data_2OPG
# 
_entry.id   2OPG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OPG         
RCSB  RCSB041424   
WWPDB D_1000041424 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OPG 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gileadi, C.'                          1  
'Phillips, C.'                         2  
'Elkins, J.'                           3  
'Papagrigoriou, E.'                    4  
'Ugochukwu, E.'                        5  
'Gorrec, F.'                           6  
'Savitsky, P.'                         7  
'Umeano, C.'                           8  
'Berridge, G.'                         9  
'Gileadi, O.'                          10 
'Salah, E.'                            11 
'Edwards, A.'                          12 
'Arrowsmith, C.H.'                     13 
'Weigelt, J.'                          14 
'Sundstrom, M.'                        15 
'Doyle, D.A.'                          16 
'Structural Genomics Consortium (SGC)' 17 
# 
_citation.id                        primary 
_citation.title                     'The crystal structure of the 10th PDZ domain of MPDZ' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gileadi, C.'                          1  
primary 'Phillips, C.'                         2  
primary 'Elkins, J.'                           3  
primary 'Papagrigoriou, E.'                    4  
primary 'Ugochukwu, E.'                        5  
primary 'Gorrec, F.'                           6  
primary 'Savitsky, P.'                         7  
primary 'Umeano, C.'                           8  
primary 'Berridge, G.'                         9  
primary 'Gileadi, O.'                          10 
primary 'Salah, E.'                            11 
primary 'Edwards, A.'                          12 
primary 'Arrowsmith, C.H.'                     13 
primary 'Weigelt, J.'                          14 
primary 'Sundstrom, M.'                        15 
primary 'Doyle, D.A.'                          16 
primary 'Structural Genomics Consortium (SGC)' 17 
# 
_cell.entry_id           2OPG 
_cell.length_a           54.944 
_cell.length_b           54.944 
_cell.length_c           118.355 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OPG 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Multiple PDZ domain protein' 10740.190 2   ? ? 'Domain PDZ-10: Residues 1625-1685' ? 
2 non-polymer syn 'SODIUM ION'                  22.990    1   ? ? ?                                   ? 
3 water       nat water                         18.015    233 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Multi-PDZ domain protein 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQ
RVRLTLYRDEAPYKSTRL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQ
RVRLTLYRDEAPYKSTRL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  MET n 
1 3  GLY n 
1 4  CYS n 
1 5  GLU n 
1 6  THR n 
1 7  THR n 
1 8  ILE n 
1 9  GLU n 
1 10 ILE n 
1 11 SER n 
1 12 LYS n 
1 13 GLY n 
1 14 ARG n 
1 15 THR n 
1 16 GLY n 
1 17 LEU n 
1 18 GLY n 
1 19 LEU n 
1 20 SER n 
1 21 ILE n 
1 22 VAL n 
1 23 GLY n 
1 24 GLY n 
1 25 SER n 
1 26 ASP n 
1 27 THR n 
1 28 LEU n 
1 29 LEU n 
1 30 GLY n 
1 31 ALA n 
1 32 ILE n 
1 33 ILE n 
1 34 ILE n 
1 35 HIS n 
1 36 GLU n 
1 37 VAL n 
1 38 TYR n 
1 39 GLU n 
1 40 GLU n 
1 41 GLY n 
1 42 ALA n 
1 43 ALA n 
1 44 CYS n 
1 45 LYS n 
1 46 ASP n 
1 47 GLY n 
1 48 ARG n 
1 49 LEU n 
1 50 TRP n 
1 51 ALA n 
1 52 GLY n 
1 53 ASP n 
1 54 GLN n 
1 55 ILE n 
1 56 LEU n 
1 57 GLU n 
1 58 VAL n 
1 59 ASN n 
1 60 GLY n 
1 61 ILE n 
1 62 ASP n 
1 63 LEU n 
1 64 ARG n 
1 65 LYS n 
1 66 ALA n 
1 67 THR n 
1 68 HIS n 
1 69 ASP n 
1 70 GLU n 
1 71 ALA n 
1 72 ILE n 
1 73 ASN n 
1 74 VAL n 
1 75 LEU n 
1 76 ARG n 
1 77 GLN n 
1 78 THR n 
1 79 PRO n 
1 80 GLN n 
1 81 ARG n 
1 82 VAL n 
1 83 ARG n 
1 84 LEU n 
1 85 THR n 
1 86 LEU n 
1 87 TYR n 
1 88 ARG n 
1 89 ASP n 
1 90 GLU n 
1 91 ALA n 
1 92 PRO n 
1 93 TYR n 
1 94 LYS n 
1 95 SER n 
1 96 THR n 
1 97 ARG n 
1 98 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'MPDZ, MUPP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MPDZ_HUMAN 
_struct_ref.pdbx_db_accession          O75970 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRV
RLTLYRDEAPYK
;
_struct_ref.pdbx_align_begin           1625 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OPG A 3 ? 94 ? O75970 1625 ? 1716 ? 1625 1716 
2 1 2OPG B 3 ? 94 ? O75970 1625 ? 1716 ? 1625 1716 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OPG SER A 1  ? UNP O75970 ? ? 'CLONING ARTIFACT' 1623 1  
1 2OPG MET A 2  ? UNP O75970 ? ? 'CLONING ARTIFACT' 1624 2  
1 2OPG SER A 95 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1717 3  
1 2OPG THR A 96 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1718 4  
1 2OPG ARG A 97 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1719 5  
1 2OPG LEU A 98 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1720 6  
2 2OPG SER B 1  ? UNP O75970 ? ? 'CLONING ARTIFACT' 1623 7  
2 2OPG MET B 2  ? UNP O75970 ? ? 'CLONING ARTIFACT' 1624 8  
2 2OPG SER B 95 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1717 9  
2 2OPG THR B 96 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1718 10 
2 2OPG ARG B 97 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1719 11 
2 2OPG LEU B 98 ? UNP O75970 ? ? 'CLONING ARTIFACT' 1720 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2OPG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   48.76 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '0.1M BIS-TRIS, 20% mPEG 5000, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-11-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97880 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97880 
# 
_reflns.entry_id                     2OPG 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            1.5 
_reflns.d_resolution_low             39.47 
_reflns.number_all                   33890 
_reflns.number_obs                   33890 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.068 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           0.455 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        7.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4827 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2OPG 
_refine.ls_number_reflns_obs                     32150 
_refine.ls_number_reflns_all                     32150 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             39.47 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_R_factor_obs                          0.17473 
_refine.ls_R_factor_all                          0.17473 
_refine.ls_R_factor_R_work                       0.17244 
_refine.ls_R_factor_R_free                       0.21718 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1718 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.970 
_refine.correlation_coeff_Fo_to_Fc_free          0.953 
_refine.B_iso_mean                               18.291 
_refine.aniso_B[1][1]                            0.27 
_refine.aniso_B[2][2]                            0.27 
_refine.aniso_B[3][3]                            -0.40 
_refine.aniso_B[1][2]                            0.13 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB entry 2FNE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.070 
_refine.pdbx_overall_ESU_R_Free                  0.078 
_refine.overall_SU_ML                            0.049 
_refine.overall_SU_B                             2.556 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1529 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             238 
_refine_hist.number_atoms_total               1768 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        39.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.021  0.022  ? 1548 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 1054 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.929  1.982  ? 2100 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.332  3.000  ? 2584 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.560  5.000  ? 200  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.580 23.750 ? 64   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.734 15.000 ? 288  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       19.421 15.000 ? 14   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.192  0.200  ? 255  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.008  0.020  ? 1712 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.002  0.020  ? 292  'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.198  0.200  ? 299  'X-RAY DIFFRACTION' ? 
r_nbd_other                  0.218  0.200  ? 1102 'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.173  0.200  ? 742  'X-RAY DIFFRACTION' ? 
r_nbtor_other                0.090  0.200  ? 951  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.184  0.200  ? 153  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.266  0.200  ? 23   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         0.358  0.200  ? 69   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.241  0.200  ? 20   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.537  3.000  ? 981  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.754  3.000  ? 412  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.903  5.000  ? 1588 'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.291  7.000  ? 583  'X-RAY DIFFRACTION' ? 
r_scangle_it                 7.195  11.000 ? 510  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.54 
_refine_ls_shell.number_reflns_R_work             2296 
_refine_ls_shell.R_factor_R_work                  0.196 
_refine_ls_shell.percent_reflns_obs               99.35 
_refine_ls_shell.R_factor_R_free                  0.258 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             134 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OPG 
_struct.title                     'The crystal structure of the 10th PDZ domain of MPDZ' 
_struct.pdbx_descriptor           'Multiple PDZ domain protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OPG 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'Structural Protein, Structural Genomics, Structural Genomics Consortium, SGC' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The two molecules in the asu correspond to two biological units' ? 
2 ?                                                                 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 41 ? GLY A 47 ? GLY A 1663 GLY A 1669 1 ? 7  
HELX_P HELX_P2 2 THR A 67 ? GLN A 77 ? THR A 1689 GLN A 1699 1 ? 11 
HELX_P HELX_P3 3 GLY B 41 ? GLY B 47 ? GLY B 1663 GLY B 1669 1 ? 7  
HELX_P HELX_P4 4 THR B 67 ? GLN B 77 ? THR B 1689 GLN B 1699 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A GLN 54 NE2 ? ? ? 1_555 C NA . NA ? ? A GLN 1676 A NA 1 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc2 metalc ? ? A ILE 55 O   ? ? ? 1_555 C NA . NA ? ? A ILE 1677 A NA 1 1_555 ? ? ? ? ? ? ? 2.793 ? 
metalc3 metalc ? ? A LEU 63 O   ? ? ? 1_555 C NA . NA ? ? A LEU 1685 A NA 1 1_555 ? ? ? ? ? ? ? 2.967 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 6 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 4  ? SER A 11 ? CYS A 1626 SER A 1633 
A 2 ARG A 81 ? ARG A 88 ? ARG A 1703 ARG A 1710 
A 3 GLN A 54 ? VAL A 58 ? GLN A 1676 VAL A 1680 
A 4 ILE A 61 ? ASP A 62 ? ILE A 1683 ASP A 1684 
B 1 ILE A 32 ? VAL A 37 ? ILE A 1654 VAL A 1659 
B 2 LEU A 19 ? GLY A 23 ? LEU A 1641 GLY A 1645 
B 3 SER B 95 ? LEU B 98 ? SER B 1717 LEU B 1720 
C 1 SER A 95 ? ARG A 97 ? SER A 1717 ARG A 1719 
C 2 LEU B 19 ? GLY B 23 ? LEU B 1641 GLY B 1645 
C 3 ILE B 32 ? VAL B 37 ? ILE B 1654 VAL B 1659 
C 4 GLN B 54 ? VAL B 58 ? GLN B 1676 VAL B 1680 
C 5 ARG B 81 ? ASP B 89 ? ARG B 1703 ASP B 1711 
C 6 GLY B 3  ? SER B 11 ? GLY B 1625 SER B 1633 
D 1 SER A 95 ? ARG A 97 ? SER A 1717 ARG A 1719 
D 2 LEU B 19 ? GLY B 23 ? LEU B 1641 GLY B 1645 
D 3 ILE B 32 ? VAL B 37 ? ILE B 1654 VAL B 1659 
D 4 GLN B 54 ? VAL B 58 ? GLN B 1676 VAL B 1680 
D 5 ILE B 61 ? ASP B 62 ? ILE B 1683 ASP B 1684 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 8  ? N ILE A 1630 O LEU A 84 ? O LEU A 1706 
A 2 3 O TYR A 87 ? O TYR A 1709 N GLN A 54 ? N GLN A 1676 
A 3 4 N VAL A 58 ? N VAL A 1680 O ILE A 61 ? O ILE A 1683 
B 1 2 O ILE A 33 ? O ILE A 1655 N VAL A 22 ? N VAL A 1644 
B 2 3 N LEU A 19 ? N LEU A 1641 O LEU B 98 ? O LEU B 1720 
C 1 2 N THR A 96 ? N THR A 1718 O ILE B 21 ? O ILE B 1643 
C 2 3 N VAL B 22 ? N VAL B 1644 O ILE B 33 ? O ILE B 1655 
C 3 4 N ILE B 32 ? N ILE B 1654 O ILE B 55 ? O ILE B 1677 
C 4 5 N LEU B 56 ? N LEU B 1678 O THR B 85 ? O THR B 1707 
C 5 6 O LEU B 86 ? O LEU B 1708 N THR B 6  ? N THR B 1628 
D 1 2 N THR A 96 ? N THR A 1718 O ILE B 21 ? O ILE B 1643 
D 2 3 N VAL B 22 ? N VAL B 1644 O ILE B 33 ? O ILE B 1655 
D 3 4 N ILE B 32 ? N ILE B 1654 O ILE B 55 ? O ILE B 1677 
D 4 5 N VAL B 58 ? N VAL B 1680 O ILE B 61 ? O ILE B 1683 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE NA A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ILE A 32 ? ILE A 1654 . ? 1_555 ? 
2 AC1 4 GLN A 54 ? GLN A 1676 . ? 1_555 ? 
3 AC1 4 ILE A 55 ? ILE A 1677 . ? 1_555 ? 
4 AC1 4 LEU A 63 ? LEU A 1685 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OPG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OPG 
_atom_sites.fract_transf_matrix[1][1]   0.018200 
_atom_sites.fract_transf_matrix[1][2]   0.010508 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021016 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008449 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1  ? 24.243 17.581 -8.209  1.00 53.71 ? 1623 SER A N   1 
ATOM   2    C  CA  . SER A 1 1  ? 24.377 16.101 -8.423  1.00 51.11 ? 1623 SER A CA  1 
ATOM   3    C  C   . SER A 1 1  ? 25.835 15.672 -8.613  1.00 44.19 ? 1623 SER A C   1 
ATOM   4    O  O   . SER A 1 1  ? 26.229 14.642 -8.083  1.00 44.19 ? 1623 SER A O   1 
ATOM   5    C  CB  . SER A 1 1  ? 23.537 15.639 -9.603  1.00 53.18 ? 1623 SER A CB  1 
ATOM   6    O  OG  . SER A 1 1  ? 23.483 14.217 -9.673  1.00 56.74 ? 1623 SER A OG  1 
ATOM   7    N  N   . MET A 1 2  ? 26.617 16.435 -9.387  1.00 34.75 ? 1624 MET A N   1 
ATOM   8    C  CA  . MET A 1 2  ? 28.089 16.335 -9.384  1.00 32.05 ? 1624 MET A CA  1 
ATOM   9    C  C   . MET A 1 2  ? 28.546 17.672 -8.775  1.00 29.96 ? 1624 MET A C   1 
ATOM   10   O  O   . MET A 1 2  ? 28.060 18.733 -9.200  1.00 31.77 ? 1624 MET A O   1 
ATOM   11   C  CB  . MET A 1 2  ? 28.723 16.248 -10.791 1.00 32.27 ? 1624 MET A CB  1 
ATOM   12   C  CG  . MET A 1 2  ? 28.475 15.006 -11.663 1.00 42.92 ? 1624 MET A CG  1 
ATOM   13   S  SD  . MET A 1 2  ? 29.593 13.676 -11.201 1.00 33.91 ? 1624 MET A SD  1 
ATOM   14   C  CE  . MET A 1 2  ? 31.147 14.119 -11.829 1.00 23.58 ? 1624 MET A CE  1 
ATOM   15   N  N   . GLY A 1 3  ? 29.436 17.625 -7.802  1.00 24.81 ? 1625 GLY A N   1 
ATOM   16   C  CA  . GLY A 1 3  ? 30.022 18.881 -7.258  1.00 20.74 ? 1625 GLY A CA  1 
ATOM   17   C  C   . GLY A 1 3  ? 31.194 19.226 -8.085  1.00 24.33 ? 1625 GLY A C   1 
ATOM   18   O  O   . GLY A 1 3  ? 31.505 18.503 -9.030  1.00 26.57 ? 1625 GLY A O   1 
ATOM   19   N  N   A CYS A 1 4  ? 31.889 20.292 -7.728  0.50 19.45 ? 1626 CYS A N   1 
ATOM   20   N  N   B CYS A 1 4  ? 31.801 20.373 -7.781  0.50 20.10 ? 1626 CYS A N   1 
ATOM   21   C  CA  A CYS A 1 4  ? 33.010 20.717 -8.524  0.50 20.73 ? 1626 CYS A CA  1 
ATOM   22   C  CA  B CYS A 1 4  ? 32.875 20.991 -8.566  0.50 21.61 ? 1626 CYS A CA  1 
ATOM   23   C  C   A CYS A 1 4  ? 34.187 21.383 -7.781  0.50 17.56 ? 1626 CYS A C   1 
ATOM   24   C  C   B CYS A 1 4  ? 34.149 21.144 -7.695  0.50 19.10 ? 1626 CYS A C   1 
ATOM   25   O  O   A CYS A 1 4  ? 34.093 22.220 -6.858  0.50 19.78 ? 1626 CYS A O   1 
ATOM   26   O  O   B CYS A 1 4  ? 34.032 21.299 -6.514  0.50 18.29 ? 1626 CYS A O   1 
ATOM   27   C  CB  A CYS A 1 4  ? 32.519 21.643 -9.599  0.50 17.69 ? 1626 CYS A CB  1 
ATOM   28   C  CB  B CYS A 1 4  ? 32.441 22.398 -8.986  0.50 21.44 ? 1626 CYS A CB  1 
ATOM   29   S  SG  A CYS A 1 4  ? 32.036 23.219 -8.922  0.50 20.05 ? 1626 CYS A SG  1 
ATOM   30   S  SG  B CYS A 1 4  ? 30.897 22.602 -9.883  0.50 28.48 ? 1626 CYS A SG  1 
ATOM   31   N  N   . GLU A 1 5  ? 35.333 21.013 -8.272  1.00 19.21 ? 1627 GLU A N   1 
ATOM   32   C  CA  . GLU A 1 5  ? 36.597 21.444 -7.653  1.00 18.02 ? 1627 GLU A CA  1 
ATOM   33   C  C   . GLU A 1 5  ? 37.151 22.638 -8.392  1.00 20.81 ? 1627 GLU A C   1 
ATOM   34   O  O   . GLU A 1 5  ? 37.035 22.708 -9.649  1.00 19.70 ? 1627 GLU A O   1 
ATOM   35   C  CB  . GLU A 1 5  ? 37.559 20.255 -7.602  1.00 26.56 ? 1627 GLU A CB  1 
ATOM   36   C  CG  . GLU A 1 5  ? 38.876 20.573 -7.106  1.00 26.96 ? 1627 GLU A CG  1 
ATOM   37   C  CD  . GLU A 1 5  ? 39.867 19.429 -7.183  1.00 26.35 ? 1627 GLU A CD  1 
ATOM   38   O  OE1 . GLU A 1 5  ? 39.472 18.236 -7.073  1.00 30.61 ? 1627 GLU A OE1 1 
ATOM   39   O  OE2 . GLU A 1 5  ? 41.072 19.705 -7.314  1.00 28.17 ? 1627 GLU A OE2 1 
ATOM   40   N  N   . THR A 1 6  ? 37.786 23.552 -7.693  1.00 18.74 ? 1628 THR A N   1 
ATOM   41   C  CA  . THR A 1 6  ? 38.582 24.576 -8.330  1.00 20.08 ? 1628 THR A CA  1 
ATOM   42   C  C   . THR A 1 6  ? 39.803 24.892 -7.506  1.00 22.39 ? 1628 THR A C   1 
ATOM   43   O  O   . THR A 1 6  ? 39.899 24.498 -6.357  1.00 21.85 ? 1628 THR A O   1 
ATOM   44   C  CB  . THR A 1 6  ? 37.845 25.849 -8.662  1.00 23.68 ? 1628 THR A CB  1 
ATOM   45   O  OG1 . THR A 1 6  ? 38.681 26.658 -9.522  1.00 24.98 ? 1628 THR A OG1 1 
ATOM   46   C  CG2 . THR A 1 6  ? 37.552 26.674 -7.397  1.00 25.09 ? 1628 THR A CG2 1 
ATOM   47   N  N   . THR A 1 7  ? 40.789 25.512 -8.143  1.00 21.32 ? 1629 THR A N   1 
ATOM   48   C  CA  . THR A 1 7  ? 41.932 26.037 -7.436  1.00 20.37 ? 1629 THR A CA  1 
ATOM   49   C  C   . THR A 1 7  ? 42.056 27.507 -7.760  1.00 24.60 ? 1629 THR A C   1 
ATOM   50   O  O   . THR A 1 7  ? 41.985 27.889 -8.923  1.00 25.97 ? 1629 THR A O   1 
ATOM   51   C  CB  . THR A 1 7  ? 43.267 25.313 -7.751  1.00 24.77 ? 1629 THR A CB  1 
ATOM   52   O  OG1 . THR A 1 7  ? 43.202 23.939 -7.298  1.00 24.32 ? 1629 THR A OG1 1 
ATOM   53   C  CG2 . THR A 1 7  ? 44.449 26.000 -7.073  1.00 27.68 ? 1629 THR A CG2 1 
ATOM   54   N  N   . ILE A 1 8  ? 42.109 28.316 -6.725  1.00 25.78 ? 1630 ILE A N   1 
ATOM   55   C  CA  . ILE A 1 8  ? 42.263 29.723 -6.921  1.00 27.85 ? 1630 ILE A CA  1 
ATOM   56   C  C   . ILE A 1 8  ? 43.364 30.268 -6.042  1.00 27.82 ? 1630 ILE A C   1 
ATOM   57   O  O   . ILE A 1 8  ? 43.600 29.756 -4.962  1.00 33.66 ? 1630 ILE A O   1 
ATOM   58   C  CB  A ILE A 1 8  ? 40.990 30.427 -6.735  0.50 24.90 ? 1630 ILE A CB  1 
ATOM   59   C  CB  B ILE A 1 8  ? 40.968 30.348 -6.386  0.50 23.91 ? 1630 ILE A CB  1 
ATOM   60   C  CG1 A ILE A 1 8  ? 40.506 30.250 -5.322  0.50 15.62 ? 1630 ILE A CG1 1 
ATOM   61   C  CG1 B ILE A 1 8  ? 39.723 30.160 -7.257  0.50 33.83 ? 1630 ILE A CG1 1 
ATOM   62   C  CG2 A ILE A 1 8  ? 39.962 29.902 -7.757  0.50 26.67 ? 1630 ILE A CG2 1 
ATOM   63   C  CG2 B ILE A 1 8  ? 41.076 31.217 -5.134  0.50 39.07 ? 1630 ILE A CG2 1 
ATOM   64   C  CD1 A ILE A 1 8  ? 39.474 31.309 -4.945  0.50 22.98 ? 1630 ILE A CD1 1 
ATOM   65   C  CD1 B ILE A 1 8  ? 38.537 29.898 -6.437  0.50 36.41 ? 1630 ILE A CD1 1 
ATOM   66   N  N   . GLU A 1 9  ? 43.989 31.361 -6.444  1.00 24.43 ? 1631 GLU A N   1 
ATOM   67   C  CA  . GLU A 1 9  ? 45.020 32.002 -5.643  1.00 26.60 ? 1631 GLU A CA  1 
ATOM   68   C  C   . GLU A 1 9  ? 44.478 33.339 -5.170  1.00 26.06 ? 1631 GLU A C   1 
ATOM   69   O  O   . GLU A 1 9  ? 44.021 34.122 -5.986  1.00 29.47 ? 1631 GLU A O   1 
ATOM   70   C  CB  . GLU A 1 9  ? 46.279 32.213 -6.493  1.00 28.25 ? 1631 GLU A CB  1 
ATOM   71   N  N   . ILE A 1 10 ? 44.453 33.544 -3.866  1.00 23.11 ? 1632 ILE A N   1 
ATOM   72   C  CA  . ILE A 1 10 ? 43.998 34.782 -3.273  1.00 24.08 ? 1632 ILE A CA  1 
ATOM   73   C  C   . ILE A 1 10 ? 45.220 35.474 -2.682  1.00 24.25 ? 1632 ILE A C   1 
ATOM   74   O  O   . ILE A 1 10 ? 45.955 34.901 -1.882  1.00 22.77 ? 1632 ILE A O   1 
ATOM   75   C  CB  . ILE A 1 10 ? 42.975 34.555 -2.116  1.00 26.94 ? 1632 ILE A CB  1 
ATOM   76   C  CG1 . ILE A 1 10 ? 41.656 33.923 -2.579  1.00 27.46 ? 1632 ILE A CG1 1 
ATOM   77   C  CG2 . ILE A 1 10 ? 42.625 35.893 -1.426  1.00 27.39 ? 1632 ILE A CG2 1 
ATOM   78   C  CD1 . ILE A 1 10 ? 40.875 34.734 -3.578  1.00 30.60 ? 1632 ILE A CD1 1 
ATOM   79   N  N   . SER A 1 11 ? 45.411 36.743 -3.027  1.00 22.68 ? 1633 SER A N   1 
ATOM   80   C  CA  . SER A 1 11 ? 46.384 37.580 -2.345  1.00 22.85 ? 1633 SER A CA  1 
ATOM   81   C  C   . SER A 1 11 ? 45.737 38.214 -1.110  1.00 20.61 ? 1633 SER A C   1 
ATOM   82   O  O   . SER A 1 11 ? 44.689 38.903 -1.217  1.00 23.17 ? 1633 SER A O   1 
ATOM   83   C  CB  . SER A 1 11 ? 46.828 38.692 -3.274  1.00 21.92 ? 1633 SER A CB  1 
ATOM   84   O  OG  . SER A 1 11 ? 47.440 38.174 -4.443  1.00 30.38 ? 1633 SER A OG  1 
ATOM   85   N  N   . LYS A 1 12 ? 46.335 38.004 0.043   1.00 18.89 ? 1634 LYS A N   1 
ATOM   86   C  CA  . LYS A 1 12 ? 45.804 38.530 1.269   1.00 20.71 ? 1634 LYS A CA  1 
ATOM   87   C  C   . LYS A 1 12 ? 45.710 40.049 1.305   1.00 22.77 ? 1634 LYS A C   1 
ATOM   88   O  O   . LYS A 1 12 ? 46.581 40.750 0.756   1.00 23.61 ? 1634 LYS A O   1 
ATOM   89   C  CB  . LYS A 1 12 ? 46.656 38.092 2.427   1.00 20.13 ? 1634 LYS A CB  1 
ATOM   90   C  CG  . LYS A 1 12 ? 46.528 36.704 2.745   1.00 21.36 ? 1634 LYS A CG  1 
ATOM   91   C  CD  . LYS A 1 12 ? 47.458 36.388 3.875   1.00 22.04 ? 1634 LYS A CD  1 
ATOM   92   C  CE  . LYS A 1 12 ? 47.548 34.980 4.126   1.00 22.18 ? 1634 LYS A CE  1 
ATOM   93   N  NZ  . LYS A 1 12 ? 48.604 34.660 5.131   1.00 25.46 ? 1634 LYS A NZ  1 
ATOM   94   N  N   . GLY A 1 13 ? 44.700 40.614 1.983   1.00 21.44 ? 1635 GLY A N   1 
ATOM   95   C  CA  . GLY A 1 13 ? 44.762 42.049 2.358   1.00 20.79 ? 1635 GLY A CA  1 
ATOM   96   C  C   . GLY A 1 13 ? 45.073 42.263 3.817   1.00 22.41 ? 1635 GLY A C   1 
ATOM   97   O  O   . GLY A 1 13 ? 45.497 41.351 4.534   1.00 23.86 ? 1635 GLY A O   1 
ATOM   98   N  N   . ARG A 1 14 ? 44.864 43.499 4.287   1.00 25.87 ? 1636 ARG A N   1 
ATOM   99   C  CA  . ARG A 1 14 ? 45.095 43.857 5.687   1.00 24.39 ? 1636 ARG A CA  1 
ATOM   100  C  C   . ARG A 1 14 ? 44.354 42.922 6.639   1.00 30.07 ? 1636 ARG A C   1 
ATOM   101  O  O   . ARG A 1 14 ? 44.888 42.567 7.673   1.00 30.07 ? 1636 ARG A O   1 
ATOM   102  C  CB  . ARG A 1 14 ? 44.635 45.288 5.918   1.00 25.17 ? 1636 ARG A CB  1 
ATOM   103  C  CG  . ARG A 1 14 ? 45.626 46.287 5.368   1.00 28.81 ? 1636 ARG A CG  1 
ATOM   104  C  CD  . ARG A 1 14 ? 45.160 47.749 5.583   1.00 33.94 ? 1636 ARG A CD  1 
ATOM   105  N  NE  . ARG A 1 14 ? 46.269 48.639 5.322   1.00 33.44 ? 1636 ARG A NE  1 
ATOM   106  C  CZ  . ARG A 1 14 ? 46.669 49.616 6.125   1.00 48.18 ? 1636 ARG A CZ  1 
ATOM   107  N  NH1 . ARG A 1 14 ? 46.022 49.889 7.245   1.00 54.91 ? 1636 ARG A NH1 1 
ATOM   108  N  NH2 . ARG A 1 14 ? 47.718 50.354 5.779   1.00 51.90 ? 1636 ARG A NH2 1 
ATOM   109  N  N   . THR A 1 15 ? 43.135 42.518 6.274   1.00 23.87 ? 1637 THR A N   1 
ATOM   110  C  CA  . THR A 1 15 ? 42.328 41.601 7.073   1.00 31.49 ? 1637 THR A CA  1 
ATOM   111  C  C   . THR A 1 15 ? 42.536 40.179 6.696   1.00 29.81 ? 1637 THR A C   1 
ATOM   112  O  O   . THR A 1 15 ? 41.757 39.279 7.123   1.00 34.59 ? 1637 THR A O   1 
ATOM   113  C  CB  . THR A 1 15 ? 40.838 41.915 6.932   1.00 35.53 ? 1637 THR A CB  1 
ATOM   114  O  OG1 . THR A 1 15 ? 40.463 41.866 5.545   1.00 30.86 ? 1637 THR A OG1 1 
ATOM   115  C  CG2 . THR A 1 15 ? 40.535 43.293 7.521   1.00 32.03 ? 1637 THR A CG2 1 
ATOM   116  N  N   . GLY A 1 16 ? 43.551 39.905 5.871   1.00 27.56 ? 1638 GLY A N   1 
ATOM   117  C  CA  . GLY A 1 16 ? 43.892 38.525 5.549   1.00 23.83 ? 1638 GLY A CA  1 
ATOM   118  C  C   . GLY A 1 16 ? 43.127 38.050 4.338   1.00 21.16 ? 1638 GLY A C   1 
ATOM   119  O  O   . GLY A 1 16 ? 42.958 38.804 3.377   1.00 21.82 ? 1638 GLY A O   1 
ATOM   120  N  N   . LEU A 1 17 ? 42.609 36.819 4.458   1.00 26.62 ? 1639 LEU A N   1 
ATOM   121  C  CA  . LEU A 1 17 ? 41.725 36.213 3.456   1.00 23.60 ? 1639 LEU A CA  1 
ATOM   122  C  C   . LEU A 1 17 ? 40.330 36.823 3.399   1.00 20.17 ? 1639 LEU A C   1 
ATOM   123  O  O   . LEU A 1 17 ? 39.733 36.867 2.304   1.00 24.00 ? 1639 LEU A O   1 
ATOM   124  C  CB  . LEU A 1 17 ? 41.633 34.704 3.660   1.00 25.25 ? 1639 LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 17 ? 42.924 33.907 3.441   1.00 28.73 ? 1639 LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 17 ? 42.773 32.407 3.723   1.00 30.17 ? 1639 LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 17 ? 43.405 34.111 1.966   1.00 37.59 ? 1639 LEU A CD2 1 
ATOM   128  N  N   . GLY A 1 18 ? 39.792 37.355 4.519   1.00 19.54 ? 1640 GLY A N   1 
ATOM   129  C  CA  . GLY A 1 18 ? 38.464 37.878 4.497   1.00 19.82 ? 1640 GLY A CA  1 
ATOM   130  C  C   . GLY A 1 18 ? 37.404 36.765 4.560   1.00 17.56 ? 1640 GLY A C   1 
ATOM   131  O  O   . GLY A 1 18 ? 36.365 36.882 3.934   1.00 22.83 ? 1640 GLY A O   1 
ATOM   132  N  N   . LEU A 1 19 ? 37.676 35.787 5.354   1.00 20.79 ? 1641 LEU A N   1 
ATOM   133  C  CA  A LEU A 1 19 ? 36.669 34.751 5.497   0.50 19.07 ? 1641 LEU A CA  1 
ATOM   134  C  CA  B LEU A 1 19 ? 36.847 34.533 5.452   0.50 19.60 ? 1641 LEU A CA  1 
ATOM   135  C  C   . LEU A 1 19 ? 36.657 34.126 6.887   1.00 22.03 ? 1641 LEU A C   1 
ATOM   136  O  O   . LEU A 1 19 ? 37.574 34.242 7.703   1.00 20.81 ? 1641 LEU A O   1 
ATOM   137  C  CB  A LEU A 1 19 ? 36.834 33.722 4.379   0.50 18.40 ? 1641 LEU A CB  1 
ATOM   138  C  CB  B LEU A 1 19 ? 37.549 33.287 4.832   0.50 20.23 ? 1641 LEU A CB  1 
ATOM   139  C  CG  A LEU A 1 19 ? 38.186 32.992 4.401   0.50 19.59 ? 1641 LEU A CG  1 
ATOM   140  C  CG  B LEU A 1 19 ? 37.913 33.344 3.338   0.50 15.65 ? 1641 LEU A CG  1 
ATOM   141  C  CD1 A LEU A 1 19 ? 38.239 31.875 5.418   0.50 18.34 ? 1641 LEU A CD1 1 
ATOM   142  C  CD1 B LEU A 1 19 ? 38.710 32.121 2.909   0.50 27.45 ? 1641 LEU A CD1 1 
ATOM   143  C  CD2 A LEU A 1 19 ? 38.485 32.481 2.987   0.50 20.74 ? 1641 LEU A CD2 1 
ATOM   144  C  CD2 B LEU A 1 19 ? 36.709 33.561 2.484   0.50 22.69 ? 1641 LEU A CD2 1 
ATOM   145  N  N   . SER A 1 20 ? 35.540 33.465 7.204   1.00 19.73 ? 1642 SER A N   1 
ATOM   146  C  CA  . SER A 1 20 ? 35.542 32.667 8.391   1.00 20.92 ? 1642 SER A CA  1 
ATOM   147  C  C   . SER A 1 20 ? 35.296 31.243 8.073   1.00 18.38 ? 1642 SER A C   1 
ATOM   148  O  O   . SER A 1 20 ? 34.623 30.940 7.066   1.00 20.55 ? 1642 SER A O   1 
ATOM   149  C  CB  . SER A 1 20 ? 34.591 33.091 9.418   1.00 28.25 ? 1642 SER A CB  1 
ATOM   150  O  OG  . SER A 1 20 ? 33.308 32.990 8.990   1.00 30.10 ? 1642 SER A OG  1 
ATOM   151  N  N   . ILE A 1 21 ? 35.863 30.404 8.906   1.00 18.32 ? 1643 ILE A N   1 
ATOM   152  C  CA  . ILE A 1 21 ? 35.879 28.983 8.750   1.00 18.69 ? 1643 ILE A CA  1 
ATOM   153  C  C   . ILE A 1 21 ? 35.157 28.272 9.844   1.00 18.83 ? 1643 ILE A C   1 
ATOM   154  O  O   . ILE A 1 21 ? 35.299 28.670 11.014  1.00 19.03 ? 1643 ILE A O   1 
ATOM   155  C  CB  . ILE A 1 21 ? 37.397 28.536 8.886   1.00 24.71 ? 1643 ILE A CB  1 
ATOM   156  C  CG1 . ILE A 1 21 ? 38.234 29.319 7.880   1.00 35.03 ? 1643 ILE A CG1 1 
ATOM   157  C  CG2 . ILE A 1 21 ? 37.513 27.118 8.589   1.00 26.96 ? 1643 ILE A CG2 1 
ATOM   158  C  CD1 . ILE A 1 21 ? 37.808 28.912 6.515   1.00 30.82 ? 1643 ILE A CD1 1 
ATOM   159  N  N   . VAL A 1 22 ? 34.411 27.222 9.510   1.00 16.68 ? 1644 VAL A N   1 
ATOM   160  C  CA  . VAL A 1 22 ? 33.771 26.349 10.475  1.00 16.00 ? 1644 VAL A CA  1 
ATOM   161  C  C   . VAL A 1 22 ? 34.165 24.914 10.118  1.00 17.19 ? 1644 VAL A C   1 
ATOM   162  O  O   . VAL A 1 22 ? 34.707 24.625 9.030   1.00 18.65 ? 1644 VAL A O   1 
ATOM   163  C  CB  . VAL A 1 22 ? 32.239 26.465 10.500  1.00 17.33 ? 1644 VAL A CB  1 
ATOM   164  C  CG1 . VAL A 1 22 ? 31.844 27.832 11.067  1.00 18.63 ? 1644 VAL A CG1 1 
ATOM   165  C  CG2 . VAL A 1 22 ? 31.695 26.315 9.078   1.00 18.08 ? 1644 VAL A CG2 1 
ATOM   166  N  N   . GLY A 1 23 ? 33.961 23.950 10.972  1.00 17.74 ? 1645 GLY A N   1 
ATOM   167  C  CA  . GLY A 1 23 ? 34.071 22.535 10.671  1.00 17.13 ? 1645 GLY A CA  1 
ATOM   168  C  C   . GLY A 1 23 ? 35.387 21.949 11.019  1.00 17.71 ? 1645 GLY A C   1 
ATOM   169  O  O   . GLY A 1 23 ? 36.134 22.501 11.812  1.00 20.85 ? 1645 GLY A O   1 
ATOM   170  N  N   . GLY A 1 24 ? 35.686 20.813 10.415  1.00 19.40 ? 1646 GLY A N   1 
ATOM   171  C  CA  . GLY A 1 24 ? 36.835 19.972 10.797  1.00 18.57 ? 1646 GLY A CA  1 
ATOM   172  C  C   . GLY A 1 24 ? 36.392 18.531 10.945  1.00 21.67 ? 1646 GLY A C   1 
ATOM   173  O  O   . GLY A 1 24 ? 35.192 18.223 11.121  1.00 19.65 ? 1646 GLY A O   1 
ATOM   174  N  N   . SER A 1 25 ? 37.366 17.641 10.857  1.00 21.40 ? 1647 SER A N   1 
ATOM   175  C  CA  . SER A 1 25 ? 37.090 16.200 10.973  1.00 21.61 ? 1647 SER A CA  1 
ATOM   176  C  C   . SER A 1 25 ? 36.557 15.869 12.352  1.00 24.93 ? 1647 SER A C   1 
ATOM   177  O  O   . SER A 1 25 ? 35.997 14.776 12.570  1.00 29.30 ? 1647 SER A O   1 
ATOM   178  C  CB  . SER A 1 25 ? 38.352 15.410 10.646  1.00 22.86 ? 1647 SER A CB  1 
ATOM   179  O  OG  . SER A 1 25 ? 39.411 15.742 11.522  1.00 24.39 ? 1647 SER A OG  1 
ATOM   180  N  N   . ASP A 1 26 ? 36.765 16.770 13.302  1.00 23.84 ? 1648 ASP A N   1 
ATOM   181  C  CA  . ASP A 1 26 ? 36.297 16.672 14.696  1.00 25.40 ? 1648 ASP A CA  1 
ATOM   182  C  C   . ASP A 1 26 ? 34.902 17.259 14.907  1.00 26.59 ? 1648 ASP A C   1 
ATOM   183  O  O   . ASP A 1 26 ? 34.463 17.402 16.035  1.00 28.85 ? 1648 ASP A O   1 
ATOM   184  C  CB  . ASP A 1 26 ? 37.305 17.316 15.652  1.00 24.46 ? 1648 ASP A CB  1 
ATOM   185  C  CG  . ASP A 1 26 ? 37.636 18.774 15.323  1.00 26.96 ? 1648 ASP A CG  1 
ATOM   186  O  OD1 . ASP A 1 26 ? 37.697 19.143 14.168  1.00 23.83 ? 1648 ASP A OD1 1 
ATOM   187  O  OD2 . ASP A 1 26 ? 37.894 19.566 16.251  1.00 32.63 ? 1648 ASP A OD2 1 
ATOM   188  N  N   . THR A 1 27 ? 34.162 17.519 13.830  1.00 23.50 ? 1649 THR A N   1 
ATOM   189  C  CA  . THR A 1 27 ? 32.859 18.187 13.884  1.00 23.17 ? 1649 THR A CA  1 
ATOM   190  C  C   . THR A 1 27 ? 31.792 17.456 13.057  1.00 25.02 ? 1649 THR A C   1 
ATOM   191  O  O   . THR A 1 27 ? 32.126 16.642 12.243  1.00 24.88 ? 1649 THR A O   1 
ATOM   192  C  CB  . THR A 1 27 ? 32.931 19.643 13.381  1.00 21.80 ? 1649 THR A CB  1 
ATOM   193  O  OG1 . THR A 1 27 ? 33.020 19.643 11.944  1.00 23.27 ? 1649 THR A OG1 1 
ATOM   194  C  CG2 . THR A 1 27 ? 34.128 20.407 14.022  1.00 25.32 ? 1649 THR A CG2 1 
ATOM   195  N  N   . LEU A 1 28 ? 30.534 17.875 13.236  1.00 26.59 ? 1650 LEU A N   1 
ATOM   196  C  CA  . LEU A 1 28 ? 29.351 17.368 12.483  1.00 26.12 ? 1650 LEU A CA  1 
ATOM   197  C  C   . LEU A 1 28 ? 29.537 17.550 10.985  1.00 28.86 ? 1650 LEU A C   1 
ATOM   198  O  O   . LEU A 1 28 ? 29.141 16.700 10.204  1.00 31.59 ? 1650 LEU A O   1 
ATOM   199  C  CB  . LEU A 1 28 ? 28.129 18.133 12.971  1.00 26.26 ? 1650 LEU A CB  1 
ATOM   200  C  CG  . LEU A 1 28 ? 26.741 17.674 12.563  1.00 33.07 ? 1650 LEU A CG  1 
ATOM   201  C  CD1 . LEU A 1 28 ? 26.539 16.288 13.093  1.00 27.33 ? 1650 LEU A CD1 1 
ATOM   202  C  CD2 . LEU A 1 28 ? 25.672 18.647 13.124  1.00 37.08 ? 1650 LEU A CD2 1 
ATOM   203  N  N   . LEU A 1 29 ? 30.230 18.620 10.561  1.00 27.53 ? 1651 LEU A N   1 
ATOM   204  C  CA  . LEU A 1 29 ? 30.575 18.798 9.145   1.00 27.95 ? 1651 LEU A CA  1 
ATOM   205  C  C   . LEU A 1 29 ? 31.582 17.879 8.540   1.00 26.15 ? 1651 LEU A C   1 
ATOM   206  O  O   . LEU A 1 29 ? 31.523 17.623 7.323   1.00 30.72 ? 1651 LEU A O   1 
ATOM   207  C  CB  . LEU A 1 29 ? 31.112 20.217 8.878   1.00 32.97 ? 1651 LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 29 ? 30.109 21.354 8.777   1.00 25.83 ? 1651 LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 29 ? 30.685 22.715 8.758   1.00 22.91 ? 1651 LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 29 ? 29.178 21.113 7.502   1.00 24.58 ? 1651 LEU A CD2 1 
ATOM   211  N  N   . GLY A 1 30 ? 32.570 17.425 9.310   1.00 23.23 ? 1652 GLY A N   1 
ATOM   212  C  CA  . GLY A 1 30 ? 33.602 16.600 8.883   1.00 26.90 ? 1652 GLY A CA  1 
ATOM   213  C  C   . GLY A 1 30 ? 34.490 17.096 7.801   1.00 25.19 ? 1652 GLY A C   1 
ATOM   214  O  O   . GLY A 1 30 ? 35.095 16.297 7.108   1.00 29.11 ? 1652 GLY A O   1 
ATOM   215  N  N   . ALA A 1 31 ? 34.534 18.432 7.672   1.00 22.05 ? 1653 ALA A N   1 
ATOM   216  C  CA  . ALA A 1 31 ? 35.253 19.113 6.622   1.00 20.12 ? 1653 ALA A CA  1 
ATOM   217  C  C   . ALA A 1 31 ? 35.442 20.575 7.005   1.00 16.16 ? 1653 ALA A C   1 
ATOM   218  O  O   . ALA A 1 31 ? 34.633 21.128 7.750   1.00 18.32 ? 1653 ALA A O   1 
ATOM   219  C  CB  . ALA A 1 31 ? 34.397 19.104 5.357   1.00 24.07 ? 1653 ALA A CB  1 
ATOM   220  N  N   . ILE A 1 32 ? 36.452 21.217 6.433   1.00 17.28 ? 1654 ILE A N   1 
ATOM   221  C  CA  . ILE A 1 32 ? 36.740 22.655 6.655   1.00 16.30 ? 1654 ILE A CA  1 
ATOM   222  C  C   . ILE A 1 32 ? 35.894 23.419 5.674   1.00 16.87 ? 1654 ILE A C   1 
ATOM   223  O  O   . ILE A 1 32 ? 36.137 23.317 4.451   1.00 16.74 ? 1654 ILE A O   1 
ATOM   224  C  CB  . ILE A 1 32 ? 38.259 22.935 6.482   1.00 17.12 ? 1654 ILE A CB  1 
ATOM   225  C  CG1 . ILE A 1 32 ? 39.085 22.122 7.488   1.00 16.94 ? 1654 ILE A CG1 1 
ATOM   226  C  CG2 . ILE A 1 32 ? 38.520 24.450 6.641   1.00 17.66 ? 1654 ILE A CG2 1 
ATOM   227  C  CD1 . ILE A 1 32 ? 38.784 22.376 8.946   1.00 19.78 ? 1654 ILE A CD1 1 
ATOM   228  N  N   . ILE A 1 33 ? 34.902 24.171 6.126   1.00 16.76 ? 1655 ILE A N   1 
ATOM   229  C  CA  . ILE A 1 33 ? 33.977 24.868 5.270   1.00 16.08 ? 1655 ILE A CA  1 
ATOM   230  C  C   . ILE A 1 33 ? 34.080 26.372 5.476   1.00 16.55 ? 1655 ILE A C   1 
ATOM   231  O  O   . ILE A 1 33 ? 34.209 26.846 6.639   1.00 16.49 ? 1655 ILE A O   1 
ATOM   232  C  CB  . ILE A 1 33 ? 32.572 24.396 5.608   1.00 16.56 ? 1655 ILE A CB  1 
ATOM   233  C  CG1 . ILE A 1 33 ? 32.404 22.892 5.406   1.00 19.11 ? 1655 ILE A CG1 1 
ATOM   234  C  CG2 . ILE A 1 33 ? 31.481 25.122 4.850   1.00 19.02 ? 1655 ILE A CG2 1 
ATOM   235  C  CD1 . ILE A 1 33 ? 32.641 22.329 3.984   1.00 20.03 ? 1655 ILE A CD1 1 
ATOM   236  N  N   . ILE A 1 34 ? 33.913 27.123 4.409   1.00 16.78 ? 1656 ILE A N   1 
ATOM   237  C  CA  . ILE A 1 34 ? 33.821 28.565 4.477   1.00 17.09 ? 1656 ILE A CA  1 
ATOM   238  C  C   . ILE A 1 34 ? 32.436 28.938 4.949   1.00 16.12 ? 1656 ILE A C   1 
ATOM   239  O  O   . ILE A 1 34 ? 31.411 28.637 4.297   1.00 18.41 ? 1656 ILE A O   1 
ATOM   240  C  CB  . ILE A 1 34 ? 34.136 29.234 3.147   1.00 18.10 ? 1656 ILE A CB  1 
ATOM   241  C  CG1 . ILE A 1 34 ? 35.574 28.900 2.793   1.00 19.07 ? 1656 ILE A CG1 1 
ATOM   242  C  CG2 . ILE A 1 34 ? 33.924 30.779 3.288   1.00 20.41 ? 1656 ILE A CG2 1 
ATOM   243  C  CD1 . ILE A 1 34 ? 36.063 29.397 1.371   1.00 24.97 ? 1656 ILE A CD1 1 
ATOM   244  N  N   . HIS A 1 35 ? 32.330 29.572 6.138   1.00 16.94 ? 1657 HIS A N   1 
ATOM   245  C  CA  . HIS A 1 35 ? 31.035 30.011 6.668   1.00 16.95 ? 1657 HIS A CA  1 
ATOM   246  C  C   . HIS A 1 35 ? 30.611 31.346 6.061   1.00 17.69 ? 1657 HIS A C   1 
ATOM   247  O  O   . HIS A 1 35 ? 29.420 31.572 5.776   1.00 18.67 ? 1657 HIS A O   1 
ATOM   248  C  CB  . HIS A 1 35 ? 31.116 30.147 8.187   1.00 15.16 ? 1657 HIS A CB  1 
ATOM   249  C  CG  . HIS A 1 35 ? 29.966 30.904 8.789   1.00 16.36 ? 1657 HIS A CG  1 
ATOM   250  N  ND1 . HIS A 1 35 ? 28.673 30.370 8.836   1.00 20.48 ? 1657 HIS A ND1 1 
ATOM   251  C  CD2 . HIS A 1 35 ? 29.880 32.155 9.334   1.00 17.57 ? 1657 HIS A CD2 1 
ATOM   252  C  CE1 . HIS A 1 35 ? 27.867 31.285 9.370   1.00 22.45 ? 1657 HIS A CE1 1 
ATOM   253  N  NE2 . HIS A 1 35 ? 28.565 32.367 9.677   1.00 20.80 ? 1657 HIS A NE2 1 
ATOM   254  N  N   . GLU A 1 36 ? 31.553 32.268 5.883   1.00 16.77 ? 1658 GLU A N   1 
ATOM   255  C  CA  . GLU A 1 36 ? 31.238 33.629 5.367   1.00 21.34 ? 1658 GLU A CA  1 
ATOM   256  C  C   . GLU A 1 36 ? 32.427 34.221 4.658   1.00 17.84 ? 1658 GLU A C   1 
ATOM   257  O  O   . GLU A 1 36 ? 33.585 34.008 5.078   1.00 17.77 ? 1658 GLU A O   1 
ATOM   258  C  CB  . GLU A 1 36 ? 30.740 34.525 6.522   1.00 22.84 ? 1658 GLU A CB  1 
ATOM   259  C  CG  . GLU A 1 36 ? 30.233 35.929 6.062   1.00 27.76 ? 1658 GLU A CG  1 
ATOM   260  C  CD  . GLU A 1 36 ? 29.611 36.726 7.176   1.00 33.47 ? 1658 GLU A CD  1 
ATOM   261  O  OE1 . GLU A 1 36 ? 29.389 36.158 8.249   1.00 33.32 ? 1658 GLU A OE1 1 
ATOM   262  O  OE2 . GLU A 1 36 ? 29.314 37.941 6.960   1.00 36.40 ? 1658 GLU A OE2 1 
ATOM   263  N  N   . VAL A 1 37 ? 32.112 34.950 3.585   1.00 19.34 ? 1659 VAL A N   1 
ATOM   264  C  CA  . VAL A 1 37 ? 33.041 35.781 2.833   1.00 20.49 ? 1659 VAL A CA  1 
ATOM   265  C  C   . VAL A 1 37 ? 32.692 37.251 3.128   1.00 21.36 ? 1659 VAL A C   1 
ATOM   266  O  O   . VAL A 1 37 ? 31.556 37.705 2.880   1.00 23.10 ? 1659 VAL A O   1 
ATOM   267  C  CB  . VAL A 1 37 ? 32.989 35.497 1.354   1.00 19.67 ? 1659 VAL A CB  1 
ATOM   268  C  CG1 . VAL A 1 37 ? 34.034 36.334 0.593   1.00 24.27 ? 1659 VAL A CG1 1 
ATOM   269  C  CG2 . VAL A 1 37 ? 33.205 33.960 1.070   1.00 22.76 ? 1659 VAL A CG2 1 
ATOM   270  N  N   . TYR A 1 38 ? 33.606 37.936 3.775   1.00 22.58 ? 1660 TYR A N   1 
ATOM   271  C  CA  . TYR A 1 38 ? 33.315 39.279 4.311   1.00 23.52 ? 1660 TYR A CA  1 
ATOM   272  C  C   . TYR A 1 38 ? 33.370 40.337 3.229   1.00 26.11 ? 1660 TYR A C   1 
ATOM   273  O  O   . TYR A 1 38 ? 34.306 40.395 2.442   1.00 25.45 ? 1660 TYR A O   1 
ATOM   274  C  CB  . TYR A 1 38 ? 34.284 39.599 5.458   1.00 23.70 ? 1660 TYR A CB  1 
ATOM   275  C  CG  . TYR A 1 38 ? 34.043 38.757 6.669   1.00 21.71 ? 1660 TYR A CG  1 
ATOM   276  C  CD1 . TYR A 1 38 ? 32.868 38.877 7.360   1.00 24.03 ? 1660 TYR A CD1 1 
ATOM   277  C  CD2 . TYR A 1 38 ? 34.951 37.813 7.099   1.00 27.08 ? 1660 TYR A CD2 1 
ATOM   278  C  CE1 . TYR A 1 38 ? 32.643 38.054 8.481   1.00 26.32 ? 1660 TYR A CE1 1 
ATOM   279  C  CE2 . TYR A 1 38 ? 34.744 37.049 8.165   1.00 25.53 ? 1660 TYR A CE2 1 
ATOM   280  C  CZ  . TYR A 1 38 ? 33.628 37.166 8.874   1.00 24.39 ? 1660 TYR A CZ  1 
ATOM   281  O  OH  . TYR A 1 38 ? 33.430 36.335 9.975   1.00 35.81 ? 1660 TYR A OH  1 
ATOM   282  N  N   . GLU A 1 39 ? 32.429 41.278 3.264   1.00 28.84 ? 1661 GLU A N   1 
ATOM   283  C  CA  . GLU A 1 39 ? 32.402 42.344 2.272   1.00 28.13 ? 1661 GLU A CA  1 
ATOM   284  C  C   . GLU A 1 39 ? 33.666 43.163 2.421   1.00 26.79 ? 1661 GLU A C   1 
ATOM   285  O  O   . GLU A 1 39 ? 34.134 43.398 3.538   1.00 31.85 ? 1661 GLU A O   1 
ATOM   286  C  CB  A GLU A 1 39 ? 31.127 43.208 2.421   0.50 30.43 ? 1661 GLU A CB  1 
ATOM   287  C  CB  B GLU A 1 39 ? 31.161 43.256 2.406   0.50 30.14 ? 1661 GLU A CB  1 
ATOM   288  C  CG  A GLU A 1 39 ? 29.864 42.360 2.176   0.50 32.75 ? 1661 GLU A CG  1 
ATOM   289  C  CG  B GLU A 1 39 ? 29.908 42.685 1.728   0.50 35.06 ? 1661 GLU A CG  1 
ATOM   290  C  CD  A GLU A 1 39 ? 28.555 43.134 2.092   0.50 40.14 ? 1661 GLU A CD  1 
ATOM   291  C  CD  B GLU A 1 39 ? 30.066 42.502 0.217   0.50 39.48 ? 1661 GLU A CD  1 
ATOM   292  O  OE1 A GLU A 1 39 ? 28.555 44.382 1.929   0.50 33.20 ? 1661 GLU A OE1 1 
ATOM   293  O  OE1 B GLU A 1 39 ? 30.476 43.470 -0.470  0.50 36.91 ? 1661 GLU A OE1 1 
ATOM   294  O  OE2 A GLU A 1 39 ? 27.510 42.448 2.177   0.50 36.62 ? 1661 GLU A OE2 1 
ATOM   295  O  OE2 B GLU A 1 39 ? 29.774 41.391 -0.280  0.50 40.95 ? 1661 GLU A OE2 1 
ATOM   296  N  N   . GLU A 1 40 ? 34.260 43.519 1.286   1.00 29.49 ? 1662 GLU A N   1 
ATOM   297  C  CA  . GLU A 1 40 ? 35.462 44.352 1.218   1.00 32.23 ? 1662 GLU A CA  1 
ATOM   298  C  C   . GLU A 1 40 ? 36.739 43.615 1.558   1.00 31.61 ? 1662 GLU A C   1 
ATOM   299  O  O   . GLU A 1 40 ? 37.822 44.189 1.487   1.00 33.06 ? 1662 GLU A O   1 
ATOM   300  C  CB  . GLU A 1 40 ? 35.375 45.640 2.082   1.00 37.31 ? 1662 GLU A CB  1 
ATOM   301  C  CG  . GLU A 1 40 ? 34.141 46.522 1.857   1.00 45.65 ? 1662 GLU A CG  1 
ATOM   302  C  CD  . GLU A 1 40 ? 33.921 46.875 0.396   1.00 60.41 ? 1662 GLU A CD  1 
ATOM   303  O  OE1 . GLU A 1 40 ? 34.917 47.122 -0.325  1.00 74.16 ? 1662 GLU A OE1 1 
ATOM   304  O  OE2 . GLU A 1 40 ? 32.748 46.902 -0.032  1.00 69.95 ? 1662 GLU A OE2 1 
ATOM   305  N  N   . GLY A 1 41 ? 36.637 42.336 1.891   1.00 22.32 ? 1663 GLY A N   1 
ATOM   306  C  CA  . GLY A 1 41 ? 37.846 41.528 2.101   1.00 22.81 ? 1663 GLY A CA  1 
ATOM   307  C  C   . GLY A 1 41 ? 38.394 40.962 0.785   1.00 19.67 ? 1663 GLY A C   1 
ATOM   308  O  O   . GLY A 1 41 ? 37.769 41.093 -0.279  1.00 22.98 ? 1663 GLY A O   1 
ATOM   309  N  N   . ALA A 1 42 ? 39.545 40.331 0.866   1.00 20.18 ? 1664 ALA A N   1 
ATOM   310  C  CA  . ALA A 1 42 ? 40.206 39.823 -0.327  1.00 22.34 ? 1664 ALA A CA  1 
ATOM   311  C  C   . ALA A 1 42 ? 39.431 38.758 -1.068  1.00 21.65 ? 1664 ALA A C   1 
ATOM   312  O  O   . ALA A 1 42 ? 39.325 38.799 -2.276  1.00 22.35 ? 1664 ALA A O   1 
ATOM   313  C  CB  . ALA A 1 42 ? 41.604 39.326 -0.016  1.00 22.92 ? 1664 ALA A CB  1 
ATOM   314  N  N   . ALA A 1 43 ? 38.848 37.837 -0.333  1.00 23.92 ? 1665 ALA A N   1 
ATOM   315  C  CA  . ALA A 1 43 ? 38.076 36.809 -0.960  1.00 18.97 ? 1665 ALA A CA  1 
ATOM   316  C  C   . ALA A 1 43 ? 36.795 37.344 -1.661  1.00 23.25 ? 1665 ALA A C   1 
ATOM   317  O  O   . ALA A 1 43 ? 36.387 36.880 -2.742  1.00 22.71 ? 1665 ALA A O   1 
ATOM   318  C  CB  . ALA A 1 43 ? 37.721 35.686 0.116   1.00 21.27 ? 1665 ALA A CB  1 
ATOM   319  N  N   . CYS A 1 44 ? 36.171 38.356 -1.060  1.00 20.83 ? 1666 CYS A N   1 
ATOM   320  C  CA  . CYS A 1 44 ? 34.992 38.996 -1.703  1.00 22.28 ? 1666 CYS A CA  1 
ATOM   321  C  C   . CYS A 1 44 ? 35.364 39.663 -3.019  1.00 24.63 ? 1666 CYS A C   1 
ATOM   322  O  O   . CYS A 1 44 ? 34.688 39.518 -4.042  1.00 25.39 ? 1666 CYS A O   1 
ATOM   323  C  CB  . CYS A 1 44 ? 34.428 40.010 -0.730  1.00 21.93 ? 1666 CYS A CB  1 
ATOM   324  S  SG  . CYS A 1 44 ? 33.043 40.962 -1.391  1.00 31.84 ? 1666 CYS A SG  1 
ATOM   325  N  N   . LYS A 1 45 ? 36.464 40.396 -2.988  1.00 23.11 ? 1667 LYS A N   1 
ATOM   326  C  CA  . LYS A 1 45 ? 36.870 41.172 -4.148  1.00 25.19 ? 1667 LYS A CA  1 
ATOM   327  C  C   . LYS A 1 45 ? 37.278 40.244 -5.293  1.00 26.63 ? 1667 LYS A C   1 
ATOM   328  O  O   . LYS A 1 45 ? 37.032 40.541 -6.459  1.00 29.97 ? 1667 LYS A O   1 
ATOM   329  C  CB  A LYS A 1 45 ? 38.021 42.111 -3.774  0.50 24.45 ? 1667 LYS A CB  1 
ATOM   330  C  CB  B LYS A 1 45 ? 38.017 42.118 -3.771  0.50 26.19 ? 1667 LYS A CB  1 
ATOM   331  C  CG  A LYS A 1 45 ? 37.635 43.170 -2.768  0.50 20.87 ? 1667 LYS A CG  1 
ATOM   332  C  CG  B LYS A 1 45 ? 37.566 43.498 -3.340  0.50 33.43 ? 1667 LYS A CG  1 
ATOM   333  C  CD  A LYS A 1 45 ? 38.801 44.096 -2.402  0.50 28.59 ? 1667 LYS A CD  1 
ATOM   334  C  CD  B LYS A 1 45 ? 36.658 43.500 -2.112  0.50 35.11 ? 1667 LYS A CD  1 
ATOM   335  C  CE  A LYS A 1 45 ? 38.321 45.374 -1.716  0.50 32.79 ? 1667 LYS A CE  1 
ATOM   336  C  CE  B LYS A 1 45 ? 35.770 44.734 -2.137  0.50 42.28 ? 1667 LYS A CE  1 
ATOM   337  N  N   . ASP A 1 46 ? 37.906 39.116 -4.954  1.00 26.14 ? 1668 ASP A N   1 
ATOM   338  C  CA  . ASP A 1 46 ? 38.178 38.101 -5.959  1.00 23.35 ? 1668 ASP A CA  1 
ATOM   339  C  C   . ASP A 1 46 ? 36.899 37.576 -6.600  1.00 23.57 ? 1668 ASP A C   1 
ATOM   340  O  O   . ASP A 1 46 ? 36.859 37.337 -7.796  1.00 28.04 ? 1668 ASP A O   1 
ATOM   341  C  CB  . ASP A 1 46 ? 39.107 37.010 -5.389  1.00 23.08 ? 1668 ASP A CB  1 
ATOM   342  C  CG  . ASP A 1 46 ? 39.326 35.876 -6.366  1.00 27.98 ? 1668 ASP A CG  1 
ATOM   343  O  OD1 . ASP A 1 46 ? 40.224 35.990 -7.232  1.00 29.99 ? 1668 ASP A OD1 1 
ATOM   344  O  OD2 . ASP A 1 46 ? 38.504 34.943 -6.348  1.00 25.73 ? 1668 ASP A OD2 1 
ATOM   345  N  N   . GLY A 1 47 ? 35.850 37.401 -5.814  1.00 22.89 ? 1669 GLY A N   1 
ATOM   346  C  CA  . GLY A 1 47 ? 34.527 37.040 -6.332  1.00 24.70 ? 1669 GLY A CA  1 
ATOM   347  C  C   . GLY A 1 47 ? 34.184 35.569 -6.470  1.00 25.91 ? 1669 GLY A C   1 
ATOM   348  O  O   . GLY A 1 47 ? 32.997 35.210 -6.541  1.00 35.87 ? 1669 GLY A O   1 
ATOM   349  N  N   . ARG A 1 48 ? 35.187 34.710 -6.472  1.00 22.77 ? 1670 ARG A N   1 
ATOM   350  C  CA  . ARG A 1 48 ? 34.994 33.286 -6.781  1.00 22.06 ? 1670 ARG A CA  1 
ATOM   351  C  C   . ARG A 1 48 ? 34.606 32.410 -5.587  1.00 23.34 ? 1670 ARG A C   1 
ATOM   352  O  O   . ARG A 1 48 ? 33.811 31.496 -5.765  1.00 29.51 ? 1670 ARG A O   1 
ATOM   353  C  CB  . ARG A 1 48 ? 36.270 32.748 -7.447  1.00 23.33 ? 1670 ARG A CB  1 
ATOM   354  C  CG  . ARG A 1 48 ? 36.522 33.445 -8.786  1.00 27.32 ? 1670 ARG A CG  1 
ATOM   355  C  CD  . ARG A 1 48 ? 37.734 32.896 -9.495  1.00 28.52 ? 1670 ARG A CD  1 
ATOM   356  N  NE  . ARG A 1 48 ? 38.943 33.362 -8.837  1.00 29.26 ? 1670 ARG A NE  1 
ATOM   357  C  CZ  . ARG A 1 48 ? 40.187 33.073 -9.225  1.00 26.86 ? 1670 ARG A CZ  1 
ATOM   358  N  NH1 . ARG A 1 48 ? 40.386 32.264 -10.247 1.00 32.28 ? 1670 ARG A NH1 1 
ATOM   359  N  NH2 . ARG A 1 48 ? 41.218 33.553 -8.559  1.00 26.79 ? 1670 ARG A NH2 1 
ATOM   360  N  N   . LEU A 1 49 ? 35.110 32.705 -4.399  1.00 20.28 ? 1671 LEU A N   1 
ATOM   361  C  CA  . LEU A 1 49 ? 34.814 31.882 -3.215  1.00 17.63 ? 1671 LEU A CA  1 
ATOM   362  C  C   . LEU A 1 49 ? 33.415 32.123 -2.701  1.00 21.04 ? 1671 LEU A C   1 
ATOM   363  O  O   . LEU A 1 49 ? 32.985 33.251 -2.611  1.00 22.06 ? 1671 LEU A O   1 
ATOM   364  C  CB  . LEU A 1 49 ? 35.790 32.155 -2.092  1.00 20.89 ? 1671 LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 49 ? 37.230 31.742 -2.286  1.00 24.37 ? 1671 LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 49 ? 38.116 32.172 -1.147  1.00 28.62 ? 1671 LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 49 ? 37.333 30.226 -2.444  1.00 28.23 ? 1671 LEU A CD2 1 
ATOM   368  N  N   . TRP A 1 50 ? 32.713 31.055 -2.319  1.00 19.01 ? 1672 TRP A N   1 
ATOM   369  C  CA  . TRP A 1 50 ? 31.359 31.148 -1.784  1.00 19.26 ? 1672 TRP A CA  1 
ATOM   370  C  C   . TRP A 1 50 ? 31.272 30.475 -0.451  1.00 18.14 ? 1672 TRP A C   1 
ATOM   371  O  O   . TRP A 1 50 ? 31.927 29.464 -0.172  1.00 18.23 ? 1672 TRP A O   1 
ATOM   372  C  CB  . TRP A 1 50 ? 30.303 30.444 -2.640  1.00 20.19 ? 1672 TRP A CB  1 
ATOM   373  C  CG  . TRP A 1 50 ? 29.983 30.957 -3.968  1.00 20.83 ? 1672 TRP A CG  1 
ATOM   374  C  CD1 . TRP A 1 50 ? 30.479 32.044 -4.548  1.00 24.68 ? 1672 TRP A CD1 1 
ATOM   375  C  CD2 . TRP A 1 50 ? 29.087 30.329 -4.901  1.00 22.47 ? 1672 TRP A CD2 1 
ATOM   376  N  NE1 . TRP A 1 50 ? 29.948 32.175 -5.843  1.00 30.47 ? 1672 TRP A NE1 1 
ATOM   377  C  CE2 . TRP A 1 50 ? 29.079 31.129 -6.058  1.00 28.78 ? 1672 TRP A CE2 1 
ATOM   378  C  CE3 . TRP A 1 50 ? 28.261 29.197 -4.846  1.00 22.46 ? 1672 TRP A CE3 1 
ATOM   379  C  CZ2 . TRP A 1 50 ? 28.273 30.817 -7.182  1.00 26.84 ? 1672 TRP A CZ2 1 
ATOM   380  C  CZ3 . TRP A 1 50 ? 27.491 28.885 -5.952  1.00 27.26 ? 1672 TRP A CZ3 1 
ATOM   381  C  CH2 . TRP A 1 50 ? 27.523 29.682 -7.106  1.00 30.24 ? 1672 TRP A CH2 1 
ATOM   382  N  N   . ALA A 1 51 ? 30.434 30.997 0.449   1.00 16.64 ? 1673 ALA A N   1 
ATOM   383  C  CA  . ALA A 1 51 ? 30.103 30.245 1.652   1.00 16.66 ? 1673 ALA A CA  1 
ATOM   384  C  C   . ALA A 1 51 ? 29.668 28.856 1.254   1.00 17.00 ? 1673 ALA A C   1 
ATOM   385  O  O   . ALA A 1 51 ? 28.931 28.694 0.291   1.00 18.04 ? 1673 ALA A O   1 
ATOM   386  C  CB  . ALA A 1 51 ? 28.994 30.974 2.459   1.00 18.31 ? 1673 ALA A CB  1 
ATOM   387  N  N   . GLY A 1 52 ? 30.097 27.864 2.041   1.00 14.92 ? 1674 GLY A N   1 
ATOM   388  C  CA  . GLY A 1 52 ? 29.806 26.506 1.816   1.00 16.44 ? 1674 GLY A CA  1 
ATOM   389  C  C   . GLY A 1 52 ? 30.898 25.741 1.090   1.00 17.32 ? 1674 GLY A C   1 
ATOM   390  O  O   . GLY A 1 52 ? 30.879 24.509 1.114   1.00 17.18 ? 1674 GLY A O   1 
ATOM   391  N  N   . ASP A 1 53 ? 31.818 26.455 0.465   1.00 15.42 ? 1675 ASP A N   1 
ATOM   392  C  CA  . ASP A 1 53 ? 32.941 25.768 -0.205  1.00 15.54 ? 1675 ASP A CA  1 
ATOM   393  C  C   . ASP A 1 53 ? 33.791 25.133 0.851   1.00 14.79 ? 1675 ASP A C   1 
ATOM   394  O  O   . ASP A 1 53 ? 34.012 25.662 1.955   1.00 16.38 ? 1675 ASP A O   1 
ATOM   395  C  CB  . ASP A 1 53 ? 33.751 26.826 -0.994  1.00 17.18 ? 1675 ASP A CB  1 
ATOM   396  C  CG  . ASP A 1 53 ? 33.029 27.373 -2.238  1.00 17.19 ? 1675 ASP A CG  1 
ATOM   397  O  OD1 . ASP A 1 53 ? 31.951 26.869 -2.620  1.00 18.92 ? 1675 ASP A OD1 1 
ATOM   398  O  OD2 . ASP A 1 53 ? 33.609 28.319 -2.851  1.00 20.34 ? 1675 ASP A OD2 1 
ATOM   399  N  N   . GLN A 1 54 ? 34.333 23.997 0.520   1.00 15.73 ? 1676 GLN A N   1 
ATOM   400  C  CA  . GLN A 1 54 ? 35.230 23.204 1.359   1.00 16.35 ? 1676 GLN A CA  1 
ATOM   401  C  C   . GLN A 1 54 ? 36.643 23.466 0.937   1.00 16.86 ? 1676 GLN A C   1 
ATOM   402  O  O   . GLN A 1 54 ? 36.971 23.356 -0.253  1.00 16.53 ? 1676 GLN A O   1 
ATOM   403  C  CB  . GLN A 1 54 ? 34.971 21.676 1.230   1.00 15.89 ? 1676 GLN A CB  1 
ATOM   404  C  CG  . GLN A 1 54 ? 35.849 20.871 2.103   1.00 17.48 ? 1676 GLN A CG  1 
ATOM   405  C  CD  . GLN A 1 54 ? 35.640 19.397 1.997   1.00 19.44 ? 1676 GLN A CD  1 
ATOM   406  O  OE1 . GLN A 1 54 ? 34.672 18.940 1.394   1.00 21.01 ? 1676 GLN A OE1 1 
ATOM   407  N  NE2 . GLN A 1 54 ? 36.561 18.601 2.635   1.00 20.18 ? 1676 GLN A NE2 1 
ATOM   408  N  N   . ILE A 1 55 ? 37.514 23.753 1.879   1.00 15.97 ? 1677 ILE A N   1 
ATOM   409  C  CA  . ILE A 1 55 ? 38.944 23.870 1.596   1.00 15.12 ? 1677 ILE A CA  1 
ATOM   410  C  C   . ILE A 1 55 ? 39.591 22.483 1.641   1.00 17.67 ? 1677 ILE A C   1 
ATOM   411  O  O   . ILE A 1 55 ? 39.667 21.868 2.694   1.00 18.70 ? 1677 ILE A O   1 
ATOM   412  C  CB  . ILE A 1 55 ? 39.667 24.802 2.584   1.00 16.16 ? 1677 ILE A CB  1 
ATOM   413  C  CG1 . ILE A 1 55 ? 39.049 26.165 2.565   1.00 17.57 ? 1677 ILE A CG1 1 
ATOM   414  C  CG2 . ILE A 1 55 ? 41.150 24.891 2.172   1.00 19.85 ? 1677 ILE A CG2 1 
ATOM   415  C  CD1 . ILE A 1 55 ? 39.640 27.178 3.611   1.00 19.12 ? 1677 ILE A CD1 1 
ATOM   416  N  N   . LEU A 1 56 ? 39.948 21.950 0.487   1.00 16.21 ? 1678 LEU A N   1 
ATOM   417  C  CA  . LEU A 1 56 ? 40.651 20.689 0.356   1.00 17.94 ? 1678 LEU A CA  1 
ATOM   418  C  C   . LEU A 1 56 ? 42.132 20.756 0.630   1.00 19.11 ? 1678 LEU A C   1 
ATOM   419  O  O   . LEU A 1 56 ? 42.696 19.886 1.243   1.00 17.99 ? 1678 LEU A O   1 
ATOM   420  C  CB  . LEU A 1 56 ? 40.456 20.065 -1.018  1.00 16.72 ? 1678 LEU A CB  1 
ATOM   421  C  CG  . LEU A 1 56 ? 39.045 19.881 -1.527  1.00 16.24 ? 1678 LEU A CG  1 
ATOM   422  C  CD1 . LEU A 1 56 ? 39.083 19.303 -2.932  1.00 18.50 ? 1678 LEU A CD1 1 
ATOM   423  C  CD2 . LEU A 1 56 ? 38.248 18.934 -0.567  1.00 19.38 ? 1678 LEU A CD2 1 
ATOM   424  N  N   . GLU A 1 57 ? 42.763 21.791 0.123   1.00 17.35 ? 1679 GLU A N   1 
ATOM   425  C  CA  . GLU A 1 57 ? 44.213 21.953 0.250   1.00 19.09 ? 1679 GLU A CA  1 
ATOM   426  C  C   . GLU A 1 57 ? 44.540 23.409 0.246   1.00 18.07 ? 1679 GLU A C   1 
ATOM   427  O  O   . GLU A 1 57 ? 43.834 24.209 -0.361  1.00 18.09 ? 1679 GLU A O   1 
ATOM   428  C  CB  . GLU A 1 57 ? 44.948 21.351 -0.956  1.00 20.37 ? 1679 GLU A CB  1 
ATOM   429  C  CG  . GLU A 1 57 ? 44.615 19.955 -1.366  1.00 24.23 ? 1679 GLU A CG  1 
ATOM   430  C  CD  . GLU A 1 57 ? 45.479 19.405 -2.508  1.00 31.51 ? 1679 GLU A CD  1 
ATOM   431  O  OE1 . GLU A 1 57 ? 46.395 20.096 -3.022  1.00 30.86 ? 1679 GLU A OE1 1 
ATOM   432  O  OE2 . GLU A 1 57 ? 45.192 18.256 -2.910  1.00 34.90 ? 1679 GLU A OE2 1 
ATOM   433  N  N   . VAL A 1 58 ? 45.684 23.730 0.845   1.00 19.13 ? 1680 VAL A N   1 
ATOM   434  C  CA  . VAL A 1 58 ? 46.216 25.104 0.899   1.00 18.90 ? 1680 VAL A CA  1 
ATOM   435  C  C   . VAL A 1 58 ? 47.709 25.025 0.576   1.00 19.19 ? 1680 VAL A C   1 
ATOM   436  O  O   . VAL A 1 58 ? 48.442 24.387 1.311   1.00 20.54 ? 1680 VAL A O   1 
ATOM   437  C  CB  A VAL A 1 58 ? 45.829 25.845 2.147   0.50 24.36 ? 1680 VAL A CB  1 
ATOM   438  C  CB  B VAL A 1 58 ? 46.141 25.554 2.405   0.50 16.68 ? 1680 VAL A CB  1 
ATOM   439  C  CG1 A VAL A 1 58 ? 46.351 25.171 3.337   0.50 28.12 ? 1680 VAL A CG1 1 
ATOM   440  C  CG1 B VAL A 1 58 ? 46.779 26.914 2.589   0.50 18.07 ? 1680 VAL A CG1 1 
ATOM   441  C  CG2 A VAL A 1 58 ? 46.304 27.306 2.035   0.50 28.17 ? 1680 VAL A CG2 1 
ATOM   442  C  CG2 B VAL A 1 58 ? 44.713 25.516 2.982   0.50 18.12 ? 1680 VAL A CG2 1 
ATOM   443  N  N   . ASN A 1 59 ? 48.137 25.628 -0.510  1.00 23.29 ? 1681 ASN A N   1 
ATOM   444  C  CA  . ASN A 1 59 ? 49.576 25.614 -0.878  1.00 24.63 ? 1681 ASN A CA  1 
ATOM   445  C  C   . ASN A 1 59 ? 50.249 24.223 -0.701  1.00 30.28 ? 1681 ASN A C   1 
ATOM   446  O  O   . ASN A 1 59 ? 51.288 24.052 -0.032  1.00 36.35 ? 1681 ASN A O   1 
ATOM   447  C  CB  A ASN A 1 59 ? 50.338 26.662 -0.057  0.50 25.32 ? 1681 ASN A CB  1 
ATOM   448  C  CB  B ASN A 1 59 ? 50.314 26.676 -0.108  0.50 23.63 ? 1681 ASN A CB  1 
ATOM   449  C  CG  A ASN A 1 59 ? 49.957 28.107 -0.384  0.50 28.61 ? 1681 ASN A CG  1 
ATOM   450  C  CG  B ASN A 1 59 ? 49.960 28.046 -0.557  0.50 21.44 ? 1681 ASN A CG  1 
ATOM   451  O  OD1 A ASN A 1 59 ? 50.780 28.863 -0.909  0.50 37.38 ? 1681 ASN A OD1 1 
ATOM   452  O  OD1 B ASN A 1 59 ? 49.370 28.235 -1.613  0.50 24.61 ? 1681 ASN A OD1 1 
ATOM   453  N  ND2 A ASN A 1 59 ? 48.761 28.525 0.000   0.50 22.03 ? 1681 ASN A ND2 1 
ATOM   454  N  ND2 B ASN A 1 59 ? 50.362 29.045 0.226   0.50 25.70 ? 1681 ASN A ND2 1 
ATOM   455  N  N   . GLY A 1 60 ? 49.617 23.229 -1.252  1.00 31.69 ? 1682 GLY A N   1 
ATOM   456  C  CA  . GLY A 1 60 ? 50.164 21.873 -1.171  1.00 36.25 ? 1682 GLY A CA  1 
ATOM   457  C  C   . GLY A 1 60 ? 50.001 21.124 0.144   1.00 34.48 ? 1682 GLY A C   1 
ATOM   458  O  O   . GLY A 1 60 ? 50.551 20.035 0.309   1.00 36.73 ? 1682 GLY A O   1 
ATOM   459  N  N   . ILE A 1 61 ? 49.202 21.647 1.072   1.00 26.27 ? 1683 ILE A N   1 
ATOM   460  C  CA  . ILE A 1 61 ? 49.002 20.967 2.331   1.00 21.60 ? 1683 ILE A CA  1 
ATOM   461  C  C   . ILE A 1 61 ? 47.558 20.488 2.346   1.00 23.00 ? 1683 ILE A C   1 
ATOM   462  O  O   . ILE A 1 61 ? 46.620 21.271 2.145   1.00 22.20 ? 1683 ILE A O   1 
ATOM   463  C  CB  . ILE A 1 61 ? 49.302 21.871 3.468   1.00 22.62 ? 1683 ILE A CB  1 
ATOM   464  C  CG1 . ILE A 1 61 ? 50.758 22.399 3.429   1.00 26.00 ? 1683 ILE A CG1 1 
ATOM   465  C  CG2 . ILE A 1 61 ? 49.026 21.229 4.807   1.00 23.64 ? 1683 ILE A CG2 1 
ATOM   466  C  CD1 . ILE A 1 61 ? 50.971 23.552 4.379   1.00 34.45 ? 1683 ILE A CD1 1 
ATOM   467  N  N   . ASP A 1 62 ? 47.389 19.187 2.531   1.00 21.57 ? 1684 ASP A N   1 
ATOM   468  C  CA  . ASP A 1 62 ? 46.071 18.548 2.530   1.00 20.80 ? 1684 ASP A CA  1 
ATOM   469  C  C   . ASP A 1 62 ? 45.314 18.898 3.796   1.00 23.04 ? 1684 ASP A C   1 
ATOM   470  O  O   . ASP A 1 62 ? 45.825 18.716 4.914   1.00 24.91 ? 1684 ASP A O   1 
ATOM   471  C  CB  . ASP A 1 62 ? 46.289 17.033 2.408   1.00 23.03 ? 1684 ASP A CB  1 
ATOM   472  C  CG  . ASP A 1 62 ? 45.039 16.225 2.187   1.00 26.76 ? 1684 ASP A CG  1 
ATOM   473  O  OD1 . ASP A 1 62 ? 43.933 16.745 1.926   1.00 24.52 ? 1684 ASP A OD1 1 
ATOM   474  O  OD2 . ASP A 1 62 ? 45.160 14.943 2.202   1.00 29.92 ? 1684 ASP A OD2 1 
ATOM   475  N  N   . LEU A 1 63 ? 44.079 19.381 3.630   1.00 19.46 ? 1685 LEU A N   1 
ATOM   476  C  CA  . LEU A 1 63 ? 43.195 19.676 4.739   1.00 20.03 ? 1685 LEU A CA  1 
ATOM   477  C  C   . LEU A 1 63 ? 41.919 18.822 4.695   1.00 18.60 ? 1685 LEU A C   1 
ATOM   478  O  O   . LEU A 1 63 ? 41.014 18.999 5.513   1.00 19.97 ? 1685 LEU A O   1 
ATOM   479  C  CB  . LEU A 1 63 ? 42.809 21.150 4.801   1.00 20.09 ? 1685 LEU A CB  1 
ATOM   480  C  CG  . LEU A 1 63 ? 43.869 22.198 5.158   1.00 23.29 ? 1685 LEU A CG  1 
ATOM   481  C  CD1 . LEU A 1 63 ? 43.125 23.499 5.327   1.00 23.08 ? 1685 LEU A CD1 1 
ATOM   482  C  CD2 . LEU A 1 63 ? 44.653 21.832 6.412   1.00 27.28 ? 1685 LEU A CD2 1 
ATOM   483  N  N   . ARG A 1 64 ? 41.870 17.816 3.837   1.00 17.72 ? 1686 ARG A N   1 
ATOM   484  C  CA  . ARG A 1 64 ? 40.686 16.998 3.691   1.00 19.15 ? 1686 ARG A CA  1 
ATOM   485  C  C   . ARG A 1 64 ? 40.256 16.348 4.982   1.00 20.68 ? 1686 ARG A C   1 
ATOM   486  O  O   . ARG A 1 64 ? 39.081 16.236 5.214   1.00 26.70 ? 1686 ARG A O   1 
ATOM   487  C  CB  . ARG A 1 64 ? 40.837 15.934 2.575   1.00 18.26 ? 1686 ARG A CB  1 
ATOM   488  C  CG  . ARG A 1 64 ? 40.855 16.492 1.152   1.00 21.15 ? 1686 ARG A CG  1 
ATOM   489  C  CD  . ARG A 1 64 ? 41.376 15.475 0.092   1.00 19.29 ? 1686 ARG A CD  1 
ATOM   490  N  NE  . ARG A 1 64 ? 41.488 16.052 -1.248  1.00 22.31 ? 1686 ARG A NE  1 
ATOM   491  C  CZ  . ARG A 1 64 ? 42.514 16.753 -1.655  1.00 21.48 ? 1686 ARG A CZ  1 
ATOM   492  N  NH1 . ARG A 1 64 ? 43.523 16.968 -0.844  1.00 25.97 ? 1686 ARG A NH1 1 
ATOM   493  N  NH2 . ARG A 1 64 ? 42.518 17.231 -2.921  1.00 31.85 ? 1686 ARG A NH2 1 
ATOM   494  N  N   . LYS A 1 65 ? 41.202 15.916 5.803   1.00 20.60 ? 1687 LYS A N   1 
ATOM   495  C  CA  . LYS A 1 65 ? 40.857 15.260 7.053   1.00 22.58 ? 1687 LYS A CA  1 
ATOM   496  C  C   . LYS A 1 65 ? 41.334 16.023 8.278   1.00 24.35 ? 1687 LYS A C   1 
ATOM   497  O  O   . LYS A 1 65 ? 41.423 15.473 9.378   1.00 24.22 ? 1687 LYS A O   1 
ATOM   498  C  CB  . LYS A 1 65 ? 41.414 13.846 7.016   1.00 26.77 ? 1687 LYS A CB  1 
ATOM   499  C  CG  . LYS A 1 65 ? 40.725 12.950 5.973   1.00 33.65 ? 1687 LYS A CG  1 
ATOM   500  C  CD  . LYS A 1 65 ? 41.090 11.472 6.132   1.00 42.89 ? 1687 LYS A CD  1 
ATOM   501  C  CE  . LYS A 1 65 ? 40.457 10.881 7.366   1.00 46.45 ? 1687 LYS A CE  1 
ATOM   502  N  NZ  . LYS A 1 65 ? 38.979 11.016 7.341   1.00 45.94 ? 1687 LYS A NZ  1 
ATOM   503  N  N   . ALA A 1 66 ? 41.629 17.314 8.105   1.00 21.69 ? 1688 ALA A N   1 
ATOM   504  C  CA  . ALA A 1 66 ? 42.134 18.128 9.199   1.00 19.44 ? 1688 ALA A CA  1 
ATOM   505  C  C   . ALA A 1 66 ? 41.058 18.399 10.246  1.00 18.45 ? 1688 ALA A C   1 
ATOM   506  O  O   . ALA A 1 66 ? 39.889 18.623 9.893   1.00 19.91 ? 1688 ALA A O   1 
ATOM   507  C  CB  . ALA A 1 66 ? 42.625 19.456 8.670   1.00 19.75 ? 1688 ALA A CB  1 
ATOM   508  N  N   . THR A 1 67 ? 41.491 18.481 11.512  1.00 18.98 ? 1689 THR A N   1 
ATOM   509  C  CA  . THR A 1 67 ? 40.667 19.017 12.574  1.00 19.35 ? 1689 THR A CA  1 
ATOM   510  C  C   . THR A 1 67 ? 40.592 20.542 12.411  1.00 18.50 ? 1689 THR A C   1 
ATOM   511  O  O   . THR A 1 67 ? 41.372 21.172 11.691  1.00 18.46 ? 1689 THR A O   1 
ATOM   512  C  CB  . THR A 1 67 ? 41.224 18.758 13.967  1.00 21.42 ? 1689 THR A CB  1 
ATOM   513  O  OG1 . THR A 1 67 ? 42.456 19.448 14.130  1.00 21.82 ? 1689 THR A OG1 1 
ATOM   514  C  CG2 . THR A 1 67 ? 41.405 17.236 14.258  1.00 22.00 ? 1689 THR A CG2 1 
ATOM   515  N  N   . HIS A 1 68 ? 39.642 21.171 13.106  1.00 20.00 ? 1690 HIS A N   1 
ATOM   516  C  CA  . HIS A 1 68 ? 39.510 22.620 12.991  1.00 18.38 ? 1690 HIS A CA  1 
ATOM   517  C  C   . HIS A 1 68 ? 40.832 23.317 13.350  1.00 18.98 ? 1690 HIS A C   1 
ATOM   518  O  O   . HIS A 1 68 ? 41.368 24.143 12.645  1.00 18.34 ? 1690 HIS A O   1 
ATOM   519  C  CB  . HIS A 1 68 ? 38.416 23.122 13.931  1.00 19.27 ? 1690 HIS A CB  1 
ATOM   520  C  CG  . HIS A 1 68 ? 38.069 24.570 13.703  1.00 20.04 ? 1690 HIS A CG  1 
ATOM   521  N  ND1 . HIS A 1 68 ? 37.104 24.976 12.790  1.00 19.71 ? 1690 HIS A ND1 1 
ATOM   522  C  CD2 . HIS A 1 68 ? 38.618 25.713 14.205  1.00 19.03 ? 1690 HIS A CD2 1 
ATOM   523  C  CE1 . HIS A 1 68 ? 37.044 26.316 12.801  1.00 19.23 ? 1690 HIS A CE1 1 
ATOM   524  N  NE2 . HIS A 1 68 ? 37.990 26.784 13.612  1.00 20.37 ? 1690 HIS A NE2 1 
ATOM   525  N  N   . ASP A 1 69 ? 41.400 22.931 14.485  1.00 22.52 ? 1691 ASP A N   1 
ATOM   526  C  CA  . ASP A 1 69 ? 42.651 23.557 14.927  1.00 20.25 ? 1691 ASP A CA  1 
ATOM   527  C  C   . ASP A 1 69 ? 43.849 23.266 14.024  1.00 20.18 ? 1691 ASP A C   1 
ATOM   528  O  O   . ASP A 1 69 ? 44.674 24.159 13.786  1.00 20.13 ? 1691 ASP A O   1 
ATOM   529  C  CB  . ASP A 1 69 ? 42.939 23.117 16.349  1.00 24.93 ? 1691 ASP A CB  1 
ATOM   530  C  CG  . ASP A 1 69 ? 42.353 24.057 17.388  1.00 39.89 ? 1691 ASP A CG  1 
ATOM   531  O  OD1 . ASP A 1 69 ? 41.394 24.851 17.126  1.00 31.70 ? 1691 ASP A OD1 1 
ATOM   532  O  OD2 . ASP A 1 69 ? 42.881 24.017 18.506  1.00 49.03 ? 1691 ASP A OD2 1 
ATOM   533  N  N   . GLU A 1 70 ? 43.909 22.081 13.429  1.00 20.19 ? 1692 GLU A N   1 
ATOM   534  C  CA  . GLU A 1 70 ? 44.980 21.810 12.474  1.00 21.00 ? 1692 GLU A CA  1 
ATOM   535  C  C   . GLU A 1 70 ? 44.840 22.767 11.295  1.00 18.94 ? 1692 GLU A C   1 
ATOM   536  O  O   . GLU A 1 70 ? 45.810 23.288 10.791  1.00 19.57 ? 1692 GLU A O   1 
ATOM   537  C  CB  . GLU A 1 70 ? 44.895 20.363 12.041  1.00 19.86 ? 1692 GLU A CB  1 
ATOM   538  C  CG  . GLU A 1 70 ? 45.399 19.443 13.098  1.00 19.15 ? 1692 GLU A CG  1 
ATOM   539  C  CD  . GLU A 1 70 ? 45.027 17.971 12.844  1.00 26.76 ? 1692 GLU A CD  1 
ATOM   540  O  OE1 . GLU A 1 70 ? 44.310 17.607 11.882  1.00 23.52 ? 1692 GLU A OE1 1 
ATOM   541  O  OE2 . GLU A 1 70 ? 45.539 17.143 13.642  1.00 32.28 ? 1692 GLU A OE2 1 
ATOM   542  N  N   . ALA A 1 71 ? 43.620 22.977 10.792  1.00 18.84 ? 1693 ALA A N   1 
ATOM   543  C  CA  . ALA A 1 71 ? 43.427 23.799 9.652   1.00 17.66 ? 1693 ALA A CA  1 
ATOM   544  C  C   . ALA A 1 71 ? 43.748 25.222 9.933   1.00 17.52 ? 1693 ALA A C   1 
ATOM   545  O  O   . ALA A 1 71 ? 44.279 25.943 9.091   1.00 20.53 ? 1693 ALA A O   1 
ATOM   546  C  CB  . ALA A 1 71 ? 41.940 23.680 9.235   1.00 21.72 ? 1693 ALA A CB  1 
ATOM   547  N  N   . ILE A 1 72 ? 43.395 25.714 11.102  1.00 18.00 ? 1694 ILE A N   1 
ATOM   548  C  CA  . ILE A 1 72 ? 43.678 27.102 11.438  1.00 18.83 ? 1694 ILE A CA  1 
ATOM   549  C  C   . ILE A 1 72 ? 45.153 27.326 11.518  1.00 20.97 ? 1694 ILE A C   1 
ATOM   550  O  O   . ILE A 1 72 ? 45.641 28.363 11.092  1.00 20.94 ? 1694 ILE A O   1 
ATOM   551  C  CB  . ILE A 1 72 ? 43.022 27.541 12.762  1.00 22.21 ? 1694 ILE A CB  1 
ATOM   552  C  CG1 . ILE A 1 72 ? 41.498 27.419 12.665  1.00 26.21 ? 1694 ILE A CG1 1 
ATOM   553  C  CG2 . ILE A 1 72 ? 43.509 28.958 13.181  1.00 24.53 ? 1694 ILE A CG2 1 
ATOM   554  C  CD1 . ILE A 1 72 ? 40.808 27.974 11.362  1.00 30.93 ? 1694 ILE A CD1 1 
ATOM   555  N  N   . ASN A 1 73 ? 45.867 26.363 12.072  1.00 19.34 ? 1695 ASN A N   1 
ATOM   556  C  CA  . ASN A 1 73 ? 47.302 26.483 12.127  1.00 19.30 ? 1695 ASN A CA  1 
ATOM   557  C  C   . ASN A 1 73 ? 47.852 26.576 10.694  1.00 18.93 ? 1695 ASN A C   1 
ATOM   558  O  O   . ASN A 1 73 ? 48.712 27.445 10.423  1.00 20.64 ? 1695 ASN A O   1 
ATOM   559  C  CB  . ASN A 1 73 ? 47.900 25.359 12.962  1.00 20.18 ? 1695 ASN A CB  1 
ATOM   560  C  CG  . ASN A 1 73 ? 47.971 25.719 14.409  1.00 27.78 ? 1695 ASN A CG  1 
ATOM   561  O  OD1 . ASN A 1 73 ? 46.963 25.795 15.101  1.00 35.55 ? 1695 ASN A OD1 1 
ATOM   562  N  ND2 . ASN A 1 73 ? 49.208 25.902 14.900  1.00 31.63 ? 1695 ASN A ND2 1 
ATOM   563  N  N   . VAL A 1 74 ? 47.444 25.686 9.809   1.00 17.71 ? 1696 VAL A N   1 
ATOM   564  C  CA  . VAL A 1 74 ? 47.865 25.740 8.419   1.00 18.24 ? 1696 VAL A CA  1 
ATOM   565  C  C   . VAL A 1 74 ? 47.556 27.081 7.789   1.00 20.85 ? 1696 VAL A C   1 
ATOM   566  O  O   . VAL A 1 74 ? 48.387 27.689 7.139   1.00 21.69 ? 1696 VAL A O   1 
ATOM   567  C  CB  . VAL A 1 74 ? 47.310 24.558 7.588   1.00 20.29 ? 1696 VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 74 ? 47.547 24.765 6.086   1.00 22.30 ? 1696 VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 74 ? 47.965 23.224 8.093   1.00 21.31 ? 1696 VAL A CG2 1 
ATOM   570  N  N   . LEU A 1 75 ? 46.320 27.549 7.975   1.00 18.83 ? 1697 LEU A N   1 
ATOM   571  C  CA  . LEU A 1 75 ? 45.925 28.786 7.345   1.00 18.53 ? 1697 LEU A CA  1 
ATOM   572  C  C   . LEU A 1 75 ? 46.610 29.957 7.896   1.00 20.43 ? 1697 LEU A C   1 
ATOM   573  O  O   . LEU A 1 75 ? 46.919 30.894 7.199   1.00 21.42 ? 1697 LEU A O   1 
ATOM   574  C  CB  . LEU A 1 75 ? 44.401 28.921 7.405   1.00 19.83 ? 1697 LEU A CB  1 
ATOM   575  C  CG  . LEU A 1 75 ? 43.676 27.930 6.498   1.00 21.05 ? 1697 LEU A CG  1 
ATOM   576  C  CD1 . LEU A 1 75 ? 42.232 27.549 6.949   1.00 23.16 ? 1697 LEU A CD1 1 
ATOM   577  C  CD2 . LEU A 1 75 ? 43.709 28.458 5.011   1.00 24.75 ? 1697 LEU A CD2 1 
ATOM   578  N  N   . ARG A 1 76 ? 46.876 29.947 9.196   1.00 20.45 ? 1698 ARG A N   1 
ATOM   579  C  CA  . ARG A 1 76 ? 47.627 31.011 9.804   1.00 22.72 ? 1698 ARG A CA  1 
ATOM   580  C  C   . ARG A 1 76 ? 49.020 31.164 9.223   1.00 20.62 ? 1698 ARG A C   1 
ATOM   581  O  O   . ARG A 1 76 ? 49.554 32.258 9.106   1.00 25.80 ? 1698 ARG A O   1 
ATOM   582  C  CB  . ARG A 1 76 ? 47.761 30.720 11.299  1.00 26.76 ? 1698 ARG A CB  1 
ATOM   583  C  CG  . ARG A 1 76 ? 47.075 31.677 12.129  1.00 31.24 ? 1698 ARG A CG  1 
ATOM   584  C  CD  . ARG A 1 76 ? 47.230 31.360 13.616  1.00 25.79 ? 1698 ARG A CD  1 
ATOM   585  N  NE  . ARG A 1 76 ? 48.045 32.306 14.381  1.00 21.94 ? 1698 ARG A NE  1 
ATOM   586  C  CZ  . ARG A 1 76 ? 47.540 33.340 15.099  1.00 17.92 ? 1698 ARG A CZ  1 
ATOM   587  N  NH1 . ARG A 1 76 ? 46.267 33.592 15.029  1.00 18.90 ? 1698 ARG A NH1 1 
ATOM   588  N  NH2 . ARG A 1 76 ? 48.310 34.019 15.819  1.00 17.83 ? 1698 ARG A NH2 1 
ATOM   589  N  N   . GLN A 1 77 ? 49.632 30.049 8.883   1.00 17.91 ? 1699 GLN A N   1 
ATOM   590  C  CA  . GLN A 1 77 ? 51.013 29.956 8.462   1.00 20.50 ? 1699 GLN A CA  1 
ATOM   591  C  C   . GLN A 1 77 ? 51.239 30.112 6.949   1.00 23.34 ? 1699 GLN A C   1 
ATOM   592  O  O   . GLN A 1 77 ? 52.320 29.858 6.441   1.00 32.77 ? 1699 GLN A O   1 
ATOM   593  C  CB  . GLN A 1 77 ? 51.592 28.626 8.991   1.00 25.34 ? 1699 GLN A CB  1 
ATOM   594  C  CG  . GLN A 1 77 ? 51.571 28.631 10.540  1.00 25.11 ? 1699 GLN A CG  1 
ATOM   595  C  CD  . GLN A 1 77 ? 51.647 27.249 11.221  1.00 42.83 ? 1699 GLN A CD  1 
ATOM   596  O  OE1 . GLN A 1 77 ? 51.176 27.060 12.355  1.00 45.46 ? 1699 GLN A OE1 1 
ATOM   597  N  NE2 . GLN A 1 77 ? 52.213 26.310 10.553  1.00 30.41 ? 1699 GLN A NE2 1 
ATOM   598  N  N   . THR A 1 78 ? 50.253 30.636 6.250   1.00 20.98 ? 1700 THR A N   1 
ATOM   599  C  CA  . THR A 1 78 ? 50.318 30.753 4.804   1.00 21.79 ? 1700 THR A CA  1 
ATOM   600  C  C   . THR A 1 78 ? 51.065 32.019 4.429   1.00 21.00 ? 1700 THR A C   1 
ATOM   601  O  O   . THR A 1 78 ? 51.122 32.979 5.206   1.00 21.70 ? 1700 THR A O   1 
ATOM   602  C  CB  . THR A 1 78 ? 48.921 30.801 4.185   1.00 21.30 ? 1700 THR A CB  1 
ATOM   603  O  OG1 . THR A 1 78 ? 48.127 31.804 4.853   1.00 23.08 ? 1700 THR A OG1 1 
ATOM   604  C  CG2 . THR A 1 78 ? 48.251 29.451 4.263   1.00 22.38 ? 1700 THR A CG2 1 
ATOM   605  N  N   . PRO A 1 79 ? 51.618 32.026 3.221   1.00 18.44 ? 1701 PRO A N   1 
ATOM   606  C  CA  . PRO A 1 79 ? 52.256 33.260 2.752   1.00 19.56 ? 1701 PRO A CA  1 
ATOM   607  C  C   . PRO A 1 79 ? 51.255 34.272 2.230   1.00 20.60 ? 1701 PRO A C   1 
ATOM   608  O  O   . PRO A 1 79 ? 50.047 34.079 2.387   1.00 19.76 ? 1701 PRO A O   1 
ATOM   609  C  CB  . PRO A 1 79 ? 53.147 32.736 1.658   1.00 20.75 ? 1701 PRO A CB  1 
ATOM   610  C  CG  . PRO A 1 79 ? 52.499 31.619 1.098   1.00 20.21 ? 1701 PRO A CG  1 
ATOM   611  C  CD  . PRO A 1 79 ? 51.748 30.959 2.225   1.00 20.88 ? 1701 PRO A CD  1 
ATOM   612  N  N   . GLN A 1 80 ? 51.729 35.338 1.591   1.00 17.52 ? 1702 GLN A N   1 
ATOM   613  C  CA  A GLN A 1 80 ? 50.847 36.384 1.071   0.50 18.25 ? 1702 GLN A CA  1 
ATOM   614  C  CA  B GLN A 1 80 ? 50.854 36.397 1.107   0.50 16.55 ? 1702 GLN A CA  1 
ATOM   615  C  C   . GLN A 1 80 ? 49.882 35.906 0.009   1.00 18.42 ? 1702 GLN A C   1 
ATOM   616  O  O   . GLN A 1 80 ? 48.730 36.359 -0.029  1.00 22.43 ? 1702 GLN A O   1 
ATOM   617  C  CB  A GLN A 1 80 ? 51.676 37.553 0.533   0.50 18.35 ? 1702 GLN A CB  1 
ATOM   618  C  CB  B GLN A 1 80 ? 51.723 37.588 0.668   0.50 16.02 ? 1702 GLN A CB  1 
ATOM   619  C  CG  A GLN A 1 80 ? 52.093 38.471 1.632   0.50 24.57 ? 1702 GLN A CG  1 
ATOM   620  C  CG  B GLN A 1 80 ? 51.032 38.623 -0.200  0.50 12.34 ? 1702 GLN A CG  1 
ATOM   621  C  CD  A GLN A 1 80 ? 50.927 39.016 2.419   0.50 16.84 ? 1702 GLN A CD  1 
ATOM   622  C  CD  B GLN A 1 80 ? 49.871 39.380 0.454   0.50 13.82 ? 1702 GLN A CD  1 
ATOM   623  O  OE1 A GLN A 1 80 ? 50.729 38.660 3.590   0.50 29.70 ? 1702 GLN A OE1 1 
ATOM   624  O  OE1 B GLN A 1 80 ? 49.812 39.467 1.664   0.50 19.60 ? 1702 GLN A OE1 1 
ATOM   625  N  NE2 A GLN A 1 80 ? 50.144 39.858 1.796   0.50 16.86 ? 1702 GLN A NE2 1 
ATOM   626  N  NE2 B GLN A 1 80 ? 49.067 40.073 -0.388  0.50 10.44 ? 1702 GLN A NE2 1 
ATOM   627  N  N   . ARG A 1 81 ? 50.331 35.005 -0.870  1.00 19.89 ? 1703 ARG A N   1 
ATOM   628  C  CA  . ARG A 1 81 ? 49.496 34.392 -1.924  1.00 20.84 ? 1703 ARG A CA  1 
ATOM   629  C  C   . ARG A 1 81 ? 49.136 32.969 -1.551  1.00 23.13 ? 1703 ARG A C   1 
ATOM   630  O  O   . ARG A 1 81 ? 49.993 32.096 -1.376  1.00 23.16 ? 1703 ARG A O   1 
ATOM   631  C  CB  . ARG A 1 81 ? 50.152 34.471 -3.274  1.00 26.24 ? 1703 ARG A CB  1 
ATOM   632  C  CG  . ARG A 1 81 ? 50.189 35.939 -3.745  1.00 33.96 ? 1703 ARG A CG  1 
ATOM   633  C  CD  . ARG A 1 81 ? 51.274 36.295 -4.771  1.00 32.05 ? 1703 ARG A CD  1 
ATOM   634  N  NE  . ARG A 1 81 ? 52.652 36.000 -4.327  1.00 38.47 ? 1703 ARG A NE  1 
ATOM   635  C  CZ  . ARG A 1 81 ? 53.298 36.680 -3.372  1.00 22.24 ? 1703 ARG A CZ  1 
ATOM   636  N  NH1 . ARG A 1 81 ? 54.524 36.367 -3.045  1.00 28.52 ? 1703 ARG A NH1 1 
ATOM   637  N  NH2 . ARG A 1 81 ? 52.723 37.673 -2.773  1.00 27.95 ? 1703 ARG A NH2 1 
ATOM   638  N  N   . VAL A 1 82 ? 47.838 32.778 -1.391  1.00 21.86 ? 1704 VAL A N   1 
ATOM   639  C  CA  . VAL A 1 82 ? 47.308 31.569 -0.849  1.00 23.37 ? 1704 VAL A CA  1 
ATOM   640  C  C   . VAL A 1 82 ? 46.653 30.827 -2.005  1.00 21.07 ? 1704 VAL A C   1 
ATOM   641  O  O   . VAL A 1 82 ? 45.659 31.298 -2.532  1.00 23.86 ? 1704 VAL A O   1 
ATOM   642  C  CB  . VAL A 1 82 ? 46.355 31.862 0.302   1.00 22.69 ? 1704 VAL A CB  1 
ATOM   643  C  CG1 . VAL A 1 82 ? 45.882 30.552 0.880   1.00 26.49 ? 1704 VAL A CG1 1 
ATOM   644  C  CG2 . VAL A 1 82 ? 47.128 32.666 1.401   1.00 22.27 ? 1704 VAL A CG2 1 
ATOM   645  N  N   . ARG A 1 83 ? 47.176 29.653 -2.350  1.00 21.87 ? 1705 ARG A N   1 
ATOM   646  C  CA  . ARG A 1 83 ? 46.616 28.834 -3.413  1.00 21.78 ? 1705 ARG A CA  1 
ATOM   647  C  C   . ARG A 1 83 ? 45.653 27.805 -2.755  1.00 21.14 ? 1705 ARG A C   1 
ATOM   648  O  O   . ARG A 1 83 ? 46.093 26.886 -2.070  1.00 23.91 ? 1705 ARG A O   1 
ATOM   649  C  CB  . ARG A 1 83 ? 47.679 28.100 -4.219  1.00 26.77 ? 1705 ARG A CB  1 
ATOM   650  C  CG  . ARG A 1 83 ? 48.723 29.020 -4.839  1.00 33.57 ? 1705 ARG A CG  1 
ATOM   651  N  N   . LEU A 1 84 ? 44.366 28.038 -2.916  1.00 21.54 ? 1706 LEU A N   1 
ATOM   652  C  CA  . LEU A 1 84 ? 43.344 27.194 -2.272  1.00 19.13 ? 1706 LEU A CA  1 
ATOM   653  C  C   . LEU A 1 84 ? 42.774 26.250 -3.304  1.00 20.80 ? 1706 LEU A C   1 
ATOM   654  O  O   . LEU A 1 84 ? 42.507 26.661 -4.413  1.00 24.43 ? 1706 LEU A O   1 
ATOM   655  C  CB  . LEU A 1 84 ? 42.196 28.020 -1.747  1.00 19.52 ? 1706 LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 84 ? 42.502 29.010 -0.616  1.00 23.21 ? 1706 LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 84 ? 41.348 30.016 -0.386  1.00 27.26 ? 1706 LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 84 ? 42.888 28.326 0.661   1.00 22.86 ? 1706 LEU A CD2 1 
ATOM   659  N  N   . THR A 1 85 ? 42.652 24.992 -2.927  1.00 18.46 ? 1707 THR A N   1 
ATOM   660  C  CA  . THR A 1 85 ? 41.899 24.004 -3.747  1.00 17.49 ? 1707 THR A CA  1 
ATOM   661  C  C   . THR A 1 85 ? 40.621 23.747 -2.986  1.00 18.56 ? 1707 THR A C   1 
ATOM   662  O  O   . THR A 1 85 ? 40.667 23.461 -1.785  1.00 18.32 ? 1707 THR A O   1 
ATOM   663  C  CB  . THR A 1 85 ? 42.658 22.760 -3.907  1.00 17.56 ? 1707 THR A CB  1 
ATOM   664  O  OG1 . THR A 1 85 ? 43.881 23.097 -4.591  1.00 21.52 ? 1707 THR A OG1 1 
ATOM   665  C  CG2 . THR A 1 85 ? 41.854 21.780 -4.756  1.00 20.55 ? 1707 THR A CG2 1 
ATOM   666  N  N   . LEU A 1 86 ? 39.490 23.950 -3.653  1.00 16.77 ? 1708 LEU A N   1 
ATOM   667  C  CA  . LEU A 1 86 ? 38.143 23.977 -3.036  1.00 17.34 ? 1708 LEU A CA  1 
ATOM   668  C  C   . LEU A 1 86 ? 37.247 22.983 -3.682  1.00 19.08 ? 1708 LEU A C   1 
ATOM   669  O  O   . LEU A 1 86 ? 37.373 22.683 -4.865  1.00 19.31 ? 1708 LEU A O   1 
ATOM   670  C  CB  . LEU A 1 86 ? 37.528 25.321 -3.231  1.00 18.91 ? 1708 LEU A CB  1 
ATOM   671  C  CG  . LEU A 1 86 ? 38.353 26.506 -2.722  1.00 23.52 ? 1708 LEU A CG  1 
ATOM   672  C  CD1 . LEU A 1 86 ? 38.146 27.742 -3.558  1.00 40.31 ? 1708 LEU A CD1 1 
ATOM   673  C  CD2 . LEU A 1 86 ? 38.172 26.764 -1.265  1.00 24.17 ? 1708 LEU A CD2 1 
ATOM   674  N  N   . TYR A 1 87 ? 36.310 22.499 -2.916  1.00 16.60 ? 1709 TYR A N   1 
ATOM   675  C  CA  . TYR A 1 87 ? 35.209 21.657 -3.412  1.00 15.87 ? 1709 TYR A CA  1 
ATOM   676  C  C   . TYR A 1 87 ? 33.921 22.357 -3.150  1.00 16.28 ? 1709 TYR A C   1 
ATOM   677  O  O   . TYR A 1 87 ? 33.666 22.732 -2.012  1.00 17.25 ? 1709 TYR A O   1 
ATOM   678  C  CB  . TYR A 1 87 ? 35.162 20.294 -2.844  1.00 18.67 ? 1709 TYR A CB  1 
ATOM   679  C  CG  . TYR A 1 87 ? 34.149 19.415 -3.499  1.00 19.43 ? 1709 TYR A CG  1 
ATOM   680  C  CD1 . TYR A 1 87 ? 34.413 18.833 -4.723  1.00 22.20 ? 1709 TYR A CD1 1 
ATOM   681  C  CD2 . TYR A 1 87 ? 32.933 19.143 -2.887  1.00 22.04 ? 1709 TYR A CD2 1 
ATOM   682  C  CE1 . TYR A 1 87 ? 33.510 17.987 -5.306  1.00 25.75 ? 1709 TYR A CE1 1 
ATOM   683  C  CE2 . TYR A 1 87 ? 32.027 18.278 -3.498  1.00 20.27 ? 1709 TYR A CE2 1 
ATOM   684  C  CZ  . TYR A 1 87 ? 32.325 17.742 -4.654  1.00 20.41 ? 1709 TYR A CZ  1 
ATOM   685  O  OH  . TYR A 1 87 ? 31.389 16.846 -5.234  1.00 27.64 ? 1709 TYR A OH  1 
ATOM   686  N  N   . ARG A 1 88 ? 33.118 22.576 -4.190  1.00 16.27 ? 1710 ARG A N   1 
ATOM   687  C  CA  . ARG A 1 88 ? 31.789 23.155 -4.081  1.00 15.48 ? 1710 ARG A CA  1 
ATOM   688  C  C   . ARG A 1 88 ? 30.746 22.070 -4.226  1.00 16.15 ? 1710 ARG A C   1 
ATOM   689  O  O   . ARG A 1 88 ? 30.516 21.621 -5.300  1.00 17.67 ? 1710 ARG A O   1 
ATOM   690  C  CB  . ARG A 1 88 ? 31.628 24.306 -5.084  1.00 19.76 ? 1710 ARG A CB  1 
ATOM   691  C  CG  . ARG A 1 88 ? 30.274 24.947 -5.021  1.00 19.98 ? 1710 ARG A CG  1 
ATOM   692  C  CD  . ARG A 1 88 ? 30.236 26.192 -5.879  1.00 22.02 ? 1710 ARG A CD  1 
ATOM   693  N  NE  . ARG A 1 88 ? 31.163 27.175 -5.346  1.00 22.37 ? 1710 ARG A NE  1 
ATOM   694  C  CZ  . ARG A 1 88 ? 31.486 28.283 -5.981  1.00 21.88 ? 1710 ARG A CZ  1 
ATOM   695  N  NH1 . ARG A 1 88 ? 30.963 28.556 -7.179  1.00 23.22 ? 1710 ARG A NH1 1 
ATOM   696  N  NH2 . ARG A 1 88 ? 32.351 29.111 -5.424  1.00 25.03 ? 1710 ARG A NH2 1 
ATOM   697  N  N   . ASP A 1 89 ? 30.103 21.724 -3.112  1.00 18.03 ? 1711 ASP A N   1 
ATOM   698  C  CA  . ASP A 1 89 ? 28.979 20.800 -3.124  1.00 16.59 ? 1711 ASP A CA  1 
ATOM   699  C  C   . ASP A 1 89 ? 27.761 21.524 -3.712  1.00 17.63 ? 1711 ASP A C   1 
ATOM   700  O  O   . ASP A 1 89 ? 27.704 22.788 -3.601  1.00 19.21 ? 1711 ASP A O   1 
ATOM   701  C  CB  . ASP A 1 89 ? 28.670 20.375 -1.655  1.00 18.26 ? 1711 ASP A CB  1 
ATOM   702  C  CG  . ASP A 1 89 ? 27.764 19.220 -1.568  1.00 21.43 ? 1711 ASP A CG  1 
ATOM   703  O  OD1 . ASP A 1 89 ? 28.257 18.055 -1.555  1.00 22.78 ? 1711 ASP A OD1 1 
ATOM   704  O  OD2 . ASP A 1 89 ? 26.525 19.416 -1.635  1.00 22.96 ? 1711 ASP A OD2 1 
ATOM   705  N  N   . GLU A 1 90 ? 26.841 20.803 -4.331  1.00 19.23 ? 1712 GLU A N   1 
ATOM   706  C  CA  . GLU A 1 90 ? 25.662 21.465 -4.848  1.00 22.38 ? 1712 GLU A CA  1 
ATOM   707  C  C   . GLU A 1 90 ? 24.821 22.015 -3.731  1.00 24.37 ? 1712 GLU A C   1 
ATOM   708  O  O   . GLU A 1 90 ? 24.018 22.925 -3.958  1.00 25.30 ? 1712 GLU A O   1 
ATOM   709  C  CB  . GLU A 1 90 ? 24.824 20.551 -5.705  1.00 24.39 ? 1712 GLU A CB  1 
ATOM   710  C  CG  . GLU A 1 90 ? 23.995 19.550 -4.970  1.00 28.35 ? 1712 GLU A CG  1 
ATOM   711  C  CD  . GLU A 1 90 ? 22.778 19.070 -5.728  1.00 37.67 ? 1712 GLU A CD  1 
ATOM   712  O  OE1 . GLU A 1 90 ? 21.875 18.537 -5.063  1.00 37.68 ? 1712 GLU A OE1 1 
ATOM   713  O  OE2 . GLU A 1 90 ? 22.700 19.264 -6.964  1.00 35.38 ? 1712 GLU A OE2 1 
ATOM   714  N  N   . ALA A 1 91 ? 24.937 21.483 -2.523  1.00 18.36 ? 1713 ALA A N   1 
ATOM   715  C  CA  . ALA A 1 91 ? 24.103 22.019 -1.438  1.00 20.97 ? 1713 ALA A CA  1 
ATOM   716  C  C   . ALA A 1 91 ? 24.311 23.468 -1.159  1.00 22.68 ? 1713 ALA A C   1 
ATOM   717  O  O   . ALA A 1 91 ? 25.414 23.932 -1.097  1.00 22.69 ? 1713 ALA A O   1 
ATOM   718  C  CB  . ALA A 1 91 ? 24.347 21.189 -0.192  1.00 21.74 ? 1713 ALA A CB  1 
ATOM   719  N  N   . PRO A 1 92 ? 23.212 24.224 -0.882  1.00 21.13 ? 1714 PRO A N   1 
ATOM   720  C  CA  . PRO A 1 92 ? 23.395 25.587 -0.434  1.00 23.90 ? 1714 PRO A CA  1 
ATOM   721  C  C   . PRO A 1 92 ? 23.971 25.679 0.968   1.00 21.19 ? 1714 PRO A C   1 
ATOM   722  O  O   . PRO A 1 92 ? 23.728 24.758 1.771   1.00 21.58 ? 1714 PRO A O   1 
ATOM   723  C  CB  . PRO A 1 92 ? 21.958 26.154 -0.447  1.00 23.72 ? 1714 PRO A CB  1 
ATOM   724  C  CG  . PRO A 1 92 ? 21.152 25.023 -0.304  1.00 25.06 ? 1714 PRO A CG  1 
ATOM   725  C  CD  . PRO A 1 92 ? 21.807 23.841 -0.934  1.00 23.66 ? 1714 PRO A CD  1 
ATOM   726  N  N   . TYR A 1 93 ? 24.602 26.794 1.325   1.00 20.58 ? 1715 TYR A N   1 
ATOM   727  C  CA  . TYR A 1 93 ? 25.024 27.086 2.651   1.00 21.89 ? 1715 TYR A CA  1 
ATOM   728  C  C   . TYR A 1 93 ? 24.382 28.354 3.097   1.00 25.54 ? 1715 TYR A C   1 
ATOM   729  O  O   . TYR A 1 93 ? 24.825 29.459 2.663   1.00 28.10 ? 1715 TYR A O   1 
ATOM   730  C  CB  . TYR A 1 93 ? 26.555 27.292 2.748   1.00 27.44 ? 1715 TYR A CB  1 
ATOM   731  C  CG  . TYR A 1 93 ? 27.033 27.437 4.157   1.00 22.76 ? 1715 TYR A CG  1 
ATOM   732  C  CD1 . TYR A 1 93 ? 27.466 26.377 4.863   1.00 28.13 ? 1715 TYR A CD1 1 
ATOM   733  C  CD2 . TYR A 1 93 ? 27.023 28.672 4.825   1.00 27.20 ? 1715 TYR A CD2 1 
ATOM   734  C  CE1 . TYR A 1 93 ? 27.884 26.480 6.174   1.00 29.19 ? 1715 TYR A CE1 1 
ATOM   735  C  CE2 . TYR A 1 93 ? 27.412 28.799 6.141   1.00 24.23 ? 1715 TYR A CE2 1 
ATOM   736  C  CZ  . TYR A 1 93 ? 27.904 27.740 6.852   1.00 21.84 ? 1715 TYR A CZ  1 
ATOM   737  O  OH  . TYR A 1 93 ? 28.258 27.790 8.154   1.00 25.98 ? 1715 TYR A OH  1 
ATOM   738  N  N   . LYS A 1 94 ? 23.427 28.163 4.013   1.00 20.77 ? 1716 LYS A N   1 
ATOM   739  C  CA  . LYS A 1 94 ? 22.476 29.057 4.434   1.00 22.29 ? 1716 LYS A CA  1 
ATOM   740  C  C   . LYS A 1 94 ? 22.868 29.669 5.779   1.00 18.98 ? 1716 LYS A C   1 
ATOM   741  O  O   . LYS A 1 94 ? 23.274 28.956 6.670   1.00 20.68 ? 1716 LYS A O   1 
ATOM   742  C  CB  . LYS A 1 94 ? 21.203 28.202 4.636   1.00 25.79 ? 1716 LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 94 ? 20.659 27.427 3.404   1.00 32.97 ? 1716 LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 94 ? 19.664 28.290 2.625   1.00 22.82 ? 1716 LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 94 ? 19.161 27.513 1.432   1.00 20.72 ? 1716 LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 94 ? 18.802 28.511 0.451   1.00 29.36 ? 1716 LYS A NZ  1 
ATOM   747  N  N   . SER A 1 95 ? 22.690 30.939 5.943   1.00 18.80 ? 1717 SER A N   1 
ATOM   748  C  CA  . SER A 1 95 ? 22.929 31.636 7.165   1.00 19.23 ? 1717 SER A CA  1 
ATOM   749  C  C   . SER A 1 95 ? 21.909 32.780 7.305   1.00 19.42 ? 1717 SER A C   1 
ATOM   750  O  O   . SER A 1 95 ? 21.787 33.594 6.380   1.00 22.78 ? 1717 SER A O   1 
ATOM   751  C  CB  . SER A 1 95 ? 24.354 32.112 7.129   1.00 26.46 ? 1717 SER A CB  1 
ATOM   752  O  OG  . SER A 1 95 ? 24.682 32.789 8.284   1.00 30.30 ? 1717 SER A OG  1 
ATOM   753  N  N   . THR A 1 96 ? 21.148 32.860 8.401   1.00 15.52 ? 1718 THR A N   1 
ATOM   754  C  CA  . THR A 1 96 ? 20.090 33.814 8.613   1.00 15.46 ? 1718 THR A CA  1 
ATOM   755  C  C   . THR A 1 96 ? 20.166 34.383 9.998   1.00 19.03 ? 1718 THR A C   1 
ATOM   756  O  O   . THR A 1 96 ? 20.134 33.610 10.988  1.00 18.84 ? 1718 THR A O   1 
ATOM   757  C  CB  . THR A 1 96 ? 18.691 33.177 8.369   1.00 18.55 ? 1718 THR A CB  1 
ATOM   758  O  OG1 . THR A 1 96 ? 18.654 32.598 7.042   1.00 17.90 ? 1718 THR A OG1 1 
ATOM   759  C  CG2 . THR A 1 96 ? 17.581 34.205 8.514   1.00 20.71 ? 1718 THR A CG2 1 
ATOM   760  N  N   . ARG A 1 97 ? 20.092 35.705 10.144  1.00 18.59 ? 1719 ARG A N   1 
ATOM   761  C  CA  . ARG A 1 97 ? 19.989 36.349 11.422  1.00 20.16 ? 1719 ARG A CA  1 
ATOM   762  C  C   . ARG A 1 97 ? 18.556 36.504 11.778  1.00 20.66 ? 1719 ARG A C   1 
ATOM   763  O  O   . ARG A 1 97 ? 17.730 37.030 10.983  1.00 23.65 ? 1719 ARG A O   1 
ATOM   764  C  CB  . ARG A 1 97 ? 20.666 37.741 11.342  1.00 24.91 ? 1719 ARG A CB  1 
ATOM   765  C  CG  . ARG A 1 97 ? 20.635 38.533 12.636  1.00 30.48 ? 1719 ARG A CG  1 
ATOM   766  C  CD  . ARG A 1 97 ? 21.723 39.638 12.694  1.00 34.91 ? 1719 ARG A CD  1 
ATOM   767  N  NE  . ARG A 1 97 ? 21.618 40.360 13.967  1.00 43.01 ? 1719 ARG A NE  1 
ATOM   768  C  CZ  . ARG A 1 97 ? 22.631 40.953 14.601  1.00 25.76 ? 1719 ARG A CZ  1 
ATOM   769  N  NH1 . ARG A 1 97 ? 23.850 40.963 14.090  1.00 42.55 ? 1719 ARG A NH1 1 
ATOM   770  N  NH2 . ARG A 1 97 ? 22.390 41.559 15.757  1.00 35.76 ? 1719 ARG A NH2 1 
ATOM   771  N  N   . LEU A 1 98 ? 18.172 36.102 12.964  1.00 20.88 ? 1720 LEU A N   1 
ATOM   772  C  CA  . LEU A 1 98 ? 16.863 36.469 13.464  1.00 27.40 ? 1720 LEU A CA  1 
ATOM   773  C  C   . LEU A 1 98 ? 16.880 36.978 14.899  1.00 32.73 ? 1720 LEU A C   1 
ATOM   774  O  O   . LEU A 1 98 ? 15.809 37.336 15.438  1.00 35.02 ? 1720 LEU A O   1 
ATOM   775  C  CB  . LEU A 1 98 ? 15.834 35.362 13.244  1.00 35.38 ? 1720 LEU A CB  1 
ATOM   776  C  CG  . LEU A 1 98 ? 16.113 33.930 13.656  1.00 30.38 ? 1720 LEU A CG  1 
ATOM   777  C  CD1 . LEU A 1 98 ? 15.921 33.785 15.139  1.00 39.69 ? 1720 LEU A CD1 1 
ATOM   778  C  CD2 . LEU A 1 98 ? 15.189 32.970 12.927  1.00 34.98 ? 1720 LEU A CD2 1 
ATOM   779  O  OXT . LEU A 1 98 ? 17.973 37.134 15.476  1.00 28.47 ? 1720 LEU A OXT 1 
ATOM   780  N  N   . SER B 1 1  ? 30.926 11.522 18.481  1.00 41.99 ? 1623 SER B N   1 
ATOM   781  C  CA  . SER B 1 1  ? 30.467 12.671 19.331  1.00 40.98 ? 1623 SER B CA  1 
ATOM   782  C  C   . SER B 1 1  ? 29.417 12.217 20.359  1.00 37.50 ? 1623 SER B C   1 
ATOM   783  O  O   . SER B 1 1  ? 28.669 11.237 20.131  1.00 36.29 ? 1623 SER B O   1 
ATOM   784  C  CB  . SER B 1 1  ? 29.833 13.778 18.486  1.00 39.87 ? 1623 SER B CB  1 
ATOM   785  O  OG  . SER B 1 1  ? 30.758 14.385 17.584  1.00 49.55 ? 1623 SER B OG  1 
ATOM   786  N  N   . MET B 1 2  ? 29.378 12.934 21.481  1.00 32.42 ? 1624 MET B N   1 
ATOM   787  C  CA  . MET B 1 2  ? 28.372 12.727 22.528  1.00 28.91 ? 1624 MET B CA  1 
ATOM   788  C  C   . MET B 1 2  ? 27.955 14.053 23.185  1.00 25.89 ? 1624 MET B C   1 
ATOM   789  O  O   . MET B 1 2  ? 28.628 15.060 23.027  1.00 25.19 ? 1624 MET B O   1 
ATOM   790  C  CB  . MET B 1 2  ? 28.978 11.851 23.584  1.00 27.38 ? 1624 MET B CB  1 
ATOM   791  C  CG  . MET B 1 2  ? 29.420 10.442 23.077  1.00 27.88 ? 1624 MET B CG  1 
ATOM   792  S  SD  . MET B 1 2  ? 28.003 9.378  22.589  1.00 29.16 ? 1624 MET B SD  1 
ATOM   793  C  CE  . MET B 1 2  ? 27.342 8.832  24.243  1.00 20.67 ? 1624 MET B CE  1 
ATOM   794  N  N   . GLY B 1 3  ? 26.851 14.070 23.906  1.00 21.40 ? 1625 GLY B N   1 
ATOM   795  C  CA  . GLY B 1 3  ? 26.322 15.324 24.495  1.00 20.15 ? 1625 GLY B CA  1 
ATOM   796  C  C   . GLY B 1 3  ? 25.062 15.117 25.286  1.00 18.61 ? 1625 GLY B C   1 
ATOM   797  O  O   . GLY B 1 3  ? 25.006 14.210 26.094  1.00 24.14 ? 1625 GLY B O   1 
ATOM   798  N  N   . CYS B 1 4  ? 24.078 16.016 25.147  1.00 19.66 ? 1626 CYS B N   1 
ATOM   799  C  CA  . CYS B 1 4  ? 22.858 15.950 25.905  1.00 19.08 ? 1626 CYS B CA  1 
ATOM   800  C  C   . CYS B 1 4  ? 21.693 16.676 25.217  1.00 20.78 ? 1626 CYS B C   1 
ATOM   801  O  O   . CYS B 1 4  ? 21.946 17.498 24.340  1.00 23.37 ? 1626 CYS B O   1 
ATOM   802  C  CB  . CYS B 1 4  ? 23.047 16.603 27.315  1.00 23.42 ? 1626 CYS B CB  1 
ATOM   803  S  SG  . CYS B 1 4  ? 23.395 18.398 27.149  1.00 26.51 ? 1626 CYS B SG  1 
ATOM   804  N  N   . GLU B 1 5  ? 20.445 16.401 25.601  1.00 18.35 ? 1627 GLU B N   1 
ATOM   805  C  CA  . GLU B 1 5  ? 19.261 17.139 25.160  1.00 20.63 ? 1627 GLU B CA  1 
ATOM   806  C  C   . GLU B 1 5  ? 18.752 18.031 26.236  1.00 20.25 ? 1627 GLU B C   1 
ATOM   807  O  O   . GLU B 1 5  ? 18.501 17.564 27.370  1.00 21.88 ? 1627 GLU B O   1 
ATOM   808  C  CB  . GLU B 1 5  ? 18.132 16.241 24.675  1.00 27.24 ? 1627 GLU B CB  1 
ATOM   809  C  CG  . GLU B 1 5  ? 18.383 15.601 23.375  1.00 28.60 ? 1627 GLU B CG  1 
ATOM   810  C  CD  . GLU B 1 5  ? 17.168 14.834 22.830  1.00 31.47 ? 1627 GLU B CD  1 
ATOM   811  O  OE1 . GLU B 1 5  ? 17.440 13.948 22.004  1.00 38.11 ? 1627 GLU B OE1 1 
ATOM   812  O  OE2 . GLU B 1 5  ? 15.998 15.127 23.193  1.00 44.09 ? 1627 GLU B OE2 1 
ATOM   813  N  N   . THR B 1 6  ? 18.495 19.285 25.916  1.00 19.31 ? 1628 THR B N   1 
ATOM   814  C  CA  . THR B 1 6  ? 18.044 20.296 26.841  1.00 21.20 ? 1628 THR B CA  1 
ATOM   815  C  C   . THR B 1 6  ? 16.906 21.139 26.301  1.00 21.66 ? 1628 THR B C   1 
ATOM   816  O  O   . THR B 1 6  ? 16.849 21.435 25.100  1.00 22.14 ? 1628 THR B O   1 
ATOM   817  C  CB  A THR B 1 6  ? 19.186 21.228 27.212  0.50 27.30 ? 1628 THR B CB  1 
ATOM   818  C  CB  B THR B 1 6  ? 19.228 21.188 27.285  0.50 28.80 ? 1628 THR B CB  1 
ATOM   819  O  OG1 A THR B 1 6  ? 19.876 20.663 28.331  0.50 21.39 ? 1628 THR B OG1 1 
ATOM   820  O  OG1 B THR B 1 6  ? 18.772 22.302 28.068  0.50 27.42 ? 1628 THR B OG1 1 
ATOM   821  C  CG2 A THR B 1 6  ? 18.682 22.622 27.607  0.50 27.93 ? 1628 THR B CG2 1 
ATOM   822  C  CG2 B THR B 1 6  ? 19.998 21.682 26.104  0.50 28.32 ? 1628 THR B CG2 1 
ATOM   823  N  N   . THR B 1 7  ? 15.987 21.541 27.156  1.00 21.02 ? 1629 THR B N   1 
ATOM   824  C  CA  . THR B 1 7  ? 14.895 22.375 26.759  1.00 20.32 ? 1629 THR B CA  1 
ATOM   825  C  C   . THR B 1 7  ? 14.862 23.635 27.593  1.00 23.99 ? 1629 THR B C   1 
ATOM   826  O  O   . THR B 1 7  ? 14.981 23.592 28.834  1.00 23.16 ? 1629 THR B O   1 
ATOM   827  C  CB  . THR B 1 7  ? 13.529 21.626 26.832  1.00 23.18 ? 1629 THR B CB  1 
ATOM   828  O  OG1 . THR B 1 7  ? 13.563 20.467 25.998  1.00 24.51 ? 1629 THR B OG1 1 
ATOM   829  C  CG2 . THR B 1 7  ? 12.372 22.517 26.429  1.00 23.43 ? 1629 THR B CG2 1 
ATOM   830  N  N   . ILE B 1 8  ? 14.730 24.751 26.890  1.00 22.90 ? 1630 ILE B N   1 
ATOM   831  C  CA  . ILE B 1 8  ? 14.723 26.086 27.504  1.00 23.89 ? 1630 ILE B CA  1 
ATOM   832  C  C   . ILE B 1 8  ? 13.551 26.920 26.965  1.00 24.67 ? 1630 ILE B C   1 
ATOM   833  O  O   . ILE B 1 8  ? 13.156 26.737 25.814  1.00 27.58 ? 1630 ILE B O   1 
ATOM   834  C  CB  A ILE B 1 8  ? 16.014 26.870 27.472  0.50 25.94 ? 1630 ILE B CB  1 
ATOM   835  C  CB  B ILE B 1 8  ? 16.125 26.712 27.080  0.50 28.10 ? 1630 ILE B CB  1 
ATOM   836  C  CG1 A ILE B 1 8  ? 16.323 27.459 26.098  0.50 25.99 ? 1630 ILE B CG1 1 
ATOM   837  C  CG1 B ILE B 1 8  ? 17.287 26.145 27.921  0.50 32.01 ? 1630 ILE B CG1 1 
ATOM   838  C  CG2 A ILE B 1 8  ? 17.196 26.035 28.039  0.50 28.98 ? 1630 ILE B CG2 1 
ATOM   839  C  CG2 B ILE B 1 8  ? 16.199 28.234 27.121  0.50 25.46 ? 1630 ILE B CG2 1 
ATOM   840  C  CD1 A ILE B 1 8  ? 17.275 28.592 26.255  0.50 23.88 ? 1630 ILE B CD1 1 
ATOM   841  C  CD1 B ILE B 1 8  ? 18.640 26.163 27.193  0.50 31.96 ? 1630 ILE B CD1 1 
ATOM   842  N  N   . GLU B 1 9  ? 12.994 27.783 27.781  1.00 23.72 ? 1631 GLU B N   1 
ATOM   843  C  CA  . GLU B 1 9  ? 11.983 28.716 27.317  1.00 25.30 ? 1631 GLU B CA  1 
ATOM   844  C  C   . GLU B 1 9  ? 12.534 30.099 27.492  1.00 23.63 ? 1631 GLU B C   1 
ATOM   845  O  O   . GLU B 1 9  ? 13.018 30.442 28.558  1.00 25.76 ? 1631 GLU B O   1 
ATOM   846  C  CB  . GLU B 1 9  ? 10.691 28.570 28.091  1.00 25.30 ? 1631 GLU B CB  1 
ATOM   847  C  CG  . GLU B 1 9  ? 10.057 27.217 27.893  1.00 36.01 ? 1631 GLU B CG  1 
ATOM   848  C  CD  . GLU B 1 9  ? 8.688  27.099 28.491  1.00 37.76 ? 1631 GLU B CD  1 
ATOM   849  O  OE1 . GLU B 1 9  ? 8.373  27.866 29.431  1.00 38.80 ? 1631 GLU B OE1 1 
ATOM   850  O  OE2 . GLU B 1 9  ? 7.908  26.250 27.998  1.00 43.59 ? 1631 GLU B OE2 1 
ATOM   851  N  N   . ILE B 1 10 ? 12.441 30.885 26.424  1.00 23.69 ? 1632 ILE B N   1 
ATOM   852  C  CA  . ILE B 1 10 ? 12.813 32.300 26.461  1.00 24.67 ? 1632 ILE B CA  1 
ATOM   853  C  C   . ILE B 1 10 ? 11.673 33.221 25.973  1.00 23.60 ? 1632 ILE B C   1 
ATOM   854  O  O   . ILE B 1 10 ? 10.917 32.823 25.114  1.00 25.79 ? 1632 ILE B O   1 
ATOM   855  C  CB  . ILE B 1 10 ? 14.110 32.547 25.658  1.00 27.79 ? 1632 ILE B CB  1 
ATOM   856  C  CG1 . ILE B 1 10 ? 13.932 32.460 24.162  1.00 31.40 ? 1632 ILE B CG1 1 
ATOM   857  C  CG2 . ILE B 1 10 ? 15.192 31.523 25.990  1.00 34.72 ? 1632 ILE B CG2 1 
ATOM   858  C  CD1 . ILE B 1 10 ? 15.217 32.875 23.358  1.00 41.79 ? 1632 ILE B CD1 1 
ATOM   859  N  N   . SER B 1 11 ? 11.595 34.430 26.530  1.00 25.27 ? 1633 SER B N   1 
ATOM   860  C  CA  . SER B 1 11 ? 10.647 35.434 26.050  1.00 25.47 ? 1633 SER B CA  1 
ATOM   861  C  C   . SER B 1 11 ? 11.272 36.198 24.914  1.00 24.47 ? 1633 SER B C   1 
ATOM   862  O  O   . SER B 1 11 ? 12.351 36.714 25.061  1.00 31.98 ? 1633 SER B O   1 
ATOM   863  C  CB  . SER B 1 11 ? 10.225 36.421 27.152  1.00 30.67 ? 1633 SER B CB  1 
ATOM   864  O  OG  . SER B 1 11 ? 9.297  35.771 28.008  1.00 40.68 ? 1633 SER B OG  1 
ATOM   865  N  N   . LYS B 1 12 ? 10.575 36.363 23.820  1.00 24.26 ? 1634 LYS B N   1 
ATOM   866  C  CA  . LYS B 1 12 ? 11.325 36.835 22.663  1.00 30.60 ? 1634 LYS B CA  1 
ATOM   867  C  C   . LYS B 1 12 ? 11.575 38.340 22.587  1.00 35.65 ? 1634 LYS B C   1 
ATOM   868  O  O   . LYS B 1 12 ? 12.487 38.756 21.884  1.00 37.90 ? 1634 LYS B O   1 
ATOM   869  C  CB  . LYS B 1 12 ? 10.819 36.286 21.352  1.00 35.32 ? 1634 LYS B CB  1 
ATOM   870  C  CG  . LYS B 1 12 ? 9.550  36.793 20.955  1.00 29.88 ? 1634 LYS B CG  1 
ATOM   871  C  CD  . LYS B 1 12 ? 9.394  36.794 19.518  1.00 31.17 ? 1634 LYS B CD  1 
ATOM   872  C  CE  . LYS B 1 12 ? 9.211  35.402 19.017  1.00 38.32 ? 1634 LYS B CE  1 
ATOM   873  N  NZ  . LYS B 1 12 ? 8.509  35.441 17.717  1.00 39.16 ? 1634 LYS B NZ  1 
ATOM   874  N  N   . GLY B 1 13 ? 10.782 39.132 23.298  1.00 29.03 ? 1635 GLY B N   1 
ATOM   875  C  CA  . GLY B 1 13 ? 10.981 40.587 23.388  1.00 30.32 ? 1635 GLY B CA  1 
ATOM   876  C  C   . GLY B 1 13 ? 10.814 41.375 22.111  1.00 24.70 ? 1635 GLY B C   1 
ATOM   877  O  O   . GLY B 1 13 ? 10.492 40.847 21.060  1.00 29.67 ? 1635 GLY B O   1 
ATOM   878  N  N   . ARG B 1 14 ? 11.070 42.674 22.216  1.00 31.69 ? 1636 ARG B N   1 
ATOM   879  C  CA  . ARG B 1 14 ? 11.032 43.557 21.068  1.00 28.20 ? 1636 ARG B CA  1 
ATOM   880  C  C   . ARG B 1 14 ? 12.217 43.379 20.163  1.00 31.49 ? 1636 ARG B C   1 
ATOM   881  O  O   . ARG B 1 14 ? 12.106 43.597 18.965  1.00 33.00 ? 1636 ARG B O   1 
ATOM   882  C  CB  . ARG B 1 14 ? 11.002 45.026 21.549  1.00 30.47 ? 1636 ARG B CB  1 
ATOM   883  C  CG  . ARG B 1 14 ? 10.829 45.994 20.433  1.00 36.38 ? 1636 ARG B CG  1 
ATOM   884  C  CD  . ARG B 1 14 ? 9.903  47.148 20.814  1.00 35.64 ? 1636 ARG B CD  1 
ATOM   885  N  NE  . ARG B 1 14 ? 10.558 48.133 21.631  1.00 34.98 ? 1636 ARG B NE  1 
ATOM   886  C  CZ  . ARG B 1 14 ? 10.089 49.358 21.863  1.00 25.50 ? 1636 ARG B CZ  1 
ATOM   887  N  NH1 . ARG B 1 14 ? 8.893  49.780 21.417  1.00 32.00 ? 1636 ARG B NH1 1 
ATOM   888  N  NH2 . ARG B 1 14 ? 10.788 50.173 22.641  1.00 39.20 ? 1636 ARG B NH2 1 
ATOM   889  N  N   . THR B 1 15 ? 13.343 42.965 20.749  1.00 30.59 ? 1637 THR B N   1 
ATOM   890  C  CA  . THR B 1 15 ? 14.575 42.782 20.024  1.00 27.87 ? 1637 THR B CA  1 
ATOM   891  C  C   . THR B 1 15 ? 14.591 41.453 19.203  1.00 29.64 ? 1637 THR B C   1 
ATOM   892  O  O   . THR B 1 15 ? 15.284 41.342 18.212  1.00 34.55 ? 1637 THR B O   1 
ATOM   893  C  CB  . THR B 1 15 ? 15.800 42.838 21.002  1.00 24.71 ? 1637 THR B CB  1 
ATOM   894  O  OG1 . THR B 1 15 ? 15.628 41.889 22.061  1.00 35.93 ? 1637 THR B OG1 1 
ATOM   895  C  CG2 . THR B 1 15 ? 15.906 44.205 21.602  1.00 34.98 ? 1637 THR B CG2 1 
ATOM   896  N  N   . GLY B 1 16 ? 13.742 40.506 19.607  1.00 31.58 ? 1638 GLY B N   1 
ATOM   897  C  CA  . GLY B 1 16 ? 13.653 39.198 18.993  1.00 32.47 ? 1638 GLY B CA  1 
ATOM   898  C  C   . GLY B 1 16 ? 14.739 38.357 19.625  1.00 29.52 ? 1638 GLY B C   1 
ATOM   899  O  O   . GLY B 1 16 ? 15.339 38.727 20.619  1.00 29.69 ? 1638 GLY B O   1 
ATOM   900  N  N   . LEU B 1 17 ? 14.994 37.211 19.015  1.00 31.07 ? 1639 LEU B N   1 
ATOM   901  C  CA  . LEU B 1 17 ? 15.919 36.229 19.575  1.00 26.77 ? 1639 LEU B CA  1 
ATOM   902  C  C   . LEU B 1 17 ? 17.387 36.600 19.560  1.00 23.81 ? 1639 LEU B C   1 
ATOM   903  O  O   . LEU B 1 17 ? 18.115 36.245 20.494  1.00 23.78 ? 1639 LEU B O   1 
ATOM   904  C  CB  . LEU B 1 17 ? 15.798 34.958 18.742  1.00 26.91 ? 1639 LEU B CB  1 
ATOM   905  C  CG  . LEU B 1 17 ? 14.392 34.368 18.764  1.00 35.26 ? 1639 LEU B CG  1 
ATOM   906  C  CD1 . LEU B 1 17 ? 14.411 33.113 17.894  1.00 39.04 ? 1639 LEU B CD1 1 
ATOM   907  C  CD2 . LEU B 1 17 ? 13.973 34.061 20.171  1.00 39.07 ? 1639 LEU B CD2 1 
ATOM   908  N  N   . GLY B 1 18 ? 17.855 37.217 18.499  1.00 19.54 ? 1640 GLY B N   1 
ATOM   909  C  CA  . GLY B 1 18 ? 19.244 37.625 18.332  1.00 19.19 ? 1640 GLY B CA  1 
ATOM   910  C  C   . GLY B 1 18 ? 20.156 36.403 18.158  1.00 21.52 ? 1640 GLY B C   1 
ATOM   911  O  O   . GLY B 1 18 ? 21.109 36.181 18.929  1.00 21.29 ? 1640 GLY B O   1 
ATOM   912  N  N   . LEU B 1 19 ? 19.880 35.624 17.104  1.00 20.69 ? 1641 LEU B N   1 
ATOM   913  C  CA  . LEU B 1 19 ? 20.648 34.384 16.806  1.00 19.28 ? 1641 LEU B CA  1 
ATOM   914  C  C   . LEU B 1 19 ? 21.042 34.380 15.374  1.00 19.20 ? 1641 LEU B C   1 
ATOM   915  O  O   . LEU B 1 19 ? 20.282 34.896 14.559  1.00 20.43 ? 1641 LEU B O   1 
ATOM   916  C  CB  . LEU B 1 19 ? 19.767 33.148 17.007  1.00 19.45 ? 1641 LEU B CB  1 
ATOM   917  C  CG  . LEU B 1 19 ? 19.237 32.956 18.412  1.00 18.20 ? 1641 LEU B CG  1 
ATOM   918  C  CD1 . LEU B 1 19 ? 18.274 31.844 18.489  1.00 24.29 ? 1641 LEU B CD1 1 
ATOM   919  C  CD2 . LEU B 1 19 ? 20.335 32.677 19.412  1.00 21.74 ? 1641 LEU B CD2 1 
ATOM   920  N  N   . SER B 1 20 ? 22.189 33.824 15.025  1.00 17.27 ? 1642 SER B N   1 
ATOM   921  C  CA  . SER B 1 20 ? 22.585 33.466 13.699  1.00 16.23 ? 1642 SER B CA  1 
ATOM   922  C  C   . SER B 1 20 ? 22.332 31.982 13.509  1.00 17.30 ? 1642 SER B C   1 
ATOM   923  O  O   . SER B 1 20 ? 22.831 31.185 14.295  1.00 17.62 ? 1642 SER B O   1 
ATOM   924  C  CB  . SER B 1 20 ? 24.098 33.738 13.480  1.00 18.33 ? 1642 SER B CB  1 
ATOM   925  O  OG  . SER B 1 20 ? 24.459 33.342 12.167  1.00 23.43 ? 1642 SER B OG  1 
ATOM   926  N  N   . ILE B 1 21 ? 21.513 31.581 12.535  1.00 17.21 ? 1643 ILE B N   1 
ATOM   927  C  CA  . ILE B 1 21 ? 21.100 30.215 12.318  1.00 15.55 ? 1643 ILE B CA  1 
ATOM   928  C  C   . ILE B 1 21 ? 21.689 29.726 11.041  1.00 17.19 ? 1643 ILE B C   1 
ATOM   929  O  O   . ILE B 1 21 ? 21.578 30.377 9.978   1.00 17.89 ? 1643 ILE B O   1 
ATOM   930  C  CB  . ILE B 1 21 ? 19.567 30.119 12.225  1.00 18.25 ? 1643 ILE B CB  1 
ATOM   931  C  CG1 . ILE B 1 21 ? 18.868 30.698 13.471  1.00 19.03 ? 1643 ILE B CG1 1 
ATOM   932  C  CG2 . ILE B 1 21 ? 19.164 28.680 11.935  1.00 19.73 ? 1643 ILE B CG2 1 
ATOM   933  C  CD1 . ILE B 1 21 ? 19.209 30.050 14.738  1.00 20.38 ? 1643 ILE B CD1 1 
ATOM   934  N  N   . VAL B 1 22 ? 22.351 28.585 11.079  1.00 16.94 ? 1644 VAL B N   1 
ATOM   935  C  CA  . VAL B 1 22 ? 22.838 27.919 9.922   1.00 15.24 ? 1644 VAL B CA  1 
ATOM   936  C  C   . VAL B 1 22 ? 22.255 26.545 9.777   1.00 15.31 ? 1644 VAL B C   1 
ATOM   937  O  O   . VAL B 1 22 ? 21.674 26.008 10.727  1.00 16.86 ? 1644 VAL B O   1 
ATOM   938  C  CB  . VAL B 1 22 ? 24.396 27.848 9.961   1.00 15.62 ? 1644 VAL B CB  1 
ATOM   939  C  CG1 . VAL B 1 22 ? 25.036 29.214 9.910   1.00 19.08 ? 1644 VAL B CG1 1 
ATOM   940  C  CG2 . VAL B 1 22 ? 24.899 27.099 11.204  1.00 19.95 ? 1644 VAL B CG2 1 
ATOM   941  N  N   . GLY B 1 23 ? 22.355 25.940 8.641   1.00 15.53 ? 1645 GLY B N   1 
ATOM   942  C  CA  . GLY B 1 23 ? 22.019 24.576 8.463   1.00 16.41 ? 1645 GLY B CA  1 
ATOM   943  C  C   . GLY B 1 23 ? 20.621 24.311 7.997   1.00 16.59 ? 1645 GLY B C   1 
ATOM   944  O  O   . GLY B 1 23 ? 19.948 25.164 7.454   1.00 17.97 ? 1645 GLY B O   1 
ATOM   945  N  N   . GLY B 1 24 ? 20.237 23.058 8.126   1.00 16.43 ? 1646 GLY B N   1 
ATOM   946  C  CA  . GLY B 1 24 ? 18.981 22.471 7.642   1.00 16.72 ? 1646 GLY B CA  1 
ATOM   947  C  C   . GLY B 1 24 ? 19.233 21.215 6.815   1.00 17.37 ? 1646 GLY B C   1 
ATOM   948  O  O   . GLY B 1 24 ? 20.374 20.910 6.440   1.00 17.68 ? 1646 GLY B O   1 
ATOM   949  N  N   . SER B 1 25 ? 18.156 20.500 6.539   1.00 17.14 ? 1647 SER B N   1 
ATOM   950  C  CA  . SER B 1 25 ? 18.264 19.218 5.838   1.00 18.55 ? 1647 SER B CA  1 
ATOM   951  C  C   . SER B 1 25 ? 18.734 19.327 4.421   1.00 20.73 ? 1647 SER B C   1 
ATOM   952  O  O   . SER B 1 25 ? 19.263 18.360 3.833   1.00 21.45 ? 1647 SER B O   1 
ATOM   953  C  CB  . SER B 1 25 ? 16.919 18.523 5.919   1.00 20.18 ? 1647 SER B CB  1 
ATOM   954  O  OG  . SER B 1 25 ? 15.923 19.242 5.225   1.00 20.71 ? 1647 SER B OG  1 
ATOM   955  N  N   . ASP B 1 26 ? 18.656 20.554 3.888   1.00 17.12 ? 1648 ASP B N   1 
ATOM   956  C  CA  . ASP B 1 26 ? 19.121 20.869 2.546   1.00 17.91 ? 1648 ASP B CA  1 
ATOM   957  C  C   . ASP B 1 26 ? 20.568 21.258 2.493   1.00 18.37 ? 1648 ASP B C   1 
ATOM   958  O  O   . ASP B 1 26 ? 21.104 21.490 1.374   1.00 20.12 ? 1648 ASP B O   1 
ATOM   959  C  CB  . ASP B 1 26 ? 18.223 21.929 1.894   1.00 15.76 ? 1648 ASP B CB  1 
ATOM   960  C  CG  . ASP B 1 26 ? 17.995 23.184 2.736   1.00 20.77 ? 1648 ASP B CG  1 
ATOM   961  O  OD1 . ASP B 1 26 ? 18.012 23.135 3.974   1.00 18.36 ? 1648 ASP B OD1 1 
ATOM   962  O  OD2 . ASP B 1 26 ? 17.734 24.234 2.074   1.00 19.67 ? 1648 ASP B OD2 1 
ATOM   963  N  N   . THR B 1 27 ? 21.261 21.353 3.627   1.00 17.32 ? 1649 THR B N   1 
ATOM   964  C  CA  . THR B 1 27 ? 22.640 21.795 3.710   1.00 17.25 ? 1649 THR B CA  1 
ATOM   965  C  C   . THR B 1 27 ? 23.584 20.637 4.036   1.00 21.10 ? 1649 THR B C   1 
ATOM   966  O  O   . THR B 1 27 ? 23.137 19.603 4.475   1.00 18.85 ? 1649 THR B O   1 
ATOM   967  C  CB  . THR B 1 27 ? 22.797 22.884 4.752   1.00 19.55 ? 1649 THR B CB  1 
ATOM   968  O  OG1 . THR B 1 27 ? 22.719 22.343 6.078   1.00 18.33 ? 1649 THR B OG1 1 
ATOM   969  C  CG2 . THR B 1 27 ? 21.752 23.928 4.543   1.00 18.29 ? 1649 THR B CG2 1 
ATOM   970  N  N   . LEU B 1 28 ? 24.888 20.912 3.947   1.00 19.17 ? 1650 LEU B N   1 
ATOM   971  C  CA  . LEU B 1 28 ? 25.942 19.970 4.433   1.00 20.98 ? 1650 LEU B CA  1 
ATOM   972  C  C   . LEU B 1 28 ? 25.818 19.645 5.890   1.00 23.81 ? 1650 LEU B C   1 
ATOM   973  O  O   . LEU B 1 28 ? 26.206 18.545 6.311   1.00 24.89 ? 1650 LEU B O   1 
ATOM   974  C  CB  . LEU B 1 28 ? 27.377 20.499 4.188   1.00 21.22 ? 1650 LEU B CB  1 
ATOM   975  C  CG  . LEU B 1 28 ? 27.759 20.570 2.748   1.00 20.68 ? 1650 LEU B CG  1 
ATOM   976  C  CD1 . LEU B 1 28 ? 29.181 21.197 2.680   1.00 22.74 ? 1650 LEU B CD1 1 
ATOM   977  C  CD2 . LEU B 1 28 ? 27.773 19.153 2.176   1.00 24.15 ? 1650 LEU B CD2 1 
ATOM   978  N  N   . LEU B 1 29 ? 25.369 20.590 6.715   1.00 20.00 ? 1651 LEU B N   1 
ATOM   979  C  CA  . LEU B 1 29 ? 25.209 20.310 8.123   1.00 20.91 ? 1651 LEU B CA  1 
ATOM   980  C  C   . LEU B 1 29 ? 24.136 19.297 8.435   1.00 20.61 ? 1651 LEU B C   1 
ATOM   981  O  O   . LEU B 1 29 ? 24.271 18.529 9.397   1.00 23.30 ? 1651 LEU B O   1 
ATOM   982  C  CB  . LEU B 1 29 ? 24.884 21.576 8.921   1.00 24.52 ? 1651 LEU B CB  1 
ATOM   983  C  CG  . LEU B 1 29 ? 25.969 22.463 9.426   1.00 26.48 ? 1651 LEU B CG  1 
ATOM   984  C  CD1 . LEU B 1 29 ? 25.337 23.724 9.936   1.00 26.95 ? 1651 LEU B CD1 1 
ATOM   985  C  CD2 . LEU B 1 29 ? 26.774 21.745 10.523  1.00 25.05 ? 1651 LEU B CD2 1 
ATOM   986  N  N   . GLY B 1 30 ? 23.026 19.317 7.700   1.00 18.60 ? 1652 GLY B N   1 
ATOM   987  C  CA  . GLY B 1 30 ? 21.946 18.401 7.926   1.00 20.60 ? 1652 GLY B CA  1 
ATOM   988  C  C   . GLY B 1 30 ? 21.110 18.572 9.120   1.00 23.62 ? 1652 GLY B C   1 
ATOM   989  O  O   . GLY B 1 30 ? 20.255 17.732 9.443   1.00 26.99 ? 1652 GLY B O   1 
ATOM   990  N  N   . ALA B 1 31 ? 21.351 19.649 9.831   1.00 21.37 ? 1653 ALA B N   1 
ATOM   991  C  CA  . ALA B 1 31 ? 20.761 19.983 11.158  1.00 21.53 ? 1653 ALA B CA  1 
ATOM   992  C  C   . ALA B 1 31 ? 20.778 21.482 11.256  1.00 18.92 ? 1653 ALA B C   1 
ATOM   993  O  O   . ALA B 1 31 ? 21.614 22.139 10.596  1.00 18.07 ? 1653 ALA B O   1 
ATOM   994  C  CB  . ALA B 1 31 ? 21.609 19.468 12.227  1.00 21.94 ? 1653 ALA B CB  1 
ATOM   995  N  N   . ILE B 1 32 ? 19.886 22.039 12.075  1.00 18.25 ? 1654 ILE B N   1 
ATOM   996  C  CA  . ILE B 1 32 ? 19.776 23.440 12.340  1.00 17.06 ? 1654 ILE B CA  1 
ATOM   997  C  C   . ILE B 1 32 ? 20.646 23.793 13.522  1.00 20.54 ? 1654 ILE B C   1 
ATOM   998  O  O   . ILE B 1 32 ? 20.472 23.211 14.603  1.00 19.23 ? 1654 ILE B O   1 
ATOM   999  C  CB  . ILE B 1 32 ? 18.292 23.870 12.613  1.00 18.20 ? 1654 ILE B CB  1 
ATOM   1000 C  CG1 . ILE B 1 32 ? 17.355 23.564 11.424  1.00 21.99 ? 1654 ILE B CG1 1 
ATOM   1001 C  CG2 . ILE B 1 32 ? 18.188 25.293 13.064  1.00 18.02 ? 1654 ILE B CG2 1 
ATOM   1002 C  CD1 . ILE B 1 32 ? 17.559 24.478 10.236  1.00 22.29 ? 1654 ILE B CD1 1 
ATOM   1003 N  N   . ILE B 1 33 ? 21.613 24.702 13.352  1.00 16.71 ? 1655 ILE B N   1 
ATOM   1004 C  CA  . ILE B 1 33 ? 22.601 25.046 14.385  1.00 16.23 ? 1655 ILE B CA  1 
ATOM   1005 C  C   . ILE B 1 33 ? 22.577 26.517 14.659  1.00 16.96 ? 1655 ILE B C   1 
ATOM   1006 O  O   . ILE B 1 33 ? 22.460 27.364 13.765  1.00 17.20 ? 1655 ILE B O   1 
ATOM   1007 C  CB  . ILE B 1 33 ? 24.024 24.614 13.933  1.00 19.62 ? 1655 ILE B CB  1 
ATOM   1008 C  CG1 . ILE B 1 33 ? 24.104 23.148 13.561  1.00 22.37 ? 1655 ILE B CG1 1 
ATOM   1009 C  CG2 . ILE B 1 33 ? 25.155 25.032 14.871  1.00 18.96 ? 1655 ILE B CG2 1 
ATOM   1010 C  CD1 . ILE B 1 33 ? 23.841 22.290 14.662  1.00 23.84 ? 1655 ILE B CD1 1 
ATOM   1011 N  N   . ILE B 1 34 ? 22.707 26.870 15.926  1.00 15.94 ? 1656 ILE B N   1 
ATOM   1012 C  CA  . ILE B 1 34 ? 22.910 28.247 16.338  1.00 16.09 ? 1656 ILE B CA  1 
ATOM   1013 C  C   . ILE B 1 34 ? 24.390 28.541 16.119  1.00 16.05 ? 1656 ILE B C   1 
ATOM   1014 O  O   . ILE B 1 34 ? 25.268 28.030 16.843  1.00 17.95 ? 1656 ILE B O   1 
ATOM   1015 C  CB  . ILE B 1 34 ? 22.537 28.469 17.797  1.00 18.13 ? 1656 ILE B CB  1 
ATOM   1016 C  CG1 . ILE B 1 34 ? 21.067 28.248 17.970  1.00 17.58 ? 1656 ILE B CG1 1 
ATOM   1017 C  CG2 . ILE B 1 34 ? 22.963 29.926 18.226  1.00 18.83 ? 1656 ILE B CG2 1 
ATOM   1018 C  CD1 . ILE B 1 34 ? 20.530 28.287 19.428  1.00 22.18 ? 1656 ILE B CD1 1 
ATOM   1019 N  N   . HIS B 1 35 ? 24.750 29.328 15.118  1.00 15.44 ? 1657 HIS B N   1 
ATOM   1020 C  CA  . HIS B 1 35 ? 26.115 29.685 14.873  1.00 15.60 ? 1657 HIS B CA  1 
ATOM   1021 C  C   . HIS B 1 35 ? 26.649 30.727 15.855  1.00 17.55 ? 1657 HIS B C   1 
ATOM   1022 O  O   . HIS B 1 35 ? 27.838 30.682 16.248  1.00 20.18 ? 1657 HIS B O   1 
ATOM   1023 C  CB  . HIS B 1 35 ? 26.251 30.231 13.462  1.00 17.22 ? 1657 HIS B CB  1 
ATOM   1024 C  CG  . HIS B 1 35 ? 27.625 30.676 13.129  1.00 17.49 ? 1657 HIS B CG  1 
ATOM   1025 N  ND1 . HIS B 1 35 ? 28.632 29.801 12.833  1.00 20.23 ? 1657 HIS B ND1 1 
ATOM   1026 C  CD2 . HIS B 1 35 ? 28.143 31.915 13.079  1.00 21.05 ? 1657 HIS B CD2 1 
ATOM   1027 C  CE1 . HIS B 1 35 ? 29.741 30.500 12.614  1.00 21.34 ? 1657 HIS B CE1 1 
ATOM   1028 N  NE2 . HIS B 1 35 ? 29.470 31.785 12.743  1.00 20.06 ? 1657 HIS B NE2 1 
ATOM   1029 N  N   . GLU B 1 36 ? 25.824 31.675 16.255  1.00 17.39 ? 1658 GLU B N   1 
ATOM   1030 C  CA  . GLU B 1 36 ? 26.239 32.754 17.169  1.00 20.08 ? 1658 GLU B CA  1 
ATOM   1031 C  C   . GLU B 1 36 ? 25.054 33.282 17.879  1.00 20.03 ? 1658 GLU B C   1 
ATOM   1032 O  O   . GLU B 1 36 ? 23.967 33.283 17.314  1.00 18.82 ? 1658 GLU B O   1 
ATOM   1033 C  CB  . GLU B 1 36 ? 26.900 33.888 16.345  1.00 23.44 ? 1658 GLU B CB  1 
ATOM   1034 C  CG  . GLU B 1 36 ? 27.144 35.214 17.063  1.00 34.35 ? 1658 GLU B CG  1 
ATOM   1035 C  CD  . GLU B 1 36 ? 28.249 36.058 16.408  1.00 31.95 ? 1658 GLU B CD  1 
ATOM   1036 O  OE1 . GLU B 1 36 ? 28.598 35.812 15.247  1.00 34.51 ? 1658 GLU B OE1 1 
ATOM   1037 O  OE2 . GLU B 1 36 ? 28.734 36.978 17.098  1.00 43.62 ? 1658 GLU B OE2 1 
ATOM   1038 N  N   . VAL B 1 37 ? 25.249 33.750 19.119  1.00 18.92 ? 1659 VAL B N   1 
ATOM   1039 C  CA  . VAL B 1 37 ? 24.263 34.463 19.914  1.00 18.33 ? 1659 VAL B CA  1 
ATOM   1040 C  C   . VAL B 1 37 ? 24.717 35.915 19.923  1.00 22.26 ? 1659 VAL B C   1 
ATOM   1041 O  O   . VAL B 1 37 ? 25.833 36.214 20.312  1.00 24.85 ? 1659 VAL B O   1 
ATOM   1042 C  CB  . VAL B 1 37 ? 24.140 33.889 21.334  1.00 19.79 ? 1659 VAL B CB  1 
ATOM   1043 C  CG1 . VAL B 1 37 ? 23.183 34.723 22.184  1.00 21.56 ? 1659 VAL B CG1 1 
ATOM   1044 C  CG2 . VAL B 1 37 ? 23.791 32.401 21.311  1.00 21.02 ? 1659 VAL B CG2 1 
ATOM   1045 N  N   . TYR B 1 38 ? 23.931 36.796 19.348  1.00 21.70 ? 1660 TYR B N   1 
ATOM   1046 C  CA  . TYR B 1 38 ? 24.267 38.207 19.295  1.00 20.82 ? 1660 TYR B CA  1 
ATOM   1047 C  C   . TYR B 1 38 ? 23.970 38.924 20.606  1.00 25.94 ? 1660 TYR B C   1 
ATOM   1048 O  O   . TYR B 1 38 ? 23.066 38.584 21.345  1.00 21.32 ? 1660 TYR B O   1 
ATOM   1049 C  CB  . TYR B 1 38 ? 23.525 38.864 18.146  1.00 22.91 ? 1660 TYR B CB  1 
ATOM   1050 C  CG  . TYR B 1 38 ? 23.913 38.351 16.784  1.00 22.30 ? 1660 TYR B CG  1 
ATOM   1051 C  CD1 . TYR B 1 38 ? 25.178 38.607 16.282  1.00 23.40 ? 1660 TYR B CD1 1 
ATOM   1052 C  CD2 . TYR B 1 38 ? 23.001 37.715 15.951  1.00 24.05 ? 1660 TYR B CD2 1 
ATOM   1053 C  CE1 . TYR B 1 38 ? 25.563 38.152 15.023  1.00 28.45 ? 1660 TYR B CE1 1 
ATOM   1054 C  CE2 . TYR B 1 38 ? 23.364 37.282 14.699  1.00 27.87 ? 1660 TYR B CE2 1 
ATOM   1055 C  CZ  . TYR B 1 38 ? 24.643 37.503 14.238  1.00 26.57 ? 1660 TYR B CZ  1 
ATOM   1056 O  OH  . TYR B 1 38 ? 25.016 37.065 12.983  1.00 27.68 ? 1660 TYR B OH  1 
ATOM   1057 N  N   . GLU B 1 39 ? 24.741 39.975 20.868  1.00 24.29 ? 1661 GLU B N   1 
ATOM   1058 C  CA  . GLU B 1 39 ? 24.585 40.732 22.099  1.00 28.82 ? 1661 GLU B CA  1 
ATOM   1059 C  C   . GLU B 1 39 ? 23.234 41.376 22.321  1.00 31.04 ? 1661 GLU B C   1 
ATOM   1060 O  O   . GLU B 1 39 ? 22.773 41.469 23.471  1.00 32.89 ? 1661 GLU B O   1 
ATOM   1061 C  CB  . GLU B 1 39 ? 25.662 41.837 22.189  1.00 32.24 ? 1661 GLU B CB  1 
ATOM   1062 C  CG  . GLU B 1 39 ? 27.077 41.324 22.324  1.00 40.35 ? 1661 GLU B CG  1 
ATOM   1063 C  CD  . GLU B 1 39 ? 27.316 40.552 23.614  1.00 53.27 ? 1661 GLU B CD  1 
ATOM   1064 O  OE1 . GLU B 1 39 ? 26.803 40.981 24.677  1.00 56.15 ? 1661 GLU B OE1 1 
ATOM   1065 O  OE2 . GLU B 1 39 ? 28.023 39.511 23.553  1.00 62.86 ? 1661 GLU B OE2 1 
ATOM   1066 N  N   . GLU B 1 40 ? 22.588 41.830 21.263  1.00 24.94 ? 1662 GLU B N   1 
ATOM   1067 C  CA  . GLU B 1 40 ? 21.412 42.713 21.475  1.00 33.55 ? 1662 GLU B CA  1 
ATOM   1068 C  C   . GLU B 1 40 ? 20.043 42.044 21.882  1.00 35.43 ? 1662 GLU B C   1 
ATOM   1069 O  O   . GLU B 1 40 ? 19.093 42.761 22.243  1.00 39.51 ? 1662 GLU B O   1 
ATOM   1070 C  CB  . GLU B 1 40 ? 21.203 43.608 20.232  1.00 34.66 ? 1662 GLU B CB  1 
ATOM   1071 N  N   . GLY B 1 41 ? 19.946 40.711 21.865  1.00 28.59 ? 1663 GLY B N   1 
ATOM   1072 C  CA  . GLY B 1 41 ? 18.636 40.027 21.834  1.00 23.97 ? 1663 GLY B CA  1 
ATOM   1073 C  C   . GLY B 1 41 ? 18.261 39.227 23.056  1.00 23.34 ? 1663 GLY B C   1 
ATOM   1074 O  O   . GLY B 1 41 ? 19.010 39.149 24.030  1.00 24.12 ? 1663 GLY B O   1 
ATOM   1075 N  N   . ALA B 1 42 ? 17.115 38.536 22.938  1.00 21.87 ? 1664 ALA B N   1 
ATOM   1076 C  CA  . ALA B 1 42 ? 16.538 37.762 24.021  1.00 23.97 ? 1664 ALA B CA  1 
ATOM   1077 C  C   . ALA B 1 42 ? 17.424 36.577 24.443  1.00 20.05 ? 1664 ALA B C   1 
ATOM   1078 O  O   . ALA B 1 42 ? 17.507 36.228 25.633  1.00 23.08 ? 1664 ALA B O   1 
ATOM   1079 C  CB  . ALA B 1 42 ? 15.172 37.199 23.587  1.00 28.02 ? 1664 ALA B CB  1 
ATOM   1080 N  N   . ALA B 1 43 ? 18.042 35.926 23.469  1.00 22.79 ? 1665 ALA B N   1 
ATOM   1081 C  CA  . ALA B 1 43 ? 18.888 34.744 23.788  1.00 23.49 ? 1665 ALA B CA  1 
ATOM   1082 C  C   . ALA B 1 43 ? 20.092 35.089 24.709  1.00 19.24 ? 1665 ALA B C   1 
ATOM   1083 O  O   . ALA B 1 43 ? 20.439 34.361 25.667  1.00 21.68 ? 1665 ALA B O   1 
ATOM   1084 C  CB  . ALA B 1 43 ? 19.341 34.096 22.505  1.00 21.07 ? 1665 ALA B CB  1 
ATOM   1085 N  N   . CYS B 1 44 ? 20.759 36.191 24.378  1.00 19.58 ? 1666 CYS B N   1 
ATOM   1086 C  CA  . CYS B 1 44 ? 21.862 36.669 25.162  1.00 22.35 ? 1666 CYS B CA  1 
ATOM   1087 C  C   . CYS B 1 44 ? 21.443 37.068 26.570  1.00 22.95 ? 1666 CYS B C   1 
ATOM   1088 O  O   . CYS B 1 44 ? 22.100 36.675 27.543  1.00 27.39 ? 1666 CYS B O   1 
ATOM   1089 C  CB  . CYS B 1 44 ? 22.482 37.850 24.483  1.00 20.77 ? 1666 CYS B CB  1 
ATOM   1090 S  SG  . CYS B 1 44 ? 23.971 38.434 25.358  1.00 30.16 ? 1666 CYS B SG  1 
ATOM   1091 N  N   . LYS B 1 45 ? 20.315 37.760 26.659  1.00 26.20 ? 1667 LYS B N   1 
ATOM   1092 C  CA  . LYS B 1 45 ? 19.778 38.215 27.948  1.00 25.41 ? 1667 LYS B CA  1 
ATOM   1093 C  C   . LYS B 1 45 ? 19.454 37.021 28.850  1.00 27.76 ? 1667 LYS B C   1 
ATOM   1094 O  O   . LYS B 1 45 ? 19.704 37.035 30.078  1.00 27.98 ? 1667 LYS B O   1 
ATOM   1095 C  CB  . LYS B 1 45 ? 18.542 39.075 27.711  1.00 27.88 ? 1667 LYS B CB  1 
ATOM   1096 C  CG  . LYS B 1 45 ? 18.855 40.427 27.063  1.00 42.20 ? 1667 LYS B CG  1 
ATOM   1097 C  CD  . LYS B 1 45 ? 17.672 41.418 27.198  1.00 53.11 ? 1667 LYS B CD  1 
ATOM   1098 C  CE  . LYS B 1 45 ? 17.818 42.606 26.246  1.00 55.80 ? 1667 LYS B CE  1 
ATOM   1099 N  NZ  . LYS B 1 45 ? 17.377 42.291 24.844  1.00 55.66 ? 1667 LYS B NZ  1 
ATOM   1100 N  N   . ASP B 1 46 ? 18.935 35.967 28.235  1.00 23.20 ? 1668 ASP B N   1 
ATOM   1101 C  CA  . ASP B 1 46 ? 18.585 34.778 28.976  1.00 25.08 ? 1668 ASP B CA  1 
ATOM   1102 C  C   . ASP B 1 46 ? 19.846 34.046 29.415  1.00 22.84 ? 1668 ASP B C   1 
ATOM   1103 O  O   . ASP B 1 46 ? 19.918 33.586 30.550  1.00 25.65 ? 1668 ASP B O   1 
ATOM   1104 C  CB  . ASP B 1 46 ? 17.733 33.899 28.115  1.00 21.35 ? 1668 ASP B CB  1 
ATOM   1105 C  CG  . ASP B 1 46 ? 17.474 32.586 28.766  1.00 31.01 ? 1668 ASP B CG  1 
ATOM   1106 O  OD1 . ASP B 1 46 ? 16.560 32.538 29.608  1.00 29.24 ? 1668 ASP B OD1 1 
ATOM   1107 O  OD2 . ASP B 1 46 ? 18.242 31.624 28.507  1.00 26.39 ? 1668 ASP B OD2 1 
ATOM   1108 N  N   . GLY B 1 47 ? 20.835 33.933 28.515  1.00 22.22 ? 1669 GLY B N   1 
ATOM   1109 C  CA  . GLY B 1 47 ? 22.152 33.398 28.845  1.00 24.41 ? 1669 GLY B CA  1 
ATOM   1110 C  C   . GLY B 1 47 ? 22.413 31.934 28.645  1.00 25.20 ? 1669 GLY B C   1 
ATOM   1111 O  O   . GLY B 1 47 ? 23.559 31.518 28.700  1.00 26.48 ? 1669 GLY B O   1 
ATOM   1112 N  N   . ARG B 1 48 ? 21.382 31.130 28.422  1.00 20.43 ? 1670 ARG B N   1 
ATOM   1113 C  CA  . ARG B 1 48 ? 21.493 29.691 28.394  1.00 19.54 ? 1670 ARG B CA  1 
ATOM   1114 C  C   . ARG B 1 48 ? 21.801 29.081 27.055  1.00 23.14 ? 1670 ARG B C   1 
ATOM   1115 O  O   . ARG B 1 48 ? 22.405 28.050 27.040  1.00 28.66 ? 1670 ARG B O   1 
ATOM   1116 C  CB  . ARG B 1 48 ? 20.230 29.026 28.962  1.00 19.85 ? 1670 ARG B CB  1 
ATOM   1117 C  CG  . ARG B 1 48 ? 20.072 29.306 30.457  1.00 20.91 ? 1670 ARG B CG  1 
ATOM   1118 C  CD  . ARG B 1 48 ? 18.821 28.710 30.991  1.00 20.75 ? 1670 ARG B CD  1 
ATOM   1119 N  NE  . ARG B 1 48 ? 17.718 29.482 30.470  1.00 23.27 ? 1670 ARG B NE  1 
ATOM   1120 C  CZ  . ARG B 1 48 ? 16.451 29.127 30.558  1.00 24.74 ? 1670 ARG B CZ  1 
ATOM   1121 N  NH1 . ARG B 1 48 ? 16.107 28.016 31.166  1.00 26.44 ? 1670 ARG B NH1 1 
ATOM   1122 N  NH2 . ARG B 1 48 ? 15.519 29.923 30.012  1.00 28.27 ? 1670 ARG B NH2 1 
ATOM   1123 N  N   . LEU B 1 49 ? 21.419 29.702 25.946  1.00 20.03 ? 1671 LEU B N   1 
ATOM   1124 C  CA  . LEU B 1 49 ? 21.716 29.220 24.605  1.00 18.33 ? 1671 LEU B CA  1 
ATOM   1125 C  C   . LEU B 1 49 ? 23.138 29.512 24.246  1.00 22.67 ? 1671 LEU B C   1 
ATOM   1126 O  O   . LEU B 1 49 ? 23.649 30.610 24.460  1.00 22.65 ? 1671 LEU B O   1 
ATOM   1127 C  CB  . LEU B 1 49 ? 20.852 29.907 23.536  1.00 20.03 ? 1671 LEU B CB  1 
ATOM   1128 C  CG  . LEU B 1 49 ? 19.423 29.542 23.559  1.00 22.84 ? 1671 LEU B CG  1 
ATOM   1129 C  CD1 . LEU B 1 49 ? 18.588 30.389 22.548  1.00 24.74 ? 1671 LEU B CD1 1 
ATOM   1130 C  CD2 . LEU B 1 49 ? 19.188 28.053 23.219  1.00 27.95 ? 1671 LEU B CD2 1 
ATOM   1131 N  N   . TRP B 1 50 ? 23.767 28.530 23.587  1.00 17.64 ? 1672 TRP B N   1 
ATOM   1132 C  CA  . TRP B 1 50 ? 25.146 28.579 23.259  1.00 18.40 ? 1672 TRP B CA  1 
ATOM   1133 C  C   . TRP B 1 50 ? 25.385 28.342 21.767  1.00 17.41 ? 1672 TRP B C   1 
ATOM   1134 O  O   . TRP B 1 50 ? 24.709 27.542 21.127  1.00 16.71 ? 1672 TRP B O   1 
ATOM   1135 C  CB  . TRP B 1 50 ? 25.892 27.466 23.948  1.00 19.19 ? 1672 TRP B CB  1 
ATOM   1136 C  CG  . TRP B 1 50 ? 25.978 27.528 25.462  1.00 20.67 ? 1672 TRP B CG  1 
ATOM   1137 C  CD1 . TRP B 1 50 ? 25.496 28.483 26.275  1.00 24.22 ? 1672 TRP B CD1 1 
ATOM   1138 C  CD2 . TRP B 1 50 ? 26.587 26.542 26.283  1.00 29.54 ? 1672 TRP B CD2 1 
ATOM   1139 N  NE1 . TRP B 1 50 ? 25.809 28.173 27.603  1.00 24.93 ? 1672 TRP B NE1 1 
ATOM   1140 C  CE2 . TRP B 1 50 ? 26.482 26.979 27.612  1.00 31.25 ? 1672 TRP B CE2 1 
ATOM   1141 C  CE3 . TRP B 1 50 ? 27.238 25.334 26.012  1.00 25.65 ? 1672 TRP B CE3 1 
ATOM   1142 C  CZ2 . TRP B 1 50 ? 26.968 26.227 28.675  1.00 32.33 ? 1672 TRP B CZ2 1 
ATOM   1143 C  CZ3 . TRP B 1 50 ? 27.752 24.596 27.065  1.00 29.51 ? 1672 TRP B CZ3 1 
ATOM   1144 C  CH2 . TRP B 1 50 ? 27.585 25.045 28.383  1.00 26.85 ? 1672 TRP B CH2 1 
ATOM   1145 N  N   . ALA B 1 51 ? 26.401 29.005 21.246  1.00 17.46 ? 1673 ALA B N   1 
ATOM   1146 C  CA  . ALA B 1 51 ? 26.901 28.675 19.911  1.00 16.49 ? 1673 ALA B CA  1 
ATOM   1147 C  C   . ALA B 1 51 ? 27.106 27.166 19.791  1.00 16.07 ? 1673 ALA B C   1 
ATOM   1148 O  O   . ALA B 1 51 ? 27.674 26.523 20.702  1.00 16.89 ? 1673 ALA B O   1 
ATOM   1149 C  CB  . ALA B 1 51 ? 28.203 29.418 19.607  1.00 20.20 ? 1673 ALA B CB  1 
ATOM   1150 N  N   . GLY B 1 52 ? 26.690 26.616 18.643  1.00 15.88 ? 1674 GLY B N   1 
ATOM   1151 C  CA  . GLY B 1 52 ? 26.779 25.188 18.376  1.00 14.87 ? 1674 GLY B CA  1 
ATOM   1152 C  C   . GLY B 1 52 ? 25.595 24.373 18.763  1.00 15.80 ? 1674 GLY B C   1 
ATOM   1153 O  O   . GLY B 1 52 ? 25.458 23.228 18.332  1.00 16.91 ? 1674 GLY B O   1 
ATOM   1154 N  N   . ASP B 1 53 ? 24.678 24.935 19.542  1.00 16.15 ? 1675 ASP B N   1 
ATOM   1155 C  CA  . ASP B 1 53 ? 23.452 24.171 19.953  1.00 16.91 ? 1675 ASP B CA  1 
ATOM   1156 C  C   . ASP B 1 53 ? 22.656 23.803 18.705  1.00 16.53 ? 1675 ASP B C   1 
ATOM   1157 O  O   . ASP B 1 53 ? 22.499 24.640 17.781  1.00 17.06 ? 1675 ASP B O   1 
ATOM   1158 C  CB  . ASP B 1 53 ? 22.585 24.987 20.912  1.00 17.37 ? 1675 ASP B CB  1 
ATOM   1159 C  CG  . ASP B 1 53 ? 23.132 25.101 22.342  1.00 16.56 ? 1675 ASP B CG  1 
ATOM   1160 O  OD1 . ASP B 1 53 ? 24.109 24.328 22.697  1.00 17.80 ? 1675 ASP B OD1 1 
ATOM   1161 O  OD2 . ASP B 1 53 ? 22.583 25.912 23.123  1.00 18.37 ? 1675 ASP B OD2 1 
ATOM   1162 N  N   . GLN B 1 54 ? 22.162 22.565 18.628  1.00 16.05 ? 1676 GLN B N   1 
ATOM   1163 C  CA  . GLN B 1 54 ? 21.386 22.075 17.550  1.00 16.92 ? 1676 GLN B CA  1 
ATOM   1164 C  C   . GLN B 1 54 ? 19.918 22.094 17.893  1.00 20.26 ? 1676 GLN B C   1 
ATOM   1165 O  O   . GLN B 1 54 ? 19.526 21.517 18.863  1.00 19.19 ? 1676 GLN B O   1 
ATOM   1166 C  CB  . GLN B 1 54 ? 21.852 20.665 17.252  1.00 18.05 ? 1676 GLN B CB  1 
ATOM   1167 C  CG  . GLN B 1 54 ? 21.164 19.936 16.183  1.00 23.21 ? 1676 GLN B CG  1 
ATOM   1168 C  CD  . GLN B 1 54 ? 21.827 18.567 15.899  1.00 22.36 ? 1676 GLN B CD  1 
ATOM   1169 O  OE1 . GLN B 1 54 ? 23.035 18.260 16.221  1.00 24.56 ? 1676 GLN B OE1 1 
ATOM   1170 N  NE2 . GLN B 1 54 ? 21.080 17.760 15.220  1.00 27.78 ? 1676 GLN B NE2 1 
ATOM   1171 N  N   . ILE B 1 55 ? 19.125 22.812 17.120  1.00 17.82 ? 1677 ILE B N   1 
ATOM   1172 C  CA  . ILE B 1 55 ? 17.718 22.979 17.404  1.00 16.58 ? 1677 ILE B CA  1 
ATOM   1173 C  C   . ILE B 1 55 ? 16.963 21.800 16.866  1.00 17.74 ? 1677 ILE B C   1 
ATOM   1174 O  O   . ILE B 1 55 ? 16.892 21.572 15.663  1.00 20.38 ? 1677 ILE B O   1 
ATOM   1175 C  CB  . ILE B 1 55 ? 17.167 24.285 16.831  1.00 18.03 ? 1677 ILE B CB  1 
ATOM   1176 C  CG1 . ILE B 1 55 ? 17.929 25.523 17.362  1.00 17.83 ? 1677 ILE B CG1 1 
ATOM   1177 C  CG2 . ILE B 1 55 ? 15.618 24.409 17.154  1.00 22.09 ? 1677 ILE B CG2 1 
ATOM   1178 C  CD1 . ILE B 1 55 ? 17.414 26.838 16.799  1.00 21.18 ? 1677 ILE B CD1 1 
ATOM   1179 N  N   . LEU B 1 56 ? 16.393 21.004 17.788  1.00 17.16 ? 1678 LEU B N   1 
ATOM   1180 C  CA  . LEU B 1 56 ? 15.673 19.815 17.416  1.00 17.95 ? 1678 LEU B CA  1 
ATOM   1181 C  C   . LEU B 1 56 ? 14.218 20.127 17.255  1.00 16.22 ? 1678 LEU B C   1 
ATOM   1182 O  O   . LEU B 1 56 ? 13.572 19.542 16.384  1.00 17.68 ? 1678 LEU B O   1 
ATOM   1183 C  CB  . LEU B 1 56 ? 15.833 18.720 18.508  1.00 17.38 ? 1678 LEU B CB  1 
ATOM   1184 C  CG  . LEU B 1 56 ? 17.286 18.255 18.778  1.00 17.02 ? 1678 LEU B CG  1 
ATOM   1185 C  CD1 . LEU B 1 56 ? 17.291 17.280 19.916  1.00 19.16 ? 1678 LEU B CD1 1 
ATOM   1186 C  CD2 . LEU B 1 56 ? 17.937 17.670 17.547  1.00 18.47 ? 1678 LEU B CD2 1 
ATOM   1187 N  N   . GLU B 1 57 ? 13.672 20.947 18.154  1.00 17.67 ? 1679 GLU B N   1 
ATOM   1188 C  CA  . GLU B 1 57 ? 12.212 21.270 18.183  1.00 18.34 ? 1679 GLU B CA  1 
ATOM   1189 C  C   . GLU B 1 57 ? 11.955 22.668 18.686  1.00 16.94 ? 1679 GLU B C   1 
ATOM   1190 O  O   . GLU B 1 57 ? 12.741 23.181 19.499  1.00 18.73 ? 1679 GLU B O   1 
ATOM   1191 C  CB  . GLU B 1 57 ? 11.473 20.309 19.137  1.00 22.15 ? 1679 GLU B CB  1 
ATOM   1192 C  CG  . GLU B 1 57 ? 11.612 18.889 18.827  1.00 23.72 ? 1679 GLU B CG  1 
ATOM   1193 C  CD  . GLU B 1 57 ? 10.525 18.007 19.397  1.00 29.27 ? 1679 GLU B CD  1 
ATOM   1194 O  OE1 . GLU B 1 57 ? 9.531  18.483 20.040  1.00 34.26 ? 1679 GLU B OE1 1 
ATOM   1195 O  OE2 . GLU B 1 57 ? 10.720 16.813 19.194  1.00 30.60 ? 1679 GLU B OE2 1 
ATOM   1196 N  N   . VAL B 1 58 ? 10.898 23.337 18.159  1.00 17.36 ? 1680 VAL B N   1 
ATOM   1197 C  CA  . VAL B 1 58 ? 10.455 24.631 18.602  1.00 19.98 ? 1680 VAL B CA  1 
ATOM   1198 C  C   . VAL B 1 58 ? 8.970  24.541 18.891  1.00 19.13 ? 1680 VAL B C   1 
ATOM   1199 O  O   . VAL B 1 58 ? 8.213  24.219 17.996  1.00 20.49 ? 1680 VAL B O   1 
ATOM   1200 C  CB  . VAL B 1 58 ? 10.705 25.685 17.529  1.00 21.11 ? 1680 VAL B CB  1 
ATOM   1201 C  CG1 . VAL B 1 58 ? 10.211 27.088 17.967  1.00 26.58 ? 1680 VAL B CG1 1 
ATOM   1202 C  CG2 . VAL B 1 58 ? 12.236 25.704 17.196  1.00 25.44 ? 1680 VAL B CG2 1 
ATOM   1203 N  N   . ASN B 1 59 ? 8.584  24.808 20.124  1.00 21.38 ? 1681 ASN B N   1 
ATOM   1204 C  CA  . ASN B 1 59 ? 7.154  24.854 20.513  1.00 21.71 ? 1681 ASN B CA  1 
ATOM   1205 C  C   . ASN B 1 59 ? 6.355  23.665 19.964  1.00 19.97 ? 1681 ASN B C   1 
ATOM   1206 O  O   . ASN B 1 59 ? 5.246  23.813 19.422  1.00 26.36 ? 1681 ASN B O   1 
ATOM   1207 C  CB  . ASN B 1 59 ? 6.532  26.171 20.098  1.00 24.62 ? 1681 ASN B CB  1 
ATOM   1208 C  CG  . ASN B 1 59 ? 7.063  27.367 20.893  1.00 29.34 ? 1681 ASN B CG  1 
ATOM   1209 O  OD1 . ASN B 1 59 ? 8.259  27.537 21.090  1.00 36.96 ? 1681 ASN B OD1 1 
ATOM   1210 N  ND2 . ASN B 1 59 ? 6.157  28.280 21.240  1.00 33.46 ? 1681 ASN B ND2 1 
ATOM   1211 N  N   . GLY B 1 60 ? 6.944  22.482 20.080  1.00 23.86 ? 1682 GLY B N   1 
ATOM   1212 C  CA  . GLY B 1 60 ? 6.290  21.269 19.712  1.00 24.40 ? 1682 GLY B CA  1 
ATOM   1213 C  C   . GLY B 1 60 ? 6.428  20.848 18.290  1.00 21.31 ? 1682 GLY B C   1 
ATOM   1214 O  O   . GLY B 1 60 ? 5.883  19.819 17.906  1.00 27.91 ? 1682 GLY B O   1 
ATOM   1215 N  N   . ILE B 1 61 ? 7.131  21.648 17.478  1.00 18.59 ? 1683 ILE B N   1 
ATOM   1216 C  CA  . ILE B 1 61 ? 7.304  21.380 16.093  1.00 19.88 ? 1683 ILE B CA  1 
ATOM   1217 C  C   . ILE B 1 61 ? 8.693  20.775 15.867  1.00 19.22 ? 1683 ILE B C   1 
ATOM   1218 O  O   . ILE B 1 61 ? 9.673  21.358 16.227  1.00 19.68 ? 1683 ILE B O   1 
ATOM   1219 C  CB  . ILE B 1 61 ? 7.121  22.658 15.254  1.00 20.28 ? 1683 ILE B CB  1 
ATOM   1220 C  CG1 . ILE B 1 61 ? 5.706  23.223 15.480  1.00 24.20 ? 1683 ILE B CG1 1 
ATOM   1221 C  CG2 . ILE B 1 61 ? 7.459  22.430 13.783  1.00 21.58 ? 1683 ILE B CG2 1 
ATOM   1222 C  CD1 . ILE B 1 61 ? 5.618  24.669 15.147  1.00 31.70 ? 1683 ILE B CD1 1 
ATOM   1223 N  N   . ASP B 1 62 ? 8.738  19.592 15.273  1.00 19.34 ? 1684 ASP B N   1 
ATOM   1224 C  CA  . ASP B 1 62 ? 10.002 18.859 15.004  1.00 21.58 ? 1684 ASP B CA  1 
ATOM   1225 C  C   . ASP B 1 62 ? 10.742 19.564 13.894  1.00 22.42 ? 1684 ASP B C   1 
ATOM   1226 O  O   . ASP B 1 62 ? 10.197 19.752 12.785  1.00 24.53 ? 1684 ASP B O   1 
ATOM   1227 C  CB  . ASP B 1 62 ? 9.662  17.410 14.573  1.00 20.94 ? 1684 ASP B CB  1 
ATOM   1228 C  CG  . ASP B 1 62 ? 10.824 16.476 14.620  1.00 26.79 ? 1684 ASP B CG  1 
ATOM   1229 O  OD1 . ASP B 1 62 ? 11.911 16.937 14.905  1.00 19.29 ? 1684 ASP B OD1 1 
ATOM   1230 O  OD2 . ASP B 1 62 ? 10.638 15.282 14.315  1.00 28.43 ? 1684 ASP B OD2 1 
ATOM   1231 N  N   . LEU B 1 63 ? 11.985 19.933 14.136  1.00 18.16 ? 1685 LEU B N   1 
ATOM   1232 C  CA  . LEU B 1 63 ? 12.813 20.534 13.107  1.00 19.96 ? 1685 LEU B CA  1 
ATOM   1233 C  C   . LEU B 1 63 ? 13.944 19.606 12.656  1.00 21.06 ? 1685 LEU B C   1 
ATOM   1234 O  O   . LEU B 1 63 ? 14.850 20.028 11.933  1.00 20.85 ? 1685 LEU B O   1 
ATOM   1235 C  CB  . LEU B 1 63 ? 13.403 21.850 13.585  1.00 19.71 ? 1685 LEU B CB  1 
ATOM   1236 C  CG  . LEU B 1 63 ? 12.393 23.003 13.797  1.00 21.10 ? 1685 LEU B CG  1 
ATOM   1237 C  CD1 . LEU B 1 63 ? 13.224 24.212 14.060  1.00 25.61 ? 1685 LEU B CD1 1 
ATOM   1238 C  CD2 . LEU B 1 63 ? 11.497 23.183 12.572  1.00 25.12 ? 1685 LEU B CD2 1 
ATOM   1239 N  N   . ARG B 1 64 ? 13.952 18.354 13.098  1.00 20.04 ? 1686 ARG B N   1 
ATOM   1240 C  CA  . ARG B 1 64 ? 15.048 17.447 12.749  1.00 20.49 ? 1686 ARG B CA  1 
ATOM   1241 C  C   . ARG B 1 64 ? 15.165 17.238 11.234  1.00 19.84 ? 1686 ARG B C   1 
ATOM   1242 O  O   . ARG B 1 64 ? 16.286 16.976 10.741  1.00 26.10 ? 1686 ARG B O   1 
ATOM   1243 C  CB  . ARG B 1 64 ? 14.917 16.128 13.453  1.00 19.55 ? 1686 ARG B CB  1 
ATOM   1244 C  CG  . ARG B 1 64 ? 15.074 16.208 14.910  1.00 21.12 ? 1686 ARG B CG  1 
ATOM   1245 C  CD  . ARG B 1 64 ? 14.648 14.845 15.543  1.00 20.61 ? 1686 ARG B CD  1 
ATOM   1246 N  NE  . ARG B 1 64 ? 14.811 14.820 16.987  1.00 21.10 ? 1686 ARG B NE  1 
ATOM   1247 C  CZ  . ARG B 1 64 ? 13.954 15.287 17.857  1.00 18.83 ? 1686 ARG B CZ  1 
ATOM   1248 N  NH1 . ARG B 1 64 ? 12.845 15.891 17.436  1.00 21.15 ? 1686 ARG B NH1 1 
ATOM   1249 N  NH2 . ARG B 1 64 ? 14.125 15.136 19.169  1.00 24.59 ? 1686 ARG B NH2 1 
ATOM   1250 N  N   . LYS B 1 65 ? 14.077 17.294 10.494  1.00 19.96 ? 1687 LYS B N   1 
ATOM   1251 C  CA  . LYS B 1 65 ? 14.177 17.066 9.043   1.00 22.73 ? 1687 LYS B CA  1 
ATOM   1252 C  C   . LYS B 1 65 ? 13.890 18.355 8.264   1.00 22.30 ? 1687 LYS B C   1 
ATOM   1253 O  O   . LYS B 1 65 ? 13.736 18.341 7.041   1.00 22.93 ? 1687 LYS B O   1 
ATOM   1254 C  CB  . LYS B 1 65 ? 13.162 16.019 8.620   1.00 26.67 ? 1687 LYS B CB  1 
ATOM   1255 C  CG  . LYS B 1 65 ? 13.464 14.618 9.148   1.00 32.55 ? 1687 LYS B CG  1 
ATOM   1256 C  CD  . LYS B 1 65 ? 12.437 13.612 8.651   1.00 42.37 ? 1687 LYS B CD  1 
ATOM   1257 C  CE  . LYS B 1 65 ? 12.884 12.189 8.952   1.00 52.55 ? 1687 LYS B CE  1 
ATOM   1258 N  NZ  . LYS B 1 65 ? 11.825 11.200 8.609   1.00 58.45 ? 1687 LYS B NZ  1 
ATOM   1259 N  N   . ALA B 1 66 ? 13.804 19.496 8.956   1.00 20.16 ? 1688 ALA B N   1 
ATOM   1260 C  CA  . ALA B 1 66 ? 13.412 20.758 8.340   1.00 19.84 ? 1688 ALA B CA  1 
ATOM   1261 C  C   . ALA B 1 66 ? 14.520 21.321 7.450   1.00 18.27 ? 1688 ALA B C   1 
ATOM   1262 O  O   . ALA B 1 66 ? 15.676 21.301 7.805   1.00 17.67 ? 1688 ALA B O   1 
ATOM   1263 C  CB  . ALA B 1 66 ? 13.119 21.776 9.442   1.00 20.01 ? 1688 ALA B CB  1 
ATOM   1264 N  N   . THR B 1 67 ? 14.136 21.871 6.311   1.00 18.12 ? 1689 THR B N   1 
ATOM   1265 C  CA  . THR B 1 67 ? 15.044 22.703 5.519   1.00 17.58 ? 1689 THR B CA  1 
ATOM   1266 C  C   . THR B 1 67 ? 15.338 23.977 6.257   1.00 16.64 ? 1689 THR B C   1 
ATOM   1267 O  O   . THR B 1 67 ? 14.661 24.346 7.193   1.00 16.38 ? 1689 THR B O   1 
ATOM   1268 C  CB  . THR B 1 67 ? 14.486 23.040 4.156   1.00 18.01 ? 1689 THR B CB  1 
ATOM   1269 O  OG1 . THR B 1 67 ? 13.348 23.884 4.290   1.00 19.44 ? 1689 THR B OG1 1 
ATOM   1270 C  CG2 . THR B 1 67 ? 14.084 21.792 3.367   1.00 18.92 ? 1689 THR B CG2 1 
ATOM   1271 N  N   . HIS B 1 68 ? 16.401 24.647 5.836   1.00 17.23 ? 1690 HIS B N   1 
ATOM   1272 C  CA  . HIS B 1 68 ? 16.674 25.964 6.419   1.00 15.81 ? 1690 HIS B CA  1 
ATOM   1273 C  C   . HIS B 1 68 ? 15.507 26.891 6.419   1.00 15.04 ? 1690 HIS B C   1 
ATOM   1274 O  O   . HIS B 1 68 ? 15.146 27.485 7.457   1.00 15.82 ? 1690 HIS B O   1 
ATOM   1275 C  CB  . HIS B 1 68 ? 17.833 26.622 5.673   1.00 16.43 ? 1690 HIS B CB  1 
ATOM   1276 C  CG  . HIS B 1 68 ? 18.353 27.872 6.276   1.00 15.46 ? 1690 HIS B CG  1 
ATOM   1277 N  ND1 . HIS B 1 68 ? 19.306 27.812 7.278   1.00 16.83 ? 1690 HIS B ND1 1 
ATOM   1278 C  CD2 . HIS B 1 68 ? 18.052 29.174 6.095   1.00 16.15 ? 1690 HIS B CD2 1 
ATOM   1279 C  CE1 . HIS B 1 68 ? 19.590 29.042 7.652   1.00 16.95 ? 1690 HIS B CE1 1 
ATOM   1280 N  NE2 . HIS B 1 68 ? 18.836 29.889 6.973   1.00 18.07 ? 1690 HIS B NE2 1 
ATOM   1281 N  N   . ASP B 1 69 ? 14.895 27.071 5.259   1.00 14.27 ? 1691 ASP B N   1 
ATOM   1282 C  CA  . ASP B 1 69 ? 13.777 28.036 5.164   1.00 15.46 ? 1691 ASP B CA  1 
ATOM   1283 C  C   . ASP B 1 69 ? 12.596 27.621 6.028   1.00 18.34 ? 1691 ASP B C   1 
ATOM   1284 O  O   . ASP B 1 69 ? 11.961 28.482 6.656   1.00 17.30 ? 1691 ASP B O   1 
ATOM   1285 C  CB  . ASP B 1 69 ? 13.321 28.186 3.724   1.00 15.86 ? 1691 ASP B CB  1 
ATOM   1286 C  CG  . ASP B 1 69 ? 14.314 28.948 2.850   1.00 17.27 ? 1691 ASP B CG  1 
ATOM   1287 O  OD1 . ASP B 1 69 ? 15.256 29.568 3.382   1.00 19.57 ? 1691 ASP B OD1 1 
ATOM   1288 O  OD2 . ASP B 1 69 ? 14.198 28.897 1.603   1.00 19.55 ? 1691 ASP B OD2 1 
ATOM   1289 N  N   . GLU B 1 70 ? 12.336 26.330 6.116   1.00 17.03 ? 1692 GLU B N   1 
ATOM   1290 C  CA  . GLU B 1 70 ? 11.245 25.818 6.937   1.00 17.75 ? 1692 GLU B CA  1 
ATOM   1291 C  C   . GLU B 1 70 ? 11.536 26.154 8.380   1.00 18.58 ? 1692 GLU B C   1 
ATOM   1292 O  O   . GLU B 1 70 ? 10.628 26.557 9.150   1.00 19.28 ? 1692 GLU B O   1 
ATOM   1293 C  CB  . GLU B 1 70 ? 11.096 24.302 6.752   1.00 18.80 ? 1692 GLU B CB  1 
ATOM   1294 C  CG  . GLU B 1 70 ? 10.452 23.965 5.452   1.00 20.69 ? 1692 GLU B CG  1 
ATOM   1295 C  CD  . GLU B 1 70 ? 10.594 22.505 5.055   1.00 23.76 ? 1692 GLU B CD  1 
ATOM   1296 O  OE1 . GLU B 1 70 ? 11.181 21.684 5.787   1.00 23.90 ? 1692 GLU B OE1 1 
ATOM   1297 O  OE2 . GLU B 1 70 ? 10.033 22.180 3.991   1.00 29.21 ? 1692 GLU B OE2 1 
ATOM   1298 N  N   . ALA B 1 71 ? 12.768 25.911 8.854   1.00 16.21 ? 1693 ALA B N   1 
ATOM   1299 C  CA  . ALA B 1 71 ? 13.093 26.195 10.203  1.00 16.88 ? 1693 ALA B CA  1 
ATOM   1300 C  C   . ALA B 1 71 ? 13.012 27.661 10.528  1.00 16.08 ? 1693 ALA B C   1 
ATOM   1301 O  O   . ALA B 1 71 ? 12.560 28.053 11.620  1.00 18.15 ? 1693 ALA B O   1 
ATOM   1302 C  CB  . ALA B 1 71 ? 14.482 25.656 10.528  1.00 17.35 ? 1693 ALA B CB  1 
ATOM   1303 N  N   . ILE B 1 72 ? 13.504 28.514 9.634   1.00 16.07 ? 1694 ILE B N   1 
ATOM   1304 C  CA  . ILE B 1 72 ? 13.453 29.949 9.864   1.00 15.84 ? 1694 ILE B CA  1 
ATOM   1305 C  C   . ILE B 1 72 ? 12.003 30.397 9.996   1.00 17.78 ? 1694 ILE B C   1 
ATOM   1306 O  O   . ILE B 1 72 ? 11.706 31.206 10.878  1.00 18.02 ? 1694 ILE B O   1 
ATOM   1307 C  CB  . ILE B 1 72 ? 14.167 30.760 8.765   1.00 17.16 ? 1694 ILE B CB  1 
ATOM   1308 C  CG1 . ILE B 1 72 ? 15.687 30.444 8.799   1.00 17.14 ? 1694 ILE B CG1 1 
ATOM   1309 C  CG2 . ILE B 1 72 ? 13.947 32.250 8.878   1.00 18.96 ? 1694 ILE B CG2 1 
ATOM   1310 C  CD1 . ILE B 1 72 ? 16.355 30.599 10.083  1.00 20.97 ? 1694 ILE B CD1 1 
ATOM   1311 N  N   . ASN B 1 73 ? 11.129 29.824 9.193   1.00 17.22 ? 1695 ASN B N   1 
ATOM   1312 C  CA  . ASN B 1 73 ? 9.725  30.203 9.307   1.00 17.61 ? 1695 ASN B CA  1 
ATOM   1313 C  C   . ASN B 1 73 ? 9.177  29.825 10.634  1.00 18.36 ? 1695 ASN B C   1 
ATOM   1314 O  O   . ASN B 1 73 ? 8.472  30.646 11.257  1.00 18.80 ? 1695 ASN B O   1 
ATOM   1315 C  CB  . ASN B 1 73 ? 8.949  29.562 8.197   1.00 16.77 ? 1695 ASN B CB  1 
ATOM   1316 C  CG  . ASN B 1 73 ? 7.515  29.881 8.237   1.00 30.45 ? 1695 ASN B CG  1 
ATOM   1317 O  OD1 . ASN B 1 73 ? 7.125  31.048 8.144   1.00 47.35 ? 1695 ASN B OD1 1 
ATOM   1318 N  ND2 . ASN B 1 73 ? 6.694  28.846 8.444   1.00 45.01 ? 1695 ASN B ND2 1 
ATOM   1319 N  N   . VAL B 1 74 ? 9.417  28.605 11.108  1.00 16.31 ? 1696 VAL B N   1 
ATOM   1320 C  CA  . VAL B 1 74 ? 8.934  28.207 12.424  1.00 17.43 ? 1696 VAL B CA  1 
ATOM   1321 C  C   . VAL B 1 74 ? 9.458  29.161 13.463  1.00 18.86 ? 1696 VAL B C   1 
ATOM   1322 O  O   . VAL B 1 74 ? 8.682  29.611 14.341  1.00 18.89 ? 1696 VAL B O   1 
ATOM   1323 C  CB  . VAL B 1 74 ? 9.366  26.766 12.670  1.00 19.34 ? 1696 VAL B CB  1 
ATOM   1324 C  CG1 . VAL B 1 74 ? 9.169  26.356 14.160  1.00 21.92 ? 1696 VAL B CG1 1 
ATOM   1325 C  CG2 . VAL B 1 74 ? 8.562  25.836 11.775  1.00 21.22 ? 1696 VAL B CG2 1 
ATOM   1326 N  N   . LEU B 1 75 ? 10.762 29.469 13.454  1.00 18.16 ? 1697 LEU B N   1 
ATOM   1327 C  CA  . LEU B 1 75 ? 11.311 30.378 14.456  1.00 19.43 ? 1697 LEU B CA  1 
ATOM   1328 C  C   . LEU B 1 75 ? 10.736 31.782 14.437  1.00 20.57 ? 1697 LEU B C   1 
ATOM   1329 O  O   . LEU B 1 75 ? 10.630 32.447 15.523  1.00 22.82 ? 1697 LEU B O   1 
ATOM   1330 C  CB  . LEU B 1 75 ? 12.841 30.431 14.315  1.00 18.69 ? 1697 LEU B CB  1 
ATOM   1331 C  CG  . LEU B 1 75 ? 13.595 29.227 14.833  1.00 22.06 ? 1697 LEU B CG  1 
ATOM   1332 C  CD1 . LEU B 1 75 ? 15.014 29.042 14.191  1.00 22.44 ? 1697 LEU B CD1 1 
ATOM   1333 C  CD2 . LEU B 1 75 ? 13.648 29.213 16.380  1.00 19.62 ? 1697 LEU B CD2 1 
ATOM   1334 N  N   . ARG B 1 76 ? 10.345 32.282 13.275  1.00 19.73 ? 1698 ARG B N   1 
ATOM   1335 C  CA  . ARG B 1 76 ? 9.691  33.593 13.127  1.00 19.99 ? 1698 ARG B CA  1 
ATOM   1336 C  C   . ARG B 1 76 ? 8.255  33.613 13.579  1.00 23.44 ? 1698 ARG B C   1 
ATOM   1337 O  O   . ARG B 1 76 ? 7.743  34.678 13.921  1.00 27.65 ? 1698 ARG B O   1 
ATOM   1338 C  CB  . ARG B 1 76 ? 9.749  34.056 11.681  1.00 20.62 ? 1698 ARG B CB  1 
ATOM   1339 C  CG  . ARG B 1 76 ? 11.146 34.429 11.184  1.00 21.86 ? 1698 ARG B CG  1 
ATOM   1340 C  CD  . ARG B 1 76 ? 11.129 34.847 9.716   1.00 22.59 ? 1698 ARG B CD  1 
ATOM   1341 N  NE  . ARG B 1 76 ? 12.418 35.429 9.355   1.00 25.43 ? 1698 ARG B NE  1 
ATOM   1342 C  CZ  . ARG B 1 76 ? 12.962 35.410 8.144   1.00 24.91 ? 1698 ARG B CZ  1 
ATOM   1343 N  NH1 . ARG B 1 76 ? 12.337 34.874 7.067   1.00 27.24 ? 1698 ARG B NH1 1 
ATOM   1344 N  NH2 . ARG B 1 76 ? 14.141 35.987 8.056   1.00 30.39 ? 1698 ARG B NH2 1 
ATOM   1345 N  N   . GLN B 1 77 ? 7.607  32.470 13.590  1.00 18.06 ? 1699 GLN B N   1 
ATOM   1346 C  CA  . GLN B 1 77 ? 6.176  32.338 13.847  1.00 21.54 ? 1699 GLN B CA  1 
ATOM   1347 C  C   . GLN B 1 77 ? 5.886  31.905 15.273  1.00 22.44 ? 1699 GLN B C   1 
ATOM   1348 O  O   . GLN B 1 77 ? 4.796  31.420 15.561  1.00 26.46 ? 1699 GLN B O   1 
ATOM   1349 C  CB  . GLN B 1 77 ? 5.567  31.338 12.863  1.00 22.75 ? 1699 GLN B CB  1 
ATOM   1350 C  CG  . GLN B 1 77 ? 5.400  31.927 11.487  1.00 26.39 ? 1699 GLN B CG  1 
ATOM   1351 C  CD  . GLN B 1 77 ? 4.507  31.068 10.576  1.00 37.46 ? 1699 GLN B CD  1 
ATOM   1352 N  N   . THR B 1 78 ? 6.805  32.148 16.184  1.00 23.02 ? 1700 THR B N   1 
ATOM   1353 C  CA  . THR B 1 78 ? 6.643  31.739 17.580  1.00 24.67 ? 1700 THR B CA  1 
ATOM   1354 C  C   . THR B 1 78 ? 5.837  32.799 18.333  1.00 27.01 ? 1700 THR B C   1 
ATOM   1355 O  O   . THR B 1 78 ? 5.878  33.994 18.025  1.00 25.30 ? 1700 THR B O   1 
ATOM   1356 C  CB  . THR B 1 78 ? 8.006  31.508 18.225  1.00 26.98 ? 1700 THR B CB  1 
ATOM   1357 O  OG1 . THR B 1 78 ? 8.926  32.567 17.924  1.00 29.71 ? 1700 THR B OG1 1 
ATOM   1358 C  CG2 . THR B 1 78 ? 8.663  30.195 17.719  1.00 28.11 ? 1700 THR B CG2 1 
ATOM   1359 N  N   . PRO B 1 79 ? 5.136  32.363 19.393  1.00 26.52 ? 1701 PRO B N   1 
ATOM   1360 C  CA  . PRO B 1 79 ? 4.558  33.322 20.326  1.00 24.31 ? 1701 PRO B CA  1 
ATOM   1361 C  C   . PRO B 1 79 ? 5.640  33.942 21.149  1.00 23.37 ? 1701 PRO B C   1 
ATOM   1362 O  O   . PRO B 1 79 ? 6.857  33.733 20.931  1.00 22.54 ? 1701 PRO B O   1 
ATOM   1363 C  CB  . PRO B 1 79 ? 3.580  32.484 21.171  1.00 25.67 ? 1701 PRO B CB  1 
ATOM   1364 C  CG  . PRO B 1 79 ? 3.993  31.101 21.000  1.00 27.06 ? 1701 PRO B CG  1 
ATOM   1365 C  CD  . PRO B 1 79 ? 4.904  30.973 19.787  1.00 30.27 ? 1701 PRO B CD  1 
ATOM   1366 N  N   . GLN B 1 80 ? 5.245  34.746 22.121  1.00 20.43 ? 1702 GLN B N   1 
ATOM   1367 C  CA  . GLN B 1 80 ? 6.253  35.411 22.866  1.00 20.46 ? 1702 GLN B CA  1 
ATOM   1368 C  C   . GLN B 1 80 ? 7.110  34.476 23.710  1.00 23.43 ? 1702 GLN B C   1 
ATOM   1369 O  O   . GLN B 1 80 ? 8.292  34.698 23.876  1.00 27.76 ? 1702 GLN B O   1 
ATOM   1370 C  CB  . GLN B 1 80 ? 5.579  36.461 23.747  1.00 22.79 ? 1702 GLN B CB  1 
ATOM   1371 C  CG  . GLN B 1 80 ? 4.871  37.587 22.954  1.00 28.06 ? 1702 GLN B CG  1 
ATOM   1372 C  CD  . GLN B 1 80 ? 5.890  38.444 22.193  1.00 23.00 ? 1702 GLN B CD  1 
ATOM   1373 O  OE1 . GLN B 1 80 ? 6.012  38.369 20.959  1.00 28.47 ? 1702 GLN B OE1 1 
ATOM   1374 N  NE2 . GLN B 1 80 ? 6.665  39.219 22.962  1.00 27.76 ? 1702 GLN B NE2 1 
ATOM   1375 N  N   . ARG B 1 81 ? 6.530  33.383 24.206  1.00 21.55 ? 1703 ARG B N   1 
ATOM   1376 C  CA  . ARG B 1 81 ? 7.281  32.357 24.912  1.00 24.63 ? 1703 ARG B CA  1 
ATOM   1377 C  C   . ARG B 1 81 ? 7.775  31.268 23.922  1.00 22.79 ? 1703 ARG B C   1 
ATOM   1378 O  O   . ARG B 1 81 ? 6.991  30.548 23.301  1.00 25.76 ? 1703 ARG B O   1 
ATOM   1379 C  CB  . ARG B 1 81 ? 6.392  31.716 25.988  1.00 27.07 ? 1703 ARG B CB  1 
ATOM   1380 C  CG  . ARG B 1 81 ? 7.079  30.622 26.833  1.00 40.86 ? 1703 ARG B CG  1 
ATOM   1381 C  CD  . ARG B 1 81 ? 6.106  29.927 27.806  1.00 49.85 ? 1703 ARG B CD  1 
ATOM   1382 N  NE  . ARG B 1 81 ? 5.864  30.704 29.020  1.00 54.94 ? 1703 ARG B NE  1 
ATOM   1383 N  N   . VAL B 1 82 ? 9.089  31.213 23.732  1.00 20.85 ? 1704 VAL B N   1 
ATOM   1384 C  CA  . VAL B 1 82 ? 9.746  30.321 22.766  1.00 22.78 ? 1704 VAL B CA  1 
ATOM   1385 C  C   . VAL B 1 82 ? 10.387 29.162 23.522  1.00 22.70 ? 1704 VAL B C   1 
ATOM   1386 O  O   . VAL B 1 82 ? 11.324 29.317 24.319  1.00 25.88 ? 1704 VAL B O   1 
ATOM   1387 C  CB  . VAL B 1 82 ? 10.824 31.058 21.934  1.00 23.67 ? 1704 VAL B CB  1 
ATOM   1388 C  CG1 . VAL B 1 82 ? 11.402 30.145 20.896  1.00 26.54 ? 1704 VAL B CG1 1 
ATOM   1389 C  CG2 . VAL B 1 82 ? 10.229 32.302 21.283  1.00 25.80 ? 1704 VAL B CG2 1 
ATOM   1390 N  N   . ARG B 1 83 ? 9.878  27.966 23.244  1.00 22.57 ? 1705 ARG B N   1 
ATOM   1391 C  CA  . ARG B 1 83 ? 10.331 26.764 23.871  1.00 20.18 ? 1705 ARG B CA  1 
ATOM   1392 C  C   . ARG B 1 83 ? 11.208 25.919 22.931  1.00 19.33 ? 1705 ARG B C   1 
ATOM   1393 O  O   . ARG B 1 83 ? 10.695 25.343 21.946  1.00 22.70 ? 1705 ARG B O   1 
ATOM   1394 C  CB  . ARG B 1 83 ? 9.133  25.940 24.308  1.00 23.35 ? 1705 ARG B CB  1 
ATOM   1395 C  CG  . ARG B 1 83 ? 9.501  24.656 25.025  1.00 22.01 ? 1705 ARG B CG  1 
ATOM   1396 C  CD  . ARG B 1 83 ? 8.214  23.862 25.464  1.00 25.33 ? 1705 ARG B CD  1 
ATOM   1397 N  NE  . ARG B 1 83 ? 8.587  22.567 26.067  1.00 25.23 ? 1705 ARG B NE  1 
ATOM   1398 C  CZ  . ARG B 1 83 ? 8.946  22.456 27.344  1.00 23.29 ? 1705 ARG B CZ  1 
ATOM   1399 N  NH1 . ARG B 1 83 ? 8.922  23.541 28.124  1.00 28.41 ? 1705 ARG B NH1 1 
ATOM   1400 N  NH2 . ARG B 1 83 ? 9.272  21.266 27.864  1.00 27.75 ? 1705 ARG B NH2 1 
ATOM   1401 N  N   . LEU B 1 84 ? 12.521 25.896 23.188  1.00 20.95 ? 1706 LEU B N   1 
ATOM   1402 C  CA  . LEU B 1 84 ? 13.472 25.301 22.282  1.00 19.51 ? 1706 LEU B CA  1 
ATOM   1403 C  C   . LEU B 1 84 ? 14.015 24.024 22.884  1.00 19.21 ? 1706 LEU B C   1 
ATOM   1404 O  O   . LEU B 1 84 ? 14.374 24.013 24.089  1.00 20.50 ? 1706 LEU B O   1 
ATOM   1405 C  CB  . LEU B 1 84 ? 14.661 26.214 22.042  1.00 21.78 ? 1706 LEU B CB  1 
ATOM   1406 C  CG  . LEU B 1 84 ? 14.289 27.555 21.458  1.00 24.52 ? 1706 LEU B CG  1 
ATOM   1407 C  CD1 . LEU B 1 84 ? 15.503 28.476 21.518  1.00 31.56 ? 1706 LEU B CD1 1 
ATOM   1408 C  CD2 . LEU B 1 84 ? 13.786 27.284 20.041  1.00 25.08 ? 1706 LEU B CD2 1 
ATOM   1409 N  N   . THR B 1 85 ? 14.023 22.944 22.123  1.00 18.95 ? 1707 THR B N   1 
ATOM   1410 C  CA  . THR B 1 85 ? 14.641 21.692 22.491  1.00 17.31 ? 1707 THR B CA  1 
ATOM   1411 C  C   . THR B 1 85 ? 15.892 21.530 21.675  1.00 19.08 ? 1707 THR B C   1 
ATOM   1412 O  O   . THR B 1 85 ? 15.810 21.585 20.417  1.00 19.66 ? 1707 THR B O   1 
ATOM   1413 C  CB  . THR B 1 85 ? 13.761 20.473 22.283  1.00 20.81 ? 1707 THR B CB  1 
ATOM   1414 O  OG1 . THR B 1 85 ? 12.585 20.590 23.088  1.00 24.19 ? 1707 THR B OG1 1 
ATOM   1415 C  CG2 . THR B 1 85 ? 14.469 19.223 22.692  1.00 20.72 ? 1707 THR B CG2 1 
ATOM   1416 N  N   . LEU B 1 86 ? 17.015 21.359 22.346  1.00 19.56 ? 1708 LEU B N   1 
ATOM   1417 C  CA  . LEU B 1 86 ? 18.340 21.400 21.739  1.00 20.37 ? 1708 LEU B CA  1 
ATOM   1418 C  C   . LEU B 1 86 ? 19.139 20.161 22.027  1.00 21.11 ? 1708 LEU B C   1 
ATOM   1419 O  O   . LEU B 1 86 ? 18.979 19.561 23.110  1.00 19.48 ? 1708 LEU B O   1 
ATOM   1420 C  CB  . LEU B 1 86 ? 19.132 22.544 22.318  1.00 22.00 ? 1708 LEU B CB  1 
ATOM   1421 C  CG  . LEU B 1 86 ? 18.410 23.863 22.443  1.00 32.66 ? 1708 LEU B CG  1 
ATOM   1422 C  CD1 . LEU B 1 86 ? 18.944 24.744 23.578  1.00 36.44 ? 1708 LEU B CD1 1 
ATOM   1423 C  CD2 . LEU B 1 86 ? 18.413 24.570 21.110  1.00 24.01 ? 1708 LEU B CD2 1 
ATOM   1424 N  N   . TYR B 1 87 ? 20.011 19.755 21.105  1.00 19.00 ? 1709 TYR B N   1 
ATOM   1425 C  CA  . TYR B 1 87 ? 21.142 18.881 21.380  1.00 18.04 ? 1709 TYR B CA  1 
ATOM   1426 C  C   . TYR B 1 87 ? 22.404 19.737 21.545  1.00 16.31 ? 1709 TYR B C   1 
ATOM   1427 O  O   . TYR B 1 87 ? 22.705 20.542 20.672  1.00 17.40 ? 1709 TYR B O   1 
ATOM   1428 C  CB  . TYR B 1 87 ? 21.340 17.826 20.274  1.00 20.53 ? 1709 TYR B CB  1 
ATOM   1429 C  CG  . TYR B 1 87 ? 22.672 17.043 20.389  1.00 18.24 ? 1709 TYR B CG  1 
ATOM   1430 C  CD1 . TYR B 1 87 ? 22.829 16.048 21.335  1.00 23.45 ? 1709 TYR B CD1 1 
ATOM   1431 C  CD2 . TYR B 1 87 ? 23.802 17.450 19.662  1.00 19.63 ? 1709 TYR B CD2 1 
ATOM   1432 C  CE1 . TYR B 1 87 ? 24.053 15.435 21.498  1.00 21.35 ? 1709 TYR B CE1 1 
ATOM   1433 C  CE2 . TYR B 1 87 ? 25.029 16.815 19.825  1.00 20.17 ? 1709 TYR B CE2 1 
ATOM   1434 C  CZ  . TYR B 1 87 ? 25.122 15.822 20.710  1.00 21.46 ? 1709 TYR B CZ  1 
ATOM   1435 O  OH  . TYR B 1 87 ? 26.366 15.183 20.867  1.00 23.06 ? 1709 TYR B OH  1 
ATOM   1436 N  N   . ARG B 1 88 ? 23.138 19.538 22.631  1.00 17.65 ? 1710 ARG B N   1 
ATOM   1437 C  CA  . ARG B 1 88 ? 24.348 20.246 23.015  1.00 17.65 ? 1710 ARG B CA  1 
ATOM   1438 C  C   . ARG B 1 88 ? 25.463 19.199 23.056  1.00 18.11 ? 1710 ARG B C   1 
ATOM   1439 O  O   . ARG B 1 88 ? 25.364 18.224 23.822  1.00 19.33 ? 1710 ARG B O   1 
ATOM   1440 C  CB  . ARG B 1 88 ? 24.167 20.927 24.322  1.00 20.32 ? 1710 ARG B CB  1 
ATOM   1441 C  CG  . ARG B 1 88 ? 25.319 21.694 24.747  1.00 22.21 ? 1710 ARG B CG  1 
ATOM   1442 C  CD  . ARG B 1 88 ? 25.058 22.501 25.944  1.00 23.08 ? 1710 ARG B CD  1 
ATOM   1443 N  NE  . ARG B 1 88 ? 24.241 23.625 25.514  1.00 19.08 ? 1710 ARG B NE  1 
ATOM   1444 C  CZ  . ARG B 1 88 ? 23.659 24.457 26.331  1.00 22.97 ? 1710 ARG B CZ  1 
ATOM   1445 N  NH1 . ARG B 1 88 ? 23.824 24.295 27.628  1.00 23.67 ? 1710 ARG B NH1 1 
ATOM   1446 N  NH2 . ARG B 1 88 ? 22.927 25.480 25.856  1.00 20.62 ? 1710 ARG B NH2 1 
ATOM   1447 N  N   . ASP B 1 89 ? 26.512 19.415 22.258  1.00 19.38 ? 1711 ASP B N   1 
ATOM   1448 C  CA  . ASP B 1 89 ? 27.645 18.510 22.170  1.00 20.19 ? 1711 ASP B CA  1 
ATOM   1449 C  C   . ASP B 1 89 ? 28.603 18.759 23.334  1.00 21.96 ? 1711 ASP B C   1 
ATOM   1450 O  O   . ASP B 1 89 ? 28.753 19.875 23.871  1.00 21.52 ? 1711 ASP B O   1 
ATOM   1451 C  CB  . ASP B 1 89 ? 28.383 18.712 20.867  1.00 19.52 ? 1711 ASP B CB  1 
ATOM   1452 C  CG  . ASP B 1 89 ? 29.212 17.556 20.503  1.00 20.52 ? 1711 ASP B CG  1 
ATOM   1453 O  OD1 . ASP B 1 89 ? 28.644 16.627 19.901  1.00 31.29 ? 1711 ASP B OD1 1 
ATOM   1454 O  OD2 . ASP B 1 89 ? 30.421 17.489 20.831  1.00 26.40 ? 1711 ASP B OD2 1 
ATOM   1455 N  N   . GLU B 1 90 ? 29.300 17.717 23.758  1.00 21.72 ? 1712 GLU B N   1 
ATOM   1456 C  CA  . GLU B 1 90 ? 30.354 17.867 24.730  1.00 20.08 ? 1712 GLU B CA  1 
ATOM   1457 C  C   . GLU B 1 90 ? 31.511 18.774 24.368  1.00 21.63 ? 1712 GLU B C   1 
ATOM   1458 O  O   . GLU B 1 90 ? 32.218 19.291 25.229  1.00 25.29 ? 1712 GLU B O   1 
ATOM   1459 C  CB  . GLU B 1 90 ? 30.880 16.461 25.125  1.00 28.63 ? 1712 GLU B CB  1 
ATOM   1460 C  CG  . GLU B 1 90 ? 31.501 15.747 23.976  1.00 25.03 ? 1712 GLU B CG  1 
ATOM   1461 C  CD  . GLU B 1 90 ? 31.970 14.300 24.269  1.00 35.95 ? 1712 GLU B CD  1 
ATOM   1462 O  OE1 . GLU B 1 90 ? 31.659 13.719 25.354  1.00 29.56 ? 1712 GLU B OE1 1 
ATOM   1463 O  OE2 . GLU B 1 90 ? 32.594 13.753 23.342  1.00 40.14 ? 1712 GLU B OE2 1 
ATOM   1464 N  N   . ALA B 1 91 ? 31.730 18.968 23.071  1.00 21.60 ? 1713 ALA B N   1 
ATOM   1465 C  CA  . ALA B 1 91 ? 32.791 19.786 22.536  1.00 21.44 ? 1713 ALA B CA  1 
ATOM   1466 C  C   . ALA B 1 91 ? 32.330 21.170 22.132  1.00 22.98 ? 1713 ALA B C   1 
ATOM   1467 O  O   . ALA B 1 91 ? 31.205 21.317 21.666  1.00 22.42 ? 1713 ALA B O   1 
ATOM   1468 C  CB  . ALA B 1 91 ? 33.366 19.089 21.333  1.00 24.52 ? 1713 ALA B CB  1 
ATOM   1469 N  N   . PRO B 1 92 ? 33.217 22.180 22.272  1.00 24.09 ? 1714 PRO B N   1 
ATOM   1470 C  CA  . PRO B 1 92 ? 32.897 23.535 21.868  1.00 24.43 ? 1714 PRO B CA  1 
ATOM   1471 C  C   . PRO B 1 92 ? 32.744 23.711 20.378  1.00 20.74 ? 1714 PRO B C   1 
ATOM   1472 O  O   . PRO B 1 92 ? 33.394 23.034 19.576  1.00 22.01 ? 1714 PRO B O   1 
ATOM   1473 C  CB  . PRO B 1 92 ? 34.132 24.334 22.307  1.00 26.43 ? 1714 PRO B CB  1 
ATOM   1474 C  CG  . PRO B 1 92 ? 35.239 23.339 22.335  1.00 29.57 ? 1714 PRO B CG  1 
ATOM   1475 C  CD  . PRO B 1 92 ? 34.582 22.099 22.854  1.00 27.30 ? 1714 PRO B CD  1 
ATOM   1476 N  N   . TYR B 1 93 ? 31.913 24.674 20.018  1.00 19.80 ? 1715 TYR B N   1 
ATOM   1477 C  CA  . TYR B 1 93 ? 31.688 24.993 18.623  1.00 19.66 ? 1715 TYR B CA  1 
ATOM   1478 C  C   . TYR B 1 93 ? 32.797 25.824 18.098  1.00 23.07 ? 1715 TYR B C   1 
ATOM   1479 O  O   . TYR B 1 93 ? 33.109 26.856 18.668  1.00 29.26 ? 1715 TYR B O   1 
ATOM   1480 C  CB  . TYR B 1 93 ? 30.385 25.767 18.492  1.00 22.28 ? 1715 TYR B CB  1 
ATOM   1481 C  CG  . TYR B 1 93 ? 29.961 26.148 17.090  1.00 20.16 ? 1715 TYR B CG  1 
ATOM   1482 C  CD1 . TYR B 1 93 ? 29.543 25.179 16.223  1.00 18.37 ? 1715 TYR B CD1 1 
ATOM   1483 C  CD2 . TYR B 1 93 ? 29.979 27.430 16.672  1.00 19.63 ? 1715 TYR B CD2 1 
ATOM   1484 C  CE1 . TYR B 1 93 ? 29.147 25.502 14.962  1.00 19.07 ? 1715 TYR B CE1 1 
ATOM   1485 C  CE2 . TYR B 1 93 ? 29.573 27.811 15.417  1.00 18.41 ? 1715 TYR B CE2 1 
ATOM   1486 C  CZ  . TYR B 1 93 ? 29.146 26.828 14.539  1.00 16.77 ? 1715 TYR B CZ  1 
ATOM   1487 O  OH  . TYR B 1 93 ? 28.715 27.209 13.311  1.00 20.41 ? 1715 TYR B OH  1 
ATOM   1488 N  N   . LYS B 1 94 ? 33.410 25.404 17.001  1.00 22.77 ? 1716 LYS B N   1 
ATOM   1489 C  CA  . LYS B 1 94 ? 34.475 26.278 16.481  1.00 25.07 ? 1716 LYS B CA  1 
ATOM   1490 C  C   . LYS B 1 94 ? 34.167 27.077 15.209  1.00 18.75 ? 1716 LYS B C   1 
ATOM   1491 O  O   . LYS B 1 94 ? 33.552 26.614 14.287  1.00 20.48 ? 1716 LYS B O   1 
ATOM   1492 C  CB  . LYS B 1 94 ? 35.792 25.541 16.384  1.00 31.50 ? 1716 LYS B CB  1 
ATOM   1493 C  CG  . LYS B 1 94 ? 36.320 25.098 17.765  1.00 29.71 ? 1716 LYS B CG  1 
ATOM   1494 C  CD  . LYS B 1 94 ? 37.638 24.462 17.589  1.00 30.06 ? 1716 LYS B CD  1 
ATOM   1495 C  CE  . LYS B 1 94 ? 38.146 23.805 18.860  1.00 29.02 ? 1716 LYS B CE  1 
ATOM   1496 N  NZ  . LYS B 1 94 ? 39.560 23.445 18.689  1.00 28.37 ? 1716 LYS B NZ  1 
ATOM   1497 N  N   . SER B 1 95 ? 34.558 28.320 15.260  1.00 20.80 ? 1717 SER B N   1 
ATOM   1498 C  CA  . SER B 1 95 ? 34.401 29.262 14.212  1.00 17.70 ? 1717 SER B CA  1 
ATOM   1499 C  C   . SER B 1 95 ? 35.556 30.231 14.289  1.00 20.39 ? 1717 SER B C   1 
ATOM   1500 O  O   . SER B 1 95 ? 35.808 30.806 15.383  1.00 21.80 ? 1717 SER B O   1 
ATOM   1501 C  CB  . SER B 1 95 ? 33.028 29.932 14.326  1.00 20.79 ? 1717 SER B CB  1 
ATOM   1502 O  OG  . SER B 1 95 ? 32.850 30.921 13.386  1.00 29.54 ? 1717 SER B OG  1 
ATOM   1503 N  N   . THR B 1 96 ? 36.270 30.402 13.190  1.00 17.07 ? 1718 THR B N   1 
ATOM   1504 C  CA  . THR B 1 96 ? 37.489 31.175 13.179  1.00 16.28 ? 1718 THR B CA  1 
ATOM   1505 C  C   . THR B 1 96 ? 37.580 32.113 12.003  1.00 18.49 ? 1718 THR B C   1 
ATOM   1506 O  O   . THR B 1 96 ? 37.364 31.736 10.854  1.00 18.21 ? 1718 THR B O   1 
ATOM   1507 C  CB  . THR B 1 96 ? 38.722 30.234 13.178  1.00 17.87 ? 1718 THR B CB  1 
ATOM   1508 O  OG1 . THR B 1 96 ? 38.669 29.354 14.292  1.00 20.16 ? 1718 THR B OG1 1 
ATOM   1509 C  CG2 . THR B 1 96 ? 40.019 31.047 13.225  1.00 19.06 ? 1718 THR B CG2 1 
ATOM   1510 N  N   . ARG B 1 97 ? 37.919 33.387 12.221  1.00 17.34 ? 1719 ARG B N   1 
ATOM   1511 C  CA  . ARG B 1 97 ? 38.075 34.368 11.169  1.00 17.62 ? 1719 ARG B CA  1 
ATOM   1512 C  C   . ARG B 1 97 ? 39.529 34.435 10.766  1.00 21.15 ? 1719 ARG B C   1 
ATOM   1513 O  O   . ARG B 1 97 ? 40.401 34.467 11.646  1.00 26.24 ? 1719 ARG B O   1 
ATOM   1514 C  CB  . ARG B 1 97 ? 37.515 35.756 11.633  1.00 21.06 ? 1719 ARG B CB  1 
ATOM   1515 C  CG  . ARG B 1 97 ? 37.784 36.822 10.608  1.00 30.57 ? 1719 ARG B CG  1 
ATOM   1516 C  CD  . ARG B 1 97 ? 37.045 38.142 10.888  1.00 37.30 ? 1719 ARG B CD  1 
ATOM   1517 N  NE  . ARG B 1 97 ? 37.296 39.120 9.819   1.00 35.99 ? 1719 ARG B NE  1 
ATOM   1518 C  CZ  . ARG B 1 97 ? 36.435 40.070 9.445   1.00 46.83 ? 1719 ARG B CZ  1 
ATOM   1519 N  NH1 . ARG B 1 97 ? 35.247 40.220 10.051  1.00 38.89 ? 1719 ARG B NH1 1 
ATOM   1520 N  NH2 . ARG B 1 97 ? 36.775 40.892 8.453   1.00 50.28 ? 1719 ARG B NH2 1 
ATOM   1521 N  N   . LEU B 1 98 ? 39.795 34.439 9.459   1.00 19.05 ? 1720 LEU B N   1 
ATOM   1522 C  CA  . LEU B 1 98 ? 41.141 34.412 8.876   1.00 25.01 ? 1720 LEU B CA  1 
ATOM   1523 C  C   . LEU B 1 98 ? 41.227 35.351 7.664   1.00 23.08 ? 1720 LEU B C   1 
ATOM   1524 O  O   . LEU B 1 98 ? 40.189 35.867 7.128   1.00 21.84 ? 1720 LEU B O   1 
ATOM   1525 C  CB  . LEU B 1 98 ? 41.439 32.977 8.380   1.00 29.03 ? 1720 LEU B CB  1 
ATOM   1526 C  CG  . LEU B 1 98 ? 41.624 31.809 9.358   1.00 30.07 ? 1720 LEU B CG  1 
ATOM   1527 C  CD1 . LEU B 1 98 ? 41.239 30.499 8.741   1.00 39.67 ? 1720 LEU B CD1 1 
ATOM   1528 C  CD2 . LEU B 1 98 ? 43.055 31.744 9.842   1.00 38.54 ? 1720 LEU B CD2 1 
ATOM   1529 O  OXT . LEU B 1 98 ? 42.341 35.630 7.126   1.00 24.15 ? 1720 LEU B OXT 1 
HETATM 1530 NA NA  . NA  C 2 .  ? 38.457 20.056 4.441   1.00 23.44 ? 1    NA  A NA  1 
HETATM 1531 O  O   . HOH D 3 .  ? 31.493 22.151 -0.364  1.00 16.08 ? 2    HOH A O   1 
HETATM 1532 O  O   . HOH D 3 .  ? 39.993 21.262 16.609  1.00 22.76 ? 8    HOH A O   1 
HETATM 1533 O  O   . HOH D 3 .  ? 36.352 38.770 1.759   1.00 22.17 ? 11   HOH A O   1 
HETATM 1534 O  O   . HOH D 3 .  ? 38.459 18.378 7.507   1.00 22.60 ? 12   HOH A O   1 
HETATM 1535 O  O   . HOH D 3 .  ? 24.191 26.368 6.296   1.00 20.77 ? 13   HOH A O   1 
HETATM 1536 O  O   . HOH D 3 .  ? 32.104 19.596 0.651   1.00 20.63 ? 14   HOH A O   1 
HETATM 1537 O  O   . HOH D 3 .  ? 29.280 26.847 -1.802  1.00 20.05 ? 15   HOH A O   1 
HETATM 1538 O  O   . HOH D 3 .  ? 53.207 34.473 -1.620  1.00 22.53 ? 17   HOH A O   1 
HETATM 1539 O  O   . HOH D 3 .  ? 25.862 23.524 2.977   1.00 21.86 ? 19   HOH A O   1 
HETATM 1540 O  O   . HOH D 3 .  ? 29.269 33.650 0.089   1.00 23.06 ? 23   HOH A O   1 
HETATM 1541 O  O   . HOH D 3 .  ? 37.232 34.541 -3.944  1.00 26.27 ? 26   HOH A O   1 
HETATM 1542 O  O   . HOH D 3 .  ? 29.224 34.889 2.654   1.00 22.12 ? 27   HOH A O   1 
HETATM 1543 O  O   . HOH D 3 .  ? 26.979 34.345 10.959  1.00 28.98 ? 32   HOH A O   1 
HETATM 1544 O  O   . HOH D 3 .  ? 40.991 40.703 3.266   1.00 28.70 ? 34   HOH A O   1 
HETATM 1545 O  O   . HOH D 3 .  ? 30.759 17.436 -0.485  1.00 20.48 ? 35   HOH A O   1 
HETATM 1546 O  O   . HOH D 3 .  ? 28.708 22.648 -7.253  1.00 28.95 ? 39   HOH A O   1 
HETATM 1547 O  O   . HOH D 3 .  ? 46.061 24.375 -3.429  1.00 28.37 ? 42   HOH A O   1 
HETATM 1548 O  O   . HOH D 3 .  ? 43.829 31.867 -9.779  1.00 30.83 ? 43   HOH A O   1 
HETATM 1549 O  O   . HOH D 3 .  ? 19.914 37.260 7.668   1.00 28.26 ? 44   HOH A O   1 
HETATM 1550 O  O   . HOH D 3 .  ? 33.940 35.746 -3.380  1.00 29.89 ? 46   HOH A O   1 
HETATM 1551 O  O   . HOH D 3 .  ? 43.786 19.018 16.446  1.00 35.88 ? 47   HOH A O   1 
HETATM 1552 O  O   . HOH D 3 .  ? 29.030 27.096 -9.018  1.00 31.40 ? 49   HOH A O   1 
HETATM 1553 O  O   . HOH D 3 .  ? 41.359 39.907 -3.892  1.00 29.19 ? 51   HOH A O   1 
HETATM 1554 O  O   . HOH D 3 .  ? 48.664 41.745 2.945   1.00 27.70 ? 52   HOH A O   1 
HETATM 1555 O  O   . HOH D 3 .  ? 52.186 33.524 7.560   1.00 31.62 ? 54   HOH A O   1 
HETATM 1556 O  O   . HOH D 3 .  ? 29.185 24.097 -1.481  1.00 21.31 ? 55   HOH A O   1 
HETATM 1557 O  O   A HOH D 3 .  ? 27.242 17.940 -4.832  0.50 37.16 ? 56   HOH A O   1 
HETATM 1558 O  O   B HOH D 3 .  ? 28.871 17.033 -4.318  0.50 36.77 ? 56   HOH A O   1 
HETATM 1559 O  O   . HOH D 3 .  ? 27.560 33.249 4.756   1.00 28.91 ? 58   HOH A O   1 
HETATM 1560 O  O   . HOH D 3 .  ? 50.541 26.666 5.811   1.00 27.96 ? 59   HOH A O   1 
HETATM 1561 O  O   . HOH D 3 .  ? 25.077 28.335 -1.266  1.00 33.80 ? 61   HOH A O   1 
HETATM 1562 O  O   . HOH D 3 .  ? 26.836 30.207 -0.858  1.00 25.83 ? 62   HOH A O   1 
HETATM 1563 O  O   . HOH D 3 .  ? 25.508 32.210 3.125   1.00 33.97 ? 67   HOH A O   1 
HETATM 1564 O  O   . HOH D 3 .  ? 50.836 36.075 5.382   1.00 33.50 ? 69   HOH A O   1 
HETATM 1565 O  O   . HOH D 3 .  ? 48.432 34.485 8.925   1.00 42.03 ? 73   HOH A O   1 
HETATM 1566 O  O   . HOH D 3 .  ? 27.556 23.712 0.880   1.00 25.21 ? 75   HOH A O   1 
HETATM 1567 O  O   . HOH D 3 .  ? 44.086 32.618 13.371  1.00 36.88 ? 76   HOH A O   1 
HETATM 1568 O  O   . HOH D 3 .  ? 21.512 29.609 -0.467  1.00 38.20 ? 77   HOH A O   1 
HETATM 1569 O  O   . HOH D 3 .  ? 44.069 16.050 5.890   1.00 31.29 ? 82   HOH A O   1 
HETATM 1570 O  O   . HOH D 3 .  ? 26.669 26.174 -2.649  1.00 30.97 ? 85   HOH A O   1 
HETATM 1571 O  O   . HOH D 3 .  ? 36.833 15.754 3.258   1.00 29.38 ? 86   HOH A O   1 
HETATM 1572 O  O   . HOH D 3 .  ? 48.287 22.022 11.356  1.00 31.56 ? 87   HOH A O   1 
HETATM 1573 O  O   . HOH D 3 .  ? 49.752 17.501 3.144   1.00 32.25 ? 89   HOH A O   1 
HETATM 1574 O  O   . HOH D 3 .  ? 26.721 25.157 -4.878  1.00 37.90 ? 90   HOH A O   1 
HETATM 1575 O  O   . HOH D 3 .  ? 40.803 16.572 -5.234  1.00 33.78 ? 93   HOH A O   1 
HETATM 1576 O  O   . HOH D 3 .  ? 47.898 22.401 -3.054  1.00 35.27 ? 99   HOH A O   1 
HETATM 1577 O  O   . HOH D 3 .  ? 36.358 43.308 5.316   1.00 42.83 ? 100  HOH A O   1 
HETATM 1578 O  O   . HOH D 3 .  ? 45.097 41.737 -2.233  1.00 36.45 ? 102  HOH A O   1 
HETATM 1579 O  O   . HOH D 3 .  ? 30.747 34.916 -1.853  1.00 32.67 ? 105  HOH A O   1 
HETATM 1580 O  O   . HOH D 3 .  ? 30.157 19.121 15.817  1.00 38.42 ? 107  HOH A O   1 
HETATM 1581 O  O   . HOH D 3 .  ? 37.145 28.321 -10.763 1.00 36.83 ? 108  HOH A O   1 
HETATM 1582 O  O   . HOH D 3 .  ? 43.309 38.121 -4.617  1.00 32.54 ? 109  HOH A O   1 
HETATM 1583 O  O   . HOH D 3 .  ? 27.787 25.443 8.854   1.00 31.61 ? 118  HOH A O   1 
HETATM 1584 O  O   . HOH D 3 .  ? 48.132 17.747 5.714   1.00 39.85 ? 119  HOH A O   1 
HETATM 1585 O  O   . HOH D 3 .  ? 51.799 31.026 -3.253  1.00 36.02 ? 120  HOH A O   1 
HETATM 1586 O  O   . HOH D 3 .  ? 35.898 22.112 16.432  1.00 44.44 ? 121  HOH A O   1 
HETATM 1587 O  O   . HOH D 3 .  ? 28.153 28.892 -10.806 1.00 39.52 ? 122  HOH A O   1 
HETATM 1588 O  O   A HOH D 3 .  ? 22.963 33.306 3.733   0.50 26.90 ? 124  HOH A O   1 
HETATM 1589 O  O   B HOH D 3 .  ? 21.590 32.169 3.389   0.50 25.16 ? 124  HOH A O   1 
HETATM 1590 O  O   . HOH D 3 .  ? 32.128 31.113 -8.449  1.00 37.73 ? 128  HOH A O   1 
HETATM 1591 O  O   . HOH D 3 .  ? 16.644 33.363 5.371   1.00 32.90 ? 129  HOH A O   1 
HETATM 1592 O  O   . HOH D 3 .  ? 45.849 20.359 16.915  1.00 43.21 ? 135  HOH A O   1 
HETATM 1593 O  O   . HOH D 3 .  ? 27.482 25.150 -7.985  1.00 34.16 ? 139  HOH A O   1 
HETATM 1594 O  O   . HOH D 3 .  ? 26.570 34.725 6.897   1.00 36.76 ? 142  HOH A O   1 
HETATM 1595 O  O   . HOH D 3 .  ? 28.091 15.430 2.476   1.00 36.52 ? 143  HOH A O   1 
HETATM 1596 O  O   . HOH D 3 .  ? 40.321 40.919 -6.444  1.00 45.04 ? 146  HOH A O   1 
HETATM 1597 O  O   . HOH D 3 .  ? 48.917 21.794 13.859  1.00 38.46 ? 150  HOH A O   1 
HETATM 1598 O  O   . HOH D 3 .  ? 21.783 19.145 -2.548  1.00 38.34 ? 154  HOH A O   1 
HETATM 1599 O  O   . HOH D 3 .  ? 35.034 28.981 -8.912  1.00 41.62 ? 155  HOH A O   1 
HETATM 1600 O  O   . HOH D 3 .  ? 41.558 43.734 3.700   1.00 40.73 ? 158  HOH A O   1 
HETATM 1601 O  O   . HOH D 3 .  ? 43.979 13.147 0.408   1.00 37.91 ? 159  HOH A O   1 
HETATM 1602 O  O   . HOH D 3 .  ? 55.492 35.221 -5.186  1.00 40.93 ? 161  HOH A O   1 
HETATM 1603 O  O   . HOH D 3 .  ? 39.424 14.098 13.853  1.00 39.96 ? 162  HOH A O   1 
HETATM 1604 O  O   . HOH D 3 .  ? 38.783 30.254 -11.655 1.00 41.74 ? 164  HOH A O   1 
HETATM 1605 O  O   . HOH D 3 .  ? 26.657 16.299 0.120   1.00 42.91 ? 165  HOH A O   1 
HETATM 1606 O  O   . HOH D 3 .  ? 46.072 25.531 18.386  1.00 40.64 ? 167  HOH A O   1 
HETATM 1607 O  O   . HOH D 3 .  ? 51.788 24.925 7.868   1.00 44.59 ? 172  HOH A O   1 
HETATM 1608 O  O   . HOH D 3 .  ? 48.233 19.497 10.069  1.00 44.77 ? 173  HOH A O   1 
HETATM 1609 O  O   . HOH D 3 .  ? 35.247 27.285 -4.970  1.00 34.42 ? 174  HOH A O   1 
HETATM 1610 O  O   . HOH D 3 .  ? 30.307 41.139 5.288   1.00 40.99 ? 176  HOH A O   1 
HETATM 1611 O  O   . HOH D 3 .  ? 47.121 13.863 3.328   1.00 50.31 ? 178  HOH A O   1 
HETATM 1612 O  O   . HOH D 3 .  ? 50.509 23.446 10.800  1.00 46.08 ? 185  HOH A O   1 
HETATM 1613 O  O   . HOH D 3 .  ? 25.366 42.268 16.577  1.00 55.14 ? 187  HOH A O   1 
HETATM 1614 O  O   A HOH D 3 .  ? 23.522 17.496 1.291   0.50 33.37 ? 190  HOH A O   1 
HETATM 1615 O  O   B HOH D 3 .  ? 21.639 17.656 1.571   0.50 35.13 ? 190  HOH A O   1 
HETATM 1616 O  O   . HOH D 3 .  ? 41.839 19.739 17.898  1.00 41.74 ? 195  HOH A O   1 
HETATM 1617 O  O   . HOH D 3 .  ? 46.624 16.170 -1.887  1.00 49.57 ? 199  HOH A O   1 
HETATM 1618 O  O   . HOH D 3 .  ? 20.163 35.420 5.037   1.00 46.17 ? 203  HOH A O   1 
HETATM 1619 O  O   . HOH D 3 .  ? 35.418 29.476 -6.558  1.00 45.04 ? 209  HOH A O   1 
HETATM 1620 O  O   . HOH D 3 .  ? 51.655 27.453 3.181   1.00 41.20 ? 211  HOH A O   1 
HETATM 1621 O  O   . HOH D 3 .  ? 43.502 15.160 11.507  1.00 48.86 ? 218  HOH A O   1 
HETATM 1622 O  O   . HOH D 3 .  ? 46.221 18.365 9.109   1.00 51.65 ? 219  HOH A O   1 
HETATM 1623 O  O   . HOH D 3 .  ? 19.119 39.862 15.294  1.00 49.82 ? 220  HOH A O   1 
HETATM 1624 O  O   . HOH D 3 .  ? 45.336 20.925 -5.624  1.00 40.54 ? 221  HOH A O   1 
HETATM 1625 O  O   . HOH D 3 .  ? 31.391 42.278 7.124   1.00 49.23 ? 223  HOH A O   1 
HETATM 1626 O  O   . HOH D 3 .  ? 53.106 25.394 1.980   1.00 43.09 ? 224  HOH A O   1 
HETATM 1627 O  O   . HOH D 3 .  ? 26.781 16.472 8.761   1.00 48.83 ? 226  HOH A O   1 
HETATM 1628 O  O   . HOH D 3 .  ? 40.588 43.644 1.212   1.00 47.22 ? 228  HOH A O   1 
HETATM 1629 O  O   . HOH D 3 .  ? 39.686 36.820 -9.931  1.00 48.45 ? 229  HOH A O   1 
HETATM 1630 O  O   . HOH D 3 .  ? 19.210 40.867 17.822  1.00 47.49 ? 230  HOH A O   1 
HETATM 1631 O  O   . HOH D 3 .  ? 46.036 40.589 8.626   1.00 47.45 ? 231  HOH A O   1 
HETATM 1632 O  O   . HOH D 3 .  ? 44.396 45.591 1.883   1.00 48.21 ? 232  HOH A O   1 
HETATM 1633 O  O   . HOH D 3 .  ? 47.385 39.688 5.682   1.00 47.03 ? 235  HOH A O   1 
HETATM 1634 O  O   . HOH D 3 .  ? 50.001 19.937 7.988   1.00 57.48 ? 242  HOH A O   1 
HETATM 1635 O  O   . HOH D 3 .  ? 43.967 15.602 16.498  1.00 45.97 ? 251  HOH A O   1 
HETATM 1636 O  O   . HOH D 3 .  ? 42.643 36.669 -6.782  1.00 45.75 ? 252  HOH A O   1 
HETATM 1637 O  O   . HOH D 3 .  ? 46.012 36.211 -6.409  1.00 50.31 ? 253  HOH A O   1 
HETATM 1638 O  O   . HOH D 3 .  ? 24.747 17.455 -1.744  1.00 49.19 ? 254  HOH A O   1 
HETATM 1639 O  O   . HOH D 3 .  ? 32.561 19.023 17.618  1.00 52.28 ? 260  HOH A O   1 
HETATM 1640 O  O   . HOH D 3 .  ? 31.091 38.921 0.161   1.00 48.24 ? 268  HOH A O   1 
HETATM 1641 O  O   . HOH D 3 .  ? 32.313 39.501 -5.415  1.00 55.91 ? 269  HOH A O   1 
HETATM 1642 O  O   . HOH D 3 .  ? 35.705 12.920 10.544  1.00 46.83 ? 270  HOH A O   1 
HETATM 1643 O  O   . HOH D 3 .  ? 44.865 22.253 19.055  1.00 52.66 ? 271  HOH A O   1 
HETATM 1644 O  O   . HOH D 3 .  ? 47.579 15.268 11.730  1.00 60.03 ? 272  HOH A O   1 
HETATM 1645 O  O   . HOH D 3 .  ? 39.367 38.423 7.932   1.00 39.21 ? 273  HOH A O   1 
HETATM 1646 O  O   . HOH E 3 .  ? 26.741 24.245 22.094  1.00 18.84 ? 3    HOH B O   1 
HETATM 1647 O  O   . HOH E 3 .  ? 17.591 20.481 13.312  1.00 21.40 ? 4    HOH B O   1 
HETATM 1648 O  O   . HOH E 3 .  ? 15.838 26.104 2.637   1.00 17.62 ? 5    HOH B O   1 
HETATM 1649 O  O   . HOH E 3 .  ? 11.284 17.964 10.815  1.00 24.77 ? 6    HOH B O   1 
HETATM 1650 O  O   . HOH E 3 .  ? 17.396 24.269 -0.564  1.00 21.47 ? 7    HOH B O   1 
HETATM 1651 O  O   . HOH E 3 .  ? 32.514 24.174 13.504  1.00 19.36 ? 9    HOH B O   1 
HETATM 1652 O  O   . HOH E 3 .  ? 25.154 20.668 19.261  1.00 20.33 ? 10   HOH B O   1 
HETATM 1653 O  O   . HOH E 3 .  ? 27.776 33.121 20.417  1.00 25.24 ? 16   HOH B O   1 
HETATM 1654 O  O   . HOH E 3 .  ? 15.092 24.990 31.070  1.00 25.02 ? 18   HOH B O   1 
HETATM 1655 O  O   . HOH E 3 .  ? 17.158 30.507 1.752   1.00 24.72 ? 20   HOH B O   1 
HETATM 1656 O  O   . HOH E 3 .  ? 7.997  25.979 8.215   1.00 26.04 ? 21   HOH B O   1 
HETATM 1657 O  O   . HOH E 3 .  ? 20.546 37.334 21.723  1.00 23.68 ? 22   HOH B O   1 
HETATM 1658 O  O   . HOH E 3 .  ? 6.167  18.327 14.335  1.00 29.74 ? 24   HOH B O   1 
HETATM 1659 O  O   . HOH E 3 .  ? 19.404 31.940 25.958  1.00 25.47 ? 25   HOH B O   1 
HETATM 1660 O  O   . HOH E 3 .  ? 17.231 20.060 9.839   1.00 23.20 ? 28   HOH B O   1 
HETATM 1661 O  O   . HOH E 3 .  ? 20.302 20.496 -1.138  1.00 27.31 ? 29   HOH B O   1 
HETATM 1662 O  O   . HOH E 3 .  ? 10.507 22.528 22.144  1.00 27.73 ? 30   HOH B O   1 
HETATM 1663 O  O   A HOH E 3 .  ? 29.953 26.194 22.114  0.50 19.80 ? 31   HOH B O   1 
HETATM 1664 O  O   B HOH E 3 .  ? 31.831 26.619 22.040  0.50 24.93 ? 31   HOH B O   1 
HETATM 1665 O  O   . HOH E 3 .  ? 27.668 31.216 22.541  1.00 27.79 ? 33   HOH B O   1 
HETATM 1666 O  O   . HOH E 3 .  ? 13.467 24.948 1.716   1.00 26.26 ? 36   HOH B O   1 
HETATM 1667 O  O   . HOH E 3 .  ? 37.777 41.013 5.842   1.00 33.28 ? 37   HOH B O   1 
HETATM 1668 O  O   . HOH E 3 .  ? 27.035 21.855 20.831  1.00 20.85 ? 38   HOH B O   1 
HETATM 1669 O  O   . HOH E 3 .  ? 25.599 19.265 16.903  1.00 23.75 ? 40   HOH B O   1 
HETATM 1670 O  O   . HOH E 3 .  ? 30.269 31.330 17.095  1.00 31.74 ? 41   HOH B O   1 
HETATM 1671 O  O   . HOH E 3 .  ? 16.238 13.339 19.925  1.00 28.57 ? 45   HOH B O   1 
HETATM 1672 O  O   . HOH E 3 .  ? 3.427  33.119 24.732  1.00 30.16 ? 50   HOH B O   1 
HETATM 1673 O  O   . HOH E 3 .  ? 22.886 26.634 29.386  1.00 28.66 ? 53   HOH B O   1 
HETATM 1674 O  O   . HOH E 3 .  ? 15.489 37.010 27.456  1.00 34.21 ? 57   HOH B O   1 
HETATM 1675 O  O   . HOH E 3 .  ? 13.278 27.826 30.752  1.00 26.43 ? 63   HOH B O   1 
HETATM 1676 O  O   . HOH E 3 .  ? 29.499 22.426 19.918  1.00 27.06 ? 64   HOH B O   1 
HETATM 1677 O  O   . HOH E 3 .  ? 12.165 31.183 5.736   1.00 27.22 ? 65   HOH B O   1 
HETATM 1678 O  O   . HOH E 3 .  ? 15.758 18.468 2.628   1.00 36.32 ? 68   HOH B O   1 
HETATM 1679 O  O   . HOH E 3 .  ? 14.593 34.009 29.913  1.00 42.23 ? 70   HOH B O   1 
HETATM 1680 O  O   . HOH E 3 .  ? 5.341  35.500 15.765  1.00 28.17 ? 72   HOH B O   1 
HETATM 1681 O  O   . HOH E 3 .  ? 14.305 16.098 25.143  1.00 34.33 ? 74   HOH B O   1 
HETATM 1682 O  O   . HOH E 3 .  ? 11.967 12.962 14.523  1.00 34.12 ? 78   HOH B O   1 
HETATM 1683 O  O   . HOH E 3 .  ? 36.195 28.884 17.924  1.00 38.70 ? 79   HOH B O   1 
HETATM 1684 O  O   . HOH E 3 .  ? 23.545 15.492 16.408  1.00 35.57 ? 80   HOH B O   1 
HETATM 1685 O  O   . HOH E 3 .  ? 7.740  19.431 11.596  1.00 37.87 ? 81   HOH B O   1 
HETATM 1686 O  O   . HOH E 3 .  ? 30.216 23.410 12.185  1.00 27.02 ? 83   HOH B O   1 
HETATM 1687 O  O   . HOH E 3 .  ? 28.558 25.480 11.104  1.00 28.13 ? 84   HOH B O   1 
HETATM 1688 O  O   . HOH E 3 .  ? 22.841 32.964 25.651  1.00 29.69 ? 88   HOH B O   1 
HETATM 1689 O  O   . HOH E 3 .  ? 14.630 31.704 4.989   1.00 29.63 ? 91   HOH B O   1 
HETATM 1690 O  O   . HOH E 3 .  ? 10.132 18.436 8.393   1.00 35.44 ? 92   HOH B O   1 
HETATM 1691 O  O   . HOH E 3 .  ? 26.014 32.125 24.503  1.00 33.30 ? 94   HOH B O   1 
HETATM 1692 O  O   . HOH E 3 .  ? 26.025 23.725 5.621   1.00 30.25 ? 96   HOH B O   1 
HETATM 1693 O  O   . HOH E 3 .  ? 10.051 26.743 2.122   1.00 31.89 ? 97   HOH B O   1 
HETATM 1694 O  O   . HOH E 3 .  ? 31.265 33.958 12.410  1.00 34.96 ? 98   HOH B O   1 
HETATM 1695 O  O   . HOH E 3 .  ? 32.022 22.718 15.949  1.00 30.01 ? 101  HOH B O   1 
HETATM 1696 O  O   . HOH E 3 .  ? 16.044 17.792 28.732  1.00 36.84 ? 103  HOH B O   1 
HETATM 1697 O  O   . HOH E 3 .  ? 25.497 22.455 29.294  1.00 31.71 ? 104  HOH B O   1 
HETATM 1698 O  O   . HOH E 3 .  ? 37.932 34.291 15.105  1.00 34.19 ? 106  HOH B O   1 
HETATM 1699 O  O   . HOH E 3 .  ? 8.686  20.847 21.418  1.00 38.29 ? 110  HOH B O   1 
HETATM 1700 O  O   . HOH E 3 .  ? 18.745 17.992 14.227  1.00 30.39 ? 111  HOH B O   1 
HETATM 1701 O  O   . HOH E 3 .  ? 30.101 32.796 19.459  1.00 33.59 ? 112  HOH B O   1 
HETATM 1702 O  O   . HOH E 3 .  ? 4.563  29.177 24.059  1.00 38.37 ? 113  HOH B O   1 
HETATM 1703 O  O   . HOH E 3 .  ? 26.836 40.742 19.015  1.00 39.14 ? 114  HOH B O   1 
HETATM 1704 O  O   . HOH E 3 .  ? 27.020 21.846 16.445  1.00 27.84 ? 115  HOH B O   1 
HETATM 1705 O  O   . HOH E 3 .  ? 32.371 29.688 18.385  1.00 32.08 ? 116  HOH B O   1 
HETATM 1706 O  O   . HOH E 3 .  ? 9.013  30.216 5.533   1.00 36.52 ? 117  HOH B O   1 
HETATM 1707 O  O   . HOH E 3 .  ? 22.353 15.435 13.144  1.00 37.68 ? 123  HOH B O   1 
HETATM 1708 O  O   . HOH E 3 .  ? 10.803 49.907 25.461  1.00 47.94 ? 125  HOH B O   1 
HETATM 1709 O  O   . HOH E 3 .  ? 27.949 17.790 17.055  1.00 33.02 ? 126  HOH B O   1 
HETATM 1710 O  O   . HOH E 3 .  ? 19.481 15.699 7.611   1.00 34.83 ? 130  HOH B O   1 
HETATM 1711 O  O   . HOH E 3 .  ? 34.231 33.078 12.884  1.00 35.19 ? 132  HOH B O   1 
HETATM 1712 O  O   . HOH E 3 .  ? 23.130 16.780 5.149   1.00 37.49 ? 133  HOH B O   1 
HETATM 1713 O  O   . HOH E 3 .  ? 18.732 16.735 11.698  1.00 33.67 ? 134  HOH B O   1 
HETATM 1714 O  O   . HOH E 3 .  ? 4.905  36.962 19.244  1.00 36.32 ? 136  HOH B O   1 
HETATM 1715 O  O   . HOH E 3 .  ? 20.153 16.093 5.184   1.00 31.71 ? 138  HOH B O   1 
HETATM 1716 O  O   . HOH E 3 .  ? 11.854 29.750 31.981  1.00 44.79 ? 140  HOH B O   1 
HETATM 1717 O  O   . HOH E 3 .  ? 6.913  35.363 27.234  1.00 54.31 ? 144  HOH B O   1 
HETATM 1718 O  O   . HOH E 3 .  ? 33.528 21.082 17.835  1.00 35.53 ? 145  HOH B O   1 
HETATM 1719 O  O   . HOH E 3 .  ? 9.209  27.609 4.574   1.00 29.93 ? 148  HOH B O   1 
HETATM 1720 O  O   . HOH E 3 .  ? 8.470  39.027 24.753  1.00 42.04 ? 153  HOH B O   1 
HETATM 1721 O  O   . HOH E 3 .  ? 20.308 14.012 27.351  1.00 44.64 ? 157  HOH B O   1 
HETATM 1722 O  O   . HOH E 3 .  ? 9.316  24.090 1.904   1.00 32.67 ? 166  HOH B O   1 
HETATM 1723 O  O   . HOH E 3 .  ? 23.459 16.276 10.857  1.00 39.19 ? 168  HOH B O   1 
HETATM 1724 O  O   . HOH E 3 .  ? 14.303 18.045 26.934  1.00 34.89 ? 169  HOH B O   1 
HETATM 1725 O  O   . HOH E 3 .  ? 29.668 21.763 17.307  1.00 40.75 ? 170  HOH B O   1 
HETATM 1726 O  O   . HOH E 3 .  ? 9.160  37.010 13.881  1.00 40.72 ? 171  HOH B O   1 
HETATM 1727 O  O   . HOH E 3 .  ? 13.249 37.443 11.037  1.00 48.20 ? 175  HOH B O   1 
HETATM 1728 O  O   . HOH E 3 .  ? 37.896 32.307 16.869  1.00 45.57 ? 177  HOH B O   1 
HETATM 1729 O  O   . HOH E 3 .  ? 16.599 37.642 6.769   1.00 45.11 ? 179  HOH B O   1 
HETATM 1730 O  O   . HOH E 3 .  ? 18.712 32.400 2.563   1.00 51.65 ? 181  HOH B O   1 
HETATM 1731 O  O   . HOH E 3 .  ? 13.157 43.600 24.023  1.00 40.90 ? 182  HOH B O   1 
HETATM 1732 O  O   . HOH E 3 .  ? 26.267 36.502 23.346  1.00 39.99 ? 183  HOH B O   1 
HETATM 1733 O  O   . HOH E 3 .  ? 2.937  24.853 18.597  1.00 48.34 ? 184  HOH B O   1 
HETATM 1734 O  O   . HOH E 3 .  ? 13.152 22.773 -0.002  0.50 35.19 ? 186  HOH B O   1 
HETATM 1735 O  O   . HOH E 3 .  ? 13.727 38.883 26.143  1.00 42.32 ? 189  HOH B O   1 
HETATM 1736 O  O   . HOH E 3 .  ? 15.085 35.841 5.469   1.00 45.70 ? 193  HOH B O   1 
HETATM 1737 O  O   . HOH E 3 .  ? 30.377 31.236 22.153  1.00 41.31 ? 196  HOH B O   1 
HETATM 1738 O  O   . HOH E 3 .  ? 10.490 40.578 18.469  1.00 54.96 ? 198  HOH B O   1 
HETATM 1739 O  O   . HOH E 3 .  ? 7.542  33.676 8.823   1.00 39.73 ? 200  HOH B O   1 
HETATM 1740 O  O   . HOH E 3 .  ? 28.678 21.922 14.541  1.00 47.77 ? 204  HOH B O   1 
HETATM 1741 O  O   . HOH E 3 .  ? 10.523 15.386 11.180  1.00 55.01 ? 207  HOH B O   1 
HETATM 1742 O  O   . HOH E 3 .  ? 31.857 28.860 21.019  1.00 41.63 ? 210  HOH B O   1 
HETATM 1743 O  O   . HOH E 3 .  ? 12.715 32.042 30.765  1.00 47.96 ? 212  HOH B O   1 
HETATM 1744 O  O   . HOH E 3 .  ? 13.365 36.447 16.830  1.00 46.78 ? 215  HOH B O   1 
HETATM 1745 O  O   . HOH E 3 .  ? 38.529 36.682 15.387  1.00 40.89 ? 217  HOH B O   1 
HETATM 1746 O  O   . HOH E 3 .  ? 28.062 16.962 5.249   1.00 39.42 ? 222  HOH B O   1 
HETATM 1747 O  O   . HOH E 3 .  ? 5.124  37.571 26.867  1.00 46.81 ? 225  HOH B O   1 
HETATM 1748 O  O   . HOH E 3 .  ? 11.303 35.089 16.213  1.00 41.45 ? 236  HOH B O   1 
HETATM 1749 O  O   . HOH E 3 .  ? 35.073 34.536 14.759  1.00 41.42 ? 237  HOH B O   1 
HETATM 1750 O  O   . HOH E 3 .  ? 12.810 15.695 21.524  1.00 43.41 ? 238  HOH B O   1 
HETATM 1751 O  O   . HOH E 3 .  ? 8.666  19.338 25.009  1.00 46.30 ? 239  HOH B O   1 
HETATM 1752 O  O   . HOH E 3 .  ? 29.491 39.149 15.532  1.00 48.96 ? 241  HOH B O   1 
HETATM 1753 O  O   . HOH E 3 .  ? 23.236 35.621 10.953  1.00 48.67 ? 246  HOH B O   1 
HETATM 1754 O  O   . HOH E 3 .  ? 23.731 42.595 18.650  1.00 40.76 ? 247  HOH B O   1 
HETATM 1755 O  O   . HOH E 3 .  ? 9.058  32.171 7.101   1.00 37.20 ? 248  HOH B O   1 
HETATM 1756 O  O   . HOH E 3 .  ? 41.276 34.335 14.084  1.00 42.82 ? 250  HOH B O   1 
HETATM 1757 O  O   . HOH E 3 .  ? 21.423 22.064 29.751  1.00 43.72 ? 255  HOH B O   1 
HETATM 1758 O  O   . HOH E 3 .  ? 27.388 35.396 13.217  1.00 56.77 ? 256  HOH B O   1 
HETATM 1759 O  O   A HOH E 3 .  ? 31.347 15.059 20.897  0.50 33.39 ? 257  HOH B O   1 
HETATM 1760 O  O   B HOH E 3 .  ? 32.264 16.125 19.602  0.50 35.24 ? 257  HOH B O   1 
HETATM 1761 O  O   . HOH E 3 .  ? 18.637 18.445 -0.852  1.00 44.39 ? 258  HOH B O   1 
HETATM 1762 O  O   . HOH E 3 .  ? 7.467  26.423 5.625   1.00 35.53 ? 259  HOH B O   1 
HETATM 1763 O  O   . HOH E 3 .  ? 26.131 32.733 28.990  1.00 53.50 ? 262  HOH B O   1 
HETATM 1764 O  O   . HOH E 3 .  ? 10.859 19.057 5.769   1.00 51.09 ? 263  HOH B O   1 
HETATM 1765 O  O   . HOH E 3 .  ? 10.747 20.080 2.375   1.00 47.89 ? 264  HOH B O   1 
HETATM 1766 O  O   . HOH E 3 .  ? 15.533 20.101 0.546   1.00 44.74 ? 265  HOH B O   1 
HETATM 1767 O  O   . HOH E 3 .  ? 12.689 18.387 2.686   1.00 53.84 ? 266  HOH B O   1 
HETATM 1768 O  O   . HOH E 3 .  ? 9.605  20.982 8.203   1.00 45.82 ? 267  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1623 1623 SER SER A . n 
A 1 2  MET 2  1624 1624 MET MET A . n 
A 1 3  GLY 3  1625 1625 GLY GLY A . n 
A 1 4  CYS 4  1626 1626 CYS CYS A . n 
A 1 5  GLU 5  1627 1627 GLU GLU A . n 
A 1 6  THR 6  1628 1628 THR THR A . n 
A 1 7  THR 7  1629 1629 THR THR A . n 
A 1 8  ILE 8  1630 1630 ILE ILE A . n 
A 1 9  GLU 9  1631 1631 GLU GLU A . n 
A 1 10 ILE 10 1632 1632 ILE ILE A . n 
A 1 11 SER 11 1633 1633 SER SER A . n 
A 1 12 LYS 12 1634 1634 LYS LYS A . n 
A 1 13 GLY 13 1635 1635 GLY GLY A . n 
A 1 14 ARG 14 1636 1636 ARG ARG A . n 
A 1 15 THR 15 1637 1637 THR THR A . n 
A 1 16 GLY 16 1638 1638 GLY GLY A . n 
A 1 17 LEU 17 1639 1639 LEU LEU A . n 
A 1 18 GLY 18 1640 1640 GLY GLY A . n 
A 1 19 LEU 19 1641 1641 LEU LEU A . n 
A 1 20 SER 20 1642 1642 SER SER A . n 
A 1 21 ILE 21 1643 1643 ILE ILE A . n 
A 1 22 VAL 22 1644 1644 VAL VAL A . n 
A 1 23 GLY 23 1645 1645 GLY GLY A . n 
A 1 24 GLY 24 1646 1646 GLY GLY A . n 
A 1 25 SER 25 1647 1647 SER SER A . n 
A 1 26 ASP 26 1648 1648 ASP ASP A . n 
A 1 27 THR 27 1649 1649 THR THR A . n 
A 1 28 LEU 28 1650 1650 LEU LEU A . n 
A 1 29 LEU 29 1651 1651 LEU LEU A . n 
A 1 30 GLY 30 1652 1652 GLY GLY A . n 
A 1 31 ALA 31 1653 1653 ALA ALA A . n 
A 1 32 ILE 32 1654 1654 ILE ILE A . n 
A 1 33 ILE 33 1655 1655 ILE ILE A . n 
A 1 34 ILE 34 1656 1656 ILE ILE A . n 
A 1 35 HIS 35 1657 1657 HIS HIS A . n 
A 1 36 GLU 36 1658 1658 GLU GLU A . n 
A 1 37 VAL 37 1659 1659 VAL VAL A . n 
A 1 38 TYR 38 1660 1660 TYR TYR A . n 
A 1 39 GLU 39 1661 1661 GLU GLU A . n 
A 1 40 GLU 40 1662 1662 GLU GLU A . n 
A 1 41 GLY 41 1663 1663 GLY GLY A . n 
A 1 42 ALA 42 1664 1664 ALA ALA A . n 
A 1 43 ALA 43 1665 1665 ALA ALA A . n 
A 1 44 CYS 44 1666 1666 CYS CYS A . n 
A 1 45 LYS 45 1667 1667 LYS LYS A . n 
A 1 46 ASP 46 1668 1668 ASP ASP A . n 
A 1 47 GLY 47 1669 1669 GLY GLY A . n 
A 1 48 ARG 48 1670 1670 ARG ARG A . n 
A 1 49 LEU 49 1671 1671 LEU LEU A . n 
A 1 50 TRP 50 1672 1672 TRP TRP A . n 
A 1 51 ALA 51 1673 1673 ALA ALA A . n 
A 1 52 GLY 52 1674 1674 GLY GLY A . n 
A 1 53 ASP 53 1675 1675 ASP ASP A . n 
A 1 54 GLN 54 1676 1676 GLN GLN A . n 
A 1 55 ILE 55 1677 1677 ILE ILE A . n 
A 1 56 LEU 56 1678 1678 LEU LEU A . n 
A 1 57 GLU 57 1679 1679 GLU GLU A . n 
A 1 58 VAL 58 1680 1680 VAL VAL A . n 
A 1 59 ASN 59 1681 1681 ASN ASN A . n 
A 1 60 GLY 60 1682 1682 GLY GLY A . n 
A 1 61 ILE 61 1683 1683 ILE ILE A . n 
A 1 62 ASP 62 1684 1684 ASP ASP A . n 
A 1 63 LEU 63 1685 1685 LEU LEU A . n 
A 1 64 ARG 64 1686 1686 ARG ARG A . n 
A 1 65 LYS 65 1687 1687 LYS LYS A . n 
A 1 66 ALA 66 1688 1688 ALA ALA A . n 
A 1 67 THR 67 1689 1689 THR THR A . n 
A 1 68 HIS 68 1690 1690 HIS HIS A . n 
A 1 69 ASP 69 1691 1691 ASP ASP A . n 
A 1 70 GLU 70 1692 1692 GLU GLU A . n 
A 1 71 ALA 71 1693 1693 ALA ALA A . n 
A 1 72 ILE 72 1694 1694 ILE ILE A . n 
A 1 73 ASN 73 1695 1695 ASN ASN A . n 
A 1 74 VAL 74 1696 1696 VAL VAL A . n 
A 1 75 LEU 75 1697 1697 LEU LEU A . n 
A 1 76 ARG 76 1698 1698 ARG ARG A . n 
A 1 77 GLN 77 1699 1699 GLN GLN A . n 
A 1 78 THR 78 1700 1700 THR THR A . n 
A 1 79 PRO 79 1701 1701 PRO PRO A . n 
A 1 80 GLN 80 1702 1702 GLN GLN A . n 
A 1 81 ARG 81 1703 1703 ARG ARG A . n 
A 1 82 VAL 82 1704 1704 VAL VAL A . n 
A 1 83 ARG 83 1705 1705 ARG ARG A . n 
A 1 84 LEU 84 1706 1706 LEU LEU A . n 
A 1 85 THR 85 1707 1707 THR THR A . n 
A 1 86 LEU 86 1708 1708 LEU LEU A . n 
A 1 87 TYR 87 1709 1709 TYR TYR A . n 
A 1 88 ARG 88 1710 1710 ARG ARG A . n 
A 1 89 ASP 89 1711 1711 ASP ASP A . n 
A 1 90 GLU 90 1712 1712 GLU GLU A . n 
A 1 91 ALA 91 1713 1713 ALA ALA A . n 
A 1 92 PRO 92 1714 1714 PRO PRO A . n 
A 1 93 TYR 93 1715 1715 TYR TYR A . n 
A 1 94 LYS 94 1716 1716 LYS LYS A . n 
A 1 95 SER 95 1717 1717 SER SER A . n 
A 1 96 THR 96 1718 1718 THR THR A . n 
A 1 97 ARG 97 1719 1719 ARG ARG A . n 
A 1 98 LEU 98 1720 1720 LEU LEU A . n 
B 1 1  SER 1  1623 1623 SER SER B . n 
B 1 2  MET 2  1624 1624 MET MET B . n 
B 1 3  GLY 3  1625 1625 GLY GLY B . n 
B 1 4  CYS 4  1626 1626 CYS CYS B . n 
B 1 5  GLU 5  1627 1627 GLU GLU B . n 
B 1 6  THR 6  1628 1628 THR THR B . n 
B 1 7  THR 7  1629 1629 THR THR B . n 
B 1 8  ILE 8  1630 1630 ILE ILE B . n 
B 1 9  GLU 9  1631 1631 GLU GLU B . n 
B 1 10 ILE 10 1632 1632 ILE ILE B . n 
B 1 11 SER 11 1633 1633 SER SER B . n 
B 1 12 LYS 12 1634 1634 LYS LYS B . n 
B 1 13 GLY 13 1635 1635 GLY GLY B . n 
B 1 14 ARG 14 1636 1636 ARG ARG B . n 
B 1 15 THR 15 1637 1637 THR THR B . n 
B 1 16 GLY 16 1638 1638 GLY GLY B . n 
B 1 17 LEU 17 1639 1639 LEU LEU B . n 
B 1 18 GLY 18 1640 1640 GLY GLY B . n 
B 1 19 LEU 19 1641 1641 LEU LEU B . n 
B 1 20 SER 20 1642 1642 SER SER B . n 
B 1 21 ILE 21 1643 1643 ILE ILE B . n 
B 1 22 VAL 22 1644 1644 VAL VAL B . n 
B 1 23 GLY 23 1645 1645 GLY GLY B . n 
B 1 24 GLY 24 1646 1646 GLY GLY B . n 
B 1 25 SER 25 1647 1647 SER SER B . n 
B 1 26 ASP 26 1648 1648 ASP ASP B . n 
B 1 27 THR 27 1649 1649 THR THR B . n 
B 1 28 LEU 28 1650 1650 LEU LEU B . n 
B 1 29 LEU 29 1651 1651 LEU LEU B . n 
B 1 30 GLY 30 1652 1652 GLY GLY B . n 
B 1 31 ALA 31 1653 1653 ALA ALA B . n 
B 1 32 ILE 32 1654 1654 ILE ILE B . n 
B 1 33 ILE 33 1655 1655 ILE ILE B . n 
B 1 34 ILE 34 1656 1656 ILE ILE B . n 
B 1 35 HIS 35 1657 1657 HIS HIS B . n 
B 1 36 GLU 36 1658 1658 GLU GLU B . n 
B 1 37 VAL 37 1659 1659 VAL VAL B . n 
B 1 38 TYR 38 1660 1660 TYR TYR B . n 
B 1 39 GLU 39 1661 1661 GLU GLU B . n 
B 1 40 GLU 40 1662 1662 GLU GLU B . n 
B 1 41 GLY 41 1663 1663 GLY GLY B . n 
B 1 42 ALA 42 1664 1664 ALA ALA B . n 
B 1 43 ALA 43 1665 1665 ALA ALA B . n 
B 1 44 CYS 44 1666 1666 CYS CYS B . n 
B 1 45 LYS 45 1667 1667 LYS LYS B . n 
B 1 46 ASP 46 1668 1668 ASP ASP B . n 
B 1 47 GLY 47 1669 1669 GLY GLY B . n 
B 1 48 ARG 48 1670 1670 ARG ARG B . n 
B 1 49 LEU 49 1671 1671 LEU LEU B . n 
B 1 50 TRP 50 1672 1672 TRP TRP B . n 
B 1 51 ALA 51 1673 1673 ALA ALA B . n 
B 1 52 GLY 52 1674 1674 GLY GLY B . n 
B 1 53 ASP 53 1675 1675 ASP ASP B . n 
B 1 54 GLN 54 1676 1676 GLN GLN B . n 
B 1 55 ILE 55 1677 1677 ILE ILE B . n 
B 1 56 LEU 56 1678 1678 LEU LEU B . n 
B 1 57 GLU 57 1679 1679 GLU GLU B . n 
B 1 58 VAL 58 1680 1680 VAL VAL B . n 
B 1 59 ASN 59 1681 1681 ASN ASN B . n 
B 1 60 GLY 60 1682 1682 GLY GLY B . n 
B 1 61 ILE 61 1683 1683 ILE ILE B . n 
B 1 62 ASP 62 1684 1684 ASP ASP B . n 
B 1 63 LEU 63 1685 1685 LEU LEU B . n 
B 1 64 ARG 64 1686 1686 ARG ARG B . n 
B 1 65 LYS 65 1687 1687 LYS LYS B . n 
B 1 66 ALA 66 1688 1688 ALA ALA B . n 
B 1 67 THR 67 1689 1689 THR THR B . n 
B 1 68 HIS 68 1690 1690 HIS HIS B . n 
B 1 69 ASP 69 1691 1691 ASP ASP B . n 
B 1 70 GLU 70 1692 1692 GLU GLU B . n 
B 1 71 ALA 71 1693 1693 ALA ALA B . n 
B 1 72 ILE 72 1694 1694 ILE ILE B . n 
B 1 73 ASN 73 1695 1695 ASN ASN B . n 
B 1 74 VAL 74 1696 1696 VAL VAL B . n 
B 1 75 LEU 75 1697 1697 LEU LEU B . n 
B 1 76 ARG 76 1698 1698 ARG ARG B . n 
B 1 77 GLN 77 1699 1699 GLN GLN B . n 
B 1 78 THR 78 1700 1700 THR THR B . n 
B 1 79 PRO 79 1701 1701 PRO PRO B . n 
B 1 80 GLN 80 1702 1702 GLN GLN B . n 
B 1 81 ARG 81 1703 1703 ARG ARG B . n 
B 1 82 VAL 82 1704 1704 VAL VAL B . n 
B 1 83 ARG 83 1705 1705 ARG ARG B . n 
B 1 84 LEU 84 1706 1706 LEU LEU B . n 
B 1 85 THR 85 1707 1707 THR THR B . n 
B 1 86 LEU 86 1708 1708 LEU LEU B . n 
B 1 87 TYR 87 1709 1709 TYR TYR B . n 
B 1 88 ARG 88 1710 1710 ARG ARG B . n 
B 1 89 ASP 89 1711 1711 ASP ASP B . n 
B 1 90 GLU 90 1712 1712 GLU GLU B . n 
B 1 91 ALA 91 1713 1713 ALA ALA B . n 
B 1 92 PRO 92 1714 1714 PRO PRO B . n 
B 1 93 TYR 93 1715 1715 TYR TYR B . n 
B 1 94 LYS 94 1716 1716 LYS LYS B . n 
B 1 95 SER 95 1717 1717 SER SER B . n 
B 1 96 THR 96 1718 1718 THR THR B . n 
B 1 97 ARG 97 1719 1719 ARG ARG B . n 
B 1 98 LEU 98 1720 1720 LEU LEU B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NA  1   1   1   NA  NA  A . 
D 3 HOH 1   2   1   HOH HOH A . 
D 3 HOH 2   8   8   HOH HOH A . 
D 3 HOH 3   11  11  HOH HOH A . 
D 3 HOH 4   12  12  HOH HOH A . 
D 3 HOH 5   13  13  HOH HOH A . 
D 3 HOH 6   14  14  HOH HOH A . 
D 3 HOH 7   15  15  HOH HOH A . 
D 3 HOH 8   17  17  HOH HOH A . 
D 3 HOH 9   19  19  HOH HOH A . 
D 3 HOH 10  23  23  HOH HOH A . 
D 3 HOH 11  26  26  HOH HOH A . 
D 3 HOH 12  27  27  HOH HOH A . 
D 3 HOH 13  32  32  HOH HOH A . 
D 3 HOH 14  34  34  HOH HOH A . 
D 3 HOH 15  35  35  HOH HOH A . 
D 3 HOH 16  39  39  HOH HOH A . 
D 3 HOH 17  42  42  HOH HOH A . 
D 3 HOH 18  43  43  HOH HOH A . 
D 3 HOH 19  44  44  HOH HOH A . 
D 3 HOH 20  46  46  HOH HOH A . 
D 3 HOH 21  47  47  HOH HOH A . 
D 3 HOH 22  49  49  HOH HOH A . 
D 3 HOH 23  51  51  HOH HOH A . 
D 3 HOH 24  52  52  HOH HOH A . 
D 3 HOH 25  54  54  HOH HOH A . 
D 3 HOH 26  55  55  HOH HOH A . 
D 3 HOH 27  56  56  HOH HOH A . 
D 3 HOH 28  58  58  HOH HOH A . 
D 3 HOH 29  59  59  HOH HOH A . 
D 3 HOH 30  61  61  HOH HOH A . 
D 3 HOH 31  62  62  HOH HOH A . 
D 3 HOH 32  67  67  HOH HOH A . 
D 3 HOH 33  69  69  HOH HOH A . 
D 3 HOH 34  73  73  HOH HOH A . 
D 3 HOH 35  75  75  HOH HOH A . 
D 3 HOH 36  76  76  HOH HOH A . 
D 3 HOH 37  77  77  HOH HOH A . 
D 3 HOH 38  82  82  HOH HOH A . 
D 3 HOH 39  85  85  HOH HOH A . 
D 3 HOH 40  86  86  HOH HOH A . 
D 3 HOH 41  87  87  HOH HOH A . 
D 3 HOH 42  89  89  HOH HOH A . 
D 3 HOH 43  90  90  HOH HOH A . 
D 3 HOH 44  93  93  HOH HOH A . 
D 3 HOH 45  99  99  HOH HOH A . 
D 3 HOH 46  100 100 HOH HOH A . 
D 3 HOH 47  102 102 HOH HOH A . 
D 3 HOH 48  105 105 HOH HOH A . 
D 3 HOH 49  107 107 HOH HOH A . 
D 3 HOH 50  108 108 HOH HOH A . 
D 3 HOH 51  109 109 HOH HOH A . 
D 3 HOH 52  118 118 HOH HOH A . 
D 3 HOH 53  119 119 HOH HOH A . 
D 3 HOH 54  120 120 HOH HOH A . 
D 3 HOH 55  121 121 HOH HOH A . 
D 3 HOH 56  122 122 HOH HOH A . 
D 3 HOH 57  124 124 HOH HOH A . 
D 3 HOH 58  128 128 HOH HOH A . 
D 3 HOH 59  129 129 HOH HOH A . 
D 3 HOH 60  135 135 HOH HOH A . 
D 3 HOH 61  139 139 HOH HOH A . 
D 3 HOH 62  142 142 HOH HOH A . 
D 3 HOH 63  143 143 HOH HOH A . 
D 3 HOH 64  146 146 HOH HOH A . 
D 3 HOH 65  150 150 HOH HOH A . 
D 3 HOH 66  154 154 HOH HOH A . 
D 3 HOH 67  155 155 HOH HOH A . 
D 3 HOH 68  158 158 HOH HOH A . 
D 3 HOH 69  159 159 HOH HOH A . 
D 3 HOH 70  161 161 HOH HOH A . 
D 3 HOH 71  162 162 HOH HOH A . 
D 3 HOH 72  164 164 HOH HOH A . 
D 3 HOH 73  165 165 HOH HOH A . 
D 3 HOH 74  167 167 HOH HOH A . 
D 3 HOH 75  172 172 HOH HOH A . 
D 3 HOH 76  173 173 HOH HOH A . 
D 3 HOH 77  174 174 HOH HOH A . 
D 3 HOH 78  176 176 HOH HOH A . 
D 3 HOH 79  178 178 HOH HOH A . 
D 3 HOH 80  185 185 HOH HOH A . 
D 3 HOH 81  187 187 HOH HOH A . 
D 3 HOH 82  190 190 HOH HOH A . 
D 3 HOH 83  195 195 HOH HOH A . 
D 3 HOH 84  199 199 HOH HOH A . 
D 3 HOH 85  203 203 HOH HOH A . 
D 3 HOH 86  209 209 HOH HOH A . 
D 3 HOH 87  211 211 HOH HOH A . 
D 3 HOH 88  218 218 HOH HOH A . 
D 3 HOH 89  219 219 HOH HOH A . 
D 3 HOH 90  220 220 HOH HOH A . 
D 3 HOH 91  221 221 HOH HOH A . 
D 3 HOH 92  223 223 HOH HOH A . 
D 3 HOH 93  224 224 HOH HOH A . 
D 3 HOH 94  226 226 HOH HOH A . 
D 3 HOH 95  228 228 HOH HOH A . 
D 3 HOH 96  229 229 HOH HOH A . 
D 3 HOH 97  230 230 HOH HOH A . 
D 3 HOH 98  231 231 HOH HOH A . 
D 3 HOH 99  232 232 HOH HOH A . 
D 3 HOH 100 235 235 HOH HOH A . 
D 3 HOH 101 242 242 HOH HOH A . 
D 3 HOH 102 251 251 HOH HOH A . 
D 3 HOH 103 252 252 HOH HOH A . 
D 3 HOH 104 253 253 HOH HOH A . 
D 3 HOH 105 254 254 HOH HOH A . 
D 3 HOH 106 260 260 HOH HOH A . 
D 3 HOH 107 268 268 HOH HOH A . 
D 3 HOH 108 269 269 HOH HOH A . 
D 3 HOH 109 270 270 HOH HOH A . 
D 3 HOH 110 271 271 HOH HOH A . 
D 3 HOH 111 272 272 HOH HOH A . 
D 3 HOH 112 273 273 HOH HOH A . 
E 3 HOH 1   3   3   HOH HOH B . 
E 3 HOH 2   4   4   HOH HOH B . 
E 3 HOH 3   5   5   HOH HOH B . 
E 3 HOH 4   6   6   HOH HOH B . 
E 3 HOH 5   7   7   HOH HOH B . 
E 3 HOH 6   9   9   HOH HOH B . 
E 3 HOH 7   10  10  HOH HOH B . 
E 3 HOH 8   16  16  HOH HOH B . 
E 3 HOH 9   18  18  HOH HOH B . 
E 3 HOH 10  20  20  HOH HOH B . 
E 3 HOH 11  21  21  HOH HOH B . 
E 3 HOH 12  22  22  HOH HOH B . 
E 3 HOH 13  24  24  HOH HOH B . 
E 3 HOH 14  25  25  HOH HOH B . 
E 3 HOH 15  28  28  HOH HOH B . 
E 3 HOH 16  29  29  HOH HOH B . 
E 3 HOH 17  30  30  HOH HOH B . 
E 3 HOH 18  31  31  HOH HOH B . 
E 3 HOH 19  33  33  HOH HOH B . 
E 3 HOH 20  36  36  HOH HOH B . 
E 3 HOH 21  37  37  HOH HOH B . 
E 3 HOH 22  38  38  HOH HOH B . 
E 3 HOH 23  40  40  HOH HOH B . 
E 3 HOH 24  41  41  HOH HOH B . 
E 3 HOH 25  45  45  HOH HOH B . 
E 3 HOH 26  50  50  HOH HOH B . 
E 3 HOH 27  53  53  HOH HOH B . 
E 3 HOH 28  57  57  HOH HOH B . 
E 3 HOH 29  63  63  HOH HOH B . 
E 3 HOH 30  64  64  HOH HOH B . 
E 3 HOH 31  65  65  HOH HOH B . 
E 3 HOH 32  68  68  HOH HOH B . 
E 3 HOH 33  70  70  HOH HOH B . 
E 3 HOH 34  72  72  HOH HOH B . 
E 3 HOH 35  74  74  HOH HOH B . 
E 3 HOH 36  78  78  HOH HOH B . 
E 3 HOH 37  79  79  HOH HOH B . 
E 3 HOH 38  80  80  HOH HOH B . 
E 3 HOH 39  81  81  HOH HOH B . 
E 3 HOH 40  83  83  HOH HOH B . 
E 3 HOH 41  84  84  HOH HOH B . 
E 3 HOH 42  88  88  HOH HOH B . 
E 3 HOH 43  91  91  HOH HOH B . 
E 3 HOH 44  92  92  HOH HOH B . 
E 3 HOH 45  94  94  HOH HOH B . 
E 3 HOH 46  96  96  HOH HOH B . 
E 3 HOH 47  97  97  HOH HOH B . 
E 3 HOH 48  98  98  HOH HOH B . 
E 3 HOH 49  101 101 HOH HOH B . 
E 3 HOH 50  103 103 HOH HOH B . 
E 3 HOH 51  104 104 HOH HOH B . 
E 3 HOH 52  106 106 HOH HOH B . 
E 3 HOH 53  110 110 HOH HOH B . 
E 3 HOH 54  111 111 HOH HOH B . 
E 3 HOH 55  112 112 HOH HOH B . 
E 3 HOH 56  113 113 HOH HOH B . 
E 3 HOH 57  114 114 HOH HOH B . 
E 3 HOH 58  115 115 HOH HOH B . 
E 3 HOH 59  116 116 HOH HOH B . 
E 3 HOH 60  117 117 HOH HOH B . 
E 3 HOH 61  123 123 HOH HOH B . 
E 3 HOH 62  125 125 HOH HOH B . 
E 3 HOH 63  126 126 HOH HOH B . 
E 3 HOH 64  130 130 HOH HOH B . 
E 3 HOH 65  132 132 HOH HOH B . 
E 3 HOH 66  133 133 HOH HOH B . 
E 3 HOH 67  134 134 HOH HOH B . 
E 3 HOH 68  136 136 HOH HOH B . 
E 3 HOH 69  138 138 HOH HOH B . 
E 3 HOH 70  140 140 HOH HOH B . 
E 3 HOH 71  144 144 HOH HOH B . 
E 3 HOH 72  145 145 HOH HOH B . 
E 3 HOH 73  148 148 HOH HOH B . 
E 3 HOH 74  153 153 HOH HOH B . 
E 3 HOH 75  157 157 HOH HOH B . 
E 3 HOH 76  166 166 HOH HOH B . 
E 3 HOH 77  168 168 HOH HOH B . 
E 3 HOH 78  169 169 HOH HOH B . 
E 3 HOH 79  170 170 HOH HOH B . 
E 3 HOH 80  171 171 HOH HOH B . 
E 3 HOH 81  175 175 HOH HOH B . 
E 3 HOH 82  177 177 HOH HOH B . 
E 3 HOH 83  179 179 HOH HOH B . 
E 3 HOH 84  181 181 HOH HOH B . 
E 3 HOH 85  182 182 HOH HOH B . 
E 3 HOH 86  183 183 HOH HOH B . 
E 3 HOH 87  184 184 HOH HOH B . 
E 3 HOH 88  186 186 HOH HOH B . 
E 3 HOH 89  189 189 HOH HOH B . 
E 3 HOH 90  193 193 HOH HOH B . 
E 3 HOH 91  196 196 HOH HOH B . 
E 3 HOH 92  198 198 HOH HOH B . 
E 3 HOH 93  200 200 HOH HOH B . 
E 3 HOH 94  204 204 HOH HOH B . 
E 3 HOH 95  207 207 HOH HOH B . 
E 3 HOH 96  210 210 HOH HOH B . 
E 3 HOH 97  212 212 HOH HOH B . 
E 3 HOH 98  215 215 HOH HOH B . 
E 3 HOH 99  217 217 HOH HOH B . 
E 3 HOH 100 222 222 HOH HOH B . 
E 3 HOH 101 225 225 HOH HOH B . 
E 3 HOH 102 236 236 HOH HOH B . 
E 3 HOH 103 237 237 HOH HOH B . 
E 3 HOH 104 238 238 HOH HOH B . 
E 3 HOH 105 239 239 HOH HOH B . 
E 3 HOH 106 241 241 HOH HOH B . 
E 3 HOH 107 246 246 HOH HOH B . 
E 3 HOH 108 247 247 HOH HOH B . 
E 3 HOH 109 248 248 HOH HOH B . 
E 3 HOH 110 250 250 HOH HOH B . 
E 3 HOH 111 255 255 HOH HOH B . 
E 3 HOH 112 256 256 HOH HOH B . 
E 3 HOH 113 257 257 HOH HOH B . 
E 3 HOH 114 258 258 HOH HOH B . 
E 3 HOH 115 259 259 HOH HOH B . 
E 3 HOH 116 262 262 HOH HOH B . 
E 3 HOH 117 263 263 HOH HOH B . 
E 3 HOH 118 264 264 HOH HOH B . 
E 3 HOH 119 265 265 HOH HOH B . 
E 3 HOH 120 266 266 HOH HOH B . 
E 3 HOH 121 267 267 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D 
2 1 B,E   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     186 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   E 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A GLN 54 ? A GLN 1676 ? 1_555 NA ? C NA . ? A NA 1 ? 1_555 O ? A ILE 55 ? A ILE 1677 ? 1_555 102.3 ? 
2 NE2 ? A GLN 54 ? A GLN 1676 ? 1_555 NA ? C NA . ? A NA 1 ? 1_555 O ? A LEU 63 ? A LEU 1685 ? 1_555 126.2 ? 
3 O   ? A ILE 55 ? A ILE 1677 ? 1_555 NA ? C NA . ? A NA 1 ? 1_555 O ? A LEU 63 ? A LEU 1685 ? 1_555 94.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-02-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC refinement       5.2.0019  ? 1 
MOSFLM 'data reduction' .         ? 2 
CCP4   'data scaling'   '(SCALA)' ? 3 
PHASER phasing          .         ? 4 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     1712 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    ND2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ASN 
_pdbx_validate_symm_contact.auth_seq_id_2     1695 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CG1 A ILE 1630 ? B CB A ILE 1630 ? B CG2 A ILE 1630 ? B 126.41 111.40 15.01 2.20 N 
2 1 NE  B ARG 1698 ? ? CZ B ARG 1698 ? ? NH2 B ARG 1698 ? ? 114.96 120.30 -5.34 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 1662 ? ? 76.91  -0.94   
2 1 PRO A 1701 ? ? -79.96 -169.83 
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CB 
_pdbx_validate_chiral.label_alt_id    B 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ILE 
_pdbx_validate_chiral.auth_seq_id     1630 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 1631 ? CG  ? A GLU 9  CG  
2  1 Y 1 A GLU 1631 ? CD  ? A GLU 9  CD  
3  1 Y 1 A GLU 1631 ? OE1 ? A GLU 9  OE1 
4  1 Y 1 A GLU 1631 ? OE2 ? A GLU 9  OE2 
5  1 Y 1 A LYS 1667 ? NZ  ? A LYS 45 NZ  
6  1 Y 1 A ARG 1705 ? CD  ? A ARG 83 CD  
7  1 Y 1 A ARG 1705 ? NE  ? A ARG 83 NE  
8  1 Y 1 A ARG 1705 ? CZ  ? A ARG 83 CZ  
9  1 Y 1 A ARG 1705 ? NH1 ? A ARG 83 NH1 
10 1 Y 1 A ARG 1705 ? NH2 ? A ARG 83 NH2 
11 1 Y 1 B GLU 1662 ? CG  ? B GLU 40 CG  
12 1 Y 1 B GLU 1662 ? CD  ? B GLU 40 CD  
13 1 Y 1 B GLU 1662 ? OE1 ? B GLU 40 OE1 
14 1 Y 1 B GLU 1662 ? OE2 ? B GLU 40 OE2 
15 1 Y 1 B GLN 1699 ? OE1 ? B GLN 77 OE1 
16 1 Y 1 B GLN 1699 ? NE2 ? B GLN 77 NE2 
17 1 Y 1 B ARG 1703 ? CZ  ? B ARG 81 CZ  
18 1 Y 1 B ARG 1703 ? NH1 ? B ARG 81 NH1 
19 1 Y 1 B ARG 1703 ? NH2 ? B ARG 81 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION' NA  
3 water        HOH 
#