR B CG  1 
ATOM   3493 C  CD1 . TYR B 1 159 ? -0.525  4.785   43.220  1.00 26.28 ? 1046 TYR B CD1 1 
ATOM   3494 C  CD2 . TYR B 1 159 ? -0.715  4.431   40.881  1.00 25.18 ? 1046 TYR B CD2 1 
ATOM   3495 C  CE1 . TYR B 1 159 ? 0.831   5.055   43.076  1.00 24.51 ? 1046 TYR B CE1 1 
ATOM   3496 C  CE2 . TYR B 1 159 ? 0.616   4.738   40.739  1.00 26.30 ? 1046 TYR B CE2 1 
ATOM   3497 C  CZ  . TYR B 1 159 ? 1.389   5.025   41.821  1.00 26.04 ? 1046 TYR B CZ  1 
ATOM   3498 O  OH  . TYR B 1 159 ? 2.727   5.315   41.600  1.00 32.00 ? 1046 TYR B OH  1 
ATOM   3499 N  N   . VAL B 1 160 ? -3.848  5.589   44.716  1.00 21.12 ? 1047 VAL B N   1 
ATOM   3500 C  CA  . VAL B 1 160 ? -3.606  6.278   46.000  1.00 24.58 ? 1047 VAL B CA  1 
ATOM   3501 C  C   . VAL B 1 160 ? -3.033  5.306   46.976  1.00 22.97 ? 1047 VAL B C   1 
ATOM   3502 O  O   . VAL B 1 160 ? -3.460  4.147   47.012  1.00 22.89 ? 1047 VAL B O   1 
ATOM   3503 C  CB  . VAL B 1 160 ? -4.914  6.959   46.527  1.00 28.11 ? 1047 VAL B CB  1 
ATOM   3504 C  CG1 . VAL B 1 160 ? -6.077  5.971   46.578  1.00 25.35 ? 1047 VAL B CG1 1 
ATOM   3505 C  CG2 . VAL B 1 160 ? -4.721  7.664   47.895  1.00 23.00 ? 1047 VAL B CG2 1 
ATOM   3506 N  N   . ILE B 1 161 ? -2.035  5.759   47.734  1.00 21.77 ? 1048 ILE B N   1 
ATOM   3507 C  CA  . ILE B 1 161 ? -1.451  4.961   48.804  1.00 18.37 ? 1048 ILE B CA  1 
ATOM   3508 C  C   . ILE B 1 161 ? -1.893  5.555   50.148  1.00 21.78 ? 1048 ILE B C   1 
ATOM   3509 O  O   . ILE B 1 161 ? -1.623  6.721   50.436  1.00 21.72 ? 1048 ILE B O   1 
ATOM   3510 C  CB  . ILE B 1 161 ? 0.069   4.873   48.736  1.00 22.62 ? 1048 ILE B CB  1 
ATOM   3511 C  CG1 . ILE B 1 161 ? 0.550   4.397   47.334  1.00 24.38 ? 1048 ILE B CG1 1 
ATOM   3512 C  CG2 . ILE B 1 161 ? 0.617   3.921   49.857  1.00 21.84 ? 1048 ILE B CG2 1 
ATOM   3513 C  CD1 . ILE B 1 161 ? 2.032   4.593   47.068  1.00 27.28 ? 1048 ILE B CD1 1 
ATOM   3514 N  N   . ARG B 1 162 ? -2.586  4.738   50.937  1.00 22.33 ? 1049 ARG B N   1 
ATOM   3515 C  CA  . ARG B 1 162 ? -3.039  5.133   52.275  1.00 23.21 ? 1049 ARG B CA  1 
ATOM   3516 C  C   . ARG B 1 162 ? -2.225  4.361   53.310  1.00 24.92 ? 1049 ARG B C   1 
ATOM   3517 O  O   . ARG B 1 162 ? -2.148  3.141   53.208  1.00 26.07 ? 1049 ARG B O   1 
ATOM   3518 C  CB  A ARG B 1 162 ? -4.527  4.844   52.447  0.50 19.65 ? 1049 ARG B CB  1 
ATOM   3519 C  CB  B ARG B 1 162 ? -4.543  4.832   52.425  0.50 20.64 ? 1049 ARG B CB  1 
ATOM   3520 C  CG  A ARG B 1 162 ? -5.419  5.639   51.504  0.50 19.78 ? 1049 ARG B CG  1 
ATOM   3521 C  CG  B ARG B 1 162 ? -5.417  5.105   51.159  0.50 21.77 ? 1049 ARG B CG  1 
ATOM   3522 C  CD  A ARG B 1 162 ? -6.887  5.408   51.802  0.50 27.95 ? 1049 ARG B CD  1 
ATOM   3523 C  CD  B ARG B 1 162 ? -6.878  4.774   51.406  0.50 27.96 ? 1049 ARG B CD  1 
ATOM   3524 N  NE  A ARG B 1 162 ? -7.775  6.002   50.795  0.50 27.29 ? 1049 ARG B NE  1 
ATOM   3525 N  NE  B ARG B 1 162 ? -7.690  4.702   50.189  0.50 34.53 ? 1049 ARG B NE  1 
ATOM   3526 C  CZ  A ARG B 1 162 ? -8.200  5.399   49.686  0.50 24.25 ? 1049 ARG B CZ  1 
ATOM   3527 C  CZ  B ARG B 1 162 ? -8.171  5.745   49.513  0.50 33.11 ? 1049 ARG B CZ  1 
ATOM   3528 N  NH1 A ARG B 1 162 ? -7.842  4.156   49.389  0.50 28.14 ? 1049 ARG B NH1 1 
ATOM   3529 N  NH1 B ARG B 1 162 ? -7.936  6.988   49.906  0.50 23.82 ? 1049 ARG B NH1 1 
ATOM   3530 N  NH2 A ARG B 1 162 ? -9.019  6.048   48.863  0.50 29.84 ? 1049 ARG B NH2 1 
ATOM   3531 N  NH2 B ARG B 1 162 ? -8.909  5.543   48.422  0.50 33.12 ? 1049 ARG B NH2 1 
ATOM   3532 N  N   . THR B 1 163 ? -1.703  5.073   54.311  1.00 22.64 ? 1050 THR B N   1 
ATOM   3533 C  CA  . THR B 1 163 ? -0.915  4.499   55.382  1.00 21.83 ? 1050 THR B CA  1 
ATOM   3534 C  C   . THR B 1 163 ? -1.641  4.584   56.689  1.00 23.04 ? 1050 THR B C   1 
ATOM   3535 O  O   . THR B 1 163 ? -2.156  5.657   57.013  1.00 20.73 ? 1050 THR B O   1 
ATOM   3536 C  CB  . THR B 1 163 ? 0.425   5.231   55.525  1.00 25.10 ? 1050 THR B CB  1 
ATOM   3537 O  OG1 . THR B 1 163 ? 1.086   5.214   54.265  1.00 23.79 ? 1050 THR B OG1 1 
ATOM   3538 C  CG2 . THR B 1 163 ? 1.320   4.531   56.607  1.00 20.87 ? 1050 THR B CG2 1 
ATOM   3539 N  N   . PHE B 1 164 ? -1.679  3.456   57.408  1.00 21.11 ? 1051 PHE B N   1 
ATOM   3540 C  CA  . PHE B 1 164 ? -2.466  3.303   58.648  1.00 19.13 ? 1051 PHE B CA  1 
ATOM   3541 C  C   . PHE B 1 164 ? -1.567  2.738   59.739  1.00 24.44 ? 1051 PHE B C   1 
ATOM   3542 O  O   . PHE B 1 164 ? -0.623  1.996   59.479  1.00 23.23 ? 1051 PHE B O   1 
ATOM   3543 C  CB  . PHE B 1 164 ? -3.621  2.316   58.497  1.00 23.64 ? 1051 PHE B CB  1 
ATOM   3544 C  CG  . PHE B 1 164 ? -4.544  2.631   57.374  1.00 20.24 ? 1051 PHE B CG  1 
ATOM   3545 C  CD1 . PHE B 1 164 ? -5.650  3.453   57.567  1.00 19.53 ? 1051 PHE B CD1 1 
ATOM   3546 C  CD2 . PHE B 1 164 ? -4.313  2.129   56.122  1.00 23.80 ? 1051 PHE B CD2 1 
ATOM   3547 C  CE1 . PHE B 1 164 ? -6.496  3.685   56.513  1.00 21.22 ? 1051 PHE B CE1 1 
ATOM   3548 C  CE2 . PHE B 1 164 ? -5.170  2.392   55.073  1.00 21.44 ? 1051 PHE B CE2 1 
ATOM   3549 C  CZ  . PHE B 1 164 ? -6.236  3.196   55.282  1.00 26.26 ? 1051 PHE B CZ  1 
ATOM   3550 N  N   . THR B 1 165 ? -1.913  3.045   60.972  1.00 22.60 ? 1052 THR B N   1 
ATOM   3551 C  CA  . THR B 1 165 ? -1.479  2.195   62.080  1.00 24.60 ? 1052 THR B CA  1 
ATOM   3552 C  C   . THR B 1 165 ? -2.557  1.163   62.315  1.00 25.71 ? 1052 THR B C   1 
ATOM   3553 O  O   . THR B 1 165 ? -3.759  1.396   62.077  1.00 23.22 ? 1052 THR B O   1 
ATOM   3554 C  CB  . THR B 1 165 ? -1.203  2.966   63.383  1.00 23.82 ? 1052 THR B CB  1 
ATOM   3555 O  OG1 . THR B 1 165 ? -2.394  3.662   63.788  1.00 23.55 ? 1052 THR B OG1 1 
ATOM   3556 C  CG2 . THR B 1 165 ? -0.043  3.933   63.209  1.00 27.85 ? 1052 THR B CG2 1 
ATOM   3557 N  N   . VAL B 1 166 ? -2.119  0.008   62.784  1.00 21.95 ? 1053 VAL B N   1 
ATOM   3558 C  CA  . VAL B 1 166 ? -3.003  -1.121  63.055  1.00 20.58 ? 1053 VAL B CA  1 
ATOM   3559 C  C   . VAL B 1 166 ? -2.633  -1.704  64.430  1.00 25.46 ? 1053 VAL B C   1 
ATOM   3560 O  O   . VAL B 1 166 ? -1.467  -1.965  64.706  1.00 22.98 ? 1053 VAL B O   1 
ATOM   3561 C  CB  . VAL B 1 166 ? -2.958  -2.229  61.943  1.00 21.90 ? 1053 VAL B CB  1 
ATOM   3562 C  CG1 . VAL B 1 166 ? -3.963  -3.368  62.288  1.00 21.85 ? 1053 VAL B CG1 1 
ATOM   3563 C  CG2 . VAL B 1 166 ? -3.199  -1.659  60.496  1.00 22.44 ? 1053 VAL B CG2 1 
ATOM   3564 N  N   . GLN B 1 167 ? -3.626  -1.892  65.280  1.00 23.73 ? 1054 GLN B N   1 
ATOM   3565 C  CA  . GLN B 1 167 ? -3.418  -2.371  66.649  1.00 24.94 ? 1054 GLN B CA  1 
ATOM   3566 C  C   . GLN B 1 167 ? -4.592  -3.230  67.096  1.00 26.24 ? 1054 GLN B C   1 
ATOM   3567 O  O   . GLN B 1 167 ? -5.733  -2.862  66.907  1.00 26.14 ? 1054 GLN B O   1 
ATOM   3568 C  CB  . GLN B 1 167 ? -3.324  -1.196  67.608  1.00 24.59 ? 1054 GLN B CB  1 
ATOM   3569 C  CG  . GLN B 1 167 ? -2.905  -1.628  69.078  1.00 28.55 ? 1054 GLN B CG  1 
ATOM   3570 C  CD  . GLN B 1 167 ? -2.774  -0.449  70.054  1.00 41.26 ? 1054 GLN B CD  1 
ATOM   3571 O  OE1 . GLN B 1 167 ? -3.107  0.679   69.707  1.00 34.99 ? 1054 GLN B OE1 1 
ATOM   3572 N  NE2 . GLN B 1 167 ? -2.265  -0.714  71.278  1.00 35.37 ? 1054 GLN B NE2 1 
ATOM   3573 N  N   . LYS B 1 168 ? -4.283  -4.343  67.719  1.00 23.85 ? 1055 LYS B N   1 
ATOM   3574 C  CA  . LYS B 1 168 ? -5.269  -5.210  68.332  1.00 23.98 ? 1055 LYS B CA  1 
ATOM   3575 C  C   . LYS B 1 168 ? -5.473  -4.759  69.776  1.00 23.79 ? 1055 LYS B C   1 
ATOM   3576 O  O   . LYS B 1 168 ? -4.547  -4.690  70.617  1.00 24.48 ? 1055 LYS B O   1 
ATOM   3577 C  CB  . LYS B 1 168 ? -4.856  -6.677  68.243  1.00 24.45 ? 1055 LYS B CB  1 
ATOM   3578 C  CG  . LYS B 1 168 ? -5.855  -7.641  68.885  1.00 25.83 ? 1055 LYS B CG  1 
ATOM   3579 C  CD  . LYS B 1 168 ? -5.359  -9.093  68.816  1.00 29.36 ? 1055 LYS B CD  1 
ATOM   3580 C  CE  . LYS B 1 168 ? -6.289  -10.102 69.532  1.00 33.34 ? 1055 LYS B CE  1 
ATOM   3581 N  NZ  . LYS B 1 168 ? -7.437  -10.532 68.660  1.00 42.11 ? 1055 LYS B NZ  1 
ATOM   3582 N  N   . LYS B 1 169 ? -6.721  -4.467  70.068  1.00 29.23 ? 1056 LYS B N   1 
ATOM   3583 C  CA  . LYS B 1 169 ? -7.074  -3.823  71.328  1.00 28.91 ? 1056 LYS B CA  1 
ATOM   3584 C  C   . LYS B 1 169 ? -6.788  -4.816  72.456  1.00 26.73 ? 1056 LYS B C   1 
ATOM   3585 O  O   . LYS B 1 169 ? -6.904  -6.048  72.301  1.00 28.23 ? 1056 LYS B O   1 
ATOM   3586 C  CB  . LYS B 1 169 ? -8.510  -3.233  71.286  1.00 38.45 ? 1056 LYS B CB  1 
ATOM   3587 C  CG  . LYS B 1 169 ? -8.650  -2.057  70.208  1.00 36.19 ? 1056 LYS B CG  1 
ATOM   3588 C  CD  . LYS B 1 169 ? -9.997  -1.280  70.284  1.00 48.31 ? 1056 LYS B CD  1 
ATOM   3589 C  CE  . LYS B 1 169 ? -10.076 -0.295  71.445  1.00 49.78 ? 1056 LYS B CE  1 
ATOM   3590 N  NZ  . LYS B 1 169 ? -11.282 0.618   71.379  1.00 40.43 ? 1056 LYS B NZ  1 
ATOM   3591 N  N   . GLY B 1 170 ? -6.238  -4.282  73.546  1.00 30.64 ? 1057 GLY B N   1 
ATOM   3592 C  CA  . GLY B 1 170 ? -5.783  -5.119  74.638  1.00 30.05 ? 1057 GLY B CA  1 
ATOM   3593 C  C   . GLY B 1 170 ? -4.302  -5.428  74.581  1.00 40.32 ? 1057 GLY B C   1 
ATOM   3594 O  O   . GLY B 1 170 ? -3.726  -5.857  75.581  1.00 34.44 ? 1057 GLY B O   1 
ATOM   3595 N  N   . TYR B 1 171 ? -3.673  -5.205  73.425  1.00 26.80 ? 1058 TYR B N   1 
ATOM   3596 C  CA  . TYR B 1 171 ? -2.265  -5.543  73.229  1.00 30.16 ? 1058 TYR B CA  1 
ATOM   3597 C  C   . TYR B 1 171 ? -1.521  -4.270  72.793  1.00 26.30 ? 1058 TYR B C   1 
ATOM   3598 O  O   . TYR B 1 171 ? -2.148  -3.280  72.342  1.00 24.74 ? 1058 TYR B O   1 
ATOM   3599 C  CB  . TYR B 1 171 ? -2.109  -6.701  72.233  1.00 34.01 ? 1058 TYR B CB  1 
ATOM   3600 C  CG  . TYR B 1 171 ? -2.773  -7.968  72.733  1.00 35.70 ? 1058 TYR B CG  1 
ATOM   3601 C  CD1 . TYR B 1 171 ? -2.060  -8.911  73.474  1.00 49.25 ? 1058 TYR B CD1 1 
ATOM   3602 C  CD2 . TYR B 1 171 ? -4.126  -8.200  72.504  1.00 40.66 ? 1058 TYR B CD2 1 
ATOM   3603 C  CE1 . TYR B 1 171 ? -2.674  -10.070 73.960  1.00 47.41 ? 1058 TYR B CE1 1 
ATOM   3604 C  CE2 . TYR B 1 171 ? -4.754  -9.354  72.991  1.00 42.98 ? 1058 TYR B CE2 1 
ATOM   3605 C  CZ  . TYR B 1 171 ? -4.021  -10.281 73.720  1.00 60.30 ? 1058 TYR B CZ  1 
ATOM   3606 O  OH  . TYR B 1 171 ? -4.630  -11.424 74.191  1.00 66.25 ? 1058 TYR B OH  1 
ATOM   3607 N  N   . HIS B 1 172 ? -0.200  -4.295  72.945  1.00 25.17 ? 1059 HIS B N   1 
ATOM   3608 C  CA  . HIS B 1 172 ? 0.631   -3.094  72.827  1.00 22.64 ? 1059 HIS B CA  1 
ATOM   3609 C  C   . HIS B 1 172 ? 1.335   -2.938  71.507  1.00 20.98 ? 1059 HIS B C   1 
ATOM   3610 O  O   . HIS B 1 172 ? 1.954   -1.897  71.261  1.00 23.48 ? 1059 HIS B O   1 
ATOM   3611 C  CB  . HIS B 1 172 ? 1.702   -3.121  73.917  1.00 22.72 ? 1059 HIS B CB  1 
ATOM   3612 C  CG  . HIS B 1 172 ? 1.138   -3.212  75.294  1.00 24.25 ? 1059 HIS B CG  1 
ATOM   3613 N  ND1 . HIS B 1 172 ? 0.511   -2.155  75.912  1.00 27.69 ? 1059 HIS B ND1 1 
ATOM   3614 C  CD2 . HIS B 1 172 ? 1.054   -4.259  76.147  1.00 32.57 ? 1059 HIS B CD2 1 
ATOM   3615 C  CE1 . HIS B 1 172 ? 0.133   -2.526  77.125  1.00 27.08 ? 1059 HIS B CE1 1 
ATOM   3616 N  NE2 . HIS B 1 172 ? 0.432   -3.806  77.283  1.00 26.15 ? 1059 HIS B NE2 1 
ATOM   3617 N  N   . GLU B 1 173 ? 1.255   -3.946  70.659  1.00 22.33 ? 1060 GLU B N   1 
ATOM   3618 C  CA  . GLU B 1 173 ? 1.890   -3.903  69.333  1.00 22.88 ? 1060 GLU B CA  1 
ATOM   3619 C  C   . GLU B 1 173 ? 1.134   -2.989  68.388  1.00 22.30 ? 1060 GLU B C   1 
ATOM   3620 O  O   . GLU B 1 173 ? -0.087  -3.146  68.205  1.00 26.73 ? 1060 GLU B O   1 
ATOM   3621 C  CB  . GLU B 1 173 ? 1.945   -5.303  68.737  1.00 24.50 ? 1060 GLU B CB  1 
ATOM   3622 C  CG  . GLU B 1 173 ? 2.668   -5.320  67.407  1.00 22.49 ? 1060 GLU B CG  1 
ATOM   3623 C  CD  . GLU B 1 173 ? 2.958   -6.702  66.846  1.00 27.94 ? 1060 GLU B CD  1 
ATOM   3624 O  OE1 . GLU B 1 173 ? 2.569   -7.744  67.453  1.00 30.93 ? 1060 GLU B OE1 1 
ATOM   3625 O  OE2 . GLU B 1 173 ? 3.526   -6.715  65.724  1.00 30.91 ? 1060 GLU B OE2 1 
ATOM   3626 N  N   . ILE B 1 174 ? 1.870   -2.098  67.736  1.00 24.81 ? 1061 ILE B N   1 
ATOM   3627 C  CA  . ILE B 1 174 ? 1.298   -1.136  66.790  1.00 23.79 ? 1061 ILE B CA  1 
ATOM   3628 C  C   . ILE B 1 174 ? 2.028   -1.315  65.464  1.00 26.88 ? 1061 ILE B C   1 
ATOM   3629 O  O   . ILE B 1 174 ? 3.232   -1.108  65.389  1.00 26.85 ? 1061 ILE B O   1 
ATOM   3630 C  CB  . ILE B 1 174 ? 1.369   0.306   67.234  1.00 24.50 ? 1061 ILE B CB  1 
ATOM   3631 C  CG1 . ILE B 1 174 ? 0.547   0.533   68.528  1.00 25.28 ? 1061 ILE B CG1 1 
ATOM   3632 C  CG2 . ILE B 1 174 ? 0.749   1.154   66.105  1.00 25.43 ? 1061 ILE B CG2 1 
ATOM   3633 C  CD1 . ILE B 1 174 ? 0.764   1.914   69.139  1.00 30.64 ? 1061 ILE B CD1 1 
ATOM   3634 N  N   . ARG B 1 175 ? 1.298   -1.749  64.448  1.00 19.72 ? 1062 ARG B N   1 
ATOM   3635 C  CA  . ARG B 1 175 ? 1.873   -2.058  63.132  1.00 21.45 ? 1062 ARG B CA  1 
ATOM   3636 C  C   . ARG B 1 175 ? 1.552   -0.960  62.146  1.00 22.79 ? 1062 ARG B C   1 
ATOM   3637 O  O   . ARG B 1 175 ? 0.598   -0.212  62.323  1.00 27.15 ? 1062 ARG B O   1 
ATOM   3638 C  CB  . ARG B 1 175 ? 1.400   -3.408  62.590  1.00 26.34 ? 1062 ARG B CB  1 
ATOM   3639 C  CG  . ARG B 1 175 ? 1.759   -4.581  63.473  1.00 25.70 ? 1062 ARG B CG  1 
ATOM   3640 C  CD  . ARG B 1 175 ? 1.191   -5.872  62.924  1.00 27.49 ? 1062 ARG B CD  1 
ATOM   3641 N  NE  . ARG B 1 175 ? 1.457   -6.985  63.842  1.00 25.12 ? 1062 ARG B NE  1 
ATOM   3642 C  CZ  . ARG B 1 175 ? 0.865   -8.153  63.794  1.00 27.35 ? 1062 ARG B CZ  1 
ATOM   3643 N  NH1 . ARG B 1 175 ? -0.016  -8.448  62.838  1.00 23.77 ? 1062 ARG B NH1 1 
ATOM   3644 N  NH2 . ARG B 1 175 ? 1.176   -9.045  64.717  1.00 23.38 ? 1062 ARG B NH2 1 
ATOM   3645 N  N   . GLU B 1 176 ? 2.410   -0.825  61.144  1.00 21.83 ? 1063 GLU B N   1 
ATOM   3646 C  CA  . GLU B 1 176 ? 2.188   0.111   60.054  1.00 23.03 ? 1063 GLU B CA  1 
ATOM   3647 C  C   . GLU B 1 176 ? 1.782   -0.699  58.817  1.00 26.28 ? 1063 GLU B C   1 
ATOM   3648 O  O   . GLU B 1 176 ? 2.408   -1.695  58.487  1.00 27.42 ? 1063 GLU B O   1 
ATOM   3649 C  CB  . GLU B 1 176 ? 3.426   0.961   59.764  1.00 28.53 ? 1063 GLU B CB  1 
ATOM   3650 C  CG  . GLU B 1 176 ? 3.241   1.934   58.608  1.00 30.74 ? 1063 GLU B CG  1 
ATOM   3651 C  CD  . GLU B 1 176 ? 4.444   2.847   58.435  1.00 39.20 ? 1063 GLU B CD  1 
ATOM   3652 O  OE1 . GLU B 1 176 ? 5.532   2.351   58.077  1.00 40.14 ? 1063 GLU B OE1 1 
ATOM   3653 O  OE2 . GLU B 1 176 ? 4.305   4.045   58.708  1.00 35.39 ? 1063 GLU B OE2 1 
ATOM   3654 N  N   . LEU B 1 177 ? 0.734   -0.250  58.157  1.00 22.79 ? 1064 LEU B N   1 
ATOM   3655 C  CA  . LEU B 1 177 ? 0.150   -0.948  57.007  1.00 23.81 ? 1064 LEU B CA  1 
ATOM   3656 C  C   . LEU B 1 177 ? -0.122  0.046   55.904  1.00 24.29 ? 1064 LEU B C   1 
ATOM   3657 O  O   . LEU B 1 177 ? -0.591  1.165   56.181  1.00 22.38 ? 1064 LEU B O   1 
ATOM   3658 C  CB  . LEU B 1 177 ? -1.148  -1.638  57.409  1.00 27.25 ? 1064 LEU B CB  1 
ATOM   3659 C  CG  . LEU B 1 177 ? -1.830  -2.422  56.268  1.00 28.78 ? 1064 LEU B CG  1 
ATOM   3660 C  CD1 . LEU B 1 177 ? -2.417  -3.822  56.700  1.00 25.57 ? 1064 LEU B CD1 1 
ATOM   3661 C  CD2 . LEU B 1 177 ? -2.899  -1.582  55.561  1.00 27.90 ? 1064 LEU B CD2 1 
ATOM   3662 N  N   . ARG B 1 178 ? 0.190   -0.342  54.665  1.00 22.42 ? 1065 ARG B N   1 
ATOM   3663 C  CA  . ARG B 1 178 ? -0.179  0.436   53.486  1.00 24.50 ? 1065 ARG B CA  1 
ATOM   3664 C  C   . ARG B 1 178 ? -1.195  -0.261  52.612  1.00 23.21 ? 1065 ARG B C   1 
ATOM   3665 O  O   . ARG B 1 178 ? -1.106  -1.470  52.323  1.00 23.38 ? 1065 ARG B O   1 
ATOM   3666 C  CB  . ARG B 1 178 ? 1.031   0.796   52.658  1.00 22.22 ? 1065 ARG B CB  1 
ATOM   3667 C  CG  . ARG B 1 178 ? 2.079   1.629   53.410  1.00 28.50 ? 1065 ARG B CG  1 
ATOM   3668 C  CD  . ARG B 1 178 ? 3.264   1.882   52.506  1.00 25.99 ? 1065 ARG B CD  1 
ATOM   3669 N  NE  . ARG B 1 178 ? 4.342   2.537   53.214  1.00 30.46 ? 1065 ARG B NE  1 
ATOM   3670 C  CZ  . ARG B 1 178 ? 5.391   1.945   53.755  1.00 35.45 ? 1065 ARG B CZ  1 
ATOM   3671 N  NH1 . ARG B 1 178 ? 5.569   0.635   53.698  1.00 31.19 ? 1065 ARG B NH1 1 
ATOM   3672 N  NH2 . ARG B 1 178 ? 6.293   2.695   54.348  1.00 40.79 ? 1065 ARG B NH2 1 
ATOM   3673 N  N   . LEU B 1 179 ? -2.197  0.521   52.246  1.00 21.48 ? 1066 LEU B N   1 
ATOM   3674 C  CA  . LEU B 1 179 ? -3.239  0.140   51.279  1.00 20.14 ? 1066 LEU B CA  1 
ATOM   3675 C  C   . LEU B 1 179 ? -2.946  0.851   49.963  1.00 21.67 ? 1066 LEU B C   1 
ATOM   3676 O  O   . LEU B 1 179 ? -3.002  2.074   49.876  1.00 23.56 ? 1066 LEU B O   1 
ATOM   3677 C  CB  . LEU B 1 179 ? -4.623  0.506   51.804  1.00 22.97 ? 1066 LEU B CB  1 
ATOM   3678 C  CG  . LEU B 1 179 ? -5.881  0.305   50.924  1.00 37.29 ? 1066 LEU B CG  1 
ATOM   3679 C  CD1 . LEU B 1 179 ? -5.912  -0.943  50.128  1.00 28.80 ? 1066 LEU B CD1 1 
ATOM   3680 C  CD2 . LEU B 1 179 ? -7.166  0.388   51.809  1.00 35.22 ? 1066 LEU B CD2 1 
ATOM   3681 N  N   . PHE B 1 180 ? -2.490  0.076   49.007  1.00 21.78 ? 1067 PHE B N   1 
ATOM   3682 C  CA  . PHE B 1 180 ? -2.161  0.560   47.660  1.00 20.35 ? 1067 PHE B CA  1 
ATOM   3683 C  C   . PHE B 1 180 ? -3.411  0.347   46.867  1.00 22.24 ? 1067 PHE B C   1 
ATOM   3684 O  O   . PHE B 1 180 ? -3.748  -0.794  46.501  1.00 23.29 ? 1067 PHE B O   1 
ATOM   3685 C  CB  . PHE B 1 180 ? -1.010  -0.254  47.046  1.00 22.14 ? 1067 PHE B CB  1 
ATOM   3686 C  CG  . PHE B 1 180 ? 0.274   -0.255  47.845  1.00 17.96 ? 1067 PHE B CG  1 
ATOM   3687 C  CD1 . PHE B 1 180 ? 1.306   0.646   47.504  1.00 20.81 ? 1067 PHE B CD1 1 
ATOM   3688 C  CD2 . PHE B 1 180 ? 0.456   -1.116  48.925  1.00 20.85 ? 1067 PHE B CD2 1 
ATOM   3689 C  CE1 . PHE B 1 180 ? 2.534   0.637   48.219  1.00 26.52 ? 1067 PHE B CE1 1 
ATOM   3690 C  CE2 . PHE B 1 180 ? 1.659   -1.144  49.643  1.00 22.97 ? 1067 PHE B CE2 1 
ATOM   3691 C  CZ  . PHE B 1 180 ? 2.706   -0.263  49.280  1.00 23.64 ? 1067 PHE B CZ  1 
ATOM   3692 N  N   . HIS B 1 181 ? -4.090  1.451   46.567  1.00 20.05 ? 1068 HIS B N   1 
ATOM   3693 C  CA  . HIS B 1 181 ? -5.407  1.383   45.917  1.00 20.10 ? 1068 HIS B CA  1 
ATOM   3694 C  C   . HIS B 1 181 ? -5.270  1.856   44.465  1.00 22.69 ? 1068 HIS B C   1 
ATOM   3695 O  O   . HIS B 1 181 ? -5.094  3.051   44.193  1.00 22.16 ? 1068 HIS B O   1 
ATOM   3696 C  CB  . HIS B 1 181 ? -6.399  2.225   46.736  1.00 25.37 ? 1068 HIS B CB  1 
ATOM   3697 C  CG  . HIS B 1 181 ? -7.802  2.154   46.241  1.00 24.09 ? 1068 HIS B CG  1 
ATOM   3698 N  ND1 . HIS B 1 181 ? -8.799  2.959   46.750  1.00 24.12 ? 1068 HIS B ND1 1 
ATOM   3699 C  CD2 . HIS B 1 181 ? -8.380  1.384   45.285  1.00 25.19 ? 1068 HIS B CD2 1 
ATOM   3700 C  CE1 . HIS B 1 181 ? -9.942  2.681   46.124  1.00 26.00 ? 1068 HIS B CE1 1 
ATOM   3701 N  NE2 . HIS B 1 181 ? -9.711  1.741   45.225  1.00 23.27 ? 1068 HIS B NE2 1 
ATOM   3702 N  N   . PHE B 1 182 ? -5.337  0.902   43.545  1.00 19.55 ? 1069 PHE B N   1 
ATOM   3703 C  CA  . PHE B 1 182 ? -5.384  1.190   42.089  1.00 21.41 ? 1069 PHE B CA  1 
ATOM   3704 C  C   . PHE B 1 182 ? -6.789  1.595   41.712  1.00 25.94 ? 1069 PHE B C   1 
ATOM   3705 O  O   . PHE B 1 182 ? -7.717  0.790   41.811  1.00 26.84 ? 1069 PHE B O   1 
ATOM   3706 C  CB  . PHE B 1 182 ? -4.928  -0.011  41.274  1.00 22.88 ? 1069 PHE B CB  1 
ATOM   3707 C  CG  . PHE B 1 182 ? -4.578  0.322   39.851  1.00 20.14 ? 1069 PHE B CG  1 
ATOM   3708 C  CD1 . PHE B 1 182 ? -3.414  1.062   39.555  1.00 22.78 ? 1069 PHE B CD1 1 
ATOM   3709 C  CD2 . PHE B 1 182 ? -5.404  -0.037  38.820  1.00 27.31 ? 1069 PHE B CD2 1 
ATOM   3710 C  CE1 . PHE B 1 182 ? -3.062  1.389   38.270  1.00 22.58 ? 1069 PHE B CE1 1 
ATOM   3711 C  CE2 . PHE B 1 182 ? -5.037  0.258   37.496  1.00 22.99 ? 1069 PHE B CE2 1 
ATOM   3712 C  CZ  . PHE B 1 182 ? -3.889  0.992   37.223  1.00 24.92 ? 1069 PHE B CZ  1 
ATOM   3713 N  N   . THR B 1 183 ? -6.940  2.860   41.313  1.00 23.37 ? 1070 THR B N   1 
ATOM   3714 C  CA  . THR B 1 183 ? -8.247  3.455   41.068  1.00 21.12 ? 1070 THR B CA  1 
ATOM   3715 C  C   . THR B 1 183 ? -8.554  3.730   39.598  1.00 24.65 ? 1070 THR B C   1 
ATOM   3716 O  O   . THR B 1 183 ? -9.615  4.299   39.257  1.00 20.61 ? 1070 THR B O   1 
ATOM   3717 C  CB  . THR B 1 183 ? -8.354  4.798   41.886  1.00 22.05 ? 1070 THR B CB  1 
ATOM   3718 O  OG1 . THR B 1 183 ? -7.232  5.621   41.552  1.00 22.03 ? 1070 THR B OG1 1 
ATOM   3719 C  CG2 . THR B 1 183 ? -8.345  4.528   43.451  1.00 23.45 ? 1070 THR B CG2 1 
ATOM   3720 N  N   . SER B 1 184 ? -7.649  3.337   38.722  1.00 21.34 ? 1071 SER B N   1 
ATOM   3721 C  CA  . SER B 1 184 ? -7.745  3.731   37.315  1.00 25.08 ? 1071 SER B CA  1 
ATOM   3722 C  C   . SER B 1 184 ? -8.049  2.581   36.395  1.00 28.90 ? 1071 SER B C   1 
ATOM   3723 O  O   . SER B 1 184 ? -8.009  2.751   35.191  1.00 23.89 ? 1071 SER B O   1 
ATOM   3724 C  CB  . SER B 1 184 ? -6.465  4.461   36.851  1.00 24.14 ? 1071 SER B CB  1 
ATOM   3725 O  OG  . SER B 1 184 ? -5.273  3.772   37.227  1.00 23.62 ? 1071 SER B OG  1 
ATOM   3726 N  N   . TRP B 1 185 ? -8.331  1.405   36.930  1.00 24.38 ? 1072 TRP B N   1 
ATOM   3727 C  CA  . TRP B 1 185 ? -8.746  0.292   36.030  1.00 23.39 ? 1072 TRP B CA  1 
ATOM   3728 C  C   . TRP B 1 185 ? -10.105 0.614   35.406  1.00 26.10 ? 1072 TRP B C   1 
ATOM   3729 O  O   . TRP B 1 185 ? -11.040 1.000   36.109  1.00 26.73 ? 1072 TRP B O   1 
ATOM   3730 C  CB  . TRP B 1 185 ? -8.734  -1.038  36.761  1.00 26.45 ? 1072 TRP B CB  1 
ATOM   3731 C  CG  . TRP B 1 185 ? -8.778  -2.235  35.847  1.00 24.51 ? 1072 TRP B CG  1 
ATOM   3732 C  CD1 . TRP B 1 185 ? -9.811  -2.626  35.042  1.00 31.55 ? 1072 TRP B CD1 1 
ATOM   3733 C  CD2 . TRP B 1 185 ? -7.747  -3.233  35.699  1.00 22.78 ? 1072 TRP B CD2 1 
ATOM   3734 N  NE1 . TRP B 1 185 ? -9.467  -3.778  34.387  1.00 25.76 ? 1072 TRP B NE1 1 
ATOM   3735 C  CE2 . TRP B 1 185 ? -8.224  -4.191  34.792  1.00 24.74 ? 1072 TRP B CE2 1 
ATOM   3736 C  CE3 . TRP B 1 185 ? -6.497  -3.422  36.296  1.00 25.88 ? 1072 TRP B CE3 1 
ATOM   3737 C  CZ2 . TRP B 1 185 ? -7.478  -5.296  34.416  1.00 29.95 ? 1072 TRP B CZ2 1 
ATOM   3738 C  CZ3 . TRP B 1 185 ? -5.741  -4.526  35.906  1.00 31.34 ? 1072 TRP B CZ3 1 
ATOM   3739 C  CH2 . TRP B 1 185 ? -6.251  -5.450  34.986  1.00 28.32 ? 1072 TRP B CH2 1 
ATOM   3740 N  N   . PRO B 1 186 ? -10.216 0.545   34.062  1.00 21.73 ? 1073 PRO B N   1 
ATOM   3741 C  CA  . PRO B 1 186 ? -11.514 1.014   33.500  1.00 26.77 ? 1073 PRO B CA  1 
ATOM   3742 C  C   . PRO B 1 186 ? -12.701 0.127   33.903  1.00 29.30 ? 1073 PRO B C   1 
ATOM   3743 O  O   . PRO B 1 186 ? -12.521 -1.018  34.216  1.00 27.75 ? 1073 PRO B O   1 
ATOM   3744 C  CB  . PRO B 1 186 ? -11.285 1.024   31.981  1.00 33.30 ? 1073 PRO B CB  1 
ATOM   3745 C  CG  . PRO B 1 186 ? -9.999  0.321   31.736  1.00 32.28 ? 1073 PRO B CG  1 
ATOM   3746 C  CD  . PRO B 1 186 ? -9.249  0.177   33.010  1.00 27.79 ? 1073 PRO B CD  1 
ATOM   3747 N  N   . ASP B 1 187 ? -13.913 0.689   33.881  1.00 35.65 ? 1074 ASP B N   1 
ATOM   3748 C  CA  . ASP B 1 187 ? -15.137 -0.057  34.234  1.00 39.74 ? 1074 ASP B CA  1 
ATOM   3749 C  C   . ASP B 1 187 ? -15.403 -1.279  33.332  1.00 35.84 ? 1074 ASP B C   1 
ATOM   3750 O  O   . ASP B 1 187 ? -15.924 -2.277  33.805  1.00 37.33 ? 1074 ASP B O   1 
ATOM   3751 C  CB  . ASP B 1 187 ? -16.353 0.888   34.242  1.00 44.19 ? 1074 ASP B CB  1 
ATOM   3752 C  CG  . ASP B 1 187 ? -16.558 1.584   35.604  1.00 53.25 ? 1074 ASP B CG  1 
ATOM   3753 O  OD1 . ASP B 1 187 ? -15.692 1.422   36.512  1.00 37.76 ? 1074 ASP B OD1 1 
ATOM   3754 O  OD2 . ASP B 1 187 ? -17.593 2.287   35.779  1.00 58.25 ? 1074 ASP B OD2 1 
ATOM   3755 N  N   . HIS B 1 188 ? -15.009 -1.187  32.063  1.00 31.91 ? 1075 HIS B N   1 
ATOM   3756 C  CA  . HIS B 1 188 ? -15.033 -2.319  31.129  1.00 41.63 ? 1075 HIS B CA  1 
ATOM   3757 C  C   . HIS B 1 188 ? -13.653 -2.534  30.519  1.00 34.78 ? 1075 HIS B C   1 
ATOM   3758 O  O   . HIS B 1 188 ? -12.975 -1.575  30.156  1.00 33.74 ? 1075 HIS B O   1 
ATOM   3759 C  CB  . HIS B 1 188 ? -15.988 -2.047  29.976  1.00 35.92 ? 1075 HIS B CB  1 
ATOM   3760 C  CG  . HIS B 1 188 ? -17.325 -1.560  30.419  1.00 42.44 ? 1075 HIS B CG  1 
ATOM   3761 N  ND1 . HIS B 1 188 ? -18.297 -2.404  30.911  1.00 42.42 ? 1075 HIS B ND1 1 
ATOM   3762 C  CD2 . HIS B 1 188 ? -17.837 -0.308  30.487  1.00 49.94 ? 1075 HIS B CD2 1 
ATOM   3763 C  CE1 . HIS B 1 188 ? -19.362 -1.696  31.237  1.00 45.32 ? 1075 HIS B CE1 1 
ATOM   3764 N  NE2 . HIS B 1 188 ? -19.107 -0.419  30.995  1.00 47.64 ? 1075 HIS B NE2 1 
ATOM   3765 N  N   . GLY B 1 189 ? -13.281 -3.796  30.372  1.00 30.44 ? 1076 GLY B N   1 
ATOM   3766 C  CA  . GLY B 1 189 ? -12.073 -4.145  29.660  1.00 32.19 ? 1076 GLY B CA  1 
ATOM   3767 C  C   . GLY B 1 189 ? -10.889 -3.914  30.562  1.00 27.54 ? 1076 GLY B C   1 
ATOM   3768 O  O   . GLY B 1 189 ? -11.016 -3.826  31.775  1.00 34.64 ? 1076 GLY B O   1 
ATOM   3769 N  N   . VAL B 1 190 ? -9.727  -3.862  29.931  1.00 23.93 ? 1077 VAL B N   1 
ATOM   3770 C  CA  . VAL B 1 190 ? -8.461  -3.758  30.625  1.00 24.48 ? 1077 VAL B CA  1 
ATOM   3771 C  C   . VAL B 1 190 ? -7.917  -2.342  30.368  1.00 23.87 ? 1077 VAL B C   1 
ATOM   3772 O  O   . VAL B 1 190 ? -8.353  -1.667  29.431  1.00 26.30 ? 1077 VAL B O   1 
ATOM   3773 C  CB  . VAL B 1 190 ? -7.470  -4.816  30.088  1.00 22.62 ? 1077 VAL B CB  1 
ATOM   3774 C  CG1 . VAL B 1 190 ? -8.009  -6.231  30.371  1.00 27.00 ? 1077 VAL B CG1 1 
ATOM   3775 C  CG2 . VAL B 1 190 ? -7.123  -4.524  28.641  1.00 21.40 ? 1077 VAL B CG2 1 
ATOM   3776 N  N   . PRO B 1 191 ? -6.952  -1.890  31.177  1.00 22.44 ? 1078 PRO B N   1 
ATOM   3777 C  CA  . PRO B 1 191 ? -6.353  -0.550  30.971  1.00 24.40 ? 1078 PRO B CA  1 
ATOM   3778 C  C   . PRO B 1 191 ? -5.812  -0.423  29.535  1.00 27.63 ? 1078 PRO B C   1 
ATOM   3779 O  O   . PRO B 1 191 ? -5.254  -1.401  29.024  1.00 28.07 ? 1078 PRO B O   1 
ATOM   3780 C  CB  . PRO B 1 191 ? -5.215  -0.527  31.974  1.00 27.87 ? 1078 PRO B CB  1 
ATOM   3781 C  CG  . PRO B 1 191 ? -5.598  -1.517  33.081  1.00 27.63 ? 1078 PRO B CG  1 
ATOM   3782 C  CD  . PRO B 1 191 ? -6.334  -2.612  32.314  1.00 27.54 ? 1078 PRO B CD  1 
ATOM   3783 N  N   . CYS B 1 192 ? -5.967  0.730   28.886  1.00 27.51 ? 1079 CYS B N   1 
ATOM   3784 C  CA  . CYS B 1 192 ? -5.492  0.865   27.501  1.00 27.20 ? 1079 CYS B CA  1 
ATOM   3785 C  C   . CYS B 1 192 ? -4.021  1.223   27.403  1.00 25.48 ? 1079 CYS B C   1 
ATOM   3786 O  O   . CYS B 1 192 ? -3.508  1.376   26.301  1.00 27.44 ? 1079 CYS B O   1 
ATOM   3787 C  CB  . CYS B 1 192 ? -6.301  1.886   26.708  1.00 31.08 ? 1079 CYS B CB  1 
ATOM   3788 S  SG  . CYS B 1 192 ? -6.330  3.498   27.430  1.00 39.16 ? 1079 CYS B SG  1 
ATOM   3789 N  N   . TYR B 1 193 ? -3.372  1.393   28.545  1.00 26.90 ? 1080 TYR B N   1 
ATOM   3790 C  CA  . TYR B 1 193 ? -1.934  1.576   28.638  1.00 24.62 ? 1080 TYR B CA  1 
ATOM   3791 C  C   . TYR B 1 193 ? -1.507  0.923   29.949  1.00 29.08 ? 1080 TYR B C   1 
ATOM   3792 O  O   . TYR B 1 193 ? -2.283  0.885   30.927  1.00 22.50 ? 1080 TYR B O   1 
ATOM   3793 C  CB  . TYR B 1 193 ? -1.586  3.092   28.586  1.00 26.23 ? 1080 TYR B CB  1 
ATOM   3794 C  CG  . TYR B 1 193 ? -2.056  3.870   29.806  1.00 21.96 ? 1080 TYR B CG  1 
ATOM   3795 C  CD1 . TYR B 1 193 ? -1.174  4.115   30.859  1.00 35.94 ? 1080 TYR B CD1 1 
ATOM   3796 C  CD2 . TYR B 1 193 ? -3.347  4.315   29.927  1.00 24.99 ? 1080 TYR B CD2 1 
ATOM   3797 C  CE1 . TYR B 1 193 ? -1.576  4.793   31.978  1.00 30.70 ? 1080 TYR B CE1 1 
ATOM   3798 C  CE2 . TYR B 1 193 ? -3.767  4.985   31.056  1.00 35.59 ? 1080 TYR B CE2 1 
ATOM   3799 C  CZ  . TYR B 1 193 ? -2.872  5.213   32.088  1.00 29.07 ? 1080 TYR B CZ  1 
ATOM   3800 O  OH  . TYR B 1 193 ? -3.267  5.871   33.238  1.00 37.35 ? 1080 TYR B OH  1 
ATOM   3801 N  N   . ALA B 1 194 ? -0.265  0.455   30.021  1.00 25.28 ? 1081 ALA B N   1 
ATOM   3802 C  CA  . ALA B 1 194 ? 0.205   -0.294  31.195  1.00 29.58 ? 1081 ALA B CA  1 
ATOM   3803 C  C   . ALA B 1 194 ? 1.009   0.507   32.180  1.00 24.37 ? 1081 ALA B C   1 
ATOM   3804 O  O   . ALA B 1 194 ? 1.224   0.056   33.306  1.00 26.53 ? 1081 ALA B O   1 
ATOM   3805 C  CB  . ALA B 1 194 ? 0.992   -1.529  30.767  1.00 32.72 ? 1081 ALA B CB  1 
ATOM   3806 N  N   . THR B 1 195 ? 1.371   1.740   31.826  1.00 27.99 ? 1082 THR B N   1 
ATOM   3807 C  CA  . THR B 1 195 ? 2.341   2.501   32.588  1.00 26.79 ? 1082 THR B CA  1 
ATOM   3808 C  C   . THR B 1 195 ? 1.912   2.842   34.019  1.00 24.63 ? 1082 THR B C   1 
ATOM   3809 O  O   . THR B 1 195 ? 2.745   2.819   34.950  1.00 25.55 ? 1082 THR B O   1 
ATOM   3810 C  CB  . THR B 1 195 ? 2.726   3.819   31.859  1.00 32.76 ? 1082 THR B CB  1 
ATOM   3811 O  OG1 . THR B 1 195 ? 2.827   3.588   30.434  1.00 35.14 ? 1082 THR B OG1 1 
ATOM   3812 C  CG2 . THR B 1 195 ? 4.063   4.351   32.431  1.00 31.64 ? 1082 THR B CG2 1 
ATOM   3813 N  N   . GLY B 1 196 ? 0.642   3.180   34.219  1.00 24.14 ? 1083 GLY B N   1 
ATOM   3814 C  CA  . GLY B 1 196 ? 0.149   3.448   35.568  1.00 24.65 ? 1083 GLY B CA  1 
ATOM   3815 C  C   . GLY B 1 196 ? 0.212   2.204   36.457  1.00 21.92 ? 1083 GLY B C   1 
ATOM   3816 O  O   . GLY B 1 196 ? 0.650   2.262   37.604  1.00 24.18 ? 1083 GLY B O   1 
ATOM   3817 N  N   . LEU B 1 197 ? -0.240  1.081   35.940  1.00 23.10 ? 1084 LEU B N   1 
ATOM   3818 C  CA  . LEU B 1 197 ? -0.172  -0.161  36.688  1.00 21.33 ? 1084 LEU B CA  1 
ATOM   3819 C  C   . LEU B 1 197 ? 1.267   -0.580  36.973  1.00 22.26 ? 1084 LEU B C   1 
ATOM   3820 O  O   . LEU B 1 197 ? 1.587   -1.015  38.092  1.00 23.78 ? 1084 LEU B O   1 
ATOM   3821 C  CB  . LEU B 1 197 ? -0.954  -1.273  36.002  1.00 23.58 ? 1084 LEU B CB  1 
ATOM   3822 C  CG  . LEU B 1 197 ? -1.071  -2.548  36.848  1.00 27.87 ? 1084 LEU B CG  1 
ATOM   3823 C  CD1 . LEU B 1 197 ? -1.801  -2.356  38.187  1.00 23.36 ? 1084 LEU B CD1 1 
ATOM   3824 C  CD2 . LEU B 1 197 ? -1.767  -3.660  36.005  1.00 26.39 ? 1084 LEU B CD2 1 
ATOM   3825 N  N   . LEU B 1 198 ? 2.164   -0.424  36.009  1.00 23.21 ? 1085 LEU B N   1 
ATOM   3826 C  CA  . LEU B 1 198 ? 3.588   -0.701  36.302  1.00 24.64 ? 1085 LEU B CA  1 
ATOM   3827 C  C   . LEU B 1 198 ? 4.182   0.205   37.372  1.00 25.63 ? 1085 LEU B C   1 
ATOM   3828 O  O   . LEU B 1 198 ? 4.996   -0.236  38.185  1.00 25.55 ? 1085 LEU B O   1 
ATOM   3829 C  CB  . LEU B 1 198 ? 4.407   -0.573  35.037  1.00 21.79 ? 1085 LEU B CB  1 
ATOM   3830 C  CG  . LEU B 1 198 ? 4.061   -1.617  33.975  1.00 24.91 ? 1085 LEU B CG  1 
ATOM   3831 C  CD1 . LEU B 1 198 ? 4.794   -1.379  32.630  1.00 22.02 ? 1085 LEU B CD1 1 
ATOM   3832 C  CD2 . LEU B 1 198 ? 4.430   -3.045  34.523  1.00 24.48 ? 1085 LEU B CD2 1 
ATOM   3833 N  N   . GLY B 1 199 ? 3.833   1.492   37.351  1.00 23.61 ? 1086 GLY B N   1 
ATOM   3834 C  CA  . GLY B 1 199 ? 4.266   2.396   38.399  1.00 21.03 ? 1086 GLY B CA  1 
ATOM   3835 C  C   . GLY B 1 199 ? 3.782   1.923   39.778  1.00 24.85 ? 1086 GLY B C   1 
ATOM   3836 O  O   . GLY B 1 199 ? 4.509   1.964   40.763  1.00 24.31 ? 1086 GLY B O   1 
ATOM   3837 N  N   . PHE B 1 200 ? 2.533   1.501   39.808  1.00 21.99 ? 1087 PHE B N   1 
ATOM   3838 C  CA  . PHE B 1 200 ? 1.861   0.988   41.002  1.00 20.49 ? 1087 PHE B CA  1 
ATOM   3839 C  C   . PHE B 1 200 ? 2.566   -0.242  41.547  1.00 26.15 ? 1087 PHE B C   1 
ATOM   3840 O  O   . PHE B 1 200 ? 2.874   -0.329  42.748  1.00 23.31 ? 1087 PHE B O   1 
ATOM   3841 C  CB  . PHE B 1 200 ? 0.407   0.718   40.633  1.00 21.75 ? 1087 PHE B CB  1 
ATOM   3842 C  CG  . PHE B 1 200 ? -0.435  0.084   41.719  1.00 22.07 ? 1087 PHE B CG  1 
ATOM   3843 C  CD1 . PHE B 1 200 ? -1.016  0.881   42.734  1.00 26.26 ? 1087 PHE B CD1 1 
ATOM   3844 C  CD2 . PHE B 1 200 ? -0.706  -1.277  41.688  1.00 25.28 ? 1087 PHE B CD2 1 
ATOM   3845 C  CE1 . PHE B 1 200 ? -1.822  0.341   43.668  1.00 20.51 ? 1087 PHE B CE1 1 
ATOM   3846 C  CE2 . PHE B 1 200 ? -1.519  -1.846  42.638  1.00 27.98 ? 1087 PHE B CE2 1 
ATOM   3847 C  CZ  . PHE B 1 200 ? -2.085  -1.032  43.641  1.00 25.18 ? 1087 PHE B CZ  1 
ATOM   3848 N  N   . VAL B 1 201 ? 2.853   -1.193  40.653  1.00 21.93 ? 1088 VAL B N   1 
ATOM   3849 C  CA  . VAL B 1 201 ? 3.616   -2.402  41.046  1.00 24.58 ? 1088 VAL B CA  1 
ATOM   3850 C  C   . VAL B 1 201 ? 4.956   -2.012  41.642  1.00 25.15 ? 1088 VAL B C   1 
ATOM   3851 O  O   . VAL B 1 201 ? 5.381   -2.562  42.668  1.00 25.36 ? 1088 VAL B O   1 
ATOM   3852 C  CB  . VAL B 1 201 ? 3.827   -3.354  39.842  1.00 25.47 ? 1088 VAL B CB  1 
ATOM   3853 C  CG1 . VAL B 1 201 ? 4.845   -4.521  40.211  1.00 27.17 ? 1088 VAL B CG1 1 
ATOM   3854 C  CG2 . VAL B 1 201 ? 2.514   -3.940  39.402  1.00 21.87 ? 1088 VAL B CG2 1 
ATOM   3855 N  N   . ARG B 1 202 ? 5.651   -1.066  41.001  1.00 24.99 ? 1089 ARG B N   1 
ATOM   3856 C  CA  . ARG B 1 202 ? 6.929   -0.561  41.536  1.00 22.09 ? 1089 ARG B CA  1 
ATOM   3857 C  C   . ARG B 1 202 ? 6.825   -0.025  42.964  1.00 24.08 ? 1089 ARG B C   1 
ATOM   3858 O  O   . ARG B 1 202 ? 7.740   -0.225  43.777  1.00 25.44 ? 1089 ARG B O   1 
ATOM   3859 C  CB  . ARG B 1 202 ? 7.568   0.493   40.630  1.00 30.10 ? 1089 ARG B CB  1 
ATOM   3860 C  CG  . ARG B 1 202 ? 8.917   1.009   41.231  1.00 39.78 ? 1089 ARG B CG  1 
ATOM   3861 C  CD  . ARG B 1 202 ? 9.714   1.964   40.332  1.00 39.25 ? 1089 ARG B CD  1 
ATOM   3862 N  NE  . ARG B 1 202 ? 9.752   1.442   38.974  1.00 40.12 ? 1089 ARG B NE  1 
ATOM   3863 C  CZ  . ARG B 1 202 ? 8.984   1.878   37.980  1.00 62.71 ? 1089 ARG B CZ  1 
ATOM   3864 N  NH1 . ARG B 1 202 ? 8.132   2.889   38.173  1.00 45.94 ? 1089 ARG B NH1 1 
ATOM   3865 N  NH2 . ARG B 1 202 ? 9.084   1.312   36.780  1.00 71.65 ? 1089 ARG B NH2 1 
ATOM   3866 N  N   . GLN B 1 203 ? 5.754   0.709   43.252  1.00 23.44 ? 1090 GLN B N   1 
ATOM   3867 C  CA  . GLN B 1 203 ? 5.513   1.224   44.623  1.00 20.75 ? 1090 GLN B CA  1 
ATOM   3868 C  C   . GLN B 1 203 ? 5.437   0.108   45.643  1.00 21.94 ? 1090 GLN B C   1 
ATOM   3869 O  O   . GLN B 1 203 ? 6.040   0.190   46.719  1.00 24.43 ? 1090 GLN B O   1 
ATOM   3870 C  CB  . GLN B 1 203 ? 4.243   2.026   44.674  1.00 25.66 ? 1090 GLN B CB  1 
ATOM   3871 C  CG  . GLN B 1 203 ? 4.292   3.344   43.879  1.00 28.66 ? 1090 GLN B CG  1 
ATOM   3872 C  CD  . GLN B 1 203 ? 4.733   4.585   44.625  1.00 29.77 ? 1090 GLN B CD  1 
ATOM   3873 O  OE1 . GLN B 1 203 ? 5.314   4.535   45.702  1.00 27.01 ? 1090 GLN B OE1 1 
ATOM   3874 N  NE2 . GLN B 1 203 ? 4.457   5.752   44.009  1.00 27.70 ? 1090 GLN B NE2 1 
ATOM   3875 N  N   . VAL B 1 204 ? 4.711   -0.933  45.294  1.00 22.20 ? 1091 VAL B N   1 
ATOM   3876 C  CA  . VAL B 1 204 ? 4.507   -2.076  46.202  1.00 25.90 ? 1091 VAL B CA  1 
ATOM   3877 C  C   . VAL B 1 204 ? 5.848   -2.762  46.402  1.00 22.19 ? 1091 VAL B C   1 
ATOM   3878 O  O   . VAL B 1 204 ? 6.221   -3.111  47.534  1.00 24.79 ? 1091 VAL B O   1 
ATOM   3879 C  CB  . VAL B 1 204 ? 3.447   -3.076  45.683  1.00 24.14 ? 1091 VAL B CB  1 
ATOM   3880 C  CG1 . VAL B 1 204 ? 3.311   -4.296  46.688  1.00 20.68 ? 1091 VAL B CG1 1 
ATOM   3881 C  CG2 . VAL B 1 204 ? 2.107   -2.381  45.456  1.00 23.68 ? 1091 VAL B CG2 1 
ATOM   3882 N  N   . LYS B 1 205 ? 6.579   -2.981  45.303  1.00 21.44 ? 1092 LYS B N   1 
ATOM   3883 C  CA  . LYS B 1 205 ? 7.939   -3.574  45.406  1.00 23.99 ? 1092 LYS B CA  1 
ATOM   3884 C  C   . LYS B 1 205 ? 8.893   -2.763  46.286  1.00 27.34 ? 1092 LYS B C   1 
ATOM   3885 O  O   . LYS B 1 205 ? 9.647   -3.339  47.075  1.00 25.09 ? 1092 LYS B O   1 
ATOM   3886 C  CB  . LYS B 1 205 ? 8.530   -3.765  44.000  1.00 24.40 ? 1092 LYS B CB  1 
ATOM   3887 C  CG  . LYS B 1 205 ? 7.828   -4.841  43.160  1.00 30.50 ? 1092 LYS B CG  1 
ATOM   3888 C  CD  . LYS B 1 205 ? 8.526   -5.054  41.808  1.00 30.77 ? 1092 LYS B CD  1 
ATOM   3889 C  CE  . LYS B 1 205 ? 7.979   -6.208  40.807  1.00 30.77 ? 1092 LYS B CE  1 
ATOM   3890 N  NZ  . LYS B 1 205 ? 8.212   -7.538  41.418  1.00 41.77 ? 1092 LYS B NZ  1 
ATOM   3891 N  N   . PHE B 1 206 ? 8.929   -1.439  46.115  1.00 24.08 ? 1093 PHE B N   1 
ATOM   3892 C  CA  . PHE B 1 206 ? 9.768   -0.583  46.952  1.00 25.01 ? 1093 PHE B CA  1 
ATOM   3893 C  C   . PHE B 1 206 ? 9.376   -0.553  48.428  1.00 26.78 ? 1093 PHE B C   1 
ATOM   3894 O  O   . PHE B 1 206 ? 10.243  -0.504  49.301  1.00 28.12 ? 1093 PHE B O   1 
ATOM   3895 C  CB  . PHE B 1 206 ? 9.786   0.852   46.417  1.00 24.57 ? 1093 PHE B CB  1 
ATOM   3896 C  CG  . PHE B 1 206 ? 10.631  1.016   45.152  1.00 31.59 ? 1093 PHE B CG  1 
ATOM   3897 N  N   . LEU B 1 207 ? 8.077   -0.578  48.689  1.00 23.98 ? 1094 LEU B N   1 
ATOM   3898 C  CA  . LEU B 1 207 ? 7.598   -0.190  49.989  1.00 26.63 ? 1094 LEU B CA  1 
ATOM   3899 C  C   . LEU B 1 207 ? 7.243   -1.356  50.889  1.00 26.46 ? 1094 LEU B C   1 
ATOM   3900 O  O   . LEU B 1 207 ? 7.339   -1.241  52.103  1.00 28.05 ? 1094 LEU B O   1 
ATOM   3901 C  CB  . LEU B 1 207 ? 6.433   0.783   49.871  1.00 25.68 ? 1094 LEU B CB  1 
ATOM   3902 C  CG  . LEU B 1 207 ? 6.811   2.181   49.343  1.00 23.64 ? 1094 LEU B CG  1 
ATOM   3903 C  CD1 . LEU B 1 207 ? 5.572   3.076   49.093  1.00 23.36 ? 1094 LEU B CD1 1 
ATOM   3904 C  CD2 . LEU B 1 207 ? 7.816   2.868   50.288  1.00 25.94 ? 1094 LEU B CD2 1 
ATOM   3905 N  N   . ASN B 1 208 ? 6.781   -2.455  50.320  1.00 24.76 ? 1095 ASN B N   1 
ATOM   3906 C  CA  . ASN B 1 208 ? 6.391   -3.583  51.179  1.00 23.78 ? 1095 ASN B CA  1 
ATOM   3907 C  C   . ASN B 1 208 ? 7.599   -4.059  52.040  1.00 26.02 ? 1095 ASN B C   1 
ATOM   3908 O  O   . ASN B 1 208 ? 8.683   -4.280  51.501  1.00 27.72 ? 1095 ASN B O   1 
ATOM   3909 C  CB  . ASN B 1 208 ? 5.895   -4.753  50.355  1.00 26.13 ? 1095 ASN B CB  1 
ATOM   3910 C  CG  . ASN B 1 208 ? 5.470   -5.897  51.229  1.00 25.31 ? 1095 ASN B CG  1 
ATOM   3911 O  OD1 . ASN B 1 208 ? 4.535   -5.758  52.029  1.00 23.07 ? 1095 ASN B OD1 1 
ATOM   3912 N  ND2 . ASN B 1 208 ? 6.155   -7.023  51.108  1.00 25.72 ? 1095 ASN B ND2 1 
ATOM   3913 N  N   . PRO B 1 209 ? 7.431   -4.163  53.363  1.00 24.38 ? 1096 PRO B N   1 
ATOM   3914 C  CA  . PRO B 1 209 ? 8.576   -4.668  54.158  1.00 26.04 ? 1096 PRO B CA  1 
ATOM   3915 C  C   . PRO B 1 209 ? 8.703   -6.163  53.971  1.00 21.53 ? 1096 PRO B C   1 
ATOM   3916 O  O   . PRO B 1 209 ? 7.763   -6.920  54.238  1.00 25.03 ? 1096 PRO B O   1 
ATOM   3917 C  CB  . PRO B 1 209 ? 8.221   -4.333  55.604  1.00 30.50 ? 1096 PRO B CB  1 
ATOM   3918 C  CG  . PRO B 1 209 ? 6.972   -3.538  55.549  1.00 33.43 ? 1096 PRO B CG  1 
ATOM   3919 C  CD  . PRO B 1 209 ? 6.316   -3.742  54.222  1.00 25.84 ? 1096 PRO B CD  1 
ATOM   3920 N  N   . PRO B 1 210 ? 9.887   -6.602  53.528  1.00 25.36 ? 1097 PRO B N   1 
ATOM   3921 C  CA  . PRO B 1 210 ? 10.029  -8.013  53.176  1.00 29.24 ? 1097 PRO B CA  1 
ATOM   3922 C  C   . PRO B 1 210 ? 9.954   -8.981  54.365  1.00 24.44 ? 1097 PRO B C   1 
ATOM   3923 O  O   . PRO B 1 210 ? 9.648   -10.152 54.158  1.00 26.96 ? 1097 PRO B O   1 
ATOM   3924 C  CB  . PRO B 1 210 ? 11.378  -8.071  52.467  1.00 31.44 ? 1097 PRO B CB  1 
ATOM   3925 C  CG  . PRO B 1 210 ? 12.105  -6.809  52.855  1.00 39.26 ? 1097 PRO B CG  1 
ATOM   3926 C  CD  . PRO B 1 210 ? 11.121  -5.820  53.344  1.00 31.17 ? 1097 PRO B CD  1 
ATOM   3927 N  N   . GLU B 1 211 ? 10.179  -8.489  55.575  1.00 24.15 ? 1098 GLU B N   1 
ATOM   3928 C  CA  . GLU B 1 211 ? 9.994   -9.291  56.775  1.00 25.34 ? 1098 GLU B CA  1 
ATOM   3929 C  C   . GLU B 1 211 ? 8.558   -9.460  57.256  1.00 26.44 ? 1098 GLU B C   1 
ATOM   3930 O  O   . GLU B 1 211 ? 8.321   -10.177 58.225  1.00 27.15 ? 1098 GLU B O   1 
ATOM   3931 C  CB  . GLU B 1 211 ? 10.850  -8.714  57.909  1.00 28.99 ? 1098 GLU B CB  1 
ATOM   3932 C  CG  . GLU B 1 211 ? 12.322  -8.849  57.578  1.00 30.85 ? 1098 GLU B CG  1 
ATOM   3933 C  CD  . GLU B 1 211 ? 13.210  -7.894  58.342  1.00 43.47 ? 1098 GLU B CD  1 
ATOM   3934 O  OE1 . GLU B 1 211 ? 13.002  -6.674  58.286  1.00 41.30 ? 1098 GLU B OE1 1 
ATOM   3935 O  OE2 . GLU B 1 211 ? 14.133  -8.374  58.991  1.00 35.86 ? 1098 GLU B OE2 1 
ATOM   3936 N  N   . ALA B 1 212 ? 7.611   -8.794  56.610  1.00 23.39 ? 1099 ALA B N   1 
ATOM   3937 C  CA  . ALA B 1 212 ? 6.210   -8.850  57.018  1.00 25.74 ? 1099 ALA B CA  1 
ATOM   3938 C  C   . ALA B 1 212 ? 5.610   -10.108 56.393  1.00 27.51 ? 1099 ALA B C   1 
ATOM   3939 O  O   . ALA B 1 212 ? 6.299   -10.861 55.712  1.00 23.07 ? 1099 ALA B O   1 
ATOM   3940 C  CB  . ALA B 1 212 ? 5.470   -7.601  56.561  1.00 25.09 ? 1099 ALA B CB  1 
ATOM   3941 N  N   . GLY B 1 213 ? 4.334   -10.332 56.660  1.00 23.19 ? 1100 GLY B N   1 
ATOM   3942 C  CA  . GLY B 1 213 ? 3.636   -11.435 56.118  1.00 26.03 ? 1100 GLY B CA  1 
ATOM   3943 C  C   . GLY B 1 213 ? 3.211   -11.174 54.673  1.00 23.80 ? 1100 GLY B C   1 
ATOM   3944 O  O   . GLY B 1 213 ? 3.670   -10.210 54.000  1.00 23.02 ? 1100 GLY B O   1 
ATOM   3945 N  N   . PRO B 1 214 ? 2.333   -12.038 54.180  1.00 25.76 ? 1101 PRO B N   1 
ATOM   3946 C  CA  . PRO B 1 214 ? 1.932   -11.965 52.775  1.00 24.12 ? 1101 PRO B CA  1 
ATOM   3947 C  C   . PRO B 1 214 ? 1.214   -10.657 52.407  1.00 21.90 ? 1101 PRO B C   1 
ATOM   3948 O  O   . PRO B 1 214 ? 0.494   -10.060 53.219  1.00 23.40 ? 1101 PRO B O   1 
ATOM   3949 C  CB  . PRO B 1 214 ? 0.988   -13.163 52.582  1.00 25.72 ? 1101 PRO B CB  1 
ATOM   3950 C  CG  . PRO B 1 214 ? 1.115   -14.000 53.785  1.00 31.66 ? 1101 PRO B CG  1 
ATOM   3951 C  CD  . PRO B 1 214 ? 1.671   -13.134 54.901  1.00 24.92 ? 1101 PRO B CD  1 
ATOM   3952 N  N   . ILE B 1 215 ? 1.471   -10.265 51.162  1.00 25.77 ? 1102 ILE B N   1 
ATOM   3953 C  CA  . ILE B 1 215 ? 0.901   -9.092  50.550  1.00 25.23 ? 1102 ILE B CA  1 
ATOM   3954 C  C   . ILE B 1 215 ? -0.536  -9.481  50.164  1.00 21.64 ? 1102 ILE B C   1 
ATOM   3955 O  O   . ILE B 1 215 ? -0.738  -10.413 49.374  1.00 24.33 ? 1102 ILE B O   1 
ATOM   3956 C  CB  . ILE B 1 215 ? 1.649   -8.684  49.264  1.00 23.85 ? 1102 ILE B CB  1 
ATOM   3957 C  CG1 . ILE B 1 215 ? 3.092   -8.203  49.573  1.00 25.47 ? 1102 ILE B CG1 1 
ATOM   3958 C  CG2 . ILE B 1 215 ? 0.848   -7.473  48.612  1.00 20.23 ? 1102 ILE B CG2 1 
ATOM   3959 C  CD1 . ILE B 1 215 ? 3.953   -7.968  48.276  1.00 30.81 ? 1102 ILE B CD1 1 
ATOM   3960 N  N   . VAL B 1 216 ? -1.528  -8.789  50.724  1.00 21.74 ? 1103 VAL B N   1 
ATOM   3961 C  CA  . VAL B 1 216 ? -2.916  -9.117  50.445  1.00 22.70 ? 1103 VAL B CA  1 
ATOM   3962 C  C   . VAL B 1 216 ? -3.344  -8.427  49.132  1.00 27.89 ? 1103 VAL B C   1 
ATOM   3963 O  O   . VAL B 1 216 ? -3.168  -7.220  48.957  1.00 27.03 ? 1103 VAL B O   1 
ATOM   3964 C  CB  . VAL B 1 216 ? -3.816  -8.747  51.621  1.00 22.71 ? 1103 VAL B CB  1 
ATOM   3965 C  CG1 . VAL B 1 216 ? -5.303  -8.918  51.232  1.00 25.19 ? 1103 VAL B CG1 1 
ATOM   3966 C  CG2 . VAL B 1 216 ? -3.499  -9.572  52.839  1.00 22.68 ? 1103 VAL B CG2 1 
ATOM   3967 N  N   . VAL B 1 217 ? -3.824  -9.211  48.175  1.00 25.78 ? 1104 VAL B N   1 
ATOM   3968 C  CA  . VAL B 1 217 ? -4.258  -8.657  46.881  1.00 22.52 ? 1104 VAL B CA  1 
ATOM   3969 C  C   . VAL B 1 217 ? -5.712  -9.006  46.661  1.00 23.92 ? 1104 VAL B C   1 
ATOM   3970 O  O   . VAL B 1 217 ? -6.108  -10.185 46.745  1.00 23.06 ? 1104 VAL B O   1 
ATOM   3971 C  CB  . VAL B 1 217 ? -3.410  -9.210  45.703  1.00 22.60 ? 1104 VAL B CB  1 
ATOM   3972 C  CG1 . VAL B 1 217 ? -3.701  -8.460  44.384  1.00 25.68 ? 1104 VAL B CG1 1 
ATOM   3973 C  CG2 . VAL B 1 217 ? -1.871  -9.147  46.070  1.00 22.34 ? 1104 VAL B CG2 1 
ATOM   3974 N  N   . HIS B 1 218 ? -6.492  -7.993  46.288  1.00 20.26 ? 1105 HIS B N   1 
ATOM   3975 C  CA  . HIS B 1 218 ? -7.912  -8.203  46.005  1.00 21.28 ? 1105 HIS B CA  1 
ATOM   3976 C  C   . HIS B 1 218 ? -8.444  -7.288  44.939  1.00 24.96 ? 1105 HIS B C   1 
ATOM   3977 O  O   . HIS B 1 218 ? -7.890  -6.233  44.646  1.00 22.19 ? 1105 HIS B O   1 
ATOM   3978 C  CB  . HIS B 1 218 ? -8.745  -8.085  47.298  1.00 24.78 ? 1105 HIS B CB  1 
ATOM   3979 C  CG  . HIS B 1 218 ? -9.054  -6.665  47.716  1.00 23.50 ? 1105 HIS B CG  1 
ATOM   3980 N  ND1 . HIS B 1 218 ? -10.139 -5.973  47.209  1.00 22.25 ? 1105 HIS B ND1 1 
ATOM   3981 C  CD2 . HIS B 1 218 ? -8.479  -5.849  48.637  1.00 23.04 ? 1105 HIS B CD2 1 
ATOM   3982 C  CE1 . HIS B 1 218 ? -10.181 -4.770  47.776  1.00 23.08 ? 1105 HIS B CE1 1 
ATOM   3983 N  NE2 . HIS B 1 218 ? -9.216  -4.682  48.668  1.00 23.20 ? 1105 HIS B NE2 1 
ATOM   3984 N  N   . CYS B 1 219 ? -9.534  -7.738  44.342  1.00 23.42 ? 1106 CYS B N   1 
ATOM   3985 C  CA  . CYS B 1 219 ? -10.337 -6.917  43.439  1.00 23.39 ? 1106 CYS B CA  1 
ATOM   3986 C  C   . CYS B 1 219 ? -11.766 -7.064  43.899  1.00 22.99 ? 1106 CYS B C   1 
ATOM   3987 O  O   . CYS B 1 219 ? -12.031 -6.765  45.053  1.00 26.18 ? 1106 CYS B O   1 
ATOM   3988 C  CB  . CYS B 1 219 ? -10.128 -7.280  41.968  1.00 21.37 ? 1106 CYS B CB  1 
ATOM   3989 S  SG  . CYS B 1 219 ? -10.287 -9.084  41.574  1.00 25.22 ? 1106 CYS B SG  1 
ATOM   3990 N  N   . SER B 1 220 ? -12.708 -7.466  43.038  1.00 23.88 ? 1107 SER B N   1 
ATOM   3991 C  CA  . SER B 1 220 ? -14.105 -7.719  43.516  1.00 21.04 ? 1107 SER B CA  1 
ATOM   3992 C  C   . SER B 1 220 ? -14.187 -9.218  43.851  1.00 25.13 ? 1107 SER B C   1 
ATOM   3993 O  O   . SER B 1 220 ? -14.213 -9.595  45.018  1.00 24.54 ? 1107 SER B O   1 
ATOM   3994 C  CB  . SER B 1 220 ? -15.145 -7.309  42.481  1.00 21.25 ? 1107 SER B CB  1 
ATOM   3995 O  OG  . SER B 1 220 ? -16.455 -7.384  43.068  1.00 23.00 ? 1107 SER B OG  1 
ATOM   3996 N  N   . ALA B 1 221 ? -14.181 -10.091 42.850  1.00 23.96 ? 1108 ALA B N   1 
ATOM   3997 C  CA  . ALA B 1 221 ? -14.251 -11.524 43.127  1.00 24.62 ? 1108 ALA B CA  1 
ATOM   3998 C  C   . ALA B 1 221 ? -12.937 -12.131 43.646  1.00 27.70 ? 1108 ALA B C   1 
ATOM   3999 O  O   . ALA B 1 221 ? -12.972 -13.175 44.282  1.00 22.33 ? 1108 ALA B O   1 
ATOM   4000 C  CB  . ALA B 1 221 ? -14.795 -12.323 41.935  1.00 27.57 ? 1108 ALA B CB  1 
ATOM   4001 N  N   . GLY B 1 222 ? -11.788 -11.522 43.340  1.00 24.55 ? 1109 GLY B N   1 
ATOM   4002 C  CA  . GLY B 1 222 ? -10.486 -12.051 43.745  1.00 25.99 ? 1109 GLY B CA  1 
ATOM   4003 C  C   . GLY B 1 222 ? -9.805  -12.979 42.751  1.00 28.58 ? 1109 GLY B C   1 
ATOM   4004 O  O   . GLY B 1 222 ? -8.953  -13.787 43.138  1.00 27.36 ? 1109 GLY B O   1 
ATOM   4005 N  N   . ALA B 1 223 ? -10.151 -12.842 41.459  1.00 23.86 ? 1110 ALA B N   1 
ATOM   4006 C  CA  . ALA B 1 223 ? -9.575  -13.656 40.404  1.00 24.85 ? 1110 ALA B CA  1 
ATOM   4007 C  C   . ALA B 1 223 ? -8.887  -12.867 39.259  1.00 23.51 ? 1110 ALA B C   1 
ATOM   4008 O  O   . ALA B 1 223 ? -7.736  -13.155 38.904  1.00 24.08 ? 1110 ALA B O   1 
ATOM   4009 C  CB  . ALA B 1 223 ? -10.624 -14.582 39.835  1.00 27.69 ? 1110 ALA B CB  1 
ATOM   4010 N  N   . GLY B 1 224 ? -9.610  -11.950 38.635  1.00 24.89 ? 1111 GLY B N   1 
ATOM   4011 C  CA  . GLY B 1 224 ? -9.158  -11.419 37.340  1.00 27.38 ? 1111 GLY B CA  1 
ATOM   4012 C  C   . GLY B 1 224 ? -8.043  -10.409 37.492  1.00 24.80 ? 1111 GLY B C   1 
ATOM   4013 O  O   . GLY B 1 224 ? -6.882  -10.673 37.173  1.00 26.10 ? 1111 GLY B O   1 
ATOM   4014 N  N   . ARG B 1 225 ? -8.399  -9.236  37.968  1.00 22.76 ? 1112 ARG B N   1 
ATOM   4015 C  CA  . ARG B 1 225 ? -7.419  -8.172  38.188  1.00 21.84 ? 1112 ARG B CA  1 
ATOM   4016 C  C   . ARG B 1 225 ? -6.393  -8.565  39.245  1.00 19.77 ? 1112 ARG B C   1 
ATOM   4017 O  O   . ARG B 1 225 ? -5.208  -8.259  39.133  1.00 24.29 ? 1112 ARG B O   1 
ATOM   4018 C  CB  . ARG B 1 225 ? -8.140  -6.893  38.594  1.00 26.87 ? 1112 ARG B CB  1 
ATOM   4019 C  CG  . ARG B 1 225 ? -9.161  -6.364  37.543  1.00 27.60 ? 1112 ARG B CG  1 
ATOM   4020 C  CD  . ARG B 1 225 ? -9.930  -5.216  38.121  1.00 28.34 ? 1112 ARG B CD  1 
ATOM   4021 N  NE  . ARG B 1 225 ? -11.068 -4.775  37.310  1.00 25.54 ? 1112 ARG B NE  1 
ATOM   4022 C  CZ  . ARG B 1 225 ? -11.885 -3.791  37.665  1.00 31.34 ? 1112 ARG B CZ  1 
ATOM   4023 N  NH1 . ARG B 1 225 ? -11.670 -3.126  38.789  1.00 25.82 ? 1112 ARG B NH1 1 
ATOM   4024 N  NH2 . ARG B 1 225 ? -12.920 -3.467  36.897  1.00 29.50 ? 1112 ARG B NH2 1 
ATOM   4025 N  N   . THR B 1 226 ? -6.871  -9.264  40.275  1.00 23.92 ? 1113 THR B N   1 
ATOM   4026 C  CA  . THR B 1 226 ? -5.997  -9.848  41.311  1.00 21.75 ? 1113 THR B CA  1 
ATOM   4027 C  C   . THR B 1 226 ? -4.910  -10.702 40.654  1.00 24.69 ? 1113 THR B C   1 
ATOM   4028 O  O   . THR B 1 226 ? -3.712  -10.545 40.914  1.00 22.50 ? 1113 THR B O   1 
ATOM   4029 C  CB  . THR B 1 226 ? -6.867  -10.653 42.270  1.00 25.32 ? 1113 THR B CB  1 
ATOM   4030 O  OG1 . THR B 1 226 ? -7.665  -9.739  43.028  1.00 25.13 ? 1113 THR B OG1 1 
ATOM   4031 C  CG2 . THR B 1 226 ? -6.030  -11.456 43.236  1.00 21.44 ? 1113 THR B CG2 1 
ATOM   4032 N  N   . GLY B 1 227 ? -5.332  -11.560 39.738  1.00 26.22 ? 1114 GLY B N   1 
ATOM   4033 C  CA  . GLY B 1 227 ? -4.417  -12.414 38.995  1.00 21.80 ? 1114 GLY B CA  1 
ATOM   4034 C  C   . GLY B 1 227 ? -3.486  -11.640 38.095  1.00 22.56 ? 1114 GLY B C   1 
ATOM   4035 O  O   . GLY B 1 227 ? -2.285  -11.983 38.013  1.00 23.71 ? 1114 GLY B O   1 
ATOM   4036 N  N   . CYS B 1 228 ? -3.994  -10.598 37.442  1.00 22.24 ? 1115 CYS B N   1 
ATOM   4037 C  CA  . CYS B 1 228 ? -3.153  -9.763  36.604  1.00 22.65 ? 1115 CYS B CA  1 
ATOM   4038 C  C   . CYS B 1 228 ? -2.023  -9.133  37.440  1.00 21.38 ? 1115 CYS B C   1 
ATOM   4039 O  O   . CYS B 1 228 ? -0.879  -9.160  37.017  1.00 21.88 ? 1115 CYS B O   1 
ATOM   4040 C  CB  . CYS B 1 228 ? -3.941  -8.697  35.887  1.00 26.25 ? 1115 CYS B CB  1 
ATOM   4041 S  SG  . CYS B 1 228 ? -5.064  -9.376  34.643  1.00 24.69 ? 1115 CYS B SG  1 
ATOM   4042 N  N   . PHE B 1 229 ? -2.361  -8.540  38.578  1.00 23.31 ? 1116 PHE B N   1 
ATOM   4043 C  CA  . PHE B 1 229 ? -1.341  -7.933  39.440  1.00 22.02 ? 1116 PHE B CA  1 
ATOM   4044 C  C   . PHE B 1 229 ? -0.276  -8.978  39.789  1.00 23.92 ? 1116 PHE B C   1 
ATOM   4045 O  O   . PHE B 1 229 ? 0.928   -8.733  39.660  1.00 23.99 ? 1116 PHE B O   1 
ATOM   4046 C  CB  . PHE B 1 229 ? -1.953  -7.320  40.728  1.00 23.41 ? 1116 PHE B CB  1 
ATOM   4047 C  CG  . PHE B 1 229 ? -0.941  -6.738  41.620  1.00 24.02 ? 1116 PHE B CG  1 
ATOM   4048 C  CD1 . PHE B 1 229 ? -0.513  -5.408  41.452  1.00 25.70 ? 1116 PHE B CD1 1 
ATOM   4049 C  CD2 . PHE B 1 229 ? -0.316  -7.500  42.580  1.00 24.19 ? 1116 PHE B CD2 1 
ATOM   4050 C  CE1 . PHE B 1 229 ? 0.522   -4.910  42.257  1.00 24.51 ? 1116 PHE B CE1 1 
ATOM   4051 C  CE2 . PHE B 1 229 ? 0.698   -6.973  43.371  1.00 22.34 ? 1116 PHE B CE2 1 
ATOM   4052 C  CZ  . PHE B 1 229 ? 1.119   -5.723  43.210  1.00 25.85 ? 1116 PHE B CZ  1 
ATOM   4053 N  N   . ILE B 1 230 ? -0.721  -10.127 40.288  1.00 23.81 ? 1117 ILE B N   1 
ATOM   4054 C  CA  . ILE B 1 230 ? 0.237   -11.179 40.729  1.00 24.61 ? 1117 ILE B CA  1 
ATOM   4055 C  C   . ILE B 1 230 ? 1.101   -11.666 39.568  1.00 21.22 ? 1117 ILE B C   1 
ATOM   4056 O  O   . ILE B 1 230 ? 2.310   -11.725 39.705  1.00 21.68 ? 1117 ILE B O   1 
ATOM   4057 C  CB  . ILE B 1 230 ? -0.468  -12.328 41.448  1.00 22.15 ? 1117 ILE B CB  1 
ATOM   4058 C  CG1 . ILE B 1 230 ? -1.116  -11.771 42.750  1.00 20.11 ? 1117 ILE B CG1 1 
ATOM   4059 C  CG2 . ILE B 1 230 ? 0.504   -13.517 41.714  1.00 22.42 ? 1117 ILE B CG2 1 
ATOM   4060 C  CD1 . ILE B 1 230 ? -2.113  -12.693 43.520  1.00 23.07 ? 1117 ILE B CD1 1 
ATOM   4061 N  N   . ALA B 1 231 ? 0.492   -11.925 38.422  1.00 24.04 ? 1118 ALA B N   1 
ATOM   4062 C  CA  . ALA B 1 231 ? 1.222   -12.396 37.244  1.00 20.12 ? 1118 ALA B CA  1 
ATOM   4063 C  C   . ALA B 1 231 ? 2.277   -11.392 36.791  1.00 24.37 ? 1118 ALA B C   1 
ATOM   4064 O  O   . ALA B 1 231 ? 3.418   -11.748 36.486  1.00 24.35 ? 1118 ALA B O   1 
ATOM   4065 C  CB  . ALA B 1 231 ? 0.270   -12.716 36.100  1.00 23.82 ? 1118 ALA B CB  1 
ATOM   4066 N  N   . ILE B 1 232 ? 1.898   -10.129 36.742  1.00 21.34 ? 1119 ILE B N   1 
ATOM   4067 C  CA  . ILE B 1 232 ? 2.849   -9.083  36.313  1.00 21.73 ? 1119 ILE B CA  1 
ATOM   4068 C  C   . ILE B 1 232 ? 4.008   -8.958  37.303  1.00 19.30 ? 1119 ILE B C   1 
ATOM   4069 O  O   . ILE B 1 232 ? 5.181   -8.982  36.920  1.00 24.51 ? 1119 ILE B O   1 
ATOM   4070 C  CB  . ILE B 1 232 ? 2.108   -7.714  36.109  1.00 22.29 ? 1119 ILE B CB  1 
ATOM   4071 C  CG1 . ILE B 1 232 ? 1.182   -7.810  34.899  1.00 22.67 ? 1119 ILE B CG1 1 
ATOM   4072 C  CG2 . ILE B 1 232 ? 3.167   -6.547  35.918  1.00 21.99 ? 1119 ILE B CG2 1 
ATOM   4073 C  CD1 . ILE B 1 232 ? 0.080   -6.683  34.842  1.00 21.86 ? 1119 ILE B CD1 1 
ATOM   4074 N  N   . ASP B 1 233 ? 3.667   -8.839  38.568  1.00 25.95 ? 1120 ASP B N   1 
ATOM   4075 C  CA  . ASP B 1 233 ? 4.655   -8.722  39.610  1.00 22.17 ? 1120 ASP B CA  1 
ATOM   4076 C  C   . ASP B 1 233 ? 5.651   -9.883  39.544  1.00 23.74 ? 1120 ASP B C   1 
ATOM   4077 O  O   . ASP B 1 233 ? 6.854   -9.687  39.619  1.00 23.72 ? 1120 ASP B O   1 
ATOM   4078 C  CB  . ASP B 1 233 ? 3.954   -8.692  40.953  1.00 17.91 ? 1120 ASP B CB  1 
ATOM   4079 C  CG  . ASP B 1 233 ? 4.896   -8.303  42.114  1.00 26.16 ? 1120 ASP B CG  1 
ATOM   4080 O  OD1 . ASP B 1 233 ? 5.632   -7.300  41.988  1.00 27.43 ? 1120 ASP B OD1 1 
ATOM   4081 O  OD2 . ASP B 1 233 ? 4.770   -8.918  43.184  1.00 27.89 ? 1120 ASP B OD2 1 
ATOM   4082 N  N   . THR B 1 234 ? 5.132   -11.078 39.393  1.00 23.51 ? 1121 THR B N   1 
ATOM   4083 C  CA  . THR B 1 234 ? 5.948   -12.289 39.425  1.00 20.02 ? 1121 THR B CA  1 
ATOM   4084 C  C   . THR B 1 234 ? 6.857   -12.373 38.189  1.00 25.52 ? 1121 THR B C   1 
ATOM   4085 O  O   . THR B 1 234 ? 8.046   -12.712 38.282  1.00 23.21 ? 1121 THR B O   1 
ATOM   4086 C  CB  . THR B 1 234 ? 5.012   -13.529 39.514  1.00 25.09 ? 1121 THR B CB  1 
ATOM   4087 O  OG1 . THR B 1 234 ? 4.233   -13.481 40.734  1.00 25.05 ? 1121 THR B OG1 1 
ATOM   4088 C  CG2 . THR B 1 234 ? 5.790   -14.854 39.423  1.00 24.45 ? 1121 THR B CG2 1 
ATOM   4089 N  N   . MET B 1 235 ? 6.289   -12.054 37.027  1.00 23.50 ? 1122 MET B N   1 
ATOM   4090 C  CA  . MET B 1 235 ? 7.028   -12.108 35.772  1.00 23.03 ? 1122 MET B CA  1 
ATOM   4091 C  C   . MET B 1 235 ? 8.098   -10.981 35.703  1.00 21.20 ? 1122 MET B C   1 
ATOM   4092 O  O   . MET B 1 235 ? 9.174   -11.148 35.111  1.00 23.28 ? 1122 MET B O   1 
ATOM   4093 C  CB  . MET B 1 235 ? 6.054   -12.029 34.584  1.00 22.64 ? 1122 MET B CB  1 
ATOM   4094 C  CG  . MET B 1 235 ? 5.228   -13.317 34.384  1.00 25.55 ? 1122 MET B CG  1 
ATOM   4095 S  SD  . MET B 1 235 ? 6.179   -14.835 34.073  1.00 25.38 ? 1122 MET B SD  1 
ATOM   4096 C  CE  . MET B 1 235 ? 6.481   -15.504 35.692  1.00 24.38 ? 1122 MET B CE  1 
ATOM   4097 N  N   . LEU B 1 236 ? 7.826   -9.819  36.288  1.00 20.87 ? 1123 LEU B N   1 
ATOM   4098 C  CA  . LEU B 1 236 ? 8.903   -8.805  36.373  1.00 24.64 ? 1123 LEU B CA  1 
ATOM   4099 C  C   . LEU B 1 236 ? 10.130  -9.310  37.155  1.00 25.94 ? 1123 LEU B C   1 
ATOM   4100 O  O   . LEU B 1 236 ? 11.282  -9.109  36.729  1.00 22.96 ? 1123 LEU B O   1 
ATOM   4101 C  CB  . LEU B 1 236 ? 8.416   -7.495  36.966  1.00 26.76 ? 1123 LEU B CB  1 
ATOM   4102 C  CG  . LEU B 1 236 ? 7.407   -6.759  36.097  1.00 29.43 ? 1123 LEU B CG  1 
ATOM   4103 C  CD1 . LEU B 1 236 ? 7.106   -5.479  36.844  1.00 34.10 ? 1123 LEU B CD1 1 
ATOM   4104 C  CD2 . LEU B 1 236 ? 7.835   -6.528  34.641  1.00 38.51 ? 1123 LEU B CD2 1 
ATOM   4105 N  N   . ASP B 1 237 ? 9.882   -10.006 38.269  1.00 26.88 ? 1124 ASP B N   1 
ATOM   4106 C  CA  . ASP B 1 237 ? 10.971  -10.624 39.043  1.00 27.44 ? 1124 ASP B CA  1 
ATOM   4107 C  C   . ASP B 1 237 ? 11.708  -11.689 38.201  1.00 25.38 ? 1124 ASP B C   1 
ATOM   4108 O  O   . ASP B 1 237 ? 12.950  -11.767 38.187  1.00 26.24 ? 1124 ASP B O   1 
ATOM   4109 C  CB  . ASP B 1 237 ? 10.399  -11.292 40.293  1.00 24.61 ? 1124 ASP B CB  1 
ATOM   4110 C  CG  . ASP B 1 237 ? 9.944   -10.298 41.352  1.00 38.40 ? 1124 ASP B CG  1 
ATOM   4111 O  OD1 . ASP B 1 237 ? 10.217  -9.097  41.179  1.00 26.84 ? 1124 ASP B OD1 1 
ATOM   4112 O  OD2 . ASP B 1 237 ? 9.307   -10.741 42.329  1.00 34.28 ? 1124 ASP B OD2 1 
ATOM   4113 N  N   . MET B 1 238 ? 10.951  -12.523 37.480  1.00 25.35 ? 1125 MET B N   1 
ATOM   4114 C  CA  . MET B 1 238 ? 11.606  -13.537 36.639  1.00 25.46 ? 1125 MET B CA  1 
ATOM   4115 C  C   . MET B 1 238 ? 12.458  -12.892 35.533  1.00 25.53 ? 1125 MET B C   1 
ATOM   4116 O  O   . MET B 1 238 ? 13.556  -13.357 35.239  1.00 24.78 ? 1125 MET B O   1 
ATOM   4117 C  CB  . MET B 1 238 ? 10.545  -14.434 35.983  1.00 22.58 ? 1125 MET B CB  1 
ATOM   4118 C  CG  . MET B 1 238 ? 11.127  -15.585 35.185  1.00 30.36 ? 1125 MET B CG  1 
ATOM   4119 S  SD  . MET B 1 238 ? 9.846   -16.734 34.659  1.00 26.62 ? 1125 MET B SD  1 
ATOM   4120 C  CE  . MET B 1 238 ? 10.832  -18.107 34.066  1.00 31.95 ? 1125 MET B CE  1 
ATOM   4121 N  N   . ALA B 1 239 ? 11.902  -11.861 34.882  1.00 24.51 ? 1126 ALA B N   1 
ATOM   4122 C  CA  . ALA B 1 239 ? 12.616  -11.137 33.832  1.00 24.84 ? 1126 ALA B CA  1 
ATOM   4123 C  C   . ALA B 1 239 ? 13.926  -10.578 34.409  1.00 25.32 ? 1126 ALA B C   1 
ATOM   4124 O  O   . ALA B 1 239 ? 15.001  -10.748 33.822  1.00 25.71 ? 1126 ALA B O   1 
ATOM   4125 C  CB  . ALA B 1 239 ? 11.780  -10.014 33.262  1.00 25.70 ? 1126 ALA B CB  1 
ATOM   4126 N  N   . GLU B 1 240 ? 13.808  -9.903  35.560  1.00 29.42 ? 1127 GLU B N   1 
ATOM   4127 C  CA  . GLU B 1 240 ? 14.960  -9.238  36.187  1.00 29.18 ? 1127 GLU B CA  1 
ATOM   4128 C  C   . GLU B 1 240 ? 16.059  -10.225 36.505  1.00 28.32 ? 1127 GLU B C   1 
ATOM   4129 O  O   . GLU B 1 240 ? 17.267  -9.950  36.287  1.00 26.81 ? 1127 GLU B O   1 
ATOM   4130 C  CB  . GLU B 1 240 ? 14.552  -8.545  37.486  1.00 29.35 ? 1127 GLU B CB  1 
ATOM   4131 C  CG  . GLU B 1 240 ? 15.750  -7.963  38.276  1.00 27.40 ? 1127 GLU B CG  1 
ATOM   4132 C  CD  . GLU B 1 240 ? 15.330  -7.383  39.629  1.00 38.76 ? 1127 GLU B CD  1 
ATOM   4133 O  OE1 . GLU B 1 240 ? 14.237  -7.733  40.107  1.00 37.92 ? 1127 GLU B OE1 1 
ATOM   4134 O  OE2 . GLU B 1 240 ? 16.100  -6.572  40.229  1.00 38.49 ? 1127 GLU B OE2 1 
ATOM   4135 N  N   . ASN B 1 241 ? 15.662  -11.362 37.051  1.00 26.94 ? 1128 ASN B N   1 
ATOM   4136 C  CA  . ASN B 1 241 ? 16.668  -12.339 37.549  1.00 23.98 ? 1128 ASN B CA  1 
ATOM   4137 C  C   . ASN B 1 241 ? 17.200  -13.303 36.486  1.00 35.18 ? 1128 ASN B C   1 
ATOM   4138 O  O   . ASN B 1 241 ? 18.377  -13.675 36.536  1.00 28.10 ? 1128 ASN B O   1 
ATOM   4139 C  CB  . ASN B 1 241 ? 16.106  -13.111 38.741  1.00 28.12 ? 1128 ASN B CB  1 
ATOM   4140 C  CG  . ASN B 1 241 ? 15.949  -12.223 40.019  1.00 51.85 ? 1128 ASN B CG  1 
ATOM   4141 O  OD1 . ASN B 1 241 ? 16.918  -11.996 40.773  1.00 35.76 ? 1128 ASN B OD1 1 
ATOM   4142 N  ND2 . ASN B 1 241 ? 14.726  -11.736 40.265  1.00 32.62 ? 1128 ASN B ND2 1 
ATOM   4143 N  N   . GLU B 1 242 ? 16.339  -13.725 35.558  1.00 26.36 ? 1129 GLU B N   1 
ATOM   4144 C  CA  . GLU B 1 242 ? 16.673  -14.731 34.526  1.00 29.14 ? 1129 GLU B CA  1 
ATOM   4145 C  C   . GLU B 1 242 ? 16.748  -14.241 33.086  1.00 25.76 ? 1129 GLU B C   1 
ATOM   4146 O  O   . GLU B 1 242 ? 17.250  -14.956 32.233  1.00 22.10 ? 1129 GLU B O   1 
ATOM   4147 C  CB  . GLU B 1 242 ? 15.647  -15.867 34.535  1.00 27.84 ? 1129 GLU B CB  1 
ATOM   4148 C  CG  . GLU B 1 242 ? 15.491  -16.528 35.862  1.00 28.14 ? 1129 GLU B CG  1 
ATOM   4149 C  CD  . GLU B 1 242 ? 14.540  -17.698 35.814  1.00 31.61 ? 1129 GLU B CD  1 
ATOM   4150 O  OE1 . GLU B 1 242 ? 14.633  -18.496 34.863  1.00 36.85 ? 1129 GLU B OE1 1 
ATOM   4151 O  OE2 . GLU B 1 242 ? 13.697  -17.823 36.739  1.00 30.29 ? 1129 GLU B OE2 1 
ATOM   4152 N  N   . GLY B 1 243 ? 16.208  -13.072 32.783  1.00 24.33 ? 1130 GLY B N   1 
ATOM   4153 C  CA  . GLY B 1 243 ? 16.208  -12.581 31.407  1.00 29.84 ? 1130 GLY B CA  1 
ATOM   4154 C  C   . GLY B 1 243 ? 15.271  -13.353 30.502  1.00 30.73 ? 1130 GLY B C   1 
ATOM   4155 O  O   . GLY B 1 243 ? 15.384  -13.290 29.282  1.00 22.87 ? 1130 GLY B O   1 
ATOM   4156 N  N   . VAL B 1 244 ? 14.324  -14.054 31.114  1.00 24.45 ? 1131 VAL B N   1 
ATOM   4157 C  CA  . VAL B 1 244 ? 13.261  -14.785 30.398  1.00 26.50 ? 1131 VAL B CA  1 
ATOM   4158 C  C   . VAL B 1 244 ? 11.958  -14.597 31.166  1.00 32.08 ? 1131 VAL B C   1 
ATOM   4159 O  O   . VAL B 1 244 ? 11.977  -14.200 32.336  1.00 26.02 ? 1131 VAL B O   1 
ATOM   4160 C  CB  . VAL B 1 244 ? 13.576  -16.288 30.262  1.00 29.63 ? 1131 VAL B CB  1 
ATOM   4161 C  CG1 . VAL B 1 244 ? 14.978  -16.482 29.722  1.00 29.33 ? 1131 VAL B CG1 1 
ATOM   4162 C  CG2 . VAL B 1 244 ? 13.411  -16.996 31.628  1.00 27.53 ? 1131 VAL B CG2 1 
ATOM   4163 N  N   . VAL B 1 245 ? 10.828  -14.820 30.492  1.00 21.81 ? 1132 VAL B N   1 
ATOM   4164 C  CA  . VAL B 1 245 ? 9.512   -14.888 31.184  1.00 24.87 ? 1132 VAL B CA  1 
ATOM   4165 C  C   . VAL B 1 245 ? 8.749   -16.136 30.695  1.00 29.10 ? 1132 VAL B C   1 
ATOM   4166 O  O   . VAL B 1 245 ? 8.976   -16.612 29.589  1.00 28.47 ? 1132 VAL B O   1 
ATOM   4167 C  CB  . VAL B 1 245 ? 8.632   -13.657 30.918  1.00 27.51 ? 1132 VAL B CB  1 
ATOM   4168 C  CG1 . VAL B 1 245 ? 9.229   -12.388 31.556  1.00 33.87 ? 1132 VAL B CG1 1 
ATOM   4169 C  CG2 . VAL B 1 245 ? 8.400   -13.431 29.385  1.00 26.80 ? 1132 VAL B CG2 1 
ATOM   4170 N  N   . ASP B 1 246 ? 7.886   -16.668 31.556  1.00 25.70 ? 1133 ASP B N   1 
ATOM   4171 C  CA  . ASP B 1 246 ? 7.044   -17.802 31.221  1.00 25.56 ? 1133 ASP B CA  1 
ATOM   4172 C  C   . ASP B 1 246 ? 5.666   -17.538 31.765  1.00 24.96 ? 1133 ASP B C   1 
ATOM   4173 O  O   . ASP B 1 246 ? 5.263   -18.060 32.825  1.00 23.10 ? 1133 ASP B O   1 
ATOM   4174 C  CB  . ASP B 1 246 ? 7.573   -19.140 31.734  1.00 31.78 ? 1133 ASP B CB  1 
ATOM   4175 C  CG  . ASP B 1 246 ? 6.773   -20.355 31.159  1.00 33.95 ? 1133 ASP B CG  1 
ATOM   4176 O  OD1 . ASP B 1 246 ? 5.692   -20.170 30.517  1.00 30.03 ? 1133 ASP B OD1 1 
ATOM   4177 O  OD2 . ASP B 1 246 ? 7.221   -21.500 31.329  1.00 38.10 ? 1133 ASP B OD2 1 
ATOM   4178 N  N   . ILE B 1 247 ? 4.915   -16.757 31.006  1.00 25.49 ? 1134 ILE B N   1 
ATOM   4179 C  CA  . ILE B 1 247 ? 3.624   -16.247 31.467  1.00 23.81 ? 1134 ILE B CA  1 
ATOM   4180 C  C   . ILE B 1 247 ? 2.597   -17.363 31.491  1.00 25.77 ? 1134 ILE B C   1 
ATOM   4181 O  O   . ILE B 1 247 ? 1.798   -17.450 32.424  1.00 24.18 ? 1134 ILE B O   1 
ATOM   4182 C  CB  . ILE B 1 247 ? 3.140   -15.082 30.561  1.00 28.20 ? 1134 ILE B CB  1 
ATOM   4183 C  CG1 . ILE B 1 247 ? 4.117   -13.882 30.642  1.00 33.23 ? 1134 ILE B CG1 1 
ATOM   4184 C  CG2 . ILE B 1 247 ? 1.728   -14.605 30.950  1.00 23.61 ? 1134 ILE B CG2 1 
ATOM   4185 C  CD1 . ILE B 1 247 ? 4.055   -12.869 29.466  1.00 28.12 ? 1134 ILE B CD1 1 
ATOM   4186 N  N   . PHE B 1 248 ? 2.616   -18.216 30.469  1.00 25.07 ? 1135 PHE B N   1 
ATOM   4187 C  CA  . PHE B 1 248 ? 1.658   -19.328 30.412  1.00 24.59 ? 1135 PHE B CA  1 
ATOM   4188 C  C   . PHE B 1 248 ? 1.788   -20.226 31.651  1.00 23.79 ? 1135 PHE B C   1 
ATOM   4189 O  O   . PHE B 1 248 ? 0.802   -20.500 32.324  1.00 23.78 ? 1135 PHE B O   1 
ATOM   4190 C  CB  . PHE B 1 248 ? 1.846   -20.152 29.139  1.00 23.80 ? 1135 PHE B CB  1 
ATOM   4191 C  CG  . PHE B 1 248 ? 0.969   -21.384 29.097  1.00 22.67 ? 1135 PHE B CG  1 
ATOM   4192 C  CD1 . PHE B 1 248 ? -0.412  -21.282 28.836  1.00 23.30 ? 1135 PHE B CD1 1 
ATOM   4193 C  CD2 . PHE B 1 248 ? 1.494   -22.645 29.322  1.00 30.84 ? 1135 PHE B CD2 1 
ATOM   4194 C  CE1 . PHE B 1 248 ? -1.226  -22.392 28.798  1.00 29.54 ? 1135 PHE B CE1 1 
ATOM   4195 C  CE2 . PHE B 1 248 ? 0.647   -23.783 29.283  1.00 27.70 ? 1135 PHE B CE2 1 
ATOM   4196 C  CZ  . PHE B 1 248 ? -0.698  -23.646 29.026  1.00 36.62 ? 1135 PHE B CZ  1 
ATOM   4197 N  N   . ASN B 1 249 ? 2.988   -20.695 31.957  1.00 28.22 ? 1136 ASN B N   1 
ATOM   4198 C  CA  . ASN B 1 249 ? 3.168   -21.565 33.147  1.00 26.86 ? 1136 ASN B CA  1 
ATOM   4199 C  C   . ASN B 1 249 ? 2.962   -20.802 34.464  1.00 27.21 ? 1136 ASN B C   1 
ATOM   4200 O  O   . ASN B 1 249 ? 2.429   -21.346 35.426  1.00 24.02 ? 1136 ASN B O   1 
ATOM   4201 C  CB  . ASN B 1 249 ? 4.511   -22.304 33.085  1.00 26.59 ? 1136 ASN B CB  1 
ATOM   4202 C  CG  . ASN B 1 249 ? 4.490   -23.441 32.030  1.00 29.62 ? 1136 ASN B CG  1 
ATOM   4203 O  OD1 . ASN B 1 249 ? 3.558   -24.275 32.013  1.00 28.48 ? 1136 ASN B OD1 1 
ATOM   4204 N  ND2 . ASN B 1 249 ? 5.473   -23.460 31.138  1.00 31.38 ? 1136 ASN B ND2 1 
ATOM   4205 N  N   . CYS B 1 250 ? 3.308   -19.521 34.495  1.00 24.27 ? 1137 CYS B N   1 
ATOM   4206 C  CA  . CYS B 1 250 ? 2.946   -18.687 35.645  1.00 22.48 ? 1137 CYS B CA  1 
ATOM   4207 C  C   . CYS B 1 250 ? 1.434   -18.728 35.929  1.00 23.65 ? 1137 CYS B C   1 
ATOM   4208 O  O   . CYS B 1 250 ? 0.985   -19.045 37.053  1.00 25.05 ? 1137 CYS B O   1 
ATOM   4209 C  CB  . CYS B 1 250 ? 3.367   -17.233 35.407  1.00 24.76 ? 1137 CYS B CB  1 
ATOM   4210 S  SG  . CYS B 1 250 ? 2.942   -16.145 36.797  1.00 26.11 ? 1137 CYS B SG  1 
ATOM   4211 N  N   . VAL B 1 251 ? 0.630   -18.455 34.907  1.00 23.35 ? 1138 VAL B N   1 
ATOM   4212 C  CA  . VAL B 1 251 ? -0.814  -18.406 35.101  1.00 20.70 ? 1138 VAL B CA  1 
ATOM   4213 C  C   . VAL B 1 251 ? -1.388  -19.794 35.466  1.00 23.07 ? 1138 VAL B C   1 
ATOM   4214 O  O   . VAL B 1 251 ? -2.269  -19.907 36.321  1.00 23.56 ? 1138 VAL B O   1 
ATOM   4215 C  CB  . VAL B 1 251 ? -1.533  -17.745 33.888  1.00 24.78 ? 1138 VAL B CB  1 
ATOM   4216 C  CG1 . VAL B 1 251 ? -3.077  -17.765 34.087  1.00 23.50 ? 1138 VAL B CG1 1 
ATOM   4217 C  CG2 . VAL B 1 251 ? -1.022  -16.296 33.704  1.00 24.40 ? 1138 VAL B CG2 1 
ATOM   4218 N  N   . ARG B 1 252 ? -0.834  -20.837 34.840  1.00 22.28 ? 1139 ARG B N   1 
ATOM   4219 C  CA  . ARG B 1 252 ? -1.203  -22.205 35.106  1.00 31.11 ? 1139 ARG B CA  1 
ATOM   4220 C  C   . ARG B 1 252 ? -0.953  -22.477 36.590  1.00 23.46 ? 1139 ARG B C   1 
ATOM   4221 O  O   . ARG B 1 252 ? -1.845  -22.992 37.298  1.00 24.42 ? 1139 ARG B O   1 
ATOM   4222 C  CB  . ARG B 1 252 ? -0.416  -23.156 34.164  1.00 28.78 ? 1139 ARG B CB  1 
ATOM   4223 C  CG  . ARG B 1 252 ? -0.917  -24.553 34.105  1.00 34.26 ? 1139 ARG B CG  1 
ATOM   4224 C  CD  . ARG B 1 252 ? -0.065  -25.448 33.197  1.00 27.35 ? 1139 ARG B CD  1 
ATOM   4225 N  NE  . ARG B 1 252 ? 1.373   -25.362 33.501  1.00 35.30 ? 1139 ARG B NE  1 
ATOM   4226 C  CZ  . ARG B 1 252 ? 1.972   -25.880 34.579  1.00 41.02 ? 1139 ARG B CZ  1 
ATOM   4227 N  NH1 . ARG B 1 252 ? 1.284   -26.552 35.503  1.00 56.22 ? 1139 ARG B NH1 1 
ATOM   4228 N  NH2 . ARG B 1 252 ? 3.282   -25.711 34.753  1.00 52.79 ? 1139 ARG B NH2 1 
ATOM   4229 N  N   . GLU B 1 253 ? 0.208   -22.074 37.098  1.00 23.55 ? 1140 GLU B N   1 
ATOM   4230 C  CA  . GLU B 1 253 ? 0.516   -22.271 38.511  1.00 24.17 ? 1140 GLU B CA  1 
ATOM   4231 C  C   . GLU B 1 253 ? -0.358  -21.463 39.443  1.00 29.27 ? 1140 GLU B C   1 
ATOM   4232 O  O   . GLU B 1 253 ? -0.764  -21.946 40.507  1.00 27.41 ? 1140 GLU B O   1 
ATOM   4233 C  CB  . GLU B 1 253 ? 2.028   -22.059 38.802  1.00 25.27 ? 1140 GLU B CB  1 
ATOM   4234 C  CG  . GLU B 1 253 ? 2.929   -23.121 38.192  1.00 29.80 ? 1140 GLU B CG  1 
ATOM   4235 C  CD  . GLU B 1 253 ? 4.405   -22.744 38.282  1.00 40.18 ? 1140 GLU B CD  1 
ATOM   4236 O  OE1 . GLU B 1 253 ? 4.724   -21.759 38.974  1.00 46.57 ? 1140 GLU B OE1 1 
ATOM   4237 O  OE2 . GLU B 1 253 ? 5.236   -23.420 37.656  1.00 54.91 ? 1140 GLU B OE2 1 
ATOM   4238 N  N   . LEU B 1 254 ? -0.671  -20.228 39.055  1.00 26.25 ? 1141 LEU B N   1 
ATOM   4239 C  CA  . LEU B 1 254 ? -1.526  -19.355 39.849  1.00 27.27 ? 1141 LEU B CA  1 
ATOM   4240 C  C   . LEU B 1 254 ? -2.856  -20.025 40.000  1.00 31.15 ? 1141 LEU B C   1 
ATOM   4241 O  O   . LEU B 1 254 ? -3.411  -20.068 41.111  1.00 30.25 ? 1141 LEU B O   1 
ATOM   4242 C  CB  . LEU B 1 254 ? -1.710  -17.990 39.185  1.00 24.47 ? 1141 LEU B CB  1 
ATOM   4243 C  CG  . LEU B 1 254 ? -0.463  -17.082 39.149  1.00 27.01 ? 1141 LEU B CG  1 
ATOM   4244 C  CD1 . LEU B 1 254 ? -0.841  -15.739 38.508  1.00 30.61 ? 1141 LEU B CD1 1 
ATOM   4245 C  CD2 . LEU B 1 254 ? 0.178   -16.867 40.544  1.00 30.72 ? 1141 LEU B CD2 1 
ATOM   4246 N  N   . ARG B 1 255 ? -3.342  -20.613 38.906  1.00 28.38 ? 1142 ARG B N   1 
ATOM   4247 C  CA  . ARG B 1 255 ? -4.676  -21.217 38.916  1.00 28.45 ? 1142 ARG B CA  1 
ATOM   4248 C  C   . ARG B 1 255 ? -4.758  -22.460 39.810  1.00 31.06 ? 1142 ARG B C   1 
ATOM   4249 O  O   . ARG B 1 255 ? -5.817  -22.783 40.323  1.00 32.48 ? 1142 ARG B O   1 
ATOM   4250 C  CB  . ARG B 1 255 ? -5.134  -21.514 37.511  1.00 36.85 ? 1142 ARG B CB  1 
ATOM   4251 C  CG  . ARG B 1 255 ? -5.395  -20.252 36.735  1.00 30.65 ? 1142 ARG B CG  1 
ATOM   4252 C  CD  . ARG B 1 255 ? -6.321  -20.468 35.705  1.00 31.79 ? 1142 ARG B CD  1 
ATOM   4253 N  NE  . ARG B 1 255 ? -6.668  -19.263 34.980  1.00 27.55 ? 1142 ARG B NE  1 
ATOM   4254 C  CZ  . ARG B 1 255 ? -7.424  -19.293 33.907  1.00 26.79 ? 1142 ARG B CZ  1 
ATOM   4255 N  NH1 . ARG B 1 255 ? -7.885  -20.465 33.468  1.00 28.40 ? 1142 ARG B NH1 1 
ATOM   4256 N  NH2 . ARG B 1 255 ? -7.723  -18.184 33.251  1.00 35.47 ? 1142 ARG B NH2 1 
ATOM   4257 N  N   . ALA B 1 256 ? -3.614  -23.086 40.052  1.00 29.53 ? 1143 ALA B N   1 
ATOM   4258 C  CA  . ALA B 1 256 ? -3.529  -24.219 40.957  1.00 34.38 ? 1143 ALA B CA  1 
ATOM   4259 C  C   . ALA B 1 256 ? -3.898  -23.838 42.401  1.00 29.17 ? 1143 ALA B C   1 
ATOM   4260 O  O   . ALA B 1 256 ? -4.449  -24.649 43.132  1.00 26.47 ? 1143 ALA B O   1 
ATOM   4261 C  CB  . ALA B 1 256 ? -2.136  -24.840 40.902  1.00 31.24 ? 1143 ALA B CB  1 
ATOM   4262 N  N   . GLN B 1 257 ? -3.624  -22.585 42.768  1.00 22.65 ? 1144 GLN B N   1 
ATOM   4263 C  CA  . GLN B 1 257 ? -3.763  -22.107 44.107  1.00 22.37 ? 1144 GLN B CA  1 
ATOM   4264 C  C   . GLN B 1 257 ? -5.038  -21.330 44.339  1.00 23.19 ? 1144 GLN B C   1 
ATOM   4265 O  O   . GLN B 1 257 ? -5.518  -21.313 45.490  1.00 22.46 ? 1144 GLN B O   1 
ATOM   4266 C  CB  . GLN B 1 257 ? -2.553  -21.215 44.425  1.00 26.54 ? 1144 GLN B CB  1 
ATOM   4267 C  CG  . GLN B 1 257 ? -1.271  -21.934 44.244  1.00 35.66 ? 1144 GLN B CG  1 
ATOM   4268 C  CD  . GLN B 1 257 ? -0.075  -21.042 44.179  1.00 33.41 ? 1144 GLN B CD  1 
ATOM   4269 O  OE1 . GLN B 1 257 ? 0.409   -20.635 45.203  1.00 25.98 ? 1144 GLN B OE1 1 
ATOM   4270 N  NE2 . GLN B 1 257 ? 0.471   -20.840 42.988  1.00 33.95 ? 1144 GLN B NE2 1 
ATOM   4271 N  N   . ARG B 1 258 ? -5.586  -20.685 43.294  1.00 21.02 ? 1145 ARG B N   1 
ATOM   4272 C  CA  . ARG B 1 258 ? -6.926  -20.068 43.377  1.00 21.37 ? 1145 ARG B CA  1 
ATOM   4273 C  C   . ARG B 1 258 ? -7.597  -20.067 41.993  1.00 25.79 ? 1145 ARG B C   1 
ATOM   4274 O  O   . ARG B 1 258 ? -6.966  -19.753 40.975  1.00 24.32 ? 1145 ARG B O   1 
ATOM   4275 C  CB  . ARG B 1 258 ? -6.892  -18.651 43.970  1.00 19.08 ? 1145 ARG B CB  1 
ATOM   4276 C  CG  . ARG B 1 258 ? -8.274  -18.006 44.176  1.00 26.10 ? 1145 ARG B CG  1 
ATOM   4277 C  CD  . ARG B 1 258 ? -8.114  -16.688 44.974  1.00 27.38 ? 1145 ARG B CD  1 
ATOM   4278 N  NE  . ARG B 1 258 ? -9.335  -15.902 45.019  1.00 23.24 ? 1145 ARG B NE  1 
ATOM   4279 C  CZ  . ARG B 1 258 ? -10.286 -16.053 45.922  1.00 25.05 ? 1145 ARG B CZ  1 
ATOM   4280 N  NH1 . ARG B 1 258 ? -10.229 -17.020 46.813  1.00 25.28 ? 1145 ARG B NH1 1 
ATOM   4281 N  NH2 . ARG B 1 258 ? -11.355 -15.281 45.872  1.00 24.10 ? 1145 ARG B NH2 1 
ATOM   4282 N  N   . VAL B 1 259 ? -8.878  -20.429 41.973  1.00 24.67 ? 1146 VAL B N   1 
ATOM   4283 C  CA  . VAL B 1 259 ? -9.601  -20.653 40.704  1.00 22.03 ? 1146 VAL B CA  1 
ATOM   4284 C  C   . VAL B 1 259 ? -9.571  -19.423 39.789  1.00 24.29 ? 1146 VAL B C   1 
ATOM   4285 O  O   . VAL B 1 259 ? -9.788  -18.282 40.235  1.00 25.07 ? 1146 VAL B O   1 
ATOM   4286 C  CB  . VAL B 1 259 ? -11.051 -21.022 41.004  1.00 20.60 ? 1146 VAL B CB  1 
ATOM   4287 C  CG1 . VAL B 1 259 ? -11.723 -19.921 41.873  1.00 20.71 ? 1146 VAL B CG1 1 
ATOM   4288 C  CG2 . VAL B 1 259 ? -11.776 -21.344 39.692  1.00 27.59 ? 1146 VAL B CG2 1 
ATOM   4289 N  N   . ASN B 1 260 ? -9.316  -19.659 38.506  1.00 21.49 ? 1147 ASN B N   1 
ATOM   4290 C  CA  . ASN B 1 260 ? -9.448  -18.654 37.440  1.00 21.40 ? 1147 ASN B CA  1 
ATOM   4291 C  C   . ASN B 1 260 ? -8.666  -17.358 37.583  1.00 26.74 ? 1147 ASN B C   1 
ATOM   4292 O  O   . ASN B 1 260 ? -9.061  -16.325 36.995  1.00 26.98 ? 1147 ASN B O   1 
ATOM   4293 C  CB  . ASN B 1 260 ? -10.946 -18.342 37.139  1.00 25.83 ? 1147 ASN B CB  1 
ATOM   4294 C  CG  . ASN B 1 260 ? -11.666 -19.495 36.489  1.00 26.57 ? 1147 ASN B CG  1 
ATOM   4295 O  OD1 . ASN B 1 260 ? -11.050 -20.465 35.996  1.00 24.94 ? 1147 ASN B OD1 1 
ATOM   4296 N  ND2 . ASN B 1 260 ? -12.993 -19.380 36.443  1.00 26.45 ? 1147 ASN B ND2 1 
ATOM   4297 N  N   . LEU B 1 261 ? -7.553  -17.381 38.335  1.00 24.68 ? 1148 LEU B N   1 
ATOM   4298 C  CA  . LEU B 1 261 ? -6.689  -16.208 38.391  1.00 23.43 ? 1148 LEU B CA  1 
ATOM   4299 C  C   . LEU B 1 261 ? -6.241  -15.870 36.957  1.00 25.81 ? 1148 LEU B C   1 
ATOM   4300 O  O   . LEU B 1 261 ? -5.800  -16.772 36.184  1.00 25.53 ? 1148 LEU B O   1 
ATOM   4301 C  CB  . LEU B 1 261 ? -5.488  -16.430 39.332  1.00 26.20 ? 1148 LEU B CB  1 
ATOM   4302 C  CG  . LEU B 1 261 ? -5.738  -16.215 40.834  1.00 29.19 ? 1148 LEU B CG  1 
ATOM   4303 C  CD1 . LEU B 1 261 ? -4.435  -16.491 41.649  1.00 36.55 ? 1148 LEU B CD1 1 
ATOM   4304 C  CD2 . LEU B 1 261 ? -6.181  -14.789 41.125  1.00 39.35 ? 1148 LEU B CD2 1 
ATOM   4305 N  N   . VAL B 1 262 ? -6.390  -14.584 36.608  1.00 23.16 ? 1149 VAL B N   1 
ATOM   4306 C  CA  . VAL B 1 262 ? -6.348  -14.024 35.236  1.00 23.23 ? 1149 VAL B CA  1 
ATOM   4307 C  C   . VAL B 1 262 ? -7.542  -14.594 34.463  1.00 25.42 ? 1149 VAL B C   1 
ATOM   4308 O  O   . VAL B 1 262 ? -7.441  -15.632 33.827  1.00 27.02 ? 1149 VAL B O   1 
ATOM   4309 C  CB  . VAL B 1 262 ? -4.990  -14.230 34.540  1.00 23.11 ? 1149 VAL B CB  1 
ATOM   4310 C  CG1 . VAL B 1 262 ? -4.992  -13.534 33.177  1.00 22.43 ? 1149 VAL B CG1 1 
ATOM   4311 C  CG2 . VAL B 1 262 ? -3.786  -13.812 35.489  1.00 26.12 ? 1149 VAL B CG2 1 
ATOM   4312 N  N   . GLN B 1 263 ? -8.673  -13.905 34.558  1.00 23.56 ? 1150 GLN B N   1 
ATOM   4313 C  CA  . GLN B 1 263 ? -9.982  -14.492 34.371  1.00 22.75 ? 1150 GLN B CA  1 
ATOM   4314 C  C   . GLN B 1 263 ? -10.575 -14.360 32.966  1.00 28.05 ? 1150 GLN B C   1 
ATOM   4315 O  O   . GLN B 1 263 ? -11.572 -15.019 32.671  1.00 33.33 ? 1150 GLN B O   1 
ATOM   4316 C  CB  . GLN B 1 263 ? -10.926 -13.850 35.393  1.00 32.83 ? 1150 GLN B CB  1 
ATOM   4317 C  CG  . GLN B 1 263 ? -12.298 -14.485 35.567  1.00 31.39 ? 1150 GLN B CG  1 
ATOM   4318 C  CD  . GLN B 1 263 ? -13.086 -13.800 36.713  1.00 28.10 ? 1150 GLN B CD  1 
ATOM   4319 O  OE1 . GLN B 1 263 ? -12.736 -12.692 37.174  1.00 34.95 ? 1150 GLN B OE1 1 
ATOM   4320 N  NE2 . GLN B 1 263 ? -14.193 -14.412 37.094  1.00 34.00 ? 1150 GLN B NE2 1 
ATOM   4321 N  N   . THR B 1 264 ? -9.996  -13.487 32.115  1.00 25.17 ? 1151 THR B N   1 
ATOM   4322 C  CA  . THR B 1 264 ? -10.407 -13.348 30.733  1.00 25.05 ? 1151 THR B CA  1 
ATOM   4323 C  C   . THR B 1 264 ? -9.238  -13.376 29.776  1.00 25.90 ? 1151 THR B C   1 
ATOM   4324 O  O   . THR B 1 264 ? -8.081  -13.157 30.148  1.00 22.37 ? 1151 THR B O   1 
ATOM   4325 C  CB  . THR B 1 264 ? -11.163 -12.029 30.514  1.00 28.96 ? 1151 THR B CB  1 
ATOM   4326 O  OG1 . THR B 1 264 ? -10.232 -10.961 30.612  1.00 24.71 ? 1151 THR B OG1 1 
ATOM   4327 C  CG2 . THR B 1 264 ? -12.331 -11.827 31.563  1.00 26.90 ? 1151 THR B CG2 1 
ATOM   4328 N  N   . GLU B 1 265 ? -9.554  -13.644 28.524  1.00 27.16 ? 1152 GLU B N   1 
ATOM   4329 C  CA  . GLU B 1 265 ? -8.552  -13.664 27.499  1.00 26.62 ? 1152 GLU B CA  1 
ATOM   4330 C  C   . GLU B 1 265 ? -7.898  -12.301 27.380  1.00 22.81 ? 1152 GLU B C   1 
ATOM   4331 O  O   . GLU B 1 265 ? -6.676  -12.197 27.219  1.00 23.72 ? 1152 GLU B O   1 
ATOM   4332 C  CB  . GLU B 1 265 ? -9.166  -14.035 26.179  1.00 30.15 ? 1152 GLU B CB  1 
ATOM   4333 C  CG  . GLU B 1 265 ? -8.111  -14.331 25.156  1.00 35.42 ? 1152 GLU B CG  1 
ATOM   4334 C  CD  . GLU B 1 265 ? -8.670  -14.344 23.777  1.00 54.12 ? 1152 GLU B CD  1 
ATOM   4335 O  OE1 . GLU B 1 265 ? -9.704  -15.032 23.556  1.00 41.27 ? 1152 GLU B OE1 1 
ATOM   4336 O  OE2 . GLU B 1 265 ? -8.077  -13.656 22.939  1.00 53.01 ? 1152 GLU B OE2 1 
ATOM   4337 N  N   . GLU B 1 266 ? -8.729  -11.260 27.452  1.00 20.46 ? 1153 GLU B N   1 
ATOM   4338 C  CA  . GLU B 1 266 ? -8.258  -9.880  27.375  1.00 25.98 ? 1153 GLU B CA  1 
ATOM   4339 C  C   . GLU B 1 266 ? -7.249  -9.585  28.487  1.00 22.68 ? 1153 GLU B C   1 
ATOM   4340 O  O   . GLU B 1 266 ? -6.228  -8.905  28.303  1.00 22.35 ? 1153 GLU B O   1 
ATOM   4341 C  CB  . GLU B 1 266 ? -9.489  -8.955  27.492  1.00 26.50 ? 1153 GLU B CB  1 
ATOM   4342 C  CG  . GLU B 1 266 ? -9.220  -7.506  27.191  1.00 44.94 ? 1153 GLU B CG  1 
ATOM   4343 C  CD  . GLU B 1 266 ? -10.481 -6.626  27.321  1.00 55.48 ? 1153 GLU B CD  1 
ATOM   4344 O  OE1 . GLU B 1 266 ? -11.503 -7.075  27.934  1.00 45.69 ? 1153 GLU B OE1 1 
ATOM   4345 O  OE2 . GLU B 1 266 ? -10.427 -5.474  26.821  1.00 44.89 ? 1153 GLU B OE2 1 
ATOM   4346 N  N   . GLN B 1 267 ? -7.550  -10.047 29.687  1.00 23.70 ? 1154 GLN B N   1 
ATOM   4347 C  CA  . GLN B 1 267 ? -6.586  -9.922  30.788  1.00 21.74 ? 1154 GLN B CA  1 
ATOM   4348 C  C   . GLN B 1 267 ? -5.275  -10.638 30.534  1.00 23.69 ? 1154 GLN B C   1 
ATOM   4349 O  O   . GLN B 1 267 ? -4.190  -10.141 30.898  1.00 21.86 ? 1154 GLN B O   1 
ATOM   4350 C  CB  . GLN B 1 267 ? -7.204  -10.384 32.111  1.00 19.60 ? 1154 GLN B CB  1 
ATOM   4351 C  CG  . GLN B 1 267 ? -8.195  -9.402  32.710  1.00 21.22 ? 1154 GLN B CG  1 
ATOM   4352 C  CD  . GLN B 1 267 ? -9.066  -10.014 33.838  1.00 27.83 ? 1154 GLN B CD  1 
ATOM   4353 O  OE1 . GLN B 1 267 ? -8.849  -11.143 34.276  1.00 29.62 ? 1154 GLN B OE1 1 
ATOM   4354 N  NE2 . GLN B 1 267 ? -10.073 -9.269  34.275  1.00 26.52 ? 1154 GLN B NE2 1 
ATOM   4355 N  N   . TYR B 1 268 ? -5.364  -11.835 29.974  1.00 22.86 ? 1155 TYR B N   1 
ATOM   4356 C  CA  . TYR B 1 268 ? -4.179  -12.600 29.646  1.00 21.85 ? 1155 TYR B CA  1 
ATOM   4357 C  C   . TYR B 1 268 ? -3.296  -11.821 28.652  1.00 22.88 ? 1155 TYR B C   1 
ATOM   4358 O  O   . TYR B 1 268 ? -2.092  -11.706 28.829  1.00 24.76 ? 1155 TYR B O   1 
ATOM   4359 C  CB  . TYR B 1 268 ? -4.576  -13.971 29.096  1.00 26.57 ? 1155 TYR B CB  1 
ATOM   4360 C  CG  . TYR B 1 268 ? -3.446  -14.940 28.905  1.00 20.22 ? 1155 TYR B CG  1 
ATOM   4361 C  CD1 . TYR B 1 268 ? -2.826  -15.527 29.998  1.00 28.06 ? 1155 TYR B CD1 1 
ATOM   4362 C  CD2 . TYR B 1 268 ? -2.994  -15.283 27.622  1.00 22.33 ? 1155 TYR B CD2 1 
ATOM   4363 C  CE1 . TYR B 1 268 ? -1.825  -16.440 29.835  1.00 22.36 ? 1155 TYR B CE1 1 
ATOM   4364 C  CE2 . TYR B 1 268 ? -1.984  -16.217 27.437  1.00 28.20 ? 1155 TYR B CE2 1 
ATOM   4365 C  CZ  . TYR B 1 268 ? -1.390  -16.781 28.549  1.00 28.02 ? 1155 TYR B CZ  1 
ATOM   4366 O  OH  . TYR B 1 268 ? -0.395  -17.703 28.379  1.00 23.66 ? 1155 TYR B OH  1 
ATOM   4367 N  N   . VAL B 1 269 ? -3.899  -11.207 27.649  1.00 22.92 ? 1156 VAL B N   1 
ATOM   4368 C  CA  . VAL B 1 269 ? -3.120  -10.408 26.691  1.00 21.99 ? 1156 VAL B CA  1 
ATOM   4369 C  C   . VAL B 1 269 ? -2.559  -9.171  27.371  1.00 23.37 ? 1156 VAL B C   1 
ATOM   4370 O  O   . VAL B 1 269 ? -1.427  -8.793  27.135  1.00 22.74 ? 1156 VAL B O   1 
ATOM   4371 C  CB  . VAL B 1 269 ? -3.948  -10.058 25.450  1.00 23.32 ? 1156 VAL B CB  1 
ATOM   4372 C  CG1 . VAL B 1 269 ? -3.143  -9.170  24.465  1.00 23.95 ? 1156 VAL B CG1 1 
ATOM   4373 C  CG2 . VAL B 1 269 ? -4.403  -11.369 24.763  1.00 22.98 ? 1156 VAL B CG2 1 
ATOM   4374 N  N   . PHE B 1 270 ? -3.360  -8.541  28.216  1.00 23.43 ? 1157 PHE B N   1 
ATOM   4375 C  CA  . PHE B 1 270 ? -2.891  -7.361  28.968  1.00 24.64 ? 1157 PHE B CA  1 
ATOM   4376 C  C   . PHE B 1 270 ? -1.651  -7.662  29.801  1.00 22.29 ? 1157 PHE B C   1 
ATOM   4377 O  O   . PHE B 1 270 ? -0.703  -6.864  29.812  1.00 23.57 ? 1157 PHE B O   1 
ATOM   4378 C  CB  . PHE B 1 270 ? -4.008  -6.795  29.832  1.00 21.61 ? 1157 PHE B CB  1 
ATOM   4379 C  CG  . PHE B 1 270 ? -3.556  -5.610  30.664  1.00 22.68 ? 1157 PHE B CG  1 
ATOM   4380 C  CD1 . PHE B 1 270 ? -3.219  -4.388  30.074  1.00 23.17 ? 1157 PHE B CD1 1 
ATOM   4381 C  CD2 . PHE B 1 270 ? -3.396  -5.759  32.032  1.00 25.29 ? 1157 PHE B CD2 1 
ATOM   4382 C  CE1 . PHE B 1 270 ? -2.731  -3.322  30.899  1.00 23.08 ? 1157 PHE B CE1 1 
ATOM   4383 C  CE2 . PHE B 1 270 ? -2.938  -4.720  32.817  1.00 23.74 ? 1157 PHE B CE2 1 
ATOM   4384 C  CZ  . PHE B 1 270 ? -2.600  -3.505  32.244  1.00 24.72 ? 1157 PHE B CZ  1 
ATOM   4385 N  N   . VAL B 1 271 ? -1.619  -8.826  30.435  1.00 22.43 ? 1158 VAL B N   1 
ATOM   4386 C  CA  . VAL B 1 271 ? -0.428  -9.256  31.213  1.00 22.25 ? 1158 VAL B CA  1 
ATOM   4387 C  C   . VAL B 1 271 ? 0.831   -9.290  30.298  1.00 22.04 ? 1158 VAL B C   1 
ATOM   4388 O  O   . VAL B 1 271 ? 1.902   -8.782  30.669  1.00 21.30 ? 1158 VAL B O   1 
ATOM   4389 C  CB  . VAL B 1 271 ? -0.682  -10.619 31.927  1.00 25.40 ? 1158 VAL B CB  1 
ATOM   4390 C  CG1 . VAL B 1 271 ? 0.646   -11.217 32.449  1.00 19.95 ? 1158 VAL B CG1 1 
ATOM   4391 C  CG2 . VAL B 1 271 ? -1.750  -10.401 33.104  1.00 23.83 ? 1158 VAL B CG2 1 
ATOM   4392 N  N   . HIS B 1 272 ? 0.676   -9.809  29.093  1.00 22.37 ? 1159 HIS B N   1 
ATOM   4393 C  CA  . HIS B 1 272 ? 1.762   -9.769  28.098  1.00 21.58 ? 1159 HIS B CA  1 
ATOM   4394 C  C   . HIS B 1 272 ? 2.184   -8.348  27.737  1.00 19.90 ? 1159 HIS B C   1 
ATOM   4395 O  O   . HIS B 1 272 ? 3.364   -8.022  27.750  1.00 21.69 ? 1159 HIS B O   1 
ATOM   4396 C  CB  . HIS B 1 272 ? 1.351   -10.520 26.839  1.00 20.41 ? 1159 HIS B CB  1 
ATOM   4397 C  CG  . HIS B 1 272 ? 1.361   -11.996 27.006  1.00 20.63 ? 1159 HIS B CG  1 
ATOM   4398 N  ND1 . HIS B 1 272 ? 0.367   -12.676 27.676  1.00 22.20 ? 1159 HIS B ND1 1 
ATOM   4399 C  CD2 . HIS B 1 272 ? 2.264   -12.930 26.604  1.00 24.12 ? 1159 HIS B CD2 1 
ATOM   4400 C  CE1 . HIS B 1 272 ? 0.664   -13.971 27.693  1.00 26.99 ? 1159 HIS B CE1 1 
ATOM   4401 N  NE2 . HIS B 1 272 ? 1.791   -14.153 27.012  1.00 24.01 ? 1159 HIS B NE2 1 
ATOM   4402 N  N   . ASP B 1 273 ? 1.214   -7.534  27.360  1.00 23.21 ? 1160 ASP B N   1 
ATOM   4403 C  CA  . ASP B 1 273 ? 1.455   -6.144  26.977  1.00 26.16 ? 1160 ASP B CA  1 
ATOM   4404 C  C   . ASP B 1 273 ? 2.182   -5.339  28.080  1.00 26.17 ? 1160 ASP B C   1 
ATOM   4405 O  O   . ASP B 1 273 ? 3.095   -4.535  27.794  1.00 24.73 ? 1160 ASP B O   1 
ATOM   4406 C  CB  . ASP B 1 273 ? 0.138   -5.468  26.646  1.00 23.55 ? 1160 ASP B CB  1 
ATOM   4407 C  CG  . ASP B 1 273 ? -0.406  -5.878  25.293  1.00 33.56 ? 1160 ASP B CG  1 
ATOM   4408 O  OD1 . ASP B 1 273 ? 0.382   -6.311  24.456  1.00 26.03 ? 1160 ASP B OD1 1 
ATOM   4409 O  OD2 . ASP B 1 273 ? -1.614  -5.757  25.054  1.00 29.11 ? 1160 ASP B OD2 1 
ATOM   4410 N  N   . ALA B 1 274 ? 1.740   -5.518  29.318  1.00 23.26 ? 1161 ALA B N   1 
ATOM   4411 C  CA  . ALA B 1 274 ? 2.344   -4.856  30.478  1.00 21.74 ? 1161 ALA B CA  1 
ATOM   4412 C  C   . ALA B 1 274 ? 3.785   -5.289  30.719  1.00 18.70 ? 1161 ALA B C   1 
ATOM   4413 O  O   . ALA B 1 274 ? 4.698   -4.446  30.861  1.00 23.35 ? 1161 ALA B O   1 
ATOM   4414 C  CB  . ALA B 1 274 ? 1.502   -5.105  31.716  1.00 20.10 ? 1161 ALA B CB  1 
ATOM   4415 N  N   . ILE B 1 275 ? 4.021   -6.582  30.676  1.00 22.78 ? 1162 ILE B N   1 
ATOM   4416 C  CA  . ILE B 1 275 ? 5.369   -7.098  30.818  1.00 23.61 ? 1162 ILE B CA  1 
ATOM   4417 C  C   . ILE B 1 275 ? 6.263   -6.600  29.690  1.00 27.29 ? 1162 ILE B C   1 
ATOM   4418 O  O   . ILE B 1 275 ? 7.361   -6.132  29.943  1.00 24.76 ? 1162 ILE B O   1 
ATOM   4419 C  CB  . ILE B 1 275 ? 5.397   -8.621  30.957  1.00 23.46 ? 1162 ILE B CB  1 
ATOM   4420 C  CG1 . ILE B 1 275 ? 4.724   -9.031  32.283  1.00 29.62 ? 1162 ILE B CG1 1 
ATOM   4421 C  CG2 . ILE B 1 275 ? 6.845   -9.160  30.917  1.00 24.89 ? 1162 ILE B CG2 1 
ATOM   4422 C  CD1 . ILE B 1 275 ? 4.316   -10.552 32.337  1.00 29.55 ? 1162 ILE B CD1 1 
ATOM   4423 N  N   . LEU B 1 276 ? 5.784   -6.635  28.447  1.00 26.76 ? 1163 LEU B N   1 
ATOM   4424 C  CA  . LEU B 1 276 ? 6.578   -6.135  27.364  1.00 23.49 ? 1163 LEU B CA  1 
ATOM   4425 C  C   . LEU B 1 276 ? 6.941   -4.687  27.601  1.00 27.21 ? 1163 LEU B C   1 
ATOM   4426 O  O   . LEU B 1 276 ? 8.106   -4.300  27.457  1.00 25.31 ? 1163 LEU B O   1 
ATOM   4427 C  CB  . LEU B 1 276 ? 5.820   -6.279  26.051  1.00 26.00 ? 1163 LEU B CB  1 
ATOM   4428 C  CG  . LEU B 1 276 ? 6.473   -5.744  24.775  1.00 30.95 ? 1163 LEU B CG  1 
ATOM   4429 C  CD1 . LEU B 1 276 ? 7.785   -6.444  24.514  1.00 35.03 ? 1163 LEU B CD1 1 
ATOM   4430 C  CD2 . LEU B 1 276 ? 5.486   -5.881  23.565  1.00 29.19 ? 1163 LEU B CD2 1 
ATOM   4431 N  N   . GLU B 1 277 ? 5.974   -3.855  27.998  1.00 24.83 ? 1164 GLU B N   1 
ATOM   4432 C  CA  . GLU B 1 277 ? 6.322   -2.449  28.227  1.00 24.64 ? 1164 GLU B CA  1 
ATOM   4433 C  C   . GLU B 1 277 ? 7.454   -2.316  29.264  1.00 28.02 ? 1164 GLU B C   1 
ATOM   4434 O  O   . GLU B 1 277 ? 8.429   -1.560  29.067  1.00 26.74 ? 1164 GLU B O   1 
ATOM   4435 C  CB  . GLU B 1 277 ? 5.119   -1.613  28.637  1.00 27.18 ? 1164 GLU B CB  1 
ATOM   4436 C  CG  . GLU B 1 277 ? 5.564   -0.259  29.170  1.00 36.83 ? 1164 GLU B CG  1 
ATOM   4437 C  CD  . GLU B 1 277 ? 4.449   0.702   29.415  1.00 39.50 ? 1164 GLU B CD  1 
ATOM   4438 O  OE1 . GLU B 1 277 ? 3.323   0.454   28.942  1.00 36.54 ? 1164 GLU B OE1 1 
ATOM   4439 O  OE2 . GLU B 1 277 ? 4.718   1.731   30.075  1.00 41.12 ? 1164 GLU B OE2 1 
ATOM   4440 N  N   . ALA B 1 278 ? 7.307   -3.030  30.368  1.00 23.32 ? 1165 ALA B N   1 
ATOM   4441 C  CA  . ALA B 1 278 ? 8.325   -3.045  31.409  1.00 26.79 ? 1165 ALA B CA  1 
ATOM   4442 C  C   . ALA B 1 278 ? 9.678   -3.418  30.818  1.00 33.79 ? 1165 ALA B C   1 
ATOM   4443 O  O   . ALA B 1 278 ? 10.709  -2.847  31.172  1.00 36.82 ? 1165 ALA B O   1 
ATOM   4444 C  CB  . ALA B 1 278 ? 7.950   -3.990  32.511  1.00 27.38 ? 1165 ALA B CB  1 
ATOM   4445 N  N   . CYS B 1 279 ? 9.693   -4.370  29.912  1.00 30.46 ? 1166 CYS B N   1 
ATOM   4446 C  CA  . CYS B 1 279 ? 10.978  -4.816  29.349  1.00 34.43 ? 1166 CYS B CA  1 
ATOM   4447 C  C   . CYS B 1 279 ? 11.548  -3.819  28.347  1.00 37.19 ? 1166 CYS B C   1 
ATOM   4448 O  O   . CYS B 1 279 ? 12.765  -3.792  28.121  1.00 42.68 ? 1166 CYS B O   1 
ATOM   4449 C  CB  . CYS B 1 279 ? 10.837  -6.202  28.712  1.00 33.22 ? 1166 CYS B CB  1 
ATOM   4450 S  SG  . CYS B 1 279 ? 10.506  -7.520  29.898  1.00 36.56 ? 1166 CYS B SG  1 
ATOM   4451 N  N   . LEU B 1 280 ? 10.691  -3.011  27.730  1.00 40.01 ? 1167 LEU B N   1 
ATOM   4452 C  CA  . LEU B 1 280 ? 11.162  -1.995  26.776  1.00 37.78 ? 1167 LEU B CA  1 
ATOM   4453 C  C   . LEU B 1 280 ? 11.804  -0.825  27.510  1.00 51.46 ? 1167 LEU B C   1 
ATOM   4454 O  O   . LEU B 1 280 ? 12.924  -0.427  27.190  1.00 52.27 ? 1167 LEU B O   1 
ATOM   4455 C  CB  . LEU B 1 280 ? 10.014  -1.463  25.908  1.00 40.66 ? 1167 LEU B CB  1 
ATOM   4456 C  CG  . LEU B 1 280 ? 9.373   -2.450  24.950  1.00 41.49 ? 1167 LEU B CG  1 
ATOM   4457 C  CD1 . LEU B 1 280 ? 8.017   -1.937  24.475  1.00 47.53 ? 1167 LEU B CD1 1 
ATOM   4458 C  CD2 . LEU B 1 280 ? 10.293  -2.725  23.767  1.00 47.37 ? 1167 LEU B CD2 1 
ATOM   4459 N  N   . CYS B 1 281 ? 11.100  -0.299  28.511  1.00 49.05 ? 1168 CYS B N   1 
ATOM   4460 C  CA  . CYS B 1 281 ? 11.410  1.019   29.079  1.00 55.39 ? 1168 CYS B CA  1 
ATOM   4461 C  C   . CYS B 1 281 ? 12.704  1.146   29.922  1.00 54.25 ? 1168 CYS B C   1 
ATOM   4462 O  O   . CYS B 1 281 ? 13.072  0.263   30.697  1.00 62.92 ? 1168 CYS B O   1 
ATOM   4463 C  CB  . CYS B 1 281 ? 10.210  1.503   29.884  1.00 57.35 ? 1168 CYS B CB  1 
ATOM   4464 S  SG  . CYS B 1 281 ? 8.761   1.663   28.854  1.00 69.76 ? 1168 CYS B SG  1 
HETATM 4465 C  C1  . B3P C 2 .   ? 24.295  -15.686 85.891  1.00 43.76 ? 301  B3P A C1  1 
HETATM 4466 C  C2  . B3P C 2 .   ? 24.992  -16.168 87.163  1.00 53.43 ? 301  B3P A C2  1 
HETATM 4467 C  C3  . B3P C 2 .   ? 24.392  -14.148 85.704  1.00 42.36 ? 301  B3P A C3  1 
HETATM 4468 N  N1  . B3P C 2 .   ? 23.795  -13.778 84.398  1.00 41.71 ? 301  B3P A N1  1 
HETATM 4469 C  C4  . B3P C 2 .   ? 23.382  -12.367 84.159  1.00 33.65 ? 301  B3P A C4  1 
HETATM 4470 C  C5  . B3P C 2 .   ? 24.595  -11.437 84.083  1.00 35.64 ? 301  B3P A C5  1 
HETATM 4471 C  C6  . B3P C 2 .   ? 22.580  -12.311 82.825  1.00 32.23 ? 301  B3P A C6  1 
HETATM 4472 C  C7  . B3P C 2 .   ? 22.479  -11.858 85.274  1.00 26.52 ? 301  B3P A C7  1 
HETATM 4473 O  O4  . B3P C 2 .   ? 25.555  -11.922 83.154  1.00 43.52 ? 301  B3P A O4  1 
HETATM 4474 O  O5  . B3P C 2 .   ? 22.362  -10.978 82.362  1.00 32.85 ? 301  B3P A O5  1 
HETATM 4475 O  O6  . B3P C 2 .   ? 21.395  -12.755 85.573  1.00 31.76 ? 301  B3P A O6  1 
HETATM 4476 NA NA  . NA  D 3 .   ? 6.336   -8.113  45.861  1.00 49.66 ? 501  NA  B NA  1 
HETATM 4477 C  C1  . B3P E 2 .   ? 5.489   10.027  50.420  1.00 24.45 ? 301  B3P B C1  1 
HETATM 4478 C  C2  . B3P E 2 .   ? 5.624   8.498   50.621  1.00 23.81 ? 301  B3P B C2  1 
HETATM 4479 C  C3  . B3P E 2 .   ? 6.153   10.425  49.075  1.00 29.53 ? 301  B3P B C3  1 
HETATM 4480 N  N1  . B3P E 2 .   ? 6.113   11.880  48.923  1.00 28.97 ? 301  B3P B N1  1 
HETATM 4481 C  C4  . B3P E 2 .   ? 6.618   12.402  47.626  1.00 33.69 ? 301  B3P B C4  1 
HETATM 4482 C  C5  . B3P E 2 .   ? 8.128   12.086  47.474  1.00 40.69 ? 301  B3P B C5  1 
HETATM 4483 C  C6  . B3P E 2 .   ? 5.954   11.773  46.402  1.00 33.51 ? 301  B3P B C6  1 
HETATM 4484 C  C7  . B3P E 2 .   ? 6.433   13.934  47.684  1.00 34.51 ? 301  B3P B C7  1 
HETATM 4485 N  N2  . B3P E 2 .   ? 4.978   8.187   51.908  1.00 19.06 ? 301  B3P B N2  1 
HETATM 4486 C  C8  . B3P E 2 .   ? 4.718   6.738   52.048  1.00 20.10 ? 301  B3P B C8  1 
HETATM 4487 C  C9  . B3P E 2 .   ? 5.979   5.910   51.985  1.00 23.47 ? 301  B3P B C9  1 
HETATM 4488 C  C10 . B3P E 2 .   ? 4.046   6.571   53.433  1.00 19.95 ? 301  B3P B C10 1 
HETATM 4489 C  C11 . B3P E 2 .   ? 3.839   6.264   50.908  1.00 24.62 ? 301  B3P B C11 1 
HETATM 4490 O  O1  . B3P E 2 .   ? 6.938   6.452   52.942  1.00 30.37 ? 301  B3P B O1  1 
HETATM 4491 O  O2  . B3P E 2 .   ? 3.680   5.217   53.677  1.00 22.62 ? 301  B3P B O2  1 
HETATM 4492 O  O3  . B3P E 2 .   ? 2.689   7.106   50.747  1.00 22.12 ? 301  B3P B O3  1 
HETATM 4493 O  O4  . B3P E 2 .   ? 8.790   12.484  48.662  1.00 39.15 ? 301  B3P B O4  1 
HETATM 4494 O  O5  . B3P E 2 .   ? 4.527   11.871  46.413  1.00 40.25 ? 301  B3P B O5  1 
HETATM 4495 O  O6  . B3P E 2 .   ? 6.757   14.465  46.409  1.00 47.54 ? 301  B3P B O6  1 
HETATM 4496 C  C1  . EDO F 4 .   ? -10.941 -6.150  34.182  1.00 43.69 ? 502  EDO B C1  1 
HETATM 4497 O  O1  . EDO F 4 .   ? -10.895 -6.739  32.897  1.00 25.30 ? 502  EDO B O1  1 
HETATM 4498 C  C2  . EDO F 4 .   ? -11.978 -6.744  35.084  1.00 26.59 ? 502  EDO B C2  1 
HETATM 4499 O  O2  . EDO F 4 .   ? -12.937 -5.762  35.426  1.00 52.51 ? 502  EDO B O2  1 
HETATM 4500 O  O   . HOH G 5 .   ? 22.294  -4.103  82.563  1.00 27.96 ? 27   HOH A O   1 
HETATM 4501 O  O   . HOH G 5 .   ? 21.358  1.721   81.825  1.00 24.59 ? 28   HOH A O   1 
HETATM 4502 O  O   . HOH G 5 .   ? 16.748  -1.927  66.201  1.00 24.15 ? 38   HOH A O   1 
HETATM 4503 O  O   . HOH G 5 .   ? 17.643  0.867   74.982  1.00 22.41 ? 41   HOH A O   1 
HETATM 4504 O  O   . HOH G 5 .   ? 22.386  -4.701  79.736  1.00 29.88 ? 42   HOH A O   1 
HETATM 4505 O  O   . HOH G 5 .   ? 23.987  -1.312  70.834  1.00 25.88 ? 55   HOH A O   1 
HETATM 4506 O  O   . HOH G 5 .   ? 16.668  -6.221  101.942 1.00 29.42 ? 57   HOH A O   1 
HETATM 4507 O  O   . HOH G 5 .   ? 9.365   -5.226  96.225  1.00 25.05 ? 59   HOH A O   1 
HETATM 4508 O  O   . HOH G 5 .   ? 3.579   8.205   81.694  1.00 28.20 ? 62   HOH A O   1 
HETATM 4509 O  O   . HOH G 5 .   ? 17.546  -9.005  103.807 1.00 24.01 ? 64   HOH A O   1 
HETATM 4510 O  O   . HOH G 5 .   ? 5.683   -13.859 75.654  1.00 33.47 ? 66   HOH A O   1 
HETATM 4511 O  O   . HOH G 5 .   ? 24.165  -7.242  101.510 1.00 38.72 ? 75   HOH A O   1 
HETATM 4512 O  O   . HOH G 5 .   ? -5.862  -2.421  91.707  1.00 47.37 ? 76   HOH A O   1 
HETATM 4513 O  O   . HOH G 5 .   ? 16.336  -0.372  58.288  1.00 31.31 ? 82   HOH A O   1 
HETATM 4514 O  O   . HOH G 5 .   ? 19.021  -12.811 83.901  1.00 28.37 ? 86   HOH A O   1 
HETATM 4515 O  O   . HOH G 5 .   ? 24.561  -6.169  78.811  1.00 33.20 ? 90   HOH A O   1 
HETATM 4516 O  O   . HOH G 5 .   ? 6.890   4.858   83.385  1.00 30.83 ? 91   HOH A O   1 
HETATM 4517 O  O   . HOH G 5 .   ? -3.415  1.133   84.094  1.00 32.21 ? 94   HOH A O   1 
HETATM 4518 O  O   . HOH G 5 .   ? 15.129  -9.065  68.266  1.00 31.21 ? 95   HOH A O   1 
HETATM 4519 O  O   . HOH G 5 .   ? 4.470   5.720   82.482  1.00 26.18 ? 96   HOH A O   1 
HETATM 4520 O  O   . HOH G 5 .   ? 0.547   0.827   75.940  1.00 34.05 ? 98   HOH A O   1 
HETATM 4521 O  O   . HOH G 5 .   ? 26.842  -6.027  80.089  1.00 39.19 ? 102  HOH A O   1 
HETATM 4522 O  O   . HOH G 5 .   ? -0.256  -6.614  84.198  1.00 43.22 ? 103  HOH A O   1 
HETATM 4523 O  O   . HOH G 5 .   ? 24.375  6.043   75.798  1.00 32.04 ? 112  HOH A O   1 
HETATM 4524 O  O   . HOH G 5 .   ? 3.384   8.391   78.953  1.00 28.98 ? 115  HOH A O   1 
HETATM 4525 O  O   . HOH G 5 .   ? 29.780  -0.125  78.765  1.00 39.54 ? 117  HOH A O   1 
HETATM 4526 O  O   . HOH G 5 .   ? 4.750   -8.612  64.040  1.00 33.06 ? 121  HOH A O   1 
HETATM 4527 O  O   . HOH G 5 .   ? 11.383  4.419   69.682  1.00 46.16 ? 125  HOH A O   1 
HETATM 4528 O  O   . HOH G 5 .   ? 14.423  14.261  77.153  1.00 36.09 ? 128  HOH A O   1 
HETATM 4529 O  O   . HOH G 5 .   ? 23.317  2.158   71.455  1.00 36.36 ? 129  HOH A O   1 
HETATM 4530 O  O   . HOH G 5 .   ? 1.939   -6.432  72.738  1.00 34.88 ? 131  HOH A O   1 
HETATM 4531 O  O   . HOH G 5 .   ? 4.044   -12.480 78.124  1.00 56.62 ? 133  HOH A O   1 
HETATM 4532 O  O   . HOH G 5 .   ? 14.093  -8.731  70.884  1.00 23.49 ? 136  HOH A O   1 
HETATM 4533 O  O   . HOH G 5 .   ? 24.034  -13.374 91.380  1.00 40.78 ? 139  HOH A O   1 
HETATM 4534 O  O   . HOH G 5 .   ? 5.901   18.893  83.243  1.00 47.40 ? 141  HOH A O   1 
HETATM 4535 O  O   . HOH G 5 .   ? 25.749  1.998   74.043  1.00 34.36 ? 146  HOH A O   1 
HETATM 4536 O  O   . HOH G 5 .   ? 18.495  5.194   70.883  1.00 30.95 ? 149  HOH A O   1 
HETATM 4537 O  O   . HOH G 5 .   ? 2.507   -9.233  91.856  1.00 29.28 ? 159  HOH A O   1 
HETATM 4538 O  O   . HOH G 5 .   ? 5.304   -8.789  91.085  1.00 30.26 ? 161  HOH A O   1 
HETATM 4539 O  O   . HOH G 5 .   ? 12.127  -16.250 75.058  1.00 33.89 ? 162  HOH A O   1 
HETATM 4540 O  O   . HOH G 5 .   ? 18.449  -12.008 97.577  1.00 34.60 ? 163  HOH A O   1 
HETATM 4541 O  O   . HOH G 5 .   ? 9.770   0.950   63.564  1.00 39.62 ? 165  HOH A O   1 
HETATM 4542 O  O   . HOH G 5 .   ? 6.555   4.719   99.047  1.00 39.66 ? 169  HOH A O   1 
HETATM 4543 O  O   . HOH G 5 .   ? 20.001  -5.073  107.771 1.00 40.99 ? 172  HOH A O   1 
HETATM 4544 O  O   . HOH G 5 .   ? 3.561   -8.763  70.546  1.00 34.72 ? 174  HOH A O   1 
HETATM 4545 O  O   . HOH G 5 .   ? 23.939  -11.726 88.522  1.00 39.30 ? 175  HOH A O   1 
HETATM 4546 O  O   . HOH G 5 .   ? 24.436  3.530   82.316  1.00 37.59 ? 177  HOH A O   1 
HETATM 4547 O  O   . HOH G 5 .   ? 24.570  -4.076  76.881  1.00 44.11 ? 179  HOH A O   1 
HETATM 4548 O  O   . HOH G 5 .   ? 28.167  -0.281  86.299  1.00 31.61 ? 185  HOH A O   1 
HETATM 4549 O  O   . HOH G 5 .   ? 6.630   -5.579  97.101  1.00 33.23 ? 190  HOH A O   1 
HETATM 4550 O  O   . HOH G 5 .   ? 2.692   8.887   89.653  1.00 38.60 ? 191  HOH A O   1 
HETATM 4551 O  O   . HOH G 5 .   ? 18.768  -1.734  55.757  1.00 34.96 ? 197  HOH A O   1 
HETATM 4552 O  O   . HOH G 5 .   ? -2.597  15.968  83.591  1.00 47.29 ? 199  HOH A O   1 
HETATM 4553 O  O   . HOH G 5 .   ? 7.140   -8.155  61.539  1.00 32.21 ? 201  HOH A O   1 
HETATM 4554 O  O   . HOH G 5 .   ? 7.464   -12.733 84.622  1.00 42.87 ? 205  HOH A O   1 
HETATM 4555 O  O   . HOH G 5 .   ? 17.140  3.715   66.432  1.00 41.03 ? 206  HOH A O   1 
HETATM 4556 O  O   . HOH G 5 .   ? -0.377  -9.437  83.343  1.00 52.94 ? 207  HOH A O   1 
HETATM 4557 O  O   . HOH G 5 .   ? 11.489  -7.386  103.275 1.00 40.01 ? 208  HOH A O   1 
HETATM 4558 O  O   . HOH G 5 .   ? 16.523  -12.385 70.778  1.00 36.58 ? 212  HOH A O   1 
HETATM 4559 O  O   . HOH G 5 .   ? 14.585  14.196  74.319  1.00 50.92 ? 215  HOH A O   1 
HETATM 4560 O  O   . HOH G 5 .   ? 31.368  -3.460  86.502  1.00 48.22 ? 217  HOH A O   1 
HETATM 4561 O  O   . HOH G 5 .   ? 14.773  -8.050  104.444 1.00 37.52 ? 224  HOH A O   1 
HETATM 4562 O  O   . HOH G 5 .   ? 20.233  -14.633 96.986  1.00 44.07 ? 228  HOH A O   1 
HETATM 4563 O  O   . HOH G 5 .   ? 16.724  -18.589 82.238  1.00 38.86 ? 229  HOH A O   1 
HETATM 4564 O  O   . HOH G 5 .   ? 22.280  -0.189  75.110  1.00 36.17 ? 230  HOH A O   1 
HETATM 4565 O  O   . HOH G 5 .   ? 20.676  -17.402 85.448  1.00 41.01 ? 239  HOH A O   1 
HETATM 4566 O  O   . HOH G 5 .   ? 3.090   -8.469  96.276  1.00 36.51 ? 240  HOH A O   1 
HETATM 4567 O  O   . HOH G 5 .   ? 1.905   4.463   75.703  1.00 37.76 ? 242  HOH A O   1 
HETATM 4568 O  O   . HOH G 5 .   ? 7.305   2.489   69.834  1.00 37.78 ? 243  HOH A O   1 
HETATM 4569 O  O   . HOH G 5 .   ? 7.208   1.571   71.961  1.00 31.22 ? 245  HOH A O   1 
HETATM 4570 O  O   . HOH G 5 .   ? 4.613   5.703   72.453  1.00 44.64 ? 246  HOH A O   1 
HETATM 4571 O  O   . HOH G 5 .   ? 15.181  16.939  77.782  1.00 54.80 ? 247  HOH A O   1 
HETATM 4572 O  O   . HOH G 5 .   ? 23.663  -1.764  76.771  1.00 33.96 ? 248  HOH A O   1 
HETATM 4573 O  O   . HOH G 5 .   ? -0.213  -6.290  86.718  1.00 54.42 ? 250  HOH A O   1 
HETATM 4574 O  O   . HOH G 5 .   ? 20.476  -1.642  76.187  1.00 43.09 ? 253  HOH A O   1 
HETATM 4575 O  O   . HOH G 5 .   ? 23.606  8.186   76.775  1.00 46.42 ? 258  HOH A O   1 
HETATM 4576 O  O   . HOH G 5 .   ? 19.642  -18.244 90.475  1.00 50.53 ? 259  HOH A O   1 
HETATM 4577 O  O   . HOH G 5 .   ? 19.865  10.455  77.986  1.00 54.16 ? 263  HOH A O   1 
HETATM 4578 O  O   . HOH G 5 .   ? 24.295  -3.944  70.261  1.00 24.41 ? 264  HOH A O   1 
HETATM 4579 O  O   . HOH G 5 .   ? 26.522  -9.045  89.788  1.00 45.69 ? 265  HOH A O   1 
HETATM 4580 O  O   . HOH G 5 .   ? 21.378  12.668  108.398 1.00 29.56 ? 272  HOH A O   1 
HETATM 4581 O  O   . HOH G 5 .   ? 25.317  -5.985  103.766 1.00 30.54 ? 275  HOH A O   1 
HETATM 4582 O  O   . HOH G 5 .   ? 25.084  7.714   91.759  1.00 28.73 ? 278  HOH A O   1 
HETATM 4583 O  O   . HOH G 5 .   ? 7.006   3.598   96.357  1.00 32.31 ? 279  HOH A O   1 
HETATM 4584 O  O   . HOH G 5 .   ? 7.118   6.867   108.448 1.00 35.56 ? 280  HOH A O   1 
HETATM 4585 O  O   . HOH G 5 .   ? 23.540  -4.114  74.287  1.00 26.83 ? 281  HOH A O   1 
HETATM 4586 O  O   . HOH G 5 .   ? 30.313  6.559   114.684 1.00 39.91 ? 282  HOH A O   1 
HETATM 4587 O  O   . HOH G 5 .   ? 13.026  2.732   109.176 1.00 38.56 ? 283  HOH A O   1 
HETATM 4588 O  O   . HOH G 5 .   ? 15.549  0.860   108.821 1.00 36.83 ? 284  HOH A O   1 
HETATM 4589 O  O   . HOH G 5 .   ? 23.695  -11.899 78.927  1.00 40.28 ? 293  HOH A O   1 
HETATM 4590 O  O   . HOH G 5 .   ? 24.709  -14.997 81.951  1.00 43.79 ? 294  HOH A O   1 
HETATM 4591 O  O   . HOH G 5 .   ? 7.881   13.768  79.824  1.00 32.95 ? 295  HOH A O   1 
HETATM 4592 O  O   . HOH G 5 .   ? 16.124  1.612   112.776 1.00 51.50 ? 305  HOH A O   1 
HETATM 4593 O  O   . HOH G 5 .   ? 23.084  11.886  121.026 1.00 60.49 ? 306  HOH A O   1 
HETATM 4594 O  O   . HOH G 5 .   ? 20.691  10.941  125.549 1.00 53.63 ? 307  HOH A O   1 
HETATM 4595 O  O   . HOH G 5 .   ? 15.366  8.222   125.320 1.00 53.10 ? 308  HOH A O   1 
HETATM 4596 O  O   . HOH G 5 .   ? 13.353  11.923  115.994 1.00 64.31 ? 309  HOH A O   1 
HETATM 4597 O  O   . HOH G 5 .   ? 12.280  13.826  119.313 1.00 40.51 ? 310  HOH A O   1 
HETATM 4598 O  O   . HOH G 5 .   ? 13.405  15.151  115.592 1.00 38.16 ? 311  HOH A O   1 
HETATM 4599 O  O   . HOH G 5 .   ? 14.159  17.274  116.342 1.00 45.16 ? 312  HOH A O   1 
HETATM 4600 O  O   . HOH G 5 .   ? 6.694   9.817   107.553 1.00 38.50 ? 313  HOH A O   1 
HETATM 4601 O  O   . HOH G 5 .   ? 6.462   12.888  101.023 1.00 55.68 ? 314  HOH A O   1 
HETATM 4602 O  O   . HOH G 5 .   ? 7.339   3.793   105.397 1.00 41.54 ? 315  HOH A O   1 
HETATM 4603 O  O   . HOH G 5 .   ? 10.201  18.847  94.962  1.00 41.94 ? 316  HOH A O   1 
HETATM 4604 O  O   . HOH G 5 .   ? 9.039   17.774  97.111  1.00 46.71 ? 317  HOH A O   1 
HETATM 4605 O  O   . HOH G 5 .   ? 2.606   16.738  95.419  1.00 48.72 ? 318  HOH A O   1 
HETATM 4606 O  O   . HOH G 5 .   ? 10.602  25.164  85.689  1.00 46.21 ? 319  HOH A O   1 
HETATM 4607 O  O   . HOH G 5 .   ? 10.137  22.730  86.182  1.00 41.39 ? 320  HOH A O   1 
HETATM 4608 O  O   . HOH G 5 .   ? 2.820   10.444  75.445  1.00 47.82 ? 321  HOH A O   1 
HETATM 4609 O  O   . HOH G 5 .   ? 8.340   16.077  89.744  1.00 33.33 ? 322  HOH A O   1 
HETATM 4610 O  O   . HOH G 5 .   ? 17.844  17.306  82.932  1.00 48.88 ? 323  HOH A O   1 
HETATM 4611 O  O   . HOH G 5 .   ? 20.598  13.904  92.166  1.00 40.26 ? 324  HOH A O   1 
HETATM 4612 O  O   . HOH G 5 .   ? 21.317  13.479  94.462  1.00 56.86 ? 325  HOH A O   1 
HETATM 4613 O  O   . HOH G 5 .   ? 25.104  14.767  99.156  1.00 50.30 ? 326  HOH A O   1 
HETATM 4614 O  O   . HOH G 5 .   ? 24.445  12.537  79.861  1.00 60.89 ? 327  HOH A O   1 
HETATM 4615 O  O   . HOH G 5 .   ? 24.260  7.832   81.437  1.00 45.20 ? 328  HOH A O   1 
HETATM 4616 O  O   . HOH G 5 .   ? 27.052  6.789   79.409  1.00 44.91 ? 329  HOH A O   1 
HETATM 4617 O  O   . HOH G 5 .   ? 26.702  8.699   78.035  1.00 67.06 ? 330  HOH A O   1 
HETATM 4618 O  O   . HOH G 5 .   ? 21.112  8.369   76.551  1.00 38.47 ? 331  HOH A O   1 
HETATM 4619 O  O   . HOH G 5 .   ? 20.794  6.372   71.555  1.00 44.55 ? 332  HOH A O   1 
HETATM 4620 O  O   . HOH G 5 .   ? 17.383  9.073   70.882  1.00 44.97 ? 333  HOH A O   1 
HETATM 4621 O  O   . HOH G 5 .   ? 24.469  2.708   89.521  1.00 45.36 ? 334  HOH A O   1 
HETATM 4622 O  O   . HOH G 5 .   ? 27.025  3.597   90.927  1.00 49.15 ? 335  HOH A O   1 
HETATM 4623 O  O   . HOH G 5 .   ? 26.702  2.107   86.133  1.00 40.74 ? 336  HOH A O   1 
HETATM 4624 O  O   . HOH G 5 .   ? 30.366  2.268   95.330  1.00 49.61 ? 337  HOH A O   1 
HETATM 4625 O  O   . HOH G 5 .   ? -3.691  -1.895  75.705  1.00 46.47 ? 338  HOH A O   1 
HETATM 4626 O  O   . HOH G 5 .   ? 24.046  -1.658  73.577  1.00 38.94 ? 346  HOH A O   1 
HETATM 4627 O  O   . HOH G 5 .   ? 0.814   -10.478 90.167  1.00 49.87 ? 347  HOH A O   1 
HETATM 4628 O  O   A HOH G 5 .   ? 3.616   -7.909  78.666  0.50 28.56 ? 348  HOH A O   1 
HETATM 4629 O  O   B HOH G 5 .   ? 3.026   -9.903  79.140  0.50 36.40 ? 348  HOH A O   1 
HETATM 4630 O  O   . HOH G 5 .   ? 12.727  -13.069 69.429  1.00 51.61 ? 349  HOH A O   1 
HETATM 4631 O  O   . HOH G 5 .   ? 12.628  -13.256 93.867  1.00 48.76 ? 350  HOH A O   1 
HETATM 4632 O  O   . HOH G 5 .   ? 22.479  -10.302 96.477  1.00 43.59 ? 351  HOH A O   1 
HETATM 4633 O  O   . HOH G 5 .   ? 25.175  -8.848  95.314  1.00 40.40 ? 352  HOH A O   1 
HETATM 4634 O  O   . HOH G 5 .   ? 29.050  -3.766  92.728  1.00 37.70 ? 353  HOH A O   1 
HETATM 4635 O  O   . HOH G 5 .   ? 23.396  -8.242  71.957  1.00 51.38 ? 354  HOH A O   1 
HETATM 4636 O  O   . HOH G 5 .   ? 12.487  -5.842  62.215  1.00 39.10 ? 355  HOH A O   1 
HETATM 4637 O  O   . HOH G 5 .   ? 15.915  -8.818  63.004  1.00 45.99 ? 356  HOH A O   1 
HETATM 4638 O  O   . HOH G 5 .   ? 19.740  0.181   61.648  1.00 47.97 ? 357  HOH A O   1 
HETATM 4639 O  O   . HOH G 5 .   ? 18.476  0.883   58.810  1.00 43.47 ? 358  HOH A O   1 
HETATM 4640 O  O   . HOH G 5 .   ? 18.281  3.498   54.591  1.00 52.97 ? 359  HOH A O   1 
HETATM 4641 O  O   . HOH G 5 .   ? 16.464  -1.432  108.939 1.00 60.42 ? 360  HOH A O   1 
HETATM 4642 O  O   . HOH G 5 .   ? 6.359   6.215   95.064  1.00 41.77 ? 361  HOH A O   1 
HETATM 4643 O  O   . HOH G 5 .   ? 33.440  16.288  107.400 1.00 64.00 ? 362  HOH A O   1 
HETATM 4644 O  O   . HOH G 5 .   ? 23.003  13.553  106.197 1.00 34.95 ? 363  HOH A O   1 
HETATM 4645 O  O   . HOH G 5 .   ? 22.210  15.734  109.626 1.00 39.25 ? 364  HOH A O   1 
HETATM 4646 O  O   . HOH G 5 .   ? 8.027   6.247   111.263 1.00 59.18 ? 365  HOH A O   1 
HETATM 4647 O  O   . HOH G 5 .   ? 4.640   -10.947 64.391  1.00 44.10 ? 400  HOH A O   1 
HETATM 4648 O  O   . HOH G 5 .   ? 5.286   -10.911 69.497  1.00 41.32 ? 407  HOH A O   1 
HETATM 4649 O  O   . HOH G 5 .   ? 5.019   -1.854  105.140 1.00 58.48 ? 414  HOH A O   1 
HETATM 4650 O  O   . HOH G 5 .   ? 3.005   -2.209  102.095 1.00 47.97 ? 415  HOH A O   1 
HETATM 4651 O  O   . HOH G 5 .   ? 25.826  14.009  113.994 1.00 50.65 ? 416  HOH A O   1 
HETATM 4652 O  O   . HOH G 5 .   ? 28.583  12.422  115.043 1.00 50.90 ? 417  HOH A O   1 
HETATM 4653 O  O   . HOH G 5 .   ? 31.294  13.742  110.940 1.00 47.32 ? 418  HOH A O   1 
HETATM 4654 O  O   . HOH G 5 .   ? 21.163  2.485   114.525 1.00 53.16 ? 419  HOH A O   1 
HETATM 4655 O  O   . HOH G 5 .   ? -4.156  18.716  76.749  1.00 49.04 ? 420  HOH A O   1 
HETATM 4656 O  O   . HOH G 5 .   ? 2.836   16.530  76.202  1.00 45.80 ? 421  HOH A O   1 
HETATM 4657 O  O   . HOH G 5 .   ? 30.433  -2.761  80.052  1.00 50.69 ? 422  HOH A O   1 
HETATM 4658 O  O   . HOH G 5 .   ? 26.119  -12.348 87.696  1.00 49.06 ? 426  HOH A O   1 
HETATM 4659 O  O   . HOH G 5 .   ? 11.541  -14.455 83.704  1.00 42.25 ? 429  HOH A O   1 
HETATM 4660 O  O   . HOH G 5 .   ? 9.587   -12.834 81.809  1.00 41.16 ? 430  HOH A O   1 
HETATM 4661 O  O   . HOH G 5 .   ? 14.044  -17.573 81.379  1.00 43.13 ? 431  HOH A O   1 
HETATM 4662 O  O   . HOH G 5 .   ? 10.977  -18.272 77.343  1.00 55.74 ? 432  HOH A O   1 
HETATM 4663 O  O   . HOH G 5 .   ? 11.461  -15.983 70.618  1.00 48.62 ? 433  HOH A O   1 
HETATM 4664 O  O   . HOH H 5 .   ? -0.791  -7.097  60.326  1.00 16.88 ? 1174 HOH B O   1 
HETATM 4665 O  O   . HOH H 5 .   ? -13.988 -11.399 52.559  1.00 15.80 ? 1175 HOH B O   1 
HETATM 4666 O  O   . HOH H 5 .   ? -15.056 -14.435 55.873  1.00 16.98 ? 1176 HOH B O   1 
HETATM 4667 O  O   . HOH H 5 .   ? -14.766 -14.100 53.120  1.00 15.61 ? 1177 HOH B O   1 
HETATM 4668 O  O   . HOH H 5 .   ? 2.766   -16.633 26.052  1.00 21.82 ? 1178 HOH B O   1 
HETATM 4669 O  O   . HOH H 5 .   ? -7.973  -28.100 47.705  1.00 17.85 ? 1179 HOH B O   1 
HETATM 4670 O  O   . HOH H 5 .   ? -1.919  1.657   33.618  1.00 19.56 ? 1180 HOH B O   1 
HETATM 4671 O  O   . HOH H 5 .   ? 2.870   -7.477  53.562  1.00 18.31 ? 1181 HOH B O   1 
HETATM 4672 O  O   . HOH H 5 .   ? -12.533 -24.399 51.118  1.00 18.62 ? 1182 HOH B O   1 
HETATM 4673 O  O   . HOH H 5 .   ? -11.531 -10.729 51.625  1.00 14.76 ? 1183 HOH B O   1 
HETATM 4674 O  O   . HOH H 5 .   ? -8.541  -31.346 45.664  1.00 21.12 ? 1184 HOH B O   1 
HETATM 4675 O  O   . HOH H 5 .   ? -9.095  0.543   39.580  1.00 19.92 ? 1185 HOH B O   1 
HETATM 4676 O  O   . HOH H 5 .   ? -7.933  -23.786 39.343  1.00 25.64 ? 1186 HOH B O   1 
HETATM 4677 O  O   . HOH H 5 .   ? 6.691   -12.696 42.982  1.00 20.39 ? 1187 HOH B O   1 
HETATM 4678 O  O   . HOH H 5 .   ? -4.559  2.298   65.008  1.00 22.22 ? 1188 HOH B O   1 
HETATM 4679 O  O   . HOH H 5 .   ? 3.660   -1.525  53.103  1.00 17.46 ? 1189 HOH B O   1 
HETATM 4680 O  O   . HOH H 5 .   ? -3.786  3.395   34.875  1.00 20.67 ? 1190 HOH B O   1 
HETATM 4681 O  O   . HOH H 5 .   ? 0.487   7.130   52.418  1.00 19.16 ? 1191 HOH B O   1 
HETATM 4682 O  O   . HOH H 5 .   ? -3.760  -20.509 57.221  1.00 23.21 ? 1192 HOH B O   1 
HETATM 4683 O  O   . HOH H 5 .   ? -12.239 -11.543 39.758  1.00 20.53 ? 1193 HOH B O   1 
HETATM 4684 O  O   . HOH H 5 .   ? -15.862 -14.344 45.141  1.00 20.03 ? 1194 HOH B O   1 
HETATM 4685 O  O   . HOH H 5 .   ? -3.846  -5.366  26.480  1.00 24.25 ? 1195 HOH B O   1 
HETATM 4686 O  O   . HOH H 5 .   ? -15.537 -16.881 59.130  1.00 23.16 ? 1196 HOH B O   1 
HETATM 4687 O  O   . HOH H 5 .   ? -0.705  8.685   38.652  1.00 23.19 ? 1197 HOH B O   1 
HETATM 4688 O  O   . HOH H 5 .   ? 4.927   -2.138  61.303  1.00 29.15 ? 1198 HOH B O   1 
HETATM 4689 O  O   . HOH H 5 .   ? -16.113 3.891   43.815  1.00 25.38 ? 1199 HOH B O   1 
HETATM 4690 O  O   . HOH H 5 .   ? -5.571  -26.834 41.901  1.00 25.82 ? 1200 HOH B O   1 
HETATM 4691 O  O   . HOH H 5 .   ? -1.604  -15.778 16.122  1.00 25.20 ? 1201 HOH B O   1 
HETATM 4692 O  O   . HOH H 5 .   ? -9.887  -21.419 44.525  1.00 18.22 ? 1202 HOH B O   1 
HETATM 4693 O  O   . HOH H 5 .   ? -13.424 3.603   44.892  1.00 23.19 ? 1203 HOH B O   1 
HETATM 4694 O  O   . HOH H 5 .   ? 3.811   -1.038  55.892  1.00 23.02 ? 1204 HOH B O   1 
HETATM 4695 O  O   . HOH H 5 .   ? 0.088   -11.703 64.384  1.00 25.80 ? 1205 HOH B O   1 
HETATM 4696 O  O   . HOH H 5 .   ? -9.033  -22.607 37.317  1.00 22.08 ? 1206 HOH B O   1 
HETATM 4697 O  O   . HOH H 5 .   ? -10.449 -19.561 54.731  1.00 20.86 ? 1207 HOH B O   1 
HETATM 4698 O  O   . HOH H 5 .   ? -18.033 -7.453  59.214  1.00 23.72 ? 1208 HOH B O   1 
HETATM 4699 O  O   . HOH H 5 .   ? -21.658 -6.549  51.144  1.00 22.70 ? 1209 HOH B O   1 
HETATM 4700 O  O   . HOH H 5 .   ? 8.620   -12.580 55.490  1.00 30.50 ? 1210 HOH B O   1 
HETATM 4701 O  O   . HOH H 5 .   ? -15.379 -21.813 38.883  1.00 22.72 ? 1211 HOH B O   1 
HETATM 4702 O  O   . HOH H 5 .   ? -16.676 -10.536 59.443  1.00 21.22 ? 1212 HOH B O   1 
HETATM 4703 O  O   . HOH H 5 .   ? -11.241 -8.645  38.594  1.00 25.11 ? 1213 HOH B O   1 
HETATM 4704 O  O   . HOH H 5 .   ? -7.113  2.689   30.732  1.00 30.66 ? 1214 HOH B O   1 
HETATM 4705 O  O   . HOH H 5 .   ? -6.436  9.870   61.405  1.00 29.20 ? 1215 HOH B O   1 
HETATM 4706 O  O   . HOH H 5 .   ? -7.478  6.827   39.247  1.00 23.66 ? 1216 HOH B O   1 
HETATM 4707 O  O   . HOH H 5 .   ? -12.106 -14.547 28.093  1.00 25.41 ? 1217 HOH B O   1 
HETATM 4708 O  O   . HOH H 5 .   ? -11.824 0.706   38.711  1.00 27.24 ? 1218 HOH B O   1 
HETATM 4709 O  O   . HOH H 5 .   ? -22.817 -8.715  50.991  1.00 33.95 ? 1219 HOH B O   1 
HETATM 4710 O  O   . HOH H 5 .   ? -8.260  -22.424 62.207  1.00 24.57 ? 1220 HOH B O   1 
HETATM 4711 O  O   . HOH H 5 .   ? -14.113 -9.437  40.035  1.00 23.21 ? 1221 HOH B O   1 
HETATM 4712 O  O   . HOH H 5 .   ? 6.020   -0.139  56.956  1.00 25.34 ? 1222 HOH B O   1 
HETATM 4713 O  O   . HOH H 5 .   ? -12.165 -9.975  36.287  1.00 23.66 ? 1223 HOH B O   1 
HETATM 4714 O  O   . HOH H 5 .   ? -20.826 -21.772 50.925  1.00 25.35 ? 1224 HOH B O   1 
HETATM 4715 O  O   . HOH H 5 .   ? -18.899 0.690   51.622  1.00 30.76 ? 1225 HOH B O   1 
HETATM 4716 O  O   . HOH H 5 .   ? 6.074   -11.951 59.291  1.00 30.15 ? 1226 HOH B O   1 
HETATM 4717 O  O   . HOH H 5 .   ? 20.559  -12.698 38.087  1.00 35.08 ? 1227 HOH B O   1 
HETATM 4718 O  O   . HOH H 5 .   ? 11.387  -9.784  19.947  1.00 26.73 ? 1228 HOH B O   1 
HETATM 4719 O  O   . HOH H 5 .   ? -13.023 -3.748  33.582  1.00 27.27 ? 1229 HOH B O   1 
HETATM 4720 O  O   . HOH H 5 .   ? -3.525  2.242   67.586  1.00 28.30 ? 1230 HOH B O   1 
HETATM 4721 O  O   . HOH H 5 .   ? -11.349 -8.123  63.311  1.00 21.40 ? 1231 HOH B O   1 
HETATM 4722 O  O   . HOH H 5 .   ? -15.839 -22.573 58.157  1.00 25.54 ? 1232 HOH B O   1 
HETATM 4723 O  O   . HOH H 5 .   ? -8.522  -7.889  71.907  1.00 32.17 ? 1233 HOH B O   1 
HETATM 4724 O  O   . HOH H 5 .   ? 5.450   6.510   47.725  1.00 22.52 ? 1234 HOH B O   1 
HETATM 4725 O  O   . HOH H 5 .   ? -14.323 -4.648  40.219  1.00 22.68 ? 1235 HOH B O   1 
HETATM 4726 O  O   . HOH H 5 .   ? 16.761  -11.773 26.669  1.00 35.22 ? 1236 HOH B O   1 
HETATM 4727 O  O   . HOH H 5 .   ? -9.427  -24.225 60.798  1.00 37.42 ? 1237 HOH B O   1 
HETATM 4728 O  O   . HOH H 5 .   ? -11.493 -11.317 26.953  1.00 28.06 ? 1238 HOH B O   1 
HETATM 4729 O  O   . HOH H 5 .   ? 5.357   8.400   44.833  1.00 26.99 ? 1239 HOH B O   1 
HETATM 4730 O  O   . HOH H 5 .   ? -1.760  12.762  54.431  1.00 24.64 ? 1240 HOH B O   1 
HETATM 4731 O  O   . HOH H 5 .   ? -1.797  -4.784  69.378  1.00 22.90 ? 1241 HOH B O   1 
HETATM 4732 O  O   . HOH H 5 .   ? -18.918 -28.644 52.303  1.00 30.01 ? 1242 HOH B O   1 
HETATM 4733 O  O   . HOH H 5 .   ? 5.943   -9.225  52.991  1.00 24.19 ? 1243 HOH B O   1 
HETATM 4734 O  O   . HOH H 5 .   ? 1.062   -8.458  69.345  1.00 47.86 ? 1244 HOH B O   1 
HETATM 4735 O  O   . HOH H 5 .   ? -20.112 -8.540  43.959  1.00 38.16 ? 1245 HOH B O   1 
HETATM 4736 O  O   . HOH H 5 .   ? -5.924  -7.074  26.212  1.00 25.30 ? 1246 HOH B O   1 
HETATM 4737 O  O   . HOH H 5 .   ? -19.617 -18.296 60.821  1.00 28.51 ? 1247 HOH B O   1 
HETATM 4738 O  O   . HOH H 5 .   ? -15.850 -25.539 37.493  1.00 35.85 ? 1248 HOH B O   1 
HETATM 4739 O  O   . HOH H 5 .   ? -7.537  -10.742 65.848  1.00 39.04 ? 1249 HOH B O   1 
HETATM 4740 O  O   . HOH H 5 .   ? -12.987 7.400   60.639  1.00 29.46 ? 1250 HOH B O   1 
HETATM 4741 O  O   . HOH H 5 .   ? -7.189  8.207   52.763  1.00 27.16 ? 1251 HOH B O   1 
HETATM 4742 O  O   . HOH H 5 .   ? -1.010  -20.497 20.853  1.00 36.00 ? 1252 HOH B O   1 
HETATM 4743 O  O   . HOH H 5 .   ? 4.343   -17.603 28.193  1.00 26.19 ? 1253 HOH B O   1 
HETATM 4744 O  O   . HOH H 5 .   ? -20.658 -5.777  48.647  1.00 36.28 ? 1254 HOH B O   1 
HETATM 4745 O  O   . HOH H 5 .   ? -21.788 -6.029  46.279  1.00 39.14 ? 1255 HOH B O   1 
HETATM 4746 O  O   . HOH H 5 .   ? 5.903   9.546   54.245  1.00 29.42 ? 1256 HOH B O   1 
HETATM 4747 O  O   . HOH H 5 .   ? -16.324 -15.037 61.104  1.00 37.17 ? 1257 HOH B O   1 
HETATM 4748 O  O   . HOH H 5 .   ? -4.758  -27.844 28.382  1.00 49.63 ? 1258 HOH B O   1 
HETATM 4749 O  O   . HOH H 5 .   ? -15.140 2.152   65.309  1.00 35.62 ? 1259 HOH B O   1 
HETATM 4750 O  O   . HOH H 5 .   ? 2.661   -14.486 58.235  1.00 30.07 ? 1260 HOH B O   1 
HETATM 4751 O  O   . HOH H 5 .   ? 5.151   5.921   57.217  1.00 30.52 ? 1261 HOH B O   1 
HETATM 4752 O  O   . HOH H 5 .   ? 7.992   3.822   45.811  1.00 34.37 ? 1262 HOH B O   1 
HETATM 4753 O  O   . HOH H 5 .   ? -14.507 -17.044 36.032  1.00 31.58 ? 1263 HOH B O   1 
HETATM 4754 O  O   . HOH H 5 .   ? -13.998 3.389   33.267  1.00 41.39 ? 1264 HOH B O   1 
HETATM 4755 O  O   . HOH H 5 .   ? 8.493   -13.694 45.871  1.00 27.13 ? 1265 HOH B O   1 
HETATM 4756 O  O   . HOH H 5 .   ? 5.665   -19.871 27.831  1.00 37.96 ? 1266 HOH B O   1 
HETATM 4757 O  O   . HOH H 5 .   ? 6.173   -15.793 28.421  1.00 42.50 ? 1267 HOH B O   1 
HETATM 4758 O  O   . HOH H 5 .   ? -4.345  -2.693  26.789  1.00 34.41 ? 1268 HOH B O   1 
HETATM 4759 O  O   . HOH H 5 .   ? -3.116  -5.661  22.753  1.00 28.37 ? 1269 HOH B O   1 
HETATM 4760 O  O   . HOH H 5 .   ? -14.844 -27.573 56.448  1.00 35.25 ? 1270 HOH B O   1 
HETATM 4761 O  O   . HOH H 5 .   ? 2.206   -18.889 42.355  1.00 28.76 ? 1271 HOH B O   1 
HETATM 4762 O  O   . HOH H 5 .   ? -12.976 -6.912  39.826  1.00 28.31 ? 1272 HOH B O   1 
HETATM 4763 O  O   . HOH H 5 .   ? -12.615 -16.074 70.542  1.00 46.18 ? 1273 HOH B O   1 
HETATM 4764 O  O   . HOH H 5 .   ? -22.631 -16.495 43.095  1.00 39.13 ? 1274 HOH B O   1 
HETATM 4765 O  O   . HOH H 5 .   ? -6.116  -12.069 64.459  1.00 47.96 ? 1275 HOH B O   1 
HETATM 4766 O  O   . HOH H 5 .   ? 14.018  -14.194 49.455  1.00 34.37 ? 1276 HOH B O   1 
HETATM 4767 O  O   . HOH H 5 .   ? 5.453   -22.132 43.583  1.00 37.11 ? 1277 HOH B O   1 
HETATM 4768 O  O   . HOH H 5 .   ? 3.848   -19.423 24.895  1.00 41.94 ? 1278 HOH B O   1 
HETATM 4769 O  O   . HOH H 5 .   ? 7.838   -10.965 51.891  1.00 44.70 ? 1279 HOH B O   1 
HETATM 4770 O  O   . HOH H 5 .   ? 4.626   1.332   65.639  1.00 34.89 ? 1280 HOH B O   1 
HETATM 4771 O  O   . HOH H 5 .   ? -9.203  -15.416 64.665  1.00 37.24 ? 1281 HOH B O   1 
HETATM 4772 O  O   . HOH H 5 .   ? -27.186 -18.011 52.362  1.00 33.76 ? 1282 HOH B O   1 
HETATM 4773 O  O   . HOH H 5 .   ? -0.953  -9.868  68.581  1.00 37.04 ? 1283 HOH B O   1 
HETATM 4774 O  O   . HOH H 5 .   ? -10.928 -0.814  28.442  1.00 39.82 ? 1284 HOH B O   1 
HETATM 4775 O  O   . HOH H 5 .   ? 3.446   5.745   39.135  1.00 26.67 ? 1285 HOH B O   1 
HETATM 4776 O  O   . HOH H 5 .   ? -18.519 -13.560 58.558  1.00 34.29 ? 1286 HOH B O   1 
HETATM 4777 O  O   . HOH H 5 .   ? 6.532   3.924   40.903  1.00 34.73 ? 1287 HOH B O   1 
HETATM 4778 O  O   . HOH H 5 .   ? -2.526  -27.883 52.095  1.00 43.21 ? 1288 HOH B O   1 
HETATM 4779 O  O   . HOH H 5 .   ? -6.067  2.524   33.187  1.00 29.14 ? 1289 HOH B O   1 
HETATM 4780 O  O   . HOH H 5 .   ? 6.765   -19.392 35.196  1.00 40.36 ? 1290 HOH B O   1 
HETATM 4781 O  O   . HOH H 5 .   ? -18.081 4.782   46.010  1.00 38.34 ? 1291 HOH B O   1 
HETATM 4782 O  O   . HOH H 5 .   ? -0.169  -21.487 47.294  1.00 30.09 ? 1292 HOH B O   1 
HETATM 4783 O  O   . HOH H 5 .   ? -9.096  6.926   54.056  1.00 29.86 ? 1293 HOH B O   1 
HETATM 4784 O  O   . HOH H 5 .   ? -24.119 -18.156 55.099  1.00 30.95 ? 1294 HOH B O   1 
HETATM 4785 O  O   . HOH H 5 .   ? -4.489  -24.176 54.037  1.00 38.96 ? 1295 HOH B O   1 
HETATM 4786 O  O   . HOH H 5 .   ? 13.490  -3.954  51.062  1.00 34.71 ? 1296 HOH B O   1 
HETATM 4787 O  O   . HOH H 5 .   ? -0.933  -18.106 59.737  1.00 34.39 ? 1297 HOH B O   1 
HETATM 4788 O  O   . HOH H 5 .   ? 5.224   -13.910 57.909  1.00 36.95 ? 1298 HOH B O   1 
HETATM 4789 O  O   . HOH H 5 .   ? 3.222   7.872   57.028  1.00 40.29 ? 1299 HOH B O   1 
HETATM 4790 O  O   . HOH H 5 .   ? -6.647  -12.779 21.206  1.00 41.22 ? 1300 HOH B O   1 
HETATM 4791 O  O   . HOH H 5 .   ? -11.436 -8.478  30.741  1.00 32.89 ? 1301 HOH B O   1 
HETATM 4792 O  O   . HOH H 5 .   ? -14.808 1.345   57.271  1.00 35.23 ? 1302 HOH B O   1 
HETATM 4793 O  O   . HOH H 5 .   ? -14.605 6.069   58.191  1.00 34.99 ? 1303 HOH B O   1 
HETATM 4794 O  O   . HOH H 5 .   ? -14.564 1.465   30.667  1.00 51.01 ? 1304 HOH B O   1 
HETATM 4795 O  O   . HOH H 5 .   ? -25.579 -12.349 55.658  1.00 34.70 ? 1305 HOH B O   1 
HETATM 4796 O  O   . HOH H 5 .   ? 3.732   4.323   61.523  1.00 49.20 ? 1306 HOH B O   1 
HETATM 4797 O  O   . HOH H 5 .   ? -6.536  -14.847 64.019  1.00 37.30 ? 1307 HOH B O   1 
HETATM 4798 O  O   . HOH H 5 .   ? 3.258   -22.904 48.967  1.00 43.11 ? 1308 HOH B O   1 
HETATM 4799 O  O   . HOH H 5 .   ? -19.079 0.438   48.540  1.00 41.76 ? 1309 HOH B O   1 
HETATM 4800 O  O   . HOH H 5 .   ? -9.540  4.827   33.980  1.00 47.93 ? 1310 HOH B O   1 
HETATM 4801 O  O   . HOH H 5 .   ? -2.034  5.711   65.388  1.00 37.13 ? 1311 HOH B O   1 
HETATM 4802 O  O   . HOH H 5 .   ? 2.512   -12.810 63.345  1.00 40.69 ? 1312 HOH B O   1 
HETATM 4803 O  O   . HOH H 5 .   ? 4.648   -5.459  43.525  1.00 42.31 ? 1313 HOH B O   1 
HETATM 4804 O  O   . HOH H 5 .   ? 11.398  -8.134  23.057  1.00 32.73 ? 1314 HOH B O   1 
HETATM 4805 O  O   . HOH H 5 .   ? 4.413   -21.420 25.498  1.00 46.57 ? 1315 HOH B O   1 
HETATM 4806 O  O   . HOH H 5 .   ? -6.161  -24.462 23.135  1.00 34.28 ? 1316 HOH B O   1 
HETATM 4807 O  O   . HOH H 5 .   ? -1.959  -4.440  20.626  1.00 51.18 ? 1317 HOH B O   1 
HETATM 4808 O  O   . HOH H 5 .   ? 3.898   -6.035  60.168  1.00 35.50 ? 1318 HOH B O   1 
HETATM 4809 O  O   . HOH H 5 .   ? -8.693  -10.868 23.933  1.00 41.70 ? 1319 HOH B O   1 
HETATM 4810 O  O   . HOH H 5 .   ? -9.702  10.768  55.616  1.00 37.74 ? 1320 HOH B O   1 
HETATM 4811 O  O   . HOH H 5 .   ? -11.164 6.963   51.981  1.00 40.26 ? 1321 HOH B O   1 
HETATM 4812 O  O   . HOH H 5 .   ? -1.320  -25.471 44.686  1.00 32.01 ? 1322 HOH B O   1 
HETATM 4813 O  O   . HOH H 5 .   ? -9.794  -19.832 31.766  1.00 39.08 ? 1323 HOH B O   1 
HETATM 4814 O  O   . HOH H 5 .   ? -9.153  -21.149 29.543  1.00 42.25 ? 1324 HOH B O   1 
HETATM 4815 O  O   . HOH H 5 .   ? -16.150 -10.342 38.820  1.00 45.17 ? 1325 HOH B O   1 
HETATM 4816 O  O   . HOH H 5 .   ? 5.680   -17.321 19.465  1.00 50.95 ? 1326 HOH B O   1 
HETATM 4817 O  O   . HOH H 5 .   ? -10.122 -25.832 31.296  1.00 37.18 ? 1327 HOH B O   1 
HETATM 4818 O  O   . HOH H 5 .   ? -3.060  -22.980 56.591  1.00 37.28 ? 1328 HOH B O   1 
HETATM 4819 O  O   . HOH H 5 .   ? -2.485  -25.713 37.215  1.00 38.03 ? 1329 HOH B O   1 
HETATM 4820 O  O   . HOH H 5 .   ? 0.612   12.633  56.926  1.00 51.09 ? 1330 HOH B O   1 
HETATM 4821 O  O   . HOH H 5 .   ? -16.141 -20.953 36.738  1.00 44.88 ? 1331 HOH B O   1 
HETATM 4822 O  O   . HOH H 5 .   ? -14.025 -11.502 62.505  1.00 36.74 ? 1332 HOH B O   1 
HETATM 4823 O  O   . HOH H 5 .   ? 7.491   -17.708 52.541  1.00 42.52 ? 1333 HOH B O   1 
HETATM 4824 O  O   . HOH H 5 .   ? 5.449   -4.665  62.103  1.00 39.44 ? 1334 HOH B O   1 
HETATM 4825 O  O   . HOH H 5 .   ? 1.644   -16.218 56.817  1.00 37.57 ? 1335 HOH B O   1 
HETATM 4826 O  O   . HOH H 5 .   ? 3.878   -15.855 41.573  1.00 30.81 ? 1336 HOH B O   1 
HETATM 4827 O  O   . HOH H 5 .   ? -4.633  -26.866 38.135  1.00 41.15 ? 1337 HOH B O   1 
HETATM 4828 O  O   . HOH H 5 .   ? -10.572 -27.409 34.430  1.00 40.92 ? 1338 HOH B O   1 
HETATM 4829 O  O   . HOH H 5 .   ? 6.883   -21.664 36.168  1.00 53.94 ? 1339 HOH B O   1 
HETATM 4830 O  O   . HOH H 5 .   ? -7.869  -26.287 29.082  1.00 46.30 ? 1340 HOH B O   1 
HETATM 4831 O  O   . HOH H 5 .   ? -15.945 -11.313 64.205  1.00 58.75 ? 1341 HOH B O   1 
HETATM 4832 O  O   . HOH H 5 .   ? 7.899   8.398   45.196  1.00 49.29 ? 1342 HOH B O   1 
HETATM 4833 O  O   . HOH H 5 .   ? 13.467  -9.745  42.285  1.00 37.03 ? 1343 HOH B O   1 
HETATM 4834 O  O   . HOH H 5 .   ? 1.497   -4.553  59.400  1.00 49.55 ? 1344 HOH B O   1 
HETATM 4835 O  O   . HOH H 5 .   ? -4.580  11.556  55.046  1.00 35.26 ? 1345 HOH B O   1 
HETATM 4836 O  O   . HOH H 5 .   ? -16.566 -3.153  36.563  1.00 37.90 ? 1346 HOH B O   1 
HETATM 4837 O  O   . HOH H 5 .   ? -13.759 -9.469  67.039  1.00 45.68 ? 1347 HOH B O   1 
HETATM 4838 O  O   . HOH H 5 .   ? -4.338  11.782  57.747  1.00 43.72 ? 1348 HOH B O   1 
HETATM 4839 O  O   . HOH H 5 .   ? -21.579 -14.699 57.921  1.00 45.91 ? 1349 HOH B O   1 
HETATM 4840 O  O   . HOH H 5 .   ? 7.907   6.742   48.555  1.00 39.43 ? 1350 HOH B O   1 
HETATM 4841 O  O   . HOH H 5 .   ? 3.535   -3.050  25.252  1.00 45.50 ? 1351 HOH B O   1 
HETATM 4842 O  O   . HOH H 5 .   ? -1.702  -27.479 35.426  1.00 44.29 ? 1352 HOH B O   1 
HETATM 4843 O  O   . HOH H 5 .   ? 12.972  -2.332  49.262  1.00 43.12 ? 1353 HOH B O   1 
HETATM 4844 O  O   . HOH H 5 .   ? -12.479 5.193   47.040  1.00 42.68 ? 1354 HOH B O   1 
HETATM 4845 O  O   . HOH H 5 .   ? -17.310 -12.529 61.650  1.00 62.40 ? 1355 HOH B O   1 
HETATM 4846 O  O   . HOH H 5 .   ? -13.434 4.024   66.669  1.00 46.03 ? 1356 HOH B O   1 
HETATM 4847 O  O   . HOH H 5 .   ? -7.307  -16.281 12.224  1.00 50.07 ? 1357 HOH B O   1 
HETATM 4848 O  O   . HOH H 5 .   ? -11.573 -9.170  65.484  1.00 42.74 ? 1358 HOH B O   1 
HETATM 4849 O  O   . HOH H 5 .   ? 5.437   -5.320  64.792  1.00 24.53 ? 1359 HOH B O   1 
HETATM 4850 O  O   . HOH H 5 .   ? 9.466   -5.133  49.091  1.00 19.85 ? 1360 HOH B O   1 
HETATM 4851 O  O   . HOH H 5 .   ? -15.116 -29.278 46.875  1.00 21.90 ? 1361 HOH B O   1 
HETATM 4852 O  O   . HOH H 5 .   ? 11.163  -5.770  56.527  1.00 24.96 ? 1362 HOH B O   1 
HETATM 4853 O  O   . HOH H 5 .   ? -10.431 -26.276 54.133  1.00 28.06 ? 1363 HOH B O   1 
HETATM 4854 O  O   . HOH H 5 .   ? 8.100   -7.651  49.211  1.00 25.40 ? 1364 HOH B O   1 
HETATM 4855 O  O   . HOH H 5 .   ? 7.426   -19.763 45.446  1.00 34.39 ? 1365 HOH B O   1 
HETATM 4856 O  O   . HOH H 5 .   ? -2.377  -11.691 10.649  1.00 27.52 ? 1366 HOH B O   1 
HETATM 4857 O  O   . HOH H 5 .   ? -20.551 -19.977 48.221  1.00 28.48 ? 1367 HOH B O   1 
HETATM 4858 O  O   . HOH H 5 .   ? 14.388  -4.703  59.534  1.00 31.45 ? 1368 HOH B O   1 
HETATM 4859 O  O   A HOH H 5 .   ? -5.915  9.496   43.897  0.50 10.36 ? 1369 HOH B O   1 
HETATM 4860 O  O   B HOH H 5 .   ? -6.553  8.207   43.136  0.50 22.61 ? 1369 HOH B O   1 
HETATM 4861 O  O   . HOH H 5 .   ? 1.910   11.821  51.182  1.00 32.05 ? 1370 HOH B O   1 
HETATM 4862 O  O   . HOH H 5 .   ? 3.273   12.708  49.140  1.00 27.76 ? 1371 HOH B O   1 
HETATM 4863 O  O   . HOH H 5 .   ? -14.630 -24.974 60.263  1.00 30.35 ? 1372 HOH B O   1 
HETATM 4864 O  O   . HOH H 5 .   ? 11.660  -3.193  55.764  1.00 33.68 ? 1373 HOH B O   1 
HETATM 4865 O  O   . HOH H 5 .   ? 8.279   0.087   55.692  1.00 37.32 ? 1374 HOH B O   1 
HETATM 4866 O  O   . HOH H 5 .   ? 9.624   -0.818  53.638  1.00 42.97 ? 1375 HOH B O   1 
HETATM 4867 O  O   . HOH H 5 .   ? 12.339  -2.265  53.213  1.00 41.29 ? 1376 HOH B O   1 
HETATM 4868 O  O   . HOH H 5 .   ? -6.827  -8.557  23.708  1.00 39.74 ? 1377 HOH B O   1 
HETATM 4869 O  O   . HOH H 5 .   ? -18.879 -26.958 43.720  1.00 29.64 ? 1378 HOH B O   1 
HETATM 4870 O  O   . HOH H 5 .   ? 5.505   -2.813  65.231  1.00 33.93 ? 1379 HOH B O   1 
HETATM 4871 O  O   . HOH H 5 .   ? -8.004  -30.721 48.431  1.00 28.58 ? 1380 HOH B O   1 
HETATM 4872 O  O   . HOH H 5 .   ? 12.942  -16.955 23.424  1.00 32.84 ? 1381 HOH B O   1 
HETATM 4873 O  O   . HOH H 5 .   ? 7.240   -2.027  37.536  1.00 31.74 ? 1382 HOH B O   1 
HETATM 4874 O  O   . HOH H 5 .   ? 8.248   -21.501 43.564  1.00 41.63 ? 1383 HOH B O   1 
HETATM 4875 O  O   . HOH H 5 .   ? -8.088  -5.279  25.274  1.00 38.37 ? 1384 HOH B O   1 
HETATM 4876 O  O   . HOH H 5 .   ? -7.078  -3.054  25.229  1.00 43.54 ? 1385 HOH B O   1 
HETATM 4877 O  O   . HOH H 5 .   ? -6.070  -1.265  73.285  1.00 47.54 ? 1386 HOH B O   1 
HETATM 4878 O  O   . HOH H 5 .   ? 4.783   2.588   68.103  1.00 42.16 ? 1387 HOH B O   1 
HETATM 4879 O  O   . HOH H 5 .   ? 4.699   1.903   63.184  1.00 58.36 ? 1388 HOH B O   1 
HETATM 4880 O  O   . HOH H 5 .   ? 6.645   4.072   61.814  1.00 68.70 ? 1389 HOH B O   1 
HETATM 4881 O  O   . HOH H 5 .   ? 6.650   5.179   55.248  1.00 32.02 ? 1390 HOH B O   1 
HETATM 4882 O  O   . HOH H 5 .   ? 6.227   -1.947  58.869  1.00 40.86 ? 1391 HOH B O   1 
HETATM 4883 O  O   . HOH H 5 .   ? 10.512  -2.124  51.713  1.00 51.89 ? 1392 HOH B O   1 
HETATM 4884 O  O   . HOH H 5 .   ? 2.243   -5.896  20.289  1.00 35.32 ? 1393 HOH B O   1 
HETATM 4885 O  O   . HOH H 5 .   ? -1.326  -1.644  26.668  1.00 49.13 ? 1394 HOH B O   1 
HETATM 4886 O  O   . HOH H 5 .   ? -8.211  -13.789 11.202  1.00 44.75 ? 1395 HOH B O   1 
HETATM 4887 O  O   . HOH H 5 .   ? -1.327  -23.193 22.997  1.00 46.61 ? 1396 HOH B O   1 
HETATM 4888 O  O   . HOH H 5 .   ? 0.656   -23.158 25.101  1.00 56.27 ? 1397 HOH B O   1 
HETATM 4889 O  O   . HOH H 5 .   ? -6.828  -26.707 25.002  1.00 48.73 ? 1398 HOH B O   1 
HETATM 4890 O  O   . HOH H 5 .   ? -8.839  -23.438 21.808  1.00 48.47 ? 1399 HOH B O   1 
HETATM 4891 O  O   . HOH H 5 .   ? -11.611 -18.057 32.678  1.00 56.37 ? 1400 HOH B O   1 
HETATM 4892 O  O   . HOH H 5 .   ? -17.390 -23.694 39.550  1.00 46.95 ? 1401 HOH B O   1 
HETATM 4893 O  O   . HOH H 5 .   ? -17.219 -30.008 42.511  1.00 38.44 ? 1402 HOH B O   1 
HETATM 4894 O  O   . HOH H 5 .   ? -18.711 -29.642 48.786  1.00 47.30 ? 1403 HOH B O   1 
HETATM 4895 O  O   . HOH H 5 .   ? -22.982 -27.088 54.761  1.00 39.52 ? 1404 HOH B O   1 
HETATM 4896 O  O   . HOH H 5 .   ? -22.057 -27.755 57.138  1.00 56.22 ? 1405 HOH B O   1 
HETATM 4897 O  O   . HOH H 5 .   ? -26.234 -21.681 57.463  1.00 49.74 ? 1406 HOH B O   1 
HETATM 4898 O  O   . HOH H 5 .   ? -22.394 -16.709 56.008  1.00 53.69 ? 1407 HOH B O   1 
HETATM 4899 O  O   A HOH H 5 .   ? -22.265 -10.485 46.870  0.50 27.50 ? 1408 HOH B O   1 
HETATM 4900 O  O   B HOH H 5 .   ? -22.768 -12.205 47.361  0.50 29.25 ? 1408 HOH B O   1 
HETATM 4901 O  O   . HOH H 5 .   ? -18.219 -9.512  41.676  1.00 46.97 ? 1409 HOH B O   1 
HETATM 4902 O  O   . HOH H 5 .   ? -7.572  -33.460 41.826  1.00 53.10 ? 1410 HOH B O   1 
HETATM 4903 O  O   . HOH H 5 .   ? -6.149  -30.714 47.035  1.00 48.28 ? 1411 HOH B O   1 
HETATM 4904 O  O   . HOH H 5 .   ? -16.169 -26.290 58.414  1.00 45.17 ? 1412 HOH B O   1 
HETATM 4905 O  O   A HOH H 5 .   ? -3.808  -20.542 60.110  0.50 31.59 ? 1413 HOH B O   1 
HETATM 4906 O  O   B HOH H 5 .   ? -4.553  -20.278 61.908  0.50 25.11 ? 1413 HOH B O   1 
HETATM 4907 O  O   . HOH H 5 .   ? -5.611  -22.426 62.347  1.00 47.90 ? 1414 HOH B O   1 
HETATM 4908 O  O   . HOH H 5 .   ? -15.117 -22.462 69.993  1.00 51.20 ? 1415 HOH B O   1 
HETATM 4909 O  O   . HOH H 5 .   ? -16.676 -23.279 68.254  1.00 47.05 ? 1416 HOH B O   1 
HETATM 4910 O  O   . HOH H 5 .   ? 5.030   -18.049 40.488  1.00 42.61 ? 1417 HOH B O   1 
HETATM 4911 O  O   . HOH H 5 .   ? 6.312   -18.283 38.073  1.00 46.74 ? 1418 HOH B O   1 
HETATM 4912 O  O   . HOH H 5 .   ? 7.339   -20.774 38.954  1.00 41.88 ? 1419 HOH B O   1 
HETATM 4913 O  O   . HOH H 5 .   ? 8.162   -23.131 38.471  1.00 42.07 ? 1420 HOH B O   1 
HETATM 4914 O  O   . HOH H 5 .   ? 9.382   -19.807 37.503  1.00 46.90 ? 1421 HOH B O   1 
HETATM 4915 O  O   . HOH H 5 .   ? 8.892   -22.129 46.653  1.00 48.17 ? 1422 HOH B O   1 
HETATM 4916 O  O   . HOH H 5 .   ? 9.057   -24.105 42.796  1.00 43.68 ? 1423 HOH B O   1 
HETATM 4917 O  O   . HOH H 5 .   ? 9.440   -9.850  49.783  1.00 36.08 ? 1424 HOH B O   1 
HETATM 4918 O  O   . HOH H 5 .   ? 5.241   -13.872 53.572  1.00 52.67 ? 1425 HOH B O   1 
HETATM 4919 O  O   . HOH H 5 .   ? 4.150   -22.901 51.777  1.00 49.33 ? 1426 HOH B O   1 
HETATM 4920 O  O   . HOH H 5 .   ? -24.521 -3.441  43.464  1.00 33.76 ? 1427 HOH B O   1 
HETATM 4921 O  O   A HOH H 5 .   ? -11.226 5.213   36.944  0.50 33.38 ? 1428 HOH B O   1 
HETATM 4922 O  O   B HOH H 5 .   ? -12.845 3.591   36.459  0.50 34.27 ? 1428 HOH B O   1 
HETATM 4923 O  O   . HOH H 5 .   ? -21.055 3.463   38.493  1.00 39.89 ? 1429 HOH B O   1 
HETATM 4924 O  O   . HOH H 5 .   ? -7.674  9.665   65.289  1.00 44.72 ? 1430 HOH B O   1 
HETATM 4925 O  O   . HOH H 5 .   ? -6.684  6.587   66.701  1.00 44.61 ? 1431 HOH B O   1 
HETATM 4926 O  O   . HOH H 5 .   ? -17.719 4.957   62.364  1.00 55.29 ? 1432 HOH B O   1 
HETATM 4927 O  O   . HOH H 5 .   ? 9.685   -2.817  39.367  1.00 55.33 ? 1433 HOH B O   1 
HETATM 4928 O  O   . HOH H 5 .   ? 11.652  -7.012  39.824  1.00 42.12 ? 1434 HOH B O   1 
HETATM 4929 O  O   . HOH H 5 .   ? 3.146   -26.562 30.724  1.00 52.38 ? 1435 HOH B O   1 
HETATM 4930 O  O   . HOH H 5 .   ? 1.475   -24.216 43.807  1.00 55.55 ? 1436 HOH B O   1 
HETATM 4931 O  O   . HOH H 5 .   ? 8.308   -1.492  35.347  1.00 46.03 ? 1437 HOH B O   1 
HETATM 4932 O  O   . HOH H 5 .   ? 8.300   0.071   33.164  1.00 50.86 ? 1438 HOH B O   1 
HETATM 4933 O  O   . HOH H 5 .   ? 6.888   13.160  51.108  1.00 42.02 ? 1439 HOH B O   1 
HETATM 4934 O  O   . HOH H 5 .   ? 6.145   12.632  53.460  1.00 55.91 ? 1440 HOH B O   1 
HETATM 4935 O  O   . HOH H 5 .   ? 9.216   10.754  50.959  1.00 56.21 ? 1441 HOH B O   1 
HETATM 4936 O  O   . HOH H 5 .   ? -15.377 -6.703  36.330  1.00 51.89 ? 1442 HOH B O   1 
HETATM 4937 O  O   . HOH H 5 .   ? -14.968 -5.868  31.360  1.00 44.35 ? 1443 HOH B O   1 
HETATM 4938 O  O   . HOH H 5 .   ? 10.611  -21.460 44.669  1.00 48.25 ? 1444 HOH B O   1 
HETATM 4939 O  O   . HOH H 5 .   ? -24.465 -21.581 47.578  1.00 48.98 ? 1445 HOH B O   1 
HETATM 4940 O  O   . HOH H 5 .   ? -28.380 -22.754 53.479  1.00 52.11 ? 1446 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   888  ?    ?   ?   A . n 
A 1 2   MET 2   889  889  MET MET A . n 
A 1 3   ALA 3   890  890  ALA ALA A . n 
A 1 4   ILE 4   891  891  ILE ILE A . n 
A 1 5   ARG 5   892  892  ARG ARG A . n 
A 1 6   VAL 6   893  893  VAL VAL A . n 
A 1 7   ALA 7   894  894  ALA ALA A . n 
A 1 8   ASP 8   895  895  ASP ASP A . n 
A 1 9   LEU 9   896  896  LEU LEU A . n 
A 1 10  LEU 10  897  897  LEU LEU A . n 
A 1 11  GLN 11  898  898  GLN GLN A . n 
A 1 12  HIS 12  899  899  HIS HIS A . n 
A 1 13  ILE 13  900  900  ILE ILE A . n 
A 1 14  THR 14  901  901  THR THR A . n 
A 1 15  GLN 15  902  902  GLN GLN A . n 
A 1 16  MET 16  903  903  MET MET A . n 
A 1 17  LYS 17  904  904  LYS LYS A . n 
A 1 18  ARG 18  905  905  ARG ARG A . n 
A 1 19  GLY 19  906  906  GLY GLY A . n 
A 1 20  GLN 20  907  907  GLN GLN A . n 
A 1 21  GLY 21  908  908  GLY GLY A . n 
A 1 22  TYR 22  909  909  TYR TYR A . n 
A 1 23  GLY 23  910  910  GLY GLY A . n 
A 1 24  PHE 24  911  911  PHE PHE A . n 
A 1 25  LYS 25  912  912  LYS LYS A . n 
A 1 26  GLU 26  913  913  GLU GLU A . n 
A 1 27  GLU 27  914  914  GLU GLU A . n 
A 1 28  TYR 28  915  915  TYR TYR A . n 
A 1 29  GLU 29  916  916  GLU GLU A . n 
A 1 30  ALA 30  917  917  ALA ALA A . n 
A 1 31  LEU 31  918  918  LEU LEU A . n 
A 1 32  PRO 32  919  919  PRO PRO A . n 
A 1 33  GLU 33  920  920  GLU GLU A . n 
A 1 34  GLY 34  921  921  GLY GLY A . n 
A 1 35  GLN 35  922  922  GLN GLN A . n 
A 1 36  THR 36  923  923  THR THR A . n 
A 1 37  ALA 37  924  924  ALA ALA A . n 
A 1 38  SER 38  925  925  SER SER A . n 
A 1 39  TRP 39  926  926  TRP TRP A . n 
A 1 40  ASP 40  927  927  ASP ASP A . n 
A 1 41  THR 41  928  928  THR THR A . n 
A 1 42  ALA 42  929  929  ALA ALA A . n 
A 1 43  LYS 43  930  930  LYS LYS A . n 
A 1 44  GLU 44  931  931  GLU GLU A . n 
A 1 45  ASP 45  932  932  ASP ASP A . n 
A 1 46  GLU 46  933  933  GLU GLU A . n 
A 1 47  ASN 47  934  934  ASN ASN A . n 
A 1 48  ARG 48  935  935  ARG ARG A . n 
A 1 49  ASN 49  936  936  ASN ASN A . n 
A 1 50  LYS 50  937  937  LYS LYS A . n 
A 1 51  ASN 51  938  938  ASN ASN A . n 
A 1 52  ARG 52  939  939  ARG ARG A . n 
A 1 53  TYR 53  940  940  TYR TYR A . n 
A 1 54  GLY 54  941  941  GLY GLY A . n 
A 1 55  ASN 55  942  942  ASN ASN A . n 
A 1 56  ILE 56  943  943  ILE ILE A . n 
A 1 57  ILE 57  944  944  ILE ILE A . n 
A 1 58  SER 58  945  945  SER SER A . n 
A 1 59  TYR 59  946  946  TYR TYR A . n 
A 1 60  ASP 60  947  947  ASP ASP A . n 
A 1 61  HIS 61  948  948  HIS HIS A . n 
A 1 62  SER 62  949  949  SER SER A . n 
A 1 63  ARG 63  950  950  ARG ARG A . n 
A 1 64  VAL 64  951  951  VAL VAL A . n 
A 1 65  ARG 65  952  952  ARG ARG A . n 
A 1 66  LEU 66  953  953  LEU LEU A . n 
A 1 67  LEU 67  954  954  LEU LEU A . n 
A 1 68  VAL 68  955  955  VAL VAL A . n 
A 1 69  LEU 69  956  956  LEU LEU A . n 
A 1 70  ASP 70  957  ?    ?   ?   A . n 
A 1 71  GLY 71  958  ?    ?   ?   A . n 
A 1 72  ASP 72  959  959  ASP ASP A . n 
A 1 73  PRO 73  960  960  PRO PRO A . n 
A 1 74  HIS 74  961  961  HIS HIS A . n 
A 1 75  SER 75  962  962  SER SER A . n 
A 1 76  ASP 76  963  963  ASP ASP A . n 
A 1 77  TYR 77  964  964  TYR TYR A . n 
A 1 78  ILE 78  965  965  ILE ILE A . n 
A 1 79  ASN 79  966  966  ASN ASN A . n 
A 1 80  ALA 80  967  967  ALA ALA A . n 
A 1 81  ASN 81  968  968  ASN ASN A . n 
A 1 82  TYR 82  969  969  TYR TYR A . n 
A 1 83  ILE 83  970  970  ILE ILE A . n 
A 1 84  ASP 84  971  971  ASP ASP A . n 
A 1 85  GLY 85  972  972  GLY GLY A . n 
A 1 86  TYR 86  973  973  TYR TYR A . n 
A 1 87  HIS 87  974  974  HIS HIS A . n 
A 1 88  ARG 88  975  975  ARG ARG A . n 
A 1 89  PRO 89  976  976  PRO PRO A . n 
A 1 90  ARG 90  977  977  ARG ARG A . n 
A 1 91  HIS 91  978  978  HIS HIS A . n 
A 1 92  TYR 92  979  979  TYR TYR A . n 
A 1 93  ILE 93  980  980  ILE ILE A . n 
A 1 94  ALA 94  981  981  ALA ALA A . n 
A 1 95  THR 95  982  982  THR THR A . n 
A 1 96  GLN 96  983  983  GLN GLN A . n 
A 1 97  GLY 97  984  984  GLY GLY A . n 
A 1 98  PRO 98  985  985  PRO PRO A . n 
A 1 99  MET 99  986  986  MET MET A . n 
A 1 100 GLN 100 987  987  GLN GLN A . n 
A 1 101 GLU 101 988  988  GLU GLU A . n 
A 1 102 THR 102 989  989  THR THR A . n 
A 1 103 VAL 103 990  990  VAL VAL A . n 
A 1 104 LYS 104 991  991  LYS LYS A . n 
A 1 105 ASP 105 992  992  ASP ASP A . n 
A 1 106 PHE 106 993  993  PHE PHE A . n 
A 1 107 TRP 107 994  994  TRP TRP A . n 
A 1 108 ARG 108 995  995  ARG ARG A . n 
A 1 109 MET 109 996  996  MET MET A . n 
A 1 110 ILE 110 997  997  ILE ILE A . n 
A 1 111 TRP 111 998  998  TRP TRP A . n 
A 1 112 GLN 112 999  999  GLN GLN A . n 
A 1 113 GLU 113 1000 1000 GLU GLU A . n 
A 1 114 ASN 114 1001 1001 ASN ASN A . n 
A 1 115 SER 115 1002 1002 SER SER A . n 
A 1 116 ALA 116 1003 1003 ALA ALA A . n 
A 1 117 SER 117 1004 1004 SER SER A . n 
A 1 118 ILE 118 1005 1005 ILE ILE A . n 
A 1 119 VAL 119 1006 1006 VAL VAL A . n 
A 1 120 MET 120 1007 1007 MET MET A . n 
A 1 121 VAL 121 1008 1008 VAL VAL A . n 
A 1 122 THR 122 1009 1009 THR THR A . n 
A 1 123 ASN 123 1010 1010 ASN ASN A . n 
A 1 124 LEU 124 1011 1011 LEU LEU A . n 
A 1 125 VAL 125 1012 1012 VAL VAL A . n 
A 1 126 GLU 126 1013 1013 GLU GLU A . n 
A 1 127 VAL 127 1014 1014 VAL VAL A . n 
A 1 128 GLY 128 1015 1015 GLY GLY A . n 
A 1 129 ARG 129 1016 1016 ARG ARG A . n 
A 1 130 VAL 130 1017 1017 VAL VAL A . n 
A 1 131 LYS 131 1018 1018 LYS LYS A . n 
A 1 132 CYS 132 1019 1019 CYS CYS A . n 
A 1 133 VAL 133 1020 1020 VAL VAL A . n 
A 1 134 ARG 134 1021 1021 ARG ARG A . n 
A 1 135 TYR 135 1022 1022 TYR TYR A . n 
A 1 136 TRP 136 1023 1023 TRP TRP A . n 
A 1 137 PRO 137 1024 1024 PRO PRO A . n 
A 1 138 ASP 138 1025 1025 ASP ASP A . n 
A 1 139 ASP 139 1026 1026 ASP ASP A . n 
A 1 140 THR 140 1027 1027 THR THR A . n 
A 1 141 GLU 141 1028 1028 GLU GLU A . n 
A 1 142 VAL 142 1029 1029 VAL VAL A . n 
A 1 143 TYR 143 1030 1030 TYR TYR A . n 
A 1 144 GLY 144 1031 1031 GLY GLY A . n 
A 1 145 ASP 145 1032 1032 ASP ASP A . n 
A 1 146 ILE 146 1033 1033 ILE ILE A . n 
A 1 147 LYS 147 1034 1034 LYS LYS A . n 
A 1 148 VAL 148 1035 1035 VAL VAL A . n 
A 1 149 THR 149 1036 1036 THR THR A . n 
A 1 150 LEU 150 1037 1037 LEU LEU A . n 
A 1 151 ILE 151 1038 1038 ILE ILE A . n 
A 1 152 GLU 152 1039 1039 GLU GLU A . n 
A 1 153 THR 153 1040 1040 THR THR A . n 
A 1 154 GLU 154 1041 1041 GLU GLU A . n 
A 1 155 PRO 155 1042 1042 PRO PRO A . n 
A 1 156 LEU 156 1043 1043 LEU LEU A . n 
A 1 157 ALA 157 1044 1044 ALA ALA A . n 
A 1 158 GLU 158 1045 1045 GLU GLU A . n 
A 1 159 TYR 159 1046 1046 TYR TYR A . n 
A 1 160 VAL 160 1047 1047 VAL VAL A . n 
A 1 161 ILE 161 1048 1048 ILE ILE A . n 
A 1 162 ARG 162 1049 1049 ARG ARG A . n 
A 1 163 THR 163 1050 1050 THR THR A . n 
A 1 164 PHE 164 1051 1051 PHE PHE A . n 
A 1 165 THR 165 1052 1052 THR THR A . n 
A 1 166 VAL 166 1053 1053 VAL VAL A . n 
A 1 167 GLN 167 1054 1054 GLN GLN A . n 
A 1 168 LYS 168 1055 1055 LYS LYS A . n 
A 1 169 LYS 169 1056 1056 LYS LYS A . n 
A 1 170 GLY 170 1057 1057 GLY GLY A . n 
A 1 171 TYR 171 1058 1058 TYR TYR A . n 
A 1 172 HIS 172 1059 1059 HIS HIS A . n 
A 1 173 GLU 173 1060 1060 GLU GLU A . n 
A 1 174 ILE 174 1061 1061 ILE ILE A . n 
A 1 175 ARG 175 1062 1062 ARG ARG A . n 
A 1 176 GLU 176 1063 1063 GLU GLU A . n 
A 1 177 LEU 177 1064 1064 LEU LEU A . n 
A 1 178 ARG 178 1065 1065 ARG ARG A . n 
A 1 179 LEU 179 1066 1066 LEU LEU A . n 
A 1 180 PHE 180 1067 1067 PHE PHE A . n 
A 1 181 HIS 181 1068 1068 HIS HIS A . n 
A 1 182 PHE 182 1069 1069 PHE PHE A . n 
A 1 183 THR 183 1070 1070 THR THR A . n 
A 1 184 SER 184 1071 1071 SER SER A . n 
A 1 185 TRP 185 1072 1072 TRP TRP A . n 
A 1 186 PRO 186 1073 1073 PRO PRO A . n 
A 1 187 ASP 187 1074 1074 ASP ASP A . n 
A 1 188 HIS 188 1075 1075 HIS HIS A . n 
A 1 189 GLY 189 1076 1076 GLY GLY A . n 
A 1 190 VAL 190 1077 1077 VAL VAL A . n 
A 1 191 PRO 191 1078 1078 PRO PRO A . n 
A 1 192 CYS 192 1079 1079 CYS CYS A . n 
A 1 193 TYR 193 1080 1080 TYR TYR A . n 
A 1 194 ALA 194 1081 1081 ALA ALA A . n 
A 1 195 THR 195 1082 1082 THR THR A . n 
A 1 196 GLY 196 1083 1083 GLY GLY A . n 
A 1 197 LEU 197 1084 1084 LEU LEU A . n 
A 1 198 LEU 198 1085 1085 LEU LEU A . n 
A 1 199 GLY 199 1086 1086 GLY GLY A . n 
A 1 200 PHE 200 1087 1087 PHE PHE A . n 
A 1 201 VAL 201 1088 1088 VAL VAL A . n 
A 1 202 ARG 202 1089 1089 ARG ARG A . n 
A 1 203 GLN 203 1090 1090 GLN GLN A . n 
A 1 204 VAL 204 1091 1091 VAL VAL A . n 
A 1 205 LYS 205 1092 1092 LYS LYS A . n 
A 1 206 PHE 206 1093 1093 PHE PHE A . n 
A 1 207 LEU 207 1094 1094 LEU LEU A . n 
A 1 208 ASN 208 1095 1095 ASN ASN A . n 
A 1 209 PRO 209 1096 1096 PRO PRO A . n 
A 1 210 PRO 210 1097 1097 PRO PRO A . n 
A 1 211 GLU 211 1098 1098 GLU GLU A . n 
A 1 212 ALA 212 1099 1099 ALA ALA A . n 
A 1 213 GLY 213 1100 1100 GLY GLY A . n 
A 1 214 PRO 214 1101 1101 PRO PRO A . n 
A 1 215 ILE 215 1102 1102 ILE ILE A . n 
A 1 216 VAL 216 1103 1103 VAL VAL A . n 
A 1 217 VAL 217 1104 1104 VAL VAL A . n 
A 1 218 HIS 218 1105 1105 HIS HIS A . n 
A 1 219 CYS 219 1106 1106 CYS CYS A . n 
A 1 220 SER 220 1107 1107 SER SER A . n 
A 1 221 ALA 221 1108 1108 ALA ALA A . n 
A 1 222 GLY 222 1109 1109 GLY GLY A . n 
A 1 223 ALA 223 1110 1110 ALA ALA A . n 
A 1 224 GLY 224 1111 1111 GLY GLY A . n 
A 1 225 ARG 225 1112 1112 ARG ARG A . n 
A 1 226 THR 226 1113 1113 THR THR A . n 
A 1 227 GLY 227 1114 1114 GLY GLY A . n 
A 1 228 CYS 228 1115 1115 CYS CYS A . n 
A 1 229 PHE 229 1116 1116 PHE PHE A . n 
A 1 230 ILE 230 1117 1117 ILE ILE A . n 
A 1 231 ALA 231 1118 1118 ALA ALA A . n 
A 1 232 ILE 232 1119 1119 ILE ILE A . n 
A 1 233 ASP 233 1120 1120 ASP ASP A . n 
A 1 234 THR 234 1121 1121 THR THR A . n 
A 1 235 MET 235 1122 1122 MET MET A . n 
A 1 236 LEU 236 1123 1123 LEU LEU A . n 
A 1 237 ASP 237 1124 1124 ASP ASP A . n 
A 1 238 MET 238 1125 1125 MET MET A . n 
A 1 239 ALA 239 1126 1126 ALA ALA A . n 
A 1 240 GLU 240 1127 1127 GLU GLU A . n 
A 1 241 ASN 241 1128 1128 ASN ASN A . n 
A 1 242 GLU 242 1129 1129 GLU GLU A . n 
A 1 243 GLY 243 1130 1130 GLY GLY A . n 
A 1 244 VAL 244 1131 1131 VAL VAL A . n 
A 1 245 VAL 245 1132 1132 VAL VAL A . n 
A 1 246 ASP 246 1133 1133 ASP ASP A . n 
A 1 247 ILE 247 1134 1134 ILE ILE A . n 
A 1 248 PHE 248 1135 1135 PHE PHE A . n 
A 1 249 ASN 249 1136 1136 ASN ASN A . n 
A 1 250 CYS 250 1137 1137 CYS CYS A . n 
A 1 251 VAL 251 1138 1138 VAL VAL A . n 
A 1 252 ARG 252 1139 1139 ARG ARG A . n 
A 1 253 GLU 253 1140 1140 GLU GLU A . n 
A 1 254 LEU 254 1141 1141 LEU LEU A . n 
A 1 255 ARG 255 1142 1142 ARG ARG A . n 
A 1 256 ALA 256 1143 1143 ALA ALA A . n 
A 1 257 GLN 257 1144 1144 GLN GLN A . n 
A 1 258 ARG 258 1145 1145 ARG ARG A . n 
A 1 259 VAL 259 1146 1146 VAL VAL A . n 
A 1 260 ASN 260 1147 1147 ASN ASN A . n 
A 1 261 LEU 261 1148 1148 LEU LEU A . n 
A 1 262 VAL 262 1149 1149 VAL VAL A . n 
A 1 263 GLN 263 1150 1150 GLN GLN A . n 
A 1 264 THR 264 1151 1151 THR THR A . n 
A 1 265 GLU 265 1152 1152 GLU GLU A . n 
A 1 266 GLU 266 1153 1153 GLU GLU A . n 
A 1 267 GLN 267 1154 1154 GLN GLN A . n 
A 1 268 TYR 268 1155 1155 TYR TYR A . n 
A 1 269 VAL 269 1156 1156 VAL VAL A . n 
A 1 270 PHE 270 1157 1157 PHE PHE A . n 
A 1 271 VAL 271 1158 1158 VAL VAL A . n 
A 1 272 HIS 272 1159 1159 HIS HIS A . n 
A 1 273 ASP 273 1160 1160 ASP ASP A . n 
A 1 274 ALA 274 1161 1161 ALA ALA A . n 
A 1 275 ILE 275 1162 1162 ILE ILE A . n 
A 1 276 LEU 276 1163 1163 LEU LEU A . n 
A 1 277 GLU 277 1164 1164 GLU GLU A . n 
A 1 278 ALA 278 1165 1165 ALA ALA A . n 
A 1 279 CYS 279 1166 1166 CYS CYS A . n 
A 1 280 LEU 280 1167 1167 LEU LEU A . n 
A 1 281 CYS 281 1168 1168 CYS CYS A . n 
A 1 282 GLY 282 1169 ?    ?   ?   A . n 
A 1 283 ASN 283 1170 ?    ?   ?   A . n 
A 1 284 THR 284 1171 ?    ?   ?   A . n 
A 1 285 ALA 285 1172 ?    ?   ?   A . n 
A 1 286 ILE 286 1173 ?    ?   ?   A . n 
B 1 1   SER 1   888  888  SER SER B . n 
B 1 2   MET 2   889  889  MET MET B . n 
B 1 3   ALA 3   890  890  ALA ALA B . n 
B 1 4   ILE 4   891  891  ILE ILE B . n 
B 1 5   ARG 5   892  892  ARG ARG B . n 
B 1 6   VAL 6   893  893  VAL VAL B . n 
B 1 7   ALA 7   894  894  ALA ALA B . n 
B 1 8   ASP 8   895  895  ASP ASP B . n 
B 1 9   LEU 9   896  896  LEU LEU B . n 
B 1 10  LEU 10  897  897  LEU LEU B . n 
B 1 11  GLN 11  898  898  GLN GLN B . n 
B 1 12  HIS 12  899  899  HIS HIS B . n 
B 1 13  ILE 13  900  900  ILE ILE B . n 
B 1 14  THR 14  901  901  THR THR B . n 
B 1 15  GLN 15  902  902  GLN GLN B . n 
B 1 16  MET 16  903  903  MET MET B . n 
B 1 17  LYS 17  904  904  LYS LYS B . n 
B 1 18  ARG 18  905  905  ARG ARG B . n 
B 1 19  GLY 19  906  906  GLY GLY B . n 
B 1 20  GLN 20  907  907  GLN GLN B . n 
B 1 21  GLY 21  908  908  GLY GLY B . n 
B 1 22  TYR 22  909  909  TYR TYR B . n 
B 1 23  GLY 23  910  910  GLY GLY B . n 
B 1 24  PHE 24  911  911  PHE PHE B . n 
B 1 25  LYS 25  912  912  LYS LYS B . n 
B 1 26  GLU 26  913  913  GLU GLU B . n 
B 1 27  GLU 27  914  914  GLU GLU B . n 
B 1 28  TYR 28  915  915  TYR TYR B . n 
B 1 29  GLU 29  916  916  GLU GLU B . n 
B 1 30  ALA 30  917  917  ALA ALA B . n 
B 1 31  LEU 31  918  918  LEU LEU B . n 
B 1 32  PRO 32  919  919  PRO PRO B . n 
B 1 33  GLU 33  920  920  GLU GLU B . n 
B 1 34  GLY 34  921  921  GLY GLY B . n 
B 1 35  GLN 35  922  922  GLN GLN B . n 
B 1 36  THR 36  923  923  THR THR B . n 
B 1 37  ALA 37  924  924  ALA ALA B . n 
B 1 38  SER 38  925  925  SER SER B . n 
B 1 39  TRP 39  926  926  TRP TRP B . n 
B 1 40  ASP 40  927  927  ASP ASP B . n 
B 1 41  THR 41  928  928  THR THR B . n 
B 1 42  ALA 42  929  929  ALA ALA B . n 
B 1 43  LYS 43  930  930  LYS LYS B . n 
B 1 44  GLU 44  931  931  GLU GLU B . n 
B 1 45  ASP 45  932  932  ASP ASP B . n 
B 1 46  GLU 46  933  933  GLU GLU B . n 
B 1 47  ASN 47  934  934  ASN ASN B . n 
B 1 48  ARG 48  935  935  ARG ARG B . n 
B 1 49  ASN 49  936  936  ASN ASN B . n 
B 1 50  LYS 50  937  937  LYS LYS B . n 
B 1 51  ASN 51  938  938  ASN ASN B . n 
B 1 52  ARG 52  939  939  ARG ARG B . n 
B 1 53  TYR 53  940  940  TYR TYR B . n 
B 1 54  GLY 54  941  941  GLY GLY B . n 
B 1 55  ASN 55  942  942  ASN ASN B . n 
B 1 56  ILE 56  943  943  ILE ILE B . n 
B 1 57  ILE 57  944  944  ILE ILE B . n 
B 1 58  SER 58  945  945  SER SER B . n 
B 1 59  TYR 59  946  946  TYR TYR B . n 
B 1 60  ASP 60  947  947  ASP ASP B . n 
B 1 61  HIS 61  948  948  HIS HIS B . n 
B 1 62  SER 62  949  949  SER SER B . n 
B 1 63  ARG 63  950  950  ARG ARG B . n 
B 1 64  VAL 64  951  951  VAL VAL B . n 
B 1 65  ARG 65  952  952  ARG ARG B . n 
B 1 66  LEU 66  953  953  LEU LEU B . n 
B 1 67  LEU 67  954  954  LEU LEU B . n 
B 1 68  VAL 68  955  955  VAL VAL B . n 
B 1 69  LEU 69  956  956  LEU LEU B . n 
B 1 70  ASP 70  957  957  ASP ASP B . n 
B 1 71  GLY 71  958  958  GLY GLY B . n 
B 1 72  ASP 72  959  959  ASP ASP B . n 
B 1 73  PRO 73  960  960  PRO PRO B . n 
B 1 74  HIS 74  961  961  HIS HIS B . n 
B 1 75  SER 75  962  962  SER SER B . n 
B 1 76  ASP 76  963  963  ASP ASP B . n 
B 1 77  TYR 77  964  964  TYR TYR B . n 
B 1 78  ILE 78  965  965  ILE ILE B . n 
B 1 79  ASN 79  966  966  ASN ASN B . n 
B 1 80  ALA 80  967  967  ALA ALA B . n 
B 1 81  ASN 81  968  968  ASN ASN B . n 
B 1 82  TYR 82  969  969  TYR TYR B . n 
B 1 83  ILE 83  970  970  ILE ILE B . n 
B 1 84  ASP 84  971  971  ASP ASP B . n 
B 1 85  GLY 85  972  972  GLY GLY B . n 
B 1 86  TYR 86  973  973  TYR TYR B . n 
B 1 87  HIS 87  974  974  HIS HIS B . n 
B 1 88  ARG 88  975  975  ARG ARG B . n 
B 1 89  PRO 89  976  976  PRO PRO B . n 
B 1 90  ARG 90  977  977  ARG ARG B . n 
B 1 91  HIS 91  978  978  HIS HIS B . n 
B 1 92  TYR 92  979  979  TYR TYR B . n 
B 1 93  ILE 93  980  980  ILE ILE B . n 
B 1 94  ALA 94  981  981  ALA ALA B . n 
B 1 95  THR 95  982  982  THR THR B . n 
B 1 96  GLN 96  983  983  GLN GLN B . n 
B 1 97  GLY 97  984  984  GLY GLY B . n 
B 1 98  PRO 98  985  985  PRO PRO B . n 
B 1 99  MET 99  986  986  MET MET B . n 
B 1 100 GLN 100 987  987  GLN GLN B . n 
B 1 101 GLU 101 988  988  GLU GLU B . n 
B 1 102 THR 102 989  989  THR THR B . n 
B 1 103 VAL 103 990  990  VAL VAL B . n 
B 1 104 LYS 104 991  991  LYS LYS B . n 
B 1 105 ASP 105 992  992  ASP ASP B . n 
B 1 106 PHE 106 993  993  PHE PHE B . n 
B 1 107 TRP 107 994  994  TRP TRP B . n 
B 1 108 ARG 108 995  995  ARG ARG B . n 
B 1 109 MET 109 996  996  MET MET B . n 
B 1 110 ILE 110 997  997  ILE ILE B . n 
B 1 111 TRP 111 998  998  TRP TRP B . n 
B 1 112 GLN 112 999  999  GLN GLN B . n 
B 1 113 GLU 113 1000 1000 GLU GLU B . n 
B 1 114 ASN 114 1001 1001 ASN ASN B . n 
B 1 115 SER 115 1002 1002 SER SER B . n 
B 1 116 ALA 116 1003 1003 ALA ALA B . n 
B 1 117 SER 117 1004 1004 SER SER B . n 
B 1 118 ILE 118 1005 1005 ILE ILE B . n 
B 1 119 VAL 119 1006 1006 VAL VAL B . n 
B 1 120 MET 120 1007 1007 MET MET B . n 
B 1 121 VAL 121 1008 1008 VAL VAL B . n 
B 1 122 THR 122 1009 1009 THR THR B . n 
B 1 123 ASN 123 1010 1010 ASN ASN B . n 
B 1 124 LEU 124 1011 1011 LEU LEU B . n 
B 1 125 VAL 125 1012 1012 VAL VAL B . n 
B 1 126 GLU 126 1013 1013 GLU GLU B . n 
B 1 127 VAL 127 1014 1014 VAL VAL B . n 
B 1 128 GLY 128 1015 1015 GLY GLY B . n 
B 1 129 ARG 129 1016 1016 ARG ARG B . n 
B 1 130 VAL 130 1017 1017 VAL VAL B . n 
B 1 131 LYS 131 1018 1018 LYS LYS B . n 
B 1 132 CYS 132 1019 1019 CYS CYS B . n 
B 1 133 VAL 133 1020 1020 VAL VAL B . n 
B 1 134 ARG 134 1021 1021 ARG ARG B . n 
B 1 135 TYR 135 1022 1022 TYR TYR B . n 
B 1 136 TRP 136 1023 1023 TRP TRP B . n 
B 1 137 PRO 137 1024 1024 PRO PRO B . n 
B 1 138 ASP 138 1025 1025 ASP ASP B . n 
B 1 139 ASP 139 1026 1026 ASP ASP B . n 
B 1 140 THR 140 1027 1027 THR THR B . n 
B 1 141 GLU 141 1028 1028 GLU GLU B . n 
B 1 142 VAL 142 1029 1029 VAL VAL B . n 
B 1 143 TYR 143 1030 1030 TYR TYR B . n 
B 1 144 GLY 144 1031 1031 GLY GLY B . n 
B 1 145 ASP 145 1032 1032 ASP ASP B . n 
B 1 146 ILE 146 1033 1033 ILE ILE B . n 
B 1 147 LYS 147 1034 1034 LYS LYS B . n 
B 1 148 VAL 148 1035 1035 VAL VAL B . n 
B 1 149 THR 149 1036 1036 THR THR B . n 
B 1 150 LEU 150 1037 1037 LEU LEU B . n 
B 1 151 ILE 151 1038 1038 ILE ILE B . n 
B 1 152 GLU 152 1039 1039 GLU GLU B . n 
B 1 153 THR 153 1040 1040 THR THR B . n 
B 1 154 GLU 154 1041 1041 GLU GLU B . n 
B 1 155 PRO 155 1042 1042 PRO PRO B . n 
B 1 156 LEU 156 1043 1043 LEU LEU B . n 
B 1 157 ALA 157 1044 1044 ALA ALA B . n 
B 1 158 GLU 158 1045 1045 GLU GLU B . n 
B 1 159 TYR 159 1046 1046 TYR TYR B . n 
B 1 160 VAL 160 1047 1047 VAL VAL B . n 
B 1 161 ILE 161 1048 1048 ILE ILE B . n 
B 1 162 ARG 162 1049 1049 ARG ARG B . n 
B 1 163 THR 163 1050 1050 THR THR B . n 
B 1 164 PHE 164 1051 1051 PHE PHE B . n 
B 1 165 THR 165 1052 1052 THR THR B . n 
B 1 166 VAL 166 1053 1053 VAL VAL B . n 
B 1 167 GLN 167 1054 1054 GLN GLN B . n 
B 1 168 LYS 168 1055 1055 LYS LYS B . n 
B 1 169 LYS 169 1056 1056 LYS LYS B . n 
B 1 170 GLY 170 1057 1057 GLY GLY B . n 
B 1 171 TYR 171 1058 1058 TYR TYR B . n 
B 1 172 HIS 172 1059 1059 HIS HIS B . n 
B 1 173 GLU 173 1060 1060 GLU GLU B . n 
B 1 174 ILE 174 1061 1061 ILE ILE B . n 
B 1 175 ARG 175 1062 1062 ARG ARG B . n 
B 1 176 GLU 176 1063 1063 GLU GLU B . n 
B 1 177 LEU 177 1064 1064 LEU LEU B . n 
B 1 178 ARG 178 1065 1065 ARG ARG B . n 
B 1 179 LEU 179 1066 1066 LEU LEU B . n 
B 1 180 PHE 180 1067 1067 PHE PHE B . n 
B 1 181 HIS 181 1068 1068 HIS HIS B . n 
B 1 182 PHE 182 1069 1069 PHE PHE B . n 
B 1 183 THR 183 1070 1070 THR THR B . n 
B 1 184 SER 184 1071 1071 SER SER B . n 
B 1 185 TRP 185 1072 1072 TRP TRP B . n 
B 1 186 PRO 186 1073 1073 PRO PRO B . n 
B 1 187 ASP 187 1074 1074 ASP ASP B . n 
B 1 188 HIS 188 1075 1075 HIS HIS B . n 
B 1 189 GLY 189 1076 1076 GLY GLY B . n 
B 1 190 VAL 190 1077 1077 VAL VAL B . n 
B 1 191 PRO 191 1078 1078 PRO PRO B . n 
B 1 192 CYS 192 1079 1079 CYS CYS B . n 
B 1 193 TYR 193 1080 1080 TYR TYR B . n 
B 1 194 ALA 194 1081 1081 ALA ALA B . n 
B 1 195 THR 195 1082 1082 THR THR B . n 
B 1 196 GLY 196 1083 1083 GLY GLY B . n 
B 1 197 LEU 197 1084 1084 LEU LEU B . n 
B 1 198 LEU 198 1085 1085 LEU LEU B . n 
B 1 199 GLY 199 1086 1086 GLY GLY B . n 
B 1 200 PHE 200 1087 1087 PHE PHE B . n 
B 1 201 VAL 201 1088 1088 VAL VAL B . n 
B 1 202 ARG 202 1089 1089 ARG ARG B . n 
B 1 203 GLN 203 1090 1090 GLN GLN B . n 
B 1 204 VAL 204 1091 1091 VAL VAL B . n 
B 1 205 LYS 205 1092 1092 LYS LYS B . n 
B 1 206 PHE 206 1093 1093 PHE PHE B . n 
B 1 207 LEU 207 1094 1094 LEU LEU B . n 
B 1 208 ASN 208 1095 1095 ASN ASN B . n 
B 1 209 PRO 209 1096 1096 PRO PRO B . n 
B 1 210 PRO 210 1097 1097 PRO PRO B . n 
B 1 211 GLU 211 1098 1098 GLU GLU B . n 
B 1 212 ALA 212 1099 1099 ALA ALA B . n 
B 1 213 GLY 213 1100 1100 GLY GLY B . n 
B 1 214 PRO 214 1101 1101 PRO PRO B . n 
B 1 215 ILE 215 1102 1102 ILE ILE B . n 
B 1 216 VAL 216 1103 1103 VAL VAL B . n 
B 1 217 VAL 217 1104 1104 VAL VAL B . n 
B 1 218 HIS 218 1105 1105 HIS HIS B . n 
B 1 219 CYS 219 1106 1106 CYS CYS B . n 
B 1 220 SER 220 1107 1107 SER SER B . n 
B 1 221 ALA 221 1108 1108 ALA ALA B . n 
B 1 222 GLY 222 1109 1109 GLY GLY B . n 
B 1 223 ALA 223 1110 1110 ALA ALA B . n 
B 1 224 GLY 224 1111 1111 GLY GLY B . n 
B 1 225 ARG 225 1112 1112 ARG ARG B . n 
B 1 226 THR 226 1113 1113 THR THR B . n 
B 1 227 GLY 227 1114 1114 GLY GLY B . n 
B 1 228 CYS 228 1115 1115 CYS CYS B . n 
B 1 229 PHE 229 1116 1116 PHE PHE B . n 
B 1 230 ILE 230 1117 1117 ILE ILE B . n 
B 1 231 ALA 231 1118 1118 ALA ALA B . n 
B 1 232 ILE 232 1119 1119 ILE ILE B . n 
B 1 233 ASP 233 1120 1120 ASP ASP B . n 
B 1 234 THR 234 1121 1121 THR THR B . n 
B 1 235 MET 235 1122 1122 MET MET B . n 
B 1 236 LEU 236 1123 1123 LEU LEU B . n 
B 1 237 ASP 237 1124 1124 ASP ASP B . n 
B 1 238 MET 238 1125 1125 MET MET B . n 
B 1 239 ALA 239 1126 1126 ALA ALA B . n 
B 1 240 GLU 240 1127 1127 GLU GLU B . n 
B 1 241 ASN 241 1128 1128 ASN ASN B . n 
B 1 242 GLU 242 1129 1129 GLU GLU B . n 
B 1 243 GLY 243 1130 1130 GLY GLY B . n 
B 1 244 VAL 244 1131 1131 VAL VAL B . n 
B 1 245 VAL 245 1132 1132 VAL VAL B . n 
B 1 246 ASP 246 1133 1133 ASP ASP B . n 
B 1 247 ILE 247 1134 1134 ILE ILE B . n 
B 1 248 PHE 248 1135 1135 PHE PHE B . n 
B 1 249 ASN 249 1136 1136 ASN ASN B . n 
B 1 250 CYS 250 1137 1137 CYS CYS B . n 
B 1 251 VAL 251 1138 1138 VAL VAL B . n 
B 1 252 ARG 252 1139 1139 ARG ARG B . n 
B 1 253 GLU 253 1140 1140 GLU GLU B . n 
B 1 254 LEU 254 1141 1141 LEU LEU B . n 
B 1 255 ARG 255 1142 1142 ARG ARG B . n 
B 1 256 ALA 256 1143 1143 ALA ALA B . n 
B 1 257 GLN 257 1144 1144 GLN GLN B . n 
B 1 258 ARG 258 1145 1145 ARG ARG B . n 
B 1 259 VAL 259 1146 1146 VAL VAL B . n 
B 1 260 ASN 260 1147 1147 ASN ASN B . n 
B 1 261 LEU 261 1148 1148 LEU LEU B . n 
B 1 262 VAL 262 1149 1149 VAL VAL B . n 
B 1 263 GLN 263 1150 1150 GLN GLN B . n 
B 1 264 THR 264 1151 1151 THR THR B . n 
B 1 265 GLU 265 1152 1152 GLU GLU B . n 
B 1 266 GLU 266 1153 1153 GLU GLU B . n 
B 1 267 GLN 267 1154 1154 GLN GLN B . n 
B 1 268 TYR 268 1155 1155 TYR TYR B . n 
B 1 269 VAL 269 1156 1156 VAL VAL B . n 
B 1 270 PHE 270 1157 1157 PHE PHE B . n 
B 1 271 VAL 271 1158 1158 VAL VAL B . n 
B 1 272 HIS 272 1159 1159 HIS HIS B . n 
B 1 273 ASP 273 1160 1160 ASP ASP B . n 
B 1 274 ALA 274 1161 1161 ALA ALA B . n 
B 1 275 ILE 275 1162 1162 ILE ILE B . n 
B 1 276 LEU 276 1163 1163 LEU LEU B . n 
B 1 277 GLU 277 1164 1164 GLU GLU B . n 
B 1 278 ALA 278 1165 1165 ALA ALA B . n 
B 1 279 CYS 279 1166 1166 CYS CYS B . n 
B 1 280 LEU 280 1167 1167 LEU LEU B . n 
B 1 281 CYS 281 1168 1168 CYS CYS B . n 
B 1 282 GLY 282 1169 ?    ?   ?   B . n 
B 1 283 ASN 283 1170 ?    ?   ?   B . n 
B 1 284 THR 284 1171 ?    ?   ?   B . n 
B 1 285 ALA 285 1172 ?    ?   ?   B . n 
B 1 286 ILE 286 1173 ?    ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 B3P 1   301  301 B3P B3P A . 
D 3 NA  1   501  501 NA  NA  B . 
E 2 B3P 1   301  301 B3P B3P B . 
F 4 EDO 1   502  502 EDO EDO B . 
G 5 HOH 1   27   27  HOH HOH A . 
G 5 HOH 2   28   28  HOH HOH A . 
G 5 HOH 3   38   38  HOH HOH A . 
G 5 HOH 4   41   41  HOH HOH A . 
G 5 HOH 5   42   42  HOH HOH A . 
G 5 HOH 6   55   55  HOH HOH A . 
G 5 HOH 7   57   57  HOH HOH A . 
G 5 HOH 8   59   59  HOH HOH A . 
G 5 HOH 9   62   62  HOH HOH A . 
G 5 HOH 10  64   64  HOH HOH A . 
G 5 HOH 11  66   66  HOH HOH A . 
G 5 HOH 12  75   75  HOH HOH A . 
G 5 HOH 13  76   76  HOH HOH A . 
G 5 HOH 14  82   82  HOH HOH A . 
G 5 HOH 15  86   86  HOH HOH A . 
G 5 HOH 16  90   90  HOH HOH A . 
G 5 HOH 17  91   91  HOH HOH A . 
G 5 HOH 18  94   94  HOH HOH A . 
G 5 HOH 19  95   95  HOH HOH A . 
G 5 HOH 20  96   96  HOH HOH A . 
G 5 HOH 21  98   98  HOH HOH A . 
G 5 HOH 22  102  102 HOH HOH A . 
G 5 HOH 23  103  103 HOH HOH A . 
G 5 HOH 24  112  112 HOH HOH A . 
G 5 HOH 25  115  115 HOH HOH A . 
G 5 HOH 26  117  117 HOH HOH A . 
G 5 HOH 27  121  121 HOH HOH A . 
G 5 HOH 28  125  125 HOH HOH A . 
G 5 HOH 29  128  128 HOH HOH A . 
G 5 HOH 30  129  129 HOH HOH A . 
G 5 HOH 31  131  131 HOH HOH A . 
G 5 HOH 32  133  133 HOH HOH A . 
G 5 HOH 33  136  136 HOH HOH A . 
G 5 HOH 34  139  139 HOH HOH A . 
G 5 HOH 35  141  141 HOH HOH A . 
G 5 HOH 36  146  146 HOH HOH A . 
G 5 HOH 37  149  149 HOH HOH A . 
G 5 HOH 38  159  159 HOH HOH A . 
G 5 HOH 39  161  161 HOH HOH A . 
G 5 HOH 40  162  162 HOH HOH A . 
G 5 HOH 41  163  163 HOH HOH A . 
G 5 HOH 42  165  165 HOH HOH A . 
G 5 HOH 43  169  169 HOH HOH A . 
G 5 HOH 44  172  172 HOH HOH A . 
G 5 HOH 45  174  174 HOH HOH A . 
G 5 HOH 46  175  175 HOH HOH A . 
G 5 HOH 47  177  177 HOH HOH A . 
G 5 HOH 48  179  179 HOH HOH A . 
G 5 HOH 49  185  185 HOH HOH A . 
G 5 HOH 50  190  190 HOH HOH A . 
G 5 HOH 51  191  191 HOH HOH A . 
G 5 HOH 52  197  197 HOH HOH A . 
G 5 HOH 53  199  199 HOH HOH A . 
G 5 HOH 54  201  201 HOH HOH A . 
G 5 HOH 55  205  205 HOH HOH A . 
G 5 HOH 56  206  206 HOH HOH A . 
G 5 HOH 57  207  207 HOH HOH A . 
G 5 HOH 58  208  208 HOH HOH A . 
G 5 HOH 59  212  212 HOH HOH A . 
G 5 HOH 60  215  215 HOH HOH A . 
G 5 HOH 61  217  217 HOH HOH A . 
G 5 HOH 62  224  224 HOH HOH A . 
G 5 HOH 63  228  228 HOH HOH A . 
G 5 HOH 64  229  229 HOH HOH A . 
G 5 HOH 65  230  230 HOH HOH A . 
G 5 HOH 66  239  239 HOH HOH A . 
G 5 HOH 67  240  240 HOH HOH A . 
G 5 HOH 68  242  242 HOH HOH A . 
G 5 HOH 69  243  243 HOH HOH A . 
G 5 HOH 70  245  245 HOH HOH A . 
G 5 HOH 71  246  246 HOH HOH A . 
G 5 HOH 72  247  247 HOH HOH A . 
G 5 HOH 73  248  248 HOH HOH A . 
G 5 HOH 74  250  250 HOH HOH A . 
G 5 HOH 75  253  253 HOH HOH A . 
G 5 HOH 76  258  258 HOH HOH A . 
G 5 HOH 77  259  259 HOH HOH A . 
G 5 HOH 78  263  263 HOH HOH A . 
G 5 HOH 79  264  264 HOH HOH A . 
G 5 HOH 80  265  265 HOH HOH A . 
G 5 HOH 81  272  272 HOH HOH A . 
G 5 HOH 82  275  275 HOH HOH A . 
G 5 HOH 83  278  278 HOH HOH A . 
G 5 HOH 84  279  279 HOH HOH A . 
G 5 HOH 85  280  280 HOH HOH A . 
G 5 HOH 86  281  281 HOH HOH A . 
G 5 HOH 87  282  282 HOH HOH A . 
G 5 HOH 88  283  283 HOH HOH A . 
G 5 HOH 89  284  284 HOH HOH A . 
G 5 HOH 90  293  293 HOH HOH A . 
G 5 HOH 91  294  294 HOH HOH A . 
G 5 HOH 92  295  295 HOH HOH A . 
G 5 HOH 93  305  305 HOH HOH A . 
G 5 HOH 94  306  306 HOH HOH A . 
G 5 HOH 95  307  307 HOH HOH A . 
G 5 HOH 96  308  308 HOH HOH A . 
G 5 HOH 97  309  309 HOH HOH A . 
G 5 HOH 98  310  310 HOH HOH A . 
G 5 HOH 99  311  311 HOH HOH A . 
G 5 HOH 100 312  312 HOH HOH A . 
G 5 HOH 101 313  313 HOH HOH A . 
G 5 HOH 102 314  314 HOH HOH A . 
G 5 HOH 103 315  315 HOH HOH A . 
G 5 HOH 104 316  316 HOH HOH A . 
G 5 HOH 105 317  317 HOH HOH A . 
G 5 HOH 106 318  318 HOH HOH A . 
G 5 HOH 107 319  319 HOH HOH A . 
G 5 HOH 108 320  320 HOH HOH A . 
G 5 HOH 109 321  321 HOH HOH A . 
G 5 HOH 110 322  322 HOH HOH A . 
G 5 HOH 111 323  323 HOH HOH A . 
G 5 HOH 112 324  324 HOH HOH A . 
G 5 HOH 113 325  325 HOH HOH A . 
G 5 HOH 114 326  326 HOH HOH A . 
G 5 HOH 115 327  327 HOH HOH A . 
G 5 HOH 116 328  328 HOH HOH A . 
G 5 HOH 117 329  329 HOH HOH A . 
G 5 HOH 118 330  330 HOH HOH A . 
G 5 HOH 119 331  331 HOH HOH A . 
G 5 HOH 120 332  332 HOH HOH A . 
G 5 HOH 121 333  333 HOH HOH A . 
G 5 HOH 122 334  334 HOH HOH A . 
G 5 HOH 123 335  335 HOH HOH A . 
G 5 HOH 124 336  336 HOH HOH A . 
G 5 HOH 125 337  337 HOH HOH A . 
G 5 HOH 126 338  338 HOH HOH A . 
G 5 HOH 127 346  346 HOH HOH A . 
G 5 HOH 128 347  347 HOH HOH A . 
G 5 HOH 129 348  348 HOH HOH A . 
G 5 HOH 130 349  349 HOH HOH A . 
G 5 HOH 131 350  350 HOH HOH A . 
G 5 HOH 132 351  351 HOH HOH A . 
G 5 HOH 133 352  352 HOH HOH A . 
G 5 HOH 134 353  353 HOH HOH A . 
G 5 HOH 135 354  354 HOH HOH A . 
G 5 HOH 136 355  355 HOH HOH A . 
G 5 HOH 137 356  356 HOH HOH A . 
G 5 HOH 138 357  357 HOH HOH A . 
G 5 HOH 139 358  358 HOH HOH A . 
G 5 HOH 140 359  359 HOH HOH A . 
G 5 HOH 141 360  360 HOH HOH A . 
G 5 HOH 142 361  361 HOH HOH A . 
G 5 HOH 143 362  362 HOH HOH A . 
G 5 HOH 144 363  363 HOH HOH A . 
G 5 HOH 145 364  364 HOH HOH A . 
G 5 HOH 146 365  365 HOH HOH A . 
G 5 HOH 147 400  400 HOH HOH A . 
G 5 HOH 148 407  407 HOH HOH A . 
G 5 HOH 149 414  414 HOH HOH A . 
G 5 HOH 150 415  415 HOH HOH A . 
G 5 HOH 151 416  416 HOH HOH A . 
G 5 HOH 152 417  417 HOH HOH A . 
G 5 HOH 153 418  418 HOH HOH A . 
G 5 HOH 154 419  419 HOH HOH A . 
G 5 HOH 155 420  420 HOH HOH A . 
G 5 HOH 156 421  421 HOH HOH A . 
G 5 HOH 157 422  422 HOH HOH A . 
G 5 HOH 158 426  426 HOH HOH A . 
G 5 HOH 159 429  429 HOH HOH A . 
G 5 HOH 160 430  430 HOH HOH A . 
G 5 HOH 161 431  431 HOH HOH A . 
G 5 HOH 162 432  432 HOH HOH A . 
G 5 HOH 163 433  433 HOH HOH A . 
H 5 HOH 1   1174 1   HOH HOH B . 
H 5 HOH 2   1175 2   HOH HOH B . 
H 5 HOH 3   1176 3   HOH HOH B . 
H 5 HOH 4   1177 4   HOH HOH B . 
H 5 HOH 5   1178 5   HOH HOH B . 
H 5 HOH 6   1179 6   HOH HOH B . 
H 5 HOH 7   1180 7   HOH HOH B . 
H 5 HOH 8   1181 8   HOH HOH B . 
H 5 HOH 9   1182 9   HOH HOH B . 
H 5 HOH 10  1183 10  HOH HOH B . 
H 5 HOH 11  1184 11  HOH HOH B . 
H 5 HOH 12  1185 12  HOH HOH B . 
H 5 HOH 13  1186 13  HOH HOH B . 
H 5 HOH 14  1187 14  HOH HOH B . 
H 5 HOH 15  1188 15  HOH HOH B . 
H 5 HOH 16  1189 16  HOH HOH B . 
H 5 HOH 17  1190 17  HOH HOH B . 
H 5 HOH 18  1191 18  HOH HOH B . 
H 5 HOH 19  1192 19  HOH HOH B . 
H 5 HOH 20  1193 20  HOH HOH B . 
H 5 HOH 21  1194 21  HOH HOH B . 
H 5 HOH 22  1195 22  HOH HOH B . 
H 5 HOH 23  1196 23  HOH HOH B . 
H 5 HOH 24  1197 24  HOH HOH B . 
H 5 HOH 25  1198 25  HOH HOH B . 
H 5 HOH 26  1199 26  HOH HOH B . 
H 5 HOH 27  1200 29  HOH HOH B . 
H 5 HOH 28  1201 30  HOH HOH B . 
H 5 HOH 29  1202 31  HOH HOH B . 
H 5 HOH 30  1203 32  HOH HOH B . 
H 5 HOH 31  1204 33  HOH HOH B . 
H 5 HOH 32  1205 34  HOH HOH B . 
H 5 HOH 33  1206 35  HOH HOH B . 
H 5 HOH 34  1207 36  HOH HOH B . 
H 5 HOH 35  1208 37  HOH HOH B . 
H 5 HOH 36  1209 39  HOH HOH B . 
H 5 HOH 37  1210 40  HOH HOH B . 
H 5 HOH 38  1211 43  HOH HOH B . 
H 5 HOH 39  1212 44  HOH HOH B . 
H 5 HOH 40  1213 45  HOH HOH B . 
H 5 HOH 41  1214 46  HOH HOH B . 
H 5 HOH 42  1215 47  HOH HOH B . 
H 5 HOH 43  1216 48  HOH HOH B . 
H 5 HOH 44  1217 49  HOH HOH B . 
H 5 HOH 45  1218 50  HOH HOH B . 
H 5 HOH 46  1219 51  HOH HOH B . 
H 5 HOH 47  1220 52  HOH HOH B . 
H 5 HOH 48  1221 53  HOH HOH B . 
H 5 HOH 49  1222 54  HOH HOH B . 
H 5 HOH 50  1223 56  HOH HOH B . 
H 5 HOH 51  1224 58  HOH HOH B . 
H 5 HOH 52  1225 60  HOH HOH B . 
H 5 HOH 53  1226 61  HOH HOH B . 
H 5 HOH 54  1227 63  HOH HOH B . 
H 5 HOH 55  1228 65  HOH HOH B . 
H 5 HOH 56  1229 67  HOH HOH B . 
H 5 HOH 57  1230 68  HOH HOH B . 
H 5 HOH 58  1231 69  HOH HOH B . 
H 5 HOH 59  1232 70  HOH HOH B . 
H 5 HOH 60  1233 71  HOH HOH B . 
H 5 HOH 61  1234 72  HOH HOH B . 
H 5 HOH 62  1235 73  HOH HOH B . 
H 5 HOH 63  1236 74  HOH HOH B . 
H 5 HOH 64  1237 77  HOH HOH B . 
H 5 HOH 65  1238 78  HOH HOH B . 
H 5 HOH 66  1239 79  HOH HOH B . 
H 5 HOH 67  1240 80  HOH HOH B . 
H 5 HOH 68  1241 81  HOH HOH B . 
H 5 HOH 69  1242 83  HOH HOH B . 
H 5 HOH 70  1243 84  HOH HOH B . 
H 5 HOH 71  1244 85  HOH HOH B . 
H 5 HOH 72  1245 87  HOH HOH B . 
H 5 HOH 73  1246 88  HOH HOH B . 
H 5 HOH 74  1247 89  HOH HOH B . 
H 5 HOH 75  1248 92  HOH HOH B . 
H 5 HOH 76  1249 93  HOH HOH B . 
H 5 HOH 77  1250 97  HOH HOH B . 
H 5 HOH 78  1251 99  HOH HOH B . 
H 5 HOH 79  1252 100 HOH HOH B . 
H 5 HOH 80  1253 101 HOH HOH B . 
H 5 HOH 81  1254 104 HOH HOH B . 
H 5 HOH 82  1255 105 HOH HOH B . 
H 5 HOH 83  1256 106 HOH HOH B . 
H 5 HOH 84  1257 107 HOH HOH B . 
H 5 HOH 85  1258 108 HOH HOH B . 
H 5 HOH 86  1259 109 HOH HOH B . 
H 5 HOH 87  1260 110 HOH HOH B . 
H 5 HOH 88  1261 111 HOH HOH B . 
H 5 HOH 89  1262 113 HOH HOH B . 
H 5 HOH 90  1263 114 HOH HOH B . 
H 5 HOH 91  1264 116 HOH HOH B . 
H 5 HOH 92  1265 118 HOH HOH B . 
H 5 HOH 93  1266 119 HOH HOH B . 
H 5 HOH 94  1267 120 HOH HOH B . 
H 5 HOH 95  1268 122 HOH HOH B . 
H 5 HOH 96  1269 123 HOH HOH B . 
H 5 HOH 97  1270 124 HOH HOH B . 
H 5 HOH 98  1271 126 HOH HOH B . 
H 5 HOH 99  1272 127 HOH HOH B . 
H 5 HOH 100 1273 130 HOH HOH B . 
H 5 HOH 101 1274 132 HOH HOH B . 
H 5 HOH 102 1275 134 HOH HOH B . 
H 5 HOH 103 1276 135 HOH HOH B . 
H 5 HOH 104 1277 137 HOH HOH B . 
H 5 HOH 105 1278 138 HOH HOH B . 
H 5 HOH 106 1279 140 HOH HOH B . 
H 5 HOH 107 1280 142 HOH HOH B . 
H 5 HOH 108 1281 143 HOH HOH B . 
H 5 HOH 109 1282 144 HOH HOH B . 
H 5 HOH 110 1283 145 HOH HOH B . 
H 5 HOH 111 1284 147 HOH HOH B . 
H 5 HOH 112 1285 148 HOH HOH B . 
H 5 HOH 113 1286 150 HOH HOH B . 
H 5 HOH 114 1287 151 HOH HOH B . 
H 5 HOH 115 1288 152 HOH HOH B . 
H 5 HOH 116 1289 153 HOH HOH B . 
H 5 HOH 117 1290 154 HOH HOH B . 
H 5 HOH 118 1291 155 HOH HOH B . 
H 5 HOH 119 1292 156 HOH HOH B . 
H 5 HOH 120 1293 157 HOH HOH B . 
H 5 HOH 121 1294 158 HOH HOH B . 
H 5 HOH 122 1295 160 HOH HOH B . 
H 5 HOH 123 1296 164 HOH HOH B . 
H 5 HOH 124 1297 166 HOH HOH B . 
H 5 HOH 125 1298 167 HOH HOH B . 
H 5 HOH 126 1299 168 HOH HOH B . 
H 5 HOH 127 1300 170 HOH HOH B . 
H 5 HOH 128 1301 171 HOH HOH B . 
H 5 HOH 129 1302 173 HOH HOH B . 
H 5 HOH 130 1303 176 HOH HOH B . 
H 5 HOH 131 1304 178 HOH HOH B . 
H 5 HOH 132 1305 180 HOH HOH B . 
H 5 HOH 133 1306 181 HOH HOH B . 
H 5 HOH 134 1307 182 HOH HOH B . 
H 5 HOH 135 1308 183 HOH HOH B . 
H 5 HOH 136 1309 184 HOH HOH B . 
H 5 HOH 137 1310 186 HOH HOH B . 
H 5 HOH 138 1311 187 HOH HOH B . 
H 5 HOH 139 1312 188 HOH HOH B . 
H 5 HOH 140 1313 189 HOH HOH B . 
H 5 HOH 141 1314 192 HOH HOH B . 
H 5 HOH 142 1315 193 HOH HOH B . 
H 5 HOH 143 1316 194 HOH HOH B . 
H 5 HOH 144 1317 195 HOH HOH B . 
H 5 HOH 145 1318 196 HOH HOH B . 
H 5 HOH 146 1319 198 HOH HOH B . 
H 5 HOH 147 1320 200 HOH HOH B . 
H 5 HOH 148 1321 202 HOH HOH B . 
H 5 HOH 149 1322 203 HOH HOH B . 
H 5 HOH 150 1323 204 HOH HOH B . 
H 5 HOH 151 1324 209 HOH HOH B . 
H 5 HOH 152 1325 210 HOH HOH B . 
H 5 HOH 153 1326 211 HOH HOH B . 
H 5 HOH 154 1327 213 HOH HOH B . 
H 5 HOH 155 1328 214 HOH HOH B . 
H 5 HOH 156 1329 216 HOH HOH B . 
H 5 HOH 157 1330 218 HOH HOH B . 
H 5 HOH 158 1331 219 HOH HOH B . 
H 5 HOH 159 1332 220 HOH HOH B . 
H 5 HOH 160 1333 221 HOH HOH B . 
H 5 HOH 161 1334 222 HOH HOH B . 
H 5 HOH 162 1335 223 HOH HOH B . 
H 5 HOH 163 1336 225 HOH HOH B . 
H 5 HOH 164 1337 226 HOH HOH B . 
H 5 HOH 165 1338 227 HOH HOH B . 
H 5 HOH 166 1339 231 HOH HOH B . 
H 5 HOH 167 1340 232 HOH HOH B . 
H 5 HOH 168 1341 233 HOH HOH B . 
H 5 HOH 169 1342 234 HOH HOH B . 
H 5 HOH 170 1343 235 HOH HOH B . 
H 5 HOH 171 1344 236 HOH HOH B . 
H 5 HOH 172 1345 237 HOH HOH B . 
H 5 HOH 173 1346 238 HOH HOH B . 
H 5 HOH 174 1347 241 HOH HOH B . 
H 5 HOH 175 1348 244 HOH HOH B . 
H 5 HOH 176 1349 249 HOH HOH B . 
H 5 HOH 177 1350 251 HOH HOH B . 
H 5 HOH 178 1351 252 HOH HOH B . 
H 5 HOH 179 1352 254 HOH HOH B . 
H 5 HOH 180 1353 255 HOH HOH B . 
H 5 HOH 181 1354 256 HOH HOH B . 
H 5 HOH 182 1355 257 HOH HOH B . 
H 5 HOH 183 1356 260 HOH HOH B . 
H 5 HOH 184 1357 261 HOH HOH B . 
H 5 HOH 185 1358 262 HOH HOH B . 
H 5 HOH 186 1359 266 HOH HOH B . 
H 5 HOH 187 1360 267 HOH HOH B . 
H 5 HOH 188 1361 268 HOH HOH B . 
H 5 HOH 189 1362 269 HOH HOH B . 
H 5 HOH 190 1363 270 HOH HOH B . 
H 5 HOH 191 1364 271 HOH HOH B . 
H 5 HOH 192 1365 273 HOH HOH B . 
H 5 HOH 193 1366 274 HOH HOH B . 
H 5 HOH 194 1367 276 HOH HOH B . 
H 5 HOH 195 1368 277 HOH HOH B . 
H 5 HOH 196 1369 285 HOH HOH B . 
H 5 HOH 197 1370 286 HOH HOH B . 
H 5 HOH 198 1371 287 HOH HOH B . 
H 5 HOH 199 1372 288 HOH HOH B . 
H 5 HOH 200 1373 289 HOH HOH B . 
H 5 HOH 201 1374 290 HOH HOH B . 
H 5 HOH 202 1375 291 HOH HOH B . 
H 5 HOH 203 1376 292 HOH HOH B . 
H 5 HOH 204 1377 296 HOH HOH B . 
H 5 HOH 205 1378 297 HOH HOH B . 
H 5 HOH 206 1379 298 HOH HOH B . 
H 5 HOH 207 1380 299 HOH HOH B . 
H 5 HOH 208 1381 300 HOH HOH B . 
H 5 HOH 209 1382 301 HOH HOH B . 
H 5 HOH 210 1383 302 HOH HOH B . 
H 5 HOH 211 1384 303 HOH HOH B . 
H 5 HOH 212 1385 304 HOH HOH B . 
H 5 HOH 213 1386 339 HOH HOH B . 
H 5 HOH 214 1387 340 HOH HOH B . 
H 5 HOH 215 1388 341 HOH HOH B . 
H 5 HOH 216 1389 342 HOH HOH B . 
H 5 HOH 217 1390 343 HOH HOH B . 
H 5 HOH 218 1391 344 HOH HOH B . 
H 5 HOH 219 1392 345 HOH HOH B . 
H 5 HOH 220 1393 366 HOH HOH B . 
H 5 HOH 221 1394 367 HOH HOH B . 
H 5 HOH 222 1395 368 HOH HOH B . 
H 5 HOH 223 1396 369 HOH HOH B . 
H 5 HOH 224 1397 370 HOH HOH B . 
H 5 HOH 225 1398 371 HOH HOH B . 
H 5 HOH 226 1399 372 HOH HOH B . 
H 5 HOH 227 1400 373 HOH HOH B . 
H 5 HOH 228 1401 374 HOH HOH B . 
H 5 HOH 229 1402 375 HOH HOH B . 
H 5 HOH 230 1403 376 HOH HOH B . 
H 5 HOH 231 1404 377 HOH HOH B . 
H 5 HOH 232 1405 378 HOH HOH B . 
H 5 HOH 233 1406 379 HOH HOH B . 
H 5 HOH 234 1407 380 HOH HOH B . 
H 5 HOH 235 1408 381 HOH HOH B . 
H 5 HOH 236 1409 382 HOH HOH B . 
H 5 HOH 237 1410 383 HOH HOH B . 
H 5 HOH 238 1411 384 HOH HOH B . 
H 5 HOH 239 1412 385 HOH HOH B . 
H 5 HOH 240 1413 386 HOH HOH B . 
H 5 HOH 241 1414 387 HOH HOH B . 
H 5 HOH 242 1415 388 HOH HOH B . 
H 5 HOH 243 1416 389 HOH HOH B . 
H 5 HOH 244 1417 390 HOH HOH B . 
H 5 HOH 245 1418 391 HOH HOH B . 
H 5 HOH 246 1419 392 HOH HOH B . 
H 5 HOH 247 1420 393 HOH HOH B . 
H 5 HOH 248 1421 394 HOH HOH B . 
H 5 HOH 249 1422 395 HOH HOH B . 
H 5 HOH 250 1423 396 HOH HOH B . 
H 5 HOH 251 1424 397 HOH HOH B . 
H 5 HOH 252 1425 398 HOH HOH B . 
H 5 HOH 253 1426 399 HOH HOH B . 
H 5 HOH 254 1427 401 HOH HOH B . 
H 5 HOH 255 1428 402 HOH HOH B . 
H 5 HOH 256 1429 403 HOH HOH B . 
H 5 HOH 257 1430 404 HOH HOH B . 
H 5 HOH 258 1431 405 HOH HOH B . 
H 5 HOH 259 1432 406 HOH HOH B . 
H 5 HOH 260 1433 408 HOH HOH B . 
H 5 HOH 261 1434 409 HOH HOH B . 
H 5 HOH 262 1435 410 HOH HOH B . 
H 5 HOH 263 1436 411 HOH HOH B . 
H 5 HOH 264 1437 412 HOH HOH B . 
H 5 HOH 265 1438 413 HOH HOH B . 
H 5 HOH 266 1439 423 HOH HOH B . 
H 5 HOH 267 1440 424 HOH HOH B . 
H 5 HOH 268 1441 425 HOH HOH B . 
H 5 HOH 269 1442 427 HOH HOH B . 
H 5 HOH 270 1443 428 HOH HOH B . 
H 5 HOH 271 1444 434 HOH HOH B . 
H 5 HOH 272 1445 435 HOH HOH B . 
H 5 HOH 273 1446 436 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,G     
2 1 B,D,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-20 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            diffrn_source 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_diffrn_source.type' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 14.1045 4.2965  90.3753 -0.0016 -0.0164 0.0083  0.0026 0.0362  0.0037 0.6075 0.7007 2.8582 0.1452 0.0334  0.3368 
0.1005  0.0058 0.1767  0.0939  -0.0232 0.0528 -0.3328 -0.1288 -0.0774 'X-RAY DIFFRACTION' 
2 ? refined -4.5917 -9.8099 44.8135 -0.1091 -0.1021 -0.0694 0.0078 -0.0110 0.0013 0.5843 0.5080 0.9607 0.1290 -0.0151 0.0253 
-0.0179 0.0222 -0.0211 -0.0313 0.0126  0.0165 0.0146  0.0284  0.0053  'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 889 A 2 A 1168 A 281 ? 'X-RAY DIFFRACTION' ? 
2 2 B 888 B 1 B 1168 B 281 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC       refinement        5.2.0019       ? 1 
CrystalClear 'data collection' '(MSC/RIGAKU)' ? 2 
MOSFLM       'data reduction'  .              ? 3 
CCP4         'data scaling'    '(SCALA)'      ? 4 
PHASER       phasing           .              ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OE1 B GLU 916  ? ? O B HOH 1399 ? ? 2.16 
2 1 O   B HOH 1278 ? ? O B HOH 1315 ? ? 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 1008 ? ? -114.27 52.32   
2  1 ASP A 1026 ? ? -135.44 -85.70  
3  1 CYS A 1106 ? ? -129.41 -122.90 
4  1 SER A 1107 ? ? -94.30  -66.16  
5  1 ALA A 1110 ? ? -125.62 -62.43  
6  1 ASN A 1147 ? ? 57.55   19.85   
7  1 VAL A 1149 ? ? 67.73   90.35   
8  1 TRP B 926  ? ? -140.61 48.73   
9  1 VAL B 1008 ? ? -116.72 52.07   
10 1 ASP B 1026 ? ? -134.40 -77.47  
11 1 CYS B 1106 ? ? -130.67 -124.99 
12 1 SER B 1107 ? ? -93.30  -71.41  
13 1 ALA B 1110 ? ? -123.17 -55.26  
14 1 VAL B 1149 ? ? 65.05   88.23   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    974 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ARG 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    975 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -149.41 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLN 898  ? CG  ? A GLN 11  CG  
2   1 Y 1 A GLN 898  ? CD  ? A GLN 11  CD  
3   1 Y 1 A GLN 898  ? OE1 ? A GLN 11  OE1 
4   1 Y 1 A GLN 898  ? NE2 ? A GLN 11  NE2 
5   1 Y 1 A GLN 902  ? CG  ? A GLN 15  CG  
6   1 Y 1 A GLN 902  ? CD  ? A GLN 15  CD  
7   1 Y 1 A GLN 902  ? OE1 ? A GLN 15  OE1 
8   1 Y 1 A GLN 902  ? NE2 ? A GLN 15  NE2 
9   1 Y 1 A LYS 912  ? CD  ? A LYS 25  CD  
10  1 Y 1 A LYS 912  ? CE  ? A LYS 25  CE  
11  1 Y 1 A LYS 912  ? NZ  ? A LYS 25  NZ  
12  1 Y 1 A GLU 920  ? CG  ? A GLU 33  CG  
13  1 Y 1 A GLU 920  ? CD  ? A GLU 33  CD  
14  1 Y 1 A GLU 920  ? OE1 ? A GLU 33  OE1 
15  1 Y 1 A GLU 920  ? OE2 ? A GLU 33  OE2 
16  1 Y 1 A LYS 930  ? CD  ? A LYS 43  CD  
17  1 Y 1 A LYS 930  ? CE  ? A LYS 43  CE  
18  1 Y 1 A LYS 930  ? NZ  ? A LYS 43  NZ  
19  1 Y 1 A GLU 933  ? CG  ? A GLU 46  CG  
20  1 Y 1 A GLU 933  ? CD  ? A GLU 46  CD  
21  1 Y 1 A GLU 933  ? OE1 ? A GLU 46  OE1 
22  1 Y 1 A GLU 933  ? OE2 ? A GLU 46  OE2 
23  1 Y 1 A ARG 935  ? CD  ? A ARG 48  CD  
24  1 Y 1 A ARG 935  ? NE  ? A ARG 48  NE  
25  1 Y 1 A ARG 935  ? CZ  ? A ARG 48  CZ  
26  1 Y 1 A ARG 935  ? NH1 ? A ARG 48  NH1 
27  1 Y 1 A ARG 935  ? NH2 ? A ARG 48  NH2 
28  1 Y 1 A TYR 940  ? CG  ? A TYR 53  CG  
29  1 Y 1 A TYR 940  ? CD1 ? A TYR 53  CD1 
30  1 Y 1 A TYR 940  ? CD2 ? A TYR 53  CD2 
31  1 Y 1 A TYR 940  ? CE1 ? A TYR 53  CE1 
32  1 Y 1 A TYR 940  ? CE2 ? A TYR 53  CE2 
33  1 Y 1 A TYR 940  ? CZ  ? A TYR 53  CZ  
34  1 Y 1 A TYR 940  ? OH  ? A TYR 53  OH  
35  1 Y 1 A ARG 952  ? CD  ? A ARG 65  CD  
36  1 Y 1 A ARG 952  ? NE  ? A ARG 65  NE  
37  1 Y 1 A ARG 952  ? CZ  ? A ARG 65  CZ  
38  1 Y 1 A ARG 952  ? NH1 ? A ARG 65  NH1 
39  1 Y 1 A ARG 952  ? NH2 ? A ARG 65  NH2 
40  1 Y 1 A LEU 954  ? CD1 ? A LEU 67  CD1 
41  1 Y 1 A LEU 954  ? CD2 ? A LEU 67  CD2 
42  1 Y 1 A HIS 974  ? CG  ? A HIS 87  CG  
43  1 Y 1 A HIS 974  ? ND1 ? A HIS 87  ND1 
44  1 Y 1 A HIS 974  ? CD2 ? A HIS 87  CD2 
45  1 Y 1 A HIS 974  ? CE1 ? A HIS 87  CE1 
46  1 Y 1 A HIS 974  ? NE2 ? A HIS 87  NE2 
47  1 Y 1 A ARG 975  ? CG  ? A ARG 88  CG  
48  1 Y 1 A ARG 975  ? CD  ? A ARG 88  CD  
49  1 Y 1 A ARG 975  ? NE  ? A ARG 88  NE  
50  1 Y 1 A ARG 975  ? CZ  ? A ARG 88  CZ  
51  1 Y 1 A ARG 975  ? NH1 ? A ARG 88  NH1 
52  1 Y 1 A ARG 975  ? NH2 ? A ARG 88  NH2 
53  1 Y 1 A VAL 1014 ? CG1 ? A VAL 127 CG1 
54  1 Y 1 A VAL 1014 ? CG2 ? A VAL 127 CG2 
55  1 Y 1 A ARG 1016 ? CG  ? A ARG 129 CG  
56  1 Y 1 A ARG 1016 ? CD  ? A ARG 129 CD  
57  1 Y 1 A ARG 1016 ? NE  ? A ARG 129 NE  
58  1 Y 1 A ARG 1016 ? CZ  ? A ARG 129 CZ  
59  1 Y 1 A ARG 1016 ? NH1 ? A ARG 129 NH1 
60  1 Y 1 A ARG 1016 ? NH2 ? A ARG 129 NH2 
61  1 Y 1 A GLU 1127 ? CD  ? A GLU 240 CD  
62  1 Y 1 A GLU 1127 ? OE1 ? A GLU 240 OE1 
63  1 Y 1 A GLU 1127 ? OE2 ? A GLU 240 OE2 
64  1 Y 1 A ASN 1128 ? CG  ? A ASN 241 CG  
65  1 Y 1 A ASN 1128 ? OD1 ? A ASN 241 OD1 
66  1 Y 1 A ASN 1128 ? ND2 ? A ASN 241 ND2 
67  1 Y 1 A ARG 1139 ? CG  ? A ARG 252 CG  
68  1 Y 1 A ARG 1139 ? CD  ? A ARG 252 CD  
69  1 Y 1 A ARG 1139 ? NE  ? A ARG 252 NE  
70  1 Y 1 A ARG 1139 ? CZ  ? A ARG 252 CZ  
71  1 Y 1 A ARG 1139 ? NH1 ? A ARG 252 NH1 
72  1 Y 1 A ARG 1139 ? NH2 ? A ARG 252 NH2 
73  1 Y 1 A GLN 1150 ? CD  ? A GLN 263 CD  
74  1 Y 1 A GLN 1150 ? OE1 ? A GLN 263 OE1 
75  1 Y 1 A GLN 1150 ? NE2 ? A GLN 263 NE2 
76  1 Y 1 B GLN 898  ? CD  ? B GLN 11  CD  
77  1 Y 1 B GLN 898  ? OE1 ? B GLN 11  OE1 
78  1 Y 1 B GLN 898  ? NE2 ? B GLN 11  NE2 
79  1 Y 1 B GLN 902  ? CD  ? B GLN 15  CD  
80  1 Y 1 B GLN 902  ? OE1 ? B GLN 15  OE1 
81  1 Y 1 B GLN 902  ? NE2 ? B GLN 15  NE2 
82  1 Y 1 B ARG 905  ? NE  ? B ARG 18  NE  
83  1 Y 1 B ARG 905  ? CZ  ? B ARG 18  CZ  
84  1 Y 1 B ARG 905  ? NH1 ? B ARG 18  NH1 
85  1 Y 1 B ARG 905  ? NH2 ? B ARG 18  NH2 
86  1 Y 1 B LYS 912  ? CD  ? B LYS 25  CD  
87  1 Y 1 B LYS 912  ? CE  ? B LYS 25  CE  
88  1 Y 1 B LYS 912  ? NZ  ? B LYS 25  NZ  
89  1 Y 1 B LYS 930  ? CD  ? B LYS 43  CD  
90  1 Y 1 B LYS 930  ? CE  ? B LYS 43  CE  
91  1 Y 1 B LYS 930  ? NZ  ? B LYS 43  NZ  
92  1 Y 1 B ARG 1016 ? CD  ? B ARG 129 CD  
93  1 Y 1 B ARG 1016 ? NE  ? B ARG 129 NE  
94  1 Y 1 B ARG 1016 ? CZ  ? B ARG 129 CZ  
95  1 Y 1 B ARG 1016 ? NH1 ? B ARG 129 NH1 
96  1 Y 1 B ARG 1016 ? NH2 ? B ARG 129 NH2 
97  1 Y 1 B PHE 1093 ? CD1 ? B PHE 206 CD1 
98  1 Y 1 B PHE 1093 ? CD2 ? B PHE 206 CD2 
99  1 Y 1 B PHE 1093 ? CE1 ? B PHE 206 CE1 
100 1 Y 1 B PHE 1093 ? CE2 ? B PHE 206 CE2 
101 1 Y 1 B PHE 1093 ? CZ  ? B PHE 206 CZ  
102 1 N 1 A B3P 301  ? N2  ? C B3P 1   N2  
103 1 N 1 A B3P 301  ? C8  ? C B3P 1   C8  
104 1 N 1 A B3P 301  ? C9  ? C B3P 1   C9  
105 1 N 1 A B3P 301  ? C10 ? C B3P 1   C10 
106 1 N 1 A B3P 301  ? C11 ? C B3P 1   C11 
107 1 N 1 A B3P 301  ? O1  ? C B3P 1   O1  
108 1 N 1 A B3P 301  ? O2  ? C B3P 1   O2  
109 1 N 1 A B3P 301  ? O3  ? C B3P 1   O3  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 888  ? A SER 1   
2  1 Y 1 A ASP 957  ? A ASP 70  
3  1 Y 1 A GLY 958  ? A GLY 71  
4  1 Y 1 A GLY 1169 ? A GLY 282 
5  1 Y 1 A ASN 1170 ? A ASN 283 
6  1 Y 1 A THR 1171 ? A THR 284 
7  1 Y 1 A ALA 1172 ? A ALA 285 
8  1 Y 1 A ILE 1173 ? A ILE 286 
9  1 Y 1 B GLY 1169 ? B GLY 282 
10 1 Y 1 B ASN 1170 ? B ASN 283 
11 1 Y 1 B THR 1171 ? B THR 284 
12 1 Y 1 B ALA 1172 ? B ALA 285 
13 1 Y 1 B ILE 1173 ? B ILE 286 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' B3P 
3 'SODIUM ION'                                                                                    NA  
4 1,2-ETHANEDIOL                                                                                  EDO 
5 water                                                                                           HOH 
#