data_2OQS
# 
_entry.id   2OQS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2OQS         pdb_00002oqs 10.2210/pdb2oqs/pdb 
RCSB  RCSB041472   ?            ?                   
WWPDB D_1000041472 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OQS 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Y.'      1 
'Baleja, J.D.' 2 
'Henry, G.D.'  3 
'Hegde, R.S.'  4 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the hDlg/SAP97 PDZ2 domain and its mechanism of interaction with HPV-18 papillomavirus E6 protein.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                10864 
_citation.page_last                 10874 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17713926 
_citation.pdbx_database_id_DOI      10.1021/bi700879k 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, Y.'      1 ? 
primary 'Henry, G.D.'  2 ? 
primary 'Hegde, R.S.'  3 ? 
primary 'Baleja, J.D.' 4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Disks large homolog 1'        10400.886 1 ? ? 'second PDZ domain, residues 318-406' ? 
2 polymer syn 'C-terminal HPV-18 E6 peptide' 789.880   1 ? ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Synapse-associated protein 97, SAP-97, hDlg' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDF
VYLKVAKPTGSHHHHHH
;
;MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDF
VYLKVAKPTGSHHHHHH
;
A ? 
2 'polypeptide(L)' no no RRETQV                                                                                               
RRETQV                                                                                               B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLU n 
1 3  ILE n 
1 4  LYS n 
1 5  LEU n 
1 6  ILE n 
1 7  LYS n 
1 8  GLY n 
1 9  PRO n 
1 10 LYS n 
1 11 GLY n 
1 12 LEU n 
1 13 GLY n 
1 14 PHE n 
1 15 SER n 
1 16 ILE n 
1 17 ALA n 
1 18 GLY n 
1 19 GLY n 
1 20 VAL n 
1 21 GLY n 
1 22 ASN n 
1 23 GLN n 
1 24 HIS n 
1 25 ILE n 
1 26 PRO n 
1 27 GLY n 
1 28 ASP n 
1 29 ASN n 
1 30 SER n 
1 31 ILE n 
1 32 TYR n 
1 33 VAL n 
1 34 THR n 
1 35 LYS n 
1 36 ILE n 
1 37 ILE n 
1 38 GLU n 
1 39 GLY n 
1 40 GLY n 
1 41 ALA n 
1 42 ALA n 
1 43 HIS n 
1 44 LYS n 
1 45 ASP n 
1 46 GLY n 
1 47 LYS n 
1 48 LEU n 
1 49 GLN n 
1 50 ILE n 
1 51 GLY n 
1 52 ASP n 
1 53 LYS n 
1 54 LEU n 
1 55 LEU n 
1 56 ALA n 
1 57 VAL n 
1 58 ASN n 
1 59 ASN n 
1 60 VAL n 
1 61 CYS n 
1 62 LEU n 
1 63 GLU n 
1 64 GLU n 
1 65 VAL n 
1 66 THR n 
1 67 HIS n 
1 68 GLU n 
1 69 GLU n 
1 70 ALA n 
1 71 VAL n 
1 72 THR n 
1 73 ALA n 
1 74 LEU n 
1 75 LYS n 
1 76 ASN n 
1 77 THR n 
1 78 SER n 
1 79 ASP n 
1 80 PHE n 
1 81 VAL n 
1 82 TYR n 
1 83 LEU n 
1 84 LYS n 
1 85 VAL n 
1 86 ALA n 
1 87 LYS n 
1 88 PRO n 
1 89 THR n 
1 90 GLY n 
1 91 SER n 
1 92 HIS n 
1 93 HIS n 
1 94 HIS n 
1 95 HIS n 
1 96 HIS n 
1 97 HIS n 
2 1  ARG n 
2 2  ARG n 
2 3  GLU n 
2 4  THR n 
2 5  GLN n 
2 6  VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 DLG1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET30a(+)' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'This sequence occurs naturally in Homo sapiens (human)' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DLG1_HUMAN Q12959 1 
;MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDF
VYLKVAKPT
;
318 ? 
2 PDB 2OQS       2OQS   2 ?                                                                                            ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OQS A 1 ? 89 ? Q12959 318 ? 405 ? 1   89  
2 2 2OQS B 1 ? 6  ? 2OQS   301 ? 306 ? 301 306 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OQS GLY A 90 ? UNP Q12959 ? ? 'expression tag' 90 1 
1 2OQS SER A 91 ? UNP Q12959 ? ? 'expression tag' 91 2 
1 2OQS HIS A 92 ? UNP Q12959 ? ? 'expression tag' 92 3 
1 2OQS HIS A 93 ? UNP Q12959 ? ? 'expression tag' 93 4 
1 2OQS HIS A 94 ? UNP Q12959 ? ? 'expression tag' 94 5 
1 2OQS HIS A 95 ? UNP Q12959 ? ? 'expression tag' 95 6 
1 2OQS HIS A 96 ? UNP Q12959 ? ? 'expression tag' 96 7 
1 2OQS HIS A 97 ? UNP Q12959 ? ? 'expression tag' 97 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D NOESY'                    1 
2 3 3D_15N-separated_NOESY        3 
3 3 HCCH-TOCSY                    3 
4 3 HNCACB                        3 
5 3 CBCACONH                      3 
6 3 'HBHA(CO)NH'                  3 
7 4 CT-13C/1H-HSQC                4 
8 5 'HSQC-DSSE (IPAP) for HN RDC' 5 
9 6 'HSQC-DSSE (IPAP) for HN RDC' 6 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 293 ambient 6.5 '28.2 mM' . K 
2 293 ambient 6.5 '28.2 mM' . K 
3 293 ambient 6.5 '28.2 mM' . K 
4 293 ambient 6.5 '28.2 mM' . K 
5 293 ambient 6.5 '28.2 mM' . K 
6 293 ambient 6.5 '28.2 mM' . K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '2mM hDLG/SAP97 PDZ2 domain, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 99.5% D2O' '99.5% D2O' 
2 
'2mM hDLG/SAP97 PDZ2 domain  U-15N, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O' 
'90% H2O/10% D2O' 
3 
;2 mM hDLG/SAP97 PDZ2 domain  U-15N, 13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20 mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O
;
'90% H2O/10% D2O' 
4 '2 mM hDLG/SAP97 PDZ2 domain, U-15N, U-10%13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5' 
'90% H2O/10% D2O' 
5 
;2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 5% C8E5, C8E5/n-octanol 0.87, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O
;
'90% H2O/10% D2O' 
6 
;2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 10 mg/ml pf1 phage, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5,90% H2O, 10% D2O
;
'90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             'AVANCE DRX' 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2OQS 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 1426 restraints, 1126 are NOE-derived 
distance constraints, 163 dihedral angle restraints, 50 distance restraints  
from hydrogen bonds and 87 NH residual dipolar couplings.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2OQS 
_pdbx_nmr_details.text       'The structure was determined using triple-resonance NMR spectroscopy.' 
# 
_pdbx_nmr_ensemble.entry_id                                      2OQS 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             30 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2OQS 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
collection           XwinNMR 3.5   'Bruker Biospin'                  1 
processing           XwinNMR 3.5   'Bruker Biospin'                  2 
'data analysis'      Sparky  3.112 'T. D. Goddard and D. G. Kneller' 3 
refinement           CNS     1.1   Brunger                           4 
'structure solution' CNS     1.1   Brunger                           5 
# 
_exptl.entry_id          2OQS 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2OQS 
_struct.title                     'Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OQS 
_struct_keywords.pdbx_keywords   'PEPTIDE BINDING PROTEIN' 
_struct_keywords.text            
'HPV E6, hDLG PDZ domain, protein-peptide complex, PEPTIDE-BINDING PROTEIN, PEPTIDE BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 40 ? GLY A 46 ? GLY A 40 GLY A 46 1 ? 7  
HELX_P HELX_P2 2 THR A 66 ? ASN A 76 ? THR A 66 ASN A 76 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 2  ? ILE A 6  ? GLU A 2   ILE A 6   
A 2 PHE A 80 ? ALA A 86 ? PHE A 80  ALA A 86  
A 3 LYS A 53 ? VAL A 57 ? LYS A 53  VAL A 57  
A 4 ILE A 31 ? TYR A 32 ? ILE A 31  TYR A 32  
B 1 GLU A 2  ? ILE A 6  ? GLU A 2   ILE A 6   
B 2 PHE A 80 ? ALA A 86 ? PHE A 80  ALA A 86  
B 3 LYS A 53 ? VAL A 57 ? LYS A 53  VAL A 57  
B 4 VAL A 60 ? CYS A 61 ? VAL A 60  CYS A 61  
C 1 SER A 15 ? ALA A 17 ? SER A 15  ALA A 17  
C 2 GLU B 3  ? GLN B 5  ? GLU B 303 GLN B 305 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 5  ? N LEU A 5  O VAL A 81 ? O VAL A 81  
A 2 3 O LYS A 84 ? O LYS A 84 N ALA A 56 ? N ALA A 56  
A 3 4 O LEU A 54 ? O LEU A 54 N ILE A 31 ? N ILE A 31  
B 1 2 N LEU A 5  ? N LEU A 5  O VAL A 81 ? O VAL A 81  
B 2 3 O LYS A 84 ? O LYS A 84 N ALA A 56 ? N ALA A 56  
B 3 4 N VAL A 57 ? N VAL A 57 O VAL A 60 ? O VAL A 60  
C 1 2 N ILE A 16 ? N ILE A 16 O THR B 4  ? O THR B 304 
# 
_database_PDB_matrix.entry_id          2OQS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OQS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -8.456  0.335   -7.611  1.00 1.83 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? -8.388  1.721   -7.070  1.00 1.38 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? -6.959  2.262   -7.108  1.00 1.20 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1  ? -6.125  1.900   -6.274  1.00 1.07 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? -8.918  1.715   -5.632  1.00 1.81 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? -9.263  3.098   -5.101  1.00 2.04 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? -8.705  3.352   -3.405  1.00 2.69 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? -10.144 4.136   -2.684  1.00 3.17 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? -9.432  -0.004  -7.493  1.00 2.20 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? -7.787  -0.249  -7.069  1.00 2.22 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? -8.194  0.374   -8.616  1.00 1.92 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? -9.018  2.355   -7.677  1.00 1.47 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? -9.809  1.106   -5.592  1.00 2.32 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? -8.167  1.282   -4.986  1.00 2.16 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? -8.795  3.839   -5.732  1.00 2.47 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? -10.335 3.225   -5.136  1.00 2.24 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? -9.842  5.027   -2.154  1.00 3.35 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? -10.619 3.452   -1.995  1.00 3.35 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? -10.841 4.400   -3.465  1.00 3.67 ? 1   MET A HE3  1  
ATOM 20    N N    . GLU A 1 2  ? -6.686  3.132   -8.079  1.00 1.25 ? 2   GLU A N    1  
ATOM 21    C CA   . GLU A 1 2  ? -5.360  3.729   -8.229  1.00 1.15 ? 2   GLU A CA   1  
ATOM 22    C C    . GLU A 1 2  ? -5.328  5.143   -7.649  1.00 1.12 ? 2   GLU A C    1  
ATOM 23    O O    . GLU A 1 2  ? -6.356  5.820   -7.584  1.00 1.17 ? 2   GLU A O    1  
ATOM 24    C CB   . GLU A 1 2  ? -4.943  3.753   -9.706  1.00 1.22 ? 2   GLU A CB   1  
ATOM 25    C CG   . GLU A 1 2  ? -5.751  4.715   -10.567 1.00 1.74 ? 2   GLU A CG   1  
ATOM 26    C CD   . GLU A 1 2  ? -6.905  4.034   -11.278 1.00 1.63 ? 2   GLU A CD   1  
ATOM 27    O OE1  . GLU A 1 2  ? -6.678  3.459   -12.364 1.00 1.88 ? 2   GLU A OE1  1  
ATOM 28    O OE2  . GLU A 1 2  ? -8.036  4.074   -10.749 1.00 1.97 ? 2   GLU A OE2  1  
ATOM 29    H H    . GLU A 1 2  ? -7.396  3.379   -8.707  1.00 1.40 ? 2   GLU A H    1  
ATOM 30    H HA   . GLU A 1 2  ? -4.661  3.117   -7.681  1.00 1.06 ? 2   GLU A HA   1  
ATOM 31    H HB2  . GLU A 1 2  ? -3.903  4.038   -9.768  1.00 1.76 ? 2   GLU A HB2  1  
ATOM 32    H HB3  . GLU A 1 2  ? -5.056  2.760   -10.114 1.00 1.34 ? 2   GLU A HB3  1  
ATOM 33    H HG2  . GLU A 1 2  ? -6.147  5.498   -9.939  1.00 2.14 ? 2   GLU A HG2  1  
ATOM 34    H HG3  . GLU A 1 2  ? -5.097  5.148   -11.309 1.00 2.47 ? 2   GLU A HG3  1  
ATOM 35    N N    . ILE A 1 3  ? -4.139  5.586   -7.237  1.00 1.09 ? 3   ILE A N    1  
ATOM 36    C CA   . ILE A 1 3  ? -3.950  6.915   -6.671  1.00 1.10 ? 3   ILE A CA   1  
ATOM 37    C C    . ILE A 1 3  ? -2.580  7.449   -7.086  1.00 1.02 ? 3   ILE A C    1  
ATOM 38    O O    . ILE A 1 3  ? -1.567  6.770   -6.894  1.00 1.07 ? 3   ILE A O    1  
ATOM 39    C CB   . ILE A 1 3  ? -4.032  6.887   -5.128  1.00 1.18 ? 3   ILE A CB   1  
ATOM 40    C CG1  . ILE A 1 3  ? -5.406  6.391   -4.663  1.00 1.34 ? 3   ILE A CG1  1  
ATOM 41    C CG2  . ILE A 1 3  ? -3.742  8.266   -4.560  1.00 1.22 ? 3   ILE A CG2  1  
ATOM 42    C CD1  . ILE A 1 3  ? -5.457  4.901   -4.406  1.00 1.10 ? 3   ILE A CD1  1  
ATOM 43    H H    . ILE A 1 3  ? -3.348  5.016   -7.319  1.00 1.08 ? 3   ILE A H    1  
ATOM 44    H HA   . ILE A 1 3  ? -4.723  7.566   -7.054  1.00 1.15 ? 3   ILE A HA   1  
ATOM 45    H HB   . ILE A 1 3  ? -3.273  6.212   -4.764  1.00 1.17 ? 3   ILE A HB   1  
ATOM 46    H HG12 . ILE A 1 3  ? -5.670  6.893   -3.745  1.00 1.83 ? 3   ILE A HG12 1  
ATOM 47    H HG13 . ILE A 1 3  ? -6.142  6.624   -5.418  1.00 1.86 ? 3   ILE A HG13 1  
ATOM 48    H HG21 . ILE A 1 3  ? -4.375  8.995   -5.042  1.00 1.72 ? 3   ILE A HG21 1  
ATOM 49    H HG22 . ILE A 1 3  ? -2.707  8.515   -4.739  1.00 1.51 ? 3   ILE A HG22 1  
ATOM 50    H HG23 . ILE A 1 3  ? -3.934  8.267   -3.498  1.00 1.55 ? 3   ILE A HG23 1  
ATOM 51    H HD11 . ILE A 1 3  ? -4.573  4.434   -4.816  1.00 1.47 ? 3   ILE A HD11 1  
ATOM 52    H HD12 . ILE A 1 3  ? -6.335  4.484   -4.876  1.00 1.61 ? 3   ILE A HD12 1  
ATOM 53    H HD13 . ILE A 1 3  ? -5.499  4.721   -3.342  1.00 1.54 ? 3   ILE A HD13 1  
ATOM 54    N N    . LYS A 1 4  ? -2.540  8.651   -7.665  1.00 0.98 ? 4   LYS A N    1  
ATOM 55    C CA   . LYS A 1 4  ? -1.271  9.227   -8.103  1.00 0.96 ? 4   LYS A CA   1  
ATOM 56    C C    . LYS A 1 4  ? -0.676  10.142  -7.031  1.00 0.96 ? 4   LYS A C    1  
ATOM 57    O O    . LYS A 1 4  ? -0.972  11.337  -6.974  1.00 1.08 ? 4   LYS A O    1  
ATOM 58    C CB   . LYS A 1 4  ? -1.464  9.991   -9.415  1.00 1.07 ? 4   LYS A CB   1  
ATOM 59    C CG   . LYS A 1 4  ? -1.602  9.087   -10.630 1.00 1.35 ? 4   LYS A CG   1  
ATOM 60    C CD   . LYS A 1 4  ? -2.239  9.818   -11.803 1.00 1.59 ? 4   LYS A CD   1  
ATOM 61    C CE   . LYS A 1 4  ? -3.679  9.379   -12.020 1.00 2.29 ? 4   LYS A CE   1  
ATOM 62    N NZ   . LYS A 1 4  ? -4.024  9.296   -13.467 1.00 2.93 ? 4   LYS A NZ   1  
ATOM 63    H H    . LYS A 1 4  ? -3.368  9.156   -7.806  1.00 1.01 ? 4   LYS A H    1  
ATOM 64    H HA   . LYS A 1 4  ? -0.585  8.411   -8.276  1.00 0.96 ? 4   LYS A HA   1  
ATOM 65    H HB2  . LYS A 1 4  ? -2.356  10.595  -9.339  1.00 1.56 ? 4   LYS A HB2  1  
ATOM 66    H HB3  . LYS A 1 4  ? -0.615  10.639  -9.572  1.00 1.61 ? 4   LYS A HB3  1  
ATOM 67    H HG2  . LYS A 1 4  ? -0.622  8.743   -10.924 1.00 1.93 ? 4   LYS A HG2  1  
ATOM 68    H HG3  . LYS A 1 4  ? -2.218  8.239   -10.367 1.00 1.87 ? 4   LYS A HG3  1  
ATOM 69    H HD2  . LYS A 1 4  ? -2.222  10.878  -11.606 1.00 1.98 ? 4   LYS A HD2  1  
ATOM 70    H HD3  . LYS A 1 4  ? -1.668  9.607   -12.696 1.00 1.90 ? 4   LYS A HD3  1  
ATOM 71    H HE2  . LYS A 1 4  ? -3.819  8.406   -11.571 1.00 2.72 ? 4   LYS A HE2  1  
ATOM 72    H HE3  . LYS A 1 4  ? -4.335  10.093  -11.543 1.00 2.70 ? 4   LYS A HE3  1  
ATOM 73    H HZ1  . LYS A 1 4  ? -5.027  9.045   -13.581 1.00 3.17 ? 4   LYS A HZ1  1  
ATOM 74    H HZ2  . LYS A 1 4  ? -3.441  8.571   -13.933 1.00 3.54 ? 4   LYS A HZ2  1  
ATOM 75    H HZ3  . LYS A 1 4  ? -3.853  10.212  -13.929 1.00 3.06 ? 4   LYS A HZ3  1  
ATOM 76    N N    . LEU A 1 5  ? 0.155   9.549   -6.177  1.00 0.89 ? 5   LEU A N    1  
ATOM 77    C CA   . LEU A 1 5  ? 0.797   10.281  -5.087  1.00 0.97 ? 5   LEU A CA   1  
ATOM 78    C C    . LEU A 1 5  ? 2.136   10.870  -5.528  1.00 0.88 ? 5   LEU A C    1  
ATOM 79    O O    . LEU A 1 5  ? 2.967   10.178  -6.117  1.00 0.82 ? 5   LEU A O    1  
ATOM 80    C CB   . LEU A 1 5  ? 0.994   9.371   -3.871  1.00 1.11 ? 5   LEU A CB   1  
ATOM 81    C CG   . LEU A 1 5  ? 0.062   9.659   -2.690  1.00 1.42 ? 5   LEU A CG   1  
ATOM 82    C CD1  . LEU A 1 5  ? 0.201   8.582   -1.625  1.00 1.50 ? 5   LEU A CD1  1  
ATOM 83    C CD2  . LEU A 1 5  ? 0.353   11.032  -2.101  1.00 2.09 ? 5   LEU A CD2  1  
ATOM 84    H H    . LEU A 1 5  ? 0.300   8.584   -6.280  1.00 0.85 ? 5   LEU A H    1  
ATOM 85    H HA   . LEU A 1 5  ? 0.140   11.093  -4.810  1.00 1.10 ? 5   LEU A HA   1  
ATOM 86    H HB2  . LEU A 1 5  ? 0.840   8.348   -4.184  1.00 1.26 ? 5   LEU A HB2  1  
ATOM 87    H HB3  . LEU A 1 5  ? 2.012   9.475   -3.530  1.00 1.25 ? 5   LEU A HB3  1  
ATOM 88    H HG   . LEU A 1 5  ? -0.961  9.654   -3.037  1.00 1.86 ? 5   LEU A HG   1  
ATOM 89    H HD11 . LEU A 1 5  ? -0.302  8.899   -0.724  1.00 1.87 ? 5   LEU A HD11 1  
ATOM 90    H HD12 . LEU A 1 5  ? 1.248   8.417   -1.415  1.00 2.01 ? 5   LEU A HD12 1  
ATOM 91    H HD13 . LEU A 1 5  ? -0.243  7.664   -1.982  1.00 1.76 ? 5   LEU A HD13 1  
ATOM 92    H HD21 . LEU A 1 5  ? 1.414   11.127  -1.917  1.00 2.37 ? 5   LEU A HD21 1  
ATOM 93    H HD22 . LEU A 1 5  ? -0.185  11.148  -1.173  1.00 2.53 ? 5   LEU A HD22 1  
ATOM 94    H HD23 . LEU A 1 5  ? 0.040   11.796  -2.797  1.00 2.63 ? 5   LEU A HD23 1  
ATOM 95    N N    . ILE A 1 6  ? 2.331   12.160  -5.242  1.00 0.95 ? 6   ILE A N    1  
ATOM 96    C CA   . ILE A 1 6  ? 3.565   12.851  -5.611  1.00 0.90 ? 6   ILE A CA   1  
ATOM 97    C C    . ILE A 1 6  ? 4.614   12.733  -4.502  1.00 0.93 ? 6   ILE A C    1  
ATOM 98    O O    . ILE A 1 6  ? 4.346   13.060  -3.343  1.00 1.06 ? 6   ILE A O    1  
ATOM 99    C CB   . ILE A 1 6  ? 3.313   14.348  -5.920  1.00 1.04 ? 6   ILE A CB   1  
ATOM 100   C CG1  . ILE A 1 6  ? 4.588   14.999  -6.468  1.00 1.29 ? 6   ILE A CG1  1  
ATOM 101   C CG2  . ILE A 1 6  ? 2.824   15.087  -4.680  1.00 1.21 ? 6   ILE A CG2  1  
ATOM 102   C CD1  . ILE A 1 6  ? 4.394   16.430  -6.923  1.00 1.94 ? 6   ILE A CD1  1  
ATOM 103   H H    . ILE A 1 6  ? 1.623   12.656  -4.781  1.00 1.06 ? 6   ILE A H    1  
ATOM 104   H HA   . ILE A 1 6  ? 3.948   12.385  -6.507  1.00 0.86 ? 6   ILE A HA   1  
ATOM 105   H HB   . ILE A 1 6  ? 2.539   14.409  -6.670  1.00 1.27 ? 6   ILE A HB   1  
ATOM 106   H HG12 . ILE A 1 6  ? 5.344   14.998  -5.697  1.00 1.47 ? 6   ILE A HG12 1  
ATOM 107   H HG13 . ILE A 1 6  ? 4.942   14.427  -7.313  1.00 1.34 ? 6   ILE A HG13 1  
ATOM 108   H HG21 . ILE A 1 6  ? 3.665   15.319  -4.045  1.00 1.62 ? 6   ILE A HG21 1  
ATOM 109   H HG22 . ILE A 1 6  ? 2.125   14.465  -4.140  1.00 1.62 ? 6   ILE A HG22 1  
ATOM 110   H HG23 . ILE A 1 6  ? 2.334   16.003  -4.978  1.00 1.45 ? 6   ILE A HG23 1  
ATOM 111   H HD11 . ILE A 1 6  ? 3.361   16.584  -7.198  1.00 2.44 ? 6   ILE A HD11 1  
ATOM 112   H HD12 . ILE A 1 6  ? 5.026   16.626  -7.775  1.00 2.21 ? 6   ILE A HD12 1  
ATOM 113   H HD13 . ILE A 1 6  ? 4.656   17.102  -6.119  1.00 2.30 ? 6   ILE A HD13 1  
ATOM 114   N N    . LYS A 1 7  ? 5.802   12.249  -4.865  1.00 0.91 ? 7   LYS A N    1  
ATOM 115   C CA   . LYS A 1 7  ? 6.891   12.071  -3.904  1.00 1.06 ? 7   LYS A CA   1  
ATOM 116   C C    . LYS A 1 7  ? 7.307   13.399  -3.272  1.00 1.18 ? 7   LYS A C    1  
ATOM 117   O O    . LYS A 1 7  ? 7.751   14.317  -3.967  1.00 1.29 ? 7   LYS A O    1  
ATOM 118   C CB   . LYS A 1 7  ? 8.099   11.416  -4.581  1.00 1.26 ? 7   LYS A CB   1  
ATOM 119   C CG   . LYS A 1 7  ? 9.304   11.256  -3.663  1.00 1.78 ? 7   LYS A CG   1  
ATOM 120   C CD   . LYS A 1 7  ? 9.126   10.095  -2.700  1.00 2.30 ? 7   LYS A CD   1  
ATOM 121   C CE   . LYS A 1 7  ? 10.051  10.220  -1.499  1.00 2.50 ? 7   LYS A CE   1  
ATOM 122   N NZ   . LYS A 1 7  ? 9.726   9.223   -0.440  1.00 3.10 ? 7   LYS A NZ   1  
ATOM 123   H H    . LYS A 1 7  ? 5.945   11.991  -5.799  1.00 0.88 ? 7   LYS A H    1  
ATOM 124   H HA   . LYS A 1 7  ? 6.534   11.415  -3.125  1.00 1.12 ? 7   LYS A HA   1  
ATOM 125   H HB2  . LYS A 1 7  ? 7.812   10.438  -4.936  1.00 1.17 ? 7   LYS A HB2  1  
ATOM 126   H HB3  . LYS A 1 7  ? 8.395   12.022  -5.422  1.00 1.45 ? 7   LYS A HB3  1  
ATOM 127   H HG2  . LYS A 1 7  ? 10.181  11.076  -4.265  1.00 2.05 ? 7   LYS A HG2  1  
ATOM 128   H HG3  . LYS A 1 7  ? 9.436   12.166  -3.097  1.00 2.37 ? 7   LYS A HG3  1  
ATOM 129   H HD2  . LYS A 1 7  ? 8.103   10.081  -2.352  1.00 2.80 ? 7   LYS A HD2  1  
ATOM 130   H HD3  . LYS A 1 7  ? 9.345   9.175   -3.218  1.00 2.70 ? 7   LYS A HD3  1  
ATOM 131   H HE2  . LYS A 1 7  ? 11.068  10.062  -1.827  1.00 3.04 ? 7   LYS A HE2  1  
ATOM 132   H HE3  . LYS A 1 7  ? 9.957   11.214  -1.088  1.00 2.26 ? 7   LYS A HE3  1  
ATOM 133   H HZ1  . LYS A 1 7  ? 9.934   8.262   -0.778  1.00 3.61 ? 7   LYS A HZ1  1  
ATOM 134   H HZ2  . LYS A 1 7  ? 8.718   9.283   -0.191  1.00 3.37 ? 7   LYS A HZ2  1  
ATOM 135   H HZ3  . LYS A 1 7  ? 10.292  9.409   0.411   1.00 3.30 ? 7   LYS A HZ3  1  
ATOM 136   N N    . GLY A 1 8  ? 7.166   13.484  -1.949  1.00 1.38 ? 8   GLY A N    1  
ATOM 137   C CA   . GLY A 1 8  ? 7.534   14.692  -1.229  1.00 1.62 ? 8   GLY A CA   1  
ATOM 138   C C    . GLY A 1 8  ? 8.809   14.519  -0.419  1.00 1.78 ? 8   GLY A C    1  
ATOM 139   O O    . GLY A 1 8  ? 9.244   13.389  -0.181  1.00 1.78 ? 8   GLY A O    1  
ATOM 140   H H    . GLY A 1 8  ? 6.809   12.714  -1.458  1.00 1.48 ? 8   GLY A H    1  
ATOM 141   H HA2  . GLY A 1 8  ? 7.676   15.493  -1.940  1.00 1.65 ? 8   GLY A HA2  1  
ATOM 142   H HA3  . GLY A 1 8  ? 6.729   14.958  -0.560  1.00 1.79 ? 8   GLY A HA3  1  
ATOM 143   N N    . PRO A 1 9  ? 9.435   15.627  0.024   1.00 2.05 ? 9   PRO A N    1  
ATOM 144   C CA   . PRO A 1 9  ? 10.673  15.581  0.820   1.00 2.32 ? 9   PRO A CA   1  
ATOM 145   C C    . PRO A 1 9  ? 10.538  14.695  2.059   1.00 2.37 ? 9   PRO A C    1  
ATOM 146   O O    . PRO A 1 9  ? 11.444  13.924  2.381   1.00 2.77 ? 9   PRO A O    1  
ATOM 147   C CB   . PRO A 1 9  ? 10.896  17.041  1.224   1.00 2.68 ? 9   PRO A CB   1  
ATOM 148   C CG   . PRO A 1 9  ? 10.180  17.833  0.185   1.00 2.59 ? 9   PRO A CG   1  
ATOM 149   C CD   . PRO A 1 9  ? 8.984   17.012  -0.208  1.00 2.24 ? 9   PRO A CD   1  
ATOM 150   H HA   . PRO A 1 9  ? 11.509  15.237  0.226   1.00 2.37 ? 9   PRO A HA   1  
ATOM 151   H HB2  . PRO A 1 9  ? 10.483  17.211  2.207   1.00 2.85 ? 9   PRO A HB2  1  
ATOM 152   H HB3  . PRO A 1 9  ? 11.952  17.259  1.227   1.00 2.89 ? 9   PRO A HB3  1  
ATOM 153   H HG2  . PRO A 1 9  ? 9.865   18.781  0.598   1.00 2.84 ? 9   PRO A HG2  1  
ATOM 154   H HG3  . PRO A 1 9  ? 10.824  17.990  -0.667  1.00 2.61 ? 9   PRO A HG3  1  
ATOM 155   H HD2  . PRO A 1 9  ? 8.138   17.253  0.417   1.00 2.35 ? 9   PRO A HD2  1  
ATOM 156   H HD3  . PRO A 1 9  ? 8.744   17.170  -1.249  1.00 2.14 ? 9   PRO A HD3  1  
ATOM 157   N N    . LYS A 1 10 ? 9.397   14.808  2.744   1.00 2.38 ? 10  LYS A N    1  
ATOM 158   C CA   . LYS A 1 10 ? 9.135   14.014  3.943   1.00 2.57 ? 10  LYS A CA   1  
ATOM 159   C C    . LYS A 1 10 ? 9.178   12.521  3.616   1.00 2.26 ? 10  LYS A C    1  
ATOM 160   O O    . LYS A 1 10 ? 10.085  11.810  4.054   1.00 2.45 ? 10  LYS A O    1  
ATOM 161   C CB   . LYS A 1 10 ? 7.781   14.389  4.555   1.00 2.99 ? 10  LYS A CB   1  
ATOM 162   C CG   . LYS A 1 10 ? 7.785   15.734  5.268   1.00 3.71 ? 10  LYS A CG   1  
ATOM 163   C CD   . LYS A 1 10 ? 7.686   15.572  6.779   1.00 4.04 ? 10  LYS A CD   1  
ATOM 164   C CE   . LYS A 1 10 ? 9.062   15.450  7.423   1.00 4.40 ? 10  LYS A CE   1  
ATOM 165   N NZ   . LYS A 1 10 ? 9.450   14.029  7.643   1.00 4.92 ? 10  LYS A NZ   1  
ATOM 166   H H    . LYS A 1 10 ? 8.719   15.442  2.426   1.00 2.55 ? 10  LYS A H    1  
ATOM 167   H HA   . LYS A 1 10 ? 9.916   14.233  4.658   1.00 2.82 ? 10  LYS A HA   1  
ATOM 168   H HB2  . LYS A 1 10 ? 7.041   14.425  3.768   1.00 3.13 ? 10  LYS A HB2  1  
ATOM 169   H HB3  . LYS A 1 10 ? 7.498   13.628  5.268   1.00 2.88 ? 10  LYS A HB3  1  
ATOM 170   H HG2  . LYS A 1 10 ? 8.702   16.253  5.032   1.00 3.97 ? 10  LYS A HG2  1  
ATOM 171   H HG3  . LYS A 1 10 ? 6.943   16.316  4.922   1.00 4.13 ? 10  LYS A HG3  1  
ATOM 172   H HD2  . LYS A 1 10 ? 7.184   16.434  7.193   1.00 4.48 ? 10  LYS A HD2  1  
ATOM 173   H HD3  . LYS A 1 10 ? 7.115   14.682  6.999   1.00 4.00 ? 10  LYS A HD3  1  
ATOM 174   H HE2  . LYS A 1 10 ? 9.791   15.916  6.777   1.00 4.59 ? 10  LYS A HE2  1  
ATOM 175   H HE3  . LYS A 1 10 ? 9.047   15.962  8.374   1.00 4.53 ? 10  LYS A HE3  1  
ATOM 176   H HZ1  . LYS A 1 10 ? 9.581   13.548  6.730   1.00 5.28 ? 10  LYS A HZ1  1  
ATOM 177   H HZ2  . LYS A 1 10 ? 8.710   13.534  8.181   1.00 5.13 ? 10  LYS A HZ2  1  
ATOM 178   H HZ3  . LYS A 1 10 ? 10.341  13.980  8.177   1.00 5.08 ? 10  LYS A HZ3  1  
ATOM 179   N N    . GLY A 1 11 ? 8.199   12.054  2.838   1.00 2.10 ? 11  GLY A N    1  
ATOM 180   C CA   . GLY A 1 11 ? 8.150   10.651  2.459   1.00 2.10 ? 11  GLY A CA   1  
ATOM 181   C C    . GLY A 1 11 ? 6.732   10.142  2.282   1.00 2.08 ? 11  GLY A C    1  
ATOM 182   O O    . GLY A 1 11 ? 5.871   10.854  1.757   1.00 2.30 ? 11  GLY A O    1  
ATOM 183   H H    . GLY A 1 11 ? 7.505   12.668  2.518   1.00 2.22 ? 11  GLY A H    1  
ATOM 184   H HA2  . GLY A 1 11 ? 8.683   10.524  1.528   1.00 2.53 ? 11  GLY A HA2  1  
ATOM 185   H HA3  . GLY A 1 11 ? 8.639   10.066  3.224   1.00 2.21 ? 11  GLY A HA3  1  
ATOM 186   N N    . LEU A 1 12 ? 6.487   8.909   2.723   1.00 2.47 ? 12  LEU A N    1  
ATOM 187   C CA   . LEU A 1 12 ? 5.161   8.302   2.617   1.00 2.77 ? 12  LEU A CA   1  
ATOM 188   C C    . LEU A 1 12 ? 4.279   8.742   3.785   1.00 1.92 ? 12  LEU A C    1  
ATOM 189   O O    . LEU A 1 12 ? 3.170   9.231   3.579   1.00 2.52 ? 12  LEU A O    1  
ATOM 190   C CB   . LEU A 1 12 ? 5.278   6.777   2.570   1.00 3.62 ? 12  LEU A CB   1  
ATOM 191   C CG   . LEU A 1 12 ? 5.772   6.211   1.234   1.00 4.87 ? 12  LEU A CG   1  
ATOM 192   C CD1  . LEU A 1 12 ? 7.292   6.158   1.204   1.00 5.33 ? 12  LEU A CD1  1  
ATOM 193   C CD2  . LEU A 1 12 ? 5.185   4.830   0.987   1.00 5.70 ? 12  LEU A CD2  1  
ATOM 194   H H    . LEU A 1 12 ? 7.214   8.396   3.135   1.00 2.84 ? 12  LEU A H    1  
ATOM 195   H HA   . LEU A 1 12 ? 4.714   8.649   1.696   1.00 3.41 ? 12  LEU A HA   1  
ATOM 196   H HB2  . LEU A 1 12 ? 5.962   6.466   3.344   1.00 3.58 ? 12  LEU A HB2  1  
ATOM 197   H HB3  . LEU A 1 12 ? 4.308   6.355   2.778   1.00 3.65 ? 12  LEU A HB3  1  
ATOM 198   H HG   . LEU A 1 12 ? 5.446   6.860   0.435   1.00 5.19 ? 12  LEU A HG   1  
ATOM 199   H HD11 . LEU A 1 12 ? 7.626   5.979   0.191   1.00 5.40 ? 12  LEU A HD11 1  
ATOM 200   H HD12 . LEU A 1 12 ? 7.638   5.361   1.842   1.00 5.57 ? 12  LEU A HD12 1  
ATOM 201   H HD13 . LEU A 1 12 ? 7.693   7.099   1.551   1.00 5.68 ? 12  LEU A HD13 1  
ATOM 202   H HD21 . LEU A 1 12 ? 4.900   4.386   1.929   1.00 6.03 ? 12  LEU A HD21 1  
ATOM 203   H HD22 . LEU A 1 12 ? 5.924   4.206   0.505   1.00 5.93 ? 12  LEU A HD22 1  
ATOM 204   H HD23 . LEU A 1 12 ? 4.318   4.917   0.351   1.00 6.06 ? 12  LEU A HD23 1  
ATOM 205   N N    . GLY A 1 13 ? 4.785   8.576   5.008   1.00 1.13 ? 13  GLY A N    1  
ATOM 206   C CA   . GLY A 1 13 ? 4.041   8.980   6.190   1.00 1.11 ? 13  GLY A CA   1  
ATOM 207   C C    . GLY A 1 13 ? 3.062   7.934   6.696   1.00 0.96 ? 13  GLY A C    1  
ATOM 208   O O    . GLY A 1 13 ? 2.020   8.286   7.245   1.00 1.03 ? 13  GLY A O    1  
ATOM 209   H H    . GLY A 1 13 ? 5.678   8.184   5.109   1.00 1.49 ? 13  GLY A H    1  
ATOM 210   H HA2  . GLY A 1 13 ? 4.746   9.196   6.980   1.00 1.58 ? 13  GLY A HA2  1  
ATOM 211   H HA3  . GLY A 1 13 ? 3.496   9.883   5.964   1.00 1.81 ? 13  GLY A HA3  1  
ATOM 212   N N    . PHE A 1 14 ? 3.389   6.654   6.519   1.00 0.81 ? 14  PHE A N    1  
ATOM 213   C CA   . PHE A 1 14 ? 2.522   5.566   6.979   1.00 0.71 ? 14  PHE A CA   1  
ATOM 214   C C    . PHE A 1 14 ? 3.307   4.255   7.085   1.00 0.56 ? 14  PHE A C    1  
ATOM 215   O O    . PHE A 1 14 ? 4.522   4.238   6.892   1.00 0.52 ? 14  PHE A O    1  
ATOM 216   C CB   . PHE A 1 14 ? 1.302   5.406   6.060   1.00 0.74 ? 14  PHE A CB   1  
ATOM 217   C CG   . PHE A 1 14 ? 1.635   5.118   4.624   1.00 0.63 ? 14  PHE A CG   1  
ATOM 218   C CD1  . PHE A 1 14 ? 2.003   3.843   4.223   1.00 1.27 ? 14  PHE A CD1  1  
ATOM 219   C CD2  . PHE A 1 14 ? 1.567   6.122   3.675   1.00 1.41 ? 14  PHE A CD2  1  
ATOM 220   C CE1  . PHE A 1 14 ? 2.299   3.578   2.902   1.00 1.33 ? 14  PHE A CE1  1  
ATOM 221   C CE2  . PHE A 1 14 ? 1.861   5.864   2.351   1.00 1.46 ? 14  PHE A CE2  1  
ATOM 222   C CZ   . PHE A 1 14 ? 2.228   4.590   1.963   1.00 0.83 ? 14  PHE A CZ   1  
ATOM 223   H H    . PHE A 1 14 ? 4.229   6.430   6.065   1.00 0.79 ? 14  PHE A H    1  
ATOM 224   H HA   . PHE A 1 14 ? 2.176   5.830   7.968   1.00 0.81 ? 14  PHE A HA   1  
ATOM 225   H HB2  . PHE A 1 14 ? 0.692   4.593   6.424   1.00 0.84 ? 14  PHE A HB2  1  
ATOM 226   H HB3  . PHE A 1 14 ? 0.723   6.318   6.089   1.00 0.89 ? 14  PHE A HB3  1  
ATOM 227   H HD1  . PHE A 1 14 ? 2.058   3.052   4.956   1.00 2.12 ? 14  PHE A HD1  1  
ATOM 228   H HD2  . PHE A 1 14 ? 1.281   7.120   3.977   1.00 2.28 ? 14  PHE A HD2  1  
ATOM 229   H HE1  . PHE A 1 14 ? 2.585   2.581   2.602   1.00 2.19 ? 14  PHE A HE1  1  
ATOM 230   H HE2  . PHE A 1 14 ? 1.803   6.656   1.620   1.00 2.33 ? 14  PHE A HE2  1  
ATOM 231   H HZ   . PHE A 1 14 ? 2.459   4.385   0.929   1.00 0.99 ? 14  PHE A HZ   1  
ATOM 232   N N    . SER A 1 15 ? 2.612   3.160   7.389   1.00 0.55 ? 15  SER A N    1  
ATOM 233   C CA   . SER A 1 15 ? 3.237   1.857   7.515   1.00 0.47 ? 15  SER A CA   1  
ATOM 234   C C    . SER A 1 15 ? 2.471   0.825   6.688   1.00 0.47 ? 15  SER A C    1  
ATOM 235   O O    . SER A 1 15 ? 1.400   1.120   6.154   1.00 0.52 ? 15  SER A O    1  
ATOM 236   C CB   . SER A 1 15 ? 3.264   1.436   8.981   1.00 0.50 ? 15  SER A CB   1  
ATOM 237   O OG   . SER A 1 15 ? 1.976   1.496   9.548   1.00 0.57 ? 15  SER A OG   1  
ATOM 238   H H    . SER A 1 15 ? 1.647   3.215   7.522   1.00 0.65 ? 15  SER A H    1  
ATOM 239   H HA   . SER A 1 15 ? 4.248   1.928   7.146   1.00 0.48 ? 15  SER A HA   1  
ATOM 240   H HB2  . SER A 1 15 ? 3.619   0.430   9.049   1.00 0.52 ? 15  SER A HB2  1  
ATOM 241   H HB3  . SER A 1 15 ? 3.915   2.091   9.539   1.00 0.54 ? 15  SER A HB3  1  
ATOM 242   H HG   . SER A 1 15 ? 1.733   2.414   9.673   1.00 1.10 ? 15  SER A HG   1  
ATOM 243   N N    . ILE A 1 16 ? 3.016   -0.384  6.593   1.00 0.44 ? 16  ILE A N    1  
ATOM 244   C CA   . ILE A 1 16 ? 2.376   -1.460  5.835   1.00 0.46 ? 16  ILE A CA   1  
ATOM 245   C C    . ILE A 1 16 ? 2.812   -2.829  6.354   1.00 0.46 ? 16  ILE A C    1  
ATOM 246   O O    . ILE A 1 16 ? 3.759   -2.937  7.131   1.00 0.45 ? 16  ILE A O    1  
ATOM 247   C CB   . ILE A 1 16 ? 2.712   -1.394  4.317   1.00 0.47 ? 16  ILE A CB   1  
ATOM 248   C CG1  . ILE A 1 16 ? 4.081   -2.023  4.011   1.00 0.67 ? 16  ILE A CG1  1  
ATOM 249   C CG2  . ILE A 1 16 ? 2.646   0.036   3.791   1.00 0.57 ? 16  ILE A CG2  1  
ATOM 250   C CD1  . ILE A 1 16 ? 5.254   -1.135  4.337   1.00 0.64 ? 16  ILE A CD1  1  
ATOM 251   H H    . ILE A 1 16 ? 3.864   -0.566  7.051   1.00 0.44 ? 16  ILE A H    1  
ATOM 252   H HA   . ILE A 1 16 ? 1.296   -1.362  5.946   1.00 0.49 ? 16  ILE A HA   1  
ATOM 253   H HB   . ILE A 1 16 ? 1.965   -1.961  3.801   1.00 0.59 ? 16  ILE A HB   1  
ATOM 254   H HG12 . ILE A 1 16 ? 4.190   -2.933  4.579   1.00 1.45 ? 16  ILE A HG12 1  
ATOM 255   H HG13 . ILE A 1 16 ? 4.130   -2.259  2.957   1.00 1.37 ? 16  ILE A HG13 1  
ATOM 256   H HG21 . ILE A 1 16 ? 3.350   0.653   4.332   1.00 1.32 ? 16  ILE A HG21 1  
ATOM 257   H HG22 . ILE A 1 16 ? 1.647   0.424   3.927   1.00 1.06 ? 16  ILE A HG22 1  
ATOM 258   H HG23 . ILE A 1 16 ? 2.894   0.044   2.741   1.00 1.09 ? 16  ILE A HG23 1  
ATOM 259   H HD11 . ILE A 1 16 ? 4.917   -0.315  4.953   1.00 1.34 ? 16  ILE A HD11 1  
ATOM 260   H HD12 . ILE A 1 16 ? 5.676   -0.748  3.420   1.00 1.24 ? 16  ILE A HD12 1  
ATOM 261   H HD13 . ILE A 1 16 ? 6.002   -1.706  4.868   1.00 1.38 ? 16  ILE A HD13 1  
ATOM 262   N N    . ALA A 1 17 ? 2.127   -3.862  5.880   1.00 0.51 ? 17  ALA A N    1  
ATOM 263   C CA   . ALA A 1 17 ? 2.427   -5.250  6.222   1.00 0.55 ? 17  ALA A CA   1  
ATOM 264   C C    . ALA A 1 17 ? 2.353   -6.070  4.933   1.00 0.73 ? 17  ALA A C    1  
ATOM 265   O O    . ALA A 1 17 ? 1.794   -5.590  3.951   1.00 1.19 ? 17  ALA A O    1  
ATOM 266   C CB   . ALA A 1 17 ? 1.468   -5.761  7.284   1.00 0.71 ? 17  ALA A CB   1  
ATOM 267   H H    . ALA A 1 17 ? 1.394   -3.692  5.250   1.00 0.55 ? 17  ALA A H    1  
ATOM 268   H HA   . ALA A 1 17 ? 3.432   -5.293  6.611   1.00 0.50 ? 17  ALA A HA   1  
ATOM 269   H HB1  . ALA A 1 17 ? 1.232   -6.797  7.091   1.00 1.21 ? 17  ALA A HB1  1  
ATOM 270   H HB2  . ALA A 1 17 ? 0.559   -5.174  7.264   1.00 1.22 ? 17  ALA A HB2  1  
ATOM 271   H HB3  . ALA A 1 17 ? 1.928   -5.673  8.257   1.00 1.33 ? 17  ALA A HB3  1  
ATOM 272   N N    . GLY A 1 18 ? 2.888   -7.291  4.902   1.00 0.60 ? 18  GLY A N    1  
ATOM 273   C CA   . GLY A 1 18 ? 2.779   -8.050  3.664   1.00 0.77 ? 18  GLY A CA   1  
ATOM 274   C C    . GLY A 1 18 ? 3.679   -9.263  3.553   1.00 0.85 ? 18  GLY A C    1  
ATOM 275   O O    . GLY A 1 18 ? 4.868   -9.164  3.833   1.00 1.29 ? 18  GLY A O    1  
ATOM 276   H H    . GLY A 1 18 ? 3.283   -7.676  5.711   1.00 0.67 ? 18  GLY A H    1  
ATOM 277   H HA2  . GLY A 1 18 ? 1.761   -8.377  3.560   1.00 0.96 ? 18  GLY A HA2  1  
ATOM 278   H HA3  . GLY A 1 18 ? 3.007   -7.386  2.846   1.00 1.37 ? 18  GLY A HA3  1  
ATOM 279   N N    . GLY A 1 19 ? 3.136   -10.398 3.100   1.00 1.01 ? 19  GLY A N    1  
ATOM 280   C CA   . GLY A 1 19 ? 3.958   -11.585 2.918   1.00 1.61 ? 19  GLY A CA   1  
ATOM 281   C C    . GLY A 1 19 ? 3.770   -12.630 3.993   1.00 0.89 ? 19  GLY A C    1  
ATOM 282   O O    . GLY A 1 19 ? 3.279   -12.330 5.076   1.00 0.76 ? 19  GLY A O    1  
ATOM 283   H H    . GLY A 1 19 ? 2.183   -10.447 2.875   1.00 1.01 ? 19  GLY A H    1  
ATOM 284   H HA2  . GLY A 1 19 ? 3.716   -12.027 1.964   1.00 2.30 ? 19  GLY A HA2  1  
ATOM 285   H HA3  . GLY A 1 19 ? 4.995   -11.285 2.905   1.00 2.32 ? 19  GLY A HA3  1  
ATOM 286   N N    . VAL A 1 20 ? 4.166   -13.865 3.683   1.00 0.97 ? 20  VAL A N    1  
ATOM 287   C CA   . VAL A 1 20 ? 4.051   -14.973 4.629   1.00 1.05 ? 20  VAL A CA   1  
ATOM 288   C C    . VAL A 1 20 ? 4.959   -14.736 5.841   1.00 1.18 ? 20  VAL A C    1  
ATOM 289   O O    . VAL A 1 20 ? 6.099   -14.288 5.692   1.00 1.35 ? 20  VAL A O    1  
ATOM 290   C CB   . VAL A 1 20 ? 4.416   -16.327 3.977   1.00 1.68 ? 20  VAL A CB   1  
ATOM 291   C CG1  . VAL A 1 20 ? 4.182   -17.474 4.950   1.00 1.76 ? 20  VAL A CG1  1  
ATOM 292   C CG2  . VAL A 1 20 ? 3.622   -16.544 2.695   1.00 2.72 ? 20  VAL A CG2  1  
ATOM 293   H H    . VAL A 1 20 ? 4.539   -14.027 2.789   1.00 1.38 ? 20  VAL A H    1  
ATOM 294   H HA   . VAL A 1 20 ? 3.021   -15.017 4.958   1.00 0.98 ? 20  VAL A HA   1  
ATOM 295   H HB   . VAL A 1 20 ? 5.467   -16.309 3.724   1.00 2.13 ? 20  VAL A HB   1  
ATOM 296   H HG11 . VAL A 1 20 ? 4.903   -17.418 5.754   1.00 2.30 ? 20  VAL A HG11 1  
ATOM 297   H HG12 . VAL A 1 20 ? 4.293   -18.414 4.432   1.00 1.97 ? 20  VAL A HG12 1  
ATOM 298   H HG13 . VAL A 1 20 ? 3.184   -17.404 5.357   1.00 2.15 ? 20  VAL A HG13 1  
ATOM 299   H HG21 . VAL A 1 20 ? 3.318   -15.590 2.292   1.00 3.33 ? 20  VAL A HG21 1  
ATOM 300   H HG22 . VAL A 1 20 ? 2.747   -17.140 2.910   1.00 3.14 ? 20  VAL A HG22 1  
ATOM 301   H HG23 . VAL A 1 20 ? 4.238   -17.059 1.973   1.00 3.02 ? 20  VAL A HG23 1  
ATOM 302   N N    . GLY A 1 21 ? 4.443   -15.024 7.040   1.00 1.30 ? 21  GLY A N    1  
ATOM 303   C CA   . GLY A 1 21 ? 5.219   -14.818 8.261   1.00 1.54 ? 21  GLY A CA   1  
ATOM 304   C C    . GLY A 1 21 ? 5.123   -13.390 8.790   1.00 1.24 ? 21  GLY A C    1  
ATOM 305   O O    . GLY A 1 21 ? 5.383   -13.139 9.967   1.00 1.56 ? 21  GLY A O    1  
ATOM 306   H H    . GLY A 1 21 ? 3.527   -15.370 7.095   1.00 1.35 ? 21  GLY A H    1  
ATOM 307   H HA2  . GLY A 1 21 ? 4.857   -15.495 9.020   1.00 1.90 ? 21  GLY A HA2  1  
ATOM 308   H HA3  . GLY A 1 21 ? 6.256   -15.044 8.057   1.00 1.72 ? 21  GLY A HA3  1  
ATOM 309   N N    . ASN A 1 22 ? 4.736   -12.462 7.913   1.00 0.73 ? 22  ASN A N    1  
ATOM 310   C CA   . ASN A 1 22 ? 4.578   -11.051 8.263   1.00 0.61 ? 22  ASN A CA   1  
ATOM 311   C C    . ASN A 1 22 ? 3.245   -10.504 7.723   1.00 0.65 ? 22  ASN A C    1  
ATOM 312   O O    . ASN A 1 22 ? 3.073   -9.289  7.596   1.00 0.67 ? 22  ASN A O    1  
ATOM 313   C CB   . ASN A 1 22 ? 5.750   -10.218 7.704   1.00 0.47 ? 22  ASN A CB   1  
ATOM 314   C CG   . ASN A 1 22 ? 6.341   -10.795 6.428   1.00 0.74 ? 22  ASN A CG   1  
ATOM 315   O OD1  . ASN A 1 22 ? 5.627   -11.078 5.472   1.00 1.27 ? 22  ASN A OD1  1  
ATOM 316   N ND2  . ASN A 1 22 ? 7.659   -10.974 6.414   1.00 1.63 ? 22  ASN A ND2  1  
ATOM 317   H H    . ASN A 1 22 ? 4.534   -12.739 7.001   1.00 0.63 ? 22  ASN A H    1  
ATOM 318   H HA   . ASN A 1 22 ? 4.575   -10.976 9.340   1.00 0.88 ? 22  ASN A HA   1  
ATOM 319   H HB2  . ASN A 1 22 ? 5.396   -9.222  7.490   1.00 0.82 ? 22  ASN A HB2  1  
ATOM 320   H HB3  . ASN A 1 22 ? 6.538   -10.157 8.440   1.00 0.63 ? 22  ASN A HB3  1  
ATOM 321   H HD21 . ASN A 1 22 ? 8.170   -10.728 7.212   1.00 2.15 ? 22  ASN A HD21 1  
ATOM 322   H HD22 . ASN A 1 22 ? 8.064   -11.343 5.601   1.00 1.98 ? 22  ASN A HD22 1  
ATOM 323   N N    . GLN A 1 23 ? 2.314   -11.410 7.378   1.00 0.77 ? 23  GLN A N    1  
ATOM 324   C CA   . GLN A 1 23 ? 1.009   -11.035 6.819   1.00 0.94 ? 23  GLN A CA   1  
ATOM 325   C C    . GLN A 1 23 ? 0.234   -10.060 7.702   1.00 0.88 ? 23  GLN A C    1  
ATOM 326   O O    . GLN A 1 23 ? 0.268   -10.149 8.930   1.00 0.87 ? 23  GLN A O    1  
ATOM 327   C CB   . GLN A 1 23 ? 0.148   -12.286 6.614   1.00 1.19 ? 23  GLN A CB   1  
ATOM 328   C CG   . GLN A 1 23 ? 0.581   -13.162 5.450   1.00 1.42 ? 23  GLN A CG   1  
ATOM 329   C CD   . GLN A 1 23 ? -0.369  -14.322 5.211   1.00 1.55 ? 23  GLN A CD   1  
ATOM 330   O OE1  . GLN A 1 23 ? -0.008  -15.482 5.406   1.00 1.62 ? 23  GLN A OE1  1  
ATOM 331   N NE2  . GLN A 1 23 ? -1.592  -14.015 4.789   1.00 2.34 ? 23  GLN A NE2  1  
ATOM 332   H H    . GLN A 1 23 ? 2.504   -12.367 7.468   1.00 0.79 ? 23  GLN A H    1  
ATOM 333   H HA   . GLN A 1 23 ? 1.183   -10.576 5.858   1.00 1.04 ? 23  GLN A HA   1  
ATOM 334   H HB2  . GLN A 1 23 ? 0.184   -12.883 7.514   1.00 1.46 ? 23  GLN A HB2  1  
ATOM 335   H HB3  . GLN A 1 23 ? -0.874  -11.979 6.442   1.00 1.49 ? 23  GLN A HB3  1  
ATOM 336   H HG2  . GLN A 1 23 ? 0.623   -12.559 4.556   1.00 1.80 ? 23  GLN A HG2  1  
ATOM 337   H HG3  . GLN A 1 23 ? 1.563   -13.560 5.663   1.00 1.68 ? 23  GLN A HG3  1  
ATOM 338   H HE21 . GLN A 1 23 ? -1.814  -13.069 4.657   1.00 2.92 ? 23  GLN A HE21 1  
ATOM 339   H HE22 . GLN A 1 23 ? -2.222  -14.747 4.624   1.00 2.51 ? 23  GLN A HE22 1  
ATOM 340   N N    . HIS A 1 24 ? -0.483  -9.144  7.050   1.00 0.86 ? 24  HIS A N    1  
ATOM 341   C CA   . HIS A 1 24 ? -1.303  -8.150  7.746   1.00 0.83 ? 24  HIS A CA   1  
ATOM 342   C C    . HIS A 1 24 ? -2.719  -8.675  7.978   1.00 0.84 ? 24  HIS A C    1  
ATOM 343   O O    . HIS A 1 24 ? -3.384  -8.288  8.941   1.00 0.92 ? 24  HIS A O    1  
ATOM 344   C CB   . HIS A 1 24 ? -1.400  -6.864  6.924   1.00 0.85 ? 24  HIS A CB   1  
ATOM 345   C CG   . HIS A 1 24 ? -2.071  -5.752  7.648   1.00 0.83 ? 24  HIS A CG   1  
ATOM 346   N ND1  . HIS A 1 24 ? -1.441  -4.987  8.597   1.00 0.90 ? 24  HIS A ND1  1  
ATOM 347   C CD2  . HIS A 1 24 ? -3.330  -5.276  7.550   1.00 0.81 ? 24  HIS A CD2  1  
ATOM 348   C CE1  . HIS A 1 24 ? -2.280  -4.084  9.053   1.00 0.88 ? 24  HIS A CE1  1  
ATOM 349   N NE2  . HIS A 1 24 ? -3.438  -4.234  8.435   1.00 0.82 ? 24  HIS A NE2  1  
ATOM 350   H H    . HIS A 1 24 ? -0.464  -9.134  6.069   1.00 0.90 ? 24  HIS A H    1  
ATOM 351   H HA   . HIS A 1 24 ? -0.841  -7.932  8.697   1.00 0.84 ? 24  HIS A HA   1  
ATOM 352   H HB2  . HIS A 1 24 ? -0.418  -6.534  6.647   1.00 0.91 ? 24  HIS A HB2  1  
ATOM 353   H HB3  . HIS A 1 24 ? -1.972  -7.056  6.032   1.00 0.87 ? 24  HIS A HB3  1  
ATOM 354   H HD1  . HIS A 1 24 ? -0.515  -5.095  8.898   1.00 0.98 ? 24  HIS A HD1  1  
ATOM 355   H HD2  . HIS A 1 24 ? -4.104  -5.652  6.894   1.00 0.82 ? 24  HIS A HD2  1  
ATOM 356   H HE1  . HIS A 1 24 ? -2.053  -3.346  9.795   1.00 0.95 ? 24  HIS A HE1  1  
ATOM 357   H HE2  . HIS A 1 24 ? -4.185  -3.602  8.480   1.00 0.82 ? 24  HIS A HE2  1  
ATOM 358   N N    . ILE A 1 25 ? -3.172  -9.548  7.081   1.00 0.80 ? 25  ILE A N    1  
ATOM 359   C CA   . ILE A 1 25 ? -4.508  -10.120 7.167   1.00 0.86 ? 25  ILE A CA   1  
ATOM 360   C C    . ILE A 1 25 ? -4.477  -11.618 6.862   1.00 0.81 ? 25  ILE A C    1  
ATOM 361   O O    . ILE A 1 25 ? -3.920  -12.037 5.846   1.00 0.80 ? 25  ILE A O    1  
ATOM 362   C CB   . ILE A 1 25 ? -5.475  -9.414  6.187   1.00 0.95 ? 25  ILE A CB   1  
ATOM 363   C CG1  . ILE A 1 25 ? -5.395  -7.890  6.349   1.00 1.01 ? 25  ILE A CG1  1  
ATOM 364   C CG2  . ILE A 1 25 ? -6.903  -9.894  6.399   1.00 1.51 ? 25  ILE A CG2  1  
ATOM 365   C CD1  . ILE A 1 25 ? -5.997  -7.377  7.642   1.00 1.16 ? 25  ILE A CD1  1  
ATOM 366   H H    . ILE A 1 25 ? -2.583  -9.813  6.344   1.00 0.77 ? 25  ILE A H    1  
ATOM 367   H HA   . ILE A 1 25 ? -4.872  -9.971  8.173   1.00 0.92 ? 25  ILE A HA   1  
ATOM 368   H HB   . ILE A 1 25 ? -5.182  -9.674  5.182   1.00 1.28 ? 25  ILE A HB   1  
ATOM 369   H HG12 . ILE A 1 25 ? -4.360  -7.587  6.325   1.00 1.40 ? 25  ILE A HG12 1  
ATOM 370   H HG13 . ILE A 1 25 ? -5.919  -7.421  5.529   1.00 1.51 ? 25  ILE A HG13 1  
ATOM 371   H HG21 . ILE A 1 25 ? -7.014  -10.887 5.989   1.00 1.96 ? 25  ILE A HG21 1  
ATOM 372   H HG22 . ILE A 1 25 ? -7.584  -9.219  5.903   1.00 1.82 ? 25  ILE A HG22 1  
ATOM 373   H HG23 . ILE A 1 25 ? -7.121  -9.913  7.456   1.00 1.95 ? 25  ILE A HG23 1  
ATOM 374   H HD11 . ILE A 1 25 ? -6.305  -8.212  8.253   1.00 1.53 ? 25  ILE A HD11 1  
ATOM 375   H HD12 . ILE A 1 25 ? -6.855  -6.760  7.419   1.00 1.45 ? 25  ILE A HD12 1  
ATOM 376   H HD13 . ILE A 1 25 ? -5.262  -6.793  8.175   1.00 1.78 ? 25  ILE A HD13 1  
ATOM 377   N N    . PRO A 1 26 ? -5.074  -12.449 7.742   1.00 0.82 ? 26  PRO A N    1  
ATOM 378   C CA   . PRO A 1 26 ? -5.108  -13.905 7.557   1.00 0.82 ? 26  PRO A CA   1  
ATOM 379   C C    . PRO A 1 26 ? -5.755  -14.305 6.233   1.00 0.86 ? 26  PRO A C    1  
ATOM 380   O O    . PRO A 1 26 ? -6.886  -13.911 5.939   1.00 0.95 ? 26  PRO A O    1  
ATOM 381   C CB   . PRO A 1 26 ? -5.941  -14.412 8.742   1.00 0.88 ? 26  PRO A CB   1  
ATOM 382   C CG   . PRO A 1 26 ? -6.653  -13.211 9.268   1.00 0.98 ? 26  PRO A CG   1  
ATOM 383   C CD   . PRO A 1 26 ? -5.758  -12.041 8.979   1.00 0.87 ? 26  PRO A CD   1  
ATOM 384   H HA   . PRO A 1 26 ? -4.114  -14.329 7.608   1.00 0.79 ? 26  PRO A HA   1  
ATOM 385   H HB2  . PRO A 1 26 ? -6.638  -15.163 8.398   1.00 1.04 ? 26  PRO A HB2  1  
ATOM 386   H HB3  . PRO A 1 26 ? -5.287  -14.837 9.487   1.00 0.96 ? 26  PRO A HB3  1  
ATOM 387   H HG2  . PRO A 1 26 ? -7.598  -13.093 8.761   1.00 1.27 ? 26  PRO A HG2  1  
ATOM 388   H HG3  . PRO A 1 26 ? -6.806  -13.311 10.333  1.00 1.26 ? 26  PRO A HG3  1  
ATOM 389   H HD2  . PRO A 1 26 ? -6.345  -11.147 8.822   1.00 0.94 ? 26  PRO A HD2  1  
ATOM 390   H HD3  . PRO A 1 26 ? -5.051  -11.896 9.783   1.00 0.95 ? 26  PRO A HD3  1  
ATOM 391   N N    . GLY A 1 27 ? -5.025  -15.089 5.436   1.00 0.85 ? 27  GLY A N    1  
ATOM 392   C CA   . GLY A 1 27 ? -5.535  -15.533 4.148   1.00 0.94 ? 27  GLY A CA   1  
ATOM 393   C C    . GLY A 1 27 ? -5.148  -14.616 2.995   1.00 0.92 ? 27  GLY A C    1  
ATOM 394   O O    . GLY A 1 27 ? -5.324  -14.983 1.833   1.00 1.06 ? 27  GLY A O    1  
ATOM 395   H H    . GLY A 1 27 ? -4.132  -15.370 5.727   1.00 0.81 ? 27  GLY A H    1  
ATOM 396   H HA2  . GLY A 1 27 ? -5.149  -16.521 3.947   1.00 1.04 ? 27  GLY A HA2  1  
ATOM 397   H HA3  . GLY A 1 27 ? -6.612  -15.588 4.203   1.00 1.00 ? 27  GLY A HA3  1  
ATOM 398   N N    . ASP A 1 28 ? -4.620  -13.426 3.306   1.00 0.80 ? 28  ASP A N    1  
ATOM 399   C CA   . ASP A 1 28 ? -4.212  -12.473 2.275   1.00 0.80 ? 28  ASP A CA   1  
ATOM 400   C C    . ASP A 1 28 ? -2.793  -11.968 2.540   1.00 0.65 ? 28  ASP A C    1  
ATOM 401   O O    . ASP A 1 28 ? -2.558  -11.228 3.499   1.00 0.57 ? 28  ASP A O    1  
ATOM 402   C CB   . ASP A 1 28 ? -5.188  -11.293 2.229   1.00 0.91 ? 28  ASP A CB   1  
ATOM 403   C CG   . ASP A 1 28 ? -5.777  -11.078 0.846   1.00 1.08 ? 28  ASP A CG   1  
ATOM 404   O OD1  . ASP A 1 28 ? -6.805  -11.716 0.533   1.00 1.48 ? 28  ASP A OD1  1  
ATOM 405   O OD2  . ASP A 1 28 ? -5.212  -10.269 0.080   1.00 1.68 ? 28  ASP A OD2  1  
ATOM 406   H H    . ASP A 1 28 ? -4.490  -13.176 4.243   1.00 0.76 ? 28  ASP A H    1  
ATOM 407   H HA   . ASP A 1 28 ? -4.228  -12.983 1.324   1.00 0.92 ? 28  ASP A HA   1  
ATOM 408   H HB2  . ASP A 1 28 ? -5.999  -11.476 2.918   1.00 1.05 ? 28  ASP A HB2  1  
ATOM 409   H HB3  . ASP A 1 28 ? -4.669  -10.391 2.523   1.00 0.85 ? 28  ASP A HB3  1  
ATOM 410   N N    . ASN A 1 29 ? -1.849  -12.376 1.689   1.00 0.69 ? 29  ASN A N    1  
ATOM 411   C CA   . ASN A 1 29 ? -0.449  -11.967 1.839   1.00 0.63 ? 29  ASN A CA   1  
ATOM 412   C C    . ASN A 1 29 ? -0.159  -10.643 1.114   1.00 0.59 ? 29  ASN A C    1  
ATOM 413   O O    . ASN A 1 29 ? 1.003   -10.310 0.869   1.00 0.65 ? 29  ASN A O    1  
ATOM 414   C CB   . ASN A 1 29 ? 0.492   -13.058 1.313   1.00 0.79 ? 29  ASN A CB   1  
ATOM 415   C CG   . ASN A 1 29 ? 0.028   -14.464 1.655   1.00 1.36 ? 29  ASN A CG   1  
ATOM 416   O OD1  . ASN A 1 29 ? -0.945  -14.964 1.087   1.00 2.11 ? 29  ASN A OD1  1  
ATOM 417   N ND2  . ASN A 1 29 ? 0.723   -15.111 2.584   1.00 1.98 ? 29  ASN A ND2  1  
ATOM 418   H H    . ASN A 1 29 ? -2.100  -12.969 0.950   1.00 0.80 ? 29  ASN A H    1  
ATOM 419   H HA   . ASN A 1 29 ? -0.260  -11.829 2.893   1.00 0.58 ? 29  ASN A HA   1  
ATOM 420   H HB2  . ASN A 1 29 ? 0.560   -12.975 0.239   1.00 1.38 ? 29  ASN A HB2  1  
ATOM 421   H HB3  . ASN A 1 29 ? 1.473   -12.910 1.743   1.00 1.03 ? 29  ASN A HB3  1  
ATOM 422   H HD21 . ASN A 1 29 ? 1.487   -14.655 2.993   1.00 2.27 ? 29  ASN A HD21 1  
ATOM 423   H HD22 . ASN A 1 29 ? 0.441   -16.018 2.823   1.00 2.54 ? 29  ASN A HD22 1  
ATOM 424   N N    . SER A 1 30 ? -1.211  -9.885  0.777   1.00 0.56 ? 30  SER A N    1  
ATOM 425   C CA   . SER A 1 30 ? -1.048  -8.601  0.092   1.00 0.56 ? 30  SER A CA   1  
ATOM 426   C C    . SER A 1 30 ? -0.432  -7.559  1.028   1.00 0.55 ? 30  SER A C    1  
ATOM 427   O O    . SER A 1 30 ? -0.140  -7.851  2.190   1.00 0.55 ? 30  SER A O    1  
ATOM 428   C CB   . SER A 1 30 ? -2.396  -8.105  -0.446  1.00 0.60 ? 30  SER A CB   1  
ATOM 429   O OG   . SER A 1 30 ? -2.943  -9.025  -1.375  1.00 1.39 ? 30  SER A OG   1  
ATOM 430   H H    . SER A 1 30 ? -2.113  -10.191 1.000   1.00 0.58 ? 30  SER A H    1  
ATOM 431   H HA   . SER A 1 30 ? -0.376  -8.757  -0.738  1.00 0.60 ? 30  SER A HA   1  
ATOM 432   H HB2  . SER A 1 30 ? -3.089  -7.987  0.373   1.00 1.26 ? 30  SER A HB2  1  
ATOM 433   H HB3  . SER A 1 30 ? -2.257  -7.154  -0.940  1.00 1.02 ? 30  SER A HB3  1  
ATOM 434   H HG   . SER A 1 30 ? -3.885  -9.124  -1.213  1.00 1.77 ? 30  SER A HG   1  
ATOM 435   N N    . ILE A 1 31 ? -0.239  -6.338  0.521   1.00 0.55 ? 31  ILE A N    1  
ATOM 436   C CA   . ILE A 1 31 ? 0.341   -5.269  1.333   1.00 0.55 ? 31  ILE A CA   1  
ATOM 437   C C    . ILE A 1 31 ? -0.741  -4.322  1.867   1.00 0.57 ? 31  ILE A C    1  
ATOM 438   O O    . ILE A 1 31 ? -1.346  -3.563  1.113   1.00 0.65 ? 31  ILE A O    1  
ATOM 439   C CB   . ILE A 1 31 ? 1.419   -4.466  0.561   1.00 0.53 ? 31  ILE A CB   1  
ATOM 440   C CG1  . ILE A 1 31 ? 2.445   -5.402  -0.099  1.00 0.62 ? 31  ILE A CG1  1  
ATOM 441   C CG2  . ILE A 1 31 ? 2.120   -3.485  1.490   1.00 0.60 ? 31  ILE A CG2  1  
ATOM 442   C CD1  . ILE A 1 31 ? 2.595   -6.752  0.573   1.00 0.80 ? 31  ILE A CD1  1  
ATOM 443   H H    . ILE A 1 31 ? -0.506  -6.162  -0.408  1.00 0.57 ? 31  ILE A H    1  
ATOM 444   H HA   . ILE A 1 31 ? 0.822   -5.737  2.176   1.00 0.54 ? 31  ILE A HA   1  
ATOM 445   H HB   . ILE A 1 31 ? 0.930   -3.895  -0.209  1.00 0.74 ? 31  ILE A HB   1  
ATOM 446   H HG12 . ILE A 1 31 ? 2.149   -5.577  -1.119  1.00 1.20 ? 31  ILE A HG12 1  
ATOM 447   H HG13 . ILE A 1 31 ? 3.411   -4.918  -0.092  1.00 1.19 ? 31  ILE A HG13 1  
ATOM 448   H HG21 . ILE A 1 31 ? 2.901   -2.971  0.949   1.00 1.13 ? 31  ILE A HG21 1  
ATOM 449   H HG22 . ILE A 1 31 ? 2.552   -4.021  2.321   1.00 1.21 ? 31  ILE A HG22 1  
ATOM 450   H HG23 . ILE A 1 31 ? 1.405   -2.765  1.860   1.00 1.13 ? 31  ILE A HG23 1  
ATOM 451   H HD11 . ILE A 1 31 ? 1.993   -7.481  0.052   1.00 1.15 ? 31  ILE A HD11 1  
ATOM 452   H HD12 . ILE A 1 31 ? 2.265   -6.680  1.597   1.00 1.28 ? 31  ILE A HD12 1  
ATOM 453   H HD13 . ILE A 1 31 ? 3.631   -7.055  0.548   1.00 1.46 ? 31  ILE A HD13 1  
ATOM 454   N N    . TYR A 1 32 ? -0.976  -4.382  3.181   1.00 0.60 ? 32  TYR A N    1  
ATOM 455   C CA   . TYR A 1 32 ? -1.980  -3.543  3.836   1.00 0.62 ? 32  TYR A CA   1  
ATOM 456   C C    . TYR A 1 32 ? -1.331  -2.488  4.728   1.00 0.59 ? 32  TYR A C    1  
ATOM 457   O O    . TYR A 1 32 ? -0.312  -2.747  5.366   1.00 0.61 ? 32  TYR A O    1  
ATOM 458   C CB   . TYR A 1 32 ? -2.911  -4.399  4.696   1.00 0.69 ? 32  TYR A CB   1  
ATOM 459   C CG   . TYR A 1 32 ? -3.787  -5.362  3.927   1.00 0.71 ? 32  TYR A CG   1  
ATOM 460   C CD1  . TYR A 1 32 ? -3.238  -6.451  3.262   1.00 1.28 ? 32  TYR A CD1  1  
ATOM 461   C CD2  . TYR A 1 32 ? -5.166  -5.196  3.890   1.00 1.34 ? 32  TYR A CD2  1  
ATOM 462   C CE1  . TYR A 1 32 ? -4.037  -7.342  2.575   1.00 1.30 ? 32  TYR A CE1  1  
ATOM 463   C CE2  . TYR A 1 32 ? -5.974  -6.082  3.212   1.00 1.38 ? 32  TYR A CE2  1  
ATOM 464   C CZ   . TYR A 1 32 ? -5.406  -7.157  2.553   1.00 0.80 ? 32  TYR A CZ   1  
ATOM 465   O OH   . TYR A 1 32 ? -6.208  -8.048  1.876   1.00 0.86 ? 32  TYR A OH   1  
ATOM 466   H H    . TYR A 1 32 ? -0.453  -5.009  3.716   1.00 0.66 ? 32  TYR A H    1  
ATOM 467   H HA   . TYR A 1 32 ? -2.559  -3.050  3.072   1.00 0.64 ? 32  TYR A HA   1  
ATOM 468   H HB2  . TYR A 1 32 ? -2.312  -4.981  5.377   1.00 0.68 ? 32  TYR A HB2  1  
ATOM 469   H HB3  . TYR A 1 32 ? -3.556  -3.746  5.267   1.00 0.74 ? 32  TYR A HB3  1  
ATOM 470   H HD1  . TYR A 1 32 ? -2.170  -6.593  3.281   1.00 2.05 ? 32  TYR A HD1  1  
ATOM 471   H HD2  . TYR A 1 32 ? -5.608  -4.355  4.399   1.00 2.10 ? 32  TYR A HD2  1  
ATOM 472   H HE1  . TYR A 1 32 ? -3.587  -8.181  2.058   1.00 2.06 ? 32  TYR A HE1  1  
ATOM 473   H HE2  . TYR A 1 32 ? -7.045  -5.927  3.198   1.00 2.17 ? 32  TYR A HE2  1  
ATOM 474   H HH   . TYR A 1 32 ? -5.908  -8.126  0.968   1.00 1.32 ? 32  TYR A HH   1  
ATOM 475   N N    . VAL A 1 33 ? -1.953  -1.312  4.795   1.00 0.57 ? 33  VAL A N    1  
ATOM 476   C CA   . VAL A 1 33 ? -1.458  -0.227  5.640   1.00 0.55 ? 33  VAL A CA   1  
ATOM 477   C C    . VAL A 1 33 ? -1.873  -0.470  7.093   1.00 0.59 ? 33  VAL A C    1  
ATOM 478   O O    . VAL A 1 33 ? -3.049  -0.705  7.381   1.00 0.65 ? 33  VAL A O    1  
ATOM 479   C CB   . VAL A 1 33 ? -1.980  1.148   5.167   1.00 0.59 ? 33  VAL A CB   1  
ATOM 480   C CG1  . VAL A 1 33 ? -1.643  2.237   6.179   1.00 0.62 ? 33  VAL A CG1  1  
ATOM 481   C CG2  . VAL A 1 33 ? -1.406  1.488   3.799   1.00 0.56 ? 33  VAL A CG2  1  
ATOM 482   H H    . VAL A 1 33 ? -2.770  -1.182  4.288   1.00 0.61 ? 33  VAL A H    1  
ATOM 483   H HA   . VAL A 1 33 ? -0.379  -0.223  5.579   1.00 0.51 ? 33  VAL A HA   1  
ATOM 484   H HB   . VAL A 1 33 ? -3.055  1.092   5.078   1.00 0.67 ? 33  VAL A HB   1  
ATOM 485   H HG11 . VAL A 1 33 ? -0.738  1.972   6.706   1.00 1.13 ? 33  VAL A HG11 1  
ATOM 486   H HG12 . VAL A 1 33 ? -2.454  2.335   6.885   1.00 1.12 ? 33  VAL A HG12 1  
ATOM 487   H HG13 . VAL A 1 33 ? -1.498  3.176   5.664   1.00 1.21 ? 33  VAL A HG13 1  
ATOM 488   H HG21 . VAL A 1 33 ? -0.529  0.885   3.615   1.00 1.23 ? 33  VAL A HG21 1  
ATOM 489   H HG22 . VAL A 1 33 ? -1.136  2.534   3.770   1.00 0.96 ? 33  VAL A HG22 1  
ATOM 490   H HG23 . VAL A 1 33 ? -2.147  1.288   3.039   1.00 1.26 ? 33  VAL A HG23 1  
ATOM 491   N N    . THR A 1 34 ? -0.894  -0.456  7.998   1.00 0.62 ? 34  THR A N    1  
ATOM 492   C CA   . THR A 1 34 ? -1.149  -0.722  9.417   1.00 0.71 ? 34  THR A CA   1  
ATOM 493   C C    . THR A 1 34 ? -1.248  0.550   10.269  1.00 0.72 ? 34  THR A C    1  
ATOM 494   O O    . THR A 1 34 ? -1.875  0.534   11.329  1.00 0.84 ? 34  THR A O    1  
ATOM 495   C CB   . THR A 1 34 ? -0.053  -1.643  9.983   1.00 0.74 ? 34  THR A CB   1  
ATOM 496   O OG1  . THR A 1 34 ? 1.014   -0.888  10.534  1.00 1.39 ? 34  THR A OG1  1  
ATOM 497   C CG2  . THR A 1 34 ? 0.543   -2.583  8.954   1.00 1.29 ? 34  THR A CG2  1  
ATOM 498   H H    . THR A 1 34 ? 0.026   -0.298  7.696   1.00 0.62 ? 34  THR A H    1  
ATOM 499   H HA   . THR A 1 34 ? -2.092  -1.243  9.481   1.00 0.81 ? 34  THR A HA   1  
ATOM 500   H HB   . THR A 1 34 ? -0.480  -2.246  10.770  1.00 1.08 ? 34  THR A HB   1  
ATOM 501   H HG1  . THR A 1 34 ? 1.149   -1.144  11.450  1.00 1.62 ? 34  THR A HG1  1  
ATOM 502   H HG21 . THR A 1 34 ? -0.165  -2.739  8.154   1.00 1.65 ? 34  THR A HG21 1  
ATOM 503   H HG22 . THR A 1 34 ? 0.772   -3.528  9.421   1.00 1.98 ? 34  THR A HG22 1  
ATOM 504   H HG23 . THR A 1 34 ? 1.449   -2.150  8.554   1.00 1.56 ? 34  THR A HG23 1  
ATOM 505   N N    . LYS A 1 35 ? -0.607  1.637   9.832   1.00 0.65 ? 35  LYS A N    1  
ATOM 506   C CA   . LYS A 1 35 ? -0.616  2.884   10.602  1.00 0.71 ? 35  LYS A CA   1  
ATOM 507   C C    . LYS A 1 35 ? -0.240  4.084   9.734   1.00 0.69 ? 35  LYS A C    1  
ATOM 508   O O    . LYS A 1 35 ? 0.858   4.132   9.179   1.00 0.62 ? 35  LYS A O    1  
ATOM 509   C CB   . LYS A 1 35 ? 0.379   2.765   11.765  1.00 0.72 ? 35  LYS A CB   1  
ATOM 510   C CG   . LYS A 1 35 ? 0.077   3.663   12.953  1.00 1.32 ? 35  LYS A CG   1  
ATOM 511   C CD   . LYS A 1 35 ? 0.112   5.136   12.577  1.00 1.46 ? 35  LYS A CD   1  
ATOM 512   C CE   . LYS A 1 35 ? 0.264   6.021   13.806  1.00 2.02 ? 35  LYS A CE   1  
ATOM 513   N NZ   . LYS A 1 35 ? 1.106   7.218   13.532  1.00 2.54 ? 35  LYS A NZ   1  
ATOM 514   H H    . LYS A 1 35 ? -0.101  1.593   8.994   1.00 0.59 ? 35  LYS A H    1  
ATOM 515   H HA   . LYS A 1 35 ? -1.608  3.030   10.999  1.00 0.80 ? 35  LYS A HA   1  
ATOM 516   H HB2  . LYS A 1 35 ? 0.384   1.744   12.112  1.00 0.98 ? 35  LYS A HB2  1  
ATOM 517   H HB3  . LYS A 1 35 ? 1.365   3.011   11.402  1.00 1.18 ? 35  LYS A HB3  1  
ATOM 518   H HG2  . LYS A 1 35 ? -0.900  3.422   13.335  1.00 1.91 ? 35  LYS A HG2  1  
ATOM 519   H HG3  . LYS A 1 35 ? 0.821   3.480   13.714  1.00 2.08 ? 35  LYS A HG3  1  
ATOM 520   H HD2  . LYS A 1 35 ? 0.948   5.310   11.916  1.00 1.89 ? 35  LYS A HD2  1  
ATOM 521   H HD3  . LYS A 1 35 ? -0.807  5.391   12.074  1.00 1.86 ? 35  LYS A HD3  1  
ATOM 522   H HE2  . LYS A 1 35 ? -0.715  6.348   14.121  1.00 2.47 ? 35  LYS A HE2  1  
ATOM 523   H HE3  . LYS A 1 35 ? 0.721   5.444   14.596  1.00 2.40 ? 35  LYS A HE3  1  
ATOM 524   H HZ1  . LYS A 1 35 ? 1.129   7.838   14.366  1.00 2.55 ? 35  LYS A HZ1  1  
ATOM 525   H HZ2  . LYS A 1 35 ? 0.719   7.751   12.727  1.00 2.90 ? 35  LYS A HZ2  1  
ATOM 526   H HZ3  . LYS A 1 35 ? 2.078   6.927   13.304  1.00 3.18 ? 35  LYS A HZ3  1  
ATOM 527   N N    . ILE A 1 36 ? -1.145  5.056   9.631   1.00 0.86 ? 36  ILE A N    1  
ATOM 528   C CA   . ILE A 1 36 ? -0.886  6.255   8.838   1.00 0.92 ? 36  ILE A CA   1  
ATOM 529   C C    . ILE A 1 36 ? -0.506  7.439   9.737   1.00 0.98 ? 36  ILE A C    1  
ATOM 530   O O    . ILE A 1 36 ? -1.250  7.799   10.652  1.00 1.06 ? 36  ILE A O    1  
ATOM 531   C CB   . ILE A 1 36 ? -2.102  6.640   7.967   1.00 1.03 ? 36  ILE A CB   1  
ATOM 532   C CG1  . ILE A 1 36 ? -2.488  5.470   7.052   1.00 1.40 ? 36  ILE A CG1  1  
ATOM 533   C CG2  . ILE A 1 36 ? -1.793  7.887   7.146   1.00 1.12 ? 36  ILE A CG2  1  
ATOM 534   C CD1  . ILE A 1 36 ? -3.386  5.863   5.897   1.00 1.35 ? 36  ILE A CD1  1  
ATOM 535   H H    . ILE A 1 36 ? -2.001  4.969   10.101  1.00 0.98 ? 36  ILE A H    1  
ATOM 536   H HA   . ILE A 1 36 ? -0.057  6.037   8.180   1.00 0.85 ? 36  ILE A HA   1  
ATOM 537   H HB   . ILE A 1 36 ? -2.930  6.865   8.621   1.00 0.95 ? 36  ILE A HB   1  
ATOM 538   H HG12 . ILE A 1 36 ? -1.591  5.037   6.637   1.00 1.63 ? 36  ILE A HG12 1  
ATOM 539   H HG13 . ILE A 1 36 ? -3.006  4.723   7.635   1.00 1.62 ? 36  ILE A HG13 1  
ATOM 540   H HG21 . ILE A 1 36 ? -2.691  8.221   6.647   1.00 1.46 ? 36  ILE A HG21 1  
ATOM 541   H HG22 . ILE A 1 36 ? -1.037  7.656   6.410   1.00 1.45 ? 36  ILE A HG22 1  
ATOM 542   H HG23 . ILE A 1 36 ? -1.433  8.669   7.799   1.00 1.44 ? 36  ILE A HG23 1  
ATOM 543   H HD11 . ILE A 1 36 ? -2.786  6.280   5.100   1.00 1.87 ? 36  ILE A HD11 1  
ATOM 544   H HD12 . ILE A 1 36 ? -4.102  6.599   6.231   1.00 1.71 ? 36  ILE A HD12 1  
ATOM 545   H HD13 . ILE A 1 36 ? -3.907  4.990   5.536   1.00 1.41 ? 36  ILE A HD13 1  
ATOM 546   N N    . ILE A 1 37 ? 0.654   8.038   9.463   1.00 1.03 ? 37  ILE A N    1  
ATOM 547   C CA   . ILE A 1 37 ? 1.144   9.182   10.232  1.00 1.10 ? 37  ILE A CA   1  
ATOM 548   C C    . ILE A 1 37 ? 0.456   10.473  9.779   1.00 1.10 ? 37  ILE A C    1  
ATOM 549   O O    . ILE A 1 37 ? 0.103   10.619  8.606   1.00 1.37 ? 37  ILE A O    1  
ATOM 550   C CB   . ILE A 1 37 ? 2.679   9.332   10.084  1.00 1.14 ? 37  ILE A CB   1  
ATOM 551   C CG1  . ILE A 1 37 ? 3.406   8.208   10.828  1.00 1.47 ? 37  ILE A CG1  1  
ATOM 552   C CG2  . ILE A 1 37 ? 3.148   10.686  10.593  1.00 1.32 ? 37  ILE A CG2  1  
ATOM 553   C CD1  . ILE A 1 37 ? 3.519   6.925   10.035  1.00 1.68 ? 37  ILE A CD1  1  
ATOM 554   H H    . ILE A 1 37 ? 1.199   7.705   8.720   1.00 1.06 ? 37  ILE A H    1  
ATOM 555   H HA   . ILE A 1 37 ? 0.915   9.009   11.273  1.00 1.17 ? 37  ILE A HA   1  
ATOM 556   H HB   . ILE A 1 37 ? 2.924   9.271   9.035   1.00 1.07 ? 37  ILE A HB   1  
ATOM 557   H HG12 . ILE A 1 37 ? 4.408   8.535   11.066  1.00 1.63 ? 37  ILE A HG12 1  
ATOM 558   H HG13 . ILE A 1 37 ? 2.878   7.989   11.744  1.00 1.84 ? 37  ILE A HG13 1  
ATOM 559   H HG21 . ILE A 1 37 ? 2.685   10.894  11.547  1.00 1.40 ? 37  ILE A HG21 1  
ATOM 560   H HG22 . ILE A 1 37 ? 2.871   11.451  9.884   1.00 1.79 ? 37  ILE A HG22 1  
ATOM 561   H HG23 . ILE A 1 37 ? 4.222   10.675  10.709  1.00 1.90 ? 37  ILE A HG23 1  
ATOM 562   H HD11 . ILE A 1 37 ? 2.558   6.431   10.012  1.00 2.18 ? 37  ILE A HD11 1  
ATOM 563   H HD12 . ILE A 1 37 ? 4.246   6.276   10.500  1.00 1.92 ? 37  ILE A HD12 1  
ATOM 564   H HD13 . ILE A 1 37 ? 3.832   7.152   9.027   1.00 1.93 ? 37  ILE A HD13 1  
ATOM 565   N N    . GLU A 1 38 ? 0.271   11.407  10.717  1.00 0.96 ? 38  GLU A N    1  
ATOM 566   C CA   . GLU A 1 38 ? -0.371  12.687  10.415  1.00 0.99 ? 38  GLU A CA   1  
ATOM 567   C C    . GLU A 1 38 ? 0.447   13.484  9.399   1.00 1.31 ? 38  GLU A C    1  
ATOM 568   O O    . GLU A 1 38 ? 1.675   13.384  9.361   1.00 1.64 ? 38  GLU A O    1  
ATOM 569   C CB   . GLU A 1 38 ? -0.562  13.507  11.695  1.00 1.23 ? 38  GLU A CB   1  
ATOM 570   C CG   . GLU A 1 38 ? -1.798  13.116  12.491  1.00 1.71 ? 38  GLU A CG   1  
ATOM 571   C CD   . GLU A 1 38 ? -1.513  12.032  13.514  1.00 2.41 ? 38  GLU A CD   1  
ATOM 572   O OE1  . GLU A 1 38 ? -1.533  10.840  13.139  1.00 3.11 ? 38  GLU A OE1  1  
ATOM 573   O OE2  . GLU A 1 38 ? -1.264  12.374  14.690  1.00 2.79 ? 38  GLU A OE2  1  
ATOM 574   H H    . GLU A 1 38 ? 0.576   11.231  11.632  1.00 0.97 ? 38  GLU A H    1  
ATOM 575   H HA   . GLU A 1 38 ? -1.340  12.476  9.988   1.00 1.23 ? 38  GLU A HA   1  
ATOM 576   H HB2  . GLU A 1 38 ? 0.303   13.375  12.327  1.00 1.66 ? 38  GLU A HB2  1  
ATOM 577   H HB3  . GLU A 1 38 ? -0.646  14.551  11.431  1.00 1.49 ? 38  GLU A HB3  1  
ATOM 578   H HG2  . GLU A 1 38 ? -2.169  13.988  13.009  1.00 2.01 ? 38  GLU A HG2  1  
ATOM 579   H HG3  . GLU A 1 38 ? -2.554  12.756  11.808  1.00 1.90 ? 38  GLU A HG3  1  
ATOM 580   N N    . GLY A 1 39 ? -0.248  14.277  8.581   1.00 1.69 ? 39  GLY A N    1  
ATOM 581   C CA   . GLY A 1 39 ? 0.414   15.088  7.570   1.00 2.36 ? 39  GLY A CA   1  
ATOM 582   C C    . GLY A 1 39 ? 1.225   14.276  6.564   1.00 2.68 ? 39  GLY A C    1  
ATOM 583   O O    . GLY A 1 39 ? 2.088   14.825  5.879   1.00 3.15 ? 39  GLY A O    1  
ATOM 584   H H    . GLY A 1 39 ? -1.221  14.320  8.671   1.00 1.72 ? 39  GLY A H    1  
ATOM 585   H HA2  . GLY A 1 39 ? -0.336  15.649  7.033   1.00 2.72 ? 39  GLY A HA2  1  
ATOM 586   H HA3  . GLY A 1 39 ? 1.074   15.784  8.066   1.00 2.45 ? 39  GLY A HA3  1  
ATOM 587   N N    . GLY A 1 40 ? 0.956   12.968  6.477   1.00 2.49 ? 40  GLY A N    1  
ATOM 588   C CA   . GLY A 1 40 ? 1.683   12.115  5.549   1.00 2.80 ? 40  GLY A CA   1  
ATOM 589   C C    . GLY A 1 40 ? 1.037   12.054  4.175   1.00 2.61 ? 40  GLY A C    1  
ATOM 590   O O    . GLY A 1 40 ? -0.092  12.508  3.996   1.00 2.37 ? 40  GLY A O    1  
ATOM 591   H H    . GLY A 1 40 ? 0.265   12.580  7.051   1.00 2.19 ? 40  GLY A H    1  
ATOM 592   H HA2  . GLY A 1 40 ? 2.690   12.491  5.444   1.00 3.27 ? 40  GLY A HA2  1  
ATOM 593   H HA3  . GLY A 1 40 ? 1.726   11.116  5.957   1.00 2.80 ? 40  GLY A HA3  1  
ATOM 594   N N    . ALA A 1 41 ? 1.761   11.495  3.203   1.00 2.83 ? 41  ALA A N    1  
ATOM 595   C CA   . ALA A 1 41 ? 1.265   11.370  1.829   1.00 2.70 ? 41  ALA A CA   1  
ATOM 596   C C    . ALA A 1 41 ? -0.148  10.787  1.789   1.00 2.11 ? 41  ALA A C    1  
ATOM 597   O O    . ALA A 1 41 ? -1.055  11.389  1.211   1.00 2.06 ? 41  ALA A O    1  
ATOM 598   C CB   . ALA A 1 41 ? 2.214   10.513  1.003   1.00 3.00 ? 41  ALA A CB   1  
ATOM 599   H H    . ALA A 1 41 ? 2.659   11.162  3.413   1.00 3.11 ? 41  ALA A H    1  
ATOM 600   H HA   . ALA A 1 41 ? 1.246   12.359  1.395   1.00 2.91 ? 41  ALA A HA   1  
ATOM 601   H HB1  . ALA A 1 41 ? 2.153   9.487   1.334   1.00 3.45 ? 41  ALA A HB1  1  
ATOM 602   H HB2  . ALA A 1 41 ? 3.225   10.872  1.128   1.00 3.26 ? 41  ALA A HB2  1  
ATOM 603   H HB3  . ALA A 1 41 ? 1.938   10.572  -0.040  1.00 2.99 ? 41  ALA A HB3  1  
ATOM 604   N N    . ALA A 1 42 ? -0.333  9.618   2.409   1.00 1.82 ? 42  ALA A N    1  
ATOM 605   C CA   . ALA A 1 42 ? -1.642  8.964   2.442   1.00 1.36 ? 42  ALA A CA   1  
ATOM 606   C C    . ALA A 1 42 ? -2.638  9.771   3.274   1.00 1.16 ? 42  ALA A C    1  
ATOM 607   O O    . ALA A 1 42 ? -3.745  10.060  2.819   1.00 1.02 ? 42  ALA A O    1  
ATOM 608   C CB   . ALA A 1 42 ? -1.514  7.550   2.991   1.00 1.50 ? 42  ALA A CB   1  
ATOM 609   H H    . ALA A 1 42 ? 0.425   9.189   2.858   1.00 2.06 ? 42  ALA A H    1  
ATOM 610   H HA   . ALA A 1 42 ? -2.007  8.899   1.428   1.00 1.30 ? 42  ALA A HA   1  
ATOM 611   H HB1  . ALA A 1 42 ? -1.024  6.924   2.261   1.00 1.77 ? 42  ALA A HB1  1  
ATOM 612   H HB2  . ALA A 1 42 ? -2.498  7.156   3.200   1.00 1.88 ? 42  ALA A HB2  1  
ATOM 613   H HB3  . ALA A 1 42 ? -0.933  7.567   3.900   1.00 1.93 ? 42  ALA A HB3  1  
ATOM 614   N N    . HIS A 1 43 ? -2.233  10.127  4.497   1.00 1.34 ? 43  HIS A N    1  
ATOM 615   C CA   . HIS A 1 43 ? -3.078  10.903  5.410   1.00 1.21 ? 43  HIS A CA   1  
ATOM 616   C C    . HIS A 1 43 ? -3.630  12.162  4.733   1.00 1.08 ? 43  HIS A C    1  
ATOM 617   O O    . HIS A 1 43 ? -4.818  12.468  4.852   1.00 1.15 ? 43  HIS A O    1  
ATOM 618   C CB   . HIS A 1 43 ? -2.275  11.289  6.656   1.00 1.39 ? 43  HIS A CB   1  
ATOM 619   C CG   . HIS A 1 43 ? -3.075  11.999  7.702   1.00 1.16 ? 43  HIS A CG   1  
ATOM 620   N ND1  . HIS A 1 43 ? -3.229  13.369  7.730   1.00 1.34 ? 43  HIS A ND1  1  
ATOM 621   C CD2  . HIS A 1 43 ? -3.757  11.523  8.770   1.00 1.15 ? 43  HIS A CD2  1  
ATOM 622   C CE1  . HIS A 1 43 ? -3.968  13.706  8.771   1.00 1.22 ? 43  HIS A CE1  1  
ATOM 623   N NE2  . HIS A 1 43 ? -4.302  12.604  9.417   1.00 1.28 ? 43  HIS A NE2  1  
ATOM 624   H H    . HIS A 1 43 ? -1.340  9.853   4.798   1.00 1.62 ? 43  HIS A H    1  
ATOM 625   H HA   . HIS A 1 43 ? -3.906  10.276  5.706   1.00 1.26 ? 43  HIS A HA   1  
ATOM 626   H HB2  . HIS A 1 43 ? -1.870  10.395  7.103   1.00 1.74 ? 43  HIS A HB2  1  
ATOM 627   H HB3  . HIS A 1 43 ? -1.462  11.936  6.362   1.00 1.58 ? 43  HIS A HB3  1  
ATOM 628   H HD1  . HIS A 1 43 ? -2.851  14.002  7.083   1.00 1.69 ? 43  HIS A HD1  1  
ATOM 629   H HD2  . HIS A 1 43 ? -3.855  10.485  9.056   1.00 1.32 ? 43  HIS A HD2  1  
ATOM 630   H HE1  . HIS A 1 43 ? -4.246  14.712  9.049   1.00 1.34 ? 43  HIS A HE1  1  
ATOM 631   H HE2  . HIS A 1 43 ? -4.912  12.561  10.184  1.00 1.60 ? 43  HIS A HE2  1  
ATOM 632   N N    . LYS A 1 44 ? -2.759  12.884  4.025   1.00 1.15 ? 44  LYS A N    1  
ATOM 633   C CA   . LYS A 1 44 ? -3.152  14.109  3.327   1.00 1.31 ? 44  LYS A CA   1  
ATOM 634   C C    . LYS A 1 44 ? -4.035  13.802  2.117   1.00 1.39 ? 44  LYS A C    1  
ATOM 635   O O    . LYS A 1 44 ? -4.990  14.528  1.839   1.00 1.46 ? 44  LYS A O    1  
ATOM 636   C CB   . LYS A 1 44 ? -1.912  14.890  2.880   1.00 1.74 ? 44  LYS A CB   1  
ATOM 637   C CG   . LYS A 1 44 ? -1.174  15.572  4.022   1.00 1.89 ? 44  LYS A CG   1  
ATOM 638   C CD   . LYS A 1 44 ? 0.177   16.107  3.572   1.00 2.36 ? 44  LYS A CD   1  
ATOM 639   C CE   . LYS A 1 44 ? 0.585   17.336  4.370   1.00 2.17 ? 44  LYS A CE   1  
ATOM 640   N NZ   . LYS A 1 44 ? 1.186   18.389  3.503   1.00 2.66 ? 44  LYS A NZ   1  
ATOM 641   H H    . LYS A 1 44 ? -1.828  12.583  3.968   1.00 1.26 ? 44  LYS A H    1  
ATOM 642   H HA   . LYS A 1 44 ? -3.715  14.718  4.020   1.00 1.30 ? 44  LYS A HA   1  
ATOM 643   H HB2  . LYS A 1 44 ? -1.228  14.208  2.396   1.00 2.10 ? 44  LYS A HB2  1  
ATOM 644   H HB3  . LYS A 1 44 ? -2.212  15.646  2.171   1.00 2.02 ? 44  LYS A HB3  1  
ATOM 645   H HG2  . LYS A 1 44 ? -1.775  16.394  4.385   1.00 1.94 ? 44  LYS A HG2  1  
ATOM 646   H HG3  . LYS A 1 44 ? -1.022  14.857  4.818   1.00 2.08 ? 44  LYS A HG3  1  
ATOM 647   H HD2  . LYS A 1 44 ? 0.921   15.337  3.710   1.00 2.71 ? 44  LYS A HD2  1  
ATOM 648   H HD3  . LYS A 1 44 ? 0.118   16.370  2.526   1.00 2.84 ? 44  LYS A HD3  1  
ATOM 649   H HE2  . LYS A 1 44 ? -0.289  17.741  4.858   1.00 2.08 ? 44  LYS A HE2  1  
ATOM 650   H HE3  . LYS A 1 44 ? 1.308   17.040  5.116   1.00 2.50 ? 44  LYS A HE3  1  
ATOM 651   H HZ1  . LYS A 1 44 ? 0.492   18.709  2.797   1.00 3.12 ? 44  LYS A HZ1  1  
ATOM 652   H HZ2  . LYS A 1 44 ? 2.020   18.012  3.009   1.00 3.21 ? 44  LYS A HZ2  1  
ATOM 653   H HZ3  . LYS A 1 44 ? 1.477   19.203  4.081   1.00 2.66 ? 44  LYS A HZ3  1  
ATOM 654   N N    . ASP A 1 45 ? -3.713  12.718  1.405   1.00 1.59 ? 45  ASP A N    1  
ATOM 655   C CA   . ASP A 1 45 ? -4.479  12.310  0.229   1.00 1.86 ? 45  ASP A CA   1  
ATOM 656   C C    . ASP A 1 45 ? -5.924  11.979  0.605   1.00 1.89 ? 45  ASP A C    1  
ATOM 657   O O    . ASP A 1 45 ? -6.864  12.476  -0.018  1.00 1.97 ? 45  ASP A O    1  
ATOM 658   C CB   . ASP A 1 45 ? -3.821  11.095  -0.436  1.00 2.33 ? 45  ASP A CB   1  
ATOM 659   C CG   . ASP A 1 45 ? -4.120  11.011  -1.921  1.00 2.69 ? 45  ASP A CG   1  
ATOM 660   O OD1  . ASP A 1 45 ? -5.263  10.655  -2.279  1.00 2.80 ? 45  ASP A OD1  1  
ATOM 661   O OD2  . ASP A 1 45 ? -3.210  11.300  -2.727  1.00 3.24 ? 45  ASP A OD2  1  
ATOM 662   H H    . ASP A 1 45 ? -2.942  12.178  1.682   1.00 1.67 ? 45  ASP A H    1  
ATOM 663   H HA   . ASP A 1 45 ? -4.479  13.134  -0.468  1.00 1.92 ? 45  ASP A HA   1  
ATOM 664   H HB2  . ASP A 1 45 ? -2.751  11.158  -0.309  1.00 2.40 ? 45  ASP A HB2  1  
ATOM 665   H HB3  . ASP A 1 45 ? -4.183  10.193  0.036   1.00 2.46 ? 45  ASP A HB3  1  
ATOM 666   N N    . GLY A 1 46 ? -6.088  11.137  1.628   1.00 2.08 ? 46  GLY A N    1  
ATOM 667   C CA   . GLY A 1 46 ? -7.416  10.750  2.078   1.00 2.49 ? 46  GLY A CA   1  
ATOM 668   C C    . GLY A 1 46 ? -7.926  9.480   1.413   1.00 2.11 ? 46  GLY A C    1  
ATOM 669   O O    . GLY A 1 46 ? -8.753  8.768   1.988   1.00 2.47 ? 46  GLY A O    1  
ATOM 670   H H    . GLY A 1 46 ? -5.295  10.780  2.079   1.00 2.09 ? 46  GLY A H    1  
ATOM 671   H HA2  . GLY A 1 46 ? -7.387  10.593  3.145   1.00 2.83 ? 46  GLY A HA2  1  
ATOM 672   H HA3  . GLY A 1 46 ? -8.104  11.554  1.865   1.00 3.17 ? 46  GLY A HA3  1  
ATOM 673   N N    . LYS A 1 47 ? -7.436  9.192   0.203   1.00 1.87 ? 47  LYS A N    1  
ATOM 674   C CA   . LYS A 1 47 ? -7.852  7.999   -0.533  1.00 2.32 ? 47  LYS A CA   1  
ATOM 675   C C    . LYS A 1 47 ? -7.416  6.722   0.188   1.00 1.93 ? 47  LYS A C    1  
ATOM 676   O O    . LYS A 1 47 ? -8.176  5.755   0.260   1.00 1.95 ? 47  LYS A O    1  
ATOM 677   C CB   . LYS A 1 47 ? -7.279  8.019   -1.955  1.00 2.80 ? 47  LYS A CB   1  
ATOM 678   C CG   . LYS A 1 47 ? -7.971  9.013   -2.875  1.00 3.64 ? 47  LYS A CG   1  
ATOM 679   C CD   . LYS A 1 47 ? -7.315  9.057   -4.248  1.00 4.17 ? 47  LYS A CD   1  
ATOM 680   C CE   . LYS A 1 47 ? -7.353  10.456  -4.846  1.00 5.03 ? 47  LYS A CE   1  
ATOM 681   N NZ   . LYS A 1 47 ? -8.635  10.727  -5.556  1.00 5.67 ? 47  LYS A NZ   1  
ATOM 682   H H    . LYS A 1 47 ? -6.778  9.794   -0.202  1.00 1.83 ? 47  LYS A H    1  
ATOM 683   H HA   . LYS A 1 47 ? -8.930  8.010   -0.592  1.00 3.00 ? 47  LYS A HA   1  
ATOM 684   H HB2  . LYS A 1 47 ? -6.231  8.274   -1.905  1.00 2.86 ? 47  LYS A HB2  1  
ATOM 685   H HB3  . LYS A 1 47 ? -7.381  7.033   -2.385  1.00 3.00 ? 47  LYS A HB3  1  
ATOM 686   H HG2  . LYS A 1 47 ? -9.004  8.722   -2.991  1.00 4.05 ? 47  LYS A HG2  1  
ATOM 687   H HG3  . LYS A 1 47 ? -7.921  9.996   -2.429  1.00 3.92 ? 47  LYS A HG3  1  
ATOM 688   H HD2  . LYS A 1 47 ? -6.285  8.748   -4.152  1.00 4.28 ? 47  LYS A HD2  1  
ATOM 689   H HD3  . LYS A 1 47 ? -7.838  8.379   -4.906  1.00 4.30 ? 47  LYS A HD3  1  
ATOM 690   H HE2  . LYS A 1 47 ? -7.233  11.178  -4.052  1.00 5.17 ? 47  LYS A HE2  1  
ATOM 691   H HE3  . LYS A 1 47 ? -6.537  10.555  -5.546  1.00 5.45 ? 47  LYS A HE3  1  
ATOM 692   H HZ1  . LYS A 1 47 ? -8.607  11.669  -5.995  1.00 5.78 ? 47  LYS A HZ1  1  
ATOM 693   H HZ2  . LYS A 1 47 ? -9.430  10.694  -4.885  1.00 5.80 ? 47  LYS A HZ2  1  
ATOM 694   H HZ3  . LYS A 1 47 ? -8.791  10.016  -6.297  1.00 6.21 ? 47  LYS A HZ3  1  
ATOM 695   N N    . LEU A 1 48 ? -6.191  6.724   0.721   1.00 1.68 ? 48  LEU A N    1  
ATOM 696   C CA   . LEU A 1 48 ? -5.666  5.563   1.433   1.00 1.38 ? 48  LEU A CA   1  
ATOM 697   C C    . LEU A 1 48 ? -6.045  5.602   2.913   1.00 1.28 ? 48  LEU A C    1  
ATOM 698   O O    . LEU A 1 48 ? -5.743  6.564   3.623   1.00 1.35 ? 48  LEU A O    1  
ATOM 699   C CB   . LEU A 1 48 ? -4.142  5.478   1.286   1.00 1.19 ? 48  LEU A CB   1  
ATOM 700   C CG   . LEU A 1 48 ? -3.550  4.072   1.450   1.00 1.09 ? 48  LEU A CG   1  
ATOM 701   C CD1  . LEU A 1 48 ? -2.196  3.974   0.765   1.00 1.56 ? 48  LEU A CD1  1  
ATOM 702   C CD2  . LEU A 1 48 ? -3.430  3.707   2.923   1.00 1.06 ? 48  LEU A CD2  1  
ATOM 703   H H    . LEU A 1 48 ? -5.630  7.525   0.632   1.00 1.80 ? 48  LEU A H    1  
ATOM 704   H HA   . LEU A 1 48 ? -6.106  4.683   0.989   1.00 1.52 ? 48  LEU A HA   1  
ATOM 705   H HB2  . LEU A 1 48 ? -3.877  5.844   0.304   1.00 1.43 ? 48  LEU A HB2  1  
ATOM 706   H HB3  . LEU A 1 48 ? -3.691  6.123   2.025   1.00 1.29 ? 48  LEU A HB3  1  
ATOM 707   H HG   . LEU A 1 48 ? -4.211  3.351   0.986   1.00 1.25 ? 48  LEU A HG   1  
ATOM 708   H HD11 . LEU A 1 48 ? -2.328  4.060   -0.304  1.00 2.04 ? 48  LEU A HD11 1  
ATOM 709   H HD12 . LEU A 1 48 ? -1.744  3.021   0.996   1.00 1.85 ? 48  LEU A HD12 1  
ATOM 710   H HD13 . LEU A 1 48 ? -1.556  4.770   1.114   1.00 2.03 ? 48  LEU A HD13 1  
ATOM 711   H HD21 . LEU A 1 48 ? -3.692  2.667   3.056   1.00 1.74 ? 48  LEU A HD21 1  
ATOM 712   H HD22 . LEU A 1 48 ? -4.098  4.320   3.504   1.00 1.43 ? 48  LEU A HD22 1  
ATOM 713   H HD23 . LEU A 1 48 ? -2.415  3.866   3.253   1.00 1.30 ? 48  LEU A HD23 1  
ATOM 714   N N    . GLN A 1 49 ? -6.702  4.536   3.363   1.00 1.21 ? 49  GLN A N    1  
ATOM 715   C CA   . GLN A 1 49 ? -7.130  4.403   4.748   1.00 1.17 ? 49  GLN A CA   1  
ATOM 716   C C    . GLN A 1 49 ? -6.843  2.989   5.253   1.00 1.09 ? 49  GLN A C    1  
ATOM 717   O O    . GLN A 1 49 ? -6.897  2.030   4.482   1.00 1.14 ? 49  GLN A O    1  
ATOM 718   C CB   . GLN A 1 49 ? -8.624  4.719   4.874   1.00 1.30 ? 49  GLN A CB   1  
ATOM 719   C CG   . GLN A 1 49 ? -9.545  3.642   4.312   1.00 1.46 ? 49  GLN A CG   1  
ATOM 720   C CD   . GLN A 1 49 ? -9.570  3.616   2.796   1.00 1.45 ? 49  GLN A CD   1  
ATOM 721   O OE1  . GLN A 1 49 ? -10.175 4.479   2.159   1.00 1.54 ? 49  GLN A OE1  1  
ATOM 722   N NE2  . GLN A 1 49 ? -8.912  2.622   2.209   1.00 1.52 ? 49  GLN A NE2  1  
ATOM 723   H H    . GLN A 1 49 ? -6.900  3.810   2.743   1.00 1.26 ? 49  GLN A H    1  
ATOM 724   H HA   . GLN A 1 49 ? -6.569  5.108   5.342   1.00 1.19 ? 49  GLN A HA   1  
ATOM 725   H HB2  . GLN A 1 49 ? -8.858  4.847   5.915   1.00 1.32 ? 49  GLN A HB2  1  
ATOM 726   H HB3  . GLN A 1 49 ? -8.829  5.643   4.354   1.00 1.34 ? 49  GLN A HB3  1  
ATOM 727   H HG2  . GLN A 1 49 ? -9.208  2.679   4.666   1.00 1.57 ? 49  GLN A HG2  1  
ATOM 728   H HG3  . GLN A 1 49 ? -10.547 3.822   4.671   1.00 1.59 ? 49  GLN A HG3  1  
ATOM 729   H HE21 . GLN A 1 49 ? -8.451  1.971   2.779   1.00 1.62 ? 49  GLN A HE21 1  
ATOM 730   H HE22 . GLN A 1 49 ? -8.910  2.583   1.230   1.00 1.56 ? 49  GLN A HE22 1  
ATOM 731   N N    . ILE A 1 50 ? -6.538  2.860   6.546   1.00 1.06 ? 50  ILE A N    1  
ATOM 732   C CA   . ILE A 1 50 ? -6.245  1.551   7.143   1.00 1.03 ? 50  ILE A CA   1  
ATOM 733   C C    . ILE A 1 50 ? -7.216  0.478   6.638   1.00 1.05 ? 50  ILE A C    1  
ATOM 734   O O    . ILE A 1 50 ? -8.417  0.729   6.514   1.00 1.16 ? 50  ILE A O    1  
ATOM 735   C CB   . ILE A 1 50 ? -6.306  1.598   8.687   1.00 1.08 ? 50  ILE A CB   1  
ATOM 736   C CG1  . ILE A 1 50 ? -7.586  2.295   9.163   1.00 1.76 ? 50  ILE A CG1  1  
ATOM 737   C CG2  . ILE A 1 50 ? -5.075  2.302   9.242   1.00 1.14 ? 50  ILE A CG2  1  
ATOM 738   C CD1  . ILE A 1 50 ? -8.313  1.548   10.261  1.00 2.56 ? 50  ILE A CD1  1  
ATOM 739   H H    . ILE A 1 50 ? -6.512  3.660   7.113   1.00 1.12 ? 50  ILE A H    1  
ATOM 740   H HA   . ILE A 1 50 ? -5.241  1.273   6.853   1.00 1.00 ? 50  ILE A HA   1  
ATOM 741   H HB   . ILE A 1 50 ? -6.299  0.582   9.054   1.00 1.51 ? 50  ILE A HB   1  
ATOM 742   H HG12 . ILE A 1 50 ? -7.338  3.275   9.541   1.00 1.94 ? 50  ILE A HG12 1  
ATOM 743   H HG13 . ILE A 1 50 ? -8.265  2.399   8.328   1.00 2.32 ? 50  ILE A HG13 1  
ATOM 744   H HG21 . ILE A 1 50 ? -4.203  1.687   9.077   1.00 1.55 ? 50  ILE A HG21 1  
ATOM 745   H HG22 . ILE A 1 50 ? -5.202  2.468   10.302  1.00 1.63 ? 50  ILE A HG22 1  
ATOM 746   H HG23 . ILE A 1 50 ? -4.946  3.251   8.743   1.00 1.57 ? 50  ILE A HG23 1  
ATOM 747   H HD11 . ILE A 1 50 ? -7.710  1.551   11.158  1.00 3.13 ? 50  ILE A HD11 1  
ATOM 748   H HD12 . ILE A 1 50 ? -8.488  0.529   9.949   1.00 2.96 ? 50  ILE A HD12 1  
ATOM 749   H HD13 . ILE A 1 50 ? -9.258  2.031   10.461  1.00 2.79 ? 50  ILE A HD13 1  
ATOM 750   N N    . GLY A 1 51 ? -6.692  -0.718  6.354   1.00 1.02 ? 51  GLY A N    1  
ATOM 751   C CA   . GLY A 1 51 ? -7.529  -1.809  5.873   1.00 1.10 ? 51  GLY A CA   1  
ATOM 752   C C    . GLY A 1 51 ? -7.398  -2.069  4.381   1.00 1.04 ? 51  GLY A C    1  
ATOM 753   O O    . GLY A 1 51 ? -7.713  -3.170  3.924   1.00 1.03 ? 51  GLY A O    1  
ATOM 754   H H    . GLY A 1 51 ? -5.733  -0.877  6.480   1.00 0.99 ? 51  GLY A H    1  
ATOM 755   H HA2  . GLY A 1 51 ? -7.254  -2.708  6.401   1.00 1.22 ? 51  GLY A HA2  1  
ATOM 756   H HA3  . GLY A 1 51 ? -8.559  -1.586  6.091   1.00 1.14 ? 51  GLY A HA3  1  
ATOM 757   N N    . ASP A 1 52 ? -6.937  -1.075  3.608   1.00 1.04 ? 52  ASP A N    1  
ATOM 758   C CA   . ASP A 1 52 ? -6.785  -1.252  2.174   1.00 1.01 ? 52  ASP A CA   1  
ATOM 759   C C    . ASP A 1 52 ? -5.616  -2.176  1.853   1.00 0.91 ? 52  ASP A C    1  
ATOM 760   O O    . ASP A 1 52 ? -4.642  -2.263  2.618   1.00 0.88 ? 52  ASP A O    1  
ATOM 761   C CB   . ASP A 1 52 ? -6.608  0.095   1.460   1.00 1.03 ? 52  ASP A CB   1  
ATOM 762   C CG   . ASP A 1 52 ? -5.622  1.033   2.132   1.00 1.11 ? 52  ASP A CG   1  
ATOM 763   O OD1  . ASP A 1 52 ? -4.654  0.554   2.764   1.00 1.55 ? 52  ASP A OD1  1  
ATOM 764   O OD2  . ASP A 1 52 ? -5.819  2.255   2.013   1.00 1.56 ? 52  ASP A OD2  1  
ATOM 765   H H    . ASP A 1 52 ? -6.693  -0.216  4.001   1.00 1.07 ? 52  ASP A H    1  
ATOM 766   H HA   . ASP A 1 52 ? -7.689  -1.712  1.818   1.00 1.08 ? 52  ASP A HA   1  
ATOM 767   H HB2  . ASP A 1 52 ? -6.261  -0.080  0.456   1.00 0.99 ? 52  ASP A HB2  1  
ATOM 768   H HB3  . ASP A 1 52 ? -7.566  0.589   1.422   1.00 1.18 ? 52  ASP A HB3  1  
ATOM 769   N N    . LYS A 1 53 ? -5.714  -2.852  0.708   1.00 0.88 ? 53  LYS A N    1  
ATOM 770   C CA   . LYS A 1 53 ? -4.667  -3.762  0.266   1.00 0.82 ? 53  LYS A CA   1  
ATOM 771   C C    . LYS A 1 53 ? -3.982  -3.230  -0.984  1.00 0.76 ? 53  LYS A C    1  
ATOM 772   O O    . LYS A 1 53 ? -4.588  -2.552  -1.805  1.00 0.87 ? 53  LYS A O    1  
ATOM 773   C CB   . LYS A 1 53 ? -5.236  -5.158  -0.006  1.00 0.94 ? 53  LYS A CB   1  
ATOM 774   C CG   . LYS A 1 53 ? -6.463  -5.168  -0.906  1.00 1.33 ? 53  LYS A CG   1  
ATOM 775   C CD   . LYS A 1 53 ? -7.567  -6.036  -0.326  1.00 1.83 ? 53  LYS A CD   1  
ATOM 776   C CE   . LYS A 1 53 ? -7.690  -7.354  -1.079  1.00 2.37 ? 53  LYS A CE   1  
ATOM 777   N NZ   . LYS A 1 53 ? -8.268  -8.437  -0.233  1.00 3.23 ? 53  LYS A NZ   1  
ATOM 778   H H    . LYS A 1 53 ? -6.504  -2.721  0.142   1.00 0.92 ? 53  LYS A H    1  
ATOM 779   H HA   . LYS A 1 53 ? -3.936  -3.832  1.057   1.00 0.82 ? 53  LYS A HA   1  
ATOM 780   H HB2  . LYS A 1 53 ? -4.472  -5.760  -0.472  1.00 1.54 ? 53  LYS A HB2  1  
ATOM 781   H HB3  . LYS A 1 53 ? -5.507  -5.607  0.935   1.00 1.39 ? 53  LYS A HB3  1  
ATOM 782   H HG2  . LYS A 1 53 ? -6.831  -4.160  -1.013  1.00 1.78 ? 53  LYS A HG2  1  
ATOM 783   H HG3  . LYS A 1 53 ? -6.182  -5.555  -1.874  1.00 1.86 ? 53  LYS A HG3  1  
ATOM 784   H HD2  . LYS A 1 53 ? -7.343  -6.242  0.712   1.00 2.39 ? 53  LYS A HD2  1  
ATOM 785   H HD3  . LYS A 1 53 ? -8.503  -5.504  -0.394  1.00 2.03 ? 53  LYS A HD3  1  
ATOM 786   H HE2  . LYS A 1 53 ? -8.327  -7.205  -1.937  1.00 2.44 ? 53  LYS A HE2  1  
ATOM 787   H HE3  . LYS A 1 53 ? -6.707  -7.656  -1.411  1.00 2.77 ? 53  LYS A HE3  1  
ATOM 788   H HZ1  . LYS A 1 53 ? -8.371  -8.110  0.750   1.00 3.81 ? 53  LYS A HZ1  1  
ATOM 789   H HZ2  . LYS A 1 53 ? -7.646  -9.270  -0.245  1.00 3.55 ? 53  LYS A HZ2  1  
ATOM 790   H HZ3  . LYS A 1 53 ? -9.202  -8.713  -0.594  1.00 3.45 ? 53  LYS A HZ3  1  
ATOM 791   N N    . LEU A 1 54 ? -2.708  -3.541  -1.104  1.00 0.64 ? 54  LEU A N    1  
ATOM 792   C CA   . LEU A 1 54 ? -1.922  -3.081  -2.239  1.00 0.66 ? 54  LEU A CA   1  
ATOM 793   C C    . LEU A 1 54 ? -1.853  -4.129  -3.341  1.00 0.64 ? 54  LEU A C    1  
ATOM 794   O O    . LEU A 1 54 ? -1.091  -5.094  -3.258  1.00 0.79 ? 54  LEU A O    1  
ATOM 795   C CB   . LEU A 1 54 ? -0.518  -2.665  -1.796  1.00 0.73 ? 54  LEU A CB   1  
ATOM 796   C CG   . LEU A 1 54 ? -0.061  -1.296  -2.310  1.00 0.83 ? 54  LEU A CG   1  
ATOM 797   C CD1  . LEU A 1 54 ? 0.996   -0.699  -1.392  1.00 1.11 ? 54  LEU A CD1  1  
ATOM 798   C CD2  . LEU A 1 54 ? 0.463   -1.407  -3.735  1.00 1.72 ? 54  LEU A CD2  1  
ATOM 799   H H    . LEU A 1 54 ? -2.306  -4.072  -0.389  1.00 0.62 ? 54  LEU A H    1  
ATOM 800   H HA   . LEU A 1 54 ? -2.421  -2.211  -2.638  1.00 0.75 ? 54  LEU A HA   1  
ATOM 801   H HB2  . LEU A 1 54 ? -0.498  -2.643  -0.717  1.00 1.24 ? 54  LEU A HB2  1  
ATOM 802   H HB3  . LEU A 1 54 ? 0.185   -3.409  -2.139  1.00 1.21 ? 54  LEU A HB3  1  
ATOM 803   H HG   . LEU A 1 54 ? -0.908  -0.625  -2.318  1.00 1.18 ? 54  LEU A HG   1  
ATOM 804   H HD11 . LEU A 1 54 ? 0.564   0.112   -0.825  1.00 1.58 ? 54  LEU A HD11 1  
ATOM 805   H HD12 . LEU A 1 54 ? 1.820   -0.328  -1.983  1.00 1.88 ? 54  LEU A HD12 1  
ATOM 806   H HD13 . LEU A 1 54 ? 1.356   -1.460  -0.713  1.00 1.17 ? 54  LEU A HD13 1  
ATOM 807   H HD21 . LEU A 1 54 ? 1.392   -1.958  -3.737  1.00 2.31 ? 54  LEU A HD21 1  
ATOM 808   H HD22 . LEU A 1 54 ? 0.629   -0.417  -4.135  1.00 2.00 ? 54  LEU A HD22 1  
ATOM 809   H HD23 . LEU A 1 54 ? -0.262  -1.924  -4.347  1.00 2.08 ? 54  LEU A HD23 1  
ATOM 810   N N    . LEU A 1 55 ? -2.648  -3.906  -4.387  1.00 0.56 ? 55  LEU A N    1  
ATOM 811   C CA   . LEU A 1 55 ? -2.679  -4.796  -5.538  1.00 0.58 ? 55  LEU A CA   1  
ATOM 812   C C    . LEU A 1 55 ? -1.342  -4.733  -6.267  1.00 0.54 ? 55  LEU A C    1  
ATOM 813   O O    . LEU A 1 55 ? -0.717  -5.765  -6.516  1.00 0.56 ? 55  LEU A O    1  
ATOM 814   C CB   . LEU A 1 55 ? -3.826  -4.415  -6.483  1.00 0.66 ? 55  LEU A CB   1  
ATOM 815   C CG   . LEU A 1 55 ? -3.836  -5.147  -7.829  1.00 0.91 ? 55  LEU A CG   1  
ATOM 816   C CD1  . LEU A 1 55 ? -5.214  -5.728  -8.113  1.00 1.27 ? 55  LEU A CD1  1  
ATOM 817   C CD2  . LEU A 1 55 ? -3.409  -4.208  -8.950  1.00 1.87 ? 55  LEU A CD2  1  
ATOM 818   H H    . LEU A 1 55 ? -3.215  -3.107  -4.391  1.00 0.58 ? 55  LEU A H    1  
ATOM 819   H HA   . LEU A 1 55 ? -2.835  -5.800  -5.176  1.00 0.62 ? 55  LEU A HA   1  
ATOM 820   H HB2  . LEU A 1 55 ? -4.759  -4.620  -5.980  1.00 0.75 ? 55  LEU A HB2  1  
ATOM 821   H HB3  . LEU A 1 55 ? -3.768  -3.354  -6.676  1.00 0.98 ? 55  LEU A HB3  1  
ATOM 822   H HG   . LEU A 1 55 ? -3.132  -5.965  -7.792  1.00 1.50 ? 55  LEU A HG   1  
ATOM 823   H HD11 . LEU A 1 55 ? -5.965  -4.971  -7.943  1.00 1.70 ? 55  LEU A HD11 1  
ATOM 824   H HD12 . LEU A 1 55 ? -5.392  -6.567  -7.456  1.00 1.74 ? 55  LEU A HD12 1  
ATOM 825   H HD13 . LEU A 1 55 ? -5.261  -6.059  -9.140  1.00 1.86 ? 55  LEU A HD13 1  
ATOM 826   H HD21 . LEU A 1 55 ? -3.151  -4.787  -9.825  1.00 2.39 ? 55  LEU A HD21 1  
ATOM 827   H HD22 . LEU A 1 55 ? -2.551  -3.635  -8.633  1.00 2.39 ? 55  LEU A HD22 1  
ATOM 828   H HD23 . LEU A 1 55 ? -4.222  -3.538  -9.189  1.00 2.37 ? 55  LEU A HD23 1  
ATOM 829   N N    . ALA A 1 56 ? -0.902  -3.512  -6.596  1.00 0.51 ? 56  ALA A N    1  
ATOM 830   C CA   . ALA A 1 56 ? 0.376   -3.328  -7.283  1.00 0.49 ? 56  ALA A CA   1  
ATOM 831   C C    . ALA A 1 56 ? 0.936   -1.921  -7.055  1.00 0.53 ? 56  ALA A C    1  
ATOM 832   O O    . ALA A 1 56 ? 0.200   -1.005  -6.701  1.00 0.67 ? 56  ALA A O    1  
ATOM 833   C CB   . ALA A 1 56 ? 0.210   -3.593  -8.779  1.00 0.54 ? 56  ALA A CB   1  
ATOM 834   H H    . ALA A 1 56 ? -1.449  -2.716  -6.364  1.00 0.53 ? 56  ALA A H    1  
ATOM 835   H HA   . ALA A 1 56 ? 1.077   -4.055  -6.879  1.00 0.52 ? 56  ALA A HA   1  
ATOM 836   H HB1  . ALA A 1 56 ? -0.014  -4.638  -8.943  1.00 1.19 ? 56  ALA A HB1  1  
ATOM 837   H HB2  . ALA A 1 56 ? 1.123   -3.335  -9.298  1.00 0.99 ? 56  ALA A HB2  1  
ATOM 838   H HB3  . ALA A 1 56 ? -0.601  -2.989  -9.162  1.00 1.25 ? 56  ALA A HB3  1  
ATOM 839   N N    . VAL A 1 57 ? 2.244   -1.754  -7.252  1.00 0.50 ? 57  VAL A N    1  
ATOM 840   C CA   . VAL A 1 57 ? 2.882   -0.452  -7.066  1.00 0.59 ? 57  VAL A CA   1  
ATOM 841   C C    . VAL A 1 57 ? 4.083   -0.290  -8.002  1.00 0.53 ? 57  VAL A C    1  
ATOM 842   O O    . VAL A 1 57 ? 5.052   -1.040  -7.919  1.00 0.52 ? 57  VAL A O    1  
ATOM 843   C CB   . VAL A 1 57 ? 3.320   -0.234  -5.598  1.00 0.77 ? 57  VAL A CB   1  
ATOM 844   C CG1  . VAL A 1 57 ? 4.299   -1.307  -5.153  1.00 1.42 ? 57  VAL A CG1  1  
ATOM 845   C CG2  . VAL A 1 57 ? 3.917   1.154   -5.412  1.00 1.47 ? 57  VAL A CG2  1  
ATOM 846   H H    . VAL A 1 57 ? 2.793   -2.527  -7.521  1.00 0.48 ? 57  VAL A H    1  
ATOM 847   H HA   . VAL A 1 57 ? 2.151   0.306   -7.312  1.00 0.66 ? 57  VAL A HA   1  
ATOM 848   H HB   . VAL A 1 57 ? 2.441   -0.306  -4.972  1.00 1.34 ? 57  VAL A HB   1  
ATOM 849   H HG11 . VAL A 1 57 ? 3.958   -2.272  -5.496  1.00 1.89 ? 57  VAL A HG11 1  
ATOM 850   H HG12 . VAL A 1 57 ? 4.364   -1.311  -4.075  1.00 1.82 ? 57  VAL A HG12 1  
ATOM 851   H HG13 . VAL A 1 57 ? 5.273   -1.100  -5.570  1.00 2.12 ? 57  VAL A HG13 1  
ATOM 852   H HG21 . VAL A 1 57 ? 4.981   1.113   -5.586  1.00 1.95 ? 57  VAL A HG21 1  
ATOM 853   H HG22 . VAL A 1 57 ? 3.729   1.493   -4.404  1.00 1.95 ? 57  VAL A HG22 1  
ATOM 854   H HG23 . VAL A 1 57 ? 3.463   1.839   -6.113  1.00 2.01 ? 57  VAL A HG23 1  
ATOM 855   N N    . ASN A 1 58 ? 3.997   0.690   -8.905  1.00 0.57 ? 58  ASN A N    1  
ATOM 856   C CA   . ASN A 1 58 ? 5.065   0.950   -9.876  1.00 0.58 ? 58  ASN A CA   1  
ATOM 857   C C    . ASN A 1 58 ? 5.179   -0.200  -10.887 1.00 0.59 ? 58  ASN A C    1  
ATOM 858   O O    . ASN A 1 58 ? 6.281   -0.585  -11.284 1.00 0.60 ? 58  ASN A O    1  
ATOM 859   C CB   . ASN A 1 58 ? 6.408   1.177   -9.164  1.00 0.57 ? 58  ASN A CB   1  
ATOM 860   C CG   . ASN A 1 58 ? 6.350   2.319   -8.164  1.00 0.80 ? 58  ASN A CG   1  
ATOM 861   O OD1  . ASN A 1 58 ? 6.574   2.124   -6.969  1.00 1.39 ? 58  ASN A OD1  1  
ATOM 862   N ND2  . ASN A 1 58 ? 6.049   3.520   -8.648  1.00 1.49 ? 58  ASN A ND2  1  
ATOM 863   H H    . ASN A 1 58 ? 3.190   1.245   -8.929  1.00 0.63 ? 58  ASN A H    1  
ATOM 864   H HA   . ASN A 1 58 ? 4.801   1.850   -10.412 1.00 0.65 ? 58  ASN A HA   1  
ATOM 865   H HB2  . ASN A 1 58 ? 6.687   0.277   -8.637  1.00 0.64 ? 58  ASN A HB2  1  
ATOM 866   H HB3  . ASN A 1 58 ? 7.164   1.405   -9.899  1.00 0.74 ? 58  ASN A HB3  1  
ATOM 867   H HD21 . ASN A 1 58 ? 5.884   3.605   -9.610  1.00 2.05 ? 58  ASN A HD21 1  
ATOM 868   H HD22 . ASN A 1 58 ? 6.002   4.272   -8.021  1.00 1.75 ? 58  ASN A HD22 1  
ATOM 869   N N    . ASN A 1 59 ? 4.018   -0.735  -11.294 1.00 0.60 ? 59  ASN A N    1  
ATOM 870   C CA   . ASN A 1 59 ? 3.938   -1.840  -12.263 1.00 0.65 ? 59  ASN A CA   1  
ATOM 871   C C    . ASN A 1 59 ? 4.145   -3.217  -11.611 1.00 0.61 ? 59  ASN A C    1  
ATOM 872   O O    . ASN A 1 59 ? 3.862   -4.241  -12.237 1.00 0.67 ? 59  ASN A O    1  
ATOM 873   C CB   . ASN A 1 59 ? 4.946   -1.650  -13.405 1.00 0.71 ? 59  ASN A CB   1  
ATOM 874   C CG   . ASN A 1 59 ? 4.319   -1.866  -14.771 1.00 1.18 ? 59  ASN A CG   1  
ATOM 875   O OD1  . ASN A 1 59 ? 3.939   -0.912  -15.448 1.00 1.74 ? 59  ASN A OD1  1  
ATOM 876   N ND2  . ASN A 1 59 ? 4.208   -3.126  -15.182 1.00 1.52 ? 59  ASN A ND2  1  
ATOM 877   H H    . ASN A 1 59 ? 3.186   -0.370  -10.927 1.00 0.61 ? 59  ASN A H    1  
ATOM 878   H HA   . ASN A 1 59 ? 2.944   -1.819  -12.684 1.00 0.68 ? 59  ASN A HA   1  
ATOM 879   H HB2  . ASN A 1 59 ? 5.340   -0.645  -13.368 1.00 0.83 ? 59  ASN A HB2  1  
ATOM 880   H HB3  . ASN A 1 59 ? 5.757   -2.353  -13.285 1.00 0.74 ? 59  ASN A HB3  1  
ATOM 881   H HD21 . ASN A 1 59 ? 4.530   -3.839  -14.592 1.00 1.74 ? 59  ASN A HD21 1  
ATOM 882   H HD22 . ASN A 1 59 ? 3.805   -3.290  -16.061 1.00 1.84 ? 59  ASN A HD22 1  
ATOM 883   N N    . VAL A 1 60 ? 4.632   -3.250  -10.363 1.00 0.53 ? 60  VAL A N    1  
ATOM 884   C CA   . VAL A 1 60 ? 4.856   -4.519  -9.667  1.00 0.52 ? 60  VAL A CA   1  
ATOM 885   C C    . VAL A 1 60 ? 3.659   -4.884  -8.797  1.00 0.51 ? 60  VAL A C    1  
ATOM 886   O O    . VAL A 1 60 ? 3.042   -4.011  -8.194  1.00 0.50 ? 60  VAL A O    1  
ATOM 887   C CB   . VAL A 1 60 ? 6.126   -4.488  -8.780  1.00 0.50 ? 60  VAL A CB   1  
ATOM 888   C CG1  . VAL A 1 60 ? 7.343   -4.061  -9.585  1.00 0.51 ? 60  VAL A CG1  1  
ATOM 889   C CG2  . VAL A 1 60 ? 5.943   -3.584  -7.566  1.00 0.54 ? 60  VAL A CG2  1  
ATOM 890   H H    . VAL A 1 60 ? 4.840   -2.411  -9.902  1.00 0.52 ? 60  VAL A H    1  
ATOM 891   H HA   . VAL A 1 60 ? 4.986   -5.289  -10.415 1.00 0.56 ? 60  VAL A HA   1  
ATOM 892   H HB   . VAL A 1 60 ? 6.298   -5.489  -8.421  1.00 0.58 ? 60  VAL A HB   1  
ATOM 893   H HG11 . VAL A 1 60 ? 7.046   -3.348  -10.339 1.00 1.18 ? 60  VAL A HG11 1  
ATOM 894   H HG12 . VAL A 1 60 ? 7.782   -4.925  -10.060 1.00 0.93 ? 60  VAL A HG12 1  
ATOM 895   H HG13 . VAL A 1 60 ? 8.069   -3.605  -8.925  1.00 1.23 ? 60  VAL A HG13 1  
ATOM 896   H HG21 . VAL A 1 60 ? 6.650   -2.769  -7.614  1.00 0.98 ? 60  VAL A HG21 1  
ATOM 897   H HG22 . VAL A 1 60 ? 6.113   -4.155  -6.665  1.00 1.15 ? 60  VAL A HG22 1  
ATOM 898   H HG23 . VAL A 1 60 ? 4.939   -3.189  -7.555  1.00 1.17 ? 60  VAL A HG23 1  
ATOM 899   N N    . CYS A 1 61 ? 3.342   -6.173  -8.712  1.00 0.53 ? 61  CYS A N    1  
ATOM 900   C CA   . CYS A 1 61 ? 2.224   -6.617  -7.885  1.00 0.54 ? 61  CYS A CA   1  
ATOM 901   C C    . CYS A 1 61 ? 2.671   -6.742  -6.434  1.00 0.58 ? 61  CYS A C    1  
ATOM 902   O O    . CYS A 1 61 ? 3.686   -7.378  -6.139  1.00 0.72 ? 61  CYS A O    1  
ATOM 903   C CB   . CYS A 1 61 ? 1.651   -7.937  -8.390  1.00 0.56 ? 61  CYS A CB   1  
ATOM 904   S SG   . CYS A 1 61 ? 2.841   -9.299  -8.442  1.00 0.71 ? 61  CYS A SG   1  
ATOM 905   H H    . CYS A 1 61 ? 3.876   -6.838  -9.195  1.00 0.55 ? 61  CYS A H    1  
ATOM 906   H HA   . CYS A 1 61 ? 1.458   -5.857  -7.941  1.00 0.53 ? 61  CYS A HA   1  
ATOM 907   H HB2  . CYS A 1 61 ? 0.840   -8.232  -7.742  1.00 0.91 ? 61  CYS A HB2  1  
ATOM 908   H HB3  . CYS A 1 61 ? 1.270   -7.791  -9.389  1.00 0.84 ? 61  CYS A HB3  1  
ATOM 909   H HG   . CYS A 1 61 ? 3.459   -9.125  -9.157  1.00 1.12 ? 61  CYS A HG   1  
ATOM 910   N N    . LEU A 1 62 ? 1.902   -6.144  -5.532  1.00 0.55 ? 62  LEU A N    1  
ATOM 911   C CA   . LEU A 1 62 ? 2.200   -6.192  -4.110  1.00 0.62 ? 62  LEU A CA   1  
ATOM 912   C C    . LEU A 1 62 ? 1.282   -7.176  -3.365  1.00 0.58 ? 62  LEU A C    1  
ATOM 913   O O    . LEU A 1 62 ? 0.999   -6.998  -2.176  1.00 0.51 ? 62  LEU A O    1  
ATOM 914   C CB   . LEU A 1 62 ? 2.107   -4.781  -3.526  1.00 0.77 ? 62  LEU A CB   1  
ATOM 915   C CG   . LEU A 1 62 ? 3.365   -4.310  -2.790  1.00 0.95 ? 62  LEU A CG   1  
ATOM 916   C CD1  . LEU A 1 62 ? 4.544   -4.231  -3.747  1.00 1.71 ? 62  LEU A CD1  1  
ATOM 917   C CD2  . LEU A 1 62 ? 3.124   -2.965  -2.124  1.00 1.08 ? 62  LEU A CD2  1  
ATOM 918   H H    . LEU A 1 62 ? 1.084   -5.693  -5.819  1.00 0.55 ? 62  LEU A H    1  
ATOM 919   H HA   . LEU A 1 62 ? 3.217   -6.538  -4.006  1.00 0.72 ? 62  LEU A HA   1  
ATOM 920   H HB2  . LEU A 1 62 ? 1.914   -4.094  -4.338  1.00 1.26 ? 62  LEU A HB2  1  
ATOM 921   H HB3  . LEU A 1 62 ? 1.276   -4.744  -2.846  1.00 1.09 ? 62  LEU A HB3  1  
ATOM 922   H HG   . LEU A 1 62 ? 3.613   -5.025  -2.022  1.00 1.61 ? 62  LEU A HG   1  
ATOM 923   H HD11 . LEU A 1 62 ? 4.189   -4.005  -4.741  1.00 2.12 ? 62  LEU A HD11 1  
ATOM 924   H HD12 . LEU A 1 62 ? 5.064   -5.177  -3.757  1.00 2.04 ? 62  LEU A HD12 1  
ATOM 925   H HD13 . LEU A 1 62 ? 5.220   -3.455  -3.422  1.00 2.37 ? 62  LEU A HD13 1  
ATOM 926   H HD21 . LEU A 1 62 ? 3.928   -2.755  -1.434  1.00 1.44 ? 62  LEU A HD21 1  
ATOM 927   H HD22 . LEU A 1 62 ? 2.188   -2.991  -1.587  1.00 1.77 ? 62  LEU A HD22 1  
ATOM 928   H HD23 . LEU A 1 62 ? 3.085   -2.191  -2.876  1.00 1.57 ? 62  LEU A HD23 1  
ATOM 929   N N    . GLU A 1 63 ? 0.794   -8.199  -4.073  1.00 0.72 ? 63  GLU A N    1  
ATOM 930   C CA   . GLU A 1 63 ? -0.111  -9.184  -3.475  1.00 0.80 ? 63  GLU A CA   1  
ATOM 931   C C    . GLU A 1 63 ? 0.544   -10.560 -3.309  1.00 0.95 ? 63  GLU A C    1  
ATOM 932   O O    . GLU A 1 63 ? 0.052   -11.389 -2.540  1.00 1.83 ? 63  GLU A O    1  
ATOM 933   C CB   . GLU A 1 63 ? -1.379  -9.311  -4.322  1.00 0.86 ? 63  GLU A CB   1  
ATOM 934   C CG   . GLU A 1 63 ? -2.216  -8.042  -4.353  1.00 1.12 ? 63  GLU A CG   1  
ATOM 935   C CD   . GLU A 1 63 ? -3.417  -8.156  -5.271  1.00 1.31 ? 63  GLU A CD   1  
ATOM 936   O OE1  . GLU A 1 63 ? -3.229  -8.104  -6.504  1.00 1.65 ? 63  GLU A OE1  1  
ATOM 937   O OE2  . GLU A 1 63 ? -4.547  -8.291  -4.756  1.00 1.96 ? 63  GLU A OE2  1  
ATOM 938   H H    . GLU A 1 63 ? 1.027   -8.281  -5.021  1.00 0.83 ? 63  GLU A H    1  
ATOM 939   H HA   . GLU A 1 63 ? -0.387  -8.819  -2.498  1.00 0.80 ? 63  GLU A HA   1  
ATOM 940   H HB2  . GLU A 1 63 ? -1.098  -9.557  -5.335  1.00 1.08 ? 63  GLU A HB2  1  
ATOM 941   H HB3  . GLU A 1 63 ? -1.987  -10.109 -3.922  1.00 1.32 ? 63  GLU A HB3  1  
ATOM 942   H HG2  . GLU A 1 63 ? -2.566  -7.832  -3.353  1.00 1.64 ? 63  GLU A HG2  1  
ATOM 943   H HG3  . GLU A 1 63 ? -1.596  -7.227  -4.694  1.00 1.48 ? 63  GLU A HG3  1  
ATOM 944   N N    . GLU A 1 64 ? 1.645   -10.806 -4.025  1.00 1.04 ? 64  GLU A N    1  
ATOM 945   C CA   . GLU A 1 64 ? 2.343   -12.090 -3.938  1.00 1.08 ? 64  GLU A CA   1  
ATOM 946   C C    . GLU A 1 64 ? 3.825   -11.895 -3.606  1.00 0.90 ? 64  GLU A C    1  
ATOM 947   O O    . GLU A 1 64 ? 4.698   -12.527 -4.207  1.00 0.96 ? 64  GLU A O    1  
ATOM 948   C CB   . GLU A 1 64 ? 2.184   -12.878 -5.244  1.00 1.28 ? 64  GLU A CB   1  
ATOM 949   C CG   . GLU A 1 64 ? 2.131   -12.001 -6.481  1.00 1.53 ? 64  GLU A CG   1  
ATOM 950   C CD   . GLU A 1 64 ? 1.981   -12.801 -7.761  1.00 2.14 ? 64  GLU A CD   1  
ATOM 951   O OE1  . GLU A 1 64 ? 3.015   -13.184 -8.347  1.00 2.93 ? 64  GLU A OE1  1  
ATOM 952   O OE2  . GLU A 1 64 ? 0.829   -13.046 -8.178  1.00 2.40 ? 64  GLU A OE2  1  
ATOM 953   H H    . GLU A 1 64 ? 1.997   -10.112 -4.620  1.00 1.69 ? 64  GLU A H    1  
ATOM 954   H HA   . GLU A 1 64 ? 1.885   -12.652 -3.142  1.00 1.19 ? 64  GLU A HA   1  
ATOM 955   H HB2  . GLU A 1 64 ? 3.017   -13.558 -5.346  1.00 1.35 ? 64  GLU A HB2  1  
ATOM 956   H HB3  . GLU A 1 64 ? 1.268   -13.450 -5.195  1.00 1.23 ? 64  GLU A HB3  1  
ATOM 957   H HG2  . GLU A 1 64 ? 1.290   -11.332 -6.391  1.00 1.77 ? 64  GLU A HG2  1  
ATOM 958   H HG3  . GLU A 1 64 ? 3.043   -11.426 -6.535  1.00 1.72 ? 64  GLU A HG3  1  
ATOM 959   N N    . VAL A 1 65 ? 4.100   -11.012 -2.645  1.00 0.80 ? 65  VAL A N    1  
ATOM 960   C CA   . VAL A 1 65 ? 5.474   -10.726 -2.230  1.00 0.64 ? 65  VAL A CA   1  
ATOM 961   C C    . VAL A 1 65 ? 5.619   -10.708 -0.712  1.00 0.64 ? 65  VAL A C    1  
ATOM 962   O O    . VAL A 1 65 ? 4.640   -10.533 0.018   1.00 0.70 ? 65  VAL A O    1  
ATOM 963   C CB   . VAL A 1 65 ? 5.972   -9.371  -2.780  1.00 0.56 ? 65  VAL A CB   1  
ATOM 964   C CG1  . VAL A 1 65 ? 6.177   -9.441  -4.287  1.00 0.64 ? 65  VAL A CG1  1  
ATOM 965   C CG2  . VAL A 1 65 ? 5.009   -8.247  -2.414  1.00 0.59 ? 65  VAL A CG2  1  
ATOM 966   H H    . VAL A 1 65 ? 3.357   -10.539 -2.212  1.00 0.90 ? 65  VAL A H    1  
ATOM 967   H HA   . VAL A 1 65 ? 6.108   -11.503 -2.631  1.00 0.65 ? 65  VAL A HA   1  
ATOM 968   H HB   . VAL A 1 65 ? 6.928   -9.157  -2.319  1.00 0.50 ? 65  VAL A HB   1  
ATOM 969   H HG11 . VAL A 1 65 ? 5.352   -9.971  -4.740  1.00 1.20 ? 65  VAL A HG11 1  
ATOM 970   H HG12 . VAL A 1 65 ? 7.099   -9.961  -4.500  1.00 1.37 ? 65  VAL A HG12 1  
ATOM 971   H HG13 . VAL A 1 65 ? 6.228   -8.441  -4.691  1.00 0.86 ? 65  VAL A HG13 1  
ATOM 972   H HG21 . VAL A 1 65 ? 5.319   -7.334  -2.900  1.00 0.99 ? 65  VAL A HG21 1  
ATOM 973   H HG22 . VAL A 1 65 ? 5.015   -8.103  -1.343  1.00 1.30 ? 65  VAL A HG22 1  
ATOM 974   H HG23 . VAL A 1 65 ? 4.012   -8.505  -2.737  1.00 1.16 ? 65  VAL A HG23 1  
ATOM 975   N N    . THR A 1 66 ? 6.859   -10.866 -0.251  1.00 0.63 ? 66  THR A N    1  
ATOM 976   C CA   . THR A 1 66 ? 7.162   -10.844 1.177   1.00 0.69 ? 66  THR A CA   1  
ATOM 977   C C    . THR A 1 66 ? 7.008   -9.421  1.721   1.00 0.61 ? 66  THR A C    1  
ATOM 978   O O    . THR A 1 66 ? 6.548   -8.523  1.007   1.00 0.66 ? 66  THR A O    1  
ATOM 979   C CB   . THR A 1 66 ? 8.585   -11.361 1.433   1.00 0.74 ? 66  THR A CB   1  
ATOM 980   O OG1  . THR A 1 66 ? 9.535   -10.607 0.700   1.00 1.53 ? 66  THR A OG1  1  
ATOM 981   C CG2  . THR A 1 66 ? 8.774   -12.818 1.060   1.00 1.17 ? 66  THR A CG2  1  
ATOM 982   H H    . THR A 1 66 ? 7.591   -10.983 -0.894  1.00 0.62 ? 66  THR A H    1  
ATOM 983   H HA   . THR A 1 66 ? 6.455   -11.490 1.677   1.00 0.80 ? 66  THR A HA   1  
ATOM 984   H HB   . THR A 1 66 ? 8.811   -11.259 2.484   1.00 1.20 ? 66  THR A HB   1  
ATOM 985   H HG1  . THR A 1 66 ? 9.806   -9.843  1.216   1.00 1.88 ? 66  THR A HG1  1  
ATOM 986   H HG21 . THR A 1 66 ? 8.015   -13.414 1.544   1.00 1.74 ? 66  THR A HG21 1  
ATOM 987   H HG22 . THR A 1 66 ? 9.751   -13.147 1.383   1.00 1.61 ? 66  THR A HG22 1  
ATOM 988   H HG23 . THR A 1 66 ? 8.693   -12.930 -0.010  1.00 1.74 ? 66  THR A HG23 1  
ATOM 989   N N    . HIS A 1 67 ? 7.411   -9.204  2.972   1.00 0.51 ? 67  HIS A N    1  
ATOM 990   C CA   . HIS A 1 67 ? 7.314   -7.869  3.554   1.00 0.45 ? 67  HIS A CA   1  
ATOM 991   C C    . HIS A 1 67 ? 8.380   -6.958  2.959   1.00 0.43 ? 67  HIS A C    1  
ATOM 992   O O    . HIS A 1 67 ? 8.118   -5.788  2.681   1.00 0.41 ? 67  HIS A O    1  
ATOM 993   C CB   . HIS A 1 67 ? 7.398   -7.895  5.082   1.00 0.45 ? 67  HIS A CB   1  
ATOM 994   C CG   . HIS A 1 67 ? 7.060   -6.570  5.690   1.00 0.46 ? 67  HIS A CG   1  
ATOM 995   N ND1  . HIS A 1 67 ? 5.815   -6.285  6.197   1.00 0.51 ? 67  HIS A ND1  1  
ATOM 996   C CD2  . HIS A 1 67 ? 7.783   -5.429  5.815   1.00 0.49 ? 67  HIS A CD2  1  
ATOM 997   C CE1  . HIS A 1 67 ? 5.783   -5.032  6.601   1.00 0.54 ? 67  HIS A CE1  1  
ATOM 998   N NE2  . HIS A 1 67 ? 6.963   -4.489  6.384   1.00 0.52 ? 67  HIS A NE2  1  
ATOM 999   H H    . HIS A 1 67 ? 7.791   -9.943  3.490   1.00 0.50 ? 67  HIS A H    1  
ATOM 1000  H HA   . HIS A 1 67 ? 6.347   -7.473  3.273   1.00 0.44 ? 67  HIS A HA   1  
ATOM 1001  H HB2  . HIS A 1 67 ? 6.694   -8.620  5.457   1.00 0.46 ? 67  HIS A HB2  1  
ATOM 1002  H HB3  . HIS A 1 67 ? 8.390   -8.173  5.395   1.00 0.44 ? 67  HIS A HB3  1  
ATOM 1003  H HD1  . HIS A 1 67 ? 5.066   -6.912  6.257   1.00 0.56 ? 67  HIS A HD1  1  
ATOM 1004  H HD2  . HIS A 1 67 ? 8.808   -5.281  5.514   1.00 0.54 ? 67  HIS A HD2  1  
ATOM 1005  H HE1  . HIS A 1 67 ? 4.927   -4.528  7.015   1.00 0.61 ? 67  HIS A HE1  1  
ATOM 1006  H HE2  . HIS A 1 67 ? 7.154   -3.530  6.434   1.00 0.56 ? 67  HIS A HE2  1  
ATOM 1007  N N    . GLU A 1 68 ? 9.580   -7.506  2.761   1.00 0.45 ? 68  GLU A N    1  
ATOM 1008  C CA   . GLU A 1 68 ? 10.690  -6.747  2.186   1.00 0.45 ? 68  GLU A CA   1  
ATOM 1009  C C    . GLU A 1 68 ? 10.252  -6.067  0.890   1.00 0.42 ? 68  GLU A C    1  
ATOM 1010  O O    . GLU A 1 68 ? 10.517  -4.885  0.684   1.00 0.41 ? 68  GLU A O    1  
ATOM 1011  C CB   . GLU A 1 68 ? 11.887  -7.666  1.916   1.00 0.49 ? 68  GLU A CB   1  
ATOM 1012  C CG   . GLU A 1 68 ? 12.382  -8.413  3.148   1.00 1.43 ? 68  GLU A CG   1  
ATOM 1013  C CD   . GLU A 1 68 ? 11.819  -9.820  3.245   1.00 2.13 ? 68  GLU A CD   1  
ATOM 1014  O OE1  . GLU A 1 68 ? 12.385  -10.732 2.606   1.00 2.90 ? 68  GLU A OE1  1  
ATOM 1015  O OE2  . GLU A 1 68 ? 10.811  -10.008 3.958   1.00 2.59 ? 68  GLU A OE2  1  
ATOM 1016  H H    . GLU A 1 68 ? 9.728   -8.439  3.013   1.00 0.47 ? 68  GLU A H    1  
ATOM 1017  H HA   . GLU A 1 68 ? 10.979  -5.989  2.899   1.00 0.47 ? 68  GLU A HA   1  
ATOM 1018  H HB2  . GLU A 1 68 ? 11.606  -8.394  1.171   1.00 1.08 ? 68  GLU A HB2  1  
ATOM 1019  H HB3  . GLU A 1 68 ? 12.703  -7.070  1.533   1.00 1.21 ? 68  GLU A HB3  1  
ATOM 1020  H HG2  . GLU A 1 68 ? 13.460  -8.475  3.107   1.00 2.02 ? 68  GLU A HG2  1  
ATOM 1021  H HG3  . GLU A 1 68 ? 12.088  -7.861  4.029   1.00 2.08 ? 68  GLU A HG3  1  
ATOM 1022  N N    . GLU A 1 69 ? 9.563   -6.824  0.031   1.00 0.44 ? 69  GLU A N    1  
ATOM 1023  C CA   . GLU A 1 69 ? 9.066   -6.297  -1.240  1.00 0.43 ? 69  GLU A CA   1  
ATOM 1024  C C    . GLU A 1 69 ? 8.006   -5.219  -1.001  1.00 0.41 ? 69  GLU A C    1  
ATOM 1025  O O    . GLU A 1 69 ? 7.960   -4.219  -1.718  1.00 0.41 ? 69  GLU A O    1  
ATOM 1026  C CB   . GLU A 1 69 ? 8.488   -7.424  -2.100  1.00 0.46 ? 69  GLU A CB   1  
ATOM 1027  C CG   . GLU A 1 69 ? 9.203   -7.603  -3.431  1.00 0.76 ? 69  GLU A CG   1  
ATOM 1028  C CD   . GLU A 1 69 ? 8.898   -6.487  -4.413  1.00 1.07 ? 69  GLU A CD   1  
ATOM 1029  O OE1  . GLU A 1 69 ? 9.556   -5.428  -4.333  1.00 1.70 ? 69  GLU A OE1  1  
ATOM 1030  O OE2  . GLU A 1 69 ? 8.001   -6.672  -5.263  1.00 1.84 ? 69  GLU A OE2  1  
ATOM 1031  H H    . GLU A 1 69 ? 9.376   -7.758  0.267   1.00 0.48 ? 69  GLU A H    1  
ATOM 1032  H HA   . GLU A 1 69 ? 9.901   -5.852  -1.759  1.00 0.46 ? 69  GLU A HA   1  
ATOM 1033  H HB2  . GLU A 1 69 ? 8.555   -8.352  -1.552  1.00 0.64 ? 69  GLU A HB2  1  
ATOM 1034  H HB3  . GLU A 1 69 ? 7.448   -7.210  -2.302  1.00 0.63 ? 69  GLU A HB3  1  
ATOM 1035  H HG2  . GLU A 1 69 ? 10.268  -7.626  -3.254  1.00 1.51 ? 69  GLU A HG2  1  
ATOM 1036  H HG3  . GLU A 1 69 ? 8.892   -8.542  -3.867  1.00 1.43 ? 69  GLU A HG3  1  
ATOM 1037  N N    . ALA A 1 70 ? 7.170   -5.421  0.024   1.00 0.41 ? 70  ALA A N    1  
ATOM 1038  C CA   . ALA A 1 70 ? 6.125   -4.456  0.378   1.00 0.41 ? 70  ALA A CA   1  
ATOM 1039  C C    . ALA A 1 70 ? 6.735   -3.095  0.721   1.00 0.40 ? 70  ALA A C    1  
ATOM 1040  O O    . ALA A 1 70 ? 6.229   -2.052  0.305   1.00 0.42 ? 70  ALA A O    1  
ATOM 1041  C CB   . ALA A 1 70 ? 5.315   -4.970  1.561   1.00 0.44 ? 70  ALA A CB   1  
ATOM 1042  H H    . ALA A 1 70 ? 7.269   -6.234  0.570   1.00 0.44 ? 70  ALA A H    1  
ATOM 1043  H HA   . ALA A 1 70 ? 5.458   -4.346  -0.467  1.00 0.42 ? 70  ALA A HA   1  
ATOM 1044  H HB1  . ALA A 1 70 ? 5.239   -6.046  1.507   1.00 1.00 ? 70  ALA A HB1  1  
ATOM 1045  H HB2  . ALA A 1 70 ? 4.326   -4.538  1.534   1.00 1.28 ? 70  ALA A HB2  1  
ATOM 1046  H HB3  . ALA A 1 70 ? 5.804   -4.690  2.482   1.00 0.98 ? 70  ALA A HB3  1  
ATOM 1047  N N    . VAL A 1 71 ? 7.836   -3.121  1.471   1.00 0.40 ? 71  VAL A N    1  
ATOM 1048  C CA   . VAL A 1 71 ? 8.532   -1.899  1.867   1.00 0.42 ? 71  VAL A CA   1  
ATOM 1049  C C    . VAL A 1 71 ? 9.431   -1.381  0.744   1.00 0.41 ? 71  VAL A C    1  
ATOM 1050  O O    . VAL A 1 71 ? 9.548   -0.172  0.546   1.00 0.42 ? 71  VAL A O    1  
ATOM 1051  C CB   . VAL A 1 71 ? 9.377   -2.121  3.144   1.00 0.48 ? 71  VAL A CB   1  
ATOM 1052  C CG1  . VAL A 1 71 ? 10.327  -0.955  3.387   1.00 0.52 ? 71  VAL A CG1  1  
ATOM 1053  C CG2  . VAL A 1 71 ? 8.475   -2.338  4.348   1.00 0.50 ? 71  VAL A CG2  1  
ATOM 1054  H H    . VAL A 1 71 ? 8.195   -3.991  1.746   1.00 0.41 ? 71  VAL A H    1  
ATOM 1055  H HA   . VAL A 1 71 ? 7.781   -1.149  2.082   1.00 0.43 ? 71  VAL A HA   1  
ATOM 1056  H HB   . VAL A 1 71 ? 9.972   -3.014  3.004   1.00 0.51 ? 71  VAL A HB   1  
ATOM 1057  H HG11 . VAL A 1 71 ? 10.593  -0.920  4.435   1.00 1.18 ? 71  VAL A HG11 1  
ATOM 1058  H HG12 . VAL A 1 71 ? 9.842   -0.031  3.109   1.00 1.21 ? 71  VAL A HG12 1  
ATOM 1059  H HG13 . VAL A 1 71 ? 11.218  -1.087  2.793   1.00 1.02 ? 71  VAL A HG13 1  
ATOM 1060  H HG21 . VAL A 1 71 ? 8.308   -1.395  4.847   1.00 1.07 ? 71  VAL A HG21 1  
ATOM 1061  H HG22 . VAL A 1 71 ? 8.947   -3.028  5.032   1.00 1.12 ? 71  VAL A HG22 1  
ATOM 1062  H HG23 . VAL A 1 71 ? 7.530   -2.744  4.023   1.00 1.00 ? 71  VAL A HG23 1  
ATOM 1063  N N    . THR A 1 72 ? 10.060  -2.305  0.012   1.00 0.43 ? 72  THR A N    1  
ATOM 1064  C CA   . THR A 1 72 ? 10.948  -1.947  -1.093  1.00 0.47 ? 72  THR A CA   1  
ATOM 1065  C C    . THR A 1 72 ? 10.189  -1.215  -2.200  1.00 0.42 ? 72  THR A C    1  
ATOM 1066  O O    . THR A 1 72 ? 10.712  -0.276  -2.800  1.00 0.44 ? 72  THR A O    1  
ATOM 1067  C CB   . THR A 1 72 ? 11.625  -3.202  -1.661  1.00 0.53 ? 72  THR A CB   1  
ATOM 1068  O OG1  . THR A 1 72 ? 12.553  -3.736  -0.731  1.00 0.60 ? 72  THR A OG1  1  
ATOM 1069  C CG2  . THR A 1 72 ? 12.371  -2.955  -2.959  1.00 0.61 ? 72  THR A CG2  1  
ATOM 1070  H H    . THR A 1 72 ? 9.919   -3.250  0.217   1.00 0.46 ? 72  THR A H    1  
ATOM 1071  H HA   . THR A 1 72 ? 11.707  -1.292  -0.701  1.00 0.51 ? 72  THR A HA   1  
ATOM 1072  H HB   . THR A 1 72 ? 10.868  -3.951  -1.850  1.00 0.53 ? 72  THR A HB   1  
ATOM 1073  H HG1  . THR A 1 72 ? 13.189  -3.058  -0.483  1.00 0.98 ? 72  THR A HG1  1  
ATOM 1074  H HG21 . THR A 1 72 ? 13.019  -2.098  -2.844  1.00 1.16 ? 72  THR A HG21 1  
ATOM 1075  H HG22 . THR A 1 72 ? 11.663  -2.767  -3.753  1.00 0.86 ? 72  THR A HG22 1  
ATOM 1076  H HG23 . THR A 1 72 ? 12.964  -3.823  -3.205  1.00 1.27 ? 72  THR A HG23 1  
ATOM 1077  N N    . ALA A 1 73 ? 8.959   -1.652  -2.468  1.00 0.37 ? 73  ALA A N    1  
ATOM 1078  C CA   . ALA A 1 73 ? 8.128   -1.048  -3.505  1.00 0.36 ? 73  ALA A CA   1  
ATOM 1079  C C    . ALA A 1 73 ? 7.547   0.279   -3.035  1.00 0.34 ? 73  ALA A C    1  
ATOM 1080  O O    . ALA A 1 73 ? 7.446   1.227   -3.817  1.00 0.36 ? 73  ALA A O    1  
ATOM 1081  C CB   . ALA A 1 73 ? 7.018   -2.002  -3.915  1.00 0.41 ? 73  ALA A CB   1  
ATOM 1082  H H    . ALA A 1 73 ? 8.594   -2.403  -1.965  1.00 0.37 ? 73  ALA A H    1  
ATOM 1083  H HA   . ALA A 1 73 ? 8.753   -0.871  -4.371  1.00 0.39 ? 73  ALA A HA   1  
ATOM 1084  H HB1  . ALA A 1 73 ? 6.809   -1.879  -4.966  1.00 1.15 ? 73  ALA A HB1  1  
ATOM 1085  H HB2  . ALA A 1 73 ? 6.128   -1.784  -3.342  1.00 1.01 ? 73  ALA A HB2  1  
ATOM 1086  H HB3  . ALA A 1 73 ? 7.328   -3.019  -3.726  1.00 1.08 ? 73  ALA A HB3  1  
ATOM 1087  N N    . LEU A 1 74 ? 7.193   0.358   -1.747  1.00 0.33 ? 74  LEU A N    1  
ATOM 1088  C CA   . LEU A 1 74 ? 6.657   1.590   -1.178  1.00 0.37 ? 74  LEU A CA   1  
ATOM 1089  C C    . LEU A 1 74 ? 7.757   2.643   -1.103  1.00 0.38 ? 74  LEU A C    1  
ATOM 1090  O O    . LEU A 1 74 ? 7.496   3.841   -1.225  1.00 0.44 ? 74  LEU A O    1  
ATOM 1091  C CB   . LEU A 1 74 ? 6.099   1.335   0.225   1.00 0.41 ? 74  LEU A CB   1  
ATOM 1092  C CG   . LEU A 1 74 ? 4.676   0.777   0.286   1.00 0.61 ? 74  LEU A CG   1  
ATOM 1093  C CD1  . LEU A 1 74 ? 3.656   1.905   0.281   1.00 1.73 ? 74  LEU A CD1  1  
ATOM 1094  C CD2  . LEU A 1 74 ? 4.413   -0.184  -0.865  1.00 1.13 ? 74  LEU A CD2  1  
ATOM 1095  H H    . LEU A 1 74 ? 7.321   -0.418  -1.153  1.00 0.33 ? 74  LEU A H    1  
ATOM 1096  H HA   . LEU A 1 74 ? 5.866   1.945   -1.821  1.00 0.42 ? 74  LEU A HA   1  
ATOM 1097  H HB2  . LEU A 1 74 ? 6.755   0.637   0.725   1.00 0.61 ? 74  LEU A HB2  1  
ATOM 1098  H HB3  . LEU A 1 74 ? 6.117   2.267   0.770   1.00 0.47 ? 74  LEU A HB3  1  
ATOM 1099  H HG   . LEU A 1 74 ? 4.563   0.230   1.208   1.00 1.29 ? 74  LEU A HG   1  
ATOM 1100  H HD11 . LEU A 1 74 ? 3.688   2.416   -0.670  1.00 2.20 ? 74  LEU A HD11 1  
ATOM 1101  H HD12 . LEU A 1 74 ? 3.887   2.602   1.072   1.00 2.34 ? 74  LEU A HD12 1  
ATOM 1102  H HD13 . LEU A 1 74 ? 2.668   1.498   0.438   1.00 2.24 ? 74  LEU A HD13 1  
ATOM 1103  H HD21 . LEU A 1 74 ? 4.140   0.375   -1.747  1.00 1.57 ? 74  LEU A HD21 1  
ATOM 1104  H HD22 . LEU A 1 74 ? 3.609   -0.853  -0.597  1.00 1.72 ? 74  LEU A HD22 1  
ATOM 1105  H HD23 . LEU A 1 74 ? 5.306   -0.757  -1.064  1.00 1.75 ? 74  LEU A HD23 1  
ATOM 1106  N N    . LYS A 1 75 ? 8.991   2.175   -0.905  1.00 0.38 ? 75  LYS A N    1  
ATOM 1107  C CA   . LYS A 1 75 ? 10.149  3.069   -0.815  1.00 0.47 ? 75  LYS A CA   1  
ATOM 1108  C C    . LYS A 1 75 ? 10.730  3.395   -2.199  1.00 0.49 ? 75  LYS A C    1  
ATOM 1109  O O    . LYS A 1 75 ? 11.486  4.359   -2.341  1.00 0.59 ? 75  LYS A O    1  
ATOM 1110  C CB   . LYS A 1 75 ? 11.234  2.462   0.086   1.00 0.57 ? 75  LYS A CB   1  
ATOM 1111  C CG   . LYS A 1 75 ? 12.036  1.344   -0.567  1.00 0.64 ? 75  LYS A CG   1  
ATOM 1112  C CD   . LYS A 1 75 ? 13.475  1.319   -0.071  1.00 1.05 ? 75  LYS A CD   1  
ATOM 1113  C CE   . LYS A 1 75 ? 13.591  0.642   1.287   1.00 0.88 ? 75  LYS A CE   1  
ATOM 1114  N NZ   . LYS A 1 75 ? 14.696  1.219   2.104   1.00 1.44 ? 75  LYS A NZ   1  
ATOM 1115  H H    . LYS A 1 75 ? 9.123   1.198   -0.822  1.00 0.37 ? 75  LYS A H    1  
ATOM 1116  H HA   . LYS A 1 75 ? 9.809   3.991   -0.366  1.00 0.54 ? 75  LYS A HA   1  
ATOM 1117  H HB2  . LYS A 1 75 ? 11.920  3.244   0.376   1.00 0.67 ? 75  LYS A HB2  1  
ATOM 1118  H HB3  . LYS A 1 75 ? 10.764  2.064   0.974   1.00 0.62 ? 75  LYS A HB3  1  
ATOM 1119  H HG2  . LYS A 1 75 ? 11.572  0.401   -0.335  1.00 0.87 ? 75  LYS A HG2  1  
ATOM 1120  H HG3  . LYS A 1 75 ? 12.038  1.493   -1.636  1.00 0.88 ? 75  LYS A HG3  1  
ATOM 1121  H HD2  . LYS A 1 75 ? 14.080  0.778   -0.783  1.00 1.90 ? 75  LYS A HD2  1  
ATOM 1122  H HD3  . LYS A 1 75 ? 13.835  2.334   0.011   1.00 1.62 ? 75  LYS A HD3  1  
ATOM 1123  H HE2  . LYS A 1 75 ? 12.660  0.766   1.819   1.00 1.04 ? 75  LYS A HE2  1  
ATOM 1124  H HE3  . LYS A 1 75 ? 13.779  -0.409  1.136   1.00 1.51 ? 75  LYS A HE3  1  
ATOM 1125  H HZ1  . LYS A 1 75 ? 14.532  2.233   2.262   1.00 1.72 ? 75  LYS A HZ1  1  
ATOM 1126  H HZ2  . LYS A 1 75 ? 15.605  1.098   1.613   1.00 1.94 ? 75  LYS A HZ2  1  
ATOM 1127  H HZ3  . LYS A 1 75 ? 14.747  0.740   3.026   1.00 1.92 ? 75  LYS A HZ3  1  
ATOM 1128  N N    . ASN A 1 76 ? 10.382  2.593   -3.213  1.00 0.48 ? 76  ASN A N    1  
ATOM 1129  C CA   . ASN A 1 76 ? 10.878  2.809   -4.576  1.00 0.59 ? 76  ASN A CA   1  
ATOM 1130  C C    . ASN A 1 76 ? 10.098  3.929   -5.273  1.00 0.69 ? 76  ASN A C    1  
ATOM 1131  O O    . ASN A 1 76 ? 9.429   3.703   -6.284  1.00 1.15 ? 76  ASN A O    1  
ATOM 1132  C CB   . ASN A 1 76 ? 10.786  1.510   -5.386  1.00 0.64 ? 76  ASN A CB   1  
ATOM 1133  C CG   . ASN A 1 76 ? 11.570  1.572   -6.685  1.00 0.85 ? 76  ASN A CG   1  
ATOM 1134  O OD1  . ASN A 1 76 ? 12.802  1.601   -6.679  1.00 0.90 ? 76  ASN A OD1  1  
ATOM 1135  N ND2  . ASN A 1 76 ? 10.859  1.594   -7.809  1.00 1.55 ? 76  ASN A ND2  1  
ATOM 1136  H H    . ASN A 1 76 ? 9.781   1.838   -3.041  1.00 0.45 ? 76  ASN A H    1  
ATOM 1137  H HA   . ASN A 1 76 ? 11.914  3.103   -4.504  1.00 0.73 ? 76  ASN A HA   1  
ATOM 1138  H HB2  . ASN A 1 76 ? 11.176  0.695   -4.794  1.00 0.71 ? 76  ASN A HB2  1  
ATOM 1139  H HB3  . ASN A 1 76 ? 9.750   1.312   -5.621  1.00 0.75 ? 76  ASN A HB3  1  
ATOM 1140  H HD21 . ASN A 1 76 ? 9.881   1.568   -7.741  1.00 1.95 ? 76  ASN A HD21 1  
ATOM 1141  H HD22 . ASN A 1 76 ? 11.342  1.636   -8.661  1.00 1.75 ? 76  ASN A HD22 1  
ATOM 1142  N N    . THR A 1 77 ? 10.183  5.137   -4.716  1.00 0.90 ? 77  THR A N    1  
ATOM 1143  C CA   . THR A 1 77 ? 9.483   6.293   -5.269  1.00 1.07 ? 77  THR A CA   1  
ATOM 1144  C C    . THR A 1 77 ? 10.461  7.412   -5.628  1.00 0.80 ? 77  THR A C    1  
ATOM 1145  O O    . THR A 1 77 ? 11.150  7.952   -4.759  1.00 1.47 ? 77  THR A O    1  
ATOM 1146  C CB   . THR A 1 77 ? 8.435   6.803   -4.272  1.00 2.00 ? 77  THR A CB   1  
ATOM 1147  O OG1  . THR A 1 77 ? 9.011   7.018   -2.992  1.00 2.60 ? 77  THR A OG1  1  
ATOM 1148  C CG2  . THR A 1 77 ? 7.267   5.856   -4.095  1.00 2.53 ? 77  THR A CG2  1  
ATOM 1149  H H    . THR A 1 77 ? 10.719  5.250   -3.903  1.00 1.26 ? 77  THR A H    1  
ATOM 1150  H HA   . THR A 1 77 ? 8.979   5.974   -6.169  1.00 1.56 ? 77  THR A HA   1  
ATOM 1151  H HB   . THR A 1 77 ? 8.044   7.746   -4.629  1.00 2.59 ? 77  THR A HB   1  
ATOM 1152  H HG1  . THR A 1 77 ? 9.255   6.174   -2.601  1.00 2.91 ? 77  THR A HG1  1  
ATOM 1153  H HG21 . THR A 1 77 ? 6.936   5.510   -5.063  1.00 2.58 ? 77  THR A HG21 1  
ATOM 1154  H HG22 . THR A 1 77 ? 6.458   6.371   -3.599  1.00 3.13 ? 77  THR A HG22 1  
ATOM 1155  H HG23 . THR A 1 77 ? 7.577   5.012   -3.498  1.00 2.95 ? 77  THR A HG23 1  
ATOM 1156  N N    . SER A 1 78 ? 10.509  7.759   -6.916  1.00 1.14 ? 78  SER A N    1  
ATOM 1157  C CA   . SER A 1 78 ? 11.394  8.817   -7.398  1.00 1.74 ? 78  SER A CA   1  
ATOM 1158  C C    . SER A 1 78 ? 10.672  10.166  -7.383  1.00 1.42 ? 78  SER A C    1  
ATOM 1159  O O    . SER A 1 78 ? 10.767  10.910  -6.407  1.00 1.44 ? 78  SER A O    1  
ATOM 1160  C CB   . SER A 1 78 ? 11.904  8.488   -8.806  1.00 2.76 ? 78  SER A CB   1  
ATOM 1161  O OG   . SER A 1 78 ? 12.906  7.486   -8.765  1.00 3.36 ? 78  SER A OG   1  
ATOM 1162  H H    . SER A 1 78 ? 9.928   7.291   -7.554  1.00 1.57 ? 78  SER A H    1  
ATOM 1163  H HA   . SER A 1 78 ? 12.237  8.870   -6.725  1.00 2.08 ? 78  SER A HA   1  
ATOM 1164  H HB2  . SER A 1 78 ? 11.083  8.132   -9.410  1.00 3.05 ? 78  SER A HB2  1  
ATOM 1165  H HB3  . SER A 1 78 ? 12.320  9.377   -9.254  1.00 3.31 ? 78  SER A HB3  1  
ATOM 1166  H HG   . SER A 1 78 ? 12.497  6.620   -8.823  1.00 3.89 ? 78  SER A HG   1  
ATOM 1167  N N    . ASP A 1 79 ? 9.942   10.473  -8.459  1.00 1.32 ? 79  ASP A N    1  
ATOM 1168  C CA   . ASP A 1 79 ? 9.197   11.728  -8.550  1.00 1.18 ? 79  ASP A CA   1  
ATOM 1169  C C    . ASP A 1 79 ? 7.729   11.502  -8.185  1.00 0.99 ? 79  ASP A C    1  
ATOM 1170  O O    . ASP A 1 79 ? 7.138   12.284  -7.438  1.00 0.92 ? 79  ASP A O    1  
ATOM 1171  C CB   . ASP A 1 79 ? 9.313   12.333  -9.956  1.00 1.46 ? 79  ASP A CB   1  
ATOM 1172  C CG   . ASP A 1 79 ? 8.694   11.459  -11.034 1.00 1.61 ? 79  ASP A CG   1  
ATOM 1173  O OD1  . ASP A 1 79 ? 9.328   10.455  -11.424 1.00 2.07 ? 79  ASP A OD1  1  
ATOM 1174  O OD2  . ASP A 1 79 ? 7.575   11.779  -11.489 1.00 2.23 ? 79  ASP A OD2  1  
ATOM 1175  H H    . ASP A 1 79 ? 9.897   9.839   -9.205  1.00 1.49 ? 79  ASP A H    1  
ATOM 1176  H HA   . ASP A 1 79 ? 9.626   12.417  -7.836  1.00 1.15 ? 79  ASP A HA   1  
ATOM 1177  H HB2  . ASP A 1 79 ? 8.813   13.290  -9.969  1.00 2.06 ? 79  ASP A HB2  1  
ATOM 1178  H HB3  . ASP A 1 79 ? 10.357  12.476  -10.192 1.00 1.75 ? 79  ASP A HB3  1  
ATOM 1179  N N    . PHE A 1 80 ? 7.154   10.419  -8.711  1.00 0.97 ? 80  PHE A N    1  
ATOM 1180  C CA   . PHE A 1 80 ? 5.766   10.066  -8.441  1.00 0.85 ? 80  PHE A CA   1  
ATOM 1181  C C    . PHE A 1 80 ? 5.659   8.601   -8.029  1.00 0.82 ? 80  PHE A C    1  
ATOM 1182  O O    . PHE A 1 80 ? 6.629   7.846   -8.144  1.00 0.92 ? 80  PHE A O    1  
ATOM 1183  C CB   . PHE A 1 80 ? 4.898   10.334  -9.673  1.00 0.92 ? 80  PHE A CB   1  
ATOM 1184  C CG   . PHE A 1 80 ? 3.833   11.359  -9.428  1.00 0.94 ? 80  PHE A CG   1  
ATOM 1185  C CD1  . PHE A 1 80 ? 4.135   12.710  -9.474  1.00 1.68 ? 80  PHE A CD1  1  
ATOM 1186  C CD2  . PHE A 1 80 ? 2.536   10.972  -9.139  1.00 1.39 ? 80  PHE A CD2  1  
ATOM 1187  C CE1  . PHE A 1 80 ? 3.161   13.657  -9.237  1.00 1.77 ? 80  PHE A CE1  1  
ATOM 1188  C CE2  . PHE A 1 80 ? 1.557   11.917  -8.901  1.00 1.43 ? 80  PHE A CE2  1  
ATOM 1189  C CZ   . PHE A 1 80 ? 1.870   13.260  -8.950  1.00 1.14 ? 80  PHE A CZ   1  
ATOM 1190  H H    . PHE A 1 80 ? 7.686   9.834   -9.290  1.00 1.09 ? 80  PHE A H    1  
ATOM 1191  H HA   . PHE A 1 80 ? 5.419   10.682  -7.625  1.00 0.81 ? 80  PHE A HA   1  
ATOM 1192  H HB2  . PHE A 1 80 ? 5.523   10.687  -10.479 1.00 1.04 ? 80  PHE A HB2  1  
ATOM 1193  H HB3  . PHE A 1 80 ? 4.416   9.415   -9.974  1.00 0.93 ? 80  PHE A HB3  1  
ATOM 1194  H HD1  . PHE A 1 80 ? 5.144   13.021  -9.700  1.00 2.48 ? 80  PHE A HD1  1  
ATOM 1195  H HD2  . PHE A 1 80 ? 2.290   9.919   -9.102  1.00 2.16 ? 80  PHE A HD2  1  
ATOM 1196  H HE1  . PHE A 1 80 ? 3.407   14.708  -9.277  1.00 2.61 ? 80  PHE A HE1  1  
ATOM 1197  H HE2  . PHE A 1 80 ? 0.549   11.606  -8.677  1.00 2.19 ? 80  PHE A HE2  1  
ATOM 1198  H HZ   . PHE A 1 80 ? 1.109   14.000  -8.760  1.00 1.26 ? 80  PHE A HZ   1  
ATOM 1199  N N    . VAL A 1 81 ? 4.476   8.189   -7.571  1.00 0.75 ? 81  VAL A N    1  
ATOM 1200  C CA   . VAL A 1 81 ? 4.246   6.806   -7.174  1.00 0.77 ? 81  VAL A CA   1  
ATOM 1201  C C    . VAL A 1 81 ? 2.839   6.369   -7.585  1.00 0.65 ? 81  VAL A C    1  
ATOM 1202  O O    . VAL A 1 81 ? 1.846   6.958   -7.152  1.00 0.59 ? 81  VAL A O    1  
ATOM 1203  C CB   . VAL A 1 81 ? 4.445   6.598   -5.653  1.00 0.88 ? 81  VAL A CB   1  
ATOM 1204  C CG1  . VAL A 1 81 ? 3.628   7.599   -4.845  1.00 1.19 ? 81  VAL A CG1  1  
ATOM 1205  C CG2  . VAL A 1 81 ? 4.100   5.169   -5.254  1.00 1.58 ? 81  VAL A CG2  1  
ATOM 1206  H H    . VAL A 1 81 ? 3.719   8.810   -7.524  1.00 0.74 ? 81  VAL A H    1  
ATOM 1207  H HA   . VAL A 1 81 ? 4.966   6.190   -7.696  1.00 0.89 ? 81  VAL A HA   1  
ATOM 1208  H HB   . VAL A 1 81 ? 5.488   6.765   -5.429  1.00 1.14 ? 81  VAL A HB   1  
ATOM 1209  H HG11 . VAL A 1 81 ? 4.137   8.551   -4.835  1.00 1.78 ? 81  VAL A HG11 1  
ATOM 1210  H HG12 . VAL A 1 81 ? 3.519   7.239   -3.832  1.00 1.62 ? 81  VAL A HG12 1  
ATOM 1211  H HG13 . VAL A 1 81 ? 2.653   7.716   -5.292  1.00 1.67 ? 81  VAL A HG13 1  
ATOM 1212  H HG21 . VAL A 1 81 ? 4.443   4.984   -4.246  1.00 1.98 ? 81  VAL A HG21 1  
ATOM 1213  H HG22 . VAL A 1 81 ? 4.582   4.479   -5.930  1.00 2.06 ? 81  VAL A HG22 1  
ATOM 1214  H HG23 . VAL A 1 81 ? 3.030   5.029   -5.301  1.00 2.07 ? 81  VAL A HG23 1  
ATOM 1215  N N    . TYR A 1 82 ? 2.759   5.337   -8.422  1.00 0.72 ? 82  TYR A N    1  
ATOM 1216  C CA   . TYR A 1 82 ? 1.466   4.837   -8.879  1.00 0.69 ? 82  TYR A CA   1  
ATOM 1217  C C    . TYR A 1 82 ? 1.029   3.641   -8.043  1.00 0.67 ? 82  TYR A C    1  
ATOM 1218  O O    . TYR A 1 82 ? 1.481   2.513   -8.255  1.00 0.77 ? 82  TYR A O    1  
ATOM 1219  C CB   . TYR A 1 82 ? 1.522   4.463   -10.359 1.00 0.85 ? 82  TYR A CB   1  
ATOM 1220  C CG   . TYR A 1 82 ? 0.164   4.252   -10.987 1.00 0.93 ? 82  TYR A CG   1  
ATOM 1221  C CD1  . TYR A 1 82 ? -0.447  3.007   -10.946 1.00 1.57 ? 82  TYR A CD1  1  
ATOM 1222  C CD2  . TYR A 1 82 ? -0.507  5.292   -11.620 1.00 1.41 ? 82  TYR A CD2  1  
ATOM 1223  C CE1  . TYR A 1 82 ? -1.685  2.801   -11.516 1.00 1.72 ? 82  TYR A CE1  1  
ATOM 1224  C CE2  . TYR A 1 82 ? -1.748  5.094   -12.192 1.00 1.55 ? 82  TYR A CE2  1  
ATOM 1225  C CZ   . TYR A 1 82 ? -2.334  3.848   -12.137 1.00 1.33 ? 82  TYR A CZ   1  
ATOM 1226  O OH   . TYR A 1 82 ? -3.570  3.646   -12.705 1.00 1.58 ? 82  TYR A OH   1  
ATOM 1227  H H    . TYR A 1 82 ? 3.585   4.909   -8.731  1.00 0.85 ? 82  TYR A H    1  
ATOM 1228  H HA   . TYR A 1 82 ? 0.743   5.629   -8.746  1.00 0.64 ? 82  TYR A HA   1  
ATOM 1229  H HB2  . TYR A 1 82 ? 2.022   5.251   -10.903 1.00 0.88 ? 82  TYR A HB2  1  
ATOM 1230  H HB3  . TYR A 1 82 ? 2.077   3.545   -10.466 1.00 0.99 ? 82  TYR A HB3  1  
ATOM 1231  H HD1  . TYR A 1 82 ? 0.062   2.188   -10.459 1.00 2.27 ? 82  TYR A HD1  1  
ATOM 1232  H HD2  . TYR A 1 82 ? -0.046  6.267   -11.663 1.00 2.08 ? 82  TYR A HD2  1  
ATOM 1233  H HE1  . TYR A 1 82 ? -2.138  1.826   -11.473 1.00 2.47 ? 82  TYR A HE1  1  
ATOM 1234  H HE2  . TYR A 1 82 ? -2.253  5.913   -12.678 1.00 2.24 ? 82  TYR A HE2  1  
ATOM 1235  H HH   . TYR A 1 82 ? -3.464  3.260   -13.578 1.00 1.97 ? 82  TYR A HH   1  
ATOM 1236  N N    . LEU A 1 83 ? 0.159   3.913   -7.077  1.00 0.62 ? 83  LEU A N    1  
ATOM 1237  C CA   . LEU A 1 83 ? -0.342  2.886   -6.173  1.00 0.65 ? 83  LEU A CA   1  
ATOM 1238  C C    . LEU A 1 83 ? -1.587  2.199   -6.730  1.00 0.66 ? 83  LEU A C    1  
ATOM 1239  O O    . LEU A 1 83 ? -2.561  2.857   -7.100  1.00 0.71 ? 83  LEU A O    1  
ATOM 1240  C CB   . LEU A 1 83 ? -0.654  3.501   -4.806  1.00 0.74 ? 83  LEU A CB   1  
ATOM 1241  C CG   . LEU A 1 83 ? -0.961  2.495   -3.694  1.00 0.74 ? 83  LEU A CG   1  
ATOM 1242  C CD1  . LEU A 1 83 ? 0.266   2.265   -2.825  1.00 1.34 ? 83  LEU A CD1  1  
ATOM 1243  C CD2  . LEU A 1 83 ? -2.132  2.981   -2.853  1.00 1.38 ? 83  LEU A CD2  1  
ATOM 1244  H H    . LEU A 1 83 ? -0.129  4.840   -6.954  1.00 0.62 ? 83  LEU A H    1  
ATOM 1245  H HA   . LEU A 1 83 ? 0.435   2.146   -6.051  1.00 0.69 ? 83  LEU A HA   1  
ATOM 1246  H HB2  . LEU A 1 83 ? 0.195   4.095   -4.502  1.00 0.88 ? 83  LEU A HB2  1  
ATOM 1247  H HB3  . LEU A 1 83 ? -1.507  4.153   -4.916  1.00 0.80 ? 83  LEU A HB3  1  
ATOM 1248  H HG   . LEU A 1 83 ? -1.238  1.550   -4.138  1.00 1.48 ? 83  LEU A HG   1  
ATOM 1249  H HD11 . LEU A 1 83 ? 0.701   3.217   -2.556  1.00 1.81 ? 83  LEU A HD11 1  
ATOM 1250  H HD12 . LEU A 1 83 ? 0.990   1.681   -3.373  1.00 1.91 ? 83  LEU A HD12 1  
ATOM 1251  H HD13 . LEU A 1 83 ? -0.020  1.735   -1.930  1.00 1.85 ? 83  LEU A HD13 1  
ATOM 1252  H HD21 . LEU A 1 83 ? -2.392  2.226   -2.127  1.00 1.83 ? 83  LEU A HD21 1  
ATOM 1253  H HD22 . LEU A 1 83 ? -2.979  3.172   -3.493  1.00 2.00 ? 83  LEU A HD22 1  
ATOM 1254  H HD23 . LEU A 1 83 ? -1.854  3.892   -2.342  1.00 1.85 ? 83  LEU A HD23 1  
ATOM 1255  N N    . LYS A 1 84 ? -1.548  0.869   -6.762  1.00 0.66 ? 84  LYS A N    1  
ATOM 1256  C CA   . LYS A 1 84 ? -2.666  0.065   -7.241  1.00 0.68 ? 84  LYS A CA   1  
ATOM 1257  C C    . LYS A 1 84 ? -3.259  -0.721  -6.084  1.00 0.65 ? 84  LYS A C    1  
ATOM 1258  O O    . LYS A 1 84 ? -2.599  -1.587  -5.516  1.00 0.68 ? 84  LYS A O    1  
ATOM 1259  C CB   . LYS A 1 84 ? -2.225  -0.884  -8.360  1.00 0.69 ? 84  LYS A CB   1  
ATOM 1260  C CG   . LYS A 1 84 ? -1.982  -0.188  -9.689  1.00 0.76 ? 84  LYS A CG   1  
ATOM 1261  C CD   . LYS A 1 84 ? -3.104  -0.462  -10.678 1.00 0.99 ? 84  LYS A CD   1  
ATOM 1262  C CE   . LYS A 1 84 ? -4.339  0.372   -10.369 1.00 1.18 ? 84  LYS A CE   1  
ATOM 1263  N NZ   . LYS A 1 84 ? -5.397  -0.428  -9.689  1.00 1.56 ? 84  LYS A NZ   1  
ATOM 1264  H H    . LYS A 1 84 ? -0.745  0.412   -6.433  1.00 0.68 ? 84  LYS A H    1  
ATOM 1265  H HA   . LYS A 1 84 ? -3.415  0.728   -7.621  1.00 0.72 ? 84  LYS A HA   1  
ATOM 1266  H HB2  . LYS A 1 84 ? -1.314  -1.377  -8.064  1.00 0.66 ? 84  LYS A HB2  1  
ATOM 1267  H HB3  . LYS A 1 84 ? -2.994  -1.630  -8.505  1.00 0.73 ? 84  LYS A HB3  1  
ATOM 1268  H HG2  . LYS A 1 84 ? -1.917  0.877   -9.520  1.00 0.93 ? 84  LYS A HG2  1  
ATOM 1269  H HG3  . LYS A 1 84 ? -1.051  -0.545  -10.106 1.00 0.86 ? 84  LYS A HG3  1  
ATOM 1270  H HD2  . LYS A 1 84 ? -2.760  -0.220  -11.673 1.00 1.65 ? 84  LYS A HD2  1  
ATOM 1271  H HD3  . LYS A 1 84 ? -3.366  -1.508  -10.631 1.00 1.42 ? 84  LYS A HD3  1  
ATOM 1272  H HE2  . LYS A 1 84 ? -4.054  1.191   -9.727  1.00 1.51 ? 84  LYS A HE2  1  
ATOM 1273  H HE3  . LYS A 1 84 ? -4.735  0.762   -11.295 1.00 1.85 ? 84  LYS A HE3  1  
ATOM 1274  H HZ1  . LYS A 1 84 ? -5.705  -1.210  -10.303 1.00 2.19 ? 84  LYS A HZ1  1  
ATOM 1275  H HZ2  . LYS A 1 84 ? -6.218  0.174   -9.476  1.00 1.68 ? 84  LYS A HZ2  1  
ATOM 1276  H HZ3  . LYS A 1 84 ? -5.033  -0.824  -8.799  1.00 2.00 ? 84  LYS A HZ3  1  
ATOM 1277  N N    . VAL A 1 85 ? -4.497  -0.396  -5.720  1.00 0.76 ? 85  VAL A N    1  
ATOM 1278  C CA   . VAL A 1 85 ? -5.167  -1.061  -4.609  1.00 0.74 ? 85  VAL A CA   1  
ATOM 1279  C C    . VAL A 1 85 ? -6.281  -1.982  -5.107  1.00 0.91 ? 85  VAL A C    1  
ATOM 1280  O O    . VAL A 1 85 ? -7.087  -1.591  -5.952  1.00 1.17 ? 85  VAL A O    1  
ATOM 1281  C CB   . VAL A 1 85 ? -5.759  -0.028  -3.619  1.00 0.99 ? 85  VAL A CB   1  
ATOM 1282  C CG1  . VAL A 1 85 ? -6.352  -0.710  -2.394  1.00 1.92 ? 85  VAL A CG1  1  
ATOM 1283  C CG2  . VAL A 1 85 ? -4.700  0.985   -3.209  1.00 0.65 ? 85  VAL A CG2  1  
ATOM 1284  H H    . VAL A 1 85 ? -4.967  0.322   -6.194  1.00 0.92 ? 85  VAL A H    1  
ATOM 1285  H HA   . VAL A 1 85 ? -4.429  -1.653  -4.084  1.00 0.62 ? 85  VAL A HA   1  
ATOM 1286  H HB   . VAL A 1 85 ? -6.552  0.504   -4.124  1.00 1.45 ? 85  VAL A HB   1  
ATOM 1287  H HG11 . VAL A 1 85 ? -5.629  -0.695  -1.588  1.00 2.23 ? 85  VAL A HG11 1  
ATOM 1288  H HG12 . VAL A 1 85 ? -6.598  -1.734  -2.633  1.00 2.51 ? 85  VAL A HG12 1  
ATOM 1289  H HG13 . VAL A 1 85 ? -7.245  -0.188  -2.087  1.00 2.42 ? 85  VAL A HG13 1  
ATOM 1290  H HG21 . VAL A 1 85 ? -5.051  1.550   -2.359  1.00 1.26 ? 85  VAL A HG21 1  
ATOM 1291  H HG22 . VAL A 1 85 ? -4.504  1.656   -4.033  1.00 1.21 ? 85  VAL A HG22 1  
ATOM 1292  H HG23 . VAL A 1 85 ? -3.789  0.466   -2.944  1.00 1.21 ? 85  VAL A HG23 1  
ATOM 1293  N N    . ALA A 1 86 ? -6.320  -3.204  -4.573  1.00 0.91 ? 86  ALA A N    1  
ATOM 1294  C CA   . ALA A 1 86 ? -7.338  -4.181  -4.958  1.00 1.24 ? 86  ALA A CA   1  
ATOM 1295  C C    . ALA A 1 86 ? -8.566  -4.082  -4.055  1.00 1.27 ? 86  ALA A C    1  
ATOM 1296  O O    . ALA A 1 86 ? -8.450  -3.767  -2.868  1.00 1.09 ? 86  ALA A O    1  
ATOM 1297  C CB   . ALA A 1 86 ? -6.767  -5.592  -4.917  1.00 1.46 ? 86  ALA A CB   1  
ATOM 1298  H H    . ALA A 1 86 ? -5.652  -3.454  -3.899  1.00 0.76 ? 86  ALA A H    1  
ATOM 1299  H HA   . ALA A 1 86 ? -7.636  -3.968  -5.976  1.00 1.52 ? 86  ALA A HA   1  
ATOM 1300  H HB1  . ALA A 1 86 ? -5.948  -5.629  -4.214  1.00 1.81 ? 86  ALA A HB1  1  
ATOM 1301  H HB2  . ALA A 1 86 ? -6.410  -5.864  -5.899  1.00 2.07 ? 86  ALA A HB2  1  
ATOM 1302  H HB3  . ALA A 1 86 ? -7.537  -6.284  -4.610  1.00 1.62 ? 86  ALA A HB3  1  
ATOM 1303  N N    . LYS A 1 87 ? -9.740  -4.363  -4.620  1.00 1.68 ? 87  LYS A N    1  
ATOM 1304  C CA   . LYS A 1 87 ? -10.989 -4.315  -3.863  1.00 1.86 ? 87  LYS A CA   1  
ATOM 1305  C C    . LYS A 1 87 ? -11.338 -5.698  -3.313  1.00 1.91 ? 87  LYS A C    1  
ATOM 1306  O O    . LYS A 1 87 ? -11.583 -6.636  -4.075  1.00 2.04 ? 87  LYS A O    1  
ATOM 1307  C CB   . LYS A 1 87 ? -12.135 -3.778  -4.734  1.00 2.22 ? 87  LYS A CB   1  
ATOM 1308  C CG   . LYS A 1 87 ? -12.436 -4.622  -5.966  1.00 2.53 ? 87  LYS A CG   1  
ATOM 1309  C CD   . LYS A 1 87 ? -13.037 -3.786  -7.087  1.00 2.89 ? 87  LYS A CD   1  
ATOM 1310  C CE   . LYS A 1 87 ? -14.546 -3.645  -6.937  1.00 3.28 ? 87  LYS A CE   1  
ATOM 1311  N NZ   . LYS A 1 87 ? -14.923 -2.385  -6.238  1.00 4.20 ? 87  LYS A NZ   1  
ATOM 1312  H H    . LYS A 1 87 ? -9.766  -4.616  -5.567  1.00 1.92 ? 87  LYS A H    1  
ATOM 1313  H HA   . LYS A 1 87 ? -10.840 -3.641  -3.033  1.00 1.79 ? 87  LYS A HA   1  
ATOM 1314  H HB2  . LYS A 1 87 ? -13.031 -3.727  -4.134  1.00 2.44 ? 87  LYS A HB2  1  
ATOM 1315  H HB3  . LYS A 1 87 ? -11.880 -2.781  -5.064  1.00 2.56 ? 87  LYS A HB3  1  
ATOM 1316  H HG2  . LYS A 1 87 ? -11.519 -5.071  -6.318  1.00 2.95 ? 87  LYS A HG2  1  
ATOM 1317  H HG3  . LYS A 1 87 ? -13.137 -5.399  -5.694  1.00 2.69 ? 87  LYS A HG3  1  
ATOM 1318  H HD2  . LYS A 1 87 ? -12.590 -2.803  -7.068  1.00 3.05 ? 87  LYS A HD2  1  
ATOM 1319  H HD3  . LYS A 1 87 ? -12.821 -4.263  -8.032  1.00 3.28 ? 87  LYS A HD3  1  
ATOM 1320  H HE2  . LYS A 1 87 ? -14.993 -3.649  -7.920  1.00 3.46 ? 87  LYS A HE2  1  
ATOM 1321  H HE3  . LYS A 1 87 ? -14.918 -4.487  -6.371  1.00 3.29 ? 87  LYS A HE3  1  
ATOM 1322  H HZ1  . LYS A 1 87 ? -14.515 -1.565  -6.732  1.00 4.41 ? 87  LYS A HZ1  1  
ATOM 1323  H HZ2  . LYS A 1 87 ? -14.568 -2.398  -5.260  1.00 4.48 ? 87  LYS A HZ2  1  
ATOM 1324  H HZ3  . LYS A 1 87 ? -15.958 -2.284  -6.218  1.00 4.70 ? 87  LYS A HZ3  1  
ATOM 1325  N N    . PRO A 1 88 ? -11.353 -5.847  -1.973  1.00 1.88 ? 88  PRO A N    1  
ATOM 1326  C CA   . PRO A 1 88 ? -11.662 -7.128  -1.325  1.00 2.01 ? 88  PRO A CA   1  
ATOM 1327  C C    . PRO A 1 88 ? -13.133 -7.522  -1.476  1.00 2.20 ? 88  PRO A C    1  
ATOM 1328  O O    . PRO A 1 88 ? -14.024 -6.817  -0.997  1.00 2.28 ? 88  PRO A O    1  
ATOM 1329  C CB   . PRO A 1 88 ? -11.321 -6.873  0.146   1.00 1.98 ? 88  PRO A CB   1  
ATOM 1330  C CG   . PRO A 1 88 ? -11.463 -5.400  0.322   1.00 1.91 ? 88  PRO A CG   1  
ATOM 1331  C CD   . PRO A 1 88 ? -11.059 -4.786  -0.990  1.00 1.79 ? 88  PRO A CD   1  
ATOM 1332  H HA   . PRO A 1 88 ? -11.034 -7.920  -1.707  1.00 2.04 ? 88  PRO A HA   1  
ATOM 1333  H HB2  . PRO A 1 88 ? -12.011 -7.414  0.778   1.00 2.18 ? 88  PRO A HB2  1  
ATOM 1334  H HB3  . PRO A 1 88 ? -10.312 -7.197  0.346   1.00 1.96 ? 88  PRO A HB3  1  
ATOM 1335  H HG2  . PRO A 1 88 ? -12.490 -5.155  0.550   1.00 2.24 ? 88  PRO A HG2  1  
ATOM 1336  H HG3  . PRO A 1 88 ? -10.810 -5.060  1.112   1.00 1.85 ? 88  PRO A HG3  1  
ATOM 1337  H HD2  . PRO A 1 88 ? -11.647 -3.902  -1.189  1.00 1.89 ? 88  PRO A HD2  1  
ATOM 1338  H HD3  . PRO A 1 88 ? -10.006 -4.546  -0.985  1.00 1.68 ? 88  PRO A HD3  1  
ATOM 1339  N N    . THR A 1 89 ? -13.382 -8.651  -2.146  1.00 2.38 ? 89  THR A N    1  
ATOM 1340  C CA   . THR A 1 89 ? -14.744 -9.137  -2.357  1.00 2.59 ? 89  THR A CA   1  
ATOM 1341  C C    . THR A 1 89 ? -14.840 -10.625 -2.015  1.00 2.77 ? 89  THR A C    1  
ATOM 1342  O O    . THR A 1 89 ? -15.546 -11.009 -1.081  1.00 3.51 ? 89  THR A O    1  
ATOM 1343  C CB   . THR A 1 89 ? -15.181 -8.897  -3.808  1.00 3.08 ? 89  THR A CB   1  
ATOM 1344  O OG1  . THR A 1 89 ? -14.981 -7.541  -4.178  1.00 3.51 ? 89  THR A OG1  1  
ATOM 1345  C CG2  . THR A 1 89 ? -16.637 -9.232  -4.062  1.00 3.88 ? 89  THR A CG2  1  
ATOM 1346  H H    . THR A 1 89 ? -12.636 -9.170  -2.511  1.00 2.41 ? 89  THR A H    1  
ATOM 1347  H HA   . THR A 1 89 ? -15.399 -8.588  -1.697  1.00 2.82 ? 89  THR A HA   1  
ATOM 1348  H HB   . THR A 1 89 ? -14.581 -9.517  -4.460  1.00 3.20 ? 89  THR A HB   1  
ATOM 1349  H HG1  . THR A 1 89 ? -15.436 -6.967  -3.557  1.00 3.87 ? 89  THR A HG1  1  
ATOM 1350  H HG21 . THR A 1 89 ? -17.251 -8.758  -3.312  1.00 4.03 ? 89  THR A HG21 1  
ATOM 1351  H HG22 . THR A 1 89 ? -16.773 -10.303 -4.016  1.00 4.36 ? 89  THR A HG22 1  
ATOM 1352  H HG23 . THR A 1 89 ? -16.922 -8.876  -5.041  1.00 4.30 ? 89  THR A HG23 1  
ATOM 1353  N N    . GLY A 1 90 ? -14.120 -11.454 -2.776  1.00 2.75 ? 90  GLY A N    1  
ATOM 1354  C CA   . GLY A 1 90 ? -14.125 -12.889 -2.541  1.00 3.54 ? 90  GLY A CA   1  
ATOM 1355  C C    . GLY A 1 90 ? -15.415 -13.562 -2.981  1.00 4.20 ? 90  GLY A C    1  
ATOM 1356  O O    . GLY A 1 90 ? -16.439 -12.901 -3.169  1.00 4.69 ? 90  GLY A O    1  
ATOM 1357  H H    . GLY A 1 90 ? -13.573 -11.085 -3.501  1.00 2.65 ? 90  GLY A H    1  
ATOM 1358  H HA2  . GLY A 1 90 ? -13.302 -13.331 -3.083  1.00 3.91 ? 90  GLY A HA2  1  
ATOM 1359  H HA3  . GLY A 1 90 ? -13.981 -13.069 -1.487  1.00 3.79 ? 90  GLY A HA3  1  
ATOM 1360  N N    . SER A 1 91 ? -15.362 -14.885 -3.140  1.00 4.69 ? 91  SER A N    1  
ATOM 1361  C CA   . SER A 1 91 ? -16.528 -15.663 -3.554  1.00 5.64 ? 91  SER A CA   1  
ATOM 1362  C C    . SER A 1 91 ? -17.191 -16.332 -2.350  1.00 5.73 ? 91  SER A C    1  
ATOM 1363  O O    . SER A 1 91 ? -18.414 -16.299 -2.209  1.00 6.47 ? 91  SER A O    1  
ATOM 1364  C CB   . SER A 1 91 ? -16.123 -16.722 -4.585  1.00 6.57 ? 91  SER A CB   1  
ATOM 1365  O OG   . SER A 1 91 ? -16.994 -16.706 -5.703  1.00 7.06 ? 91  SER A OG   1  
ATOM 1366  H H    . SER A 1 91 ? -14.517 -15.352 -2.969  1.00 4.66 ? 91  SER A H    1  
ATOM 1367  H HA   . SER A 1 91 ? -17.237 -14.985 -4.007  1.00 5.94 ? 91  SER A HA   1  
ATOM 1368  H HB2  . SER A 1 91 ? -15.119 -16.524 -4.925  1.00 6.78 ? 91  SER A HB2  1  
ATOM 1369  H HB3  . SER A 1 91 ? -16.162 -17.701 -4.128  1.00 6.97 ? 91  SER A HB3  1  
ATOM 1370  H HG   . SER A 1 91 ? -16.620 -16.154 -6.394  1.00 7.36 ? 91  SER A HG   1  
ATOM 1371  N N    . HIS A 1 92 ? -16.373 -16.937 -1.484  1.00 5.26 ? 92  HIS A N    1  
ATOM 1372  C CA   . HIS A 1 92 ? -16.876 -17.612 -0.288  1.00 5.60 ? 92  HIS A CA   1  
ATOM 1373  C C    . HIS A 1 92 ? -17.286 -16.599 0.780   1.00 5.37 ? 92  HIS A C    1  
ATOM 1374  O O    . HIS A 1 92 ? -16.529 -15.687 1.112   1.00 5.46 ? 92  HIS A O    1  
ATOM 1375  C CB   . HIS A 1 92 ? -15.813 -18.564 0.272   1.00 5.86 ? 92  HIS A CB   1  
ATOM 1376  C CG   . HIS A 1 92 ? -16.316 -19.457 1.366   1.00 6.59 ? 92  HIS A CG   1  
ATOM 1377  N ND1  . HIS A 1 92 ? -17.278 -20.426 1.167   1.00 7.09 ? 92  HIS A ND1  1  
ATOM 1378  C CD2  . HIS A 1 92 ? -15.981 -19.526 2.677   1.00 7.14 ? 92  HIS A CD2  1  
ATOM 1379  C CE1  . HIS A 1 92 ? -17.513 -21.051 2.308   1.00 7.83 ? 92  HIS A CE1  1  
ATOM 1380  N NE2  . HIS A 1 92 ? -16.739 -20.524 3.239   1.00 7.84 ? 92  HIS A NE2  1  
ATOM 1381  H H    . HIS A 1 92 ? -15.407 -16.926 -1.653  1.00 4.89 ? 92  HIS A H    1  
ATOM 1382  H HA   . HIS A 1 92 ? -17.744 -18.187 -0.574  1.00 6.24 ? 92  HIS A HA   1  
ATOM 1383  H HB2  . HIS A 1 92 ? -15.447 -19.192 -0.526  1.00 5.88 ? 92  HIS A HB2  1  
ATOM 1384  H HB3  . HIS A 1 92 ? -14.993 -17.982 0.668   1.00 5.88 ? 92  HIS A HB3  1  
ATOM 1385  H HD1  . HIS A 1 92 ? -17.723 -20.625 0.317   1.00 7.08 ? 92  HIS A HD1  1  
ATOM 1386  H HD2  . HIS A 1 92 ? -15.255 -18.909 3.186   1.00 7.21 ? 92  HIS A HD2  1  
ATOM 1387  H HE1  . HIS A 1 92 ? -18.218 -21.855 2.454   1.00 8.46 ? 92  HIS A HE1  1  
ATOM 1388  H HE2  . HIS A 1 92 ? -16.642 -20.867 4.152   1.00 8.38 ? 92  HIS A HE2  1  
ATOM 1389  N N    . ARG B 2 1  ? 3.338   -12.246 11.964  1.00 1.88 ? 301 ARG B N    1  
ATOM 1390  C CA   . ARG B 2 1  ? 2.879   -10.920 11.461  1.00 1.27 ? 301 ARG B CA   1  
ATOM 1391  C C    . ARG B 2 1  ? 3.927   -9.836  11.718  1.00 1.29 ? 301 ARG B C    1  
ATOM 1392  O O    . ARG B 2 1  ? 4.519   -9.779  12.798  1.00 2.06 ? 301 ARG B O    1  
ATOM 1393  C CB   . ARG B 2 1  ? 1.564   -10.551 12.160  1.00 1.61 ? 301 ARG B CB   1  
ATOM 1394  C CG   . ARG B 2 1  ? 0.412   -11.495 11.845  1.00 2.13 ? 301 ARG B CG   1  
ATOM 1395  C CD   . ARG B 2 1  ? -0.642  -11.471 12.942  1.00 2.72 ? 301 ARG B CD   1  
ATOM 1396  N NE   . ARG B 2 1  ? -0.202  -12.176 14.148  1.00 3.09 ? 301 ARG B NE   1  
ATOM 1397  C CZ   . ARG B 2 1  ? -0.716  -11.972 15.364  1.00 3.70 ? 301 ARG B CZ   1  
ATOM 1398  N NH1  . ARG B 2 1  ? -1.696  -11.089 15.545  1.00 4.18 ? 301 ARG B NH1  1  
ATOM 1399  N NH2  . ARG B 2 1  ? -0.250  -12.658 16.403  1.00 4.22 ? 301 ARG B NH2  1  
ATOM 1400  H H1   . ARG B 2 1  ? 4.323   -12.380 11.656  1.00 2.43 ? 301 ARG B H1   1  
ATOM 1401  H H2   . ARG B 2 1  ? 2.717   -12.974 11.555  1.00 1.96 ? 301 ARG B H2   1  
ATOM 1402  H H3   . ARG B 2 1  ? 3.271   -12.236 13.002  1.00 2.41 ? 301 ARG B H3   1  
ATOM 1403  H HA   . ARG B 2 1  ? 2.707   -10.998 10.398  1.00 1.25 ? 301 ARG B HA   1  
ATOM 1404  H HB2  . ARG B 2 1  ? 1.724   -10.559 13.227  1.00 1.79 ? 301 ARG B HB2  1  
ATOM 1405  H HB3  . ARG B 2 1  ? 1.277   -9.555  11.856  1.00 2.19 ? 301 ARG B HB3  1  
ATOM 1406  H HG2  . ARG B 2 1  ? -0.044  -11.193 10.916  1.00 2.63 ? 301 ARG B HG2  1  
ATOM 1407  H HG3  . ARG B 2 1  ? 0.797   -12.500 11.751  1.00 2.48 ? 301 ARG B HG3  1  
ATOM 1408  H HD2  . ARG B 2 1  ? -0.856  -10.443 13.193  1.00 3.13 ? 301 ARG B HD2  1  
ATOM 1409  H HD3  . ARG B 2 1  ? -1.539  -11.943 12.568  1.00 3.11 ? 301 ARG B HD3  1  
ATOM 1410  H HE   . ARG B 2 1  ? 0.517   -12.836 14.047  1.00 3.22 ? 301 ARG B HE   1  
ATOM 1411  H HH11 . ARG B 2 1  ? -2.056  -10.573 14.768  1.00 4.11 ? 301 ARG B HH11 1  
ATOM 1412  H HH12 . ARG B 2 1  ? -2.074  -10.944 16.460  1.00 4.83 ? 301 ARG B HH12 1  
ATOM 1413  H HH21 . ARG B 2 1  ? 0.484   -13.325 16.274  1.00 4.29 ? 301 ARG B HH21 1  
ATOM 1414  H HH22 . ARG B 2 1  ? -0.632  -12.507 17.315  1.00 4.75 ? 301 ARG B HH22 1  
ATOM 1415  N N    . ARG B 2 2  ? 4.147   -8.977  10.721  1.00 1.12 ? 302 ARG B N    1  
ATOM 1416  C CA   . ARG B 2 2  ? 5.120   -7.892  10.839  1.00 1.03 ? 302 ARG B CA   1  
ATOM 1417  C C    . ARG B 2 2  ? 4.614   -6.626  10.153  1.00 1.02 ? 302 ARG B C    1  
ATOM 1418  O O    . ARG B 2 2  ? 4.198   -6.659  8.993   1.00 1.45 ? 302 ARG B O    1  
ATOM 1419  C CB   . ARG B 2 2  ? 6.467   -8.305  10.238  1.00 1.13 ? 302 ARG B CB   1  
ATOM 1420  C CG   . ARG B 2 2  ? 7.584   -7.299  10.504  1.00 1.12 ? 302 ARG B CG   1  
ATOM 1421  C CD   . ARG B 2 2  ? 8.965   -7.938  10.423  1.00 1.50 ? 302 ARG B CD   1  
ATOM 1422  N NE   . ARG B 2 2  ? 9.256   -8.466  9.091   1.00 2.09 ? 302 ARG B NE   1  
ATOM 1423  C CZ   . ARG B 2 2  ? 9.745   -7.736  8.083   1.00 2.72 ? 302 ARG B CZ   1  
ATOM 1424  N NH1  . ARG B 2 2  ? 9.964   -6.432  8.235   1.00 2.99 ? 302 ARG B NH1  1  
ATOM 1425  N NH2  . ARG B 2 2  ? 10.014  -8.316  6.918   1.00 3.57 ? 302 ARG B NH2  1  
ATOM 1426  H H    . ARG B 2 2  ? 3.642   -9.073  9.887   1.00 1.61 ? 302 ARG B H    1  
ATOM 1427  H HA   . ARG B 2 2  ? 5.255   -7.684  11.890  1.00 1.03 ? 302 ARG B HA   1  
ATOM 1428  H HB2  . ARG B 2 2  ? 6.759   -9.257  10.654  1.00 1.20 ? 302 ARG B HB2  1  
ATOM 1429  H HB3  . ARG B 2 2  ? 6.355   -8.406  9.169   1.00 1.34 ? 302 ARG B HB3  1  
ATOM 1430  H HG2  . ARG B 2 2  ? 7.523   -6.510  9.770   1.00 1.33 ? 302 ARG B HG2  1  
ATOM 1431  H HG3  . ARG B 2 2  ? 7.448   -6.883  11.491  1.00 1.30 ? 302 ARG B HG3  1  
ATOM 1432  H HD2  . ARG B 2 2  ? 9.705   -7.191  10.669  1.00 1.82 ? 302 ARG B HD2  1  
ATOM 1433  H HD3  . ARG B 2 2  ? 9.020   -8.744  11.140  1.00 1.86 ? 302 ARG B HD3  1  
ATOM 1434  H HE   . ARG B 2 2  ? 9.092   -9.421  8.940   1.00 2.48 ? 302 ARG B HE   1  
ATOM 1435  H HH11 . ARG B 2 2  ? 9.762   -5.986  9.107   1.00 2.71 ? 302 ARG B HH11 1  
ATOM 1436  H HH12 . ARG B 2 2  ? 10.332  -5.895  7.475   1.00 3.75 ? 302 ARG B HH12 1  
ATOM 1437  H HH21 . ARG B 2 2  ? 9.853   -9.296  6.797   1.00 3.78 ? 302 ARG B HH21 1  
ATOM 1438  H HH22 . ARG B 2 2  ? 10.376  -7.772  6.160   1.00 4.18 ? 302 ARG B HH22 1  
ATOM 1439  N N    . GLU B 2 3  ? 4.658   -5.511  10.881  1.00 0.69 ? 303 GLU B N    1  
ATOM 1440  C CA   . GLU B 2 3  ? 4.211   -4.225  10.355  1.00 0.66 ? 303 GLU B CA   1  
ATOM 1441  C C    . GLU B 2 3  ? 5.320   -3.183  10.489  1.00 0.71 ? 303 GLU B C    1  
ATOM 1442  O O    . GLU B 2 3  ? 5.661   -2.766  11.598  1.00 1.16 ? 303 GLU B O    1  
ATOM 1443  C CB   . GLU B 2 3  ? 2.949   -3.758  11.090  1.00 0.71 ? 303 GLU B CB   1  
ATOM 1444  C CG   . GLU B 2 3  ? 1.890   -4.845  11.235  1.00 1.12 ? 303 GLU B CG   1  
ATOM 1445  C CD   . GLU B 2 3  ? 0.828   -4.501  12.265  1.00 1.54 ? 303 GLU B CD   1  
ATOM 1446  O OE1  . GLU B 2 3  ? 1.166   -4.423  13.465  1.00 2.08 ? 303 GLU B OE1  1  
ATOM 1447  O OE2  . GLU B 2 3  ? -0.342  -4.317  11.871  1.00 1.99 ? 303 GLU B OE2  1  
ATOM 1448  H H    . GLU B 2 3  ? 5.003   -5.554  11.798  1.00 0.73 ? 303 GLU B H    1  
ATOM 1449  H HA   . GLU B 2 3  ? 3.981   -4.357  9.307   1.00 0.62 ? 303 GLU B HA   1  
ATOM 1450  H HB2  . GLU B 2 3  ? 3.226   -3.422  12.077  1.00 1.19 ? 303 GLU B HB2  1  
ATOM 1451  H HB3  . GLU B 2 3  ? 2.514   -2.933  10.547  1.00 0.81 ? 303 GLU B HB3  1  
ATOM 1452  H HG2  . GLU B 2 3  ? 1.408   -4.990  10.280  1.00 1.28 ? 303 GLU B HG2  1  
ATOM 1453  H HG3  . GLU B 2 3  ? 2.374   -5.763  11.533  1.00 1.65 ? 303 GLU B HG3  1  
ATOM 1454  N N    . THR B 2 4  ? 5.890   -2.781  9.353   1.00 0.55 ? 304 THR B N    1  
ATOM 1455  C CA   . THR B 2 4  ? 6.972   -1.801  9.340   1.00 0.55 ? 304 THR B CA   1  
ATOM 1456  C C    . THR B 2 4  ? 6.532   -0.500  8.672   1.00 0.53 ? 304 THR B C    1  
ATOM 1457  O O    . THR B 2 4  ? 5.761   -0.516  7.709   1.00 0.54 ? 304 THR B O    1  
ATOM 1458  C CB   . THR B 2 4  ? 8.200   -2.393  8.628   1.00 0.55 ? 304 THR B CB   1  
ATOM 1459  O OG1  . THR B 2 4  ? 9.209   -2.727  9.564   1.00 0.65 ? 304 THR B OG1  1  
ATOM 1460  C CG2  . THR B 2 4  ? 8.826   -1.478  7.594   1.00 0.56 ? 304 THR B CG2  1  
ATOM 1461  H H    . THR B 2 4  ? 5.581   -3.158  8.503   1.00 0.76 ? 304 THR B H    1  
ATOM 1462  H HA   . THR B 2 4  ? 7.236   -1.589  10.365  1.00 0.59 ? 304 THR B HA   1  
ATOM 1463  H HB   . THR B 2 4  ? 7.901   -3.298  8.121   1.00 0.56 ? 304 THR B HB   1  
ATOM 1464  H HG1  . THR B 2 4  ? 9.268   -3.682  9.645   1.00 0.96 ? 304 THR B HG1  1  
ATOM 1465  H HG21 . THR B 2 4  ? 9.105   -0.546  8.062   1.00 1.05 ? 304 THR B HG21 1  
ATOM 1466  H HG22 . THR B 2 4  ? 8.113   -1.288  6.806   1.00 1.13 ? 304 THR B HG22 1  
ATOM 1467  H HG23 . THR B 2 4  ? 9.703   -1.951  7.179   1.00 1.23 ? 304 THR B HG23 1  
ATOM 1468  N N    . GLN B 2 5  ? 7.041   0.623   9.180   1.00 0.58 ? 305 GLN B N    1  
ATOM 1469  C CA   . GLN B 2 5  ? 6.714   1.933   8.623   1.00 0.60 ? 305 GLN B CA   1  
ATOM 1470  C C    . GLN B 2 5  ? 7.544   2.204   7.373   1.00 0.58 ? 305 GLN B C    1  
ATOM 1471  O O    . GLN B 2 5  ? 8.650   1.681   7.224   1.00 0.74 ? 305 GLN B O    1  
ATOM 1472  C CB   . GLN B 2 5  ? 6.947   3.042   9.651   1.00 0.76 ? 305 GLN B CB   1  
ATOM 1473  C CG   . GLN B 2 5  ? 5.689   3.448   10.404  1.00 0.89 ? 305 GLN B CG   1  
ATOM 1474  C CD   . GLN B 2 5  ? 5.975   4.402   11.550  1.00 1.13 ? 305 GLN B CD   1  
ATOM 1475  O OE1  . GLN B 2 5  ? 6.528   5.483   11.349  1.00 1.67 ? 305 GLN B OE1  1  
ATOM 1476  N NE2  . GLN B 2 5  ? 5.597   4.007   12.761  1.00 1.50 ? 305 GLN B NE2  1  
ATOM 1477  H H    . GLN B 2 5  ? 7.660   0.569   9.939   1.00 0.64 ? 305 GLN B H    1  
ATOM 1478  H HA   . GLN B 2 5  ? 5.670   1.922   8.349   1.00 0.57 ? 305 GLN B HA   1  
ATOM 1479  H HB2  . GLN B 2 5  ? 7.681   2.707   10.370  1.00 0.76 ? 305 GLN B HB2  1  
ATOM 1480  H HB3  . GLN B 2 5  ? 7.328   3.913   9.137   1.00 0.88 ? 305 GLN B HB3  1  
ATOM 1481  H HG2  . GLN B 2 5  ? 5.014   3.932   9.714   1.00 0.96 ? 305 GLN B HG2  1  
ATOM 1482  H HG3  . GLN B 2 5  ? 5.221   2.560   10.802  1.00 0.87 ? 305 GLN B HG3  1  
ATOM 1483  H HE21 . GLN B 2 5  ? 5.159   3.134   12.852  1.00 1.97 ? 305 GLN B HE21 1  
ATOM 1484  H HE22 . GLN B 2 5  ? 5.770   4.607   13.518  1.00 1.62 ? 305 GLN B HE22 1  
ATOM 1485  N N    . VAL B 2 6  ? 7.001   3.019   6.473   1.00 0.58 ? 306 VAL B N    1  
ATOM 1486  C CA   . VAL B 2 6  ? 7.684   3.355   5.228   1.00 0.63 ? 306 VAL B CA   1  
ATOM 1487  C C    . VAL B 2 6  ? 7.504   4.831   4.866   1.00 0.77 ? 306 VAL B C    1  
ATOM 1488  O O    . VAL B 2 6  ? 8.401   5.386   4.196   1.00 1.47 ? 306 VAL B O    1  
ATOM 1489  C CB   . VAL B 2 6  ? 7.181   2.475   4.063   1.00 0.54 ? 306 VAL B CB   1  
ATOM 1490  C CG1  . VAL B 2 6  ? 7.648   1.037   4.245   1.00 0.51 ? 306 VAL B CG1  1  
ATOM 1491  C CG2  . VAL B 2 6  ? 5.662   2.537   3.958   1.00 0.49 ? 306 VAL B CG2  1  
ATOM 1492  O OXT  . VAL B 2 6  ? 6.472   5.420   5.255   1.00 1.14 ? 306 VAL B OXT  1  
ATOM 1493  H H    . VAL B 2 6  ? 6.113   3.399   6.648   1.00 0.70 ? 306 VAL B H    1  
ATOM 1494  H HA   . VAL B 2 6  ? 8.738   3.158   5.365   1.00 0.71 ? 306 VAL B HA   1  
ATOM 1495  H HB   . VAL B 2 6  ? 7.602   2.854   3.143   1.00 0.63 ? 306 VAL B HB   1  
ATOM 1496  H HG11 . VAL B 2 6  ? 8.720   1.021   4.379   1.00 1.08 ? 306 VAL B HG11 1  
ATOM 1497  H HG12 . VAL B 2 6  ? 7.386   0.460   3.372   1.00 1.13 ? 306 VAL B HG12 1  
ATOM 1498  H HG13 . VAL B 2 6  ? 7.171   0.609   5.116   1.00 1.04 ? 306 VAL B HG13 1  
ATOM 1499  H HG21 . VAL B 2 6  ? 5.366   3.506   3.583   1.00 1.09 ? 306 VAL B HG21 1  
ATOM 1500  H HG22 . VAL B 2 6  ? 5.228   2.382   4.936   1.00 1.15 ? 306 VAL B HG22 1  
ATOM 1501  H HG23 . VAL B 2 6  ? 5.317   1.769   3.283   1.00 1.15 ? 306 VAL B HG23 1  
ATOM 1502  N N    . MET A 1 1  ? -8.509  -0.589  -9.243  1.00 1.83 ? 1   MET A N    2  
ATOM 1503  C CA   . MET A 1 1  ? -8.376  0.796   -8.712  1.00 1.38 ? 1   MET A CA   2  
ATOM 1504  C C    . MET A 1 1  ? -6.909  1.211   -8.599  1.00 1.20 ? 1   MET A C    2  
ATOM 1505  O O    . MET A 1 1  ? -6.064  0.428   -8.158  1.00 1.07 ? 1   MET A O    2  
ATOM 1506  C CB   . MET A 1 1  ? -9.053  0.864   -7.338  1.00 1.81 ? 1   MET A CB   2  
ATOM 1507  C CG   . MET A 1 1  ? -10.466 1.427   -7.380  1.00 2.04 ? 1   MET A CG   2  
ATOM 1508  S SD   . MET A 1 1  ? -10.870 2.394   -5.912  1.00 2.69 ? 1   MET A SD   2  
ATOM 1509  C CE   . MET A 1 1  ? -12.271 1.479   -5.272  1.00 3.17 ? 1   MET A CE   2  
ATOM 1510  H H1   . MET A 1 1  ? -8.126  -0.596  -10.208 1.00 2.20 ? 1   MET A H1   2  
ATOM 1511  H H2   . MET A 1 1  ? -9.521  -0.834  -9.239  1.00 2.22 ? 1   MET A H2   2  
ATOM 1512  H H3   . MET A 1 1  ? -7.968  -1.222  -8.620  1.00 1.92 ? 1   MET A H3   2  
ATOM 1513  H HA   . MET A 1 1  ? -8.879  1.471   -9.389  1.00 1.47 ? 1   MET A HA   2  
ATOM 1514  H HB2  . MET A 1 1  ? -9.099  -0.132  -6.922  1.00 2.32 ? 1   MET A HB2  2  
ATOM 1515  H HB3  . MET A 1 1  ? -8.460  1.489   -6.688  1.00 2.16 ? 1   MET A HB3  2  
ATOM 1516  H HG2  . MET A 1 1  ? -10.562 2.062   -8.249  1.00 2.47 ? 1   MET A HG2  2  
ATOM 1517  H HG3  . MET A 1 1  ? -11.164 0.606   -7.457  1.00 2.24 ? 1   MET A HG3  2  
ATOM 1518  H HE1  . MET A 1 1  ? -12.946 1.242   -6.081  1.00 3.35 ? 1   MET A HE1  2  
ATOM 1519  H HE2  . MET A 1 1  ? -12.787 2.078   -4.537  1.00 3.35 ? 1   MET A HE2  2  
ATOM 1520  H HE3  . MET A 1 1  ? -11.925 0.565   -4.813  1.00 3.67 ? 1   MET A HE3  2  
ATOM 1521  N N    . GLU A 1 2  ? -6.615  2.449   -8.999  1.00 1.25 ? 2   GLU A N    2  
ATOM 1522  C CA   . GLU A 1 2  ? -5.251  2.980   -8.944  1.00 1.15 ? 2   GLU A CA   2  
ATOM 1523  C C    . GLU A 1 2  ? -5.209  4.293   -8.161  1.00 1.12 ? 2   GLU A C    2  
ATOM 1524  O O    . GLU A 1 2  ? -6.230  4.969   -8.014  1.00 1.17 ? 2   GLU A O    2  
ATOM 1525  C CB   . GLU A 1 2  ? -4.705  3.196   -10.360 1.00 1.22 ? 2   GLU A CB   2  
ATOM 1526  C CG   . GLU A 1 2  ? -5.570  4.104   -11.225 1.00 1.74 ? 2   GLU A CG   2  
ATOM 1527  C CD   . GLU A 1 2  ? -6.405  3.332   -12.228 1.00 1.63 ? 2   GLU A CD   2  
ATOM 1528  O OE1  . GLU A 1 2  ? -7.521  2.901   -11.866 1.00 1.88 ? 2   GLU A OE1  2  
ATOM 1529  O OE2  . GLU A 1 2  ? -5.945  3.157   -13.376 1.00 1.97 ? 2   GLU A OE2  2  
ATOM 1530  H H    . GLU A 1 2  ? -7.335  3.023   -9.339  1.00 1.40 ? 2   GLU A H    2  
ATOM 1531  H HA   . GLU A 1 2  ? -4.634  2.255   -8.437  1.00 1.06 ? 2   GLU A HA   2  
ATOM 1532  H HB2  . GLU A 1 2  ? -3.722  3.635   -10.289 1.00 1.76 ? 2   GLU A HB2  2  
ATOM 1533  H HB3  . GLU A 1 2  ? -4.625  2.237   -10.851 1.00 1.34 ? 2   GLU A HB3  2  
ATOM 1534  H HG2  . GLU A 1 2  ? -6.232  4.666   -10.585 1.00 2.14 ? 2   GLU A HG2  2  
ATOM 1535  H HG3  . GLU A 1 2  ? -4.926  4.785   -11.763 1.00 2.47 ? 2   GLU A HG3  2  
ATOM 1536  N N    . ILE A 1 3  ? -4.022  4.649   -7.659  1.00 1.09 ? 3   ILE A N    2  
ATOM 1537  C CA   . ILE A 1 3  ? -3.843  5.875   -6.891  1.00 1.10 ? 3   ILE A CA   2  
ATOM 1538  C C    . ILE A 1 3  ? -2.460  6.479   -7.144  1.00 1.02 ? 3   ILE A C    2  
ATOM 1539  O O    . ILE A 1 3  ? -1.441  5.855   -6.842  1.00 1.07 ? 3   ILE A O    2  
ATOM 1540  C CB   . ILE A 1 3  ? -3.987  5.611   -5.375  1.00 1.18 ? 3   ILE A CB   2  
ATOM 1541  C CG1  . ILE A 1 3  ? -5.368  5.034   -5.042  1.00 1.34 ? 3   ILE A CG1  2  
ATOM 1542  C CG2  . ILE A 1 3  ? -3.740  6.890   -4.596  1.00 1.22 ? 3   ILE A CG2  2  
ATOM 1543  C CD1  . ILE A 1 3  ? -5.375  3.527   -4.896  1.00 1.10 ? 3   ILE A CD1  2  
ATOM 1544  H H    . ILE A 1 3  ? -3.241  4.080   -7.806  1.00 1.08 ? 3   ILE A H    2  
ATOM 1545  H HA   . ILE A 1 3  ? -4.603  6.581   -7.191  1.00 1.15 ? 3   ILE A HA   2  
ATOM 1546  H HB   . ILE A 1 3  ? -3.229  4.896   -5.087  1.00 1.17 ? 3   ILE A HB   2  
ATOM 1547  H HG12 . ILE A 1 3  ? -5.712  5.456   -4.109  1.00 1.83 ? 3   ILE A HG12 2  
ATOM 1548  H HG13 . ILE A 1 3  ? -6.061  5.296   -5.826  1.00 1.86 ? 3   ILE A HG13 2  
ATOM 1549  H HG21 . ILE A 1 3  ? -4.377  7.672   -4.979  1.00 1.72 ? 3   ILE A HG21 2  
ATOM 1550  H HG22 . ILE A 1 3  ? -2.706  7.181   -4.709  1.00 1.51 ? 3   ILE A HG22 2  
ATOM 1551  H HG23 . ILE A 1 3  ? -3.956  6.725   -3.552  1.00 1.55 ? 3   ILE A HG23 2  
ATOM 1552  H HD11 . ILE A 1 3  ? -5.626  3.074   -5.844  1.00 1.47 ? 3   ILE A HD11 2  
ATOM 1553  H HD12 . ILE A 1 3  ? -6.107  3.240   -4.155  1.00 1.61 ? 3   ILE A HD12 2  
ATOM 1554  H HD13 . ILE A 1 3  ? -4.397  3.190   -4.585  1.00 1.54 ? 3   ILE A HD13 2  
ATOM 1555  N N    . LYS A 1 4  ? -2.426  7.697   -7.687  1.00 0.98 ? 4   LYS A N    2  
ATOM 1556  C CA   . LYS A 1 4  ? -1.167  8.388   -7.967  1.00 0.96 ? 4   LYS A CA   2  
ATOM 1557  C C    . LYS A 1 4  ? -1.082  9.668   -7.134  1.00 0.96 ? 4   LYS A C    2  
ATOM 1558  O O    . LYS A 1 4  ? -2.109  10.294  -6.860  1.00 1.08 ? 4   LYS A O    2  
ATOM 1559  C CB   . LYS A 1 4  ? -1.085  8.723   -9.460  1.00 1.07 ? 4   LYS A CB   2  
ATOM 1560  C CG   . LYS A 1 4  ? 0.325   8.992   -9.959  1.00 1.35 ? 4   LYS A CG   2  
ATOM 1561  C CD   . LYS A 1 4  ? 0.343   9.276   -11.454 1.00 1.59 ? 4   LYS A CD   2  
ATOM 1562  C CE   . LYS A 1 4  ? -0.326  10.603  -11.785 1.00 2.29 ? 4   LYS A CE   2  
ATOM 1563  N NZ   . LYS A 1 4  ? 0.498   11.433  -12.707 1.00 2.93 ? 4   LYS A NZ   2  
ATOM 1564  H H    . LYS A 1 4  ? -3.261  8.161   -7.909  1.00 1.01 ? 4   LYS A H    2  
ATOM 1565  H HA   . LYS A 1 4  ? -0.351  7.733   -7.699  1.00 0.96 ? 4   LYS A HA   2  
ATOM 1566  H HB2  . LYS A 1 4  ? -1.487  7.894   -10.024 1.00 1.56 ? 4   LYS A HB2  2  
ATOM 1567  H HB3  . LYS A 1 4  ? -1.684  9.600   -9.652  1.00 1.61 ? 4   LYS A HB3  2  
ATOM 1568  H HG2  . LYS A 1 4  ? 0.722   9.847   -9.435  1.00 1.93 ? 4   LYS A HG2  2  
ATOM 1569  H HG3  . LYS A 1 4  ? 0.939   8.127   -9.758  1.00 1.87 ? 4   LYS A HG3  2  
ATOM 1570  H HD2  . LYS A 1 4  ? 1.368   9.308   -11.792 1.00 1.98 ? 4   LYS A HD2  2  
ATOM 1571  H HD3  . LYS A 1 4  ? -0.181  8.482   -11.967 1.00 1.90 ? 4   LYS A HD3  2  
ATOM 1572  H HE2  . LYS A 1 4  ? -1.279  10.403  -12.253 1.00 2.72 ? 4   LYS A HE2  2  
ATOM 1573  H HE3  . LYS A 1 4  ? -0.486  11.150  -10.868 1.00 2.70 ? 4   LYS A HE3  2  
ATOM 1574  H HZ1  . LYS A 1 4  ? 0.444   11.055  -13.675 1.00 3.17 ? 4   LYS A HZ1  2  
ATOM 1575  H HZ2  . LYS A 1 4  ? 1.493   11.430  -12.400 1.00 3.54 ? 4   LYS A HZ2  2  
ATOM 1576  H HZ3  . LYS A 1 4  ? 0.153   12.413  -12.711 1.00 3.06 ? 4   LYS A HZ3  2  
ATOM 1577  N N    . LEU A 1 5  ? 0.128   10.067  -6.726  1.00 0.89 ? 5   LEU A N    2  
ATOM 1578  C CA   . LEU A 1 5  ? 0.304   11.278  -5.923  1.00 0.97 ? 5   LEU A CA   2  
ATOM 1579  C C    . LEU A 1 5  ? 1.672   11.913  -6.195  1.00 0.88 ? 5   LEU A C    2  
ATOM 1580  O O    . LEU A 1 5  ? 2.529   11.306  -6.844  1.00 0.82 ? 5   LEU A O    2  
ATOM 1581  C CB   . LEU A 1 5  ? 0.172   10.951  -4.431  1.00 1.11 ? 5   LEU A CB   2  
ATOM 1582  C CG   . LEU A 1 5  ? -1.089  11.495  -3.753  1.00 1.42 ? 5   LEU A CG   2  
ATOM 1583  C CD1  . LEU A 1 5  ? -1.749  10.416  -2.907  1.00 1.50 ? 5   LEU A CD1  2  
ATOM 1584  C CD2  . LEU A 1 5  ? -0.757  12.715  -2.903  1.00 2.09 ? 5   LEU A CD2  2  
ATOM 1585  H H    . LEU A 1 5  ? 0.937   9.561   -6.954  1.00 0.85 ? 5   LEU A H    2  
ATOM 1586  H HA   . LEU A 1 5  ? -0.467  11.980  -6.201  1.00 1.10 ? 5   LEU A HA   2  
ATOM 1587  H HB2  . LEU A 1 5  ? 0.183   9.878   -4.318  1.00 1.26 ? 5   LEU A HB2  2  
ATOM 1588  H HB3  . LEU A 1 5  ? 1.031   11.357  -3.916  1.00 1.25 ? 5   LEU A HB3  2  
ATOM 1589  H HG   . LEU A 1 5  ? -1.795  11.800  -4.513  1.00 1.86 ? 5   LEU A HG   2  
ATOM 1590  H HD11 . LEU A 1 5  ? -1.868  10.774  -1.894  1.00 1.87 ? 5   LEU A HD11 2  
ATOM 1591  H HD12 . LEU A 1 5  ? -1.130  9.530   -2.904  1.00 2.01 ? 5   LEU A HD12 2  
ATOM 1592  H HD13 . LEU A 1 5  ? -2.718  10.177  -3.319  1.00 1.76 ? 5   LEU A HD13 2  
ATOM 1593  H HD21 . LEU A 1 5  ? -0.437  12.394  -1.922  1.00 2.37 ? 5   LEU A HD21 2  
ATOM 1594  H HD22 . LEU A 1 5  ? -1.633  13.339  -2.810  1.00 2.53 ? 5   LEU A HD22 2  
ATOM 1595  H HD23 . LEU A 1 5  ? 0.037   13.277  -3.373  1.00 2.63 ? 5   LEU A HD23 2  
ATOM 1596  N N    . ILE A 1 6  ? 1.881   13.125  -5.678  1.00 0.95 ? 6   ILE A N    2  
ATOM 1597  C CA   . ILE A 1 6  ? 3.150   13.831  -5.852  1.00 0.90 ? 6   ILE A CA   2  
ATOM 1598  C C    . ILE A 1 6  ? 4.029   13.667  -4.608  1.00 0.93 ? 6   ILE A C    2  
ATOM 1599  O O    . ILE A 1 6  ? 3.532   13.719  -3.481  1.00 1.06 ? 6   ILE A O    2  
ATOM 1600  C CB   . ILE A 1 6  ? 2.923   15.337  -6.138  1.00 1.04 ? 6   ILE A CB   2  
ATOM 1601  C CG1  . ILE A 1 6  ? 4.214   15.996  -6.635  1.00 1.29 ? 6   ILE A CG1  2  
ATOM 1602  C CG2  . ILE A 1 6  ? 2.399   16.054  -4.898  1.00 1.21 ? 6   ILE A CG2  2  
ATOM 1603  C CD1  . ILE A 1 6  ? 3.996   17.351  -7.274  1.00 1.94 ? 6   ILE A CD1  2  
ATOM 1604  H H    . ILE A 1 6  ? 1.174   13.551  -5.149  1.00 1.06 ? 6   ILE A H    2  
ATOM 1605  H HA   . ILE A 1 6  ? 3.660   13.398  -6.701  1.00 0.86 ? 6   ILE A HA   2  
ATOM 1606  H HB   . ILE A 1 6  ? 2.170   15.419  -6.908  1.00 1.27 ? 6   ILE A HB   2  
ATOM 1607  H HG12 . ILE A 1 6  ? 4.888   16.128  -5.802  1.00 1.47 ? 6   ILE A HG12 2  
ATOM 1608  H HG13 . ILE A 1 6  ? 4.678   15.354  -7.370  1.00 1.34 ? 6   ILE A HG13 2  
ATOM 1609  H HG21 . ILE A 1 6  ? 3.210   16.204  -4.199  1.00 1.62 ? 6   ILE A HG21 2  
ATOM 1610  H HG22 . ILE A 1 6  ? 1.630   15.456  -4.433  1.00 1.62 ? 6   ILE A HG22 2  
ATOM 1611  H HG23 . ILE A 1 6  ? 1.989   17.011  -5.183  1.00 1.45 ? 6   ILE A HG23 2  
ATOM 1612  H HD11 . ILE A 1 6  ? 3.949   18.107  -6.504  1.00 2.44 ? 6   ILE A HD11 2  
ATOM 1613  H HD12 . ILE A 1 6  ? 3.070   17.343  -7.830  1.00 2.21 ? 6   ILE A HD12 2  
ATOM 1614  H HD13 . ILE A 1 6  ? 4.815   17.569  -7.943  1.00 2.30 ? 6   ILE A HD13 2  
ATOM 1615  N N    . LYS A 1 7  ? 5.333   13.461  -4.817  1.00 0.91 ? 7   LYS A N    2  
ATOM 1616  C CA   . LYS A 1 7  ? 6.276   13.280  -3.711  1.00 1.06 ? 7   LYS A CA   2  
ATOM 1617  C C    . LYS A 1 7  ? 6.249   14.466  -2.746  1.00 1.18 ? 7   LYS A C    2  
ATOM 1618  O O    . LYS A 1 7  ? 6.297   15.624  -3.167  1.00 1.29 ? 7   LYS A O    2  
ATOM 1619  C CB   . LYS A 1 7  ? 7.696   13.090  -4.252  1.00 1.26 ? 7   LYS A CB   2  
ATOM 1620  C CG   . LYS A 1 7  ? 8.726   12.767  -3.179  1.00 1.78 ? 7   LYS A CG   2  
ATOM 1621  C CD   . LYS A 1 7  ? 8.793   11.274  -2.905  1.00 2.30 ? 7   LYS A CD   2  
ATOM 1622  C CE   . LYS A 1 7  ? 9.565   10.974  -1.629  1.00 2.50 ? 7   LYS A CE   2  
ATOM 1623  N NZ   . LYS A 1 7  ? 10.980  10.603  -1.908  1.00 3.10 ? 7   LYS A NZ   2  
ATOM 1624  H H    . LYS A 1 7  ? 5.676   13.419  -5.735  1.00 0.88 ? 7   LYS A H    2  
ATOM 1625  H HA   . LYS A 1 7  ? 5.988   12.390  -3.174  1.00 1.12 ? 7   LYS A HA   2  
ATOM 1626  H HB2  . LYS A 1 7  ? 7.691   12.281  -4.968  1.00 1.17 ? 7   LYS A HB2  2  
ATOM 1627  H HB3  . LYS A 1 7  ? 8.002   13.996  -4.750  1.00 1.45 ? 7   LYS A HB3  2  
ATOM 1628  H HG2  . LYS A 1 7  ? 9.696   13.106  -3.511  1.00 2.05 ? 7   LYS A HG2  2  
ATOM 1629  H HG3  . LYS A 1 7  ? 8.456   13.281  -2.269  1.00 2.37 ? 7   LYS A HG3  2  
ATOM 1630  H HD2  . LYS A 1 7  ? 7.789   10.892  -2.803  1.00 2.80 ? 7   LYS A HD2  2  
ATOM 1631  H HD3  . LYS A 1 7  ? 9.284   10.788  -3.735  1.00 2.70 ? 7   LYS A HD3  2  
ATOM 1632  H HE2  . LYS A 1 7  ? 9.551   11.851  -0.998  1.00 3.04 ? 7   LYS A HE2  2  
ATOM 1633  H HE3  . LYS A 1 7  ? 9.082   10.156  -1.116  1.00 2.26 ? 7   LYS A HE3  2  
ATOM 1634  H HZ1  . LYS A 1 7  ? 11.473  11.394  -2.372  1.00 3.61 ? 7   LYS A HZ1  2  
ATOM 1635  H HZ2  . LYS A 1 7  ? 11.016  9.772   -2.533  1.00 3.37 ? 7   LYS A HZ2  2  
ATOM 1636  H HZ3  . LYS A 1 7  ? 11.472  10.377  -1.021  1.00 3.30 ? 7   LYS A HZ3  2  
ATOM 1637  N N    . GLY A 1 8  ? 6.185   14.161  -1.448  1.00 1.38 ? 8   GLY A N    2  
ATOM 1638  C CA   . GLY A 1 8  ? 6.167   15.200  -0.431  1.00 1.62 ? 8   GLY A CA   2  
ATOM 1639  C C    . GLY A 1 8  ? 7.550   15.462  0.142   1.00 1.78 ? 8   GLY A C    2  
ATOM 1640  O O    . GLY A 1 8  ? 8.552   15.275  -0.553  1.00 1.78 ? 8   GLY A O    2  
ATOM 1641  H H    . GLY A 1 8  ? 6.159   13.218  -1.178  1.00 1.48 ? 8   GLY A H    2  
ATOM 1642  H HA2  . GLY A 1 8  ? 5.789   16.113  -0.867  1.00 1.65 ? 8   GLY A HA2  2  
ATOM 1643  H HA3  . GLY A 1 8  ? 5.510   14.894  0.368   1.00 1.79 ? 8   GLY A HA3  2  
ATOM 1644  N N    . PRO A 1 9  ? 7.643   15.897  1.414   1.00 2.05 ? 9   PRO A N    2  
ATOM 1645  C CA   . PRO A 1 9  ? 8.924   16.177  2.064   1.00 2.32 ? 9   PRO A CA   2  
ATOM 1646  C C    . PRO A 1 9  ? 9.685   14.887  2.396   1.00 2.37 ? 9   PRO A C    2  
ATOM 1647  O O    . PRO A 1 9  ? 10.562  14.475  1.634   1.00 2.77 ? 9   PRO A O    2  
ATOM 1648  C CB   . PRO A 1 9  ? 8.534   16.958  3.336   1.00 2.68 ? 9   PRO A CB   2  
ATOM 1649  C CG   . PRO A 1 9  ? 7.067   17.222  3.217   1.00 2.59 ? 9   PRO A CG   2  
ATOM 1650  C CD   . PRO A 1 9  ? 6.519   16.150  2.321   1.00 2.24 ? 9   PRO A CD   2  
ATOM 1651  H HA   . PRO A 1 9  ? 9.548   16.799  1.437   1.00 2.37 ? 9   PRO A HA   2  
ATOM 1652  H HB2  . PRO A 1 9  ? 8.757   16.368  4.210   1.00 2.85 ? 9   PRO A HB2  2  
ATOM 1653  H HB3  . PRO A 1 9  ? 9.094   17.882  3.374   1.00 2.89 ? 9   PRO A HB3  2  
ATOM 1654  H HG2  . PRO A 1 9  ? 6.604   17.167  4.192   1.00 2.84 ? 9   PRO A HG2  2  
ATOM 1655  H HG3  . PRO A 1 9  ? 6.904   18.196  2.780   1.00 2.61 ? 9   PRO A HG3  2  
ATOM 1656  H HD2  . PRO A 1 9  ? 6.275   15.268  2.893   1.00 2.35 ? 9   PRO A HD2  2  
ATOM 1657  H HD3  . PRO A 1 9  ? 5.656   16.509  1.780   1.00 2.14 ? 9   PRO A HD3  2  
ATOM 1658  N N    . LYS A 1 10 ? 9.358   14.255  3.530   1.00 2.38 ? 10  LYS A N    2  
ATOM 1659  C CA   . LYS A 1 10 ? 10.026  13.021  3.944   1.00 2.57 ? 10  LYS A CA   2  
ATOM 1660  C C    . LYS A 1 10 ? 9.802   11.900  2.927   1.00 2.26 ? 10  LYS A C    2  
ATOM 1661  O O    . LYS A 1 10 ? 10.740  11.474  2.251   1.00 2.45 ? 10  LYS A O    2  
ATOM 1662  C CB   . LYS A 1 10 ? 9.532   12.585  5.330   1.00 2.99 ? 10  LYS A CB   2  
ATOM 1663  C CG   . LYS A 1 10 ? 9.813   13.600  6.429   1.00 3.71 ? 10  LYS A CG   2  
ATOM 1664  C CD   . LYS A 1 10 ? 11.059  13.240  7.223   1.00 4.04 ? 10  LYS A CD   2  
ATOM 1665  C CE   . LYS A 1 10 ? 10.707  12.627  8.570   1.00 4.40 ? 10  LYS A CE   2  
ATOM 1666  N NZ   . LYS A 1 10 ? 11.916  12.167  9.308   1.00 4.92 ? 10  LYS A NZ   2  
ATOM 1667  H H    . LYS A 1 10 ? 8.666   14.631  4.112   1.00 2.55 ? 10  LYS A H    2  
ATOM 1668  H HA   . LYS A 1 10 ? 11.085  13.226  4.002   1.00 2.82 ? 10  LYS A HA   2  
ATOM 1669  H HB2  . LYS A 1 10 ? 8.466   12.423  5.284   1.00 3.13 ? 10  LYS A HB2  2  
ATOM 1670  H HB3  . LYS A 1 10 ? 10.015  11.656  5.596   1.00 2.88 ? 10  LYS A HB3  2  
ATOM 1671  H HG2  . LYS A 1 10 ? 9.955   14.572  5.979   1.00 3.97 ? 10  LYS A HG2  2  
ATOM 1672  H HG3  . LYS A 1 10 ? 8.966   13.633  7.099   1.00 4.13 ? 10  LYS A HG3  2  
ATOM 1673  H HD2  . LYS A 1 10 ? 11.643  12.529  6.658   1.00 4.48 ? 10  LYS A HD2  2  
ATOM 1674  H HD3  . LYS A 1 10 ? 11.640  14.136  7.387   1.00 4.00 ? 10  LYS A HD3  2  
ATOM 1675  H HE2  . LYS A 1 10 ? 10.194  13.369  9.165   1.00 4.59 ? 10  LYS A HE2  2  
ATOM 1676  H HE3  . LYS A 1 10 ? 10.052  11.784  8.407   1.00 4.53 ? 10  LYS A HE3  2  
ATOM 1677  H HZ1  . LYS A 1 10 ? 12.436  12.983  9.687   1.00 5.28 ? 10  LYS A HZ1  2  
ATOM 1678  H HZ2  . LYS A 1 10 ? 12.542  11.632  8.672   1.00 5.13 ? 10  LYS A HZ2  2  
ATOM 1679  H HZ3  . LYS A 1 10 ? 11.638  11.550  10.098  1.00 5.08 ? 10  LYS A HZ3  2  
ATOM 1680  N N    . GLY A 1 11 ? 8.558   11.425  2.822   1.00 2.10 ? 11  GLY A N    2  
ATOM 1681  C CA   . GLY A 1 11 ? 8.246   10.360  1.883   1.00 2.10 ? 11  GLY A CA   2  
ATOM 1682  C C    . GLY A 1 11 ? 6.776   9.979   1.882   1.00 2.08 ? 11  GLY A C    2  
ATOM 1683  O O    . GLY A 1 11 ? 5.931   10.755  1.427   1.00 2.30 ? 11  GLY A O    2  
ATOM 1684  H H    . GLY A 1 11 ? 7.850   11.803  3.387   1.00 2.22 ? 11  GLY A H    2  
ATOM 1685  H HA2  . GLY A 1 11 ? 8.522   10.680  0.891   1.00 2.53 ? 11  GLY A HA2  2  
ATOM 1686  H HA3  . GLY A 1 11 ? 8.830   9.489   2.142   1.00 2.21 ? 11  GLY A HA3  2  
ATOM 1687  N N    . LEU A 1 12 ? 6.472   8.781   2.385   1.00 2.47 ? 12  LEU A N    2  
ATOM 1688  C CA   . LEU A 1 12 ? 5.094   8.290   2.435   1.00 2.77 ? 12  LEU A CA   2  
ATOM 1689  C C    . LEU A 1 12 ? 4.385   8.756   3.705   1.00 1.92 ? 12  LEU A C    2  
ATOM 1690  O O    . LEU A 1 12 ? 3.291   9.316   3.638   1.00 2.52 ? 12  LEU A O    2  
ATOM 1691  C CB   . LEU A 1 12 ? 5.065   6.762   2.362   1.00 3.62 ? 12  LEU A CB   2  
ATOM 1692  C CG   . LEU A 1 12 ? 5.711   6.149   1.117   1.00 4.87 ? 12  LEU A CG   2  
ATOM 1693  C CD1  . LEU A 1 12 ? 5.596   4.634   1.160   1.00 5.33 ? 12  LEU A CD1  2  
ATOM 1694  C CD2  . LEU A 1 12 ? 5.069   6.700   -0.150  1.00 5.70 ? 12  LEU A CD2  2  
ATOM 1695  H H    . LEU A 1 12 ? 7.192   8.211   2.728   1.00 2.84 ? 12  LEU A H    2  
ATOM 1696  H HA   . LEU A 1 12 ? 4.571   8.691   1.581   1.00 3.41 ? 12  LEU A HA   2  
ATOM 1697  H HB2  . LEU A 1 12 ? 5.572   6.374   3.230   1.00 3.58 ? 12  LEU A HB2  2  
ATOM 1698  H HB3  . LEU A 1 12 ? 4.036   6.444   2.398   1.00 3.65 ? 12  LEU A HB3  2  
ATOM 1699  H HG   . LEU A 1 12 ? 6.761   6.404   1.101   1.00 5.19 ? 12  LEU A HG   2  
ATOM 1700  H HD11 . LEU A 1 12 ? 6.561   4.206   1.391   1.00 5.40 ? 12  LEU A HD11 2  
ATOM 1701  H HD12 . LEU A 1 12 ? 5.263   4.270   0.199   1.00 5.57 ? 12  LEU A HD12 2  
ATOM 1702  H HD13 . LEU A 1 12 ? 4.884   4.347   1.920   1.00 5.68 ? 12  LEU A HD13 2  
ATOM 1703  H HD21 . LEU A 1 12 ? 3.994   6.648   -0.062  1.00 6.03 ? 12  LEU A HD21 2  
ATOM 1704  H HD22 . LEU A 1 12 ? 5.390   6.115   -0.999  1.00 5.93 ? 12  LEU A HD22 2  
ATOM 1705  H HD23 . LEU A 1 12 ? 5.370   7.728   -0.287  1.00 6.06 ? 12  LEU A HD23 2  
ATOM 1706  N N    . GLY A 1 13 ? 5.010   8.520   4.857   1.00 1.13 ? 13  GLY A N    2  
ATOM 1707  C CA   . GLY A 1 13 ? 4.424   8.924   6.123   1.00 1.11 ? 13  GLY A CA   2  
ATOM 1708  C C    . GLY A 1 13 ? 3.429   7.917   6.677   1.00 0.96 ? 13  GLY A C    2  
ATOM 1709  O O    . GLY A 1 13 ? 2.451   8.303   7.310   1.00 1.03 ? 13  GLY A O    2  
ATOM 1710  H H    . GLY A 1 13 ? 5.879   8.069   4.849   1.00 1.49 ? 13  GLY A H    2  
ATOM 1711  H HA2  . GLY A 1 13 ? 5.216   9.056   6.844   1.00 1.58 ? 13  GLY A HA2  2  
ATOM 1712  H HA3  . GLY A 1 13 ? 3.920   9.869   5.988   1.00 1.81 ? 13  GLY A HA3  2  
ATOM 1713  N N    . PHE A 1 14 ? 3.676   6.625   6.442   1.00 0.81 ? 14  PHE A N    2  
ATOM 1714  C CA   . PHE A 1 14 ? 2.791   5.569   6.939   1.00 0.71 ? 14  PHE A CA   2  
ATOM 1715  C C    . PHE A 1 14 ? 3.526   4.225   6.991   1.00 0.56 ? 14  PHE A C    2  
ATOM 1716  O O    . PHE A 1 14 ? 4.726   4.159   6.720   1.00 0.52 ? 14  PHE A O    2  
ATOM 1717  C CB   . PHE A 1 14 ? 1.517   5.469   6.083   1.00 0.74 ? 14  PHE A CB   2  
ATOM 1718  C CG   . PHE A 1 14 ? 1.753   5.141   4.631   1.00 0.63 ? 14  PHE A CG   2  
ATOM 1719  C CD1  . PHE A 1 14 ? 2.124   3.862   4.244   1.00 1.27 ? 14  PHE A CD1  2  
ATOM 1720  C CD2  . PHE A 1 14 ? 1.588   6.111   3.654   1.00 1.41 ? 14  PHE A CD2  2  
ATOM 1721  C CE1  . PHE A 1 14 ? 2.328   3.558   2.913   1.00 1.33 ? 14  PHE A CE1  2  
ATOM 1722  C CE2  . PHE A 1 14 ? 1.788   5.810   2.320   1.00 1.46 ? 14  PHE A CE2  2  
ATOM 1723  C CZ   . PHE A 1 14 ? 2.160   4.533   1.949   1.00 0.83 ? 14  PHE A CZ   2  
ATOM 1724  H H    . PHE A 1 14 ? 4.469   6.374   5.923   1.00 0.79 ? 14  PHE A H    2  
ATOM 1725  H HA   . PHE A 1 14 ? 2.509   5.837   7.947   1.00 0.81 ? 14  PHE A HA   2  
ATOM 1726  H HB2  . PHE A 1 14 ? 0.881   4.699   6.492   1.00 0.84 ? 14  PHE A HB2  2  
ATOM 1727  H HB3  . PHE A 1 14 ? 0.994   6.413   6.128   1.00 0.89 ? 14  PHE A HB3  2  
ATOM 1728  H HD1  . PHE A 1 14 ? 2.255   3.099   4.997   1.00 2.12 ? 14  PHE A HD1  2  
ATOM 1729  H HD2  . PHE A 1 14 ? 1.298   7.111   3.941   1.00 2.28 ? 14  PHE A HD2  2  
ATOM 1730  H HE1  . PHE A 1 14 ? 2.619   2.557   2.625   1.00 2.19 ? 14  PHE A HE1  2  
ATOM 1731  H HE2  . PHE A 1 14 ? 1.655   6.574   1.568   1.00 2.33 ? 14  PHE A HE2  2  
ATOM 1732  H HZ   . PHE A 1 14 ? 2.318   4.296   0.907   1.00 0.99 ? 14  PHE A HZ   2  
ATOM 1733  N N    . SER A 1 15 ? 2.805   3.156   7.335   1.00 0.55 ? 15  SER A N    2  
ATOM 1734  C CA   . SER A 1 15 ? 3.389   1.826   7.413   1.00 0.47 ? 15  SER A CA   2  
ATOM 1735  C C    . SER A 1 15 ? 2.529   0.819   6.649   1.00 0.47 ? 15  SER A C    2  
ATOM 1736  O O    . SER A 1 15 ? 1.442   1.152   6.174   1.00 0.52 ? 15  SER A O    2  
ATOM 1737  C CB   . SER A 1 15 ? 3.531   1.387   8.870   1.00 0.50 ? 15  SER A CB   2  
ATOM 1738  O OG   . SER A 1 15 ? 2.424   1.793   9.642   1.00 0.57 ? 15  SER A OG   2  
ATOM 1739  H H    . SER A 1 15 ? 1.853   3.254   7.532   1.00 0.65 ? 15  SER A H    2  
ATOM 1740  H HA   . SER A 1 15 ? 4.365   1.865   6.962   1.00 0.48 ? 15  SER A HA   2  
ATOM 1741  H HB2  . SER A 1 15 ? 3.598   0.317   8.907   1.00 0.52 ? 15  SER A HB2  2  
ATOM 1742  H HB3  . SER A 1 15 ? 4.425   1.819   9.292   1.00 0.54 ? 15  SER A HB3  2  
ATOM 1743  H HG   . SER A 1 15 ? 2.202   1.100   10.269  1.00 1.10 ? 15  SER A HG   2  
ATOM 1744  N N    . ILE A 1 16 ? 3.020   -0.415  6.546   1.00 0.44 ? 16  ILE A N    2  
ATOM 1745  C CA   . ILE A 1 16 ? 2.302   -1.482  5.848   1.00 0.46 ? 16  ILE A CA   2  
ATOM 1746  C C    . ILE A 1 16 ? 2.739   -2.856  6.358   1.00 0.46 ? 16  ILE A C    2  
ATOM 1747  O O    . ILE A 1 16 ? 3.727   -2.976  7.081   1.00 0.45 ? 16  ILE A O    2  
ATOM 1748  C CB   . ILE A 1 16 ? 2.541   -1.448  4.312   1.00 0.47 ? 16  ILE A CB   2  
ATOM 1749  C CG1  . ILE A 1 16 ? 3.875   -2.107  3.932   1.00 0.67 ? 16  ILE A CG1  2  
ATOM 1750  C CG2  . ILE A 1 16 ? 2.467   -0.030  3.762   1.00 0.57 ? 16  ILE A CG2  2  
ATOM 1751  C CD1  . ILE A 1 16 ? 5.086   -1.316  4.348   1.00 0.64 ? 16  ILE A CD1  2  
ATOM 1752  H H    . ILE A 1 16 ? 3.886   -0.620  6.958   1.00 0.44 ? 16  ILE A H    2  
ATOM 1753  H HA   . ILE A 1 16 ? 1.235   -1.352  6.027   1.00 0.49 ? 16  ILE A HA   2  
ATOM 1754  H HB   . ILE A 1 16 ? 1.753   -2.012  3.858   1.00 0.59 ? 16  ILE A HB   2  
ATOM 1755  H HG12 . ILE A 1 16 ? 3.939   -3.077  4.400   1.00 1.45 ? 16  ILE A HG12 2  
ATOM 1756  H HG13 . ILE A 1 16 ? 3.912   -2.231  2.859   1.00 1.37 ? 16  ILE A HG13 2  
ATOM 1757  H HG21 . ILE A 1 16 ? 3.221   0.581   4.235   1.00 1.32 ? 16  ILE A HG21 2  
ATOM 1758  H HG22 . ILE A 1 16 ? 1.490   0.384   3.962   1.00 1.06 ? 16  ILE A HG22 2  
ATOM 1759  H HG23 . ILE A 1 16 ? 2.637   -0.049  2.695   1.00 1.09 ? 16  ILE A HG23 2  
ATOM 1760  H HD11 . ILE A 1 16 ? 5.736   -1.939  4.943   1.00 1.34 ? 16  ILE A HD11 2  
ATOM 1761  H HD12 . ILE A 1 16 ? 4.770   -0.463  4.927   1.00 1.24 ? 16  ILE A HD12 2  
ATOM 1762  H HD13 . ILE A 1 16 ? 5.612   -0.981  3.466   1.00 1.38 ? 16  ILE A HD13 2  
ATOM 1763  N N    . ALA A 1 17 ? 2.009   -3.882  5.934   1.00 0.51 ? 17  ALA A N    2  
ATOM 1764  C CA   . ALA A 1 17 ? 2.302   -5.272  6.274   1.00 0.55 ? 17  ALA A CA   2  
ATOM 1765  C C    . ALA A 1 17 ? 2.172   -6.095  4.991   1.00 0.73 ? 17  ALA A C    2  
ATOM 1766  O O    . ALA A 1 17 ? 1.589   -5.609  4.031   1.00 1.19 ? 17  ALA A O    2  
ATOM 1767  C CB   . ALA A 1 17 ? 1.365   -5.767  7.367   1.00 0.71 ? 17  ALA A CB   2  
ATOM 1768  H H    . ALA A 1 17 ? 1.246   -3.703  5.343   1.00 0.55 ? 17  ALA A H    2  
ATOM 1769  H HA   . ALA A 1 17 ? 3.320   -5.328  6.632   1.00 0.50 ? 17  ALA A HA   2  
ATOM 1770  H HB1  . ALA A 1 17 ? 1.902   -5.824  8.302   1.00 1.21 ? 17  ALA A HB1  2  
ATOM 1771  H HB2  . ALA A 1 17 ? 0.992   -6.746  7.106   1.00 1.22 ? 17  ALA A HB2  2  
ATOM 1772  H HB3  . ALA A 1 17 ? 0.536   -5.079  7.471   1.00 1.33 ? 17  ALA A HB3  2  
ATOM 1773  N N    . GLY A 1 18 ? 2.687   -7.324  4.937   1.00 0.60 ? 18  GLY A N    2  
ATOM 1774  C CA   . GLY A 1 18 ? 2.521   -8.072  3.697   1.00 0.77 ? 18  GLY A CA   2  
ATOM 1775  C C    . GLY A 1 18 ? 3.382   -9.310  3.546   1.00 0.85 ? 18  GLY A C    2  
ATOM 1776  O O    . GLY A 1 18 ? 4.587   -9.251  3.775   1.00 1.29 ? 18  GLY A O    2  
ATOM 1777  H H    . GLY A 1 18 ? 3.112   -7.717  5.727   1.00 0.67 ? 18  GLY A H    2  
ATOM 1778  H HA2  . GLY A 1 18 ? 1.490   -8.370  3.621   1.00 0.96 ? 18  GLY A HA2  2  
ATOM 1779  H HA3  . GLY A 1 18 ? 2.741   -7.405  2.877   1.00 1.37 ? 18  GLY A HA3  2  
ATOM 1780  N N    . GLY A 1 19 ? 2.780   -10.426 3.125   1.00 1.01 ? 19  GLY A N    2  
ATOM 1781  C CA   . GLY A 1 19 ? 3.541   -11.647 2.912   1.00 1.61 ? 19  GLY A CA   2  
ATOM 1782  C C    . GLY A 1 19 ? 3.312   -12.682 3.988   1.00 0.89 ? 19  GLY A C    2  
ATOM 1783  O O    . GLY A 1 19 ? 2.916   -12.345 5.094   1.00 0.76 ? 19  GLY A O    2  
ATOM 1784  H H    . GLY A 1 19 ? 1.815   -10.437 2.951   1.00 1.01 ? 19  GLY A H    2  
ATOM 1785  H HA2  . GLY A 1 19 ? 3.260   -12.069 1.960   1.00 2.30 ? 19  GLY A HA2  2  
ATOM 1786  H HA3  . GLY A 1 19 ? 4.593   -11.400 2.885   1.00 2.32 ? 19  GLY A HA3  2  
ATOM 1787  N N    . VAL A 1 20 ? 3.552   -13.948 3.657   1.00 0.97 ? 20  VAL A N    2  
ATOM 1788  C CA   . VAL A 1 20 ? 3.364   -15.034 4.617   1.00 1.05 ? 20  VAL A CA   2  
ATOM 1789  C C    . VAL A 1 20 ? 4.343   -14.880 5.790   1.00 1.18 ? 20  VAL A C    2  
ATOM 1790  O O    . VAL A 1 20 ? 5.520   -14.575 5.586   1.00 1.35 ? 20  VAL A O    2  
ATOM 1791  C CB   . VAL A 1 20 ? 3.557   -16.422 3.964   1.00 1.68 ? 20  VAL A CB   2  
ATOM 1792  C CG1  . VAL A 1 20 ? 3.401   -17.531 4.997   1.00 1.76 ? 20  VAL A CG1  2  
ATOM 1793  C CG2  . VAL A 1 20 ? 2.576   -16.619 2.815   1.00 2.72 ? 20  VAL A CG2  2  
ATOM 1794  H H    . VAL A 1 20 ? 3.847   -14.151 2.743   1.00 1.38 ? 20  VAL A H    2  
ATOM 1795  H HA   . VAL A 1 20 ? 2.348   -14.966 4.989   1.00 0.98 ? 20  VAL A HA   2  
ATOM 1796  H HB   . VAL A 1 20 ? 4.559   -16.474 3.564   1.00 2.13 ? 20  VAL A HB   2  
ATOM 1797  H HG11 . VAL A 1 20 ? 2.527   -17.339 5.602   1.00 2.30 ? 20  VAL A HG11 2  
ATOM 1798  H HG12 . VAL A 1 20 ? 4.276   -17.561 5.628   1.00 1.97 ? 20  VAL A HG12 2  
ATOM 1799  H HG13 . VAL A 1 20 ? 3.288   -18.480 4.492   1.00 2.15 ? 20  VAL A HG13 2  
ATOM 1800  H HG21 . VAL A 1 20 ? 2.922   -17.421 2.180   1.00 3.33 ? 20  VAL A HG21 2  
ATOM 1801  H HG22 . VAL A 1 20 ? 2.507   -15.709 2.239   1.00 3.14 ? 20  VAL A HG22 2  
ATOM 1802  H HG23 . VAL A 1 20 ? 1.602   -16.870 3.211   1.00 3.02 ? 20  VAL A HG23 2  
ATOM 1803  N N    . GLY A 1 21 ? 3.848   -15.087 7.015   1.00 1.30 ? 21  GLY A N    2  
ATOM 1804  C CA   . GLY A 1 21 ? 4.695   -14.956 8.201   1.00 1.54 ? 21  GLY A CA   2  
ATOM 1805  C C    . GLY A 1 21 ? 4.823   -13.514 8.692   1.00 1.24 ? 21  GLY A C    2  
ATOM 1806  O O    . GLY A 1 21 ? 5.176   -13.276 9.848   1.00 1.56 ? 21  GLY A O    2  
ATOM 1807  H H    . GLY A 1 21 ? 2.904   -15.331 7.111   1.00 1.35 ? 21  GLY A H    2  
ATOM 1808  H HA2  . GLY A 1 21 ? 4.274   -15.556 8.995   1.00 1.90 ? 21  GLY A HA2  2  
ATOM 1809  H HA3  . GLY A 1 21 ? 5.681   -15.332 7.968   1.00 1.72 ? 21  GLY A HA3  2  
ATOM 1810  N N    . ASN A 1 22 ? 4.520   -12.562 7.811   1.00 0.73 ? 22  ASN A N    2  
ATOM 1811  C CA   . ASN A 1 22 ? 4.575   -11.135 8.126   1.00 0.61 ? 22  ASN A CA   2  
ATOM 1812  C C    . ASN A 1 22 ? 3.386   -10.398 7.492   1.00 0.65 ? 22  ASN A C    2  
ATOM 1813  O O    . ASN A 1 22 ? 3.473   -9.205  7.193   1.00 0.67 ? 22  ASN A O    2  
ATOM 1814  C CB   . ASN A 1 22 ? 5.891   -10.516 7.621   1.00 0.47 ? 22  ASN A CB   2  
ATOM 1815  C CG   . ASN A 1 22 ? 6.301   -11.026 6.248   1.00 0.74 ? 22  ASN A CG   2  
ATOM 1816  O OD1  . ASN A 1 22 ? 5.460   -11.245 5.378   1.00 1.27 ? 22  ASN A OD1  2  
ATOM 1817  N ND2  . ASN A 1 22 ? 7.599   -11.219 6.049   1.00 1.63 ? 22  ASN A ND2  2  
ATOM 1818  H H    . ASN A 1 22 ? 4.233   -12.831 6.922   1.00 0.63 ? 22  ASN A H    2  
ATOM 1819  H HA   . ASN A 1 22 ? 4.521   -11.028 9.199   1.00 0.88 ? 22  ASN A HA   2  
ATOM 1820  H HB2  . ASN A 1 22 ? 5.774   -9.446  7.566   1.00 0.82 ? 22  ASN A HB2  2  
ATOM 1821  H HB3  . ASN A 1 22 ? 6.686   -10.741 8.313   1.00 0.63 ? 22  ASN A HB3  2  
ATOM 1822  H HD21 . ASN A 1 22 ? 8.217   -11.025 6.786   1.00 2.15 ? 22  ASN A HD21 2  
ATOM 1823  H HD22 . ASN A 1 22 ? 7.889   -11.548 5.173   1.00 1.98 ? 22  ASN A HD22 2  
ATOM 1824  N N    . GLN A 1 23 ? 2.282   -11.122 7.260   1.00 0.77 ? 23  GLN A N    2  
ATOM 1825  C CA   . GLN A 1 23 ? 1.095   -10.544 6.628   1.00 0.94 ? 23  GLN A CA   2  
ATOM 1826  C C    . GLN A 1 23 ? 0.314   -9.644  7.578   1.00 0.88 ? 23  GLN A C    2  
ATOM 1827  O O    . GLN A 1 23 ? 0.465   -9.717  8.797   1.00 0.87 ? 23  GLN A O    2  
ATOM 1828  C CB   . GLN A 1 23 ? 0.178   -11.654 6.091   1.00 1.19 ? 23  GLN A CB   2  
ATOM 1829  C CG   . GLN A 1 23 ? -0.517  -12.468 7.175   1.00 1.42 ? 23  GLN A CG   2  
ATOM 1830  C CD   . GLN A 1 23 ? 0.245   -13.730 7.543   1.00 1.55 ? 23  GLN A CD   2  
ATOM 1831  O OE1  . GLN A 1 23 ? 0.751   -14.439 6.673   1.00 1.62 ? 23  GLN A OE1  2  
ATOM 1832  N NE2  . GLN A 1 23 ? 0.331   -14.018 8.837   1.00 2.34 ? 23  GLN A NE2  2  
ATOM 1833  H H    . GLN A 1 23 ? 2.268   -12.074 7.491   1.00 0.79 ? 23  GLN A H    2  
ATOM 1834  H HA   . GLN A 1 23 ? 1.432   -9.947  5.794   1.00 1.04 ? 23  GLN A HA   2  
ATOM 1835  H HB2  . GLN A 1 23 ? -0.582  -11.203 5.470   1.00 1.46 ? 23  GLN A HB2  2  
ATOM 1836  H HB3  . GLN A 1 23 ? 0.766   -12.328 5.488   1.00 1.49 ? 23  GLN A HB3  2  
ATOM 1837  H HG2  . GLN A 1 23 ? -0.617  -11.857 8.060   1.00 1.80 ? 23  GLN A HG2  2  
ATOM 1838  H HG3  . GLN A 1 23 ? -1.498  -12.749 6.822   1.00 1.68 ? 23  GLN A HG3  2  
ATOM 1839  H HE21 . GLN A 1 23 ? -0.096  -13.412 9.479   1.00 2.92 ? 23  GLN A HE21 2  
ATOM 1840  H HE22 . GLN A 1 23 ? 0.818   -14.828 9.099   1.00 2.51 ? 23  GLN A HE22 2  
ATOM 1841  N N    . HIS A 1 24 ? -0.516  -8.785  6.992   1.00 0.86 ? 24  HIS A N    2  
ATOM 1842  C CA   . HIS A 1 24 ? -1.329  -7.843  7.757   1.00 0.83 ? 24  HIS A CA   2  
ATOM 1843  C C    . HIS A 1 24 ? -2.685  -8.433  8.141   1.00 0.84 ? 24  HIS A C    2  
ATOM 1844  O O    . HIS A 1 24 ? -3.290  -8.014  9.129   1.00 0.92 ? 24  HIS A O    2  
ATOM 1845  C CB   . HIS A 1 24 ? -1.566  -6.570  6.943   1.00 0.85 ? 24  HIS A CB   2  
ATOM 1846  C CG   . HIS A 1 24 ? -2.197  -5.481  7.728   1.00 0.83 ? 24  HIS A CG   2  
ATOM 1847  N ND1  . HIS A 1 24 ? -1.513  -4.735  8.654   1.00 0.90 ? 24  HIS A ND1  2  
ATOM 1848  C CD2  . HIS A 1 24 ? -3.459  -5.005  7.712   1.00 0.81 ? 24  HIS A CD2  2  
ATOM 1849  C CE1  . HIS A 1 24 ? -2.321  -3.842  9.173   1.00 0.88 ? 24  HIS A CE1  2  
ATOM 1850  N NE2  . HIS A 1 24 ? -3.514  -3.981  8.622   1.00 0.82 ? 24  HIS A NE2  2  
ATOM 1851  H H    . HIS A 1 24 ? -0.569  -8.772  6.012   1.00 0.90 ? 24  HIS A H    2  
ATOM 1852  H HA   . HIS A 1 24 ? -0.790  -7.588  8.656   1.00 0.84 ? 24  HIS A HA   2  
ATOM 1853  H HB2  . HIS A 1 24 ? -0.629  -6.203  6.561   1.00 0.91 ? 24  HIS A HB2  2  
ATOM 1854  H HB3  . HIS A 1 24 ? -2.220  -6.792  6.117   1.00 0.87 ? 24  HIS A HB3  2  
ATOM 1855  H HD1  . HIS A 1 24 ? -0.575  -4.854  8.904   1.00 0.98 ? 24  HIS A HD1  2  
ATOM 1856  H HD2  . HIS A 1 24 ? -4.271  -5.370  7.094   1.00 0.82 ? 24  HIS A HD2  2  
ATOM 1857  H HE1  . HIS A 1 24 ? -2.048  -3.117  9.911   1.00 0.95 ? 24  HIS A HE1  2  
ATOM 1858  H HE2  . HIS A 1 24 ? -4.324  -3.504  8.898   1.00 0.82 ? 24  HIS A HE2  2  
ATOM 1859  N N    . ILE A 1 25 ? -3.165  -9.393  7.353   1.00 0.80 ? 25  ILE A N    2  
ATOM 1860  C CA   . ILE A 1 25 ? -4.458  -10.012 7.613   1.00 0.86 ? 25  ILE A CA   2  
ATOM 1861  C C    . ILE A 1 25 ? -4.456  -11.489 7.218   1.00 0.81 ? 25  ILE A C    2  
ATOM 1862  O O    . ILE A 1 25 ? -4.008  -11.845 6.127   1.00 0.80 ? 25  ILE A O    2  
ATOM 1863  C CB   . ILE A 1 25 ? -5.590  -9.275  6.857   1.00 0.95 ? 25  ILE A CB   2  
ATOM 1864  C CG1  . ILE A 1 25 ? -5.451  -7.757  7.024   1.00 1.01 ? 25  ILE A CG1  2  
ATOM 1865  C CG2  . ILE A 1 25 ? -6.952  -9.736  7.351   1.00 1.51 ? 25  ILE A CG2  2  
ATOM 1866  C CD1  . ILE A 1 25 ? -6.560  -6.966  6.363   1.00 1.16 ? 25  ILE A CD1  2  
ATOM 1867  H H    . ILE A 1 25 ? -2.636  -9.684  6.580   1.00 0.77 ? 25  ILE A H    2  
ATOM 1868  H HA   . ILE A 1 25 ? -4.654  -9.934  8.672   1.00 0.92 ? 25  ILE A HA   2  
ATOM 1869  H HB   . ILE A 1 25 ? -5.512  -9.518  5.809   1.00 1.28 ? 25  ILE A HB   2  
ATOM 1870  H HG12 . ILE A 1 25 ? -5.457  -7.515  8.077   1.00 1.40 ? 25  ILE A HG12 2  
ATOM 1871  H HG13 . ILE A 1 25 ? -4.513  -7.438  6.593   1.00 1.51 ? 25  ILE A HG13 2  
ATOM 1872  H HG21 . ILE A 1 25 ? -7.128  -9.335  8.339   1.00 1.96 ? 25  ILE A HG21 2  
ATOM 1873  H HG22 . ILE A 1 25 ? -6.977  -10.814 7.389   1.00 1.82 ? 25  ILE A HG22 2  
ATOM 1874  H HG23 . ILE A 1 25 ? -7.717  -9.380  6.677   1.00 1.95 ? 25  ILE A HG23 2  
ATOM 1875  H HD11 . ILE A 1 25 ? -7.450  -7.014  6.974   1.00 1.53 ? 25  ILE A HD11 2  
ATOM 1876  H HD12 . ILE A 1 25 ? -6.768  -7.384  5.389   1.00 1.45 ? 25  ILE A HD12 2  
ATOM 1877  H HD13 . ILE A 1 25 ? -6.252  -5.937  6.255   1.00 1.78 ? 25  ILE A HD13 2  
ATOM 1878  N N    . PRO A 1 26 ? -4.963  -12.371 8.105   1.00 0.82 ? 26  PRO A N    2  
ATOM 1879  C CA   . PRO A 1 26 ? -5.024  -13.816 7.847   1.00 0.82 ? 26  PRO A CA   2  
ATOM 1880  C C    . PRO A 1 26 ? -5.780  -14.137 6.560   1.00 0.86 ? 26  PRO A C    2  
ATOM 1881  O O    . PRO A 1 26 ? -6.901  -13.667 6.355   1.00 0.95 ? 26  PRO A O    2  
ATOM 1882  C CB   . PRO A 1 26 ? -5.769  -14.381 9.066   1.00 0.88 ? 26  PRO A CB   2  
ATOM 1883  C CG   . PRO A 1 26 ? -6.412  -13.204 9.719   1.00 0.98 ? 26  PRO A CG   2  
ATOM 1884  C CD   . PRO A 1 26 ? -5.522  -12.032 9.424   1.00 0.87 ? 26  PRO A CD   2  
ATOM 1885  H HA   . PRO A 1 26 ? -4.035  -14.247 7.796   1.00 0.79 ? 26  PRO A HA   2  
ATOM 1886  H HB2  . PRO A 1 26 ? -6.505  -15.100 8.738   1.00 1.04 ? 26  PRO A HB2  2  
ATOM 1887  H HB3  . PRO A 1 26 ? -5.063  -14.859 9.729   1.00 0.96 ? 26  PRO A HB3  2  
ATOM 1888  H HG2  . PRO A 1 26 ? -7.394  -13.043 9.300   1.00 1.27 ? 26  PRO A HG2  2  
ATOM 1889  H HG3  . PRO A 1 26 ? -6.478  -13.364 10.784  1.00 1.26 ? 26  PRO A HG3  2  
ATOM 1890  H HD2  . PRO A 1 26 ? -6.099  -11.120 9.378   1.00 0.94 ? 26  PRO A HD2  2  
ATOM 1891  H HD3  . PRO A 1 26 ? -4.741  -11.951 10.165  1.00 0.95 ? 26  PRO A HD3  2  
ATOM 1892  N N    . GLY A 1 27 ? -5.153  -14.928 5.690   1.00 0.85 ? 27  GLY A N    2  
ATOM 1893  C CA   . GLY A 1 27 ? -5.771  -15.290 4.426   1.00 0.94 ? 27  GLY A CA   2  
ATOM 1894  C C    . GLY A 1 27 ? -5.305  -14.404 3.285   1.00 0.92 ? 27  GLY A C    2  
ATOM 1895  O O    . GLY A 1 27 ? -4.807  -14.900 2.273   1.00 1.06 ? 27  GLY A O    2  
ATOM 1896  H H    . GLY A 1 27 ? -4.258  -15.265 5.906   1.00 0.81 ? 27  GLY A H    2  
ATOM 1897  H HA2  . GLY A 1 27 ? -5.524  -16.316 4.197   1.00 1.04 ? 27  GLY A HA2  2  
ATOM 1898  H HA3  . GLY A 1 27 ? -6.843  -15.201 4.522   1.00 1.00 ? 27  GLY A HA3  2  
ATOM 1899  N N    . ASP A 1 28 ? -5.462  -13.088 3.451   1.00 0.80 ? 28  ASP A N    2  
ATOM 1900  C CA   . ASP A 1 28 ? -5.047  -12.127 2.432   1.00 0.80 ? 28  ASP A CA   2  
ATOM 1901  C C    . ASP A 1 28 ? -3.592  -11.712 2.643   1.00 0.65 ? 28  ASP A C    2  
ATOM 1902  O O    . ASP A 1 28 ? -3.278  -10.952 3.561   1.00 0.57 ? 28  ASP A O    2  
ATOM 1903  C CB   . ASP A 1 28 ? -5.959  -10.896 2.456   1.00 0.91 ? 28  ASP A CB   2  
ATOM 1904  C CG   . ASP A 1 28 ? -6.210  -10.335 1.069   1.00 1.08 ? 28  ASP A CG   2  
ATOM 1905  O OD1  . ASP A 1 28 ? -5.263  -9.780  0.474   1.00 1.48 ? 28  ASP A OD1  2  
ATOM 1906  O OD2  . ASP A 1 28 ? -7.353  -10.447 0.581   1.00 1.68 ? 28  ASP A OD2  2  
ATOM 1907  H H    . ASP A 1 28 ? -5.861  -12.756 4.282   1.00 0.76 ? 28  ASP A H    2  
ATOM 1908  H HA   . ASP A 1 28 ? -5.135  -12.610 1.469   1.00 0.92 ? 28  ASP A HA   2  
ATOM 1909  H HB2  . ASP A 1 28 ? -6.909  -11.168 2.891   1.00 1.05 ? 28  ASP A HB2  2  
ATOM 1910  H HB3  . ASP A 1 28 ? -5.499  -10.127 3.059   1.00 0.85 ? 28  ASP A HB3  2  
ATOM 1911  N N    . ASN A 1 29 ? -2.708  -12.224 1.786   1.00 0.69 ? 29  ASN A N    2  
ATOM 1912  C CA   . ASN A 1 29 ? -1.277  -11.922 1.874   1.00 0.63 ? 29  ASN A CA   2  
ATOM 1913  C C    . ASN A 1 29 ? -0.901  -10.642 1.110   1.00 0.59 ? 29  ASN A C    2  
ATOM 1914  O O    . ASN A 1 29 ? 0.277   -10.411 0.827   1.00 0.65 ? 29  ASN A O    2  
ATOM 1915  C CB   . ASN A 1 29 ? -0.459  -13.104 1.352   1.00 0.79 ? 29  ASN A CB   2  
ATOM 1916  C CG   . ASN A 1 29 ? -0.665  -13.372 -0.131  1.00 1.36 ? 29  ASN A CG   2  
ATOM 1917  O OD1  . ASN A 1 29 ? -1.783  -13.303 -0.641  1.00 2.11 ? 29  ASN A OD1  2  
ATOM 1918  N ND2  . ASN A 1 29 ? 0.420   -13.686 -0.832  1.00 1.98 ? 29  ASN A ND2  2  
ATOM 1919  H H    . ASN A 1 29 ? -3.023  -12.828 1.082   1.00 0.80 ? 29  ASN A H    2  
ATOM 1920  H HA   . ASN A 1 29 ? -1.034  -11.782 2.921   1.00 0.58 ? 29  ASN A HA   2  
ATOM 1921  H HB2  . ASN A 1 29 ? 0.587   -12.902 1.519   1.00 1.38 ? 29  ASN A HB2  2  
ATOM 1922  H HB3  . ASN A 1 29 ? -0.740  -13.988 1.901   1.00 1.03 ? 29  ASN A HB3  2  
ATOM 1923  H HD21 . ASN A 1 29 ? 1.280   -13.728 -0.364  1.00 2.27 ? 29  ASN A HD21 2  
ATOM 1924  H HD22 . ASN A 1 29 ? 0.315   -13.864 -1.790  1.00 2.54 ? 29  ASN A HD22 2  
ATOM 1925  N N    . SER A 1 30 ? -1.893  -9.799  0.799   1.00 0.56 ? 30  SER A N    2  
ATOM 1926  C CA   . SER A 1 30 ? -1.637  -8.540  0.096   1.00 0.56 ? 30  SER A CA   2  
ATOM 1927  C C    . SER A 1 30 ? -1.200  -7.473  1.094   1.00 0.55 ? 30  SER A C    2  
ATOM 1928  O O    . SER A 1 30 ? -1.471  -7.596  2.287   1.00 0.55 ? 30  SER A O    2  
ATOM 1929  C CB   . SER A 1 30 ? -2.887  -8.075  -0.657  1.00 0.60 ? 30  SER A CB   2  
ATOM 1930  O OG   . SER A 1 30 ? -3.329  -9.062  -1.574  1.00 1.39 ? 30  SER A OG   2  
ATOM 1931  H H    . SER A 1 30 ? -2.810  -10.014 1.065   1.00 0.58 ? 30  SER A H    2  
ATOM 1932  H HA   . SER A 1 30 ? -0.836  -8.708  -0.611  1.00 0.60 ? 30  SER A HA   2  
ATOM 1933  H HB2  . SER A 1 30 ? -3.678  -7.878  0.050   1.00 1.26 ? 30  SER A HB2  2  
ATOM 1934  H HB3  . SER A 1 30 ? -2.659  -7.171  -1.203  1.00 1.02 ? 30  SER A HB3  2  
ATOM 1935  H HG   . SER A 1 30 ? -2.855  -8.966  -2.402  1.00 1.77 ? 30  SER A HG   2  
ATOM 1936  N N    . ILE A 1 31 ? -0.473  -6.460  0.626   1.00 0.55 ? 31  ILE A N    2  
ATOM 1937  C CA   . ILE A 1 31 ? 0.040   -5.419  1.523   1.00 0.55 ? 31  ILE A CA   2  
ATOM 1938  C C    . ILE A 1 31 ? -1.053  -4.447  1.997   1.00 0.57 ? 31  ILE A C    2  
ATOM 1939  O O    . ILE A 1 31 ? -1.745  -3.827  1.194   1.00 0.65 ? 31  ILE A O    2  
ATOM 1940  C CB   . ILE A 1 31 ? 1.198   -4.621  0.864   1.00 0.53 ? 31  ILE A CB   2  
ATOM 1941  C CG1  . ILE A 1 31 ? 2.168   -5.553  0.117   1.00 0.62 ? 31  ILE A CG1  2  
ATOM 1942  C CG2  . ILE A 1 31 ? 1.947   -3.803  1.907   1.00 0.60 ? 31  ILE A CG2  2  
ATOM 1943  C CD1  . ILE A 1 31 ? 2.277   -6.953  0.696   1.00 0.80 ? 31  ILE A CD1  2  
ATOM 1944  H H    . ILE A 1 31 ? -0.217  -6.439  -0.324  1.00 0.57 ? 31  ILE A H    2  
ATOM 1945  H HA   . ILE A 1 31 ? 0.439   -5.921  2.389   1.00 0.54 ? 31  ILE A HA   2  
ATOM 1946  H HB   . ILE A 1 31 ? 0.773   -3.929  0.155   1.00 0.74 ? 31  ILE A HB   2  
ATOM 1947  H HG12 . ILE A 1 31 ? 1.839   -5.647  -0.905  1.00 1.20 ? 31  ILE A HG12 2  
ATOM 1948  H HG13 . ILE A 1 31 ? 3.153   -5.112  0.127   1.00 1.19 ? 31  ILE A HG13 2  
ATOM 1949  H HG21 . ILE A 1 31 ? 2.628   -4.445  2.445   1.00 1.13 ? 31  ILE A HG21 2  
ATOM 1950  H HG22 . ILE A 1 31 ? 1.242   -3.366  2.598   1.00 1.21 ? 31  ILE A HG22 2  
ATOM 1951  H HG23 . ILE A 1 31 ? 2.505   -3.019  1.416   1.00 1.13 ? 31  ILE A HG23 2  
ATOM 1952  H HD11 . ILE A 1 31 ? 1.885   -7.667  -0.013  1.00 1.15 ? 31  ILE A HD11 2  
ATOM 1953  H HD12 . ILE A 1 31 ? 1.712   -7.010  1.612   1.00 1.28 ? 31  ILE A HD12 2  
ATOM 1954  H HD13 . ILE A 1 31 ? 3.312   -7.181  0.898   1.00 1.46 ? 31  ILE A HD13 2  
ATOM 1955  N N    . TYR A 1 32 ? -1.174  -4.317  3.326   1.00 0.60 ? 32  TYR A N    2  
ATOM 1956  C CA   . TYR A 1 32 ? -2.147  -3.421  3.950   1.00 0.62 ? 32  TYR A CA   2  
ATOM 1957  C C    . TYR A 1 32 ? -1.434  -2.379  4.810   1.00 0.59 ? 32  TYR A C    2  
ATOM 1958  O O    . TYR A 1 32 ? -0.383  -2.659  5.384   1.00 0.61 ? 32  TYR A O    2  
ATOM 1959  C CB   . TYR A 1 32 ? -3.103  -4.208  4.846   1.00 0.69 ? 32  TYR A CB   2  
ATOM 1960  C CG   . TYR A 1 32 ? -4.059  -5.124  4.122   1.00 0.71 ? 32  TYR A CG   2  
ATOM 1961  C CD1  . TYR A 1 32 ? -3.626  -6.330  3.592   1.00 1.28 ? 32  TYR A CD1  2  
ATOM 1962  C CD2  . TYR A 1 32 ? -5.397  -4.790  3.990   1.00 1.34 ? 32  TYR A CD2  2  
ATOM 1963  C CE1  . TYR A 1 32 ? -4.498  -7.183  2.944   1.00 1.30 ? 32  TYR A CE1  2  
ATOM 1964  C CE2  . TYR A 1 32 ? -6.281  -5.632  3.351   1.00 1.38 ? 32  TYR A CE2  2  
ATOM 1965  C CZ   . TYR A 1 32 ? -5.829  -6.828  2.826   1.00 0.80 ? 32  TYR A CZ   2  
ATOM 1966  O OH   . TYR A 1 32 ? -6.708  -7.671  2.188   1.00 0.86 ? 32  TYR A OH   2  
ATOM 1967  H H    . TYR A 1 32 ? -0.576  -4.830  3.899   1.00 0.66 ? 32  TYR A H    2  
ATOM 1968  H HA   . TYR A 1 32 ? -2.705  -2.924  3.172   1.00 0.64 ? 32  TYR A HA   2  
ATOM 1969  H HB2  . TYR A 1 32 ? -2.523  -4.816  5.518   1.00 0.68 ? 32  TYR A HB2  2  
ATOM 1970  H HB3  . TYR A 1 32 ? -3.691  -3.510  5.425   1.00 0.74 ? 32  TYR A HB3  2  
ATOM 1971  H HD1  . TYR A 1 32 ? -2.587  -6.600  3.693   1.00 2.05 ? 32  TYR A HD1  2  
ATOM 1972  H HD2  . TYR A 1 32 ? -5.746  -3.854  4.398   1.00 2.10 ? 32  TYR A HD2  2  
ATOM 1973  H HE1  . TYR A 1 32 ? -4.136  -8.120  2.532   1.00 2.06 ? 32  TYR A HE1  2  
ATOM 1974  H HE2  . TYR A 1 32 ? -7.321  -5.349  3.262   1.00 2.17 ? 32  TYR A HE2  2  
ATOM 1975  H HH   . TYR A 1 32 ? -7.221  -8.154  2.839   1.00 1.32 ? 32  TYR A HH   2  
ATOM 1976  N N    . VAL A 1 33 ? -2.025  -1.191  4.921   1.00 0.57 ? 33  VAL A N    2  
ATOM 1977  C CA   . VAL A 1 33 ? -1.453  -0.122  5.743   1.00 0.55 ? 33  VAL A CA   2  
ATOM 1978  C C    . VAL A 1 33 ? -1.740  -0.383  7.225   1.00 0.59 ? 33  VAL A C    2  
ATOM 1979  O O    . VAL A 1 33 ? -2.887  -0.616  7.613   1.00 0.65 ? 33  VAL A O    2  
ATOM 1980  C CB   . VAL A 1 33 ? -1.995  1.267   5.335   1.00 0.59 ? 33  VAL A CB   2  
ATOM 1981  C CG1  . VAL A 1 33 ? -1.732  2.303   6.421   1.00 0.62 ? 33  VAL A CG1  2  
ATOM 1982  C CG2  . VAL A 1 33 ? -1.377  1.708   4.014   1.00 0.56 ? 33  VAL A CG2  2  
ATOM 1983  H H    . VAL A 1 33 ? -2.867  -1.037  4.463   1.00 0.61 ? 33  VAL A H    2  
ATOM 1984  H HA   . VAL A 1 33 ? -0.383  -0.129  5.589   1.00 0.51 ? 33  VAL A HA   2  
ATOM 1985  H HB   . VAL A 1 33 ? -3.064  1.189   5.197   1.00 0.67 ? 33  VAL A HB   2  
ATOM 1986  H HG11 . VAL A 1 33 ? -2.421  2.151   7.239   1.00 1.13 ? 33  VAL A HG11 2  
ATOM 1987  H HG12 . VAL A 1 33 ? -1.869  3.295   6.015   1.00 1.12 ? 33  VAL A HG12 2  
ATOM 1988  H HG13 . VAL A 1 33 ? -0.718  2.199   6.781   1.00 1.21 ? 33  VAL A HG13 2  
ATOM 1989  H HG21 . VAL A 1 33 ? -2.085  1.552   3.216   1.00 1.23 ? 33  VAL A HG21 2  
ATOM 1990  H HG22 . VAL A 1 33 ? -0.486  1.127   3.822   1.00 0.96 ? 33  VAL A HG22 2  
ATOM 1991  H HG23 . VAL A 1 33 ? -1.119  2.755   4.067   1.00 1.26 ? 33  VAL A HG23 2  
ATOM 1992  N N    . THR A 1 34 ? -0.682  -0.386  8.037   1.00 0.62 ? 34  THR A N    2  
ATOM 1993  C CA   . THR A 1 34 ? -0.806  -0.670  9.471   1.00 0.71 ? 34  THR A CA   2  
ATOM 1994  C C    . THR A 1 34 ? -0.871  0.591   10.346  1.00 0.72 ? 34  THR A C    2  
ATOM 1995  O O    . THR A 1 34 ? -1.486  0.564   11.413  1.00 0.84 ? 34  THR A O    2  
ATOM 1996  C CB   . THR A 1 34 ? 0.359   -1.559  9.935   1.00 0.74 ? 34  THR A CB   2  
ATOM 1997  O OG1  . THR A 1 34 ? 1.502   -0.780  10.246  1.00 1.39 ? 34  THR A OG1  2  
ATOM 1998  C CG2  . THR A 1 34 ? 0.781   -2.590  8.907   1.00 1.29 ? 34  THR A CG2  2  
ATOM 1999  H H    . THR A 1 34 ? 0.207   -0.230  7.652   1.00 0.62 ? 34  THR A H    2  
ATOM 2000  H HA   . THR A 1 34 ? -1.724  -1.220  9.610   1.00 0.81 ? 34  THR A HA   2  
ATOM 2001  H HB   . THR A 1 34 ? 0.057   -2.088  10.827  1.00 1.08 ? 34  THR A HB   2  
ATOM 2002  H HG1  . THR A 1 34 ? 1.762   -0.945  11.156  1.00 1.62 ? 34  THR A HG1  2  
ATOM 2003  H HG21 . THR A 1 34 ? 0.768   -3.571  9.356   1.00 1.65 ? 34  THR A HG21 2  
ATOM 2004  H HG22 . THR A 1 34 ? 1.778   -2.366  8.562   1.00 1.98 ? 34  THR A HG22 2  
ATOM 2005  H HG23 . THR A 1 34 ? 0.098   -2.569  8.071   1.00 1.56 ? 34  THR A HG23 2  
ATOM 2006  N N    . LYS A 1 35 ? -0.245  1.686   9.904   1.00 0.65 ? 35  LYS A N    2  
ATOM 2007  C CA   . LYS A 1 35 ? -0.245  2.936   10.679  1.00 0.71 ? 35  LYS A CA   2  
ATOM 2008  C C    . LYS A 1 35 ? 0.098   4.139   9.806   1.00 0.69 ? 35  LYS A C    2  
ATOM 2009  O O    . LYS A 1 35 ? 1.142   4.164   9.158   1.00 0.62 ? 35  LYS A O    2  
ATOM 2010  C CB   . LYS A 1 35 ? 0.769   2.864   11.832  1.00 0.72 ? 35  LYS A CB   2  
ATOM 2011  C CG   . LYS A 1 35 ? 0.440   1.833   12.902  1.00 1.32 ? 35  LYS A CG   2  
ATOM 2012  C CD   . LYS A 1 35 ? 1.394   1.933   14.083  1.00 1.46 ? 35  LYS A CD   2  
ATOM 2013  C CE   . LYS A 1 35 ? 1.004   0.981   15.203  1.00 2.02 ? 35  LYS A CE   2  
ATOM 2014  N NZ   . LYS A 1 35 ? 2.149   0.688   16.110  1.00 2.54 ? 35  LYS A NZ   2  
ATOM 2015  H H    . LYS A 1 35 ? 0.217   1.656   9.039   1.00 0.59 ? 35  LYS A H    2  
ATOM 2016  H HA   . LYS A 1 35 ? -1.234  3.071   11.090  1.00 0.80 ? 35  LYS A HA   2  
ATOM 2017  H HB2  . LYS A 1 35 ? 1.740   2.627   11.425  1.00 0.98 ? 35  LYS A HB2  2  
ATOM 2018  H HB3  . LYS A 1 35 ? 0.819   3.834   12.306  1.00 1.18 ? 35  LYS A HB3  2  
ATOM 2019  H HG2  . LYS A 1 35 ? -0.567  1.998   13.250  1.00 1.91 ? 35  LYS A HG2  2  
ATOM 2020  H HG3  . LYS A 1 35 ? 0.518   0.845   12.473  1.00 2.08 ? 35  LYS A HG3  2  
ATOM 2021  H HD2  . LYS A 1 35 ? 2.391   1.688   13.749  1.00 1.89 ? 35  LYS A HD2  2  
ATOM 2022  H HD3  . LYS A 1 35 ? 1.379   2.945   14.461  1.00 1.86 ? 35  LYS A HD3  2  
ATOM 2023  H HE2  . LYS A 1 35 ? 0.208   1.431   15.779  1.00 2.47 ? 35  LYS A HE2  2  
ATOM 2024  H HE3  . LYS A 1 35 ? 0.654   0.057   14.768  1.00 2.40 ? 35  LYS A HE3  2  
ATOM 2025  H HZ1  . LYS A 1 35 ? 1.830   0.106   16.910  1.00 2.55 ? 35  LYS A HZ1  2  
ATOM 2026  H HZ2  . LYS A 1 35 ? 2.551   1.574   16.478  1.00 2.90 ? 35  LYS A HZ2  2  
ATOM 2027  H HZ3  . LYS A 1 35 ? 2.890   0.173   15.595  1.00 3.18 ? 35  LYS A HZ3  2  
ATOM 2028  N N    . ILE A 1 36 ? -0.776  5.143   9.803   1.00 0.86 ? 36  ILE A N    2  
ATOM 2029  C CA   . ILE A 1 36 ? -0.543  6.350   9.015   1.00 0.92 ? 36  ILE A CA   2  
ATOM 2030  C C    . ILE A 1 36 ? -0.050  7.499   9.901   1.00 0.98 ? 36  ILE A C    2  
ATOM 2031  O O    . ILE A 1 36 ? -0.725  7.892   10.855  1.00 1.06 ? 36  ILE A O    2  
ATOM 2032  C CB   . ILE A 1 36 ? -1.814  6.792   8.257   1.00 1.03 ? 36  ILE A CB   2  
ATOM 2033  C CG1  . ILE A 1 36 ? -2.231  5.711   7.254   1.00 1.40 ? 36  ILE A CG1  2  
ATOM 2034  C CG2  . ILE A 1 36 ? -1.577  8.123   7.550   1.00 1.12 ? 36  ILE A CG2  2  
ATOM 2035  C CD1  . ILE A 1 36 ? -3.165  6.208   6.173   1.00 1.35 ? 36  ILE A CD1  2  
ATOM 2036  H H    . ILE A 1 36 ? -1.591  5.074   10.343  1.00 0.98 ? 36  ILE A H    2  
ATOM 2037  H HA   . ILE A 1 36 ? 0.219   6.119   8.285   1.00 0.85 ? 36  ILE A HA   2  
ATOM 2038  H HB   . ILE A 1 36 ? -2.606  6.931   8.977   1.00 0.95 ? 36  ILE A HB   2  
ATOM 2039  H HG12 . ILE A 1 36 ? -1.349  5.318   6.772   1.00 1.63 ? 36  ILE A HG12 2  
ATOM 2040  H HG13 . ILE A 1 36 ? -2.731  4.913   7.784   1.00 1.62 ? 36  ILE A HG13 2  
ATOM 2041  H HG21 . ILE A 1 36 ? -0.800  8.003   6.809   1.00 1.46 ? 36  ILE A HG21 2  
ATOM 2042  H HG22 . ILE A 1 36 ? -1.274  8.865   8.272   1.00 1.45 ? 36  ILE A HG22 2  
ATOM 2043  H HG23 . ILE A 1 36 ? -2.489  8.440   7.068   1.00 1.44 ? 36  ILE A HG23 2  
ATOM 2044  H HD11 . ILE A 1 36 ? -3.553  5.368   5.618   1.00 1.87 ? 36  ILE A HD11 2  
ATOM 2045  H HD12 . ILE A 1 36 ? -2.626  6.863   5.504   1.00 1.71 ? 36  ILE A HD12 2  
ATOM 2046  H HD13 . ILE A 1 36 ? -3.982  6.752   6.626   1.00 1.41 ? 36  ILE A HD13 2  
ATOM 2047  N N    . ILE A 1 37 ? 1.129   8.037   9.572   1.00 1.03 ? 37  ILE A N    2  
ATOM 2048  C CA   . ILE A 1 37 ? 1.720   9.144   10.324  1.00 1.10 ? 37  ILE A CA   2  
ATOM 2049  C C    . ILE A 1 37 ? 1.069   10.474  9.932   1.00 1.10 ? 37  ILE A C    2  
ATOM 2050  O O    . ILE A 1 37 ? 0.635   10.650  8.791   1.00 1.37 ? 37  ILE A O    2  
ATOM 2051  C CB   . ILE A 1 37 ? 3.252   9.224   10.089  1.00 1.14 ? 37  ILE A CB   2  
ATOM 2052  C CG1  . ILE A 1 37 ? 3.966   8.070   10.799  1.00 1.47 ? 37  ILE A CG1  2  
ATOM 2053  C CG2  . ILE A 1 37 ? 3.814   10.559  10.559  1.00 1.32 ? 37  ILE A CG2  2  
ATOM 2054  C CD1  . ILE A 1 37 ? 4.004   6.788   9.996   1.00 1.68 ? 37  ILE A CD1  2  
ATOM 2055  H H    . ILE A 1 37 ? 1.614   7.683   8.798   1.00 1.06 ? 37  ILE A H    2  
ATOM 2056  H HA   . ILE A 1 37 ? 1.546   8.966   11.376  1.00 1.17 ? 37  ILE A HA   2  
ATOM 2057  H HB   . ILE A 1 37 ? 3.432   9.147   9.029   1.00 1.07 ? 37  ILE A HB   2  
ATOM 2058  H HG12 . ILE A 1 37 ? 4.986   8.360   11.002  1.00 1.63 ? 37  ILE A HG12 2  
ATOM 2059  H HG13 . ILE A 1 37 ? 3.463   7.863   11.732  1.00 1.84 ? 37  ILE A HG13 2  
ATOM 2060  H HG21 . ILE A 1 37 ? 3.440   10.782  11.547  1.00 1.40 ? 37  ILE A HG21 2  
ATOM 2061  H HG22 . ILE A 1 37 ? 3.511   11.338  9.875   1.00 1.79 ? 37  ILE A HG22 2  
ATOM 2062  H HG23 . ILE A 1 37 ? 4.893   10.506  10.586  1.00 1.90 ? 37  ILE A HG23 2  
ATOM 2063  H HD11 . ILE A 1 37 ? 4.707   6.103   10.447  1.00 2.18 ? 37  ILE A HD11 2  
ATOM 2064  H HD12 . ILE A 1 37 ? 4.313   7.006   8.984   1.00 1.92 ? 37  ILE A HD12 2  
ATOM 2065  H HD13 . ILE A 1 37 ? 3.022   6.340   9.984   1.00 1.93 ? 37  ILE A HD13 2  
ATOM 2066  N N    . GLU A 1 38 ? 1.008   11.408  10.885  1.00 0.96 ? 38  GLU A N    2  
ATOM 2067  C CA   . GLU A 1 38 ? 0.413   12.724  10.641  1.00 0.99 ? 38  GLU A CA   2  
ATOM 2068  C C    . GLU A 1 38 ? 1.183   13.486  9.561   1.00 1.31 ? 38  GLU A C    2  
ATOM 2069  O O    . GLU A 1 38 ? 2.398   13.331  9.423   1.00 1.64 ? 38  GLU A O    2  
ATOM 2070  C CB   . GLU A 1 38 ? 0.373   13.547  11.933  1.00 1.23 ? 38  GLU A CB   2  
ATOM 2071  C CG   . GLU A 1 38 ? -0.850  13.265  12.794  1.00 1.71 ? 38  GLU A CG   2  
ATOM 2072  C CD   . GLU A 1 38 ? -1.331  14.493  13.542  1.00 2.41 ? 38  GLU A CD   2  
ATOM 2073  O OE1  . GLU A 1 38 ? -2.164  15.239  12.985  1.00 2.79 ? 38  GLU A OE1  2  
ATOM 2074  O OE2  . GLU A 1 38 ? -0.876  14.709  14.686  1.00 3.11 ? 38  GLU A OE2  2  
ATOM 2075  H H    . GLU A 1 38 ? 1.374   11.207  11.773  1.00 0.97 ? 38  GLU A H    2  
ATOM 2076  H HA   . GLU A 1 38 ? -0.599  12.567  10.296  1.00 1.23 ? 38  GLU A HA   2  
ATOM 2077  H HB2  . GLU A 1 38 ? 1.255   13.328  12.516  1.00 1.66 ? 38  GLU A HB2  2  
ATOM 2078  H HB3  . GLU A 1 38 ? 0.372   14.596  11.678  1.00 1.49 ? 38  GLU A HB3  2  
ATOM 2079  H HG2  . GLU A 1 38 ? -1.649  12.915  12.158  1.00 2.01 ? 38  GLU A HG2  2  
ATOM 2080  H HG3  . GLU A 1 38 ? -0.599  12.498  13.512  1.00 1.90 ? 38  GLU A HG3  2  
ATOM 2081  N N    . GLY A 1 39 ? 0.460   14.316  8.804   1.00 1.69 ? 39  GLY A N    2  
ATOM 2082  C CA   . GLY A 1 39 ? 1.073   15.104  7.743   1.00 2.36 ? 39  GLY A CA   2  
ATOM 2083  C C    . GLY A 1 39 ? 1.750   14.261  6.666   1.00 2.68 ? 39  GLY A C    2  
ATOM 2084  O O    . GLY A 1 39 ? 2.573   14.777  5.908   1.00 3.15 ? 39  GLY A O    2  
ATOM 2085  H H    . GLY A 1 39 ? -0.499  14.401  8.974   1.00 1.72 ? 39  GLY A H    2  
ATOM 2086  H HA2  . GLY A 1 39 ? 0.308   15.706  7.277   1.00 2.72 ? 39  GLY A HA2  2  
ATOM 2087  H HA3  . GLY A 1 39 ? 1.808   15.760  8.183   1.00 2.45 ? 39  GLY A HA3  2  
ATOM 2088  N N    . GLY A 1 40 ? 1.410   12.971  6.597   1.00 2.49 ? 40  GLY A N    2  
ATOM 2089  C CA   . GLY A 1 40 ? 2.008   12.093  5.604   1.00 2.80 ? 40  GLY A CA   2  
ATOM 2090  C C    . GLY A 1 40 ? 1.259   12.098  4.284   1.00 2.61 ? 40  GLY A C    2  
ATOM 2091  O O    . GLY A 1 40 ? 0.139   12.602  4.202   1.00 2.37 ? 40  GLY A O    2  
ATOM 2092  H H    . GLY A 1 40 ? 0.751   12.612  7.227   1.00 2.19 ? 40  GLY A H    2  
ATOM 2093  H HA2  . GLY A 1 40 ? 3.025   12.408  5.428   1.00 3.27 ? 40  GLY A HA2  2  
ATOM 2094  H HA3  . GLY A 1 40 ? 2.020   11.085  5.993   1.00 2.80 ? 40  GLY A HA3  2  
ATOM 2095  N N    . ALA A 1 41 ? 1.884   11.535  3.248   1.00 2.83 ? 41  ALA A N    2  
ATOM 2096  C CA   . ALA A 1 41 ? 1.284   11.467  1.914   1.00 2.70 ? 41  ALA A CA   2  
ATOM 2097  C C    . ALA A 1 41 ? -0.155  10.952  1.968   1.00 2.11 ? 41  ALA A C    2  
ATOM 2098  O O    . ALA A 1 41 ? -1.066  11.588  1.438   1.00 2.06 ? 41  ALA A O    2  
ATOM 2099  C CB   . ALA A 1 41 ? 2.123   10.581  1.004   1.00 3.00 ? 41  ALA A CB   2  
ATOM 2100  H H    . ALA A 1 41 ? 2.778   11.154  3.385   1.00 3.11 ? 41  ALA A H    2  
ATOM 2101  H HA   . ALA A 1 41 ? 1.281   12.465  1.501   1.00 2.91 ? 41  ALA A HA   2  
ATOM 2102  H HB1  . ALA A 1 41 ? 3.140   10.947  0.982   1.00 3.45 ? 41  ALA A HB1  2  
ATOM 2103  H HB2  . ALA A 1 41 ? 1.711   10.598  0.005   1.00 3.26 ? 41  ALA A HB2  2  
ATOM 2104  H HB3  . ALA A 1 41 ? 2.114   9.569   1.380   1.00 2.99 ? 41  ALA A HB3  2  
ATOM 2105  N N    . ALA A 1 42 ? -0.352  9.801   2.616   1.00 1.82 ? 42  ALA A N    2  
ATOM 2106  C CA   . ALA A 1 42 ? -1.682  9.205   2.741   1.00 1.36 ? 42  ALA A CA   2  
ATOM 2107  C C    . ALA A 1 42 ? -2.575  10.042  3.657   1.00 1.16 ? 42  ALA A C    2  
ATOM 2108  O O    . ALA A 1 42 ? -3.696  10.394  3.290   1.00 1.02 ? 42  ALA A O    2  
ATOM 2109  C CB   . ALA A 1 42 ? -1.576  7.777   3.260   1.00 1.50 ? 42  ALA A CB   2  
ATOM 2110  H H    . ALA A 1 42 ? 0.414   9.343   3.022   1.00 2.06 ? 42  ALA A H    2  
ATOM 2111  H HA   . ALA A 1 42 ? -2.124  9.173   1.757   1.00 1.30 ? 42  ALA A HA   2  
ATOM 2112  H HB1  . ALA A 1 42 ? -0.933  7.755   4.127   1.00 1.77 ? 42  ALA A HB1  2  
ATOM 2113  H HB2  . ALA A 1 42 ? -1.163  7.144   2.489   1.00 1.88 ? 42  ALA A HB2  2  
ATOM 2114  H HB3  . ALA A 1 42 ? -2.559  7.419   3.531   1.00 1.93 ? 42  ALA A HB3  2  
ATOM 2115  N N    . HIS A 1 43 ? -2.066  10.348  4.852   1.00 1.34 ? 43  HIS A N    2  
ATOM 2116  C CA   . HIS A 1 43 ? -2.802  11.139  5.842   1.00 1.21 ? 43  HIS A CA   2  
ATOM 2117  C C    . HIS A 1 43 ? -3.332  12.449  5.249   1.00 1.08 ? 43  HIS A C    2  
ATOM 2118  O O    . HIS A 1 43 ? -4.486  12.816  5.474   1.00 1.15 ? 43  HIS A O    2  
ATOM 2119  C CB   . HIS A 1 43 ? -1.891  11.445  7.034   1.00 1.39 ? 43  HIS A CB   2  
ATOM 2120  C CG   . HIS A 1 43 ? -2.570  12.174  8.149   1.00 1.16 ? 43  HIS A CG   2  
ATOM 2121  N ND1  . HIS A 1 43 ? -2.619  13.549  8.226   1.00 1.34 ? 43  HIS A ND1  2  
ATOM 2122  C CD2  . HIS A 1 43 ? -3.217  11.713  9.245   1.00 1.15 ? 43  HIS A CD2  2  
ATOM 2123  C CE1  . HIS A 1 43 ? -3.263  13.904  9.322   1.00 1.22 ? 43  HIS A CE1  2  
ATOM 2124  N NE2  . HIS A 1 43 ? -3.637  12.809  9.958   1.00 1.28 ? 43  HIS A NE2  2  
ATOM 2125  H H    . HIS A 1 43 ? -1.169  10.023  5.081   1.00 1.62 ? 43  HIS A H    2  
ATOM 2126  H HA   . HIS A 1 43 ? -3.637  10.548  6.184   1.00 1.26 ? 43  HIS A HA   2  
ATOM 2127  H HB2  . HIS A 1 43 ? -1.509  10.518  7.432   1.00 1.74 ? 43  HIS A HB2  2  
ATOM 2128  H HB3  . HIS A 1 43 ? -1.064  12.050  6.696   1.00 1.58 ? 43  HIS A HB3  2  
ATOM 2129  H HD1  . HIS A 1 43 ? -2.240  14.171  7.571   1.00 1.69 ? 43  HIS A HD1  2  
ATOM 2130  H HD2  . HIS A 1 43 ? -3.376  10.675  9.506   1.00 1.32 ? 43  HIS A HD2  2  
ATOM 2131  H HE1  . HIS A 1 43 ? -3.444  14.917  9.645   1.00 1.34 ? 43  HIS A HE1  2  
ATOM 2132  H HE2  . HIS A 1 43 ? -4.213  12.786  10.751  1.00 1.60 ? 43  HIS A HE2  2  
ATOM 2133  N N    . LYS A 1 44 ? -2.477  13.150  4.503   1.00 1.15 ? 44  LYS A N    2  
ATOM 2134  C CA   . LYS A 1 44 ? -2.851  14.425  3.887   1.00 1.31 ? 44  LYS A CA   2  
ATOM 2135  C C    . LYS A 1 44 ? -3.815  14.226  2.717   1.00 1.39 ? 44  LYS A C    2  
ATOM 2136  O O    . LYS A 1 44 ? -4.735  15.024  2.525   1.00 1.46 ? 44  LYS A O    2  
ATOM 2137  C CB   . LYS A 1 44 ? -1.602  15.173  3.408   1.00 1.74 ? 44  LYS A CB   2  
ATOM 2138  C CG   . LYS A 1 44 ? -0.667  15.596  4.533   1.00 1.89 ? 44  LYS A CG   2  
ATOM 2139  C CD   . LYS A 1 44 ? -0.078  16.976  4.282   1.00 2.36 ? 44  LYS A CD   2  
ATOM 2140  C CE   . LYS A 1 44 ? -0.338  17.915  5.450   1.00 2.17 ? 44  LYS A CE   2  
ATOM 2141  N NZ   . LYS A 1 44 ? -1.685  18.547  5.370   1.00 2.66 ? 44  LYS A NZ   2  
ATOM 2142  H H    . LYS A 1 44 ? -1.569  12.806  4.369   1.00 1.26 ? 44  LYS A H    2  
ATOM 2143  H HA   . LYS A 1 44 ? -3.345  15.021  4.640   1.00 1.30 ? 44  LYS A HA   2  
ATOM 2144  H HB2  . LYS A 1 44 ? -1.051  14.533  2.735   1.00 2.10 ? 44  LYS A HB2  2  
ATOM 2145  H HB3  . LYS A 1 44 ? -1.912  16.060  2.874   1.00 2.02 ? 44  LYS A HB3  2  
ATOM 2146  H HG2  . LYS A 1 44 ? -1.218  15.614  5.461   1.00 1.94 ? 44  LYS A HG2  2  
ATOM 2147  H HG3  . LYS A 1 44 ? 0.139   14.880  4.606   1.00 2.08 ? 44  LYS A HG3  2  
ATOM 2148  H HD2  . LYS A 1 44 ? 0.987   16.881  4.140   1.00 2.71 ? 44  LYS A HD2  2  
ATOM 2149  H HD3  . LYS A 1 44 ? -0.526  17.393  3.391   1.00 2.84 ? 44  LYS A HD3  2  
ATOM 2150  H HE2  . LYS A 1 44 ? -0.268  17.354  6.369   1.00 2.08 ? 44  LYS A HE2  2  
ATOM 2151  H HE3  . LYS A 1 44 ? 0.415   18.690  5.446   1.00 2.50 ? 44  LYS A HE3  2  
ATOM 2152  H HZ1  . LYS A 1 44 ? -1.851  19.140  6.208   1.00 3.12 ? 44  LYS A HZ1  2  
ATOM 2153  H HZ2  . LYS A 1 44 ? -2.421  17.813  5.327   1.00 3.21 ? 44  LYS A HZ2  2  
ATOM 2154  H HZ3  . LYS A 1 44 ? -1.751  19.140  4.520   1.00 2.66 ? 44  LYS A HZ3  2  
ATOM 2155  N N    . ASP A 1 45 ? -3.599  13.167  1.934   1.00 1.59 ? 45  ASP A N    2  
ATOM 2156  C CA   . ASP A 1 45 ? -4.452  12.878  0.782   1.00 1.86 ? 45  ASP A CA   2  
ATOM 2157  C C    . ASP A 1 45 ? -5.874  12.523  1.218   1.00 1.89 ? 45  ASP A C    2  
ATOM 2158  O O    . ASP A 1 45 ? -6.837  13.151  0.773   1.00 1.97 ? 45  ASP A O    2  
ATOM 2159  C CB   . ASP A 1 45 ? -3.859  11.739  -0.054  1.00 2.33 ? 45  ASP A CB   2  
ATOM 2160  C CG   . ASP A 1 45 ? -4.352  11.755  -1.489  1.00 2.69 ? 45  ASP A CG   2  
ATOM 2161  O OD1  . ASP A 1 45 ? -4.043  12.724  -2.214  1.00 3.24 ? 45  ASP A OD1  2  
ATOM 2162  O OD2  . ASP A 1 45 ? -5.047  10.798  -1.886  1.00 2.80 ? 45  ASP A OD2  2  
ATOM 2163  H H    . ASP A 1 45 ? -2.849  12.568  2.134   1.00 1.67 ? 45  ASP A H    2  
ATOM 2164  H HA   . ASP A 1 45 ? -4.492  13.770  0.173   1.00 1.92 ? 45  ASP A HA   2  
ATOM 2165  H HB2  . ASP A 1 45 ? -2.783  11.830  -0.064  1.00 2.40 ? 45  ASP A HB2  2  
ATOM 2166  H HB3  . ASP A 1 45 ? -4.131  10.794  0.392   1.00 2.46 ? 45  ASP A HB3  2  
ATOM 2167  N N    . GLY A 1 46 ? -5.999  11.519  2.089   1.00 2.08 ? 46  GLY A N    2  
ATOM 2168  C CA   . GLY A 1 46 ? -7.309  11.104  2.570   1.00 2.49 ? 46  GLY A CA   2  
ATOM 2169  C C    . GLY A 1 46 ? -7.818  9.835   1.902   1.00 2.11 ? 46  GLY A C    2  
ATOM 2170  O O    . GLY A 1 46 ? -8.569  9.072   2.513   1.00 2.47 ? 46  GLY A O    2  
ATOM 2171  H H    . GLY A 1 46 ? -5.196  11.057  2.410   1.00 2.09 ? 46  GLY A H    2  
ATOM 2172  H HA2  . GLY A 1 46 ? -7.249  10.936  3.634   1.00 2.83 ? 46  GLY A HA2  2  
ATOM 2173  H HA3  . GLY A 1 46 ? -8.015  11.901  2.385   1.00 3.17 ? 46  GLY A HA3  2  
ATOM 2174  N N    . LYS A 1 47 ? -7.416  9.608   0.648   1.00 1.87 ? 47  LYS A N    2  
ATOM 2175  C CA   . LYS A 1 47 ? -7.846  8.423   -0.098  1.00 2.32 ? 47  LYS A CA   2  
ATOM 2176  C C    . LYS A 1 47 ? -7.356  7.134   0.565   1.00 1.93 ? 47  LYS A C    2  
ATOM 2177  O O    . LYS A 1 47 ? -8.107  6.162   0.665   1.00 1.95 ? 47  LYS A O    2  
ATOM 2178  C CB   . LYS A 1 47 ? -7.341  8.484   -1.543  1.00 2.80 ? 47  LYS A CB   2  
ATOM 2179  C CG   . LYS A 1 47 ? -8.266  9.248   -2.479  1.00 3.64 ? 47  LYS A CG   2  
ATOM 2180  C CD   . LYS A 1 47 ? -7.501  9.873   -3.637  1.00 4.17 ? 47  LYS A CD   2  
ATOM 2181  C CE   . LYS A 1 47 ? -8.280  9.775   -4.939  1.00 5.03 ? 47  LYS A CE   2  
ATOM 2182  N NZ   . LYS A 1 47 ? -7.622  10.530  -6.042  1.00 5.67 ? 47  LYS A NZ   2  
ATOM 2183  H H    . LYS A 1 47 ? -6.820  10.253  0.214   1.00 1.83 ? 47  LYS A H    2  
ATOM 2184  H HA   . LYS A 1 47 ? -8.925  8.417   -0.107  1.00 3.00 ? 47  LYS A HA   2  
ATOM 2185  H HB2  . LYS A 1 47 ? -6.375  8.963   -1.555  1.00 2.86 ? 47  LYS A HB2  2  
ATOM 2186  H HB3  . LYS A 1 47 ? -7.239  7.476   -1.919  1.00 3.00 ? 47  LYS A HB3  2  
ATOM 2187  H HG2  . LYS A 1 47 ? -9.003  8.567   -2.875  1.00 4.05 ? 47  LYS A HG2  2  
ATOM 2188  H HG3  . LYS A 1 47 ? -8.759  10.032  -1.921  1.00 3.92 ? 47  LYS A HG3  2  
ATOM 2189  H HD2  . LYS A 1 47 ? -7.320  10.914  -3.416  1.00 4.28 ? 47  LYS A HD2  2  
ATOM 2190  H HD3  . LYS A 1 47 ? -6.557  9.358   -3.752  1.00 4.30 ? 47  LYS A HD3  2  
ATOM 2191  H HE2  . LYS A 1 47 ? -8.353  8.735   -5.223  1.00 5.17 ? 47  LYS A HE2  2  
ATOM 2192  H HE3  . LYS A 1 47 ? -9.271  10.174  -4.782  1.00 5.45 ? 47  LYS A HE3  2  
ATOM 2193  H HZ1  . LYS A 1 47 ? -6.655  10.176  -6.190  1.00 5.78 ? 47  LYS A HZ1  2  
ATOM 2194  H HZ2  . LYS A 1 47 ? -7.578  11.542  -5.806  1.00 5.80 ? 47  LYS A HZ2  2  
ATOM 2195  H HZ3  . LYS A 1 47 ? -8.159  10.415  -6.925  1.00 6.21 ? 47  LYS A HZ3  2  
ATOM 2196  N N    . LEU A 1 48 ? -6.099  7.129   1.016   1.00 1.68 ? 48  LEU A N    2  
ATOM 2197  C CA   . LEU A 1 48 ? -5.525  5.952   1.665   1.00 1.38 ? 48  LEU A CA   2  
ATOM 2198  C C    . LEU A 1 48 ? -5.797  5.962   3.168   1.00 1.28 ? 48  LEU A C    2  
ATOM 2199  O O    . LEU A 1 48 ? -5.347  6.856   3.887   1.00 1.35 ? 48  LEU A O    2  
ATOM 2200  C CB   . LEU A 1 48 ? -4.017  5.877   1.405   1.00 1.19 ? 48  LEU A CB   2  
ATOM 2201  C CG   . LEU A 1 48 ? -3.408  4.475   1.507   1.00 1.09 ? 48  LEU A CG   2  
ATOM 2202  C CD1  . LEU A 1 48 ? -2.123  4.388   0.700   1.00 1.56 ? 48  LEU A CD1  2  
ATOM 2203  C CD2  . LEU A 1 48 ? -3.157  4.105   2.961   1.00 1.06 ? 48  LEU A CD2  2  
ATOM 2204  H H    . LEU A 1 48 ? -5.544  7.930   0.913   1.00 1.80 ? 48  LEU A H    2  
ATOM 2205  H HA   . LEU A 1 48 ? -5.995  5.079   1.235   1.00 1.52 ? 48  LEU A HA   2  
ATOM 2206  H HB2  . LEU A 1 48 ? -3.825  6.259   0.412   1.00 1.43 ? 48  LEU A HB2  2  
ATOM 2207  H HB3  . LEU A 1 48 ? -3.518  6.514   2.118   1.00 1.29 ? 48  LEU A HB3  2  
ATOM 2208  H HG   . LEU A 1 48 ? -4.107  3.757   1.099   1.00 1.25 ? 48  LEU A HG   2  
ATOM 2209  H HD11 . LEU A 1 48 ? -1.583  3.494   0.976   1.00 2.04 ? 48  LEU A HD11 2  
ATOM 2210  H HD12 . LEU A 1 48 ? -1.511  5.255   0.903   1.00 1.85 ? 48  LEU A HD12 2  
ATOM 2211  H HD13 . LEU A 1 48 ? -2.360  4.354   -0.353  1.00 2.03 ? 48  LEU A HD13 2  
ATOM 2212  H HD21 . LEU A 1 48 ? -3.801  4.690   3.599   1.00 1.74 ? 48  LEU A HD21 2  
ATOM 2213  H HD22 . LEU A 1 48 ? -2.125  4.301   3.210   1.00 1.43 ? 48  LEU A HD22 2  
ATOM 2214  H HD23 . LEU A 1 48 ? -3.370  3.054   3.103   1.00 1.30 ? 48  LEU A HD23 2  
ATOM 2215  N N    . GLN A 1 49 ? -6.536  4.955   3.627   1.00 1.21 ? 49  GLN A N    2  
ATOM 2216  C CA   . GLN A 1 49 ? -6.882  4.813   5.036   1.00 1.17 ? 49  GLN A CA   2  
ATOM 2217  C C    . GLN A 1 49 ? -6.593  3.388   5.516   1.00 1.09 ? 49  GLN A C    2  
ATOM 2218  O O    . GLN A 1 49 ? -6.767  2.431   4.761   1.00 1.14 ? 49  GLN A O    2  
ATOM 2219  C CB   . GLN A 1 49 ? -8.361  5.158   5.248   1.00 1.30 ? 49  GLN A CB   2  
ATOM 2220  C CG   . GLN A 1 49 ? -9.331  4.058   4.830   1.00 1.46 ? 49  GLN A CG   2  
ATOM 2221  C CD   . GLN A 1 49 ? -9.468  3.930   3.323   1.00 1.45 ? 49  GLN A CD   2  
ATOM 2222  O OE1  . GLN A 1 49 ? -10.194 4.695   2.688   1.00 1.54 ? 49  GLN A OE1  2  
ATOM 2223  N NE2  . GLN A 1 49 ? -8.767  2.961   2.740   1.00 1.52 ? 49  GLN A NE2  2  
ATOM 2224  H H    . GLN A 1 49 ? -6.859  4.279   3.000   1.00 1.26 ? 49  GLN A H    2  
ATOM 2225  H HA   . GLN A 1 49 ? -6.278  5.503   5.601   1.00 1.19 ? 49  GLN A HA   2  
ATOM 2226  H HB2  . GLN A 1 49 ? -8.519  5.362   6.293   1.00 1.32 ? 49  GLN A HB2  2  
ATOM 2227  H HB3  . GLN A 1 49 ? -8.595  6.046   4.681   1.00 1.34 ? 49  GLN A HB3  2  
ATOM 2228  H HG2  . GLN A 1 49 ? -8.981  3.116   5.225   1.00 1.57 ? 49  GLN A HG2  2  
ATOM 2229  H HG3  . GLN A 1 49 ? -10.303 4.280   5.246   1.00 1.59 ? 49  GLN A HG3  2  
ATOM 2230  H HE21 . GLN A 1 49 ? -8.205  2.389   3.305   1.00 1.62 ? 49  GLN A HE21 2  
ATOM 2231  H HE22 . GLN A 1 49 ? -8.839  2.859   1.768   1.00 1.56 ? 49  GLN A HE22 2  
ATOM 2232  N N    . ILE A 1 50 ? -6.157  3.249   6.772   1.00 1.06 ? 50  ILE A N    2  
ATOM 2233  C CA   . ILE A 1 50 ? -5.852  1.930   7.343   1.00 1.03 ? 50  ILE A CA   2  
ATOM 2234  C C    . ILE A 1 50 ? -6.918  0.907   6.942   1.00 1.05 ? 50  ILE A C    2  
ATOM 2235  O O    . ILE A 1 50 ? -8.116  1.177   7.059   1.00 1.16 ? 50  ILE A O    2  
ATOM 2236  C CB   . ILE A 1 50 ? -5.760  1.984   8.886   1.00 1.08 ? 50  ILE A CB   2  
ATOM 2237  C CG1  . ILE A 1 50 ? -4.683  2.981   9.327   1.00 1.76 ? 50  ILE A CG1  2  
ATOM 2238  C CG2  . ILE A 1 50 ? -5.470  0.601   9.456   1.00 1.14 ? 50  ILE A CG2  2  
ATOM 2239  C CD1  . ILE A 1 50 ? -5.238  4.191   10.050  1.00 2.56 ? 50  ILE A CD1  2  
ATOM 2240  H H    . ILE A 1 50 ? -6.044  4.048   7.329   1.00 1.12 ? 50  ILE A H    2  
ATOM 2241  H HA   . ILE A 1 50 ? -4.895  1.611   6.955   1.00 1.00 ? 50  ILE A HA   2  
ATOM 2242  H HB   . ILE A 1 50 ? -6.716  2.307   9.268   1.00 1.51 ? 50  ILE A HB   2  
ATOM 2243  H HG12 . ILE A 1 50 ? -3.993  2.486   9.995   1.00 1.94 ? 50  ILE A HG12 2  
ATOM 2244  H HG13 . ILE A 1 50 ? -4.146  3.331   8.458   1.00 2.32 ? 50  ILE A HG13 2  
ATOM 2245  H HG21 . ILE A 1 50 ? -5.259  0.683   10.512  1.00 1.55 ? 50  ILE A HG21 2  
ATOM 2246  H HG22 . ILE A 1 50 ? -4.615  0.176   8.950   1.00 1.63 ? 50  ILE A HG22 2  
ATOM 2247  H HG23 . ILE A 1 50 ? -6.329  -0.036  9.309   1.00 1.57 ? 50  ILE A HG23 2  
ATOM 2248  H HD11 . ILE A 1 50 ? -5.996  4.659   9.439   1.00 3.13 ? 50  ILE A HD11 2  
ATOM 2249  H HD12 . ILE A 1 50 ? -4.441  4.896   10.236  1.00 2.96 ? 50  ILE A HD12 2  
ATOM 2250  H HD13 . ILE A 1 50 ? -5.672  3.881   10.988  1.00 2.79 ? 50  ILE A HD13 2  
ATOM 2251  N N    . GLY A 1 51 ? -6.483  -0.261  6.458   1.00 1.02 ? 51  GLY A N    2  
ATOM 2252  C CA   . GLY A 1 51 ? -7.422  -1.290  6.039   1.00 1.10 ? 51  GLY A CA   2  
ATOM 2253  C C    . GLY A 1 51 ? -7.366  -1.566  4.546   1.00 1.04 ? 51  GLY A C    2  
ATOM 2254  O O    . GLY A 1 51 ? -7.796  -2.632  4.101   1.00 1.03 ? 51  GLY A O    2  
ATOM 2255  H H    . GLY A 1 51 ? -5.524  -0.442  6.374   1.00 0.99 ? 51  GLY A H    2  
ATOM 2256  H HA2  . GLY A 1 51 ? -7.191  -2.203  6.567   1.00 1.22 ? 51  GLY A HA2  2  
ATOM 2257  H HA3  . GLY A 1 51 ? -8.423  -0.987  6.296   1.00 1.14 ? 51  GLY A HA3  2  
ATOM 2258  N N    . ASP A 1 52 ? -6.838  -0.615  3.763   1.00 1.04 ? 52  ASP A N    2  
ATOM 2259  C CA   . ASP A 1 52 ? -6.741  -0.788  2.323   1.00 1.01 ? 52  ASP A CA   2  
ATOM 2260  C C    . ASP A 1 52 ? -5.694  -1.838  1.962   1.00 0.91 ? 52  ASP A C    2  
ATOM 2261  O O    . ASP A 1 52 ? -4.682  -1.999  2.662   1.00 0.88 ? 52  ASP A O    2  
ATOM 2262  C CB   . ASP A 1 52 ? -6.422  0.542   1.628   1.00 1.03 ? 52  ASP A CB   2  
ATOM 2263  C CG   . ASP A 1 52 ? -5.369  1.369   2.338   1.00 1.11 ? 52  ASP A CG   2  
ATOM 2264  O OD1  . ASP A 1 52 ? -4.375  0.796   2.834   1.00 1.55 ? 52  ASP A OD1  2  
ATOM 2265  O OD2  . ASP A 1 52 ? -5.541  2.600   2.391   1.00 1.56 ? 52  ASP A OD2  2  
ATOM 2266  H H    . ASP A 1 52 ? -6.507  0.215   4.154   1.00 1.07 ? 52  ASP A H    2  
ATOM 2267  H HA   . ASP A 1 52 ? -7.701  -1.131  1.982   1.00 1.08 ? 52  ASP A HA   2  
ATOM 2268  H HB2  . ASP A 1 52 ? -6.071  0.344   0.628   1.00 0.99 ? 52  ASP A HB2  2  
ATOM 2269  H HB3  . ASP A 1 52 ? -7.328  1.125   1.576   1.00 1.18 ? 52  ASP A HB3  2  
ATOM 2270  N N    . LYS A 1 53 ? -5.955  -2.550  0.867   1.00 0.88 ? 53  LYS A N    2  
ATOM 2271  C CA   . LYS A 1 53 ? -5.058  -3.598  0.390   1.00 0.82 ? 53  LYS A CA   2  
ATOM 2272  C C    . LYS A 1 53 ? -4.316  -3.154  -0.867  1.00 0.76 ? 53  LYS A C    2  
ATOM 2273  O O    . LYS A 1 53 ? -4.812  -2.353  -1.644  1.00 0.87 ? 53  LYS A O    2  
ATOM 2274  C CB   . LYS A 1 53 ? -5.826  -4.901  0.113   1.00 0.94 ? 53  LYS A CB   2  
ATOM 2275  C CG   . LYS A 1 53 ? -7.290  -4.711  -0.269  1.00 1.33 ? 53  LYS A CG   2  
ATOM 2276  C CD   . LYS A 1 53 ? -8.154  -4.355  0.937   1.00 1.83 ? 53  LYS A CD   2  
ATOM 2277  C CE   . LYS A 1 53 ? -9.062  -5.504  1.344   1.00 2.37 ? 53  LYS A CE   2  
ATOM 2278  N NZ   . LYS A 1 53 ? -9.631  -5.315  2.708   1.00 3.23 ? 53  LYS A NZ   2  
ATOM 2279  H H    . LYS A 1 53 ? -6.777  -2.364  0.366   1.00 0.92 ? 53  LYS A H    2  
ATOM 2280  H HA   . LYS A 1 53 ? -4.332  -3.784  1.168   1.00 0.82 ? 53  LYS A HA   2  
ATOM 2281  H HB2  . LYS A 1 53 ? -5.337  -5.424  -0.695  1.00 1.54 ? 53  LYS A HB2  2  
ATOM 2282  H HB3  . LYS A 1 53 ? -5.787  -5.516  0.996   1.00 1.39 ? 53  LYS A HB3  2  
ATOM 2283  H HG2  . LYS A 1 53 ? -7.362  -3.918  -0.996  1.00 1.78 ? 53  LYS A HG2  2  
ATOM 2284  H HG3  . LYS A 1 53 ? -7.656  -5.630  -0.701  1.00 1.86 ? 53  LYS A HG3  2  
ATOM 2285  H HD2  . LYS A 1 53 ? -7.510  -4.108  1.767   1.00 2.39 ? 53  LYS A HD2  2  
ATOM 2286  H HD3  . LYS A 1 53 ? -8.762  -3.498  0.687   1.00 2.03 ? 53  LYS A HD3  2  
ATOM 2287  H HE2  . LYS A 1 53 ? -9.872  -5.572  0.636   1.00 2.44 ? 53  LYS A HE2  2  
ATOM 2288  H HE3  . LYS A 1 53 ? -8.492  -6.421  1.326   1.00 2.77 ? 53  LYS A HE3  2  
ATOM 2289  H HZ1  . LYS A 1 53 ? -9.176  -4.507  3.182   1.00 3.81 ? 53  LYS A HZ1  2  
ATOM 2290  H HZ2  . LYS A 1 53 ? -9.477  -6.170  3.281   1.00 3.55 ? 53  LYS A HZ2  2  
ATOM 2291  H HZ3  . LYS A 1 53 ? -10.653 -5.134  2.648   1.00 3.45 ? 53  LYS A HZ3  2  
ATOM 2292  N N    . LEU A 1 54 ? -3.113  -3.668  -1.031  1.00 0.64 ? 54  LEU A N    2  
ATOM 2293  C CA   . LEU A 1 54 ? -2.274  -3.315  -2.171  1.00 0.66 ? 54  LEU A CA   2  
ATOM 2294  C C    . LEU A 1 54 ? -2.231  -4.426  -3.212  1.00 0.64 ? 54  LEU A C    2  
ATOM 2295  O O    . LEU A 1 54 ? -1.925  -5.580  -2.902  1.00 0.79 ? 54  LEU A O    2  
ATOM 2296  C CB   . LEU A 1 54 ? -0.856  -2.978  -1.706  1.00 0.73 ? 54  LEU A CB   2  
ATOM 2297  C CG   . LEU A 1 54 ? -0.341  -1.612  -2.162  1.00 0.83 ? 54  LEU A CG   2  
ATOM 2298  C CD1  . LEU A 1 54 ? 0.757   -1.116  -1.233  1.00 1.11 ? 54  LEU A CD1  2  
ATOM 2299  C CD2  . LEU A 1 54 ? 0.158   -1.688  -3.597  1.00 1.72 ? 54  LEU A CD2  2  
ATOM 2300  H H    . LEU A 1 54 ? -2.779  -4.272  -0.348  1.00 0.62 ? 54  LEU A H    2  
ATOM 2301  H HA   . LEU A 1 54 ? -2.703  -2.436  -2.628  1.00 0.75 ? 54  LEU A HA   2  
ATOM 2302  H HB2  . LEU A 1 54 ? -0.838  -3.005  -0.627  1.00 1.24 ? 54  LEU A HB2  2  
ATOM 2303  H HB3  . LEU A 1 54 ? -0.185  -3.735  -2.081  1.00 1.21 ? 54  LEU A HB3  2  
ATOM 2304  H HG   . LEU A 1 54 ? -1.152  -0.899  -2.128  1.00 1.18 ? 54  LEU A HG   2  
ATOM 2305  H HD11 . LEU A 1 54 ? 0.397   -0.265  -0.672  1.00 1.58 ? 54  LEU A HD11 2  
ATOM 2306  H HD12 . LEU A 1 54 ? 1.619   -0.823  -1.815  1.00 1.88 ? 54  LEU A HD12 2  
ATOM 2307  H HD13 . LEU A 1 54 ? 1.036   -1.905  -0.550  1.00 1.17 ? 54  LEU A HD13 2  
ATOM 2308  H HD21 . LEU A 1 54 ? -0.633  -2.053  -4.235  1.00 2.31 ? 54  LEU A HD21 2  
ATOM 2309  H HD22 . LEU A 1 54 ? 1.002   -2.361  -3.650  1.00 2.00 ? 54  LEU A HD22 2  
ATOM 2310  H HD23 . LEU A 1 54 ? 0.462   -0.705  -3.926  1.00 2.08 ? 54  LEU A HD23 2  
ATOM 2311  N N    . LEU A 1 55 ? -2.518  -4.052  -4.456  1.00 0.56 ? 55  LEU A N    2  
ATOM 2312  C CA   . LEU A 1 55 ? -2.497  -4.985  -5.574  1.00 0.58 ? 55  LEU A CA   2  
ATOM 2313  C C    . LEU A 1 55 ? -1.143  -4.928  -6.273  1.00 0.54 ? 55  LEU A C    2  
ATOM 2314  O O    . LEU A 1 55 ? -0.489  -5.957  -6.444  1.00 0.56 ? 55  LEU A O    2  
ATOM 2315  C CB   . LEU A 1 55 ? -3.622  -4.668  -6.568  1.00 0.66 ? 55  LEU A CB   2  
ATOM 2316  C CG   . LEU A 1 55 ? -3.816  -5.689  -7.697  1.00 0.91 ? 55  LEU A CG   2  
ATOM 2317  C CD1  . LEU A 1 55 ? -2.768  -5.499  -8.786  1.00 1.27 ? 55  LEU A CD1  2  
ATOM 2318  C CD2  . LEU A 1 55 ? -3.770  -7.109  -7.151  1.00 1.87 ? 55  LEU A CD2  2  
ATOM 2319  H H    . LEU A 1 55 ? -2.732  -3.110  -4.627  1.00 0.58 ? 55  LEU A H    2  
ATOM 2320  H HA   . LEU A 1 55 ? -2.643  -5.979  -5.180  1.00 0.62 ? 55  LEU A HA   2  
ATOM 2321  H HB2  . LEU A 1 55 ? -4.546  -4.597  -6.016  1.00 0.75 ? 55  LEU A HB2  2  
ATOM 2322  H HB3  . LEU A 1 55 ? -3.417  -3.707  -7.015  1.00 0.98 ? 55  LEU A HB3  2  
ATOM 2323  H HG   . LEU A 1 55 ? -4.787  -5.535  -8.144  1.00 1.50 ? 55  LEU A HG   2  
ATOM 2324  H HD11 . LEU A 1 55 ? -1.914  -6.126  -8.578  1.00 1.70 ? 55  LEU A HD11 2  
ATOM 2325  H HD12 . LEU A 1 55 ? -2.458  -4.465  -8.811  1.00 1.74 ? 55  LEU A HD12 2  
ATOM 2326  H HD13 . LEU A 1 55 ? -3.190  -5.771  -9.742  1.00 1.86 ? 55  LEU A HD13 2  
ATOM 2327  H HD21 . LEU A 1 55 ? -2.752  -7.363  -6.894  1.00 2.39 ? 55  LEU A HD21 2  
ATOM 2328  H HD22 . LEU A 1 55 ? -4.135  -7.795  -7.900  1.00 2.39 ? 55  LEU A HD22 2  
ATOM 2329  H HD23 . LEU A 1 55 ? -4.391  -7.176  -6.269  1.00 2.37 ? 55  LEU A HD23 2  
ATOM 2330  N N    . ALA A 1 56 ? -0.721  -3.721  -6.677  1.00 0.51 ? 56  ALA A N    2  
ATOM 2331  C CA   . ALA A 1 56 ? 0.565   -3.560  -7.355  1.00 0.49 ? 56  ALA A CA   2  
ATOM 2332  C C    . ALA A 1 56 ? 1.188   -2.185  -7.077  1.00 0.53 ? 56  ALA A C    2  
ATOM 2333  O O    . ALA A 1 56 ? 0.494   -1.243  -6.708  1.00 0.67 ? 56  ALA A O    2  
ATOM 2334  C CB   . ALA A 1 56 ? 0.388   -3.761  -8.860  1.00 0.54 ? 56  ALA A CB   2  
ATOM 2335  H H    . ALA A 1 56 ? -1.289  -2.923  -6.518  1.00 0.53 ? 56  ALA A H    2  
ATOM 2336  H HA   . ALA A 1 56 ? 1.232   -4.333  -6.982  1.00 0.52 ? 56  ALA A HA   2  
ATOM 2337  H HB1  . ALA A 1 56 ? -0.397  -3.111  -9.218  1.00 1.19 ? 56  ALA A HB1  2  
ATOM 2338  H HB2  . ALA A 1 56 ? 0.123   -4.789  -9.063  1.00 0.99 ? 56  ALA A HB2  2  
ATOM 2339  H HB3  . ALA A 1 56 ? 1.311   -3.519  -9.370  1.00 1.25 ? 56  ALA A HB3  2  
ATOM 2340  N N    . VAL A 1 57 ? 2.506   -2.084  -7.263  1.00 0.50 ? 57  VAL A N    2  
ATOM 2341  C CA   . VAL A 1 57 ? 3.235   -0.836  -7.051  1.00 0.59 ? 57  VAL A CA   2  
ATOM 2342  C C    . VAL A 1 57 ? 4.219   -0.598  -8.197  1.00 0.53 ? 57  VAL A C    2  
ATOM 2343  O O    . VAL A 1 57 ? 5.190   -1.339  -8.354  1.00 0.52 ? 57  VAL A O    2  
ATOM 2344  C CB   . VAL A 1 57 ? 4.007   -0.844  -5.711  1.00 0.77 ? 57  VAL A CB   2  
ATOM 2345  C CG1  . VAL A 1 57 ? 4.755   0.466   -5.507  1.00 1.42 ? 57  VAL A CG1  2  
ATOM 2346  C CG2  . VAL A 1 57 ? 3.063   -1.105  -4.547  1.00 1.47 ? 57  VAL A CG2  2  
ATOM 2347  H H    . VAL A 1 57 ? 3.006   -2.878  -7.553  1.00 0.48 ? 57  VAL A H    2  
ATOM 2348  H HA   . VAL A 1 57 ? 2.518   -0.027  -7.028  1.00 0.66 ? 57  VAL A HA   2  
ATOM 2349  H HB   . VAL A 1 57 ? 4.731   -1.644  -5.742  1.00 1.34 ? 57  VAL A HB   2  
ATOM 2350  H HG11 . VAL A 1 57 ? 4.895   0.641   -4.451  1.00 1.89 ? 57  VAL A HG11 2  
ATOM 2351  H HG12 . VAL A 1 57 ? 4.186   1.279   -5.934  1.00 1.82 ? 57  VAL A HG12 2  
ATOM 2352  H HG13 . VAL A 1 57 ? 5.719   0.408   -5.991  1.00 2.12 ? 57  VAL A HG13 2  
ATOM 2353  H HG21 . VAL A 1 57 ? 2.233   -0.416  -4.595  1.00 1.95 ? 57  VAL A HG21 2  
ATOM 2354  H HG22 . VAL A 1 57 ? 3.593   -0.967  -3.616  1.00 1.95 ? 57  VAL A HG22 2  
ATOM 2355  H HG23 . VAL A 1 57 ? 2.693   -2.118  -4.605  1.00 2.01 ? 57  VAL A HG23 2  
ATOM 2356  N N    . ASN A 1 58 ? 3.963   0.437   -8.996  1.00 0.57 ? 58  ASN A N    2  
ATOM 2357  C CA   . ASN A 1 58 ? 4.824   0.773   -10.133 1.00 0.58 ? 58  ASN A CA   2  
ATOM 2358  C C    . ASN A 1 58 ? 4.910   -0.387  -11.138 1.00 0.59 ? 58  ASN A C    2  
ATOM 2359  O O    . ASN A 1 58 ? 5.974   -0.648  -11.705 1.00 0.60 ? 58  ASN A O    2  
ATOM 2360  C CB   . ASN A 1 58 ? 6.225   1.166   -9.646  1.00 0.57 ? 58  ASN A CB   2  
ATOM 2361  C CG   . ASN A 1 58 ? 6.269   2.582   -9.103  1.00 0.80 ? 58  ASN A CG   2  
ATOM 2362  O OD1  . ASN A 1 58 ? 6.183   3.550   -9.859  1.00 1.39 ? 58  ASN A OD1  2  
ATOM 2363  N ND2  . ASN A 1 58 ? 6.406   2.711   -7.787  1.00 1.49 ? 58  ASN A ND2  2  
ATOM 2364  H H    . ASN A 1 58 ? 3.176   0.995   -8.818  1.00 0.63 ? 58  ASN A H    2  
ATOM 2365  H HA   . ASN A 1 58 ? 4.382   1.622   -10.633 1.00 0.65 ? 58  ASN A HA   2  
ATOM 2366  H HB2  . ASN A 1 58 ? 6.530   0.489   -8.863  1.00 0.64 ? 58  ASN A HB2  2  
ATOM 2367  H HB3  . ASN A 1 58 ? 6.920   1.094   -10.470 1.00 0.74 ? 58  ASN A HB3  2  
ATOM 2368  H HD21 . ASN A 1 58 ? 6.470   1.898   -7.245  1.00 2.05 ? 58  ASN A HD21 2  
ATOM 2369  H HD22 . ASN A 1 58 ? 6.436   3.617   -7.413  1.00 1.75 ? 58  ASN A HD22 2  
ATOM 2370  N N    . ASN A 1 59 ? 3.775   -1.073  -11.343 1.00 0.60 ? 59  ASN A N    2  
ATOM 2371  C CA   . ASN A 1 59 ? 3.678   -2.211  -12.275 1.00 0.65 ? 59  ASN A CA   2  
ATOM 2372  C C    . ASN A 1 59 ? 3.986   -3.554  -11.597 1.00 0.61 ? 59  ASN A C    2  
ATOM 2373  O O    . ASN A 1 59 ? 3.629   -4.608  -12.125 1.00 0.67 ? 59  ASN A O    2  
ATOM 2374  C CB   . ASN A 1 59 ? 4.603   -2.017  -13.484 1.00 0.71 ? 59  ASN A CB   2  
ATOM 2375  C CG   . ASN A 1 59 ? 4.087   -2.713  -14.731 1.00 1.18 ? 59  ASN A CG   2  
ATOM 2376  O OD1  . ASN A 1 59 ? 4.490   -3.834  -15.041 1.00 1.74 ? 59  ASN A OD1  2  
ATOM 2377  N ND2  . ASN A 1 59 ? 3.189   -2.049  -15.454 1.00 1.52 ? 59  ASN A ND2  2  
ATOM 2378  H H    . ASN A 1 59 ? 2.978   -0.801  -10.842 1.00 0.61 ? 59  ASN A H    2  
ATOM 2379  H HA   . ASN A 1 59 ? 2.659   -2.242  -12.630 1.00 0.68 ? 59  ASN A HA   2  
ATOM 2380  H HB2  . ASN A 1 59 ? 4.693   -0.963  -13.697 1.00 0.83 ? 59  ASN A HB2  2  
ATOM 2381  H HB3  . ASN A 1 59 ? 5.579   -2.418  -13.251 1.00 0.74 ? 59  ASN A HB3  2  
ATOM 2382  H HD21 . ASN A 1 59 ? 2.913   -1.159  -15.148 1.00 1.74 ? 59  ASN A HD21 2  
ATOM 2383  H HD22 . ASN A 1 59 ? 2.841   -2.477  -16.263 1.00 1.84 ? 59  ASN A HD22 2  
ATOM 2384  N N    . VAL A 1 60 ? 4.635   -3.521  -10.429 1.00 0.53 ? 60  VAL A N    2  
ATOM 2385  C CA   . VAL A 1 60 ? 4.966   -4.749  -9.702  1.00 0.52 ? 60  VAL A CA   2  
ATOM 2386  C C    . VAL A 1 60 ? 3.805   -5.161  -8.801  1.00 0.51 ? 60  VAL A C    2  
ATOM 2387  O O    . VAL A 1 60 ? 3.174   -4.314  -8.187  1.00 0.50 ? 60  VAL A O    2  
ATOM 2388  C CB   . VAL A 1 60 ? 6.254   -4.594  -8.850  1.00 0.50 ? 60  VAL A CB   2  
ATOM 2389  C CG1  . VAL A 1 60 ? 7.339   -3.862  -9.630  1.00 0.51 ? 60  VAL A CG1  2  
ATOM 2390  C CG2  . VAL A 1 60 ? 5.974   -3.882  -7.530  1.00 0.54 ? 60  VAL A CG2  2  
ATOM 2391  H H    . VAL A 1 60 ? 4.889   -2.658  -10.042 1.00 0.52 ? 60  VAL A H    2  
ATOM 2392  H HA   . VAL A 1 60 ? 5.134   -5.531  -10.431 1.00 0.56 ? 60  VAL A HA   2  
ATOM 2393  H HB   . VAL A 1 60 ? 6.621   -5.582  -8.621  1.00 0.58 ? 60  VAL A HB   2  
ATOM 2394  H HG11 . VAL A 1 60 ? 7.993   -3.348  -8.941  1.00 1.18 ? 60  VAL A HG11 2  
ATOM 2395  H HG12 . VAL A 1 60 ? 6.885   -3.145  -10.297 1.00 0.93 ? 60  VAL A HG12 2  
ATOM 2396  H HG13 . VAL A 1 60 ? 7.913   -4.574  -10.205 1.00 1.23 ? 60  VAL A HG13 2  
ATOM 2397  H HG21 . VAL A 1 60 ? 5.009   -3.402  -7.574  1.00 0.98 ? 60  VAL A HG21 2  
ATOM 2398  H HG22 . VAL A 1 60 ? 6.737   -3.137  -7.353  1.00 1.15 ? 60  VAL A HG22 2  
ATOM 2399  H HG23 . VAL A 1 60 ? 5.981   -4.600  -6.723  1.00 1.17 ? 60  VAL A HG23 2  
ATOM 2400  N N    . CYS A 1 61 ? 3.520   -6.456  -8.711  1.00 0.53 ? 61  CYS A N    2  
ATOM 2401  C CA   . CYS A 1 61 ? 2.423   -6.917  -7.862  1.00 0.54 ? 61  CYS A CA   2  
ATOM 2402  C C    . CYS A 1 61 ? 2.864   -6.995  -6.405  1.00 0.58 ? 61  CYS A C    2  
ATOM 2403  O O    . CYS A 1 61 ? 3.876   -7.622  -6.082  1.00 0.72 ? 61  CYS A O    2  
ATOM 2404  C CB   . CYS A 1 61 ? 1.887   -8.267  -8.328  1.00 0.56 ? 61  CYS A CB   2  
ATOM 2405  S SG   . CYS A 1 61 ? 3.088   -9.619  -8.256  1.00 0.71 ? 61  CYS A SG   2  
ATOM 2406  H H    . CYS A 1 61 ? 4.052   -7.108  -9.214  1.00 0.55 ? 61  CYS A H    2  
ATOM 2407  H HA   . CYS A 1 61 ? 1.630   -6.186  -7.936  1.00 0.53 ? 61  CYS A HA   2  
ATOM 2408  H HB2  . CYS A 1 61 ? 1.048   -8.539  -7.706  1.00 0.91 ? 61  CYS A HB2  2  
ATOM 2409  H HB3  . CYS A 1 61 ? 1.553   -8.175  -9.350  1.00 0.84 ? 61  CYS A HB3  2  
ATOM 2410  H HG   . CYS A 1 61 ? 3.761   -9.451  -8.918  1.00 1.12 ? 61  CYS A HG   2  
ATOM 2411  N N    . LEU A 1 62 ? 2.078   -6.377  -5.526  1.00 0.55 ? 62  LEU A N    2  
ATOM 2412  C CA   . LEU A 1 62 ? 2.348   -6.392  -4.094  1.00 0.62 ? 62  LEU A CA   2  
ATOM 2413  C C    . LEU A 1 62 ? 1.416   -7.377  -3.367  1.00 0.58 ? 62  LEU A C    2  
ATOM 2414  O O    . LEU A 1 62 ? 1.188   -7.253  -2.161  1.00 0.51 ? 62  LEU A O    2  
ATOM 2415  C CB   . LEU A 1 62 ? 2.206   -4.976  -3.526  1.00 0.77 ? 62  LEU A CB   2  
ATOM 2416  C CG   . LEU A 1 62 ? 3.354   -4.528  -2.616  1.00 0.95 ? 62  LEU A CG   2  
ATOM 2417  C CD1  . LEU A 1 62 ? 4.622   -4.303  -3.426  1.00 1.71 ? 62  LEU A CD1  2  
ATOM 2418  C CD2  . LEU A 1 62 ? 2.975   -3.267  -1.858  1.00 1.08 ? 62  LEU A CD2  2  
ATOM 2419  H H    . LEU A 1 62 ? 1.256   -5.944  -5.834  1.00 0.55 ? 62  LEU A H    2  
ATOM 2420  H HA   . LEU A 1 62 ? 3.367   -6.721  -3.958  1.00 0.72 ? 62  LEU A HA   2  
ATOM 2421  H HB2  . LEU A 1 62 ? 2.143   -4.286  -4.355  1.00 1.26 ? 62  LEU A HB2  2  
ATOM 2422  H HB3  . LEU A 1 62 ? 1.286   -4.923  -2.968  1.00 1.09 ? 62  LEU A HB3  2  
ATOM 2423  H HG   . LEU A 1 62 ? 3.556   -5.306  -1.894  1.00 1.61 ? 62  LEU A HG   2  
ATOM 2424  H HD11 . LEU A 1 62 ? 5.415   -3.976  -2.771  1.00 2.12 ? 62  LEU A HD11 2  
ATOM 2425  H HD12 . LEU A 1 62 ? 4.441   -3.548  -4.177  1.00 2.04 ? 62  LEU A HD12 2  
ATOM 2426  H HD13 . LEU A 1 62 ? 4.911   -5.227  -3.907  1.00 2.37 ? 62  LEU A HD13 2  
ATOM 2427  H HD21 . LEU A 1 62 ? 1.959   -3.352  -1.502  1.00 1.44 ? 62  LEU A HD21 2  
ATOM 2428  H HD22 . LEU A 1 62 ? 3.055   -2.413  -2.513  1.00 1.77 ? 62  LEU A HD22 2  
ATOM 2429  H HD23 . LEU A 1 62 ? 3.641   -3.138  -1.017  1.00 1.57 ? 62  LEU A HD23 2  
ATOM 2430  N N    . GLU A 1 63 ? 0.858   -8.337  -4.114  1.00 0.72 ? 63  GLU A N    2  
ATOM 2431  C CA   . GLU A 1 63 ? -0.069  -9.318  -3.547  1.00 0.80 ? 63  GLU A CA   2  
ATOM 2432  C C    . GLU A 1 63 ? 0.589   -10.682 -3.323  1.00 0.95 ? 63  GLU A C    2  
ATOM 2433  O O    . GLU A 1 63 ? 0.109   -11.472 -2.510  1.00 1.83 ? 63  GLU A O    2  
ATOM 2434  C CB   . GLU A 1 63 ? -1.286  -9.479  -4.464  1.00 0.86 ? 63  GLU A CB   2  
ATOM 2435  C CG   . GLU A 1 63 ? -0.948  -10.034 -5.842  1.00 1.12 ? 63  GLU A CG   2  
ATOM 2436  C CD   . GLU A 1 63 ? -2.178  -10.450 -6.627  1.00 1.31 ? 63  GLU A CD   2  
ATOM 2437  O OE1  . GLU A 1 63 ? -2.823  -11.445 -6.238  1.00 1.65 ? 63  GLU A OE1  2  
ATOM 2438  O OE2  . GLU A 1 63 ? -2.493  -9.781  -7.634  1.00 1.96 ? 63  GLU A OE2  2  
ATOM 2439  H H    . GLU A 1 63 ? 1.057   -8.374  -5.073  1.00 0.83 ? 63  GLU A H    2  
ATOM 2440  H HA   . GLU A 1 63 ? -0.404  -8.939  -2.593  1.00 0.80 ? 63  GLU A HA   2  
ATOM 2441  H HB2  . GLU A 1 63 ? -1.989  -10.151 -3.992  1.00 1.08 ? 63  GLU A HB2  2  
ATOM 2442  H HB3  . GLU A 1 63 ? -1.754  -8.515  -4.592  1.00 1.32 ? 63  GLU A HB3  2  
ATOM 2443  H HG2  . GLU A 1 63 ? -0.424  -9.274  -6.402  1.00 1.64 ? 63  GLU A HG2  2  
ATOM 2444  H HG3  . GLU A 1 63 ? -0.309  -10.896 -5.722  1.00 1.48 ? 63  GLU A HG3  2  
ATOM 2445  N N    . GLU A 1 64 ? 1.677   -10.963 -4.045  1.00 1.04 ? 64  GLU A N    2  
ATOM 2446  C CA   . GLU A 1 64 ? 2.375   -12.240 -3.911  1.00 1.08 ? 64  GLU A CA   2  
ATOM 2447  C C    . GLU A 1 64 ? 3.875   -12.032 -3.692  1.00 0.90 ? 64  GLU A C    2  
ATOM 2448  O O    . GLU A 1 64 ? 4.707   -12.587 -4.416  1.00 0.96 ? 64  GLU A O    2  
ATOM 2449  C CB   . GLU A 1 64 ? 2.125   -13.109 -5.145  1.00 1.28 ? 64  GLU A CB   2  
ATOM 2450  C CG   . GLU A 1 64 ? 1.510   -14.462 -4.821  1.00 1.53 ? 64  GLU A CG   2  
ATOM 2451  C CD   . GLU A 1 64 ? 2.480   -15.388 -4.111  1.00 2.14 ? 64  GLU A CD   2  
ATOM 2452  O OE1  . GLU A 1 64 ? 3.207   -16.131 -4.803  1.00 2.40 ? 64  GLU A OE1  2  
ATOM 2453  O OE2  . GLU A 1 64 ? 2.513   -15.370 -2.862  1.00 2.93 ? 64  GLU A OE2  2  
ATOM 2454  H H    . GLU A 1 64 ? 2.019   -10.298 -4.679  1.00 1.69 ? 64  GLU A H    2  
ATOM 2455  H HA   . GLU A 1 64 ? 1.973   -12.745 -3.050  1.00 1.19 ? 64  GLU A HA   2  
ATOM 2456  H HB2  . GLU A 1 64 ? 1.457   -12.585 -5.812  1.00 1.35 ? 64  GLU A HB2  2  
ATOM 2457  H HB3  . GLU A 1 64 ? 3.062   -13.277 -5.647  1.00 1.23 ? 64  GLU A HB3  2  
ATOM 2458  H HG2  . GLU A 1 64 ? 0.651   -14.309 -4.183  1.00 1.77 ? 64  GLU A HG2  2  
ATOM 2459  H HG3  . GLU A 1 64 ? 1.195   -14.930 -5.741  1.00 1.72 ? 64  GLU A HG3  2  
ATOM 2460  N N    . VAL A 1 65 ? 4.210   -11.226 -2.686  1.00 0.80 ? 65  VAL A N    2  
ATOM 2461  C CA   . VAL A 1 65 ? 5.606   -10.935 -2.366  1.00 0.64 ? 65  VAL A CA   2  
ATOM 2462  C C    . VAL A 1 65 ? 5.835   -10.823 -0.860  1.00 0.64 ? 65  VAL A C    2  
ATOM 2463  O O    . VAL A 1 65 ? 4.924   -10.477 -0.104  1.00 0.70 ? 65  VAL A O    2  
ATOM 2464  C CB   . VAL A 1 65 ? 6.083   -9.628  -3.034  1.00 0.56 ? 65  VAL A CB   2  
ATOM 2465  C CG1  . VAL A 1 65 ? 6.315   -9.836  -4.525  1.00 0.64 ? 65  VAL A CG1  2  
ATOM 2466  C CG2  . VAL A 1 65 ? 5.089   -8.498  -2.792  1.00 0.59 ? 65  VAL A CG2  2  
ATOM 2467  H H    . VAL A 1 65 ? 3.496   -10.815 -2.155  1.00 0.90 ? 65  VAL A H    2  
ATOM 2468  H HA   . VAL A 1 65 ? 6.209   -11.746 -2.748  1.00 0.65 ? 65  VAL A HA   2  
ATOM 2469  H HB   . VAL A 1 65 ? 7.025   -9.348  -2.586  1.00 0.50 ? 65  VAL A HB   2  
ATOM 2470  H HG11 . VAL A 1 65 ? 6.844   -10.764 -4.681  1.00 1.20 ? 65  VAL A HG11 2  
ATOM 2471  H HG12 . VAL A 1 65 ? 6.901   -9.018  -4.915  1.00 1.37 ? 65  VAL A HG12 2  
ATOM 2472  H HG13 . VAL A 1 65 ? 5.364   -9.874  -5.036  1.00 0.86 ? 65  VAL A HG13 2  
ATOM 2473  H HG21 . VAL A 1 65 ? 4.978   -8.338  -1.730  1.00 0.99 ? 65  VAL A HG21 2  
ATOM 2474  H HG22 . VAL A 1 65 ? 4.132   -8.763  -3.217  1.00 1.30 ? 65  VAL A HG22 2  
ATOM 2475  H HG23 . VAL A 1 65 ? 5.452   -7.593  -3.257  1.00 1.16 ? 65  VAL A HG23 2  
ATOM 2476  N N    . THR A 1 66 ? 7.069   -11.106 -0.439  1.00 0.63 ? 66  THR A N    2  
ATOM 2477  C CA   . THR A 1 66 ? 7.441   -11.024 0.974   1.00 0.69 ? 66  THR A CA   2  
ATOM 2478  C C    . THR A 1 66 ? 7.295   -9.588  1.475   1.00 0.61 ? 66  THR A C    2  
ATOM 2479  O O    . THR A 1 66 ? 7.233   -8.649  0.674   1.00 0.66 ? 66  THR A O    2  
ATOM 2480  C CB   . THR A 1 66 ? 8.885   -11.510 1.182   1.00 0.74 ? 66  THR A CB   2  
ATOM 2481  O OG1  . THR A 1 66 ? 9.183   -12.603 0.328   1.00 1.53 ? 66  THR A OG1  2  
ATOM 2482  C CG2  . THR A 1 66 ? 9.172   -11.950 2.603   1.00 1.17 ? 66  THR A CG2  2  
ATOM 2483  H H    . THR A 1 66 ? 7.746   -11.366 -1.100  1.00 0.62 ? 66  THR A H    2  
ATOM 2484  H HA   . THR A 1 66 ? 6.770   -11.660 1.533   1.00 0.80 ? 66  THR A HA   2  
ATOM 2485  H HB   . THR A 1 66 ? 9.561   -10.701 0.945   1.00 1.20 ? 66  THR A HB   2  
ATOM 2486  H HG1  . THR A 1 66 ? 8.531   -13.298 0.452   1.00 1.88 ? 66  THR A HG1  2  
ATOM 2487  H HG21 . THR A 1 66 ? 8.373   -12.588 2.950   1.00 1.74 ? 66  THR A HG21 2  
ATOM 2488  H HG22 . THR A 1 66 ? 9.243   -11.082 3.242   1.00 1.61 ? 66  THR A HG22 2  
ATOM 2489  H HG23 . THR A 1 66 ? 10.104  -12.494 2.630   1.00 1.74 ? 66  THR A HG23 2  
ATOM 2490  N N    . HIS A 1 67 ? 7.225   -9.415  2.796   1.00 0.51 ? 67  HIS A N    2  
ATOM 2491  C CA   . HIS A 1 67 ? 7.073   -8.076  3.371   1.00 0.45 ? 67  HIS A CA   2  
ATOM 2492  C C    . HIS A 1 67 ? 8.136   -7.126  2.823   1.00 0.43 ? 67  HIS A C    2  
ATOM 2493  O O    . HIS A 1 67 ? 7.853   -5.952  2.575   1.00 0.41 ? 67  HIS A O    2  
ATOM 2494  C CB   . HIS A 1 67 ? 7.096   -8.094  4.907   1.00 0.45 ? 67  HIS A CB   2  
ATOM 2495  C CG   . HIS A 1 67 ? 6.839   -6.743  5.500   1.00 0.46 ? 67  HIS A CG   2  
ATOM 2496  N ND1  . HIS A 1 67 ? 5.645   -6.403  6.093   1.00 0.51 ? 67  HIS A ND1  2  
ATOM 2497  C CD2  . HIS A 1 67 ? 7.603   -5.624  5.537   1.00 0.49 ? 67  HIS A CD2  2  
ATOM 2498  C CE1  . HIS A 1 67 ? 5.683   -5.137  6.459   1.00 0.54 ? 67  HIS A CE1  2  
ATOM 2499  N NE2  . HIS A 1 67 ? 6.858   -4.640  6.135   1.00 0.52 ? 67  HIS A NE2  2  
ATOM 2500  H H    . HIS A 1 67 ? 7.268   -10.201 3.381   1.00 0.50 ? 67  HIS A H    2  
ATOM 2501  H HA   . HIS A 1 67 ? 6.109   -7.708  3.053   1.00 0.44 ? 67  HIS A HA   2  
ATOM 2502  H HB2  . HIS A 1 67 ? 6.322   -8.756  5.262   1.00 0.46 ? 67  HIS A HB2  2  
ATOM 2503  H HB3  . HIS A 1 67 ? 8.054   -8.446  5.259   1.00 0.44 ? 67  HIS A HB3  2  
ATOM 2504  H HD1  . HIS A 1 67 ? 4.885   -7.003  6.234   1.00 0.56 ? 67  HIS A HD1  2  
ATOM 2505  H HD2  . HIS A 1 67 ? 8.608   -5.521  5.160   1.00 0.54 ? 67  HIS A HD2  2  
ATOM 2506  H HE1  . HIS A 1 67 ? 4.876   -4.591  6.919   1.00 0.61 ? 67  HIS A HE1  2  
ATOM 2507  H HE2  . HIS A 1 67 ? 7.072   -3.685  6.118   1.00 0.56 ? 67  HIS A HE2  2  
ATOM 2508  N N    . GLU A 1 68 ? 9.355   -7.635  2.626   1.00 0.45 ? 68  GLU A N    2  
ATOM 2509  C CA   . GLU A 1 68 ? 10.451  -6.824  2.091   1.00 0.45 ? 68  GLU A CA   2  
ATOM 2510  C C    . GLU A 1 68 ? 10.013  -6.103  0.816   1.00 0.42 ? 68  GLU A C    2  
ATOM 2511  O O    . GLU A 1 68 ? 10.231  -4.902  0.672   1.00 0.41 ? 68  GLU A O    2  
ATOM 2512  C CB   . GLU A 1 68 ? 11.679  -7.696  1.802   1.00 0.49 ? 68  GLU A CB   2  
ATOM 2513  C CG   . GLU A 1 68 ? 12.255  -8.369  3.038   1.00 1.43 ? 68  GLU A CG   2  
ATOM 2514  C CD   . GLU A 1 68 ? 13.132  -9.559  2.699   1.00 2.13 ? 68  GLU A CD   2  
ATOM 2515  O OE1  . GLU A 1 68 ? 12.584  -10.665 2.504   1.00 2.90 ? 68  GLU A OE1  2  
ATOM 2516  O OE2  . GLU A 1 68 ? 14.367  -9.385  2.626   1.00 2.59 ? 68  GLU A OE2  2  
ATOM 2517  H H    . GLU A 1 68 ? 9.524   -8.574  2.847   1.00 0.47 ? 68  GLU A H    2  
ATOM 2518  H HA   . GLU A 1 68 ? 10.711  -6.086  2.836   1.00 0.47 ? 68  GLU A HA   2  
ATOM 2519  H HB2  . GLU A 1 68 ? 11.405  -8.463  1.094   1.00 1.08 ? 68  GLU A HB2  2  
ATOM 2520  H HB3  . GLU A 1 68 ? 12.450  -7.076  1.366   1.00 1.21 ? 68  GLU A HB3  2  
ATOM 2521  H HG2  . GLU A 1 68 ? 12.848  -7.649  3.583   1.00 2.02 ? 68  GLU A HG2  2  
ATOM 2522  H HG3  . GLU A 1 68 ? 11.440  -8.707  3.662   1.00 2.08 ? 68  GLU A HG3  2  
ATOM 2523  N N    . GLU A 1 69 ? 9.379   -6.846  -0.096  1.00 0.44 ? 69  GLU A N    2  
ATOM 2524  C CA   . GLU A 1 69 ? 8.889   -6.281  -1.356  1.00 0.43 ? 69  GLU A CA   2  
ATOM 2525  C C    . GLU A 1 69 ? 7.830   -5.207  -1.099  1.00 0.41 ? 69  GLU A C    2  
ATOM 2526  O O    . GLU A 1 69 ? 7.773   -4.201  -1.807  1.00 0.41 ? 69  GLU A O    2  
ATOM 2527  C CB   . GLU A 1 69 ? 8.311   -7.381  -2.245  1.00 0.46 ? 69  GLU A CB   2  
ATOM 2528  C CG   . GLU A 1 69 ? 9.356   -8.098  -3.086  1.00 0.76 ? 69  GLU A CG   2  
ATOM 2529  C CD   . GLU A 1 69 ? 9.784   -7.290  -4.297  1.00 1.07 ? 69  GLU A CD   2  
ATOM 2530  O OE1  . GLU A 1 69 ? 10.726  -6.479  -4.167  1.00 1.84 ? 69  GLU A OE1  2  
ATOM 2531  O OE2  . GLU A 1 69 ? 9.176   -7.466  -5.373  1.00 1.70 ? 69  GLU A OE2  2  
ATOM 2532  H H    . GLU A 1 69 ? 9.230   -7.798  0.089   1.00 0.48 ? 69  GLU A H    2  
ATOM 2533  H HA   . GLU A 1 69 ? 9.728   -5.825  -1.861  1.00 0.46 ? 69  GLU A HA   2  
ATOM 2534  H HB2  . GLU A 1 69 ? 7.822   -8.112  -1.619  1.00 0.64 ? 69  GLU A HB2  2  
ATOM 2535  H HB3  . GLU A 1 69 ? 7.581   -6.944  -2.911  1.00 0.63 ? 69  GLU A HB3  2  
ATOM 2536  H HG2  . GLU A 1 69 ? 10.224  -8.288  -2.474  1.00 1.51 ? 69  GLU A HG2  2  
ATOM 2537  H HG3  . GLU A 1 69 ? 8.943   -9.037  -3.426  1.00 1.43 ? 69  GLU A HG3  2  
ATOM 2538  N N    . ALA A 1 70 ? 7.010   -5.419  -0.064  1.00 0.41 ? 70  ALA A N    2  
ATOM 2539  C CA   . ALA A 1 70 ? 5.969   -4.461  0.315   1.00 0.41 ? 70  ALA A CA   2  
ATOM 2540  C C    . ALA A 1 70 ? 6.588   -3.113  0.681   1.00 0.40 ? 70  ALA A C    2  
ATOM 2541  O O    . ALA A 1 70 ? 6.085   -2.056  0.299   1.00 0.42 ? 70  ALA A O    2  
ATOM 2542  C CB   . ALA A 1 70 ? 5.175   -4.998  1.497   1.00 0.44 ? 70  ALA A CB   2  
ATOM 2543  H H    . ALA A 1 70 ? 7.124   -6.232  0.475   1.00 0.44 ? 70  ALA A H    2  
ATOM 2544  H HA   . ALA A 1 70 ? 5.289   -4.333  -0.520  1.00 0.42 ? 70  ALA A HA   2  
ATOM 2545  H HB1  . ALA A 1 70 ? 4.251   -4.449  1.589   1.00 1.00 ? 70  ALA A HB1  2  
ATOM 2546  H HB2  . ALA A 1 70 ? 5.753   -4.880  2.402   1.00 1.28 ? 70  ALA A HB2  2  
ATOM 2547  H HB3  . ALA A 1 70 ? 4.960   -6.044  1.343   1.00 0.98 ? 70  ALA A HB3  2  
ATOM 2548  N N    . VAL A 1 71 ? 7.694   -3.168  1.420   1.00 0.40 ? 71  VAL A N    2  
ATOM 2549  C CA   . VAL A 1 71 ? 8.401   -1.967  1.846   1.00 0.42 ? 71  VAL A CA   2  
ATOM 2550  C C    . VAL A 1 71 ? 9.286   -1.414  0.732   1.00 0.41 ? 71  VAL A C    2  
ATOM 2551  O O    . VAL A 1 71 ? 9.387   -0.203  0.567   1.00 0.42 ? 71  VAL A O    2  
ATOM 2552  C CB   . VAL A 1 71 ? 9.262   -2.238  3.102   1.00 0.48 ? 71  VAL A CB   2  
ATOM 2553  C CG1  . VAL A 1 71 ? 10.269  -1.118  3.336   1.00 0.52 ? 71  VAL A CG1  2  
ATOM 2554  C CG2  . VAL A 1 71 ? 8.376   -2.425  4.323   1.00 0.50 ? 71  VAL A CG2  2  
ATOM 2555  H H    . VAL A 1 71 ? 8.047   -4.047  1.673   1.00 0.41 ? 71  VAL A H    2  
ATOM 2556  H HA   . VAL A 1 71 ? 7.657   -1.223  2.098   1.00 0.43 ? 71  VAL A HA   2  
ATOM 2557  H HB   . VAL A 1 71 ? 9.811   -3.155  2.942   1.00 0.51 ? 71  VAL A HB   2  
ATOM 2558  H HG11 . VAL A 1 71 ? 11.165  -1.318  2.767   1.00 1.18 ? 71  VAL A HG11 2  
ATOM 2559  H HG12 . VAL A 1 71 ? 10.515  -1.067  4.386   1.00 1.21 ? 71  VAL A HG12 2  
ATOM 2560  H HG13 . VAL A 1 71 ? 9.844   -0.178  3.020   1.00 1.02 ? 71  VAL A HG13 2  
ATOM 2561  H HG21 . VAL A 1 71 ? 8.919   -2.969  5.081   1.00 1.07 ? 71  VAL A HG21 2  
ATOM 2562  H HG22 . VAL A 1 71 ? 7.492   -2.979  4.045   1.00 1.12 ? 71  VAL A HG22 2  
ATOM 2563  H HG23 . VAL A 1 71 ? 8.088   -1.458  4.710   1.00 1.00 ? 71  VAL A HG23 2  
ATOM 2564  N N    . THR A 1 72 ? 9.920   -2.307  -0.029  1.00 0.43 ? 72  THR A N    2  
ATOM 2565  C CA   . THR A 1 72 ? 10.798  -1.903  -1.125  1.00 0.47 ? 72  THR A CA   2  
ATOM 2566  C C    . THR A 1 72 ? 10.025  -1.177  -2.228  1.00 0.42 ? 72  THR A C    2  
ATOM 2567  O O    . THR A 1 72 ? 10.569  -0.294  -2.891  1.00 0.44 ? 72  THR A O    2  
ATOM 2568  C CB   . THR A 1 72 ? 11.516  -3.127  -1.710  1.00 0.53 ? 72  THR A CB   2  
ATOM 2569  O OG1  . THR A 1 72 ? 12.343  -3.736  -0.734  1.00 0.60 ? 72  THR A OG1  2  
ATOM 2570  C CG2  . THR A 1 72 ? 12.390  -2.802  -2.905  1.00 0.61 ? 72  THR A CG2  2  
ATOM 2571  H H    . THR A 1 72 ? 9.791   -3.260  0.149   1.00 0.46 ? 72  THR A H    2  
ATOM 2572  H HA   . THR A 1 72 ? 11.535  -1.229  -0.720  1.00 0.51 ? 72  THR A HA   2  
ATOM 2573  H HB   . THR A 1 72 ? 10.776  -3.849  -2.025  1.00 0.53 ? 72  THR A HB   2  
ATOM 2574  H HG1  . THR A 1 72 ? 11.966  -4.580  -0.477  1.00 0.98 ? 72  THR A HG1  2  
ATOM 2575  H HG21 . THR A 1 72 ? 13.037  -1.973  -2.662  1.00 1.16 ? 72  THR A HG21 2  
ATOM 2576  H HG22 . THR A 1 72 ? 11.766  -2.537  -3.747  1.00 0.86 ? 72  THR A HG22 2  
ATOM 2577  H HG23 . THR A 1 72 ? 12.989  -3.665  -3.158  1.00 1.27 ? 72  THR A HG23 2  
ATOM 2578  N N    . ALA A 1 73 ? 8.760   -1.556  -2.425  1.00 0.37 ? 73  ALA A N    2  
ATOM 2579  C CA   . ALA A 1 73 ? 7.923   -0.944  -3.454  1.00 0.36 ? 73  ALA A CA   2  
ATOM 2580  C C    . ALA A 1 73 ? 7.342   0.382   -2.980  1.00 0.34 ? 73  ALA A C    2  
ATOM 2581  O O    . ALA A 1 73 ? 7.236   1.328   -3.761  1.00 0.36 ? 73  ALA A O    2  
ATOM 2582  C CB   . ALA A 1 73 ? 6.810   -1.895  -3.868  1.00 0.41 ? 73  ALA A CB   2  
ATOM 2583  H H    . ALA A 1 73 ? 8.376   -2.264  -1.874  1.00 0.37 ? 73  ALA A H    2  
ATOM 2584  H HA   . ALA A 1 73 ? 8.545   -0.760  -4.318  1.00 0.39 ? 73  ALA A HA   2  
ATOM 2585  H HB1  . ALA A 1 73 ? 7.196   -2.903  -3.917  1.00 1.15 ? 73  ALA A HB1  2  
ATOM 2586  H HB2  . ALA A 1 73 ? 6.436   -1.606  -4.839  1.00 1.01 ? 73  ALA A HB2  2  
ATOM 2587  H HB3  . ALA A 1 73 ? 6.010   -1.851  -3.145  1.00 1.08 ? 73  ALA A HB3  2  
ATOM 2588  N N    . LEU A 1 74 ? 6.993   0.459   -1.694  1.00 0.33 ? 74  LEU A N    2  
ATOM 2589  C CA   . LEU A 1 74 ? 6.455   1.691   -1.127  1.00 0.37 ? 74  LEU A CA   2  
ATOM 2590  C C    . LEU A 1 74 ? 7.581   2.701   -0.919  1.00 0.38 ? 74  LEU A C    2  
ATOM 2591  O O    . LEU A 1 74 ? 7.393   3.908   -1.086  1.00 0.44 ? 74  LEU A O    2  
ATOM 2592  C CB   . LEU A 1 74 ? 5.774   1.403   0.214   1.00 0.41 ? 74  LEU A CB   2  
ATOM 2593  C CG   . LEU A 1 74 ? 4.313   0.960   0.133   1.00 0.61 ? 74  LEU A CG   2  
ATOM 2594  C CD1  . LEU A 1 74 ? 3.421   2.113   -0.301  1.00 1.73 ? 74  LEU A CD1  2  
ATOM 2595  C CD2  . LEU A 1 74 ? 4.157   -0.225  -0.809  1.00 1.13 ? 74  LEU A CD2  2  
ATOM 2596  H H    . LEU A 1 74 ? 7.125   -0.315  -1.099  1.00 0.33 ? 74  LEU A H    2  
ATOM 2597  H HA   . LEU A 1 74 ? 5.733   2.099   -1.818  1.00 0.42 ? 74  LEU A HA   2  
ATOM 2598  H HB2  . LEU A 1 74 ? 6.334   0.626   0.715   1.00 0.61 ? 74  LEU A HB2  2  
ATOM 2599  H HB3  . LEU A 1 74 ? 5.821   2.297   0.816   1.00 0.47 ? 74  LEU A HB3  2  
ATOM 2600  H HG   . LEU A 1 74 ? 3.999   0.648   1.115   1.00 1.29 ? 74  LEU A HG   2  
ATOM 2601  H HD11 . LEU A 1 74 ? 2.389   1.863   -0.106  1.00 2.20 ? 74  LEU A HD11 2  
ATOM 2602  H HD12 . LEU A 1 74 ? 3.553   2.293   -1.358  1.00 2.34 ? 74  LEU A HD12 2  
ATOM 2603  H HD13 . LEU A 1 74 ? 3.687   3.002   0.250   1.00 2.24 ? 74  LEU A HD13 2  
ATOM 2604  H HD21 . LEU A 1 74 ? 5.120   -0.685  -0.969  1.00 1.57 ? 74  LEU A HD21 2  
ATOM 2605  H HD22 . LEU A 1 74 ? 3.758   0.114   -1.753  1.00 1.72 ? 74  LEU A HD22 2  
ATOM 2606  H HD23 . LEU A 1 74 ? 3.483   -0.946  -0.370  1.00 1.75 ? 74  LEU A HD23 2  
ATOM 2607  N N    . LYS A 1 75 ? 8.750   2.182   -0.548  1.00 0.38 ? 75  LYS A N    2  
ATOM 2608  C CA   . LYS A 1 75 ? 9.931   3.012   -0.301  1.00 0.47 ? 75  LYS A CA   2  
ATOM 2609  C C    . LYS A 1 75 ? 10.540  3.556   -1.599  1.00 0.49 ? 75  LYS A C    2  
ATOM 2610  O O    . LYS A 1 75 ? 11.158  4.622   -1.590  1.00 0.59 ? 75  LYS A O    2  
ATOM 2611  C CB   . LYS A 1 75 ? 10.986  2.211   0.479   1.00 0.57 ? 75  LYS A CB   2  
ATOM 2612  C CG   . LYS A 1 75 ? 12.426  2.610   0.183   1.00 0.64 ? 75  LYS A CG   2  
ATOM 2613  C CD   . LYS A 1 75 ? 13.393  2.005   1.189   1.00 1.05 ? 75  LYS A CD   2  
ATOM 2614  C CE   . LYS A 1 75 ? 13.479  0.493   1.047   1.00 0.88 ? 75  LYS A CE   2  
ATOM 2615  N NZ   . LYS A 1 75 ? 14.442  -0.104  2.013   1.00 1.44 ? 75  LYS A NZ   2  
ATOM 2616  H H    . LYS A 1 75 ? 8.815   1.204   -0.433  1.00 0.37 ? 75  LYS A H    2  
ATOM 2617  H HA   . LYS A 1 75 ? 9.618   3.849   0.306   1.00 0.54 ? 75  LYS A HA   2  
ATOM 2618  H HB2  . LYS A 1 75 ? 10.811  2.343   1.535   1.00 0.67 ? 75  LYS A HB2  2  
ATOM 2619  H HB3  . LYS A 1 75 ? 10.874  1.167   0.235   1.00 0.62 ? 75  LYS A HB3  2  
ATOM 2620  H HG2  . LYS A 1 75 ? 12.688  2.264   -0.808  1.00 0.87 ? 75  LYS A HG2  2  
ATOM 2621  H HG3  . LYS A 1 75 ? 12.506  3.687   0.222   1.00 0.88 ? 75  LYS A HG3  2  
ATOM 2622  H HD2  . LYS A 1 75 ? 14.374  2.426   1.028   1.00 1.90 ? 75  LYS A HD2  2  
ATOM 2623  H HD3  . LYS A 1 75 ? 13.057  2.246   2.187   1.00 1.62 ? 75  LYS A HD3  2  
ATOM 2624  H HE2  . LYS A 1 75 ? 12.500  0.071   1.225   1.00 1.04 ? 75  LYS A HE2  2  
ATOM 2625  H HE3  . LYS A 1 75 ? 13.795  0.255   0.042   1.00 1.51 ? 75  LYS A HE3  2  
ATOM 2626  H HZ1  . LYS A 1 75 ? 14.432  -1.141  1.933   1.00 1.72 ? 75  LYS A HZ1  2  
ATOM 2627  H HZ2  . LYS A 1 75 ? 14.185  0.160   2.985   1.00 1.94 ? 75  LYS A HZ2  2  
ATOM 2628  H HZ3  . LYS A 1 75 ? 15.405  0.238   1.816   1.00 1.92 ? 75  LYS A HZ3  2  
ATOM 2629  N N    . ASN A 1 76 ? 10.387  2.819   -2.704  1.00 0.48 ? 76  ASN A N    2  
ATOM 2630  C CA   . ASN A 1 76 ? 10.956  3.244   -3.983  1.00 0.59 ? 76  ASN A CA   2  
ATOM 2631  C C    . ASN A 1 76 ? 10.163  4.389   -4.619  1.00 0.69 ? 76  ASN A C    2  
ATOM 2632  O O    . ASN A 1 76 ? 9.397   4.186   -5.564  1.00 1.15 ? 76  ASN A O    2  
ATOM 2633  C CB   . ASN A 1 76 ? 11.059  2.066   -4.954  1.00 0.64 ? 76  ASN A CB   2  
ATOM 2634  C CG   . ASN A 1 76 ? 12.164  2.271   -5.975  1.00 0.85 ? 76  ASN A CG   2  
ATOM 2635  O OD1  . ASN A 1 76 ? 13.100  1.476   -6.060  1.00 0.90 ? 76  ASN A OD1  2  
ATOM 2636  N ND2  . ASN A 1 76 ? 12.062  3.344   -6.759  1.00 1.55 ? 76  ASN A ND2  2  
ATOM 2637  H H    . ASN A 1 76 ? 9.898   1.970   -2.654  1.00 0.45 ? 76  ASN A H    2  
ATOM 2638  H HA   . ASN A 1 76 ? 11.954  3.604   -3.780  1.00 0.73 ? 76  ASN A HA   2  
ATOM 2639  H HB2  . ASN A 1 76 ? 11.271  1.167   -4.396  1.00 0.71 ? 76  ASN A HB2  2  
ATOM 2640  H HB3  . ASN A 1 76 ? 10.122  1.950   -5.478  1.00 0.75 ? 76  ASN A HB3  2  
ATOM 2641  H HD21 . ASN A 1 76 ? 11.289  3.932   -6.644  1.00 1.95 ? 76  ASN A HD21 2  
ATOM 2642  H HD22 . ASN A 1 76 ? 12.772  3.511   -7.406  1.00 1.75 ? 76  ASN A HD22 2  
ATOM 2643  N N    . THR A 1 77 ? 10.362  5.590   -4.087  1.00 0.90 ? 77  THR A N    2  
ATOM 2644  C CA   . THR A 1 77 ? 9.687   6.786   -4.582  1.00 1.07 ? 77  THR A CA   2  
ATOM 2645  C C    . THR A 1 77 ? 10.704  7.883   -4.914  1.00 0.80 ? 77  THR A C    2  
ATOM 2646  O O    . THR A 1 77 ? 11.693  8.060   -4.199  1.00 1.47 ? 77  THR A O    2  
ATOM 2647  C CB   . THR A 1 77 ? 8.686   7.286   -3.538  1.00 2.00 ? 77  THR A CB   2  
ATOM 2648  O OG1  . THR A 1 77 ? 8.187   8.567   -3.882  1.00 2.60 ? 77  THR A OG1  2  
ATOM 2649  C CG2  . THR A 1 77 ? 9.282   7.372   -2.149  1.00 2.53 ? 77  THR A CG2  2  
ATOM 2650  H H    . THR A 1 77 ? 10.976  5.669   -3.326  1.00 1.26 ? 77  THR A H    2  
ATOM 2651  H HA   . THR A 1 77 ? 9.153   6.519   -5.482  1.00 1.56 ? 77  THR A HA   2  
ATOM 2652  H HB   . THR A 1 77 ? 7.854   6.599   -3.496  1.00 2.59 ? 77  THR A HB   2  
ATOM 2653  H HG1  . THR A 1 77 ? 7.525   8.478   -4.572  1.00 2.91 ? 77  THR A HG1  2  
ATOM 2654  H HG21 . THR A 1 77 ? 8.846   6.608   -1.524  1.00 2.58 ? 77  THR A HG21 2  
ATOM 2655  H HG22 . THR A 1 77 ? 9.081   8.344   -1.727  1.00 3.13 ? 77  THR A HG22 2  
ATOM 2656  H HG23 . THR A 1 77 ? 10.351  7.219   -2.210  1.00 2.95 ? 77  THR A HG23 2  
ATOM 2657  N N    . SER A 1 78 ? 10.452  8.616   -6.000  1.00 1.14 ? 78  SER A N    2  
ATOM 2658  C CA   . SER A 1 78 ? 11.344  9.695   -6.423  1.00 1.74 ? 78  SER A CA   2  
ATOM 2659  C C    . SER A 1 78 ? 10.565  10.991  -6.654  1.00 1.42 ? 78  SER A C    2  
ATOM 2660  O O    . SER A 1 78 ? 10.544  11.867  -5.790  1.00 1.44 ? 78  SER A O    2  
ATOM 2661  C CB   . SER A 1 78 ? 12.102  9.294   -7.694  1.00 2.76 ? 78  SER A CB   2  
ATOM 2662  O OG   . SER A 1 78 ? 13.111  8.341   -7.405  1.00 3.36 ? 78  SER A OG   2  
ATOM 2663  H H    . SER A 1 78 ? 9.645   8.425   -6.524  1.00 1.57 ? 78  SER A H    2  
ATOM 2664  H HA   . SER A 1 78 ? 12.059  9.861   -5.630  1.00 2.08 ? 78  SER A HA   2  
ATOM 2665  H HB2  . SER A 1 78 ? 11.410  8.862   -8.403  1.00 3.05 ? 78  SER A HB2  2  
ATOM 2666  H HB3  . SER A 1 78 ? 12.563  10.169  -8.129  1.00 3.31 ? 78  SER A HB3  2  
ATOM 2667  H HG   . SER A 1 78 ? 13.954  8.789   -7.303  1.00 3.89 ? 78  SER A HG   2  
ATOM 2668  N N    . ASP A 1 79 ? 9.917   11.098  -7.815  1.00 1.32 ? 79  ASP A N    2  
ATOM 2669  C CA   . ASP A 1 79 ? 9.126   12.281  -8.151  1.00 1.18 ? 79  ASP A CA   2  
ATOM 2670  C C    . ASP A 1 79 ? 7.647   12.010  -7.895  1.00 0.99 ? 79  ASP A C    2  
ATOM 2671  O O    . ASP A 1 79 ? 7.004   12.709  -7.112  1.00 0.92 ? 79  ASP A O    2  
ATOM 2672  C CB   . ASP A 1 79 ? 9.345   12.677  -9.615  1.00 1.46 ? 79  ASP A CB   2  
ATOM 2673  C CG   . ASP A 1 79 ? 10.778  13.090  -9.897  1.00 1.61 ? 79  ASP A CG   2  
ATOM 2674  O OD1  . ASP A 1 79 ? 11.598  12.207  -10.226 1.00 2.23 ? 79  ASP A OD1  2  
ATOM 2675  O OD2  . ASP A 1 79 ? 11.079  14.298  -9.788  1.00 2.07 ? 79  ASP A OD2  2  
ATOM 2676  H H    . ASP A 1 79 ? 9.963   10.361  -8.459  1.00 1.49 ? 79  ASP A H    2  
ATOM 2677  H HA   . ASP A 1 79 ? 9.449   13.091  -7.513  1.00 1.15 ? 79  ASP A HA   2  
ATOM 2678  H HB2  . ASP A 1 79 ? 9.103   11.836  -10.248 1.00 2.06 ? 79  ASP A HB2  2  
ATOM 2679  H HB3  . ASP A 1 79 ? 8.695   13.504  -9.859  1.00 1.75 ? 79  ASP A HB3  2  
ATOM 2680  N N    . PHE A 1 80 ? 7.121   10.982  -8.558  1.00 0.97 ? 80  PHE A N    2  
ATOM 2681  C CA   . PHE A 1 80 ? 5.723   10.593  -8.408  1.00 0.85 ? 80  PHE A CA   2  
ATOM 2682  C C    . PHE A 1 80 ? 5.628   9.136   -7.959  1.00 0.82 ? 80  PHE A C    2  
ATOM 2683  O O    . PHE A 1 80 ? 6.627   8.412   -7.969  1.00 0.92 ? 80  PHE A O    2  
ATOM 2684  C CB   . PHE A 1 80 ? 4.979   10.783  -9.733  1.00 0.92 ? 80  PHE A CB   2  
ATOM 2685  C CG   . PHE A 1 80 ? 3.944   11.868  -9.689  1.00 0.94 ? 80  PHE A CG   2  
ATOM 2686  C CD1  . PHE A 1 80 ? 4.319   13.198  -9.579  1.00 1.68 ? 80  PHE A CD1  2  
ATOM 2687  C CD2  . PHE A 1 80 ? 2.597   11.558  -9.755  1.00 1.39 ? 80  PHE A CD2  2  
ATOM 2688  C CE1  . PHE A 1 80 ? 3.367   14.198  -9.537  1.00 1.77 ? 80  PHE A CE1  2  
ATOM 2689  C CE2  . PHE A 1 80 ? 1.640   12.554  -9.713  1.00 1.43 ? 80  PHE A CE2  2  
ATOM 2690  C CZ   . PHE A 1 80 ? 2.026   13.877  -9.603  1.00 1.14 ? 80  PHE A CZ   2  
ATOM 2691  H H    . PHE A 1 80 ? 7.689   10.465  -9.169  1.00 1.09 ? 80  PHE A H    2  
ATOM 2692  H HA   . PHE A 1 80 ? 5.277   11.223  -7.654  1.00 0.81 ? 80  PHE A HA   2  
ATOM 2693  H HB2  . PHE A 1 80 ? 5.691   11.036  -10.505 1.00 1.04 ? 80  PHE A HB2  2  
ATOM 2694  H HB3  . PHE A 1 80 ? 4.483   9.860   -9.996  1.00 0.93 ? 80  PHE A HB3  2  
ATOM 2695  H HD1  . PHE A 1 80 ? 5.367   13.451  -9.528  1.00 2.48 ? 80  PHE A HD1  2  
ATOM 2696  H HD2  . PHE A 1 80 ? 2.297   10.523  -9.841  1.00 2.16 ? 80  PHE A HD2  2  
ATOM 2697  H HE1  . PHE A 1 80 ? 3.672   15.230  -9.451  1.00 2.61 ? 80  PHE A HE1  2  
ATOM 2698  H HE2  . PHE A 1 80 ? 0.592   12.300  -9.764  1.00 2.19 ? 80  PHE A HE2  2  
ATOM 2699  H HZ   . PHE A 1 80 ? 1.281   14.657  -9.569  1.00 1.26 ? 80  PHE A HZ   2  
ATOM 2700  N N    . VAL A 1 81 ? 4.429   8.701   -7.574  1.00 0.75 ? 81  VAL A N    2  
ATOM 2701  C CA   . VAL A 1 81 ? 4.216   7.325   -7.136  1.00 0.77 ? 81  VAL A CA   2  
ATOM 2702  C C    . VAL A 1 81 ? 2.888   6.803   -7.682  1.00 0.65 ? 81  VAL A C    2  
ATOM 2703  O O    . VAL A 1 81 ? 1.917   7.554   -7.783  1.00 0.59 ? 81  VAL A O    2  
ATOM 2704  C CB   . VAL A 1 81 ? 4.243   7.216   -5.587  1.00 0.88 ? 81  VAL A CB   2  
ATOM 2705  C CG1  . VAL A 1 81 ? 2.976   6.567   -5.035  1.00 1.19 ? 81  VAL A CG1  2  
ATOM 2706  C CG2  . VAL A 1 81 ? 5.476   6.449   -5.131  1.00 1.58 ? 81  VAL A CG2  2  
ATOM 2707  H H    . VAL A 1 81 ? 3.654   9.304   -7.589  1.00 0.74 ? 81  VAL A H    2  
ATOM 2708  H HA   . VAL A 1 81 ? 5.018   6.720   -7.535  1.00 0.89 ? 81  VAL A HA   2  
ATOM 2709  H HB   . VAL A 1 81 ? 4.305   8.216   -5.181  1.00 1.14 ? 81  VAL A HB   2  
ATOM 2710  H HG11 . VAL A 1 81 ? 2.860   5.582   -5.464  1.00 1.78 ? 81  VAL A HG11 2  
ATOM 2711  H HG12 . VAL A 1 81 ? 2.119   7.172   -5.291  1.00 1.62 ? 81  VAL A HG12 2  
ATOM 2712  H HG13 . VAL A 1 81 ? 3.050   6.485   -3.961  1.00 1.67 ? 81  VAL A HG13 2  
ATOM 2713  H HG21 . VAL A 1 81 ? 5.280   5.388   -5.185  1.00 1.98 ? 81  VAL A HG21 2  
ATOM 2714  H HG22 . VAL A 1 81 ? 5.713   6.720   -4.114  1.00 2.06 ? 81  VAL A HG22 2  
ATOM 2715  H HG23 . VAL A 1 81 ? 6.309   6.694   -5.772  1.00 2.07 ? 81  VAL A HG23 2  
ATOM 2716  N N    . TYR A 1 82 ? 2.846   5.518   -8.034  1.00 0.72 ? 82  TYR A N    2  
ATOM 2717  C CA   . TYR A 1 82 ? 1.628   4.921   -8.567  1.00 0.69 ? 82  TYR A CA   2  
ATOM 2718  C C    . TYR A 1 82 ? 1.286   3.623   -7.838  1.00 0.67 ? 82  TYR A C    2  
ATOM 2719  O O    . TYR A 1 82 ? 1.839   2.559   -8.128  1.00 0.77 ? 82  TYR A O    2  
ATOM 2720  C CB   . TYR A 1 82 ? 1.796   4.666   -10.065 1.00 0.85 ? 82  TYR A CB   2  
ATOM 2721  C CG   . TYR A 1 82 ? 0.520   4.306   -10.790 1.00 0.93 ? 82  TYR A CG   2  
ATOM 2722  C CD1  . TYR A 1 82 ? 0.112   2.983   -10.889 1.00 1.57 ? 82  TYR A CD1  2  
ATOM 2723  C CD2  . TYR A 1 82 ? -0.268  5.282   -11.389 1.00 1.41 ? 82  TYR A CD2  2  
ATOM 2724  C CE1  . TYR A 1 82 ? -1.040  2.641   -11.563 1.00 1.72 ? 82  TYR A CE1  2  
ATOM 2725  C CE2  . TYR A 1 82 ? -1.426  4.947   -12.063 1.00 1.55 ? 82  TYR A CE2  2  
ATOM 2726  C CZ   . TYR A 1 82 ? -1.808  3.625   -12.148 1.00 1.33 ? 82  TYR A CZ   2  
ATOM 2727  O OH   . TYR A 1 82 ? -2.957  3.285   -12.824 1.00 1.58 ? 82  TYR A OH   2  
ATOM 2728  H H    . TYR A 1 82 ? 3.648   4.962   -7.931  1.00 0.85 ? 82  TYR A H    2  
ATOM 2729  H HA   . TYR A 1 82 ? 0.822   5.624   -8.419  1.00 0.64 ? 82  TYR A HA   2  
ATOM 2730  H HB2  . TYR A 1 82 ? 2.199   5.555   -10.529 1.00 0.88 ? 82  TYR A HB2  2  
ATOM 2731  H HB3  . TYR A 1 82 ? 2.487   3.852   -10.200 1.00 0.99 ? 82  TYR A HB3  2  
ATOM 2732  H HD1  . TYR A 1 82 ? 0.713   2.213   -10.428 1.00 2.27 ? 82  TYR A HD1  2  
ATOM 2733  H HD2  . TYR A 1 82 ? 0.034   6.317   -11.323 1.00 2.08 ? 82  TYR A HD2  2  
ATOM 2734  H HE1  . TYR A 1 82 ? -1.336  1.606   -11.627 1.00 2.47 ? 82  TYR A HE1  2  
ATOM 2735  H HE2  . TYR A 1 82 ? -2.025  5.718   -12.521 1.00 2.24 ? 82  TYR A HE2  2  
ATOM 2736  H HH   . TYR A 1 82 ? -2.739  3.046   -13.729 1.00 1.97 ? 82  TYR A HH   2  
ATOM 2737  N N    . LEU A 1 83 ? 0.371   3.739   -6.884  1.00 0.62 ? 83  LEU A N    2  
ATOM 2738  C CA   . LEU A 1 83 ? -0.073  2.606   -6.080  1.00 0.65 ? 83  LEU A CA   2  
ATOM 2739  C C    . LEU A 1 83 ? -1.312  1.959   -6.693  1.00 0.66 ? 83  LEU A C    2  
ATOM 2740  O O    . LEU A 1 83 ? -2.288  2.643   -7.007  1.00 0.71 ? 83  LEU A O    2  
ATOM 2741  C CB   . LEU A 1 83 ? -0.368  3.067   -4.651  1.00 0.74 ? 83  LEU A CB   2  
ATOM 2742  C CG   . LEU A 1 83 ? -0.444  1.953   -3.605  1.00 0.74 ? 83  LEU A CG   2  
ATOM 2743  C CD1  . LEU A 1 83 ? 0.897   1.779   -2.906  1.00 1.34 ? 83  LEU A CD1  2  
ATOM 2744  C CD2  . LEU A 1 83 ? -1.540  2.256   -2.596  1.00 1.38 ? 83  LEU A CD2  2  
ATOM 2745  H H    . LEU A 1 83 ? 0.000   4.626   -6.705  1.00 0.62 ? 83  LEU A H    2  
ATOM 2746  H HA   . LEU A 1 83 ? 0.727   1.880   -6.058  1.00 0.69 ? 83  LEU A HA   2  
ATOM 2747  H HB2  . LEU A 1 83 ? 0.405   3.759   -4.353  1.00 0.88 ? 83  LEU A HB2  2  
ATOM 2748  H HB3  . LEU A 1 83 ? -1.313  3.589   -4.654  1.00 0.80 ? 83  LEU A HB3  2  
ATOM 2749  H HG   . LEU A 1 83 ? -0.687  1.021   -4.095  1.00 1.48 ? 83  LEU A HG   2  
ATOM 2750  H HD11 . LEU A 1 83 ? 1.425   2.720   -2.899  1.00 1.81 ? 83  LEU A HD11 2  
ATOM 2751  H HD12 . LEU A 1 83 ? 1.484   1.041   -3.433  1.00 1.91 ? 83  LEU A HD12 2  
ATOM 2752  H HD13 . LEU A 1 83 ? 0.735   1.450   -1.890  1.00 1.85 ? 83  LEU A HD13 2  
ATOM 2753  H HD21 . LEU A 1 83 ? -1.972  1.332   -2.243  1.00 1.83 ? 83  LEU A HD21 2  
ATOM 2754  H HD22 . LEU A 1 83 ? -2.305  2.855   -3.068  1.00 2.00 ? 83  LEU A HD22 2  
ATOM 2755  H HD23 . LEU A 1 83 ? -1.121  2.800   -1.762  1.00 1.85 ? 83  LEU A HD23 2  
ATOM 2756  N N    . LYS A 1 84 ? -1.271  0.637   -6.848  1.00 0.66 ? 84  LYS A N    2  
ATOM 2757  C CA   . LYS A 1 84 ? -2.389  -0.111  -7.412  1.00 0.68 ? 84  LYS A CA   2  
ATOM 2758  C C    . LYS A 1 84 ? -3.086  -0.925  -6.332  1.00 0.65 ? 84  LYS A C    2  
ATOM 2759  O O    . LYS A 1 84 ? -2.519  -1.873  -5.803  1.00 0.68 ? 84  LYS A O    2  
ATOM 2760  C CB   . LYS A 1 84 ? -1.915  -1.026  -8.548  1.00 0.69 ? 84  LYS A CB   2  
ATOM 2761  C CG   . LYS A 1 84 ? -1.896  -0.351  -9.912  1.00 0.76 ? 84  LYS A CG   2  
ATOM 2762  C CD   . LYS A 1 84 ? -3.283  0.120   -10.330 1.00 0.99 ? 84  LYS A CD   2  
ATOM 2763  C CE   . LYS A 1 84 ? -4.257  -1.042  -10.461 1.00 1.18 ? 84  LYS A CE   2  
ATOM 2764  N NZ   . LYS A 1 84 ? -5.477  -0.664  -11.229 1.00 1.56 ? 84  LYS A NZ   2  
ATOM 2765  H H    . LYS A 1 84 ? -0.469  0.148   -6.567  1.00 0.68 ? 84  LYS A H    2  
ATOM 2766  H HA   . LYS A 1 84 ? -3.090  0.594   -7.807  1.00 0.72 ? 84  LYS A HA   2  
ATOM 2767  H HB2  . LYS A 1 84 ? -0.916  -1.366  -8.328  1.00 0.66 ? 84  LYS A HB2  2  
ATOM 2768  H HB3  . LYS A 1 84 ? -2.572  -1.882  -8.604  1.00 0.73 ? 84  LYS A HB3  2  
ATOM 2769  H HG2  . LYS A 1 84 ? -1.238  0.505   -9.869  1.00 0.93 ? 84  LYS A HG2  2  
ATOM 2770  H HG3  . LYS A 1 84 ? -1.528  -1.052  -10.645 1.00 0.86 ? 84  LYS A HG3  2  
ATOM 2771  H HD2  . LYS A 1 84 ? -3.658  0.807   -9.588  1.00 1.65 ? 84  LYS A HD2  2  
ATOM 2772  H HD3  . LYS A 1 84 ? -3.209  0.624   -11.284 1.00 1.42 ? 84  LYS A HD3  2  
ATOM 2773  H HE2  . LYS A 1 84 ? -3.761  -1.856  -10.969 1.00 1.51 ? 84  LYS A HE2  2  
ATOM 2774  H HE3  . LYS A 1 84 ? -4.550  -1.362  -9.472  1.00 1.85 ? 84  LYS A HE3  2  
ATOM 2775  H HZ1  . LYS A 1 84 ? -6.212  -1.389  -11.108 1.00 2.19 ? 84  LYS A HZ1  2  
ATOM 2776  H HZ2  . LYS A 1 84 ? -5.250  -0.581  -12.241 1.00 1.68 ? 84  LYS A HZ2  2  
ATOM 2777  H HZ3  . LYS A 1 84 ? -5.845  0.248   -10.893 1.00 2.00 ? 84  LYS A HZ3  2  
ATOM 2778  N N    . VAL A 1 85 ? -4.313  -0.530  -5.995  1.00 0.76 ? 85  VAL A N    2  
ATOM 2779  C CA   . VAL A 1 85 ? -5.088  -1.213  -4.960  1.00 0.74 ? 85  VAL A CA   2  
ATOM 2780  C C    . VAL A 1 85 ? -6.307  -1.917  -5.558  1.00 0.91 ? 85  VAL A C    2  
ATOM 2781  O O    . VAL A 1 85 ? -7.145  -1.284  -6.202  1.00 1.17 ? 85  VAL A O    2  
ATOM 2782  C CB   . VAL A 1 85 ? -5.560  -0.221  -3.874  1.00 0.99 ? 85  VAL A CB   2  
ATOM 2783  C CG1  . VAL A 1 85 ? -6.505  -0.898  -2.889  1.00 1.92 ? 85  VAL A CG1  2  
ATOM 2784  C CG2  . VAL A 1 85 ? -4.365  0.385   -3.149  1.00 0.65 ? 85  VAL A CG2  2  
ATOM 2785  H H    . VAL A 1 85 ? -4.704  0.252   -6.440  1.00 0.92 ? 85  VAL A H    2  
ATOM 2786  H HA   . VAL A 1 85 ? -4.447  -1.951  -4.494  1.00 0.62 ? 85  VAL A HA   2  
ATOM 2787  H HB   . VAL A 1 85 ? -6.100  0.579   -4.358  1.00 1.45 ? 85  VAL A HB   2  
ATOM 2788  H HG11 . VAL A 1 85 ? -7.522  -0.615  -3.110  1.00 2.23 ? 85  VAL A HG11 2  
ATOM 2789  H HG12 . VAL A 1 85 ? -6.254  -0.594  -1.882  1.00 2.51 ? 85  VAL A HG12 2  
ATOM 2790  H HG13 . VAL A 1 85 ? -6.401  -1.972  -2.972  1.00 2.42 ? 85  VAL A HG13 2  
ATOM 2791  H HG21 . VAL A 1 85 ? -4.708  0.932   -2.284  1.00 1.26 ? 85  VAL A HG21 2  
ATOM 2792  H HG22 . VAL A 1 85 ? -3.842  1.056   -3.815  1.00 1.21 ? 85  VAL A HG22 2  
ATOM 2793  H HG23 . VAL A 1 85 ? -3.696  -0.404  -2.835  1.00 1.21 ? 85  VAL A HG23 2  
ATOM 2794  N N    . ALA A 1 86 ? -6.401  -3.228  -5.335  1.00 0.91 ? 86  ALA A N    2  
ATOM 2795  C CA   . ALA A 1 86 ? -7.519  -4.017  -5.848  1.00 1.24 ? 86  ALA A CA   2  
ATOM 2796  C C    . ALA A 1 86 ? -8.354  -4.597  -4.710  1.00 1.27 ? 86  ALA A C    2  
ATOM 2797  O O    . ALA A 1 86 ? -7.840  -5.329  -3.861  1.00 1.09 ? 86  ALA A O    2  
ATOM 2798  C CB   . ALA A 1 86 ? -7.012  -5.130  -6.755  1.00 1.46 ? 86  ALA A CB   2  
ATOM 2799  H H    . ALA A 1 86 ? -5.700  -3.673  -4.814  1.00 0.76 ? 86  ALA A H    2  
ATOM 2800  H HA   . ALA A 1 86 ? -8.144  -3.362  -6.439  1.00 1.52 ? 86  ALA A HA   2  
ATOM 2801  H HB1  . ALA A 1 86 ? -7.846  -5.732  -7.084  1.00 1.81 ? 86  ALA A HB1  2  
ATOM 2802  H HB2  . ALA A 1 86 ? -6.315  -5.748  -6.211  1.00 2.07 ? 86  ALA A HB2  2  
ATOM 2803  H HB3  . ALA A 1 86 ? -6.520  -4.698  -7.613  1.00 1.62 ? 86  ALA A HB3  2  
ATOM 2804  N N    . LYS A 1 87 ? -9.645  -4.263  -4.700  1.00 1.68 ? 87  LYS A N    2  
ATOM 2805  C CA   . LYS A 1 87 ? -10.561 -4.748  -3.669  1.00 1.86 ? 87  LYS A CA   2  
ATOM 2806  C C    . LYS A 1 87 ? -10.820 -6.249  -3.829  1.00 1.91 ? 87  LYS A C    2  
ATOM 2807  O O    . LYS A 1 87 ? -11.368 -6.686  -4.844  1.00 2.04 ? 87  LYS A O    2  
ATOM 2808  C CB   . LYS A 1 87 ? -11.886 -3.978  -3.729  1.00 2.22 ? 87  LYS A CB   2  
ATOM 2809  C CG   . LYS A 1 87 ? -11.901 -2.719  -2.877  1.00 2.53 ? 87  LYS A CG   2  
ATOM 2810  C CD   . LYS A 1 87 ? -13.168 -1.908  -3.102  1.00 2.89 ? 87  LYS A CD   2  
ATOM 2811  C CE   . LYS A 1 87 ? -13.293 -0.772  -2.099  1.00 3.28 ? 87  LYS A CE   2  
ATOM 2812  N NZ   . LYS A 1 87 ? -14.482 0.083   -2.369  1.00 4.20 ? 87  LYS A NZ   2  
ATOM 2813  H H    . LYS A 1 87 ? -9.992  -3.674  -5.403  1.00 1.92 ? 87  LYS A H    2  
ATOM 2814  H HA   . LYS A 1 87 ? -10.100 -4.573  -2.709  1.00 1.79 ? 87  LYS A HA   2  
ATOM 2815  H HB2  . LYS A 1 87 ? -12.077 -3.695  -4.755  1.00 2.44 ? 87  LYS A HB2  2  
ATOM 2816  H HB3  . LYS A 1 87 ? -12.681 -4.625  -3.392  1.00 2.56 ? 87  LYS A HB3  2  
ATOM 2817  H HG2  . LYS A 1 87 ? -11.846 -3.001  -1.836  1.00 2.95 ? 87  LYS A HG2  2  
ATOM 2818  H HG3  . LYS A 1 87 ? -11.044 -2.112  -3.133  1.00 2.69 ? 87  LYS A HG3  2  
ATOM 2819  H HD2  . LYS A 1 87 ? -13.145 -1.492  -4.099  1.00 3.05 ? 87  LYS A HD2  2  
ATOM 2820  H HD3  . LYS A 1 87 ? -14.023 -2.561  -3.003  1.00 3.28 ? 87  LYS A HD3  2  
ATOM 2821  H HE2  . LYS A 1 87 ? -13.381 -1.192  -1.108  1.00 3.46 ? 87  LYS A HE2  2  
ATOM 2822  H HE3  . LYS A 1 87 ? -12.402 -0.163  -2.152  1.00 3.29 ? 87  LYS A HE3  2  
ATOM 2823  H HZ1  . LYS A 1 87 ? -14.403 0.518   -3.311  1.00 4.41 ? 87  LYS A HZ1  2  
ATOM 2824  H HZ2  . LYS A 1 87 ? -14.550 0.837   -1.655  1.00 4.48 ? 87  LYS A HZ2  2  
ATOM 2825  H HZ3  . LYS A 1 87 ? -15.350 -0.489  -2.337  1.00 4.70 ? 87  LYS A HZ3  2  
ATOM 2826  N N    . PRO A 1 88 ? -10.425 -7.061  -2.826  1.00 1.88 ? 88  PRO A N    2  
ATOM 2827  C CA   . PRO A 1 88 ? -10.613 -8.519  -2.855  1.00 2.01 ? 88  PRO A CA   2  
ATOM 2828  C C    . PRO A 1 88 ? -12.089 -8.908  -2.967  1.00 2.20 ? 88  PRO A C    2  
ATOM 2829  O O    . PRO A 1 88 ? -12.940 -8.341  -2.277  1.00 2.28 ? 88  PRO A O    2  
ATOM 2830  C CB   . PRO A 1 88 ? -10.029 -8.990  -1.515  1.00 1.98 ? 88  PRO A CB   2  
ATOM 2831  C CG   . PRO A 1 88 ? -9.132  -7.886  -1.078  1.00 1.91 ? 88  PRO A CG   2  
ATOM 2832  C CD   . PRO A 1 88 ? -9.763  -6.624  -1.587  1.00 1.79 ? 88  PRO A CD   2  
ATOM 2833  H HA   . PRO A 1 88 ? -10.060 -8.966  -3.668  1.00 2.04 ? 88  PRO A HA   2  
ATOM 2834  H HB2  . PRO A 1 88 ? -10.828 -9.150  -0.806  1.00 2.18 ? 88  PRO A HB2  2  
ATOM 2835  H HB3  . PRO A 1 88 ? -9.480  -9.907  -1.659  1.00 1.96 ? 88  PRO A HB3  2  
ATOM 2836  H HG2  . PRO A 1 88 ? -9.070  -7.868  0.000   1.00 2.24 ? 88  PRO A HG2  2  
ATOM 2837  H HG3  . PRO A 1 88 ? -8.151  -8.016  -1.509  1.00 1.85 ? 88  PRO A HG3  2  
ATOM 2838  H HD2  . PRO A 1 88 ? -10.483 -6.247  -0.876  1.00 1.89 ? 88  PRO A HD2  2  
ATOM 2839  H HD3  . PRO A 1 88 ? -9.008  -5.881  -1.795  1.00 1.68 ? 88  PRO A HD3  2  
ATOM 2840  N N    . THR A 1 89 ? -12.387 -9.873  -3.841  1.00 2.38 ? 89  THR A N    2  
ATOM 2841  C CA   . THR A 1 89 ? -13.762 -10.332 -4.044  1.00 2.59 ? 89  THR A CA   2  
ATOM 2842  C C    . THR A 1 89 ? -13.804 -11.827 -4.358  1.00 2.77 ? 89  THR A C    2  
ATOM 2843  O O    . THR A 1 89 ? -13.062 -12.311 -5.216  1.00 3.51 ? 89  THR A O    2  
ATOM 2844  C CB   . THR A 1 89 ? -14.430 -9.542  -5.178  1.00 3.08 ? 89  THR A CB   2  
ATOM 2845  O OG1  . THR A 1 89 ? -13.559 -9.413  -6.291  1.00 3.51 ? 89  THR A OG1  2  
ATOM 2846  C CG2  . THR A 1 89 ? -14.867 -8.150  -4.766  1.00 3.88 ? 89  THR A CG2  2  
ATOM 2847  H H    . THR A 1 89 ? -11.665 -10.286 -4.361  1.00 2.41 ? 89  THR A H    2  
ATOM 2848  H HA   . THR A 1 89 ? -14.306 -10.155 -3.128  1.00 2.82 ? 89  THR A HA   2  
ATOM 2849  H HB   . THR A 1 89 ? -15.311 -10.080 -5.501  1.00 3.20 ? 89  THR A HB   2  
ATOM 2850  H HG1  . THR A 1 89 ? -12.837 -8.820  -6.072  1.00 3.87 ? 89  THR A HG1  2  
ATOM 2851  H HG21 . THR A 1 89 ? -15.452 -7.707  -5.559  1.00 4.03 ? 89  THR A HG21 2  
ATOM 2852  H HG22 . THR A 1 89 ? -13.996 -7.539  -4.577  1.00 4.36 ? 89  THR A HG22 2  
ATOM 2853  H HG23 . THR A 1 89 ? -15.465 -8.212  -3.869  1.00 4.30 ? 89  THR A HG23 2  
ATOM 2854  N N    . GLY A 1 90 ? -14.678 -12.549 -3.656  1.00 2.75 ? 90  GLY A N    2  
ATOM 2855  C CA   . GLY A 1 90 ? -14.809 -13.983 -3.867  1.00 3.54 ? 90  GLY A CA   2  
ATOM 2856  C C    . GLY A 1 90 ? -14.464 -14.810 -2.633  1.00 4.20 ? 90  GLY A C    2  
ATOM 2857  O O    . GLY A 1 90 ? -14.384 -16.037 -2.716  1.00 4.69 ? 90  GLY A O    2  
ATOM 2858  H H    . GLY A 1 90 ? -15.239 -12.103 -2.987  1.00 2.65 ? 90  GLY A H    2  
ATOM 2859  H HA2  . GLY A 1 90 ? -15.829 -14.197 -4.150  1.00 3.91 ? 90  GLY A HA2  2  
ATOM 2860  H HA3  . GLY A 1 90 ? -14.157 -14.278 -4.675  1.00 3.79 ? 90  GLY A HA3  2  
ATOM 2861  N N    . SER A 1 91 ? -14.262 -14.146 -1.489  1.00 4.69 ? 91  SER A N    2  
ATOM 2862  C CA   . SER A 1 91 ? -13.927 -14.838 -0.244  1.00 5.64 ? 91  SER A CA   2  
ATOM 2863  C C    . SER A 1 91 ? -15.124 -15.625 0.293   1.00 5.73 ? 91  SER A C    2  
ATOM 2864  O O    . SER A 1 91 ? -14.960 -16.717 0.840   1.00 6.47 ? 91  SER A O    2  
ATOM 2865  C CB   . SER A 1 91 ? -13.447 -13.834 0.809   1.00 6.57 ? 91  SER A CB   2  
ATOM 2866  O OG   . SER A 1 91 ? -14.430 -12.842 1.060   1.00 7.06 ? 91  SER A OG   2  
ATOM 2867  H H    . SER A 1 91 ? -14.339 -13.170 -1.481  1.00 4.66 ? 91  SER A H    2  
ATOM 2868  H HA   . SER A 1 91 ? -13.125 -15.529 -0.457  1.00 5.94 ? 91  SER A HA   2  
ATOM 2869  H HB2  . SER A 1 91 ? -13.239 -14.356 1.732   1.00 6.78 ? 91  SER A HB2  2  
ATOM 2870  H HB3  . SER A 1 91 ? -12.546 -13.351 0.459   1.00 6.97 ? 91  SER A HB3  2  
ATOM 2871  H HG   . SER A 1 91 ? -14.127 -12.261 1.760   1.00 7.36 ? 91  SER A HG   2  
ATOM 2872  N N    . HIS A 1 92 ? -16.326 -15.066 0.134   1.00 5.26 ? 92  HIS A N    2  
ATOM 2873  C CA   . HIS A 1 92 ? -17.549 -15.715 0.602   1.00 5.60 ? 92  HIS A CA   2  
ATOM 2874  C C    . HIS A 1 92 ? -17.952 -16.855 -0.328  1.00 5.37 ? 92  HIS A C    2  
ATOM 2875  O O    . HIS A 1 92 ? -17.570 -18.007 -0.118  1.00 5.46 ? 92  HIS A O    2  
ATOM 2876  C CB   . HIS A 1 92 ? -18.691 -14.699 0.702   1.00 5.86 ? 92  HIS A CB   2  
ATOM 2877  C CG   . HIS A 1 92 ? -18.444 -13.609 1.702   1.00 6.59 ? 92  HIS A CG   2  
ATOM 2878  N ND1  . HIS A 1 92 ? -17.692 -12.488 1.423   1.00 7.09 ? 92  HIS A ND1  2  
ATOM 2879  C CD2  . HIS A 1 92 ? -18.857 -13.473 2.984   1.00 7.14 ? 92  HIS A CD2  2  
ATOM 2880  C CE1  . HIS A 1 92 ? -17.653 -11.709 2.490   1.00 7.83 ? 92  HIS A CE1  2  
ATOM 2881  N NE2  . HIS A 1 92 ? -18.353 -12.284 3.450   1.00 7.84 ? 92  HIS A NE2  2  
ATOM 2882  H H    . HIS A 1 92 ? -16.391 -14.193 -0.311  1.00 4.89 ? 92  HIS A H    2  
ATOM 2883  H HA   . HIS A 1 92 ? -17.354 -16.120 1.585   1.00 6.24 ? 92  HIS A HA   2  
ATOM 2884  H HB2  . HIS A 1 92 ? -18.836 -14.235 -0.263  1.00 5.88 ? 92  HIS A HB2  2  
ATOM 2885  H HB3  . HIS A 1 92 ? -19.597 -15.213 0.988   1.00 5.88 ? 92  HIS A HB3  2  
ATOM 2886  H HD1  . HIS A 1 92 ? -17.252 -12.291 0.570   1.00 7.08 ? 92  HIS A HD1  2  
ATOM 2887  H HD2  . HIS A 1 92 ? -19.470 -14.171 3.538   1.00 7.21 ? 92  HIS A HD2  2  
ATOM 2888  H HE1  . HIS A 1 92 ? -17.137 -10.763 2.564   1.00 8.46 ? 92  HIS A HE1  2  
ATOM 2889  H HE2  . HIS A 1 92 ? -18.583 -11.867 4.306   1.00 8.38 ? 92  HIS A HE2  2  
ATOM 2890  N N    . ARG B 2 1  ? 2.597   -12.378 11.606  1.00 1.88 ? 301 ARG B N    2  
ATOM 2891  C CA   . ARG B 2 1  ? 2.352   -11.017 11.050  1.00 1.27 ? 301 ARG B CA   2  
ATOM 2892  C C    . ARG B 2 1  ? 3.450   -10.037 11.462  1.00 1.29 ? 301 ARG B C    2  
ATOM 2893  O O    . ARG B 2 1  ? 3.986   -10.115 12.570  1.00 2.06 ? 301 ARG B O    2  
ATOM 2894  C CB   . ARG B 2 1  ? 0.983   -10.517 11.532  1.00 1.61 ? 301 ARG B CB   2  
ATOM 2895  C CG   . ARG B 2 1  ? 0.766   -10.636 13.036  1.00 2.13 ? 301 ARG B CG   2  
ATOM 2896  C CD   . ARG B 2 1  ? -0.428  -11.522 13.357  1.00 2.72 ? 301 ARG B CD   2  
ATOM 2897  N NE   . ARG B 2 1  ? -1.696  -10.897 12.975  1.00 3.09 ? 301 ARG B NE   2  
ATOM 2898  C CZ   . ARG B 2 1  ? -2.399  -10.081 13.767  1.00 3.70 ? 301 ARG B CZ   2  
ATOM 2899  N NH1  . ARG B 2 1  ? -1.967  -9.781  14.990  1.00 4.18 ? 301 ARG B NH1  2  
ATOM 2900  N NH2  . ARG B 2 1  ? -3.542  -9.561  13.330  1.00 4.22 ? 301 ARG B NH2  2  
ATOM 2901  H H1   . ARG B 2 1  ? 3.372   -12.807 11.062  1.00 2.43 ? 301 ARG B H1   2  
ATOM 2902  H H2   . ARG B 2 1  ? 1.718   -12.927 11.502  1.00 1.96 ? 301 ARG B H2   2  
ATOM 2903  H H3   . ARG B 2 1  ? 2.858   -12.273 12.607  1.00 2.41 ? 301 ARG B H3   2  
ATOM 2904  H HA   . ARG B 2 1  ? 2.339   -11.091 9.974   1.00 1.25 ? 301 ARG B HA   2  
ATOM 2905  H HB2  . ARG B 2 1  ? 0.879   -9.478  11.260  1.00 1.79 ? 301 ARG B HB2  2  
ATOM 2906  H HB3  . ARG B 2 1  ? 0.213   -11.087 11.033  1.00 2.19 ? 301 ARG B HB3  2  
ATOM 2907  H HG2  . ARG B 2 1  ? 1.649   -11.062 13.488  1.00 2.63 ? 301 ARG B HG2  2  
ATOM 2908  H HG3  . ARG B 2 1  ? 0.591   -9.650  13.442  1.00 2.48 ? 301 ARG B HG3  2  
ATOM 2909  H HD2  . ARG B 2 1  ? -0.323  -12.452 12.818  1.00 3.13 ? 301 ARG B HD2  2  
ATOM 2910  H HD3  . ARG B 2 1  ? -0.438  -11.722 14.418  1.00 3.11 ? 301 ARG B HD3  2  
ATOM 2911  H HE   . ARG B 2 1  ? -2.043  -11.095 12.081  1.00 3.22 ? 301 ARG B HE   2  
ATOM 2912  H HH11 . ARG B 2 1  ? -1.108  -10.164 15.327  1.00 4.11 ? 301 ARG B HH11 2  
ATOM 2913  H HH12 . ARG B 2 1  ? -2.502  -9.170  15.573  1.00 4.83 ? 301 ARG B HH12 2  
ATOM 2914  H HH21 . ARG B 2 1  ? -3.873  -9.780  12.411  1.00 4.29 ? 301 ARG B HH21 2  
ATOM 2915  H HH22 . ARG B 2 1  ? -4.072  -8.950  13.919  1.00 4.75 ? 301 ARG B HH22 2  
ATOM 2916  N N    . ARG B 2 2  ? 3.779   -9.114  10.557  1.00 1.12 ? 302 ARG B N    2  
ATOM 2917  C CA   . ARG B 2 2  ? 4.811   -8.111  10.813  1.00 1.03 ? 302 ARG B CA   2  
ATOM 2918  C C    . ARG B 2 2  ? 4.481   -6.799  10.103  1.00 1.02 ? 302 ARG B C    2  
ATOM 2919  O O    . ARG B 2 2  ? 4.066   -6.797  8.942   1.00 1.45 ? 302 ARG B O    2  
ATOM 2920  C CB   . ARG B 2 2  ? 6.180   -8.623  10.353  1.00 1.13 ? 302 ARG B CB   2  
ATOM 2921  C CG   . ARG B 2 2  ? 7.321   -7.654  10.631  1.00 1.12 ? 302 ARG B CG   2  
ATOM 2922  C CD   . ARG B 2 2  ? 8.682   -8.310  10.437  1.00 1.50 ? 302 ARG B CD   2  
ATOM 2923  N NE   . ARG B 2 2  ? 9.034   -9.194  11.550  1.00 2.09 ? 302 ARG B NE   2  
ATOM 2924  C CZ   . ARG B 2 2  ? 10.260  -9.683  11.756  1.00 2.72 ? 302 ARG B CZ   2  
ATOM 2925  N NH1  . ARG B 2 2  ? 11.254  -9.387  10.923  1.00 2.99 ? 302 ARG B NH1  2  
ATOM 2926  N NH2  . ARG B 2 2  ? 10.492  -10.474 12.798  1.00 3.57 ? 302 ARG B NH2  2  
ATOM 2927  H H    . ARG B 2 2  ? 3.312   -9.104  9.696   1.00 1.61 ? 302 ARG B H    2  
ATOM 2928  H HA   . ARG B 2 2  ? 4.842   -7.933  11.877  1.00 1.03 ? 302 ARG B HA   2  
ATOM 2929  H HB2  . ARG B 2 2  ? 6.392   -9.552  10.862  1.00 1.20 ? 302 ARG B HB2  2  
ATOM 2930  H HB3  . ARG B 2 2  ? 6.141   -8.806  9.290   1.00 1.34 ? 302 ARG B HB3  2  
ATOM 2931  H HG2  . ARG B 2 2  ? 7.241   -6.817  9.954   1.00 1.33 ? 302 ARG B HG2  2  
ATOM 2932  H HG3  . ARG B 2 2  ? 7.243   -7.303  11.649  1.00 1.30 ? 302 ARG B HG3  2  
ATOM 2933  H HD2  . ARG B 2 2  ? 8.665   -8.886  9.524   1.00 1.82 ? 302 ARG B HD2  2  
ATOM 2934  H HD3  . ARG B 2 2  ? 9.429   -7.535  10.357  1.00 1.86 ? 302 ARG B HD3  2  
ATOM 2935  H HE   . ARG B 2 2  ? 8.321   -9.435  12.179  1.00 2.48 ? 302 ARG B HE   2  
ATOM 2936  H HH11 . ARG B 2 2  ? 11.090  -8.793  10.135  1.00 2.71 ? 302 ARG B HH11 2  
ATOM 2937  H HH12 . ARG B 2 2  ? 12.169  -9.757  11.085  1.00 3.75 ? 302 ARG B HH12 2  
ATOM 2938  H HH21 . ARG B 2 2  ? 9.750   -10.703 13.428  1.00 3.78 ? 302 ARG B HH21 2  
ATOM 2939  H HH22 . ARG B 2 2  ? 11.410  -10.842 12.953  1.00 4.18 ? 302 ARG B HH22 2  
ATOM 2940  N N    . GLU B 2 3  ? 4.665   -5.689  10.815  1.00 0.69 ? 303 GLU B N    2  
ATOM 2941  C CA   . GLU B 2 3  ? 4.386   -4.364  10.267  1.00 0.66 ? 303 GLU B CA   2  
ATOM 2942  C C    . GLU B 2 3  ? 5.650   -3.506  10.252  1.00 0.71 ? 303 GLU B C    2  
ATOM 2943  O O    . GLU B 2 3  ? 6.497   -3.619  11.141  1.00 1.16 ? 303 GLU B O    2  
ATOM 2944  C CB   . GLU B 2 3  ? 3.293   -3.673  11.088  1.00 0.71 ? 303 GLU B CB   2  
ATOM 2945  C CG   . GLU B 2 3  ? 1.994   -4.466  11.176  1.00 1.12 ? 303 GLU B CG   2  
ATOM 2946  C CD   . GLU B 2 3  ? 2.034   -5.559  12.230  1.00 1.54 ? 303 GLU B CD   2  
ATOM 2947  O OE1  . GLU B 2 3  ? 2.235   -5.231  13.419  1.00 2.08 ? 303 GLU B OE1  2  
ATOM 2948  O OE2  . GLU B 2 3  ? 1.863   -6.741  11.866  1.00 1.99 ? 303 GLU B OE2  2  
ATOM 2949  H H    . GLU B 2 3  ? 4.996   -5.762  11.735  1.00 0.73 ? 303 GLU B H    2  
ATOM 2950  H HA   . GLU B 2 3  ? 4.040   -4.490  9.251   1.00 0.62 ? 303 GLU B HA   2  
ATOM 2951  H HB2  . GLU B 2 3  ? 3.661   -3.514  12.090  1.00 1.19 ? 303 GLU B HB2  2  
ATOM 2952  H HB3  . GLU B 2 3  ? 3.074   -2.716  10.639  1.00 0.81 ? 303 GLU B HB3  2  
ATOM 2953  H HG2  . GLU B 2 3  ? 1.190   -3.788  11.419  1.00 1.28 ? 303 GLU B HG2  2  
ATOM 2954  H HG3  . GLU B 2 3  ? 1.801   -4.922  10.216  1.00 1.65 ? 303 GLU B HG3  2  
ATOM 2955  N N    . THR B 2 4  ? 5.773   -2.652  9.236   1.00 0.55 ? 304 THR B N    2  
ATOM 2956  C CA   . THR B 2 4  ? 6.937   -1.777  9.106   1.00 0.55 ? 304 THR B CA   2  
ATOM 2957  C C    . THR B 2 4  ? 6.573   -0.479  8.383   1.00 0.53 ? 304 THR B C    2  
ATOM 2958  O O    . THR B 2 4  ? 5.729   -0.472  7.485   1.00 0.54 ? 304 THR B O    2  
ATOM 2959  C CB   . THR B 2 4  ? 8.065   -2.515  8.369   1.00 0.55 ? 304 THR B CB   2  
ATOM 2960  O OG1  . THR B 2 4  ? 9.005   -3.042  9.289   1.00 0.65 ? 304 THR B OG1  2  
ATOM 2961  C CG2  . THR B 2 4  ? 8.827   -1.656  7.381   1.00 0.56 ? 304 THR B CG2  2  
ATOM 2962  H H    . THR B 2 4  ? 5.067   -2.609  8.557   1.00 0.76 ? 304 THR B H    2  
ATOM 2963  H HA   . THR B 2 4  ? 7.273   -1.534  10.101  1.00 0.59 ? 304 THR B HA   2  
ATOM 2964  H HB   . THR B 2 4  ? 7.636   -3.338  7.820   1.00 0.56 ? 304 THR B HB   2  
ATOM 2965  H HG1  . THR B 2 4  ? 9.330   -2.340  9.859   1.00 0.96 ? 304 THR B HG1  2  
ATOM 2966  H HG21 . THR B 2 4  ? 9.641   -2.228  6.960   1.00 1.05 ? 304 THR B HG21 2  
ATOM 2967  H HG22 . THR B 2 4  ? 9.219   -0.786  7.885   1.00 1.13 ? 304 THR B HG22 2  
ATOM 2968  H HG23 . THR B 2 4  ? 8.160   -1.346  6.590   1.00 1.23 ? 304 THR B HG23 2  
ATOM 2969  N N    . GLN B 2 5  ? 7.223   0.616   8.781   1.00 0.58 ? 305 GLN B N    2  
ATOM 2970  C CA   . GLN B 2 5  ? 6.974   1.921   8.173   1.00 0.60 ? 305 GLN B CA   2  
ATOM 2971  C C    . GLN B 2 5  ? 7.669   2.044   6.821   1.00 0.58 ? 305 GLN B C    2  
ATOM 2972  O O    . GLN B 2 5  ? 8.662   1.365   6.553   1.00 0.74 ? 305 GLN B O    2  
ATOM 2973  C CB   . GLN B 2 5  ? 7.434   3.047   9.101   1.00 0.76 ? 305 GLN B CB   2  
ATOM 2974  C CG   . GLN B 2 5  ? 6.318   3.611   9.966   1.00 0.89 ? 305 GLN B CG   2  
ATOM 2975  C CD   . GLN B 2 5  ? 6.838   4.459   11.111  1.00 1.13 ? 305 GLN B CD   2  
ATOM 2976  O OE1  . GLN B 2 5  ? 7.209   5.618   10.921  1.00 1.67 ? 305 GLN B OE1  2  
ATOM 2977  N NE2  . GLN B 2 5  ? 6.866   3.886   12.311  1.00 1.50 ? 305 GLN B NE2  2  
ATOM 2978  H H    . GLN B 2 5  ? 7.887   0.543   9.499   1.00 0.64 ? 305 GLN B H    2  
ATOM 2979  H HA   . GLN B 2 5  ? 5.912   2.013   8.018   1.00 0.57 ? 305 GLN B HA   2  
ATOM 2980  H HB2  . GLN B 2 5  ? 8.211   2.670   9.750   1.00 0.76 ? 305 GLN B HB2  2  
ATOM 2981  H HB3  . GLN B 2 5  ? 7.835   3.850   8.500   1.00 0.88 ? 305 GLN B HB3  2  
ATOM 2982  H HG2  . GLN B 2 5  ? 5.677   4.222   9.348   1.00 0.96 ? 305 GLN B HG2  2  
ATOM 2983  H HG3  . GLN B 2 5  ? 5.748   2.790   10.374  1.00 0.87 ? 305 GLN B HG3  2  
ATOM 2984  H HE21 . GLN B 2 5  ? 6.555   2.960   12.390  1.00 1.97 ? 305 GLN B HE21 2  
ATOM 2985  H HE22 . GLN B 2 5  ? 7.196   4.414   13.066  1.00 1.62 ? 305 GLN B HE22 2  
ATOM 2986  N N    . VAL B 2 6  ? 7.130   2.915   5.971   1.00 0.58 ? 306 VAL B N    2  
ATOM 2987  C CA   . VAL B 2 6  ? 7.678   3.135   4.636   1.00 0.63 ? 306 VAL B CA   2  
ATOM 2988  C C    . VAL B 2 6  ? 7.583   4.606   4.219   1.00 0.77 ? 306 VAL B C    2  
ATOM 2989  O O    . VAL B 2 6  ? 6.797   5.354   4.843   1.00 1.47 ? 306 VAL B O    2  
ATOM 2990  C CB   . VAL B 2 6  ? 6.953   2.262   3.591   1.00 0.54 ? 306 VAL B CB   2  
ATOM 2991  C CG1  . VAL B 2 6  ? 7.384   0.809   3.719   1.00 0.51 ? 306 VAL B CG1  2  
ATOM 2992  C CG2  . VAL B 2 6  ? 5.441   2.389   3.737   1.00 0.49 ? 306 VAL B CG2  2  
ATOM 2993  O OXT  . VAL B 2 6  ? 8.297   4.998   3.273   1.00 1.14 ? 306 VAL B OXT  2  
ATOM 2994  H H    . VAL B 2 6  ? 6.335   3.420   6.247   1.00 0.70 ? 306 VAL B H    2  
ATOM 2995  H HA   . VAL B 2 6  ? 8.719   2.845   4.651   1.00 0.71 ? 306 VAL B HA   2  
ATOM 2996  H HB   . VAL B 2 6  ? 7.228   2.609   2.605   1.00 0.63 ? 306 VAL B HB   2  
ATOM 2997  H HG11 . VAL B 2 6  ? 6.918   0.227   2.940   1.00 1.08 ? 306 VAL B HG11 2  
ATOM 2998  H HG12 . VAL B 2 6  ? 7.083   0.425   4.684   1.00 1.13 ? 306 VAL B HG12 2  
ATOM 2999  H HG13 . VAL B 2 6  ? 8.457   0.743   3.625   1.00 1.04 ? 306 VAL B HG13 2  
ATOM 3000  H HG21 . VAL B 2 6  ? 5.111   1.805   4.584   1.00 1.09 ? 306 VAL B HG21 2  
ATOM 3001  H HG22 . VAL B 2 6  ? 4.960   2.028   2.841   1.00 1.15 ? 306 VAL B HG22 2  
ATOM 3002  H HG23 . VAL B 2 6  ? 5.182   3.426   3.893   1.00 1.15 ? 306 VAL B HG23 2  
ATOM 3003  N N    . MET A 1 1  ? -9.635  3.268   -9.752  1.00 1.83 ? 1   MET A N    3  
ATOM 3004  C CA   . MET A 1 1  ? -9.107  3.527   -8.384  1.00 1.38 ? 1   MET A CA   3  
ATOM 3005  C C    . MET A 1 1  ? -7.580  3.471   -8.364  1.00 1.20 ? 1   MET A C    3  
ATOM 3006  O O    . MET A 1 1  ? -6.989  2.404   -8.179  1.00 1.07 ? 1   MET A O    3  
ATOM 3007  C CB   . MET A 1 1  ? -9.694  2.485   -7.423  1.00 1.81 ? 1   MET A CB   3  
ATOM 3008  C CG   . MET A 1 1  ? -10.706 3.059   -6.445  1.00 2.04 ? 1   MET A CG   3  
ATOM 3009  S SD   . MET A 1 1  ? -11.023 1.959   -5.051  1.00 2.69 ? 1   MET A SD   3  
ATOM 3010  C CE   . MET A 1 1  ? -12.292 2.875   -4.179  1.00 3.17 ? 1   MET A CE   3  
ATOM 3011  H H1   . MET A 1 1  ? -9.326  2.317   -10.038 1.00 2.20 ? 1   MET A H1   3  
ATOM 3012  H H2   . MET A 1 1  ? -9.245  3.996   -10.385 1.00 2.22 ? 1   MET A H2   3  
ATOM 3013  H H3   . MET A 1 1  ? -10.673 3.325   -9.708  1.00 1.92 ? 1   MET A H3   3  
ATOM 3014  H HA   . MET A 1 1  ? -9.426  4.512   -8.077  1.00 1.47 ? 1   MET A HA   3  
ATOM 3015  H HB2  . MET A 1 1  ? -10.182 1.714   -8.001  1.00 2.32 ? 1   MET A HB2  3  
ATOM 3016  H HB3  . MET A 1 1  ? -8.890  2.040   -6.856  1.00 2.16 ? 1   MET A HB3  3  
ATOM 3017  H HG2  . MET A 1 1  ? -10.329 3.996   -6.065  1.00 2.47 ? 1   MET A HG2  3  
ATOM 3018  H HG3  . MET A 1 1  ? -11.634 3.231   -6.968  1.00 2.24 ? 1   MET A HG3  3  
ATOM 3019  H HE1  . MET A 1 1  ? -12.106 3.935   -4.282  1.00 3.35 ? 1   MET A HE1  3  
ATOM 3020  H HE2  . MET A 1 1  ? -12.275 2.607   -3.133  1.00 3.35 ? 1   MET A HE2  3  
ATOM 3021  H HE3  . MET A 1 1  ? -13.258 2.637   -4.596  1.00 3.67 ? 1   MET A HE3  3  
ATOM 3022  N N    . GLU A 1 2  ? -6.946  4.628   -8.560  1.00 1.25 ? 2   GLU A N    3  
ATOM 3023  C CA   . GLU A 1 2  ? -5.489  4.712   -8.568  1.00 1.15 ? 2   GLU A CA   3  
ATOM 3024  C C    . GLU A 1 2  ? -4.992  5.856   -7.685  1.00 1.12 ? 2   GLU A C    3  
ATOM 3025  O O    . GLU A 1 2  ? -5.431  7.001   -7.818  1.00 1.17 ? 2   GLU A O    3  
ATOM 3026  C CB   . GLU A 1 2  ? -4.962  4.881   -9.997  1.00 1.22 ? 2   GLU A CB   3  
ATOM 3027  C CG   . GLU A 1 2  ? -5.688  5.948   -10.801 1.00 1.74 ? 2   GLU A CG   3  
ATOM 3028  C CD   . GLU A 1 2  ? -6.667  5.361   -11.800 1.00 1.63 ? 2   GLU A CD   3  
ATOM 3029  O OE1  . GLU A 1 2  ? -6.230  4.977   -12.905 1.00 1.97 ? 2   GLU A OE1  3  
ATOM 3030  O OE2  . GLU A 1 2  ? -7.872  5.287   -11.478 1.00 1.88 ? 2   GLU A OE2  3  
ATOM 3031  H H    . GLU A 1 2  ? -7.473  5.443   -8.706  1.00 1.40 ? 2   GLU A H    3  
ATOM 3032  H HA   . GLU A 1 2  ? -5.106  3.783   -8.167  1.00 1.06 ? 2   GLU A HA   3  
ATOM 3033  H HB2  . GLU A 1 2  ? -3.915  5.146   -9.954  1.00 1.76 ? 2   GLU A HB2  3  
ATOM 3034  H HB3  . GLU A 1 2  ? -5.062  3.940   -10.517 1.00 1.34 ? 2   GLU A HB3  3  
ATOM 3035  H HG2  . GLU A 1 2  ? -6.231  6.584   -10.119 1.00 2.14 ? 2   GLU A HG2  3  
ATOM 3036  H HG3  . GLU A 1 2  ? -4.958  6.537   -11.337 1.00 2.47 ? 2   GLU A HG3  3  
ATOM 3037  N N    . ILE A 1 3  ? -4.081  5.521   -6.776  1.00 1.09 ? 3   ILE A N    3  
ATOM 3038  C CA   . ILE A 1 3  ? -3.518  6.498   -5.850  1.00 1.10 ? 3   ILE A CA   3  
ATOM 3039  C C    . ILE A 1 3  ? -2.184  7.027   -6.366  1.00 1.02 ? 3   ILE A C    3  
ATOM 3040  O O    . ILE A 1 3  ? -1.154  6.358   -6.256  1.00 1.07 ? 3   ILE A O    3  
ATOM 3041  C CB   . ILE A 1 3  ? -3.314  5.891   -4.443  1.00 1.18 ? 3   ILE A CB   3  
ATOM 3042  C CG1  . ILE A 1 3  ? -4.602  5.229   -3.946  1.00 1.34 ? 3   ILE A CG1  3  
ATOM 3043  C CG2  . ILE A 1 3  ? -2.851  6.960   -3.465  1.00 1.22 ? 3   ILE A CG2  3  
ATOM 3044  C CD1  . ILE A 1 3  ? -4.417  3.788   -3.523  1.00 1.10 ? 3   ILE A CD1  3  
ATOM 3045  H H    . ILE A 1 3  ? -3.807  4.582   -6.729  1.00 1.08 ? 3   ILE A H    3  
ATOM 3046  H HA   . ILE A 1 3  ? -4.214  7.321   -5.767  1.00 1.15 ? 3   ILE A HA   3  
ATOM 3047  H HB   . ILE A 1 3  ? -2.537  5.143   -4.510  1.00 1.17 ? 3   ILE A HB   3  
ATOM 3048  H HG12 . ILE A 1 3  ? -4.975  5.778   -3.093  1.00 1.83 ? 3   ILE A HG12 3  
ATOM 3049  H HG13 . ILE A 1 3  ? -5.341  5.253   -4.734  1.00 1.86 ? 3   ILE A HG13 3  
ATOM 3050  H HG21 . ILE A 1 3  ? -2.993  6.610   -2.454  1.00 1.72 ? 3   ILE A HG21 3  
ATOM 3051  H HG22 . ILE A 1 3  ? -3.425  7.861   -3.620  1.00 1.51 ? 3   ILE A HG22 3  
ATOM 3052  H HG23 . ILE A 1 3  ? -1.804  7.167   -3.630  1.00 1.55 ? 3   ILE A HG23 3  
ATOM 3053  H HD11 . ILE A 1 3  ? -5.217  3.503   -2.856  1.00 1.47 ? 3   ILE A HD11 3  
ATOM 3054  H HD12 . ILE A 1 3  ? -3.469  3.680   -3.016  1.00 1.61 ? 3   ILE A HD12 3  
ATOM 3055  H HD13 . ILE A 1 3  ? -4.432  3.153   -4.397  1.00 1.54 ? 3   ILE A HD13 3  
ATOM 3056  N N    . LYS A 1 4  ? -2.210  8.238   -6.933  1.00 0.98 ? 4   LYS A N    3  
ATOM 3057  C CA   . LYS A 1 4  ? -1.001  8.856   -7.464  1.00 0.96 ? 4   LYS A CA   3  
ATOM 3058  C C    . LYS A 1 4  ? -0.459  9.903   -6.491  1.00 0.96 ? 4   LYS A C    3  
ATOM 3059  O O    . LYS A 1 4  ? -0.858  11.070  -6.516  1.00 1.08 ? 4   LYS A O    3  
ATOM 3060  C CB   . LYS A 1 4  ? -1.283  9.488   -8.832  1.00 1.07 ? 4   LYS A CB   3  
ATOM 3061  C CG   . LYS A 1 4  ? -0.384  8.964   -9.941  1.00 1.35 ? 4   LYS A CG   3  
ATOM 3062  C CD   . LYS A 1 4  ? -0.345  9.917   -11.126 1.00 1.59 ? 4   LYS A CD   3  
ATOM 3063  C CE   . LYS A 1 4  ? -1.501  9.668   -12.084 1.00 2.29 ? 4   LYS A CE   3  
ATOM 3064  N NZ   . LYS A 1 4  ? -2.273  10.912  -12.363 1.00 2.93 ? 4   LYS A NZ   3  
ATOM 3065  H H    . LYS A 1 4  ? -3.059  8.725   -6.991  1.00 1.01 ? 4   LYS A H    3  
ATOM 3066  H HA   . LYS A 1 4  ? -0.258  8.080   -7.584  1.00 0.96 ? 4   LYS A HA   3  
ATOM 3067  H HB2  . LYS A 1 4  ? -2.309  9.285   -9.105  1.00 1.56 ? 4   LYS A HB2  3  
ATOM 3068  H HB3  . LYS A 1 4  ? -1.145  10.556  -8.760  1.00 1.61 ? 4   LYS A HB3  3  
ATOM 3069  H HG2  . LYS A 1 4  ? 0.617   8.846   -9.555  1.00 1.93 ? 4   LYS A HG2  3  
ATOM 3070  H HG3  . LYS A 1 4  ? -0.760  8.007   -10.274 1.00 1.87 ? 4   LYS A HG3  3  
ATOM 3071  H HD2  . LYS A 1 4  ? -0.406  10.931  -10.761 1.00 1.98 ? 4   LYS A HD2  3  
ATOM 3072  H HD3  . LYS A 1 4  ? 0.585   9.779   -11.656 1.00 1.90 ? 4   LYS A HD3  3  
ATOM 3073  H HE2  . LYS A 1 4  ? -1.105  9.286   -13.013 1.00 2.72 ? 4   LYS A HE2  3  
ATOM 3074  H HE3  . LYS A 1 4  ? -2.163  8.934   -11.648 1.00 2.70 ? 4   LYS A HE3  3  
ATOM 3075  H HZ1  . LYS A 1 4  ? -1.654  11.626  -12.799 1.00 3.17 ? 4   LYS A HZ1  3  
ATOM 3076  H HZ2  . LYS A 1 4  ? -2.662  11.297  -11.478 1.00 3.54 ? 4   LYS A HZ2  3  
ATOM 3077  H HZ3  . LYS A 1 4  ? -3.058  10.707  -13.013 1.00 3.06 ? 4   LYS A HZ3  3  
ATOM 3078  N N    . LEU A 1 5  ? 0.430   9.450   -5.615  1.00 0.89 ? 5   LEU A N    3  
ATOM 3079  C CA   . LEU A 1 5  ? 1.022   10.313  -4.595  1.00 0.97 ? 5   LEU A CA   3  
ATOM 3080  C C    . LEU A 1 5  ? 2.294   10.992  -5.102  1.00 0.88 ? 5   LEU A C    3  
ATOM 3081  O O    . LEU A 1 5  ? 3.172   10.347  -5.676  1.00 0.82 ? 5   LEU A O    3  
ATOM 3082  C CB   . LEU A 1 5  ? 1.317   9.505   -3.326  1.00 1.11 ? 5   LEU A CB   3  
ATOM 3083  C CG   . LEU A 1 5  ? 0.235   9.569   -2.239  1.00 1.42 ? 5   LEU A CG   3  
ATOM 3084  C CD1  . LEU A 1 5  ? -1.155  9.683   -2.854  1.00 1.50 ? 5   LEU A CD1  3  
ATOM 3085  C CD2  . LEU A 1 5  ? 0.317   8.347   -1.336  1.00 2.09 ? 5   LEU A CD2  3  
ATOM 3086  H H    . LEU A 1 5  ? 0.642   8.492   -5.644  1.00 0.85 ? 5   LEU A H    3  
ATOM 3087  H HA   . LEU A 1 5  ? 0.299   11.078  -4.358  1.00 1.10 ? 5   LEU A HA   3  
ATOM 3088  H HB2  . LEU A 1 5  ? 1.452   8.471   -3.608  1.00 1.26 ? 5   LEU A HB2  3  
ATOM 3089  H HB3  . LEU A 1 5  ? 2.241   9.867   -2.901  1.00 1.25 ? 5   LEU A HB3  3  
ATOM 3090  H HG   . LEU A 1 5  ? 0.399   10.446  -1.631  1.00 1.86 ? 5   LEU A HG   3  
ATOM 3091  H HD11 . LEU A 1 5  ? -1.896  9.390   -2.127  1.00 1.87 ? 5   LEU A HD11 3  
ATOM 3092  H HD12 . LEU A 1 5  ? -1.221  9.037   -3.718  1.00 2.01 ? 5   LEU A HD12 3  
ATOM 3093  H HD13 . LEU A 1 5  ? -1.331  10.705  -3.156  1.00 1.76 ? 5   LEU A HD13 3  
ATOM 3094  H HD21 . LEU A 1 5  ? 0.017   7.469   -1.889  1.00 2.37 ? 5   LEU A HD21 3  
ATOM 3095  H HD22 . LEU A 1 5  ? -0.339  8.481   -0.488  1.00 2.53 ? 5   LEU A HD22 3  
ATOM 3096  H HD23 . LEU A 1 5  ? 1.333   8.224   -0.988  1.00 2.63 ? 5   LEU A HD23 3  
ATOM 3097  N N    . ILE A 1 6  ? 2.374   12.309  -4.887  1.00 0.95 ? 6   ILE A N    3  
ATOM 3098  C CA   . ILE A 1 6  ? 3.526   13.095  -5.322  1.00 0.90 ? 6   ILE A CA   3  
ATOM 3099  C C    . ILE A 1 6  ? 4.605   13.127  -4.237  1.00 0.93 ? 6   ILE A C    3  
ATOM 3100  O O    . ILE A 1 6  ? 4.341   13.503  -3.094  1.00 1.06 ? 6   ILE A O    3  
ATOM 3101  C CB   . ILE A 1 6  ? 3.126   14.545  -5.688  1.00 1.04 ? 6   ILE A CB   3  
ATOM 3102  C CG1  . ILE A 1 6  ? 4.317   15.284  -6.309  1.00 1.29 ? 6   ILE A CG1  3  
ATOM 3103  C CG2  . ILE A 1 6  ? 2.610   15.293  -4.464  1.00 1.21 ? 6   ILE A CG2  3  
ATOM 3104  C CD1  . ILE A 1 6  ? 3.988   16.686  -6.778  1.00 1.94 ? 6   ILE A CD1  3  
ATOM 3105  H H    . ILE A 1 6  ? 1.630   12.760  -4.436  1.00 1.06 ? 6   ILE A H    3  
ATOM 3106  H HA   . ILE A 1 6  ? 3.928   12.625  -6.210  1.00 0.86 ? 6   ILE A HA   3  
ATOM 3107  H HB   . ILE A 1 6  ? 2.327   14.500  -6.412  1.00 1.27 ? 6   ILE A HB   3  
ATOM 3108  H HG12 . ILE A 1 6  ? 5.108   15.358  -5.578  1.00 1.47 ? 6   ILE A HG12 3  
ATOM 3109  H HG13 . ILE A 1 6  ? 4.675   14.725  -7.162  1.00 1.34 ? 6   ILE A HG13 3  
ATOM 3110  H HG21 . ILE A 1 6  ? 3.447   15.640  -3.876  1.00 1.62 ? 6   ILE A HG21 3  
ATOM 3111  H HG22 . ILE A 1 6  ? 2.001   14.631  -3.867  1.00 1.62 ? 6   ILE A HG22 3  
ATOM 3112  H HG23 . ILE A 1 6  ? 2.018   16.138  -4.782  1.00 1.45 ? 6   ILE A HG23 3  
ATOM 3113  H HD11 . ILE A 1 6  ? 4.234   17.392  -5.998  1.00 2.44 ? 6   ILE A HD11 3  
ATOM 3114  H HD12 . ILE A 1 6  ? 2.935   16.753  -7.006  1.00 2.21 ? 6   ILE A HD12 3  
ATOM 3115  H HD13 . ILE A 1 6  ? 4.564   16.914  -7.663  1.00 2.30 ? 6   ILE A HD13 3  
ATOM 3116  N N    . LYS A 1 7  ? 5.817   12.710  -4.604  1.00 0.91 ? 7   LYS A N    3  
ATOM 3117  C CA   . LYS A 1 7  ? 6.941   12.673  -3.667  1.00 1.06 ? 7   LYS A CA   3  
ATOM 3118  C C    . LYS A 1 7  ? 7.287   14.068  -3.144  1.00 1.18 ? 7   LYS A C    3  
ATOM 3119  O O    . LYS A 1 7  ? 7.710   14.942  -3.906  1.00 1.29 ? 7   LYS A O    3  
ATOM 3120  C CB   . LYS A 1 7  ? 8.170   12.045  -4.331  1.00 1.26 ? 7   LYS A CB   3  
ATOM 3121  C CG   . LYS A 1 7  ? 9.354   11.868  -3.390  1.00 1.78 ? 7   LYS A CG   3  
ATOM 3122  C CD   . LYS A 1 7  ? 9.177   10.657  -2.486  1.00 2.30 ? 7   LYS A CD   3  
ATOM 3123  C CE   . LYS A 1 7  ? 9.524   10.982  -1.039  1.00 2.50 ? 7   LYS A CE   3  
ATOM 3124  N NZ   . LYS A 1 7  ? 10.994  11.128  -0.837  1.00 3.10 ? 7   LYS A NZ   3  
ATOM 3125  H H    . LYS A 1 7  ? 5.956   12.407  -5.525  1.00 0.88 ? 7   LYS A H    3  
ATOM 3126  H HA   . LYS A 1 7  ? 6.648   12.056  -2.832  1.00 1.12 ? 7   LYS A HA   3  
ATOM 3127  H HB2  . LYS A 1 7  ? 7.899   11.075  -4.720  1.00 1.17 ? 7   LYS A HB2  3  
ATOM 3128  H HB3  . LYS A 1 7  ? 8.482   12.675  -5.150  1.00 1.45 ? 7   LYS A HB3  3  
ATOM 3129  H HG2  . LYS A 1 7  ? 10.251  11.736  -3.976  1.00 2.05 ? 7   LYS A HG2  3  
ATOM 3130  H HG3  . LYS A 1 7  ? 9.450   12.753  -2.778  1.00 2.37 ? 7   LYS A HG3  3  
ATOM 3131  H HD2  . LYS A 1 7  ? 8.148   10.331  -2.531  1.00 2.80 ? 7   LYS A HD2  3  
ATOM 3132  H HD3  . LYS A 1 7  ? 9.823   9.864   -2.832  1.00 2.70 ? 7   LYS A HD3  3  
ATOM 3133  H HE2  . LYS A 1 7  ? 9.040   11.907  -0.765  1.00 3.04 ? 7   LYS A HE2  3  
ATOM 3134  H HE3  . LYS A 1 7  ? 9.160   10.185  -0.408  1.00 2.26 ? 7   LYS A HE3  3  
ATOM 3135  H HZ1  . LYS A 1 7  ? 11.484  10.261  -1.136  1.00 3.61 ? 7   LYS A HZ1  3  
ATOM 3136  H HZ2  . LYS A 1 7  ? 11.200  11.300  0.168   1.00 3.37 ? 7   LYS A HZ2  3  
ATOM 3137  H HZ3  . LYS A 1 7  ? 11.355  11.927  -1.394  1.00 3.30 ? 7   LYS A HZ3  3  
ATOM 3138  N N    . GLY A 1 8  ? 7.107   14.261  -1.836  1.00 1.38 ? 8   GLY A N    3  
ATOM 3139  C CA   . GLY A 1 8  ? 7.406   15.542  -1.214  1.00 1.62 ? 8   GLY A CA   3  
ATOM 3140  C C    . GLY A 1 8  ? 8.474   15.429  -0.139  1.00 1.78 ? 8   GLY A C    3  
ATOM 3141  O O    . GLY A 1 8  ? 9.207   14.439  -0.092  1.00 1.78 ? 8   GLY A O    3  
ATOM 3142  H H    . GLY A 1 8  ? 6.769   13.521  -1.289  1.00 1.48 ? 8   GLY A H    3  
ATOM 3143  H HA2  . GLY A 1 8  ? 7.747   16.229  -1.975  1.00 1.65 ? 8   GLY A HA2  3  
ATOM 3144  H HA3  . GLY A 1 8  ? 6.502   15.932  -0.770  1.00 1.79 ? 8   GLY A HA3  3  
ATOM 3145  N N    . PRO A 1 9  ? 8.587   16.437  0.751   1.00 2.05 ? 9   PRO A N    3  
ATOM 3146  C CA   . PRO A 1 9  ? 9.581   16.438  1.836   1.00 2.32 ? 9   PRO A CA   3  
ATOM 3147  C C    . PRO A 1 9  ? 9.393   15.262  2.797   1.00 2.37 ? 9   PRO A C    3  
ATOM 3148  O O    . PRO A 1 9  ? 10.368  14.669  3.262   1.00 2.77 ? 9   PRO A O    3  
ATOM 3149  C CB   . PRO A 1 9  ? 9.334   17.767  2.561   1.00 2.68 ? 9   PRO A CB   3  
ATOM 3150  C CG   . PRO A 1 9  ? 8.575   18.606  1.591   1.00 2.59 ? 9   PRO A CG   3  
ATOM 3151  C CD   . PRO A 1 9  ? 7.757   17.652  0.771   1.00 2.24 ? 9   PRO A CD   3  
ATOM 3152  H HA   . PRO A 1 9  ? 10.588  16.420  1.446   1.00 2.37 ? 9   PRO A HA   3  
ATOM 3153  H HB2  . PRO A 1 9  ? 8.762   17.587  3.461   1.00 2.85 ? 9   PRO A HB2  3  
ATOM 3154  H HB3  . PRO A 1 9  ? 10.281  18.220  2.817   1.00 2.89 ? 9   PRO A HB3  3  
ATOM 3155  H HG2  . PRO A 1 9  ? 7.931   19.290  2.124   1.00 2.84 ? 9   PRO A HG2  3  
ATOM 3156  H HG3  . PRO A 1 9  ? 9.261   19.150  0.961   1.00 2.61 ? 9   PRO A HG3  3  
ATOM 3157  H HD2  . PRO A 1 9  ? 6.804   17.464  1.246   1.00 2.35 ? 9   PRO A HD2  3  
ATOM 3158  H HD3  . PRO A 1 9  ? 7.613   18.039  -0.227  1.00 2.14 ? 9   PRO A HD3  3  
ATOM 3159  N N    . LYS A 1 10 ? 8.134   14.930  3.080   1.00 2.38 ? 10  LYS A N    3  
ATOM 3160  C CA   . LYS A 1 10 ? 7.810   13.822  3.975   1.00 2.57 ? 10  LYS A CA   3  
ATOM 3161  C C    . LYS A 1 10 ? 7.698   12.515  3.194   1.00 2.26 ? 10  LYS A C    3  
ATOM 3162  O O    . LYS A 1 10 ? 8.426   11.558  3.462   1.00 2.45 ? 10  LYS A O    3  
ATOM 3163  C CB   . LYS A 1 10 ? 6.504   14.099  4.726   1.00 2.99 ? 10  LYS A CB   3  
ATOM 3164  C CG   . LYS A 1 10 ? 6.593   15.265  5.699   1.00 3.71 ? 10  LYS A CG   3  
ATOM 3165  C CD   . LYS A 1 10 ? 5.262   15.992  5.822   1.00 4.04 ? 10  LYS A CD   3  
ATOM 3166  C CE   . LYS A 1 10 ? 4.951   16.811  4.577   1.00 4.40 ? 10  LYS A CE   3  
ATOM 3167  N NZ   . LYS A 1 10 ? 5.820   18.018  4.467   1.00 4.92 ? 10  LYS A NZ   3  
ATOM 3168  H H    . LYS A 1 10 ? 7.406   15.441  2.667   1.00 2.55 ? 10  LYS A H    3  
ATOM 3169  H HA   . LYS A 1 10 ? 8.614   13.730  4.691   1.00 2.82 ? 10  LYS A HA   3  
ATOM 3170  H HB2  . LYS A 1 10 ? 5.728   14.316  4.007   1.00 3.13 ? 10  LYS A HB2  3  
ATOM 3171  H HB3  . LYS A 1 10 ? 6.229   13.215  5.283   1.00 2.88 ? 10  LYS A HB3  3  
ATOM 3172  H HG2  . LYS A 1 10 ? 6.876   14.890  6.671   1.00 3.97 ? 10  LYS A HG2  3  
ATOM 3173  H HG3  . LYS A 1 10 ? 7.342   15.961  5.348   1.00 4.13 ? 10  LYS A HG3  3  
ATOM 3174  H HD2  . LYS A 1 10 ? 4.478   15.264  5.966   1.00 4.48 ? 10  LYS A HD2  3  
ATOM 3175  H HD3  . LYS A 1 10 ? 5.302   16.653  6.676   1.00 4.00 ? 10  LYS A HD3  3  
ATOM 3176  H HE2  . LYS A 1 10 ? 5.102   16.191  3.706   1.00 4.59 ? 10  LYS A HE2  3  
ATOM 3177  H HE3  . LYS A 1 10 ? 3.918   17.126  4.619   1.00 4.53 ? 10  LYS A HE3  3  
ATOM 3178  H HZ1  . LYS A 1 10 ? 6.805   17.734  4.289   1.00 5.28 ? 10  LYS A HZ1  3  
ATOM 3179  H HZ2  . LYS A 1 10 ? 5.782   18.568  5.349   1.00 5.13 ? 10  LYS A HZ2  3  
ATOM 3180  H HZ3  . LYS A 1 10 ? 5.499   18.620  3.683   1.00 5.08 ? 10  LYS A HZ3  3  
ATOM 3181  N N    . GLY A 1 11 ? 6.775   12.483  2.231   1.00 2.10 ? 11  GLY A N    3  
ATOM 3182  C CA   . GLY A 1 11 ? 6.571   11.292  1.425   1.00 2.10 ? 11  GLY A CA   3  
ATOM 3183  C C    . GLY A 1 11 ? 5.377   10.483  1.896   1.00 2.08 ? 11  GLY A C    3  
ATOM 3184  O O    . GLY A 1 11 ? 4.437   11.041  2.465   1.00 2.30 ? 11  GLY A O    3  
ATOM 3185  H H    . GLY A 1 11 ? 6.223   13.277  2.070   1.00 2.22 ? 11  GLY A H    3  
ATOM 3186  H HA2  . GLY A 1 11 ? 6.411   11.586  0.399   1.00 2.53 ? 11  GLY A HA2  3  
ATOM 3187  H HA3  . GLY A 1 11 ? 7.455   10.674  1.480   1.00 2.21 ? 11  GLY A HA3  3  
ATOM 3188  N N    . LEU A 1 12 ? 5.417   9.169   1.649   1.00 2.47 ? 12  LEU A N    3  
ATOM 3189  C CA   . LEU A 1 12 ? 4.332   8.258   2.039   1.00 2.77 ? 12  LEU A CA   3  
ATOM 3190  C C    . LEU A 1 12 ? 3.712   8.663   3.380   1.00 1.92 ? 12  LEU A C    3  
ATOM 3191  O O    . LEU A 1 12 ? 2.529   8.996   3.448   1.00 2.52 ? 12  LEU A O    3  
ATOM 3192  C CB   . LEU A 1 12 ? 4.859   6.819   2.123   1.00 3.62 ? 12  LEU A CB   3  
ATOM 3193  C CG   . LEU A 1 12 ? 5.189   6.155   0.780   1.00 4.87 ? 12  LEU A CG   3  
ATOM 3194  C CD1  . LEU A 1 12 ? 6.581   6.553   0.306   1.00 5.33 ? 12  LEU A CD1  3  
ATOM 3195  C CD2  . LEU A 1 12 ? 5.082   4.643   0.895   1.00 5.70 ? 12  LEU A CD2  3  
ATOM 3196  H H    . LEU A 1 12 ? 6.193   8.801   1.181   1.00 2.84 ? 12  LEU A H    3  
ATOM 3197  H HA   . LEU A 1 12 ? 3.570   8.306   1.276   1.00 3.41 ? 12  LEU A HA   3  
ATOM 3198  H HB2  . LEU A 1 12 ? 5.756   6.824   2.725   1.00 3.58 ? 12  LEU A HB2  3  
ATOM 3199  H HB3  . LEU A 1 12 ? 4.117   6.216   2.623   1.00 3.65 ? 12  LEU A HB3  3  
ATOM 3200  H HG   . LEU A 1 12 ? 4.477   6.487   0.038   1.00 5.19 ? 12  LEU A HG   3  
ATOM 3201  H HD11 . LEU A 1 12 ? 7.179   6.851   1.154   1.00 5.40 ? 12  LEU A HD11 3  
ATOM 3202  H HD12 . LEU A 1 12 ? 6.504   7.377   -0.388  1.00 5.57 ? 12  LEU A HD12 3  
ATOM 3203  H HD13 . LEU A 1 12 ? 7.047   5.712   -0.186  1.00 5.68 ? 12  LEU A HD13 3  
ATOM 3204  H HD21 . LEU A 1 12 ? 4.705   4.381   1.873   1.00 6.03 ? 12  LEU A HD21 3  
ATOM 3205  H HD22 . LEU A 1 12 ? 6.057   4.200   0.755   1.00 5.93 ? 12  LEU A HD22 3  
ATOM 3206  H HD23 . LEU A 1 12 ? 4.405   4.271   0.139   1.00 6.06 ? 12  LEU A HD23 3  
ATOM 3207  N N    . GLY A 1 13 ? 4.520   8.627   4.441   1.00 1.13 ? 13  GLY A N    3  
ATOM 3208  C CA   . GLY A 1 13 ? 4.039   8.994   5.762   1.00 1.11 ? 13  GLY A CA   3  
ATOM 3209  C C    . GLY A 1 13 ? 3.030   8.007   6.323   1.00 0.96 ? 13  GLY A C    3  
ATOM 3210  O O    . GLY A 1 13 ? 1.975   8.406   6.815   1.00 1.03 ? 13  GLY A O    3  
ATOM 3211  H H    . GLY A 1 13 ? 5.448   8.336   4.321   1.00 1.49 ? 13  GLY A H    3  
ATOM 3212  H HA2  . GLY A 1 13 ? 4.881   9.049   6.435   1.00 1.58 ? 13  GLY A HA2  3  
ATOM 3213  H HA3  . GLY A 1 13 ? 3.577   9.969   5.706   1.00 1.81 ? 13  GLY A HA3  3  
ATOM 3214  N N    . PHE A 1 14 ? 3.355   6.717   6.240   1.00 0.81 ? 14  PHE A N    3  
ATOM 3215  C CA   . PHE A 1 14 ? 2.480   5.654   6.742   1.00 0.71 ? 14  PHE A CA   3  
ATOM 3216  C C    . PHE A 1 14 ? 3.267   4.351   6.901   1.00 0.56 ? 14  PHE A C    3  
ATOM 3217  O O    . PHE A 1 14 ? 4.485   4.339   6.722   1.00 0.52 ? 14  PHE A O    3  
ATOM 3218  C CB   . PHE A 1 14 ? 1.257   5.458   5.827   1.00 0.74 ? 14  PHE A CB   3  
ATOM 3219  C CG   . PHE A 1 14 ? 1.578   5.083   4.405   1.00 0.63 ? 14  PHE A CG   3  
ATOM 3220  C CD1  . PHE A 1 14 ? 2.034   3.812   4.093   1.00 1.27 ? 14  PHE A CD1  3  
ATOM 3221  C CD2  . PHE A 1 14 ? 1.406   6.000   3.378   1.00 1.41 ? 14  PHE A CD2  3  
ATOM 3222  C CE1  . PHE A 1 14 ? 2.315   3.462   2.788   1.00 1.33 ? 14  PHE A CE1  3  
ATOM 3223  C CE2  . PHE A 1 14 ? 1.684   5.653   2.069   1.00 1.46 ? 14  PHE A CE2  3  
ATOM 3224  C CZ   . PHE A 1 14 ? 2.139   4.383   1.774   1.00 0.83 ? 14  PHE A CZ   3  
ATOM 3225  H H    . PHE A 1 14 ? 4.206   6.466   5.824   1.00 0.79 ? 14  PHE A H    3  
ATOM 3226  H HA   . PHE A 1 14 ? 2.134   5.960   7.719   1.00 0.81 ? 14  PHE A HA   3  
ATOM 3227  H HB2  . PHE A 1 14 ? 0.638   4.675   6.236   1.00 0.84 ? 14  PHE A HB2  3  
ATOM 3228  H HB3  . PHE A 1 14 ? 0.688   6.377   5.806   1.00 0.89 ? 14  PHE A HB3  3  
ATOM 3229  H HD1  . PHE A 1 14 ? 2.172   3.091   4.884   1.00 2.12 ? 14  PHE A HD1  3  
ATOM 3230  H HD2  . PHE A 1 14 ? 1.051   6.993   3.606   1.00 2.28 ? 14  PHE A HD2  3  
ATOM 3231  H HE1  . PHE A 1 14 ? 2.672   2.468   2.561   1.00 2.19 ? 14  PHE A HE1  3  
ATOM 3232  H HE2  . PHE A 1 14 ? 1.546   6.376   1.278   1.00 2.33 ? 14  PHE A HE2  3  
ATOM 3233  H HZ   . PHE A 1 14 ? 2.356   4.110   0.753   1.00 0.99 ? 14  PHE A HZ   3  
ATOM 3234  N N    . SER A 1 15 ? 2.579   3.256   7.223   1.00 0.55 ? 15  SER A N    3  
ATOM 3235  C CA   . SER A 1 15 ? 3.228   1.960   7.383   1.00 0.47 ? 15  SER A CA   3  
ATOM 3236  C C    . SER A 1 15 ? 2.478   0.904   6.579   1.00 0.47 ? 15  SER A C    3  
ATOM 3237  O O    . SER A 1 15 ? 1.380   1.160   6.081   1.00 0.52 ? 15  SER A O    3  
ATOM 3238  C CB   . SER A 1 15 ? 3.290   1.552   8.855   1.00 0.50 ? 15  SER A CB   3  
ATOM 3239  O OG   . SER A 1 15 ? 2.206   2.084   9.585   1.00 0.57 ? 15  SER A OG   3  
ATOM 3240  H H    . SER A 1 15 ? 1.609   3.296   7.330   1.00 0.65 ? 15  SER A H    3  
ATOM 3241  H HA   . SER A 1 15 ? 4.230   2.043   6.998   1.00 0.48 ? 15  SER A HA   3  
ATOM 3242  H HB2  . SER A 1 15 ? 3.256   0.478   8.926   1.00 0.52 ? 15  SER A HB2  3  
ATOM 3243  H HB3  . SER A 1 15 ? 4.210   1.912   9.289   1.00 0.54 ? 15  SER A HB3  3  
ATOM 3244  H HG   . SER A 1 15 ? 2.331   3.029   9.700   1.00 1.10 ? 15  SER A HG   3  
ATOM 3245  N N    . ILE A 1 16 ? 3.068   -0.281  6.453   1.00 0.44 ? 16  ILE A N    3  
ATOM 3246  C CA   . ILE A 1 16 ? 2.443   -1.366  5.703   1.00 0.46 ? 16  ILE A CA   3  
ATOM 3247  C C    . ILE A 1 16 ? 2.932   -2.727  6.179   1.00 0.46 ? 16  ILE A C    3  
ATOM 3248  O O    . ILE A 1 16 ? 3.913   -2.826  6.913   1.00 0.45 ? 16  ILE A O    3  
ATOM 3249  C CB   . ILE A 1 16 ? 2.722   -1.259  4.176   1.00 0.47 ? 16  ILE A CB   3  
ATOM 3250  C CG1  . ILE A 1 16 ? 4.007   -2.002  3.770   1.00 0.67 ? 16  ILE A CG1  3  
ATOM 3251  C CG2  . ILE A 1 16 ? 2.775   0.194   3.724   1.00 0.57 ? 16  ILE A CG2  3  
ATOM 3252  C CD1  . ILE A 1 16 ? 5.276   -1.349  4.257   1.00 0.64 ? 16  ILE A CD1  3  
ATOM 3253  H H    . ILE A 1 16 ? 3.940   -0.433  6.877   1.00 0.44 ? 16  ILE A H    3  
ATOM 3254  H HA   . ILE A 1 16 ? 1.368   -1.306  5.849   1.00 0.49 ? 16  ILE A HA   3  
ATOM 3255  H HB   . ILE A 1 16 ? 1.901   -1.724  3.674   1.00 0.59 ? 16  ILE A HB   3  
ATOM 3256  H HG12 . ILE A 1 16 ? 3.979   -3.004  4.167   1.00 1.45 ? 16  ILE A HG12 3  
ATOM 3257  H HG13 . ILE A 1 16 ? 4.055   -2.052  2.692   1.00 1.37 ? 16  ILE A HG13 3  
ATOM 3258  H HG21 . ILE A 1 16 ? 1.808   0.650   3.868   1.00 1.32 ? 16  ILE A HG21 3  
ATOM 3259  H HG22 . ILE A 1 16 ? 3.039   0.234   2.679   1.00 1.06 ? 16  ILE A HG22 3  
ATOM 3260  H HG23 . ILE A 1 16 ? 3.515   0.726   4.303   1.00 1.09 ? 16  ILE A HG23 3  
ATOM 3261  H HD11 . ILE A 1 16 ? 5.832   -2.050  4.864   1.00 1.34 ? 16  ILE A HD11 3  
ATOM 3262  H HD12 . ILE A 1 16 ? 5.025   -0.480  4.842   1.00 1.24 ? 16  ILE A HD12 3  
ATOM 3263  H HD13 . ILE A 1 16 ? 5.874   -1.053  3.406   1.00 1.38 ? 16  ILE A HD13 3  
ATOM 3264  N N    . ALA A 1 17 ? 2.244   -3.760  5.713   1.00 0.51 ? 17  ALA A N    3  
ATOM 3265  C CA   . ALA A 1 17 ? 2.575   -5.145  6.005   1.00 0.55 ? 17  ALA A CA   3  
ATOM 3266  C C    . ALA A 1 17 ? 2.481   -5.923  4.695   1.00 0.73 ? 17  ALA A C    3  
ATOM 3267  O O    . ALA A 1 17 ? 1.939   -5.404  3.728   1.00 1.19 ? 17  ALA A O    3  
ATOM 3268  C CB   . ALA A 1 17 ? 1.644   -5.711  7.063   1.00 0.71 ? 17  ALA A CB   3  
ATOM 3269  H H    . ALA A 1 17 ? 1.480   -3.587  5.122   1.00 0.55 ? 17  ALA A H    3  
ATOM 3270  H HA   . ALA A 1 17 ? 3.590   -5.185  6.373   1.00 0.50 ? 17  ALA A HA   3  
ATOM 3271  H HB1  . ALA A 1 17 ? 2.006   -5.437  8.043   1.00 1.21 ? 17  ALA A HB1  3  
ATOM 3272  H HB2  . ALA A 1 17 ? 1.614   -6.787  6.978   1.00 1.22 ? 17  ALA A HB2  3  
ATOM 3273  H HB3  . ALA A 1 17 ? 0.650   -5.308  6.922   1.00 1.33 ? 17  ALA A HB3  3  
ATOM 3274  N N    . GLY A 1 18 ? 2.988   -7.149  4.638   1.00 0.60 ? 18  GLY A N    3  
ATOM 3275  C CA   . GLY A 1 18 ? 2.879   -7.893  3.388   1.00 0.77 ? 18  GLY A CA   3  
ATOM 3276  C C    . GLY A 1 18 ? 3.765   -9.119  3.288   1.00 0.85 ? 18  GLY A C    3  
ATOM 3277  O O    . GLY A 1 18 ? 4.975   -8.994  3.423   1.00 1.29 ? 18  GLY A O    3  
ATOM 3278  H H    . GLY A 1 18 ? 3.378   -7.545  5.439   1.00 0.67 ? 18  GLY A H    3  
ATOM 3279  H HA2  . GLY A 1 18 ? 1.858   -8.201  3.270   1.00 0.96 ? 18  GLY A HA2  3  
ATOM 3280  H HA3  . GLY A 1 18 ? 3.131   -7.225  2.579   1.00 1.37 ? 18  GLY A HA3  3  
ATOM 3281  N N    . GLY A 1 19 ? 3.202   -10.298 3.014   1.00 1.01 ? 19  GLY A N    3  
ATOM 3282  C CA   . GLY A 1 19 ? 4.040   -11.480 2.868   1.00 1.61 ? 19  GLY A CA   3  
ATOM 3283  C C    . GLY A 1 19 ? 3.844   -12.514 3.957   1.00 0.89 ? 19  GLY A C    3  
ATOM 3284  O O    . GLY A 1 19 ? 3.442   -12.187 5.075   1.00 0.76 ? 19  GLY A O    3  
ATOM 3285  H H    . GLY A 1 19 ? 2.234   -10.384 2.890   1.00 1.01 ? 19  GLY A H    3  
ATOM 3286  H HA2  . GLY A 1 19 ? 3.819   -11.940 1.916   1.00 2.30 ? 19  GLY A HA2  3  
ATOM 3287  H HA3  . GLY A 1 19 ? 5.075   -11.171 2.867   1.00 2.32 ? 19  GLY A HA3  3  
ATOM 3288  N N    . VAL A 1 20 ? 4.153   -13.770 3.625   1.00 0.97 ? 20  VAL A N    3  
ATOM 3289  C CA   . VAL A 1 20 ? 4.034   -14.871 4.577   1.00 1.05 ? 20  VAL A CA   3  
ATOM 3290  C C    . VAL A 1 20 ? 5.054   -14.701 5.705   1.00 1.18 ? 20  VAL A C    3  
ATOM 3291  O O    . VAL A 1 20 ? 6.128   -14.132 5.496   1.00 1.35 ? 20  VAL A O    3  
ATOM 3292  C CB   . VAL A 1 20 ? 4.239   -16.244 3.895   1.00 1.68 ? 20  VAL A CB   3  
ATOM 3293  C CG1  . VAL A 1 20 ? 4.002   -17.379 4.881   1.00 1.76 ? 20  VAL A CG1  3  
ATOM 3294  C CG2  . VAL A 1 20 ? 3.324   -16.386 2.686   1.00 2.72 ? 20  VAL A CG2  3  
ATOM 3295  H H    . VAL A 1 20 ? 4.484   -13.957 2.722   1.00 1.38 ? 20  VAL A H    3  
ATOM 3296  H HA   . VAL A 1 20 ? 3.034   -14.839 4.993   1.00 0.98 ? 20  VAL A HA   3  
ATOM 3297  H HB   . VAL A 1 20 ? 5.262   -16.302 3.553   1.00 2.13 ? 20  VAL A HB   3  
ATOM 3298  H HG11 . VAL A 1 20 ? 3.082   -17.205 5.418   1.00 2.30 ? 20  VAL A HG11 3  
ATOM 3299  H HG12 . VAL A 1 20 ? 4.824   -17.427 5.580   1.00 1.97 ? 20  VAL A HG12 3  
ATOM 3300  H HG13 . VAL A 1 20 ? 3.934   -18.314 4.342   1.00 2.15 ? 20  VAL A HG13 3  
ATOM 3301  H HG21 . VAL A 1 20 ? 3.586   -15.642 1.946   1.00 3.33 ? 20  VAL A HG21 3  
ATOM 3302  H HG22 . VAL A 1 20 ? 2.298   -16.245 2.991   1.00 3.14 ? 20  VAL A HG22 3  
ATOM 3303  H HG23 . VAL A 1 20 ? 3.440   -17.371 2.260   1.00 3.02 ? 20  VAL A HG23 3  
ATOM 3304  N N    . GLY A 1 21 ? 4.705   -15.172 6.903   1.00 1.30 ? 21  GLY A N    3  
ATOM 3305  C CA   . GLY A 1 21 ? 5.600   -15.032 8.046   1.00 1.54 ? 21  GLY A CA   3  
ATOM 3306  C C    . GLY A 1 21 ? 5.478   -13.663 8.710   1.00 1.24 ? 21  GLY A C    3  
ATOM 3307  O O    . GLY A 1 21 ? 5.871   -13.488 9.865   1.00 1.56 ? 21  GLY A O    3  
ATOM 3308  H H    . GLY A 1 21 ? 3.833   -15.605 7.011   1.00 1.35 ? 21  GLY A H    3  
ATOM 3309  H HA2  . GLY A 1 21 ? 5.361   -15.795 8.773   1.00 1.90 ? 21  GLY A HA2  3  
ATOM 3310  H HA3  . GLY A 1 21 ? 6.618   -15.171 7.716   1.00 1.72 ? 21  GLY A HA3  3  
ATOM 3311  N N    . ASN A 1 22 ? 4.904   -12.704 7.977   1.00 0.73 ? 22  ASN A N    3  
ATOM 3312  C CA   . ASN A 1 22 ? 4.685   -11.350 8.469   1.00 0.61 ? 22  ASN A CA   3  
ATOM 3313  C C    . ASN A 1 22 ? 3.295   -10.855 8.018   1.00 0.65 ? 22  ASN A C    3  
ATOM 3314  O O    . ASN A 1 22 ? 3.034   -9.651  7.979   1.00 0.67 ? 22  ASN A O    3  
ATOM 3315  C CB   . ASN A 1 22 ? 5.781   -10.403 7.942   1.00 0.47 ? 22  ASN A CB   3  
ATOM 3316  C CG   . ASN A 1 22 ? 5.620   -10.105 6.474   1.00 0.74 ? 22  ASN A CG   3  
ATOM 3317  O OD1  . ASN A 1 22 ? 6.086   -10.856 5.617   1.00 1.27 ? 22  ASN A OD1  3  
ATOM 3318  N ND2  . ASN A 1 22 ? 4.959   -9.005  6.180   1.00 1.63 ? 22  ASN A ND2  3  
ATOM 3319  H H    . ASN A 1 22 ? 4.591   -12.924 7.078   1.00 0.63 ? 22  ASN A H    3  
ATOM 3320  H HA   . ASN A 1 22 ? 4.719   -11.372 9.548   1.00 0.88 ? 22  ASN A HA   3  
ATOM 3321  H HB2  . ASN A 1 22 ? 5.728   -9.472  8.480   1.00 0.82 ? 22  ASN A HB2  3  
ATOM 3322  H HB3  . ASN A 1 22 ? 6.761   -10.839 8.085   1.00 0.63 ? 22  ASN A HB3  3  
ATOM 3323  H HD21 . ASN A 1 22 ? 4.611   -8.459  6.917   1.00 2.15 ? 22  ASN A HD21 3  
ATOM 3324  H HD22 . ASN A 1 22 ? 4.859   -8.770  5.241   1.00 1.98 ? 22  ASN A HD22 3  
ATOM 3325  N N    . GLN A 1 23 ? 2.420   -11.807 7.648   1.00 0.77 ? 23  GLN A N    3  
ATOM 3326  C CA   . GLN A 1 23 ? 1.069   -11.517 7.156   1.00 0.94 ? 23  GLN A CA   3  
ATOM 3327  C C    . GLN A 1 23 ? 0.311   -10.501 8.015   1.00 0.88 ? 23  GLN A C    3  
ATOM 3328  O O    . GLN A 1 23 ? 0.358   -10.545 9.246   1.00 0.87 ? 23  GLN A O    3  
ATOM 3329  C CB   . GLN A 1 23 ? 0.265   -12.817 7.068   1.00 1.19 ? 23  GLN A CB   3  
ATOM 3330  C CG   . GLN A 1 23 ? -0.907  -12.750 6.100   1.00 1.42 ? 23  GLN A CG   3  
ATOM 3331  C CD   . GLN A 1 23 ? -1.714  -14.035 6.070   1.00 1.55 ? 23  GLN A CD   3  
ATOM 3332  O OE1  . GLN A 1 23 ? -1.919  -14.627 5.010   1.00 1.62 ? 23  GLN A OE1  3  
ATOM 3333  N NE2  . GLN A 1 23 ? -2.183  -14.473 7.236   1.00 2.34 ? 23  GLN A NE2  3  
ATOM 3334  H H    . GLN A 1 23 ? 2.695   -12.745 7.683   1.00 0.79 ? 23  GLN A H    3  
ATOM 3335  H HA   . GLN A 1 23 ? 1.174   -11.116 6.159   1.00 1.04 ? 23  GLN A HA   3  
ATOM 3336  H HB2  . GLN A 1 23 ? 0.923   -13.613 6.748   1.00 1.46 ? 23  GLN A HB2  3  
ATOM 3337  H HB3  . GLN A 1 23 ? -0.120  -13.053 8.049   1.00 1.49 ? 23  GLN A HB3  3  
ATOM 3338  H HG2  . GLN A 1 23 ? -1.558  -11.941 6.398   1.00 1.80 ? 23  GLN A HG2  3  
ATOM 3339  H HG3  . GLN A 1 23 ? -0.527  -12.556 5.107   1.00 1.68 ? 23  GLN A HG3  3  
ATOM 3340  H HE21 . GLN A 1 23 ? -1.988  -13.951 8.042   1.00 2.92 ? 23  GLN A HE21 3  
ATOM 3341  H HE22 . GLN A 1 23 ? -2.704  -15.303 7.242   1.00 2.51 ? 23  GLN A HE22 3  
ATOM 3342  N N    . HIS A 1 24 ? -0.396  -9.592  7.336   1.00 0.86 ? 24  HIS A N    3  
ATOM 3343  C CA   . HIS A 1 24 ? -1.189  -8.550  7.995   1.00 0.83 ? 24  HIS A CA   3  
ATOM 3344  C C    . HIS A 1 24 ? -2.653  -8.966  8.131   1.00 0.84 ? 24  HIS A C    3  
ATOM 3345  O O    . HIS A 1 24 ? -3.334  -8.570  9.080   1.00 0.92 ? 24  HIS A O    3  
ATOM 3346  C CB   . HIS A 1 24 ? -1.116  -7.251  7.189   1.00 0.85 ? 24  HIS A CB   3  
ATOM 3347  C CG   . HIS A 1 24 ? -1.752  -6.085  7.858   1.00 0.83 ? 24  HIS A CG   3  
ATOM 3348  N ND1  . HIS A 1 24 ? -1.107  -5.309  8.791   1.00 0.90 ? 24  HIS A ND1  3  
ATOM 3349  C CD2  . HIS A 1 24 ? -2.981  -5.550  7.704   1.00 0.81 ? 24  HIS A CD2  3  
ATOM 3350  C CE1  . HIS A 1 24 ? -1.912  -4.345  9.183   1.00 0.88 ? 24  HIS A CE1  3  
ATOM 3351  N NE2  . HIS A 1 24 ? -3.058  -4.466  8.540   1.00 0.82 ? 24  HIS A NE2  3  
ATOM 3352  H H    . HIS A 1 24 ? -0.383  -9.617  6.356   1.00 0.90 ? 24  HIS A H    3  
ATOM 3353  H HA   . HIS A 1 24 ? -0.776  -8.380  8.977   1.00 0.84 ? 24  HIS A HA   3  
ATOM 3354  H HB2  . HIS A 1 24 ? -0.090  -7.003  7.008   1.00 0.91 ? 24  HIS A HB2  3  
ATOM 3355  H HB3  . HIS A 1 24 ? -1.615  -7.392  6.243   1.00 0.87 ? 24  HIS A HB3  3  
ATOM 3356  H HD1  . HIS A 1 24 ? -0.195  -5.448  9.120   1.00 0.98 ? 24  HIS A HD1  3  
ATOM 3357  H HD2  . HIS A 1 24 ? -3.755  -5.908  7.037   1.00 0.82 ? 24  HIS A HD2  3  
ATOM 3358  H HE1  . HIS A 1 24 ? -1.669  -3.583  9.898   1.00 0.95 ? 24  HIS A HE1  3  
ATOM 3359  H HE2  . HIS A 1 24 ? -3.779  -3.802  8.545   1.00 0.82 ? 24  HIS A HE2  3  
ATOM 3360  N N    . ILE A 1 25 ? -3.132  -9.758  7.171   1.00 0.80 ? 25  ILE A N    3  
ATOM 3361  C CA   . ILE A 1 25 ? -4.516  -10.220 7.170   1.00 0.86 ? 25  ILE A CA   3  
ATOM 3362  C C    . ILE A 1 25 ? -4.588  -11.729 6.940   1.00 0.81 ? 25  ILE A C    3  
ATOM 3363  O O    . ILE A 1 25 ? -3.994  -12.246 5.991   1.00 0.80 ? 25  ILE A O    3  
ATOM 3364  C CB   . ILE A 1 25 ? -5.345  -9.490  6.088   1.00 0.95 ? 25  ILE A CB   3  
ATOM 3365  C CG1  . ILE A 1 25 ? -5.200  -7.971  6.231   1.00 1.01 ? 25  ILE A CG1  3  
ATOM 3366  C CG2  . ILE A 1 25 ? -6.810  -9.893  6.167   1.00 1.51 ? 25  ILE A CG2  3  
ATOM 3367  C CD1  . ILE A 1 25 ? -5.792  -7.415  7.512   1.00 1.16 ? 25  ILE A CD1  3  
ATOM 3368  H H    . ILE A 1 25 ? -2.531  -10.035 6.449   1.00 0.77 ? 25  ILE A H    3  
ATOM 3369  H HA   . ILE A 1 25 ? -4.942  -9.991  8.135   1.00 0.92 ? 25  ILE A HA   3  
ATOM 3370  H HB   . ILE A 1 25 ? -4.969  -9.787  5.120   1.00 1.28 ? 25  ILE A HB   3  
ATOM 3371  H HG12 . ILE A 1 25 ? -4.152  -7.712  6.214   1.00 1.40 ? 25  ILE A HG12 3  
ATOM 3372  H HG13 . ILE A 1 25 ? -5.696  -7.491  5.402   1.00 1.51 ? 25  ILE A HG13 3  
ATOM 3373  H HG21 . ILE A 1 25 ? -7.263  -9.426  7.030   1.00 1.96 ? 25  ILE A HG21 3  
ATOM 3374  H HG22 . ILE A 1 25 ? -6.886  -10.966 6.256   1.00 1.82 ? 25  ILE A HG22 3  
ATOM 3375  H HG23 . ILE A 1 25 ? -7.321  -9.567  5.273   1.00 1.95 ? 25  ILE A HG23 3  
ATOM 3376  H HD11 . ILE A 1 25 ? -4.998  -7.092  8.166   1.00 1.53 ? 25  ILE A HD11 3  
ATOM 3377  H HD12 . ILE A 1 25 ? -6.374  -8.182  8.003   1.00 1.45 ? 25  ILE A HD12 3  
ATOM 3378  H HD13 . ILE A 1 25 ? -6.430  -6.575  7.278   1.00 1.78 ? 25  ILE A HD13 3  
ATOM 3379  N N    . PRO A 1 26 ? -5.320  -12.460 7.808   1.00 0.82 ? 26  PRO A N    3  
ATOM 3380  C CA   . PRO A 1 26 ? -5.465  -13.918 7.696   1.00 0.82 ? 26  PRO A CA   3  
ATOM 3381  C C    . PRO A 1 26 ? -6.033  -14.346 6.345   1.00 0.86 ? 26  PRO A C    3  
ATOM 3382  O O    . PRO A 1 26 ? -7.183  -14.041 6.018   1.00 0.95 ? 26  PRO A O    3  
ATOM 3383  C CB   . PRO A 1 26 ? -6.435  -14.284 8.831   1.00 0.88 ? 26  PRO A CB   3  
ATOM 3384  C CG   . PRO A 1 26 ? -7.076  -12.999 9.232   1.00 0.98 ? 26  PRO A CG   3  
ATOM 3385  C CD   . PRO A 1 26 ? -6.061  -11.927 8.963   1.00 0.87 ? 26  PRO A CD   3  
ATOM 3386  H HA   . PRO A 1 26 ? -4.521  -14.417 7.857   1.00 0.79 ? 26  PRO A HA   3  
ATOM 3387  H HB2  . PRO A 1 26 ? -7.166  -14.991 8.468   1.00 1.04 ? 26  PRO A HB2  3  
ATOM 3388  H HB3  . PRO A 1 26 ? -5.883  -14.719 9.652   1.00 0.96 ? 26  PRO A HB3  3  
ATOM 3389  H HG2  . PRO A 1 26 ? -7.964  -12.831 8.640   1.00 1.27 ? 26  PRO A HG2  3  
ATOM 3390  H HG3  . PRO A 1 26 ? -7.325  -13.025 10.283  1.00 1.26 ? 26  PRO A HG3  3  
ATOM 3391  H HD2  . PRO A 1 26 ? -6.551  -10.998 8.716   1.00 0.94 ? 26  PRO A HD2  3  
ATOM 3392  H HD3  . PRO A 1 26 ? -5.410  -11.799 9.815   1.00 0.95 ? 26  PRO A HD3  3  
ATOM 3393  N N    . GLY A 1 27 ? -5.214  -15.051 5.563   1.00 0.85 ? 27  GLY A N    3  
ATOM 3394  C CA   . GLY A 1 27 ? -5.640  -15.513 4.253   1.00 0.94 ? 27  GLY A CA   3  
ATOM 3395  C C    . GLY A 1 27 ? -5.027  -14.715 3.115   1.00 0.92 ? 27  GLY A C    3  
ATOM 3396  O O    . GLY A 1 27 ? -4.542  -15.293 2.141   1.00 1.06 ? 27  GLY A O    3  
ATOM 3397  H H    . GLY A 1 27 ? -4.311  -15.259 5.879   1.00 0.81 ? 27  GLY A H    3  
ATOM 3398  H HA2  . GLY A 1 27 ? -5.355  -16.549 4.142   1.00 1.04 ? 27  GLY A HA2  3  
ATOM 3399  H HA3  . GLY A 1 27 ? -6.716  -15.441 4.190   1.00 1.00 ? 27  GLY A HA3  3  
ATOM 3400  N N    . ASP A 1 28 ? -5.058  -13.386 3.232   1.00 0.80 ? 28  ASP A N    3  
ATOM 3401  C CA   . ASP A 1 28 ? -4.511  -12.512 2.196   1.00 0.80 ? 28  ASP A CA   3  
ATOM 3402  C C    . ASP A 1 28 ? -3.132  -11.976 2.582   1.00 0.65 ? 28  ASP A C    3  
ATOM 3403  O O    . ASP A 1 28 ? -3.009  -11.128 3.469   1.00 0.57 ? 28  ASP A O    3  
ATOM 3404  C CB   . ASP A 1 28 ? -5.472  -11.347 1.924   1.00 0.91 ? 28  ASP A CB   3  
ATOM 3405  C CG   . ASP A 1 28 ? -5.961  -11.307 0.484   1.00 1.08 ? 28  ASP A CG   3  
ATOM 3406  O OD1  . ASP A 1 28 ? -6.220  -12.386 -0.092  1.00 1.68 ? 28  ASP A OD1  3  
ATOM 3407  O OD2  . ASP A 1 28 ? -6.092  -10.193 -0.066  1.00 1.48 ? 28  ASP A OD2  3  
ATOM 3408  H H    . ASP A 1 28 ? -5.465  -12.983 4.028   1.00 0.76 ? 28  ASP A H    3  
ATOM 3409  H HA   . ASP A 1 28 ? -4.411  -13.097 1.294   1.00 0.92 ? 28  ASP A HA   3  
ATOM 3410  H HB2  . ASP A 1 28 ? -6.332  -11.441 2.570   1.00 1.05 ? 28  ASP A HB2  3  
ATOM 3411  H HB3  . ASP A 1 28 ? -4.969  -10.415 2.139   1.00 0.85 ? 28  ASP A HB3  3  
ATOM 3412  N N    . ASN A 1 29 ? -2.098  -12.476 1.899   1.00 0.69 ? 29  ASN A N    3  
ATOM 3413  C CA   . ASN A 1 29 ? -0.718  -12.051 2.154   1.00 0.63 ? 29  ASN A CA   3  
ATOM 3414  C C    . ASN A 1 29 ? -0.372  -10.763 1.387   1.00 0.59 ? 29  ASN A C    3  
ATOM 3415  O O    . ASN A 1 29 ? 0.805   -10.470 1.156   1.00 0.65 ? 29  ASN A O    3  
ATOM 3416  C CB   . ASN A 1 29 ? 0.260   -13.166 1.770   1.00 0.79 ? 29  ASN A CB   3  
ATOM 3417  C CG   . ASN A 1 29 ? 0.143   -14.379 2.675   1.00 1.36 ? 29  ASN A CG   3  
ATOM 3418  O OD1  . ASN A 1 29 ? 0.793   -14.452 3.718   1.00 2.11 ? 29  ASN A OD1  3  
ATOM 3419  N ND2  . ASN A 1 29 ? -0.690  -15.338 2.283   1.00 1.98 ? 29  ASN A ND2  3  
ATOM 3420  H H    . ASN A 1 29 ? -2.273  -13.151 1.210   1.00 0.80 ? 29  ASN A H    3  
ATOM 3421  H HA   . ASN A 1 29 ? -0.622  -11.859 3.214   1.00 0.58 ? 29  ASN A HA   3  
ATOM 3422  H HB2  . ASN A 1 29 ? 0.062   -13.477 0.755   1.00 1.38 ? 29  ASN A HB2  3  
ATOM 3423  H HB3  . ASN A 1 29 ? 1.270   -12.789 1.836   1.00 1.03 ? 29  ASN A HB3  3  
ATOM 3424  H HD21 . ASN A 1 29 ? -1.178  -15.215 1.441   1.00 2.27 ? 29  ASN A HD21 3  
ATOM 3425  H HD22 . ASN A 1 29 ? -0.782  -16.131 2.852   1.00 2.54 ? 29  ASN A HD22 3  
ATOM 3426  N N    . SER A 1 30 ? -1.398  -9.991  0.999   1.00 0.56 ? 30  SER A N    3  
ATOM 3427  C CA   . SER A 1 30 ? -1.200  -8.737  0.268   1.00 0.56 ? 30  SER A CA   3  
ATOM 3428  C C    . SER A 1 30 ? -0.517  -7.693  1.148   1.00 0.55 ? 30  SER A C    3  
ATOM 3429  O O    . SER A 1 30 ? -0.211  -7.956  2.315   1.00 0.55 ? 30  SER A O    3  
ATOM 3430  C CB   . SER A 1 30 ? -2.540  -8.187  -0.237  1.00 0.60 ? 30  SER A CB   3  
ATOM 3431  O OG   . SER A 1 30 ? -3.493  -9.221  -0.410  1.00 1.39 ? 30  SER A OG   3  
ATOM 3432  H H    . SER A 1 30 ? -2.310  -10.270 1.210   1.00 0.58 ? 30  SER A H    3  
ATOM 3433  H HA   . SER A 1 30 ? -0.565  -8.946  -0.580  1.00 0.60 ? 30  SER A HA   3  
ATOM 3434  H HB2  . SER A 1 30 ? -2.927  -7.477  0.477   1.00 1.26 ? 30  SER A HB2  3  
ATOM 3435  H HB3  . SER A 1 30 ? -2.387  -7.693  -1.186  1.00 1.02 ? 30  SER A HB3  3  
ATOM 3436  H HG   . SER A 1 30 ? -4.375  -8.843  -0.440  1.00 1.77 ? 30  SER A HG   3  
ATOM 3437  N N    . ILE A 1 31 ? -0.293  -6.499  0.594   1.00 0.55 ? 31  ILE A N    3  
ATOM 3438  C CA   . ILE A 1 31 ? 0.341   -5.429  1.359   1.00 0.55 ? 31  ILE A CA   3  
ATOM 3439  C C    . ILE A 1 31 ? -0.709  -4.451  1.907   1.00 0.57 ? 31  ILE A C    3  
ATOM 3440  O O    . ILE A 1 31 ? -1.333  -3.705  1.157   1.00 0.65 ? 31  ILE A O    3  
ATOM 3441  C CB   . ILE A 1 31 ? 1.416   -4.667  0.535   1.00 0.53 ? 31  ILE A CB   3  
ATOM 3442  C CG1  . ILE A 1 31 ? 2.414   -5.632  -0.138  1.00 0.62 ? 31  ILE A CG1  3  
ATOM 3443  C CG2  . ILE A 1 31 ? 2.158   -3.672  1.419   1.00 0.60 ? 31  ILE A CG2  3  
ATOM 3444  C CD1  . ILE A 1 31 ? 2.431   -7.043  0.422   1.00 0.80 ? 31  ILE A CD1  3  
ATOM 3445  H H    . ILE A 1 31 ? -0.581  -6.342  -0.333  1.00 0.57 ? 31  ILE A H    3  
ATOM 3446  H HA   . ILE A 1 31 ? 0.832   -5.896  2.194   1.00 0.54 ? 31  ILE A HA   3  
ATOM 3447  H HB   . ILE A 1 31 ? 0.918   -4.106  -0.233  1.00 0.74 ? 31  ILE A HB   3  
ATOM 3448  H HG12 . ILE A 1 31 ? 2.171   -5.704  -1.186  1.00 1.20 ? 31  ILE A HG12 3  
ATOM 3449  H HG13 . ILE A 1 31 ? 3.409   -5.226  -0.043  1.00 1.19 ? 31  ILE A HG13 3  
ATOM 3450  H HG21 . ILE A 1 31 ? 2.836   -4.203  2.069   1.00 1.13 ? 31  ILE A HG21 3  
ATOM 3451  H HG22 . ILE A 1 31 ? 1.448   -3.118  2.016   1.00 1.21 ? 31  ILE A HG22 3  
ATOM 3452  H HG23 . ILE A 1 31 ? 2.718   -2.987  0.799   1.00 1.13 ? 31  ILE A HG23 3  
ATOM 3453  H HD11 . ILE A 1 31 ? 1.905   -7.704  -0.250  1.00 1.15 ? 31  ILE A HD11 3  
ATOM 3454  H HD12 . ILE A 1 31 ? 1.948   -7.054  1.386   1.00 1.28 ? 31  ILE A HD12 3  
ATOM 3455  H HD13 . ILE A 1 31 ? 3.451   -7.378  0.526   1.00 1.46 ? 31  ILE A HD13 3  
ATOM 3456  N N    . TYR A 1 32 ? -0.903  -4.485  3.231   1.00 0.60 ? 32  TYR A N    3  
ATOM 3457  C CA   . TYR A 1 32 ? -1.888  -3.629  3.904   1.00 0.62 ? 32  TYR A CA   3  
ATOM 3458  C C    . TYR A 1 32 ? -1.230  -2.536  4.746   1.00 0.59 ? 32  TYR A C    3  
ATOM 3459  O O    . TYR A 1 32 ? -0.183  -2.754  5.351   1.00 0.61 ? 32  TYR A O    3  
ATOM 3460  C CB   . TYR A 1 32 ? -2.779  -4.471  4.816   1.00 0.69 ? 32  TYR A CB   3  
ATOM 3461  C CG   . TYR A 1 32 ? -3.719  -5.400  4.087   1.00 0.71 ? 32  TYR A CG   3  
ATOM 3462  C CD1  . TYR A 1 32 ? -3.236  -6.495  3.384   1.00 1.28 ? 32  TYR A CD1  3  
ATOM 3463  C CD2  . TYR A 1 32 ? -5.090  -5.186  4.112   1.00 1.34 ? 32  TYR A CD2  3  
ATOM 3464  C CE1  . TYR A 1 32 ? -4.093  -7.350  2.723   1.00 1.30 ? 32  TYR A CE1  3  
ATOM 3465  C CE2  . TYR A 1 32 ? -5.956  -6.036  3.459   1.00 1.38 ? 32  TYR A CE2  3  
ATOM 3466  C CZ   . TYR A 1 32 ? -5.454  -7.119  2.764   1.00 0.80 ? 32  TYR A CZ   3  
ATOM 3467  O OH   . TYR A 1 32 ? -6.312  -7.973  2.109   1.00 0.86 ? 32  TYR A OH   3  
ATOM 3468  H H    . TYR A 1 32 ? -0.378  -5.116  3.764   1.00 0.66 ? 32  TYR A H    3  
ATOM 3469  H HA   . TYR A 1 32 ? -2.501  -3.165  3.150   1.00 0.64 ? 32  TYR A HA   3  
ATOM 3470  H HB2  . TYR A 1 32 ? -2.153  -5.076  5.454   1.00 0.68 ? 32  TYR A HB2  3  
ATOM 3471  H HB3  . TYR A 1 32 ? -3.375  -3.813  5.431   1.00 0.74 ? 32  TYR A HB3  3  
ATOM 3472  H HD1  . TYR A 1 32 ? -2.172  -6.674  3.357   1.00 2.05 ? 32  TYR A HD1  3  
ATOM 3473  H HD2  . TYR A 1 32 ? -5.479  -4.338  4.652   1.00 2.10 ? 32  TYR A HD2  3  
ATOM 3474  H HE1  . TYR A 1 32 ? -3.694  -8.193  2.178   1.00 2.06 ? 32  TYR A HE1  3  
ATOM 3475  H HE2  . TYR A 1 32 ? -7.020  -5.847  3.494   1.00 2.17 ? 32  TYR A HE2  3  
ATOM 3476  H HH   . TYR A 1 32 ? -6.606  -8.659  2.715   1.00 1.32 ? 32  TYR A HH   3  
ATOM 3477  N N    . VAL A 1 33 ? -1.882  -1.374  4.810   1.00 0.57 ? 33  VAL A N    3  
ATOM 3478  C CA   . VAL A 1 33 ? -1.394  -0.250  5.610   1.00 0.55 ? 33  VAL A CA   3  
ATOM 3479  C C    . VAL A 1 33 ? -1.864  -0.405  7.059   1.00 0.59 ? 33  VAL A C    3  
ATOM 3480  O O    . VAL A 1 33 ? -3.057  -0.583  7.313   1.00 0.65 ? 33  VAL A O    3  
ATOM 3481  C CB   . VAL A 1 33 ? -1.881  1.106   5.047   1.00 0.59 ? 33  VAL A CB   3  
ATOM 3482  C CG1  . VAL A 1 33 ? -1.426  2.263   5.930   1.00 0.62 ? 33  VAL A CG1  3  
ATOM 3483  C CG2  . VAL A 1 33 ? -1.388  1.297   3.619   1.00 0.56 ? 33  VAL A CG2  3  
ATOM 3484  H H    . VAL A 1 33 ? -2.722  -1.279  4.331   1.00 0.61 ? 33  VAL A H    3  
ATOM 3485  H HA   . VAL A 1 33 ? -0.315  -0.267  5.584   1.00 0.51 ? 33  VAL A HA   3  
ATOM 3486  H HB   . VAL A 1 33 ? -2.962  1.099   5.031   1.00 0.67 ? 33  VAL A HB   3  
ATOM 3487  H HG11 . VAL A 1 33 ? -0.553  2.726   5.496   1.00 1.13 ? 33  VAL A HG11 3  
ATOM 3488  H HG12 . VAL A 1 33 ? -1.186  1.894   6.915   1.00 1.12 ? 33  VAL A HG12 3  
ATOM 3489  H HG13 . VAL A 1 33 ? -2.220  2.991   6.003   1.00 1.21 ? 33  VAL A HG13 3  
ATOM 3490  H HG21 . VAL A 1 33 ? -1.283  2.351   3.410   1.00 1.23 ? 33  VAL A HG21 3  
ATOM 3491  H HG22 . VAL A 1 33 ? -2.098  0.862   2.931   1.00 0.96 ? 33  VAL A HG22 3  
ATOM 3492  H HG23 . VAL A 1 33 ? -0.431  0.811   3.501   1.00 1.26 ? 33  VAL A HG23 3  
ATOM 3493  N N    . THR A 1 34 ? -0.919  -0.377  8.000   1.00 0.62 ? 34  THR A N    3  
ATOM 3494  C CA   . THR A 1 34 ? -1.240  -0.558  9.419   1.00 0.71 ? 34  THR A CA   3  
ATOM 3495  C C    . THR A 1 34 ? -1.312  0.757   10.211  1.00 0.72 ? 34  THR A C    3  
ATOM 3496  O O    . THR A 1 34 ? -2.002  0.818   11.230  1.00 0.84 ? 34  THR A O    3  
ATOM 3497  C CB   . THR A 1 34 ? -0.217  -1.496  10.070  1.00 0.74 ? 34  THR A CB   3  
ATOM 3498  O OG1  . THR A 1 34 ? -0.598  -1.814  11.398  1.00 1.39 ? 34  THR A OG1  3  
ATOM 3499  C CG2  . THR A 1 34 ? 1.185   -0.925  10.120  1.00 1.29 ? 34  THR A CG2  3  
ATOM 3500  H H    . THR A 1 34 ? 0.017   -0.263  7.731   1.00 0.62 ? 34  THR A H    3  
ATOM 3501  H HA   . THR A 1 34 ? -2.209  -1.032  9.469   1.00 0.81 ? 34  THR A HA   3  
ATOM 3502  H HB   . THR A 1 34 ? -0.177  -2.415  9.501   1.00 1.08 ? 34  THR A HB   3  
ATOM 3503  H HG1  . THR A 1 34 ? -0.641  -2.768  11.501  1.00 1.62 ? 34  THR A HG1  3  
ATOM 3504  H HG21 . THR A 1 34 ? 1.684   -1.273  11.013  1.00 1.65 ? 34  THR A HG21 3  
ATOM 3505  H HG22 . THR A 1 34 ? 1.134   0.153   10.135  1.00 1.98 ? 34  THR A HG22 3  
ATOM 3506  H HG23 . THR A 1 34 ? 1.737   -1.248  9.250   1.00 1.56 ? 34  THR A HG23 3  
ATOM 3507  N N    . LYS A 1 35 ? -0.609  1.802   9.758   1.00 0.65 ? 35  LYS A N    3  
ATOM 3508  C CA   . LYS A 1 35 ? -0.621  3.089   10.468  1.00 0.71 ? 35  LYS A CA   3  
ATOM 3509  C C    . LYS A 1 35 ? -0.242  4.251   9.552   1.00 0.69 ? 35  LYS A C    3  
ATOM 3510  O O    . LYS A 1 35 ? 0.862   4.288   9.013   1.00 0.62 ? 35  LYS A O    3  
ATOM 3511  C CB   . LYS A 1 35 ? 0.350   3.059   11.657  1.00 0.72 ? 35  LYS A CB   3  
ATOM 3512  C CG   . LYS A 1 35 ? -0.015  2.055   12.741  1.00 1.32 ? 35  LYS A CG   3  
ATOM 3513  C CD   . LYS A 1 35 ? 0.907   2.173   13.946  1.00 1.46 ? 35  LYS A CD   3  
ATOM 3514  C CE   . LYS A 1 35 ? 0.123   2.292   15.245  1.00 2.02 ? 35  LYS A CE   3  
ATOM 3515  N NZ   . LYS A 1 35 ? 0.553   3.467   16.052  1.00 2.54 ? 35  LYS A NZ   3  
ATOM 3516  H H    . LYS A 1 35 ? -0.085  1.708   8.935   1.00 0.59 ? 35  LYS A H    3  
ATOM 3517  H HA   . LYS A 1 35 ? -1.621  3.252   10.840  1.00 0.80 ? 35  LYS A HA   3  
ATOM 3518  H HB2  . LYS A 1 35 ? 1.337   2.813   11.295  1.00 0.98 ? 35  LYS A HB2  3  
ATOM 3519  H HB3  . LYS A 1 35 ? 0.380   4.041   12.105  1.00 1.18 ? 35  LYS A HB3  3  
ATOM 3520  H HG2  . LYS A 1 35 ? -1.031  2.236   13.058  1.00 1.91 ? 35  LYS A HG2  3  
ATOM 3521  H HG3  . LYS A 1 35 ? 0.066   1.058   12.334  1.00 2.08 ? 35  LYS A HG3  3  
ATOM 3522  H HD2  . LYS A 1 35 ? 1.532   1.294   13.995  1.00 1.89 ? 35  LYS A HD2  3  
ATOM 3523  H HD3  . LYS A 1 35 ? 1.527   3.050   13.829  1.00 1.86 ? 35  LYS A HD3  3  
ATOM 3524  H HE2  . LYS A 1 35 ? -0.926  2.392   15.010  1.00 2.47 ? 35  LYS A HE2  3  
ATOM 3525  H HE3  . LYS A 1 35 ? 0.276   1.393   15.824  1.00 2.40 ? 35  LYS A HE3  3  
ATOM 3526  H HZ1  . LYS A 1 35 ? 0.010   3.510   16.938  1.00 2.55 ? 35  LYS A HZ1  3  
ATOM 3527  H HZ2  . LYS A 1 35 ? 0.392   4.346   15.517  1.00 2.90 ? 35  LYS A HZ2  3  
ATOM 3528  H HZ3  . LYS A 1 35 ? 1.565   3.395   16.280  1.00 3.18 ? 35  LYS A HZ3  3  
ATOM 3529  N N    . ILE A 1 36 ? -1.154  5.209   9.397   1.00 0.86 ? 36  ILE A N    3  
ATOM 3530  C CA   . ILE A 1 36 ? -0.892  6.378   8.562   1.00 0.92 ? 36  ILE A CA   3  
ATOM 3531  C C    . ILE A 1 36 ? -0.470  7.575   9.421   1.00 0.98 ? 36  ILE A C    3  
ATOM 3532  O O    . ILE A 1 36 ? -1.213  8.006   10.306  1.00 1.06 ? 36  ILE A O    3  
ATOM 3533  C CB   . ILE A 1 36 ? -2.121  6.761   7.710   1.00 1.03 ? 36  ILE A CB   3  
ATOM 3534  C CG1  . ILE A 1 36 ? -2.556  5.576   6.838   1.00 1.40 ? 36  ILE A CG1  3  
ATOM 3535  C CG2  . ILE A 1 36 ? -1.808  7.976   6.846   1.00 1.12 ? 36  ILE A CG2  3  
ATOM 3536  C CD1  . ILE A 1 36 ? -3.518  5.952   5.731   1.00 1.35 ? 36  ILE A CD1  3  
ATOM 3537  H H    . ILE A 1 36 ? -2.014  5.134   9.862   1.00 0.98 ? 36  ILE A H    3  
ATOM 3538  H HA   . ILE A 1 36 ? -0.085  6.124   7.891   1.00 0.85 ? 36  ILE A HA   3  
ATOM 3539  H HB   . ILE A 1 36 ? -2.929  7.023   8.378   1.00 0.95 ? 36  ILE A HB   3  
ATOM 3540  H HG12 . ILE A 1 36 ? -1.682  5.137   6.380   1.00 1.63 ? 36  ILE A HG12 3  
ATOM 3541  H HG13 . ILE A 1 36 ? -3.037  4.837   7.461   1.00 1.62 ? 36  ILE A HG13 3  
ATOM 3542  H HG21 . ILE A 1 36 ? -2.710  8.310   6.353   1.00 1.46 ? 36  ILE A HG21 3  
ATOM 3543  H HG22 . ILE A 1 36 ? -1.069  7.710   6.104   1.00 1.45 ? 36  ILE A HG22 3  
ATOM 3544  H HG23 . ILE A 1 36 ? -1.423  8.771   7.467   1.00 1.44 ? 36  ILE A HG23 3  
ATOM 3545  H HD11 . ILE A 1 36 ? -4.078  5.080   5.430   1.00 1.87 ? 36  ILE A HD11 3  
ATOM 3546  H HD12 . ILE A 1 36 ? -2.962  6.334   4.887   1.00 1.71 ? 36  ILE A HD12 3  
ATOM 3547  H HD13 . ILE A 1 36 ? -4.198  6.712   6.090   1.00 1.41 ? 36  ILE A HD13 3  
ATOM 3548  N N    . ILE A 1 37 ? 0.725   8.106   9.151   1.00 1.03 ? 37  ILE A N    3  
ATOM 3549  C CA   . ILE A 1 37 ? 1.253   9.253   9.891   1.00 1.10 ? 37  ILE A CA   3  
ATOM 3550  C C    . ILE A 1 37 ? 0.555   10.548  9.464   1.00 1.10 ? 37  ILE A C    3  
ATOM 3551  O O    . ILE A 1 37 ? 0.161   10.698  8.305   1.00 1.37 ? 37  ILE A O    3  
ATOM 3552  C CB   . ILE A 1 37 ? 2.786   9.387   9.683   1.00 1.14 ? 37  ILE A CB   3  
ATOM 3553  C CG1  . ILE A 1 37 ? 3.531   8.345   10.523  1.00 1.47 ? 37  ILE A CG1  3  
ATOM 3554  C CG2  . ILE A 1 37 ? 3.274   10.789  10.025  1.00 1.32 ? 37  ILE A CG2  3  
ATOM 3555  C CD1  . ILE A 1 37 ? 3.663   6.999   9.845   1.00 1.68 ? 37  ILE A CD1  3  
ATOM 3556  H H    . ILE A 1 37 ? 1.267   7.720   8.432   1.00 1.06 ? 37  ILE A H    3  
ATOM 3557  H HA   . ILE A 1 37 ? 1.067   9.084   10.942  1.00 1.17 ? 37  ILE A HA   3  
ATOM 3558  H HB   . ILE A 1 37 ? 2.999   9.209   8.640   1.00 1.07 ? 37  ILE A HB   3  
ATOM 3559  H HG12 . ILE A 1 37 ? 4.525   8.708   10.735  1.00 1.63 ? 37  ILE A HG12 3  
ATOM 3560  H HG13 . ILE A 1 37 ? 3.002   8.198   11.454  1.00 1.84 ? 37  ILE A HG13 3  
ATOM 3561  H HG21 . ILE A 1 37 ? 2.860   11.096  10.974  1.00 1.40 ? 37  ILE A HG21 3  
ATOM 3562  H HG22 . ILE A 1 37 ? 2.958   11.478  9.255   1.00 1.79 ? 37  ILE A HG22 3  
ATOM 3563  H HG23 . ILE A 1 37 ? 4.353   10.790  10.084  1.00 1.90 ? 37  ILE A HG23 3  
ATOM 3564  H HD11 . ILE A 1 37 ? 4.416   6.413   10.352  1.00 2.18 ? 37  ILE A HD11 3  
ATOM 3565  H HD12 . ILE A 1 37 ? 3.953   7.142   8.814   1.00 1.92 ? 37  ILE A HD12 3  
ATOM 3566  H HD13 . ILE A 1 37 ? 2.717   6.480   9.885   1.00 1.93 ? 37  ILE A HD13 3  
ATOM 3567  N N    . GLU A 1 38 ? 0.408   11.480  10.410  1.00 0.96 ? 38  GLU A N    3  
ATOM 3568  C CA   . GLU A 1 38 ? -0.242  12.764  10.137  1.00 0.99 ? 38  GLU A CA   3  
ATOM 3569  C C    . GLU A 1 38 ? 0.532   13.563  9.088   1.00 1.31 ? 38  GLU A C    3  
ATOM 3570  O O    . GLU A 1 38 ? 1.763   13.521  9.046   1.00 1.64 ? 38  GLU A O    3  
ATOM 3571  C CB   . GLU A 1 38 ? -0.373  13.586  11.424  1.00 1.23 ? 38  GLU A CB   3  
ATOM 3572  C CG   . GLU A 1 38 ? -1.594  13.223  12.256  1.00 1.71 ? 38  GLU A CG   3  
ATOM 3573  C CD   . GLU A 1 38 ? -1.756  14.113  13.473  1.00 2.41 ? 38  GLU A CD   3  
ATOM 3574  O OE1  . GLU A 1 38 ? -2.424  15.162  13.356  1.00 2.79 ? 38  GLU A OE1  3  
ATOM 3575  O OE2  . GLU A 1 38 ? -1.215  13.762  14.542  1.00 3.11 ? 38  GLU A OE2  3  
ATOM 3576  H H    . GLU A 1 38 ? 0.744   11.300  11.314  1.00 0.97 ? 38  GLU A H    3  
ATOM 3577  H HA   . GLU A 1 38 ? -1.230  12.556  9.753   1.00 1.23 ? 38  GLU A HA   3  
ATOM 3578  H HB2  . GLU A 1 38 ? 0.508   13.431  12.029  1.00 1.66 ? 38  GLU A HB2  3  
ATOM 3579  H HB3  . GLU A 1 38 ? -0.440  14.631  11.163  1.00 1.49 ? 38  GLU A HB3  3  
ATOM 3580  H HG2  . GLU A 1 38 ? -2.475  13.319  11.639  1.00 2.01 ? 38  GLU A HG2  3  
ATOM 3581  H HG3  . GLU A 1 38 ? -1.497  12.199  12.587  1.00 1.90 ? 38  GLU A HG3  3  
ATOM 3582  N N    . GLY A 1 39 ? -0.204  14.291  8.248   1.00 1.69 ? 39  GLY A N    3  
ATOM 3583  C CA   . GLY A 1 39 ? 0.413   15.097  7.204   1.00 2.36 ? 39  GLY A CA   3  
ATOM 3584  C C    . GLY A 1 39 ? 1.186   14.277  6.178   1.00 2.68 ? 39  GLY A C    3  
ATOM 3585  O O    . GLY A 1 39 ? 2.029   14.819  5.460   1.00 3.15 ? 39  GLY A O    3  
ATOM 3586  H H    . GLY A 1 39 ? -1.178  14.286  8.340   1.00 1.72 ? 39  GLY A H    3  
ATOM 3587  H HA2  . GLY A 1 39 ? -0.362  15.648  6.691   1.00 2.72 ? 39  GLY A HA2  3  
ATOM 3588  H HA3  . GLY A 1 39 ? 1.087   15.802  7.665   1.00 2.45 ? 39  GLY A HA3  3  
ATOM 3589  N N    . GLY A 1 40 ? 0.908   12.971  6.109   1.00 2.49 ? 40  GLY A N    3  
ATOM 3590  C CA   . GLY A 1 40 ? 1.598   12.108  5.164   1.00 2.80 ? 40  GLY A CA   3  
ATOM 3591  C C    . GLY A 1 40 ? 0.877   11.999  3.831   1.00 2.61 ? 40  GLY A C    3  
ATOM 3592  O O    . GLY A 1 40 ? -0.279  12.403  3.711   1.00 2.37 ? 40  GLY A O    3  
ATOM 3593  H H    . GLY A 1 40 ? 0.232   12.591  6.707   1.00 2.19 ? 40  GLY A H    3  
ATOM 3594  H HA2  . GLY A 1 40 ? 2.588   12.502  4.991   1.00 3.27 ? 40  GLY A HA2  3  
ATOM 3595  H HA3  . GLY A 1 40 ? 1.685   11.121  5.594   1.00 2.80 ? 40  GLY A HA3  3  
ATOM 3596  N N    . ALA A 1 41 ? 1.572   11.456  2.829   1.00 2.83 ? 41  ALA A N    3  
ATOM 3597  C CA   . ALA A 1 41 ? 1.012   11.290  1.485   1.00 2.70 ? 41  ALA A CA   3  
ATOM 3598  C C    . ALA A 1 41 ? -0.401  10.702  1.522   1.00 2.11 ? 41  ALA A C    3  
ATOM 3599  O O    . ALA A 1 41 ? -1.333  11.280  0.963   1.00 2.06 ? 41  ALA A O    3  
ATOM 3600  C CB   . ALA A 1 41 ? 1.925   10.410  0.643   1.00 3.00 ? 41  ALA A CB   3  
ATOM 3601  H H    . ALA A 1 41 ? 2.493   11.166  2.995   1.00 3.11 ? 41  ALA A H    3  
ATOM 3602  H HA   . ALA A 1 41 ? 0.970   12.265  1.022   1.00 2.91 ? 41  ALA A HA   3  
ATOM 3603  H HB1  . ALA A 1 41 ? 2.951   10.708  0.793   1.00 3.45 ? 41  ALA A HB1  3  
ATOM 3604  H HB2  . ALA A 1 41 ? 1.669   10.518  -0.400  1.00 3.26 ? 41  ALA A HB2  3  
ATOM 3605  H HB3  . ALA A 1 41 ? 1.802   9.378   0.939   1.00 2.99 ? 41  ALA A HB3  3  
ATOM 3606  N N    . ALA A 1 42 ? -0.551  9.553   2.185   1.00 1.82 ? 42  ALA A N    3  
ATOM 3607  C CA   . ALA A 1 42 ? -1.850  8.890   2.295   1.00 1.36 ? 42  ALA A CA   3  
ATOM 3608  C C    . ALA A 1 42 ? -2.825  9.709   3.141   1.00 1.16 ? 42  ALA A C    3  
ATOM 3609  O O    . ALA A 1 42 ? -3.960  9.950   2.730   1.00 1.02 ? 42  ALA A O    3  
ATOM 3610  C CB   . ALA A 1 42 ? -1.684  7.494   2.881   1.00 1.50 ? 42  ALA A CB   3  
ATOM 3611  H H    . ALA A 1 42 ? 0.231   9.142   2.611   1.00 2.06 ? 42  ALA A H    3  
ATOM 3612  H HA   . ALA A 1 42 ? -2.255  8.788   1.299   1.00 1.30 ? 42  ALA A HA   3  
ATOM 3613  H HB1  . ALA A 1 42 ? -1.227  6.848   2.146   1.00 1.77 ? 42  ALA A HB1  3  
ATOM 3614  H HB2  . ALA A 1 42 ? -2.652  7.102   3.155   1.00 1.88 ? 42  ALA A HB2  3  
ATOM 3615  H HB3  . ALA A 1 42 ? -1.055  7.544   3.758   1.00 1.93 ? 42  ALA A HB3  3  
ATOM 3616  N N    . HIS A 1 43 ? -2.371  10.128  4.325   1.00 1.34 ? 43  HIS A N    3  
ATOM 3617  C CA   . HIS A 1 43 ? -3.196  10.919  5.242   1.00 1.21 ? 43  HIS A CA   3  
ATOM 3618  C C    . HIS A 1 43 ? -3.782  12.154  4.551   1.00 1.08 ? 43  HIS A C    3  
ATOM 3619  O O    . HIS A 1 43 ? -4.986  12.403  4.626   1.00 1.15 ? 43  HIS A O    3  
ATOM 3620  C CB   . HIS A 1 43 ? -2.363  11.347  6.452   1.00 1.39 ? 43  HIS A CB   3  
ATOM 3621  C CG   . HIS A 1 43 ? -3.139  12.092  7.491   1.00 1.16 ? 43  HIS A CG   3  
ATOM 3622  N ND1  . HIS A 1 43 ? -3.257  13.466  7.499   1.00 1.34 ? 43  HIS A ND1  3  
ATOM 3623  C CD2  . HIS A 1 43 ? -3.829  11.650  8.569   1.00 1.15 ? 43  HIS A CD2  3  
ATOM 3624  C CE1  . HIS A 1 43 ? -3.983  13.837  8.537   1.00 1.22 ? 43  HIS A CE1  3  
ATOM 3625  N NE2  . HIS A 1 43 ? -4.343  12.755  9.202   1.00 1.28 ? 43  HIS A NE2  3  
ATOM 3626  H H    . HIS A 1 43 ? -1.458  9.893   4.593   1.00 1.62 ? 43  HIS A H    3  
ATOM 3627  H HA   . HIS A 1 43 ? -4.007  10.293  5.580   1.00 1.26 ? 43  HIS A HA   3  
ATOM 3628  H HB2  . HIS A 1 43 ? -1.944  10.469  6.919   1.00 1.74 ? 43  HIS A HB2  3  
ATOM 3629  H HB3  . HIS A 1 43 ? -1.559  11.985  6.117   1.00 1.58 ? 43  HIS A HB3  3  
ATOM 3630  H HD1  . HIS A 1 43 ? -2.868  14.078  6.840   1.00 1.69 ? 43  HIS A HD1  3  
ATOM 3631  H HD2  . HIS A 1 43 ? -3.958  10.619  8.869   1.00 1.32 ? 43  HIS A HD2  3  
ATOM 3632  H HE1  . HIS A 1 43 ? -4.234  14.854  8.800   1.00 1.34 ? 43  HIS A HE1  3  
ATOM 3633  H HE2  . HIS A 1 43 ? -4.959  12.739  9.964   1.00 1.60 ? 43  HIS A HE2  3  
ATOM 3634  N N    . LYS A 1 44 ? -2.919  12.922  3.884   1.00 1.15 ? 44  LYS A N    3  
ATOM 3635  C CA   . LYS A 1 44 ? -3.340  14.135  3.182   1.00 1.31 ? 44  LYS A CA   3  
ATOM 3636  C C    . LYS A 1 44 ? -4.256  13.805  2.001   1.00 1.39 ? 44  LYS A C    3  
ATOM 3637  O O    . LYS A 1 44 ? -5.235  14.510  1.755   1.00 1.46 ? 44  LYS A O    3  
ATOM 3638  C CB   . LYS A 1 44 ? -2.118  14.919  2.695   1.00 1.74 ? 44  LYS A CB   3  
ATOM 3639  C CG   . LYS A 1 44 ? -1.351  15.603  3.815   1.00 1.89 ? 44  LYS A CG   3  
ATOM 3640  C CD   . LYS A 1 44 ? -0.297  16.556  3.273   1.00 2.36 ? 44  LYS A CD   3  
ATOM 3641  C CE   . LYS A 1 44 ? 0.309   17.409  4.377   1.00 2.17 ? 44  LYS A CE   3  
ATOM 3642  N NZ   . LYS A 1 44 ? 0.658   18.777  3.900   1.00 2.66 ? 44  LYS A NZ   3  
ATOM 3643  H H    . LYS A 1 44 ? -1.972  12.669  3.866   1.00 1.26 ? 44  LYS A H    3  
ATOM 3644  H HA   . LYS A 1 44 ? -3.889  14.746  3.883   1.00 1.30 ? 44  LYS A HA   3  
ATOM 3645  H HB2  . LYS A 1 44 ? -1.447  14.241  2.189   1.00 2.10 ? 44  LYS A HB2  3  
ATOM 3646  H HB3  . LYS A 1 44 ? -2.445  15.676  1.997   1.00 2.02 ? 44  LYS A HB3  3  
ATOM 3647  H HG2  . LYS A 1 44 ? -2.044  16.162  4.425   1.00 1.94 ? 44  LYS A HG2  3  
ATOM 3648  H HG3  . LYS A 1 44 ? -0.865  14.850  4.418   1.00 2.08 ? 44  LYS A HG3  3  
ATOM 3649  H HD2  . LYS A 1 44 ? 0.490   15.980  2.806   1.00 2.71 ? 44  LYS A HD2  3  
ATOM 3650  H HD3  . LYS A 1 44 ? -0.755  17.204  2.539   1.00 2.84 ? 44  LYS A HD3  3  
ATOM 3651  H HE2  . LYS A 1 44 ? -0.405  17.492  5.183   1.00 2.08 ? 44  LYS A HE2  3  
ATOM 3652  H HE3  . LYS A 1 44 ? 1.203   16.925  4.739   1.00 2.50 ? 44  LYS A HE3  3  
ATOM 3653  H HZ1  . LYS A 1 44 ? 1.302   18.718  3.085   1.00 3.12 ? 44  LYS A HZ1  3  
ATOM 3654  H HZ2  . LYS A 1 44 ? 1.127   19.312  4.660   1.00 3.21 ? 44  LYS A HZ2  3  
ATOM 3655  H HZ3  . LYS A 1 44 ? -0.201  19.287  3.612   1.00 2.66 ? 44  LYS A HZ3  3  
ATOM 3656  N N    . ASP A 1 45 ? -3.933  12.730  1.278   1.00 1.59 ? 45  ASP A N    3  
ATOM 3657  C CA   . ASP A 1 45 ? -4.731  12.305  0.126   1.00 1.86 ? 45  ASP A CA   3  
ATOM 3658  C C    . ASP A 1 45 ? -6.154  11.935  0.550   1.00 1.89 ? 45  ASP A C    3  
ATOM 3659  O O    . ASP A 1 45 ? -7.126  12.394  -0.051  1.00 1.97 ? 45  ASP A O    3  
ATOM 3660  C CB   . ASP A 1 45 ? -4.064  11.113  -0.572  1.00 2.33 ? 45  ASP A CB   3  
ATOM 3661  C CG   . ASP A 1 45 ? -4.565  10.905  -1.988  1.00 2.69 ? 45  ASP A CG   3  
ATOM 3662  O OD1  . ASP A 1 45 ? -4.443  11.842  -2.807  1.00 2.80 ? 45  ASP A OD1  3  
ATOM 3663  O OD2  . ASP A 1 45 ? -5.075  9.805   -2.282  1.00 3.24 ? 45  ASP A OD2  3  
ATOM 3664  H H    . ASP A 1 45 ? -3.141  12.207  1.526   1.00 1.67 ? 45  ASP A H    3  
ATOM 3665  H HA   . ASP A 1 45 ? -4.779  13.133  -0.566  1.00 1.92 ? 45  ASP A HA   3  
ATOM 3666  H HB2  . ASP A 1 45 ? -2.998  11.279  -0.610  1.00 2.40 ? 45  ASP A HB2  3  
ATOM 3667  H HB3  . ASP A 1 45 ? -4.264  10.215  -0.004  1.00 2.46 ? 45  ASP A HB3  3  
ATOM 3668  N N    . GLY A 1 46 ? -6.262  11.105  1.591   1.00 2.08 ? 46  GLY A N    3  
ATOM 3669  C CA   . GLY A 1 46 ? -7.566  10.686  2.086   1.00 2.49 ? 46  GLY A CA   3  
ATOM 3670  C C    . GLY A 1 46 ? -8.058  9.387   1.463   1.00 2.11 ? 46  GLY A C    3  
ATOM 3671  O O    . GLY A 1 46 ? -8.838  8.661   2.080   1.00 2.47 ? 46  GLY A O    3  
ATOM 3672  H H    . GLY A 1 46 ? -5.446  10.780  2.025   1.00 2.09 ? 46  GLY A H    3  
ATOM 3673  H HA2  . GLY A 1 46 ? -7.502  10.553  3.156   1.00 2.83 ? 46  GLY A HA2  3  
ATOM 3674  H HA3  . GLY A 1 46 ? -8.284  11.465  1.876   1.00 3.17 ? 46  GLY A HA3  3  
ATOM 3675  N N    . LYS A 1 47 ? -7.606  9.095   0.239   1.00 1.87 ? 47  LYS A N    3  
ATOM 3676  C CA   . LYS A 1 47 ? -8.009  7.877   -0.462  1.00 2.32 ? 47  LYS A CA   3  
ATOM 3677  C C    . LYS A 1 47 ? -7.562  6.627   0.297   1.00 1.93 ? 47  LYS A C    3  
ATOM 3678  O O    . LYS A 1 47 ? -8.339  5.687   0.469   1.00 1.95 ? 47  LYS A O    3  
ATOM 3679  C CB   . LYS A 1 47 ? -7.427  7.860   -1.880  1.00 2.80 ? 47  LYS A CB   3  
ATOM 3680  C CG   . LYS A 1 47 ? -8.294  7.126   -2.891  1.00 3.64 ? 47  LYS A CG   3  
ATOM 3681  C CD   . LYS A 1 47 ? -9.168  8.089   -3.680  1.00 4.17 ? 47  LYS A CD   3  
ATOM 3682  C CE   . LYS A 1 47 ? -10.646 7.761   -3.526  1.00 5.03 ? 47  LYS A CE   3  
ATOM 3683  N NZ   . LYS A 1 47 ? -11.153 8.087   -2.163  1.00 5.67 ? 47  LYS A NZ   3  
ATOM 3684  H H    . LYS A 1 47 ? -6.986  9.713   -0.200  1.00 1.83 ? 47  LYS A H    3  
ATOM 3685  H HA   . LYS A 1 47 ? -9.086  7.875   -0.526  1.00 3.00 ? 47  LYS A HA   3  
ATOM 3686  H HB2  . LYS A 1 47 ? -7.306  8.879   -2.217  1.00 2.86 ? 47  LYS A HB2  3  
ATOM 3687  H HB3  . LYS A 1 47 ? -6.459  7.383   -1.853  1.00 3.00 ? 47  LYS A HB3  3  
ATOM 3688  H HG2  . LYS A 1 47 ? -7.653  6.593   -3.578  1.00 4.05 ? 47  LYS A HG2  3  
ATOM 3689  H HG3  . LYS A 1 47 ? -8.926  6.424   -2.368  1.00 3.92 ? 47  LYS A HG3  3  
ATOM 3690  H HD2  . LYS A 1 47 ? -8.996  9.094   -3.324  1.00 4.28 ? 47  LYS A HD2  3  
ATOM 3691  H HD3  . LYS A 1 47 ? -8.903  8.026   -4.725  1.00 4.30 ? 47  LYS A HD3  3  
ATOM 3692  H HE2  . LYS A 1 47 ? -11.206 8.329   -4.254  1.00 5.17 ? 47  LYS A HE2  3  
ATOM 3693  H HE3  . LYS A 1 47 ? -10.788 6.705   -3.710  1.00 5.45 ? 47  LYS A HE3  3  
ATOM 3694  H HZ1  . LYS A 1 47 ? -12.191 8.162   -2.177  1.00 5.78 ? 47  LYS A HZ1  3  
ATOM 3695  H HZ2  . LYS A 1 47 ? -10.756 8.992   -1.840  1.00 5.80 ? 47  LYS A HZ2  3  
ATOM 3696  H HZ3  . LYS A 1 47 ? -10.881 7.342   -1.491  1.00 6.21 ? 47  LYS A HZ3  3  
ATOM 3697  N N    . LEU A 1 48 ? -6.305  6.624   0.747   1.00 1.68 ? 48  LEU A N    3  
ATOM 3698  C CA   . LEU A 1 48 ? -5.758  5.487   1.482   1.00 1.38 ? 48  LEU A CA   3  
ATOM 3699  C C    . LEU A 1 48 ? -6.138  5.545   2.961   1.00 1.28 ? 48  LEU A C    3  
ATOM 3700  O O    . LEU A 1 48 ? -5.833  6.515   3.658   1.00 1.35 ? 48  LEU A O    3  
ATOM 3701  C CB   . LEU A 1 48 ? -4.233  5.425   1.335   1.00 1.19 ? 48  LEU A CB   3  
ATOM 3702  C CG   . LEU A 1 48 ? -3.625  4.023   1.456   1.00 1.09 ? 48  LEU A CG   3  
ATOM 3703  C CD1  . LEU A 1 48 ? -2.263  3.967   0.781   1.00 1.56 ? 48  LEU A CD1  3  
ATOM 3704  C CD2  . LEU A 1 48 ? -3.515  3.611   2.917   1.00 1.06 ? 48  LEU A CD2  3  
ATOM 3705  H H    . LEU A 1 48 ? -5.735  7.403   0.572   1.00 1.80 ? 48  LEU A H    3  
ATOM 3706  H HA   . LEU A 1 48 ? -6.182  4.589   1.055   1.00 1.52 ? 48  LEU A HA   3  
ATOM 3707  H HB2  . LEU A 1 48 ? -3.968  5.826   0.366   1.00 1.43 ? 48  LEU A HB2  3  
ATOM 3708  H HB3  . LEU A 1 48 ? -3.792  6.050   2.097   1.00 1.29 ? 48  LEU A HB3  3  
ATOM 3709  H HG   . LEU A 1 48 ? -4.272  3.313   0.960   1.00 1.25 ? 48  LEU A HG   3  
ATOM 3710  H HD11 . LEU A 1 48 ? -1.488  4.131   1.516   1.00 2.04 ? 48  LEU A HD11 3  
ATOM 3711  H HD12 . LEU A 1 48 ? -2.205  4.732   0.021   1.00 1.85 ? 48  LEU A HD12 3  
ATOM 3712  H HD13 . LEU A 1 48 ? -2.127  2.997   0.325   1.00 2.03 ? 48  LEU A HD13 3  
ATOM 3713  H HD21 . LEU A 1 48 ? -2.572  3.951   3.319   1.00 1.74 ? 48  LEU A HD21 3  
ATOM 3714  H HD22 . LEU A 1 48 ? -3.571  2.535   2.990   1.00 1.43 ? 48  LEU A HD22 3  
ATOM 3715  H HD23 . LEU A 1 48 ? -4.325  4.051   3.478   1.00 1.30 ? 48  LEU A HD23 3  
ATOM 3716  N N    . GLN A 1 49 ? -6.797  4.485   3.429   1.00 1.21 ? 49  GLN A N    3  
ATOM 3717  C CA   . GLN A 1 49 ? -7.221  4.371   4.819   1.00 1.17 ? 49  GLN A CA   3  
ATOM 3718  C C    . GLN A 1 49 ? -6.795  3.017   5.390   1.00 1.09 ? 49  GLN A C    3  
ATOM 3719  O O    . GLN A 1 49 ? -6.784  2.014   4.675   1.00 1.14 ? 49  GLN A O    3  
ATOM 3720  C CB   . GLN A 1 49 ? -8.741  4.544   4.930   1.00 1.30 ? 49  GLN A CB   3  
ATOM 3721  C CG   . GLN A 1 49 ? -9.549  3.433   4.269   1.00 1.46 ? 49  GLN A CG   3  
ATOM 3722  C CD   . GLN A 1 49 ? -9.719  3.636   2.774   1.00 1.45 ? 49  GLN A CD   3  
ATOM 3723  O OE1  . GLN A 1 49 ? -10.439 4.534   2.335   1.00 1.54 ? 49  GLN A OE1  3  
ATOM 3724  N NE2  . GLN A 1 49 ? -9.055  2.800   1.981   1.00 1.52 ? 49  GLN A NE2  3  
ATOM 3725  H H    . GLN A 1 49 ? -6.995  3.748   2.818   1.00 1.26 ? 49  GLN A H    3  
ATOM 3726  H HA   . GLN A 1 49 ? -6.736  5.155   5.381   1.00 1.19 ? 49  GLN A HA   3  
ATOM 3727  H HB2  . GLN A 1 49 ? -9.008  4.576   5.973   1.00 1.32 ? 49  GLN A HB2  3  
ATOM 3728  H HB3  . GLN A 1 49 ? -9.018  5.481   4.470   1.00 1.34 ? 49  GLN A HB3  3  
ATOM 3729  H HG2  . GLN A 1 49 ? -9.047  2.492   4.433   1.00 1.57 ? 49  GLN A HG2  3  
ATOM 3730  H HG3  . GLN A 1 49 ? -10.528 3.400   4.725   1.00 1.59 ? 49  GLN A HG3  3  
ATOM 3731  H HE21 . GLN A 1 49 ? -8.500  2.109   2.398   1.00 1.62 ? 49  GLN A HE21 3  
ATOM 3732  H HE22 . GLN A 1 49 ? -9.148  2.911   1.012   1.00 1.56 ? 49  GLN A HE22 3  
ATOM 3733  N N    . ILE A 1 50 ? -6.437  2.993   6.675   1.00 1.06 ? 50  ILE A N    3  
ATOM 3734  C CA   . ILE A 1 50 ? -6.002  1.757   7.333   1.00 1.03 ? 50  ILE A CA   3  
ATOM 3735  C C    . ILE A 1 50 ? -6.958  0.598   7.032   1.00 1.05 ? 50  ILE A C    3  
ATOM 3736  O O    . ILE A 1 50 ? -8.156  0.685   7.306   1.00 1.16 ? 50  ILE A O    3  
ATOM 3737  C CB   . ILE A 1 50 ? -5.886  1.937   8.865   1.00 1.08 ? 50  ILE A CB   3  
ATOM 3738  C CG1  . ILE A 1 50 ? -4.895  3.058   9.202   1.00 1.76 ? 50  ILE A CG1  3  
ATOM 3739  C CG2  . ILE A 1 50 ? -5.458  0.634   9.528   1.00 1.14 ? 50  ILE A CG2  3  
ATOM 3740  C CD1  . ILE A 1 50 ? -5.501  4.178   10.018  1.00 2.56 ? 50  ILE A CD1  3  
ATOM 3741  H H    . ILE A 1 50 ? -6.462  3.826   7.193   1.00 1.12 ? 50  ILE A H    3  
ATOM 3742  H HA   . ILE A 1 50 ? -5.023  1.507   6.948   1.00 1.00 ? 50  ILE A HA   3  
ATOM 3743  H HB   . ILE A 1 50 ? -6.859  2.202   9.248   1.00 1.51 ? 50  ILE A HB   3  
ATOM 3744  H HG12 . ILE A 1 50 ? -4.072  2.645   9.768   1.00 1.94 ? 50  ILE A HG12 3  
ATOM 3745  H HG13 . ILE A 1 50 ? -4.514  3.482   8.284   1.00 2.32 ? 50  ILE A HG13 3  
ATOM 3746  H HG21 . ILE A 1 50 ? -6.273  -0.074  9.491   1.00 1.55 ? 50  ILE A HG21 3  
ATOM 3747  H HG22 . ILE A 1 50 ? -5.192  0.822   10.557  1.00 1.63 ? 50  ILE A HG22 3  
ATOM 3748  H HG23 . ILE A 1 50 ? -4.605  0.227   9.005   1.00 1.57 ? 50  ILE A HG23 3  
ATOM 3749  H HD11 . ILE A 1 50 ? -4.715  4.810   10.404  1.00 3.13 ? 50  ILE A HD11 3  
ATOM 3750  H HD12 . ILE A 1 50 ? -6.064  3.761   10.841  1.00 2.96 ? 50  ILE A HD12 3  
ATOM 3751  H HD13 . ILE A 1 50 ? -6.160  4.763   9.392   1.00 2.79 ? 50  ILE A HD13 3  
ATOM 3752  N N    . GLY A 1 51 ? -6.414  -0.482  6.463   1.00 1.02 ? 51  GLY A N    3  
ATOM 3753  C CA   . GLY A 1 51 ? -7.223  -1.645  6.127   1.00 1.10 ? 51  GLY A CA   3  
ATOM 3754  C C    . GLY A 1 51 ? -7.194  -1.992  4.646   1.00 1.04 ? 51  GLY A C    3  
ATOM 3755  O O    . GLY A 1 51 ? -7.447  -3.141  4.281   1.00 1.03 ? 51  GLY A O    3  
ATOM 3756  H H    . GLY A 1 51 ? -5.454  -0.492  6.262   1.00 0.99 ? 51  GLY A H    3  
ATOM 3757  H HA2  . GLY A 1 51 ? -6.854  -2.493  6.683   1.00 1.22 ? 51  GLY A HA2  3  
ATOM 3758  H HA3  . GLY A 1 51 ? -8.245  -1.463  6.417   1.00 1.14 ? 51  GLY A HA3  3  
ATOM 3759  N N    . ASP A 1 52 ? -6.886  -1.013  3.786   1.00 1.04 ? 52  ASP A N    3  
ATOM 3760  C CA   . ASP A 1 52 ? -6.831  -1.261  2.352   1.00 1.01 ? 52  ASP A CA   3  
ATOM 3761  C C    . ASP A 1 52 ? -5.666  -2.180  2.000   1.00 0.91 ? 52  ASP A C    3  
ATOM 3762  O O    . ASP A 1 52 ? -4.663  -2.242  2.725   1.00 0.88 ? 52  ASP A O    3  
ATOM 3763  C CB   . ASP A 1 52 ? -6.720  0.052   1.563   1.00 1.03 ? 52  ASP A CB   3  
ATOM 3764  C CG   . ASP A 1 52 ? -5.718  1.033   2.139   1.00 1.11 ? 52  ASP A CG   3  
ATOM 3765  O OD1  . ASP A 1 52 ? -4.684  0.595   2.688   1.00 1.55 ? 52  ASP A OD1  3  
ATOM 3766  O OD2  . ASP A 1 52 ? -5.971  2.247   2.031   1.00 1.56 ? 52  ASP A OD2  3  
ATOM 3767  H H    . ASP A 1 52 ? -6.691  -0.116  4.117   1.00 1.07 ? 52  ASP A H    3  
ATOM 3768  H HA   . ASP A 1 52 ? -7.750  -1.750  2.080   1.00 1.08 ? 52  ASP A HA   3  
ATOM 3769  H HB2  . ASP A 1 52 ? -6.418  -0.169  0.553   1.00 0.99 ? 52  ASP A HB2  3  
ATOM 3770  H HB3  . ASP A 1 52 ? -7.687  0.528   1.545   1.00 1.18 ? 52  ASP A HB3  3  
ATOM 3771  N N    . LYS A 1 53 ? -5.800  -2.883  0.876   1.00 0.88 ? 53  LYS A N    3  
ATOM 3772  C CA   . LYS A 1 53 ? -4.756  -3.790  0.419   1.00 0.82 ? 53  LYS A CA   3  
ATOM 3773  C C    . LYS A 1 53 ? -4.108  -3.274  -0.858  1.00 0.76 ? 53  LYS A C    3  
ATOM 3774  O O    . LYS A 1 53 ? -4.745  -2.606  -1.674  1.00 0.87 ? 53  LYS A O    3  
ATOM 3775  C CB   . LYS A 1 53 ? -5.320  -5.192  0.188   1.00 0.94 ? 53  LYS A CB   3  
ATOM 3776  C CG   . LYS A 1 53 ? -6.522  -5.231  -0.743  1.00 1.33 ? 53  LYS A CG   3  
ATOM 3777  C CD   . LYS A 1 53 ? -7.776  -5.685  -0.010  1.00 1.83 ? 53  LYS A CD   3  
ATOM 3778  C CE   . LYS A 1 53 ? -8.413  -6.889  -0.689  1.00 2.37 ? 53  LYS A CE   3  
ATOM 3779  N NZ   . LYS A 1 53 ? -8.434  -8.086  0.198   1.00 3.23 ? 53  LYS A NZ   3  
ATOM 3780  H H    . LYS A 1 53 ? -6.612  -2.779  0.337   1.00 0.92 ? 53  LYS A H    3  
ATOM 3781  H HA   . LYS A 1 53 ? -4.002  -3.841  1.192   1.00 0.82 ? 53  LYS A HA   3  
ATOM 3782  H HB2  . LYS A 1 53 ? -4.545  -5.814  -0.237  1.00 1.54 ? 53  LYS A HB2  3  
ATOM 3783  H HB3  . LYS A 1 53 ? -5.616  -5.604  1.137   1.00 1.39 ? 53  LYS A HB3  3  
ATOM 3784  H HG2  . LYS A 1 53 ? -6.688  -4.242  -1.141  1.00 1.78 ? 53  LYS A HG2  3  
ATOM 3785  H HG3  . LYS A 1 53 ? -6.316  -5.917  -1.550  1.00 1.86 ? 53  LYS A HG3  3  
ATOM 3786  H HD2  . LYS A 1 53 ? -7.512  -5.951  1.003   1.00 2.39 ? 53  LYS A HD2  3  
ATOM 3787  H HD3  . LYS A 1 53 ? -8.485  -4.871  0.003   1.00 2.03 ? 53  LYS A HD3  3  
ATOM 3788  H HE2  . LYS A 1 53 ? -9.427  -6.636  -0.960  1.00 2.44 ? 53  LYS A HE2  3  
ATOM 3789  H HE3  . LYS A 1 53 ? -7.853  -7.123  -1.582  1.00 2.77 ? 53  LYS A HE3  3  
ATOM 3790  H HZ1  . LYS A 1 53 ? -8.780  -7.825  1.144   1.00 3.81 ? 53  LYS A HZ1  3  
ATOM 3791  H HZ2  . LYS A 1 53 ? -7.477  -8.482  0.287   1.00 3.55 ? 53  LYS A HZ2  3  
ATOM 3792  H HZ3  . LYS A 1 53 ? -9.062  -8.813  -0.199  1.00 3.45 ? 53  LYS A HZ3  3  
ATOM 3793  N N    . LEU A 1 54 ? -2.832  -3.586  -1.003  1.00 0.64 ? 54  LEU A N    3  
ATOM 3794  C CA   . LEU A 1 54 ? -2.068  -3.149  -2.161  1.00 0.66 ? 54  LEU A CA   3  
ATOM 3795  C C    . LEU A 1 54 ? -1.980  -4.239  -3.222  1.00 0.64 ? 54  LEU A C    3  
ATOM 3796  O O    . LEU A 1 54 ? -1.369  -5.289  -3.012  1.00 0.79 ? 54  LEU A O    3  
ATOM 3797  C CB   . LEU A 1 54 ? -0.676  -2.673  -1.746  1.00 0.73 ? 54  LEU A CB   3  
ATOM 3798  C CG   . LEU A 1 54 ? -0.424  -1.180  -1.963  1.00 0.83 ? 54  LEU A CG   3  
ATOM 3799  C CD1  . LEU A 1 54 ? 0.708   -0.689  -1.073  1.00 1.11 ? 54  LEU A CD1  3  
ATOM 3800  C CD2  . LEU A 1 54 ? -0.122  -0.896  -3.427  1.00 1.72 ? 54  LEU A CD2  3  
ATOM 3801  H H    . LEU A 1 54 ? -2.410  -4.102  -0.279  1.00 0.62 ? 54  LEU A H    3  
ATOM 3802  H HA   . LEU A 1 54 ? -2.597  -2.311  -2.590  1.00 0.75 ? 54  LEU A HA   3  
ATOM 3803  H HB2  . LEU A 1 54 ? -0.546  -2.889  -0.696  1.00 1.24 ? 54  LEU A HB2  3  
ATOM 3804  H HB3  . LEU A 1 54 ? 0.060   -3.228  -2.307  1.00 1.21 ? 54  LEU A HB3  3  
ATOM 3805  H HG   . LEU A 1 54 ? -1.315  -0.631  -1.694  1.00 1.18 ? 54  LEU A HG   3  
ATOM 3806  H HD11 . LEU A 1 54 ? 0.415   0.235   -0.595  1.00 1.58 ? 54  LEU A HD11 3  
ATOM 3807  H HD12 . LEU A 1 54 ? 1.591   -0.519  -1.672  1.00 1.88 ? 54  LEU A HD12 3  
ATOM 3808  H HD13 . LEU A 1 54 ? 0.923   -1.431  -0.318  1.00 1.17 ? 54  LEU A HD13 3  
ATOM 3809  H HD21 . LEU A 1 54 ? 0.199   -1.805  -3.913  1.00 2.31 ? 54  LEU A HD21 3  
ATOM 3810  H HD22 . LEU A 1 54 ? 0.661   -0.156  -3.496  1.00 2.00 ? 54  LEU A HD22 3  
ATOM 3811  H HD23 . LEU A 1 54 ? -1.011  -0.524  -3.912  1.00 2.08 ? 54  LEU A HD23 3  
ATOM 3812  N N    . LEU A 1 55 ? -2.597  -3.960  -4.369  1.00 0.56 ? 55  LEU A N    3  
ATOM 3813  C CA   . LEU A 1 55 ? -2.607  -4.880  -5.496  1.00 0.58 ? 55  LEU A CA   3  
ATOM 3814  C C    . LEU A 1 55 ? -1.259  -4.860  -6.205  1.00 0.54 ? 55  LEU A C    3  
ATOM 3815  O O    . LEU A 1 55 ? -0.660  -5.913  -6.425  1.00 0.56 ? 55  LEU A O    3  
ATOM 3816  C CB   . LEU A 1 55 ? -3.723  -4.513  -6.479  1.00 0.66 ? 55  LEU A CB   3  
ATOM 3817  C CG   . LEU A 1 55 ? -3.915  -5.496  -7.639  1.00 0.91 ? 55  LEU A CG   3  
ATOM 3818  C CD1  . LEU A 1 55 ? -4.903  -6.590  -7.257  1.00 1.27 ? 55  LEU A CD1  3  
ATOM 3819  C CD2  . LEU A 1 55 ? -4.382  -4.762  -8.889  1.00 1.87 ? 55  LEU A CD2  3  
ATOM 3820  H H    . LEU A 1 55 ? -3.053  -3.100  -4.461  1.00 0.58 ? 55  LEU A H    3  
ATOM 3821  H HA   . LEU A 1 55 ? -2.786  -5.874  -5.114  1.00 0.62 ? 55  LEU A HA   3  
ATOM 3822  H HB2  . LEU A 1 55 ? -4.651  -4.447  -5.929  1.00 0.75 ? 55  LEU A HB2  3  
ATOM 3823  H HB3  . LEU A 1 55 ? -3.501  -3.541  -6.895  1.00 0.98 ? 55  LEU A HB3  3  
ATOM 3824  H HG   . LEU A 1 55 ? -2.970  -5.967  -7.862  1.00 1.50 ? 55  LEU A HG   3  
ATOM 3825  H HD11 . LEU A 1 55 ? -4.604  -7.521  -7.717  1.00 1.70 ? 55  LEU A HD11 3  
ATOM 3826  H HD12 . LEU A 1 55 ? -5.891  -6.321  -7.600  1.00 1.74 ? 55  LEU A HD12 3  
ATOM 3827  H HD13 . LEU A 1 55 ? -4.914  -6.707  -6.183  1.00 1.86 ? 55  LEU A HD13 3  
ATOM 3828  H HD21 . LEU A 1 55 ? -5.335  -5.159  -9.207  1.00 2.39 ? 55  LEU A HD21 3  
ATOM 3829  H HD22 . LEU A 1 55 ? -3.656  -4.896  -9.677  1.00 2.39 ? 55  LEU A HD22 3  
ATOM 3830  H HD23 . LEU A 1 55 ? -4.487  -3.709  -8.672  1.00 2.37 ? 55  LEU A HD23 3  
ATOM 3831  N N    . ALA A 1 56 ? -0.780  -3.662  -6.565  1.00 0.51 ? 56  ALA A N    3  
ATOM 3832  C CA   . ALA A 1 56 ? 0.510   -3.547  -7.250  1.00 0.49 ? 56  ALA A CA   3  
ATOM 3833  C C    . ALA A 1 56 ? 1.163   -2.176  -7.029  1.00 0.53 ? 56  ALA A C    3  
ATOM 3834  O O    . ALA A 1 56 ? 0.494   -1.213  -6.659  1.00 0.67 ? 56  ALA A O    3  
ATOM 3835  C CB   . ALA A 1 56 ? 0.328   -3.808  -8.745  1.00 0.54 ? 56  ALA A CB   3  
ATOM 3836  H H    . ALA A 1 56 ? -1.307  -2.842  -6.370  1.00 0.53 ? 56  ALA A H    3  
ATOM 3837  H HA   . ALA A 1 56 ? 1.163   -4.320  -6.846  1.00 0.52 ? 56  ALA A HA   3  
ATOM 3838  H HB1  . ALA A 1 56 ? -0.456  -3.169  -9.126  1.00 1.19 ? 56  ALA A HB1  3  
ATOM 3839  H HB2  . ALA A 1 56 ? 0.056   -4.842  -8.907  1.00 0.99 ? 56  ALA A HB2  3  
ATOM 3840  H HB3  . ALA A 1 56 ? 1.249   -3.591  -9.267  1.00 1.25 ? 56  ALA A HB3  3  
ATOM 3841  N N    . VAL A 1 57 ? 2.479   -2.099  -7.259  1.00 0.50 ? 57  VAL A N    3  
ATOM 3842  C CA   . VAL A 1 57 ? 3.221   -0.849  -7.090  1.00 0.59 ? 57  VAL A CA   3  
ATOM 3843  C C    . VAL A 1 57 ? 4.329   -0.707  -8.136  1.00 0.53 ? 57  VAL A C    3  
ATOM 3844  O O    . VAL A 1 57 ? 5.332   -1.416  -8.093  1.00 0.52 ? 57  VAL A O    3  
ATOM 3845  C CB   . VAL A 1 57 ? 3.843   -0.737  -5.680  1.00 0.77 ? 57  VAL A CB   3  
ATOM 3846  C CG1  . VAL A 1 57 ? 4.669   0.536   -5.552  1.00 1.42 ? 57  VAL A CG1  3  
ATOM 3847  C CG2  . VAL A 1 57 ? 2.762   -0.778  -4.613  1.00 1.47 ? 57  VAL A CG2  3  
ATOM 3848  H H    . VAL A 1 57 ? 2.960   -2.911  -7.544  1.00 0.48 ? 57  VAL A H    3  
ATOM 3849  H HA   . VAL A 1 57 ? 2.523   -0.033  -7.214  1.00 0.66 ? 57  VAL A HA   3  
ATOM 3850  H HB   . VAL A 1 57 ? 4.499   -1.581  -5.530  1.00 1.34 ? 57  VAL A HB   3  
ATOM 3851  H HG11 . VAL A 1 57 ? 4.144   1.356   -6.018  1.00 1.89 ? 57  VAL A HG11 3  
ATOM 3852  H HG12 . VAL A 1 57 ? 5.623   0.397   -6.039  1.00 1.82 ? 57  VAL A HG12 3  
ATOM 3853  H HG13 . VAL A 1 57 ? 4.829   0.758   -4.506  1.00 2.12 ? 57  VAL A HG13 3  
ATOM 3854  H HG21 . VAL A 1 57 ? 2.044   0.008   -4.799  1.00 1.95 ? 57  VAL A HG21 3  
ATOM 3855  H HG22 . VAL A 1 57 ? 3.209   -0.636  -3.641  1.00 1.95 ? 57  VAL A HG22 3  
ATOM 3856  H HG23 . VAL A 1 57 ? 2.263   -1.735  -4.644  1.00 2.01 ? 57  VAL A HG23 3  
ATOM 3857  N N    . ASN A 1 58 ? 4.135   0.219   -9.076  1.00 0.57 ? 58  ASN A N    3  
ATOM 3858  C CA   . ASN A 1 58 ? 5.115   0.466   -10.136 1.00 0.58 ? 58  ASN A CA   3  
ATOM 3859  C C    . ASN A 1 58 ? 5.267   -0.756  -11.050 1.00 0.59 ? 58  ASN A C    3  
ATOM 3860  O O    . ASN A 1 58 ? 6.381   -1.210  -11.321 1.00 0.60 ? 58  ASN A O    3  
ATOM 3861  C CB   . ASN A 1 58 ? 6.470   0.860   -9.528  1.00 0.57 ? 58  ASN A CB   3  
ATOM 3862  C CG   . ASN A 1 58 ? 6.955   2.213   -10.015 1.00 0.80 ? 58  ASN A CG   3  
ATOM 3863  O OD1  . ASN A 1 58 ? 7.333   2.367   -11.177 1.00 1.39 ? 58  ASN A OD1  3  
ATOM 3864  N ND2  . ASN A 1 58 ? 6.947   3.204   -9.129  1.00 1.49 ? 58  ASN A ND2  3  
ATOM 3865  H H    . ASN A 1 58 ? 3.310   0.748   -9.057  1.00 0.63 ? 58  ASN A H    3  
ATOM 3866  H HA   . ASN A 1 58 ? 4.749   1.292   -10.729 1.00 0.65 ? 58  ASN A HA   3  
ATOM 3867  H HB2  . ASN A 1 58 ? 6.378   0.900   -8.454  1.00 0.64 ? 58  ASN A HB2  3  
ATOM 3868  H HB3  . ASN A 1 58 ? 7.209   0.117   -9.793  1.00 0.74 ? 58  ASN A HB3  3  
ATOM 3869  H HD21 . ASN A 1 58 ? 6.634   3.012   -8.219  1.00 2.05 ? 58  ASN A HD21 3  
ATOM 3870  H HD22 . ASN A 1 58 ? 7.255   4.087   -9.420  1.00 1.75 ? 58  ASN A HD22 3  
ATOM 3871  N N    . ASN A 1 59 ? 4.126   -1.270  -11.524 1.00 0.60 ? 59  ASN A N    3  
ATOM 3872  C CA   . ASN A 1 59 ? 4.083   -2.434  -12.424 1.00 0.65 ? 59  ASN A CA   3  
ATOM 3873  C C    . ASN A 1 59 ? 4.294   -3.770  -11.695 1.00 0.61 ? 59  ASN A C    3  
ATOM 3874  O O    . ASN A 1 59 ? 4.043   -4.829  -12.276 1.00 0.67 ? 59  ASN A O    3  
ATOM 3875  C CB   . ASN A 1 59 ? 5.111   -2.297  -13.557 1.00 0.71 ? 59  ASN A CB   3  
ATOM 3876  C CG   . ASN A 1 59 ? 4.869   -1.072  -14.422 1.00 1.18 ? 59  ASN A CG   3  
ATOM 3877  O OD1  . ASN A 1 59 ? 5.220   0.047   -14.047 1.00 1.74 ? 59  ASN A OD1  3  
ATOM 3878  N ND2  . ASN A 1 59 ? 4.267   -1.279  -15.589 1.00 1.52 ? 59  ASN A ND2  3  
ATOM 3879  H H    . ASN A 1 59 ? 3.284   -0.844  -11.262 1.00 0.61 ? 59  ASN A H    3  
ATOM 3880  H HA   . ASN A 1 59 ? 3.098   -2.451  -12.866 1.00 0.68 ? 59  ASN A HA   3  
ATOM 3881  H HB2  . ASN A 1 59 ? 6.101   -2.224  -13.132 1.00 0.83 ? 59  ASN A HB2  3  
ATOM 3882  H HB3  . ASN A 1 59 ? 5.060   -3.173  -14.185 1.00 0.74 ? 59  ASN A HB3  3  
ATOM 3883  H HD21 . ASN A 1 59 ? 4.015   -2.196  -15.826 1.00 1.74 ? 59  ASN A HD21 3  
ATOM 3884  H HD22 . ASN A 1 59 ? 4.100   -0.504  -16.166 1.00 1.84 ? 59  ASN A HD22 3  
ATOM 3885  N N    . VAL A 1 60 ? 4.743   -3.738  -10.433 1.00 0.53 ? 60  VAL A N    3  
ATOM 3886  C CA   . VAL A 1 60 ? 4.957   -4.974  -9.677  1.00 0.52 ? 60  VAL A CA   3  
ATOM 3887  C C    . VAL A 1 60 ? 3.759   -5.276  -8.786  1.00 0.51 ? 60  VAL A C    3  
ATOM 3888  O O    . VAL A 1 60 ? 3.164   -4.364  -8.221  1.00 0.50 ? 60  VAL A O    3  
ATOM 3889  C CB   . VAL A 1 60 ? 6.234   -4.916  -8.802  1.00 0.50 ? 60  VAL A CB   3  
ATOM 3890  C CG1  . VAL A 1 60 ? 7.440   -4.477  -9.622  1.00 0.51 ? 60  VAL A CG1  3  
ATOM 3891  C CG2  . VAL A 1 60 ? 6.044   -4.004  -7.595  1.00 0.54 ? 60  VAL A CG2  3  
ATOM 3892  H H    . VAL A 1 60 ? 4.921   -2.878  -10.000 1.00 0.52 ? 60  VAL A H    3  
ATOM 3893  H HA   . VAL A 1 60 ? 5.072   -5.780  -10.388 1.00 0.56 ? 60  VAL A HA   3  
ATOM 3894  H HB   . VAL A 1 60 ? 6.425   -5.911  -8.435  1.00 0.58 ? 60  VAL A HB   3  
ATOM 3895  H HG11 . VAL A 1 60 ? 7.111   -3.866  -10.449 1.00 1.18 ? 60  VAL A HG11 3  
ATOM 3896  H HG12 . VAL A 1 60 ? 7.954   -5.348  -10.000 1.00 0.93 ? 60  VAL A HG12 3  
ATOM 3897  H HG13 . VAL A 1 60 ? 8.111   -3.906  -8.997  1.00 1.23 ? 60  VAL A HG13 3  
ATOM 3898  H HG21 . VAL A 1 60 ? 5.074   -3.536  -7.643  1.00 0.98 ? 60  VAL A HG21 3  
ATOM 3899  H HG22 . VAL A 1 60 ? 6.811   -3.244  -7.594  1.00 1.15 ? 60  VAL A HG22 3  
ATOM 3900  H HG23 . VAL A 1 60 ? 6.116   -4.588  -6.689  1.00 1.17 ? 60  VAL A HG23 3  
ATOM 3901  N N    . CYS A 1 61 ? 3.408   -6.551  -8.649  1.00 0.53 ? 61  CYS A N    3  
ATOM 3902  C CA   . CYS A 1 61 ? 2.282   -6.924  -7.801  1.00 0.54 ? 61  CYS A CA   3  
ATOM 3903  C C    . CYS A 1 61 ? 2.702   -6.924  -6.337  1.00 0.58 ? 61  CYS A C    3  
ATOM 3904  O O    . CYS A 1 61 ? 3.772   -7.428  -5.987  1.00 0.72 ? 61  CYS A O    3  
ATOM 3905  C CB   . CYS A 1 61 ? 1.714   -8.285  -8.194  1.00 0.56 ? 61  CYS A CB   3  
ATOM 3906  S SG   . CYS A 1 61 ? 2.848   -9.672  -7.947  1.00 0.71 ? 61  CYS A SG   3  
ATOM 3907  H H    . CYS A 1 61 ? 3.919   -7.250  -9.108  1.00 0.55 ? 61  CYS A H    3  
ATOM 3908  H HA   . CYS A 1 61 ? 1.514   -6.175  -7.934  1.00 0.53 ? 61  CYS A HA   3  
ATOM 3909  H HB2  . CYS A 1 61 ? 0.831   -8.471  -7.602  1.00 0.91 ? 61  CYS A HB2  3  
ATOM 3910  H HB3  . CYS A 1 61 ? 1.441   -8.259  -9.237  1.00 0.84 ? 61  CYS A HB3  3  
ATOM 3911  H HG   . CYS A 1 61 ? 3.098   -10.008 -8.812  1.00 1.12 ? 61  CYS A HG   3  
ATOM 3912  N N    . LEU A 1 62 ? 1.849   -6.365  -5.487  1.00 0.55 ? 62  LEU A N    3  
ATOM 3913  C CA   . LEU A 1 62 ? 2.113   -6.303  -4.057  1.00 0.62 ? 62  LEU A CA   3  
ATOM 3914  C C    . LEU A 1 62 ? 1.308   -7.363  -3.286  1.00 0.58 ? 62  LEU A C    3  
ATOM 3915  O O    . LEU A 1 62 ? 0.929   -7.150  -2.130  1.00 0.51 ? 62  LEU A O    3  
ATOM 3916  C CB   . LEU A 1 62 ? 1.819   -4.888  -3.550  1.00 0.77 ? 62  LEU A CB   3  
ATOM 3917  C CG   . LEU A 1 62 ? 3.028   -4.166  -2.943  1.00 0.95 ? 62  LEU A CG   3  
ATOM 3918  C CD1  . LEU A 1 62 ? 4.047   -3.837  -4.022  1.00 1.71 ? 62  LEU A CD1  3  
ATOM 3919  C CD2  . LEU A 1 62 ? 2.591   -2.904  -2.217  1.00 1.08 ? 62  LEU A CD2  3  
ATOM 3920  H H    . LEU A 1 62 ? 0.999   -6.013  -5.820  1.00 0.55 ? 62  LEU A H    3  
ATOM 3921  H HA   . LEU A 1 62 ? 3.163   -6.507  -3.914  1.00 0.72 ? 62  LEU A HA   3  
ATOM 3922  H HB2  . LEU A 1 62 ? 1.456   -4.300  -4.381  1.00 1.26 ? 62  LEU A HB2  3  
ATOM 3923  H HB3  . LEU A 1 62 ? 1.044   -4.942  -2.807  1.00 1.09 ? 62  LEU A HB3  3  
ATOM 3924  H HG   . LEU A 1 62 ? 3.503   -4.818  -2.225  1.00 1.61 ? 62  LEU A HG   3  
ATOM 3925  H HD11 . LEU A 1 62 ? 4.377   -2.815  -3.906  1.00 2.12 ? 62  LEU A HD11 3  
ATOM 3926  H HD12 . LEU A 1 62 ? 3.597   -3.961  -4.995  1.00 2.04 ? 62  LEU A HD12 3  
ATOM 3927  H HD13 . LEU A 1 62 ? 4.895   -4.500  -3.931  1.00 2.37 ? 62  LEU A HD13 3  
ATOM 3928  H HD21 . LEU A 1 62 ? 1.944   -2.325  -2.860  1.00 1.44 ? 62  LEU A HD21 3  
ATOM 3929  H HD22 . LEU A 1 62 ? 3.461   -2.317  -1.959  1.00 1.77 ? 62  LEU A HD22 3  
ATOM 3930  H HD23 . LEU A 1 62 ? 2.058   -3.171  -1.318  1.00 1.57 ? 62  LEU A HD23 3  
ATOM 3931  N N    . GLU A 1 63 ? 1.021   -8.493  -3.943  1.00 0.72 ? 63  GLU A N    3  
ATOM 3932  C CA   . GLU A 1 63 ? 0.243   -9.567  -3.322  1.00 0.80 ? 63  GLU A CA   3  
ATOM 3933  C C    . GLU A 1 63 ? 1.001   -10.903 -3.282  1.00 0.95 ? 63  GLU A C    3  
ATOM 3934  O O    . GLU A 1 63 ? 0.651   -11.785 -2.497  1.00 1.83 ? 63  GLU A O    3  
ATOM 3935  C CB   . GLU A 1 63 ? -1.084  -9.752  -4.065  1.00 0.86 ? 63  GLU A CB   3  
ATOM 3936  C CG   . GLU A 1 63 ? -2.298  -9.745  -3.151  1.00 1.12 ? 63  GLU A CG   3  
ATOM 3937  C CD   . GLU A 1 63 ? -2.884  -11.128 -2.935  1.00 1.31 ? 63  GLU A CD   3  
ATOM 3938  O OE1  . GLU A 1 63 ? -2.379  -11.857 -2.053  1.00 1.96 ? 63  GLU A OE1  3  
ATOM 3939  O OE2  . GLU A 1 63 ? -3.849  -11.481 -3.643  1.00 1.65 ? 63  GLU A OE2  3  
ATOM 3940  H H    . GLU A 1 63 ? 1.314   -8.594  -4.872  1.00 0.83 ? 63  GLU A H    3  
ATOM 3941  H HA   . GLU A 1 63 ? 0.027   -9.269  -2.307  1.00 0.80 ? 63  GLU A HA   3  
ATOM 3942  H HB2  . GLU A 1 63 ? -1.196  -8.953  -4.783  1.00 1.08 ? 63  GLU A HB2  3  
ATOM 3943  H HB3  . GLU A 1 63 ? -1.061  -10.696 -4.591  1.00 1.32 ? 63  GLU A HB3  3  
ATOM 3944  H HG2  . GLU A 1 63 ? -2.006  -9.345  -2.194  1.00 1.64 ? 63  GLU A HG2  3  
ATOM 3945  H HG3  . GLU A 1 63 ? -3.057  -9.112  -3.588  1.00 1.48 ? 63  GLU A HG3  3  
ATOM 3946  N N    . GLU A 1 64 ? 2.028   -11.055 -4.125  1.00 1.04 ? 64  GLU A N    3  
ATOM 3947  C CA   . GLU A 1 64 ? 2.805   -12.296 -4.167  1.00 1.08 ? 64  GLU A CA   3  
ATOM 3948  C C    . GLU A 1 64 ? 4.268   -12.062 -3.765  1.00 0.90 ? 64  GLU A C    3  
ATOM 3949  O O    . GLU A 1 64 ? 5.188   -12.584 -4.400  1.00 0.96 ? 64  GLU A O    3  
ATOM 3950  C CB   . GLU A 1 64 ? 2.728   -12.911 -5.567  1.00 1.28 ? 64  GLU A CB   3  
ATOM 3951  C CG   . GLU A 1 64 ? 2.066   -14.280 -5.596  1.00 1.53 ? 64  GLU A CG   3  
ATOM 3952  C CD   . GLU A 1 64 ? 1.906   -14.822 -7.004  1.00 2.14 ? 64  GLU A CD   3  
ATOM 3953  O OE1  . GLU A 1 64 ? 0.863   -14.539 -7.634  1.00 2.93 ? 64  GLU A OE1  3  
ATOM 3954  O OE2  . GLU A 1 64 ? 2.821   -15.526 -7.478  1.00 2.40 ? 64  GLU A OE2  3  
ATOM 3955  H H    . GLU A 1 64 ? 2.266   -10.325 -4.732  1.00 1.69 ? 64  GLU A H    3  
ATOM 3956  H HA   . GLU A 1 64 ? 2.364   -12.983 -3.468  1.00 1.19 ? 64  GLU A HA   3  
ATOM 3957  H HB2  . GLU A 1 64 ? 2.163   -12.250 -6.204  1.00 1.35 ? 64  GLU A HB2  3  
ATOM 3958  H HB3  . GLU A 1 64 ? 3.726   -13.010 -5.959  1.00 1.23 ? 64  GLU A HB3  3  
ATOM 3959  H HG2  . GLU A 1 64 ? 2.672   -14.971 -5.028  1.00 1.77 ? 64  GLU A HG2  3  
ATOM 3960  H HG3  . GLU A 1 64 ? 1.089   -14.203 -5.141  1.00 1.72 ? 64  GLU A HG3  3  
ATOM 3961  N N    . VAL A 1 65 ? 4.474   -11.271 -2.710  1.00 0.80 ? 65  VAL A N    3  
ATOM 3962  C CA   . VAL A 1 65 ? 5.827   -10.972 -2.236  1.00 0.64 ? 65  VAL A CA   3  
ATOM 3963  C C    . VAL A 1 65 ? 5.915   -10.890 -0.715  1.00 0.64 ? 65  VAL A C    3  
ATOM 3964  O O    . VAL A 1 65 ? 4.916   -10.670 -0.027  1.00 0.70 ? 65  VAL A O    3  
ATOM 3965  C CB   . VAL A 1 65 ? 6.358   -9.644  -2.815  1.00 0.56 ? 65  VAL A CB   3  
ATOM 3966  C CG1  . VAL A 1 65 ? 6.635   -9.772  -4.306  1.00 0.64 ? 65  VAL A CG1  3  
ATOM 3967  C CG2  . VAL A 1 65 ? 5.388   -8.502  -2.537  1.00 0.59 ? 65  VAL A CG2  3  
ATOM 3968  H H    . VAL A 1 65 ? 3.697   -10.883 -2.254  1.00 0.90 ? 65  VAL A H    3  
ATOM 3969  H HA   . VAL A 1 65 ? 6.477   -11.765 -2.577  1.00 0.65 ? 65  VAL A HA   3  
ATOM 3970  H HB   . VAL A 1 65 ? 7.291   -9.418  -2.318  1.00 0.50 ? 65  VAL A HB   3  
ATOM 3971  H HG11 . VAL A 1 65 ? 7.102   -8.866  -4.663  1.00 1.20 ? 65  VAL A HG11 3  
ATOM 3972  H HG12 . VAL A 1 65 ? 5.706   -9.931  -4.833  1.00 1.37 ? 65  VAL A HG12 3  
ATOM 3973  H HG13 . VAL A 1 65 ? 7.296   -10.609 -4.478  1.00 0.86 ? 65  VAL A HG13 3  
ATOM 3974  H HG21 . VAL A 1 65 ? 4.397   -8.784  -2.862  1.00 0.99 ? 65  VAL A HG21 3  
ATOM 3975  H HG22 . VAL A 1 65 ? 5.706   -7.621  -3.073  1.00 1.30 ? 65  VAL A HG22 3  
ATOM 3976  H HG23 . VAL A 1 65 ? 5.374   -8.293  -1.477  1.00 1.16 ? 65  VAL A HG23 3  
ATOM 3977  N N    . THR A 1 66 ? 7.142   -11.047 -0.209  1.00 0.63 ? 66  THR A N    3  
ATOM 3978  C CA   . THR A 1 66 ? 7.409   -10.971 1.226   1.00 0.69 ? 66  THR A CA   3  
ATOM 3979  C C    . THR A 1 66 ? 7.265   -9.524  1.710   1.00 0.61 ? 66  THR A C    3  
ATOM 3980  O O    . THR A 1 66 ? 6.826   -8.655  0.952   1.00 0.66 ? 66  THR A O    3  
ATOM 3981  C CB   . THR A 1 66 ? 8.813   -11.510 1.539   1.00 0.74 ? 66  THR A CB   3  
ATOM 3982  O OG1  . THR A 1 66 ? 9.749   -11.096 0.559   1.00 1.53 ? 66  THR A OG1  3  
ATOM 3983  C CG2  . THR A 1 66 ? 8.869   -13.021 1.613   1.00 1.17 ? 66  THR A CG2  3  
ATOM 3984  H H    . THR A 1 66 ? 7.885   -11.205 -0.828  1.00 0.62 ? 66  THR A H    3  
ATOM 3985  H HA   . THR A 1 66 ? 6.676   -11.581 1.733   1.00 0.80 ? 66  THR A HA   3  
ATOM 3986  H HB   . THR A 1 66 ? 9.133   -11.123 2.495   1.00 1.20 ? 66  THR A HB   3  
ATOM 3987  H HG1  . THR A 1 66 ? 9.691   -10.145 0.440   1.00 1.88 ? 66  THR A HG1  3  
ATOM 3988  H HG21 . THR A 1 66 ? 8.405   -13.442 0.733   1.00 1.74 ? 66  THR A HG21 3  
ATOM 3989  H HG22 . THR A 1 66 ? 8.342   -13.358 2.493   1.00 1.61 ? 66  THR A HG22 3  
ATOM 3990  H HG23 . THR A 1 66 ? 9.899   -13.342 1.666   1.00 1.74 ? 66  THR A HG23 3  
ATOM 3991  N N    . HIS A 1 67 ? 7.621   -9.261  2.969   1.00 0.51 ? 67  HIS A N    3  
ATOM 3992  C CA   . HIS A 1 67 ? 7.499   -7.907  3.502   1.00 0.45 ? 67  HIS A CA   3  
ATOM 3993  C C    . HIS A 1 67 ? 8.526   -6.961  2.882   1.00 0.43 ? 67  HIS A C    3  
ATOM 3994  O O    . HIS A 1 67 ? 8.193   -5.820  2.558   1.00 0.41 ? 67  HIS A O    3  
ATOM 3995  C CB   . HIS A 1 67 ? 7.560   -7.878  5.035   1.00 0.45 ? 67  HIS A CB   3  
ATOM 3996  C CG   . HIS A 1 67 ? 7.242   -6.518  5.581   1.00 0.46 ? 67  HIS A CG   3  
ATOM 3997  N ND1  . HIS A 1 67 ? 5.969   -6.146  5.949   1.00 0.51 ? 67  HIS A ND1  3  
ATOM 3998  C CD2  . HIS A 1 67 ? 8.015   -5.420  5.760   1.00 0.49 ? 67  HIS A CD2  3  
ATOM 3999  C CE1  . HIS A 1 67 ? 5.972   -4.886  6.325   1.00 0.54 ? 67  HIS A CE1  3  
ATOM 4000  N NE2  . HIS A 1 67 ? 7.197   -4.420  6.223   1.00 0.52 ? 67  HIS A NE2  3  
ATOM 4001  H H    . HIS A 1 67 ? 7.961   -9.988  3.533   1.00 0.50 ? 67  HIS A H    3  
ATOM 4002  H HA   . HIS A 1 67 ? 6.524   -7.552  3.206   1.00 0.44 ? 67  HIS A HA   3  
ATOM 4003  H HB2  . HIS A 1 67 ? 6.827   -8.564  5.418   1.00 0.46 ? 67  HIS A HB2  3  
ATOM 4004  H HB3  . HIS A 1 67 ? 8.532   -8.178  5.386   1.00 0.44 ? 67  HIS A HB3  3  
ATOM 4005  H HD1  . HIS A 1 67 ? 5.179   -6.718  5.930   1.00 0.56 ? 67  HIS A HD1  3  
ATOM 4006  H HD2  . HIS A 1 67 ? 9.069   -5.335  5.554   1.00 0.54 ? 67  HIS A HD2  3  
ATOM 4007  H HE1  . HIS A 1 67 ? 5.109   -4.326  6.641   1.00 0.61 ? 67  HIS A HE1  3  
ATOM 4008  H HE2  . HIS A 1 67 ? 7.435   -3.474  6.261   1.00 0.56 ? 67  HIS A HE2  3  
ATOM 4009  N N    . GLU A 1 68 ? 9.765   -7.424  2.715   1.00 0.45 ? 68  GLU A N    3  
ATOM 4010  C CA   . GLU A 1 68 ? 10.816  -6.590  2.125   1.00 0.45 ? 68  GLU A CA   3  
ATOM 4011  C C    . GLU A 1 68 ? 10.368  -6.023  0.773   1.00 0.42 ? 68  GLU A C    3  
ATOM 4012  O O    . GLU A 1 68 ? 10.615  -4.856  0.475   1.00 0.41 ? 68  GLU A O    3  
ATOM 4013  C CB   . GLU A 1 68 ? 12.122  -7.381  1.962   1.00 0.49 ? 68  GLU A CB   3  
ATOM 4014  C CG   . GLU A 1 68 ? 11.947  -8.744  1.306   1.00 1.43 ? 68  GLU A CG   3  
ATOM 4015  C CD   . GLU A 1 68 ? 12.133  -9.895  2.277   1.00 2.13 ? 68  GLU A CD   3  
ATOM 4016  O OE1  . GLU A 1 68 ? 11.319  -10.019 3.217   1.00 2.59 ? 68  GLU A OE1  3  
ATOM 4017  O OE2  . GLU A 1 68 ? 13.092  -10.675 2.096   1.00 2.90 ? 68  GLU A OE2  3  
ATOM 4018  H H    . GLU A 1 68 ? 9.984   -8.332  3.005   1.00 0.47 ? 68  GLU A H    3  
ATOM 4019  H HA   . GLU A 1 68 ? 10.993  -5.765  2.799   1.00 0.47 ? 68  GLU A HA   3  
ATOM 4020  H HB2  . GLU A 1 68 ? 12.805  -6.803  1.358   1.00 1.08 ? 68  GLU A HB2  3  
ATOM 4021  H HB3  . GLU A 1 68 ? 12.560  -7.531  2.939   1.00 1.21 ? 68  GLU A HB3  3  
ATOM 4022  H HG2  . GLU A 1 68 ? 10.953  -8.804  0.891   1.00 2.02 ? 68  GLU A HG2  3  
ATOM 4023  H HG3  . GLU A 1 68 ? 12.672  -8.841  0.512   1.00 2.08 ? 68  GLU A HG3  3  
ATOM 4024  N N    . GLU A 1 69 ? 9.696   -6.855  -0.027  1.00 0.44 ? 69  GLU A N    3  
ATOM 4025  C CA   . GLU A 1 69 ? 9.196   -6.434  -1.338  1.00 0.43 ? 69  GLU A CA   3  
ATOM 4026  C C    . GLU A 1 69 ? 8.077   -5.400  -1.185  1.00 0.41 ? 69  GLU A C    3  
ATOM 4027  O O    . GLU A 1 69 ? 7.995   -4.446  -1.958  1.00 0.41 ? 69  GLU A O    3  
ATOM 4028  C CB   . GLU A 1 69 ? 8.687   -7.640  -2.126  1.00 0.46 ? 69  GLU A CB   3  
ATOM 4029  C CG   . GLU A 1 69 ? 9.767   -8.357  -2.920  1.00 0.76 ? 69  GLU A CG   3  
ATOM 4030  C CD   . GLU A 1 69 ? 10.201  -9.659  -2.275  1.00 1.07 ? 69  GLU A CD   3  
ATOM 4031  O OE1  . GLU A 1 69 ? 9.493   -10.675 -2.448  1.00 1.70 ? 69  GLU A OE1  3  
ATOM 4032  O OE2  . GLU A 1 69 ? 11.249  -9.665  -1.596  1.00 1.84 ? 69  GLU A OE2  3  
ATOM 4033  H H    . GLU A 1 69 ? 9.528   -7.769  0.282   1.00 0.48 ? 69  GLU A H    3  
ATOM 4034  H HA   . GLU A 1 69 ? 10.017  -5.982  -1.877  1.00 0.46 ? 69  GLU A HA   3  
ATOM 4035  H HB2  . GLU A 1 69 ? 8.251   -8.345  -1.433  1.00 0.64 ? 69  GLU A HB2  3  
ATOM 4036  H HB3  . GLU A 1 69 ? 7.924   -7.309  -2.814  1.00 0.63 ? 69  GLU A HB3  3  
ATOM 4037  H HG2  . GLU A 1 69 ? 9.386   -8.573  -3.907  1.00 1.51 ? 69  GLU A HG2  3  
ATOM 4038  H HG3  . GLU A 1 69 ? 10.627  -7.708  -3.003  1.00 1.43 ? 69  GLU A HG3  3  
ATOM 4039  N N    . ALA A 1 70 ? 7.236   -5.594  -0.166  1.00 0.41 ? 70  ALA A N    3  
ATOM 4040  C CA   . ALA A 1 70 ? 6.133   -4.678  0.127   1.00 0.41 ? 70  ALA A CA   3  
ATOM 4041  C C    . ALA A 1 70 ? 6.662   -3.279  0.439   1.00 0.40 ? 70  ALA A C    3  
ATOM 4042  O O    . ALA A 1 70 ? 6.192   -2.285  -0.113  1.00 0.42 ? 70  ALA A O    3  
ATOM 4043  C CB   . ALA A 1 70 ? 5.340   -5.201  1.317   1.00 0.44 ? 70  ALA A CB   3  
ATOM 4044  H H    . ALA A 1 70 ? 7.375   -6.366  0.423   1.00 0.44 ? 70  ALA A H    3  
ATOM 4045  H HA   . ALA A 1 70 ? 5.470   -4.634  -0.730  1.00 0.42 ? 70  ALA A HA   3  
ATOM 4046  H HB1  . ALA A 1 70 ? 5.021   -6.212  1.122   1.00 1.00 ? 70  ALA A HB1  3  
ATOM 4047  H HB2  . ALA A 1 70 ? 4.477   -4.574  1.480   1.00 1.28 ? 70  ALA A HB2  3  
ATOM 4048  H HB3  . ALA A 1 70 ? 5.964   -5.187  2.199   1.00 0.98 ? 70  ALA A HB3  3  
ATOM 4049  N N    . VAL A 1 71 ? 7.659   -3.234  1.325   1.00 0.40 ? 71  VAL A N    3  
ATOM 4050  C CA   . VAL A 1 71 ? 8.287   -1.983  1.745   1.00 0.42 ? 71  VAL A CA   3  
ATOM 4051  C C    . VAL A 1 71 ? 9.157   -1.387  0.639   1.00 0.41 ? 71  VAL A C    3  
ATOM 4052  O O    . VAL A 1 71 ? 9.148   -0.174  0.422   1.00 0.42 ? 71  VAL A O    3  
ATOM 4053  C CB   . VAL A 1 71 ? 9.150   -2.189  3.014   1.00 0.48 ? 71  VAL A CB   3  
ATOM 4054  C CG1  . VAL A 1 71 ? 10.157  -1.058  3.192   1.00 0.52 ? 71  VAL A CG1  3  
ATOM 4055  C CG2  . VAL A 1 71 ? 8.268   -2.312  4.242   1.00 0.50 ? 71  VAL A CG2  3  
ATOM 4056  H H    . VAL A 1 71 ? 7.982   -4.082  1.690   1.00 0.41 ? 71  VAL A H    3  
ATOM 4057  H HA   . VAL A 1 71 ? 7.496   -1.285  1.985   1.00 0.43 ? 71  VAL A HA   3  
ATOM 4058  H HB   . VAL A 1 71 ? 9.700   -3.112  2.902   1.00 0.51 ? 71  VAL A HB   3  
ATOM 4059  H HG11 . VAL A 1 71 ? 10.512  -1.049  4.212   1.00 1.18 ? 71  VAL A HG11 3  
ATOM 4060  H HG12 . VAL A 1 71 ? 9.684   -0.114  2.968   1.00 1.21 ? 71  VAL A HG12 3  
ATOM 4061  H HG13 . VAL A 1 71 ? 10.992  -1.209  2.523   1.00 1.02 ? 71  VAL A HG13 3  
ATOM 4062  H HG21 . VAL A 1 71 ? 8.849   -2.703  5.064   1.00 1.07 ? 71  VAL A HG21 3  
ATOM 4063  H HG22 . VAL A 1 71 ? 7.446   -2.979  4.033   1.00 1.12 ? 71  VAL A HG22 3  
ATOM 4064  H HG23 . VAL A 1 71 ? 7.883   -1.338  4.508   1.00 1.00 ? 71  VAL A HG23 3  
ATOM 4065  N N    . THR A 1 72 ? 9.904   -2.244  -0.055  1.00 0.43 ? 72  THR A N    3  
ATOM 4066  C CA   . THR A 1 72 ? 10.782  -1.807  -1.136  1.00 0.47 ? 72  THR A CA   3  
ATOM 4067  C C    . THR A 1 72 ? 9.987   -1.186  -2.284  1.00 0.42 ? 72  THR A C    3  
ATOM 4068  O O    . THR A 1 72 ? 10.485  -0.302  -2.980  1.00 0.44 ? 72  THR A O    3  
ATOM 4069  C CB   . THR A 1 72 ? 11.620  -2.984  -1.650  1.00 0.53 ? 72  THR A CB   3  
ATOM 4070  O OG1  . THR A 1 72 ? 12.594  -3.360  -0.691  1.00 0.60 ? 72  THR A OG1  3  
ATOM 4071  C CG2  . THR A 1 72 ? 12.351  -2.693  -2.948  1.00 0.61 ? 72  THR A CG2  3  
ATOM 4072  H H    . THR A 1 72 ? 9.861   -3.198  0.163   1.00 0.46 ? 72  THR A H    3  
ATOM 4073  H HA   . THR A 1 72 ? 11.446  -1.060  -0.733  1.00 0.51 ? 72  THR A HA   3  
ATOM 4074  H HB   . THR A 1 72 ? 10.968  -3.830  -1.819  1.00 0.53 ? 72  THR A HB   3  
ATOM 4075  H HG1  . THR A 1 72 ? 12.234  -4.040  -0.118  1.00 0.98 ? 72  THR A HG1  3  
ATOM 4076  H HG21 . THR A 1 72 ? 13.075  -3.473  -3.136  1.00 1.16 ? 72  THR A HG21 3  
ATOM 4077  H HG22 . THR A 1 72 ? 12.858  -1.743  -2.870  1.00 0.86 ? 72  THR A HG22 3  
ATOM 4078  H HG23 . THR A 1 72 ? 11.642  -2.657  -3.763  1.00 1.27 ? 72  THR A HG23 3  
ATOM 4079  N N    . ALA A 1 73 ? 8.761   -1.666  -2.494  1.00 0.37 ? 73  ALA A N    3  
ATOM 4080  C CA   . ALA A 1 73 ? 7.912   -1.178  -3.573  1.00 0.36 ? 73  ALA A CA   3  
ATOM 4081  C C    . ALA A 1 73 ? 7.343   0.201   -3.273  1.00 0.34 ? 73  ALA A C    3  
ATOM 4082  O O    . ALA A 1 73 ? 7.323   1.063   -4.153  1.00 0.36 ? 73  ALA A O    3  
ATOM 4083  C CB   . ALA A 1 73 ? 6.784   -2.163  -3.841  1.00 0.41 ? 73  ALA A CB   3  
ATOM 4084  H H    . ALA A 1 73 ? 8.413   -2.382  -1.932  1.00 0.37 ? 73  ALA A H    3  
ATOM 4085  H HA   . ALA A 1 73 ? 8.516   -1.117  -4.467  1.00 0.39 ? 73  ALA A HA   3  
ATOM 4086  H HB1  . ALA A 1 73 ? 6.223   -1.842  -4.706  1.00 1.15 ? 73  ALA A HB1  3  
ATOM 4087  H HB2  . ALA A 1 73 ? 6.130   -2.204  -2.983  1.00 1.01 ? 73  ALA A HB2  3  
ATOM 4088  H HB3  . ALA A 1 73 ? 7.199   -3.143  -4.025  1.00 1.08 ? 73  ALA A HB3  3  
ATOM 4089  N N    . LEU A 1 74 ? 6.892   0.426   -2.033  1.00 0.33 ? 74  LEU A N    3  
ATOM 4090  C CA   . LEU A 1 74 ? 6.345   1.738   -1.680  1.00 0.37 ? 74  LEU A CA   3  
ATOM 4091  C C    . LEU A 1 74 ? 7.467   2.762   -1.547  1.00 0.38 ? 74  LEU A C    3  
ATOM 4092  O O    . LEU A 1 74 ? 7.244   3.958   -1.744  1.00 0.44 ? 74  LEU A O    3  
ATOM 4093  C CB   . LEU A 1 74 ? 5.512   1.715   -0.387  1.00 0.41 ? 74  LEU A CB   3  
ATOM 4094  C CG   . LEU A 1 74 ? 5.121   0.340   0.150   1.00 0.61 ? 74  LEU A CG   3  
ATOM 4095  C CD1  . LEU A 1 74 ? 5.921   0.023   1.394   1.00 1.73 ? 74  LEU A CD1  3  
ATOM 4096  C CD2  . LEU A 1 74 ? 3.641   0.275   0.463   1.00 1.13 ? 74  LEU A CD2  3  
ATOM 4097  H H    . LEU A 1 74 ? 6.944   -0.287  -1.348  1.00 0.33 ? 74  LEU A H    3  
ATOM 4098  H HA   . LEU A 1 74 ? 5.705   2.046   -2.493  1.00 0.42 ? 74  LEU A HA   3  
ATOM 4099  H HB2  . LEU A 1 74 ? 6.074   2.225   0.381   1.00 0.61 ? 74  LEU A HB2  3  
ATOM 4100  H HB3  . LEU A 1 74 ? 4.604   2.274   -0.567  1.00 0.47 ? 74  LEU A HB3  3  
ATOM 4101  H HG   . LEU A 1 74 ? 5.335   -0.410  -0.592  1.00 1.29 ? 74  LEU A HG   3  
ATOM 4102  H HD11 . LEU A 1 74 ? 5.816   -1.024  1.631   1.00 2.20 ? 74  LEU A HD11 3  
ATOM 4103  H HD12 . LEU A 1 74 ? 5.554   0.616   2.217   1.00 2.34 ? 74  LEU A HD12 3  
ATOM 4104  H HD13 . LEU A 1 74 ? 6.962   0.252   1.220   1.00 2.24 ? 74  LEU A HD13 3  
ATOM 4105  H HD21 . LEU A 1 74 ? 3.083   0.176   -0.456  1.00 1.57 ? 74  LEU A HD21 3  
ATOM 4106  H HD22 . LEU A 1 74 ? 3.342   1.176   0.975   1.00 1.72 ? 74  LEU A HD22 3  
ATOM 4107  H HD23 . LEU A 1 74 ? 3.455   -0.580  1.095   1.00 1.75 ? 74  LEU A HD23 3  
ATOM 4108  N N    . LYS A 1 75 ? 8.677   2.295   -1.210  1.00 0.38 ? 75  LYS A N    3  
ATOM 4109  C CA   . LYS A 1 75 ? 9.821   3.198   -1.054  1.00 0.47 ? 75  LYS A CA   3  
ATOM 4110  C C    . LYS A 1 75 ? 10.514  3.482   -2.391  1.00 0.49 ? 75  LYS A C    3  
ATOM 4111  O O    . LYS A 1 75 ? 11.170  4.514   -2.539  1.00 0.59 ? 75  LYS A O    3  
ATOM 4112  C CB   . LYS A 1 75 ? 10.825  2.628   -0.044  1.00 0.57 ? 75  LYS A CB   3  
ATOM 4113  C CG   . LYS A 1 75 ? 11.623  1.438   -0.560  1.00 0.64 ? 75  LYS A CG   3  
ATOM 4114  C CD   . LYS A 1 75 ? 13.095  1.550   -0.194  1.00 1.05 ? 75  LYS A CD   3  
ATOM 4115  C CE   . LYS A 1 75 ? 13.559  0.361   0.635   1.00 0.88 ? 75  LYS A CE   3  
ATOM 4116  N NZ   . LYS A 1 75 ? 14.186  -0.698  -0.204  1.00 1.44 ? 75  LYS A NZ   3  
ATOM 4117  H H    . LYS A 1 75 ? 8.809   1.326   -1.056  1.00 0.37 ? 75  LYS A H    3  
ATOM 4118  H HA   . LYS A 1 75 ? 9.440   4.132   -0.667  1.00 0.54 ? 75  LYS A HA   3  
ATOM 4119  H HB2  . LYS A 1 75 ? 11.521  3.407   0.228   1.00 0.67 ? 75  LYS A HB2  3  
ATOM 4120  H HB3  . LYS A 1 75 ? 10.288  2.317   0.840   1.00 0.62 ? 75  LYS A HB3  3  
ATOM 4121  H HG2  . LYS A 1 75 ? 11.222  0.537   -0.124  1.00 0.87 ? 75  LYS A HG2  3  
ATOM 4122  H HG3  . LYS A 1 75 ? 11.530  1.392   -1.634  1.00 0.88 ? 75  LYS A HG3  3  
ATOM 4123  H HD2  . LYS A 1 75 ? 13.679  1.590   -1.102  1.00 1.90 ? 75  LYS A HD2  3  
ATOM 4124  H HD3  . LYS A 1 75 ? 13.249  2.456   0.373   1.00 1.62 ? 75  LYS A HD3  3  
ATOM 4125  H HE2  . LYS A 1 75 ? 14.280  0.706   1.361   1.00 1.04 ? 75  LYS A HE2  3  
ATOM 4126  H HE3  . LYS A 1 75 ? 12.705  -0.057  1.150   1.00 1.51 ? 75  LYS A HE3  3  
ATOM 4127  H HZ1  . LYS A 1 75 ? 14.307  -1.569  0.351   1.00 1.72 ? 75  LYS A HZ1  3  
ATOM 4128  H HZ2  . LYS A 1 75 ? 15.118  -0.382  -0.542  1.00 1.94 ? 75  LYS A HZ2  3  
ATOM 4129  H HZ3  . LYS A 1 75 ? 13.585  -0.906  -1.027  1.00 1.92 ? 75  LYS A HZ3  3  
ATOM 4130  N N    . ASN A 1 76 ? 10.376  2.564   -3.355  1.00 0.48 ? 76  ASN A N    3  
ATOM 4131  C CA   . ASN A 1 76 ? 10.999  2.722   -4.673  1.00 0.59 ? 76  ASN A CA   3  
ATOM 4132  C C    . ASN A 1 76 ? 10.306  3.824   -5.483  1.00 0.69 ? 76  ASN A C    3  
ATOM 4133  O O    . ASN A 1 76 ? 9.602   3.548   -6.458  1.00 1.15 ? 76  ASN A O    3  
ATOM 4134  C CB   . ASN A 1 76 ? 10.961  1.394   -5.442  1.00 0.64 ? 76  ASN A CB   3  
ATOM 4135  C CG   . ASN A 1 76 ? 11.790  1.431   -6.715  1.00 0.85 ? 76  ASN A CG   3  
ATOM 4136  O OD1  . ASN A 1 76 ? 13.019  1.472   -6.667  1.00 0.90 ? 76  ASN A OD1  3  
ATOM 4137  N ND2  . ASN A 1 76 ? 11.120  1.415   -7.864  1.00 1.55 ? 76  ASN A ND2  3  
ATOM 4138  H H    . ASN A 1 76 ? 9.852   1.756   -3.170  1.00 0.45 ? 76  ASN A H    3  
ATOM 4139  H HA   . ASN A 1 76 ? 12.028  3.006   -4.517  1.00 0.73 ? 76  ASN A HA   3  
ATOM 4140  H HB2  . ASN A 1 76 ? 11.348  0.609   -4.809  1.00 0.71 ? 76  ASN A HB2  3  
ATOM 4141  H HB3  . ASN A 1 76 ? 9.939   1.166   -5.704  1.00 0.75 ? 76  ASN A HB3  3  
ATOM 4142  H HD21 . ASN A 1 76 ? 10.140  1.380   -7.829  1.00 1.95 ? 76  ASN A HD21 3  
ATOM 4143  H HD22 . ASN A 1 76 ? 11.632  1.439   -8.698  1.00 1.75 ? 76  ASN A HD22 3  
ATOM 4144  N N    . THR A 1 77 ? 10.502  5.073   -5.060  1.00 0.90 ? 77  THR A N    3  
ATOM 4145  C CA   . THR A 1 77 ? 9.892   6.219   -5.731  1.00 1.07 ? 77  THR A CA   3  
ATOM 4146  C C    . THR A 1 77 ? 10.908  7.340   -5.960  1.00 0.80 ? 77  THR A C    3  
ATOM 4147  O O    . THR A 1 77 ? 11.954  7.393   -5.309  1.00 1.47 ? 77  THR A O    3  
ATOM 4148  C CB   . THR A 1 77 ? 8.709   6.747   -4.909  1.00 2.00 ? 77  THR A CB   3  
ATOM 4149  O OG1  . THR A 1 77 ? 9.149   7.286   -3.672  1.00 2.60 ? 77  THR A OG1  3  
ATOM 4150  C CG2  . THR A 1 77 ? 7.668   5.688   -4.607  1.00 2.53 ? 77  THR A CG2  3  
ATOM 4151  H H    . THR A 1 77 ? 11.057  5.223   -4.267  1.00 1.26 ? 77  THR A H    3  
ATOM 4152  H HA   . THR A 1 77 ? 9.527   5.884   -6.690  1.00 1.56 ? 77  THR A HA   3  
ATOM 4153  H HB   . THR A 1 77 ? 8.223   7.535   -5.466  1.00 2.59 ? 77  THR A HB   3  
ATOM 4154  H HG1  . THR A 1 77 ? 9.561   6.596   -3.145  1.00 2.91 ? 77  THR A HG1  3  
ATOM 4155  H HG21 . THR A 1 77 ? 8.139   4.847   -4.122  1.00 2.58 ? 77  THR A HG21 3  
ATOM 4156  H HG22 . THR A 1 77 ? 7.208   5.361   -5.528  1.00 3.13 ? 77  THR A HG22 3  
ATOM 4157  H HG23 . THR A 1 77 ? 6.912   6.102   -3.955  1.00 2.95 ? 77  THR A HG23 3  
ATOM 4158  N N    . SER A 1 78 ? 10.577  8.240   -6.886  1.00 1.14 ? 78  SER A N    3  
ATOM 4159  C CA   . SER A 1 78 ? 11.440  9.376   -7.207  1.00 1.74 ? 78  SER A CA   3  
ATOM 4160  C C    . SER A 1 78 ? 10.638  10.676  -7.182  1.00 1.42 ? 78  SER A C    3  
ATOM 4161  O O    . SER A 1 78 ? 10.744  11.458  -6.236  1.00 1.44 ? 78  SER A O    3  
ATOM 4162  C CB   . SER A 1 78 ? 12.109  9.176   -8.573  1.00 2.76 ? 78  SER A CB   3  
ATOM 4163  O OG   . SER A 1 78 ? 13.443  9.656   -8.562  1.00 3.36 ? 78  SER A OG   3  
ATOM 4164  H H    . SER A 1 78 ? 9.722   8.139   -7.355  1.00 1.57 ? 78  SER A H    3  
ATOM 4165  H HA   . SER A 1 78 ? 12.207  9.431   -6.448  1.00 2.08 ? 78  SER A HA   3  
ATOM 4166  H HB2  . SER A 1 78 ? 12.121  8.125   -8.817  1.00 3.05 ? 78  SER A HB2  3  
ATOM 4167  H HB3  . SER A 1 78 ? 11.554  9.712   -9.328  1.00 3.31 ? 78  SER A HB3  3  
ATOM 4168  H HG   . SER A 1 78 ? 13.467  10.544  -8.925  1.00 3.89 ? 78  SER A HG   3  
ATOM 4169  N N    . ASP A 1 79 ? 9.832   10.899  -8.221  1.00 1.32 ? 79  ASP A N    3  
ATOM 4170  C CA   . ASP A 1 79 ? 9.004   12.098  -8.311  1.00 1.18 ? 79  ASP A CA   3  
ATOM 4171  C C    . ASP A 1 79 ? 7.554   11.776  -7.953  1.00 0.99 ? 79  ASP A C    3  
ATOM 4172  O O    . ASP A 1 79 ? 6.909   12.521  -7.215  1.00 0.92 ? 79  ASP A O    3  
ATOM 4173  C CB   . ASP A 1 79 ? 9.077   12.695  -9.719  1.00 1.46 ? 79  ASP A CB   3  
ATOM 4174  C CG   . ASP A 1 79 ? 10.335  13.516  -9.934  1.00 1.61 ? 79  ASP A CG   3  
ATOM 4175  O OD1  . ASP A 1 79 ? 11.401  12.915  -10.190 1.00 2.07 ? 79  ASP A OD1  3  
ATOM 4176  O OD2  . ASP A 1 79 ? 10.254  14.759  -9.847  1.00 2.23 ? 79  ASP A OD2  3  
ATOM 4177  H H    . ASP A 1 79 ? 9.789   10.238  -8.944  1.00 1.49 ? 79  ASP A H    3  
ATOM 4178  H HA   . ASP A 1 79 ? 9.383   12.819  -7.604  1.00 1.15 ? 79  ASP A HA   3  
ATOM 4179  H HB2  . ASP A 1 79 ? 9.065   11.894  -10.444 1.00 2.06 ? 79  ASP A HB2  3  
ATOM 4180  H HB3  . ASP A 1 79 ? 8.221   13.332  -9.880  1.00 1.75 ? 79  ASP A HB3  3  
ATOM 4181  N N    . PHE A 1 80 ? 7.056   10.650  -8.471  1.00 0.97 ? 80  PHE A N    3  
ATOM 4182  C CA   . PHE A 1 80 ? 5.691   10.211  -8.197  1.00 0.85 ? 80  PHE A CA   3  
ATOM 4183  C C    . PHE A 1 80 ? 5.664   8.742   -7.777  1.00 0.82 ? 80  PHE A C    3  
ATOM 4184  O O    . PHE A 1 80 ? 6.672   8.039   -7.888  1.00 0.92 ? 80  PHE A O    3  
ATOM 4185  C CB   . PHE A 1 80 ? 4.800   10.431  -9.419  1.00 0.92 ? 80  PHE A CB   3  
ATOM 4186  C CG   . PHE A 1 80 ? 3.683   11.392  -9.150  1.00 0.94 ? 80  PHE A CG   3  
ATOM 4187  C CD1  . PHE A 1 80 ? 3.913   12.758  -9.163  1.00 1.68 ? 80  PHE A CD1  3  
ATOM 4188  C CD2  . PHE A 1 80 ? 2.409   10.931  -8.866  1.00 1.39 ? 80  PHE A CD2  3  
ATOM 4189  C CE1  . PHE A 1 80 ? 2.892   13.646  -8.895  1.00 1.77 ? 80  PHE A CE1  3  
ATOM 4190  C CE2  . PHE A 1 80 ? 1.383   11.817  -8.602  1.00 1.43 ? 80  PHE A CE2  3  
ATOM 4191  C CZ   . PHE A 1 80 ? 1.627   13.176  -8.615  1.00 1.14 ? 80  PHE A CZ   3  
ATOM 4192  H H    . PHE A 1 80 ? 7.628   10.091  -9.037  1.00 1.09 ? 80  PHE A H    3  
ATOM 4193  H HA   . PHE A 1 80 ? 5.314   10.807  -7.378  1.00 0.81 ? 80  PHE A HA   3  
ATOM 4194  H HB2  . PHE A 1 80 ? 5.396   10.826  -10.229 1.00 1.04 ? 80  PHE A HB2  3  
ATOM 4195  H HB3  . PHE A 1 80 ? 4.366   9.488   -9.720  1.00 0.93 ? 80  PHE A HB3  3  
ATOM 4196  H HD1  . PHE A 1 80 ? 4.903   13.127  -9.383  1.00 2.48 ? 80  PHE A HD1  3  
ATOM 4197  H HD2  . PHE A 1 80 ? 2.218   9.866   -8.858  1.00 2.16 ? 80  PHE A HD2  3  
ATOM 4198  H HE1  . PHE A 1 80 ? 3.084   14.709  -8.908  1.00 2.61 ? 80  PHE A HE1  3  
ATOM 4199  H HE2  . PHE A 1 80 ? 0.393   11.446  -8.384  1.00 2.19 ? 80  PHE A HE2  3  
ATOM 4200  H HZ   . PHE A 1 80 ? 0.830   13.868  -8.400  1.00 1.26 ? 80  PHE A HZ   3  
ATOM 4201  N N    . VAL A 1 81 ? 4.502   8.272   -7.321  1.00 0.75 ? 81  VAL A N    3  
ATOM 4202  C CA   . VAL A 1 81 ? 4.338   6.879   -6.919  1.00 0.77 ? 81  VAL A CA   3  
ATOM 4203  C C    . VAL A 1 81 ? 2.953   6.374   -7.335  1.00 0.65 ? 81  VAL A C    3  
ATOM 4204  O O    . VAL A 1 81 ? 1.932   6.920   -6.910  1.00 0.59 ? 81  VAL A O    3  
ATOM 4205  C CB   . VAL A 1 81 ? 4.539   6.691   -5.394  1.00 0.88 ? 81  VAL A CB   3  
ATOM 4206  C CG1  . VAL A 1 81 ? 3.677   7.660   -4.595  1.00 1.19 ? 81  VAL A CG1  3  
ATOM 4207  C CG2  . VAL A 1 81 ? 4.259   5.251   -4.983  1.00 1.58 ? 81  VAL A CG2  3  
ATOM 4208  H H    . VAL A 1 81 ? 3.713   8.854   -7.281  1.00 0.74 ? 81  VAL A H    3  
ATOM 4209  H HA   . VAL A 1 81 ? 5.088   6.296   -7.434  1.00 0.89 ? 81  VAL A HA   3  
ATOM 4210  H HB   . VAL A 1 81 ? 5.573   6.907   -5.166  1.00 1.14 ? 81  VAL A HB   3  
ATOM 4211  H HG11 . VAL A 1 81 ? 3.436   7.222   -3.637  1.00 1.78 ? 81  VAL A HG11 3  
ATOM 4212  H HG12 . VAL A 1 81 ? 2.766   7.864   -5.136  1.00 1.62 ? 81  VAL A HG12 3  
ATOM 4213  H HG13 . VAL A 1 81 ? 4.218   8.582   -4.442  1.00 1.67 ? 81  VAL A HG13 3  
ATOM 4214  H HG21 . VAL A 1 81 ? 4.766   4.578   -5.658  1.00 1.98 ? 81  VAL A HG21 3  
ATOM 4215  H HG22 . VAL A 1 81 ? 3.195   5.066   -5.022  1.00 2.06 ? 81  VAL A HG22 3  
ATOM 4216  H HG23 . VAL A 1 81 ? 4.615   5.088   -3.977  1.00 2.07 ? 81  VAL A HG23 3  
ATOM 4217  N N    . TYR A 1 82 ? 2.922   5.340   -8.173  1.00 0.72 ? 82  TYR A N    3  
ATOM 4218  C CA   . TYR A 1 82 ? 1.653   4.784   -8.640  1.00 0.69 ? 82  TYR A CA   3  
ATOM 4219  C C    . TYR A 1 82 ? 1.245   3.573   -7.809  1.00 0.67 ? 82  TYR A C    3  
ATOM 4220  O O    . TYR A 1 82 ? 1.743   2.462   -8.010  1.00 0.77 ? 82  TYR A O    3  
ATOM 4221  C CB   . TYR A 1 82 ? 1.733   4.414   -10.121 1.00 0.85 ? 82  TYR A CB   3  
ATOM 4222  C CG   . TYR A 1 82 ? 0.380   4.226   -10.770 1.00 0.93 ? 82  TYR A CG   3  
ATOM 4223  C CD1  . TYR A 1 82 ? -0.257  2.995   -10.728 1.00 1.57 ? 82  TYR A CD1  3  
ATOM 4224  C CD2  . TYR A 1 82 ? -0.258  5.275   -11.419 1.00 1.41 ? 82  TYR A CD2  3  
ATOM 4225  C CE1  . TYR A 1 82 ? -1.492  2.811   -11.314 1.00 1.72 ? 82  TYR A CE1  3  
ATOM 4226  C CE2  . TYR A 1 82 ? -1.494  5.099   -12.009 1.00 1.55 ? 82  TYR A CE2  3  
ATOM 4227  C CZ   . TYR A 1 82 ? -2.108  3.866   -11.953 1.00 1.33 ? 82  TYR A CZ   3  
ATOM 4228  O OH   . TYR A 1 82 ? -3.341  3.687   -12.537 1.00 1.58 ? 82  TYR A OH   3  
ATOM 4229  H H    . TYR A 1 82 ? 3.769   4.953   -8.479  1.00 0.85 ? 82  TYR A H    3  
ATOM 4230  H HA   . TYR A 1 82 ? 0.901   5.549   -8.516  1.00 0.64 ? 82  TYR A HA   3  
ATOM 4231  H HB2  . TYR A 1 82 ? 2.250   5.197   -10.654 1.00 0.88 ? 82  TYR A HB2  3  
ATOM 4232  H HB3  . TYR A 1 82 ? 2.277   3.489   -10.225 1.00 0.99 ? 82  TYR A HB3  3  
ATOM 4233  H HD1  . TYR A 1 82 ? 0.226   2.169   -10.226 1.00 2.27 ? 82  TYR A HD1  3  
ATOM 4234  H HD2  . TYR A 1 82 ? 0.226   6.240   -11.463 1.00 2.08 ? 82  TYR A HD2  3  
ATOM 4235  H HE1  . TYR A 1 82 ? -1.968  1.846   -11.268 1.00 2.47 ? 82  TYR A HE1  3  
ATOM 4236  H HE2  . TYR A 1 82 ? -1.975  5.926   -12.509 1.00 2.24 ? 82  TYR A HE2  3  
ATOM 4237  H HH   . TYR A 1 82 ? -3.227  3.392   -13.444 1.00 1.97 ? 82  TYR A HH   3  
ATOM 4238  N N    . LEU A 1 83 ? 0.345   3.814   -6.862  1.00 0.62 ? 83  LEU A N    3  
ATOM 4239  C CA   . LEU A 1 83 ? -0.140  2.775   -5.967  1.00 0.65 ? 83  LEU A CA   3  
ATOM 4240  C C    . LEU A 1 83 ? -1.404  2.107   -6.508  1.00 0.66 ? 83  LEU A C    3  
ATOM 4241  O O    . LEU A 1 83 ? -2.409  2.773   -6.770  1.00 0.71 ? 83  LEU A O    3  
ATOM 4242  C CB   . LEU A 1 83 ? -0.420  3.380   -4.592  1.00 0.74 ? 83  LEU A CB   3  
ATOM 4243  C CG   . LEU A 1 83 ? -0.011  2.514   -3.405  1.00 0.74 ? 83  LEU A CG   3  
ATOM 4244  C CD1  . LEU A 1 83 ? 1.504   2.490   -3.253  1.00 1.34 ? 83  LEU A CD1  3  
ATOM 4245  C CD2  . LEU A 1 83 ? -0.672  3.023   -2.135  1.00 1.38 ? 83  LEU A CD2  3  
ATOM 4246  H H    . LEU A 1 83 ? 0.016   4.728   -6.749  1.00 0.62 ? 83  LEU A H    3  
ATOM 4247  H HA   . LEU A 1 83 ? 0.634   2.031   -5.870  1.00 0.69 ? 83  LEU A HA   3  
ATOM 4248  H HB2  . LEU A 1 83 ? 0.107   4.321   -4.522  1.00 0.88 ? 83  LEU A HB2  3  
ATOM 4249  H HB3  . LEU A 1 83 ? -1.479  3.576   -4.517  1.00 0.80 ? 83  LEU A HB3  3  
ATOM 4250  H HG   . LEU A 1 83 ? -0.347  1.504   -3.578  1.00 1.48 ? 83  LEU A HG   3  
ATOM 4251  H HD11 . LEU A 1 83 ? 1.763   2.066   -2.294  1.00 1.81 ? 83  LEU A HD11 3  
ATOM 4252  H HD12 . LEU A 1 83 ? 1.888   3.497   -3.316  1.00 1.91 ? 83  LEU A HD12 3  
ATOM 4253  H HD13 . LEU A 1 83 ? 1.935   1.889   -4.040  1.00 1.85 ? 83  LEU A HD13 3  
ATOM 4254  H HD21 . LEU A 1 83 ? -0.865  4.081   -2.233  1.00 1.83 ? 83  LEU A HD21 3  
ATOM 4255  H HD22 . LEU A 1 83 ? -0.017  2.851   -1.294  1.00 2.00 ? 83  LEU A HD22 3  
ATOM 4256  H HD23 . LEU A 1 83 ? -1.603  2.499   -1.980  1.00 1.85 ? 83  LEU A HD23 3  
ATOM 4257  N N    . LYS A 1 84 ? -1.349  0.783   -6.649  1.00 0.66 ? 84  LYS A N    3  
ATOM 4258  C CA   . LYS A 1 84 ? -2.487  0.003   -7.129  1.00 0.68 ? 84  LYS A CA   3  
ATOM 4259  C C    . LYS A 1 84 ? -3.105  -0.768  -5.975  1.00 0.65 ? 84  LYS A C    3  
ATOM 4260  O O    . LYS A 1 84 ? -2.451  -1.622  -5.382  1.00 0.68 ? 84  LYS A O    3  
ATOM 4261  C CB   . LYS A 1 84 ? -2.064  -0.959  -8.244  1.00 0.69 ? 84  LYS A CB   3  
ATOM 4262  C CG   . LYS A 1 84 ? -2.135  -0.350  -9.636  1.00 0.76 ? 84  LYS A CG   3  
ATOM 4263  C CD   . LYS A 1 84 ? -3.459  -0.666  -10.319 1.00 0.99 ? 84  LYS A CD   3  
ATOM 4264  C CE   . LYS A 1 84 ? -4.620  0.074   -9.670  1.00 1.18 ? 84  LYS A CE   3  
ATOM 4265  N NZ   . LYS A 1 84 ? -4.543  1.545   -9.896  1.00 1.56 ? 84  LYS A NZ   3  
ATOM 4266  H H    . LYS A 1 84 ? -0.525  0.313   -6.404  1.00 0.68 ? 84  LYS A H    3  
ATOM 4267  H HA   . LYS A 1 84 ? -3.217  0.684   -7.514  1.00 0.72 ? 84  LYS A HA   3  
ATOM 4268  H HB2  . LYS A 1 84 ? -1.049  -1.275  -8.067  1.00 0.66 ? 84  LYS A HB2  3  
ATOM 4269  H HB3  . LYS A 1 84 ? -2.709  -1.825  -8.221  1.00 0.73 ? 84  LYS A HB3  3  
ATOM 4270  H HG2  . LYS A 1 84 ? -2.031  0.721   -9.556  1.00 0.93 ? 84  LYS A HG2  3  
ATOM 4271  H HG3  . LYS A 1 84 ? -1.329  -0.749  -10.234 1.00 0.86 ? 84  LYS A HG3  3  
ATOM 4272  H HD2  . LYS A 1 84 ? -3.396  -0.374  -11.356 1.00 1.65 ? 84  LYS A HD2  3  
ATOM 4273  H HD3  . LYS A 1 84 ? -3.641  -1.729  -10.253 1.00 1.42 ? 84  LYS A HD3  3  
ATOM 4274  H HE2  . LYS A 1 84 ? -5.544  -0.296  -10.087 1.00 1.51 ? 84  LYS A HE2  3  
ATOM 4275  H HE3  . LYS A 1 84 ? -4.605  -0.120  -8.607  1.00 1.85 ? 84  LYS A HE3  3  
ATOM 4276  H HZ1  . LYS A 1 84 ? -4.327  1.744   -10.894 1.00 2.19 ? 84  LYS A HZ1  3  
ATOM 4277  H HZ2  . LYS A 1 84 ? -3.797  1.960   -9.300  1.00 1.68 ? 84  LYS A HZ2  3  
ATOM 4278  H HZ3  . LYS A 1 84 ? -5.451  1.991   -9.654  1.00 2.00 ? 84  LYS A HZ3  3  
ATOM 4279  N N    . VAL A 1 85 ? -4.357  -0.452  -5.640  1.00 0.76 ? 85  VAL A N    3  
ATOM 4280  C CA   . VAL A 1 85 ? -5.037  -1.120  -4.533  1.00 0.74 ? 85  VAL A CA   3  
ATOM 4281  C C    . VAL A 1 85 ? -6.372  -1.729  -4.963  1.00 0.91 ? 85  VAL A C    3  
ATOM 4282  O O    . VAL A 1 85 ? -7.197  -1.066  -5.596  1.00 1.17 ? 85  VAL A O    3  
ATOM 4283  C CB   . VAL A 1 85 ? -5.277  -0.158  -3.346  1.00 0.99 ? 85  VAL A CB   3  
ATOM 4284  C CG1  . VAL A 1 85 ? -3.953  0.316   -2.763  1.00 1.92 ? 85  VAL A CG1  3  
ATOM 4285  C CG2  . VAL A 1 85 ? -6.137  1.028   -3.766  1.00 0.65 ? 85  VAL A CG2  3  
ATOM 4286  H H    . VAL A 1 85 ? -4.825  0.253   -6.135  1.00 0.92 ? 85  VAL A H    3  
ATOM 4287  H HA   . VAL A 1 85 ? -4.393  -1.915  -4.190  1.00 0.62 ? 85  VAL A HA   3  
ATOM 4288  H HB   . VAL A 1 85 ? -5.806  -0.701  -2.576  1.00 1.45 ? 85  VAL A HB   3  
ATOM 4289  H HG11 . VAL A 1 85 ? -3.294  -0.529  -2.632  1.00 2.23 ? 85  VAL A HG11 3  
ATOM 4290  H HG12 . VAL A 1 85 ? -4.129  0.786   -1.807  1.00 2.51 ? 85  VAL A HG12 3  
ATOM 4291  H HG13 . VAL A 1 85 ? -3.497  1.028   -3.435  1.00 2.42 ? 85  VAL A HG13 3  
ATOM 4292  H HG21 . VAL A 1 85 ? -5.686  1.519   -4.615  1.00 1.26 ? 85  VAL A HG21 3  
ATOM 4293  H HG22 . VAL A 1 85 ? -6.213  1.726   -2.943  1.00 1.21 ? 85  VAL A HG22 3  
ATOM 4294  H HG23 . VAL A 1 85 ? -7.125  0.681   -4.033  1.00 1.21 ? 85  VAL A HG23 3  
ATOM 4295  N N    . ALA A 1 86 ? -6.573  -2.998  -4.605  1.00 0.91 ? 86  ALA A N    3  
ATOM 4296  C CA   . ALA A 1 86 ? -7.805  -3.714  -4.936  1.00 1.24 ? 86  ALA A CA   3  
ATOM 4297  C C    . ALA A 1 86 ? -8.763  -3.734  -3.745  1.00 1.27 ? 86  ALA A C    3  
ATOM 4298  O O    . ALA A 1 86 ? -8.337  -3.622  -2.594  1.00 1.09 ? 86  ALA A O    3  
ATOM 4299  C CB   . ALA A 1 86 ? -7.486  -5.133  -5.384  1.00 1.46 ? 86  ALA A CB   3  
ATOM 4300  H H    . ALA A 1 86 ? -5.873  -3.464  -4.101  1.00 0.76 ? 86  ALA A H    3  
ATOM 4301  H HA   . ALA A 1 86 ? -8.279  -3.199  -5.759  1.00 1.52 ? 86  ALA A HA   3  
ATOM 4302  H HB1  . ALA A 1 86 ? -8.407  -5.675  -5.547  1.00 1.81 ? 86  ALA A HB1  3  
ATOM 4303  H HB2  . ALA A 1 86 ? -6.905  -5.630  -4.621  1.00 2.07 ? 86  ALA A HB2  3  
ATOM 4304  H HB3  . ALA A 1 86 ? -6.921  -5.102  -6.303  1.00 1.62 ? 86  ALA A HB3  3  
ATOM 4305  N N    . LYS A 1 87 ? -10.059 -3.876  -4.028  1.00 1.68 ? 87  LYS A N    3  
ATOM 4306  C CA   . LYS A 1 87 ? -11.075 -3.910  -2.977  1.00 1.86 ? 87  LYS A CA   3  
ATOM 4307  C C    . LYS A 1 87 ? -11.494 -5.350  -2.662  1.00 1.91 ? 87  LYS A C    3  
ATOM 4308  O O    . LYS A 1 87 ? -11.704 -6.156  -3.570  1.00 2.04 ? 87  LYS A O    3  
ATOM 4309  C CB   . LYS A 1 87 ? -12.298 -3.085  -3.388  1.00 2.22 ? 87  LYS A CB   3  
ATOM 4310  C CG   . LYS A 1 87 ? -12.773 -2.121  -2.310  1.00 2.53 ? 87  LYS A CG   3  
ATOM 4311  C CD   . LYS A 1 87 ? -13.184 -0.778  -2.895  1.00 2.89 ? 87  LYS A CD   3  
ATOM 4312  C CE   . LYS A 1 87 ? -14.637 -0.452  -2.582  1.00 3.28 ? 87  LYS A CE   3  
ATOM 4313  N NZ   . LYS A 1 87 ? -15.016 0.912   -3.046  1.00 4.20 ? 87  LYS A NZ   3  
ATOM 4314  H H    . LYS A 1 87 ? -10.340 -3.962  -4.964  1.00 1.92 ? 87  LYS A H    3  
ATOM 4315  H HA   . LYS A 1 87 ? -10.641 -3.473  -2.089  1.00 1.79 ? 87  LYS A HA   3  
ATOM 4316  H HB2  . LYS A 1 87 ? -12.051 -2.511  -4.271  1.00 2.44 ? 87  LYS A HB2  3  
ATOM 4317  H HB3  . LYS A 1 87 ? -13.111 -3.757  -3.623  1.00 2.56 ? 87  LYS A HB3  3  
ATOM 4318  H HG2  . LYS A 1 87 ? -13.621 -2.556  -1.802  1.00 2.95 ? 87  LYS A HG2  3  
ATOM 4319  H HG3  . LYS A 1 87 ? -11.971 -1.966  -1.603  1.00 2.69 ? 87  LYS A HG3  3  
ATOM 4320  H HD2  . LYS A 1 87 ? -12.555 -0.007  -2.475  1.00 3.05 ? 87  LYS A HD2  3  
ATOM 4321  H HD3  . LYS A 1 87 ? -13.053 -0.806  -3.966  1.00 3.28 ? 87  LYS A HD3  3  
ATOM 4322  H HE2  . LYS A 1 87 ? -15.269 -1.177  -3.074  1.00 3.46 ? 87  LYS A HE2  3  
ATOM 4323  H HE3  . LYS A 1 87 ? -14.784 -0.513  -1.514  1.00 3.29 ? 87  LYS A HE3  3  
ATOM 4324  H HZ1  . LYS A 1 87 ? -14.450 1.629   -2.549  1.00 4.41 ? 87  LYS A HZ1  3  
ATOM 4325  H HZ2  . LYS A 1 87 ? -16.023 1.087   -2.854  1.00 4.48 ? 87  LYS A HZ2  3  
ATOM 4326  H HZ3  . LYS A 1 87 ? -14.850 1.002   -4.068  1.00 4.70 ? 87  LYS A HZ3  3  
ATOM 4327  N N    . PRO A 1 88 ? -11.620 -5.689  -1.360  1.00 1.88 ? 88  PRO A N    3  
ATOM 4328  C CA   . PRO A 1 88 ? -12.014 -7.036  -0.924  1.00 2.01 ? 88  PRO A CA   3  
ATOM 4329  C C    . PRO A 1 88 ? -13.487 -7.337  -1.214  1.00 2.20 ? 88  PRO A C    3  
ATOM 4330  O O    . PRO A 1 88 ? -14.373 -6.601  -0.776  1.00 2.28 ? 88  PRO A O    3  
ATOM 4331  C CB   . PRO A 1 88 ? -11.763 -7.008  0.587   1.00 1.98 ? 88  PRO A CB   3  
ATOM 4332  C CG   . PRO A 1 88 ? -11.883 -5.572  0.965   1.00 1.91 ? 88  PRO A CG   3  
ATOM 4333  C CD   . PRO A 1 88 ? -11.386 -4.785  -0.216  1.00 1.79 ? 88  PRO A CD   3  
ATOM 4334  H HA   . PRO A 1 88 ? -11.393 -7.793  -1.378  1.00 2.04 ? 88  PRO A HA   3  
ATOM 4335  H HB2  . PRO A 1 88 ? -12.505 -7.612  1.089   1.00 2.18 ? 88  PRO A HB2  3  
ATOM 4336  H HB3  . PRO A 1 88 ? -10.777 -7.390  0.799   1.00 1.96 ? 88  PRO A HB3  3  
ATOM 4337  H HG2  . PRO A 1 88 ? -12.916 -5.331  1.169   1.00 2.24 ? 88  PRO A HG2  3  
ATOM 4338  H HG3  . PRO A 1 88 ? -11.272 -5.370  1.832   1.00 1.85 ? 88  PRO A HG3  3  
ATOM 4339  H HD2  . PRO A 1 88 ? -11.954 -3.873  -0.326  1.00 1.89 ? 88  PRO A HD2  3  
ATOM 4340  H HD3  . PRO A 1 88 ? -10.335 -4.565  -0.108  1.00 1.68 ? 88  PRO A HD3  3  
ATOM 4341  N N    . THR A 1 89 ? -13.743 -8.421  -1.952  1.00 2.38 ? 89  THR A N    3  
ATOM 4342  C CA   . THR A 1 89 ? -15.111 -8.812  -2.294  1.00 2.59 ? 89  THR A CA   3  
ATOM 4343  C C    . THR A 1 89 ? -15.272 -10.332 -2.243  1.00 2.77 ? 89  THR A C    3  
ATOM 4344  O O    . THR A 1 89 ? -15.180 -11.013 -3.269  1.00 3.51 ? 89  THR A O    3  
ATOM 4345  C CB   . THR A 1 89 ? -15.489 -8.284  -3.684  1.00 3.08 ? 89  THR A CB   3  
ATOM 4346  O OG1  . THR A 1 89 ? -14.419 -8.448  -4.599  1.00 3.51 ? 89  THR A OG1  3  
ATOM 4347  C CG2  . THR A 1 89 ? -15.873 -6.818  -3.685  1.00 3.88 ? 89  THR A CG2  3  
ATOM 4348  H H    . THR A 1 89 ? -12.998 -8.971  -2.273  1.00 2.41 ? 89  THR A H    3  
ATOM 4349  H HA   . THR A 1 89 ? -15.771 -8.372  -1.561  1.00 2.82 ? 89  THR A HA   3  
ATOM 4350  H HB   . THR A 1 89 ? -16.337 -8.845  -4.052  1.00 3.20 ? 89  THR A HB   3  
ATOM 4351  H HG1  . THR A 1 89 ? -14.456 -9.328  -4.982  1.00 3.87 ? 89  THR A HG1  3  
ATOM 4352  H HG21 . THR A 1 89 ? -15.137 -6.253  -4.239  1.00 4.03 ? 89  THR A HG21 3  
ATOM 4353  H HG22 . THR A 1 89 ? -15.914 -6.455  -2.669  1.00 4.36 ? 89  THR A HG22 3  
ATOM 4354  H HG23 . THR A 1 89 ? -16.841 -6.700  -4.149  1.00 4.30 ? 89  THR A HG23 3  
ATOM 4355  N N    . GLY A 1 90 ? -15.510 -10.859 -1.040  1.00 2.75 ? 90  GLY A N    3  
ATOM 4356  C CA   . GLY A 1 90 ? -15.680 -12.295 -0.871  1.00 3.54 ? 90  GLY A CA   3  
ATOM 4357  C C    . GLY A 1 90 ? -16.849 -12.665 0.033   1.00 4.20 ? 90  GLY A C    3  
ATOM 4358  O O    . GLY A 1 90 ? -16.950 -13.811 0.473   1.00 4.69 ? 90  GLY A O    3  
ATOM 4359  H H    . GLY A 1 90 ? -15.569 -10.266 -0.260  1.00 2.65 ? 90  GLY A H    3  
ATOM 4360  H HA2  . GLY A 1 90 ? -15.839 -12.743 -1.840  1.00 3.91 ? 90  GLY A HA2  3  
ATOM 4361  H HA3  . GLY A 1 90 ? -14.773 -12.702 -0.447  1.00 3.79 ? 90  GLY A HA3  3  
ATOM 4362  N N    . SER A 1 91 ? -17.731 -11.700 0.315   1.00 4.69 ? 91  SER A N    3  
ATOM 4363  C CA   . SER A 1 91 ? -18.890 -11.940 1.174   1.00 5.64 ? 91  SER A CA   3  
ATOM 4364  C C    . SER A 1 91 ? -19.883 -12.895 0.509   1.00 5.73 ? 91  SER A C    3  
ATOM 4365  O O    . SER A 1 91 ? -20.318 -13.871 1.121   1.00 6.47 ? 91  SER A O    3  
ATOM 4366  C CB   . SER A 1 91 ? -19.584 -10.618 1.515   1.00 6.57 ? 91  SER A CB   3  
ATOM 4367  O OG   . SER A 1 91 ? -18.754 -9.796  2.316   1.00 7.06 ? 91  SER A OG   3  
ATOM 4368  H H    . SER A 1 91 ? -17.597 -10.804 -0.059  1.00 4.66 ? 91  SER A H    3  
ATOM 4369  H HA   . SER A 1 91 ? -18.535 -12.393 2.088   1.00 5.94 ? 91  SER A HA   3  
ATOM 4370  H HB2  . SER A 1 91 ? -19.817 -10.091 0.601   1.00 6.78 ? 91  SER A HB2  3  
ATOM 4371  H HB3  . SER A 1 91 ? -20.498 -10.822 2.054   1.00 6.97 ? 91  SER A HB3  3  
ATOM 4372  H HG   . SER A 1 91 ? -18.885 -10.012 3.242   1.00 7.36 ? 91  SER A HG   3  
ATOM 4373  N N    . HIS A 1 92 ? -20.233 -12.607 -0.746  1.00 5.26 ? 92  HIS A N    3  
ATOM 4374  C CA   . HIS A 1 92 ? -21.172 -13.439 -1.495  1.00 5.60 ? 92  HIS A CA   3  
ATOM 4375  C C    . HIS A 1 92 ? -20.446 -14.592 -2.184  1.00 5.37 ? 92  HIS A C    3  
ATOM 4376  O O    . HIS A 1 92 ? -20.094 -15.586 -1.548  1.00 5.46 ? 92  HIS A O    3  
ATOM 4377  C CB   . HIS A 1 92 ? -21.921 -12.600 -2.534  1.00 5.86 ? 92  HIS A CB   3  
ATOM 4378  C CG   . HIS A 1 92 ? -23.272 -12.145 -2.076  1.00 6.59 ? 92  HIS A CG   3  
ATOM 4379  N ND1  . HIS A 1 92 ? -24.409 -12.915 -2.205  1.00 7.09 ? 92  HIS A ND1  3  
ATOM 4380  C CD2  . HIS A 1 92 ? -23.666 -10.993 -1.484  1.00 7.14 ? 92  HIS A CD2  3  
ATOM 4381  C CE1  . HIS A 1 92 ? -25.444 -12.255 -1.715  1.00 7.83 ? 92  HIS A CE1  3  
ATOM 4382  N NE2  . HIS A 1 92 ? -25.020 -11.087 -1.270  1.00 7.84 ? 92  HIS A NE2  3  
ATOM 4383  H H    . HIS A 1 92 ? -19.850 -11.814 -1.179  1.00 4.89 ? 92  HIS A H    3  
ATOM 4384  H HA   . HIS A 1 92 ? -21.885 -13.848 -0.794  1.00 6.24 ? 92  HIS A HA   3  
ATOM 4385  H HB2  . HIS A 1 92 ? -21.337 -11.721 -2.766  1.00 5.88 ? 92  HIS A HB2  3  
ATOM 4386  H HB3  . HIS A 1 92 ? -22.053 -13.186 -3.432  1.00 5.88 ? 92  HIS A HB3  3  
ATOM 4387  H HD1  . HIS A 1 92 ? -24.453 -13.811 -2.599  1.00 7.08 ? 92  HIS A HD1  3  
ATOM 4388  H HD2  . HIS A 1 92 ? -23.033 -10.155 -1.228  1.00 7.21 ? 92  HIS A HD2  3  
ATOM 4389  H HE1  . HIS A 1 92 ? -26.463 -12.612 -1.682  1.00 8.46 ? 92  HIS A HE1  3  
ATOM 4390  H HE2  . HIS A 1 92 ? -25.595 -10.367 -0.936  1.00 8.38 ? 92  HIS A HE2  3  
ATOM 4391  N N    . ARG B 2 1  ? 3.870   -11.898 11.906  1.00 1.88 ? 301 ARG B N    3  
ATOM 4392  C CA   . ARG B 2 1  ? 3.297   -10.578 11.515  1.00 1.27 ? 301 ARG B CA   3  
ATOM 4393  C C    . ARG B 2 1  ? 4.326   -9.461  11.677  1.00 1.29 ? 301 ARG B C    3  
ATOM 4394  O O    . ARG B 2 1  ? 4.898   -9.284  12.755  1.00 2.06 ? 301 ARG B O    3  
ATOM 4395  C CB   . ARG B 2 1  ? 2.066   -10.294 12.384  1.00 1.61 ? 301 ARG B CB   3  
ATOM 4396  C CG   . ARG B 2 1  ? 1.000   -11.378 12.309  1.00 2.13 ? 301 ARG B CG   3  
ATOM 4397  C CD   . ARG B 2 1  ? -0.378  -10.835 12.658  1.00 2.72 ? 301 ARG B CD   3  
ATOM 4398  N NE   . ARG B 2 1  ? -1.392  -11.889 12.693  1.00 3.09 ? 301 ARG B NE   3  
ATOM 4399  C CZ   . ARG B 2 1  ? -2.602  -11.745 13.241  1.00 3.70 ? 301 ARG B CZ   3  
ATOM 4400  N NH1  . ARG B 2 1  ? -2.966  -10.587 13.785  1.00 4.18 ? 301 ARG B NH1  3  
ATOM 4401  N NH2  . ARG B 2 1  ? -3.454  -12.765 13.237  1.00 4.22 ? 301 ARG B NH2  3  
ATOM 4402  H H1   . ARG B 2 1  ? 3.234   -12.639 11.547  1.00 2.43 ? 301 ARG B H1   3  
ATOM 4403  H H2   . ARG B 2 1  ? 3.928   -11.925 12.945  1.00 1.96 ? 301 ARG B H2   3  
ATOM 4404  H H3   . ARG B 2 1  ? 4.813   -11.976 11.475  1.00 2.41 ? 301 ARG B H3   3  
ATOM 4405  H HA   . ARG B 2 1  ? 2.996   -10.630 10.479  1.00 1.25 ? 301 ARG B HA   3  
ATOM 4406  H HB2  . ARG B 2 1  ? 2.381   -10.201 13.413  1.00 1.79 ? 301 ARG B HB2  3  
ATOM 4407  H HB3  . ARG B 2 1  ? 1.624   -9.362  12.066  1.00 2.19 ? 301 ARG B HB3  3  
ATOM 4408  H HG2  . ARG B 2 1  ? 0.975   -11.775 11.306  1.00 2.63 ? 301 ARG B HG2  3  
ATOM 4409  H HG3  . ARG B 2 1  ? 1.253   -12.166 13.003  1.00 2.48 ? 301 ARG B HG3  3  
ATOM 4410  H HD2  . ARG B 2 1  ? -0.328  -10.364 13.629  1.00 3.13 ? 301 ARG B HD2  3  
ATOM 4411  H HD3  . ARG B 2 1  ? -0.660  -10.100 11.918  1.00 3.11 ? 301 ARG B HD3  3  
ATOM 4412  H HE   . ARG B 2 1  ? -1.159  -12.753 12.292  1.00 3.22 ? 301 ARG B HE   3  
ATOM 4413  H HH11 . ARG B 2 1  ? -2.334  -9.813  13.790  1.00 4.11 ? 301 ARG B HH11 3  
ATOM 4414  H HH12 . ARG B 2 1  ? -3.875  -10.491 14.192  1.00 4.83 ? 301 ARG B HH12 3  
ATOM 4415  H HH21 . ARG B 2 1  ? -3.189  -13.637 12.826  1.00 4.29 ? 301 ARG B HH21 3  
ATOM 4416  H HH22 . ARG B 2 1  ? -4.361  -12.661 13.647  1.00 4.75 ? 301 ARG B HH22 3  
ATOM 4417  N N    . ARG B 2 2  ? 4.560   -8.710  10.599  1.00 1.12 ? 302 ARG B N    3  
ATOM 4418  C CA   . ARG B 2 2  ? 5.523   -7.611  10.621  1.00 1.03 ? 302 ARG B CA   3  
ATOM 4419  C C    . ARG B 2 2  ? 4.963   -6.376  9.919   1.00 1.02 ? 302 ARG B C    3  
ATOM 4420  O O    . ARG B 2 2  ? 4.577   -6.434  8.749   1.00 1.45 ? 302 ARG B O    3  
ATOM 4421  C CB   . ARG B 2 2  ? 6.836   -8.036  9.959   1.00 1.13 ? 302 ARG B CB   3  
ATOM 4422  C CG   . ARG B 2 2  ? 8.057   -7.311  10.503  1.00 1.12 ? 302 ARG B CG   3  
ATOM 4423  C CD   . ARG B 2 2  ? 9.328   -8.117  10.288  1.00 1.50 ? 302 ARG B CD   3  
ATOM 4424  N NE   . ARG B 2 2  ? 9.389   -9.294  11.156  1.00 2.09 ? 302 ARG B NE   3  
ATOM 4425  C CZ   . ARG B 2 2  ? 9.789   -9.267  12.432  1.00 2.72 ? 302 ARG B CZ   3  
ATOM 4426  N NH1  . ARG B 2 2  ? 10.166  -8.123  13.000  1.00 2.99 ? 302 ARG B NH1  3  
ATOM 4427  N NH2  . ARG B 2 2  ? 9.809   -10.389 13.142  1.00 3.57 ? 302 ARG B NH2  3  
ATOM 4428  H H    . ARG B 2 2  ? 4.074   -8.901  9.770   1.00 1.61 ? 302 ARG B H    3  
ATOM 4429  H HA   . ARG B 2 2  ? 5.716   -7.363  11.654  1.00 1.03 ? 302 ARG B HA   3  
ATOM 4430  H HB2  . ARG B 2 2  ? 6.976   -9.096  10.112  1.00 1.20 ? 302 ARG B HB2  3  
ATOM 4431  H HB3  . ARG B 2 2  ? 6.771   -7.841  8.898   1.00 1.34 ? 302 ARG B HB3  3  
ATOM 4432  H HG2  . ARG B 2 2  ? 8.154   -6.362  9.997   1.00 1.33 ? 302 ARG B HG2  3  
ATOM 4433  H HG3  . ARG B 2 2  ? 7.922   -7.144  11.562  1.00 1.30 ? 302 ARG B HG3  3  
ATOM 4434  H HD2  . ARG B 2 2  ? 9.363   -8.440  9.258   1.00 1.82 ? 302 ARG B HD2  3  
ATOM 4435  H HD3  . ARG B 2 2  ? 10.180  -7.484  10.492  1.00 1.86 ? 302 ARG B HD3  3  
ATOM 4436  H HE   . ARG B 2 2  ? 9.117   -10.152 10.769  1.00 2.48 ? 302 ARG B HE   3  
ATOM 4437  H HH11 . ARG B 2 2  ? 10.155  -7.273  12.474  1.00 2.71 ? 302 ARG B HH11 3  
ATOM 4438  H HH12 . ARG B 2 2  ? 10.464  -8.114  13.955  1.00 3.75 ? 302 ARG B HH12 3  
ATOM 4439  H HH21 . ARG B 2 2  ? 9.526   -11.252 12.723  1.00 3.78 ? 302 ARG B HH21 3  
ATOM 4440  H HH22 . ARG B 2 2  ? 10.107  -10.372 14.098  1.00 4.18 ? 302 ARG B HH22 3  
ATOM 4441  N N    . GLU B 2 3  ? 4.926   -5.261  10.646  1.00 0.69 ? 303 GLU B N    3  
ATOM 4442  C CA   . GLU B 2 3  ? 4.421   -4.000  10.110  1.00 0.66 ? 303 GLU B CA   3  
ATOM 4443  C C    . GLU B 2 3  ? 5.497   -2.919  10.197  1.00 0.71 ? 303 GLU B C    3  
ATOM 4444  O O    . GLU B 2 3  ? 5.841   -2.465  11.291  1.00 1.16 ? 303 GLU B O    3  
ATOM 4445  C CB   . GLU B 2 3  ? 3.171   -3.562  10.879  1.00 0.71 ? 303 GLU B CB   3  
ATOM 4446  C CG   . GLU B 2 3  ? 1.909   -4.319  10.490  1.00 1.12 ? 303 GLU B CG   3  
ATOM 4447  C CD   . GLU B 2 3  ? 1.922   -5.770  10.943  1.00 1.54 ? 303 GLU B CD   3  
ATOM 4448  O OE1  . GLU B 2 3  ? 2.061   -6.013  12.161  1.00 2.08 ? 303 GLU B OE1  3  
ATOM 4449  O OE2  . GLU B 2 3  ? 1.792   -6.665  10.079  1.00 1.99 ? 303 GLU B OE2  3  
ATOM 4450  H H    . GLU B 2 3  ? 5.252   -5.286  11.571  1.00 0.73 ? 303 GLU B H    3  
ATOM 4451  H HA   . GLU B 2 3  ? 4.163   -4.155  9.073   1.00 0.62 ? 303 GLU B HA   3  
ATOM 4452  H HB2  . GLU B 2 3  ? 3.342   -3.711  11.935  1.00 1.19 ? 303 GLU B HB2  3  
ATOM 4453  H HB3  . GLU B 2 3  ? 3.004   -2.511  10.698  1.00 0.81 ? 303 GLU B HB3  3  
ATOM 4454  H HG2  . GLU B 2 3  ? 1.059   -3.829  10.940  1.00 1.28 ? 303 GLU B HG2  3  
ATOM 4455  H HG3  . GLU B 2 3  ? 1.808   -4.293  9.415   1.00 1.65 ? 303 GLU B HG3  3  
ATOM 4456  N N    . THR B 2 4  ? 6.034   -2.520  9.043   1.00 0.55 ? 304 THR B N    3  
ATOM 4457  C CA   . THR B 2 4  ? 7.080   -1.502  8.999   1.00 0.55 ? 304 THR B CA   3  
ATOM 4458  C C    . THR B 2 4  ? 6.594   -0.228  8.304   1.00 0.53 ? 304 THR B C    3  
ATOM 4459  O O    . THR B 2 4  ? 5.790   -0.284  7.372   1.00 0.54 ? 304 THR B O    3  
ATOM 4460  C CB   . THR B 2 4  ? 8.332   -2.060  8.304   1.00 0.55 ? 304 THR B CB   3  
ATOM 4461  O OG1  . THR B 2 4  ? 9.358   -2.307  9.248   1.00 0.65 ? 304 THR B OG1  3  
ATOM 4462  C CG2  . THR B 2 4  ? 8.913   -1.156  7.233   1.00 0.56 ? 304 THR B CG2  3  
ATOM 4463  H H    . THR B 2 4  ? 5.725   -2.925  8.205   1.00 0.76 ? 304 THR B H    3  
ATOM 4464  H HA   . THR B 2 4  ? 7.332   -1.259  10.016  1.00 0.59 ? 304 THR B HA   3  
ATOM 4465  H HB   . THR B 2 4  ? 8.078   -2.997  7.836   1.00 0.56 ? 304 THR B HB   3  
ATOM 4466  H HG1  . THR B 2 4  ? 9.530   -3.250  9.296   1.00 0.96 ? 304 THR B HG1  3  
ATOM 4467  H HG21 . THR B 2 4  ? 9.204   -0.215  7.674   1.00 1.05 ? 304 THR B HG21 3  
ATOM 4468  H HG22 . THR B 2 4  ? 8.169   -0.982  6.469   1.00 1.13 ? 304 THR B HG22 3  
ATOM 4469  H HG23 . THR B 2 4  ? 9.776   -1.630  6.791   1.00 1.23 ? 304 THR B HG23 3  
ATOM 4470  N N    . GLN B 2 5  ? 7.101   0.920   8.764   1.00 0.58 ? 305 GLN B N    3  
ATOM 4471  C CA   . GLN B 2 5  ? 6.732   2.211   8.188   1.00 0.60 ? 305 GLN B CA   3  
ATOM 4472  C C    . GLN B 2 5  ? 7.497   2.467   6.894   1.00 0.58 ? 305 GLN B C    3  
ATOM 4473  O O    . GLN B 2 5  ? 8.596   1.946   6.694   1.00 0.74 ? 305 GLN B O    3  
ATOM 4474  C CB   . GLN B 2 5  ? 6.997   3.345   9.180   1.00 0.76 ? 305 GLN B CB   3  
ATOM 4475  C CG   . GLN B 2 5  ? 5.948   3.456   10.275  1.00 0.89 ? 305 GLN B CG   3  
ATOM 4476  C CD   . GLN B 2 5  ? 6.504   4.038   11.564  1.00 1.13 ? 305 GLN B CD   3  
ATOM 4477  O OE1  . GLN B 2 5  ? 6.806   5.229   11.640  1.00 1.67 ? 305 GLN B OE1  3  
ATOM 4478  N NE2  . GLN B 2 5  ? 6.641   3.198   12.586  1.00 1.50 ? 305 GLN B NE2  3  
ATOM 4479  H H    . GLN B 2 5  ? 7.744   0.894   9.505   1.00 0.64 ? 305 GLN B H    3  
ATOM 4480  H HA   . GLN B 2 5  ? 5.677   2.182   7.965   1.00 0.57 ? 305 GLN B HA   3  
ATOM 4481  H HB2  . GLN B 2 5  ? 7.960   3.183   9.646   1.00 0.76 ? 305 GLN B HB2  3  
ATOM 4482  H HB3  . GLN B 2 5  ? 7.022   4.280   8.638   1.00 0.88 ? 305 GLN B HB3  3  
ATOM 4483  H HG2  . GLN B 2 5  ? 5.149   4.093   9.927   1.00 0.96 ? 305 GLN B HG2  3  
ATOM 4484  H HG3  . GLN B 2 5  ? 5.557   2.471   10.482  1.00 0.87 ? 305 GLN B HG3  3  
ATOM 4485  H HE21 . GLN B 2 5  ? 6.380   2.262   12.457  1.00 1.97 ? 305 GLN B HE21 3  
ATOM 4486  H HE22 . GLN B 2 5  ? 6.995   3.551   13.428  1.00 1.62 ? 305 GLN B HE22 3  
ATOM 4487  N N    . VAL B 2 6  ? 6.901   3.268   6.014   1.00 0.58 ? 306 VAL B N    3  
ATOM 4488  C CA   . VAL B 2 6  ? 7.513   3.592   4.727   1.00 0.63 ? 306 VAL B CA   3  
ATOM 4489  C C    . VAL B 2 6  ? 7.199   5.028   4.292   1.00 0.77 ? 306 VAL B C    3  
ATOM 4490  O O    . VAL B 2 6  ? 6.170   5.579   4.742   1.00 1.47 ? 306 VAL B O    3  
ATOM 4491  C CB   . VAL B 2 6  ? 7.038   2.614   3.633   1.00 0.54 ? 306 VAL B CB   3  
ATOM 4492  C CG1  . VAL B 2 6  ? 7.598   1.219   3.884   1.00 0.51 ? 306 VAL B CG1  3  
ATOM 4493  C CG2  . VAL B 2 6  ? 5.517   2.580   3.567   1.00 0.49 ? 306 VAL B CG2  3  
ATOM 4494  O OXT  . VAL B 2 6  ? 7.988   5.588   3.503   1.00 1.14 ? 306 VAL B OXT  3  
ATOM 4495  H H    . VAL B 2 6  ? 6.022   3.646   6.231   1.00 0.70 ? 306 VAL B H    3  
ATOM 4496  H HA   . VAL B 2 6  ? 8.582   3.487   4.832   1.00 0.71 ? 306 VAL B HA   3  
ATOM 4497  H HB   . VAL B 2 6  ? 7.411   2.962   2.680   1.00 0.63 ? 306 VAL B HB   3  
ATOM 4498  H HG11 . VAL B 2 6  ? 8.607   1.298   4.261   1.00 1.08 ? 306 VAL B HG11 3  
ATOM 4499  H HG12 . VAL B 2 6  ? 7.603   0.661   2.960   1.00 1.13 ? 306 VAL B HG12 3  
ATOM 4500  H HG13 . VAL B 2 6  ? 6.982   0.707   4.610   1.00 1.04 ? 306 VAL B HG13 3  
ATOM 4501  H HG21 . VAL B 2 6  ? 5.153   1.705   4.086   1.00 1.09 ? 306 VAL B HG21 3  
ATOM 4502  H HG22 . VAL B 2 6  ? 5.201   2.543   2.535   1.00 1.15 ? 306 VAL B HG22 3  
ATOM 4503  H HG23 . VAL B 2 6  ? 5.115   3.467   4.036   1.00 1.15 ? 306 VAL B HG23 3  
ATOM 4504  N N    . MET A 1 1  ? -8.516  0.173   -7.099  1.00 1.83 ? 1   MET A N    4  
ATOM 4505  C CA   . MET A 1 1  ? -8.468  1.559   -7.639  1.00 1.38 ? 1   MET A CA   4  
ATOM 4506  C C    . MET A 1 1  ? -7.046  2.119   -7.617  1.00 1.20 ? 1   MET A C    4  
ATOM 4507  O O    . MET A 1 1  ? -6.235  1.755   -6.761  1.00 1.07 ? 1   MET A O    4  
ATOM 4508  C CB   . MET A 1 1  ? -9.397  2.446   -6.804  1.00 1.81 ? 1   MET A CB   4  
ATOM 4509  C CG   . MET A 1 1  ? -10.867 2.297   -7.167  1.00 2.04 ? 1   MET A CG   4  
ATOM 4510  S SD   . MET A 1 1  ? -11.927 3.443   -6.264  1.00 2.69 ? 1   MET A SD   4  
ATOM 4511  C CE   . MET A 1 1  ? -12.689 2.339   -5.076  1.00 3.17 ? 1   MET A CE   4  
ATOM 4512  H H1   . MET A 1 1  ? -8.224  0.208   -6.101  1.00 2.20 ? 1   MET A H1   4  
ATOM 4513  H H2   . MET A 1 1  ? -7.861  -0.410  -7.661  1.00 2.22 ? 1   MET A H2   4  
ATOM 4514  H H3   . MET A 1 1  ? -9.494  -0.170  -7.189  1.00 1.92 ? 1   MET A H3   4  
ATOM 4515  H HA   . MET A 1 1  ? -8.820  1.539   -8.660  1.00 1.47 ? 1   MET A HA   4  
ATOM 4516  H HB2  . MET A 1 1  ? -9.279  2.192   -5.760  1.00 2.32 ? 1   MET A HB2  4  
ATOM 4517  H HB3  . MET A 1 1  ? -9.117  3.479   -6.948  1.00 2.16 ? 1   MET A HB3  4  
ATOM 4518  H HG2  . MET A 1 1  ? -10.983 2.480   -8.225  1.00 2.47 ? 1   MET A HG2  4  
ATOM 4519  H HG3  . MET A 1 1  ? -11.178 1.287   -6.941  1.00 2.24 ? 1   MET A HG3  4  
ATOM 4520  H HE1  . MET A 1 1  ? -13.665 2.716   -4.810  1.00 3.35 ? 1   MET A HE1  4  
ATOM 4521  H HE2  . MET A 1 1  ? -12.073 2.280   -4.192  1.00 3.35 ? 1   MET A HE2  4  
ATOM 4522  H HE3  . MET A 1 1  ? -12.790 1.356   -5.512  1.00 3.67 ? 1   MET A HE3  4  
ATOM 4523  N N    . GLU A 1 2  ? -6.751  3.008   -8.567  1.00 1.25 ? 2   GLU A N    4  
ATOM 4524  C CA   . GLU A 1 2  ? -5.431  3.626   -8.665  1.00 1.15 ? 2   GLU A CA   4  
ATOM 4525  C C    . GLU A 1 2  ? -5.454  5.062   -8.139  1.00 1.12 ? 2   GLU A C    4  
ATOM 4526  O O    . GLU A 1 2  ? -6.500  5.713   -8.136  1.00 1.17 ? 2   GLU A O    4  
ATOM 4527  C CB   . GLU A 1 2  ? -4.937  3.611   -10.118 1.00 1.22 ? 2   GLU A CB   4  
ATOM 4528  C CG   . GLU A 1 2  ? -5.858  4.332   -11.095 1.00 1.74 ? 2   GLU A CG   4  
ATOM 4529  C CD   . GLU A 1 2  ? -6.736  3.379   -11.887 1.00 1.63 ? 2   GLU A CD   4  
ATOM 4530  O OE1  . GLU A 1 2  ? -7.835  3.041   -11.399 1.00 1.88 ? 2   GLU A OE1  4  
ATOM 4531  O OE2  . GLU A 1 2  ? -6.325  2.973   -12.994 1.00 1.97 ? 2   GLU A OE2  4  
ATOM 4532  H H    . GLU A 1 2  ? -7.441  3.257   -9.217  1.00 1.40 ? 2   GLU A H    4  
ATOM 4533  H HA   . GLU A 1 2  ? -4.749  3.047   -8.060  1.00 1.06 ? 2   GLU A HA   4  
ATOM 4534  H HB2  . GLU A 1 2  ? -3.967  4.086   -10.159 1.00 1.76 ? 2   GLU A HB2  4  
ATOM 4535  H HB3  . GLU A 1 2  ? -4.837  2.587   -10.441 1.00 1.34 ? 2   GLU A HB3  4  
ATOM 4536  H HG2  . GLU A 1 2  ? -6.494  5.006   -10.542 1.00 2.14 ? 2   GLU A HG2  4  
ATOM 4537  H HG3  . GLU A 1 2  ? -5.253  4.899   -11.787 1.00 2.47 ? 2   GLU A HG3  4  
ATOM 4538  N N    . ILE A 1 3  ? -4.290  5.550   -7.708  1.00 1.09 ? 3   ILE A N    4  
ATOM 4539  C CA   . ILE A 1 3  ? -4.152  6.907   -7.192  1.00 1.10 ? 3   ILE A CA   4  
ATOM 4540  C C    . ILE A 1 3  ? -2.778  7.456   -7.569  1.00 1.02 ? 3   ILE A C    4  
ATOM 4541  O O    . ILE A 1 3  ? -1.770  6.758   -7.421  1.00 1.07 ? 3   ILE A O    4  
ATOM 4542  C CB   . ILE A 1 3  ? -4.313  6.948   -5.654  1.00 1.18 ? 3   ILE A CB   4  
ATOM 4543  C CG1  . ILE A 1 3  ? -5.736  6.554   -5.249  1.00 1.34 ? 3   ILE A CG1  4  
ATOM 4544  C CG2  . ILE A 1 3  ? -3.967  8.330   -5.119  1.00 1.22 ? 3   ILE A CG2  4  
ATOM 4545  C CD1  . ILE A 1 3  ? -5.873  5.095   -4.873  1.00 1.10 ? 3   ILE A CD1  4  
ATOM 4546  H H    . ILE A 1 3  ? -3.486  4.993   -7.747  1.00 1.08 ? 3   ILE A H    4  
ATOM 4547  H HA   . ILE A 1 3  ? -4.920  7.523   -7.639  1.00 1.15 ? 3   ILE A HA   4  
ATOM 4548  H HB   . ILE A 1 3  ? -3.616  6.242   -5.225  1.00 1.17 ? 3   ILE A HB   4  
ATOM 4549  H HG12 . ILE A 1 3  ? -6.040  7.145   -4.397  1.00 1.83 ? 3   ILE A HG12 4  
ATOM 4550  H HG13 . ILE A 1 3  ? -6.406  6.749   -6.074  1.00 1.86 ? 3   ILE A HG13 4  
ATOM 4551  H HG21 . ILE A 1 3  ? -4.622  9.063   -5.564  1.00 1.72 ? 3   ILE A HG21 4  
ATOM 4552  H HG22 . ILE A 1 3  ? -2.942  8.564   -5.369  1.00 1.51 ? 3   ILE A HG22 4  
ATOM 4553  H HG23 . ILE A 1 3  ? -4.087  8.341   -4.047  1.00 1.55 ? 3   ILE A HG23 4  
ATOM 4554  H HD11 . ILE A 1 3  ? -6.865  4.749   -5.123  1.00 1.47 ? 3   ILE A HD11 4  
ATOM 4555  H HD12 . ILE A 1 3  ? -5.710  4.979   -3.812  1.00 1.61 ? 3   ILE A HD12 4  
ATOM 4556  H HD13 . ILE A 1 3  ? -5.142  4.513   -5.415  1.00 1.54 ? 3   ILE A HD13 4  
ATOM 4557  N N    . LYS A 1 4  ? -2.727  8.695   -8.062  1.00 0.98 ? 4   LYS A N    4  
ATOM 4558  C CA   . LYS A 1 4  ? -1.454  9.290   -8.455  1.00 0.96 ? 4   LYS A CA   4  
ATOM 4559  C C    . LYS A 1 4  ? -0.843  10.098  -7.311  1.00 0.96 ? 4   LYS A C    4  
ATOM 4560  O O    . LYS A 1 4  ? -1.132  11.285  -7.144  1.00 1.08 ? 4   LYS A O    4  
ATOM 4561  C CB   . LYS A 1 4  ? -1.644  10.176  -9.691  1.00 1.07 ? 4   LYS A CB   4  
ATOM 4562  C CG   . LYS A 1 4  ? -1.637  9.402   -10.999 1.00 1.35 ? 4   LYS A CG   4  
ATOM 4563  C CD   . LYS A 1 4  ? -0.228  8.983   -11.399 1.00 1.59 ? 4   LYS A CD   4  
ATOM 4564  C CE   . LYS A 1 4  ? 0.043   9.271   -12.867 1.00 2.29 ? 4   LYS A CE   4  
ATOM 4565  N NZ   . LYS A 1 4  ? 1.211   8.502   -13.381 1.00 2.93 ? 4   LYS A NZ   4  
ATOM 4566  H H    . LYS A 1 4  ? -3.550  9.218   -8.167  1.00 1.01 ? 4   LYS A H    4  
ATOM 4567  H HA   . LYS A 1 4  ? -0.779  8.485   -8.706  1.00 0.96 ? 4   LYS A HA   4  
ATOM 4568  H HB2  . LYS A 1 4  ? -2.588  10.693  -9.608  1.00 1.56 ? 4   LYS A HB2  4  
ATOM 4569  H HB3  . LYS A 1 4  ? -0.848  10.905  -9.725  1.00 1.61 ? 4   LYS A HB3  4  
ATOM 4570  H HG2  . LYS A 1 4  ? -2.244  8.517   -10.885 1.00 1.93 ? 4   LYS A HG2  4  
ATOM 4571  H HG3  . LYS A 1 4  ? -2.051  10.027  -11.777 1.00 1.87 ? 4   LYS A HG3  4  
ATOM 4572  H HD2  . LYS A 1 4  ? 0.485   9.528   -10.798 1.00 1.98 ? 4   LYS A HD2  4  
ATOM 4573  H HD3  . LYS A 1 4  ? -0.115  7.924   -11.220 1.00 1.90 ? 4   LYS A HD3  4  
ATOM 4574  H HE2  . LYS A 1 4  ? -0.832  9.001   -13.440 1.00 2.72 ? 4   LYS A HE2  4  
ATOM 4575  H HE3  . LYS A 1 4  ? 0.237   10.326  -12.984 1.00 2.70 ? 4   LYS A HE3  4  
ATOM 4576  H HZ1  . LYS A 1 4  ? 1.020   7.481   -13.329 1.00 3.17 ? 4   LYS A HZ1  4  
ATOM 4577  H HZ2  . LYS A 1 4  ? 2.057   8.715   -12.814 1.00 3.54 ? 4   LYS A HZ2  4  
ATOM 4578  H HZ3  . LYS A 1 4  ? 1.399   8.758   -14.371 1.00 3.06 ? 4   LYS A HZ3  4  
ATOM 4579  N N    . LEU A 1 5  ? -0.015  9.426   -6.514  1.00 0.89 ? 5   LEU A N    4  
ATOM 4580  C CA   . LEU A 1 5  ? 0.627   10.058  -5.363  1.00 0.97 ? 5   LEU A CA   4  
ATOM 4581  C C    . LEU A 1 5  ? 1.966   10.692  -5.744  1.00 0.88 ? 5   LEU A C    4  
ATOM 4582  O O    . LEU A 1 5  ? 2.827   10.042  -6.339  1.00 0.82 ? 5   LEU A O    4  
ATOM 4583  C CB   . LEU A 1 5  ? 0.822   9.044   -4.233  1.00 1.11 ? 5   LEU A CB   4  
ATOM 4584  C CG   . LEU A 1 5  ? -0.432  8.746   -3.404  1.00 1.42 ? 5   LEU A CG   4  
ATOM 4585  C CD1  . LEU A 1 5  ? -0.248  7.469   -2.600  1.00 1.50 ? 5   LEU A CD1  4  
ATOM 4586  C CD2  . LEU A 1 5  ? -0.764  9.913   -2.482  1.00 2.09 ? 5   LEU A CD2  4  
ATOM 4587  H H    . LEU A 1 5  ? 0.123   8.469   -6.695  1.00 0.85 ? 5   LEU A H    4  
ATOM 4588  H HA   . LEU A 1 5  ? -0.032  10.840  -5.015  1.00 1.10 ? 5   LEU A HA   4  
ATOM 4589  H HB2  . LEU A 1 5  ? 1.171   8.118   -4.666  1.00 1.26 ? 5   LEU A HB2  4  
ATOM 4590  H HB3  . LEU A 1 5  ? 1.584   9.420   -3.567  1.00 1.25 ? 5   LEU A HB3  4  
ATOM 4591  H HG   . LEU A 1 5  ? -1.270  8.599   -4.073  1.00 1.86 ? 5   LEU A HG   4  
ATOM 4592  H HD11 . LEU A 1 5  ? -1.205  7.139   -2.224  1.00 1.87 ? 5   LEU A HD11 4  
ATOM 4593  H HD12 . LEU A 1 5  ? 0.419   7.658   -1.772  1.00 2.01 ? 5   LEU A HD12 4  
ATOM 4594  H HD13 . LEU A 1 5  ? 0.173   6.702   -3.234  1.00 1.76 ? 5   LEU A HD13 4  
ATOM 4595  H HD21 . LEU A 1 5  ? -0.776  9.571   -1.458  1.00 2.37 ? 5   LEU A HD21 4  
ATOM 4596  H HD22 . LEU A 1 5  ? -1.735  10.310  -2.739  1.00 2.53 ? 5   LEU A HD22 4  
ATOM 4597  H HD23 . LEU A 1 5  ? -0.018  10.686  -2.594  1.00 2.63 ? 5   LEU A HD23 4  
ATOM 4598  N N    . ILE A 1 6  ? 2.125   11.971  -5.391  1.00 0.95 ? 6   ILE A N    4  
ATOM 4599  C CA   . ILE A 1 6  ? 3.353   12.713  -5.684  1.00 0.90 ? 6   ILE A CA   4  
ATOM 4600  C C    . ILE A 1 6  ? 4.327   12.651  -4.502  1.00 0.93 ? 6   ILE A C    4  
ATOM 4601  O O    . ILE A 1 6  ? 3.957   12.954  -3.365  1.00 1.06 ? 6   ILE A O    4  
ATOM 4602  C CB   . ILE A 1 6  ? 3.056   14.195  -6.031  1.00 1.04 ? 6   ILE A CB   4  
ATOM 4603  C CG1  . ILE A 1 6  ? 4.335   14.899  -6.504  1.00 1.29 ? 6   ILE A CG1  4  
ATOM 4604  C CG2  . ILE A 1 6  ? 2.447   14.925  -4.838  1.00 1.21 ? 6   ILE A CG2  4  
ATOM 4605  C CD1  . ILE A 1 6  ? 4.116   16.331  -6.948  1.00 1.94 ? 6   ILE A CD1  4  
ATOM 4606  H H    . ILE A 1 6  ? 1.398   12.427  -4.917  1.00 1.06 ? 6   ILE A H    4  
ATOM 4607  H HA   . ILE A 1 6  ? 3.819   12.253  -6.545  1.00 0.86 ? 6   ILE A HA   4  
ATOM 4608  H HB   . ILE A 1 6  ? 2.333   14.210  -6.832  1.00 1.27 ? 6   ILE A HB   4  
ATOM 4609  H HG12 . ILE A 1 6  ? 5.052   14.911  -5.696  1.00 1.47 ? 6   ILE A HG12 4  
ATOM 4610  H HG13 . ILE A 1 6  ? 4.751   14.353  -7.338  1.00 1.34 ? 6   ILE A HG13 4  
ATOM 4611  H HG21 . ILE A 1 6  ? 1.740   14.278  -4.341  1.00 1.62 ? 6   ILE A HG21 4  
ATOM 4612  H HG22 . ILE A 1 6  ? 1.940   15.814  -5.182  1.00 1.62 ? 6   ILE A HG22 4  
ATOM 4613  H HG23 . ILE A 1 6  ? 3.228   15.202  -4.146  1.00 1.45 ? 6   ILE A HG23 4  
ATOM 4614  H HD11 . ILE A 1 6  ? 3.118   16.438  -7.346  1.00 2.44 ? 6   ILE A HD11 4  
ATOM 4615  H HD12 . ILE A 1 6  ? 4.837   16.584  -7.712  1.00 2.21 ? 6   ILE A HD12 4  
ATOM 4616  H HD13 . ILE A 1 6  ? 4.240   16.993  -6.104  1.00 2.30 ? 6   ILE A HD13 4  
ATOM 4617  N N    . LYS A 1 7  ? 5.570   12.249  -4.775  1.00 0.91 ? 7   LYS A N    4  
ATOM 4618  C CA   . LYS A 1 7  ? 6.591   12.140  -3.732  1.00 1.06 ? 7   LYS A CA   4  
ATOM 4619  C C    . LYS A 1 7  ? 7.107   13.518  -3.314  1.00 1.18 ? 7   LYS A C    4  
ATOM 4620  O O    . LYS A 1 7  ? 7.838   14.172  -4.061  1.00 1.29 ? 7   LYS A O    4  
ATOM 4621  C CB   . LYS A 1 7  ? 7.754   11.261  -4.209  1.00 1.26 ? 7   LYS A CB   4  
ATOM 4622  C CG   . LYS A 1 7  ? 8.882   11.127  -3.195  1.00 1.78 ? 7   LYS A CG   4  
ATOM 4623  C CD   . LYS A 1 7  ? 8.588   10.048  -2.164  1.00 2.30 ? 7   LYS A CD   4  
ATOM 4624  C CE   . LYS A 1 7  ? 9.028   10.474  -0.771  1.00 2.50 ? 7   LYS A CE   4  
ATOM 4625  N NZ   . LYS A 1 7  ? 9.072   9.322   0.175   1.00 3.10 ? 7   LYS A NZ   4  
ATOM 4626  H H    . LYS A 1 7  ? 5.803   12.010  -5.698  1.00 0.88 ? 7   LYS A H    4  
ATOM 4627  H HA   . LYS A 1 7  ? 6.132   11.671  -2.876  1.00 1.12 ? 7   LYS A HA   4  
ATOM 4628  H HB2  . LYS A 1 7  ? 7.377   10.271  -4.426  1.00 1.17 ? 7   LYS A HB2  4  
ATOM 4629  H HB3  . LYS A 1 7  ? 8.161   11.685  -5.114  1.00 1.45 ? 7   LYS A HB3  4  
ATOM 4630  H HG2  . LYS A 1 7  ? 9.793   10.871  -3.716  1.00 2.05 ? 7   LYS A HG2  4  
ATOM 4631  H HG3  . LYS A 1 7  ? 9.012   12.072  -2.688  1.00 2.37 ? 7   LYS A HG3  4  
ATOM 4632  H HD2  . LYS A 1 7  ? 7.526   9.853   -2.152  1.00 2.80 ? 7   LYS A HD2  4  
ATOM 4633  H HD3  . LYS A 1 7  ? 9.119   9.149   -2.440  1.00 2.70 ? 7   LYS A HD3  4  
ATOM 4634  H HE2  . LYS A 1 7  ? 10.013  10.912  -0.837  1.00 3.04 ? 7   LYS A HE2  4  
ATOM 4635  H HE3  . LYS A 1 7  ? 8.332   11.210  -0.398  1.00 2.26 ? 7   LYS A HE3  4  
ATOM 4636  H HZ1  . LYS A 1 7  ? 9.753   8.610   -0.161  1.00 3.61 ? 7   LYS A HZ1  4  
ATOM 4637  H HZ2  . LYS A 1 7  ? 8.133   8.882   0.247   1.00 3.37 ? 7   LYS A HZ2  4  
ATOM 4638  H HZ3  . LYS A 1 7  ? 9.364   9.647   1.118   1.00 3.30 ? 7   LYS A HZ3  4  
ATOM 4639  N N    . GLY A 1 8  ? 6.720   13.950  -2.111  1.00 1.38 ? 8   GLY A N    4  
ATOM 4640  C CA   . GLY A 1 8  ? 7.150   15.244  -1.605  1.00 1.62 ? 8   GLY A CA   4  
ATOM 4641  C C    . GLY A 1 8  ? 8.281   15.131  -0.593  1.00 1.78 ? 8   GLY A C    4  
ATOM 4642  O O    . GLY A 1 8  ? 8.920   14.082  -0.489  1.00 1.78 ? 8   GLY A O    4  
ATOM 4643  H H    . GLY A 1 8  ? 6.135   13.383  -1.565  1.00 1.48 ? 8   GLY A H    4  
ATOM 4644  H HA2  . GLY A 1 8  ? 7.486   15.849  -2.434  1.00 1.65 ? 8   GLY A HA2  4  
ATOM 4645  H HA3  . GLY A 1 8  ? 6.308   15.732  -1.136  1.00 1.79 ? 8   GLY A HA3  4  
ATOM 4646  N N    . PRO A 1 9  ? 8.549   16.206  0.178   1.00 2.05 ? 9   PRO A N    4  
ATOM 4647  C CA   . PRO A 1 9  ? 9.615   16.219  1.193   1.00 2.32 ? 9   PRO A CA   4  
ATOM 4648  C C    . PRO A 1 9  ? 9.398   15.155  2.269   1.00 2.37 ? 9   PRO A C    4  
ATOM 4649  O O    . PRO A 1 9  ? 10.306  14.380  2.580   1.00 2.77 ? 9   PRO A O    4  
ATOM 4650  C CB   . PRO A 1 9  ? 9.525   17.624  1.802   1.00 2.68 ? 9   PRO A CB   4  
ATOM 4651  C CG   . PRO A 1 9  ? 8.783   18.438  0.797   1.00 2.59 ? 9   PRO A CG   4  
ATOM 4652  C CD   . PRO A 1 9  ? 7.834   17.492  0.121   1.00 2.24 ? 9   PRO A CD   4  
ATOM 4653  H HA   . PRO A 1 9  ? 10.588  16.080  0.744   1.00 2.37 ? 9   PRO A HA   4  
ATOM 4654  H HB2  . PRO A 1 9  ? 8.993   17.578  2.742   1.00 2.85 ? 9   PRO A HB2  4  
ATOM 4655  H HB3  . PRO A 1 9  ? 10.520  18.013  1.966   1.00 2.89 ? 9   PRO A HB3  4  
ATOM 4656  H HG2  . PRO A 1 9  ? 8.236   19.226  1.294   1.00 2.84 ? 9   PRO A HG2  4  
ATOM 4657  H HG3  . PRO A 1 9  ? 9.473   18.854  0.079   1.00 2.61 ? 9   PRO A HG3  4  
ATOM 4658  H HD2  . PRO A 1 9  ? 6.900   17.441  0.661   1.00 2.35 ? 9   PRO A HD2  4  
ATOM 4659  H HD3  . PRO A 1 9  ? 7.664   17.794  -0.902  1.00 2.14 ? 9   PRO A HD3  4  
ATOM 4660  N N    . LYS A 1 10 ? 8.184   15.121  2.823   1.00 2.38 ? 10  LYS A N    4  
ATOM 4661  C CA   . LYS A 1 10 ? 7.835   14.147  3.853   1.00 2.57 ? 10  LYS A CA   4  
ATOM 4662  C C    . LYS A 1 10 ? 7.801   12.742  3.257   1.00 2.26 ? 10  LYS A C    4  
ATOM 4663  O O    . LYS A 1 10 ? 8.634   11.897  3.591   1.00 2.45 ? 10  LYS A O    4  
ATOM 4664  C CB   . LYS A 1 10 ? 6.482   14.490  4.490   1.00 2.99 ? 10  LYS A CB   4  
ATOM 4665  C CG   . LYS A 1 10 ? 6.580   15.529  5.596   1.00 3.71 ? 10  LYS A CG   4  
ATOM 4666  C CD   . LYS A 1 10 ? 5.759   15.125  6.811   1.00 4.04 ? 10  LYS A CD   4  
ATOM 4667  C CE   . LYS A 1 10 ? 5.972   16.082  7.975   1.00 4.40 ? 10  LYS A CE   4  
ATOM 4668  N NZ   . LYS A 1 10 ? 4.727   16.819  8.331   1.00 4.92 ? 10  LYS A NZ   4  
ATOM 4669  H H    . LYS A 1 10 ? 7.512   15.766  2.517   1.00 2.55 ? 10  LYS A H    4  
ATOM 4670  H HA   . LYS A 1 10 ? 8.602   14.181  4.614   1.00 2.82 ? 10  LYS A HA   4  
ATOM 4671  H HB2  . LYS A 1 10 ? 5.822   14.871  3.725   1.00 3.13 ? 10  LYS A HB2  4  
ATOM 4672  H HB3  . LYS A 1 10 ? 6.054   13.591  4.906   1.00 2.88 ? 10  LYS A HB3  4  
ATOM 4673  H HG2  . LYS A 1 10 ? 7.613   15.631  5.891   1.00 3.97 ? 10  LYS A HG2  4  
ATOM 4674  H HG3  . LYS A 1 10 ? 6.213   16.475  5.224   1.00 4.13 ? 10  LYS A HG3  4  
ATOM 4675  H HD2  . LYS A 1 10 ? 4.714   15.127  6.545   1.00 4.48 ? 10  LYS A HD2  4  
ATOM 4676  H HD3  . LYS A 1 10 ? 6.053   14.131  7.116   1.00 4.00 ? 10  LYS A HD3  4  
ATOM 4677  H HE2  . LYS A 1 10 ? 6.301   15.515  8.833   1.00 4.59 ? 10  LYS A HE2  4  
ATOM 4678  H HE3  . LYS A 1 10 ? 6.737   16.794  7.703   1.00 4.53 ? 10  LYS A HE3  4  
ATOM 4679  H HZ1  . LYS A 1 10 ? 4.374   17.346  7.507   1.00 5.28 ? 10  LYS A HZ1  4  
ATOM 4680  H HZ2  . LYS A 1 10 ? 4.918   17.489  9.104   1.00 5.13 ? 10  LYS A HZ2  4  
ATOM 4681  H HZ3  . LYS A 1 10 ? 3.992   16.150  8.642   1.00 5.08 ? 10  LYS A HZ3  4  
ATOM 4682  N N    . GLY A 1 11 ? 6.836   12.503  2.368   1.00 2.10 ? 11  GLY A N    4  
ATOM 4683  C CA   . GLY A 1 11 ? 6.708   11.206  1.728   1.00 2.10 ? 11  GLY A CA   4  
ATOM 4684  C C    . GLY A 1 11 ? 5.513   10.424  2.233   1.00 2.08 ? 11  GLY A C    4  
ATOM 4685  O O    . GLY A 1 11 ? 4.604   10.996  2.838   1.00 2.30 ? 11  GLY A O    4  
ATOM 4686  H H    . GLY A 1 11 ? 6.201   13.216  2.146   1.00 2.22 ? 11  GLY A H    4  
ATOM 4687  H HA2  . GLY A 1 11 ? 6.606   11.352  0.664   1.00 2.53 ? 11  GLY A HA2  4  
ATOM 4688  H HA3  . GLY A 1 11 ? 7.604   10.634  1.917   1.00 2.21 ? 11  GLY A HA3  4  
ATOM 4689  N N    . LEU A 1 12 ? 5.514   9.113   1.972   1.00 2.47 ? 12  LEU A N    4  
ATOM 4690  C CA   . LEU A 1 12 ? 4.422   8.224   2.391   1.00 2.77 ? 12  LEU A CA   4  
ATOM 4691  C C    . LEU A 1 12 ? 3.888   8.610   3.773   1.00 1.92 ? 12  LEU A C    4  
ATOM 4692  O O    . LEU A 1 12 ? 2.722   8.977   3.915   1.00 2.52 ? 12  LEU A O    4  
ATOM 4693  C CB   . LEU A 1 12 ? 4.904   6.770   2.404   1.00 3.62 ? 12  LEU A CB   4  
ATOM 4694  C CG   . LEU A 1 12 ? 5.462   6.257   1.073   1.00 4.87 ? 12  LEU A CG   4  
ATOM 4695  C CD1  . LEU A 1 12 ? 6.984   6.275   1.091   1.00 5.33 ? 12  LEU A CD1  4  
ATOM 4696  C CD2  . LEU A 1 12 ? 4.946   4.856   0.781   1.00 5.70 ? 12  LEU A CD2  4  
ATOM 4697  H H    . LEU A 1 12 ? 6.267   8.732   1.474   1.00 2.84 ? 12  LEU A H    4  
ATOM 4698  H HA   . LEU A 1 12 ? 3.623   8.321   1.671   1.00 3.41 ? 12  LEU A HA   4  
ATOM 4699  H HB2  . LEU A 1 12 ? 5.675   6.678   3.152   1.00 3.58 ? 12  LEU A HB2  4  
ATOM 4700  H HB3  . LEU A 1 12 ? 4.074   6.139   2.687   1.00 3.65 ? 12  LEU A HB3  4  
ATOM 4701  H HG   . LEU A 1 12 ? 5.130   6.907   0.277   1.00 5.19 ? 12  LEU A HG   4  
ATOM 4702  H HD11 . LEU A 1 12 ? 7.327   6.963   1.850   1.00 5.40 ? 12  LEU A HD11 4  
ATOM 4703  H HD12 . LEU A 1 12 ? 7.350   6.593   0.126   1.00 5.57 ? 12  LEU A HD12 4  
ATOM 4704  H HD13 . LEU A 1 12 ? 7.356   5.285   1.308   1.00 5.68 ? 12  LEU A HD13 4  
ATOM 4705  H HD21 . LEU A 1 12 ? 5.636   4.346   0.127   1.00 6.03 ? 12  LEU A HD21 4  
ATOM 4706  H HD22 . LEU A 1 12 ? 3.981   4.922   0.302   1.00 5.93 ? 12  LEU A HD22 4  
ATOM 4707  H HD23 . LEU A 1 12 ? 4.853   4.307   1.706   1.00 6.06 ? 12  LEU A HD23 4  
ATOM 4708  N N    . GLY A 1 13 ? 4.750   8.519   4.786   1.00 1.13 ? 13  GLY A N    4  
ATOM 4709  C CA   . GLY A 1 13 ? 4.351   8.858   6.141   1.00 1.11 ? 13  GLY A CA   4  
ATOM 4710  C C    . GLY A 1 13 ? 3.304   7.912   6.698   1.00 0.96 ? 13  GLY A C    4  
ATOM 4711  O O    . GLY A 1 13 ? 2.267   8.350   7.196   1.00 1.03 ? 13  GLY A O    4  
ATOM 4712  H H    . GLY A 1 13 ? 5.658   8.199   4.607   1.00 1.49 ? 13  GLY A H    4  
ATOM 4713  H HA2  . GLY A 1 13 ? 5.222   8.829   6.779   1.00 1.58 ? 13  GLY A HA2  4  
ATOM 4714  H HA3  . GLY A 1 13 ? 3.950   9.862   6.146   1.00 1.81 ? 13  GLY A HA3  4  
ATOM 4715  N N    . PHE A 1 14 ? 3.575   6.611   6.603   1.00 0.81 ? 14  PHE A N    4  
ATOM 4716  C CA   . PHE A 1 14 ? 2.657   5.583   7.095   1.00 0.71 ? 14  PHE A CA   4  
ATOM 4717  C C    . PHE A 1 14 ? 3.379   4.240   7.205   1.00 0.56 ? 14  PHE A C    4  
ATOM 4718  O O    . PHE A 1 14 ? 4.591   4.167   7.008   1.00 0.52 ? 14  PHE A O    4  
ATOM 4719  C CB   . PHE A 1 14 ? 1.402   5.477   6.211   1.00 0.74 ? 14  PHE A CB   4  
ATOM 4720  C CG   . PHE A 1 14 ? 1.663   5.157   4.764   1.00 0.63 ? 14  PHE A CG   4  
ATOM 4721  C CD1  . PHE A 1 14 ? 2.114   3.903   4.385   1.00 1.27 ? 14  PHE A CD1  4  
ATOM 4722  C CD2  . PHE A 1 14 ? 1.434   6.108   3.782   1.00 1.41 ? 14  PHE A CD2  4  
ATOM 4723  C CE1  . PHE A 1 14 ? 2.338   3.605   3.056   1.00 1.33 ? 14  PHE A CE1  4  
ATOM 4724  C CE2  . PHE A 1 14 ? 1.655   5.815   2.451   1.00 1.46 ? 14  PHE A CE2  4  
ATOM 4725  C CZ   . PHE A 1 14 ? 2.106   4.561   2.087   1.00 0.83 ? 14  PHE A CZ   4  
ATOM 4726  H H    . PHE A 1 14 ? 4.412   6.330   6.177   1.00 0.79 ? 14  PHE A H    4  
ATOM 4727  H HA   . PHE A 1 14 ? 2.354   5.880   8.088   1.00 0.81 ? 14  PHE A HA   4  
ATOM 4728  H HB2  . PHE A 1 14 ? 0.764   4.701   6.604   1.00 0.84 ? 14  PHE A HB2  4  
ATOM 4729  H HB3  . PHE A 1 14 ? 0.871   6.418   6.250   1.00 0.89 ? 14  PHE A HB3  4  
ATOM 4730  H HD1  . PHE A 1 14 ? 2.295   3.153   5.141   1.00 2.12 ? 14  PHE A HD1  4  
ATOM 4731  H HD2  . PHE A 1 14 ? 1.082   7.089   4.064   1.00 2.28 ? 14  PHE A HD2  4  
ATOM 4732  H HE1  . PHE A 1 14 ? 2.691   2.624   2.775   1.00 2.19 ? 14  PHE A HE1  4  
ATOM 4733  H HE2  . PHE A 1 14 ? 1.473   6.564   1.694   1.00 2.33 ? 14  PHE A HE2  4  
ATOM 4734  H HZ   . PHE A 1 14 ? 2.278   4.330   1.047   1.00 0.99 ? 14  PHE A HZ   4  
ATOM 4735  N N    . SER A 1 15 ? 2.641   3.174   7.509   1.00 0.55 ? 15  SER A N    4  
ATOM 4736  C CA   . SER A 1 15 ? 3.225   1.843   7.623   1.00 0.47 ? 15  SER A CA   4  
ATOM 4737  C C    . SER A 1 15 ? 2.439   0.851   6.773   1.00 0.47 ? 15  SER A C    4  
ATOM 4738  O O    . SER A 1 15 ? 1.373   1.180   6.249   1.00 0.52 ? 15  SER A O    4  
ATOM 4739  C CB   . SER A 1 15 ? 3.257   1.383   9.082   1.00 0.50 ? 15  SER A CB   4  
ATOM 4740  O OG   . SER A 1 15 ? 2.199   1.949   9.823   1.00 0.57 ? 15  SER A OG   4  
ATOM 4741  H H    . SER A 1 15 ? 1.675   3.263   7.630   1.00 0.65 ? 15  SER A H    4  
ATOM 4742  H HA   . SER A 1 15 ? 4.234   1.895   7.252   1.00 0.48 ? 15  SER A HA   4  
ATOM 4743  H HB2  . SER A 1 15 ? 3.163   0.310   9.115   1.00 0.52 ? 15  SER A HB2  4  
ATOM 4744  H HB3  . SER A 1 15 ? 4.193   1.675   9.531   1.00 0.54 ? 15  SER A HB3  4  
ATOM 4745  H HG   . SER A 1 15 ? 2.405   2.865   10.026  1.00 1.10 ? 15  SER A HG   4  
ATOM 4746  N N    . ILE A 1 16 ? 2.962   -0.366  6.647   1.00 0.44 ? 16  ILE A N    4  
ATOM 4747  C CA   . ILE A 1 16 ? 2.307   -1.412  5.865   1.00 0.46 ? 16  ILE A CA   4  
ATOM 4748  C C    . ILE A 1 16 ? 2.787   -2.797  6.297   1.00 0.46 ? 16  ILE A C    4  
ATOM 4749  O O    . ILE A 1 16 ? 3.720   -2.931  7.091   1.00 0.45 ? 16  ILE A O    4  
ATOM 4750  C CB   . ILE A 1 16 ? 2.568   -1.259  4.334   1.00 0.47 ? 16  ILE A CB   4  
ATOM 4751  C CG1  . ILE A 1 16 ? 3.873   -1.947  3.909   1.00 0.67 ? 16  ILE A CG1  4  
ATOM 4752  C CG2  . ILE A 1 16 ? 2.576   0.204   3.908   1.00 0.57 ? 16  ILE A CG2  4  
ATOM 4753  C CD1  . ILE A 1 16 ? 5.110   -1.296  4.468   1.00 0.64 ? 16  ILE A CD1  4  
ATOM 4754  H H    . ILE A 1 16 ? 3.803   -0.577  7.105   1.00 0.44 ? 16  ILE A H    4  
ATOM 4755  H HA   . ILE A 1 16 ? 1.235   -1.341  6.030   1.00 0.49 ? 16  ILE A HA   4  
ATOM 4756  H HB   . ILE A 1 16 ? 1.759   -1.739  3.823   1.00 0.59 ? 16  ILE A HB   4  
ATOM 4757  H HG12 . ILE A 1 16 ? 3.860   -2.973  4.241   1.00 1.45 ? 16  ILE A HG12 4  
ATOM 4758  H HG13 . ILE A 1 16 ? 3.945   -1.925  2.830   1.00 1.37 ? 16  ILE A HG13 4  
ATOM 4759  H HG21 . ILE A 1 16 ? 1.597   0.630   4.066   1.00 1.32 ? 16  ILE A HG21 4  
ATOM 4760  H HG22 . ILE A 1 16 ? 2.834   0.273   2.862   1.00 1.06 ? 16  ILE A HG22 4  
ATOM 4761  H HG23 . ILE A 1 16 ? 3.305   0.745   4.493   1.00 1.09 ? 16  ILE A HG23 4  
ATOM 4762  H HD11 . ILE A 1 16 ? 5.719   -0.928  3.656   1.00 1.34 ? 16  ILE A HD11 4  
ATOM 4763  H HD12 . ILE A 1 16 ? 5.670   -2.018  5.043   1.00 1.24 ? 16  ILE A HD12 4  
ATOM 4764  H HD13 . ILE A 1 16 ? 4.819   -0.473  5.102   1.00 1.38 ? 16  ILE A HD13 4  
ATOM 4765  N N    . ALA A 1 17 ? 2.157   -3.812  5.726   1.00 0.51 ? 17  ALA A N    4  
ATOM 4766  C CA   . ALA A 1 17 ? 2.498   -5.207  5.967   1.00 0.55 ? 17  ALA A CA   4  
ATOM 4767  C C    . ALA A 1 17 ? 2.400   -5.937  4.631   1.00 0.73 ? 17  ALA A C    4  
ATOM 4768  O O    . ALA A 1 17 ? 1.884   -5.364  3.675   1.00 1.19 ? 17  ALA A O    4  
ATOM 4769  C CB   . ALA A 1 17 ? 1.583   -5.815  7.019   1.00 0.71 ? 17  ALA A CB   4  
ATOM 4770  H H    . ALA A 1 17 ? 1.439   -3.616  5.087   1.00 0.55 ? 17  ALA A H    4  
ATOM 4771  H HA   . ALA A 1 17 ? 3.516   -5.251  6.323   1.00 0.50 ? 17  ALA A HA   4  
ATOM 4772  H HB1  . ALA A 1 17 ? 0.728   -5.168  7.169   1.00 1.21 ? 17  ALA A HB1  4  
ATOM 4773  H HB2  . ALA A 1 17 ? 2.121   -5.918  7.949   1.00 1.22 ? 17  ALA A HB2  4  
ATOM 4774  H HB3  . ALA A 1 17 ? 1.247   -6.786  6.688   1.00 1.33 ? 17  ALA A HB3  4  
ATOM 4775  N N    . GLY A 1 18 ? 2.867   -7.178  4.536   1.00 0.60 ? 18  GLY A N    4  
ATOM 4776  C CA   . GLY A 1 18 ? 2.745   -7.866  3.258   1.00 0.77 ? 18  GLY A CA   4  
ATOM 4777  C C    . GLY A 1 18 ? 3.580   -9.119  3.120   1.00 0.85 ? 18  GLY A C    4  
ATOM 4778  O O    . GLY A 1 18 ? 4.794   -9.056  3.292   1.00 1.29 ? 18  GLY A O    4  
ATOM 4779  H H    . GLY A 1 18 ? 3.231   -7.628  5.327   1.00 0.67 ? 18  GLY A H    4  
ATOM 4780  H HA2  . GLY A 1 18 ? 1.713   -8.129  3.115   1.00 0.96 ? 18  GLY A HA2  4  
ATOM 4781  H HA3  . GLY A 1 18 ? 3.030   -7.177  2.475   1.00 1.37 ? 18  GLY A HA3  4  
ATOM 4782  N N    . GLY A 1 19 ? 2.959   -10.249 2.762   1.00 1.01 ? 19  GLY A N    4  
ATOM 4783  C CA   . GLY A 1 19 ? 3.719   -11.475 2.562   1.00 1.61 ? 19  GLY A CA   4  
ATOM 4784  C C    . GLY A 1 19 ? 3.525   -12.509 3.650   1.00 0.89 ? 19  GLY A C    4  
ATOM 4785  O O    . GLY A 1 19 ? 3.086   -12.187 4.749   1.00 0.76 ? 19  GLY A O    4  
ATOM 4786  H H    . GLY A 1 19 ? 1.991   -10.263 2.605   1.00 1.01 ? 19  GLY A H    4  
ATOM 4787  H HA2  . GLY A 1 19 ? 3.421   -11.913 1.622   1.00 2.30 ? 19  GLY A HA2  4  
ATOM 4788  H HA3  . GLY A 1 19 ? 4.768   -11.225 2.506   1.00 2.32 ? 19  GLY A HA3  4  
ATOM 4789  N N    . VAL A 1 20 ? 3.865   -13.758 3.329   1.00 0.97 ? 20  VAL A N    4  
ATOM 4790  C CA   . VAL A 1 20 ? 3.741   -14.864 4.275   1.00 1.05 ? 20  VAL A CA   4  
ATOM 4791  C C    . VAL A 1 20 ? 4.673   -14.660 5.476   1.00 1.18 ? 20  VAL A C    4  
ATOM 4792  O O    . VAL A 1 20 ? 5.803   -14.192 5.321   1.00 1.35 ? 20  VAL A O    4  
ATOM 4793  C CB   . VAL A 1 20 ? 4.043   -16.223 3.602   1.00 1.68 ? 20  VAL A CB   4  
ATOM 4794  C CG1  . VAL A 1 20 ? 5.523   -16.348 3.255   1.00 1.76 ? 20  VAL A CG1  4  
ATOM 4795  C CG2  . VAL A 1 20 ? 3.598   -17.373 4.495   1.00 2.72 ? 20  VAL A CG2  4  
ATOM 4796  H H    . VAL A 1 20 ? 4.206   -13.933 2.426   1.00 1.38 ? 20  VAL A H    4  
ATOM 4797  H HA   . VAL A 1 20 ? 2.717   -14.879 4.624   1.00 0.98 ? 20  VAL A HA   4  
ATOM 4798  H HB   . VAL A 1 20 ? 3.479   -16.275 2.683   1.00 2.13 ? 20  VAL A HB   4  
ATOM 4799  H HG11 . VAL A 1 20 ? 5.869   -15.427 2.809   1.00 2.30 ? 20  VAL A HG11 4  
ATOM 4800  H HG12 . VAL A 1 20 ? 5.660   -17.160 2.555   1.00 1.97 ? 20  VAL A HG12 4  
ATOM 4801  H HG13 . VAL A 1 20 ? 6.088   -16.549 4.153   1.00 2.15 ? 20  VAL A HG13 4  
ATOM 4802  H HG21 . VAL A 1 20 ? 3.702   -18.305 3.959   1.00 3.33 ? 20  VAL A HG21 4  
ATOM 4803  H HG22 . VAL A 1 20 ? 2.564   -17.232 4.774   1.00 3.14 ? 20  VAL A HG22 4  
ATOM 4804  H HG23 . VAL A 1 20 ? 4.211   -17.398 5.384   1.00 3.02 ? 20  VAL A HG23 4  
ATOM 4805  N N    . GLY A 1 21 ? 4.185   -14.998 6.673   1.00 1.30 ? 21  GLY A N    4  
ATOM 4806  C CA   . GLY A 1 21 ? 4.983   -14.828 7.884   1.00 1.54 ? 21  GLY A CA   4  
ATOM 4807  C C    . GLY A 1 21 ? 4.914   -13.410 8.443   1.00 1.24 ? 21  GLY A C    4  
ATOM 4808  O O    . GLY A 1 21 ? 5.129   -13.197 9.637   1.00 1.56 ? 21  GLY A O    4  
ATOM 4809  H H    . GLY A 1 21 ? 3.275   -15.359 6.730   1.00 1.35 ? 21  GLY A H    4  
ATOM 4810  H HA2  . GLY A 1 21 ? 4.626   -15.516 8.636   1.00 1.90 ? 21  GLY A HA2  4  
ATOM 4811  H HA3  . GLY A 1 21 ? 6.013   -15.063 7.658   1.00 1.72 ? 21  GLY A HA3  4  
ATOM 4812  N N    . ASN A 1 22 ? 4.591   -12.449 7.576   1.00 0.73 ? 22  ASN A N    4  
ATOM 4813  C CA   . ASN A 1 22 ? 4.462   -11.047 7.960   1.00 0.61 ? 22  ASN A CA   4  
ATOM 4814  C C    . ASN A 1 22 ? 3.128   -10.470 7.455   1.00 0.65 ? 22  ASN A C    4  
ATOM 4815  O O    . ASN A 1 22 ? 2.971   -9.250  7.356   1.00 0.67 ? 22  ASN A O    4  
ATOM 4816  C CB   . ASN A 1 22 ? 5.651   -10.215 7.422   1.00 0.47 ? 22  ASN A CB   4  
ATOM 4817  C CG   . ASN A 1 22 ? 6.243   -10.778 6.141   1.00 0.74 ? 22  ASN A CG   4  
ATOM 4818  O OD1  . ASN A 1 22 ? 7.405   -11.182 6.110   1.00 1.27 ? 22  ASN A OD1  4  
ATOM 4819  N ND2  . ASN A 1 22 ? 5.453   -10.808 5.080   1.00 1.63 ? 22  ASN A ND2  4  
ATOM 4820  H H    . ASN A 1 22 ? 4.410   -12.696 6.650   1.00 0.63 ? 22  ASN A H    4  
ATOM 4821  H HA   . ASN A 1 22 ? 4.466   -11.004 9.037   1.00 0.88 ? 22  ASN A HA   4  
ATOM 4822  H HB2  . ASN A 1 22 ? 5.309   -9.213  7.220   1.00 0.82 ? 22  ASN A HB2  4  
ATOM 4823  H HB3  . ASN A 1 22 ? 6.436   -10.173 8.162   1.00 0.63 ? 22  ASN A HB3  4  
ATOM 4824  H HD21 . ASN A 1 22 ? 4.539   -10.471 5.173   1.00 2.15 ? 22  ASN A HD21 4  
ATOM 4825  H HD22 . ASN A 1 22 ? 5.818   -11.165 4.244   1.00 1.98 ? 22  ASN A HD22 4  
ATOM 4826  N N    . GLN A 1 23 ? 2.179   -11.359 7.108   1.00 0.77 ? 23  GLN A N    4  
ATOM 4827  C CA   . GLN A 1 23 ? 0.869   -10.958 6.580   1.00 0.94 ? 23  GLN A CA   4  
ATOM 4828  C C    . GLN A 1 23 ? 0.124   -9.997  7.501   1.00 0.88 ? 23  GLN A C    4  
ATOM 4829  O O    . GLN A 1 23 ? 0.161   -10.131 8.725   1.00 0.87 ? 23  GLN A O    4  
ATOM 4830  C CB   . GLN A 1 23 ? -0.017  -12.188 6.356   1.00 1.19 ? 23  GLN A CB   4  
ATOM 4831  C CG   . GLN A 1 23 ? 0.538   -13.192 5.360   1.00 1.42 ? 23  GLN A CG   4  
ATOM 4832  C CD   . GLN A 1 23 ? -0.308  -14.448 5.279   1.00 1.55 ? 23  GLN A CD   4  
ATOM 4833  O OE1  . GLN A 1 23 ? -1.443  -14.414 4.801   1.00 1.62 ? 23  GLN A OE1  4  
ATOM 4834  N NE2  . GLN A 1 23 ? 0.239   -15.566 5.748   1.00 2.34 ? 23  GLN A NE2  4  
ATOM 4835  H H    . GLN A 1 23 ? 2.357   -12.318 7.175   1.00 0.79 ? 23  GLN A H    4  
ATOM 4836  H HA   . GLN A 1 23 ? 1.035   -10.474 5.631   1.00 1.04 ? 23  GLN A HA   4  
ATOM 4837  H HB2  . GLN A 1 23 ? -0.153  -12.694 7.300   1.00 1.46 ? 23  GLN A HB2  4  
ATOM 4838  H HB3  . GLN A 1 23 ? -0.981  -11.857 5.997   1.00 1.49 ? 23  GLN A HB3  4  
ATOM 4839  H HG2  . GLN A 1 23 ? 0.574   -12.734 4.384   1.00 1.80 ? 23  GLN A HG2  4  
ATOM 4840  H HG3  . GLN A 1 23 ? 1.537   -13.468 5.666   1.00 1.68 ? 23  GLN A HG3  4  
ATOM 4841  H HE21 . GLN A 1 23 ? 1.146   -15.520 6.117   1.00 2.92 ? 23  GLN A HE21 4  
ATOM 4842  H HE22 . GLN A 1 23 ? -0.289  -16.390 5.708   1.00 2.51 ? 23  GLN A HE22 4  
ATOM 4843  N N    . HIS A 1 24 ? -0.563  -9.035  6.888   1.00 0.86 ? 24  HIS A N    4  
ATOM 4844  C CA   . HIS A 1 24 ? -1.341  -8.040  7.625   1.00 0.83 ? 24  HIS A CA   4  
ATOM 4845  C C    . HIS A 1 24 ? -2.775  -8.509  7.867   1.00 0.84 ? 24  HIS A C    4  
ATOM 4846  O O    . HIS A 1 24 ? -3.425  -8.060  8.813   1.00 0.92 ? 24  HIS A O    4  
ATOM 4847  C CB   . HIS A 1 24 ? -1.394  -6.727  6.844   1.00 0.85 ? 24  HIS A CB   4  
ATOM 4848  C CG   . HIS A 1 24 ? -1.964  -5.599  7.624   1.00 0.83 ? 24  HIS A CG   4  
ATOM 4849  N ND1  . HIS A 1 24 ? -1.226  -4.844  8.500   1.00 0.90 ? 24  HIS A ND1  4  
ATOM 4850  C CD2  . HIS A 1 24 ? -3.212  -5.092  7.640   1.00 0.81 ? 24  HIS A CD2  4  
ATOM 4851  C CE1  . HIS A 1 24 ? -1.993  -3.914  9.022   1.00 0.88 ? 24  HIS A CE1  4  
ATOM 4852  N NE2  . HIS A 1 24 ? -3.207  -4.039  8.520   1.00 0.82 ? 24  HIS A NE2  4  
ATOM 4853  H H    . HIS A 1 24 ? -0.542  -8.984  5.909   1.00 0.90 ? 24  HIS A H    4  
ATOM 4854  H HA   . HIS A 1 24 ? -0.858  -7.867  8.574   1.00 0.84 ? 24  HIS A HA   4  
ATOM 4855  H HB2  . HIS A 1 24 ? -0.407  -6.448  6.535   1.00 0.91 ? 24  HIS A HB2  4  
ATOM 4856  H HB3  . HIS A 1 24 ? -2.013  -6.860  5.973   1.00 0.87 ? 24  HIS A HB3  4  
ATOM 4857  H HD1  . HIS A 1 24 ? -0.280  -4.976  8.715   1.00 0.98 ? 24  HIS A HD1  4  
ATOM 4858  H HD2  . HIS A 1 24 ? -4.052  -5.450  7.059   1.00 0.82 ? 24  HIS A HD2  4  
ATOM 4859  H HE1  . HIS A 1 24 ? -1.676  -3.172  9.727   1.00 0.95 ? 24  HIS A HE1  4  
ATOM 4860  H HE2  . HIS A 1 24 ? -3.937  -3.397  8.640   1.00 0.82 ? 24  HIS A HE2  4  
ATOM 4861  N N    . ILE A 1 25 ? -3.267  -9.397  7.005   1.00 0.80 ? 25  ILE A N    4  
ATOM 4862  C CA   . ILE A 1 25 ? -4.630  -9.902  7.124   1.00 0.86 ? 25  ILE A CA   4  
ATOM 4863  C C    . ILE A 1 25 ? -4.696  -11.395 6.790   1.00 0.81 ? 25  ILE A C    4  
ATOM 4864  O O    . ILE A 1 25 ? -4.251  -11.816 5.721   1.00 0.80 ? 25  ILE A O    4  
ATOM 4865  C CB   . ILE A 1 25 ? -5.593  -9.119  6.196   1.00 0.95 ? 25  ILE A CB   4  
ATOM 4866  C CG1  . ILE A 1 25 ? -5.471  -7.606  6.427   1.00 1.01 ? 25  ILE A CG1  4  
ATOM 4867  C CG2  . ILE A 1 25 ? -7.029  -9.572  6.406   1.00 1.51 ? 25  ILE A CG2  4  
ATOM 4868  C CD1  . ILE A 1 25 ? -6.058  -7.132  7.741   1.00 1.16 ? 25  ILE A CD1  4  
ATOM 4869  H H    . ILE A 1 25 ? -2.699  -9.718  6.274   1.00 0.77 ? 25  ILE A H    4  
ATOM 4870  H HA   . ILE A 1 25 ? -4.950  -9.756  8.145   1.00 0.92 ? 25  ILE A HA   4  
ATOM 4871  H HB   . ILE A 1 25 ? -5.322  -9.338  5.175   1.00 1.28 ? 25  ILE A HB   4  
ATOM 4872  H HG12 . ILE A 1 25 ? -4.429  -7.329  6.412   1.00 1.40 ? 25  ILE A HG12 4  
ATOM 4873  H HG13 . ILE A 1 25 ? -5.986  -7.089  5.630   1.00 1.51 ? 25  ILE A HG13 4  
ATOM 4874  H HG21 . ILE A 1 25 ? -7.276  -10.335 5.682   1.00 1.96 ? 25  ILE A HG21 4  
ATOM 4875  H HG22 . ILE A 1 25 ? -7.690  -8.728  6.282   1.00 1.82 ? 25  ILE A HG22 4  
ATOM 4876  H HG23 . ILE A 1 25 ? -7.138  -9.972  7.403   1.00 1.95 ? 25  ILE A HG23 4  
ATOM 4877  H HD11 . ILE A 1 25 ? -6.186  -7.974  8.406   1.00 1.53 ? 25  ILE A HD11 4  
ATOM 4878  H HD12 . ILE A 1 25 ? -7.017  -6.668  7.562   1.00 1.45 ? 25  ILE A HD12 4  
ATOM 4879  H HD13 . ILE A 1 25 ? -5.392  -6.413  8.196   1.00 1.78 ? 25  ILE A HD13 4  
ATOM 4880  N N    . PRO A 1 26 ? -5.254  -12.217 7.707   1.00 0.82 ? 26  PRO A N    4  
ATOM 4881  C CA   . PRO A 1 26 ? -5.374  -13.670 7.507   1.00 0.82 ? 26  PRO A CA   4  
ATOM 4882  C C    . PRO A 1 26 ? -6.039  -14.029 6.178   1.00 0.86 ? 26  PRO A C    4  
ATOM 4883  O O    . PRO A 1 26 ? -7.149  -13.576 5.887   1.00 0.95 ? 26  PRO A O    4  
ATOM 4884  C CB   . PRO A 1 26 ? -6.253  -14.118 8.678   1.00 0.88 ? 26  PRO A CB   4  
ATOM 4885  C CG   . PRO A 1 26 ? -6.025  -13.095 9.734   1.00 0.98 ? 26  PRO A CG   4  
ATOM 4886  C CD   . PRO A 1 26 ? -5.803  -11.796 9.012   1.00 0.87 ? 26  PRO A CD   4  
ATOM 4887  H HA   . PRO A 1 26 ? -4.412  -14.158 7.569   1.00 0.79 ? 26  PRO A HA   4  
ATOM 4888  H HB2  . PRO A 1 26 ? -7.287  -14.144 8.367   1.00 1.04 ? 26  PRO A HB2  4  
ATOM 4889  H HB3  . PRO A 1 26 ? -5.946  -15.100 9.008   1.00 0.96 ? 26  PRO A HB3  4  
ATOM 4890  H HG2  . PRO A 1 26 ? -6.896  -13.027 10.371  1.00 1.27 ? 26  PRO A HG2  4  
ATOM 4891  H HG3  . PRO A 1 26 ? -5.153  -13.355 10.317  1.00 1.26 ? 26  PRO A HG3  4  
ATOM 4892  H HD2  . PRO A 1 26 ? -6.738  -11.270 8.885   1.00 0.94 ? 26  PRO A HD2  4  
ATOM 4893  H HD3  . PRO A 1 26 ? -5.094  -11.182 9.548   1.00 0.95 ? 26  PRO A HD3  4  
ATOM 4894  N N    . GLY A 1 27 ? -5.349  -14.838 5.372   1.00 0.85 ? 27  GLY A N    4  
ATOM 4895  C CA   . GLY A 1 27 ? -5.881  -15.241 4.079   1.00 0.94 ? 27  GLY A CA   4  
ATOM 4896  C C    . GLY A 1 27 ? -5.301  -14.430 2.935   1.00 0.92 ? 27  GLY A C    4  
ATOM 4897  O O    . GLY A 1 27 ? -4.882  -14.991 1.921   1.00 1.06 ? 27  GLY A O    4  
ATOM 4898  H H    . GLY A 1 27 ? -4.466  -15.157 5.654   1.00 0.81 ? 27  GLY A H    4  
ATOM 4899  H HA2  . GLY A 1 27 ? -5.654  -16.284 3.917   1.00 1.04 ? 27  GLY A HA2  4  
ATOM 4900  H HA3  . GLY A 1 27 ? -6.953  -15.114 4.087   1.00 1.00 ? 27  GLY A HA3  4  
ATOM 4901  N N    . ASP A 1 28 ? -5.275  -13.107 3.099   1.00 0.80 ? 28  ASP A N    4  
ATOM 4902  C CA   . ASP A 1 28 ? -4.740  -12.215 2.077   1.00 0.80 ? 28  ASP A CA   4  
ATOM 4903  C C    . ASP A 1 28 ? -3.293  -11.841 2.389   1.00 0.65 ? 28  ASP A C    4  
ATOM 4904  O O    . ASP A 1 28 ? -3.015  -11.165 3.382   1.00 0.57 ? 28  ASP A O    4  
ATOM 4905  C CB   . ASP A 1 28 ? -5.601  -10.953 1.970   1.00 0.91 ? 28  ASP A CB   4  
ATOM 4906  C CG   . ASP A 1 28 ? -5.738  -10.464 0.540   1.00 1.08 ? 28  ASP A CG   4  
ATOM 4907  O OD1  . ASP A 1 28 ? -4.702  -10.156 -0.085  1.00 1.48 ? 28  ASP A OD1  4  
ATOM 4908  O OD2  . ASP A 1 28 ? -6.882  -10.389 0.046   1.00 1.68 ? 28  ASP A OD2  4  
ATOM 4909  H H    . ASP A 1 28 ? -5.622  -12.723 3.932   1.00 0.76 ? 28  ASP A H    4  
ATOM 4910  H HA   . ASP A 1 28 ? -4.768  -12.740 1.134   1.00 0.92 ? 28  ASP A HA   4  
ATOM 4911  H HB2  . ASP A 1 28 ? -6.588  -11.165 2.353   1.00 1.05 ? 28  ASP A HB2  4  
ATOM 4912  H HB3  . ASP A 1 28 ? -5.154  -10.167 2.559   1.00 0.85 ? 28  ASP A HB3  4  
ATOM 4913  N N    . ASN A 1 29 ? -2.373  -12.284 1.531   1.00 0.69 ? 29  ASN A N    4  
ATOM 4914  C CA   . ASN A 1 29 ? -0.950  -11.996 1.712   1.00 0.63 ? 29  ASN A CA   4  
ATOM 4915  C C    . ASN A 1 29 ? -0.545  -10.690 1.014   1.00 0.59 ? 29  ASN A C    4  
ATOM 4916  O O    . ASN A 1 29 ? 0.645   -10.426 0.832   1.00 0.65 ? 29  ASN A O    4  
ATOM 4917  C CB   . ASN A 1 29 ? -0.093  -13.152 1.183   1.00 0.79 ? 29  ASN A CB   4  
ATOM 4918  C CG   . ASN A 1 29 ? -0.462  -14.494 1.795   1.00 1.36 ? 29  ASN A CG   4  
ATOM 4919  O OD1  . ASN A 1 29 ? -1.602  -14.950 1.688   1.00 2.11 ? 29  ASN A OD1  4  
ATOM 4920  N ND2  . ASN A 1 29 ? 0.508   -15.141 2.436   1.00 1.98 ? 29  ASN A ND2  4  
ATOM 4921  H H    . ASN A 1 29 ? -2.658  -12.816 0.757   1.00 0.80 ? 29  ASN A H    4  
ATOM 4922  H HA   . ASN A 1 29 ? -0.772  -11.888 2.772   1.00 0.58 ? 29  ASN A HA   4  
ATOM 4923  H HB2  . ASN A 1 29 ? -0.216  -13.220 0.114   1.00 1.38 ? 29  ASN A HB2  4  
ATOM 4924  H HB3  . ASN A 1 29 ? 0.944   -12.949 1.411   1.00 1.03 ? 29  ASN A HB3  4  
ATOM 4925  H HD21 . ASN A 1 29 ? 1.394   -14.723 2.480   1.00 2.27 ? 29  ASN A HD21 4  
ATOM 4926  H HD22 . ASN A 1 29 ? 0.297   -16.010 2.838   1.00 2.54 ? 29  ASN A HD22 4  
ATOM 4927  N N    . SER A 1 30 ? -1.533  -9.868  0.640   1.00 0.56 ? 30  SER A N    4  
ATOM 4928  C CA   . SER A 1 30 ? -1.262  -8.590  -0.019  1.00 0.56 ? 30  SER A CA   4  
ATOM 4929  C C    . SER A 1 30 ? -0.648  -7.600  0.970   1.00 0.55 ? 30  SER A C    4  
ATOM 4930  O O    . SER A 1 30 ? -0.442  -7.926  2.142   1.00 0.55 ? 30  SER A O    4  
ATOM 4931  C CB   . SER A 1 30 ? -2.542  -8.005  -0.629  1.00 0.60 ? 30  SER A CB   4  
ATOM 4932  O OG   . SER A 1 30 ? -2.242  -6.941  -1.518  1.00 1.39 ? 30  SER A OG   4  
ATOM 4933  H H    . SER A 1 30 ? -2.462  -10.118 0.821   1.00 0.58 ? 30  SER A H    4  
ATOM 4934  H HA   . SER A 1 30 ? -0.550  -8.773  -0.809  1.00 0.60 ? 30  SER A HA   4  
ATOM 4935  H HB2  . SER A 1 30 ? -3.062  -8.775  -1.179  1.00 1.26 ? 30  SER A HB2  4  
ATOM 4936  H HB3  . SER A 1 30 ? -3.178  -7.632  0.159   1.00 1.02 ? 30  SER A HB3  4  
ATOM 4937  H HG   . SER A 1 30 ? -3.037  -6.429  -1.686  1.00 1.77 ? 30  SER A HG   4  
ATOM 4938  N N    . ILE A 1 31 ? -0.372  -6.386  0.499   1.00 0.55 ? 31  ILE A N    4  
ATOM 4939  C CA   . ILE A 1 31 ? 0.203   -5.362  1.364   1.00 0.55 ? 31  ILE A CA   4  
ATOM 4940  C C    . ILE A 1 31 ? -0.880  -4.428  1.907   1.00 0.57 ? 31  ILE A C    4  
ATOM 4941  O O    . ILE A 1 31 ? -1.563  -3.745  1.151   1.00 0.65 ? 31  ILE A O    4  
ATOM 4942  C CB   . ILE A 1 31 ? 1.304   -4.540  0.650   1.00 0.53 ? 31  ILE A CB   4  
ATOM 4943  C CG1  . ILE A 1 31 ? 2.650   -5.273  0.686   1.00 0.62 ? 31  ILE A CG1  4  
ATOM 4944  C CG2  . ILE A 1 31 ? 1.453   -3.160  1.285   1.00 0.60 ? 31  ILE A CG2  4  
ATOM 4945  C CD1  . ILE A 1 31 ? 2.619   -6.677  0.113   1.00 0.80 ? 31  ILE A CD1  4  
ATOM 4946  H H    . ILE A 1 31 ? -0.588  -6.182  -0.440  1.00 0.57 ? 31  ILE A H    4  
ATOM 4947  H HA   . ILE A 1 31 ? 0.652   -5.875  2.198   1.00 0.54 ? 31  ILE A HA   4  
ATOM 4948  H HB   . ILE A 1 31 ? 1.009   -4.404  -0.375  1.00 0.74 ? 31  ILE A HB   4  
ATOM 4949  H HG12 . ILE A 1 31 ? 3.369   -4.705  0.117   1.00 1.20 ? 31  ILE A HG12 4  
ATOM 4950  H HG13 . ILE A 1 31 ? 2.984   -5.339  1.710   1.00 1.19 ? 31  ILE A HG13 4  
ATOM 4951  H HG21 . ILE A 1 31 ? 0.574   -2.570  1.074   1.00 1.13 ? 31  ILE A HG21 4  
ATOM 4952  H HG22 . ILE A 1 31 ? 2.323   -2.668  0.877   1.00 1.21 ? 31  ILE A HG22 4  
ATOM 4953  H HG23 . ILE A 1 31 ? 1.568   -3.266  2.355   1.00 1.13 ? 31  ILE A HG23 4  
ATOM 4954  H HD11 . ILE A 1 31 ? 1.619   -7.073  0.178   1.00 1.15 ? 31  ILE A HD11 4  
ATOM 4955  H HD12 . ILE A 1 31 ? 3.291   -7.310  0.673   1.00 1.28 ? 31  ILE A HD12 4  
ATOM 4956  H HD13 . ILE A 1 31 ? 2.929   -6.651  -0.920  1.00 1.46 ? 31  ILE A HD13 4  
ATOM 4957  N N    . TYR A 1 32 ? -1.030  -4.418  3.230   1.00 0.60 ? 32  TYR A N    4  
ATOM 4958  C CA   . TYR A 1 32 ? -2.029  -3.584  3.892   1.00 0.62 ? 32  TYR A CA   4  
ATOM 4959  C C    . TYR A 1 32 ? -1.376  -2.545  4.800   1.00 0.59 ? 32  TYR A C    4  
ATOM 4960  O O    . TYR A 1 32 ? -0.366  -2.823  5.445   1.00 0.61 ? 32  TYR A O    4  
ATOM 4961  C CB   . TYR A 1 32 ? -2.958  -4.454  4.735   1.00 0.69 ? 32  TYR A CB   4  
ATOM 4962  C CG   . TYR A 1 32 ? -3.891  -5.335  3.941   1.00 0.71 ? 32  TYR A CG   4  
ATOM 4963  C CD1  . TYR A 1 32 ? -3.408  -6.389  3.173   1.00 1.28 ? 32  TYR A CD1  4  
ATOM 4964  C CD2  . TYR A 1 32 ? -5.258  -5.120  3.977   1.00 1.34 ? 32  TYR A CD2  4  
ATOM 4965  C CE1  . TYR A 1 32 ? -4.268  -7.200  2.458   1.00 1.30 ? 32  TYR A CE1  4  
ATOM 4966  C CE2  . TYR A 1 32 ? -6.126  -5.923  3.270   1.00 1.38 ? 32  TYR A CE2  4  
ATOM 4967  C CZ   . TYR A 1 32 ? -5.628  -6.965  2.511   1.00 0.80 ? 32  TYR A CZ   4  
ATOM 4968  O OH   . TYR A 1 32 ? -6.488  -7.771  1.803   1.00 0.86 ? 32  TYR A OH   4  
ATOM 4969  H H    . TYR A 1 32 ? -0.460  -4.994  3.777   1.00 0.66 ? 32  TYR A H    4  
ATOM 4970  H HA   . TYR A 1 32 ? -2.607  -3.080  3.135   1.00 0.64 ? 32  TYR A HA   4  
ATOM 4971  H HB2  . TYR A 1 32 ? -2.356  -5.096  5.358   1.00 0.68 ? 32  TYR A HB2  4  
ATOM 4972  H HB3  . TYR A 1 32 ? -3.560  -3.815  5.364   1.00 0.74 ? 32  TYR A HB3  4  
ATOM 4973  H HD1  . TYR A 1 32 ? -2.344  -6.568  3.137   1.00 2.05 ? 32  TYR A HD1  4  
ATOM 4974  H HD2  . TYR A 1 32 ? -5.644  -4.306  4.571   1.00 2.10 ? 32  TYR A HD2  4  
ATOM 4975  H HE1  . TYR A 1 32 ? -3.873  -8.014  1.865   1.00 2.06 ? 32  TYR A HE1  4  
ATOM 4976  H HE2  . TYR A 1 32 ? -7.191  -5.734  3.316   1.00 2.17 ? 32  TYR A HE2  4  
ATOM 4977  H HH   . TYR A 1 32 ? -6.875  -8.424  2.392   1.00 1.32 ? 32  TYR A HH   4  
ATOM 4978  N N    . VAL A 1 33 ? -1.976  -1.357  4.866   1.00 0.57 ? 33  VAL A N    4  
ATOM 4979  C CA   . VAL A 1 33 ? -1.467  -0.282  5.719   1.00 0.55 ? 33  VAL A CA   4  
ATOM 4980  C C    . VAL A 1 33 ? -1.774  -0.581  7.189   1.00 0.59 ? 33  VAL A C    4  
ATOM 4981  O O    . VAL A 1 33 ? -2.864  -1.054  7.520   1.00 0.65 ? 33  VAL A O    4  
ATOM 4982  C CB   . VAL A 1 33 ? -2.066  1.088   5.323   1.00 0.59 ? 33  VAL A CB   4  
ATOM 4983  C CG1  . VAL A 1 33 ? -1.805  2.137   6.398   1.00 0.62 ? 33  VAL A CG1  4  
ATOM 4984  C CG2  . VAL A 1 33 ? -1.503  1.540   3.982   1.00 0.56 ? 33  VAL A CG2  4  
ATOM 4985  H H    . VAL A 1 33 ? -2.783  -1.204  4.345   1.00 0.61 ? 33  VAL A H    4  
ATOM 4986  H HA   . VAL A 1 33 ? -0.395  -0.236  5.588   1.00 0.51 ? 33  VAL A HA   4  
ATOM 4987  H HB   . VAL A 1 33 ? -3.135  0.973   5.217   1.00 0.67 ? 33  VAL A HB   4  
ATOM 4988  H HG11 . VAL A 1 33 ? -2.020  3.118   6.002   1.00 1.13 ? 33  VAL A HG11 4  
ATOM 4989  H HG12 . VAL A 1 33 ? -0.771  2.090   6.705   1.00 1.12 ? 33  VAL A HG12 4  
ATOM 4990  H HG13 . VAL A 1 33 ? -2.442  1.945   7.249   1.00 1.21 ? 33  VAL A HG13 4  
ATOM 4991  H HG21 . VAL A 1 33 ? -0.571  1.029   3.791   1.00 1.23 ? 33  VAL A HG21 4  
ATOM 4992  H HG22 . VAL A 1 33 ? -1.330  2.605   4.005   1.00 0.96 ? 33  VAL A HG22 4  
ATOM 4993  H HG23 . VAL A 1 33 ? -2.208  1.307   3.198   1.00 1.26 ? 33  VAL A HG23 4  
ATOM 4994  N N    . THR A 1 34 ? -0.796  -0.331  8.061   1.00 0.62 ? 34  THR A N    4  
ATOM 4995  C CA   . THR A 1 34 ? -0.950  -0.607  9.492   1.00 0.71 ? 34  THR A CA   4  
ATOM 4996  C C    . THR A 1 34 ? -1.111  0.665   10.334  1.00 0.72 ? 34  THR A C    4  
ATOM 4997  O O    . THR A 1 34 ? -1.807  0.643   11.350  1.00 0.84 ? 34  THR A O    4  
ATOM 4998  C CB   . THR A 1 34 ? 0.244   -1.427  10.005  1.00 0.74 ? 34  THR A CB   4  
ATOM 4999  O OG1  . THR A 1 34 ? 1.305   -0.584  10.422  1.00 1.39 ? 34  THR A OG1  4  
ATOM 5000  C CG2  . THR A 1 34 ? 0.807   -2.386  8.975   1.00 1.29 ? 34  THR A CG2  4  
ATOM 5001  H H    . THR A 1 34 ? 0.056   0.023   7.727   1.00 0.62 ? 34  THR A H    4  
ATOM 5002  H HA   . THR A 1 34 ? -1.844  -1.202  9.609   1.00 0.81 ? 34  THR A HA   4  
ATOM 5003  H HB   . THR A 1 34 ? -0.076  -2.011  10.856  1.00 1.08 ? 34  THR A HB   4  
ATOM 5004  H HG1  . THR A 1 34 ? 1.322   -0.541  11.381  1.00 1.62 ? 34  THR A HG1  4  
ATOM 5005  H HG21 . THR A 1 34 ? 0.926   -3.361  9.420   1.00 1.65 ? 34  THR A HG21 4  
ATOM 5006  H HG22 . THR A 1 34 ? 1.767   -2.027  8.634   1.00 1.98 ? 34  THR A HG22 4  
ATOM 5007  H HG23 . THR A 1 34 ? 0.130   -2.454  8.137   1.00 1.56 ? 34  THR A HG23 4  
ATOM 5008  N N    . LYS A 1 35 ? -0.471  1.763   9.921   1.00 0.65 ? 35  LYS A N    4  
ATOM 5009  C CA   . LYS A 1 35 ? -0.553  3.025   10.665  1.00 0.71 ? 35  LYS A CA   4  
ATOM 5010  C C    . LYS A 1 35 ? -0.181  4.218   9.787   1.00 0.69 ? 35  LYS A C    4  
ATOM 5011  O O    . LYS A 1 35 ? 0.924   4.280   9.252   1.00 0.62 ? 35  LYS A O    4  
ATOM 5012  C CB   . LYS A 1 35 ? 0.387   2.995   11.880  1.00 0.72 ? 35  LYS A CB   4  
ATOM 5013  C CG   . LYS A 1 35 ? -0.154  2.237   13.083  1.00 1.32 ? 35  LYS A CG   4  
ATOM 5014  C CD   . LYS A 1 35 ? -1.435  2.862   13.618  1.00 1.46 ? 35  LYS A CD   4  
ATOM 5015  C CE   . LYS A 1 35 ? -1.162  3.766   14.810  1.00 2.02 ? 35  LYS A CE   4  
ATOM 5016  N NZ   . LYS A 1 35 ? -1.871  3.303   16.036  1.00 2.54 ? 35  LYS A NZ   4  
ATOM 5017  H H    . LYS A 1 35 ? 0.062   1.726   9.099   1.00 0.59 ? 35  LYS A H    4  
ATOM 5018  H HA   . LYS A 1 35 ? -1.569  3.145   11.009  1.00 0.80 ? 35  LYS A HA   4  
ATOM 5019  H HB2  . LYS A 1 35 ? 1.316   2.531   11.587  1.00 0.98 ? 35  LYS A HB2  4  
ATOM 5020  H HB3  . LYS A 1 35 ? 0.589   4.011   12.185  1.00 1.18 ? 35  LYS A HB3  4  
ATOM 5021  H HG2  . LYS A 1 35 ? -0.354  1.218   12.794  1.00 1.91 ? 35  LYS A HG2  4  
ATOM 5022  H HG3  . LYS A 1 35 ? 0.593   2.248   13.863  1.00 2.08 ? 35  LYS A HG3  4  
ATOM 5023  H HD2  . LYS A 1 35 ? -1.894  3.447   12.835  1.00 1.89 ? 35  LYS A HD2  4  
ATOM 5024  H HD3  . LYS A 1 35 ? -2.107  2.073   13.922  1.00 1.86 ? 35  LYS A HD3  4  
ATOM 5025  H HE2  . LYS A 1 35 ? -0.099  3.777   15.004  1.00 2.47 ? 35  LYS A HE2  4  
ATOM 5026  H HE3  . LYS A 1 35 ? -1.491  4.767   14.570  1.00 2.40 ? 35  LYS A HE3  4  
ATOM 5027  H HZ1  . LYS A 1 35 ? -1.579  2.333   16.274  1.00 2.55 ? 35  LYS A HZ1  4  
ATOM 5028  H HZ2  . LYS A 1 35 ? -2.899  3.316   15.881  1.00 2.90 ? 35  LYS A HZ2  4  
ATOM 5029  H HZ3  . LYS A 1 35 ? -1.644  3.926   16.837  1.00 3.18 ? 35  LYS A HZ3  4  
ATOM 5030  N N    . ILE A 1 36 ? -1.100  5.173   9.655   1.00 0.86 ? 36  ILE A N    4  
ATOM 5031  C CA   . ILE A 1 36 ? -0.843  6.365   8.853   1.00 0.92 ? 36  ILE A CA   4  
ATOM 5032  C C    . ILE A 1 36 ? -0.364  7.524   9.733   1.00 0.98 ? 36  ILE A C    4  
ATOM 5033  O O    . ILE A 1 36 ? -1.065  7.942   10.658  1.00 1.06 ? 36  ILE A O    4  
ATOM 5034  C CB   . ILE A 1 36 ? -2.096  6.806   8.064   1.00 1.03 ? 36  ILE A CB   4  
ATOM 5035  C CG1  . ILE A 1 36 ? -2.586  5.663   7.166   1.00 1.40 ? 36  ILE A CG1  4  
ATOM 5036  C CG2  . ILE A 1 36 ? -1.794  8.051   7.236   1.00 1.12 ? 36  ILE A CG2  4  
ATOM 5037  C CD1  . ILE A 1 36 ? -3.518  6.109   6.059   1.00 1.35 ? 36  ILE A CD1  4  
ATOM 5038  H H    . ILE A 1 36 ? -1.962  5.079   10.113  1.00 0.98 ? 36  ILE A H    4  
ATOM 5039  H HA   . ILE A 1 36 ? -0.068  6.120   8.142   1.00 0.85 ? 36  ILE A HA   4  
ATOM 5040  H HB   . ILE A 1 36 ? -2.871  7.055   8.773   1.00 0.95 ? 36  ILE A HB   4  
ATOM 5041  H HG12 . ILE A 1 36 ? -1.735  5.185   6.706   1.00 1.63 ? 36  ILE A HG12 4  
ATOM 5042  H HG13 . ILE A 1 36 ? -3.113  4.940   7.772   1.00 1.62 ? 36  ILE A HG13 4  
ATOM 5043  H HG21 . ILE A 1 36 ? -1.286  8.778   7.852   1.00 1.46 ? 36  ILE A HG21 4  
ATOM 5044  H HG22 . ILE A 1 36 ? -2.718  8.473   6.870   1.00 1.45 ? 36  ILE A HG22 4  
ATOM 5045  H HG23 . ILE A 1 36 ? -1.164  7.783   6.400   1.00 1.44 ? 36  ILE A HG23 4  
ATOM 5046  H HD11 . ILE A 1 36 ? -2.957  6.655   5.315   1.00 1.87 ? 36  ILE A HD11 4  
ATOM 5047  H HD12 . ILE A 1 36 ? -4.286  6.748   6.470   1.00 1.71 ? 36  ILE A HD12 4  
ATOM 5048  H HD13 . ILE A 1 36 ? -3.975  5.244   5.603   1.00 1.41 ? 36  ILE A HD13 4  
ATOM 5049  N N    . ILE A 1 37 ? 0.834   8.038   9.440   1.00 1.03 ? 37  ILE A N    4  
ATOM 5050  C CA   . ILE A 1 37 ? 1.411   9.149   10.198  1.00 1.10 ? 37  ILE A CA   4  
ATOM 5051  C C    . ILE A 1 37 ? 0.793   10.482  9.763   1.00 1.10 ? 37  ILE A C    4  
ATOM 5052  O O    . ILE A 1 37 ? 0.462   10.669  8.590   1.00 1.37 ? 37  ILE A O    4  
ATOM 5053  C CB   . ILE A 1 37 ? 2.951   9.201   10.022  1.00 1.14 ? 37  ILE A CB   4  
ATOM 5054  C CG1  . ILE A 1 37 ? 3.619   8.111   10.864  1.00 1.47 ? 37  ILE A CG1  4  
ATOM 5055  C CG2  . ILE A 1 37 ? 3.510   10.570  10.389  1.00 1.32 ? 37  ILE A CG2  4  
ATOM 5056  C CD1  . ILE A 1 37 ? 4.059   6.908   10.057  1.00 1.68 ? 37  ILE A CD1  4  
ATOM 5057  H H    . ILE A 1 37 ? 1.344   7.663   8.691   1.00 1.06 ? 37  ILE A H    4  
ATOM 5058  H HA   . ILE A 1 37 ? 1.193   8.984   11.243  1.00 1.17 ? 37  ILE A HA   4  
ATOM 5059  H HB   . ILE A 1 37 ? 3.175   9.023   8.983   1.00 1.07 ? 37  ILE A HB   4  
ATOM 5060  H HG12 . ILE A 1 37 ? 4.493   8.521   11.345  1.00 1.63 ? 37  ILE A HG12 4  
ATOM 5061  H HG13 . ILE A 1 37 ? 2.925   7.770   11.617  1.00 1.84 ? 37  ILE A HG13 4  
ATOM 5062  H HG21 . ILE A 1 37 ? 4.583   10.502  10.495  1.00 1.40 ? 37  ILE A HG21 4  
ATOM 5063  H HG22 . ILE A 1 37 ? 3.076   10.900  11.320  1.00 1.79 ? 37  ILE A HG22 4  
ATOM 5064  H HG23 . ILE A 1 37 ? 3.271   11.277  9.608   1.00 1.90 ? 37  ILE A HG23 4  
ATOM 5065  H HD11 . ILE A 1 37 ? 4.884   6.422   10.558  1.00 2.18 ? 37  ILE A HD11 4  
ATOM 5066  H HD12 . ILE A 1 37 ? 4.373   7.228   9.075   1.00 1.92 ? 37  ILE A HD12 4  
ATOM 5067  H HD13 . ILE A 1 37 ? 3.236   6.215   9.964   1.00 1.93 ? 37  ILE A HD13 4  
ATOM 5068  N N    . GLU A 1 38 ? 0.643   11.406  10.719  1.00 0.96 ? 38  GLU A N    4  
ATOM 5069  C CA   . GLU A 1 38 ? 0.065   12.724  10.439  1.00 0.99 ? 38  GLU A CA   4  
ATOM 5070  C C    . GLU A 1 38 ? 0.889   13.478  9.392   1.00 1.31 ? 38  GLU A C    4  
ATOM 5071  O O    . GLU A 1 38 ? 2.116   13.360  9.351   1.00 1.64 ? 38  GLU A O    4  
ATOM 5072  C CB   . GLU A 1 38 ? -0.035  13.559  11.724  1.00 1.23 ? 38  GLU A CB   4  
ATOM 5073  C CG   . GLU A 1 38 ? -1.139  14.605  11.688  1.00 1.71 ? 38  GLU A CG   4  
ATOM 5074  C CD   . GLU A 1 38 ? -1.686  14.922  13.067  1.00 2.41 ? 38  GLU A CD   4  
ATOM 5075  O OE1  . GLU A 1 38 ? -1.135  15.825  13.732  1.00 2.79 ? 38  GLU A OE1  4  
ATOM 5076  O OE2  . GLU A 1 38 ? -2.667  14.268  13.481  1.00 3.11 ? 38  GLU A OE2  4  
ATOM 5077  H H    . GLU A 1 38 ? 0.928   11.193  11.632  1.00 0.97 ? 38  GLU A H    4  
ATOM 5078  H HA   . GLU A 1 38 ? -0.929  12.569  10.047  1.00 1.23 ? 38  GLU A HA   4  
ATOM 5079  H HB2  . GLU A 1 38 ? -0.227  12.900  12.558  1.00 1.66 ? 38  GLU A HB2  4  
ATOM 5080  H HB3  . GLU A 1 38 ? 0.905   14.065  11.887  1.00 1.49 ? 38  GLU A HB3  4  
ATOM 5081  H HG2  . GLU A 1 38 ? -0.743  15.514  11.259  1.00 2.01 ? 38  GLU A HG2  4  
ATOM 5082  H HG3  . GLU A 1 38 ? -1.946  14.238  11.073  1.00 1.90 ? 38  GLU A HG3  4  
ATOM 5083  N N    . GLY A 1 39 ? 0.201   14.254  8.550   1.00 1.69 ? 39  GLY A N    4  
ATOM 5084  C CA   . GLY A 1 39 ? 0.870   15.022  7.510   1.00 2.36 ? 39  GLY A CA   4  
ATOM 5085  C C    . GLY A 1 39 ? 1.601   14.152  6.495   1.00 2.68 ? 39  GLY A C    4  
ATOM 5086  O O    . GLY A 1 39 ? 2.535   14.615  5.839   1.00 3.15 ? 39  GLY A O    4  
ATOM 5087  H H    . GLY A 1 39 ? -0.771  14.311  8.639   1.00 1.72 ? 39  GLY A H    4  
ATOM 5088  H HA2  . GLY A 1 39 ? 0.133   15.614  6.990   1.00 2.72 ? 39  GLY A HA2  4  
ATOM 5089  H HA3  . GLY A 1 39 ? 1.583   15.686  7.976   1.00 2.45 ? 39  GLY A HA3  4  
ATOM 5090  N N    . GLY A 1 40 ? 1.179   12.891  6.367   1.00 2.49 ? 40  GLY A N    4  
ATOM 5091  C CA   . GLY A 1 40 ? 1.812   11.981  5.427   1.00 2.80 ? 40  GLY A CA   4  
ATOM 5092  C C    . GLY A 1 40 ? 1.100   11.929  4.087   1.00 2.61 ? 40  GLY A C    4  
ATOM 5093  O O    . GLY A 1 40 ? -0.023  12.419  3.955   1.00 2.37 ? 40  GLY A O    4  
ATOM 5094  H H    . GLY A 1 40 ? 0.433   12.575  6.917   1.00 2.19 ? 40  GLY A H    4  
ATOM 5095  H HA2  . GLY A 1 40 ? 2.832   12.300  5.266   1.00 3.27 ? 40  GLY A HA2  4  
ATOM 5096  H HA3  . GLY A 1 40 ? 1.822   10.989  5.855   1.00 2.80 ? 40  GLY A HA3  4  
ATOM 5097  N N    . ALA A 1 41 ? 1.761   11.335  3.091   1.00 2.83 ? 41  ALA A N    4  
ATOM 5098  C CA   . ALA A 1 41 ? 1.204   11.211  1.743   1.00 2.70 ? 41  ALA A CA   4  
ATOM 5099  C C    . ALA A 1 41 ? -0.238  10.702  1.767   1.00 2.11 ? 41  ALA A C    4  
ATOM 5100  O O    . ALA A 1 41 ? -1.130  11.334  1.200   1.00 2.06 ? 41  ALA A O    4  
ATOM 5101  C CB   . ALA A 1 41 ? 2.069   10.288  0.896   1.00 3.00 ? 41  ALA A CB   4  
ATOM 5102  H H    . ALA A 1 41 ? 2.655   10.972  3.267   1.00 3.11 ? 41  ALA A H    4  
ATOM 5103  H HA   . ALA A 1 41 ? 1.219   12.190  1.288   1.00 2.91 ? 41  ALA A HA   4  
ATOM 5104  H HB1  . ALA A 1 41 ? 2.049   9.292   1.315   1.00 3.45 ? 41  ALA A HB1  4  
ATOM 5105  H HB2  . ALA A 1 41 ? 3.085   10.654  0.888   1.00 3.26 ? 41  ALA A HB2  4  
ATOM 5106  H HB3  . ALA A 1 41 ? 1.687   10.263  -0.114  1.00 2.99 ? 41  ALA A HB3  4  
ATOM 5107  N N    . ALA A 1 42 ? -0.460  9.563   2.427   1.00 1.82 ? 42  ALA A N    4  
ATOM 5108  C CA   . ALA A 1 42 ? -1.798  8.978   2.521   1.00 1.36 ? 42  ALA A CA   4  
ATOM 5109  C C    . ALA A 1 42 ? -2.720  9.844   3.379   1.00 1.16 ? 42  ALA A C    4  
ATOM 5110  O O    . ALA A 1 42 ? -3.827  10.181  2.962   1.00 1.02 ? 42  ALA A O    4  
ATOM 5111  C CB   . ALA A 1 42 ? -1.719  7.565   3.084   1.00 1.50 ? 42  ALA A CB   4  
ATOM 5112  H H    . ALA A 1 42 ? 0.288   9.104   2.865   1.00 2.06 ? 42  ALA A H    4  
ATOM 5113  H HA   . ALA A 1 42 ? -2.206  8.919   1.522   1.00 1.30 ? 42  ALA A HA   4  
ATOM 5114  H HB1  . ALA A 1 42 ? -2.705  7.240   3.381   1.00 1.77 ? 42  ALA A HB1  4  
ATOM 5115  H HB2  . ALA A 1 42 ? -1.064  7.555   3.942   1.00 1.88 ? 42  ALA A HB2  4  
ATOM 5116  H HB3  . ALA A 1 42 ? -1.333  6.898   2.328   1.00 1.93 ? 42  ALA A HB3  4  
ATOM 5117  N N    . HIS A 1 43 ? -2.252  10.194  4.580   1.00 1.34 ? 43  HIS A N    4  
ATOM 5118  C CA   . HIS A 1 43 ? -3.024  11.020  5.511   1.00 1.21 ? 43  HIS A CA   4  
ATOM 5119  C C    . HIS A 1 43 ? -3.563  12.281  4.830   1.00 1.08 ? 43  HIS A C    4  
ATOM 5120  O O    . HIS A 1 43 ? -4.743  12.612  4.965   1.00 1.15 ? 43  HIS A O    4  
ATOM 5121  C CB   . HIS A 1 43 ? -2.150  11.405  6.708   1.00 1.39 ? 43  HIS A CB   4  
ATOM 5122  C CG   . HIS A 1 43 ? -2.867  12.194  7.757   1.00 1.16 ? 43  HIS A CG   4  
ATOM 5123  N ND1  . HIS A 1 43 ? -2.904  13.571  7.767   1.00 1.34 ? 43  HIS A ND1  4  
ATOM 5124  C CD2  . HIS A 1 43 ? -3.566  11.792  8.845   1.00 1.15 ? 43  HIS A CD2  4  
ATOM 5125  C CE1  . HIS A 1 43 ? -3.592  13.984  8.817   1.00 1.22 ? 43  HIS A CE1  4  
ATOM 5126  N NE2  . HIS A 1 43 ? -4.005  12.923  9.487   1.00 1.28 ? 43  HIS A NE2  4  
ATOM 5127  H H    . HIS A 1 43 ? -1.364  9.880   4.850   1.00 1.62 ? 43  HIS A H    4  
ATOM 5128  H HA   . HIS A 1 43 ? -3.858  10.431  5.862   1.00 1.26 ? 43  HIS A HA   4  
ATOM 5129  H HB2  . HIS A 1 43 ? -1.774  10.507  7.171   1.00 1.74 ? 43  HIS A HB2  4  
ATOM 5130  H HB3  . HIS A 1 43 ? -1.318  11.997  6.357   1.00 1.58 ? 43  HIS A HB3  4  
ATOM 5131  H HD1  . HIS A 1 43 ? -2.489  14.160  7.103   1.00 1.69 ? 43  HIS A HD1  4  
ATOM 5132  H HD2  . HIS A 1 43 ? -3.747  10.770  9.149   1.00 1.32 ? 43  HIS A HD2  4  
ATOM 5133  H HE1  . HIS A 1 43 ? -3.779  15.013  9.083   1.00 1.34 ? 43  HIS A HE1  4  
ATOM 5134  H HE2  . HIS A 1 43 ? -4.440  12.946  10.364  1.00 1.60 ? 43  HIS A HE2  4  
ATOM 5135  N N    . LYS A 1 44 ? -2.691  12.981  4.104   1.00 1.15 ? 44  LYS A N    4  
ATOM 5136  C CA   . LYS A 1 44 ? -3.072  14.208  3.403   1.00 1.31 ? 44  LYS A CA   4  
ATOM 5137  C C    . LYS A 1 44 ? -3.980  13.912  2.210   1.00 1.39 ? 44  LYS A C    4  
ATOM 5138  O O    . LYS A 1 44 ? -4.920  14.663  1.939   1.00 1.46 ? 44  LYS A O    4  
ATOM 5139  C CB   . LYS A 1 44 ? -1.822  14.957  2.933   1.00 1.74 ? 44  LYS A CB   4  
ATOM 5140  C CG   . LYS A 1 44 ? -1.039  15.604  4.063   1.00 1.89 ? 44  LYS A CG   4  
ATOM 5141  C CD   . LYS A 1 44 ? 0.331   16.069  3.594   1.00 2.36 ? 44  LYS A CD   4  
ATOM 5142  C CE   . LYS A 1 44 ? 0.845   17.231  4.431   1.00 2.17 ? 44  LYS A CE   4  
ATOM 5143  N NZ   . LYS A 1 44 ? 1.643   18.190  3.620   1.00 2.66 ? 44  LYS A NZ   4  
ATOM 5144  H H    . LYS A 1 44 ? -1.765  12.665  4.040   1.00 1.26 ? 44  LYS A H    4  
ATOM 5145  H HA   . LYS A 1 44 ? -3.609  14.832  4.101   1.00 1.30 ? 44  LYS A HA   4  
ATOM 5146  H HB2  . LYS A 1 44 ? -1.171  14.262  2.423   1.00 2.10 ? 44  LYS A HB2  4  
ATOM 5147  H HB3  . LYS A 1 44 ? -2.120  15.731  2.240   1.00 2.02 ? 44  LYS A HB3  4  
ATOM 5148  H HG2  . LYS A 1 44 ? -1.591  16.456  4.429   1.00 1.94 ? 44  LYS A HG2  4  
ATOM 5149  H HG3  . LYS A 1 44 ? -0.912  14.885  4.859   1.00 2.08 ? 44  LYS A HG3  4  
ATOM 5150  H HD2  . LYS A 1 44 ? 1.027   15.247  3.675   1.00 2.71 ? 44  LYS A HD2  4  
ATOM 5151  H HD3  . LYS A 1 44 ? 0.260   16.383  2.563   1.00 2.84 ? 44  LYS A HD3  4  
ATOM 5152  H HE2  . LYS A 1 44 ? 0.000   17.752  4.858   1.00 2.08 ? 44  LYS A HE2  4  
ATOM 5153  H HE3  . LYS A 1 44 ? 1.464   16.839  5.225   1.00 2.50 ? 44  LYS A HE3  4  
ATOM 5154  H HZ1  . LYS A 1 44 ? 1.057   18.593  2.861   1.00 3.12 ? 44  LYS A HZ1  4  
ATOM 5155  H HZ2  . LYS A 1 44 ? 2.460   17.706  3.194   1.00 3.21 ? 44  LYS A HZ2  4  
ATOM 5156  H HZ3  . LYS A 1 44 ? 1.991   18.964  4.221   1.00 2.66 ? 44  LYS A HZ3  4  
ATOM 5157  N N    . ASP A 1 45 ? -3.698  12.816  1.500   1.00 1.59 ? 45  ASP A N    4  
ATOM 5158  C CA   . ASP A 1 45 ? -4.493  12.423  0.337   1.00 1.86 ? 45  ASP A CA   4  
ATOM 5159  C C    . ASP A 1 45 ? -5.941  12.134  0.736   1.00 1.89 ? 45  ASP A C    4  
ATOM 5160  O O    . ASP A 1 45 ? -6.873  12.679  0.142   1.00 1.97 ? 45  ASP A O    4  
ATOM 5161  C CB   . ASP A 1 45 ? -3.877  11.193  -0.339  1.00 2.33 ? 45  ASP A CB   4  
ATOM 5162  C CG   . ASP A 1 45 ? -4.278  11.059  -1.798  1.00 2.69 ? 45  ASP A CG   4  
ATOM 5163  O OD1  . ASP A 1 45 ? -4.182  12.061  -2.539  1.00 3.24 ? 45  ASP A OD1  4  
ATOM 5164  O OD2  . ASP A 1 45 ? -4.681  9.948   -2.201  1.00 2.80 ? 45  ASP A OD2  4  
ATOM 5165  H H    . ASP A 1 45 ? -2.939  12.257  1.769   1.00 1.67 ? 45  ASP A H    4  
ATOM 5166  H HA   . ASP A 1 45 ? -4.483  13.248  -0.361  1.00 1.92 ? 45  ASP A HA   4  
ATOM 5167  H HB2  . ASP A 1 45 ? -2.800  11.266  -0.291  1.00 2.40 ? 45  ASP A HB2  4  
ATOM 5168  H HB3  . ASP A 1 45 ? -4.194  10.303  0.185   1.00 2.46 ? 45  ASP A HB3  4  
ATOM 5169  N N    . GLY A 1 46 ? -6.118  11.281  1.746   1.00 2.08 ? 46  GLY A N    4  
ATOM 5170  C CA   . GLY A 1 46 ? -7.454  10.940  2.213   1.00 2.49 ? 46  GLY A CA   4  
ATOM 5171  C C    . GLY A 1 46 ? -8.025  9.690   1.558   1.00 2.11 ? 46  GLY A C    4  
ATOM 5172  O O    . GLY A 1 46 ? -8.940  9.069   2.102   1.00 2.47 ? 46  GLY A O    4  
ATOM 5173  H H    . GLY A 1 46 ? -5.334  10.885  2.181   1.00 2.09 ? 46  GLY A H    4  
ATOM 5174  H HA2  . GLY A 1 46 ? -7.417  10.782  3.280   1.00 2.83 ? 46  GLY A HA2  4  
ATOM 5175  H HA3  . GLY A 1 46 ? -8.115  11.770  2.011   1.00 3.17 ? 46  GLY A HA3  4  
ATOM 5176  N N    . LYS A 1 47 ? -7.492  9.319   0.390   1.00 1.87 ? 47  LYS A N    4  
ATOM 5177  C CA   . LYS A 1 47 ? -7.966  8.136   -0.328  1.00 2.32 ? 47  LYS A CA   4  
ATOM 5178  C C    . LYS A 1 47 ? -7.510  6.849   0.357   1.00 1.93 ? 47  LYS A C    4  
ATOM 5179  O O    . LYS A 1 47 ? -8.243  5.857   0.370   1.00 1.95 ? 47  LYS A O    4  
ATOM 5180  C CB   . LYS A 1 47 ? -7.475  8.158   -1.779  1.00 2.80 ? 47  LYS A CB   4  
ATOM 5181  C CG   . LYS A 1 47 ? -8.503  8.687   -2.766  1.00 3.64 ? 47  LYS A CG   4  
ATOM 5182  C CD   . LYS A 1 47 ? -8.675  10.194  -2.646  1.00 4.17 ? 47  LYS A CD   4  
ATOM 5183  C CE   . LYS A 1 47 ? -7.589  10.945  -3.404  1.00 5.03 ? 47  LYS A CE   4  
ATOM 5184  N NZ   . LYS A 1 47 ? -8.157  11.991  -4.299  1.00 5.67 ? 47  LYS A NZ   4  
ATOM 5185  H H    . LYS A 1 47 ? -6.765  9.851   0.005   1.00 1.83 ? 47  LYS A H    4  
ATOM 5186  H HA   . LYS A 1 47 ? -9.046  8.164   -0.326  1.00 3.00 ? 47  LYS A HA   4  
ATOM 5187  H HB2  . LYS A 1 47 ? -6.595  8.780   -1.840  1.00 2.86 ? 47  LYS A HB2  4  
ATOM 5188  H HB3  . LYS A 1 47 ? -7.212  7.152   -2.072  1.00 3.00 ? 47  LYS A HB3  4  
ATOM 5189  H HG2  . LYS A 1 47 ? -8.178  8.453   -3.768  1.00 4.05 ? 47  LYS A HG2  4  
ATOM 5190  H HG3  . LYS A 1 47 ? -9.452  8.210   -2.573  1.00 3.92 ? 47  LYS A HG3  4  
ATOM 5191  H HD2  . LYS A 1 47 ? -9.638  10.469  -3.051  1.00 4.28 ? 47  LYS A HD2  4  
ATOM 5192  H HD3  . LYS A 1 47 ? -8.630  10.471  -1.603  1.00 4.30 ? 47  LYS A HD3  4  
ATOM 5193  H HE2  . LYS A 1 47 ? -6.928  11.413  -2.691  1.00 5.17 ? 47  LYS A HE2  4  
ATOM 5194  H HE3  . LYS A 1 47 ? -7.031  10.238  -4.000  1.00 5.45 ? 47  LYS A HE3  4  
ATOM 5195  H HZ1  . LYS A 1 47 ? -8.802  11.558  -4.991  1.00 5.78 ? 47  LYS A HZ1  4  
ATOM 5196  H HZ2  . LYS A 1 47 ? -7.393  12.476  -4.811  1.00 5.80 ? 47  LYS A HZ2  4  
ATOM 5197  H HZ3  . LYS A 1 47 ? -8.685  12.692  -3.741  1.00 6.21 ? 47  LYS A HZ3  4  
ATOM 5198  N N    . LEU A 1 48 ? -6.301  6.864   0.924   1.00 1.68 ? 48  LEU A N    4  
ATOM 5199  C CA   . LEU A 1 48 ? -5.761  5.691   1.606   1.00 1.38 ? 48  LEU A CA   4  
ATOM 5200  C C    . LEU A 1 48 ? -6.132  5.696   3.090   1.00 1.28 ? 48  LEU A C    4  
ATOM 5201  O O    . LEU A 1 48 ? -5.895  6.676   3.799   1.00 1.35 ? 48  LEU A O    4  
ATOM 5202  C CB   . LEU A 1 48 ? -4.238  5.634   1.444   1.00 1.19 ? 48  LEU A CB   4  
ATOM 5203  C CG   . LEU A 1 48 ? -3.628  4.230   1.499   1.00 1.09 ? 48  LEU A CG   4  
ATOM 5204  C CD1  . LEU A 1 48 ? -2.294  4.193   0.769   1.00 1.56 ? 48  LEU A CD1  4  
ATOM 5205  C CD2  . LEU A 1 48 ? -3.463  3.776   2.941   1.00 1.06 ? 48  LEU A CD2  4  
ATOM 5206  H H    . LEU A 1 48 ? -5.758  7.678   0.888   1.00 1.80 ? 48  LEU A H    4  
ATOM 5207  H HA   . LEU A 1 48 ? -6.193  4.815   1.145   1.00 1.52 ? 48  LEU A HA   4  
ATOM 5208  H HB2  . LEU A 1 48 ? -3.983  6.077   0.491   1.00 1.43 ? 48  LEU A HB2  4  
ATOM 5209  H HB3  . LEU A 1 48 ? -3.791  6.227   2.228   1.00 1.29 ? 48  LEU A HB3  4  
ATOM 5210  H HG   . LEU A 1 48 ? -4.296  3.535   1.008   1.00 1.25 ? 48  LEU A HG   4  
ATOM 5211  H HD11 . LEU A 1 48 ? -2.426  4.551   -0.242  1.00 2.04 ? 48  LEU A HD11 4  
ATOM 5212  H HD12 . LEU A 1 48 ? -1.925  3.178   0.746   1.00 1.85 ? 48  LEU A HD12 4  
ATOM 5213  H HD13 . LEU A 1 48 ? -1.584  4.823   1.285   1.00 2.03 ? 48  LEU A HD13 4  
ATOM 5214  H HD21 . LEU A 1 48 ? -2.456  3.982   3.272   1.00 1.74 ? 48  LEU A HD21 4  
ATOM 5215  H HD22 . LEU A 1 48 ? -3.653  2.713   3.004   1.00 1.43 ? 48  LEU A HD22 4  
ATOM 5216  H HD23 . LEU A 1 48 ? -4.164  4.303   3.569   1.00 1.30 ? 48  LEU A HD23 4  
ATOM 5217  N N    . GLN A 1 49 ? -6.707  4.584   3.546   1.00 1.21 ? 49  GLN A N    4  
ATOM 5218  C CA   . GLN A 1 49 ? -7.114  4.422   4.938   1.00 1.17 ? 49  GLN A CA   4  
ATOM 5219  C C    . GLN A 1 49 ? -6.643  3.068   5.471   1.00 1.09 ? 49  GLN A C    4  
ATOM 5220  O O    . GLN A 1 49 ? -6.639  2.077   4.739   1.00 1.14 ? 49  GLN A O    4  
ATOM 5221  C CB   . GLN A 1 49 ? -8.638  4.538   5.069   1.00 1.30 ? 49  GLN A CB   4  
ATOM 5222  C CG   . GLN A 1 49 ? -9.413  3.523   4.239   1.00 1.46 ? 49  GLN A CG   4  
ATOM 5223  C CD   . GLN A 1 49 ? -9.618  3.970   2.803   1.00 1.45 ? 49  GLN A CD   4  
ATOM 5224  O OE1  . GLN A 1 49 ? -10.340 4.931   2.537   1.00 1.54 ? 49  GLN A OE1  4  
ATOM 5225  N NE2  . GLN A 1 49 ? -8.981  3.273   1.866   1.00 1.52 ? 49  GLN A NE2  4  
ATOM 5226  H H    . GLN A 1 49 ? -6.859  3.842   2.927   1.00 1.26 ? 49  GLN A H    4  
ATOM 5227  H HA   . GLN A 1 49 ? -6.650  5.206   5.517   1.00 1.19 ? 49  GLN A HA   4  
ATOM 5228  H HB2  . GLN A 1 49 ? -8.906  4.400   6.104   1.00 1.32 ? 49  GLN A HB2  4  
ATOM 5229  H HB3  . GLN A 1 49 ? -8.938  5.528   4.759   1.00 1.34 ? 49  GLN A HB3  4  
ATOM 5230  H HG2  . GLN A 1 49 ? -8.869  2.590   4.234   1.00 1.57 ? 49  GLN A HG2  4  
ATOM 5231  H HG3  . GLN A 1 49 ? -10.380 3.370   4.694   1.00 1.59 ? 49  GLN A HG3  4  
ATOM 5232  H HE21 . GLN A 1 49 ? -8.420  2.520   2.149   1.00 1.62 ? 49  GLN A HE21 4  
ATOM 5233  H HE22 . GLN A 1 49 ? -9.098  3.541   0.932   1.00 1.56 ? 49  GLN A HE22 4  
ATOM 5234  N N    . ILE A 1 50 ? -6.245  3.028   6.742   1.00 1.06 ? 50  ILE A N    4  
ATOM 5235  C CA   . ILE A 1 50 ? -5.769  1.786   7.360   1.00 1.03 ? 50  ILE A CA   4  
ATOM 5236  C C    . ILE A 1 50 ? -6.728  0.624   7.088   1.00 1.05 ? 50  ILE A C    4  
ATOM 5237  O O    . ILE A 1 50 ? -7.912  0.693   7.424   1.00 1.16 ? 50  ILE A O    4  
ATOM 5238  C CB   . ILE A 1 50 ? -5.576  1.936   8.888   1.00 1.08 ? 50  ILE A CB   4  
ATOM 5239  C CG1  . ILE A 1 50 ? -6.811  2.574   9.536   1.00 1.76 ? 50  ILE A CG1  4  
ATOM 5240  C CG2  . ILE A 1 50 ? -4.328  2.756   9.188   1.00 1.14 ? 50  ILE A CG2  4  
ATOM 5241  C CD1  . ILE A 1 50 ? -7.446  1.710   10.603  1.00 2.56 ? 50  ILE A CD1  4  
ATOM 5242  H H    . ILE A 1 50 ? -6.269  3.849   7.278   1.00 1.12 ? 50  ILE A H    4  
ATOM 5243  H HA   . ILE A 1 50 ? -4.809  1.550   6.922   1.00 1.00 ? 50  ILE A HA   4  
ATOM 5244  H HB   . ILE A 1 50 ? -5.431  0.950   9.304   1.00 1.51 ? 50  ILE A HB   4  
ATOM 5245  H HG12 . ILE A 1 50 ? -6.527  3.510   9.995   1.00 1.94 ? 50  ILE A HG12 4  
ATOM 5246  H HG13 . ILE A 1 50 ? -7.554  2.763   8.775   1.00 2.32 ? 50  ILE A HG13 4  
ATOM 5247  H HG21 . ILE A 1 50 ? -4.535  3.449   9.990   1.00 1.55 ? 50  ILE A HG21 4  
ATOM 5248  H HG22 . ILE A 1 50 ? -4.036  3.306   8.305   1.00 1.63 ? 50  ILE A HG22 4  
ATOM 5249  H HG23 . ILE A 1 50 ? -3.525  2.096   9.482   1.00 1.57 ? 50  ILE A HG23 4  
ATOM 5250  H HD11 . ILE A 1 50 ? -7.808  0.795   10.158  1.00 3.13 ? 50  ILE A HD11 4  
ATOM 5251  H HD12 . ILE A 1 50 ? -8.272  2.242   11.053  1.00 2.96 ? 50  ILE A HD12 4  
ATOM 5252  H HD13 . ILE A 1 50 ? -6.713  1.476   11.360  1.00 2.79 ? 50  ILE A HD13 4  
ATOM 5253  N N    . GLY A 1 51 ? -6.207  -0.437  6.467   1.00 1.02 ? 51  GLY A N    4  
ATOM 5254  C CA   . GLY A 1 51 ? -7.023  -1.599  6.146   1.00 1.10 ? 51  GLY A CA   4  
ATOM 5255  C C    . GLY A 1 51 ? -7.069  -1.908  4.658   1.00 1.04 ? 51  GLY A C    4  
ATOM 5256  O O    . GLY A 1 51 ? -7.374  -3.039  4.276   1.00 1.03 ? 51  GLY A O    4  
ATOM 5257  H H    . GLY A 1 51 ? -5.260  -0.430  6.214   1.00 0.99 ? 51  GLY A H    4  
ATOM 5258  H HA2  . GLY A 1 51 ? -6.620  -2.457  6.662   1.00 1.22 ? 51  GLY A HA2  4  
ATOM 5259  H HA3  . GLY A 1 51 ? -8.030  -1.431  6.493   1.00 1.14 ? 51  GLY A HA3  4  
ATOM 5260  N N    . ASP A 1 52 ? -6.767  -0.919  3.808   1.00 1.04 ? 52  ASP A N    4  
ATOM 5261  C CA   . ASP A 1 52 ? -6.779  -1.134  2.368   1.00 1.01 ? 52  ASP A CA   4  
ATOM 5262  C C    . ASP A 1 52 ? -5.644  -2.066  1.951   1.00 0.91 ? 52  ASP A C    4  
ATOM 5263  O O    . ASP A 1 52 ? -4.673  -2.251  2.698   1.00 0.88 ? 52  ASP A O    4  
ATOM 5264  C CB   . ASP A 1 52 ? -6.682  0.195   1.604   1.00 1.03 ? 52  ASP A CB   4  
ATOM 5265  C CG   . ASP A 1 52 ? -5.626  1.137   2.144   1.00 1.11 ? 52  ASP A CG   4  
ATOM 5266  O OD1  . ASP A 1 52 ? -4.559  0.662   2.590   1.00 1.55 ? 52  ASP A OD1  4  
ATOM 5267  O OD2  . ASP A 1 52 ? -5.869  2.357   2.109   1.00 1.56 ? 52  ASP A OD2  4  
ATOM 5268  H H    . ASP A 1 52 ? -6.533  -0.035  4.152   1.00 1.07 ? 52  ASP A H    4  
ATOM 5269  H HA   . ASP A 1 52 ? -7.715  -1.603  2.126   1.00 1.08 ? 52  ASP A HA   4  
ATOM 5270  H HB2  . ASP A 1 52 ? -6.447  -0.007  0.573   1.00 0.99 ? 52  ASP A HB2  4  
ATOM 5271  H HB3  . ASP A 1 52 ? -7.638  0.693   1.657   1.00 1.18 ? 52  ASP A HB3  4  
ATOM 5272  N N    . LYS A 1 53 ? -5.770  -2.647  0.758   1.00 0.88 ? 53  LYS A N    4  
ATOM 5273  C CA   . LYS A 1 53 ? -4.756  -3.560  0.246   1.00 0.82 ? 53  LYS A CA   4  
ATOM 5274  C C    . LYS A 1 53 ? -4.023  -2.970  -0.956  1.00 0.76 ? 53  LYS A C    4  
ATOM 5275  O O    . LYS A 1 53 ? -4.572  -2.189  -1.720  1.00 0.87 ? 53  LYS A O    4  
ATOM 5276  C CB   . LYS A 1 53 ? -5.384  -4.905  -0.136  1.00 0.94 ? 53  LYS A CB   4  
ATOM 5277  C CG   . LYS A 1 53 ? -6.646  -4.786  -0.978  1.00 1.33 ? 53  LYS A CG   4  
ATOM 5278  C CD   . LYS A 1 53 ? -7.899  -4.921  -0.127  1.00 1.83 ? 53  LYS A CD   4  
ATOM 5279  C CE   . LYS A 1 53 ? -8.489  -6.320  -0.216  1.00 2.37 ? 53  LYS A CE   4  
ATOM 5280  N NZ   . LYS A 1 53 ? -9.107  -6.747  1.071   1.00 3.23 ? 53  LYS A NZ   4  
ATOM 5281  H H    . LYS A 1 53 ? -6.559  -2.449  0.209   1.00 0.92 ? 53  LYS A H    4  
ATOM 5282  H HA   . LYS A 1 53 ? -4.039  -3.726  1.036   1.00 0.82 ? 53  LYS A HA   4  
ATOM 5283  H HB2  . LYS A 1 53 ? -4.661  -5.480  -0.694  1.00 1.54 ? 53  LYS A HB2  4  
ATOM 5284  H HB3  . LYS A 1 53 ? -5.631  -5.438  0.768   1.00 1.39 ? 53  LYS A HB3  4  
ATOM 5285  H HG2  . LYS A 1 53 ? -6.654  -3.821  -1.463  1.00 1.78 ? 53  LYS A HG2  4  
ATOM 5286  H HG3  . LYS A 1 53 ? -6.642  -5.566  -1.725  1.00 1.86 ? 53  LYS A HG3  4  
ATOM 5287  H HD2  . LYS A 1 53 ? -7.648  -4.713  0.903   1.00 2.39 ? 53  LYS A HD2  4  
ATOM 5288  H HD3  . LYS A 1 53 ? -8.634  -4.207  -0.470  1.00 2.03 ? 53  LYS A HD3  4  
ATOM 5289  H HE2  . LYS A 1 53 ? -9.243  -6.330  -0.988  1.00 2.44 ? 53  LYS A HE2  4  
ATOM 5290  H HE3  . LYS A 1 53 ? -7.702  -7.014  -0.474  1.00 2.77 ? 53  LYS A HE3  4  
ATOM 5291  H HZ1  . LYS A 1 53 ? -8.385  -6.789  1.817   1.00 3.81 ? 53  LYS A HZ1  4  
ATOM 5292  H HZ2  . LYS A 1 53 ? -9.537  -7.688  0.965   1.00 3.55 ? 53  LYS A HZ2  4  
ATOM 5293  H HZ3  . LYS A 1 53 ? -9.844  -6.072  1.355   1.00 3.45 ? 53  LYS A HZ3  4  
ATOM 5294  N N    . LEU A 1 54 ? -2.769  -3.350  -1.090  1.00 0.64 ? 54  LEU A N    4  
ATOM 5295  C CA   . LEU A 1 54 ? -1.932  -2.864  -2.177  1.00 0.66 ? 54  LEU A CA   4  
ATOM 5296  C C    . LEU A 1 54 ? -1.799  -3.905  -3.282  1.00 0.64 ? 54  LEU A C    4  
ATOM 5297  O O    . LEU A 1 54 ? -1.057  -4.879  -3.154  1.00 0.79 ? 54  LEU A O    4  
ATOM 5298  C CB   . LEU A 1 54 ? -0.560  -2.432  -1.658  1.00 0.73 ? 54  LEU A CB   4  
ATOM 5299  C CG   . LEU A 1 54 ? -0.395  -0.917  -1.495  1.00 0.83 ? 54  LEU A CG   4  
ATOM 5300  C CD1  . LEU A 1 54 ? 0.724   -0.594  -0.515  1.00 1.11 ? 54  LEU A CD1  4  
ATOM 5301  C CD2  . LEU A 1 54 ? -0.135  -0.263  -2.844  1.00 1.72 ? 54  LEU A CD2  4  
ATOM 5302  H H    . LEU A 1 54 ? -2.412  -3.954  -0.413  1.00 0.62 ? 54  LEU A H    4  
ATOM 5303  H HA   . LEU A 1 54 ? -2.426  -1.997  -2.595  1.00 0.75 ? 54  LEU A HA   4  
ATOM 5304  H HB2  . LEU A 1 54 ? -0.394  -2.902  -0.699  1.00 1.24 ? 54  LEU A HB2  4  
ATOM 5305  H HB3  . LEU A 1 54 ? 0.193   -2.782  -2.348  1.00 1.21 ? 54  LEU A HB3  4  
ATOM 5306  H HG   . LEU A 1 54 ? -1.310  -0.506  -1.098  1.00 1.18 ? 54  LEU A HG   4  
ATOM 5307  H HD11 . LEU A 1 54 ? 1.587   -1.203  -0.738  1.00 1.58 ? 54  LEU A HD11 4  
ATOM 5308  H HD12 . LEU A 1 54 ? 0.389   -0.800  0.491   1.00 1.88 ? 54  LEU A HD12 4  
ATOM 5309  H HD13 . LEU A 1 54 ? 0.987   0.449   -0.601  1.00 1.17 ? 54  LEU A HD13 4  
ATOM 5310  H HD21 . LEU A 1 54 ? -1.042  0.205   -3.198  1.00 2.31 ? 54  LEU A HD21 4  
ATOM 5311  H HD22 . LEU A 1 54 ? 0.182   -1.012  -3.555  1.00 2.00 ? 54  LEU A HD22 4  
ATOM 5312  H HD23 . LEU A 1 54 ? 0.638   0.485   -2.742  1.00 2.08 ? 54  LEU A HD23 4  
ATOM 5313  N N    . LEU A 1 55 ? -2.534  -3.677  -4.370  1.00 0.56 ? 55  LEU A N    4  
ATOM 5314  C CA   . LEU A 1 55 ? -2.522  -4.569  -5.519  1.00 0.58 ? 55  LEU A CA   4  
ATOM 5315  C C    . LEU A 1 55 ? -1.201  -4.448  -6.265  1.00 0.54 ? 55  LEU A C    4  
ATOM 5316  O O    . LEU A 1 55 ? -0.573  -5.457  -6.588  1.00 0.56 ? 55  LEU A O    4  
ATOM 5317  C CB   . LEU A 1 55 ? -3.692  -4.253  -6.456  1.00 0.66 ? 55  LEU A CB   4  
ATOM 5318  C CG   . LEU A 1 55 ? -3.907  -5.254  -7.592  1.00 0.91 ? 55  LEU A CG   4  
ATOM 5319  C CD1  . LEU A 1 55 ? -4.646  -6.483  -7.086  1.00 1.27 ? 55  LEU A CD1  4  
ATOM 5320  C CD2  . LEU A 1 55 ? -4.670  -4.603  -8.737  1.00 1.87 ? 55  LEU A CD2  4  
ATOM 5321  H H    . LEU A 1 55 ? -3.098  -2.880  -4.398  1.00 0.58 ? 55  LEU A H    4  
ATOM 5322  H HA   . LEU A 1 55 ? -2.625  -5.581  -5.155  1.00 0.62 ? 55  LEU A HA   4  
ATOM 5323  H HB2  . LEU A 1 55 ? -4.594  -4.212  -5.865  1.00 0.75 ? 55  LEU A HB2  4  
ATOM 5324  H HB3  . LEU A 1 55 ? -3.524  -3.279  -6.891  1.00 0.98 ? 55  LEU A HB3  4  
ATOM 5325  H HG   . LEU A 1 55 ? -2.945  -5.574  -7.969  1.00 1.50 ? 55  LEU A HG   4  
ATOM 5326  H HD11 . LEU A 1 55 ? -4.219  -6.798  -6.145  1.00 1.70 ? 55  LEU A HD11 4  
ATOM 5327  H HD12 . LEU A 1 55 ? -4.553  -7.282  -7.807  1.00 1.74 ? 55  LEU A HD12 4  
ATOM 5328  H HD13 . LEU A 1 55 ? -5.689  -6.244  -6.947  1.00 1.86 ? 55  LEU A HD13 4  
ATOM 5329  H HD21 . LEU A 1 55 ? -4.890  -5.345  -9.491  1.00 2.39 ? 55  LEU A HD21 4  
ATOM 5330  H HD22 . LEU A 1 55 ? -4.069  -3.818  -9.170  1.00 2.39 ? 55  LEU A HD22 4  
ATOM 5331  H HD23 . LEU A 1 55 ? -5.593  -4.186  -8.363  1.00 2.37 ? 55  LEU A HD23 4  
ATOM 5332  N N    . ALA A 1 56 ? -0.779  -3.209  -6.537  1.00 0.51 ? 56  ALA A N    4  
ATOM 5333  C CA   . ALA A 1 56 ? 0.482   -2.983  -7.246  1.00 0.49 ? 56  ALA A CA   4  
ATOM 5334  C C    . ALA A 1 56 ? 1.092   -1.617  -6.911  1.00 0.53 ? 56  ALA A C    4  
ATOM 5335  O O    . ALA A 1 56 ? 0.378   -0.670  -6.588  1.00 0.67 ? 56  ALA A O    4  
ATOM 5336  C CB   . ALA A 1 56 ? 0.267   -3.112  -8.753  1.00 0.54 ? 56  ALA A CB   4  
ATOM 5337  H H    . ALA A 1 56 ? -1.329  -2.432  -6.256  1.00 0.53 ? 56  ALA A H    4  
ATOM 5338  H HA   . ALA A 1 56 ? 1.174   -3.759  -6.932  1.00 0.52 ? 56  ALA A HA   4  
ATOM 5339  H HB1  . ALA A 1 56 ? 1.179   -2.858  -9.275  1.00 1.19 ? 56  ALA A HB1  4  
ATOM 5340  H HB2  . ALA A 1 56 ? -0.519  -2.438  -9.062  1.00 0.99 ? 56  ALA A HB2  4  
ATOM 5341  H HB3  . ALA A 1 56 ? -0.017  -4.126  -8.996  1.00 1.25 ? 56  ALA A HB3  4  
ATOM 5342  N N    . VAL A 1 57 ? 2.425   -1.527  -6.993  1.00 0.50 ? 57  VAL A N    4  
ATOM 5343  C CA   . VAL A 1 57 ? 3.139   -0.281  -6.708  1.00 0.59 ? 57  VAL A CA   4  
ATOM 5344  C C    . VAL A 1 57 ? 4.263   -0.054  -7.720  1.00 0.53 ? 57  VAL A C    4  
ATOM 5345  O O    . VAL A 1 57 ? 5.234   -0.805  -7.755  1.00 0.52 ? 57  VAL A O    4  
ATOM 5346  C CB   . VAL A 1 57 ? 3.733   -0.277  -5.281  1.00 0.77 ? 57  VAL A CB   4  
ATOM 5347  C CG1  . VAL A 1 57 ? 4.375   1.068   -4.970  1.00 1.42 ? 57  VAL A CG1  4  
ATOM 5348  C CG2  . VAL A 1 57 ? 2.666   -0.609  -4.250  1.00 1.47 ? 57  VAL A CG2  4  
ATOM 5349  H H    . VAL A 1 57 ? 2.942   -2.324  -7.254  1.00 0.48 ? 57  VAL A H    4  
ATOM 5350  H HA   . VAL A 1 57 ? 2.430   0.532   -6.783  1.00 0.66 ? 57  VAL A HA   4  
ATOM 5351  H HB   . VAL A 1 57 ? 4.500   -1.037  -5.230  1.00 1.34 ? 57  VAL A HB   4  
ATOM 5352  H HG11 . VAL A 1 57 ? 4.895   1.008   -4.026  1.00 1.89 ? 57  VAL A HG11 4  
ATOM 5353  H HG12 . VAL A 1 57 ? 3.609   1.827   -4.911  1.00 1.82 ? 57  VAL A HG12 4  
ATOM 5354  H HG13 . VAL A 1 57 ? 5.076   1.322   -5.751  1.00 2.12 ? 57  VAL A HG13 4  
ATOM 5355  H HG21 . VAL A 1 57 ? 2.435   -1.663  -4.295  1.00 1.95 ? 57  VAL A HG21 4  
ATOM 5356  H HG22 . VAL A 1 57 ? 1.774   -0.036  -4.459  1.00 1.95 ? 57  VAL A HG22 4  
ATOM 5357  H HG23 . VAL A 1 57 ? 3.029   -0.361  -3.263  1.00 2.01 ? 57  VAL A HG23 4  
ATOM 5358  N N    . ASN A 1 58 ? 4.121   0.987   -8.543  1.00 0.57 ? 58  ASN A N    4  
ATOM 5359  C CA   . ASN A 1 58 ? 5.122   1.316   -9.562  1.00 0.58 ? 58  ASN A CA   4  
ATOM 5360  C C    . ASN A 1 58 ? 5.222   0.211   -10.622 1.00 0.59 ? 58  ASN A C    4  
ATOM 5361  O O    . ASN A 1 58 ? 6.319   -0.185  -11.019 1.00 0.60 ? 58  ASN A O    4  
ATOM 5362  C CB   . ASN A 1 58 ? 6.494   1.564   -8.916  1.00 0.57 ? 58  ASN A CB   4  
ATOM 5363  C CG   . ASN A 1 58 ? 6.477   2.725   -7.936  1.00 0.80 ? 58  ASN A CG   4  
ATOM 5364  O OD1  . ASN A 1 58 ? 6.038   3.826   -8.268  1.00 1.39 ? 58  ASN A OD1  4  
ATOM 5365  N ND2  . ASN A 1 58 ? 6.960   2.487   -6.719  1.00 1.49 ? 58  ASN A ND2  4  
ATOM 5366  H H    . ASN A 1 58 ? 3.321   1.549   -8.466  1.00 0.63 ? 58  ASN A H    4  
ATOM 5367  H HA   . ASN A 1 58 ? 4.801   2.226   -10.050 1.00 0.65 ? 58  ASN A HA   4  
ATOM 5368  H HB2  . ASN A 1 58 ? 6.803   0.676   -8.387  1.00 0.64 ? 58  ASN A HB2  4  
ATOM 5369  H HB3  . ASN A 1 58 ? 7.215   1.784   -9.691  1.00 0.74 ? 58  ASN A HB3  4  
ATOM 5370  H HD21 . ASN A 1 58 ? 7.296   1.587   -6.521  1.00 2.05 ? 58  ASN A HD21 4  
ATOM 5371  H HD22 . ASN A 1 58 ? 6.958   3.220   -6.069  1.00 1.75 ? 58  ASN A HD22 4  
ATOM 5372  N N    . ASN A 1 59 ? 4.055   -0.274  -11.073 1.00 0.60 ? 59  ASN A N    4  
ATOM 5373  C CA   . ASN A 1 59 ? 3.963   -1.328  -12.097 1.00 0.65 ? 59  ASN A CA   4  
ATOM 5374  C C    . ASN A 1 59 ? 4.171   -2.738  -11.526 1.00 0.61 ? 59  ASN A C    4  
ATOM 5375  O O    . ASN A 1 59 ? 3.850   -3.724  -12.194 1.00 0.67 ? 59  ASN A O    4  
ATOM 5376  C CB   . ASN A 1 59 ? 4.954   -1.082  -13.242 1.00 0.71 ? 59  ASN A CB   4  
ATOM 5377  C CG   . ASN A 1 59 ? 4.771   0.282   -13.886 1.00 1.18 ? 59  ASN A CG   4  
ATOM 5378  O OD1  . ASN A 1 59 ? 3.747   0.551   -14.514 1.00 1.74 ? 59  ASN A OD1  4  
ATOM 5379  N ND2  . ASN A 1 59 ? 5.766   1.151   -13.734 1.00 1.52 ? 59  ASN A ND2  4  
ATOM 5380  H H    . ASN A 1 59 ? 3.227   0.099   -10.703 1.00 0.61 ? 59  ASN A H    4  
ATOM 5381  H HA   . ASN A 1 59 ? 2.964   -1.282  -12.504 1.00 0.68 ? 59  ASN A HA   4  
ATOM 5382  H HB2  . ASN A 1 59 ? 5.961   -1.149  -12.862 1.00 0.83 ? 59  ASN A HB2  4  
ATOM 5383  H HB3  . ASN A 1 59 ? 4.811   -1.838  -14.000 1.00 0.74 ? 59  ASN A HB3  4  
ATOM 5384  H HD21 . ASN A 1 59 ? 6.554   0.872   -13.222 1.00 1.74 ? 59  ASN A HD21 4  
ATOM 5385  H HD22 . ASN A 1 59 ? 5.670   2.039   -14.140 1.00 1.84 ? 59  ASN A HD22 4  
ATOM 5386  N N    . VAL A 1 60 ? 4.690   -2.848  -10.298 1.00 0.53 ? 60  VAL A N    4  
ATOM 5387  C CA   . VAL A 1 60 ? 4.907   -4.157  -9.681  1.00 0.52 ? 60  VAL A CA   4  
ATOM 5388  C C    . VAL A 1 60 ? 3.722   -4.537  -8.801  1.00 0.51 ? 60  VAL A C    4  
ATOM 5389  O O    . VAL A 1 60 ? 3.098   -3.673  -8.197  1.00 0.50 ? 60  VAL A O    4  
ATOM 5390  C CB   . VAL A 1 60 ? 6.199   -4.205  -8.827  1.00 0.50 ? 60  VAL A CB   4  
ATOM 5391  C CG1  . VAL A 1 60 ? 7.407   -3.742  -9.630  1.00 0.51 ? 60  VAL A CG1  4  
ATOM 5392  C CG2  . VAL A 1 60 ? 6.058   -3.382  -7.552  1.00 0.54 ? 60  VAL A CG2  4  
ATOM 5393  H H    . VAL A 1 60 ? 4.919   -2.040  -9.796  1.00 0.52 ? 60  VAL A H    4  
ATOM 5394  H HA   . VAL A 1 60 ? 4.999   -4.886  -10.475 1.00 0.56 ? 60  VAL A HA   4  
ATOM 5395  H HB   . VAL A 1 60 ? 6.363   -5.231  -8.540  1.00 0.58 ? 60  VAL A HB   4  
ATOM 5396  H HG11 . VAL A 1 60 ? 8.120   -3.274  -8.968  1.00 1.18 ? 60  VAL A HG11 4  
ATOM 5397  H HG12 . VAL A 1 60 ? 7.092   -3.031  -10.380 1.00 0.93 ? 60  VAL A HG12 4  
ATOM 5398  H HG13 . VAL A 1 60 ? 7.866   -4.593  -10.111 1.00 1.23 ? 60  VAL A HG13 4  
ATOM 5399  H HG21 . VAL A 1 60 ? 6.243   -4.014  -6.697  1.00 0.98 ? 60  VAL A HG21 4  
ATOM 5400  H HG22 . VAL A 1 60 ? 5.059   -2.978  -7.491  1.00 1.15 ? 60  VAL A HG22 4  
ATOM 5401  H HG23 . VAL A 1 60 ? 6.773   -2.574  -7.564  1.00 1.17 ? 60  VAL A HG23 4  
ATOM 5402  N N    . CYS A 1 61 ? 3.418   -5.829  -8.717  1.00 0.53 ? 61  CYS A N    4  
ATOM 5403  C CA   . CYS A 1 61 ? 2.308   -6.287  -7.885  1.00 0.54 ? 61  CYS A CA   4  
ATOM 5404  C C    . CYS A 1 61 ? 2.759   -6.435  -6.436  1.00 0.58 ? 61  CYS A C    4  
ATOM 5405  O O    . CYS A 1 61 ? 3.791   -7.049  -6.158  1.00 0.72 ? 61  CYS A O    4  
ATOM 5406  C CB   . CYS A 1 61 ? 1.739   -7.607  -8.405  1.00 0.56 ? 61  CYS A CB   4  
ATOM 5407  S SG   . CYS A 1 61 ? 2.892   -8.999  -8.334  1.00 0.71 ? 61  CYS A SG   4  
ATOM 5408  H H    . CYS A 1 61 ? 3.955   -6.486  -9.209  1.00 0.55 ? 61  CYS A H    4  
ATOM 5409  H HA   . CYS A 1 61 ? 1.536   -5.533  -7.929  1.00 0.53 ? 61  CYS A HA   4  
ATOM 5410  H HB2  . CYS A 1 61 ? 0.874   -7.868  -7.815  1.00 0.91 ? 61  CYS A HB2  4  
ATOM 5411  H HB3  . CYS A 1 61 ? 1.439   -7.478  -9.433  1.00 0.84 ? 61  CYS A HB3  4  
ATOM 5412  H HG   . CYS A 1 61 ? 2.962   -9.281  -7.419  1.00 1.12 ? 61  CYS A HG   4  
ATOM 5413  N N    . LEU A 1 62 ? 1.979   -5.872  -5.516  1.00 0.55 ? 62  LEU A N    4  
ATOM 5414  C CA   . LEU A 1 62 ? 2.293   -5.945  -4.094  1.00 0.62 ? 62  LEU A CA   4  
ATOM 5415  C C    . LEU A 1 62 ? 1.442   -7.000  -3.373  1.00 0.58 ? 62  LEU A C    4  
ATOM 5416  O O    . LEU A 1 62 ? 1.061   -6.822  -2.208  1.00 0.51 ? 62  LEU A O    4  
ATOM 5417  C CB   . LEU A 1 62 ? 2.130   -4.567  -3.450  1.00 0.77 ? 62  LEU A CB   4  
ATOM 5418  C CG   . LEU A 1 62 ? 3.212   -4.212  -2.429  1.00 0.95 ? 62  LEU A CG   4  
ATOM 5419  C CD1  . LEU A 1 62 ? 4.572   -4.119  -3.104  1.00 1.71 ? 62  LEU A CD1  4  
ATOM 5420  C CD2  . LEU A 1 62 ? 2.880   -2.910  -1.722  1.00 1.08 ? 62  LEU A CD2  4  
ATOM 5421  H H    . LEU A 1 62 ? 1.158   -5.415  -5.793  1.00 0.55 ? 62  LEU A H    4  
ATOM 5422  H HA   . LEU A 1 62 ? 3.329   -6.239  -4.011  1.00 0.72 ? 62  LEU A HA   4  
ATOM 5423  H HB2  . LEU A 1 62 ? 2.146   -3.824  -4.234  1.00 1.26 ? 62  LEU A HB2  4  
ATOM 5424  H HB3  . LEU A 1 62 ? 1.172   -4.528  -2.960  1.00 1.09 ? 62  LEU A HB3  4  
ATOM 5425  H HG   . LEU A 1 62 ? 3.265   -4.993  -1.686  1.00 1.61 ? 62  LEU A HG   4  
ATOM 5426  H HD11 . LEU A 1 62 ? 4.530   -3.388  -3.898  1.00 2.12 ? 62  LEU A HD11 4  
ATOM 5427  H HD12 . LEU A 1 62 ? 4.836   -5.082  -3.517  1.00 2.04 ? 62  LEU A HD12 4  
ATOM 5428  H HD13 . LEU A 1 62 ? 5.314   -3.823  -2.380  1.00 2.37 ? 62  LEU A HD13 4  
ATOM 5429  H HD21 . LEU A 1 62 ? 1.844   -2.919  -1.421  1.00 1.44 ? 62  LEU A HD21 4  
ATOM 5430  H HD22 . LEU A 1 62 ? 3.054   -2.082  -2.392  1.00 1.77 ? 62  LEU A HD22 4  
ATOM 5431  H HD23 . LEU A 1 62 ? 3.508   -2.804  -0.850  1.00 1.57 ? 62  LEU A HD23 4  
ATOM 5432  N N    . GLU A 1 63 ? 1.128   -8.091  -4.077  1.00 0.72 ? 63  GLU A N    4  
ATOM 5433  C CA   . GLU A 1 63 ? 0.317   -9.163  -3.508  1.00 0.80 ? 63  GLU A CA   4  
ATOM 5434  C C    . GLU A 1 63 ? 1.207   -10.302 -2.985  1.00 0.95 ? 63  GLU A C    4  
ATOM 5435  O O    . GLU A 1 63 ? 1.753   -10.191 -1.887  1.00 1.83 ? 63  GLU A O    4  
ATOM 5436  C CB   . GLU A 1 63 ? -0.698  -9.669  -4.541  1.00 0.86 ? 63  GLU A CB   4  
ATOM 5437  C CG   . GLU A 1 63 ? -1.807  -8.670  -4.839  1.00 1.12 ? 63  GLU A CG   4  
ATOM 5438  C CD   . GLU A 1 63 ? -2.515  -8.953  -6.152  1.00 1.31 ? 63  GLU A CD   4  
ATOM 5439  O OE1  . GLU A 1 63 ? -2.028  -8.485  -7.204  1.00 1.96 ? 63  GLU A OE1  4  
ATOM 5440  O OE2  . GLU A 1 63 ? -3.559  -9.640  -6.128  1.00 1.65 ? 63  GLU A OE2  4  
ATOM 5441  H H    . GLU A 1 63 ? 1.431   -8.163  -5.007  1.00 0.83 ? 63  GLU A H    4  
ATOM 5442  H HA   . GLU A 1 63 ? -0.224  -8.746  -2.671  1.00 0.80 ? 63  GLU A HA   4  
ATOM 5443  H HB2  . GLU A 1 63 ? -0.179  -9.887  -5.464  1.00 1.08 ? 63  GLU A HB2  4  
ATOM 5444  H HB3  . GLU A 1 63 ? -1.151  -10.577 -4.171  1.00 1.32 ? 63  GLU A HB3  4  
ATOM 5445  H HG2  . GLU A 1 63 ? -2.533  -8.710  -4.041  1.00 1.64 ? 63  GLU A HG2  4  
ATOM 5446  H HG3  . GLU A 1 63 ? -1.377  -7.680  -4.886  1.00 1.48 ? 63  GLU A HG3  4  
ATOM 5447  N N    . GLU A 1 64 ? 1.306   -11.411 -3.740  1.00 1.04 ? 64  GLU A N    4  
ATOM 5448  C CA   . GLU A 1 64 ? 2.089   -12.591 -3.325  1.00 1.08 ? 64  GLU A CA   4  
ATOM 5449  C C    . GLU A 1 64 ? 3.604   -12.327 -3.183  1.00 0.90 ? 64  GLU A C    4  
ATOM 5450  O O    . GLU A 1 64 ? 4.426   -13.023 -3.785  1.00 0.96 ? 64  GLU A O    4  
ATOM 5451  C CB   . GLU A 1 64 ? 1.848   -13.747 -4.298  1.00 1.28 ? 64  GLU A CB   4  
ATOM 5452  C CG   . GLU A 1 64 ? 2.087   -13.374 -5.747  1.00 1.53 ? 64  GLU A CG   4  
ATOM 5453  C CD   . GLU A 1 64 ? 2.137   -14.580 -6.666  1.00 2.14 ? 64  GLU A CD   4  
ATOM 5454  O OE1  . GLU A 1 64 ? 3.229   -15.168 -6.815  1.00 2.93 ? 64  GLU A OE1  4  
ATOM 5455  O OE2  . GLU A 1 64 ? 1.084   -14.937 -7.236  1.00 2.40 ? 64  GLU A OE2  4  
ATOM 5456  H H    . GLU A 1 64 ? 0.792   -11.466 -4.571  1.00 1.69 ? 64  GLU A H    4  
ATOM 5457  H HA   . GLU A 1 64 ? 1.717   -12.889 -2.364  1.00 1.19 ? 64  GLU A HA   4  
ATOM 5458  H HB2  . GLU A 1 64 ? 2.507   -14.564 -4.044  1.00 1.35 ? 64  GLU A HB2  4  
ATOM 5459  H HB3  . GLU A 1 64 ? 0.824   -14.078 -4.198  1.00 1.23 ? 64  GLU A HB3  4  
ATOM 5460  H HG2  . GLU A 1 64 ? 1.288   -12.726 -6.069  1.00 1.77 ? 64  GLU A HG2  4  
ATOM 5461  H HG3  . GLU A 1 64 ? 3.026   -12.847 -5.812  1.00 1.72 ? 64  GLU A HG3  4  
ATOM 5462  N N    . VAL A 1 65 ? 3.958   -11.340 -2.362  1.00 0.80 ? 65  VAL A N    4  
ATOM 5463  C CA   . VAL A 1 65 ? 5.357   -10.996 -2.102  1.00 0.64 ? 65  VAL A CA   4  
ATOM 5464  C C    . VAL A 1 65 ? 5.597   -10.881 -0.603  1.00 0.64 ? 65  VAL A C    4  
ATOM 5465  O O    . VAL A 1 65 ? 4.681   -10.537 0.145   1.00 0.70 ? 65  VAL A O    4  
ATOM 5466  C CB   . VAL A 1 65 ? 5.771   -9.667  -2.770  1.00 0.56 ? 65  VAL A CB   4  
ATOM 5467  C CG1  . VAL A 1 65 ? 5.841   -9.826  -4.281  1.00 0.64 ? 65  VAL A CG1  4  
ATOM 5468  C CG2  . VAL A 1 65 ? 4.820   -8.540  -2.385  1.00 0.59 ? 65  VAL A CG2  4  
ATOM 5469  H H    . VAL A 1 65 ? 3.251   -10.839 -1.909  1.00 0.90 ? 65  VAL A H    4  
ATOM 5470  H HA   . VAL A 1 65 ? 5.978   -11.787 -2.498  1.00 0.65 ? 65  VAL A HA   4  
ATOM 5471  H HB   . VAL A 1 65 ? 6.759   -9.409  -2.412  1.00 0.50 ? 65  VAL A HB   4  
ATOM 5472  H HG11 . VAL A 1 65 ? 4.848   -9.987  -4.674  1.00 1.20 ? 65  VAL A HG11 4  
ATOM 5473  H HG12 . VAL A 1 65 ? 6.466   -10.672 -4.525  1.00 1.37 ? 65  VAL A HG12 4  
ATOM 5474  H HG13 . VAL A 1 65 ? 6.261   -8.932  -4.719  1.00 0.86 ? 65  VAL A HG13 4  
ATOM 5475  H HG21 . VAL A 1 65 ? 3.810   -8.813  -2.648  1.00 0.99 ? 65  VAL A HG21 4  
ATOM 5476  H HG22 . VAL A 1 65 ? 5.099   -7.639  -2.911  1.00 1.30 ? 65  VAL A HG22 4  
ATOM 5477  H HG23 . VAL A 1 65 ? 4.882   -8.367  -1.319  1.00 1.16 ? 65  VAL A HG23 4  
ATOM 5478  N N    . THR A 1 66 ? 6.828   -11.153 -0.161  1.00 0.63 ? 66  THR A N    4  
ATOM 5479  C CA   . THR A 1 66 ? 7.166   -11.060 1.258   1.00 0.69 ? 66  THR A CA   4  
ATOM 5480  C C    . THR A 1 66 ? 7.073   -9.607  1.730   1.00 0.61 ? 66  THR A C    4  
ATOM 5481  O O    . THR A 1 66 ? 6.596   -8.736  0.993   1.00 0.66 ? 66  THR A O    4  
ATOM 5482  C CB   . THR A 1 66 ? 8.575   -11.621 1.506   1.00 0.74 ? 66  THR A CB   4  
ATOM 5483  O OG1  . THR A 1 66 ? 9.538   -10.923 0.735   1.00 1.53 ? 66  THR A OG1  4  
ATOM 5484  C CG2  . THR A 1 66 ? 8.700   -13.093 1.171   1.00 1.17 ? 66  THR A CG2  4  
ATOM 5485  H H    . THR A 1 66 ? 7.534   -11.412 -0.791  1.00 0.62 ? 66  THR A H    4  
ATOM 5486  H HA   . THR A 1 66 ? 6.450   -11.651 1.809   1.00 0.80 ? 66  THR A HA   4  
ATOM 5487  H HB   . THR A 1 66 ? 8.823   -11.499 2.548   1.00 1.20 ? 66  THR A HB   4  
ATOM 5488  H HG1  . THR A 1 66 ? 9.840   -10.151 1.219   1.00 1.88 ? 66  THR A HG1  4  
ATOM 5489  H HG21 . THR A 1 66 ? 8.295   -13.682 1.982   1.00 1.74 ? 66  THR A HG21 4  
ATOM 5490  H HG22 . THR A 1 66 ? 9.740   -13.343 1.029   1.00 1.61 ? 66  THR A HG22 4  
ATOM 5491  H HG23 . THR A 1 66 ? 8.151   -13.305 0.265   1.00 1.74 ? 66  THR A HG23 4  
ATOM 5492  N N    . HIS A 1 67 ? 7.554   -9.328  2.941   1.00 0.51 ? 67  HIS A N    4  
ATOM 5493  C CA   . HIS A 1 67 ? 7.520   -7.962  3.438   1.00 0.45 ? 67  HIS A CA   4  
ATOM 5494  C C    . HIS A 1 67 ? 8.624   -7.137  2.783   1.00 0.43 ? 67  HIS A C    4  
ATOM 5495  O O    . HIS A 1 67 ? 8.442   -5.949  2.527   1.00 0.41 ? 67  HIS A O    4  
ATOM 5496  C CB   . HIS A 1 67 ? 7.589   -7.891  4.967   1.00 0.45 ? 67  HIS A CB   4  
ATOM 5497  C CG   . HIS A 1 67 ? 7.220   -6.531  5.476   1.00 0.46 ? 67  HIS A CG   4  
ATOM 5498  N ND1  . HIS A 1 67 ? 5.952   -6.222  5.913   1.00 0.51 ? 67  HIS A ND1  4  
ATOM 5499  C CD2  . HIS A 1 67 ? 7.933   -5.379  5.555   1.00 0.49 ? 67  HIS A CD2  4  
ATOM 5500  C CE1  . HIS A 1 67 ? 5.898   -4.943  6.230   1.00 0.54 ? 67  HIS A CE1  4  
ATOM 5501  N NE2  . HIS A 1 67 ? 7.087   -4.410  6.026   1.00 0.52 ? 67  HIS A NE2  4  
ATOM 5502  H H    . HIS A 1 67 ? 7.963   -10.043 3.473   1.00 0.50 ? 67  HIS A H    4  
ATOM 5503  H HA   . HIS A 1 67 ? 6.575   -7.544  3.124   1.00 0.44 ? 67  HIS A HA   4  
ATOM 5504  H HB2  . HIS A 1 67 ? 6.889   -8.599  5.380   1.00 0.46 ? 67  HIS A HB2  4  
ATOM 5505  H HB3  . HIS A 1 67 ? 8.579   -8.132  5.312   1.00 0.44 ? 67  HIS A HB3  4  
ATOM 5506  H HD1  . HIS A 1 67 ? 5.202   -6.848  5.979   1.00 0.56 ? 67  HIS A HD1  4  
ATOM 5507  H HD2  . HIS A 1 67 ? 8.970   -5.243  5.286   1.00 0.54 ? 67  HIS A HD2  4  
ATOM 5508  H HE1  . HIS A 1 67 ? 5.025   -4.417  6.581   1.00 0.61 ? 67  HIS A HE1  4  
ATOM 5509  H HE2  . HIS A 1 67 ? 7.285   -3.452  6.061   1.00 0.56 ? 67  HIS A HE2  4  
ATOM 5510  N N    . GLU A 1 68 ? 9.765   -7.774  2.502   1.00 0.45 ? 68  GLU A N    4  
ATOM 5511  C CA   . GLU A 1 68 ? 10.888  -7.092  1.857   1.00 0.45 ? 68  GLU A CA   4  
ATOM 5512  C C    . GLU A 1 68 ? 10.418  -6.361  0.600   1.00 0.42 ? 68  GLU A C    4  
ATOM 5513  O O    . GLU A 1 68 ? 10.721  -5.184  0.411   1.00 0.41 ? 68  GLU A O    4  
ATOM 5514  C CB   . GLU A 1 68 ? 11.989  -8.092  1.491   1.00 0.49 ? 68  GLU A CB   4  
ATOM 5515  C CG   . GLU A 1 68 ? 12.567  -8.837  2.684   1.00 1.43 ? 68  GLU A CG   4  
ATOM 5516  C CD   . GLU A 1 68 ? 13.029  -10.239 2.329   1.00 2.13 ? 68  GLU A CD   4  
ATOM 5517  O OE1  . GLU A 1 68 ? 12.164  -11.125 2.156   1.00 2.59 ? 68  GLU A OE1  4  
ATOM 5518  O OE2  . GLU A 1 68 ? 14.256  -10.451 2.223   1.00 2.90 ? 68  GLU A OE2  4  
ATOM 5519  H H    . GLU A 1 68 ? 9.859   -8.717  2.741   1.00 0.47 ? 68  GLU A H    4  
ATOM 5520  H HA   . GLU A 1 68 ? 11.286  -6.370  2.555   1.00 0.47 ? 68  GLU A HA   4  
ATOM 5521  H HB2  . GLU A 1 68 ? 11.583  -8.818  0.803   1.00 1.08 ? 68  GLU A HB2  4  
ATOM 5522  H HB3  . GLU A 1 68 ? 12.794  -7.561  1.003   1.00 1.21 ? 68  GLU A HB3  4  
ATOM 5523  H HG2  . GLU A 1 68 ? 13.410  -8.282  3.064   1.00 2.02 ? 68  GLU A HG2  4  
ATOM 5524  H HG3  . GLU A 1 68 ? 11.809  -8.907  3.451   1.00 2.08 ? 68  GLU A HG3  4  
ATOM 5525  N N    . GLU A 1 69 ? 9.654   -7.062  -0.242  1.00 0.44 ? 69  GLU A N    4  
ATOM 5526  C CA   . GLU A 1 69 ? 9.118   -6.472  -1.469  1.00 0.43 ? 69  GLU A CA   4  
ATOM 5527  C C    . GLU A 1 69 ? 8.074   -5.409  -1.133  1.00 0.41 ? 69  GLU A C    4  
ATOM 5528  O O    . GLU A 1 69 ? 7.990   -4.376  -1.799  1.00 0.41 ? 69  GLU A O    4  
ATOM 5529  C CB   . GLU A 1 69 ? 8.495   -7.551  -2.358  1.00 0.46 ? 69  GLU A CB   4  
ATOM 5530  C CG   . GLU A 1 69 ? 9.519   -8.455  -3.032  1.00 0.76 ? 69  GLU A CG   4  
ATOM 5531  C CD   . GLU A 1 69 ? 9.862   -9.674  -2.197  1.00 1.07 ? 69  GLU A CD   4  
ATOM 5532  O OE1  . GLU A 1 69 ? 9.074   -10.645 -2.210  1.00 1.84 ? 69  GLU A OE1  4  
ATOM 5533  O OE2  . GLU A 1 69 ? 10.918  -9.659  -1.531  1.00 1.70 ? 69  GLU A OE2  4  
ATOM 5534  H H    . GLU A 1 69 ? 9.434   -7.993  -0.024  1.00 0.48 ? 69  GLU A H    4  
ATOM 5535  H HA   . GLU A 1 69 ? 9.935   -6.005  -1.999  1.00 0.46 ? 69  GLU A HA   4  
ATOM 5536  H HB2  . GLU A 1 69 ? 7.846   -8.168  -1.753  1.00 0.64 ? 69  GLU A HB2  4  
ATOM 5537  H HB3  . GLU A 1 69 ? 7.907   -7.074  -3.128  1.00 0.63 ? 69  GLU A HB3  4  
ATOM 5538  H HG2  . GLU A 1 69 ? 9.118   -8.785  -3.979  1.00 1.51 ? 69  GLU A HG2  4  
ATOM 5539  H HG3  . GLU A 1 69 ? 10.421  -7.887  -3.203  1.00 1.43 ? 69  GLU A HG3  4  
ATOM 5540  N N    . ALA A 1 70 ? 7.294   -5.668  -0.081  1.00 0.41 ? 70  ALA A N    4  
ATOM 5541  C CA   . ALA A 1 70 ? 6.263   -4.738  0.378   1.00 0.41 ? 70  ALA A CA   4  
ATOM 5542  C C    . ALA A 1 70 ? 6.867   -3.398  0.803   1.00 0.40 ? 70  ALA A C    4  
ATOM 5543  O O    . ALA A 1 70 ? 6.382   -2.332  0.423   1.00 0.42 ? 70  ALA A O    4  
ATOM 5544  C CB   . ALA A 1 70 ? 5.518   -5.349  1.553   1.00 0.44 ? 70  ALA A CB   4  
ATOM 5545  H H    . ALA A 1 70 ? 7.426   -6.505  0.417   1.00 0.44 ? 70  ALA A H    4  
ATOM 5546  H HA   . ALA A 1 70 ? 5.557   -4.578  -0.427  1.00 0.42 ? 70  ALA A HA   4  
ATOM 5547  H HB1  . ALA A 1 70 ? 4.944   -6.198  1.216   1.00 1.00 ? 70  ALA A HB1  4  
ATOM 5548  H HB2  . ALA A 1 70 ? 4.859   -4.611  1.983   1.00 1.28 ? 70  ALA A HB2  4  
ATOM 5549  H HB3  . ALA A 1 70 ? 6.229   -5.671  2.299   1.00 0.98 ? 70  ALA A HB3  4  
ATOM 5550  N N    . VAL A 1 71 ? 7.930   -3.475  1.601   1.00 0.40 ? 71  VAL A N    4  
ATOM 5551  C CA   . VAL A 1 71 ? 8.609   -2.287  2.103   1.00 0.42 ? 71  VAL A CA   4  
ATOM 5552  C C    . VAL A 1 71 ? 9.454   -1.614  1.020   1.00 0.41 ? 71  VAL A C    4  
ATOM 5553  O O    . VAL A 1 71 ? 9.538   -0.388  0.970   1.00 0.42 ? 71  VAL A O    4  
ATOM 5554  C CB   . VAL A 1 71 ? 9.488   -2.632  3.333   1.00 0.48 ? 71  VAL A CB   4  
ATOM 5555  C CG1  . VAL A 1 71 ? 10.893  -3.060  2.923   1.00 0.52 ? 71  VAL A CG1  4  
ATOM 5556  C CG2  . VAL A 1 71 ? 9.546   -1.462  4.299   1.00 0.50 ? 71  VAL A CG2  4  
ATOM 5557  H H    . VAL A 1 71 ? 8.263   -4.362  1.852   1.00 0.41 ? 71  VAL A H    4  
ATOM 5558  H HA   . VAL A 1 71 ? 7.846   -1.590  2.421   1.00 0.43 ? 71  VAL A HA   4  
ATOM 5559  H HB   . VAL A 1 71 ? 9.028   -3.463  3.847   1.00 0.51 ? 71  VAL A HB   4  
ATOM 5560  H HG11 . VAL A 1 71 ? 10.829  -3.883  2.227   1.00 1.18 ? 71  VAL A HG11 4  
ATOM 5561  H HG12 . VAL A 1 71 ? 11.443  -3.372  3.798   1.00 1.21 ? 71  VAL A HG12 4  
ATOM 5562  H HG13 . VAL A 1 71 ? 11.401  -2.230  2.455   1.00 1.02 ? 71  VAL A HG13 4  
ATOM 5563  H HG21 . VAL A 1 71 ? 10.202  -1.708  5.121   1.00 1.07 ? 71  VAL A HG21 4  
ATOM 5564  H HG22 . VAL A 1 71 ? 8.555   -1.262  4.680   1.00 1.12 ? 71  VAL A HG22 4  
ATOM 5565  H HG23 . VAL A 1 71 ? 9.919   -0.587  3.788   1.00 1.00 ? 71  VAL A HG23 4  
ATOM 5566  N N    . THR A 1 72 ? 10.078  -2.420  0.162   1.00 0.43 ? 72  THR A N    4  
ATOM 5567  C CA   . THR A 1 72 ? 10.916  -1.900  -0.911  1.00 0.47 ? 72  THR A CA   4  
ATOM 5568  C C    . THR A 1 72 ? 10.087  -1.157  -1.962  1.00 0.42 ? 72  THR A C    4  
ATOM 5569  O O    . THR A 1 72 ? 10.524  -0.130  -2.480  1.00 0.44 ? 72  THR A O    4  
ATOM 5570  C CB   . THR A 1 72 ? 11.706  -3.038  -1.567  1.00 0.53 ? 72  THR A CB   4  
ATOM 5571  O OG1  . THR A 1 72 ? 12.662  -3.566  -0.665  1.00 0.60 ? 72  THR A OG1  4  
ATOM 5572  C CG2  . THR A 1 72 ? 12.445  -2.614  -2.819  1.00 0.61 ? 72  THR A CG2  4  
ATOM 5573  H H    . THR A 1 72 ? 9.977   -3.389  0.258   1.00 0.46 ? 72  THR A H    4  
ATOM 5574  H HA   . THR A 1 72 ? 11.612  -1.208  -0.468  1.00 0.51 ? 72  THR A HA   4  
ATOM 5575  H HB   . THR A 1 72 ? 11.020  -3.831  -1.836  1.00 0.53 ? 72  THR A HB   4  
ATOM 5576  H HG1  . THR A 1 72 ? 12.286  -4.318  -0.201  1.00 0.98 ? 72  THR A HG1  4  
ATOM 5577  H HG21 . THR A 1 72 ? 13.035  -1.734  -2.608  1.00 1.16 ? 72  THR A HG21 4  
ATOM 5578  H HG22 . THR A 1 72 ? 11.734  -2.392  -3.602  1.00 0.86 ? 72  THR A HG22 4  
ATOM 5579  H HG23 . THR A 1 72 ? 13.097  -3.414  -3.141  1.00 1.27 ? 72  THR A HG23 4  
ATOM 5580  N N    . ALA A 1 73 ? 8.901   -1.682  -2.281  1.00 0.37 ? 73  ALA A N    4  
ATOM 5581  C CA   . ALA A 1 73 ? 8.023   -1.070  -3.278  1.00 0.36 ? 73  ALA A CA   4  
ATOM 5582  C C    . ALA A 1 73 ? 7.520   0.284   -2.805  1.00 0.34 ? 73  ALA A C    4  
ATOM 5583  O O    . ALA A 1 73 ? 7.516   1.251   -3.569  1.00 0.36 ? 73  ALA A O    4  
ATOM 5584  C CB   . ALA A 1 73 ? 6.850   -1.987  -3.592  1.00 0.41 ? 73  ALA A CB   4  
ATOM 5585  H H    . ALA A 1 73 ? 8.602   -2.503  -1.852  1.00 0.37 ? 73  ALA A H    4  
ATOM 5586  H HA   . ALA A 1 73 ? 8.594   -0.934  -4.187  1.00 0.39 ? 73  ALA A HA   4  
ATOM 5587  H HB1  . ALA A 1 73 ? 6.304   -1.599  -4.439  1.00 1.15 ? 73  ALA A HB1  4  
ATOM 5588  H HB2  . ALA A 1 73 ? 6.194   -2.040  -2.735  1.00 1.01 ? 73  ALA A HB2  4  
ATOM 5589  H HB3  . ALA A 1 73 ? 7.217   -2.976  -3.824  1.00 1.08 ? 73  ALA A HB3  4  
ATOM 5590  N N    . LEU A 1 74 ? 7.128   0.360   -1.531  1.00 0.33 ? 74  LEU A N    4  
ATOM 5591  C CA   . LEU A 1 74 ? 6.661   1.617   -0.957  1.00 0.37 ? 74  LEU A CA   4  
ATOM 5592  C C    . LEU A 1 74 ? 7.833   2.580   -0.820  1.00 0.38 ? 74  LEU A C    4  
ATOM 5593  O O    . LEU A 1 74 ? 7.677   3.795   -0.955  1.00 0.44 ? 74  LEU A O    4  
ATOM 5594  C CB   . LEU A 1 74 ? 6.041   1.377   0.422   1.00 0.41 ? 74  LEU A CB   4  
ATOM 5595  C CG   . LEU A 1 74 ? 4.597   0.875   0.427   1.00 0.61 ? 74  LEU A CG   4  
ATOM 5596  C CD1  . LEU A 1 74 ? 3.634   2.002   0.088   1.00 1.73 ? 74  LEU A CD1  4  
ATOM 5597  C CD2  . LEU A 1 74 ? 4.420   -0.289  -0.536  1.00 1.13 ? 74  LEU A CD2  4  
ATOM 5598  H H    . LEU A 1 74 ? 7.182   -0.434  -0.949  1.00 0.33 ? 74  LEU A H    4  
ATOM 5599  H HA   . LEU A 1 74 ? 5.921   2.043   -1.617  1.00 0.42 ? 74  LEU A HA   4  
ATOM 5600  H HB2  . LEU A 1 74 ? 6.650   0.653   0.944   1.00 0.61 ? 74  LEU A HB2  4  
ATOM 5601  H HB3  . LEU A 1 74 ? 6.074   2.307   0.972   1.00 0.47 ? 74  LEU A HB3  4  
ATOM 5602  H HG   . LEU A 1 74 ? 4.361   0.523   1.418   1.00 1.29 ? 74  LEU A HG   4  
ATOM 5603  H HD11 . LEU A 1 74 ? 2.643   1.598   -0.059  1.00 2.20 ? 74  LEU A HD11 4  
ATOM 5604  H HD12 . LEU A 1 74 ? 3.959   2.495   -0.816  1.00 2.34 ? 74  LEU A HD12 4  
ATOM 5605  H HD13 . LEU A 1 74 ? 3.615   2.714   0.899   1.00 2.24 ? 74  LEU A HD13 4  
ATOM 5606  H HD21 . LEU A 1 74 ? 5.332   -0.861  -0.577  1.00 1.57 ? 74  LEU A HD21 4  
ATOM 5607  H HD22 . LEU A 1 74 ? 4.187   0.089   -1.521  1.00 1.72 ? 74  LEU A HD22 4  
ATOM 5608  H HD23 . LEU A 1 74 ? 3.614   -0.920  -0.193  1.00 1.75 ? 74  LEU A HD23 4  
ATOM 5609  N N    . LYS A 1 75 ? 9.009   2.015   -0.542  1.00 0.38 ? 75  LYS A N    4  
ATOM 5610  C CA   . LYS A 1 75 ? 10.232  2.803   -0.371  1.00 0.47 ? 75  LYS A CA   4  
ATOM 5611  C C    . LYS A 1 75 ? 10.791  3.298   -1.712  1.00 0.49 ? 75  LYS A C    4  
ATOM 5612  O O    . LYS A 1 75 ? 11.493  4.310   -1.755  1.00 0.59 ? 75  LYS A O    4  
ATOM 5613  C CB   . LYS A 1 75 ? 11.289  1.968   0.368   1.00 0.57 ? 75  LYS A CB   4  
ATOM 5614  C CG   . LYS A 1 75 ? 12.727  2.317   0.011   1.00 0.64 ? 75  LYS A CG   4  
ATOM 5615  C CD   . LYS A 1 75 ? 13.709  1.750   1.026   1.00 1.05 ? 75  LYS A CD   4  
ATOM 5616  C CE   . LYS A 1 75 ? 13.749  2.588   2.296   1.00 0.88 ? 75  LYS A CE   4  
ATOM 5617  N NZ   . LYS A 1 75 ? 14.400  1.863   3.423   1.00 1.44 ? 75  LYS A NZ   4  
ATOM 5618  H H    . LYS A 1 75 ? 9.056   1.031   -0.441  1.00 0.37 ? 75  LYS A H    4  
ATOM 5619  H HA   . LYS A 1 75 ? 9.985   3.662   0.235   1.00 0.54 ? 75  LYS A HA   4  
ATOM 5620  H HB2  . LYS A 1 75 ? 11.162  2.111   1.431   1.00 0.67 ? 75  LYS A HB2  4  
ATOM 5621  H HB3  . LYS A 1 75 ? 11.130  0.925   0.136   1.00 0.62 ? 75  LYS A HB3  4  
ATOM 5622  H HG2  . LYS A 1 75 ? 12.954  1.908   -0.963  1.00 0.87 ? 75  LYS A HG2  4  
ATOM 5623  H HG3  . LYS A 1 75 ? 12.831  3.392   -0.016  1.00 0.88 ? 75  LYS A HG3  4  
ATOM 5624  H HD2  . LYS A 1 75 ? 13.411  0.744   1.280   1.00 1.90 ? 75  LYS A HD2  4  
ATOM 5625  H HD3  . LYS A 1 75 ? 14.696  1.733   0.585   1.00 1.62 ? 75  LYS A HD3  4  
ATOM 5626  H HE2  . LYS A 1 75 ? 14.302  3.494   2.097   1.00 1.04 ? 75  LYS A HE2  4  
ATOM 5627  H HE3  . LYS A 1 75 ? 12.738  2.840   2.578   1.00 1.51 ? 75  LYS A HE3  4  
ATOM 5628  H HZ1  . LYS A 1 75 ? 13.863  1.002   3.654   1.00 1.72 ? 75  LYS A HZ1  4  
ATOM 5629  H HZ2  . LYS A 1 75 ? 14.436  2.472   4.267   1.00 1.94 ? 75  LYS A HZ2  4  
ATOM 5630  H HZ3  . LYS A 1 75 ? 15.370  1.594   3.164   1.00 1.92 ? 75  LYS A HZ3  4  
ATOM 5631  N N    . ASN A 1 76 ? 10.491  2.580   -2.796  1.00 0.48 ? 76  ASN A N    4  
ATOM 5632  C CA   . ASN A 1 76 ? 10.984  2.947   -4.123  1.00 0.59 ? 76  ASN A CA   4  
ATOM 5633  C C    . ASN A 1 76 ? 10.171  4.094   -4.736  1.00 0.69 ? 76  ASN A C    4  
ATOM 5634  O O    . ASN A 1 76 ? 9.525   3.930   -5.774  1.00 1.15 ? 76  ASN A O    4  
ATOM 5635  C CB   . ASN A 1 76 ? 10.963  1.722   -5.042  1.00 0.64 ? 76  ASN A CB   4  
ATOM 5636  C CG   . ASN A 1 76 ? 11.777  1.927   -6.307  1.00 0.85 ? 76  ASN A CG   4  
ATOM 5637  O OD1  . ASN A 1 76 ? 13.007  1.929   -6.272  1.00 0.90 ? 76  ASN A OD1  4  
ATOM 5638  N ND2  . ASN A 1 76 ? 11.092  2.104   -7.433  1.00 1.55 ? 76  ASN A ND2  4  
ATOM 5639  H H    . ASN A 1 76 ? 9.934   1.779   -2.703  1.00 0.45 ? 76  ASN A H    4  
ATOM 5640  H HA   . ASN A 1 76 ? 12.007  3.275   -4.011  1.00 0.73 ? 76  ASN A HA   4  
ATOM 5641  H HB2  . ASN A 1 76 ? 11.373  0.876   -4.508  1.00 0.71 ? 76  ASN A HB2  4  
ATOM 5642  H HB3  . ASN A 1 76 ? 9.942   1.505   -5.321  1.00 0.75 ? 76  ASN A HB3  4  
ATOM 5643  H HD21 . ASN A 1 76 ? 10.113  2.090   -7.388  1.00 1.95 ? 76  ASN A HD21 4  
ATOM 5644  H HD22 . ASN A 1 76 ? 11.594  2.243   -8.262  1.00 1.75 ? 76  ASN A HD22 4  
ATOM 5645  N N    . THR A 1 77 ? 10.213  5.257   -4.086  1.00 0.90 ? 77  THR A N    4  
ATOM 5646  C CA   . THR A 1 77 ? 9.490   6.436   -4.559  1.00 1.07 ? 77  THR A CA   4  
ATOM 5647  C C    . THR A 1 77 ? 10.456  7.585   -4.852  1.00 0.80 ? 77  THR A C    4  
ATOM 5648  O O    . THR A 1 77 ? 11.128  8.090   -3.951  1.00 1.47 ? 77  THR A O    4  
ATOM 5649  C CB   . THR A 1 77 ? 8.442   6.871   -3.529  1.00 2.00 ? 77  THR A CB   4  
ATOM 5650  O OG1  . THR A 1 77 ? 8.960   6.788   -2.210  1.00 2.60 ? 77  THR A OG1  4  
ATOM 5651  C CG2  . THR A 1 77 ? 7.175   6.042   -3.576  1.00 2.53 ? 77  THR A CG2  4  
ATOM 5652  H H    . THR A 1 77 ? 10.740  5.322   -3.262  1.00 1.26 ? 77  THR A H    4  
ATOM 5653  H HA   . THR A 1 77 ? 8.987   6.166   -5.477  1.00 1.56 ? 77  THR A HA   4  
ATOM 5654  H HB   . THR A 1 77 ? 8.170   7.899   -3.721  1.00 2.59 ? 77  THR A HB   4  
ATOM 5655  H HG1  . THR A 1 77 ? 8.419   7.315   -1.618  1.00 2.91 ? 77  THR A HG1  4  
ATOM 5656  H HG21 . THR A 1 77 ? 7.172   5.440   -4.472  1.00 2.58 ? 77  THR A HG21 4  
ATOM 5657  H HG22 . THR A 1 77 ? 6.316   6.697   -3.581  1.00 3.13 ? 77  THR A HG22 4  
ATOM 5658  H HG23 . THR A 1 77 ? 7.130   5.399   -2.710  1.00 2.95 ? 77  THR A HG23 4  
ATOM 5659  N N    . SER A 1 78 ? 10.516  7.991   -6.123  1.00 1.14 ? 78  SER A N    4  
ATOM 5660  C CA   . SER A 1 78 ? 11.394  9.082   -6.547  1.00 1.74 ? 78  SER A CA   4  
ATOM 5661  C C    . SER A 1 78 ? 10.596  10.372  -6.748  1.00 1.42 ? 78  SER A C    4  
ATOM 5662  O O    . SER A 1 78 ? 10.510  11.198  -5.840  1.00 1.44 ? 78  SER A O    4  
ATOM 5663  C CB   . SER A 1 78 ? 12.139  8.698   -7.831  1.00 2.76 ? 78  SER A CB   4  
ATOM 5664  O OG   . SER A 1 78 ? 13.184  7.781   -7.560  1.00 3.36 ? 78  SER A OG   4  
ATOM 5665  H H    . SER A 1 78 ? 9.950   7.546   -6.787  1.00 1.57 ? 78  SER A H    4  
ATOM 5666  H HA   . SER A 1 78 ? 12.117  9.245   -5.761  1.00 2.08 ? 78  SER A HA   4  
ATOM 5667  H HB2  . SER A 1 78 ? 11.446  8.240   -8.523  1.00 3.05 ? 78  SER A HB2  4  
ATOM 5668  H HB3  . SER A 1 78 ? 12.561  9.585   -8.281  1.00 3.31 ? 78  SER A HB3  4  
ATOM 5669  H HG   . SER A 1 78 ? 12.853  6.883   -7.642  1.00 3.89 ? 78  SER A HG   4  
ATOM 5670  N N    . ASP A 1 79 ? 10.006  10.538  -7.935  1.00 1.32 ? 79  ASP A N    4  
ATOM 5671  C CA   . ASP A 1 79 ? 9.209   11.725  -8.238  1.00 1.18 ? 79  ASP A CA   4  
ATOM 5672  C C    . ASP A 1 79 ? 7.731   11.447  -7.982  1.00 0.99 ? 79  ASP A C    4  
ATOM 5673  O O    . ASP A 1 79 ? 7.074   12.172  -7.234  1.00 0.92 ? 79  ASP A O    4  
ATOM 5674  C CB   . ASP A 1 79 ? 9.424   12.157  -9.692  1.00 1.46 ? 79  ASP A CB   4  
ATOM 5675  C CG   . ASP A 1 79 ? 10.752  12.860  -9.898  1.00 1.61 ? 79  ASP A CG   4  
ATOM 5676  O OD1  . ASP A 1 79 ? 11.777  12.162  -10.057 1.00 2.07 ? 79  ASP A OD1  4  
ATOM 5677  O OD2  . ASP A 1 79 ? 10.769  14.109  -9.900  1.00 2.23 ? 79  ASP A OD2  4  
ATOM 5678  H H    . ASP A 1 79 ? 10.105  9.844   -8.621  1.00 1.49 ? 79  ASP A H    4  
ATOM 5679  H HA   . ASP A 1 79 ? 9.533   12.519  -7.581  1.00 1.15 ? 79  ASP A HA   4  
ATOM 5680  H HB2  . ASP A 1 79 ? 9.398   11.284  -10.327 1.00 2.06 ? 79  ASP A HB2  4  
ATOM 5681  H HB3  . ASP A 1 79 ? 8.630   12.831  -9.982  1.00 1.75 ? 79  ASP A HB3  4  
ATOM 5682  N N    . PHE A 1 80 ? 7.221   10.385  -8.605  1.00 0.97 ? 80  PHE A N    4  
ATOM 5683  C CA   . PHE A 1 80 ? 5.825   9.991   -8.449  1.00 0.85 ? 80  PHE A CA   4  
ATOM 5684  C C    . PHE A 1 80 ? 5.717   8.509   -8.105  1.00 0.82 ? 80  PHE A C    4  
ATOM 5685  O O    . PHE A 1 80 ? 6.680   7.755   -8.265  1.00 0.92 ? 80  PHE A O    4  
ATOM 5686  C CB   . PHE A 1 80 ? 5.043   10.288  -9.730  1.00 0.92 ? 80  PHE A CB   4  
ATOM 5687  C CG   . PHE A 1 80 ? 3.905   11.240  -9.514  1.00 0.94 ? 80  PHE A CG   4  
ATOM 5688  C CD1  . PHE A 1 80 ? 4.119   12.609  -9.527  1.00 1.68 ? 80  PHE A CD1  4  
ATOM 5689  C CD2  . PHE A 1 80 ? 2.625   10.765  -9.285  1.00 1.39 ? 80  PHE A CD2  4  
ATOM 5690  C CE1  . PHE A 1 80 ? 3.075   13.487  -9.314  1.00 1.77 ? 80  PHE A CE1  4  
ATOM 5691  C CE2  . PHE A 1 80 ? 1.578   11.640  -9.073  1.00 1.43 ? 80  PHE A CE2  4  
ATOM 5692  C CZ   . PHE A 1 80 ? 1.804   13.002  -9.086  1.00 1.14 ? 80  PHE A CZ   4  
ATOM 5693  H H    . PHE A 1 80 ? 7.801   9.850   -9.187  1.00 1.09 ? 80  PHE A H    4  
ATOM 5694  H HA   . PHE A 1 80 ? 5.404   10.567  -7.639  1.00 0.81 ? 80  PHE A HA   4  
ATOM 5695  H HB2  . PHE A 1 80 ? 5.710   10.723  -10.460 1.00 1.04 ? 80  PHE A HB2  4  
ATOM 5696  H HB3  . PHE A 1 80 ? 4.639   9.366   -10.122 1.00 0.93 ? 80  PHE A HB3  4  
ATOM 5697  H HD1  . PHE A 1 80 ? 5.114   12.989  -9.706  1.00 2.48 ? 80  PHE A HD1  4  
ATOM 5698  H HD2  . PHE A 1 80 ? 2.446   9.697   -9.275  1.00 2.16 ? 80  PHE A HD2  4  
ATOM 5699  H HE1  . PHE A 1 80 ? 3.255   14.551  -9.326  1.00 2.61 ? 80  PHE A HE1  4  
ATOM 5700  H HE2  . PHE A 1 80 ? 0.585   11.260  -8.895  1.00 2.19 ? 80  PHE A HE2  4  
ATOM 5701  H HZ   . PHE A 1 80 ? 0.987   13.686  -8.917  1.00 1.26 ? 80  PHE A HZ   4  
ATOM 5702  N N    . VAL A 1 81 ? 4.536   8.089   -7.652  1.00 0.75 ? 81  VAL A N    4  
ATOM 5703  C CA   . VAL A 1 81 ? 4.294   6.692   -7.313  1.00 0.77 ? 81  VAL A CA   4  
ATOM 5704  C C    . VAL A 1 81 ? 2.878   6.289   -7.729  1.00 0.65 ? 81  VAL A C    4  
ATOM 5705  O O    . VAL A 1 81 ? 1.900   6.936   -7.338  1.00 0.59 ? 81  VAL A O    4  
ATOM 5706  C CB   . VAL A 1 81 ? 4.505   6.417   -5.805  1.00 0.88 ? 81  VAL A CB   4  
ATOM 5707  C CG1  . VAL A 1 81 ? 3.590   7.282   -4.952  1.00 1.19 ? 81  VAL A CG1  4  
ATOM 5708  C CG2  . VAL A 1 81 ? 4.294   4.941   -5.496  1.00 1.58 ? 81  VAL A CG2  4  
ATOM 5709  H H    . VAL A 1 81 ? 3.786   8.714   -7.570  1.00 0.74 ? 81  VAL A H    4  
ATOM 5710  H HA   . VAL A 1 81 ? 5.002   6.092   -7.870  1.00 0.89 ? 81  VAL A HA   4  
ATOM 5711  H HB   . VAL A 1 81 ? 5.527   6.667   -5.558  1.00 1.14 ? 81  VAL A HB   4  
ATOM 5712  H HG11 . VAL A 1 81 ? 2.563   6.993   -5.119  1.00 1.78 ? 81  VAL A HG11 4  
ATOM 5713  H HG12 . VAL A 1 81 ? 3.721   8.319   -5.221  1.00 1.62 ? 81  VAL A HG12 4  
ATOM 5714  H HG13 . VAL A 1 81 ? 3.836   7.147   -3.909  1.00 1.67 ? 81  VAL A HG13 4  
ATOM 5715  H HG21 . VAL A 1 81 ? 3.237   4.738   -5.408  1.00 1.98 ? 81  VAL A HG21 4  
ATOM 5716  H HG22 . VAL A 1 81 ? 4.786   4.694   -4.567  1.00 2.06 ? 81  VAL A HG22 4  
ATOM 5717  H HG23 . VAL A 1 81 ? 4.710   4.343   -6.293  1.00 2.07 ? 81  VAL A HG23 4  
ATOM 5718  N N    . TYR A 1 82 ? 2.774   5.228   -8.525  1.00 0.72 ? 82  TYR A N    4  
ATOM 5719  C CA   . TYR A 1 82 ? 1.474   4.752   -8.991  1.00 0.69 ? 82  TYR A CA   4  
ATOM 5720  C C    . TYR A 1 82 ? 0.954   3.641   -8.085  1.00 0.67 ? 82  TYR A C    4  
ATOM 5721  O O    . TYR A 1 82 ? 1.368   2.485   -8.189  1.00 0.77 ? 82  TYR A O    4  
ATOM 5722  C CB   . TYR A 1 82 ? 1.581   4.260   -10.432 1.00 0.85 ? 82  TYR A CB   4  
ATOM 5723  C CG   . TYR A 1 82 ? 0.252   3.975   -11.090 1.00 0.93 ? 82  TYR A CG   4  
ATOM 5724  C CD1  . TYR A 1 82 ? -0.339  2.725   -10.976 1.00 1.57 ? 82  TYR A CD1  4  
ATOM 5725  C CD2  . TYR A 1 82 ? -0.404  4.947   -11.836 1.00 1.41 ? 82  TYR A CD2  4  
ATOM 5726  C CE1  . TYR A 1 82 ? -1.544  2.448   -11.584 1.00 1.72 ? 82  TYR A CE1  4  
ATOM 5727  C CE2  . TYR A 1 82 ? -1.613  4.679   -12.446 1.00 1.55 ? 82  TYR A CE2  4  
ATOM 5728  C CZ   . TYR A 1 82 ? -2.179  3.428   -12.317 1.00 1.33 ? 82  TYR A CZ   4  
ATOM 5729  O OH   . TYR A 1 82 ? -3.382  3.149   -12.929 1.00 1.58 ? 82  TYR A OH   4  
ATOM 5730  H H    . TYR A 1 82 ? 3.589   4.758   -8.802  1.00 0.85 ? 82  TYR A H    4  
ATOM 5731  H HA   . TYR A 1 82 ? 0.785   5.583   -8.953  1.00 0.64 ? 82  TYR A HA   4  
ATOM 5732  H HB2  . TYR A 1 82 ? 2.090   5.009   -11.021 1.00 0.88 ? 82  TYR A HB2  4  
ATOM 5733  H HB3  . TYR A 1 82 ? 2.152   3.348   -10.443 1.00 0.99 ? 82  TYR A HB3  4  
ATOM 5734  H HD1  . TYR A 1 82 ? 0.160   1.960   -10.399 1.00 2.27 ? 82  TYR A HD1  4  
ATOM 5735  H HD2  . TYR A 1 82 ? 0.043   5.925   -11.936 1.00 2.08 ? 82  TYR A HD2  4  
ATOM 5736  H HE1  . TYR A 1 82 ? -1.984  1.470   -11.480 1.00 2.47 ? 82  TYR A HE1  4  
ATOM 5737  H HE2  . TYR A 1 82 ? -2.109  5.446   -13.020 1.00 2.24 ? 82  TYR A HE2  4  
ATOM 5738  H HH   . TYR A 1 82 ? -3.929  3.939   -12.941 1.00 1.97 ? 82  TYR A HH   4  
ATOM 5739  N N    . LEU A 1 83 ? 0.071   4.025   -7.172  1.00 0.62 ? 83  LEU A N    4  
ATOM 5740  C CA   . LEU A 1 83 ? -0.497  3.095   -6.200  1.00 0.65 ? 83  LEU A CA   4  
ATOM 5741  C C    . LEU A 1 83 ? -1.726  2.361   -6.739  1.00 0.66 ? 83  LEU A C    4  
ATOM 5742  O O    . LEU A 1 83 ? -2.679  2.980   -7.213  1.00 0.71 ? 83  LEU A O    4  
ATOM 5743  C CB   . LEU A 1 83 ? -0.864  3.849   -4.919  1.00 0.74 ? 83  LEU A CB   4  
ATOM 5744  C CG   . LEU A 1 83 ? -1.233  2.968   -3.724  1.00 0.74 ? 83  LEU A CG   4  
ATOM 5745  C CD1  . LEU A 1 83 ? -0.174  3.074   -2.635  1.00 1.34 ? 83  LEU A CD1  4  
ATOM 5746  C CD2  . LEU A 1 83 ? -2.600  3.355   -3.181  1.00 1.38 ? 83  LEU A CD2  4  
ATOM 5747  H H    . LEU A 1 83 ? -0.171  4.971   -7.124  1.00 0.62 ? 83  LEU A H    4  
ATOM 5748  H HA   . LEU A 1 83 ? 0.263   2.366   -5.963  1.00 0.69 ? 83  LEU A HA   4  
ATOM 5749  H HB2  . LEU A 1 83 ? -0.023  4.467   -4.639  1.00 0.88 ? 83  LEU A HB2  4  
ATOM 5750  H HB3  . LEU A 1 83 ? -1.704  4.493   -5.135  1.00 0.80 ? 83  LEU A HB3  4  
ATOM 5751  H HG   . LEU A 1 83 ? -1.279  1.937   -4.044  1.00 1.48 ? 83  LEU A HG   4  
ATOM 5752  H HD11 . LEU A 1 83 ? -0.461  2.464   -1.791  1.00 1.81 ? 83  LEU A HD11 4  
ATOM 5753  H HD12 . LEU A 1 83 ? -0.084  4.104   -2.321  1.00 1.91 ? 83  LEU A HD12 4  
ATOM 5754  H HD13 . LEU A 1 83 ? 0.775   2.731   -3.022  1.00 1.85 ? 83  LEU A HD13 4  
ATOM 5755  H HD21 . LEU A 1 83 ? -2.562  4.363   -2.794  1.00 1.83 ? 83  LEU A HD21 4  
ATOM 5756  H HD22 . LEU A 1 83 ? -2.879  2.675   -2.388  1.00 2.00 ? 83  LEU A HD22 4  
ATOM 5757  H HD23 . LEU A 1 83 ? -3.331  3.301   -3.974  1.00 1.85 ? 83  LEU A HD23 4  
ATOM 5758  N N    . LYS A 1 84 ? -1.693  1.033   -6.626  1.00 0.66 ? 84  LYS A N    4  
ATOM 5759  C CA   . LYS A 1 84 ? -2.795  0.178   -7.059  1.00 0.68 ? 84  LYS A CA   4  
ATOM 5760  C C    . LYS A 1 84 ? -3.370  -0.553  -5.854  1.00 0.65 ? 84  LYS A C    4  
ATOM 5761  O O    . LYS A 1 84 ? -2.620  -0.979  -4.973  1.00 0.68 ? 84  LYS A O    4  
ATOM 5762  C CB   . LYS A 1 84 ? -2.324  -0.826  -8.112  1.00 0.69 ? 84  LYS A CB   4  
ATOM 5763  C CG   . LYS A 1 84 ? -2.665  -0.419  -9.537  1.00 0.76 ? 84  LYS A CG   4  
ATOM 5764  C CD   . LYS A 1 84 ? -3.958  -1.071  -10.006 1.00 0.99 ? 84  LYS A CD   4  
ATOM 5765  C CE   . LYS A 1 84 ? -4.992  -0.033  -10.419 1.00 1.18 ? 84  LYS A CE   4  
ATOM 5766  N NZ   . LYS A 1 84 ? -4.779  0.449   -11.814 1.00 1.56 ? 84  LYS A NZ   4  
ATOM 5767  H H    . LYS A 1 84 ? -0.906  0.615   -6.218  1.00 0.68 ? 84  LYS A H    4  
ATOM 5768  H HA   . LYS A 1 84 ? -3.558  0.802   -7.482  1.00 0.72 ? 84  LYS A HA   4  
ATOM 5769  H HB2  . LYS A 1 84 ? -1.254  -0.933  -8.039  1.00 0.66 ? 84  LYS A HB2  4  
ATOM 5770  H HB3  . LYS A 1 84 ? -2.785  -1.783  -7.914  1.00 0.73 ? 84  LYS A HB3  4  
ATOM 5771  H HG2  . LYS A 1 84 ? -2.779  0.654   -9.576  1.00 0.93 ? 84  LYS A HG2  4  
ATOM 5772  H HG3  . LYS A 1 84 ? -1.861  -0.723  -10.191 1.00 0.86 ? 84  LYS A HG3  4  
ATOM 5773  H HD2  . LYS A 1 84 ? -3.743  -1.707  -10.851 1.00 1.65 ? 84  LYS A HD2  4  
ATOM 5774  H HD3  . LYS A 1 84 ? -4.363  -1.666  -9.199  1.00 1.42 ? 84  LYS A HD3  4  
ATOM 5775  H HE2  . LYS A 1 84 ? -5.974  -0.475  -10.348 1.00 1.51 ? 84  LYS A HE2  4  
ATOM 5776  H HE3  . LYS A 1 84 ? -4.928  0.808   -9.744  1.00 1.85 ? 84  LYS A HE3  4  
ATOM 5777  H HZ1  . LYS A 1 84 ? -5.667  0.834   -12.198 1.00 2.19 ? 84  LYS A HZ1  4  
ATOM 5778  H HZ2  . LYS A 1 84 ? -4.463  -0.335  -12.421 1.00 1.68 ? 84  LYS A HZ2  4  
ATOM 5779  H HZ3  . LYS A 1 84 ? -4.057  1.196   -11.828 1.00 2.00 ? 84  LYS A HZ3  4  
ATOM 5780  N N    . VAL A 1 85 ? -4.695  -0.690  -5.798  1.00 0.76 ? 85  VAL A N    4  
ATOM 5781  C CA   . VAL A 1 85 ? -5.338  -1.362  -4.674  1.00 0.74 ? 85  VAL A CA   4  
ATOM 5782  C C    . VAL A 1 85 ? -6.400  -2.351  -5.152  1.00 0.91 ? 85  VAL A C    4  
ATOM 5783  O O    . VAL A 1 85 ? -7.138  -2.075  -6.098  1.00 1.17 ? 85  VAL A O    4  
ATOM 5784  C CB   . VAL A 1 85 ? -5.997  -0.342  -3.715  1.00 0.99 ? 85  VAL A CB   4  
ATOM 5785  C CG1  . VAL A 1 85 ? -6.723  -1.049  -2.574  1.00 1.92 ? 85  VAL A CG1  4  
ATOM 5786  C CG2  . VAL A 1 85 ? -4.957  0.631   -3.171  1.00 0.65 ? 85  VAL A CG2  4  
ATOM 5787  H H    . VAL A 1 85 ? -5.263  -0.331  -6.512  1.00 0.92 ? 85  VAL A H    4  
ATOM 5788  H HA   . VAL A 1 85 ? -4.577  -1.898  -4.131  1.00 0.62 ? 85  VAL A HA   4  
ATOM 5789  H HB   . VAL A 1 85 ? -6.725  0.225   -4.275  1.00 1.45 ? 85  VAL A HB   4  
ATOM 5790  H HG11 . VAL A 1 85 ? -6.413  -0.623  -1.630  1.00 2.23 ? 85  VAL A HG11 4  
ATOM 5791  H HG12 . VAL A 1 85 ? -6.478  -2.101  -2.588  1.00 2.51 ? 85  VAL A HG12 4  
ATOM 5792  H HG13 . VAL A 1 85 ? -7.789  -0.925  -2.693  1.00 2.42 ? 85  VAL A HG13 4  
ATOM 5793  H HG21 . VAL A 1 85 ? -5.384  1.198   -2.357  1.00 1.26 ? 85  VAL A HG21 4  
ATOM 5794  H HG22 . VAL A 1 85 ? -4.651  1.306   -3.957  1.00 1.21 ? 85  VAL A HG22 4  
ATOM 5795  H HG23 . VAL A 1 85 ? -4.098  0.081   -2.815  1.00 1.21 ? 85  VAL A HG23 4  
ATOM 5796  N N    . ALA A 1 86 ? -6.478  -3.500  -4.480  1.00 0.91 ? 86  ALA A N    4  
ATOM 5797  C CA   . ALA A 1 86 ? -7.459  -4.524  -4.824  1.00 1.24 ? 86  ALA A CA   4  
ATOM 5798  C C    . ALA A 1 86 ? -8.769  -4.287  -4.075  1.00 1.27 ? 86  ALA A C    4  
ATOM 5799  O O    . ALA A 1 86 ? -8.761  -3.952  -2.890  1.00 1.09 ? 86  ALA A O    4  
ATOM 5800  C CB   . ALA A 1 86 ? -6.910  -5.910  -4.518  1.00 1.46 ? 86  ALA A CB   4  
ATOM 5801  H H    . ALA A 1 86 ? -5.868  -3.657  -3.729  1.00 0.76 ? 86  ALA A H    4  
ATOM 5802  H HA   . ALA A 1 86 ? -7.647  -4.462  -5.887  1.00 1.52 ? 86  ALA A HA   4  
ATOM 5803  H HB1  . ALA A 1 86 ? -7.303  -6.619  -5.232  1.00 1.81 ? 86  ALA A HB1  4  
ATOM 5804  H HB2  . ALA A 1 86 ? -7.206  -6.204  -3.521  1.00 2.07 ? 86  ALA A HB2  4  
ATOM 5805  H HB3  . ALA A 1 86 ? -5.832  -5.895  -4.583  1.00 1.62 ? 86  ALA A HB3  4  
ATOM 5806  N N    . LYS A 1 87 ? -9.891  -4.458  -4.773  1.00 1.68 ? 87  LYS A N    4  
ATOM 5807  C CA   . LYS A 1 87 ? -11.205 -4.258  -4.167  1.00 1.86 ? 87  LYS A CA   4  
ATOM 5808  C C    . LYS A 1 87 ? -11.774 -5.577  -3.644  1.00 1.91 ? 87  LYS A C    4  
ATOM 5809  O O    . LYS A 1 87 ? -12.065 -6.488  -4.422  1.00 2.04 ? 87  LYS A O    4  
ATOM 5810  C CB   . LYS A 1 87 ? -12.171 -3.630  -5.175  1.00 2.22 ? 87  LYS A CB   4  
ATOM 5811  C CG   . LYS A 1 87 ? -12.142 -2.108  -5.178  1.00 2.53 ? 87  LYS A CG   4  
ATOM 5812  C CD   . LYS A 1 87 ? -13.389 -1.522  -5.822  1.00 2.89 ? 87  LYS A CD   4  
ATOM 5813  C CE   . LYS A 1 87 ? -13.120 -1.059  -7.246  1.00 3.28 ? 87  LYS A CE   4  
ATOM 5814  N NZ   . LYS A 1 87 ? -13.364 -2.141  -8.241  1.00 4.20 ? 87  LYS A NZ   4  
ATOM 5815  H H    . LYS A 1 87 ? -9.833  -4.722  -5.716  1.00 1.92 ? 87  LYS A H    4  
ATOM 5816  H HA   . LYS A 1 87 ? -11.081 -3.580  -3.335  1.00 1.79 ? 87  LYS A HA   4  
ATOM 5817  H HB2  . LYS A 1 87 ? -11.916 -3.975  -6.166  1.00 2.44 ? 87  LYS A HB2  4  
ATOM 5818  H HB3  . LYS A 1 87 ? -13.176 -3.949  -4.941  1.00 2.56 ? 87  LYS A HB3  4  
ATOM 5819  H HG2  . LYS A 1 87 ? -12.080 -1.758  -4.158  1.00 2.95 ? 87  LYS A HG2  4  
ATOM 5820  H HG3  . LYS A 1 87 ? -11.273 -1.776  -5.727  1.00 2.69 ? 87  LYS A HG3  4  
ATOM 5821  H HD2  . LYS A 1 87 ? -14.163 -2.276  -5.841  1.00 3.05 ? 87  LYS A HD2  4  
ATOM 5822  H HD3  . LYS A 1 87 ? -13.723 -0.678  -5.236  1.00 3.28 ? 87  LYS A HD3  4  
ATOM 5823  H HE2  . LYS A 1 87 ? -13.770 -0.226  -7.469  1.00 3.46 ? 87  LYS A HE2  4  
ATOM 5824  H HE3  . LYS A 1 87 ? -12.090 -0.739  -7.319  1.00 3.29 ? 87  LYS A HE3  4  
ATOM 5825  H HZ1  . LYS A 1 87 ? -13.171 -1.792  -9.202  1.00 4.41 ? 87  LYS A HZ1  4  
ATOM 5826  H HZ2  . LYS A 1 87 ? -14.354 -2.457  -8.190  1.00 4.48 ? 87  LYS A HZ2  4  
ATOM 5827  H HZ3  . LYS A 1 87 ? -12.742 -2.952  -8.048  1.00 4.70 ? 87  LYS A HZ3  4  
ATOM 5828  N N    . PRO A 1 88 ? -11.934 -5.697  -2.310  1.00 1.88 ? 88  PRO A N    4  
ATOM 5829  C CA   . PRO A 1 88 ? -12.468 -6.911  -1.679  1.00 2.01 ? 88  PRO A CA   4  
ATOM 5830  C C    . PRO A 1 88 ? -13.964 -7.100  -1.939  1.00 2.20 ? 88  PRO A C    4  
ATOM 5831  O O    . PRO A 1 88 ? -14.725 -6.131  -1.963  1.00 2.28 ? 88  PRO A O    4  
ATOM 5832  C CB   . PRO A 1 88 ? -12.208 -6.681  -0.189  1.00 1.98 ? 88  PRO A CB   4  
ATOM 5833  C CG   . PRO A 1 88 ? -12.172 -5.201  -0.032  1.00 1.91 ? 88  PRO A CG   4  
ATOM 5834  C CD   . PRO A 1 88 ? -11.607 -4.656  -1.315  1.00 1.79 ? 88  PRO A CD   4  
ATOM 5835  H HA   . PRO A 1 88 ? -11.933 -7.790  -2.008  1.00 2.04 ? 88  PRO A HA   4  
ATOM 5836  H HB2  . PRO A 1 88 ? -13.006 -7.122  0.391   1.00 2.18 ? 88  PRO A HB2  4  
ATOM 5837  H HB3  . PRO A 1 88 ? -11.265 -7.129  0.087   1.00 1.96 ? 88  PRO A HB3  4  
ATOM 5838  H HG2  . PRO A 1 88 ? -13.172 -4.825  0.125   1.00 2.24 ? 88  PRO A HG2  4  
ATOM 5839  H HG3  . PRO A 1 88 ? -11.536 -4.935  0.799   1.00 1.85 ? 88  PRO A HG3  4  
ATOM 5840  H HD2  . PRO A 1 88 ? -12.082 -3.719  -1.568  1.00 1.89 ? 88  PRO A HD2  4  
ATOM 5841  H HD3  . PRO A 1 88 ? -10.538 -4.527  -1.231  1.00 1.68 ? 88  PRO A HD3  4  
ATOM 5842  N N    . THR A 1 89 ? -14.378 -8.356  -2.126  1.00 2.38 ? 89  THR A N    4  
ATOM 5843  C CA   . THR A 1 89 ? -15.782 -8.677  -2.378  1.00 2.59 ? 89  THR A CA   4  
ATOM 5844  C C    . THR A 1 89 ? -16.180 -9.961  -1.648  1.00 2.77 ? 89  THR A C    4  
ATOM 5845  O O    . THR A 1 89 ? -17.048 -9.942  -0.774  1.00 3.51 ? 89  THR A O    4  
ATOM 5846  C CB   . THR A 1 89 ? -16.044 -8.819  -3.885  1.00 3.08 ? 89  THR A CB   4  
ATOM 5847  O OG1  . THR A 1 89 ? -15.239 -7.916  -4.627  1.00 3.51 ? 89  THR A OG1  4  
ATOM 5848  C CG2  . THR A 1 89 ? -17.488 -8.563  -4.268  1.00 3.88 ? 89  THR A CG2  4  
ATOM 5849  H H    . THR A 1 89 ? -13.725 -9.086  -2.089  1.00 2.41 ? 89  THR A H    4  
ATOM 5850  H HA   . THR A 1 89 ? -16.380 -7.864  -1.993  1.00 2.82 ? 89  THR A HA   4  
ATOM 5851  H HB   . THR A 1 89 ? -15.794 -9.825  -4.190  1.00 3.20 ? 89  THR A HB   4  
ATOM 5852  H HG1  . THR A 1 89 ? -14.422 -8.352  -4.883  1.00 3.87 ? 89  THR A HG1  4  
ATOM 5853  H HG21 . THR A 1 89 ? -17.542 -8.300  -5.316  1.00 4.03 ? 89  THR A HG21 4  
ATOM 5854  H HG22 . THR A 1 89 ? -17.881 -7.751  -3.674  1.00 4.36 ? 89  THR A HG22 4  
ATOM 5855  H HG23 . THR A 1 89 ? -18.071 -9.454  -4.090  1.00 4.30 ? 89  THR A HG23 4  
ATOM 5856  N N    . GLY A 1 90 ? -15.537 -11.074 -2.012  1.00 2.75 ? 90  GLY A N    4  
ATOM 5857  C CA   . GLY A 1 90 ? -15.835 -12.349 -1.381  1.00 3.54 ? 90  GLY A CA   4  
ATOM 5858  C C    . GLY A 1 90 ? -15.582 -13.526 -2.304  1.00 4.20 ? 90  GLY A C    4  
ATOM 5859  O O    . GLY A 1 90 ? -16.336 -13.748 -3.253  1.00 4.69 ? 90  GLY A O    4  
ATOM 5860  H H    . GLY A 1 90 ? -14.857 -11.027 -2.715  1.00 2.65 ? 90  GLY A H    4  
ATOM 5861  H HA2  . GLY A 1 90 ? -15.215 -12.455 -0.502  1.00 3.91 ? 90  GLY A HA2  4  
ATOM 5862  H HA3  . GLY A 1 90 ? -16.872 -12.357 -1.079  1.00 3.79 ? 90  GLY A HA3  4  
ATOM 5863  N N    . SER A 1 91 ? -14.517 -14.277 -2.024  1.00 4.69 ? 91  SER A N    4  
ATOM 5864  C CA   . SER A 1 91 ? -14.154 -15.441 -2.836  1.00 5.64 ? 91  SER A CA   4  
ATOM 5865  C C    . SER A 1 91 ? -15.223 -16.536 -2.770  1.00 5.73 ? 91  SER A C    4  
ATOM 5866  O O    . SER A 1 91 ? -15.460 -17.235 -3.757  1.00 6.47 ? 91  SER A O    4  
ATOM 5867  C CB   . SER A 1 91 ? -12.801 -16.003 -2.386  1.00 6.57 ? 91  SER A CB   4  
ATOM 5868  O OG   . SER A 1 91 ? -12.811 -16.327 -1.004  1.00 7.06 ? 91  SER A OG   4  
ATOM 5869  H H    . SER A 1 91 ? -13.957 -14.042 -1.253  1.00 4.66 ? 91  SER A H    4  
ATOM 5870  H HA   . SER A 1 91 ? -14.067 -15.110 -3.859  1.00 5.94 ? 91  SER A HA   4  
ATOM 5871  H HB2  . SER A 1 91 ? -12.579 -16.897 -2.949  1.00 6.78 ? 91  SER A HB2  4  
ATOM 5872  H HB3  . SER A 1 91 ? -12.032 -15.266 -2.564  1.00 6.97 ? 91  SER A HB3  4  
ATOM 5873  H HG   . SER A 1 91 ? -13.077 -17.242 -0.892  1.00 7.36 ? 91  SER A HG   4  
ATOM 5874  N N    . HIS A 1 92 ? -15.863 -16.684 -1.605  1.00 5.26 ? 92  HIS A N    4  
ATOM 5875  C CA   . HIS A 1 92 ? -16.905 -17.697 -1.417  1.00 5.60 ? 92  HIS A CA   4  
ATOM 5876  C C    . HIS A 1 92 ? -18.046 -17.510 -2.415  1.00 5.37 ? 92  HIS A C    4  
ATOM 5877  O O    . HIS A 1 92 ? -18.374 -18.422 -3.175  1.00 5.46 ? 92  HIS A O    4  
ATOM 5878  C CB   . HIS A 1 92 ? -17.451 -17.647 0.016   1.00 5.86 ? 92  HIS A CB   4  
ATOM 5879  C CG   . HIS A 1 92 ? -18.089 -16.338 0.378   1.00 6.59 ? 92  HIS A CG   4  
ATOM 5880  N ND1  . HIS A 1 92 ? -17.369 -15.248 0.820   1.00 7.09 ? 92  HIS A ND1  4  
ATOM 5881  C CD2  . HIS A 1 92 ? -19.387 -15.949 0.361   1.00 7.14 ? 92  HIS A CD2  4  
ATOM 5882  C CE1  . HIS A 1 92 ? -18.196 -14.245 1.060   1.00 7.83 ? 92  HIS A CE1  4  
ATOM 5883  N NE2  . HIS A 1 92 ? -19.424 -14.645 0.789   1.00 7.84 ? 92  HIS A NE2  4  
ATOM 5884  H H    . HIS A 1 92 ? -15.627 -16.098 -0.856  1.00 4.89 ? 92  HIS A H    4  
ATOM 5885  H HA   . HIS A 1 92 ? -16.456 -18.664 -1.584  1.00 6.24 ? 92  HIS A HA   4  
ATOM 5886  H HB2  . HIS A 1 92 ? -18.194 -18.421 0.138   1.00 5.88 ? 92  HIS A HB2  4  
ATOM 5887  H HB3  . HIS A 1 92 ? -16.640 -17.824 0.707   1.00 5.88 ? 92  HIS A HB3  4  
ATOM 5888  H HD1  . HIS A 1 92 ? -16.398 -15.214 0.941   1.00 7.08 ? 92  HIS A HD1  4  
ATOM 5889  H HD2  . HIS A 1 92 ? -20.234 -16.551 0.065   1.00 7.21 ? 92  HIS A HD2  4  
ATOM 5890  H HE1  . HIS A 1 92 ? -17.914 -13.265 1.416   1.00 8.46 ? 92  HIS A HE1  4  
ATOM 5891  H HE2  . HIS A 1 92 ? -20.235 -14.110 0.916   1.00 8.38 ? 92  HIS A HE2  4  
ATOM 5892  N N    . ARG B 2 1  ? 3.371   -11.606 11.841  1.00 1.88 ? 301 ARG B N    4  
ATOM 5893  C CA   . ARG B 2 1  ? 2.804   -10.498 11.021  1.00 1.27 ? 301 ARG B CA   4  
ATOM 5894  C C    . ARG B 2 1  ? 3.604   -9.205  11.202  1.00 1.29 ? 301 ARG B C    4  
ATOM 5895  O O    . ARG B 2 1  ? 3.099   -8.214  11.735  1.00 2.06 ? 301 ARG B O    4  
ATOM 5896  C CB   . ARG B 2 1  ? 1.334   -10.287 11.416  1.00 1.61 ? 301 ARG B CB   4  
ATOM 5897  C CG   . ARG B 2 1  ? 1.115   -10.067 12.906  1.00 2.13 ? 301 ARG B CG   4  
ATOM 5898  C CD   . ARG B 2 1  ? 0.369   -11.232 13.543  1.00 2.72 ? 301 ARG B CD   4  
ATOM 5899  N NE   . ARG B 2 1  ? -0.579  -10.785 14.564  1.00 3.09 ? 301 ARG B NE   4  
ATOM 5900  C CZ   . ARG B 2 1  ? -1.791  -10.286 14.300  1.00 3.70 ? 301 ARG B CZ   4  
ATOM 5901  N NH1  . ARG B 2 1  ? -2.214  -10.161 13.044  1.00 4.18 ? 301 ARG B NH1  4  
ATOM 5902  N NH2  . ARG B 2 1  ? -2.584  -9.910  15.298  1.00 4.22 ? 301 ARG B NH2  4  
ATOM 5903  H H1   . ARG B 2 1  ? 4.258   -11.909 11.391  1.00 2.43 ? 301 ARG B H1   4  
ATOM 5904  H H2   . ARG B 2 1  ? 2.675   -12.380 11.853  1.00 1.96 ? 301 ARG B H2   4  
ATOM 5905  H H3   . ARG B 2 1  ? 3.544   -11.240 12.798  1.00 2.41 ? 301 ARG B H3   4  
ATOM 5906  H HA   . ARG B 2 1  ? 2.849   -10.791 9.983   1.00 1.25 ? 301 ARG B HA   4  
ATOM 5907  H HB2  . ARG B 2 1  ? 0.957   -9.421  10.892  1.00 1.79 ? 301 ARG B HB2  4  
ATOM 5908  H HB3  . ARG B 2 1  ? 0.766   -11.153 11.114  1.00 2.19 ? 301 ARG B HB3  4  
ATOM 5909  H HG2  . ARG B 2 1  ? 2.075   -9.962  13.388  1.00 2.63 ? 301 ARG B HG2  4  
ATOM 5910  H HG3  . ARG B 2 1  ? 0.541   -9.163  13.045  1.00 2.48 ? 301 ARG B HG3  4  
ATOM 5911  H HD2  . ARG B 2 1  ? -0.169  -11.763 12.772  1.00 3.13 ? 301 ARG B HD2  4  
ATOM 5912  H HD3  . ARG B 2 1  ? 1.089   -11.894 13.999  1.00 3.11 ? 301 ARG B HD3  4  
ATOM 5913  H HE   . ARG B 2 1  ? -0.299  -10.863 15.501  1.00 3.22 ? 301 ARG B HE   4  
ATOM 5914  H HH11 . ARG B 2 1  ? -1.627  -10.441 12.285  1.00 4.11 ? 301 ARG B HH11 4  
ATOM 5915  H HH12 . ARG B 2 1  ? -3.123  -9.787  12.857  1.00 4.83 ? 301 ARG B HH12 4  
ATOM 5916  H HH21 . ARG B 2 1  ? -2.274  -10.000 16.245  1.00 4.29 ? 301 ARG B HH21 4  
ATOM 5917  H HH22 . ARG B 2 1  ? -3.491  -9.536  15.104  1.00 4.75 ? 301 ARG B HH22 4  
ATOM 5918  N N    . ARG B 2 2  ? 4.862   -9.226  10.754  1.00 1.12 ? 302 ARG B N    4  
ATOM 5919  C CA   . ARG B 2 2  ? 5.740   -8.063  10.861  1.00 1.03 ? 302 ARG B CA   4  
ATOM 5920  C C    . ARG B 2 2  ? 5.191   -6.882  10.060  1.00 1.02 ? 302 ARG B C    4  
ATOM 5921  O O    . ARG B 2 2  ? 4.968   -6.986  8.850   1.00 1.45 ? 302 ARG B O    4  
ATOM 5922  C CB   . ARG B 2 2  ? 7.156   -8.420  10.385  1.00 1.13 ? 302 ARG B CB   4  
ATOM 5923  C CG   . ARG B 2 2  ? 8.013   -7.217  10.009  1.00 1.12 ? 302 ARG B CG   4  
ATOM 5924  C CD   . ARG B 2 2  ? 8.240   -6.289  11.194  1.00 1.50 ? 302 ARG B CD   4  
ATOM 5925  N NE   . ARG B 2 2  ? 9.303   -6.772  12.074  1.00 2.09 ? 302 ARG B NE   4  
ATOM 5926  C CZ   . ARG B 2 2  ? 10.605  -6.547  11.870  1.00 2.72 ? 302 ARG B CZ   4  
ATOM 5927  N NH1  . ARG B 2 2  ? 11.013  -5.843  10.818  1.00 2.99 ? 302 ARG B NH1  4  
ATOM 5928  N NH2  . ARG B 2 2  ? 11.501  -7.028  12.726  1.00 3.57 ? 302 ARG B NH2  4  
ATOM 5929  H H    . ARG B 2 2  ? 5.208   -10.044 10.343  1.00 1.61 ? 302 ARG B H    4  
ATOM 5930  H HA   . ARG B 2 2  ? 5.784   -7.782  11.903  1.00 1.03 ? 302 ARG B HA   4  
ATOM 5931  H HB2  . ARG B 2 2  ? 7.661   -8.958  11.173  1.00 1.20 ? 302 ARG B HB2  4  
ATOM 5932  H HB3  . ARG B 2 2  ? 7.079   -9.062  9.520   1.00 1.34 ? 302 ARG B HB3  4  
ATOM 5933  H HG2  . ARG B 2 2  ? 8.971   -7.569  9.654   1.00 1.33 ? 302 ARG B HG2  4  
ATOM 5934  H HG3  . ARG B 2 2  ? 7.519   -6.667  9.222   1.00 1.30 ? 302 ARG B HG3  4  
ATOM 5935  H HD2  . ARG B 2 2  ? 8.508   -5.311  10.821  1.00 1.82 ? 302 ARG B HD2  4  
ATOM 5936  H HD3  . ARG B 2 2  ? 7.323   -6.217  11.759  1.00 1.86 ? 302 ARG B HD3  4  
ATOM 5937  H HE   . ARG B 2 2  ? 9.035   -7.293  12.860  1.00 2.48 ? 302 ARG B HE   4  
ATOM 5938  H HH11 . ARG B 2 2  ? 10.347  -5.477  10.168  1.00 2.71 ? 302 ARG B HH11 4  
ATOM 5939  H HH12 . ARG B 2 2  ? 11.989  -5.680  10.673  1.00 3.75 ? 302 ARG B HH12 4  
ATOM 5940  H HH21 . ARG B 2 2  ? 11.202  -7.557  13.520  1.00 3.78 ? 302 ARG B HH21 4  
ATOM 5941  H HH22 . ARG B 2 2  ? 12.476  -6.862  12.577  1.00 4.18 ? 302 ARG B HH22 4  
ATOM 5942  N N    . GLU B 2 3  ? 4.983   -5.762  10.748  1.00 0.69 ? 303 GLU B N    4  
ATOM 5943  C CA   . GLU B 2 3  ? 4.469   -4.550  10.122  1.00 0.66 ? 303 GLU B CA   4  
ATOM 5944  C C    . GLU B 2 3  ? 5.482   -3.415  10.266  1.00 0.71 ? 303 GLU B C    4  
ATOM 5945  O O    . GLU B 2 3  ? 5.722   -2.922  11.370  1.00 1.16 ? 303 GLU B O    4  
ATOM 5946  C CB   . GLU B 2 3  ? 3.131   -4.158  10.750  1.00 0.71 ? 303 GLU B CB   4  
ATOM 5947  C CG   . GLU B 2 3  ? 2.042   -5.202  10.547  1.00 1.12 ? 303 GLU B CG   4  
ATOM 5948  C CD   . GLU B 2 3  ? 1.016   -5.204  11.664  1.00 1.54 ? 303 GLU B CD   4  
ATOM 5949  O OE1  . GLU B 2 3  ? 0.028   -4.448  11.564  1.00 2.08 ? 303 GLU B OE1  4  
ATOM 5950  O OE2  . GLU B 2 3  ? 1.200   -5.965  12.637  1.00 1.99 ? 303 GLU B OE2  4  
ATOM 5951  H H    . GLU B 2 3  ? 5.187   -5.749  11.707  1.00 0.73 ? 303 GLU B H    4  
ATOM 5952  H HA   . GLU B 2 3  ? 4.322   -4.753  9.071   1.00 0.62 ? 303 GLU B HA   4  
ATOM 5953  H HB2  . GLU B 2 3  ? 3.272   -4.016  11.811  1.00 1.19 ? 303 GLU B HB2  4  
ATOM 5954  H HB3  . GLU B 2 3  ? 2.797   -3.230  10.312  1.00 0.81 ? 303 GLU B HB3  4  
ATOM 5955  H HG2  . GLU B 2 3  ? 1.537   -5.000  9.616   1.00 1.28 ? 303 GLU B HG2  4  
ATOM 5956  H HG3  . GLU B 2 3  ? 2.503   -6.177  10.499  1.00 1.65 ? 303 GLU B HG3  4  
ATOM 5957  N N    . THR B 2 4  ? 6.089   -3.025  9.145   1.00 0.55 ? 304 THR B N    4  
ATOM 5958  C CA   . THR B 2 4  ? 7.097   -1.967  9.141   1.00 0.55 ? 304 THR B CA   4  
ATOM 5959  C C    . THR B 2 4  ? 6.562   -0.679  8.512   1.00 0.53 ? 304 THR B C    4  
ATOM 5960  O O    . THR B 2 4  ? 5.662   -0.710  7.670   1.00 0.54 ? 304 THR B O    4  
ATOM 5961  C CB   . THR B 2 4  ? 8.352   -2.456  8.401   1.00 0.55 ? 304 THR B CB   4  
ATOM 5962  O OG1  . THR B 2 4  ? 9.366   -2.823  9.321   1.00 0.65 ? 304 THR B OG1  4  
ATOM 5963  C CG2  . THR B 2 4  ? 8.949   -1.441  7.446   1.00 0.56 ? 304 THR B CG2  4  
ATOM 5964  H H    . THR B 2 4  ? 5.864   -3.470  8.303   1.00 0.76 ? 304 THR B H    4  
ATOM 5965  H HA   . THR B 2 4  ? 7.357   -1.765  10.167  1.00 0.59 ? 304 THR B HA   4  
ATOM 5966  H HB   . THR B 2 4  ? 8.092   -3.331  7.824   1.00 0.56 ? 304 THR B HB   4  
ATOM 5967  H HG1  . THR B 2 4  ? 9.561   -2.081  9.899   1.00 0.96 ? 304 THR B HG1  4  
ATOM 5968  H HG21 . THR B 2 4  ? 9.841   -1.851  6.997   1.00 1.05 ? 304 THR B HG21 4  
ATOM 5969  H HG22 . THR B 2 4  ? 9.198   -0.540  7.986   1.00 1.13 ? 304 THR B HG22 4  
ATOM 5970  H HG23 . THR B 2 4  ? 8.230   -1.211  6.673   1.00 1.23 ? 304 THR B HG23 4  
ATOM 5971  N N    . GLN B 2 5  ? 7.138   0.454   8.924   1.00 0.58 ? 305 GLN B N    4  
ATOM 5972  C CA   . GLN B 2 5  ? 6.740   1.760   8.402   1.00 0.60 ? 305 GLN B CA   4  
ATOM 5973  C C    . GLN B 2 5  ? 7.479   2.077   7.103   1.00 0.58 ? 305 GLN B C    4  
ATOM 5974  O O    . GLN B 2 5  ? 8.599   1.612   6.886   1.00 0.74 ? 305 GLN B O    4  
ATOM 5975  C CB   . GLN B 2 5  ? 7.012   2.856   9.436   1.00 0.76 ? 305 GLN B CB   4  
ATOM 5976  C CG   . GLN B 2 5  ? 6.013   2.869   10.582  1.00 0.89 ? 305 GLN B CG   4  
ATOM 5977  C CD   . GLN B 2 5  ? 6.580   3.488   11.846  1.00 1.13 ? 305 GLN B CD   4  
ATOM 5978  O OE1  . GLN B 2 5  ? 7.607   3.045   12.361  1.00 1.67 ? 305 GLN B OE1  4  
ATOM 5979  N NE2  . GLN B 2 5  ? 5.912   4.519   12.354  1.00 1.50 ? 305 GLN B NE2  4  
ATOM 5980  H H    . GLN B 2 5  ? 7.856   0.408   9.590   1.00 0.64 ? 305 GLN B H    4  
ATOM 5981  H HA   . GLN B 2 5  ? 5.682   1.724   8.200   1.00 0.57 ? 305 GLN B HA   4  
ATOM 5982  H HB2  . GLN B 2 5  ? 8.000   2.710   9.847   1.00 0.76 ? 305 GLN B HB2  4  
ATOM 5983  H HB3  . GLN B 2 5  ? 6.974   3.816   8.943   1.00 0.88 ? 305 GLN B HB3  4  
ATOM 5984  H HG2  . GLN B 2 5  ? 5.146   3.438   10.279  1.00 0.96 ? 305 GLN B HG2  4  
ATOM 5985  H HG3  . GLN B 2 5  ? 5.717   1.852   10.796  1.00 0.87 ? 305 GLN B HG3  4  
ATOM 5986  H HE21 . GLN B 2 5  ? 5.101   4.820   11.893  1.00 1.97 ? 305 GLN B HE21 4  
ATOM 5987  H HE22 . GLN B 2 5  ? 6.259   4.938   13.169  1.00 1.62 ? 305 GLN B HE22 4  
ATOM 5988  N N    . VAL B 2 6  ? 6.840   2.868   6.242   1.00 0.58 ? 306 VAL B N    4  
ATOM 5989  C CA   . VAL B 2 6  ? 7.429   3.246   4.957   1.00 0.63 ? 306 VAL B CA   4  
ATOM 5990  C C    . VAL B 2 6  ? 7.167   4.717   4.626   1.00 0.77 ? 306 VAL B C    4  
ATOM 5991  O O    . VAL B 2 6  ? 8.088   5.373   4.095   1.00 1.47 ? 306 VAL B O    4  
ATOM 5992  C CB   . VAL B 2 6  ? 6.887   2.361   3.814   1.00 0.54 ? 306 VAL B CB   4  
ATOM 5993  C CG1  . VAL B 2 6  ? 7.392   0.934   3.963   1.00 0.51 ? 306 VAL B CG1  4  
ATOM 5994  C CG2  . VAL B 2 6  ? 5.364   2.392   3.777   1.00 0.49 ? 306 VAL B CG2  4  
ATOM 5995  O OXT  . VAL B 2 6  ? 6.048   5.201   4.899   1.00 1.14 ? 306 VAL B OXT  4  
ATOM 5996  H H    . VAL B 2 6  ? 5.948   3.203   6.473   1.00 0.70 ? 306 VAL B H    4  
ATOM 5997  H HA   . VAL B 2 6  ? 8.496   3.091   5.025   1.00 0.71 ? 306 VAL B HA   4  
ATOM 5998  H HB   . VAL B 2 6  ? 7.257   2.753   2.876   1.00 0.63 ? 306 VAL B HB   4  
ATOM 5999  H HG11 . VAL B 2 6  ? 8.471   0.937   4.013   1.00 1.08 ? 306 VAL B HG11 4  
ATOM 6000  H HG12 . VAL B 2 6  ? 7.072   0.349   3.114   1.00 1.13 ? 306 VAL B HG12 4  
ATOM 6001  H HG13 . VAL B 2 6  ? 6.991   0.502   4.870   1.00 1.04 ? 306 VAL B HG13 4  
ATOM 6002  H HG21 . VAL B 2 6  ? 4.976   2.191   4.765   1.00 1.09 ? 306 VAL B HG21 4  
ATOM 6003  H HG22 . VAL B 2 6  ? 5.006   1.641   3.090   1.00 1.15 ? 306 VAL B HG22 4  
ATOM 6004  H HG23 . VAL B 2 6  ? 5.032   3.366   3.451   1.00 1.15 ? 306 VAL B HG23 4  
ATOM 6005  N N    . MET A 1 1  ? -9.557  4.556   -6.629  1.00 1.83 ? 1   MET A N    5  
ATOM 6006  C CA   . MET A 1 1  ? -9.010  3.340   -7.293  1.00 1.38 ? 1   MET A CA   5  
ATOM 6007  C C    . MET A 1 1  ? -7.505  3.457   -7.533  1.00 1.20 ? 1   MET A C    5  
ATOM 6008  O O    . MET A 1 1  ? -6.749  2.532   -7.225  1.00 1.07 ? 1   MET A O    5  
ATOM 6009  C CB   . MET A 1 1  ? -9.743  3.131   -8.622  1.00 1.81 ? 1   MET A CB   5  
ATOM 6010  C CG   . MET A 1 1  ? -9.847  1.672   -9.036  1.00 2.04 ? 1   MET A CG   5  
ATOM 6011  S SD   . MET A 1 1  ? -10.060 1.468   -10.815 1.00 2.69 ? 1   MET A SD   5  
ATOM 6012  C CE   . MET A 1 1  ? -11.697 0.743   -10.880 1.00 3.17 ? 1   MET A CE   5  
ATOM 6013  H H1   . MET A 1 1  ? -8.922  4.801   -5.843  1.00 2.20 ? 1   MET A H1   5  
ATOM 6014  H H2   . MET A 1 1  ? -10.510 4.324   -6.280  1.00 2.22 ? 1   MET A H2   5  
ATOM 6015  H H3   . MET A 1 1  ? -9.591  5.319   -7.334  1.00 1.92 ? 1   MET A H3   5  
ATOM 6016  H HA   . MET A 1 1  ? -9.195  2.490   -6.652  1.00 1.47 ? 1   MET A HA   5  
ATOM 6017  H HB2  . MET A 1 1  ? -10.742 3.531   -8.536  1.00 2.32 ? 1   MET A HB2  5  
ATOM 6018  H HB3  . MET A 1 1  ? -9.216  3.666   -9.398  1.00 2.16 ? 1   MET A HB3  5  
ATOM 6019  H HG2  . MET A 1 1  ? -8.944  1.161   -8.736  1.00 2.47 ? 1   MET A HG2  5  
ATOM 6020  H HG3  . MET A 1 1  ? -10.694 1.229   -8.533  1.00 2.24 ? 1   MET A HG3  5  
ATOM 6021  H HE1  . MET A 1 1  ? -12.227 0.965   -9.967  1.00 3.35 ? 1   MET A HE1  5  
ATOM 6022  H HE2  . MET A 1 1  ? -11.612 -0.328  -10.996 1.00 3.35 ? 1   MET A HE2  5  
ATOM 6023  H HE3  . MET A 1 1  ? -12.239 1.153   -11.720 1.00 3.67 ? 1   MET A HE3  5  
ATOM 6024  N N    . GLU A 1 2  ? -7.074  4.596   -8.083  1.00 1.25 ? 2   GLU A N    5  
ATOM 6025  C CA   . GLU A 1 2  ? -5.657  4.822   -8.358  1.00 1.15 ? 2   GLU A CA   5  
ATOM 6026  C C    . GLU A 1 2  ? -5.105  5.978   -7.521  1.00 1.12 ? 2   GLU A C    5  
ATOM 6027  O O    . GLU A 1 2  ? -5.532  7.127   -7.655  1.00 1.17 ? 2   GLU A O    5  
ATOM 6028  C CB   . GLU A 1 2  ? -5.421  5.077   -9.852  1.00 1.22 ? 2   GLU A CB   5  
ATOM 6029  C CG   . GLU A 1 2  ? -6.195  6.258   -10.412 1.00 1.74 ? 2   GLU A CG   5  
ATOM 6030  C CD   . GLU A 1 2  ? -7.379  5.830   -11.260 1.00 1.63 ? 2   GLU A CD   5  
ATOM 6031  O OE1  . GLU A 1 2  ? -7.200  5.651   -12.483 1.00 1.97 ? 2   GLU A OE1  5  
ATOM 6032  O OE2  . GLU A 1 2  ? -8.485  5.676   -10.699 1.00 1.88 ? 2   GLU A OE2  5  
ATOM 6033  H H    . GLU A 1 2  ? -7.723  5.295   -8.302  1.00 1.40 ? 2   GLU A H    5  
ATOM 6034  H HA   . GLU A 1 2  ? -5.129  3.923   -8.077  1.00 1.06 ? 2   GLU A HA   5  
ATOM 6035  H HB2  . GLU A 1 2  ? -4.368  5.262   -10.009 1.00 1.76 ? 2   GLU A HB2  5  
ATOM 6036  H HB3  . GLU A 1 2  ? -5.705  4.193   -10.403 1.00 1.34 ? 2   GLU A HB3  5  
ATOM 6037  H HG2  . GLU A 1 2  ? -6.558  6.855   -9.590  1.00 2.14 ? 2   GLU A HG2  5  
ATOM 6038  H HG3  . GLU A 1 2  ? -5.529  6.852   -11.021 1.00 2.47 ? 2   GLU A HG3  5  
ATOM 6039  N N    . ILE A 1 3  ? -4.161  5.644   -6.648  1.00 1.09 ? 3   ILE A N    5  
ATOM 6040  C CA   . ILE A 1 3  ? -3.540  6.623   -5.763  1.00 1.10 ? 3   ILE A CA   5  
ATOM 6041  C C    . ILE A 1 3  ? -2.216  7.116   -6.343  1.00 1.02 ? 3   ILE A C    5  
ATOM 6042  O O    . ILE A 1 3  ? -1.203  6.414   -6.285  1.00 1.07 ? 3   ILE A O    5  
ATOM 6043  C CB   . ILE A 1 3  ? -3.298  6.038   -4.353  1.00 1.18 ? 3   ILE A CB   5  
ATOM 6044  C CG1  . ILE A 1 3  ? -4.612  5.535   -3.746  1.00 1.34 ? 3   ILE A CG1  5  
ATOM 6045  C CG2  . ILE A 1 3  ? -2.658  7.078   -3.445  1.00 1.22 ? 3   ILE A CG2  5  
ATOM 6046  C CD1  . ILE A 1 3  ? -4.873  4.066   -3.997  1.00 1.10 ? 3   ILE A CD1  5  
ATOM 6047  H H    . ILE A 1 3  ? -3.905  4.699   -6.600  1.00 1.08 ? 3   ILE A H    5  
ATOM 6048  H HA   . ILE A 1 3  ? -4.215  7.463   -5.671  1.00 1.15 ? 3   ILE A HA   5  
ATOM 6049  H HB   . ILE A 1 3  ? -2.613  5.209   -4.446  1.00 1.17 ? 3   ILE A HB   5  
ATOM 6050  H HG12 . ILE A 1 3  ? -4.590  5.688   -2.678  1.00 1.83 ? 3   ILE A HG12 5  
ATOM 6051  H HG13 . ILE A 1 3  ? -5.433  6.095   -4.168  1.00 1.86 ? 3   ILE A HG13 5  
ATOM 6052  H HG21 . ILE A 1 3  ? -3.321  7.925   -3.344  1.00 1.72 ? 3   ILE A HG21 5  
ATOM 6053  H HG22 . ILE A 1 3  ? -1.722  7.401   -3.874  1.00 1.51 ? 3   ILE A HG22 5  
ATOM 6054  H HG23 . ILE A 1 3  ? -2.478  6.643   -2.473  1.00 1.55 ? 3   ILE A HG23 5  
ATOM 6055  H HD11 . ILE A 1 3  ? -5.517  3.956   -4.857  1.00 1.47 ? 3   ILE A HD11 5  
ATOM 6056  H HD12 . ILE A 1 3  ? -5.353  3.632   -3.132  1.00 1.61 ? 3   ILE A HD12 5  
ATOM 6057  H HD13 . ILE A 1 3  ? -3.937  3.559   -4.182  1.00 1.54 ? 3   ILE A HD13 5  
ATOM 6058  N N    . LYS A 1 4  ? -2.230  8.331   -6.904  1.00 0.98 ? 4   LYS A N    5  
ATOM 6059  C CA   . LYS A 1 4  ? -1.026  8.912   -7.490  1.00 0.96 ? 4   LYS A CA   5  
ATOM 6060  C C    . LYS A 1 4  ? -0.407  9.943   -6.545  1.00 0.96 ? 4   LYS A C    5  
ATOM 6061  O O    . LYS A 1 4  ? -0.766  11.123  -6.557  1.00 1.08 ? 4   LYS A O    5  
ATOM 6062  C CB   . LYS A 1 4  ? -1.352  9.554   -8.844  1.00 1.07 ? 4   LYS A CB   5  
ATOM 6063  C CG   . LYS A 1 4  ? -0.410  9.133   -9.962  1.00 1.35 ? 4   LYS A CG   5  
ATOM 6064  C CD   . LYS A 1 4  ? -0.812  9.745   -11.296 1.00 1.59 ? 4   LYS A CD   5  
ATOM 6065  C CE   . LYS A 1 4  ? -0.438  11.218  -11.375 1.00 2.29 ? 4   LYS A CE   5  
ATOM 6066  N NZ   . LYS A 1 4  ? 0.911   11.422  -11.975 1.00 2.93 ? 4   LYS A NZ   5  
ATOM 6067  H H    . LYS A 1 4  ? -3.064  8.846   -6.919  1.00 1.01 ? 4   LYS A H    5  
ATOM 6068  H HA   . LYS A 1 4  ? -0.316  8.113   -7.644  1.00 0.96 ? 4   LYS A HA   5  
ATOM 6069  H HB2  . LYS A 1 4  ? -2.357  9.278   -9.128  1.00 1.56 ? 4   LYS A HB2  5  
ATOM 6070  H HB3  . LYS A 1 4  ? -1.300  10.629  -8.744  1.00 1.61 ? 4   LYS A HB3  5  
ATOM 6071  H HG2  . LYS A 1 4  ? 0.591   9.455   -9.717  1.00 1.93 ? 4   LYS A HG2  5  
ATOM 6072  H HG3  . LYS A 1 4  ? -0.431  8.056   -10.049 1.00 1.87 ? 4   LYS A HG3  5  
ATOM 6073  H HD2  . LYS A 1 4  ? -0.309  9.213   -12.090 1.00 1.98 ? 4   LYS A HD2  5  
ATOM 6074  H HD3  . LYS A 1 4  ? -1.881  9.647   -11.417 1.00 1.90 ? 4   LYS A HD3  5  
ATOM 6075  H HE2  . LYS A 1 4  ? -1.170  11.730  -11.981 1.00 2.72 ? 4   LYS A HE2  5  
ATOM 6076  H HE3  . LYS A 1 4  ? -0.445  11.633  -10.379 1.00 2.70 ? 4   LYS A HE3  5  
ATOM 6077  H HZ1  . LYS A 1 4  ? 0.872   11.268  -13.004 1.00 3.17 ? 4   LYS A HZ1  5  
ATOM 6078  H HZ2  . LYS A 1 4  ? 1.592   10.753  -11.562 1.00 3.54 ? 4   LYS A HZ2  5  
ATOM 6079  H HZ3  . LYS A 1 4  ? 1.241   12.391  -11.794 1.00 3.06 ? 4   LYS A HZ3  5  
ATOM 6080  N N    . LEU A 1 5  ? 0.508   9.465   -5.707  1.00 0.89 ? 5   LEU A N    5  
ATOM 6081  C CA   . LEU A 1 5  ? 1.175   10.315  -4.723  1.00 0.97 ? 5   LEU A CA   5  
ATOM 6082  C C    . LEU A 1 5  ? 2.442   10.946  -5.294  1.00 0.88 ? 5   LEU A C    5  
ATOM 6083  O O    . LEU A 1 5  ? 3.285   10.260  -5.874  1.00 0.82 ? 5   LEU A O    5  
ATOM 6084  C CB   . LEU A 1 5  ? 1.506   9.514   -3.460  1.00 1.11 ? 5   LEU A CB   5  
ATOM 6085  C CG   . LEU A 1 5  ? 0.294   8.993   -2.681  1.00 1.42 ? 5   LEU A CG   5  
ATOM 6086  C CD1  . LEU A 1 5  ? 0.740   8.078   -1.550  1.00 1.50 ? 5   LEU A CD1  5  
ATOM 6087  C CD2  . LEU A 1 5  ? -0.534  10.151  -2.140  1.00 2.09 ? 5   LEU A CD2  5  
ATOM 6088  H H    . LEU A 1 5  ? 0.691   8.501   -5.742  1.00 0.85 ? 5   LEU A H    5  
ATOM 6089  H HA   . LEU A 1 5  ? 0.488   11.106  -4.458  1.00 1.10 ? 5   LEU A HA   5  
ATOM 6090  H HB2  . LEU A 1 5  ? 2.112   8.669   -3.746  1.00 1.26 ? 5   LEU A HB2  5  
ATOM 6091  H HB3  . LEU A 1 5  ? 2.085   10.143  -2.801  1.00 1.25 ? 5   LEU A HB3  5  
ATOM 6092  H HG   . LEU A 1 5  ? -0.330  8.417   -3.348  1.00 1.86 ? 5   LEU A HG   5  
ATOM 6093  H HD11 . LEU A 1 5  ? 1.693   8.413   -1.169  1.00 1.87 ? 5   LEU A HD11 5  
ATOM 6094  H HD12 . LEU A 1 5  ? 0.837   7.068   -1.923  1.00 2.01 ? 5   LEU A HD12 5  
ATOM 6095  H HD13 . LEU A 1 5  ? 0.007   8.098   -0.758  1.00 1.76 ? 5   LEU A HD13 5  
ATOM 6096  H HD21 . LEU A 1 5  ? -1.136  10.565  -2.935  1.00 2.37 ? 5   LEU A HD21 5  
ATOM 6097  H HD22 . LEU A 1 5  ? 0.123   10.914  -1.752  1.00 2.53 ? 5   LEU A HD22 5  
ATOM 6098  H HD23 . LEU A 1 5  ? -1.178  9.796   -1.350  1.00 2.63 ? 5   LEU A HD23 5  
ATOM 6099  N N    . ILE A 1 6  ? 2.567   12.264  -5.122  1.00 0.95 ? 6   ILE A N    5  
ATOM 6100  C CA   . ILE A 1 6  ? 3.731   12.998  -5.619  1.00 0.90 ? 6   ILE A CA   5  
ATOM 6101  C C    . ILE A 1 6  ? 4.840   13.026  -4.565  1.00 0.93 ? 6   ILE A C    5  
ATOM 6102  O O    . ILE A 1 6  ? 4.611   13.417  -3.418  1.00 1.06 ? 6   ILE A O    5  
ATOM 6103  C CB   . ILE A 1 6  ? 3.369   14.448  -6.024  1.00 1.04 ? 6   ILE A CB   5  
ATOM 6104  C CG1  . ILE A 1 6  ? 4.565   15.124  -6.704  1.00 1.29 ? 6   ILE A CG1  5  
ATOM 6105  C CG2  . ILE A 1 6  ? 2.913   15.257  -4.814  1.00 1.21 ? 6   ILE A CG2  5  
ATOM 6106  C CD1  . ILE A 1 6  ? 4.257   16.502  -7.250  1.00 1.94 ? 6   ILE A CD1  5  
ATOM 6107  H H    . ILE A 1 6  ? 1.857   12.753  -4.657  1.00 1.06 ? 6   ILE A H    5  
ATOM 6108  H HA   . ILE A 1 6  ? 4.093   12.483  -6.498  1.00 0.86 ? 6   ILE A HA   5  
ATOM 6109  H HB   . ILE A 1 6  ? 2.547   14.405  -6.723  1.00 1.27 ? 6   ILE A HB   5  
ATOM 6110  H HG12 . ILE A 1 6  ? 5.368   15.224  -5.988  1.00 1.47 ? 6   ILE A HG12 5  
ATOM 6111  H HG13 . ILE A 1 6  ? 4.898   14.507  -7.526  1.00 1.34 ? 6   ILE A HG13 5  
ATOM 6112  H HG21 . ILE A 1 6  ? 3.775   15.574  -4.248  1.00 1.62 ? 6   ILE A HG21 5  
ATOM 6113  H HG22 . ILE A 1 6  ? 2.277   14.646  -4.191  1.00 1.62 ? 6   ILE A HG22 5  
ATOM 6114  H HG23 . ILE A 1 6  ? 2.362   16.124  -5.149  1.00 1.45 ? 6   ILE A HG23 5  
ATOM 6115  H HD11 . ILE A 1 6  ? 3.205   16.571  -7.484  1.00 2.44 ? 6   ILE A HD11 5  
ATOM 6116  H HD12 . ILE A 1 6  ? 4.837   16.672  -8.145  1.00 2.21 ? 6   ILE A HD12 5  
ATOM 6117  H HD13 . ILE A 1 6  ? 4.512   17.246  -6.510  1.00 2.30 ? 6   ILE A HD13 5  
ATOM 6118  N N    . LYS A 1 7  ? 6.035   12.588  -4.960  1.00 0.91 ? 7   LYS A N    5  
ATOM 6119  C CA   . LYS A 1 7  ? 7.182   12.541  -4.053  1.00 1.06 ? 7   LYS A CA   5  
ATOM 6120  C C    . LYS A 1 7  ? 7.498   13.916  -3.463  1.00 1.18 ? 7   LYS A C    5  
ATOM 6121  O O    . LYS A 1 7  ? 7.810   14.860  -4.193  1.00 1.29 ? 7   LYS A O    5  
ATOM 6122  C CB   . LYS A 1 7  ? 8.415   11.991  -4.775  1.00 1.26 ? 7   LYS A CB   5  
ATOM 6123  C CG   . LYS A 1 7  ? 9.564   11.643  -3.839  1.00 1.78 ? 7   LYS A CG   5  
ATOM 6124  C CD   . LYS A 1 7  ? 9.543   10.172  -3.448  1.00 2.30 ? 7   LYS A CD   5  
ATOM 6125  C CE   . LYS A 1 7  ? 9.016   9.968   -2.033  1.00 2.50 ? 7   LYS A CE   5  
ATOM 6126  N NZ   . LYS A 1 7  ? 7.531   9.830   -2.000  1.00 3.10 ? 7   LYS A NZ   5  
ATOM 6127  H H    . LYS A 1 7  ? 6.145   12.271  -5.881  1.00 0.88 ? 7   LYS A H    5  
ATOM 6128  H HA   . LYS A 1 7  ? 6.930   11.872  -3.246  1.00 1.12 ? 7   LYS A HA   5  
ATOM 6129  H HB2  . LYS A 1 7  ? 8.134   11.098  -5.314  1.00 1.17 ? 7   LYS A HB2  5  
ATOM 6130  H HB3  . LYS A 1 7  ? 8.765   12.731  -5.478  1.00 1.45 ? 7   LYS A HB3  5  
ATOM 6131  H HG2  . LYS A 1 7  ? 10.497  11.859  -4.337  1.00 2.05 ? 7   LYS A HG2  5  
ATOM 6132  H HG3  . LYS A 1 7  ? 9.483   12.247  -2.947  1.00 2.37 ? 7   LYS A HG3  5  
ATOM 6133  H HD2  . LYS A 1 7  ? 8.909   9.636   -4.137  1.00 2.80 ? 7   LYS A HD2  5  
ATOM 6134  H HD3  . LYS A 1 7  ? 10.549  9.782   -3.505  1.00 2.70 ? 7   LYS A HD3  5  
ATOM 6135  H HE2  . LYS A 1 7  ? 9.459   9.072   -1.624  1.00 3.04 ? 7   LYS A HE2  5  
ATOM 6136  H HE3  . LYS A 1 7  ? 9.303   10.816  -1.428  1.00 2.26 ? 7   LYS A HE3  5  
ATOM 6137  H HZ1  . LYS A 1 7  ? 7.098   10.713  -1.660  1.00 3.61 ? 7   LYS A HZ1  5  
ATOM 6138  H HZ2  . LYS A 1 7  ? 7.260   9.057   -1.360  1.00 3.37 ? 7   LYS A HZ2  5  
ATOM 6139  H HZ3  . LYS A 1 7  ? 7.166   9.622   -2.951  1.00 3.30 ? 7   LYS A HZ3  5  
ATOM 6140  N N    . GLY A 1 8  ? 7.412   14.012  -2.137  1.00 1.38 ? 8   GLY A N    5  
ATOM 6141  C CA   . GLY A 1 8  ? 7.689   15.263  -1.450  1.00 1.62 ? 8   GLY A CA   5  
ATOM 6142  C C    . GLY A 1 8  ? 8.794   15.128  -0.414  1.00 1.78 ? 8   GLY A C    5  
ATOM 6143  O O    . GLY A 1 8  ? 9.460   14.093  -0.347  1.00 1.78 ? 8   GLY A O    5  
ATOM 6144  H H    . GLY A 1 8  ? 7.154   13.220  -1.618  1.00 1.48 ? 8   GLY A H    5  
ATOM 6145  H HA2  . GLY A 1 8  ? 7.985   16.003  -2.179  1.00 1.65 ? 8   GLY A HA2  5  
ATOM 6146  H HA3  . GLY A 1 8  ? 6.789   15.599  -0.958  1.00 1.79 ? 8   GLY A HA3  5  
ATOM 6147  N N    . PRO A 1 9  ? 9.013   16.169  0.415   1.00 2.05 ? 9   PRO A N    5  
ATOM 6148  C CA   . PRO A 1 9  ? 10.051  16.158  1.458   1.00 2.32 ? 9   PRO A CA   5  
ATOM 6149  C C    . PRO A 1 9  ? 9.864   15.020  2.464   1.00 2.37 ? 9   PRO A C    5  
ATOM 6150  O O    . PRO A 1 9  ? 10.840  14.450  2.954   1.00 2.77 ? 9   PRO A O    5  
ATOM 6151  C CB   . PRO A 1 9  ? 9.886   17.515  2.153   1.00 2.68 ? 9   PRO A CB   5  
ATOM 6152  C CG   . PRO A 1 9  ? 9.162   18.368  1.168   1.00 2.59 ? 9   PRO A CG   5  
ATOM 6153  C CD   . PRO A 1 9  ? 8.266   17.439  0.401   1.00 2.24 ? 9   PRO A CD   5  
ATOM 6154  H HA   . PRO A 1 9  ? 11.039  16.091  1.028   1.00 2.37 ? 9   PRO A HA   5  
ATOM 6155  H HB2  . PRO A 1 9  ? 9.314   17.391  3.062   1.00 2.85 ? 9   PRO A HB2  5  
ATOM 6156  H HB3  . PRO A 1 9  ? 10.857  17.924  2.387   1.00 2.89 ? 9   PRO A HB3  5  
ATOM 6157  H HG2  . PRO A 1 9  ? 8.576   19.113  1.686   1.00 2.84 ? 9   PRO A HG2  5  
ATOM 6158  H HG3  . PRO A 1 9  ? 9.869   18.841  0.503   1.00 2.61 ? 9   PRO A HG3  5  
ATOM 6159  H HD2  . PRO A 1 9  ? 7.315   17.334  0.900   1.00 2.35 ? 9   PRO A HD2  5  
ATOM 6160  H HD3  . PRO A 1 9  ? 8.129   17.795  -0.609  1.00 2.14 ? 9   PRO A HD3  5  
ATOM 6161  N N    . LYS A 1 10 ? 8.603   14.694  2.762   1.00 2.38 ? 10  LYS A N    5  
ATOM 6162  C CA   . LYS A 1 10 ? 8.287   13.623  3.704   1.00 2.57 ? 10  LYS A CA   5  
ATOM 6163  C C    . LYS A 1 10 ? 8.382   12.256  3.022   1.00 2.26 ? 10  LYS A C    5  
ATOM 6164  O O    . LYS A 1 10 ? 9.238   11.441  3.369   1.00 2.45 ? 10  LYS A O    5  
ATOM 6165  C CB   . LYS A 1 10 ? 6.888   13.829  4.297   1.00 2.99 ? 10  LYS A CB   5  
ATOM 6166  C CG   . LYS A 1 10 ? 6.602   12.961  5.514   1.00 3.71 ? 10  LYS A CG   5  
ATOM 6167  C CD   . LYS A 1 10 ? 6.287   13.802  6.742   1.00 4.04 ? 10  LYS A CD   5  
ATOM 6168  C CE   . LYS A 1 10 ? 4.849   14.299  6.729   1.00 4.40 ? 10  LYS A CE   5  
ATOM 6169  N NZ   . LYS A 1 10 ? 4.360   14.631  8.096   1.00 4.92 ? 10  LYS A NZ   5  
ATOM 6170  H H    . LYS A 1 10 ? 7.872   15.185  2.333   1.00 2.55 ? 10  LYS A H    5  
ATOM 6171  H HA   . LYS A 1 10 ? 9.014   13.662  4.502   1.00 2.82 ? 10  LYS A HA   5  
ATOM 6172  H HB2  . LYS A 1 10 ? 6.784   14.865  4.588   1.00 3.13 ? 10  LYS A HB2  5  
ATOM 6173  H HB3  . LYS A 1 10 ? 6.152   13.605  3.540   1.00 2.88 ? 10  LYS A HB3  5  
ATOM 6174  H HG2  . LYS A 1 10 ? 5.755   12.326  5.299   1.00 3.97 ? 10  LYS A HG2  5  
ATOM 6175  H HG3  . LYS A 1 10 ? 7.469   12.350  5.719   1.00 4.13 ? 10  LYS A HG3  5  
ATOM 6176  H HD2  . LYS A 1 10 ? 6.440   13.201  7.626   1.00 4.48 ? 10  LYS A HD2  5  
ATOM 6177  H HD3  . LYS A 1 10 ? 6.953   14.653  6.765   1.00 4.00 ? 10  LYS A HD3  5  
ATOM 6178  H HE2  . LYS A 1 10 ? 4.793   15.184  6.113   1.00 4.59 ? 10  LYS A HE2  5  
ATOM 6179  H HE3  . LYS A 1 10 ? 4.219   13.529  6.308   1.00 4.53 ? 10  LYS A HE3  5  
ATOM 6180  H HZ1  . LYS A 1 10 ? 3.407   15.046  8.045   1.00 5.28 ? 10  LYS A HZ1  5  
ATOM 6181  H HZ2  . LYS A 1 10 ? 5.000   15.315  8.550   1.00 5.13 ? 10  LYS A HZ2  5  
ATOM 6182  H HZ3  . LYS A 1 10 ? 4.320   13.772  8.681   1.00 5.08 ? 10  LYS A HZ3  5  
ATOM 6183  N N    . GLY A 1 11 ? 7.493   12.015  2.056   1.00 2.10 ? 11  GLY A N    5  
ATOM 6184  C CA   . GLY A 1 11 ? 7.485   10.749  1.340   1.00 2.10 ? 11  GLY A CA   5  
ATOM 6185  C C    . GLY A 1 11 ? 6.102   10.129  1.290   1.00 2.08 ? 11  GLY A C    5  
ATOM 6186  O O    . GLY A 1 11 ? 5.175   10.718  0.731   1.00 2.30 ? 11  GLY A O    5  
ATOM 6187  H H    . GLY A 1 11 ? 6.833   12.703  1.830   1.00 2.22 ? 11  GLY A H    5  
ATOM 6188  H HA2  . GLY A 1 11 ? 7.830   10.917  0.331   1.00 2.53 ? 11  GLY A HA2  5  
ATOM 6189  H HA3  . GLY A 1 11 ? 8.158   10.062  1.830   1.00 2.21 ? 11  GLY A HA3  5  
ATOM 6190  N N    . LEU A 1 12 ? 5.956   8.947   1.890   1.00 2.47 ? 12  LEU A N    5  
ATOM 6191  C CA   . LEU A 1 12 ? 4.668   8.257   1.927   1.00 2.77 ? 12  LEU A CA   5  
ATOM 6192  C C    . LEU A 1 12 ? 3.856   8.714   3.137   1.00 1.92 ? 12  LEU A C    5  
ATOM 6193  O O    . LEU A 1 12 ? 2.722   9.168   2.997   1.00 2.52 ? 12  LEU A O    5  
ATOM 6194  C CB   . LEU A 1 12 ? 4.876   6.741   1.966   1.00 3.62 ? 12  LEU A CB   5  
ATOM 6195  C CG   . LEU A 1 12 ? 5.315   6.112   0.641   1.00 4.87 ? 12  LEU A CG   5  
ATOM 6196  C CD1  . LEU A 1 12 ? 5.736   4.667   0.852   1.00 5.33 ? 12  LEU A CD1  5  
ATOM 6197  C CD2  . LEU A 1 12 ? 4.200   6.203   -0.392  1.00 5.70 ? 12  LEU A CD2  5  
ATOM 6198  H H    . LEU A 1 12 ? 6.725   8.532   2.336   1.00 2.84 ? 12  LEU A H    5  
ATOM 6199  H HA   . LEU A 1 12 ? 4.127   8.514   1.027   1.00 3.41 ? 12  LEU A HA   5  
ATOM 6200  H HB2  . LEU A 1 12 ? 5.629   6.524   2.708   1.00 3.58 ? 12  LEU A HB2  5  
ATOM 6201  H HB3  . LEU A 1 12 ? 3.950   6.277   2.269   1.00 3.65 ? 12  LEU A HB3  5  
ATOM 6202  H HG   . LEU A 1 12 ? 6.169   6.654   0.261   1.00 5.19 ? 12  LEU A HG   5  
ATOM 6203  H HD11 . LEU A 1 12 ? 5.670   4.133   -0.084  1.00 5.40 ? 12  LEU A HD11 5  
ATOM 6204  H HD12 . LEU A 1 12 ? 5.082   4.204   1.577   1.00 5.57 ? 12  LEU A HD12 5  
ATOM 6205  H HD13 . LEU A 1 12 ? 6.753   4.637   1.213   1.00 5.68 ? 12  LEU A HD13 5  
ATOM 6206  H HD21 . LEU A 1 12 ? 3.341   6.692   0.044   1.00 6.03 ? 12  LEU A HD21 5  
ATOM 6207  H HD22 . LEU A 1 12 ? 3.924   5.208   -0.713  1.00 5.93 ? 12  LEU A HD22 5  
ATOM 6208  H HD23 . LEU A 1 12 ? 4.543   6.772   -1.243  1.00 6.06 ? 12  LEU A HD23 5  
ATOM 6209  N N    . GLY A 1 13 ? 4.454   8.599   4.325   1.00 1.13 ? 13  GLY A N    5  
ATOM 6210  C CA   . GLY A 1 13 ? 3.788   9.018   5.547   1.00 1.11 ? 13  GLY A CA   5  
ATOM 6211  C C    . GLY A 1 13 ? 2.845   7.978   6.123   1.00 0.96 ? 13  GLY A C    5  
ATOM 6212  O O    . GLY A 1 13 ? 1.815   8.331   6.695   1.00 1.03 ? 13  GLY A O    5  
ATOM 6213  H H    . GLY A 1 13 ? 5.360   8.230   4.370   1.00 1.49 ? 13  GLY A H    5  
ATOM 6214  H HA2  . GLY A 1 13 ? 4.541   9.241   6.288   1.00 1.58 ? 13  GLY A HA2  5  
ATOM 6215  H HA3  . GLY A 1 13 ? 3.229   9.920   5.347   1.00 1.81 ? 13  GLY A HA3  5  
ATOM 6216  N N    . PHE A 1 14 ? 3.189   6.697   5.980   1.00 0.81 ? 14  PHE A N    5  
ATOM 6217  C CA   . PHE A 1 14 ? 2.359   5.613   6.508   1.00 0.71 ? 14  PHE A CA   5  
ATOM 6218  C C    . PHE A 1 14 ? 3.180   4.329   6.665   1.00 0.56 ? 14  PHE A C    5  
ATOM 6219  O O    . PHE A 1 14 ? 4.391   4.331   6.441   1.00 0.52 ? 14  PHE A O    5  
ATOM 6220  C CB   . PHE A 1 14 ? 1.130   5.377   5.614   1.00 0.74 ? 14  PHE A CB   5  
ATOM 6221  C CG   . PHE A 1 14 ? 1.449   5.026   4.186   1.00 0.63 ? 14  PHE A CG   5  
ATOM 6222  C CD1  . PHE A 1 14 ? 1.868   3.748   3.848   1.00 1.27 ? 14  PHE A CD1  5  
ATOM 6223  C CD2  . PHE A 1 14 ? 1.316   5.971   3.180   1.00 1.41 ? 14  PHE A CD2  5  
ATOM 6224  C CE1  . PHE A 1 14 ? 2.151   3.421   2.537   1.00 1.33 ? 14  PHE A CE1  5  
ATOM 6225  C CE2  . PHE A 1 14 ? 1.596   5.649   1.867   1.00 1.46 ? 14  PHE A CE2  5  
ATOM 6226  C CZ   . PHE A 1 14 ? 2.014   4.372   1.545   1.00 0.83 ? 14  PHE A CZ   5  
ATOM 6227  H H    . PHE A 1 14 ? 4.018   6.471   5.507   1.00 0.79 ? 14  PHE A H    5  
ATOM 6228  H HA   . PHE A 1 14 ? 2.019   5.918   7.487   1.00 0.81 ? 14  PHE A HA   5  
ATOM 6229  H HB2  . PHE A 1 14 ? 0.548   4.568   6.028   1.00 0.84 ? 14  PHE A HB2  5  
ATOM 6230  H HB3  . PHE A 1 14 ? 0.527   6.274   5.608   1.00 0.89 ? 14  PHE A HB3  5  
ATOM 6231  H HD1  . PHE A 1 14 ? 1.975   3.003   4.623   1.00 2.12 ? 14  PHE A HD1  5  
ATOM 6232  H HD2  . PHE A 1 14 ? 0.991   6.971   3.430   1.00 2.28 ? 14  PHE A HD2  5  
ATOM 6233  H HE1  . PHE A 1 14 ? 2.478   2.421   2.288   1.00 2.19 ? 14  PHE A HE1  5  
ATOM 6234  H HE2  . PHE A 1 14 ? 1.488   6.393   1.093   1.00 2.33 ? 14  PHE A HE2  5  
ATOM 6235  H HZ   . PHE A 1 14 ? 2.233   4.119   0.518   1.00 0.99 ? 14  PHE A HZ   5  
ATOM 6236  N N    . SER A 1 15 ? 2.517   3.235   7.040   1.00 0.55 ? 15  SER A N    5  
ATOM 6237  C CA   . SER A 1 15 ? 3.178   1.954   7.213   1.00 0.47 ? 15  SER A CA   5  
ATOM 6238  C C    . SER A 1 15 ? 2.407   0.864   6.473   1.00 0.47 ? 15  SER A C    5  
ATOM 6239  O O    . SER A 1 15 ? 1.312   1.111   5.962   1.00 0.52 ? 15  SER A O    5  
ATOM 6240  C CB   . SER A 1 15 ? 3.280   1.604   8.695   1.00 0.50 ? 15  SER A CB   5  
ATOM 6241  O OG   . SER A 1 15 ? 2.066   1.856   9.365   1.00 0.57 ? 15  SER A OG   5  
ATOM 6242  H H    . SER A 1 15 ? 1.555   3.274   7.193   1.00 0.65 ? 15  SER A H    5  
ATOM 6243  H HA   . SER A 1 15 ? 4.169   2.029   6.799   1.00 0.48 ? 15  SER A HA   5  
ATOM 6244  H HB2  . SER A 1 15 ? 3.511   0.561   8.791   1.00 0.52 ? 15  SER A HB2  5  
ATOM 6245  H HB3  . SER A 1 15 ? 4.058   2.193   9.154   1.00 0.54 ? 15  SER A HB3  5  
ATOM 6246  H HG   . SER A 1 15 ? 1.871   1.127   9.958   1.00 1.10 ? 15  SER A HG   5  
ATOM 6247  N N    . ILE A 1 16 ? 2.972   -0.339  6.421   1.00 0.44 ? 16  ILE A N    5  
ATOM 6248  C CA   . ILE A 1 16 ? 2.325   -1.461  5.743   1.00 0.46 ? 16  ILE A CA   5  
ATOM 6249  C C    . ILE A 1 16 ? 2.787   -2.799  6.312   1.00 0.46 ? 16  ILE A C    5  
ATOM 6250  O O    . ILE A 1 16 ? 3.780   -2.870  7.033   1.00 0.45 ? 16  ILE A O    5  
ATOM 6251  C CB   . ILE A 1 16 ? 2.611   -1.467  4.212   1.00 0.47 ? 16  ILE A CB   5  
ATOM 6252  C CG1  . ILE A 1 16 ? 3.950   -2.151  3.889   1.00 0.67 ? 16  ILE A CG1  5  
ATOM 6253  C CG2  . ILE A 1 16 ? 2.567   -0.061  3.628   1.00 0.57 ? 16  ILE A CG2  5  
ATOM 6254  C CD1  . ILE A 1 16 ? 5.159   -1.295  4.161   1.00 0.64 ? 16  ILE A CD1  5  
ATOM 6255  H H    . ILE A 1 16 ? 3.841   -0.481  6.853   1.00 0.44 ? 16  ILE A H    5  
ATOM 6256  H HA   . ILE A 1 16 ? 1.248   -1.367  5.881   1.00 0.49 ? 16  ILE A HA   5  
ATOM 6257  H HB   . ILE A 1 16 ? 1.831   -2.033  3.747   1.00 0.59 ? 16  ILE A HB   5  
ATOM 6258  H HG12 . ILE A 1 16 ? 4.045   -3.049  4.479   1.00 1.45 ? 16  ILE A HG12 5  
ATOM 6259  H HG13 . ILE A 1 16 ? 3.964   -2.416  2.842   1.00 1.37 ? 16  ILE A HG13 5  
ATOM 6260  H HG21 . ILE A 1 16 ? 1.578   0.353   3.761   1.00 1.32 ? 16  ILE A HG21 5  
ATOM 6261  H HG22 . ILE A 1 16 ? 2.801   -0.101  2.575   1.00 1.06 ? 16  ILE A HG22 5  
ATOM 6262  H HG23 . ILE A 1 16 ? 3.290   0.563   4.134   1.00 1.09 ? 16  ILE A HG23 5  
ATOM 6263  H HD11 . ILE A 1 16 ? 5.568   -0.948  3.224   1.00 1.34 ? 16  ILE A HD11 5  
ATOM 6264  H HD12 . ILE A 1 16 ? 5.903   -1.877  4.687   1.00 1.24 ? 16  ILE A HD12 5  
ATOM 6265  H HD13 . ILE A 1 16 ? 4.866   -0.450  4.763   1.00 1.38 ? 16  ILE A HD13 5  
ATOM 6266  N N    . ALA A 1 17 ? 2.068   -3.849  5.935   1.00 0.51 ? 17  ALA A N    5  
ATOM 6267  C CA   . ALA A 1 17 ? 2.374   -5.222  6.321   1.00 0.55 ? 17  ALA A CA   5  
ATOM 6268  C C    . ALA A 1 17 ? 2.292   -6.069  5.051   1.00 0.73 ? 17  ALA A C    5  
ATOM 6269  O O    . ALA A 1 17 ? 1.700   -5.620  4.077   1.00 1.19 ? 17  ALA A O    5  
ATOM 6270  C CB   . ALA A 1 17 ? 1.408   -5.708  7.393   1.00 0.71 ? 17  ALA A CB   5  
ATOM 6271  H H    . ALA A 1 17 ? 1.303   -3.702  5.341   1.00 0.55 ? 17  ALA A H    5  
ATOM 6272  H HA   . ALA A 1 17 ? 3.382   -5.255  6.711   1.00 0.50 ? 17  ALA A HA   5  
ATOM 6273  H HB1  . ALA A 1 17 ? 0.497   -5.126  7.351   1.00 1.21 ? 17  ALA A HB1  5  
ATOM 6274  H HB2  . ALA A 1 17 ? 1.862   -5.591  8.366   1.00 1.22 ? 17  ALA A HB2  5  
ATOM 6275  H HB3  . ALA A 1 17 ? 1.179   -6.750  7.227   1.00 1.33 ? 17  ALA A HB3  5  
ATOM 6276  N N    . GLY A 1 18 ? 2.856   -7.275  5.021   1.00 0.60 ? 18  GLY A N    5  
ATOM 6277  C CA   . GLY A 1 18 ? 2.734   -8.051  3.794   1.00 0.77 ? 18  GLY A CA   5  
ATOM 6278  C C    . GLY A 1 18 ? 3.661   -9.242  3.666   1.00 0.85 ? 18  GLY A C    5  
ATOM 6279  O O    . GLY A 1 18 ? 4.859   -9.105  3.889   1.00 1.29 ? 18  GLY A O    5  
ATOM 6280  H H    . GLY A 1 18 ? 3.283   -7.638  5.825   1.00 0.67 ? 18  GLY A H    5  
ATOM 6281  H HA2  . GLY A 1 18 ? 1.721   -8.407  3.722   1.00 0.96 ? 18  GLY A HA2  5  
ATOM 6282  H HA3  . GLY A 1 18 ? 2.917   -7.388  2.963   1.00 1.37 ? 18  GLY A HA3  5  
ATOM 6283  N N    . GLY A 1 19 ? 3.130   -10.402 3.268   1.00 1.01 ? 19  GLY A N    5  
ATOM 6284  C CA   . GLY A 1 19 ? 3.972   -11.572 3.078   1.00 1.61 ? 19  GLY A CA   5  
ATOM 6285  C C    . GLY A 1 19 ? 3.791   -12.623 4.147   1.00 0.89 ? 19  GLY A C    5  
ATOM 6286  O O    . GLY A 1 19 ? 3.318   -12.325 5.236   1.00 0.76 ? 19  GLY A O    5  
ATOM 6287  H H    . GLY A 1 19 ? 2.168   -10.482 3.091   1.00 1.01 ? 19  GLY A H    5  
ATOM 6288  H HA2  . GLY A 1 19 ? 3.740   -12.013 2.120   1.00 2.30 ? 19  GLY A HA2  5  
ATOM 6289  H HA3  . GLY A 1 19 ? 5.006   -11.259 3.071   1.00 2.32 ? 19  GLY A HA3  5  
ATOM 6290  N N    . VAL A 1 20 ? 4.163   -13.861 3.829   1.00 0.97 ? 20  VAL A N    5  
ATOM 6291  C CA   . VAL A 1 20 ? 4.039   -14.961 4.782   1.00 1.05 ? 20  VAL A CA   5  
ATOM 6292  C C    . VAL A 1 20 ? 4.988   -14.744 5.967   1.00 1.18 ? 20  VAL A C    5  
ATOM 6293  O O    . VAL A 1 20 ? 6.135   -14.331 5.783   1.00 1.35 ? 20  VAL A O    5  
ATOM 6294  C CB   . VAL A 1 20 ? 4.340   -16.328 4.126   1.00 1.68 ? 20  VAL A CB   5  
ATOM 6295  C CG1  . VAL A 1 20 ? 4.096   -17.463 5.110   1.00 1.76 ? 20  VAL A CG1  5  
ATOM 6296  C CG2  . VAL A 1 20 ? 3.500   -16.518 2.869   1.00 2.72 ? 20  VAL A CG2  5  
ATOM 6297  H H    . VAL A 1 20 ? 4.521   -14.034 2.932   1.00 1.38 ? 20  VAL A H    5  
ATOM 6298  H HA   . VAL A 1 20 ? 3.016   -14.967 5.139   1.00 0.98 ? 20  VAL A HA   5  
ATOM 6299  H HB   . VAL A 1 20 ? 5.381   -16.346 3.842   1.00 2.13 ? 20  VAL A HB   5  
ATOM 6300  H HG11 . VAL A 1 20 ? 4.256   -18.410 4.614   1.00 2.30 ? 20  VAL A HG11 5  
ATOM 6301  H HG12 . VAL A 1 20 ? 3.080   -17.415 5.473   1.00 1.97 ? 20  VAL A HG12 5  
ATOM 6302  H HG13 . VAL A 1 20 ? 4.780   -17.374 5.941   1.00 2.15 ? 20  VAL A HG13 5  
ATOM 6303  H HG21 . VAL A 1 20 ? 3.506   -17.560 2.587   1.00 3.33 ? 20  VAL A HG21 5  
ATOM 6304  H HG22 . VAL A 1 20 ? 3.914   -15.925 2.067   1.00 3.14 ? 20  VAL A HG22 5  
ATOM 6305  H HG23 . VAL A 1 20 ? 2.485   -16.203 3.063   1.00 3.02 ? 20  VAL A HG23 5  
ATOM 6306  N N    . GLY A 1 21 ? 4.498   -15.010 7.182   1.00 1.30 ? 21  GLY A N    5  
ATOM 6307  C CA   . GLY A 1 21 ? 5.315   -14.821 8.380   1.00 1.54 ? 21  GLY A CA   5  
ATOM 6308  C C    . GLY A 1 21 ? 5.328   -13.375 8.870   1.00 1.24 ? 21  GLY A C    5  
ATOM 6309  O O    . GLY A 1 21 ? 5.675   -13.107 10.021  1.00 1.56 ? 21  GLY A O    5  
ATOM 6310  H H    . GLY A 1 21 ? 3.577   -15.335 7.264   1.00 1.35 ? 21  GLY A H    5  
ATOM 6311  H HA2  . GLY A 1 21 ? 4.927   -15.451 9.167   1.00 1.90 ? 21  GLY A HA2  5  
ATOM 6312  H HA3  . GLY A 1 21 ? 6.328   -15.124 8.161   1.00 1.72 ? 21  GLY A HA3  5  
ATOM 6313  N N    . ASN A 1 22 ? 4.932   -12.451 7.993   1.00 0.73 ? 22  ASN A N    5  
ATOM 6314  C CA   . ASN A 1 22 ? 4.868   -11.025 8.309   1.00 0.61 ? 22  ASN A CA   5  
ATOM 6315  C C    . ASN A 1 22 ? 3.617   -10.402 7.670   1.00 0.65 ? 22  ASN A C    5  
ATOM 6316  O O    . ASN A 1 22 ? 3.603   -9.213  7.341   1.00 0.67 ? 22  ASN A O    5  
ATOM 6317  C CB   . ASN A 1 22 ? 6.124   -10.298 7.792   1.00 0.47 ? 22  ASN A CB   5  
ATOM 6318  C CG   . ASN A 1 22 ? 6.610   -10.831 6.454   1.00 0.74 ? 22  ASN A CG   5  
ATOM 6319  O OD1  . ASN A 1 22 ? 5.836   -10.967 5.509   1.00 1.27 ? 22  ASN A OD1  5  
ATOM 6320  N ND2  . ASN A 1 22 ? 7.900   -11.135 6.370   1.00 1.63 ? 22  ASN A ND2  5  
ATOM 6321  H H    . ASN A 1 22 ? 4.656   -12.741 7.106   1.00 0.63 ? 22  ASN A H    5  
ATOM 6322  H HA   . ASN A 1 22 ? 4.808   -10.918 9.381   1.00 0.88 ? 22  ASN A HA   5  
ATOM 6323  H HB2  . ASN A 1 22 ? 5.893   -9.252  7.679   1.00 0.82 ? 22  ASN A HB2  5  
ATOM 6324  H HB3  . ASN A 1 22 ? 6.925   -10.401 8.506   1.00 0.63 ? 22  ASN A HB3  5  
ATOM 6325  H HD21 . ASN A 1 22 ? 8.462   -11.002 7.162   1.00 2.15 ? 22  ASN A HD21 5  
ATOM 6326  H HD22 . ASN A 1 22 ? 8.238   -11.482 5.518   1.00 1.98 ? 22  ASN A HD22 5  
ATOM 6327  N N    . GLN A 1 23 ? 2.585   -11.227 7.459   1.00 0.77 ? 23  GLN A N    5  
ATOM 6328  C CA   . GLN A 1 23 ? 1.347   -10.783 6.815   1.00 0.94 ? 23  GLN A CA   5  
ATOM 6329  C C    . GLN A 1 23 ? 0.476   -9.923  7.723   1.00 0.88 ? 23  GLN A C    5  
ATOM 6330  O O    . GLN A 1 23 ? 0.570   -9.981  8.951   1.00 0.87 ? 23  GLN A O    5  
ATOM 6331  C CB   . GLN A 1 23 ? 0.536   -11.990 6.324   1.00 1.19 ? 23  GLN A CB   5  
ATOM 6332  C CG   . GLN A 1 23 ? 0.416   -13.111 7.347   1.00 1.42 ? 23  GLN A CG   5  
ATOM 6333  C CD   . GLN A 1 23 ? -0.987  -13.678 7.438   1.00 1.55 ? 23  GLN A CD   5  
ATOM 6334  O OE1  . GLN A 1 23 ? -1.865  -13.087 8.069   1.00 1.62 ? 23  GLN A OE1  5  
ATOM 6335  N NE2  . GLN A 1 23 ? -1.205  -14.829 6.812   1.00 2.34 ? 23  GLN A NE2  5  
ATOM 6336  H H    . GLN A 1 23 ? 2.663   -12.171 7.708   1.00 0.79 ? 23  GLN A H    5  
ATOM 6337  H HA   . GLN A 1 23 ? 1.627   -10.191 5.957   1.00 1.04 ? 23  GLN A HA   5  
ATOM 6338  H HB2  . GLN A 1 23 ? -0.460  -11.658 6.069   1.00 1.46 ? 23  GLN A HB2  5  
ATOM 6339  H HB3  . GLN A 1 23 ? 1.009   -12.389 5.439   1.00 1.49 ? 23  GLN A HB3  5  
ATOM 6340  H HG2  . GLN A 1 23 ? 1.091   -13.907 7.069   1.00 1.80 ? 23  GLN A HG2  5  
ATOM 6341  H HG3  . GLN A 1 23 ? 0.697   -12.727 8.317   1.00 1.68 ? 23  GLN A HG3  5  
ATOM 6342  H HE21 . GLN A 1 23 ? -0.458  -15.246 6.332   1.00 2.92 ? 23  GLN A HE21 5  
ATOM 6343  H HE22 . GLN A 1 23 ? -2.104  -15.216 6.858   1.00 2.51 ? 23  GLN A HE22 5  
ATOM 6344  N N    . HIS A 1 24 ? -0.374  -9.124  7.082   1.00 0.86 ? 24  HIS A N    5  
ATOM 6345  C CA   . HIS A 1 24 ? -1.293  -8.223  7.774   1.00 0.83 ? 24  HIS A CA   5  
ATOM 6346  C C    . HIS A 1 24 ? -2.670  -8.855  7.969   1.00 0.84 ? 24  HIS A C    5  
ATOM 6347  O O    . HIS A 1 24 ? -3.350  -8.590  8.963   1.00 0.92 ? 24  HIS A O    5  
ATOM 6348  C CB   . HIS A 1 24 ? -1.458  -6.936  6.965   1.00 0.85 ? 24  HIS A CB   5  
ATOM 6349  C CG   . HIS A 1 24 ? -2.191  -5.866  7.685   1.00 0.83 ? 24  HIS A CG   5  
ATOM 6350  N ND1  . HIS A 1 24 ? -1.604  -5.061  8.627   1.00 0.90 ? 24  HIS A ND1  5  
ATOM 6351  C CD2  . HIS A 1 24 ? -3.471  -5.453  7.575   1.00 0.81 ? 24  HIS A CD2  5  
ATOM 6352  C CE1  . HIS A 1 24 ? -2.485  -4.193  9.068   1.00 0.88 ? 24  HIS A CE1  5  
ATOM 6353  N NE2  . HIS A 1 24 ? -3.633  -4.406  8.447   1.00 0.82 ? 24  HIS A NE2  5  
ATOM 6354  H H    . HIS A 1 24 ? -0.378  -9.137  6.101   1.00 0.90 ? 24  HIS A H    5  
ATOM 6355  H HA   . HIS A 1 24 ? -0.871  -7.982  8.738   1.00 0.84 ? 24  HIS A HA   5  
ATOM 6356  H HB2  . HIS A 1 24 ? -0.491  -6.550  6.701   1.00 0.91 ? 24  HIS A HB2  5  
ATOM 6357  H HB3  . HIS A 1 24 ? -2.008  -7.152  6.064   1.00 0.87 ? 24  HIS A HB3  5  
ATOM 6358  H HD1  . HIS A 1 24 ? -0.676  -5.125  8.938   1.00 0.98 ? 24  HIS A HD1  5  
ATOM 6359  H HD2  . HIS A 1 24 ? -4.224  -5.871  6.915   1.00 0.82 ? 24  HIS A HD2  5  
ATOM 6360  H HE1  . HIS A 1 24 ? -2.296  -3.431  9.796   1.00 0.95 ? 24  HIS A HE1  5  
ATOM 6361  H HE2  . HIS A 1 24 ? -4.421  -3.826  8.500   1.00 0.82 ? 24  HIS A HE2  5  
ATOM 6362  N N    . ILE A 1 25 ? -3.081  -9.673  7.002   1.00 0.80 ? 25  ILE A N    5  
ATOM 6363  C CA   . ILE A 1 25 ? -4.384  -10.323 7.046   1.00 0.86 ? 25  ILE A CA   5  
ATOM 6364  C C    . ILE A 1 25 ? -4.263  -11.827 6.792   1.00 0.81 ? 25  ILE A C    5  
ATOM 6365  O O    . ILE A 1 25 ? -3.626  -12.250 5.825   1.00 0.80 ? 25  ILE A O    5  
ATOM 6366  C CB   . ILE A 1 25 ? -5.343  -9.690  6.010   1.00 0.95 ? 25  ILE A CB   5  
ATOM 6367  C CG1  . ILE A 1 25 ? -5.399  -8.166  6.184   1.00 1.01 ? 25  ILE A CG1  5  
ATOM 6368  C CG2  . ILE A 1 25 ? -6.739  -10.285 6.123   1.00 1.51 ? 25  ILE A CG2  5  
ATOM 6369  C CD1  . ILE A 1 25 ? -5.988  -7.718  7.507   1.00 1.16 ? 25  ILE A CD1  5  
ATOM 6370  H H    . ILE A 1 25 ? -2.487  -9.831  6.238   1.00 0.77 ? 25  ILE A H    5  
ATOM 6371  H HA   . ILE A 1 25 ? -4.801  -10.166 8.031   1.00 0.92 ? 25  ILE A HA   5  
ATOM 6372  H HB   . ILE A 1 25 ? -4.965  -9.912  5.026   1.00 1.28 ? 25  ILE A HB   5  
ATOM 6373  H HG12 . ILE A 1 25 ? -4.398  -7.768  6.117   1.00 1.40 ? 25  ILE A HG12 5  
ATOM 6374  H HG13 . ILE A 1 25 ? -6.002  -7.745  5.393   1.00 1.51 ? 25  ILE A HG13 5  
ATOM 6375  H HG21 . ILE A 1 25 ? -7.399  -9.562  6.581   1.00 1.96 ? 25  ILE A HG21 5  
ATOM 6376  H HG22 . ILE A 1 25 ? -6.706  -11.177 6.728   1.00 1.82 ? 25  ILE A HG22 5  
ATOM 6377  H HG23 . ILE A 1 25 ? -7.105  -10.530 5.138   1.00 1.95 ? 25  ILE A HG23 5  
ATOM 6378  H HD11 . ILE A 1 25 ? -6.401  -8.569  8.028   1.00 1.53 ? 25  ILE A HD11 5  
ATOM 6379  H HD12 . ILE A 1 25 ? -6.770  -6.994  7.325   1.00 1.45 ? 25  ILE A HD12 5  
ATOM 6380  H HD13 . ILE A 1 25 ? -5.216  -7.266  8.111   1.00 1.78 ? 25  ILE A HD13 5  
ATOM 6381  N N    . PRO A 1 26 ? -4.881  -12.659 7.660   1.00 0.82 ? 26  PRO A N    5  
ATOM 6382  C CA   . PRO A 1 26 ? -4.843  -14.122 7.527   1.00 0.82 ? 26  PRO A CA   5  
ATOM 6383  C C    . PRO A 1 26 ? -5.424  -14.586 6.193   1.00 0.86 ? 26  PRO A C    5  
ATOM 6384  O O    . PRO A 1 26 ? -6.565  -14.264 5.858   1.00 0.95 ? 26  PRO A O    5  
ATOM 6385  C CB   . PRO A 1 26 ? -5.704  -14.623 8.695   1.00 0.88 ? 26  PRO A CB   5  
ATOM 6386  C CG   . PRO A 1 26 ? -6.515  -13.445 9.115   1.00 0.98 ? 26  PRO A CG   5  
ATOM 6387  C CD   . PRO A 1 26 ? -5.664  -12.241 8.834   1.00 0.87 ? 26  PRO A CD   5  
ATOM 6388  H HA   . PRO A 1 26 ? -3.837  -14.501 7.630   1.00 0.79 ? 26  PRO A HA   5  
ATOM 6389  H HB2  . PRO A 1 26 ? -6.333  -15.435 8.359   1.00 1.04 ? 26  PRO A HB2  5  
ATOM 6390  H HB3  . PRO A 1 26 ? -5.064  -14.965 9.495   1.00 0.96 ? 26  PRO A HB3  5  
ATOM 6391  H HG2  . PRO A 1 26 ? -7.427  -13.402 8.537   1.00 1.27 ? 26  PRO A HG2  5  
ATOM 6392  H HG3  . PRO A 1 26 ? -6.739  -13.509 10.168  1.00 1.26 ? 26  PRO A HG3  5  
ATOM 6393  H HD2  . PRO A 1 26 ? -6.285  -11.386 8.603   1.00 0.94 ? 26  PRO A HD2  5  
ATOM 6394  H HD3  . PRO A 1 26 ? -5.021  -12.027 9.674   1.00 0.95 ? 26  PRO A HD3  5  
ATOM 6395  N N    . GLY A 1 27 ? -4.623  -15.331 5.430   1.00 0.85 ? 27  GLY A N    5  
ATOM 6396  C CA   . GLY A 1 27 ? -5.065  -15.814 4.134   1.00 0.94 ? 27  GLY A CA   5  
ATOM 6397  C C    . GLY A 1 27 ? -4.569  -14.932 3.001   1.00 0.92 ? 27  GLY A C    5  
ATOM 6398  O O    . GLY A 1 27 ? -4.006  -15.428 2.023   1.00 1.06 ? 27  GLY A O    5  
ATOM 6399  H H    . GLY A 1 27 ? -3.721  -15.544 5.746   1.00 0.81 ? 27  GLY A H    5  
ATOM 6400  H HA2  . GLY A 1 27 ? -4.692  -16.816 3.987   1.00 1.04 ? 27  GLY A HA2  5  
ATOM 6401  H HA3  . GLY A 1 27 ? -6.143  -15.833 4.115   1.00 1.00 ? 27  GLY A HA3  5  
ATOM 6402  N N    . ASP A 1 28 ? -4.775  -13.620 3.137   1.00 0.80 ? 28  ASP A N    5  
ATOM 6403  C CA   . ASP A 1 28 ? -4.345  -12.662 2.125   1.00 0.80 ? 28  ASP A CA   5  
ATOM 6404  C C    . ASP A 1 28 ? -2.979  -12.073 2.480   1.00 0.65 ? 28  ASP A C    5  
ATOM 6405  O O    . ASP A 1 28 ? -2.878  -11.176 3.319   1.00 0.57 ? 28  ASP A O    5  
ATOM 6406  C CB   . ASP A 1 28 ? -5.381  -11.539 1.980   1.00 0.91 ? 28  ASP A CB   5  
ATOM 6407  C CG   . ASP A 1 28 ? -5.938  -11.439 0.573   1.00 1.08 ? 28  ASP A CG   5  
ATOM 6408  O OD1  . ASP A 1 28 ? -6.619  -12.389 0.133   1.00 1.68 ? 28  ASP A OD1  5  
ATOM 6409  O OD2  . ASP A 1 28 ? -5.696  -10.407 -0.089  1.00 1.48 ? 28  ASP A OD2  5  
ATOM 6410  H H    . ASP A 1 28 ? -5.227  -13.289 3.941   1.00 0.76 ? 28  ASP A H    5  
ATOM 6411  H HA   . ASP A 1 28 ? -4.264  -13.186 1.185   1.00 0.92 ? 28  ASP A HA   5  
ATOM 6412  H HB2  . ASP A 1 28 ? -6.201  -11.726 2.658   1.00 1.05 ? 28  ASP A HB2  5  
ATOM 6413  H HB3  . ASP A 1 28 ? -4.919  -10.596 2.233   1.00 0.85 ? 28  ASP A HB3  5  
ATOM 6414  N N    . ASN A 1 29 ? -1.930  -12.590 1.836   1.00 0.69 ? 29  ASN A N    5  
ATOM 6415  C CA   . ASN A 1 29 ? -0.562  -12.121 2.084   1.00 0.63 ? 29  ASN A CA   5  
ATOM 6416  C C    . ASN A 1 29 ? -0.242  -10.836 1.300   1.00 0.59 ? 29  ASN A C    5  
ATOM 6417  O O    . ASN A 1 29 ? 0.927   -10.536 1.046   1.00 0.65 ? 29  ASN A O    5  
ATOM 6418  C CB   . ASN A 1 29 ? 0.445   -13.215 1.726   1.00 0.79 ? 29  ASN A CB   5  
ATOM 6419  C CG   . ASN A 1 29 ? 0.243   -14.481 2.540   1.00 1.36 ? 29  ASN A CG   5  
ATOM 6420  O OD1  . ASN A 1 29 ? 0.525   -14.513 3.738   1.00 2.11 ? 29  ASN A OD1  5  
ATOM 6421  N ND2  . ASN A 1 29 ? -0.247  -15.534 1.892   1.00 1.98 ? 29  ASN A ND2  5  
ATOM 6422  H H    . ASN A 1 29 ? -2.081  -13.309 1.187   1.00 0.80 ? 29  ASN A H    5  
ATOM 6423  H HA   . ASN A 1 29 ? -0.475  -11.910 3.141   1.00 0.58 ? 29  ASN A HA   5  
ATOM 6424  H HB2  . ASN A 1 29 ? 0.343   -13.460 0.681   1.00 1.38 ? 29  ASN A HB2  5  
ATOM 6425  H HB3  . ASN A 1 29 ? 1.444   -12.848 1.912   1.00 1.03 ? 29  ASN A HB3  5  
ATOM 6426  H HD21 . ASN A 1 29 ? -0.450  -15.440 0.937   1.00 2.27 ? 29  ASN A HD21 5  
ATOM 6427  H HD22 . ASN A 1 29 ? -0.386  -16.363 2.396   1.00 2.54 ? 29  ASN A HD22 5  
ATOM 6428  N N    . SER A 1 30 ? -1.279  -10.066 0.945   1.00 0.56 ? 30  SER A N    5  
ATOM 6429  C CA   . SER A 1 30 ? -1.101  -8.805  0.223   1.00 0.56 ? 30  SER A CA   5  
ATOM 6430  C C    . SER A 1 30 ? -0.445  -7.772  1.136   1.00 0.55 ? 30  SER A C    5  
ATOM 6431  O O    . SER A 1 30 ? -0.142  -8.071  2.294   1.00 0.55 ? 30  SER A O    5  
ATOM 6432  C CB   . SER A 1 30 ? -2.446  -8.280  -0.294  1.00 0.60 ? 30  SER A CB   5  
ATOM 6433  O OG   . SER A 1 30 ? -3.183  -9.304  -0.938  1.00 1.39 ? 30  SER A OG   5  
ATOM 6434  H H    . SER A 1 30 ? -2.183  -10.339 1.192   1.00 0.58 ? 30  SER A H    5  
ATOM 6435  H HA   . SER A 1 30 ? -0.448  -8.993  -0.616  1.00 0.60 ? 30  SER A HA   5  
ATOM 6436  H HB2  . SER A 1 30 ? -3.026  -7.902  0.534   1.00 1.26 ? 30  SER A HB2  5  
ATOM 6437  H HB3  . SER A 1 30 ? -2.269  -7.482  -1.001  1.00 1.02 ? 30  SER A HB3  5  
ATOM 6438  H HG   . SER A 1 30 ? -3.927  -9.557  -0.388  1.00 1.77 ? 30  SER A HG   5  
ATOM 6439  N N    . ILE A 1 31 ? -0.242  -6.551  0.637   1.00 0.55 ? 31  ILE A N    5  
ATOM 6440  C CA   . ILE A 1 31 ? 0.362   -5.516  1.470   1.00 0.55 ? 31  ILE A CA   5  
ATOM 6441  C C    . ILE A 1 31 ? -0.690  -4.503  1.942   1.00 0.57 ? 31  ILE A C    5  
ATOM 6442  O O    . ILE A 1 31 ? -1.200  -3.699  1.164   1.00 0.65 ? 31  ILE A O    5  
ATOM 6443  C CB   . ILE A 1 31 ? 1.535   -4.791  0.761   1.00 0.53 ? 31  ILE A CB   5  
ATOM 6444  C CG1  . ILE A 1 31 ? 2.480   -5.790  0.068   1.00 0.62 ? 31  ILE A CG1  5  
ATOM 6445  C CG2  . ILE A 1 31 ? 2.305   -3.932  1.752   1.00 0.60 ? 31  ILE A CG2  5  
ATOM 6446  C CD1  . ILE A 1 31 ? 2.573   -7.153  0.728   1.00 0.80 ? 31  ILE A CD1  5  
ATOM 6447  H H    . ILE A 1 31 ? -0.538  -6.348  -0.276  1.00 0.57 ? 31  ILE A H    5  
ATOM 6448  H HA   . ILE A 1 31 ? 0.761   -6.010  2.341   1.00 0.54 ? 31  ILE A HA   5  
ATOM 6449  H HB   . ILE A 1 31 ? 1.126   -4.135  0.017   1.00 0.74 ? 31  ILE A HB   5  
ATOM 6450  H HG12 . ILE A 1 31 ? 2.141   -5.942  -0.942  1.00 1.20 ? 31  ILE A HG12 5  
ATOM 6451  H HG13 . ILE A 1 31 ? 3.473   -5.366  0.040   1.00 1.19 ? 31  ILE A HG13 5  
ATOM 6452  H HG21 . ILE A 1 31 ? 2.910   -4.564  2.383   1.00 1.13 ? 31  ILE A HG21 5  
ATOM 6453  H HG22 . ILE A 1 31 ? 1.610   -3.374  2.361   1.00 1.21 ? 31  ILE A HG22 5  
ATOM 6454  H HG23 . ILE A 1 31 ? 2.942   -3.246  1.214   1.00 1.13 ? 31  ILE A HG23 5  
ATOM 6455  H HD11 . ILE A 1 31 ? 3.590   -7.336  1.041   1.00 1.15 ? 31  ILE A HD11 5  
ATOM 6456  H HD12 . ILE A 1 31 ? 2.273   -7.914  0.024   1.00 1.28 ? 31  ILE A HD12 5  
ATOM 6457  H HD13 . ILE A 1 31 ? 1.924   -7.184  1.587   1.00 1.46 ? 31  ILE A HD13 5  
ATOM 6458  N N    . TYR A 1 32 ? -1.007  -4.578  3.237   1.00 0.60 ? 32  TYR A N    5  
ATOM 6459  C CA   . TYR A 1 32 ? -2.000  -3.705  3.861   1.00 0.62 ? 32  TYR A CA   5  
ATOM 6460  C C    . TYR A 1 32 ? -1.342  -2.605  4.688   1.00 0.59 ? 32  TYR A C    5  
ATOM 6461  O O    . TYR A 1 32 ? -0.289  -2.813  5.287   1.00 0.61 ? 32  TYR A O    5  
ATOM 6462  C CB   . TYR A 1 32 ? -2.918  -4.523  4.768   1.00 0.69 ? 32  TYR A CB   5  
ATOM 6463  C CG   . TYR A 1 32 ? -3.815  -5.494  4.038   1.00 0.71 ? 32  TYR A CG   5  
ATOM 6464  C CD1  . TYR A 1 32 ? -3.288  -6.594  3.372   1.00 1.28 ? 32  TYR A CD1  5  
ATOM 6465  C CD2  . TYR A 1 32 ? -5.192  -5.315  4.024   1.00 1.34 ? 32  TYR A CD2  5  
ATOM 6466  C CE1  . TYR A 1 32 ? -4.106  -7.487  2.711   1.00 1.30 ? 32  TYR A CE1  5  
ATOM 6467  C CE2  . TYR A 1 32 ? -6.020  -6.203  3.371   1.00 1.38 ? 32  TYR A CE2  5  
ATOM 6468  C CZ   . TYR A 1 32 ? -5.473  -7.290  2.714   1.00 0.80 ? 32  TYR A CZ   5  
ATOM 6469  O OH   . TYR A 1 32 ? -6.294  -8.179  2.059   1.00 0.86 ? 32  TYR A OH   5  
ATOM 6470  H H    . TYR A 1 32 ? -0.565  -5.265  3.771   1.00 0.66 ? 32  TYR A H    5  
ATOM 6471  H HA   . TYR A 1 32 ? -2.590  -3.255  3.081   1.00 0.64 ? 32  TYR A HA   5  
ATOM 6472  H HB2  . TYR A 1 32 ? -2.310  -5.091  5.453   1.00 0.68 ? 32  TYR A HB2  5  
ATOM 6473  H HB3  . TYR A 1 32 ? -3.546  -3.847  5.331   1.00 0.74 ? 32  TYR A HB3  5  
ATOM 6474  H HD1  . TYR A 1 32 ? -2.219  -6.745  3.373   1.00 2.05 ? 32  TYR A HD1  5  
ATOM 6475  H HD2  . TYR A 1 32 ? -5.616  -4.465  4.537   1.00 2.10 ? 32  TYR A HD2  5  
ATOM 6476  H HE1  . TYR A 1 32 ? -3.673  -8.333  2.194   1.00 2.06 ? 32  TYR A HE1  5  
ATOM 6477  H HE2  . TYR A 1 32 ? -7.090  -6.040  3.375   1.00 2.17 ? 32  TYR A HE2  5  
ATOM 6478  H HH   . TYR A 1 32 ? -6.553  -8.881  2.661   1.00 1.32 ? 32  TYR A HH   5  
ATOM 6479  N N    . VAL A 1 33 ? -1.993  -1.445  4.740   1.00 0.57 ? 33  VAL A N    5  
ATOM 6480  C CA   . VAL A 1 33 ? -1.495  -0.315  5.524   1.00 0.55 ? 33  VAL A CA   5  
ATOM 6481  C C    . VAL A 1 33 ? -1.837  -0.514  7.001   1.00 0.59 ? 33  VAL A C    5  
ATOM 6482  O O    . VAL A 1 33 ? -2.996  -0.755  7.350   1.00 0.65 ? 33  VAL A O    5  
ATOM 6483  C CB   . VAL A 1 33 ? -2.079  1.025   5.020   1.00 0.59 ? 33  VAL A CB   5  
ATOM 6484  C CG1  . VAL A 1 33 ? -1.716  2.171   5.957   1.00 0.62 ? 33  VAL A CG1  5  
ATOM 6485  C CG2  . VAL A 1 33 ? -1.593  1.313   3.607   1.00 0.56 ? 33  VAL A CG2  5  
ATOM 6486  H H    . VAL A 1 33 ? -2.835  -1.356  4.265   1.00 0.61 ? 33  VAL A H    5  
ATOM 6487  H HA   . VAL A 1 33 ? -0.420  -0.283  5.413   1.00 0.51 ? 33  VAL A HA   5  
ATOM 6488  H HB   . VAL A 1 33 ? -3.155  0.939   4.996   1.00 0.67 ? 33  VAL A HB   5  
ATOM 6489  H HG11 . VAL A 1 33 ? -2.071  1.950   6.953   1.00 1.13 ? 33  VAL A HG11 5  
ATOM 6490  H HG12 . VAL A 1 33 ? -2.177  3.082   5.606   1.00 1.12 ? 33  VAL A HG12 5  
ATOM 6491  H HG13 . VAL A 1 33 ? -0.644  2.296   5.978   1.00 1.21 ? 33  VAL A HG13 5  
ATOM 6492  H HG21 . VAL A 1 33 ? -0.788  0.638   3.357   1.00 1.23 ? 33  VAL A HG21 5  
ATOM 6493  H HG22 . VAL A 1 33 ? -1.240  2.332   3.546   1.00 0.96 ? 33  VAL A HG22 5  
ATOM 6494  H HG23 . VAL A 1 33 ? -2.407  1.173   2.911   1.00 1.26 ? 33  VAL A HG23 5  
ATOM 6495  N N    . THR A 1 34 ? -0.817  -0.454  7.858   1.00 0.62 ? 34  THR A N    5  
ATOM 6496  C CA   . THR A 1 34 ? -1.003  -0.674  9.294   1.00 0.71 ? 34  THR A CA   5  
ATOM 6497  C C    . THR A 1 34 ? -1.142  0.626   10.098  1.00 0.72 ? 34  THR A C    5  
ATOM 6498  O O    . THR A 1 34 ? -1.772  0.626   11.155  1.00 0.84 ? 34  THR A O    5  
ATOM 6499  C CB   . THR A 1 34 ? 0.160   -1.506  9.852   1.00 0.74 ? 34  THR A CB   5  
ATOM 6500  O OG1  . THR A 1 34 ? 1.319   -0.708  10.027  1.00 1.39 ? 34  THR A OG1  5  
ATOM 6501  C CG2  . THR A 1 34 ? 0.545   -2.677  8.970   1.00 1.29 ? 34  THR A CG2  5  
ATOM 6502  H H    . THR A 1 34 ? 0.085   -0.291  7.510   1.00 0.62 ? 34  THR A H    5  
ATOM 6503  H HA   . THR A 1 34 ? -1.912  -1.244  9.417   1.00 0.81 ? 34  THR A HA   5  
ATOM 6504  H HB   . THR A 1 34 ? -0.126  -1.901  10.816  1.00 1.08 ? 34  THR A HB   5  
ATOM 6505  H HG1  . THR A 1 34 ? 1.654   -0.820  10.919  1.00 1.62 ? 34  THR A HG1  5  
ATOM 6506  H HG21 . THR A 1 34 ? 0.409   -3.598  9.516   1.00 1.65 ? 34  THR A HG21 5  
ATOM 6507  H HG22 . THR A 1 34 ? 1.580   -2.583  8.677   1.00 1.98 ? 34  THR A HG22 5  
ATOM 6508  H HG23 . THR A 1 34 ? -0.079  -2.687  8.090   1.00 1.56 ? 34  THR A HG23 5  
ATOM 6509  N N    . LYS A 1 35 ? -0.553  1.724   9.610   1.00 0.65 ? 35  LYS A N    5  
ATOM 6510  C CA   . LYS A 1 35 ? -0.619  3.009   10.320  1.00 0.71 ? 35  LYS A CA   5  
ATOM 6511  C C    . LYS A 1 35 ? -0.283  4.183   9.403   1.00 0.69 ? 35  LYS A C    5  
ATOM 6512  O O    . LYS A 1 35 ? 0.794   4.222   8.809   1.00 0.62 ? 35  LYS A O    5  
ATOM 6513  C CB   . LYS A 1 35 ? 0.359   3.017   11.504  1.00 0.72 ? 35  LYS A CB   5  
ATOM 6514  C CG   . LYS A 1 35 ? -0.126  2.248   12.722  1.00 1.32 ? 35  LYS A CG   5  
ATOM 6515  C CD   . LYS A 1 35 ? 0.373   2.876   14.014  1.00 1.46 ? 35  LYS A CD   5  
ATOM 6516  C CE   . LYS A 1 35 ? 0.238   1.921   15.192  1.00 2.02 ? 35  LYS A CE   5  
ATOM 6517  N NZ   . LYS A 1 35 ? 1.537   1.705   15.888  1.00 2.54 ? 35  LYS A NZ   5  
ATOM 6518  H H    . LYS A 1 35 ? -0.064  1.670   8.762   1.00 0.59 ? 35  LYS A H    5  
ATOM 6519  H HA   . LYS A 1 35 ? -1.624  3.134   10.695  1.00 0.80 ? 35  LYS A HA   5  
ATOM 6520  H HB2  . LYS A 1 35 ? 1.294   2.586   11.183  1.00 0.98 ? 35  LYS A HB2  5  
ATOM 6521  H HB3  . LYS A 1 35 ? 0.532   4.042   11.800  1.00 1.18 ? 35  LYS A HB3  5  
ATOM 6522  H HG2  . LYS A 1 35 ? -1.205  2.246   12.729  1.00 1.91 ? 35  LYS A HG2  5  
ATOM 6523  H HG3  . LYS A 1 35 ? 0.239   1.233   12.660  1.00 2.08 ? 35  LYS A HG3  5  
ATOM 6524  H HD2  . LYS A 1 35 ? 1.414   3.139   13.897  1.00 1.89 ? 35  LYS A HD2  5  
ATOM 6525  H HD3  . LYS A 1 35 ? -0.204  3.767   14.216  1.00 1.86 ? 35  LYS A HD3  5  
ATOM 6526  H HE2  . LYS A 1 35 ? -0.470  2.336   15.895  1.00 2.47 ? 35  LYS A HE2  5  
ATOM 6527  H HE3  . LYS A 1 35 ? -0.130  0.972   14.830  1.00 2.40 ? 35  LYS A HE3  5  
ATOM 6528  H HZ1  . LYS A 1 35 ? 1.920   2.614   16.221  1.00 2.55 ? 35  LYS A HZ1  5  
ATOM 6529  H HZ2  . LYS A 1 35 ? 2.223   1.270   15.238  1.00 2.90 ? 35  LYS A HZ2  5  
ATOM 6530  H HZ3  . LYS A 1 35 ? 1.405   1.077   16.706  1.00 3.18 ? 35  LYS A HZ3  5  
ATOM 6531  N N    . ILE A 1 36 ? -1.195  5.148   9.307   1.00 0.86 ? 36  ILE A N    5  
ATOM 6532  C CA   . ILE A 1 36 ? -0.969  6.327   8.475   1.00 0.92 ? 36  ILE A CA   5  
ATOM 6533  C C    . ILE A 1 36 ? -0.539  7.524   9.330   1.00 0.98 ? 36  ILE A C    5  
ATOM 6534  O O    . ILE A 1 36 ? -1.262  7.941   10.237  1.00 1.06 ? 36  ILE A O    5  
ATOM 6535  C CB   . ILE A 1 36 ? -2.224  6.702   7.657   1.00 1.03 ? 36  ILE A CB   5  
ATOM 6536  C CG1  . ILE A 1 36 ? -2.746  5.477   6.894   1.00 1.40 ? 36  ILE A CG1  5  
ATOM 6537  C CG2  . ILE A 1 36 ? -1.904  7.842   6.697   1.00 1.12 ? 36  ILE A CG2  5  
ATOM 6538  C CD1  . ILE A 1 36 ? -3.594  5.817   5.686   1.00 1.35 ? 36  ILE A CD1  5  
ATOM 6539  H H    . ILE A 1 36 ? -2.033  5.071   9.811   1.00 0.98 ? 36  ILE A H    5  
ATOM 6540  H HA   . ILE A 1 36 ? -0.175  6.088   7.781   1.00 0.85 ? 36  ILE A HA   5  
ATOM 6541  H HB   . ILE A 1 36 ? -2.985  7.043   8.342   1.00 0.95 ? 36  ILE A HB   5  
ATOM 6542  H HG12 . ILE A 1 36 ? -1.906  4.891   6.551   1.00 1.63 ? 36  ILE A HG12 5  
ATOM 6543  H HG13 . ILE A 1 36 ? -3.346  4.876   7.563   1.00 1.62 ? 36  ILE A HG13 5  
ATOM 6544  H HG21 . ILE A 1 36 ? -2.822  8.317   6.384   1.00 1.46 ? 36  ILE A HG21 5  
ATOM 6545  H HG22 . ILE A 1 36 ? -1.388  7.453   5.832   1.00 1.45 ? 36  ILE A HG22 5  
ATOM 6546  H HG23 . ILE A 1 36 ? -1.276  8.567   7.194   1.00 1.44 ? 36  ILE A HG23 5  
ATOM 6547  H HD11 . ILE A 1 36 ? -4.215  4.971   5.433   1.00 1.87 ? 36  ILE A HD11 5  
ATOM 6548  H HD12 . ILE A 1 36 ? -2.951  6.054   4.850   1.00 1.71 ? 36  ILE A HD12 5  
ATOM 6549  H HD13 . ILE A 1 36 ? -4.218  6.669   5.912   1.00 1.41 ? 36  ILE A HD13 5  
ATOM 6550  N N    . ILE A 1 37 ? 0.643   8.073   9.030   1.00 1.03 ? 37  ILE A N    5  
ATOM 6551  C CA   . ILE A 1 37 ? 1.179   9.222   9.761   1.00 1.10 ? 37  ILE A CA   5  
ATOM 6552  C C    . ILE A 1 37 ? 0.461   10.511  9.352   1.00 1.10 ? 37  ILE A C    5  
ATOM 6553  O O    . ILE A 1 37 ? 0.042   10.659  8.203   1.00 1.37 ? 37  ILE A O    5  
ATOM 6554  C CB   . ILE A 1 37 ? 2.702   9.379   9.518   1.00 1.14 ? 37  ILE A CB   5  
ATOM 6555  C CG1  . ILE A 1 37 ? 3.480   8.268   10.228  1.00 1.47 ? 37  ILE A CG1  5  
ATOM 6556  C CG2  . ILE A 1 37 ? 3.195   10.744  9.982   1.00 1.32 ? 37  ILE A CG2  5  
ATOM 6557  C CD1  . ILE A 1 37 ? 3.516   6.961   9.467   1.00 1.68 ? 37  ILE A CD1  5  
ATOM 6558  H H    . ILE A 1 37 ? 1.168   7.697   8.294   1.00 1.06 ? 37  ILE A H    5  
ATOM 6559  H HA   . ILE A 1 37 ? 1.017   9.049   10.816  1.00 1.17 ? 37  ILE A HA   5  
ATOM 6560  H HB   . ILE A 1 37 ? 2.880   9.307   8.455   1.00 1.07 ? 37  ILE A HB   5  
ATOM 6561  H HG12 . ILE A 1 37 ? 4.499   8.591   10.372  1.00 1.63 ? 37  ILE A HG12 5  
ATOM 6562  H HG13 . ILE A 1 37 ? 3.027   8.080   11.191  1.00 1.84 ? 37  ILE A HG13 5  
ATOM 6563  H HG21 . ILE A 1 37 ? 2.874   11.500  9.282   1.00 1.40 ? 37  ILE A HG21 5  
ATOM 6564  H HG22 . ILE A 1 37 ? 4.273   10.738  10.035  1.00 1.79 ? 37  ILE A HG22 5  
ATOM 6565  H HG23 . ILE A 1 37 ? 2.788   10.961  10.959  1.00 1.90 ? 37  ILE A HG23 5  
ATOM 6566  H HD11 . ILE A 1 37 ? 3.726   7.156   8.425   1.00 2.18 ? 37  ILE A HD11 5  
ATOM 6567  H HD12 . ILE A 1 37 ? 2.561   6.465   9.555   1.00 1.92 ? 37  ILE A HD12 5  
ATOM 6568  H HD13 . ILE A 1 37 ? 4.289   6.328   9.876   1.00 1.93 ? 37  ILE A HD13 5  
ATOM 6569  N N    . GLU A 1 38 ? 0.328   11.440  10.302  1.00 0.96 ? 38  GLU A N    5  
ATOM 6570  C CA   . GLU A 1 38 ? -0.335  12.719  10.042  1.00 0.99 ? 38  GLU A CA   5  
ATOM 6571  C C    . GLU A 1 38 ? 0.419   13.521  8.984   1.00 1.31 ? 38  GLU A C    5  
ATOM 6572  O O    . GLU A 1 38 ? 1.647   13.451  8.893   1.00 1.64 ? 38  GLU A O    5  
ATOM 6573  C CB   . GLU A 1 38 ? -0.453  13.534  11.334  1.00 1.23 ? 38  GLU A CB   5  
ATOM 6574  C CG   . GLU A 1 38 ? -1.650  13.148  12.191  1.00 1.71 ? 38  GLU A CG   5  
ATOM 6575  C CD   . GLU A 1 38 ? -1.504  11.776  12.823  1.00 2.41 ? 38  GLU A CD   5  
ATOM 6576  O OE1  . GLU A 1 38 ? -0.898  11.686  13.912  1.00 2.79 ? 38  GLU A OE1  5  
ATOM 6577  O OE2  . GLU A 1 38 ? -1.992  10.792  12.227  1.00 3.11 ? 38  GLU A OE2  5  
ATOM 6578  H H    . GLU A 1 38 ? 0.684   11.262  11.197  1.00 0.97 ? 38  GLU A H    5  
ATOM 6579  H HA   . GLU A 1 38 ? -1.328  12.505  9.672   1.00 1.23 ? 38  GLU A HA   5  
ATOM 6580  H HB2  . GLU A 1 38 ? 0.443   13.390  11.921  1.00 1.66 ? 38  GLU A HB2  5  
ATOM 6581  H HB3  . GLU A 1 38 ? -0.542  14.579  11.080  1.00 1.49 ? 38  GLU A HB3  5  
ATOM 6582  H HG2  . GLU A 1 38 ? -1.763  13.880  12.978  1.00 2.01 ? 38  GLU A HG2  5  
ATOM 6583  H HG3  . GLU A 1 38 ? -2.536  13.149  11.571  1.00 1.90 ? 38  GLU A HG3  5  
ATOM 6584  N N    . GLY A 1 39 ? -0.329  14.284  8.184   1.00 1.69 ? 39  GLY A N    5  
ATOM 6585  C CA   . GLY A 1 39 ? 0.270   15.096  7.133   1.00 2.36 ? 39  GLY A CA   5  
ATOM 6586  C C    . GLY A 1 39 ? 1.033   14.280  6.093   1.00 2.68 ? 39  GLY A C    5  
ATOM 6587  O O    . GLY A 1 39 ? 1.842   14.834  5.347   1.00 3.15 ? 39  GLY A O    5  
ATOM 6588  H H    . GLY A 1 39 ? -1.298  14.302  8.312   1.00 1.72 ? 39  GLY A H    5  
ATOM 6589  H HA2  . GLY A 1 39 ? -0.514  15.645  6.633   1.00 2.72 ? 39  GLY A HA2  5  
ATOM 6590  H HA3  . GLY A 1 39 ? 0.949   15.801  7.588   1.00 2.45 ? 39  GLY A HA3  5  
ATOM 6591  N N    . GLY A 1 40 ? 0.781   12.967  6.046   1.00 2.49 ? 40  GLY A N    5  
ATOM 6592  C CA   . GLY A 1 40 ? 1.463   12.108  5.091   1.00 2.80 ? 40  GLY A CA   5  
ATOM 6593  C C    . GLY A 1 40 ? 0.749   12.029  3.752   1.00 2.61 ? 40  GLY A C    5  
ATOM 6594  O O    . GLY A 1 40 ? -0.403  12.446  3.633   1.00 2.37 ? 40  GLY A O    5  
ATOM 6595  H H    . GLY A 1 40 ? 0.131   12.579  6.667   1.00 2.19 ? 40  GLY A H    5  
ATOM 6596  H HA2  . GLY A 1 40 ? 2.462   12.487  4.931   1.00 3.27 ? 40  GLY A HA2  5  
ATOM 6597  H HA3  . GLY A 1 40 ? 1.532   11.113  5.507   1.00 2.80 ? 40  GLY A HA3  5  
ATOM 6598  N N    . ALA A 1 41 ? 1.444   11.496  2.744   1.00 2.83 ? 41  ALA A N    5  
ATOM 6599  C CA   . ALA A 1 41 ? 0.890   11.357  1.395   1.00 2.70 ? 41  ALA A CA   5  
ATOM 6600  C C    . ALA A 1 41 ? -0.523  10.771  1.414   1.00 2.11 ? 41  ALA A C    5  
ATOM 6601  O O    . ALA A 1 41 ? -1.459  11.384  0.901   1.00 2.06 ? 41  ALA A O    5  
ATOM 6602  C CB   . ALA A 1 41 ? 1.804   10.494  0.536   1.00 3.00 ? 41  ALA A CB   5  
ATOM 6603  H H    . ALA A 1 41 ? 2.361   11.192  2.911   1.00 3.11 ? 41  ALA A H    5  
ATOM 6604  H HA   . ALA A 1 41 ? 0.850   12.342  0.951   1.00 2.91 ? 41  ALA A HA   5  
ATOM 6605  H HB1  . ALA A 1 41 ? 1.708   9.460   0.836   1.00 3.45 ? 41  ALA A HB1  5  
ATOM 6606  H HB2  . ALA A 1 41 ? 2.827   10.813  0.666   1.00 3.26 ? 41  ALA A HB2  5  
ATOM 6607  H HB3  . ALA A 1 41 ? 1.526   10.596  -0.501  1.00 2.99 ? 41  ALA A HB3  5  
ATOM 6608  N N    . ALA A 1 42 ? -0.671  9.584   2.010   1.00 1.82 ? 42  ALA A N    5  
ATOM 6609  C CA   . ALA A 1 42 ? -1.973  8.923   2.095   1.00 1.36 ? 42  ALA A CA   5  
ATOM 6610  C C    . ALA A 1 42 ? -2.921  9.685   3.018   1.00 1.16 ? 42  ALA A C    5  
ATOM 6611  O O    . ALA A 1 42 ? -4.063  9.964   2.651   1.00 1.02 ? 42  ALA A O    5  
ATOM 6612  C CB   . ALA A 1 42 ? -1.811  7.485   2.572   1.00 1.50 ? 42  ALA A CB   5  
ATOM 6613  H H    . ALA A 1 42 ? 0.112   9.145   2.404   1.00 2.06 ? 42  ALA A H    5  
ATOM 6614  H HA   . ALA A 1 42 ? -2.398  8.900   1.102   1.00 1.30 ? 42  ALA A HA   5  
ATOM 6615  H HB1  . ALA A 1 42 ? -1.208  7.468   3.467   1.00 1.77 ? 42  ALA A HB1  5  
ATOM 6616  H HB2  . ALA A 1 42 ? -1.327  6.903   1.801   1.00 1.88 ? 42  ALA A HB2  5  
ATOM 6617  H HB3  . ALA A 1 42 ? -2.783  7.064   2.783   1.00 1.93 ? 42  ALA A HB3  5  
ATOM 6618  N N    . HIS A 1 43 ? -2.437  10.016  4.219   1.00 1.34 ? 43  HIS A N    5  
ATOM 6619  C CA   . HIS A 1 43 ? -3.230  10.748  5.210   1.00 1.21 ? 43  HIS A CA   5  
ATOM 6620  C C    . HIS A 1 43 ? -3.886  11.991  4.602   1.00 1.08 ? 43  HIS A C    5  
ATOM 6621  O O    . HIS A 1 43 ? -5.071  12.245  4.823   1.00 1.15 ? 43  HIS A O    5  
ATOM 6622  C CB   . HIS A 1 43 ? -2.338  11.154  6.388   1.00 1.39 ? 43  HIS A CB   5  
ATOM 6623  C CG   . HIS A 1 43 ? -3.067  11.844  7.498   1.00 1.16 ? 43  HIS A CG   5  
ATOM 6624  N ND1  . HIS A 1 43 ? -3.292  13.204  7.517   1.00 1.34 ? 43  HIS A ND1  5  
ATOM 6625  C CD2  . HIS A 1 43 ? -3.612  11.358  8.637   1.00 1.15 ? 43  HIS A CD2  5  
ATOM 6626  C CE1  . HIS A 1 43 ? -3.941  13.526  8.620   1.00 1.22 ? 43  HIS A CE1  5  
ATOM 6627  N NE2  . HIS A 1 43 ? -4.149  12.423  9.318   1.00 1.28 ? 43  HIS A NE2  5  
ATOM 6628  H H    . HIS A 1 43 ? -1.520  9.752   4.448   1.00 1.62 ? 43  HIS A H    5  
ATOM 6629  H HA   . HIS A 1 43 ? -4.003  10.086  5.570   1.00 1.26 ? 43  HIS A HA   5  
ATOM 6630  H HB2  . HIS A 1 43 ? -1.873  10.271  6.797   1.00 1.74 ? 43  HIS A HB2  5  
ATOM 6631  H HB3  . HIS A 1 43 ? -1.568  11.822  6.030   1.00 1.58 ? 43  HIS A HB3  5  
ATOM 6632  H HD1  . HIS A 1 43 ? -3.015  13.839  6.824   1.00 1.69 ? 43  HIS A HD1  5  
ATOM 6633  H HD2  . HIS A 1 43 ? -3.624  10.322  8.952   1.00 1.32 ? 43  HIS A HD2  5  
ATOM 6634  H HE1  . HIS A 1 43 ? -4.244  14.521  8.906   1.00 1.34 ? 43  HIS A HE1  5  
ATOM 6635  H HE2  . HIS A 1 43 ? -4.529  12.389  10.220  1.00 1.60 ? 43  HIS A HE2  5  
ATOM 6636  N N    . LYS A 1 44 ? -3.107  12.759  3.839   1.00 1.15 ? 44  LYS A N    5  
ATOM 6637  C CA   . LYS A 1 44 ? -3.605  13.977  3.200   1.00 1.31 ? 44  LYS A CA   5  
ATOM 6638  C C    . LYS A 1 44 ? -4.495  13.656  1.997   1.00 1.39 ? 44  LYS A C    5  
ATOM 6639  O O    . LYS A 1 44 ? -5.477  14.357  1.744   1.00 1.46 ? 44  LYS A O    5  
ATOM 6640  C CB   . LYS A 1 44 ? -2.435  14.862  2.765   1.00 1.74 ? 44  LYS A CB   5  
ATOM 6641  C CG   . LYS A 1 44 ? -1.688  15.494  3.929   1.00 1.89 ? 44  LYS A CG   5  
ATOM 6642  C CD   . LYS A 1 44 ? -0.573  16.408  3.447   1.00 2.36 ? 44  LYS A CD   5  
ATOM 6643  C CE   . LYS A 1 44 ? -0.390  17.603  4.372   1.00 2.17 ? 44  LYS A CE   5  
ATOM 6644  N NZ   . LYS A 1 44 ? 1.039   17.813  4.736   1.00 2.66 ? 44  LYS A NZ   5  
ATOM 6645  H H    . LYS A 1 44 ? -2.171  12.501  3.704   1.00 1.26 ? 44  LYS A H    5  
ATOM 6646  H HA   . LYS A 1 44 ? -4.193  14.512  3.930   1.00 1.30 ? 44  LYS A HA   5  
ATOM 6647  H HB2  . LYS A 1 44 ? -1.738  14.264  2.198   1.00 2.10 ? 44  LYS A HB2  5  
ATOM 6648  H HB3  . LYS A 1 44 ? -2.813  15.654  2.135   1.00 2.02 ? 44  LYS A HB3  5  
ATOM 6649  H HG2  . LYS A 1 44 ? -2.384  16.071  4.520   1.00 1.94 ? 44  LYS A HG2  5  
ATOM 6650  H HG3  . LYS A 1 44 ? -1.261  14.710  4.536   1.00 2.08 ? 44  LYS A HG3  5  
ATOM 6651  H HD2  . LYS A 1 44 ? 0.349   15.848  3.413   1.00 2.71 ? 44  LYS A HD2  5  
ATOM 6652  H HD3  . LYS A 1 44 ? -0.816  16.766  2.457   1.00 2.84 ? 44  LYS A HD3  5  
ATOM 6653  H HE2  . LYS A 1 44 ? -0.758  18.487  3.875   1.00 2.08 ? 44  LYS A HE2  5  
ATOM 6654  H HE3  . LYS A 1 44 ? -0.961  17.435  5.274   1.00 2.50 ? 44  LYS A HE3  5  
ATOM 6655  H HZ1  . LYS A 1 44 ? 1.601   18.008  3.883   1.00 3.12 ? 44  LYS A HZ1  5  
ATOM 6656  H HZ2  . LYS A 1 44 ? 1.419   16.964  5.202   1.00 3.21 ? 44  LYS A HZ2  5  
ATOM 6657  H HZ3  . LYS A 1 44 ? 1.128   18.620  5.386   1.00 2.66 ? 44  LYS A HZ3  5  
ATOM 6658  N N    . ASP A 1 45 ? -4.149  12.596  1.261   1.00 1.59 ? 45  ASP A N    5  
ATOM 6659  C CA   . ASP A 1 45 ? -4.922  12.185  0.087   1.00 1.86 ? 45  ASP A CA   5  
ATOM 6660  C C    . ASP A 1 45 ? -6.341  11.776  0.484   1.00 1.89 ? 45  ASP A C    5  
ATOM 6661  O O    . ASP A 1 45 ? -7.318  12.267  -0.085  1.00 1.97 ? 45  ASP A O    5  
ATOM 6662  C CB   . ASP A 1 45 ? -4.225  11.024  -0.631  1.00 2.33 ? 45  ASP A CB   5  
ATOM 6663  C CG   . ASP A 1 45 ? -4.660  10.888  -2.078  1.00 2.69 ? 45  ASP A CG   5  
ATOM 6664  O OD1  . ASP A 1 45 ? -5.776  10.380  -2.320  1.00 3.24 ? 45  ASP A OD1  5  
ATOM 6665  O OD2  . ASP A 1 45 ? -3.883  11.287  -2.971  1.00 2.80 ? 45  ASP A OD2  5  
ATOM 6666  H H    . ASP A 1 45 ? -3.358  12.075  1.514   1.00 1.67 ? 45  ASP A H    5  
ATOM 6667  H HA   . ASP A 1 45 ? -4.978  13.029  -0.583  1.00 1.92 ? 45  ASP A HA   5  
ATOM 6668  H HB2  . ASP A 1 45 ? -3.158  11.185  -0.611  1.00 2.40 ? 45  ASP A HB2  5  
ATOM 6669  H HB3  . ASP A 1 45 ? -4.453  10.102  -0.117  1.00 2.46 ? 45  ASP A HB3  5  
ATOM 6670  N N    . GLY A 1 46 ? -6.442  10.874  1.462   1.00 2.08 ? 46  GLY A N    5  
ATOM 6671  C CA   . GLY A 1 46 ? -7.739  10.408  1.924   1.00 2.49 ? 46  GLY A CA   5  
ATOM 6672  C C    . GLY A 1 46 ? -8.175  9.108   1.266   1.00 2.11 ? 46  GLY A C    5  
ATOM 6673  O O    . GLY A 1 46 ? -8.877  8.305   1.885   1.00 2.47 ? 46  GLY A O    5  
ATOM 6674  H H    . GLY A 1 46 ? -5.622  10.525  1.870   1.00 2.09 ? 46  GLY A H    5  
ATOM 6675  H HA2  . GLY A 1 46 ? -7.691  10.256  2.993   1.00 2.83 ? 46  GLY A HA2  5  
ATOM 6676  H HA3  . GLY A 1 46 ? -8.476  11.168  1.715   1.00 3.17 ? 46  GLY A HA3  5  
ATOM 6677  N N    . LYS A 1 47 ? -7.762  8.898   0.011   1.00 1.87 ? 47  LYS A N    5  
ATOM 6678  C CA   . LYS A 1 47 ? -8.116  7.686   -0.727  1.00 2.32 ? 47  LYS A CA   5  
ATOM 6679  C C    . LYS A 1 47 ? -7.680  6.433   0.034   1.00 1.93 ? 47  LYS A C    5  
ATOM 6680  O O    . LYS A 1 47 ? -8.476  5.515   0.236   1.00 1.95 ? 47  LYS A O    5  
ATOM 6681  C CB   . LYS A 1 47 ? -7.479  7.703   -2.121  1.00 2.80 ? 47  LYS A CB   5  
ATOM 6682  C CG   . LYS A 1 47 ? -8.075  6.685   -3.081  1.00 3.64 ? 47  LYS A CG   5  
ATOM 6683  C CD   . LYS A 1 47 ? -7.701  6.992   -4.523  1.00 4.17 ? 47  LYS A CD   5  
ATOM 6684  C CE   . LYS A 1 47 ? -8.867  7.601   -5.287  1.00 5.03 ? 47  LYS A CE   5  
ATOM 6685  N NZ   . LYS A 1 47 ? -8.511  7.898   -6.703  1.00 5.67 ? 47  LYS A NZ   5  
ATOM 6686  H H    . LYS A 1 47 ? -7.204  9.575   -0.427  1.00 1.83 ? 47  LYS A H    5  
ATOM 6687  H HA   . LYS A 1 47 ? -9.190  7.668   -0.834  1.00 3.00 ? 47  LYS A HA   5  
ATOM 6688  H HB2  . LYS A 1 47 ? -7.608  8.686   -2.549  1.00 2.86 ? 47  LYS A HB2  5  
ATOM 6689  H HB3  . LYS A 1 47 ? -6.423  7.499   -2.023  1.00 3.00 ? 47  LYS A HB3  5  
ATOM 6690  H HG2  . LYS A 1 47 ? -7.705  5.704   -2.824  1.00 4.05 ? 47  LYS A HG2  5  
ATOM 6691  H HG3  . LYS A 1 47 ? -9.152  6.702   -2.985  1.00 3.92 ? 47  LYS A HG3  5  
ATOM 6692  H HD2  . LYS A 1 47 ? -6.876  7.686   -4.532  1.00 4.28 ? 47  LYS A HD2  5  
ATOM 6693  H HD3  . LYS A 1 47 ? -7.405  6.073   -5.010  1.00 4.30 ? 47  LYS A HD3  5  
ATOM 6694  H HE2  . LYS A 1 47 ? -9.694  6.907   -5.271  1.00 5.17 ? 47  LYS A HE2  5  
ATOM 6695  H HE3  . LYS A 1 47 ? -9.160  8.518   -4.798  1.00 5.45 ? 47  LYS A HE3  5  
ATOM 6696  H HZ1  . LYS A 1 47 ? -9.371  8.103   -7.252  1.00 5.78 ? 47  LYS A HZ1  5  
ATOM 6697  H HZ2  . LYS A 1 47 ? -8.026  7.083   -7.129  1.00 5.80 ? 47  LYS A HZ2  5  
ATOM 6698  H HZ3  . LYS A 1 47 ? -7.880  8.725   -6.747  1.00 6.21 ? 47  LYS A HZ3  5  
ATOM 6699  N N    . LEU A 1 48 ? -6.413  6.405   0.454   1.00 1.68 ? 48  LEU A N    5  
ATOM 6700  C CA   . LEU A 1 48 ? -5.880  5.264   1.194   1.00 1.38 ? 48  LEU A CA   5  
ATOM 6701  C C    . LEU A 1 48 ? -6.237  5.352   2.677   1.00 1.28 ? 48  LEU A C    5  
ATOM 6702  O O    . LEU A 1 48 ? -5.862  6.304   3.366   1.00 1.35 ? 48  LEU A O    5  
ATOM 6703  C CB   . LEU A 1 48 ? -4.359  5.170   1.025   1.00 1.19 ? 48  LEU A CB   5  
ATOM 6704  C CG   . LEU A 1 48 ? -3.765  3.778   1.270   1.00 1.09 ? 48  LEU A CG   5  
ATOM 6705  C CD1  . LEU A 1 48 ? -2.398  3.655   0.615   1.00 1.56 ? 48  LEU A CD1  5  
ATOM 6706  C CD2  . LEU A 1 48 ? -3.671  3.489   2.761   1.00 1.06 ? 48  LEU A CD2  5  
ATOM 6707  H H    . LEU A 1 48 ? -5.830  7.168   0.261   1.00 1.80 ? 48  LEU A H    5  
ATOM 6708  H HA   . LEU A 1 48 ? -6.329  4.372   0.785   1.00 1.52 ? 48  LEU A HA   5  
ATOM 6709  H HB2  . LEU A 1 48 ? -4.110  5.474   0.018   1.00 1.43 ? 48  LEU A HB2  5  
ATOM 6710  H HB3  . LEU A 1 48 ? -3.897  5.861   1.715   1.00 1.29 ? 48  LEU A HB3  5  
ATOM 6711  H HG   . LEU A 1 48 ? -4.414  3.033   0.829   1.00 1.25 ? 48  LEU A HG   5  
ATOM 6712  H HD11 . LEU A 1 48 ? -2.470  3.937   -0.426  1.00 2.04 ? 48  LEU A HD11 5  
ATOM 6713  H HD12 . LEU A 1 48 ? -2.056  2.633   0.686   1.00 1.85 ? 48  LEU A HD12 5  
ATOM 6714  H HD13 . LEU A 1 48 ? -1.697  4.306   1.117   1.00 2.03 ? 48  LEU A HD13 5  
ATOM 6715  H HD21 . LEU A 1 48 ? -4.079  2.508   2.959   1.00 1.74 ? 48  LEU A HD21 5  
ATOM 6716  H HD22 . LEU A 1 48 ? -4.233  4.228   3.309   1.00 1.43 ? 48  LEU A HD22 5  
ATOM 6717  H HD23 . LEU A 1 48 ? -2.637  3.519   3.071   1.00 1.30 ? 48  LEU A HD23 5  
ATOM 6718  N N    . GLN A 1 49 ? -6.959  4.342   3.156   1.00 1.21 ? 49  GLN A N    5  
ATOM 6719  C CA   . GLN A 1 49 ? -7.374  4.265   4.550   1.00 1.17 ? 49  GLN A CA   5  
ATOM 6720  C C    . GLN A 1 49 ? -7.067  2.879   5.117   1.00 1.09 ? 49  GLN A C    5  
ATOM 6721  O O    . GLN A 1 49 ? -7.116  1.885   4.392   1.00 1.14 ? 49  GLN A O    5  
ATOM 6722  C CB   . GLN A 1 49 ? -8.871  4.575   4.676   1.00 1.30 ? 49  GLN A CB   5  
ATOM 6723  C CG   . GLN A 1 49 ? -9.789  3.439   4.239   1.00 1.46 ? 49  GLN A CG   5  
ATOM 6724  C CD   . GLN A 1 49 ? -9.862  3.288   2.731   1.00 1.45 ? 49  GLN A CD   5  
ATOM 6725  O OE1  . GLN A 1 49 ? -10.514 4.078   2.047   1.00 1.54 ? 49  GLN A OE1  5  
ATOM 6726  N NE2  . GLN A 1 49 ? -9.192  2.269   2.201   1.00 1.52 ? 49  GLN A NE2  5  
ATOM 6727  H H    . GLN A 1 49 ? -7.214  3.619   2.552   1.00 1.26 ? 49  GLN A H    5  
ATOM 6728  H HA   . GLN A 1 49 ? -6.815  5.001   5.107   1.00 1.19 ? 49  GLN A HA   5  
ATOM 6729  H HB2  . GLN A 1 49 ? -9.087  4.800   5.705   1.00 1.32 ? 49  GLN A HB2  5  
ATOM 6730  H HB3  . GLN A 1 49 ? -9.096  5.442   4.074   1.00 1.34 ? 49  GLN A HB3  5  
ATOM 6731  H HG2  . GLN A 1 49 ? -9.423  2.515   4.660   1.00 1.57 ? 49  GLN A HG2  5  
ATOM 6732  H HG3  . GLN A 1 49 ? -10.783 3.635   4.615   1.00 1.59 ? 49  GLN A HG3  5  
ATOM 6733  H HE21 . GLN A 1 49 ? -8.692  1.679   2.805   1.00 1.62 ? 49  GLN A HE21 5  
ATOM 6734  H HE22 . GLN A 1 49 ? -9.221  2.151   1.229   1.00 1.56 ? 49  GLN A HE22 5  
ATOM 6735  N N    . ILE A 1 50 ? -6.749  2.818   6.412   1.00 1.06 ? 50  ILE A N    5  
ATOM 6736  C CA   . ILE A 1 50 ? -6.430  1.548   7.073   1.00 1.03 ? 50  ILE A CA   5  
ATOM 6737  C C    . ILE A 1 50 ? -7.370  0.426   6.623   1.00 1.05 ? 50  ILE A C    5  
ATOM 6738  O O    . ILE A 1 50 ? -8.577  0.636   6.482   1.00 1.16 ? 50  ILE A O    5  
ATOM 6739  C CB   . ILE A 1 50 ? -6.502  1.674   8.613   1.00 1.08 ? 50  ILE A CB   5  
ATOM 6740  C CG1  . ILE A 1 50 ? -7.827  2.315   9.044   1.00 1.76 ? 50  ILE A CG1  5  
ATOM 6741  C CG2  . ILE A 1 50 ? -5.321  2.481   9.135   1.00 1.14 ? 50  ILE A CG2  5  
ATOM 6742  C CD1  . ILE A 1 50 ? -8.525  1.568   10.160  1.00 2.56 ? 50  ILE A CD1  5  
ATOM 6743  H H    . ILE A 1 50 ? -6.724  3.648   6.934   1.00 1.12 ? 50  ILE A H    5  
ATOM 6744  H HA   . ILE A 1 50 ? -5.417  1.282   6.805   1.00 1.00 ? 50  ILE A HA   5  
ATOM 6745  H HB   . ILE A 1 50 ? -6.437  0.682   9.033   1.00 1.51 ? 50  ILE A HB   5  
ATOM 6746  H HG12 . ILE A 1 50 ? -7.638  3.321   9.388   1.00 1.94 ? 50  ILE A HG12 5  
ATOM 6747  H HG13 . ILE A 1 50 ? -8.496  2.350   8.198   1.00 2.32 ? 50  ILE A HG13 5  
ATOM 6748  H HG21 . ILE A 1 50 ? -5.159  2.247   10.177  1.00 1.55 ? 50  ILE A HG21 5  
ATOM 6749  H HG22 . ILE A 1 50 ? -5.531  3.536   9.031   1.00 1.63 ? 50  ILE A HG22 5  
ATOM 6750  H HG23 . ILE A 1 50 ? -4.435  2.232   8.569   1.00 1.57 ? 50  ILE A HG23 5  
ATOM 6751  H HD11 . ILE A 1 50 ? -7.913  1.594   11.049  1.00 3.13 ? 50  ILE A HD11 5  
ATOM 6752  H HD12 . ILE A 1 50 ? -8.684  0.542   9.862   1.00 2.96 ? 50  ILE A HD12 5  
ATOM 6753  H HD13 . ILE A 1 50 ? -9.477  2.035   10.365  1.00 2.79 ? 50  ILE A HD13 5  
ATOM 6754  N N    . GLY A 1 51 ? -6.811  -0.769  6.411   1.00 1.02 ? 51  GLY A N    5  
ATOM 6755  C CA   . GLY A 1 51 ? -7.616  -1.906  5.991   1.00 1.10 ? 51  GLY A CA   5  
ATOM 6756  C C    . GLY A 1 51 ? -7.518  -2.219  4.506   1.00 1.04 ? 51  GLY A C    5  
ATOM 6757  O O    . GLY A 1 51 ? -7.833  -3.340  4.099   1.00 1.03 ? 51  GLY A O    5  
ATOM 6758  H H    . GLY A 1 51 ? -5.849  -0.890  6.553   1.00 0.99 ? 51  GLY A H    5  
ATOM 6759  H HA2  . GLY A 1 51 ? -7.293  -2.775  6.544   1.00 1.22 ? 51  GLY A HA2  5  
ATOM 6760  H HA3  . GLY A 1 51 ? -8.649  -1.714  6.233   1.00 1.14 ? 51  GLY A HA3  5  
ATOM 6761  N N    . ASP A 1 52 ? -7.090  -1.253  3.685   1.00 1.04 ? 52  ASP A N    5  
ATOM 6762  C CA   . ASP A 1 52 ? -6.975  -1.485  2.256   1.00 1.01 ? 52  ASP A CA   5  
ATOM 6763  C C    . ASP A 1 52 ? -5.778  -2.371  1.932   1.00 0.91 ? 52  ASP A C    5  
ATOM 6764  O O    . ASP A 1 52 ? -4.779  -2.388  2.668   1.00 0.88 ? 52  ASP A O    5  
ATOM 6765  C CB   . ASP A 1 52 ? -6.883  -0.165  1.478   1.00 1.03 ? 52  ASP A CB   5  
ATOM 6766  C CG   . ASP A 1 52 ? -5.881  0.823   2.044   1.00 1.11 ? 52  ASP A CG   5  
ATOM 6767  O OD1  . ASP A 1 52 ? -4.879  0.394   2.658   1.00 1.55 ? 52  ASP A OD1  5  
ATOM 6768  O OD2  . ASP A 1 52 ? -6.101  2.034   1.862   1.00 1.56 ? 52  ASP A OD2  5  
ATOM 6769  H H    . ASP A 1 52 ? -6.846  -0.376  4.038   1.00 1.07 ? 52  ASP A H    5  
ATOM 6770  H HA   . ASP A 1 52 ? -7.870  -1.998  1.950   1.00 1.08 ? 52  ASP A HA   5  
ATOM 6771  H HB2  . ASP A 1 52 ? -6.594  -0.375  0.461   1.00 0.99 ? 52  ASP A HB2  5  
ATOM 6772  H HB3  . ASP A 1 52 ? -7.854  0.304   1.478   1.00 1.18 ? 52  ASP A HB3  5  
ATOM 6773  N N    . LYS A 1 53 ? -5.883  -3.092  0.817   1.00 0.88 ? 53  LYS A N    5  
ATOM 6774  C CA   . LYS A 1 53 ? -4.812  -3.969  0.375   1.00 0.82 ? 53  LYS A CA   5  
ATOM 6775  C C    . LYS A 1 53 ? -4.150  -3.414  -0.879  1.00 0.76 ? 53  LYS A C    5  
ATOM 6776  O O    . LYS A 1 53 ? -4.786  -2.740  -1.690  1.00 0.87 ? 53  LYS A O    5  
ATOM 6777  C CB   . LYS A 1 53 ? -5.339  -5.382  0.109   1.00 0.94 ? 53  LYS A CB   5  
ATOM 6778  C CG   . LYS A 1 53 ? -6.491  -5.439  -0.882  1.00 1.33 ? 53  LYS A CG   5  
ATOM 6779  C CD   . LYS A 1 53 ? -7.816  -5.697  -0.178  1.00 1.83 ? 53  LYS A CD   5  
ATOM 6780  C CE   . LYS A 1 53 ? -8.570  -6.856  -0.812  1.00 2.37 ? 53  LYS A CE   5  
ATOM 6781  N NZ   . LYS A 1 53 ? -7.951  -8.171  -0.487  1.00 3.23 ? 53  LYS A NZ   5  
ATOM 6782  H H    . LYS A 1 53 ? -6.694  -3.015  0.271   1.00 0.92 ? 53  LYS A H    5  
ATOM 6783  H HA   . LYS A 1 53 ? -4.076  -4.015  1.163   1.00 0.82 ? 53  LYS A HA   5  
ATOM 6784  H HB2  . LYS A 1 53 ? -4.533  -5.987  -0.278  1.00 1.54 ? 53  LYS A HB2  5  
ATOM 6785  H HB3  . LYS A 1 53 ? -5.676  -5.804  1.040   1.00 1.39 ? 53  LYS A HB3  5  
ATOM 6786  H HG2  . LYS A 1 53 ? -6.551  -4.497  -1.405  1.00 1.78 ? 53  LYS A HG2  5  
ATOM 6787  H HG3  . LYS A 1 53 ? -6.307  -6.235  -1.587  1.00 1.86 ? 53  LYS A HG3  5  
ATOM 6788  H HD2  . LYS A 1 53 ? -7.623  -5.931  0.859   1.00 2.39 ? 53  LYS A HD2  5  
ATOM 6789  H HD3  . LYS A 1 53 ? -8.424  -4.807  -0.239  1.00 2.03 ? 53  LYS A HD3  5  
ATOM 6790  H HE2  . LYS A 1 53 ? -9.586  -6.849  -0.449  1.00 2.44 ? 53  LYS A HE2  5  
ATOM 6791  H HE3  . LYS A 1 53 ? -8.571  -6.724  -1.884  1.00 2.77 ? 53  LYS A HE3  5  
ATOM 6792  H HZ1  . LYS A 1 53 ? -7.861  -8.278  0.545   1.00 3.81 ? 53  LYS A HZ1  5  
ATOM 6793  H HZ2  . LYS A 1 53 ? -7.004  -8.237  -0.915  1.00 3.55 ? 53  LYS A HZ2  5  
ATOM 6794  H HZ3  . LYS A 1 53 ? -8.539  -8.944  -0.854  1.00 3.45 ? 53  LYS A HZ3  5  
ATOM 6795  N N    . LEU A 1 54 ? -2.865  -3.691  -1.004  1.00 0.64 ? 54  LEU A N    5  
ATOM 6796  C CA   . LEU A 1 54 ? -2.087  -3.205  -2.137  1.00 0.66 ? 54  LEU A CA   5  
ATOM 6797  C C    . LEU A 1 54 ? -2.063  -4.212  -3.280  1.00 0.64 ? 54  LEU A C    5  
ATOM 6798  O O    . LEU A 1 54 ? -1.467  -5.286  -3.168  1.00 0.79 ? 54  LEU A O    5  
ATOM 6799  C CB   . LEU A 1 54 ? -0.667  -2.863  -1.700  1.00 0.73 ? 54  LEU A CB   5  
ATOM 6800  C CG   . LEU A 1 54 ? -0.453  -1.404  -1.289  1.00 0.83 ? 54  LEU A CG   5  
ATOM 6801  C CD1  . LEU A 1 54 ? 0.595   -1.301  -0.190  1.00 1.11 ? 54  LEU A CD1  5  
ATOM 6802  C CD2  . LEU A 1 54 ? -0.054  -0.567  -2.494  1.00 1.72 ? 54  LEU A CD2  5  
ATOM 6803  H H    . LEU A 1 54 ? -2.440  -4.209  -0.283  1.00 0.62 ? 54  LEU A H    5  
ATOM 6804  H HA   . LEU A 1 54 ? -2.562  -2.302  -2.491  1.00 0.75 ? 54  LEU A HA   5  
ATOM 6805  H HB2  . LEU A 1 54 ? -0.421  -3.491  -0.865  1.00 1.24 ? 54  LEU A HB2  5  
ATOM 6806  H HB3  . LEU A 1 54 ? 0.006   -3.088  -2.512  1.00 1.21 ? 54  LEU A HB3  5  
ATOM 6807  H HG   . LEU A 1 54 ? -1.381  -1.009  -0.899  1.00 1.18 ? 54  LEU A HG   5  
ATOM 6808  H HD11 . LEU A 1 54 ? 0.630   -2.227  0.365   1.00 1.58 ? 54  LEU A HD11 5  
ATOM 6809  H HD12 . LEU A 1 54 ? 0.338   -0.492  0.478   1.00 1.88 ? 54  LEU A HD12 5  
ATOM 6810  H HD13 . LEU A 1 54 ? 1.562   -1.110  -0.631  1.00 1.17 ? 54  LEU A HD13 5  
ATOM 6811  H HD21 . LEU A 1 54 ? 0.692   -1.096  -3.068  1.00 2.31 ? 54  LEU A HD21 5  
ATOM 6812  H HD22 . LEU A 1 54 ? 0.352   0.376   -2.159  1.00 2.00 ? 54  LEU A HD22 5  
ATOM 6813  H HD23 . LEU A 1 54 ? -0.922  -0.388  -3.111  1.00 2.08 ? 54  LEU A HD23 5  
ATOM 6814  N N    . LEU A 1 55 ? -2.705  -3.839  -4.386  1.00 0.56 ? 55  LEU A N    5  
ATOM 6815  C CA   . LEU A 1 55 ? -2.756  -4.679  -5.571  1.00 0.58 ? 55  LEU A CA   5  
ATOM 6816  C C    . LEU A 1 55 ? -1.416  -4.637  -6.293  1.00 0.54 ? 55  LEU A C    5  
ATOM 6817  O O    . LEU A 1 55 ? -0.835  -5.683  -6.588  1.00 0.56 ? 55  LEU A O    5  
ATOM 6818  C CB   . LEU A 1 55 ? -3.878  -4.217  -6.507  1.00 0.66 ? 55  LEU A CB   5  
ATOM 6819  C CG   . LEU A 1 55 ? -4.082  -5.079  -7.756  1.00 0.91 ? 55  LEU A CG   5  
ATOM 6820  C CD1  . LEU A 1 55 ? -5.499  -5.632  -7.799  1.00 1.27 ? 55  LEU A CD1  5  
ATOM 6821  C CD2  . LEU A 1 55 ? -3.781  -4.276  -9.014  1.00 1.87 ? 55  LEU A CD2  5  
ATOM 6822  H H    . LEU A 1 55 ? -3.143  -2.967  -4.412  1.00 0.58 ? 55  LEU A H    5  
ATOM 6823  H HA   . LEU A 1 55 ? -2.953  -5.692  -5.255  1.00 0.62 ? 55  LEU A HA   5  
ATOM 6824  H HB2  . LEU A 1 55 ? -4.801  -4.207  -5.946  1.00 0.75 ? 55  LEU A HB2  5  
ATOM 6825  H HB3  . LEU A 1 55 ? -3.660  -3.208  -6.824  1.00 0.98 ? 55  LEU A HB3  5  
ATOM 6826  H HG   . LEU A 1 55 ? -3.400  -5.916  -7.723  1.00 1.50 ? 55  LEU A HG   5  
ATOM 6827  H HD11 . LEU A 1 55 ? -5.653  -6.293  -6.959  1.00 1.70 ? 55  LEU A HD11 5  
ATOM 6828  H HD12 . LEU A 1 55 ? -5.644  -6.179  -8.719  1.00 1.74 ? 55  LEU A HD12 5  
ATOM 6829  H HD13 . LEU A 1 55 ? -6.205  -4.817  -7.750  1.00 1.86 ? 55  LEU A HD13 5  
ATOM 6830  H HD21 . LEU A 1 55 ? -2.791  -4.524  -9.371  1.00 2.39 ? 55  LEU A HD21 5  
ATOM 6831  H HD22 . LEU A 1 55 ? -3.828  -3.221  -8.789  1.00 2.39 ? 55  LEU A HD22 5  
ATOM 6832  H HD23 . LEU A 1 55 ? -4.508  -4.514  -9.777  1.00 2.37 ? 55  LEU A HD23 5  
ATOM 6833  N N    . ALA A 1 56 ? -0.921  -3.423  -6.570  1.00 0.51 ? 56  ALA A N    5  
ATOM 6834  C CA   . ALA A 1 56 ? 0.366   -3.276  -7.252  1.00 0.49 ? 56  ALA A CA   5  
ATOM 6835  C C    . ALA A 1 56 ? 0.984   -1.894  -7.009  1.00 0.53 ? 56  ALA A C    5  
ATOM 6836  O O    . ALA A 1 56 ? 0.285   -0.946  -6.665  1.00 0.67 ? 56  ALA A O    5  
ATOM 6837  C CB   . ALA A 1 56 ? 0.190   -3.515  -8.753  1.00 0.54 ? 56  ALA A CB   5  
ATOM 6838  H H    . ALA A 1 56 ? -1.432  -2.611  -6.308  1.00 0.53 ? 56  ALA A H    5  
ATOM 6839  H HA   . ALA A 1 56 ? 1.036   -4.039  -6.859  1.00 0.52 ? 56  ALA A HA   5  
ATOM 6840  H HB1  . ALA A 1 56 ? -0.603  -2.884  -9.125  1.00 1.19 ? 56  ALA A HB1  5  
ATOM 6841  H HB2  . ALA A 1 56 ? -0.064  -4.552  -8.929  1.00 0.99 ? 56  ALA A HB2  5  
ATOM 6842  H HB3  . ALA A 1 56 ? 1.109   -3.277  -9.270  1.00 1.25 ? 56  ALA A HB3  5  
ATOM 6843  N N    . VAL A 1 57 ? 2.305   -1.786  -7.189  1.00 0.50 ? 57  VAL A N    5  
ATOM 6844  C CA   . VAL A 1 57 ? 3.006   -0.516  -6.994  1.00 0.59 ? 57  VAL A CA   5  
ATOM 6845  C C    . VAL A 1 57 ? 4.163   -0.359  -7.979  1.00 0.53 ? 57  VAL A C    5  
ATOM 6846  O O    . VAL A 1 57 ? 5.133   -1.113  -7.938  1.00 0.52 ? 57  VAL A O    5  
ATOM 6847  C CB   . VAL A 1 57 ? 3.547   -0.361  -5.554  1.00 0.77 ? 57  VAL A CB   5  
ATOM 6848  C CG1  . VAL A 1 57 ? 2.488   0.243   -4.645  1.00 1.42 ? 57  VAL A CG1  5  
ATOM 6849  C CG2  . VAL A 1 57 ? 4.032   -1.694  -5.006  1.00 1.47 ? 57  VAL A CG2  5  
ATOM 6850  H H    . VAL A 1 57 ? 2.818   -2.584  -7.456  1.00 0.48 ? 57  VAL A H    5  
ATOM 6851  H HA   . VAL A 1 57 ? 2.295   0.279   -7.170  1.00 0.66 ? 57  VAL A HA   5  
ATOM 6852  H HB   . VAL A 1 57 ? 4.389   0.318   -5.581  1.00 1.34 ? 57  VAL A HB   5  
ATOM 6853  H HG11 . VAL A 1 57 ? 1.601   -0.373  -4.666  1.00 1.89 ? 57  VAL A HG11 5  
ATOM 6854  H HG12 . VAL A 1 57 ? 2.243   1.237   -4.988  1.00 1.82 ? 57  VAL A HG12 5  
ATOM 6855  H HG13 . VAL A 1 57 ? 2.867   0.294   -3.634  1.00 2.12 ? 57  VAL A HG13 5  
ATOM 6856  H HG21 . VAL A 1 57 ? 4.503   -1.538  -4.047  1.00 1.95 ? 57  VAL A HG21 5  
ATOM 6857  H HG22 . VAL A 1 57 ? 4.746   -2.127  -5.691  1.00 1.95 ? 57  VAL A HG22 5  
ATOM 6858  H HG23 . VAL A 1 57 ? 3.192   -2.362  -4.891  1.00 2.01 ? 57  VAL A HG23 5  
ATOM 6859  N N    . ASN A 1 58 ? 4.045   0.626   -8.871  1.00 0.57 ? 58  ASN A N    5  
ATOM 6860  C CA   . ASN A 1 58 ? 5.072   0.896   -9.881  1.00 0.58 ? 58  ASN A CA   5  
ATOM 6861  C C    . ASN A 1 58 ? 5.187   -0.262  -10.882 1.00 0.59 ? 58  ASN A C    5  
ATOM 6862  O O    . ASN A 1 58 ? 6.291   -0.650  -11.274 1.00 0.60 ? 58  ASN A O    5  
ATOM 6863  C CB   . ASN A 1 58 ? 6.427   1.169   -9.215  1.00 0.57 ? 58  ASN A CB   5  
ATOM 6864  C CG   . ASN A 1 58 ? 6.550   2.598   -8.715  1.00 0.80 ? 58  ASN A CG   5  
ATOM 6865  O OD1  . ASN A 1 58 ? 7.130   3.453   -9.385  1.00 1.39 ? 58  ASN A OD1  5  
ATOM 6866  N ND2  . ASN A 1 58 ? 6.004   2.866   -7.533  1.00 1.49 ? 58  ASN A ND2  5  
ATOM 6867  H H    . ASN A 1 58 ? 3.237   1.182   -8.854  1.00 0.63 ? 58  ASN A H    5  
ATOM 6868  H HA   . ASN A 1 58 ? 4.768   1.781   -10.421 1.00 0.65 ? 58  ASN A HA   5  
ATOM 6869  H HB2  . ASN A 1 58 ? 6.552   0.504   -8.374  1.00 0.64 ? 58  ASN A HB2  5  
ATOM 6870  H HB3  . ASN A 1 58 ? 7.217   0.990   -9.930  1.00 0.74 ? 58  ASN A HB3  5  
ATOM 6871  H HD21 . ASN A 1 58 ? 5.558   2.139   -7.051  1.00 2.05 ? 58  ASN A HD21 5  
ATOM 6872  H HD22 . ASN A 1 58 ? 6.070   3.782   -7.191  1.00 1.75 ? 58  ASN A HD22 5  
ATOM 6873  N N    . ASN A 1 59 ? 4.029   -0.795  -11.291 1.00 0.60 ? 59  ASN A N    5  
ATOM 6874  C CA   . ASN A 1 59 ? 3.953   -1.900  -12.257 1.00 0.65 ? 59  ASN A CA   5  
ATOM 6875  C C    . ASN A 1 59 ? 4.120   -3.282  -11.604 1.00 0.61 ? 59  ASN A C    5  
ATOM 6876  O O    . ASN A 1 59 ? 3.771   -4.293  -12.217 1.00 0.67 ? 59  ASN A O    5  
ATOM 6877  C CB   . ASN A 1 59 ? 4.991   -1.723  -13.374 1.00 0.71 ? 59  ASN A CB   5  
ATOM 6878  C CG   . ASN A 1 59 ? 4.601   -2.445  -14.651 1.00 1.18 ? 59  ASN A CG   5  
ATOM 6879  O OD1  . ASN A 1 59 ? 3.716   -2.001  -15.382 1.00 1.74 ? 59  ASN A OD1  5  
ATOM 6880  N ND2  . ASN A 1 59 ? 5.263   -3.566  -14.927 1.00 1.52 ? 59  ASN A ND2  5  
ATOM 6881  H H    . ASN A 1 59 ? 3.197   -0.420  -10.931 1.00 0.61 ? 59  ASN A H    5  
ATOM 6882  H HA   . ASN A 1 59 ? 2.970   -1.861  -12.703 1.00 0.68 ? 59  ASN A HA   5  
ATOM 6883  H HB2  . ASN A 1 59 ? 5.095   -0.671  -13.596 1.00 0.83 ? 59  ASN A HB2  5  
ATOM 6884  H HB3  . ASN A 1 59 ? 5.941   -2.111  -13.038 1.00 0.74 ? 59  ASN A HB3  5  
ATOM 6885  H HD21 . ASN A 1 59 ? 5.957   -3.862  -14.301 1.00 1.74 ? 59  ASN A HD21 5  
ATOM 6886  H HD22 . ASN A 1 59 ? 5.028   -4.051  -15.746 1.00 1.84 ? 59  ASN A HD22 5  
ATOM 6887  N N    . VAL A 1 60 ? 4.640   -3.337  -10.372 1.00 0.53 ? 60  VAL A N    5  
ATOM 6888  C CA   . VAL A 1 60 ? 4.819   -4.620  -9.687  1.00 0.52 ? 60  VAL A CA   5  
ATOM 6889  C C    . VAL A 1 60 ? 3.615   -4.933  -8.804  1.00 0.51 ? 60  VAL A C    5  
ATOM 6890  O O    . VAL A 1 60 ? 3.019   -4.031  -8.227  1.00 0.50 ? 60  VAL A O    5  
ATOM 6891  C CB   . VAL A 1 60 ? 6.099   -4.654  -8.816  1.00 0.50 ? 60  VAL A CB   5  
ATOM 6892  C CG1  . VAL A 1 60 ? 7.337   -4.364  -9.653  1.00 0.51 ? 60  VAL A CG1  5  
ATOM 6893  C CG2  . VAL A 1 60 ? 6.005   -3.683  -7.646  1.00 0.54 ? 60  VAL A CG2  5  
ATOM 6894  H H    . VAL A 1 60 ? 4.895   -2.509  -9.913  1.00 0.52 ? 60  VAL A H    5  
ATOM 6895  H HA   . VAL A 1 60 ? 4.904   -5.389  -10.442 1.00 0.56 ? 60  VAL A HA   5  
ATOM 6896  H HB   . VAL A 1 60 ? 6.196   -5.649  -8.412  1.00 0.58 ? 60  VAL A HB   5  
ATOM 6897  H HG11 . VAL A 1 60 ? 7.773   -5.295  -9.985  1.00 1.18 ? 60  VAL A HG11 5  
ATOM 6898  H HG12 . VAL A 1 60 ? 8.057   -3.822  -9.056  1.00 0.93 ? 60  VAL A HG12 5  
ATOM 6899  H HG13 . VAL A 1 60 ? 7.061   -3.769  -10.511 1.00 1.23 ? 60  VAL A HG13 5  
ATOM 6900  H HG21 . VAL A 1 60 ? 6.286   -4.191  -6.735  1.00 0.98 ? 60  VAL A HG21 5  
ATOM 6901  H HG22 . VAL A 1 60 ? 4.994   -3.320  -7.557  1.00 1.15 ? 60  VAL A HG22 5  
ATOM 6902  H HG23 . VAL A 1 60 ? 6.673   -2.851  -7.813  1.00 1.17 ? 60  VAL A HG23 5  
ATOM 6903  N N    . CYS A 1 61 ? 3.269   -6.214  -8.686  1.00 0.53 ? 61  CYS A N    5  
ATOM 6904  C CA   . CYS A 1 61 ? 2.142   -6.612  -7.848  1.00 0.54 ? 61  CYS A CA   5  
ATOM 6905  C C    . CYS A 1 61 ? 2.579   -6.697  -6.390  1.00 0.58 ? 61  CYS A C    5  
ATOM 6906  O O    . CYS A 1 61 ? 3.625   -7.271  -6.078  1.00 0.72 ? 61  CYS A O    5  
ATOM 6907  C CB   . CYS A 1 61 ? 1.556   -7.945  -8.306  1.00 0.56 ? 61  CYS A CB   5  
ATOM 6908  S SG   . CYS A 1 61 ? 2.756   -9.294  -8.415  1.00 0.71 ? 61  CYS A SG   5  
ATOM 6909  H H    . CYS A 1 61 ? 3.789   -6.900  -9.152  1.00 0.55 ? 61  CYS A H    5  
ATOM 6910  H HA   . CYS A 1 61 ? 1.383   -5.846  -7.935  1.00 0.53 ? 61  CYS A HA   5  
ATOM 6911  H HB2  . CYS A 1 61 ? 0.788   -8.243  -7.609  1.00 0.91 ? 61  CYS A HB2  5  
ATOM 6912  H HB3  . CYS A 1 61 ? 1.115   -7.813  -9.282  1.00 0.84 ? 61  CYS A HB3  5  
ATOM 6913  H HG   . CYS A 1 61 ? 2.342   -10.023 -8.881  1.00 1.12 ? 61  CYS A HG   5  
ATOM 6914  N N    . LEU A 1 62 ? 1.765   -6.138  -5.500  1.00 0.55 ? 62  LEU A N    5  
ATOM 6915  C CA   . LEU A 1 62 ? 2.050   -6.161  -4.072  1.00 0.62 ? 62  LEU A CA   5  
ATOM 6916  C C    . LEU A 1 62 ? 1.190   -7.201  -3.335  1.00 0.58 ? 62  LEU A C    5  
ATOM 6917  O O    . LEU A 1 62 ? 0.880   -7.035  -2.151  1.00 0.51 ? 62  LEU A O    5  
ATOM 6918  C CB   . LEU A 1 62 ? 1.853   -4.760  -3.490  1.00 0.77 ? 62  LEU A CB   5  
ATOM 6919  C CG   . LEU A 1 62 ? 3.038   -4.229  -2.678  1.00 0.95 ? 62  LEU A CG   5  
ATOM 6920  C CD1  . LEU A 1 62 ? 4.323   -4.301  -3.489  1.00 1.71 ? 62  LEU A CD1  5  
ATOM 6921  C CD2  . LEU A 1 62 ? 2.773   -2.805  -2.217  1.00 1.08 ? 62  LEU A CD2  5  
ATOM 6922  H H    . LEU A 1 62 ? 0.922   -5.736  -5.797  1.00 0.55 ? 62  LEU A H    5  
ATOM 6923  H HA   . LEU A 1 62 ? 3.088   -6.439  -3.954  1.00 0.72 ? 62  LEU A HA   5  
ATOM 6924  H HB2  . LEU A 1 62 ? 1.672   -4.079  -4.309  1.00 1.26 ? 62  LEU A HB2  5  
ATOM 6925  H HB3  . LEU A 1 62 ? 0.983   -4.771  -2.858  1.00 1.09 ? 62  LEU A HB3  5  
ATOM 6926  H HG   . LEU A 1 62 ? 3.169   -4.843  -1.803  1.00 1.61 ? 62  LEU A HG   5  
ATOM 6927  H HD11 . LEU A 1 62 ? 4.775   -5.275  -3.364  1.00 2.12 ? 62  LEU A HD11 5  
ATOM 6928  H HD12 . LEU A 1 62 ? 5.008   -3.540  -3.146  1.00 2.04 ? 62  LEU A HD12 5  
ATOM 6929  H HD13 . LEU A 1 62 ? 4.100   -4.140  -4.534  1.00 2.37 ? 62  LEU A HD13 5  
ATOM 6930  H HD21 . LEU A 1 62 ? 2.076   -2.331  -2.892  1.00 1.44 ? 62  LEU A HD21 5  
ATOM 6931  H HD22 . LEU A 1 62 ? 3.700   -2.251  -2.210  1.00 1.77 ? 62  LEU A HD22 5  
ATOM 6932  H HD23 . LEU A 1 62 ? 2.355   -2.821  -1.222  1.00 1.57 ? 62  LEU A HD23 5  
ATOM 6933  N N    . GLU A 1 63 ? 0.778   -8.259  -4.039  1.00 0.72 ? 63  GLU A N    5  
ATOM 6934  C CA   . GLU A 1 63 ? -0.067  -9.295  -3.441  1.00 0.80 ? 63  GLU A CA   5  
ATOM 6935  C C    . GLU A 1 63 ? 0.662   -10.636 -3.292  1.00 0.95 ? 63  GLU A C    5  
ATOM 6936  O O    . GLU A 1 63 ? 0.261   -11.467 -2.475  1.00 1.83 ? 63  GLU A O    5  
ATOM 6937  C CB   . GLU A 1 63 ? -1.336  -9.481  -4.276  1.00 0.86 ? 63  GLU A CB   5  
ATOM 6938  C CG   . GLU A 1 63 ? -2.348  -8.360  -4.098  1.00 1.12 ? 63  GLU A CG   5  
ATOM 6939  C CD   . GLU A 1 63 ? -3.477  -8.421  -5.109  1.00 1.31 ? 63  GLU A CD   5  
ATOM 6940  O OE1  . GLU A 1 63 ? -3.268  -7.982  -6.260  1.00 1.96 ? 63  GLU A OE1  5  
ATOM 6941  O OE2  . GLU A 1 63 ? -4.571  -8.905  -4.748  1.00 1.65 ? 63  GLU A OE2  5  
ATOM 6942  H H    . GLU A 1 63 ? 1.027   -8.335  -4.984  1.00 0.83 ? 63  GLU A H    5  
ATOM 6943  H HA   . GLU A 1 63 ? -0.353  -8.953  -2.458  1.00 0.80 ? 63  GLU A HA   5  
ATOM 6944  H HB2  . GLU A 1 63 ? -1.063  -9.530  -5.320  1.00 1.08 ? 63  GLU A HB2  5  
ATOM 6945  H HB3  . GLU A 1 63 ? -1.807  -10.410 -3.992  1.00 1.32 ? 63  GLU A HB3  5  
ATOM 6946  H HG2  . GLU A 1 63 ? -2.770  -8.427  -3.107  1.00 1.64 ? 63  GLU A HG2  5  
ATOM 6947  H HG3  . GLU A 1 63 ? -1.839  -7.413  -4.207  1.00 1.48 ? 63  GLU A HG3  5  
ATOM 6948  N N    . GLU A 1 64 ? 1.722   -10.850 -4.077  1.00 1.04 ? 64  GLU A N    5  
ATOM 6949  C CA   . GLU A 1 64 ? 2.482   -12.101 -4.011  1.00 1.08 ? 64  GLU A CA   5  
ATOM 6950  C C    . GLU A 1 64 ? 3.958   -11.840 -3.693  1.00 0.90 ? 64  GLU A C    5  
ATOM 6951  O O    . GLU A 1 64 ? 4.852   -12.320 -4.393  1.00 0.96 ? 64  GLU A O    5  
ATOM 6952  C CB   . GLU A 1 64 ? 2.346   -12.888 -5.323  1.00 1.28 ? 64  GLU A CB   5  
ATOM 6953  C CG   . GLU A 1 64 ? 2.166   -12.009 -6.547  1.00 1.53 ? 64  GLU A CG   5  
ATOM 6954  C CD   . GLU A 1 64 ? 2.179   -12.797 -7.842  1.00 2.14 ? 64  GLU A CD   5  
ATOM 6955  O OE1  . GLU A 1 64 ? 1.095   -13.238 -8.279  1.00 2.40 ? 64  GLU A OE1  5  
ATOM 6956  O OE2  . GLU A 1 64 ? 3.273   -12.973 -8.420  1.00 2.93 ? 64  GLU A OE2  5  
ATOM 6957  H H    . GLU A 1 64 ? 2.000   -10.157 -4.711  1.00 1.69 ? 64  GLU A H    5  
ATOM 6958  H HA   . GLU A 1 64 ? 2.061   -12.690 -3.215  1.00 1.19 ? 64  GLU A HA   5  
ATOM 6959  H HB2  . GLU A 1 64 ? 3.233   -13.488 -5.464  1.00 1.35 ? 64  GLU A HB2  5  
ATOM 6960  H HB3  . GLU A 1 64 ? 1.490   -13.542 -5.247  1.00 1.23 ? 64  GLU A HB3  5  
ATOM 6961  H HG2  . GLU A 1 64 ? 1.220   -11.495 -6.464  1.00 1.77 ? 64  GLU A HG2  5  
ATOM 6962  H HG3  . GLU A 1 64 ? 2.967   -11.285 -6.573  1.00 1.72 ? 64  GLU A HG3  5  
ATOM 6963  N N    . VAL A 1 65 ? 4.201   -11.076 -2.626  1.00 0.80 ? 65  VAL A N    5  
ATOM 6964  C CA   . VAL A 1 65 ? 5.568   -10.750 -2.212  1.00 0.64 ? 65  VAL A CA   5  
ATOM 6965  C C    . VAL A 1 65 ? 5.717   -10.704 -0.696  1.00 0.64 ? 65  VAL A C    5  
ATOM 6966  O O    . VAL A 1 65 ? 4.756   -10.433 0.031   1.00 0.70 ? 65  VAL A O    5  
ATOM 6967  C CB   . VAL A 1 65 ? 6.042   -9.393  -2.777  1.00 0.56 ? 65  VAL A CB   5  
ATOM 6968  C CG1  . VAL A 1 65 ? 6.252   -9.479  -4.282  1.00 0.64 ? 65  VAL A CG1  5  
ATOM 6969  C CG2  . VAL A 1 65 ? 5.059   -8.281  -2.426  1.00 0.59 ? 65  VAL A CG2  5  
ATOM 6970  H H    . VAL A 1 65 ? 3.440   -10.726 -2.118  1.00 0.90 ? 65  VAL A H    5  
ATOM 6971  H HA   . VAL A 1 65 ? 6.221   -11.518 -2.598  1.00 0.65 ? 65  VAL A HA   5  
ATOM 6972  H HB   . VAL A 1 65 ? 6.993   -9.156  -2.316  1.00 0.50 ? 65  VAL A HB   5  
ATOM 6973  H HG11 . VAL A 1 65 ? 5.327   -9.768  -4.760  1.00 1.20 ? 65  VAL A HG11 5  
ATOM 6974  H HG12 . VAL A 1 65 ? 7.013   -10.213 -4.498  1.00 1.37 ? 65  VAL A HG12 5  
ATOM 6975  H HG13 . VAL A 1 65 ? 6.564   -8.515  -4.658  1.00 0.86 ? 65  VAL A HG13 5  
ATOM 6976  H HG21 . VAL A 1 65 ? 5.378   -7.795  -1.515  1.00 0.99 ? 65  VAL A HG21 5  
ATOM 6977  H HG22 . VAL A 1 65 ? 4.074   -8.700  -2.285  1.00 1.30 ? 65  VAL A HG22 5  
ATOM 6978  H HG23 . VAL A 1 65 ? 5.031   -7.559  -3.228  1.00 1.16 ? 65  VAL A HG23 5  
ATOM 6979  N N    . THR A 1 66 ? 6.946   -10.941 -0.234  1.00 0.63 ? 66  THR A N    5  
ATOM 6980  C CA   . THR A 1 66 ? 7.256   -10.898 1.191   1.00 0.69 ? 66  THR A CA   5  
ATOM 6981  C C    . THR A 1 66 ? 7.148   -9.459  1.696   1.00 0.61 ? 66  THR A C    5  
ATOM 6982  O O    . THR A 1 66 ? 6.831   -8.547  0.925   1.00 0.66 ? 66  THR A O    5  
ATOM 6983  C CB   . THR A 1 66 ? 8.664   -11.448 1.455   1.00 0.74 ? 66  THR A CB   5  
ATOM 6984  O OG1  . THR A 1 66 ? 9.630   -10.749 0.688   1.00 1.53 ? 66  THR A OG1  5  
ATOM 6985  C CG2  . THR A 1 66 ? 8.804   -12.923 1.140   1.00 1.17 ? 66  THR A CG2  5  
ATOM 6986  H H    . THR A 1 66 ? 7.662   -11.129 -0.877  1.00 0.62 ? 66  THR A H    5  
ATOM 6987  H HA   . THR A 1 66 ? 6.532   -11.509 1.710   1.00 0.80 ? 66  THR A HA   5  
ATOM 6988  H HB   . THR A 1 66 ? 8.900   -11.310 2.500   1.00 1.20 ? 66  THR A HB   5  
ATOM 6989  H HG1  . THR A 1 66 ? 9.954   -9.994  1.188   1.00 1.88 ? 66  THR A HG1  5  
ATOM 6990  H HG21 . THR A 1 66 ? 8.998   -13.468 2.052   1.00 1.74 ? 66  THR A HG21 5  
ATOM 6991  H HG22 . THR A 1 66 ? 9.624   -13.069 0.453   1.00 1.61 ? 66  THR A HG22 5  
ATOM 6992  H HG23 . THR A 1 66 ? 7.890   -13.284 0.692   1.00 1.74 ? 66  THR A HG23 5  
ATOM 6993  N N    . HIS A 1 67 ? 7.408   -9.247  2.983   1.00 0.51 ? 67  HIS A N    5  
ATOM 6994  C CA   . HIS A 1 67 ? 7.322   -7.898  3.537   1.00 0.45 ? 67  HIS A CA   5  
ATOM 6995  C C    . HIS A 1 67 ? 8.384   -6.992  2.919   1.00 0.43 ? 67  HIS A C    5  
ATOM 6996  O O    . HIS A 1 67 ? 8.103   -5.836  2.604   1.00 0.41 ? 67  HIS A O    5  
ATOM 6997  C CB   . HIS A 1 67 ? 7.394   -7.887  5.069   1.00 0.45 ? 67  HIS A CB   5  
ATOM 6998  C CG   . HIS A 1 67 ? 7.070   -6.543  5.644   1.00 0.46 ? 67  HIS A CG   5  
ATOM 6999  N ND1  . HIS A 1 67 ? 5.823   -6.224  6.128   1.00 0.51 ? 67  HIS A ND1  5  
ATOM 7000  C CD2  . HIS A 1 67 ? 7.814   -5.418  5.763   1.00 0.49 ? 67  HIS A CD2  5  
ATOM 7001  C CE1  . HIS A 1 67 ? 5.813   -4.963  6.511   1.00 0.54 ? 67  HIS A CE1  5  
ATOM 7002  N NE2  . HIS A 1 67 ? 7.007   -4.449  6.302   1.00 0.52 ? 67  HIS A NE2  5  
ATOM 7003  H H    . HIS A 1 67 ? 7.658   -10.005 3.553   1.00 0.50 ? 67  HIS A H    5  
ATOM 7004  H HA   . HIS A 1 67 ? 6.358   -7.507  3.245   1.00 0.44 ? 67  HIS A HA   5  
ATOM 7005  H HB2  . HIS A 1 67 ? 6.671   -8.587  5.452   1.00 0.46 ? 67  HIS A HB2  5  
ATOM 7006  H HB3  . HIS A 1 67 ? 8.378   -8.175  5.401   1.00 0.44 ? 67  HIS A HB3  5  
ATOM 7007  H HD1  . HIS A 1 67 ? 5.060   -6.833  6.190   1.00 0.56 ? 67  HIS A HD1  5  
ATOM 7008  H HD2  . HIS A 1 67 ? 8.849   -5.305  5.491   1.00 0.54 ? 67  HIS A HD2  5  
ATOM 7009  H HE1  . HIS A 1 67 ? 4.966   -4.437  6.917   1.00 0.61 ? 67  HIS A HE1  5  
ATOM 7010  H HE2  . HIS A 1 67 ? 7.207   -3.491  6.301   1.00 0.56 ? 67  HIS A HE2  5  
ATOM 7011  N N    . GLU A 1 68 ? 9.602   -7.515  2.749   1.00 0.45 ? 68  GLU A N    5  
ATOM 7012  C CA   . GLU A 1 68 ? 10.695  -6.737  2.160   1.00 0.45 ? 68  GLU A CA   5  
ATOM 7013  C C    . GLU A 1 68 ? 10.239  -6.063  0.867   1.00 0.42 ? 68  GLU A C    5  
ATOM 7014  O O    . GLU A 1 68 ? 10.339  -4.845  0.730   1.00 0.41 ? 68  GLU A O    5  
ATOM 7015  C CB   . GLU A 1 68 ? 11.910  -7.630  1.886   1.00 0.49 ? 68  GLU A CB   5  
ATOM 7016  C CG   . GLU A 1 68 ? 12.504  -8.258  3.138   1.00 1.43 ? 68  GLU A CG   5  
ATOM 7017  C CD   . GLU A 1 68 ? 13.980  -8.575  2.990   1.00 2.13 ? 68  GLU A CD   5  
ATOM 7018  O OE1  . GLU A 1 68 ? 14.811  -7.700  3.311   1.00 2.90 ? 68  GLU A OE1  5  
ATOM 7019  O OE2  . GLU A 1 68 ? 14.304  -9.699  2.553   1.00 2.59 ? 68  GLU A OE2  5  
ATOM 7020  H H    . GLU A 1 68 ? 9.780   -8.431  3.040   1.00 0.47 ? 68  GLU A H    5  
ATOM 7021  H HA   . GLU A 1 68 ? 10.974  -5.972  2.870   1.00 0.47 ? 68  GLU A HA   5  
ATOM 7022  H HB2  . GLU A 1 68 ? 11.615  -8.425  1.217   1.00 1.08 ? 68  GLU A HB2  5  
ATOM 7023  H HB3  . GLU A 1 68 ? 12.676  -7.038  1.408   1.00 1.21 ? 68  GLU A HB3  5  
ATOM 7024  H HG2  . GLU A 1 68 ? 12.382  -7.571  3.963   1.00 2.02 ? 68  GLU A HG2  5  
ATOM 7025  H HG3  . GLU A 1 68 ? 11.973  -9.174  3.353   1.00 2.08 ? 68  GLU A HG3  5  
ATOM 7026  N N    . GLU A 1 69 ? 9.727   -6.864  -0.074  1.00 0.44 ? 69  GLU A N    5  
ATOM 7027  C CA   . GLU A 1 69 ? 9.242   -6.340  -1.353  1.00 0.43 ? 69  GLU A CA   5  
ATOM 7028  C C    . GLU A 1 69 ? 8.136   -5.300  -1.139  1.00 0.41 ? 69  GLU A C    5  
ATOM 7029  O O    . GLU A 1 69 ? 8.022   -4.345  -1.906  1.00 0.41 ? 69  GLU A O    5  
ATOM 7030  C CB   . GLU A 1 69 ? 8.733   -7.473  -2.249  1.00 0.46 ? 69  GLU A CB   5  
ATOM 7031  C CG   . GLU A 1 69 ? 9.079   -7.291  -3.719  1.00 0.76 ? 69  GLU A CG   5  
ATOM 7032  C CD   . GLU A 1 69 ? 8.414   -6.070  -4.333  1.00 1.07 ? 69  GLU A CD   5  
ATOM 7033  O OE1  . GLU A 1 69 ? 7.180   -6.100  -4.529  1.00 1.70 ? 69  GLU A OE1  5  
ATOM 7034  O OE2  . GLU A 1 69 ? 9.128   -5.084  -4.613  1.00 1.84 ? 69  GLU A OE2  5  
ATOM 7035  H H    . GLU A 1 69 ? 9.675   -7.827  0.105   1.00 0.48 ? 69  GLU A H    5  
ATOM 7036  H HA   . GLU A 1 69 ? 10.075  -5.857  -1.843  1.00 0.46 ? 69  GLU A HA   5  
ATOM 7037  H HB2  . GLU A 1 69 ? 9.163   -8.405  -1.913  1.00 0.64 ? 69  GLU A HB2  5  
ATOM 7038  H HB3  . GLU A 1 69 ? 7.659   -7.532  -2.162  1.00 0.63 ? 69  GLU A HB3  5  
ATOM 7039  H HG2  . GLU A 1 69 ? 10.150  -7.184  -3.813  1.00 1.51 ? 69  GLU A HG2  5  
ATOM 7040  H HG3  . GLU A 1 69 ? 8.758   -8.168  -4.262  1.00 1.43 ? 69  GLU A HG3  5  
ATOM 7041  N N    . ALA A 1 70 ? 7.339   -5.483  -0.081  1.00 0.41 ? 70  ALA A N    5  
ATOM 7042  C CA   . ALA A 1 70 ? 6.260   -4.549  0.246   1.00 0.41 ? 70  ALA A CA   5  
ATOM 7043  C C    . ALA A 1 70 ? 6.823   -3.170  0.592   1.00 0.40 ? 70  ALA A C    5  
ATOM 7044  O O    . ALA A 1 70 ? 6.314   -2.146  0.136   1.00 0.42 ? 70  ALA A O    5  
ATOM 7045  C CB   . ALA A 1 70 ? 5.447   -5.083  1.415   1.00 0.44 ? 70  ALA A CB   5  
ATOM 7046  H H    . ALA A 1 70 ? 7.489   -6.255  0.507   1.00 0.44 ? 70  ALA A H    5  
ATOM 7047  H HA   . ALA A 1 70 ? 5.608   -4.465  -0.612  1.00 0.42 ? 70  ALA A HA   5  
ATOM 7048  H HB1  . ALA A 1 70 ? 6.008   -4.966  2.330   1.00 1.00 ? 70  ALA A HB1  5  
ATOM 7049  H HB2  . ALA A 1 70 ? 5.234   -6.129  1.257   1.00 1.28 ? 70  ALA A HB2  5  
ATOM 7050  H HB3  . ALA A 1 70 ? 4.522   -4.533  1.491   1.00 0.98 ? 70  ALA A HB3  5  
ATOM 7051  N N    . VAL A 1 71 ? 7.887   -3.163  1.393   1.00 0.40 ? 71  VAL A N    5  
ATOM 7052  C CA   . VAL A 1 71 ? 8.538   -1.922  1.805   1.00 0.42 ? 71  VAL A CA   5  
ATOM 7053  C C    . VAL A 1 71 ? 9.427   -1.373  0.690   1.00 0.41 ? 71  VAL A C    5  
ATOM 7054  O O    . VAL A 1 71 ? 9.461   -0.166  0.460   1.00 0.42 ? 71  VAL A O    5  
ATOM 7055  C CB   . VAL A 1 71 ? 9.382   -2.128  3.086   1.00 0.48 ? 71  VAL A CB   5  
ATOM 7056  C CG1  . VAL A 1 71 ? 10.330  -0.959  3.320   1.00 0.52 ? 71  VAL A CG1  5  
ATOM 7057  C CG2  . VAL A 1 71 ? 8.479   -2.333  4.293   1.00 0.50 ? 71  VAL A CG2  5  
ATOM 7058  H H    . VAL A 1 71 ? 8.248   -4.022  1.704   1.00 0.41 ? 71  VAL A H    5  
ATOM 7059  H HA   . VAL A 1 71 ? 7.763   -1.200  2.018   1.00 0.43 ? 71  VAL A HA   5  
ATOM 7060  H HB   . VAL A 1 71 ? 9.976   -3.021  2.957   1.00 0.51 ? 71  VAL A HB   5  
ATOM 7061  H HG11 . VAL A 1 71 ? 11.242  -1.119  2.764   1.00 1.18 ? 71  VAL A HG11 5  
ATOM 7062  H HG12 . VAL A 1 71 ? 10.559  -0.887  4.373   1.00 1.21 ? 71  VAL A HG12 5  
ATOM 7063  H HG13 . VAL A 1 71 ? 9.862   -0.044  2.989   1.00 1.02 ? 71  VAL A HG13 5  
ATOM 7064  H HG21 . VAL A 1 71 ? 9.003   -2.916  5.037   1.00 1.07 ? 71  VAL A HG21 5  
ATOM 7065  H HG22 . VAL A 1 71 ? 7.584   -2.856  3.993   1.00 1.12 ? 71  VAL A HG22 5  
ATOM 7066  H HG23 . VAL A 1 71 ? 8.213   -1.374  4.710   1.00 1.00 ? 71  VAL A HG23 5  
ATOM 7067  N N    . THR A 1 72 ? 10.140  -2.269  0.002   1.00 0.43 ? 72  THR A N    5  
ATOM 7068  C CA   . THR A 1 72 ? 11.028  -1.879  -1.091  1.00 0.47 ? 72  THR A CA   5  
ATOM 7069  C C    . THR A 1 72 ? 10.242  -1.268  -2.253  1.00 0.42 ? 72  THR A C    5  
ATOM 7070  O O    . THR A 1 72 ? 10.725  -0.355  -2.921  1.00 0.44 ? 72  THR A O    5  
ATOM 7071  C CB   . THR A 1 72 ? 11.835  -3.088  -1.584  1.00 0.53 ? 72  THR A CB   5  
ATOM 7072  O OG1  . THR A 1 72 ? 12.577  -3.666  -0.521  1.00 0.60 ? 72  THR A OG1  5  
ATOM 7073  C CG2  . THR A 1 72 ? 12.814  -2.750  -2.693  1.00 0.61 ? 72  THR A CG2  5  
ATOM 7074  H H    . THR A 1 72 ? 10.062  -3.216  0.234   1.00 0.46 ? 72  THR A H    5  
ATOM 7075  H HA   . THR A 1 72 ? 11.709  -1.138  -0.707  1.00 0.51 ? 72  THR A HA   5  
ATOM 7076  H HB   . THR A 1 72 ? 11.150  -3.834  -1.962  1.00 0.53 ? 72  THR A HB   5  
ATOM 7077  H HG1  . THR A 1 72 ? 13.135  -2.997  -0.115  1.00 0.98 ? 72  THR A HG1  5  
ATOM 7078  H HG21 . THR A 1 72 ? 12.269  -2.486  -3.589  1.00 1.16 ? 72  THR A HG21 5  
ATOM 7079  H HG22 . THR A 1 72 ? 13.443  -3.605  -2.894  1.00 0.86 ? 72  THR A HG22 5  
ATOM 7080  H HG23 . THR A 1 72 ? 13.429  -1.916  -2.390  1.00 1.27 ? 72  THR A HG23 5  
ATOM 7081  N N    . ALA A 1 73 ? 9.028   -1.776  -2.487  1.00 0.37 ? 73  ALA A N    5  
ATOM 7082  C CA   . ALA A 1 73 ? 8.176   -1.279  -3.565  1.00 0.36 ? 73  ALA A CA   5  
ATOM 7083  C C    . ALA A 1 73 ? 7.609   0.088   -3.213  1.00 0.34 ? 73  ALA A C    5  
ATOM 7084  O O    . ALA A 1 73 ? 7.527   0.972   -4.068  1.00 0.36 ? 73  ALA A O    5  
ATOM 7085  C CB   . ALA A 1 73 ? 7.052   -2.262  -3.852  1.00 0.41 ? 73  ALA A CB   5  
ATOM 7086  H H    . ALA A 1 73 ? 8.692   -2.497  -1.925  1.00 0.37 ? 73  ALA A H    5  
ATOM 7087  H HA   . ALA A 1 73 ? 8.781   -1.191  -4.458  1.00 0.39 ? 73  ALA A HA   5  
ATOM 7088  H HB1  . ALA A 1 73 ? 7.464   -3.251  -3.993  1.00 1.15 ? 73  ALA A HB1  5  
ATOM 7089  H HB2  . ALA A 1 73 ? 6.529   -1.961  -4.747  1.00 1.01 ? 73  ALA A HB2  5  
ATOM 7090  H HB3  . ALA A 1 73 ? 6.364   -2.275  -3.021  1.00 1.08 ? 73  ALA A HB3  5  
ATOM 7091  N N    . LEU A 1 74 ? 7.253   0.270   -1.938  1.00 0.33 ? 74  LEU A N    5  
ATOM 7092  C CA   . LEU A 1 74 ? 6.734   1.548   -1.464  1.00 0.37 ? 74  LEU A CA   5  
ATOM 7093  C C    . LEU A 1 74 ? 7.865   2.566   -1.403  1.00 0.38 ? 74  LEU A C    5  
ATOM 7094  O O    . LEU A 1 74 ? 7.669   3.751   -1.674  1.00 0.44 ? 74  LEU A O    5  
ATOM 7095  C CB   . LEU A 1 74 ? 6.119   1.387   -0.070  1.00 0.41 ? 74  LEU A CB   5  
ATOM 7096  C CG   . LEU A 1 74 ? 4.649   0.973   -0.037  1.00 0.61 ? 74  LEU A CG   5  
ATOM 7097  C CD1  . LEU A 1 74 ? 3.749   2.146   -0.396  1.00 1.73 ? 74  LEU A CD1  5  
ATOM 7098  C CD2  . LEU A 1 74 ? 4.394   -0.203  -0.970  1.00 1.13 ? 74  LEU A CD2  5  
ATOM 7099  H H    . LEU A 1 74 ? 7.372   -0.460  -1.286  1.00 0.33 ? 74  LEU A H    5  
ATOM 7100  H HA   . LEU A 1 74 ? 5.979   1.888   -2.155  1.00 0.42 ? 74  LEU A HA   5  
ATOM 7101  H HB2  . LEU A 1 74 ? 6.691   0.644   0.467   1.00 0.61 ? 74  LEU A HB2  5  
ATOM 7102  H HB3  . LEU A 1 74 ? 6.214   2.329   0.449   1.00 0.47 ? 74  LEU A HB3  5  
ATOM 7103  H HG   . LEU A 1 74 ? 4.405   0.661   0.964   1.00 1.29 ? 74  LEU A HG   5  
ATOM 7104  H HD11 . LEU A 1 74 ? 2.718   1.827   -0.380  1.00 2.20 ? 74  LEU A HD11 5  
ATOM 7105  H HD12 . LEU A 1 74 ? 4.000   2.504   -1.384  1.00 2.34 ? 74  LEU A HD12 5  
ATOM 7106  H HD13 . LEU A 1 74 ? 3.891   2.940   0.321   1.00 2.24 ? 74  LEU A HD13 5  
ATOM 7107  H HD21 . LEU A 1 74 ? 4.036   0.161   -1.922  1.00 1.57 ? 74  LEU A HD21 5  
ATOM 7108  H HD22 . LEU A 1 74 ? 3.652   -0.854  -0.532  1.00 1.72 ? 74  LEU A HD22 5  
ATOM 7109  H HD23 . LEU A 1 74 ? 5.311   -0.752  -1.115  1.00 1.75 ? 74  LEU A HD23 5  
ATOM 7110  N N    . LYS A 1 75 ? 9.052   2.081   -1.036  1.00 0.38 ? 75  LYS A N    5  
ATOM 7111  C CA   . LYS A 1 75 ? 10.244  2.924   -0.922  1.00 0.47 ? 75  LYS A CA   5  
ATOM 7112  C C    . LYS A 1 75 ? 10.795  3.324   -2.297  1.00 0.49 ? 75  LYS A C    5  
ATOM 7113  O O    . LYS A 1 75 ? 11.427  4.374   -2.429  1.00 0.59 ? 75  LYS A O    5  
ATOM 7114  C CB   . LYS A 1 75 ? 11.320  2.191   -0.100  1.00 0.57 ? 75  LYS A CB   5  
ATOM 7115  C CG   . LYS A 1 75 ? 12.749  2.377   -0.602  1.00 0.64 ? 75  LYS A CG   5  
ATOM 7116  C CD   . LYS A 1 75 ? 13.658  1.249   -0.133  1.00 1.05 ? 75  LYS A CD   5  
ATOM 7117  C CE   . LYS A 1 75 ? 13.845  1.265   1.378   1.00 0.88 ? 75  LYS A CE   5  
ATOM 7118  N NZ   . LYS A 1 75 ? 14.842  2.285   1.808   1.00 1.44 ? 75  LYS A NZ   5  
ATOM 7119  H H    . LYS A 1 75 ? 9.130   1.117   -0.826  1.00 0.37 ? 75  LYS A H    5  
ATOM 7120  H HA   . LYS A 1 75 ? 9.958   3.821   -0.393  1.00 0.54 ? 75  LYS A HA   5  
ATOM 7121  H HB2  . LYS A 1 75 ? 11.277  2.547   0.918   1.00 0.67 ? 75  LYS A HB2  5  
ATOM 7122  H HB3  . LYS A 1 75 ? 11.099  1.135   -0.107  1.00 0.62 ? 75  LYS A HB3  5  
ATOM 7123  H HG2  . LYS A 1 75 ? 12.744  2.390   -1.681  1.00 0.87 ? 75  LYS A HG2  5  
ATOM 7124  H HG3  . LYS A 1 75 ? 13.132  3.315   -0.229  1.00 0.88 ? 75  LYS A HG3  5  
ATOM 7125  H HD2  . LYS A 1 75 ? 13.220  0.305   -0.421  1.00 1.90 ? 75  LYS A HD2  5  
ATOM 7126  H HD3  . LYS A 1 75 ? 14.623  1.359   -0.607  1.00 1.62 ? 75  LYS A HD3  5  
ATOM 7127  H HE2  . LYS A 1 75 ? 12.896  1.484   1.843   1.00 1.04 ? 75  LYS A HE2  5  
ATOM 7128  H HE3  . LYS A 1 75 ? 14.183  0.289   1.695   1.00 1.51 ? 75  LYS A HE3  5  
ATOM 7129  H HZ1  . LYS A 1 75 ? 15.724  2.175   1.269   1.00 1.72 ? 75  LYS A HZ1  5  
ATOM 7130  H HZ2  . LYS A 1 75 ? 15.052  2.174   2.821   1.00 1.94 ? 75  LYS A HZ2  5  
ATOM 7131  H HZ3  . LYS A 1 75 ? 14.468  3.242   1.646   1.00 1.92 ? 75  LYS A HZ3  5  
ATOM 7132  N N    . ASN A 1 76 ? 10.566  2.480   -3.310  1.00 0.48 ? 76  ASN A N    5  
ATOM 7133  C CA   . ASN A 1 76 ? 11.055  2.745   -4.667  1.00 0.59 ? 76  ASN A CA   5  
ATOM 7134  C C    . ASN A 1 76 ? 10.292  3.897   -5.333  1.00 0.69 ? 76  ASN A C    5  
ATOM 7135  O O    . ASN A 1 76 ? 9.524   3.689   -6.276  1.00 1.15 ? 76  ASN A O    5  
ATOM 7136  C CB   . ASN A 1 76 ? 10.954  1.474   -5.518  1.00 0.64 ? 76  ASN A CB   5  
ATOM 7137  C CG   . ASN A 1 76 ? 11.775  1.557   -6.793  1.00 0.85 ? 76  ASN A CG   5  
ATOM 7138  O OD1  . ASN A 1 76 ? 13.002  1.470   -6.760  1.00 0.90 ? 76  ASN A OD1  5  
ATOM 7139  N ND2  . ASN A 1 76 ? 11.099  1.725   -7.926  1.00 1.55 ? 76  ASN A ND2  5  
ATOM 7140  H H    . ASN A 1 76 ? 10.066  1.655   -3.138  1.00 0.45 ? 76  ASN A H    5  
ATOM 7141  H HA   . ASN A 1 76 ? 12.095  3.025   -4.588  1.00 0.73 ? 76  ASN A HA   5  
ATOM 7142  H HB2  . ASN A 1 76 ? 11.310  0.634   -4.940  1.00 0.71 ? 76  ASN A HB2  5  
ATOM 7143  H HB3  . ASN A 1 76 ? 9.920   1.308   -5.786  1.00 0.75 ? 76  ASN A HB3  5  
ATOM 7144  H HD21 . ASN A 1 76 ? 10.122  1.786   -7.880  1.00 1.95 ? 76  ASN A HD21 5  
ATOM 7145  H HD22 . ASN A 1 76 ? 11.607  1.781   -8.763  1.00 1.75 ? 76  ASN A HD22 5  
ATOM 7146  N N    . THR A 1 77 ? 10.507  5.111   -4.826  1.00 0.90 ? 77  THR A N    5  
ATOM 7147  C CA   . THR A 1 77 ? 9.846   6.300   -5.356  1.00 1.07 ? 77  THR A CA   5  
ATOM 7148  C C    . THR A 1 77 ? 10.864  7.380   -5.727  1.00 0.80 ? 77  THR A C    5  
ATOM 7149  O O    . THR A 1 77 ? 11.811  7.638   -4.980  1.00 1.47 ? 77  THR A O    5  
ATOM 7150  C CB   . THR A 1 77 ? 8.846   6.850   -4.332  1.00 2.00 ? 77  THR A CB   5  
ATOM 7151  O OG1  . THR A 1 77 ? 9.439   6.956   -3.047  1.00 2.60 ? 77  THR A OG1  5  
ATOM 7152  C CG2  . THR A 1 77 ? 7.606   5.996   -4.192  1.00 2.53 ? 77  THR A CG2  5  
ATOM 7153  H H    . THR A 1 77 ? 11.118  5.204   -4.065  1.00 1.26 ? 77  THR A H    5  
ATOM 7154  H HA   . THR A 1 77 ? 9.309   6.011   -6.246  1.00 1.56 ? 77  THR A HA   5  
ATOM 7155  H HB   . THR A 1 77 ? 8.533   7.837   -4.643  1.00 2.59 ? 77  THR A HB   5  
ATOM 7156  H HG1  . THR A 1 77 ? 10.244  7.477   -3.105  1.00 2.91 ? 77  THR A HG1  5  
ATOM 7157  H HG21 . THR A 1 77 ? 7.234   5.738   -5.172  1.00 2.58 ? 77  THR A HG21 5  
ATOM 7158  H HG22 . THR A 1 77 ? 6.849   6.545   -3.653  1.00 3.13 ? 77  THR A HG22 5  
ATOM 7159  H HG23 . THR A 1 77 ? 7.850   5.093   -3.651  1.00 2.95 ? 77  THR A HG23 5  
ATOM 7160  N N    . SER A 1 78 ? 10.654  8.009   -6.884  1.00 1.14 ? 78  SER A N    5  
ATOM 7161  C CA   . SER A 1 78 ? 11.541  9.068   -7.362  1.00 1.74 ? 78  SER A CA   5  
ATOM 7162  C C    . SER A 1 78 ? 10.788  10.395  -7.461  1.00 1.42 ? 78  SER A C    5  
ATOM 7163  O O    . SER A 1 78 ? 10.857  11.220  -6.549  1.00 1.44 ? 78  SER A O    5  
ATOM 7164  C CB   . SER A 1 78 ? 12.145  8.688   -8.719  1.00 2.76 ? 78  SER A CB   5  
ATOM 7165  O OG   . SER A 1 78 ? 13.172  7.721   -8.567  1.00 3.36 ? 78  SER A OG   5  
ATOM 7166  H H    . SER A 1 78 ? 9.875   7.756   -7.422  1.00 1.57 ? 78  SER A H    5  
ATOM 7167  H HA   . SER A 1 78 ? 12.340  9.178   -6.643  1.00 2.08 ? 78  SER A HA   5  
ATOM 7168  H HB2  . SER A 1 78 ? 11.373  8.277   -9.352  1.00 3.05 ? 78  SER A HB2  5  
ATOM 7169  H HB3  . SER A 1 78 ? 12.562  9.568   -9.185  1.00 3.31 ? 78  SER A HB3  5  
ATOM 7170  H HG   . SER A 1 78 ? 12.789  6.841   -8.595  1.00 3.89 ? 78  SER A HG   5  
ATOM 7171  N N    . ASP A 1 79 ? 10.059  10.590  -8.561  1.00 1.32 ? 79  ASP A N    5  
ATOM 7172  C CA   . ASP A 1 79 ? 9.281   11.809  -8.763  1.00 1.18 ? 79  ASP A CA   5  
ATOM 7173  C C    . ASP A 1 79 ? 7.827   11.580  -8.353  1.00 0.99 ? 79  ASP A C    5  
ATOM 7174  O O    . ASP A 1 79 ? 7.250   12.367  -7.602  1.00 0.92 ? 79  ASP A O    5  
ATOM 7175  C CB   . ASP A 1 79 ? 9.352   12.254  -10.228 1.00 1.46 ? 79  ASP A CB   5  
ATOM 7176  C CG   . ASP A 1 79 ? 8.631   13.567  -10.474 1.00 1.61 ? 79  ASP A CG   5  
ATOM 7177  O OD1  . ASP A 1 79 ? 9.266   14.632  -10.314 1.00 2.07 ? 79  ASP A OD1  5  
ATOM 7178  O OD2  . ASP A 1 79 ? 7.433   13.531  -10.824 1.00 2.23 ? 79  ASP A OD2  5  
ATOM 7179  H H    . ASP A 1 79 ? 10.036  9.893   -9.250  1.00 1.49 ? 79  ASP A H    5  
ATOM 7180  H HA   . ASP A 1 79 ? 9.703   12.583  -8.137  1.00 1.15 ? 79  ASP A HA   5  
ATOM 7181  H HB2  . ASP A 1 79 ? 10.387  12.377  -10.510 1.00 2.06 ? 79  ASP A HB2  5  
ATOM 7182  H HB3  . ASP A 1 79 ? 8.901   11.495  -10.851 1.00 1.75 ? 79  ASP A HB3  5  
ATOM 7183  N N    . PHE A 1 80 ? 7.252   10.482  -8.845  1.00 0.97 ? 80  PHE A N    5  
ATOM 7184  C CA   . PHE A 1 80 ? 5.876   10.114  -8.529  1.00 0.85 ? 80  PHE A CA   5  
ATOM 7185  C C    . PHE A 1 80 ? 5.799   8.652   -8.093  1.00 0.82 ? 80  PHE A C    5  
ATOM 7186  O O    . PHE A 1 80 ? 6.769   7.904   -8.241  1.00 0.92 ? 80  PHE A O    5  
ATOM 7187  C CB   . PHE A 1 80 ? 4.964   10.356  -9.733  1.00 0.92 ? 80  PHE A CB   5  
ATOM 7188  C CG   . PHE A 1 80 ? 3.860   11.328  -9.443  1.00 0.94 ? 80  PHE A CG   5  
ATOM 7189  C CD1  . PHE A 1 80 ? 4.053   12.687  -9.626  1.00 1.68 ? 80  PHE A CD1  5  
ATOM 7190  C CD2  . PHE A 1 80 ? 2.636   10.883  -8.973  1.00 1.39 ? 80  PHE A CD2  5  
ATOM 7191  C CE1  . PHE A 1 80 ? 3.043   13.585  -9.347  1.00 1.77 ? 80  PHE A CE1  5  
ATOM 7192  C CE2  . PHE A 1 80 ? 1.622   11.776  -8.695  1.00 1.43 ? 80  PHE A CE2  5  
ATOM 7193  C CZ   . PHE A 1 80 ? 1.827   13.129  -8.880  1.00 1.14 ? 80  PHE A CZ   5  
ATOM 7194  H H    . PHE A 1 80 ? 7.778   9.891   -9.424  1.00 1.09 ? 80  PHE A H    5  
ATOM 7195  H HA   . PHE A 1 80 ? 5.548   10.735  -7.709  1.00 0.81 ? 80  PHE A HA   5  
ATOM 7196  H HB2  . PHE A 1 80 ? 5.550   10.750  -10.550 1.00 1.04 ? 80  PHE A HB2  5  
ATOM 7197  H HB3  . PHE A 1 80 ? 4.515   9.421   -10.035 1.00 0.93 ? 80  PHE A HB3  5  
ATOM 7198  H HD1  . PHE A 1 80 ? 5.004   13.045  -9.993  1.00 2.48 ? 80  PHE A HD1  5  
ATOM 7199  H HD2  . PHE A 1 80 ? 2.477   9.823   -8.829  1.00 2.16 ? 80  PHE A HD2  5  
ATOM 7200  H HE1  . PHE A 1 80 ? 3.204   14.642  -9.494  1.00 2.61 ? 80  PHE A HE1  5  
ATOM 7201  H HE2  . PHE A 1 80 ? 0.672   11.418  -8.329  1.00 2.19 ? 80  PHE A HE2  5  
ATOM 7202  H HZ   . PHE A 1 80 ? 1.038   13.829  -8.657  1.00 1.26 ? 80  PHE A HZ   5  
ATOM 7203  N N    . VAL A 1 81 ? 4.640   8.236   -7.585  1.00 0.75 ? 81  VAL A N    5  
ATOM 7204  C CA   . VAL A 1 81 ? 4.439   6.854   -7.166  1.00 0.77 ? 81  VAL A CA   5  
ATOM 7205  C C    . VAL A 1 81 ? 3.020   6.400   -7.515  1.00 0.65 ? 81  VAL A C    5  
ATOM 7206  O O    . VAL A 1 81 ? 2.038   6.982   -7.043  1.00 0.59 ? 81  VAL A O    5  
ATOM 7207  C CB   . VAL A 1 81 ? 4.705   6.662   -5.652  1.00 0.88 ? 81  VAL A CB   5  
ATOM 7208  C CG1  . VAL A 1 81 ? 3.826   7.577   -4.813  1.00 1.19 ? 81  VAL A CG1  5  
ATOM 7209  C CG2  . VAL A 1 81 ? 4.508   5.206   -5.248  1.00 1.58 ? 81  VAL A CG2  5  
ATOM 7210  H H    . VAL A 1 81 ? 3.878   8.849   -7.517  1.00 0.74 ? 81  VAL A H    5  
ATOM 7211  H HA   . VAL A 1 81 ? 5.141   6.240   -7.713  1.00 0.89 ? 81  VAL A HA   5  
ATOM 7212  H HB   . VAL A 1 81 ? 5.735   6.925   -5.459  1.00 1.14 ? 81  VAL A HB   5  
ATOM 7213  H HG11 . VAL A 1 81 ? 4.439   8.334   -4.345  1.00 1.78 ? 81  VAL A HG11 5  
ATOM 7214  H HG12 . VAL A 1 81 ? 3.326   6.998   -4.050  1.00 1.62 ? 81  VAL A HG12 5  
ATOM 7215  H HG13 . VAL A 1 81 ? 3.091   8.050   -5.444  1.00 1.67 ? 81  VAL A HG13 5  
ATOM 7216  H HG21 . VAL A 1 81 ? 5.357   4.624   -5.574  1.00 1.98 ? 81  VAL A HG21 5  
ATOM 7217  H HG22 . VAL A 1 81 ? 3.610   4.821   -5.708  1.00 2.06 ? 81  VAL A HG22 5  
ATOM 7218  H HG23 . VAL A 1 81 ? 4.419   5.139   -4.174  1.00 2.07 ? 81  VAL A HG23 5  
ATOM 7219  N N    . TYR A 1 82 ? 2.916   5.363   -8.342  1.00 0.72 ? 82  TYR A N    5  
ATOM 7220  C CA   . TYR A 1 82 ? 1.610   4.846   -8.740  1.00 0.69 ? 82  TYR A CA   5  
ATOM 7221  C C    . TYR A 1 82 ? 1.216   3.665   -7.862  1.00 0.67 ? 82  TYR A C    5  
ATOM 7222  O O    . TYR A 1 82 ? 1.674   2.538   -8.060  1.00 0.77 ? 82  TYR A O    5  
ATOM 7223  C CB   . TYR A 1 82 ? 1.606   4.443   -10.216 1.00 0.85 ? 82  TYR A CB   5  
ATOM 7224  C CG   . TYR A 1 82 ? 0.232   4.114   -10.761 1.00 0.93 ? 82  TYR A CG   5  
ATOM 7225  C CD1  . TYR A 1 82 ? -0.582  5.096   -11.320 1.00 1.41 ? 82  TYR A CD1  5  
ATOM 7226  C CD2  . TYR A 1 82 ? -0.248  2.813   -10.717 1.00 1.57 ? 82  TYR A CD2  5  
ATOM 7227  C CE1  . TYR A 1 82 ? -1.834  4.785   -11.816 1.00 1.55 ? 82  TYR A CE1  5  
ATOM 7228  C CE2  . TYR A 1 82 ? -1.495  2.497   -11.211 1.00 1.72 ? 82  TYR A CE2  5  
ATOM 7229  C CZ   . TYR A 1 82 ? -2.286  3.484   -11.758 1.00 1.33 ? 82  TYR A CZ   5  
ATOM 7230  O OH   . TYR A 1 82 ? -3.532  3.170   -12.251 1.00 1.58 ? 82  TYR A OH   5  
ATOM 7231  H H    . TYR A 1 82 ? 3.737   4.944   -8.678  1.00 0.85 ? 82  TYR A H    5  
ATOM 7232  H HA   . TYR A 1 82 ? 0.890   5.637   -8.591  1.00 0.64 ? 82  TYR A HA   5  
ATOM 7233  H HB2  . TYR A 1 82 ? 2.015   5.251   -10.806 1.00 0.88 ? 82  TYR A HB2  5  
ATOM 7234  H HB3  . TYR A 1 82 ? 2.222   3.566   -10.338 1.00 0.99 ? 82  TYR A HB3  5  
ATOM 7235  H HD1  . TYR A 1 82 ? -0.228  6.115   -11.368 1.00 2.08 ? 82  TYR A HD1  5  
ATOM 7236  H HD2  . TYR A 1 82 ? 0.371   2.040   -10.288 1.00 2.27 ? 82  TYR A HD2  5  
ATOM 7237  H HE1  . TYR A 1 82 ? -2.451  5.559   -12.244 1.00 2.24 ? 82  TYR A HE1  5  
ATOM 7238  H HE2  . TYR A 1 82 ? -1.846  1.478   -11.167 1.00 2.47 ? 82  TYR A HE2  5  
ATOM 7239  H HH   . TYR A 1 82 ? -4.143  3.037   -11.522 1.00 1.97 ? 82  TYR A HH   5  
ATOM 7240  N N    . LEU A 1 83 ? 0.378   3.954   -6.874  1.00 0.62 ? 83  LEU A N    5  
ATOM 7241  C CA   . LEU A 1 83 ? -0.083  2.949   -5.926  1.00 0.65 ? 83  LEU A CA   5  
ATOM 7242  C C    . LEU A 1 83 ? -1.411  2.335   -6.359  1.00 0.66 ? 83  LEU A C    5  
ATOM 7243  O O    . LEU A 1 83 ? -2.397  3.043   -6.576  1.00 0.71 ? 83  LEU A O    5  
ATOM 7244  C CB   . LEU A 1 83 ? -0.222  3.574   -4.535  1.00 0.74 ? 83  LEU A CB   5  
ATOM 7245  C CG   . LEU A 1 83 ? -0.303  2.575   -3.380  1.00 0.74 ? 83  LEU A CG   5  
ATOM 7246  C CD1  . LEU A 1 83 ? 0.612   2.998   -2.241  1.00 1.34 ? 83  LEU A CD1  5  
ATOM 7247  C CD2  . LEU A 1 83 ? -1.739  2.441   -2.895  1.00 1.38 ? 83  LEU A CD2  5  
ATOM 7248  H H    . LEU A 1 83 ? 0.082   4.880   -6.770  1.00 0.62 ? 83  LEU A H    5  
ATOM 7249  H HA   . LEU A 1 83 ? 0.662   2.169   -5.884  1.00 0.69 ? 83  LEU A HA   5  
ATOM 7250  H HB2  . LEU A 1 83 ? 0.629   4.219   -4.368  1.00 0.88 ? 83  LEU A HB2  5  
ATOM 7251  H HB3  . LEU A 1 83 ? -1.116  4.177   -4.523  1.00 0.80 ? 83  LEU A HB3  5  
ATOM 7252  H HG   . LEU A 1 83 ? 0.025   1.606   -3.728  1.00 1.48 ? 83  LEU A HG   5  
ATOM 7253  H HD11 . LEU A 1 83 ? 1.640   2.952   -2.569  1.00 1.81 ? 83  LEU A HD11 5  
ATOM 7254  H HD12 . LEU A 1 83 ? 0.473   2.333   -1.401  1.00 1.91 ? 83  LEU A HD12 5  
ATOM 7255  H HD13 . LEU A 1 83 ? 0.373   4.008   -1.943  1.00 1.85 ? 83  LEU A HD13 5  
ATOM 7256  H HD21 . LEU A 1 83 ? -2.106  3.408   -2.585  1.00 1.83 ? 83  LEU A HD21 5  
ATOM 7257  H HD22 . LEU A 1 83 ? -1.775  1.756   -2.061  1.00 2.00 ? 83  LEU A HD22 5  
ATOM 7258  H HD23 . LEU A 1 83 ? -2.355  2.063   -3.698  1.00 1.85 ? 83  LEU A HD23 5  
ATOM 7259  N N    . LYS A 1 84 ? -1.428  1.007   -6.461  1.00 0.66 ? 84  LYS A N    5  
ATOM 7260  C CA   . LYS A 1 84 ? -2.628  0.270   -6.842  1.00 0.68 ? 84  LYS A CA   5  
ATOM 7261  C C    . LYS A 1 84 ? -3.142  -0.533  -5.660  1.00 0.65 ? 84  LYS A C    5  
ATOM 7262  O O    . LYS A 1 84 ? -2.393  -1.300  -5.053  1.00 0.68 ? 84  LYS A O    5  
ATOM 7263  C CB   . LYS A 1 84 ? -2.350  -0.659  -8.030  1.00 0.69 ? 84  LYS A CB   5  
ATOM 7264  C CG   . LYS A 1 84 ? -2.655  -0.029  -9.380  1.00 0.76 ? 84  LYS A CG   5  
ATOM 7265  C CD   . LYS A 1 84 ? -4.031  -0.430  -9.890  1.00 0.99 ? 84  LYS A CD   5  
ATOM 7266  C CE   . LYS A 1 84 ? -5.135  0.384   -9.230  1.00 1.18 ? 84  LYS A CE   5  
ATOM 7267  N NZ   . LYS A 1 84 ? -6.389  -0.404  -9.072  1.00 1.56 ? 84  LYS A NZ   5  
ATOM 7268  H H    . LYS A 1 84 ? -0.611  0.504   -6.256  1.00 0.68 ? 84  LYS A H    5  
ATOM 7269  H HA   . LYS A 1 84 ? -3.378  0.980   -7.124  1.00 0.72 ? 84  LYS A HA   5  
ATOM 7270  H HB2  . LYS A 1 84 ? -1.312  -0.944  -8.015  1.00 0.66 ? 84  LYS A HB2  5  
ATOM 7271  H HB3  . LYS A 1 84 ? -2.958  -1.545  -7.927  1.00 0.73 ? 84  LYS A HB3  5  
ATOM 7272  H HG2  . LYS A 1 84 ? -2.618  1.047   -9.282  1.00 0.93 ? 84  LYS A HG2  5  
ATOM 7273  H HG3  . LYS A 1 84 ? -1.909  -0.352  -10.091 1.00 0.86 ? 84  LYS A HG3  5  
ATOM 7274  H HD2  . LYS A 1 84 ? -4.070  -0.267  -10.957 1.00 1.65 ? 84  LYS A HD2  5  
ATOM 7275  H HD3  . LYS A 1 84 ? -4.191  -1.477  -9.678  1.00 1.42 ? 84  LYS A HD3  5  
ATOM 7276  H HE2  . LYS A 1 84 ? -4.797  0.701   -8.254  1.00 1.51 ? 84  LYS A HE2  5  
ATOM 7277  H HE3  . LYS A 1 84 ? -5.339  1.251   -9.839  1.00 1.85 ? 84  LYS A HE3  5  
ATOM 7278  H HZ1  . LYS A 1 84 ? -6.202  -1.269  -8.526  1.00 2.19 ? 84  LYS A HZ1  5  
ATOM 7279  H HZ2  . LYS A 1 84 ? -6.766  -0.667  -10.005 1.00 1.68 ? 84  LYS A HZ2  5  
ATOM 7280  H HZ3  . LYS A 1 84 ? -7.104  0.160   -8.569  1.00 2.00 ? 84  LYS A HZ3  5  
ATOM 7281  N N    . VAL A 1 85 ? -4.417  -0.346  -5.325  1.00 0.76 ? 85  VAL A N    5  
ATOM 7282  C CA   . VAL A 1 85 ? -5.021  -1.054  -4.203  1.00 0.74 ? 85  VAL A CA   5  
ATOM 7283  C C    . VAL A 1 85 ? -6.207  -1.901  -4.653  1.00 0.91 ? 85  VAL A C    5  
ATOM 7284  O O    . VAL A 1 85 ? -7.065  -1.436  -5.407  1.00 1.17 ? 85  VAL A O    5  
ATOM 7285  C CB   . VAL A 1 85 ? -5.486  -0.085  -3.092  1.00 0.99 ? 85  VAL A CB   5  
ATOM 7286  C CG1  . VAL A 1 85 ? -4.297  0.429   -2.293  1.00 1.92 ? 85  VAL A CG1  5  
ATOM 7287  C CG2  . VAL A 1 85 ? -6.285  1.074   -3.675  1.00 0.65 ? 85  VAL A CG2  5  
ATOM 7288  H H    . VAL A 1 85 ? -4.963  0.287   -5.838  1.00 0.92 ? 85  VAL A H    5  
ATOM 7289  H HA   . VAL A 1 85 ? -4.268  -1.706  -3.787  1.00 0.62 ? 85  VAL A HA   5  
ATOM 7290  H HB   . VAL A 1 85 ? -6.129  -0.630  -2.417  1.00 1.45 ? 85  VAL A HB   5  
ATOM 7291  H HG11 . VAL A 1 85 ? -4.556  0.467   -1.245  1.00 2.23 ? 85  VAL A HG11 5  
ATOM 7292  H HG12 . VAL A 1 85 ? -4.034  1.419   -2.634  1.00 2.51 ? 85  VAL A HG12 5  
ATOM 7293  H HG13 . VAL A 1 85 ? -3.454  -0.234  -2.431  1.00 2.42 ? 85  VAL A HG13 5  
ATOM 7294  H HG21 . VAL A 1 85 ? -6.600  1.730   -2.878  1.00 1.26 ? 85  VAL A HG21 5  
ATOM 7295  H HG22 . VAL A 1 85 ? -7.153  0.690   -4.190  1.00 1.21 ? 85  VAL A HG22 5  
ATOM 7296  H HG23 . VAL A 1 85 ? -5.668  1.622   -4.370  1.00 1.21 ? 85  VAL A HG23 5  
ATOM 7297  N N    . ALA A 1 86 ? -6.251  -3.146  -4.180  1.00 0.91 ? 86  ALA A N    5  
ATOM 7298  C CA   . ALA A 1 86 ? -7.333  -4.063  -4.525  1.00 1.24 ? 86  ALA A CA   5  
ATOM 7299  C C    . ALA A 1 86 ? -8.512  -3.902  -3.569  1.00 1.27 ? 86  ALA A C    5  
ATOM 7300  O O    . ALA A 1 86 ? -8.338  -3.509  -2.414  1.00 1.09 ? 86  ALA A O    5  
ATOM 7301  C CB   . ALA A 1 86 ? -6.831  -5.501  -4.513  1.00 1.46 ? 86  ALA A CB   5  
ATOM 7302  H H    . ALA A 1 86 ? -5.537  -3.453  -3.581  1.00 0.76 ? 86  ALA A H    5  
ATOM 7303  H HA   . ALA A 1 86 ? -7.660  -3.830  -5.528  1.00 1.52 ? 86  ALA A HA   5  
ATOM 7304  H HB1  . ALA A 1 86 ? -5.774  -5.516  -4.734  1.00 1.81 ? 86  ALA A HB1  5  
ATOM 7305  H HB2  . ALA A 1 86 ? -7.362  -6.073  -5.260  1.00 2.07 ? 86  ALA A HB2  5  
ATOM 7306  H HB3  . ALA A 1 86 ? -7.001  -5.934  -3.540  1.00 1.62 ? 86  ALA A HB3  5  
ATOM 7307  N N    . LYS A 1 87 ? -9.712  -4.206  -4.059  1.00 1.68 ? 87  LYS A N    5  
ATOM 7308  C CA   . LYS A 1 87 ? -10.923 -4.094  -3.250  1.00 1.86 ? 87  LYS A CA   5  
ATOM 7309  C C    . LYS A 1 87 ? -11.468 -5.476  -2.892  1.00 1.91 ? 87  LYS A C    5  
ATOM 7310  O O    . LYS A 1 87 ? -11.660 -6.322  -3.769  1.00 2.04 ? 87  LYS A O    5  
ATOM 7311  C CB   . LYS A 1 87 ? -11.989 -3.287  -3.996  1.00 2.22 ? 87  LYS A CB   5  
ATOM 7312  C CG   . LYS A 1 87 ? -11.806 -1.781  -3.879  1.00 2.53 ? 87  LYS A CG   5  
ATOM 7313  C CD   . LYS A 1 87 ? -12.989 -1.125  -3.184  1.00 2.89 ? 87  LYS A CD   5  
ATOM 7314  C CE   . LYS A 1 87 ? -13.963 -0.521  -4.185  1.00 3.28 ? 87  LYS A CE   5  
ATOM 7315  N NZ   . LYS A 1 87 ? -15.336 -0.391  -3.621  1.00 4.20 ? 87  LYS A NZ   5  
ATOM 7316  H H    . LYS A 1 87 ? -9.787  -4.512  -4.988  1.00 1.92 ? 87  LYS A H    5  
ATOM 7317  H HA   . LYS A 1 87 ? -10.664 -3.576  -2.340  1.00 1.79 ? 87  LYS A HA   5  
ATOM 7318  H HB2  . LYS A 1 87 ? -11.957 -3.552  -5.043  1.00 2.44 ? 87  LYS A HB2  5  
ATOM 7319  H HB3  . LYS A 1 87 ? -12.960 -3.543  -3.599  1.00 2.56 ? 87  LYS A HB3  5  
ATOM 7320  H HG2  . LYS A 1 87 ? -10.911 -1.580  -3.308  1.00 2.95 ? 87  LYS A HG2  5  
ATOM 7321  H HG3  . LYS A 1 87 ? -11.704 -1.364  -4.870  1.00 2.69 ? 87  LYS A HG3  5  
ATOM 7322  H HD2  . LYS A 1 87 ? -13.509 -1.868  -2.596  1.00 3.05 ? 87  LYS A HD2  5  
ATOM 7323  H HD3  . LYS A 1 87 ? -12.623 -0.342  -2.534  1.00 3.28 ? 87  LYS A HD3  5  
ATOM 7324  H HE2  . LYS A 1 87 ? -13.606 0.458   -4.468  1.00 3.46 ? 87  LYS A HE2  5  
ATOM 7325  H HE3  . LYS A 1 87 ? -14.000 -1.155  -5.059  1.00 3.29 ? 87  LYS A HE3  5  
ATOM 7326  H HZ1  . LYS A 1 87 ? -15.311 0.166   -2.743  1.00 4.41 ? 87  LYS A HZ1  5  
ATOM 7327  H HZ2  . LYS A 1 87 ? -15.728 -1.332  -3.414  1.00 4.48 ? 87  LYS A HZ2  5  
ATOM 7328  H HZ3  . LYS A 1 87 ? -15.958 0.088   -4.303  1.00 4.70 ? 87  LYS A HZ3  5  
ATOM 7329  N N    . PRO A 1 88 ? -11.728 -5.725  -1.592  1.00 1.88 ? 88  PRO A N    5  
ATOM 7330  C CA   . PRO A 1 88 ? -12.255 -7.012  -1.121  1.00 2.01 ? 88  PRO A CA   5  
ATOM 7331  C C    . PRO A 1 88 ? -13.641 -7.312  -1.693  1.00 2.20 ? 88  PRO A C    5  
ATOM 7332  O O    . PRO A 1 88 ? -14.498 -6.427  -1.759  1.00 2.28 ? 88  PRO A O    5  
ATOM 7333  C CB   . PRO A 1 88 ? -12.327 -6.844  0.402   1.00 1.98 ? 88  PRO A CB   5  
ATOM 7334  C CG   . PRO A 1 88 ? -12.332 -5.372  0.634   1.00 1.91 ? 88  PRO A CG   5  
ATOM 7335  C CD   . PRO A 1 88 ? -11.531 -4.772  -0.485  1.00 1.79 ? 88  PRO A CD   5  
ATOM 7336  H HA   . PRO A 1 88 ? -11.583 -7.821  -1.365  1.00 2.04 ? 88  PRO A HA   5  
ATOM 7337  H HB2  . PRO A 1 88 ? -13.228 -7.306  0.776   1.00 2.18 ? 88  PRO A HB2  5  
ATOM 7338  H HB3  . PRO A 1 88 ? -11.465 -7.309  0.857   1.00 1.96 ? 88  PRO A HB3  5  
ATOM 7339  H HG2  . PRO A 1 88 ? -13.346 -5.001  0.609   1.00 2.24 ? 88  PRO A HG2  5  
ATOM 7340  H HG3  . PRO A 1 88 ? -11.873 -5.148  1.585   1.00 1.85 ? 88  PRO A HG3  5  
ATOM 7341  H HD2  . PRO A 1 88 ? -11.915 -3.796  -0.743  1.00 1.89 ? 88  PRO A HD2  5  
ATOM 7342  H HD3  . PRO A 1 88 ? -10.488 -4.709  -0.212  1.00 1.68 ? 88  PRO A HD3  5  
ATOM 7343  N N    . THR A 1 89 ? -13.856 -8.565  -2.104  1.00 2.38 ? 89  THR A N    5  
ATOM 7344  C CA   . THR A 1 89 ? -15.138 -8.984  -2.670  1.00 2.59 ? 89  THR A CA   5  
ATOM 7345  C C    . THR A 1 89 ? -15.326 -10.494 -2.508  1.00 2.77 ? 89  THR A C    5  
ATOM 7346  O O    . THR A 1 89 ? -14.967 -11.272 -3.395  1.00 3.51 ? 89  THR A O    5  
ATOM 7347  C CB   . THR A 1 89 ? -15.226 -8.600  -4.155  1.00 3.08 ? 89  THR A CB   5  
ATOM 7348  O OG1  . THR A 1 89 ? -14.844 -7.250  -4.358  1.00 3.51 ? 89  THR A OG1  5  
ATOM 7349  C CG2  . THR A 1 89 ? -16.615 -8.770  -4.736  1.00 3.88 ? 89  THR A CG2  5  
ATOM 7350  H H    . THR A 1 89 ? -13.139 -9.228  -2.019  1.00 2.41 ? 89  THR A H    5  
ATOM 7351  H HA   . THR A 1 89 ? -15.921 -8.476  -2.127  1.00 2.82 ? 89  THR A HA   5  
ATOM 7352  H HB   . THR A 1 89 ? -14.554 -9.230  -4.720  1.00 3.20 ? 89  THR A HB   5  
ATOM 7353  H HG1  . THR A 1 89 ? -13.930 -7.216  -4.653  1.00 3.87 ? 89  THR A HG1  5  
ATOM 7354  H HG21 . THR A 1 89 ? -16.590 -8.559  -5.795  1.00 4.03 ? 89  THR A HG21 5  
ATOM 7355  H HG22 . THR A 1 89 ? -17.295 -8.087  -4.249  1.00 4.36 ? 89  THR A HG22 5  
ATOM 7356  H HG23 . THR A 1 89 ? -16.949 -9.785  -4.579  1.00 4.30 ? 89  THR A HG23 5  
ATOM 7357  N N    . GLY A 1 90 ? -15.886 -10.901 -1.368  1.00 2.75 ? 90  GLY A N    5  
ATOM 7358  C CA   . GLY A 1 90 ? -16.108 -12.314 -1.110  1.00 3.54 ? 90  GLY A CA   5  
ATOM 7359  C C    . GLY A 1 90 ? -17.351 -12.848 -1.799  1.00 4.20 ? 90  GLY A C    5  
ATOM 7360  O O    . GLY A 1 90 ? -18.396 -12.194 -1.802  1.00 4.69 ? 90  GLY A O    5  
ATOM 7361  H H    . GLY A 1 90 ? -16.149 -10.239 -0.693  1.00 2.65 ? 90  GLY A H    5  
ATOM 7362  H HA2  . GLY A 1 90 ? -15.250 -12.871 -1.457  1.00 3.91 ? 90  GLY A HA2  5  
ATOM 7363  H HA3  . GLY A 1 90 ? -16.211 -12.461 -0.045  1.00 3.79 ? 90  GLY A HA3  5  
ATOM 7364  N N    . SER A 1 91 ? -17.237 -14.042 -2.381  1.00 4.69 ? 91  SER A N    5  
ATOM 7365  C CA   . SER A 1 91 ? -18.358 -14.673 -3.076  1.00 5.64 ? 91  SER A CA   5  
ATOM 7366  C C    . SER A 1 91 ? -19.372 -15.233 -2.077  1.00 5.73 ? 91  SER A C    5  
ATOM 7367  O O    . SER A 1 91 ? -20.575 -15.000 -2.208  1.00 6.47 ? 91  SER A O    5  
ATOM 7368  C CB   . SER A 1 91 ? -17.857 -15.790 -3.996  1.00 6.57 ? 91  SER A CB   5  
ATOM 7369  O OG   . SER A 1 91 ? -18.851 -16.163 -4.935  1.00 7.06 ? 91  SER A OG   5  
ATOM 7370  H H    . SER A 1 91 ? -16.377 -14.513 -2.339  1.00 4.66 ? 91  SER A H    5  
ATOM 7371  H HA   . SER A 1 91 ? -18.843 -13.916 -3.674  1.00 5.94 ? 91  SER A HA   5  
ATOM 7372  H HB2  . SER A 1 91 ? -16.986 -15.447 -4.533  1.00 6.78 ? 91  SER A HB2  5  
ATOM 7373  H HB3  . SER A 1 91 ? -17.597 -16.653 -3.403  1.00 6.97 ? 91  SER A HB3  5  
ATOM 7374  H HG   . SER A 1 91 ? -19.327 -16.932 -4.612  1.00 7.36 ? 91  SER A HG   5  
ATOM 7375  N N    . HIS A 1 92 ? -18.877 -15.968 -1.079  1.00 5.26 ? 92  HIS A N    5  
ATOM 7376  C CA   . HIS A 1 92 ? -19.736 -16.558 -0.056  1.00 5.60 ? 92  HIS A CA   5  
ATOM 7377  C C    . HIS A 1 92 ? -20.074 -15.537 1.026   1.00 5.37 ? 92  HIS A C    5  
ATOM 7378  O O    . HIS A 1 92 ? -21.242 -15.332 1.358   1.00 5.46 ? 92  HIS A O    5  
ATOM 7379  C CB   . HIS A 1 92 ? -19.059 -17.781 0.572   1.00 5.86 ? 92  HIS A CB   5  
ATOM 7380  C CG   . HIS A 1 92 ? -19.975 -18.953 0.749   1.00 6.59 ? 92  HIS A CG   5  
ATOM 7381  N ND1  . HIS A 1 92 ? -21.275 -18.836 1.199   1.00 7.09 ? 92  HIS A ND1  5  
ATOM 7382  C CD2  . HIS A 1 92 ? -19.771 -20.275 0.535   1.00 7.14 ? 92  HIS A CD2  5  
ATOM 7383  C CE1  . HIS A 1 92 ? -21.829 -20.035 1.255   1.00 7.83 ? 92  HIS A CE1  5  
ATOM 7384  N NE2  . HIS A 1 92 ? -20.938 -20.924 0.856   1.00 7.84 ? 92  HIS A NE2  5  
ATOM 7385  H H    . HIS A 1 92 ? -17.908 -16.115 -1.030  1.00 4.89 ? 92  HIS A H    5  
ATOM 7386  H HA   . HIS A 1 92 ? -20.653 -16.873 -0.535  1.00 6.24 ? 92  HIS A HA   5  
ATOM 7387  H HB2  . HIS A 1 92 ? -18.241 -18.093 -0.059  1.00 5.88 ? 92  HIS A HB2  5  
ATOM 7388  H HB3  . HIS A 1 92 ? -18.672 -17.510 1.543   1.00 5.88 ? 92  HIS A HB3  5  
ATOM 7389  H HD1  . HIS A 1 92 ? -21.724 -18.000 1.442   1.00 7.08 ? 92  HIS A HD1  5  
ATOM 7390  H HD2  . HIS A 1 92 ? -18.859 -20.734 0.178   1.00 7.21 ? 92  HIS A HD2  5  
ATOM 7391  H HE1  . HIS A 1 92 ? -22.839 -20.250 1.570   1.00 8.46 ? 92  HIS A HE1  5  
ATOM 7392  H HE2  . HIS A 1 92 ? -21.054 -21.896 0.900   1.00 8.38 ? 92  HIS A HE2  5  
ATOM 7393  N N    . ARG B 2 1  ? 3.352   -12.272 11.743  1.00 1.88 ? 301 ARG B N    5  
ATOM 7394  C CA   . ARG B 2 1  ? 2.990   -10.931 11.204  1.00 1.27 ? 301 ARG B CA   5  
ATOM 7395  C C    . ARG B 2 1  ? 4.067   -9.890  11.518  1.00 1.29 ? 301 ARG B C    5  
ATOM 7396  O O    . ARG B 2 1  ? 4.792   -10.011 12.509  1.00 2.06 ? 301 ARG B O    5  
ATOM 7397  C CB   . ARG B 2 1  ? 1.640   -10.505 11.798  1.00 1.61 ? 301 ARG B CB   5  
ATOM 7398  C CG   . ARG B 2 1  ? 1.657   -10.308 13.308  1.00 2.13 ? 301 ARG B CG   5  
ATOM 7399  C CD   . ARG B 2 1  ? 2.027   -8.881  13.678  1.00 2.72 ? 301 ARG B CD   5  
ATOM 7400  N NE   . ARG B 2 1  ? 1.351   -8.433  14.895  1.00 3.09 ? 301 ARG B NE   5  
ATOM 7401  C CZ   . ARG B 2 1  ? 0.139   -7.869  14.917  1.00 3.70 ? 301 ARG B CZ   5  
ATOM 7402  N NH1  . ARG B 2 1  ? -0.545  -7.683  13.791  1.00 4.18 ? 301 ARG B NH1  5  
ATOM 7403  N NH2  . ARG B 2 1  ? -0.393  -7.491  16.076  1.00 4.22 ? 301 ARG B NH2  5  
ATOM 7404  H H1   . ARG B 2 1  ? 3.591   -12.159 12.749  1.00 2.43 ? 301 ARG B H1   5  
ATOM 7405  H H2   . ARG B 2 1  ? 4.169   -12.620 11.201  1.00 1.96 ? 301 ARG B H2   5  
ATOM 7406  H H3   . ARG B 2 1  ? 2.531   -12.897 11.622  1.00 2.41 ? 301 ARG B H3   5  
ATOM 7407  H HA   . ARG B 2 1  ? 2.891   -11.015 10.132  1.00 1.25 ? 301 ARG B HA   5  
ATOM 7408  H HB2  . ARG B 2 1  ? 1.338   -9.575  11.341  1.00 1.79 ? 301 ARG B HB2  5  
ATOM 7409  H HB3  . ARG B 2 1  ? 0.906   -11.263 11.565  1.00 2.19 ? 301 ARG B HB3  5  
ATOM 7410  H HG2  . ARG B 2 1  ? 0.675   -10.527 13.700  1.00 2.63 ? 301 ARG B HG2  5  
ATOM 7411  H HG3  . ARG B 2 1  ? 2.378   -10.983 13.743  1.00 2.48 ? 301 ARG B HG3  5  
ATOM 7412  H HD2  . ARG B 2 1  ? 3.095   -8.829  13.834  1.00 3.13 ? 301 ARG B HD2  5  
ATOM 7413  H HD3  . ARG B 2 1  ? 1.753   -8.229  12.862  1.00 3.11 ? 301 ARG B HD3  5  
ATOM 7414  H HE   . ARG B 2 1  ? 1.824   -8.559  15.744  1.00 3.22 ? 301 ARG B HE   5  
ATOM 7415  H HH11 . ARG B 2 1  ? -0.156  -7.967  12.914  1.00 4.11 ? 301 ARG B HH11 5  
ATOM 7416  H HH12 . ARG B 2 1  ? -1.451  -7.259  13.820  1.00 4.83 ? 301 ARG B HH12 5  
ATOM 7417  H HH21 . ARG B 2 1  ? 0.114   -7.629  16.927  1.00 4.29 ? 301 ARG B HH21 5  
ATOM 7418  H HH22 . ARG B 2 1  ? -1.298  -7.068  16.096  1.00 4.75 ? 301 ARG B HH22 5  
ATOM 7419  N N    . ARG B 2 2  ? 4.161   -8.868  10.666  1.00 1.12 ? 302 ARG B N    5  
ATOM 7420  C CA   . ARG B 2 2  ? 5.145   -7.799  10.843  1.00 1.03 ? 302 ARG B CA   5  
ATOM 7421  C C    . ARG B 2 2  ? 4.682   -6.517  10.151  1.00 1.02 ? 302 ARG B C    5  
ATOM 7422  O O    . ARG B 2 2  ? 4.259   -6.541  8.994   1.00 1.45 ? 302 ARG B O    5  
ATOM 7423  C CB   . ARG B 2 2  ? 6.511   -8.232  10.294  1.00 1.13 ? 302 ARG B CB   5  
ATOM 7424  C CG   . ARG B 2 2  ? 7.548   -7.115  10.249  1.00 1.12 ? 302 ARG B CG   5  
ATOM 7425  C CD   . ARG B 2 2  ? 7.897   -6.729  8.821   1.00 1.50 ? 302 ARG B CD   5  
ATOM 7426  N NE   . ARG B 2 2  ? 8.651   -7.780  8.133   1.00 2.09 ? 302 ARG B NE   5  
ATOM 7427  C CZ   . ARG B 2 2  ? 9.976   -7.935  8.222   1.00 2.72 ? 302 ARG B CZ   5  
ATOM 7428  N NH1  . ARG B 2 2  ? 10.704  -7.122  8.985   1.00 2.99 ? 302 ARG B NH1  5  
ATOM 7429  N NH2  . ARG B 2 2  ? 10.573  -8.911  7.546   1.00 3.57 ? 302 ARG B NH2  5  
ATOM 7430  H H    . ARG B 2 2  ? 3.554   -8.832  9.898   1.00 1.61 ? 302 ARG B H    5  
ATOM 7431  H HA   . ARG B 2 2  ? 5.237   -7.608  11.901  1.00 1.03 ? 302 ARG B HA   5  
ATOM 7432  H HB2  . ARG B 2 2  ? 6.898   -9.025  10.915  1.00 1.20 ? 302 ARG B HB2  5  
ATOM 7433  H HB3  . ARG B 2 2  ? 6.378   -8.607  9.293   1.00 1.34 ? 302 ARG B HB3  5  
ATOM 7434  H HG2  . ARG B 2 2  ? 7.153   -6.248  10.756  1.00 1.33 ? 302 ARG B HG2  5  
ATOM 7435  H HG3  . ARG B 2 2  ? 8.445   -7.449  10.749  1.00 1.30 ? 302 ARG B HG3  5  
ATOM 7436  H HD2  . ARG B 2 2  ? 6.982   -6.545  8.278   1.00 1.82 ? 302 ARG B HD2  5  
ATOM 7437  H HD3  . ARG B 2 2  ? 8.490   -5.827  8.840   1.00 1.86 ? 302 ARG B HD3  5  
ATOM 7438  H HE   . ARG B 2 2  ? 8.144   -8.400  7.570   1.00 2.48 ? 302 ARG B HE   5  
ATOM 7439  H HH11 . ARG B 2 2  ? 10.265  -6.388  9.499   1.00 2.71 ? 302 ARG B HH11 5  
ATOM 7440  H HH12 . ARG B 2 2  ? 11.695  -7.249  9.044   1.00 3.75 ? 302 ARG B HH12 5  
ATOM 7441  H HH21 . ARG B 2 2  ? 10.033  -9.526  6.973   1.00 3.78 ? 302 ARG B HH21 5  
ATOM 7442  H HH22 . ARG B 2 2  ? 11.564  -9.030  7.610   1.00 4.18 ? 302 ARG B HH22 5  
ATOM 7443  N N    . GLU B 2 3  ? 4.768   -5.399  10.872  1.00 0.69 ? 303 GLU B N    5  
ATOM 7444  C CA   . GLU B 2 3  ? 4.361   -4.102  10.339  1.00 0.66 ? 303 GLU B CA   5  
ATOM 7445  C C    . GLU B 2 3  ? 5.526   -3.117  10.373  1.00 0.71 ? 303 GLU B C    5  
ATOM 7446  O O    . GLU B 2 3  ? 6.163   -2.933  11.412  1.00 1.16 ? 303 GLU B O    5  
ATOM 7447  C CB   . GLU B 2 3  ? 3.179   -3.542  11.139  1.00 0.71 ? 303 GLU B CB   5  
ATOM 7448  C CG   . GLU B 2 3  ? 2.021   -4.519  11.293  1.00 1.12 ? 303 GLU B CG   5  
ATOM 7449  C CD   . GLU B 2 3  ? 1.965   -5.155  12.670  1.00 1.54 ? 303 GLU B CD   5  
ATOM 7450  O OE1  . GLU B 2 3  ? 2.822   -6.014  12.966  1.00 1.99 ? 303 GLU B OE1  5  
ATOM 7451  O OE2  . GLU B 2 3  ? 1.060   -4.797  13.454  1.00 2.08 ? 303 GLU B OE2  5  
ATOM 7452  H H    . GLU B 2 3  ? 5.115   -5.449  11.788  1.00 0.73 ? 303 GLU B H    5  
ATOM 7453  H HA   . GLU B 2 3  ? 4.056   -4.246  9.313   1.00 0.62 ? 303 GLU B HA   5  
ATOM 7454  H HB2  . GLU B 2 3  ? 3.526   -3.269  12.125  1.00 1.19 ? 303 GLU B HB2  5  
ATOM 7455  H HB3  . GLU B 2 3  ? 2.810   -2.657  10.640  1.00 0.81 ? 303 GLU B HB3  5  
ATOM 7456  H HG2  . GLU B 2 3  ? 1.095   -3.990  11.123  1.00 1.28 ? 303 GLU B HG2  5  
ATOM 7457  H HG3  . GLU B 2 3  ? 2.127   -5.302  10.556  1.00 1.65 ? 303 GLU B HG3  5  
ATOM 7458  N N    . THR B 2 4  ? 5.806   -2.491  9.228   1.00 0.55 ? 304 THR B N    5  
ATOM 7459  C CA   . THR B 2 4  ? 6.902   -1.530  9.128   1.00 0.55 ? 304 THR B CA   5  
ATOM 7460  C C    . THR B 2 4  ? 6.470   -0.278  8.362   1.00 0.53 ? 304 THR B C    5  
ATOM 7461  O O    . THR B 2 4  ? 5.688   -0.356  7.413   1.00 0.54 ? 304 THR B O    5  
ATOM 7462  C CB   . THR B 2 4  ? 8.117   -2.191  8.455   1.00 0.55 ? 304 THR B CB   5  
ATOM 7463  O OG1  . THR B 2 4  ? 9.095   -2.537  9.420   1.00 0.65 ? 304 THR B OG1  5  
ATOM 7464  C CG2  . THR B 2 4  ? 8.796   -1.331  7.409   1.00 0.56 ? 304 THR B CG2  5  
ATOM 7465  H H    . THR B 2 4  ? 5.267   -2.685  8.432   1.00 0.76 ? 304 THR B H    5  
ATOM 7466  H HA   . THR B 2 4  ? 7.174   -1.242  10.129  1.00 0.59 ? 304 THR B HA   5  
ATOM 7467  H HB   . THR B 2 4  ? 7.790   -3.096  7.970   1.00 0.56 ? 304 THR B HB   5  
ATOM 7468  H HG1  . THR B 2 4  ? 9.025   -3.472  9.625   1.00 0.96 ? 304 THR B HG1  5  
ATOM 7469  H HG21 . THR B 2 4  ? 9.118   -0.402  7.856   1.00 1.05 ? 304 THR B HG21 5  
ATOM 7470  H HG22 . THR B 2 4  ? 8.100   -1.126  6.609   1.00 1.13 ? 304 THR B HG22 5  
ATOM 7471  H HG23 . THR B 2 4  ? 9.653   -1.855  7.013   1.00 1.23 ? 304 THR B HG23 5  
ATOM 7472  N N    . GLN B 2 5  ? 6.998   0.876   8.779   1.00 0.58 ? 305 GLN B N    5  
ATOM 7473  C CA   . GLN B 2 5  ? 6.679   2.149   8.133   1.00 0.60 ? 305 GLN B CA   5  
ATOM 7474  C C    . GLN B 2 5  ? 7.427   2.293   6.811   1.00 0.58 ? 305 GLN B C    5  
ATOM 7475  O O    . GLN B 2 5  ? 8.494   1.704   6.619   1.00 0.74 ? 305 GLN B O    5  
ATOM 7476  C CB   . GLN B 2 5  ? 7.022   3.324   9.052   1.00 0.76 ? 305 GLN B CB   5  
ATOM 7477  C CG   . GLN B 2 5  ? 5.945   3.627   10.082  1.00 0.89 ? 305 GLN B CG   5  
ATOM 7478  C CD   . GLN B 2 5  ? 6.506   4.239   11.353  1.00 1.13 ? 305 GLN B CD   5  
ATOM 7479  O OE1  . GLN B 2 5  ? 6.783   3.535   12.324  1.00 1.67 ? 305 GLN B OE1  5  
ATOM 7480  N NE2  . GLN B 2 5  ? 6.675   5.559   11.354  1.00 1.50 ? 305 GLN B NE2  5  
ATOM 7481  H H    . GLN B 2 5  ? 7.620   0.869   9.537   1.00 0.64 ? 305 GLN B H    5  
ATOM 7482  H HA   . GLN B 2 5  ? 5.620   2.160   7.932   1.00 0.57 ? 305 GLN B HA   5  
ATOM 7483  H HB2  . GLN B 2 5  ? 7.940   3.102   9.576   1.00 0.76 ? 305 GLN B HB2  5  
ATOM 7484  H HB3  . GLN B 2 5  ? 7.167   4.206   8.446   1.00 0.88 ? 305 GLN B HB3  5  
ATOM 7485  H HG2  . GLN B 2 5  ? 5.237   4.318   9.650   1.00 0.96 ? 305 GLN B HG2  5  
ATOM 7486  H HG3  . GLN B 2 5  ? 5.438   2.707   10.337  1.00 0.87 ? 305 GLN B HG3  5  
ATOM 7487  H HE21 . GLN B 2 5  ? 6.432   6.060   10.547  1.00 1.97 ? 305 GLN B HE21 5  
ATOM 7488  H HE22 . GLN B 2 5  ? 7.036   5.978   12.163  1.00 1.62 ? 305 GLN B HE22 5  
ATOM 7489  N N    . VAL B 2 6  ? 6.855   3.077   5.900   1.00 0.58 ? 306 VAL B N    5  
ATOM 7490  C CA   . VAL B 2 6  ? 7.455   3.300   4.587   1.00 0.63 ? 306 VAL B CA   5  
ATOM 7491  C C    . VAL B 2 6  ? 7.251   4.741   4.111   1.00 0.77 ? 306 VAL B C    5  
ATOM 7492  O O    . VAL B 2 6  ? 8.073   5.214   3.299   1.00 1.47 ? 306 VAL B O    5  
ATOM 7493  C CB   . VAL B 2 6  ? 6.872   2.331   3.537   1.00 0.54 ? 306 VAL B CB   5  
ATOM 7494  C CG1  . VAL B 2 6  ? 7.393   0.919   3.768   1.00 0.51 ? 306 VAL B CG1  5  
ATOM 7495  C CG2  . VAL B 2 6  ? 5.348   2.357   3.566   1.00 0.49 ? 306 VAL B CG2  5  
ATOM 7496  O OXT  . VAL B 2 6  ? 6.273   5.383   4.554   1.00 1.14 ? 306 VAL B OXT  5  
ATOM 7497  H H    . VAL B 2 6  ? 6.003   3.513   6.114   1.00 0.70 ? 306 VAL B H    5  
ATOM 7498  H HA   . VAL B 2 6  ? 8.516   3.109   4.669   1.00 0.71 ? 306 VAL B HA   5  
ATOM 7499  H HB   . VAL B 2 6  ? 7.198   2.653   2.559   1.00 0.63 ? 306 VAL B HB   5  
ATOM 7500  H HG11 . VAL B 2 6  ? 8.470   0.940   3.841   1.00 1.08 ? 306 VAL B HG11 5  
ATOM 7501  H HG12 . VAL B 2 6  ? 7.101   0.287   2.942   1.00 1.13 ? 306 VAL B HG12 5  
ATOM 7502  H HG13 . VAL B 2 6  ? 6.980   0.525   4.687   1.00 1.04 ? 306 VAL B HG13 5  
ATOM 7503  H HG21 . VAL B 2 6  ? 5.007   3.382   3.579   1.00 1.09 ? 306 VAL B HG21 5  
ATOM 7504  H HG22 . VAL B 2 6  ? 4.996   1.850   4.453   1.00 1.15 ? 306 VAL B HG22 5  
ATOM 7505  H HG23 . VAL B 2 6  ? 4.962   1.860   2.689   1.00 1.15 ? 306 VAL B HG23 5  
ATOM 7506  N N    . MET A 1 1  ? -8.549  -0.071  -7.559  1.00 1.83 ? 1   MET A N    6  
ATOM 7507  C CA   . MET A 1 1  ? -8.463  1.416   -7.551  1.00 1.38 ? 1   MET A CA   6  
ATOM 7508  C C    . MET A 1 1  ? -7.010  1.890   -7.507  1.00 1.20 ? 1   MET A C    6  
ATOM 7509  O O    . MET A 1 1  ? -6.148  1.226   -6.932  1.00 1.07 ? 1   MET A O    6  
ATOM 7510  C CB   . MET A 1 1  ? -9.228  1.949   -6.335  1.00 1.81 ? 1   MET A CB   6  
ATOM 7511  C CG   . MET A 1 1  ? -10.729 2.062   -6.559  1.00 2.04 ? 1   MET A CG   6  
ATOM 7512  S SD   . MET A 1 1  ? -11.166 3.403   -7.683  1.00 2.69 ? 1   MET A SD   6  
ATOM 7513  C CE   . MET A 1 1  ? -12.803 2.892   -8.199  1.00 3.17 ? 1   MET A CE   6  
ATOM 7514  H H1   . MET A 1 1  ? -8.138  -0.419  -6.668  1.00 2.20 ? 1   MET A H1   6  
ATOM 7515  H H2   . MET A 1 1  ? -8.012  -0.415  -8.381  1.00 2.22 ? 1   MET A H2   6  
ATOM 7516  H H3   . MET A 1 1  ? -9.553  -0.331  -7.632  1.00 1.92 ? 1   MET A H3   6  
ATOM 7517  H HA   . MET A 1 1  ? -8.925  1.790   -8.452  1.00 1.47 ? 1   MET A HA   6  
ATOM 7518  H HB2  . MET A 1 1  ? -9.060  1.286   -5.499  1.00 2.32 ? 1   MET A HB2  6  
ATOM 7519  H HB3  . MET A 1 1  ? -8.849  2.930   -6.087  1.00 2.16 ? 1   MET A HB3  6  
ATOM 7520  H HG2  . MET A 1 1  ? -11.087 1.132   -6.975  1.00 2.47 ? 1   MET A HG2  6  
ATOM 7521  H HG3  . MET A 1 1  ? -11.208 2.236   -5.607  1.00 2.24 ? 1   MET A HG3  6  
ATOM 7522  H HE1  . MET A 1 1  ? -13.472 2.912   -7.352  1.00 3.35 ? 1   MET A HE1  6  
ATOM 7523  H HE2  . MET A 1 1  ? -12.759 1.889   -8.598  1.00 3.35 ? 1   MET A HE2  6  
ATOM 7524  H HE3  . MET A 1 1  ? -13.167 3.566   -8.961  1.00 3.67 ? 1   MET A HE3  6  
ATOM 7525  N N    . GLU A 1 2  ? -6.752  3.044   -8.120  1.00 1.25 ? 2   GLU A N    6  
ATOM 7526  C CA   . GLU A 1 2  ? -5.407  3.618   -8.158  1.00 1.15 ? 2   GLU A CA   6  
ATOM 7527  C C    . GLU A 1 2  ? -5.412  5.059   -7.652  1.00 1.12 ? 2   GLU A C    6  
ATOM 7528  O O    . GLU A 1 2  ? -6.453  5.721   -7.648  1.00 1.17 ? 2   GLU A O    6  
ATOM 7529  C CB   . GLU A 1 2  ? -4.841  3.564   -9.582  1.00 1.22 ? 2   GLU A CB   6  
ATOM 7530  C CG   . GLU A 1 2  ? -5.692  4.292   -10.612 1.00 1.74 ? 2   GLU A CG   6  
ATOM 7531  C CD   . GLU A 1 2  ? -6.500  3.344   -11.479 1.00 1.63 ? 2   GLU A CD   6  
ATOM 7532  O OE1  . GLU A 1 2  ? -7.577  2.899   -11.029 1.00 1.97 ? 2   GLU A OE1  6  
ATOM 7533  O OE2  . GLU A 1 2  ? -6.054  3.045   -12.607 1.00 1.88 ? 2   GLU A OE2  6  
ATOM 7534  H H    . GLU A 1 2  ? -7.485  3.525   -8.559  1.00 1.40 ? 2   GLU A H    6  
ATOM 7535  H HA   . GLU A 1 2  ? -4.779  3.027   -7.509  1.00 1.06 ? 2   GLU A HA   6  
ATOM 7536  H HB2  . GLU A 1 2  ? -3.857  4.009   -9.582  1.00 1.76 ? 2   GLU A HB2  6  
ATOM 7537  H HB3  . GLU A 1 2  ? -4.757  2.530   -9.882  1.00 1.34 ? 2   GLU A HB3  6  
ATOM 7538  H HG2  . GLU A 1 2  ? -6.374  4.952   -10.098 1.00 2.14 ? 2   GLU A HG2  6  
ATOM 7539  H HG3  . GLU A 1 2  ? -5.042  4.874   -11.249 1.00 2.47 ? 2   GLU A HG3  6  
ATOM 7540  N N    . ILE A 1 3  ? -4.241  5.545   -7.236  1.00 1.09 ? 3   ILE A N    6  
ATOM 7541  C CA   . ILE A 1 3  ? -4.095  6.907   -6.737  1.00 1.10 ? 3   ILE A CA   6  
ATOM 7542  C C    . ILE A 1 3  ? -2.777  7.501   -7.237  1.00 1.02 ? 3   ILE A C    6  
ATOM 7543  O O    . ILE A 1 3  ? -1.763  6.798   -7.300  1.00 1.07 ? 3   ILE A O    6  
ATOM 7544  C CB   . ILE A 1 3  ? -4.119  6.945   -5.191  1.00 1.18 ? 3   ILE A CB   6  
ATOM 7545  C CG1  . ILE A 1 3  ? -5.474  6.466   -4.659  1.00 1.34 ? 3   ILE A CG1  6  
ATOM 7546  C CG2  . ILE A 1 3  ? -3.812  8.346   -4.685  1.00 1.22 ? 3   ILE A CG2  6  
ATOM 7547  C CD1  . ILE A 1 3  ? -5.497  4.996   -4.293  1.00 1.10 ? 3   ILE A CD1  6  
ATOM 7548  H H    . ILE A 1 3  ? -3.439  4.986   -7.270  1.00 1.08 ? 3   ILE A H    6  
ATOM 7549  H HA   . ILE A 1 3  ? -4.918  7.499   -7.112  1.00 1.15 ? 3   ILE A HA   6  
ATOM 7550  H HB   . ILE A 1 3  ? -3.345  6.284   -4.828  1.00 1.17 ? 3   ILE A HB   6  
ATOM 7551  H HG12 . ILE A 1 3  ? -5.724  7.030   -3.773  1.00 1.83 ? 3   ILE A HG12 6  
ATOM 7552  H HG13 . ILE A 1 3  ? -6.229  6.633   -5.412  1.00 1.86 ? 3   ILE A HG13 6  
ATOM 7553  H HG21 . ILE A 1 3  ? -2.794  8.603   -4.939  1.00 1.72 ? 3   ILE A HG21 6  
ATOM 7554  H HG22 . ILE A 1 3  ? -3.937  8.378   -3.614  1.00 1.51 ? 3   ILE A HG22 6  
ATOM 7555  H HG23 . ILE A 1 3  ? -4.488  9.050   -5.149  1.00 1.55 ? 3   ILE A HG23 6  
ATOM 7556  H HD11 . ILE A 1 3  ? -5.397  4.892   -3.222  1.00 1.47 ? 3   ILE A HD11 6  
ATOM 7557  H HD12 . ILE A 1 3  ? -4.678  4.490   -4.781  1.00 1.61 ? 3   ILE A HD12 6  
ATOM 7558  H HD13 . ILE A 1 3  ? -6.432  4.561   -4.611  1.00 1.54 ? 3   ILE A HD13 6  
ATOM 7559  N N    . LYS A 1 4  ? -2.787  8.788   -7.591  1.00 0.98 ? 4   LYS A N    6  
ATOM 7560  C CA   . LYS A 1 4  ? -1.577  9.444   -8.082  1.00 0.96 ? 4   LYS A CA   6  
ATOM 7561  C C    . LYS A 1 4  ? -0.884  10.219  -6.960  1.00 0.96 ? 4   LYS A C    6  
ATOM 7562  O O    . LYS A 1 4  ? -1.207  11.379  -6.693  1.00 1.08 ? 4   LYS A O    6  
ATOM 7563  C CB   . LYS A 1 4  ? -1.917  10.381  -9.247  1.00 1.07 ? 4   LYS A CB   6  
ATOM 7564  C CG   . LYS A 1 4  ? -0.921  10.313  -10.396 1.00 1.35 ? 4   LYS A CG   6  
ATOM 7565  C CD   . LYS A 1 4  ? -1.475  9.526   -11.573 1.00 1.59 ? 4   LYS A CD   6  
ATOM 7566  C CE   . LYS A 1 4  ? -0.372  9.125   -12.543 1.00 2.29 ? 4   LYS A CE   6  
ATOM 7567  N NZ   . LYS A 1 4  ? -0.813  9.229   -13.962 1.00 2.93 ? 4   LYS A NZ   6  
ATOM 7568  H H    . LYS A 1 4  ? -3.616  9.306   -7.518  1.00 1.01 ? 4   LYS A H    6  
ATOM 7569  H HA   . LYS A 1 4  ? -0.907  8.676   -8.437  1.00 0.96 ? 4   LYS A HA   6  
ATOM 7570  H HB2  . LYS A 1 4  ? -2.893  10.122  -9.630  1.00 1.56 ? 4   LYS A HB2  6  
ATOM 7571  H HB3  . LYS A 1 4  ? -1.944  11.397  -8.883  1.00 1.61 ? 4   LYS A HB3  6  
ATOM 7572  H HG2  . LYS A 1 4  ? -0.696  11.317  -10.722 1.00 1.93 ? 4   LYS A HG2  6  
ATOM 7573  H HG3  . LYS A 1 4  ? -0.018  9.835   -10.046 1.00 1.87 ? 4   LYS A HG3  6  
ATOM 7574  H HD2  . LYS A 1 4  ? -1.957  8.634   -11.203 1.00 1.98 ? 4   LYS A HD2  6  
ATOM 7575  H HD3  . LYS A 1 4  ? -2.196  10.138  -12.095 1.00 1.90 ? 4   LYS A HD3  6  
ATOM 7576  H HE2  . LYS A 1 4  ? 0.477   9.774   -12.392 1.00 2.72 ? 4   LYS A HE2  6  
ATOM 7577  H HE3  . LYS A 1 4  ? -0.085  8.104   -12.338 1.00 2.70 ? 4   LYS A HE3  6  
ATOM 7578  H HZ1  . LYS A 1 4  ? -1.028  10.219  -14.199 1.00 3.17 ? 4   LYS A HZ1  6  
ATOM 7579  H HZ2  . LYS A 1 4  ? -1.666  8.653   -14.116 1.00 3.54 ? 4   LYS A HZ2  6  
ATOM 7580  H HZ3  . LYS A 1 4  ? -0.061  8.888   -14.596 1.00 3.06 ? 4   LYS A HZ3  6  
ATOM 7581  N N    . LEU A 1 5  ? 0.045   9.544   -6.285  1.00 0.89 ? 5   LEU A N    6  
ATOM 7582  C CA   . LEU A 1 5  ? 0.764   10.139  -5.161  1.00 0.97 ? 5   LEU A CA   6  
ATOM 7583  C C    . LEU A 1 5  ? 2.018   10.885  -5.618  1.00 0.88 ? 5   LEU A C    6  
ATOM 7584  O O    . LEU A 1 5  ? 2.875   10.328  -6.305  1.00 0.82 ? 5   LEU A O    6  
ATOM 7585  C CB   . LEU A 1 5  ? 1.138   9.059   -4.139  1.00 1.11 ? 5   LEU A CB   6  
ATOM 7586  C CG   . LEU A 1 5  ? -0.004  8.610   -3.219  1.00 1.42 ? 5   LEU A CG   6  
ATOM 7587  C CD1  . LEU A 1 5  ? 0.410   7.392   -2.407  1.00 1.50 ? 5   LEU A CD1  6  
ATOM 7588  C CD2  . LEU A 1 5  ? -0.430  9.746   -2.298  1.00 2.09 ? 5   LEU A CD2  6  
ATOM 7589  H H    . LEU A 1 5  ? 0.197   8.605   -6.522  1.00 0.85 ? 5   LEU A H    6  
ATOM 7590  H HA   . LEU A 1 5  ? 0.100   10.843  -4.687  1.00 1.10 ? 5   LEU A HA   6  
ATOM 7591  H HB2  . LEU A 1 5  ? 1.501   8.195   -4.677  1.00 1.26 ? 5   LEU A HB2  6  
ATOM 7592  H HB3  . LEU A 1 5  ? 1.938   9.439   -3.522  1.00 1.25 ? 5   LEU A HB3  6  
ATOM 7593  H HG   . LEU A 1 5  ? -0.855  8.332   -3.825  1.00 1.86 ? 5   LEU A HG   6  
ATOM 7594  H HD11 . LEU A 1 5  ? 0.492   6.535   -3.060  1.00 1.87 ? 5   LEU A HD11 6  
ATOM 7595  H HD12 . LEU A 1 5  ? -0.331  7.197   -1.647  1.00 2.01 ? 5   LEU A HD12 6  
ATOM 7596  H HD13 . LEU A 1 5  ? 1.365   7.578   -1.939  1.00 1.76 ? 5   LEU A HD13 6  
ATOM 7597  H HD21 . LEU A 1 5  ? -1.160  9.382   -1.590  1.00 2.37 ? 5   LEU A HD21 6  
ATOM 7598  H HD22 . LEU A 1 5  ? -0.865  10.542  -2.885  1.00 2.53 ? 5   LEU A HD22 6  
ATOM 7599  H HD23 . LEU A 1 5  ? 0.431   10.121  -1.765  1.00 2.63 ? 5   LEU A HD23 6  
ATOM 7600  N N    . ILE A 1 6  ? 2.095   12.163  -5.234  1.00 0.95 ? 6   ILE A N    6  
ATOM 7601  C CA   . ILE A 1 6  ? 3.219   13.024  -5.601  1.00 0.90 ? 6   ILE A CA   6  
ATOM 7602  C C    . ILE A 1 6  ? 4.339   12.891  -4.566  1.00 0.93 ? 6   ILE A C    6  
ATOM 7603  O O    . ILE A 1 6  ? 4.151   13.228  -3.394  1.00 1.06 ? 6   ILE A O    6  
ATOM 7604  C CB   . ILE A 1 6  ? 2.769   14.516  -5.682  1.00 1.04 ? 6   ILE A CB   6  
ATOM 7605  C CG1  . ILE A 1 6  ? 2.106   14.803  -7.029  1.00 1.29 ? 6   ILE A CG1  6  
ATOM 7606  C CG2  . ILE A 1 6  ? 3.930   15.491  -5.447  1.00 1.21 ? 6   ILE A CG2  6  
ATOM 7607  C CD1  . ILE A 1 6  ? 0.627   14.476  -7.060  1.00 1.94 ? 6   ILE A CD1  6  
ATOM 7608  H H    . ILE A 1 6  ? 1.355   12.540  -4.713  1.00 1.06 ? 6   ILE A H    6  
ATOM 7609  H HA   . ILE A 1 6  ? 3.574   12.708  -6.579  1.00 0.86 ? 6   ILE A HA   6  
ATOM 7610  H HB   . ILE A 1 6  ? 2.043   14.681  -4.901  1.00 1.27 ? 6   ILE A HB   6  
ATOM 7611  H HG12 . ILE A 1 6  ? 2.215   15.853  -7.261  1.00 1.47 ? 6   ILE A HG12 6  
ATOM 7612  H HG13 . ILE A 1 6  ? 2.593   14.218  -7.792  1.00 1.34 ? 6   ILE A HG13 6  
ATOM 7613  H HG21 . ILE A 1 6  ? 4.557   15.537  -6.326  1.00 1.62 ? 6   ILE A HG21 6  
ATOM 7614  H HG22 . ILE A 1 6  ? 4.516   15.167  -4.601  1.00 1.62 ? 6   ILE A HG22 6  
ATOM 7615  H HG23 . ILE A 1 6  ? 3.530   16.475  -5.245  1.00 1.45 ? 6   ILE A HG23 6  
ATOM 7616  H HD11 . ILE A 1 6  ? 0.135   14.954  -6.226  1.00 2.44 ? 6   ILE A HD11 6  
ATOM 7617  H HD12 . ILE A 1 6  ? 0.493   13.406  -6.992  1.00 2.21 ? 6   ILE A HD12 6  
ATOM 7618  H HD13 . ILE A 1 6  ? 0.199   14.835  -7.984  1.00 2.30 ? 6   ILE A HD13 6  
ATOM 7619  N N    . LYS A 1 7  ? 5.496   12.381  -4.998  1.00 0.91 ? 7   LYS A N    6  
ATOM 7620  C CA   . LYS A 1 7  ? 6.634   12.189  -4.097  1.00 1.06 ? 7   LYS A CA   6  
ATOM 7621  C C    . LYS A 1 7  ? 7.124   13.516  -3.516  1.00 1.18 ? 7   LYS A C    6  
ATOM 7622  O O    . LYS A 1 7  ? 7.582   14.397  -4.249  1.00 1.29 ? 7   LYS A O    6  
ATOM 7623  C CB   . LYS A 1 7  ? 7.785   11.480  -4.815  1.00 1.26 ? 7   LYS A CB   6  
ATOM 7624  C CG   . LYS A 1 7  ? 8.966   11.166  -3.907  1.00 1.78 ? 7   LYS A CG   6  
ATOM 7625  C CD   . LYS A 1 7  ? 8.663   10.004  -2.975  1.00 2.30 ? 7   LYS A CD   6  
ATOM 7626  C CE   . LYS A 1 7  ? 9.570   10.014  -1.754  1.00 2.50 ? 7   LYS A CE   6  
ATOM 7627  N NZ   . LYS A 1 7  ? 10.783  9.171   -1.951  1.00 3.10 ? 7   LYS A NZ   6  
ATOM 7628  H H    . LYS A 1 7  ? 5.581   12.112  -5.939  1.00 0.88 ? 7   LYS A H    6  
ATOM 7629  H HA   . LYS A 1 7  ? 6.300   11.564  -3.283  1.00 1.12 ? 7   LYS A HA   6  
ATOM 7630  H HB2  . LYS A 1 7  ? 7.420   10.552  -5.230  1.00 1.17 ? 7   LYS A HB2  6  
ATOM 7631  H HB3  . LYS A 1 7  ? 8.134   12.110  -5.617  1.00 1.45 ? 7   LYS A HB3  6  
ATOM 7632  H HG2  . LYS A 1 7  ? 9.818   10.910  -4.515  1.00 2.05 ? 7   LYS A HG2  6  
ATOM 7633  H HG3  . LYS A 1 7  ? 9.195   12.041  -3.315  1.00 2.37 ? 7   LYS A HG3  6  
ATOM 7634  H HD2  . LYS A 1 7  ? 7.637   10.075  -2.648  1.00 2.80 ? 7   LYS A HD2  6  
ATOM 7635  H HD3  . LYS A 1 7  ? 8.809   9.081   -3.513  1.00 2.70 ? 7   LYS A HD3  6  
ATOM 7636  H HE2  . LYS A 1 7  ? 9.877   11.031  -1.558  1.00 3.04 ? 7   LYS A HE2  6  
ATOM 7637  H HE3  . LYS A 1 7  ? 9.014   9.638   -0.907  1.00 2.26 ? 7   LYS A HE3  6  
ATOM 7638  H HZ1  . LYS A 1 7  ? 10.514  8.168   -2.024  1.00 3.61 ? 7   LYS A HZ1  6  
ATOM 7639  H HZ2  . LYS A 1 7  ? 11.432  9.286   -1.146  1.00 3.37 ? 7   LYS A HZ2  6  
ATOM 7640  H HZ3  . LYS A 1 7  ? 11.278  9.451   -2.822  1.00 3.30 ? 7   LYS A HZ3  6  
ATOM 7641  N N    . GLY A 1 8  ? 7.028   13.639  -2.193  1.00 1.38 ? 8   GLY A N    6  
ATOM 7642  C CA   . GLY A 1 8  ? 7.467   14.847  -1.514  1.00 1.62 ? 8   GLY A CA   6  
ATOM 7643  C C    . GLY A 1 8  ? 8.705   14.618  -0.661  1.00 1.78 ? 8   GLY A C    6  
ATOM 7644  O O    . GLY A 1 8  ? 9.140   13.476  -0.493  1.00 1.78 ? 8   GLY A O    6  
ATOM 7645  H H    . GLY A 1 8  ? 6.655   12.895  -1.673  1.00 1.48 ? 8   GLY A H    6  
ATOM 7646  H HA2  . GLY A 1 8  ? 7.687   15.605  -2.252  1.00 1.65 ? 8   GLY A HA2  6  
ATOM 7647  H HA3  . GLY A 1 8  ? 6.668   15.199  -0.879  1.00 1.79 ? 8   GLY A HA3  6  
ATOM 7648  N N    . PRO A 1 9  ? 9.295   15.693  -0.101  1.00 2.05 ? 9   PRO A N    6  
ATOM 7649  C CA   . PRO A 1 9  ? 10.495  15.595  0.747   1.00 2.32 ? 9   PRO A CA   6  
ATOM 7650  C C    . PRO A 1 9  ? 10.308  14.625  1.915   1.00 2.37 ? 9   PRO A C    6  
ATOM 7651  O O    . PRO A 1 9  ? 11.239  13.911  2.294   1.00 2.77 ? 9   PRO A O    6  
ATOM 7652  C CB   . PRO A 1 9  ? 10.687  17.024  1.266   1.00 2.68 ? 9   PRO A CB   6  
ATOM 7653  C CG   . PRO A 1 9  ? 10.007  17.887  0.260   1.00 2.59 ? 9   PRO A CG   6  
ATOM 7654  C CD   . PRO A 1 9  ? 8.840   17.089  -0.248  1.00 2.24 ? 9   PRO A CD   6  
ATOM 7655  H HA   . PRO A 1 9  ? 11.360  15.299  0.172   1.00 2.37 ? 9   PRO A HA   6  
ATOM 7656  H HB2  . PRO A 1 9  ? 10.233  17.121  2.241   1.00 2.85 ? 9   PRO A HB2  6  
ATOM 7657  H HB3  . PRO A 1 9  ? 11.741  17.248  1.329   1.00 2.89 ? 9   PRO A HB3  6  
ATOM 7658  H HG2  . PRO A 1 9  ? 9.663   18.797  0.730   1.00 2.84 ? 9   PRO A HG2  6  
ATOM 7659  H HG3  . PRO A 1 9  ? 10.685  18.115  -0.549  1.00 2.61 ? 9   PRO A HG3  6  
ATOM 7660  H HD2  . PRO A 1 9  ? 7.964   17.274  0.357   1.00 2.35 ? 9   PRO A HD2  6  
ATOM 7661  H HD3  . PRO A 1 9  ? 8.643   17.323  -1.283  1.00 2.14 ? 9   PRO A HD3  6  
ATOM 7662  N N    . LYS A 1 10 ? 9.096   14.603  2.477   1.00 2.38 ? 10  LYS A N    6  
ATOM 7663  C CA   . LYS A 1 10 ? 8.780   13.719  3.597   1.00 2.57 ? 10  LYS A CA   6  
ATOM 7664  C C    . LYS A 1 10 ? 8.857   12.253  3.166   1.00 2.26 ? 10  LYS A C    6  
ATOM 7665  O O    . LYS A 1 10 ? 9.750   11.521  3.594   1.00 2.45 ? 10  LYS A O    6  
ATOM 7666  C CB   . LYS A 1 10 ? 7.386   14.032  4.156   1.00 2.99 ? 10  LYS A CB   6  
ATOM 7667  C CG   . LYS A 1 10 ? 7.234   15.460  4.662   1.00 3.71 ? 10  LYS A CG   6  
ATOM 7668  C CD   . LYS A 1 10 ? 6.916   15.498  6.148   1.00 4.04 ? 10  LYS A CD   6  
ATOM 7669  C CE   . LYS A 1 10 ? 8.179   15.608  6.989   1.00 4.40 ? 10  LYS A CE   6  
ATOM 7670  N NZ   . LYS A 1 10 ? 7.964   16.426  8.216   1.00 4.92 ? 10  LYS A NZ   6  
ATOM 7671  H H    . LYS A 1 10 ? 8.403   15.197  2.121   1.00 2.55 ? 10  LYS A H    6  
ATOM 7672  H HA   . LYS A 1 10 ? 9.514   13.890  4.370   1.00 2.82 ? 10  LYS A HA   6  
ATOM 7673  H HB2  . LYS A 1 10 ? 6.654   13.870  3.378   1.00 3.13 ? 10  LYS A HB2  6  
ATOM 7674  H HB3  . LYS A 1 10 ? 7.182   13.359  4.976   1.00 2.88 ? 10  LYS A HB3  6  
ATOM 7675  H HG2  . LYS A 1 10 ? 8.156   15.994  4.487   1.00 3.97 ? 10  LYS A HG2  6  
ATOM 7676  H HG3  . LYS A 1 10 ? 6.432   15.938  4.118   1.00 4.13 ? 10  LYS A HG3  6  
ATOM 7677  H HD2  . LYS A 1 10 ? 6.287   16.353  6.349   1.00 4.48 ? 10  LYS A HD2  6  
ATOM 7678  H HD3  . LYS A 1 10 ? 6.391   14.594  6.418   1.00 4.00 ? 10  LYS A HD3  6  
ATOM 7679  H HE2  . LYS A 1 10 ? 8.489   14.616  7.281   1.00 4.59 ? 10  LYS A HE2  6  
ATOM 7680  H HE3  . LYS A 1 10 ? 8.955   16.067  6.393   1.00 4.53 ? 10  LYS A HE3  6  
ATOM 7681  H HZ1  . LYS A 1 10 ? 7.210   16.007  8.797   1.00 5.28 ? 10  LYS A HZ1  6  
ATOM 7682  H HZ2  . LYS A 1 10 ? 7.691   17.395  7.956   1.00 5.13 ? 10  LYS A HZ2  6  
ATOM 7683  H HZ3  . LYS A 1 10 ? 8.838   16.463  8.779   1.00 5.08 ? 10  LYS A HZ3  6  
ATOM 7684  N N    . GLY A 1 11 ? 7.915   11.834  2.317   1.00 2.10 ? 11  GLY A N    6  
ATOM 7685  C CA   . GLY A 1 11 ? 7.890   10.460  1.841   1.00 2.10 ? 11  GLY A CA   6  
ATOM 7686  C C    . GLY A 1 11 ? 6.478   9.911   1.747   1.00 2.08 ? 11  GLY A C    6  
ATOM 7687  O O    . GLY A 1 11 ? 5.592   10.563  1.191   1.00 2.30 ? 11  GLY A O    6  
ATOM 7688  H H    . GLY A 1 11 ? 7.226   12.463  2.015   1.00 2.22 ? 11  GLY A H    6  
ATOM 7689  H HA2  . GLY A 1 11 ? 8.346   10.420  0.863   1.00 2.53 ? 11  GLY A HA2  6  
ATOM 7690  H HA3  . GLY A 1 11 ? 8.460   9.842   2.519   1.00 2.21 ? 11  GLY A HA3  6  
ATOM 7691  N N    . LEU A 1 12 ? 6.264   8.720   2.303   1.00 2.47 ? 12  LEU A N    6  
ATOM 7692  C CA   . LEU A 1 12 ? 4.944   8.092   2.292   1.00 2.77 ? 12  LEU A CA   6  
ATOM 7693  C C    . LEU A 1 12 ? 4.131   8.555   3.499   1.00 1.92 ? 12  LEU A C    6  
ATOM 7694  O O    . LEU A 1 12 ? 3.004   9.024   3.354   1.00 2.52 ? 12  LEU A O    6  
ATOM 7695  C CB   . LEU A 1 12 ? 5.079   6.567   2.290   1.00 3.62 ? 12  LEU A CB   6  
ATOM 7696  C CG   . LEU A 1 12 ? 5.805   5.986   1.074   1.00 4.87 ? 12  LEU A CG   6  
ATOM 7697  C CD1  . LEU A 1 12 ? 6.365   4.611   1.395   1.00 5.33 ? 12  LEU A CD1  6  
ATOM 7698  C CD2  . LEU A 1 12 ? 4.869   5.917   -0.125  1.00 5.70 ? 12  LEU A CD2  6  
ATOM 7699  H H    . LEU A 1 12 ? 7.004   8.253   2.745   1.00 2.84 ? 12  LEU A H    6  
ATOM 7700  H HA   . LEU A 1 12 ? 4.436   8.402   1.391   1.00 3.41 ? 12  LEU A HA   6  
ATOM 7701  H HB2  . LEU A 1 12 ? 5.618   6.275   3.179   1.00 3.58 ? 12  LEU A HB2  6  
ATOM 7702  H HB3  . LEU A 1 12 ? 4.091   6.138   2.331   1.00 3.65 ? 12  LEU A HB3  6  
ATOM 7703  H HG   . LEU A 1 12 ? 6.633   6.631   0.816   1.00 5.19 ? 12  LEU A HG   6  
ATOM 7704  H HD11 . LEU A 1 12 ? 7.277   4.455   0.839   1.00 5.40 ? 12  LEU A HD11 6  
ATOM 7705  H HD12 . LEU A 1 12 ? 5.643   3.855   1.124   1.00 5.57 ? 12  LEU A HD12 6  
ATOM 7706  H HD13 . LEU A 1 12 ? 6.574   4.545   2.452   1.00 5.68 ? 12  LEU A HD13 6  
ATOM 7707  H HD21 . LEU A 1 12 ? 4.794   6.894   -0.580  1.00 6.03 ? 12  LEU A HD21 6  
ATOM 7708  H HD22 . LEU A 1 12 ? 3.891   5.596   0.200   1.00 5.93 ? 12  LEU A HD22 6  
ATOM 7709  H HD23 . LEU A 1 12 ? 5.258   5.213   -0.846  1.00 6.06 ? 12  LEU A HD23 6  
ATOM 7710  N N    . GLY A 1 13 ? 4.718   8.422   4.690   1.00 1.13 ? 13  GLY A N    6  
ATOM 7711  C CA   . GLY A 1 13 ? 4.049   8.840   5.910   1.00 1.11 ? 13  GLY A CA   6  
ATOM 7712  C C    . GLY A 1 13 ? 3.054   7.824   6.438   1.00 0.96 ? 13  GLY A C    6  
ATOM 7713  O O    . GLY A 1 13 ? 2.015   8.202   6.975   1.00 1.03 ? 13  GLY A O    6  
ATOM 7714  H H    . GLY A 1 13 ? 5.618   8.035   4.739   1.00 1.49 ? 13  GLY A H    6  
ATOM 7715  H HA2  . GLY A 1 13 ? 4.797   9.012   6.669   1.00 1.58 ? 13  GLY A HA2  6  
ATOM 7716  H HA3  . GLY A 1 13 ? 3.530   9.767   5.723   1.00 1.81 ? 13  GLY A HA3  6  
ATOM 7717  N N    . PHE A 1 14 ? 3.367   6.537   6.292   1.00 0.81 ? 14  PHE A N    6  
ATOM 7718  C CA   . PHE A 1 14 ? 2.489   5.471   6.775   1.00 0.71 ? 14  PHE A CA   6  
ATOM 7719  C C    . PHE A 1 14 ? 3.264   4.161   6.930   1.00 0.56 ? 14  PHE A C    6  
ATOM 7720  O O    . PHE A 1 14 ? 4.482   4.130   6.745   1.00 0.52 ? 14  PHE A O    6  
ATOM 7721  C CB   . PHE A 1 14 ? 1.270   5.294   5.852   1.00 0.74 ? 14  PHE A CB   6  
ATOM 7722  C CG   . PHE A 1 14 ? 1.598   4.970   4.419   1.00 0.63 ? 14  PHE A CG   6  
ATOM 7723  C CD1  . PHE A 1 14 ? 2.014   3.699   4.058   1.00 1.27 ? 14  PHE A CD1  6  
ATOM 7724  C CD2  . PHE A 1 14 ? 1.469   5.935   3.432   1.00 1.41 ? 14  PHE A CD2  6  
ATOM 7725  C CE1  . PHE A 1 14 ? 2.298   3.397   2.741   1.00 1.33 ? 14  PHE A CE1  6  
ATOM 7726  C CE2  . PHE A 1 14 ? 1.749   5.638   2.113   1.00 1.46 ? 14  PHE A CE2  6  
ATOM 7727  C CZ   . PHE A 1 14 ? 2.166   4.367   1.767   1.00 0.83 ? 14  PHE A CZ   6  
ATOM 7728  H H    . PHE A 1 14 ? 4.207   6.293   5.849   1.00 0.79 ? 14  PHE A H    6  
ATOM 7729  H HA   . PHE A 1 14 ? 2.137   5.767   7.752   1.00 0.81 ? 14  PHE A HA   6  
ATOM 7730  H HB2  . PHE A 1 14 ? 0.657   4.493   6.234   1.00 0.84 ? 14  PHE A HB2  6  
ATOM 7731  H HB3  . PHE A 1 14 ? 0.694   6.209   5.860   1.00 0.89 ? 14  PHE A HB3  6  
ATOM 7732  H HD1  . PHE A 1 14 ? 2.118   2.939   4.818   1.00 2.12 ? 14  PHE A HD1  6  
ATOM 7733  H HD2  . PHE A 1 14 ? 1.146   6.931   3.701   1.00 2.28 ? 14  PHE A HD2  6  
ATOM 7734  H HE1  . PHE A 1 14 ? 2.623   2.402   2.473   1.00 2.19 ? 14  PHE A HE1  6  
ATOM 7735  H HE2  . PHE A 1 14 ? 1.644   6.398   1.353   1.00 2.33 ? 14  PHE A HE2  6  
ATOM 7736  H HZ   . PHE A 1 14 ? 2.384   4.132   0.736   1.00 0.99 ? 14  PHE A HZ   6  
ATOM 7737  N N    . SER A 1 15 ? 2.557   3.078   7.258   1.00 0.55 ? 15  SER A N    6  
ATOM 7738  C CA   . SER A 1 15 ? 3.177   1.770   7.423   1.00 0.47 ? 15  SER A CA   6  
ATOM 7739  C C    . SER A 1 15 ? 2.412   0.726   6.617   1.00 0.47 ? 15  SER A C    6  
ATOM 7740  O O    . SER A 1 15 ? 1.336   1.013   6.085   1.00 0.52 ? 15  SER A O    6  
ATOM 7741  C CB   . SER A 1 15 ? 3.210   1.364   8.899   1.00 0.50 ? 15  SER A CB   6  
ATOM 7742  O OG   . SER A 1 15 ? 2.104   1.888   9.601   1.00 0.57 ? 15  SER A OG   6  
ATOM 7743  H H    . SER A 1 15 ? 1.588   3.146   7.374   1.00 0.65 ? 15  SER A H    6  
ATOM 7744  H HA   . SER A 1 15 ? 4.186   1.830   7.053   1.00 0.48 ? 15  SER A HA   6  
ATOM 7745  H HB2  . SER A 1 15 ? 3.183   0.291   8.970   1.00 0.52 ? 15  SER A HB2  6  
ATOM 7746  H HB3  . SER A 1 15 ? 4.114   1.733   9.355   1.00 0.54 ? 15  SER A HB3  6  
ATOM 7747  H HG   . SER A 1 15 ? 2.247   2.823   9.768   1.00 1.10 ? 15  SER A HG   6  
ATOM 7748  N N    . ILE A 1 16 ? 2.958   -0.483  6.532   1.00 0.44 ? 16  ILE A N    6  
ATOM 7749  C CA   . ILE A 1 16 ? 2.312   -1.564  5.790   1.00 0.46 ? 16  ILE A CA   6  
ATOM 7750  C C    . ILE A 1 16 ? 2.747   -2.933  6.306   1.00 0.46 ? 16  ILE A C    6  
ATOM 7751  O O    . ILE A 1 16 ? 3.710   -3.050  7.060   1.00 0.45 ? 16  ILE A O    6  
ATOM 7752  C CB   . ILE A 1 16 ? 2.633   -1.508  4.269   1.00 0.47 ? 16  ILE A CB   6  
ATOM 7753  C CG1  . ILE A 1 16 ? 4.011   -2.114  3.957   1.00 0.67 ? 16  ILE A CG1  6  
ATOM 7754  C CG2  . ILE A 1 16 ? 2.530   -0.087  3.727   1.00 0.57 ? 16  ILE A CG2  6  
ATOM 7755  C CD1  . ILE A 1 16 ? 5.167   -1.194  4.250   1.00 0.64 ? 16  ILE A CD1  6  
ATOM 7756  H H    . ILE A 1 16 ? 3.809   -0.659  6.985   1.00 0.44 ? 16  ILE A H    6  
ATOM 7757  H HA   . ILE A 1 16 ? 1.235   -1.463  5.909   1.00 0.49 ? 16  ILE A HA   6  
ATOM 7758  H HB   . ILE A 1 16 ? 1.892   -2.097  3.768   1.00 0.59 ? 16  ILE A HB   6  
ATOM 7759  H HG12 . ILE A 1 16 ? 4.147   -3.010  4.541   1.00 1.45 ? 16  ILE A HG12 6  
ATOM 7760  H HG13 . ILE A 1 16 ? 4.051   -2.369  2.907   1.00 1.37 ? 16  ILE A HG13 6  
ATOM 7761  H HG21 . ILE A 1 16 ? 1.527   0.283   3.871   1.00 1.32 ? 16  ILE A HG21 6  
ATOM 7762  H HG22 . ILE A 1 16 ? 2.766   -0.087  2.673   1.00 1.06 ? 16  ILE A HG22 6  
ATOM 7763  H HG23 . ILE A 1 16 ? 3.227   0.551   4.250   1.00 1.09 ? 16  ILE A HG23 6  
ATOM 7764  H HD11 . ILE A 1 16 ? 4.826   -0.382  4.871   1.00 1.34 ? 16  ILE A HD11 6  
ATOM 7765  H HD12 . ILE A 1 16 ? 5.556   -0.802  3.321   1.00 1.24 ? 16  ILE A HD12 6  
ATOM 7766  H HD13 . ILE A 1 16 ? 5.942   -1.746  4.764   1.00 1.38 ? 16  ILE A HD13 6  
ATOM 7767  N N    . ALA A 1 17 ? 2.038   -3.956  5.845   1.00 0.51 ? 17  ALA A N    6  
ATOM 7768  C CA   . ALA A 1 17 ? 2.321   -5.349  6.172   1.00 0.55 ? 17  ALA A CA   6  
ATOM 7769  C C    . ALA A 1 17 ? 2.234   -6.141  4.869   1.00 0.73 ? 17  ALA A C    6  
ATOM 7770  O O    . ALA A 1 17 ? 1.673   -5.636  3.905   1.00 1.19 ? 17  ALA A O    6  
ATOM 7771  C CB   . ALA A 1 17 ? 1.346   -5.867  7.216   1.00 0.71 ? 17  ALA A CB   6  
ATOM 7772  H H    . ALA A 1 17 ? 1.295   -3.774  5.230   1.00 0.55 ? 17  ALA A H    6  
ATOM 7773  H HA   . ALA A 1 17 ? 3.323   -5.414  6.564   1.00 0.50 ? 17  ALA A HA   6  
ATOM 7774  H HB1  . ALA A 1 17 ? 0.443   -5.270  7.192   1.00 1.21 ? 17  ALA A HB1  6  
ATOM 7775  H HB2  . ALA A 1 17 ? 1.795   -5.795  8.196   1.00 1.22 ? 17  ALA A HB2  6  
ATOM 7776  H HB3  . ALA A 1 17 ? 1.104   -6.897  7.006   1.00 1.33 ? 17  ALA A HB3  6  
ATOM 7777  N N    . GLY A 1 18 ? 2.755   -7.364  4.807   1.00 0.60 ? 18  GLY A N    6  
ATOM 7778  C CA   . GLY A 1 18 ? 2.626   -8.093  3.552   1.00 0.77 ? 18  GLY A CA   6  
ATOM 7779  C C    . GLY A 1 18 ? 3.512   -9.310  3.397   1.00 0.85 ? 18  GLY A C    6  
ATOM 7780  O O    . GLY A 1 18 ? 4.706   -9.226  3.656   1.00 1.29 ? 18  GLY A O    6  
ATOM 7781  H H    . GLY A 1 18 ? 3.152   -7.771  5.605   1.00 0.67 ? 18  GLY A H    6  
ATOM 7782  H HA2  . GLY A 1 18 ? 1.604   -8.407  3.456   1.00 0.96 ? 18  GLY A HA2  6  
ATOM 7783  H HA3  . GLY A 1 18 ? 2.846   -7.408  2.747   1.00 1.37 ? 18  GLY A HA3  6  
ATOM 7784  N N    . GLY A 1 19 ? 2.951   -10.434 2.939   1.00 1.01 ? 19  GLY A N    6  
ATOM 7785  C CA   . GLY A 1 19 ? 3.758   -11.625 2.724   1.00 1.61 ? 19  GLY A CA   6  
ATOM 7786  C C    . GLY A 1 19 ? 3.564   -12.681 3.786   1.00 0.89 ? 19  GLY A C    6  
ATOM 7787  O O    . GLY A 1 19 ? 3.086   -12.385 4.877   1.00 0.76 ? 19  GLY A O    6  
ATOM 7788  H H    . GLY A 1 19 ? 1.993   -10.476 2.736   1.00 1.01 ? 19  GLY A H    6  
ATOM 7789  H HA2  . GLY A 1 19 ? 3.500   -12.049 1.765   1.00 2.30 ? 19  GLY A HA2  6  
ATOM 7790  H HA3  . GLY A 1 19 ? 4.800   -11.339 2.705   1.00 2.32 ? 19  GLY A HA3  6  
ATOM 7791  N N    . VAL A 1 20 ? 3.937   -13.919 3.459   1.00 0.97 ? 20  VAL A N    6  
ATOM 7792  C CA   . VAL A 1 20 ? 3.808   -15.031 4.397   1.00 1.05 ? 20  VAL A CA   6  
ATOM 7793  C C    . VAL A 1 20 ? 4.726   -14.820 5.607   1.00 1.18 ? 20  VAL A C    6  
ATOM 7794  O O    . VAL A 1 20 ? 5.854   -14.339 5.462   1.00 1.35 ? 20  VAL A O    6  
ATOM 7795  C CB   . VAL A 1 20 ? 4.135   -16.385 3.725   1.00 1.68 ? 20  VAL A CB   6  
ATOM 7796  C CG1  . VAL A 1 20 ? 5.607   -16.466 3.342   1.00 1.76 ? 20  VAL A CG1  6  
ATOM 7797  C CG2  . VAL A 1 20 ? 3.749   -17.544 4.634   1.00 2.72 ? 20  VAL A CG2  6  
ATOM 7798  H H    . VAL A 1 20 ? 4.303   -14.082 2.564   1.00 1.38 ? 20  VAL A H    6  
ATOM 7799  H HA   . VAL A 1 20 ? 2.780   -15.054 4.732   1.00 0.98 ? 20  VAL A HA   6  
ATOM 7800  H HB   . VAL A 1 20 ? 3.551   -16.461 2.819   1.00 2.13 ? 20  VAL A HB   6  
ATOM 7801  H HG11 . VAL A 1 20 ? 5.906   -15.547 2.862   1.00 2.30 ? 20  VAL A HG11 6  
ATOM 7802  H HG12 . VAL A 1 20 ? 5.758   -17.292 2.663   1.00 1.97 ? 20  VAL A HG12 6  
ATOM 7803  H HG13 . VAL A 1 20 ? 6.203   -16.618 4.230   1.00 2.15 ? 20  VAL A HG13 6  
ATOM 7804  H HG21 . VAL A 1 20 ? 2.717   -17.437 4.937   1.00 3.33 ? 20  VAL A HG21 6  
ATOM 7805  H HG22 . VAL A 1 20 ? 4.382   -17.542 5.509   1.00 3.14 ? 20  VAL A HG22 6  
ATOM 7806  H HG23 . VAL A 1 20 ? 3.872   -18.476 4.103   1.00 3.02 ? 20  VAL A HG23 6  
ATOM 7807  N N    . GLY A 1 21 ? 4.233   -15.158 6.802   1.00 1.30 ? 21  GLY A N    6  
ATOM 7808  C CA   . GLY A 1 21 ? 5.018   -14.973 8.017   1.00 1.54 ? 21  GLY A CA   6  
ATOM 7809  C C    . GLY A 1 21 ? 4.914   -13.555 8.575   1.00 1.24 ? 21  GLY A C    6  
ATOM 7810  O O    . GLY A 1 21 ? 5.227   -13.314 9.742   1.00 1.56 ? 21  GLY A O    6  
ATOM 7811  H H    . GLY A 1 21 ? 3.325   -15.523 6.858   1.00 1.35 ? 21  GLY A H    6  
ATOM 7812  H HA2  . GLY A 1 21 ? 4.670   -15.668 8.767   1.00 1.90 ? 21  GLY A HA2  6  
ATOM 7813  H HA3  . GLY A 1 21 ? 6.054   -15.186 7.800   1.00 1.72 ? 21  GLY A HA3  6  
ATOM 7814  N N    . ASN A 1 22 ? 4.466   -12.623 7.731   1.00 0.73 ? 22  ASN A N    6  
ATOM 7815  C CA   . ASN A 1 22 ? 4.299   -11.220 8.107   1.00 0.61 ? 22  ASN A CA   6  
ATOM 7816  C C    . ASN A 1 22 ? 2.967   -10.664 7.570   1.00 0.65 ? 22  ASN A C    6  
ATOM 7817  O O    . ASN A 1 22 ? 2.822   -9.451  7.397   1.00 0.67 ? 22  ASN A O    6  
ATOM 7818  C CB   . ASN A 1 22 ? 5.474   -10.375 7.571   1.00 0.47 ? 22  ASN A CB   6  
ATOM 7819  C CG   . ASN A 1 22 ? 6.074   -10.928 6.289   1.00 0.74 ? 22  ASN A CG   6  
ATOM 7820  O OD1  . ASN A 1 22 ? 5.377   -11.123 5.299   1.00 1.27 ? 22  ASN A OD1  6  
ATOM 7821  N ND2  . ASN A 1 22 ? 7.377   -11.186 6.305   1.00 1.63 ? 22  ASN A ND2  6  
ATOM 7822  H H    . ASN A 1 22 ? 4.231   -12.889 6.826   1.00 0.63 ? 22  ASN A H    6  
ATOM 7823  H HA   . ASN A 1 22 ? 4.289   -11.164 9.185   1.00 0.88 ? 22  ASN A HA   6  
ATOM 7824  H HB2  . ASN A 1 22 ? 5.121   -9.374  7.371   1.00 0.82 ? 22  ASN A HB2  6  
ATOM 7825  H HB3  . ASN A 1 22 ? 6.255   -10.327 8.313   1.00 0.63 ? 22  ASN A HB3  6  
ATOM 7826  H HD21 . ASN A 1 22 ? 7.876   -11.008 7.131   1.00 2.15 ? 22  ASN A HD21 6  
ATOM 7827  H HD22 . ASN A 1 22 ? 7.788   -11.544 5.491   1.00 1.98 ? 22  ASN A HD22 6  
ATOM 7828  N N    . GLN A 1 23 ? 2.005   -11.557 7.281   1.00 0.77 ? 23  GLN A N    6  
ATOM 7829  C CA   . GLN A 1 23 ? 0.700   -11.161 6.734   1.00 0.94 ? 23  GLN A CA   6  
ATOM 7830  C C    . GLN A 1 23 ? -0.045  -10.168 7.624   1.00 0.88 ? 23  GLN A C    6  
ATOM 7831  O O    . GLN A 1 23 ? -0.016  -10.267 8.851   1.00 0.87 ? 23  GLN A O    6  
ATOM 7832  C CB   . GLN A 1 23 ? -0.202  -12.387 6.536   1.00 1.19 ? 23  GLN A CB   6  
ATOM 7833  C CG   . GLN A 1 23 ? 0.335   -13.416 5.555   1.00 1.42 ? 23  GLN A CG   6  
ATOM 7834  C CD   . GLN A 1 23 ? 0.898   -14.644 6.249   1.00 1.55 ? 23  GLN A CD   6  
ATOM 7835  O OE1  . GLN A 1 23 ? 1.558   -14.538 7.283   1.00 1.62 ? 23  GLN A OE1  6  
ATOM 7836  N NE2  . GLN A 1 23 ? 0.638   -15.819 5.686   1.00 2.34 ? 23  GLN A NE2  6  
ATOM 7837  H H    . GLN A 1 23 ? 2.171   -12.515 7.406   1.00 0.79 ? 23  GLN A H    6  
ATOM 7838  H HA   . GLN A 1 23 ? 0.875   -10.704 5.772   1.00 1.04 ? 23  GLN A HA   6  
ATOM 7839  H HB2  . GLN A 1 23 ? -0.337  -12.874 7.490   1.00 1.46 ? 23  GLN A HB2  6  
ATOM 7840  H HB3  . GLN A 1 23 ? -1.165  -12.052 6.178   1.00 1.49 ? 23  GLN A HB3  6  
ATOM 7841  H HG2  . GLN A 1 23 ? -0.471  -13.727 4.906   1.00 1.80 ? 23  GLN A HG2  6  
ATOM 7842  H HG3  . GLN A 1 23 ? 1.114   -12.963 4.965   1.00 1.68 ? 23  GLN A HG3  6  
ATOM 7843  H HE21 . GLN A 1 23 ? 0.104   -15.834 4.864   1.00 2.92 ? 23  GLN A HE21 6  
ATOM 7844  H HE22 . GLN A 1 23 ? 0.992   -16.626 6.116   1.00 2.51 ? 23  GLN A HE22 6  
ATOM 7845  N N    . HIS A 1 24 ? -0.739  -9.231  6.979   1.00 0.86 ? 24  HIS A N    6  
ATOM 7846  C CA   . HIS A 1 24 ? -1.535  -8.225  7.681   1.00 0.83 ? 24  HIS A CA   6  
ATOM 7847  C C    . HIS A 1 24 ? -2.971  -8.711  7.876   1.00 0.84 ? 24  HIS A C    6  
ATOM 7848  O O    . HIS A 1 24 ? -3.639  -8.336  8.841   1.00 0.92 ? 24  HIS A O    6  
ATOM 7849  C CB   . HIS A 1 24 ? -1.561  -6.917  6.890   1.00 0.85 ? 24  HIS A CB   6  
ATOM 7850  C CG   . HIS A 1 24 ? -2.187  -5.789  7.629   1.00 0.83 ? 24  HIS A CG   6  
ATOM 7851  N ND1  . HIS A 1 24 ? -1.515  -5.028  8.552   1.00 0.90 ? 24  HIS A ND1  6  
ATOM 7852  C CD2  . HIS A 1 24 ? -3.436  -5.286  7.558   1.00 0.81 ? 24  HIS A CD2  6  
ATOM 7853  C CE1  . HIS A 1 24 ? -2.322  -4.101  9.018   1.00 0.88 ? 24  HIS A CE1  6  
ATOM 7854  N NE2  . HIS A 1 24 ? -3.497  -4.232  8.433   1.00 0.82 ? 24  HIS A NE2  6  
ATOM 7855  H H    . HIS A 1 24 ? -0.727  -9.220  5.998   1.00 0.90 ? 24  HIS A H    6  
ATOM 7856  H HA   . HIS A 1 24 ? -1.085  -8.050  8.646   1.00 0.84 ? 24  HIS A HA   6  
ATOM 7857  H HB2  . HIS A 1 24 ? -0.561  -6.630  6.636   1.00 0.91 ? 24  HIS A HB2  6  
ATOM 7858  H HB3  . HIS A 1 24 ? -2.126  -7.062  5.985   1.00 0.87 ? 24  HIS A HB3  6  
ATOM 7859  H HD1  . HIS A 1 24 ? -0.584  -5.154  8.831   1.00 0.98 ? 24  HIS A HD1  6  
ATOM 7860  H HD2  . HIS A 1 24 ? -4.235  -5.649  6.923   1.00 0.82 ? 24  HIS A HD2  6  
ATOM 7861  H HE1  . HIS A 1 24 ? -2.058  -3.354  9.742   1.00 0.95 ? 24  HIS A HE1  6  
ATOM 7862  H HE2  . HIS A 1 24 ? -4.311  -3.749  8.685   1.00 0.82 ? 24  HIS A HE2  6  
ATOM 7863  N N    . ILE A 1 25 ? -3.433  -9.549  6.947   1.00 0.80 ? 25  ILE A N    6  
ATOM 7864  C CA   . ILE A 1 25 ? -4.785  -10.093 6.994   1.00 0.86 ? 25  ILE A CA   6  
ATOM 7865  C C    . ILE A 1 25 ? -4.777  -11.573 6.609   1.00 0.81 ? 25  ILE A C    6  
ATOM 7866  O O    . ILE A 1 25 ? -4.249  -11.942 5.558   1.00 0.80 ? 25  ILE A O    6  
ATOM 7867  C CB   . ILE A 1 25 ? -5.736  -9.318  6.052   1.00 0.95 ? 25  ILE A CB   6  
ATOM 7868  C CG1  . ILE A 1 25 ? -5.626  -7.807  6.290   1.00 1.01 ? 25  ILE A CG1  6  
ATOM 7869  C CG2  . ILE A 1 25 ? -7.174  -9.777  6.244   1.00 1.51 ? 25  ILE A CG2  6  
ATOM 7870  C CD1  . ILE A 1 25 ? -6.206  -7.351  7.614   1.00 1.16 ? 25  ILE A CD1  6  
ATOM 7871  H H    . ILE A 1 25 ? -2.839  -9.809  6.212   1.00 0.77 ? 25  ILE A H    6  
ATOM 7872  H HA   . ILE A 1 25 ? -5.149  -9.993  8.006   1.00 0.92 ? 25  ILE A HA   6  
ATOM 7873  H HB   . ILE A 1 25 ? -5.451  -9.534  5.033   1.00 1.28 ? 25  ILE A HB   6  
ATOM 7874  H HG12 . ILE A 1 25 ? -4.586  -7.520  6.269   1.00 1.40 ? 25  ILE A HG12 6  
ATOM 7875  H HG13 . ILE A 1 25 ? -6.153  -7.288  5.502   1.00 1.51 ? 25  ILE A HG13 6  
ATOM 7876  H HG21 . ILE A 1 25 ? -7.335  -10.030 7.282   1.00 1.96 ? 25  ILE A HG21 6  
ATOM 7877  H HG22 . ILE A 1 25 ? -7.363  -10.643 5.628   1.00 1.82 ? 25  ILE A HG22 6  
ATOM 7878  H HG23 . ILE A 1 25 ? -7.845  -8.978  5.961   1.00 1.95 ? 25  ILE A HG23 6  
ATOM 7879  H HD11 . ILE A 1 25 ? -5.510  -6.684  8.102   1.00 1.53 ? 25  ILE A HD11 6  
ATOM 7880  H HD12 . ILE A 1 25 ? -6.382  -8.209  8.245   1.00 1.45 ? 25  ILE A HD12 6  
ATOM 7881  H HD13 . ILE A 1 25 ? -7.138  -6.835  7.441   1.00 1.78 ? 25  ILE A HD13 6  
ATOM 7882  N N    . PRO A 1 26 ? -5.358  -12.445 7.461   1.00 0.82 ? 26  PRO A N    6  
ATOM 7883  C CA   . PRO A 1 26 ? -5.407  -13.890 7.202   1.00 0.82 ? 26  PRO A CA   6  
ATOM 7884  C C    . PRO A 1 26 ? -6.117  -14.220 5.892   1.00 0.86 ? 26  PRO A C    6  
ATOM 7885  O O    . PRO A 1 26 ? -7.254  -13.798 5.667   1.00 0.95 ? 26  PRO A O    6  
ATOM 7886  C CB   . PRO A 1 26 ? -6.188  -14.455 8.397   1.00 0.88 ? 26  PRO A CB   6  
ATOM 7887  C CG   . PRO A 1 26 ? -6.886  -13.283 9.000   1.00 0.98 ? 26  PRO A CG   6  
ATOM 7888  C CD   . PRO A 1 26 ? -6.006  -12.096 8.735   1.00 0.87 ? 26  PRO A CD   6  
ATOM 7889  H HA   . PRO A 1 26 ? -4.414  -14.317 7.186   1.00 0.79 ? 26  PRO A HA   6  
ATOM 7890  H HB2  . PRO A 1 26 ? -6.892  -15.196 8.050   1.00 1.04 ? 26  PRO A HB2  6  
ATOM 7891  H HB3  . PRO A 1 26 ? -5.500  -14.905 9.097   1.00 0.96 ? 26  PRO A HB3  6  
ATOM 7892  H HG2  . PRO A 1 26 ? -7.849  -13.148 8.531   1.00 1.27 ? 26  PRO A HG2  6  
ATOM 7893  H HG3  . PRO A 1 26 ? -7.002  -13.433 10.064  1.00 1.26 ? 26  PRO A HG3  6  
ATOM 7894  H HD2  . PRO A 1 26 ? -6.601  -11.200 8.637   1.00 0.94 ? 26  PRO A HD2  6  
ATOM 7895  H HD3  . PRO A 1 26 ? -5.274  -11.983 9.521   1.00 0.95 ? 26  PRO A HD3  6  
ATOM 7896  N N    . GLY A 1 27 ? -5.434  -14.975 5.031   1.00 0.85 ? 27  GLY A N    6  
ATOM 7897  C CA   . GLY A 1 27 ? -6.007  -15.353 3.750   1.00 0.94 ? 27  GLY A CA   6  
ATOM 7898  C C    . GLY A 1 27 ? -5.378  -14.616 2.580   1.00 0.92 ? 27  GLY A C    6  
ATOM 7899  O O    . GLY A 1 27 ? -5.085  -15.224 1.549   1.00 1.06 ? 27  GLY A O    6  
ATOM 7900  H H    . GLY A 1 27 ? -4.533  -15.280 5.268   1.00 0.81 ? 27  GLY A H    6  
ATOM 7901  H HA2  . GLY A 1 27 ? -5.867  -16.415 3.608   1.00 1.04 ? 27  GLY A HA2  6  
ATOM 7902  H HA3  . GLY A 1 27 ? -7.066  -15.141 3.766   1.00 1.00 ? 27  GLY A HA3  6  
ATOM 7903  N N    . ASP A 1 28 ? -5.174  -13.304 2.733   1.00 0.80 ? 28  ASP A N    6  
ATOM 7904  C CA   . ASP A 1 28 ? -4.583  -12.495 1.669   1.00 0.80 ? 28  ASP A CA   6  
ATOM 7905  C C    . ASP A 1 28 ? -3.187  -12.001 2.048   1.00 0.65 ? 28  ASP A C    6  
ATOM 7906  O O    . ASP A 1 28 ? -3.024  -11.214 2.984   1.00 0.57 ? 28  ASP A O    6  
ATOM 7907  C CB   . ASP A 1 28 ? -5.488  -11.303 1.336   1.00 0.91 ? 28  ASP A CB   6  
ATOM 7908  C CG   . ASP A 1 28 ? -5.954  -11.318 -0.109  1.00 1.08 ? 28  ASP A CG   6  
ATOM 7909  O OD1  . ASP A 1 28 ? -5.098  -11.219 -1.015  1.00 1.68 ? 28  ASP A OD1  6  
ATOM 7910  O OD2  . ASP A 1 28 ? -7.178  -11.425 -0.335  1.00 1.48 ? 28  ASP A OD2  6  
ATOM 7911  H H    . ASP A 1 28 ? -5.431  -12.872 3.574   1.00 0.76 ? 28  ASP A H    6  
ATOM 7912  H HA   . ASP A 1 28 ? -4.499  -13.120 0.793   1.00 0.92 ? 28  ASP A HA   6  
ATOM 7913  H HB2  . ASP A 1 28 ? -6.358  -11.329 1.976   1.00 1.05 ? 28  ASP A HB2  6  
ATOM 7914  H HB3  . ASP A 1 28 ? -4.945  -10.387 1.510   1.00 0.85 ? 28  ASP A HB3  6  
ATOM 7915  N N    . ASN A 1 29 ? -2.184  -12.472 1.303   1.00 0.69 ? 29  ASN A N    6  
ATOM 7916  C CA   . ASN A 1 29 ? -0.787  -12.090 1.540   1.00 0.63 ? 29  ASN A CA   6  
ATOM 7917  C C    . ASN A 1 29 ? -0.445  -10.740 0.884   1.00 0.59 ? 29  ASN A C    6  
ATOM 7918  O O    . ASN A 1 29 ? 0.729   -10.444 0.647   1.00 0.65 ? 29  ASN A O    6  
ATOM 7919  C CB   . ASN A 1 29 ? 0.162   -13.170 1.005   1.00 0.79 ? 29  ASN A CB   6  
ATOM 7920  C CG   . ASN A 1 29 ? -0.381  -14.578 1.184   1.00 1.36 ? 29  ASN A CG   6  
ATOM 7921  O OD1  . ASN A 1 29 ? -0.878  -15.187 0.237   1.00 2.11 ? 29  ASN A OD1  6  
ATOM 7922  N ND2  . ASN A 1 29 ? -0.288  -15.100 2.401   1.00 1.98 ? 29  ASN A ND2  6  
ATOM 7923  H H    . ASN A 1 29 ? -2.397  -13.101 0.581   1.00 0.80 ? 29  ASN A H    6  
ATOM 7924  H HA   . ASN A 1 29 ? -0.644  -12.004 2.609   1.00 0.58 ? 29  ASN A HA   6  
ATOM 7925  H HB2  . ASN A 1 29 ? 0.329   -13.000 -0.047  1.00 1.38 ? 29  ASN A HB2  6  
ATOM 7926  H HB3  . ASN A 1 29 ? 1.104   -13.098 1.531   1.00 1.03 ? 29  ASN A HB3  6  
ATOM 7927  H HD21 . ASN A 1 29 ? 0.119   -14.559 3.109   1.00 2.27 ? 29  ASN A HD21 6  
ATOM 7928  H HD22 . ASN A 1 29 ? -0.631  -16.007 2.543   1.00 2.54 ? 29  ASN A HD22 6  
ATOM 7929  N N    . SER A 1 30 ? -1.467  -9.922  0.598   1.00 0.56 ? 30  SER A N    6  
ATOM 7930  C CA   . SER A 1 30 ? -1.261  -8.611  -0.021  1.00 0.56 ? 30  SER A CA   6  
ATOM 7931  C C    . SER A 1 30 ? -0.584  -7.647  0.951   1.00 0.55 ? 30  SER A C    6  
ATOM 7932  O O    . SER A 1 30 ? -0.292  -8.007  2.094   1.00 0.55 ? 30  SER A O    6  
ATOM 7933  C CB   . SER A 1 30 ? -2.592  -8.016  -0.506  1.00 0.60 ? 30  SER A CB   6  
ATOM 7934  O OG   . SER A 1 30 ? -3.677  -8.899  -0.275  1.00 1.39 ? 30  SER A OG   6  
ATOM 7935  H H    . SER A 1 30 ? -2.379  -10.201 0.812   1.00 0.58 ? 30  SER A H    6  
ATOM 7936  H HA   . SER A 1 30 ? -0.612  -8.751  -0.869  1.00 0.60 ? 30  SER A HA   6  
ATOM 7937  H HB2  . SER A 1 30 ? -2.783  -7.092  0.018   1.00 1.26 ? 30  SER A HB2  6  
ATOM 7938  H HB3  . SER A 1 30 ? -2.527  -7.819  -1.567  1.00 1.02 ? 30  SER A HB3  6  
ATOM 7939  H HG   . SER A 1 30 ? -4.500  -8.460  -0.500  1.00 1.77 ? 30  SER A HG   6  
ATOM 7940  N N    . ILE A 1 31 ? -0.356  -6.411  0.500   1.00 0.55 ? 31  ILE A N    6  
ATOM 7941  C CA   . ILE A 1 31 ? 0.269   -5.407  1.355   1.00 0.55 ? 31  ILE A CA   6  
ATOM 7942  C C    . ILE A 1 31 ? -0.772  -4.411  1.878   1.00 0.57 ? 31  ILE A C    6  
ATOM 7943  O O    . ILE A 1 31 ? -1.304  -3.595  1.129   1.00 0.65 ? 31  ILE A O    6  
ATOM 7944  C CB   . ILE A 1 31 ? 1.413   -4.647  0.636   1.00 0.53 ? 31  ILE A CB   6  
ATOM 7945  C CG1  . ILE A 1 31 ? 2.405   -5.611  -0.047  1.00 0.62 ? 31  ILE A CG1  6  
ATOM 7946  C CG2  . ILE A 1 31 ? 2.146   -3.744  1.617   1.00 0.60 ? 31  ILE A CG2  6  
ATOM 7947  C CD1  . ILE A 1 31 ? 2.447   -7.015  0.529   1.00 0.80 ? 31  ILE A CD1  6  
ATOM 7948  H H    . ILE A 1 31 ? -0.640  -6.177  -0.411  1.00 0.57 ? 31  ILE A H    6  
ATOM 7949  H HA   . ILE A 1 31 ? 0.692   -5.926  2.198   1.00 0.54 ? 31  ILE A HA   6  
ATOM 7950  H HB   . ILE A 1 31 ? 0.975   -4.019  -0.117  1.00 0.74 ? 31  ILE A HB   6  
ATOM 7951  H HG12 . ILE A 1 31 ? 2.141   -5.695  -1.088  1.00 1.20 ? 31  ILE A HG12 6  
ATOM 7952  H HG13 . ILE A 1 31 ? 3.398   -5.195  0.024   1.00 1.19 ? 31  ILE A HG13 6  
ATOM 7953  H HG21 . ILE A 1 31 ? 2.832   -3.108  1.077   1.00 1.13 ? 31  ILE A HG21 6  
ATOM 7954  H HG22 . ILE A 1 31 ? 2.697   -4.349  2.322   1.00 1.21 ? 31  ILE A HG22 6  
ATOM 7955  H HG23 . ILE A 1 31 ? 1.432   -3.133  2.148   1.00 1.13 ? 31  ILE A HG23 6  
ATOM 7956  H HD11 . ILE A 1 31 ? 3.468   -7.280  0.759   1.00 1.15 ? 31  ILE A HD11 6  
ATOM 7957  H HD12 . ILE A 1 31 ? 2.048   -7.712  -0.192  1.00 1.28 ? 31  ILE A HD12 6  
ATOM 7958  H HD13 . ILE A 1 31 ? 1.854   -7.054  1.430   1.00 1.46 ? 31  ILE A HD13 6  
ATOM 7959  N N    . TYR A 1 32 ? -1.060  -4.504  3.177   1.00 0.60 ? 32  TYR A N    6  
ATOM 7960  C CA   . TYR A 1 32 ? -2.041  -3.634  3.822   1.00 0.62 ? 32  TYR A CA   6  
ATOM 7961  C C    . TYR A 1 32 ? -1.375  -2.573  4.691   1.00 0.59 ? 32  TYR A C    6  
ATOM 7962  O O    . TYR A 1 32 ? -0.349  -2.828  5.318   1.00 0.61 ? 32  TYR A O    6  
ATOM 7963  C CB   . TYR A 1 32 ? -2.984  -4.461  4.694   1.00 0.69 ? 32  TYR A CB   6  
ATOM 7964  C CG   . TYR A 1 32 ? -3.872  -5.419  3.936   1.00 0.71 ? 32  TYR A CG   6  
ATOM 7965  C CD1  . TYR A 1 32 ? -3.335  -6.473  3.209   1.00 1.28 ? 32  TYR A CD1  6  
ATOM 7966  C CD2  . TYR A 1 32 ? -5.252  -5.278  3.967   1.00 1.34 ? 32  TYR A CD2  6  
ATOM 7967  C CE1  . TYR A 1 32 ? -4.148  -7.357  2.530   1.00 1.30 ? 32  TYR A CE1  6  
ATOM 7968  C CE2  . TYR A 1 32 ? -6.074  -6.155  3.299   1.00 1.38 ? 32  TYR A CE2  6  
ATOM 7969  C CZ   . TYR A 1 32 ? -5.519  -7.197  2.579   1.00 0.80 ? 32  TYR A CZ   6  
ATOM 7970  O OH   . TYR A 1 32 ? -6.335  -8.080  1.911   1.00 0.86 ? 32  TYR A OH   6  
ATOM 7971  H H    . TYR A 1 32 ? -0.601  -5.189  3.701   1.00 0.66 ? 32  TYR A H    6  
ATOM 7972  H HA   . TYR A 1 32 ? -2.615  -3.146  3.050   1.00 0.64 ? 32  TYR A HA   6  
ATOM 7973  H HB2  . TYR A 1 32 ? -2.395  -5.041  5.385   1.00 0.68 ? 32  TYR A HB2  6  
ATOM 7974  H HB3  . TYR A 1 32 ? -3.620  -3.790  5.253   1.00 0.74 ? 32  TYR A HB3  6  
ATOM 7975  H HD1  . TYR A 1 32 ? -2.263  -6.595  3.173   1.00 2.05 ? 32  TYR A HD1  6  
ATOM 7976  H HD2  . TYR A 1 32 ? -5.681  -4.462  4.527   1.00 2.10 ? 32  TYR A HD2  6  
ATOM 7977  H HE1  . TYR A 1 32 ? -3.709  -8.167  1.965   1.00 2.06 ? 32  TYR A HE1  6  
ATOM 7978  H HE2  . TYR A 1 32 ? -7.146  -6.020  3.341   1.00 2.17 ? 32  TYR A HE2  6  
ATOM 7979  H HH   . TYR A 1 32 ? -6.523  -8.832  2.477   1.00 1.32 ? 32  TYR A HH   6  
ATOM 7980  N N    . VAL A 1 33 ? -1.991  -1.393  4.749   1.00 0.57 ? 33  VAL A N    6  
ATOM 7981  C CA   . VAL A 1 33 ? -1.485  -0.294  5.569   1.00 0.55 ? 33  VAL A CA   6  
ATOM 7982  C C    . VAL A 1 33 ? -1.879  -0.512  7.032   1.00 0.59 ? 33  VAL A C    6  
ATOM 7983  O O    . VAL A 1 33 ? -3.046  -0.774  7.335   1.00 0.65 ? 33  VAL A O    6  
ATOM 7984  C CB   . VAL A 1 33 ? -2.010  1.072   5.077   1.00 0.59 ? 33  VAL A CB   6  
ATOM 7985  C CG1  . VAL A 1 33 ? -1.724  2.171   6.093   1.00 0.62 ? 33  VAL A CG1  6  
ATOM 7986  C CG2  . VAL A 1 33 ? -1.397  1.415   3.725   1.00 0.56 ? 33  VAL A CG2  6  
ATOM 7987  H H    . VAL A 1 33 ? -2.815  -1.268  4.248   1.00 0.61 ? 33  VAL A H    6  
ATOM 7988  H HA   . VAL A 1 33 ? -0.406  -0.294  5.494   1.00 0.51 ? 33  VAL A HA   6  
ATOM 7989  H HB   . VAL A 1 33 ? -3.081  1.000   4.952   1.00 0.67 ? 33  VAL A HB   6  
ATOM 7990  H HG11 . VAL A 1 33 ? -0.746  2.017   6.526   1.00 1.13 ? 33  VAL A HG11 6  
ATOM 7991  H HG12 . VAL A 1 33 ? -2.470  2.144   6.873   1.00 1.12 ? 33  VAL A HG12 6  
ATOM 7992  H HG13 . VAL A 1 33 ? -1.752  3.133   5.601   1.00 1.21 ? 33  VAL A HG13 6  
ATOM 7993  H HG21 . VAL A 1 33 ? -2.075  1.120   2.938   1.00 1.23 ? 33  VAL A HG21 6  
ATOM 7994  H HG22 . VAL A 1 33 ? -0.462  0.886   3.610   1.00 0.96 ? 33  VAL A HG22 6  
ATOM 7995  H HG23 . VAL A 1 33 ? -1.219  2.478   3.669   1.00 1.26 ? 33  VAL A HG23 6  
ATOM 7996  N N    . THR A 1 34 ? -0.893  -0.446  7.926   1.00 0.62 ? 34  THR A N    6  
ATOM 7997  C CA   . THR A 1 34 ? -1.130  -0.684  9.353   1.00 0.71 ? 34  THR A CA   6  
ATOM 7998  C C    . THR A 1 34 ? -1.247  0.606   10.178  1.00 0.72 ? 34  THR A C    6  
ATOM 7999  O O    . THR A 1 34 ? -1.932  0.615   11.201  1.00 0.84 ? 34  THR A O    6  
ATOM 8000  C CB   . THR A 1 34 ? -0.018  -1.576  9.930   1.00 0.74 ? 34  THR A CB   6  
ATOM 8001  O OG1  . THR A 1 34 ? 1.083   -0.799  10.375  1.00 1.39 ? 34  THR A OG1  6  
ATOM 8002  C CG2  . THR A 1 34 ? 0.514   -2.599  8.943   1.00 1.29 ? 34  THR A CG2  6  
ATOM 8003  H H    . THR A 1 34 ? 0.019   -0.270  7.613   1.00 0.62 ? 34  THR A H    6  
ATOM 8004  H HA   . THR A 1 34 ? -2.064  -1.219  9.435   1.00 0.81 ? 34  THR A HA   6  
ATOM 8005  H HB   . THR A 1 34 ? -0.413  -2.115  10.779  1.00 1.08 ? 34  THR A HB   6  
ATOM 8006  H HG1  . THR A 1 34 ? 1.421   -0.275  9.646   1.00 1.62 ? 34  THR A HG1  6  
ATOM 8007  H HG21 . THR A 1 34 ? 0.570   -3.565  9.421   1.00 1.65 ? 34  THR A HG21 6  
ATOM 8008  H HG22 . THR A 1 34 ? 1.499   -2.304  8.613   1.00 1.98 ? 34  THR A HG22 6  
ATOM 8009  H HG23 . THR A 1 34 ? -0.148  -2.658  8.092   1.00 1.56 ? 34  THR A HG23 6  
ATOM 8010  N N    . LYS A 1 35 ? -0.586  1.686   9.744   1.00 0.65 ? 35  LYS A N    6  
ATOM 8011  C CA   . LYS A 1 35 ? -0.636  2.958   10.480  1.00 0.71 ? 35  LYS A CA   6  
ATOM 8012  C C    . LYS A 1 35 ? -0.247  4.140   9.594   1.00 0.69 ? 35  LYS A C    6  
ATOM 8013  O O    . LYS A 1 35 ? 0.852   4.175   9.042   1.00 0.62 ? 35  LYS A O    6  
ATOM 8014  C CB   . LYS A 1 35 ? 0.307   2.918   11.692  1.00 0.72 ? 35  LYS A CB   6  
ATOM 8015  C CG   . LYS A 1 35 ? -0.143  1.983   12.802  1.00 1.32 ? 35  LYS A CG   6  
ATOM 8016  C CD   . LYS A 1 35 ? 0.661   2.198   14.075  1.00 1.46 ? 35  LYS A CD   6  
ATOM 8017  C CE   . LYS A 1 35 ? -0.147  1.840   15.314  1.00 2.02 ? 35  LYS A CE   6  
ATOM 8018  N NZ   . LYS A 1 35 ? -0.340  0.369   15.453  1.00 2.54 ? 35  LYS A NZ   6  
ATOM 8019  H H    . LYS A 1 35 ? -0.066  1.628   8.916   1.00 0.59 ? 35  LYS A H    6  
ATOM 8020  H HA   . LYS A 1 35 ? -1.647  3.101   10.828  1.00 0.80 ? 35  LYS A HA   6  
ATOM 8021  H HB2  . LYS A 1 35 ? 1.285   2.600   11.361  1.00 0.98 ? 35  LYS A HB2  6  
ATOM 8022  H HB3  . LYS A 1 35 ? 0.386   3.915   12.101  1.00 1.18 ? 35  LYS A HB3  6  
ATOM 8023  H HG2  . LYS A 1 35 ? -1.186  2.163   13.011  1.00 1.91 ? 35  LYS A HG2  6  
ATOM 8024  H HG3  . LYS A 1 35 ? -0.011  0.962   12.472  1.00 2.08 ? 35  LYS A HG3  6  
ATOM 8025  H HD2  . LYS A 1 35 ? 1.542   1.576   14.041  1.00 1.89 ? 35  LYS A HD2  6  
ATOM 8026  H HD3  . LYS A 1 35 ? 0.953   3.236   14.134  1.00 1.86 ? 35  LYS A HD3  6  
ATOM 8027  H HE2  . LYS A 1 35 ? 0.373   2.209   16.186  1.00 2.47 ? 35  LYS A HE2  6  
ATOM 8028  H HE3  . LYS A 1 35 ? -1.115  2.317   15.247  1.00 2.40 ? 35  LYS A HE3  6  
ATOM 8029  H HZ1  . LYS A 1 35 ? 0.577   -0.120  15.397  1.00 2.55 ? 35  LYS A HZ1  6  
ATOM 8030  H HZ2  . LYS A 1 35 ? -0.957  0.015   14.693  1.00 2.90 ? 35  LYS A HZ2  6  
ATOM 8031  H HZ3  . LYS A 1 35 ? -0.780  0.151   16.370  1.00 3.18 ? 35  LYS A HZ3  6  
ATOM 8032  N N    . ILE A 1 36 ? -1.145  5.117   9.474   1.00 0.86 ? 36  ILE A N    6  
ATOM 8033  C CA   . ILE A 1 36 ? -0.875  6.303   8.667   1.00 0.92 ? 36  ILE A CA   6  
ATOM 8034  C C    . ILE A 1 36 ? -0.415  7.471   9.548   1.00 0.98 ? 36  ILE A C    6  
ATOM 8035  O O    . ILE A 1 36 ? -1.138  7.901   10.449  1.00 1.06 ? 36  ILE A O    6  
ATOM 8036  C CB   . ILE A 1 36 ? -2.113  6.729   7.846   1.00 1.03 ? 36  ILE A CB   6  
ATOM 8037  C CG1  . ILE A 1 36 ? -2.464  5.643   6.823   1.00 1.40 ? 36  ILE A CG1  6  
ATOM 8038  C CG2  . ILE A 1 36 ? -1.859  8.063   7.150   1.00 1.12 ? 36  ILE A CG2  6  
ATOM 8039  C CD1  . ILE A 1 36 ? -3.432  6.097   5.750   1.00 1.35 ? 36  ILE A CD1  6  
ATOM 8040  H H    . ILE A 1 36 ? -2.003  5.042   9.943   1.00 0.98 ? 36  ILE A H    6  
ATOM 8041  H HA   . ILE A 1 36 ? -0.084  6.053   7.974   1.00 0.85 ? 36  ILE A HA   6  
ATOM 8042  H HB   . ILE A 1 36 ? -2.942  6.858   8.525   1.00 0.95 ? 36  ILE A HB   6  
ATOM 8043  H HG12 . ILE A 1 36 ? -1.561  5.315   6.332   1.00 1.63 ? 36  ILE A HG12 6  
ATOM 8044  H HG13 . ILE A 1 36 ? -2.911  4.805   7.338   1.00 1.62 ? 36  ILE A HG13 6  
ATOM 8045  H HG21 . ILE A 1 36 ? -0.982  7.982   6.523   1.00 1.46 ? 36  ILE A HG21 6  
ATOM 8046  H HG22 . ILE A 1 36 ? -1.701  8.832   7.892   1.00 1.45 ? 36  ILE A HG22 6  
ATOM 8047  H HG23 . ILE A 1 36 ? -2.714  8.322   6.542   1.00 1.44 ? 36  ILE A HG23 6  
ATOM 8048  H HD11 . ILE A 1 36 ? -2.910  6.711   5.031   1.00 1.87 ? 36  ILE A HD11 6  
ATOM 8049  H HD12 . ILE A 1 36 ? -4.228  6.671   6.201   1.00 1.71 ? 36  ILE A HD12 6  
ATOM 8050  H HD13 . ILE A 1 36 ? -3.848  5.234   5.251   1.00 1.41 ? 36  ILE A HD13 6  
ATOM 8051  N N    . ILE A 1 37 ? 0.790   7.980   9.275   1.00 1.03 ? 37  ILE A N    6  
ATOM 8052  C CA   . ILE A 1 37 ? 1.356   9.098   10.030  1.00 1.10 ? 37  ILE A CA   6  
ATOM 8053  C C    . ILE A 1 37 ? 0.715   10.423  9.606   1.00 1.10 ? 37  ILE A C    6  
ATOM 8054  O O    . ILE A 1 37 ? 0.339   10.596  8.445   1.00 1.37 ? 37  ILE A O    6  
ATOM 8055  C CB   . ILE A 1 37 ? 2.893   9.185   9.835   1.00 1.14 ? 37  ILE A CB   6  
ATOM 8056  C CG1  . ILE A 1 37 ? 3.593   8.015   10.532  1.00 1.47 ? 37  ILE A CG1  6  
ATOM 8057  C CG2  . ILE A 1 37 ? 3.438   10.508  10.360  1.00 1.32 ? 37  ILE A CG2  6  
ATOM 8058  C CD1  . ILE A 1 37 ? 3.711   6.773   9.675   1.00 1.68 ? 37  ILE A CD1  6  
ATOM 8059  H H    . ILE A 1 37 ? 1.313   7.596   8.541   1.00 1.06 ? 37  ILE A H    6  
ATOM 8060  H HA   . ILE A 1 37 ? 1.154   8.929   11.078  1.00 1.17 ? 37  ILE A HA   6  
ATOM 8061  H HB   . ILE A 1 37 ? 3.100   9.138   8.776   1.00 1.07 ? 37  ILE A HB   6  
ATOM 8062  H HG12 . ILE A 1 37 ? 4.591   8.319   10.807  1.00 1.63 ? 37  ILE A HG12 6  
ATOM 8063  H HG13 . ILE A 1 37 ? 3.042   7.754   11.423  1.00 1.84 ? 37  ILE A HG13 6  
ATOM 8064  H HG21 . ILE A 1 37 ? 4.514   10.450  10.435  1.00 1.40 ? 37  ILE A HG21 6  
ATOM 8065  H HG22 . ILE A 1 37 ? 3.019   10.710  11.335  1.00 1.79 ? 37  ILE A HG22 6  
ATOM 8066  H HG23 . ILE A 1 37 ? 3.169   11.303  9.681   1.00 1.90 ? 37  ILE A HG23 6  
ATOM 8067  H HD11 . ILE A 1 37 ? 4.554   6.186   10.009  1.00 2.18 ? 37  ILE A HD11 6  
ATOM 8068  H HD12 . ILE A 1 37 ? 3.858   7.060   8.646   1.00 1.92 ? 37  ILE A HD12 6  
ATOM 8069  H HD13 . ILE A 1 37 ? 2.808   6.189   9.763   1.00 1.93 ? 37  ILE A HD13 6  
ATOM 8070  N N    . GLU A 1 38 ? 0.601   11.354  10.556  1.00 0.96 ? 38  GLU A N    6  
ATOM 8071  C CA   . GLU A 1 38 ? 0.013   12.670  10.286  1.00 0.99 ? 38  GLU A CA   6  
ATOM 8072  C C    . GLU A 1 38 ? 0.836   13.436  9.249   1.00 1.31 ? 38  GLU A C    6  
ATOM 8073  O O    . GLU A 1 38 ? 2.065   13.340  9.222   1.00 1.64 ? 38  GLU A O    6  
ATOM 8074  C CB   . GLU A 1 38 ? -0.093  13.488  11.580  1.00 1.23 ? 38  GLU A CB   6  
ATOM 8075  C CG   . GLU A 1 38 ? -1.141  14.588  11.525  1.00 1.71 ? 38  GLU A CG   6  
ATOM 8076  C CD   . GLU A 1 38 ? -1.601  15.024  12.903  1.00 2.41 ? 38  GLU A CD   6  
ATOM 8077  O OE1  . GLU A 1 38 ? -0.963  15.927  13.486  1.00 2.79 ? 38  GLU A OE1  6  
ATOM 8078  O OE2  . GLU A 1 38 ? -2.599  14.462  13.402  1.00 3.11 ? 38  GLU A OE2  6  
ATOM 8079  H H    . GLU A 1 38 ? 0.925   11.154  11.460  1.00 0.97 ? 38  GLU A H    6  
ATOM 8080  H HA   . GLU A 1 38 ? -0.980  12.510  9.891   1.00 1.23 ? 38  GLU A HA   6  
ATOM 8081  H HB2  . GLU A 1 38 ? -0.346  12.825  12.394  1.00 1.66 ? 38  GLU A HB2  6  
ATOM 8082  H HB3  . GLU A 1 38 ? 0.865   13.944  11.784  1.00 1.49 ? 38  GLU A HB3  6  
ATOM 8083  H HG2  . GLU A 1 38 ? -0.722  15.443  11.016  1.00 2.01 ? 38  GLU A HG2  6  
ATOM 8084  H HG3  . GLU A 1 38 ? -1.997  14.226  10.975  1.00 1.90 ? 38  GLU A HG3  6  
ATOM 8085  N N    . GLY A 1 39 ? 0.146   14.202  8.400   1.00 1.69 ? 39  GLY A N    6  
ATOM 8086  C CA   . GLY A 1 39 ? 0.815   14.984  7.370   1.00 2.36 ? 39  GLY A CA   6  
ATOM 8087  C C    . GLY A 1 39 ? 1.554   14.136  6.340   1.00 2.68 ? 39  GLY A C    6  
ATOM 8088  O O    . GLY A 1 39 ? 2.434   14.641  5.641   1.00 3.15 ? 39  GLY A O    6  
ATOM 8089  H H    . GLY A 1 39 ? -0.828  14.246  8.479   1.00 1.72 ? 39  GLY A H    6  
ATOM 8090  H HA2  . GLY A 1 39 ? 0.076   15.581  6.856   1.00 2.72 ? 39  GLY A HA2  6  
ATOM 8091  H HA3  . GLY A 1 39 ? 1.521   15.646  7.846   1.00 2.45 ? 39  GLY A HA3  6  
ATOM 8092  N N    . GLY A 1 40 ? 1.203   12.850  6.247   1.00 2.49 ? 40  GLY A N    6  
ATOM 8093  C CA   . GLY A 1 40 ? 1.853   11.964  5.294   1.00 2.80 ? 40  GLY A CA   6  
ATOM 8094  C C    . GLY A 1 40 ? 1.142   11.914  3.952   1.00 2.61 ? 40  GLY A C    6  
ATOM 8095  O O    . GLY A 1 40 ? 0.009   12.379  3.829   1.00 2.37 ? 40  GLY A O    6  
ATOM 8096  H H    . GLY A 1 40 ? 0.499   12.499  6.830   1.00 2.19 ? 40  GLY A H    6  
ATOM 8097  H HA2  . GLY A 1 40 ? 2.866   12.305  5.137   1.00 3.27 ? 40  GLY A HA2  6  
ATOM 8098  H HA3  . GLY A 1 40 ? 1.883   10.967  5.709   1.00 2.80 ? 40  GLY A HA3  6  
ATOM 8099  N N    . ALA A 1 41 ? 1.818   11.351  2.948   1.00 2.83 ? 41  ALA A N    6  
ATOM 8100  C CA   . ALA A 1 41 ? 1.264   11.234  1.596   1.00 2.70 ? 41  ALA A CA   6  
ATOM 8101  C C    . ALA A 1 41 ? -0.167  10.694  1.612   1.00 2.11 ? 41  ALA A C    6  
ATOM 8102  O O    . ALA A 1 41 ? -1.077  11.324  1.074   1.00 2.06 ? 41  ALA A O    6  
ATOM 8103  C CB   . ALA A 1 41 ? 2.151   10.341  0.740   1.00 3.00 ? 41  ALA A CB   6  
ATOM 8104  H H    . ALA A 1 41 ? 2.721   11.010  3.119   1.00 3.11 ? 41  ALA A H    6  
ATOM 8105  H HA   . ALA A 1 41 ? 1.257   12.220  1.155   1.00 2.91 ? 41  ALA A HA   6  
ATOM 8106  H HB1  . ALA A 1 41 ? 3.171   10.693  0.791   1.00 3.45 ? 41  ALA A HB1  6  
ATOM 8107  H HB2  . ALA A 1 41 ? 1.811   10.371  -0.284  1.00 3.26 ? 41  ALA A HB2  6  
ATOM 8108  H HB3  . ALA A 1 41 ? 2.102   9.326   1.107   1.00 2.99 ? 41  ALA A HB3  6  
ATOM 8109  N N    . ALA A 1 42 ? -0.362  9.529   2.239   1.00 1.82 ? 42  ALA A N    6  
ATOM 8110  C CA   . ALA A 1 42 ? -1.686  8.916   2.327   1.00 1.36 ? 42  ALA A CA   6  
ATOM 8111  C C    . ALA A 1 42 ? -2.620  9.758   3.194   1.00 1.16 ? 42  ALA A C    6  
ATOM 8112  O O    . ALA A 1 42 ? -3.742  10.066  2.789   1.00 1.02 ? 42  ALA A O    6  
ATOM 8113  C CB   . ALA A 1 42 ? -1.582  7.500   2.880   1.00 1.50 ? 42  ALA A CB   6  
ATOM 8114  H H    . ALA A 1 42 ? 0.401   9.075   2.656   1.00 2.06 ? 42  ALA A H    6  
ATOM 8115  H HA   . ALA A 1 42 ? -2.094  8.858   1.327   1.00 1.30 ? 42  ALA A HA   6  
ATOM 8116  H HB1  . ALA A 1 42 ? -2.573  7.100   3.037   1.00 1.77 ? 42  ALA A HB1  6  
ATOM 8117  H HB2  . ALA A 1 42 ? -1.048  7.519   3.818   1.00 1.88 ? 42  ALA A HB2  6  
ATOM 8118  H HB3  . ALA A 1 42 ? -1.050  6.877   2.175   1.00 1.93 ? 42  ALA A HB3  6  
ATOM 8119  N N    . HIS A 1 43 ? -2.143  10.124  4.386   1.00 1.34 ? 43  HIS A N    6  
ATOM 8120  C CA   . HIS A 1 43 ? -2.920  10.935  5.327   1.00 1.21 ? 43  HIS A CA   6  
ATOM 8121  C C    . HIS A 1 43 ? -3.501  12.180  4.649   1.00 1.08 ? 43  HIS A C    6  
ATOM 8122  O O    . HIS A 1 43 ? -4.690  12.473  4.789   1.00 1.15 ? 43  HIS A O    6  
ATOM 8123  C CB   . HIS A 1 43 ? -2.034  11.351  6.505   1.00 1.39 ? 43  HIS A CB   6  
ATOM 8124  C CG   . HIS A 1 43 ? -2.763  12.084  7.586   1.00 1.16 ? 43  HIS A CG   6  
ATOM 8125  N ND1  . HIS A 1 43 ? -2.902  13.455  7.601   1.00 1.34 ? 43  HIS A ND1  6  
ATOM 8126  C CD2  . HIS A 1 43 ? -3.384  11.632  8.701   1.00 1.15 ? 43  HIS A CD2  6  
ATOM 8127  C CE1  . HIS A 1 43 ? -3.573  13.816  8.679   1.00 1.22 ? 43  HIS A CE1  6  
ATOM 8128  N NE2  . HIS A 1 43 ? -3.879  12.728  9.363   1.00 1.28 ? 43  HIS A NE2  6  
ATOM 8129  H H    . HIS A 1 43 ? -1.243  9.835   4.643   1.00 1.62 ? 43  HIS A H    6  
ATOM 8130  H HA   . HIS A 1 43 ? -3.733  10.328  5.696   1.00 1.26 ? 43  HIS A HA   6  
ATOM 8131  H HB2  . HIS A 1 43 ? -1.594  10.469  6.943   1.00 1.74 ? 43  HIS A HB2  6  
ATOM 8132  H HB3  . HIS A 1 43 ? -1.247  11.994  6.140   1.00 1.58 ? 43  HIS A HB3  6  
ATOM 8133  H HD1  . HIS A 1 43 ? -2.558  14.073  6.922   1.00 1.69 ? 43  HIS A HD1  6  
ATOM 8134  H HD2  . HIS A 1 43 ? -3.476  10.600  9.009   1.00 1.32 ? 43  HIS A HD2  6  
ATOM 8135  H HE1  . HIS A 1 43 ? -3.823  14.829  8.957   1.00 1.34 ? 43  HIS A HE1  6  
ATOM 8136  H HE2  . HIS A 1 43 ? -4.275  12.720  10.260  1.00 1.60 ? 43  HIS A HE2  6  
ATOM 8137  N N    . LYS A 1 44 ? -2.654  12.902  3.915   1.00 1.15 ? 44  LYS A N    6  
ATOM 8138  C CA   . LYS A 1 44 ? -3.075  14.113  3.213   1.00 1.31 ? 44  LYS A CA   6  
ATOM 8139  C C    . LYS A 1 44 ? -4.013  13.782  2.050   1.00 1.39 ? 44  LYS A C    6  
ATOM 8140  O O    . LYS A 1 44 ? -4.964  14.518  1.786   1.00 1.46 ? 44  LYS A O    6  
ATOM 8141  C CB   . LYS A 1 44 ? -1.855  14.882  2.697   1.00 1.74 ? 44  LYS A CB   6  
ATOM 8142  C CG   . LYS A 1 44 ? -1.062  15.571  3.797   1.00 1.89 ? 44  LYS A CG   6  
ATOM 8143  C CD   . LYS A 1 44 ? 0.306   16.016  3.307   1.00 2.36 ? 44  LYS A CD   6  
ATOM 8144  C CE   . LYS A 1 44 ? 0.885   17.111  4.190   1.00 2.17 ? 44  LYS A CE   6  
ATOM 8145  N NZ   . LYS A 1 44 ? 2.172   17.637  3.655   1.00 2.66 ? 44  LYS A NZ   6  
ATOM 8146  H H    . LYS A 1 44 ? -1.720  12.611  3.843   1.00 1.26 ? 44  LYS A H    6  
ATOM 8147  H HA   . LYS A 1 44 ? -3.606  14.735  3.918   1.00 1.30 ? 44  LYS A HA   6  
ATOM 8148  H HB2  . LYS A 1 44 ? -1.198  14.191  2.187   1.00 2.10 ? 44  LYS A HB2  6  
ATOM 8149  H HB3  . LYS A 1 44 ? -2.186  15.633  1.996   1.00 2.02 ? 44  LYS A HB3  6  
ATOM 8150  H HG2  . LYS A 1 44 ? -1.612  16.437  4.134   1.00 1.94 ? 44  LYS A HG2  6  
ATOM 8151  H HG3  . LYS A 1 44 ? -0.934  14.882  4.620   1.00 2.08 ? 44  LYS A HG3  6  
ATOM 8152  H HD2  . LYS A 1 44 ? 0.975   15.169  3.318   1.00 2.71 ? 44  LYS A HD2  6  
ATOM 8153  H HD3  . LYS A 1 44 ? 0.213   16.392  2.299   1.00 2.84 ? 44  LYS A HD3  6  
ATOM 8154  H HE2  . LYS A 1 44 ? 0.174   17.921  4.250   1.00 2.08 ? 44  LYS A HE2  6  
ATOM 8155  H HE3  . LYS A 1 44 ? 1.054   16.707  5.178   1.00 2.50 ? 44  LYS A HE3  6  
ATOM 8156  H HZ1  . LYS A 1 44 ? 2.854   16.861  3.534   1.00 3.12 ? 44  LYS A HZ1  6  
ATOM 8157  H HZ2  . LYS A 1 44 ? 2.573   18.337  4.313   1.00 3.21 ? 44  LYS A HZ2  6  
ATOM 8158  H HZ3  . LYS A 1 44 ? 2.018   18.094  2.734   1.00 2.66 ? 44  LYS A HZ3  6  
ATOM 8159  N N    . ASP A 1 45 ? -3.742  12.667  1.365   1.00 1.59 ? 45  ASP A N    6  
ATOM 8160  C CA   . ASP A 1 45 ? -4.565  12.233  0.236   1.00 1.86 ? 45  ASP A CA   6  
ATOM 8161  C C    . ASP A 1 45 ? -5.995  11.941  0.688   1.00 1.89 ? 45  ASP A C    6  
ATOM 8162  O O    . ASP A 1 45 ? -6.951  12.502  0.150   1.00 1.97 ? 45  ASP A O    6  
ATOM 8163  C CB   . ASP A 1 45 ? -3.957  10.986  -0.417  1.00 2.33 ? 45  ASP A CB   6  
ATOM 8164  C CG   . ASP A 1 45 ? -4.342  10.847  -1.878  1.00 2.69 ? 45  ASP A CG   6  
ATOM 8165  O OD1  . ASP A 1 45 ? -5.468  10.386  -2.155  1.00 3.24 ? 45  ASP A OD1  6  
ATOM 8166  O OD2  . ASP A 1 45 ? -3.515  11.199  -2.746  1.00 2.80 ? 45  ASP A OD2  6  
ATOM 8167  H H    . ASP A 1 45 ? -2.971  12.120  1.629   1.00 1.67 ? 45  ASP A H    6  
ATOM 8168  H HA   . ASP A 1 45 ? -4.584  13.034  -0.487  1.00 1.92 ? 45  ASP A HA   6  
ATOM 8169  H HB2  . ASP A 1 45 ? -2.881  11.040  -0.352  1.00 2.40 ? 45  ASP A HB2  6  
ATOM 8170  H HB3  . ASP A 1 45 ? -4.300  10.107  0.111   1.00 2.46 ? 45  ASP A HB3  6  
ATOM 8171  N N    . GLY A 1 46 ? -6.131  11.061  1.683   1.00 2.08 ? 46  GLY A N    6  
ATOM 8172  C CA   . GLY A 1 46 ? -7.444  10.707  2.201   1.00 2.49 ? 46  GLY A CA   6  
ATOM 8173  C C    . GLY A 1 46 ? -8.020  9.447   1.570   1.00 2.11 ? 46  GLY A C    6  
ATOM 8174  O O    . GLY A 1 46 ? -8.881  8.796   2.163   1.00 2.47 ? 46  GLY A O    6  
ATOM 8175  H H    . GLY A 1 46 ? -5.328  10.650  2.070   1.00 2.09 ? 46  GLY A H    6  
ATOM 8176  H HA2  . GLY A 1 46 ? -7.367  10.555  3.267   1.00 2.83 ? 46  GLY A HA2  6  
ATOM 8177  H HA3  . GLY A 1 46 ? -8.122  11.528  2.017   1.00 3.17 ? 46  GLY A HA3  6  
ATOM 8178  N N    . LYS A 1 47 ? -7.551  9.104   0.367   1.00 1.87 ? 47  LYS A N    6  
ATOM 8179  C CA   . LYS A 1 47 ? -8.033  7.916   -0.338  1.00 2.32 ? 47  LYS A CA   6  
ATOM 8180  C C    . LYS A 1 47 ? -7.594  6.633   0.367   1.00 1.93 ? 47  LYS A C    6  
ATOM 8181  O O    . LYS A 1 47 ? -8.370  5.681   0.471   1.00 1.95 ? 47  LYS A O    6  
ATOM 8182  C CB   . LYS A 1 47 ? -7.532  7.914   -1.785  1.00 2.80 ? 47  LYS A CB   6  
ATOM 8183  C CG   . LYS A 1 47 ? -8.483  7.231   -2.756  1.00 3.64 ? 47  LYS A CG   6  
ATOM 8184  C CD   . LYS A 1 47 ? -8.919  8.175   -3.867  1.00 4.17 ? 47  LYS A CD   6  
ATOM 8185  C CE   . LYS A 1 47 ? -10.349 7.899   -4.306  1.00 5.03 ? 47  LYS A CE   6  
ATOM 8186  N NZ   . LYS A 1 47 ? -11.343 8.612   -3.454  1.00 5.67 ? 47  LYS A NZ   6  
ATOM 8187  H H    . LYS A 1 47 ? -6.867  9.663   -0.058  1.00 1.83 ? 47  LYS A H    6  
ATOM 8188  H HA   . LYS A 1 47 ? -9.112  7.955   -0.343  1.00 3.00 ? 47  LYS A HA   6  
ATOM 8189  H HB2  . LYS A 1 47 ? -7.395  8.935   -2.107  1.00 2.86 ? 47  LYS A HB2  6  
ATOM 8190  H HB3  . LYS A 1 47 ? -6.582  7.402   -1.824  1.00 3.00 ? 47  LYS A HB3  6  
ATOM 8191  H HG2  . LYS A 1 47 ? -7.983  6.381   -3.197  1.00 4.05 ? 47  LYS A HG2  6  
ATOM 8192  H HG3  . LYS A 1 47 ? -9.356  6.897   -2.216  1.00 3.92 ? 47  LYS A HG3  6  
ATOM 8193  H HD2  . LYS A 1 47 ? -8.856  9.192   -3.508  1.00 4.28 ? 47  LYS A HD2  6  
ATOM 8194  H HD3  . LYS A 1 47 ? -8.261  8.049   -4.714  1.00 4.30 ? 47  LYS A HD3  6  
ATOM 8195  H HE2  . LYS A 1 47 ? -10.467 8.224   -5.329  1.00 5.17 ? 47  LYS A HE2  6  
ATOM 8196  H HE3  . LYS A 1 47 ? -10.532 6.836   -4.245  1.00 5.45 ? 47  LYS A HE3  6  
ATOM 8197  H HZ1  . LYS A 1 47 ? -12.308 8.390   -3.770  1.00 5.78 ? 47  LYS A HZ1  6  
ATOM 8198  H HZ2  . LYS A 1 47 ? -11.196 9.640   -3.518  1.00 5.80 ? 47  LYS A HZ2  6  
ATOM 8199  H HZ3  . LYS A 1 47 ? -11.240 8.320   -2.461  1.00 6.21 ? 47  LYS A HZ3  6  
ATOM 8200  N N    . LEU A 1 48 ? -6.348  6.608   0.842   1.00 1.68 ? 48  LEU A N    6  
ATOM 8201  C CA   . LEU A 1 48 ? -5.813  5.434   1.528   1.00 1.38 ? 48  LEU A CA   6  
ATOM 8202  C C    . LEU A 1 48 ? -6.137  5.462   3.022   1.00 1.28 ? 48  LEU A C    6  
ATOM 8203  O O    . LEU A 1 48 ? -5.864  6.447   3.711   1.00 1.35 ? 48  LEU A O    6  
ATOM 8204  C CB   . LEU A 1 48 ? -4.299  5.331   1.321   1.00 1.19 ? 48  LEU A CB   6  
ATOM 8205  C CG   . LEU A 1 48 ? -3.732  3.908   1.377   1.00 1.09 ? 48  LEU A CG   6  
ATOM 8206  C CD1  . LEU A 1 48 ? -2.412  3.826   0.624   1.00 1.56 ? 48  LEU A CD1  6  
ATOM 8207  C CD2  . LEU A 1 48 ? -3.554  3.461   2.818   1.00 1.06 ? 48  LEU A CD2  6  
ATOM 8208  H H    . LEU A 1 48 ? -5.775  7.396   0.724   1.00 1.80 ? 48  LEU A H    6  
ATOM 8209  H HA   . LEU A 1 48 ? -6.281  4.563   1.092   1.00 1.52 ? 48  LEU A HA   6  
ATOM 8210  H HB2  . LEU A 1 48 ? -4.058  5.756   0.356   1.00 1.43 ? 48  LEU A HB2  6  
ATOM 8211  H HB3  . LEU A 1 48 ? -3.811  5.918   2.085   1.00 1.29 ? 48  LEU A HB3  6  
ATOM 8212  H HG   . LEU A 1 48 ? -4.429  3.230   0.904   1.00 1.25 ? 48  LEU A HG   6  
ATOM 8213  H HD11 . LEU A 1 48 ? -1.620  4.226   1.240   1.00 2.04 ? 48  LEU A HD11 6  
ATOM 8214  H HD12 . LEU A 1 48 ? -2.482  4.399   -0.289  1.00 1.85 ? 48  LEU A HD12 6  
ATOM 8215  H HD13 . LEU A 1 48 ? -2.198  2.795   0.386   1.00 2.03 ? 48  LEU A HD13 6  
ATOM 8216  H HD21 . LEU A 1 48 ? -2.576  3.752   3.170   1.00 1.74 ? 48  LEU A HD21 6  
ATOM 8217  H HD22 . LEU A 1 48 ? -3.651  2.386   2.873   1.00 1.43 ? 48  LEU A HD22 6  
ATOM 8218  H HD23 . LEU A 1 48 ? -4.311  3.920   3.435   1.00 1.30 ? 48  LEU A HD23 6  
ATOM 8219  N N    . GLN A 1 49 ? -6.711  4.362   3.509   1.00 1.21 ? 49  GLN A N    6  
ATOM 8220  C CA   . GLN A 1 49 ? -7.074  4.218   4.912   1.00 1.17 ? 49  GLN A CA   6  
ATOM 8221  C C    . GLN A 1 49 ? -6.690  2.824   5.416   1.00 1.09 ? 49  GLN A C    6  
ATOM 8222  O O    . GLN A 1 49 ? -6.734  1.853   4.661   1.00 1.14 ? 49  GLN A O    6  
ATOM 8223  C CB   . GLN A 1 49 ? -8.575  4.458   5.099   1.00 1.30 ? 49  GLN A CB   6  
ATOM 8224  C CG   . GLN A 1 49 ? -9.465  3.400   4.458   1.00 1.46 ? 49  GLN A CG   6  
ATOM 8225  C CD   . GLN A 1 49 ? -9.631  3.596   2.962   1.00 1.45 ? 49  GLN A CD   6  
ATOM 8226  O OE1  . GLN A 1 49 ? -10.258 4.557   2.517   1.00 1.54 ? 49  GLN A OE1  6  
ATOM 8227  N NE2  . GLN A 1 49 ? -9.070  2.683   2.176   1.00 1.52 ? 49  GLN A NE2  6  
ATOM 8228  H H    . GLN A 1 49 ? -6.893  3.617   2.903   1.00 1.26 ? 49  GLN A H    6  
ATOM 8229  H HA   . GLN A 1 49 ? -6.526  4.957   5.477   1.00 1.19 ? 49  GLN A HA   6  
ATOM 8230  H HB2  . GLN A 1 49 ? -8.789  4.481   6.152   1.00 1.32 ? 49  GLN A HB2  6  
ATOM 8231  H HB3  . GLN A 1 49 ? -8.830  5.417   4.670   1.00 1.34 ? 49  GLN A HB3  6  
ATOM 8232  H HG2  . GLN A 1 49 ? -9.030  2.428   4.633   1.00 1.57 ? 49  GLN A HG2  6  
ATOM 8233  H HG3  . GLN A 1 49 ? -10.441 3.443   4.921   1.00 1.59 ? 49  GLN A HG3  6  
ATOM 8234  H HE21 . GLN A 1 49 ? -8.584  1.942   2.597   1.00 1.62 ? 49  GLN A HE21 6  
ATOM 8235  H HE22 . GLN A 1 49 ? -9.163  2.788   1.206   1.00 1.56 ? 49  GLN A HE22 6  
ATOM 8236  N N    . ILE A 1 50 ? -6.311  2.733   6.693   1.00 1.06 ? 50  ILE A N    6  
ATOM 8237  C CA   . ILE A 1 50 ? -5.912  1.452   7.289   1.00 1.03 ? 50  ILE A CA   6  
ATOM 8238  C C    . ILE A 1 50 ? -6.921  0.346   6.978   1.00 1.05 ? 50  ILE A C    6  
ATOM 8239  O O    . ILE A 1 50 ? -8.115  0.483   7.254   1.00 1.16 ? 50  ILE A O    6  
ATOM 8240  C CB   . ILE A 1 50 ? -5.739  1.559   8.821   1.00 1.08 ? 50  ILE A CB   6  
ATOM 8241  C CG1  . ILE A 1 50 ? -6.934  2.280   9.459   1.00 1.76 ? 50  ILE A CG1  6  
ATOM 8242  C CG2  . ILE A 1 50 ? -4.438  2.275   9.156   1.00 1.14 ? 50  ILE A CG2  6  
ATOM 8243  C CD1  . ILE A 1 50 ? -7.523  1.542   10.642  1.00 2.56 ? 50  ILE A CD1  6  
ATOM 8244  H H    . ILE A 1 50 ? -6.292  3.542   7.244   1.00 1.12 ? 50  ILE A H    6  
ATOM 8245  H HA   . ILE A 1 50 ? -4.957  1.177   6.863   1.00 1.00 ? 50  ILE A HA   6  
ATOM 8246  H HB   . ILE A 1 50 ? -5.678  0.558   9.222   1.00 1.51 ? 50  ILE A HB   6  
ATOM 8247  H HG12 . ILE A 1 50 ? -6.619  3.255   9.801   1.00 1.94 ? 50  ILE A HG12 6  
ATOM 8248  H HG13 . ILE A 1 50 ? -7.713  2.398   8.720   1.00 2.32 ? 50  ILE A HG13 6  
ATOM 8249  H HG21 . ILE A 1 50 ? -4.267  2.232   10.222  1.00 1.55 ? 50  ILE A HG21 6  
ATOM 8250  H HG22 . ILE A 1 50 ? -4.503  3.307   8.843   1.00 1.63 ? 50  ILE A HG22 6  
ATOM 8251  H HG23 . ILE A 1 50 ? -3.620  1.794   8.641   1.00 1.57 ? 50  ILE A HG23 6  
ATOM 8252  H HD11 . ILE A 1 50 ? -6.821  1.554   11.461  1.00 3.13 ? 50  ILE A HD11 6  
ATOM 8253  H HD12 . ILE A 1 50 ? -7.732  0.521   10.362  1.00 2.96 ? 50  ILE A HD12 6  
ATOM 8254  H HD13 . ILE A 1 50 ? -8.440  2.027   10.947  1.00 2.79 ? 50  ILE A HD13 6  
ATOM 8255  N N    . GLY A 1 51 ? -6.429  -0.750  6.393   1.00 1.02 ? 51  GLY A N    6  
ATOM 8256  C CA   . GLY A 1 51 ? -7.292  -1.869  6.042   1.00 1.10 ? 51  GLY A CA   6  
ATOM 8257  C C    . GLY A 1 51 ? -7.285  -2.182  4.556   1.00 1.04 ? 51  GLY A C    6  
ATOM 8258  O O    . GLY A 1 51 ? -7.578  -3.314  4.167   1.00 1.03 ? 51  GLY A O    6  
ATOM 8259  H H    . GLY A 1 51 ? -5.471  -0.801  6.190   1.00 0.99 ? 51  GLY A H    6  
ATOM 8260  H HA2  . GLY A 1 51 ? -6.954  -2.743  6.579   1.00 1.22 ? 51  GLY A HA2  6  
ATOM 8261  H HA3  . GLY A 1 51 ? -8.302  -1.649  6.343   1.00 1.14 ? 51  GLY A HA3  6  
ATOM 8262  N N    . ASP A 1 52 ? -6.948  -1.195  3.715   1.00 1.04 ? 52  ASP A N    6  
ATOM 8263  C CA   . ASP A 1 52 ? -6.905  -1.414  2.278   1.00 1.01 ? 52  ASP A CA   6  
ATOM 8264  C C    . ASP A 1 52 ? -5.721  -2.302  1.912   1.00 0.91 ? 52  ASP A C    6  
ATOM 8265  O O    . ASP A 1 52 ? -4.733  -2.381  2.660   1.00 0.88 ? 52  ASP A O    6  
ATOM 8266  C CB   . ASP A 1 52 ? -6.825  -0.084  1.514   1.00 1.03 ? 52  ASP A CB   6  
ATOM 8267  C CG   . ASP A 1 52 ? -5.804  0.889   2.072   1.00 1.11 ? 52  ASP A CG   6  
ATOM 8268  O OD1  . ASP A 1 52 ? -4.749  0.440   2.574   1.00 1.55 ? 52  ASP A OD1  6  
ATOM 8269  O OD2  . ASP A 1 52 ? -6.060  2.104   1.997   1.00 1.56 ? 52  ASP A OD2  6  
ATOM 8270  H H    . ASP A 1 52 ? -6.717  -0.313  4.064   1.00 1.07 ? 52  ASP A H    6  
ATOM 8271  H HA   . ASP A 1 52 ? -7.814  -1.918  2.006   1.00 1.08 ? 52  ASP A HA   6  
ATOM 8272  H HB2  . ASP A 1 52 ? -6.563  -0.281  0.488   1.00 0.99 ? 52  ASP A HB2  6  
ATOM 8273  H HB3  . ASP A 1 52 ? -7.793  0.392   1.543   1.00 1.18 ? 52  ASP A HB3  6  
ATOM 8274  N N    . LYS A 1 53 ? -5.809  -2.956  0.753   1.00 0.88 ? 53  LYS A N    6  
ATOM 8275  C CA   . LYS A 1 53 ? -4.733  -3.820  0.292   1.00 0.82 ? 53  LYS A CA   6  
ATOM 8276  C C    . LYS A 1 53 ? -4.065  -3.246  -0.947  1.00 0.76 ? 53  LYS A C    6  
ATOM 8277  O O    . LYS A 1 53 ? -4.694  -2.581  -1.762  1.00 0.87 ? 53  LYS A O    6  
ATOM 8278  C CB   . LYS A 1 53 ? -5.253  -5.230  -0.002  1.00 0.94 ? 53  LYS A CB   6  
ATOM 8279  C CG   . LYS A 1 53 ? -6.457  -5.269  -0.929  1.00 1.33 ? 53  LYS A CG   6  
ATOM 8280  C CD   . LYS A 1 53 ? -7.623  -6.010  -0.293  1.00 1.83 ? 53  LYS A CD   6  
ATOM 8281  C CE   . LYS A 1 53 ? -7.986  -7.264  -1.079  1.00 2.37 ? 53  LYS A CE   6  
ATOM 8282  N NZ   . LYS A 1 53 ? -8.245  -8.432  -0.191  1.00 3.23 ? 53  LYS A NZ   6  
ATOM 8283  H H    . LYS A 1 53 ? -6.604  -2.835  0.190   1.00 0.92 ? 53  LYS A H    6  
ATOM 8284  H HA   . LYS A 1 53 ? -3.998  -3.879  1.082   1.00 0.82 ? 53  LYS A HA   6  
ATOM 8285  H HB2  . LYS A 1 53 ? -4.459  -5.805  -0.457  1.00 1.54 ? 53  LYS A HB2  6  
ATOM 8286  H HB3  . LYS A 1 53 ? -5.529  -5.695  0.928   1.00 1.39 ? 53  LYS A HB3  6  
ATOM 8287  H HG2  . LYS A 1 53 ? -6.764  -4.259  -1.152  1.00 1.78 ? 53  LYS A HG2  6  
ATOM 8288  H HG3  . LYS A 1 53 ? -6.178  -5.772  -1.845  1.00 1.86 ? 53  LYS A HG3  6  
ATOM 8289  H HD2  . LYS A 1 53 ? -7.350  -6.292  0.715   1.00 2.39 ? 53  LYS A HD2  6  
ATOM 8290  H HD3  . LYS A 1 53 ? -8.479  -5.353  -0.264  1.00 2.03 ? 53  LYS A HD3  6  
ATOM 8291  H HE2  . LYS A 1 53 ? -8.874  -7.063  -1.660  1.00 2.44 ? 53  LYS A HE2  6  
ATOM 8292  H HE3  . LYS A 1 53 ? -7.169  -7.504  -1.746  1.00 2.77 ? 53  LYS A HE3  6  
ATOM 8293  H HZ1  . LYS A 1 53 ? -7.782  -8.293  0.731   1.00 3.81 ? 53  LYS A HZ1  6  
ATOM 8294  H HZ2  . LYS A 1 53 ? -7.872  -9.300  -0.625  1.00 3.55 ? 53  LYS A HZ2  6  
ATOM 8295  H HZ3  . LYS A 1 53 ? -9.266  -8.547  -0.038  1.00 3.45 ? 53  LYS A HZ3  6  
ATOM 8296  N N    . LEU A 1 54 ? -2.780  -3.508  -1.063  1.00 0.64 ? 54  LEU A N    6  
ATOM 8297  C CA   . LEU A 1 54 ? -2.000  -3.009  -2.185  1.00 0.66 ? 54  LEU A CA   6  
ATOM 8298  C C    . LEU A 1 54 ? -1.878  -4.045  -3.292  1.00 0.64 ? 54  LEU A C    6  
ATOM 8299  O O    . LEU A 1 54 ? -1.102  -4.997  -3.195  1.00 0.79 ? 54  LEU A O    6  
ATOM 8300  C CB   . LEU A 1 54 ? -0.624  -2.534  -1.719  1.00 0.73 ? 54  LEU A CB   6  
ATOM 8301  C CG   . LEU A 1 54 ? -0.429  -1.016  -1.750  1.00 0.83 ? 54  LEU A CG   6  
ATOM 8302  C CD1  . LEU A 1 54 ? 0.630   -0.588  -0.745  1.00 1.11 ? 54  LEU A CD1  6  
ATOM 8303  C CD2  . LEU A 1 54 ? -0.063  -0.551  -3.152  1.00 1.72 ? 54  LEU A CD2  6  
ATOM 8304  H H    . LEU A 1 54 ? -2.366  -4.032  -0.346  1.00 0.62 ? 54  LEU A H    6  
ATOM 8305  H HA   . LEU A 1 54 ? -2.533  -2.157  -2.585  1.00 0.75 ? 54  LEU A HA   6  
ATOM 8306  H HB2  . LEU A 1 54 ? -0.479  -2.872  -0.706  1.00 1.24 ? 54  LEU A HB2  6  
ATOM 8307  H HB3  . LEU A 1 54 ? 0.128   -2.987  -2.346  1.00 1.21 ? 54  LEU A HB3  6  
ATOM 8308  H HG   . LEU A 1 54 ? -1.358  -0.538  -1.474  1.00 1.18 ? 54  LEU A HG   6  
ATOM 8309  H HD11 . LEU A 1 54 ? 0.932   0.429   -0.949  1.00 1.58 ? 54  LEU A HD11 6  
ATOM 8310  H HD12 . LEU A 1 54 ? 1.486   -1.240  -0.822  1.00 1.88 ? 54  LEU A HD12 6  
ATOM 8311  H HD13 . LEU A 1 54 ? 0.222   -0.647  0.254   1.00 1.17 ? 54  LEU A HD13 6  
ATOM 8312  H HD21 . LEU A 1 54 ? -0.948  -0.190  -3.654  1.00 2.31 ? 54  LEU A HD21 6  
ATOM 8313  H HD22 . LEU A 1 54 ? 0.355   -1.378  -3.709  1.00 2.00 ? 54  LEU A HD22 6  
ATOM 8314  H HD23 . LEU A 1 54 ? 0.665   0.244   -3.090  1.00 2.08 ? 54  LEU A HD23 6  
ATOM 8315  N N    . LEU A 1 55 ? -2.656  -3.836  -4.354  1.00 0.56 ? 55  LEU A N    6  
ATOM 8316  C CA   . LEU A 1 55 ? -2.652  -4.721  -5.509  1.00 0.58 ? 55  LEU A CA   6  
ATOM 8317  C C    . LEU A 1 55 ? -1.302  -4.662  -6.216  1.00 0.54 ? 55  LEU A C    6  
ATOM 8318  O O    . LEU A 1 55 ? -0.722  -5.701  -6.534  1.00 0.56 ? 55  LEU A O    6  
ATOM 8319  C CB   . LEU A 1 55 ? -3.776  -4.340  -6.479  1.00 0.66 ? 55  LEU A CB   6  
ATOM 8320  C CG   . LEU A 1 55 ? -3.853  -5.186  -7.753  1.00 0.91 ? 55  LEU A CG   6  
ATOM 8321  C CD1  . LEU A 1 55 ? -5.260  -5.731  -7.949  1.00 1.27 ? 55  LEU A CD1  6  
ATOM 8322  C CD2  . LEU A 1 55 ? -3.420  -4.367  -8.963  1.00 1.87 ? 55  LEU A CD2  6  
ATOM 8323  H H    . LEU A 1 55 ? -3.244  -3.052  -4.364  1.00 0.58 ? 55  LEU A H    6  
ATOM 8324  H HA   . LEU A 1 55 ? -2.816  -5.728  -5.156  1.00 0.62 ? 55  LEU A HA   6  
ATOM 8325  H HB2  . LEU A 1 55 ? -4.716  -4.429  -5.956  1.00 0.75 ? 55  LEU A HB2  6  
ATOM 8326  H HB3  . LEU A 1 55 ? -3.639  -3.309  -6.766  1.00 0.98 ? 55  LEU A HB3  6  
ATOM 8327  H HG   . LEU A 1 55 ? -3.181  -6.027  -7.661  1.00 1.50 ? 55  LEU A HG   6  
ATOM 8328  H HD11 . LEU A 1 55 ? -5.454  -6.498  -7.214  1.00 1.70 ? 55  LEU A HD11 6  
ATOM 8329  H HD12 . LEU A 1 55 ? -5.349  -6.152  -8.940  1.00 1.74 ? 55  LEU A HD12 6  
ATOM 8330  H HD13 . LEU A 1 55 ? -5.976  -4.931  -7.831  1.00 1.86 ? 55  LEU A HD13 6  
ATOM 8331  H HD21 . LEU A 1 55 ? -2.450  -3.932  -8.775  1.00 2.39 ? 55  LEU A HD21 6  
ATOM 8332  H HD22 . LEU A 1 55 ? -4.140  -3.582  -9.141  1.00 2.39 ? 55  LEU A HD22 6  
ATOM 8333  H HD23 . LEU A 1 55 ? -3.365  -5.008  -9.830  1.00 2.37 ? 55  LEU A HD23 6  
ATOM 8334  N N    . ALA A 1 56 ? -0.800  -3.443  -6.466  1.00 0.51 ? 56  ALA A N    6  
ATOM 8335  C CA   . ALA A 1 56 ? 0.490   -3.289  -7.143  1.00 0.49 ? 56  ALA A CA   6  
ATOM 8336  C C    . ALA A 1 56 ? 1.157   -1.940  -6.833  1.00 0.53 ? 56  ALA A C    6  
ATOM 8337  O O    . ALA A 1 56 ? 0.494   -0.982  -6.437  1.00 0.67 ? 56  ALA A O    6  
ATOM 8338  C CB   . ALA A 1 56 ? 0.302   -3.446  -8.652  1.00 0.54 ? 56  ALA A CB   6  
ATOM 8339  H H    . ALA A 1 56 ? -1.312  -2.636  -6.198  1.00 0.53 ? 56  ALA A H    6  
ATOM 8340  H HA   . ALA A 1 56 ? 1.138   -4.089  -6.795  1.00 0.52 ? 56  ALA A HA   6  
ATOM 8341  H HB1  . ALA A 1 56 ? 1.201   -3.133  -9.166  1.00 1.19 ? 56  ALA A HB1  6  
ATOM 8342  H HB2  . ALA A 1 56 ? -0.526  -2.833  -8.976  1.00 0.99 ? 56  ALA A HB2  6  
ATOM 8343  H HB3  . ALA A 1 56 ? 0.094   -4.481  -8.890  1.00 1.25 ? 56  ALA A HB3  6  
ATOM 8344  N N    . VAL A 1 57 ? 2.481   -1.880  -7.019  1.00 0.50 ? 57  VAL A N    6  
ATOM 8345  C CA   . VAL A 1 57 ? 3.245   -0.657  -6.770  1.00 0.59 ? 57  VAL A CA   6  
ATOM 8346  C C    . VAL A 1 57 ? 4.326   -0.454  -7.833  1.00 0.53 ? 57  VAL A C    6  
ATOM 8347  O O    . VAL A 1 57 ? 5.314   -1.186  -7.875  1.00 0.52 ? 57  VAL A O    6  
ATOM 8348  C CB   . VAL A 1 57 ? 3.902   -0.667  -5.371  1.00 0.77 ? 57  VAL A CB   6  
ATOM 8349  C CG1  . VAL A 1 57 ? 4.858   0.508   -5.212  1.00 1.42 ? 57  VAL A CG1  6  
ATOM 8350  C CG2  . VAL A 1 57 ? 2.840   -0.641  -4.284  1.00 1.47 ? 57  VAL A CG2  6  
ATOM 8351  H H    . VAL A 1 57 ? 2.954   -2.687  -7.327  1.00 0.48 ? 57  VAL A H    6  
ATOM 8352  H HA   . VAL A 1 57 ? 2.557   0.176   -6.813  1.00 0.66 ? 57  VAL A HA   6  
ATOM 8353  H HB   . VAL A 1 57 ? 4.469   -1.579  -5.268  1.00 1.34 ? 57  VAL A HB   6  
ATOM 8354  H HG11 . VAL A 1 57 ? 4.411   1.397   -5.635  1.00 1.89 ? 57  VAL A HG11 6  
ATOM 8355  H HG12 . VAL A 1 57 ? 5.783   0.291   -5.724  1.00 1.82 ? 57  VAL A HG12 6  
ATOM 8356  H HG13 . VAL A 1 57 ? 5.057   0.671   -4.163  1.00 2.12 ? 57  VAL A HG13 6  
ATOM 8357  H HG21 . VAL A 1 57 ? 3.316   -0.562  -3.318  1.00 1.95 ? 57  VAL A HG21 6  
ATOM 8358  H HG22 . VAL A 1 57 ? 2.260   -1.551  -4.327  1.00 1.95 ? 57  VAL A HG22 6  
ATOM 8359  H HG23 . VAL A 1 57 ? 2.190   0.208   -4.435  1.00 2.01 ? 57  VAL A HG23 6  
ATOM 8360  N N    . ASN A 1 58 ? 4.130   0.549   -8.690  1.00 0.57 ? 58  ASN A N    6  
ATOM 8361  C CA   . ASN A 1 58 ? 5.085   0.863   -9.756  1.00 0.58 ? 58  ASN A CA   6  
ATOM 8362  C C    . ASN A 1 58 ? 5.189   -0.284  -10.770 1.00 0.59 ? 58  ASN A C    6  
ATOM 8363  O O    . ASN A 1 58 ? 6.290   -0.686  -11.157 1.00 0.60 ? 58  ASN A O    6  
ATOM 8364  C CB   . ASN A 1 58 ? 6.467   1.184   -9.166  1.00 0.57 ? 58  ASN A CB   6  
ATOM 8365  C CG   . ASN A 1 58 ? 6.487   2.492   -8.392  1.00 0.80 ? 58  ASN A CG   6  
ATOM 8366  O OD1  . ASN A 1 58 ? 5.541   2.817   -7.672  1.00 1.39 ? 58  ASN A OD1  6  
ATOM 8367  N ND2  . ASN A 1 58 ? 7.570   3.250   -8.534  1.00 1.49 ? 58  ASN A ND2  6  
ATOM 8368  H H    . ASN A 1 58 ? 3.321   1.096   -8.603  1.00 0.63 ? 58  ASN A H    6  
ATOM 8369  H HA   . ASN A 1 58 ? 4.718   1.739   -10.272 1.00 0.65 ? 58  ASN A HA   6  
ATOM 8370  H HB2  . ASN A 1 58 ? 6.761   0.389   -8.498  1.00 0.64 ? 58  ASN A HB2  6  
ATOM 8371  H HB3  . ASN A 1 58 ? 7.185   1.253   -9.971  1.00 0.74 ? 58  ASN A HB3  6  
ATOM 8372  H HD21 . ASN A 1 58 ? 8.287   2.930   -9.121  1.00 2.05 ? 58  ASN A HD21 6  
ATOM 8373  H HD22 . ASN A 1 58 ? 7.607   4.098   -8.045  1.00 1.75 ? 58  ASN A HD22 6  
ATOM 8374  N N    . ASN A 1 59 ? 4.028   -0.794  -11.199 1.00 0.60 ? 59  ASN A N    6  
ATOM 8375  C CA   . ASN A 1 59 ? 3.949   -1.886  -12.181 1.00 0.65 ? 59  ASN A CA   6  
ATOM 8376  C C    . ASN A 1 59 ? 4.150   -3.275  -11.555 1.00 0.61 ? 59  ASN A C    6  
ATOM 8377  O O    . ASN A 1 59 ? 3.832   -4.284  -12.188 1.00 0.67 ? 59  ASN A O    6  
ATOM 8378  C CB   . ASN A 1 59 ? 4.963   -1.673  -13.313 1.00 0.71 ? 59  ASN A CB   6  
ATOM 8379  C CG   . ASN A 1 59 ? 4.438   -2.138  -14.658 1.00 1.18 ? 59  ASN A CG   6  
ATOM 8380  O OD1  . ASN A 1 59 ? 3.756   -1.393  -15.362 1.00 1.74 ? 59  ASN A OD1  6  
ATOM 8381  N ND2  . ASN A 1 59 ? 4.752   -3.378  -15.024 1.00 1.52 ? 59  ASN A ND2  6  
ATOM 8382  H H    . ASN A 1 59 ? 3.195   -0.415  -10.845 1.00 0.61 ? 59  ASN A H    6  
ATOM 8383  H HA   . ASN A 1 59 ? 2.958   -1.855  -12.608 1.00 0.68 ? 59  ASN A HA   6  
ATOM 8384  H HB2  . ASN A 1 59 ? 5.196   -0.621  -13.386 1.00 0.83 ? 59  ASN A HB2  6  
ATOM 8385  H HB3  . ASN A 1 59 ? 5.866   -2.222  -13.089 1.00 0.74 ? 59  ASN A HB3  6  
ATOM 8386  H HD21 . ASN A 1 59 ? 5.299   -3.918  -14.415 1.00 1.74 ? 59  ASN A HD21 6  
ATOM 8387  H HD22 . ASN A 1 59 ? 4.425   -3.701  -15.889 1.00 1.84 ? 59  ASN A HD22 6  
ATOM 8388  N N    . VAL A 1 60 ? 4.660   -3.339  -10.319 1.00 0.53 ? 60  VAL A N    6  
ATOM 8389  C CA   . VAL A 1 60 ? 4.870   -4.625  -9.649  1.00 0.52 ? 60  VAL A CA   6  
ATOM 8390  C C    . VAL A 1 60 ? 3.676   -4.970  -8.767  1.00 0.51 ? 60  VAL A C    6  
ATOM 8391  O O    . VAL A 1 60 ? 3.058   -4.082  -8.192  1.00 0.50 ? 60  VAL A O    6  
ATOM 8392  C CB   . VAL A 1 60 ? 6.156   -4.635  -8.784  1.00 0.50 ? 60  VAL A CB   6  
ATOM 8393  C CG1  . VAL A 1 60 ? 7.352   -4.123  -9.575  1.00 0.51 ? 60  VAL A CG1  6  
ATOM 8394  C CG2  . VAL A 1 60 ? 5.971   -3.831  -7.503  1.00 0.54 ? 60  VAL A CG2  6  
ATOM 8395  H H    . VAL A 1 60 ? 4.888   -2.512  -9.845  1.00 0.52 ? 60  VAL A H    6  
ATOM 8396  H HA   . VAL A 1 60 ? 4.969   -5.384  -10.413 1.00 0.56 ? 60  VAL A HA   6  
ATOM 8397  H HB   . VAL A 1 60 ? 6.354   -5.657  -8.505  1.00 0.58 ? 60  VAL A HB   6  
ATOM 8398  H HG11 . VAL A 1 60 ? 7.918   -3.433  -8.964  1.00 1.18 ? 60  VAL A HG11 6  
ATOM 8399  H HG12 . VAL A 1 60 ? 7.007   -3.616  -10.464 1.00 0.93 ? 60  VAL A HG12 6  
ATOM 8400  H HG13 . VAL A 1 60 ? 7.980   -4.955  -9.855  1.00 1.23 ? 60  VAL A HG13 6  
ATOM 8401  H HG21 . VAL A 1 60 ? 6.778   -3.118  -7.405  1.00 0.98 ? 60  VAL A HG21 6  
ATOM 8402  H HG22 . VAL A 1 60 ? 5.979   -4.500  -6.655  1.00 1.15 ? 60  VAL A HG22 6  
ATOM 8403  H HG23 . VAL A 1 60 ? 5.030   -3.306  -7.537  1.00 1.17 ? 60  VAL A HG23 6  
ATOM 8404  N N    . CYS A 1 61 ? 3.354   -6.257  -8.648  1.00 0.53 ? 61  CYS A N    6  
ATOM 8405  C CA   . CYS A 1 61 ? 2.230   -6.670  -7.811  1.00 0.54 ? 61  CYS A CA   6  
ATOM 8406  C C    . CYS A 1 61 ? 2.657   -6.750  -6.350  1.00 0.58 ? 61  CYS A C    6  
ATOM 8407  O O    . CYS A 1 61 ? 3.698   -7.325  -6.026  1.00 0.72 ? 61  CYS A O    6  
ATOM 8408  C CB   . CYS A 1 61 ? 1.654   -8.006  -8.273  1.00 0.56 ? 61  CYS A CB   6  
ATOM 8409  S SG   . CYS A 1 61 ? 2.769   -9.416  -8.067  1.00 0.71 ? 61  CYS A SG   6  
ATOM 8410  H H    . CYS A 1 61 ? 3.884   -6.936  -9.116  1.00 0.55 ? 61  CYS A H    6  
ATOM 8411  H HA   . CYS A 1 61 ? 1.465   -5.913  -7.902  1.00 0.53 ? 61  CYS A HA   6  
ATOM 8412  H HB2  . CYS A 1 61 ? 0.759   -8.208  -7.706  1.00 0.91 ? 61  CYS A HB2  6  
ATOM 8413  H HB3  . CYS A 1 61 ? 1.402   -7.933  -9.320  1.00 0.84 ? 61  CYS A HB3  6  
ATOM 8414  H HG   . CYS A 1 61 ? 2.736   -9.688  -7.146  1.00 1.12 ? 61  CYS A HG   6  
ATOM 8415  N N    . LEU A 1 62 ? 1.837   -6.179  -5.474  1.00 0.55 ? 62  LEU A N    6  
ATOM 8416  C CA   . LEU A 1 62 ? 2.107   -6.187  -4.044  1.00 0.62 ? 62  LEU A CA   6  
ATOM 8417  C C    . LEU A 1 62 ? 1.242   -7.224  -3.310  1.00 0.58 ? 62  LEU A C    6  
ATOM 8418  O O    . LEU A 1 62 ? 0.911   -7.049  -2.132  1.00 0.51 ? 62  LEU A O    6  
ATOM 8419  C CB   . LEU A 1 62 ? 1.902   -4.780  -3.478  1.00 0.77 ? 62  LEU A CB   6  
ATOM 8420  C CG   . LEU A 1 62 ? 3.134   -4.187  -2.791  1.00 0.95 ? 62  LEU A CG   6  
ATOM 8421  C CD1  . LEU A 1 62 ? 4.170   -3.770  -3.823  1.00 1.71 ? 62  LEU A CD1  6  
ATOM 8422  C CD2  . LEU A 1 62 ? 2.744   -3.006  -1.916  1.00 1.08 ? 62  LEU A CD2  6  
ATOM 8423  H H    . LEU A 1 62 ? 1.007   -5.768  -5.788  1.00 0.55 ? 62  LEU A H    6  
ATOM 8424  H HA   . LEU A 1 62 ? 3.144   -6.461  -3.914  1.00 0.72 ? 62  LEU A HA   6  
ATOM 8425  H HB2  . LEU A 1 62 ? 1.619   -4.127  -4.292  1.00 1.26 ? 62  LEU A HB2  6  
ATOM 8426  H HB3  . LEU A 1 62 ? 1.095   -4.810  -2.770  1.00 1.09 ? 62  LEU A HB3  6  
ATOM 8427  H HG   . LEU A 1 62 ? 3.581   -4.939  -2.159  1.00 1.61 ? 62  LEU A HG   6  
ATOM 8428  H HD11 . LEU A 1 62 ? 4.693   -2.893  -3.475  1.00 2.12 ? 62  LEU A HD11 6  
ATOM 8429  H HD12 . LEU A 1 62 ? 3.678   -3.549  -4.760  1.00 2.04 ? 62  LEU A HD12 6  
ATOM 8430  H HD13 . LEU A 1 62 ? 4.876   -4.576  -3.969  1.00 2.37 ? 62  LEU A HD13 6  
ATOM 8431  H HD21 . LEU A 1 62 ? 2.597   -2.133  -2.532  1.00 1.44 ? 62  LEU A HD21 6  
ATOM 8432  H HD22 . LEU A 1 62 ? 3.531   -2.813  -1.201  1.00 1.77 ? 62  LEU A HD22 6  
ATOM 8433  H HD23 . LEU A 1 62 ? 1.830   -3.233  -1.391  1.00 1.57 ? 62  LEU A HD23 6  
ATOM 8434  N N    . GLU A 1 63 ? 0.855   -8.291  -4.015  1.00 0.72 ? 63  GLU A N    6  
ATOM 8435  C CA   . GLU A 1 63 ? 0.016   -9.336  -3.428  1.00 0.80 ? 63  GLU A CA   6  
ATOM 8436  C C    . GLU A 1 63 ? 0.722   -10.696 -3.385  1.00 0.95 ? 63  GLU A C    6  
ATOM 8437  O O    . GLU A 1 63 ? 0.317   -11.578 -2.624  1.00 1.83 ? 63  GLU A O    6  
ATOM 8438  C CB   . GLU A 1 63 ? -1.299  -9.456  -4.205  1.00 0.86 ? 63  GLU A CB   6  
ATOM 8439  C CG   . GLU A 1 63 ? -2.411  -10.133 -3.417  1.00 1.12 ? 63  GLU A CG   6  
ATOM 8440  C CD   . GLU A 1 63 ? -3.790  -9.620  -3.786  1.00 1.31 ? 63  GLU A CD   6  
ATOM 8441  O OE1  . GLU A 1 63 ? -4.175  -8.539  -3.291  1.00 1.96 ? 63  GLU A OE1  6  
ATOM 8442  O OE2  . GLU A 1 63 ? -4.486  -10.299 -4.569  1.00 1.65 ? 63  GLU A OE2  6  
ATOM 8443  H H    . GLU A 1 63 ? 1.122   -8.367  -4.955  1.00 0.83 ? 63  GLU A H    6  
ATOM 8444  H HA   . GLU A 1 63 ? -0.211  -9.040  -2.418  1.00 0.80 ? 63  GLU A HA   6  
ATOM 8445  H HB2  . GLU A 1 63 ? -1.633  -8.466  -4.479  1.00 1.08 ? 63  GLU A HB2  6  
ATOM 8446  H HB3  . GLU A 1 63 ? -1.123  -10.028 -5.103  1.00 1.32 ? 63  GLU A HB3  6  
ATOM 8447  H HG2  . GLU A 1 63 ? -2.376  -11.195 -3.612  1.00 1.64 ? 63  GLU A HG2  6  
ATOM 8448  H HG3  . GLU A 1 63 ? -2.247  -9.957  -2.364  1.00 1.48 ? 63  GLU A HG3  6  
ATOM 8449  N N    . GLU A 1 64 ? 1.771   -10.870 -4.195  1.00 1.04 ? 64  GLU A N    6  
ATOM 8450  C CA   . GLU A 1 64 ? 2.510   -12.132 -4.231  1.00 1.08 ? 64  GLU A CA   6  
ATOM 8451  C C    . GLU A 1 64 ? 3.985   -11.929 -3.867  1.00 0.90 ? 64  GLU A C    6  
ATOM 8452  O O    . GLU A 1 64 ? 4.876   -12.517 -4.485  1.00 0.96 ? 64  GLU A O    6  
ATOM 8453  C CB   . GLU A 1 64 ? 2.378   -12.772 -5.612  1.00 1.28 ? 64  GLU A CB   6  
ATOM 8454  C CG   . GLU A 1 64 ? 1.365   -13.905 -5.665  1.00 1.53 ? 64  GLU A CG   6  
ATOM 8455  C CD   . GLU A 1 64 ? -0.055  -13.410 -5.867  1.00 2.14 ? 64  GLU A CD   6  
ATOM 8456  O OE1  . GLU A 1 64 ? -0.454  -13.213 -7.035  1.00 2.40 ? 64  GLU A OE1  6  
ATOM 8457  O OE2  . GLU A 1 64 ? -0.769  -13.220 -4.860  1.00 2.93 ? 64  GLU A OE2  6  
ATOM 8458  H H    . GLU A 1 64 ? 2.055   -10.137 -4.779  1.00 1.69 ? 64  GLU A H    6  
ATOM 8459  H HA   . GLU A 1 64 ? 2.064   -12.790 -3.507  1.00 1.19 ? 64  GLU A HA   6  
ATOM 8460  H HB2  . GLU A 1 64 ? 2.070   -12.014 -6.307  1.00 1.35 ? 64  GLU A HB2  6  
ATOM 8461  H HB3  . GLU A 1 64 ? 3.338   -13.160 -5.915  1.00 1.23 ? 64  GLU A HB3  6  
ATOM 8462  H HG2  . GLU A 1 64 ? 1.621   -14.562 -6.482  1.00 1.77 ? 64  GLU A HG2  6  
ATOM 8463  H HG3  . GLU A 1 64 ? 1.410   -14.456 -4.736  1.00 1.72 ? 64  GLU A HG3  6  
ATOM 8464  N N    . VAL A 1 65 ? 4.236   -11.090 -2.859  1.00 0.80 ? 65  VAL A N    6  
ATOM 8465  C CA   . VAL A 1 65 ? 5.604   -10.810 -2.419  1.00 0.64 ? 65  VAL A CA   6  
ATOM 8466  C C    . VAL A 1 65 ? 5.726   -10.772 -0.899  1.00 0.64 ? 65  VAL A C    6  
ATOM 8467  O O    . VAL A 1 65 ? 4.749   -10.529 -0.187  1.00 0.70 ? 65  VAL A O    6  
ATOM 8468  C CB   . VAL A 1 65 ? 6.125   -9.470  -2.979  1.00 0.56 ? 65  VAL A CB   6  
ATOM 8469  C CG1  . VAL A 1 65 ? 6.380   -9.573  -4.476  1.00 0.64 ? 65  VAL A CG1  6  
ATOM 8470  C CG2  . VAL A 1 65 ? 5.157   -8.334  -2.669  1.00 0.59 ? 65  VAL A CG2  6  
ATOM 8471  H H    . VAL A 1 65 ? 3.483   -10.651 -2.411  1.00 0.90 ? 65  VAL A H    6  
ATOM 8472  H HA   . VAL A 1 65 ? 6.239   -11.598 -2.796  1.00 0.65 ? 65  VAL A HA   6  
ATOM 8473  H HB   . VAL A 1 65 ? 7.066   -9.250  -2.492  1.00 0.50 ? 65  VAL A HB   6  
ATOM 8474  H HG11 . VAL A 1 65 ? 6.904   -8.690  -4.813  1.00 1.20 ? 65  VAL A HG11 6  
ATOM 8475  H HG12 . VAL A 1 65 ? 5.438   -9.653  -4.997  1.00 1.37 ? 65  VAL A HG12 6  
ATOM 8476  H HG13 . VAL A 1 65 ? 6.980   -10.448 -4.679  1.00 0.86 ? 65  VAL A HG13 6  
ATOM 8477  H HG21 . VAL A 1 65 ? 5.520   -7.420  -3.117  1.00 0.99 ? 65  VAL A HG21 6  
ATOM 8478  H HG22 . VAL A 1 65 ? 5.084   -8.205  -1.599  1.00 1.30 ? 65  VAL A HG22 6  
ATOM 8479  H HG23 . VAL A 1 65 ? 4.183   -8.569  -3.071  1.00 1.16 ? 65  VAL A HG23 6  
ATOM 8480  N N    . THR A 1 66 ? 6.950   -10.993 -0.417  1.00 0.63 ? 66  THR A N    6  
ATOM 8481  C CA   . THR A 1 66 ? 7.236   -10.964 1.015   1.00 0.69 ? 66  THR A CA   6  
ATOM 8482  C C    . THR A 1 66 ? 7.140   -9.532  1.540   1.00 0.61 ? 66  THR A C    6  
ATOM 8483  O O    . THR A 1 66 ? 6.963   -8.591  0.760   1.00 0.66 ? 66  THR A O    6  
ATOM 8484  C CB   . THR A 1 66 ? 8.632   -11.538 1.304   1.00 0.74 ? 66  THR A CB   6  
ATOM 8485  O OG1  . THR A 1 66 ? 9.047   -12.419 0.272   1.00 1.53 ? 66  THR A OG1  6  
ATOM 8486  C CG2  . THR A 1 66 ? 8.710   -12.296 2.614   1.00 1.17 ? 66  THR A CG2  6  
ATOM 8487  H H    . THR A 1 66 ? 7.683   -11.164 -1.046  1.00 0.62 ? 66  THR A H    6  
ATOM 8488  H HA   . THR A 1 66 ? 6.494   -11.570 1.514   1.00 0.80 ? 66  THR A HA   6  
ATOM 8489  H HB   . THR A 1 66 ? 9.339   -10.722 1.355   1.00 1.20 ? 66  THR A HB   6  
ATOM 8490  H HG1  . THR A 1 66 ? 8.425   -13.147 0.198   1.00 1.88 ? 66  THR A HG1  6  
ATOM 8491  H HG21 . THR A 1 66 ? 9.485   -13.046 2.550   1.00 1.74 ? 66  THR A HG21 6  
ATOM 8492  H HG22 . THR A 1 66 ? 7.762   -12.776 2.810   1.00 1.61 ? 66  THR A HG22 6  
ATOM 8493  H HG23 . THR A 1 66 ? 8.939   -11.610 3.414   1.00 1.74 ? 66  THR A HG23 6  
ATOM 8494  N N    . HIS A 1 67 ? 7.248   -9.367  2.857   1.00 0.51 ? 67  HIS A N    6  
ATOM 8495  C CA   . HIS A 1 67 ? 7.156   -8.031  3.449   1.00 0.45 ? 67  HIS A CA   6  
ATOM 8496  C C    . HIS A 1 67 ? 8.231   -7.104  2.881   1.00 0.43 ? 67  HIS A C    6  
ATOM 8497  O O    . HIS A 1 67 ? 7.956   -5.937  2.604   1.00 0.41 ? 67  HIS A O    6  
ATOM 8498  C CB   . HIS A 1 67 ? 7.206   -8.061  4.985   1.00 0.45 ? 67  HIS A CB   6  
ATOM 8499  C CG   . HIS A 1 67 ? 6.891   -6.729  5.587   1.00 0.46 ? 67  HIS A CG   6  
ATOM 8500  N ND1  . HIS A 1 67 ? 5.679   -6.446  6.171   1.00 0.51 ? 67  HIS A ND1  6  
ATOM 8501  C CD2  . HIS A 1 67 ? 7.608   -5.581  5.641   1.00 0.49 ? 67  HIS A CD2  6  
ATOM 8502  C CE1  . HIS A 1 67 ? 5.660   -5.184  6.548   1.00 0.54 ? 67  HIS A CE1  6  
ATOM 8503  N NE2  . HIS A 1 67 ? 6.818   -4.635  6.241   1.00 0.52 ? 67  HIS A NE2  6  
ATOM 8504  H H    . HIS A 1 67 ? 7.380   -10.155 3.425   1.00 0.50 ? 67  HIS A H    6  
ATOM 8505  H HA   . HIS A 1 67 ? 6.197   -7.629  3.154   1.00 0.44 ? 67  HIS A HA   6  
ATOM 8506  H HB2  . HIS A 1 67 ? 6.470   -8.761  5.349   1.00 0.46 ? 67  HIS A HB2  6  
ATOM 8507  H HB3  . HIS A 1 67 ? 8.183   -8.367  5.320   1.00 0.44 ? 67  HIS A HB3  6  
ATOM 8508  H HD1  . HIS A 1 67 ? 4.942   -7.079  6.296   1.00 0.56 ? 67  HIS A HD1  6  
ATOM 8509  H HD2  . HIS A 1 67 ? 8.610   -5.433  5.273   1.00 0.54 ? 67  HIS A HD2  6  
ATOM 8510  H HE1  . HIS A 1 67 ? 4.828   -4.679  7.004   1.00 0.61 ? 67  HIS A HE1  6  
ATOM 8511  H HE2  . HIS A 1 67 ? 6.993   -3.672  6.237   1.00 0.56 ? 67  HIS A HE2  6  
ATOM 8512  N N    . GLU A 1 68 ? 9.449   -7.623  2.707   1.00 0.45 ? 68  GLU A N    6  
ATOM 8513  C CA   . GLU A 1 68 ? 10.553  -6.826  2.163   1.00 0.45 ? 68  GLU A CA   6  
ATOM 8514  C C    . GLU A 1 68 ? 10.119  -6.104  0.887   1.00 0.42 ? 68  GLU A C    6  
ATOM 8515  O O    . GLU A 1 68 ? 10.281  -4.892  0.772   1.00 0.41 ? 68  GLU A O    6  
ATOM 8516  C CB   . GLU A 1 68 ? 11.773  -7.709  1.871   1.00 0.49 ? 68  GLU A CB   6  
ATOM 8517  C CG   . GLU A 1 68 ? 12.376  -8.350  3.111   1.00 1.43 ? 68  GLU A CG   6  
ATOM 8518  C CD   . GLU A 1 68 ? 13.305  -7.412  3.861   1.00 2.13 ? 68  GLU A CD   6  
ATOM 8519  O OE1  . GLU A 1 68 ? 12.809  -6.632  4.701   1.00 2.59 ? 68  GLU A OE1  6  
ATOM 8520  O OE2  . GLU A 1 68 ? 14.527  -7.459  3.607   1.00 2.90 ? 68  GLU A OE2  6  
ATOM 8521  H H    . GLU A 1 68 ? 9.617   -8.554  2.962   1.00 0.47 ? 68  GLU A H    6  
ATOM 8522  H HA   . GLU A 1 68 ? 10.822  -6.089  2.904   1.00 0.47 ? 68  GLU A HA   6  
ATOM 8523  H HB2  . GLU A 1 68 ? 11.481  -8.496  1.191   1.00 1.08 ? 68  GLU A HB2  6  
ATOM 8524  H HB3  . GLU A 1 68 ? 12.534  -7.104  1.400   1.00 1.21 ? 68  GLU A HB3  6  
ATOM 8525  H HG2  . GLU A 1 68 ? 11.577  -8.645  3.775   1.00 2.02 ? 68  GLU A HG2  6  
ATOM 8526  H HG3  . GLU A 1 68 ? 12.935  -9.225  2.812   1.00 2.08 ? 68  GLU A HG3  6  
ATOM 8527  N N    . GLU A 1 69 ? 9.561   -6.861  -0.060  1.00 0.44 ? 69  GLU A N    6  
ATOM 8528  C CA   . GLU A 1 69 ? 9.092   -6.299  -1.330  1.00 0.43 ? 69  GLU A CA   6  
ATOM 8529  C C    . GLU A 1 69 ? 8.024   -5.224  -1.100  1.00 0.41 ? 69  GLU A C    6  
ATOM 8530  O O    . GLU A 1 69 ? 7.966   -4.236  -1.830  1.00 0.41 ? 69  GLU A O    6  
ATOM 8531  C CB   . GLU A 1 69 ? 8.533   -7.403  -2.228  1.00 0.46 ? 69  GLU A CB   6  
ATOM 8532  C CG   . GLU A 1 69 ? 9.594   -8.354  -2.764  1.00 0.76 ? 69  GLU A CG   6  
ATOM 8533  C CD   . GLU A 1 69 ? 9.646   -9.665  -2.000  1.00 1.07 ? 69  GLU A CD   6  
ATOM 8534  O OE1  . GLU A 1 69 ? 10.174  -9.674  -0.868  1.00 1.70 ? 69  GLU A OE1  6  
ATOM 8535  O OE2  . GLU A 1 69 ? 9.159   -10.682 -2.535  1.00 1.84 ? 69  GLU A OE2  6  
ATOM 8536  H H    . GLU A 1 69 ? 9.462   -7.823  0.104   1.00 0.48 ? 69  GLU A H    6  
ATOM 8537  H HA   . GLU A 1 69 ? 9.939   -5.844  -1.821  1.00 0.46 ? 69  GLU A HA   6  
ATOM 8538  H HB2  . GLU A 1 69 ? 7.816   -7.979  -1.663  1.00 0.64 ? 69  GLU A HB2  6  
ATOM 8539  H HB3  . GLU A 1 69 ? 8.032   -6.947  -3.069  1.00 0.63 ? 69  GLU A HB3  6  
ATOM 8540  H HG2  . GLU A 1 69 ? 9.377   -8.568  -3.800  1.00 1.51 ? 69  GLU A HG2  6  
ATOM 8541  H HG3  . GLU A 1 69 ? 10.559  -7.873  -2.693  1.00 1.43 ? 69  GLU A HG3  6  
ATOM 8542  N N    . ALA A 1 70 ? 7.195   -5.418  -0.069  1.00 0.41 ? 70  ALA A N    6  
ATOM 8543  C CA   . ALA A 1 70 ? 6.143   -4.458  0.275   1.00 0.41 ? 70  ALA A CA   6  
ATOM 8544  C C    . ALA A 1 70 ? 6.745   -3.101  0.645   1.00 0.40 ? 70  ALA A C    6  
ATOM 8545  O O    . ALA A 1 70 ? 6.258   -2.053  0.220   1.00 0.42 ? 70  ALA A O    6  
ATOM 8546  C CB   . ALA A 1 70 ? 5.312   -4.987  1.436   1.00 0.44 ? 70  ALA A CB   6  
ATOM 8547  H H    . ALA A 1 70 ? 7.303   -6.218  0.488   1.00 0.44 ? 70  ALA A H    6  
ATOM 8548  H HA   . ALA A 1 70 ? 5.492   -4.339  -0.582  1.00 0.42 ? 70  ALA A HA   6  
ATOM 8549  H HB1  . ALA A 1 70 ? 5.042   -6.015  1.248   1.00 1.00 ? 70  ALA A HB1  6  
ATOM 8550  H HB2  . ALA A 1 70 ? 4.418   -4.391  1.537   1.00 1.28 ? 70  ALA A HB2  6  
ATOM 8551  H HB3  . ALA A 1 70 ? 5.886   -4.927  2.348   1.00 0.98 ? 70  ALA A HB3  6  
ATOM 8552  N N    . VAL A 1 71 ? 7.818   -3.140  1.435   1.00 0.40 ? 71  VAL A N    6  
ATOM 8553  C CA   . VAL A 1 71 ? 8.505   -1.928  1.872   1.00 0.42 ? 71  VAL A CA   6  
ATOM 8554  C C    . VAL A 1 71 ? 9.426   -1.389  0.777   1.00 0.41 ? 71  VAL A C    6  
ATOM 8555  O O    . VAL A 1 71 ? 9.520   -0.178  0.581   1.00 0.42 ? 71  VAL A O    6  
ATOM 8556  C CB   . VAL A 1 71 ? 9.329   -2.184  3.156   1.00 0.48 ? 71  VAL A CB   6  
ATOM 8557  C CG1  . VAL A 1 71 ? 10.300  -1.041  3.427   1.00 0.52 ? 71  VAL A CG1  6  
ATOM 8558  C CG2  . VAL A 1 71 ? 8.408   -2.399  4.348   1.00 0.50 ? 71  VAL A CG2  6  
ATOM 8559  H H    . VAL A 1 71 ? 8.159   -4.014  1.721   1.00 0.41 ? 71  VAL A H    6  
ATOM 8560  H HA   . VAL A 1 71 ? 7.755   -1.183  2.094   1.00 0.43 ? 71  VAL A HA   6  
ATOM 8561  H HB   . VAL A 1 71 ? 9.907   -3.086  3.012   1.00 0.51 ? 71  VAL A HB   6  
ATOM 8562  H HG11 . VAL A 1 71 ? 11.227  -1.224  2.905   1.00 1.18 ? 71  VAL A HG11 6  
ATOM 8563  H HG12 . VAL A 1 71 ? 10.491  -0.975  4.488   1.00 1.21 ? 71  VAL A HG12 6  
ATOM 8564  H HG13 . VAL A 1 71 ? 9.870   -0.113  3.081   1.00 1.02 ? 71  VAL A HG13 6  
ATOM 8565  H HG21 . VAL A 1 71 ? 8.881   -3.066  5.054   1.00 1.07 ? 71  VAL A HG21 6  
ATOM 8566  H HG22 . VAL A 1 71 ? 7.476   -2.832  4.012   1.00 1.12 ? 71  VAL A HG22 6  
ATOM 8567  H HG23 . VAL A 1 71 ? 8.211   -1.451  4.826   1.00 1.00 ? 71  VAL A HG23 6  
ATOM 8568  N N    . THR A 1 72 ? 10.102  -2.297  0.070   1.00 0.43 ? 72  THR A N    6  
ATOM 8569  C CA   . THR A 1 72 ? 11.018  -1.919  -1.003  1.00 0.47 ? 72  THR A CA   6  
ATOM 8570  C C    . THR A 1 72 ? 10.282  -1.234  -2.155  1.00 0.42 ? 72  THR A C    6  
ATOM 8571  O O    . THR A 1 72 ? 10.828  -0.338  -2.797  1.00 0.44 ? 72  THR A O    6  
ATOM 8572  C CB   . THR A 1 72 ? 11.771  -3.150  -1.520  1.00 0.53 ? 72  THR A CB   6  
ATOM 8573  O OG1  . THR A 1 72 ? 12.483  -3.779  -0.469  1.00 0.60 ? 72  THR A OG1  6  
ATOM 8574  C CG2  . THR A 1 72 ? 12.768  -2.832  -2.617  1.00 0.61 ? 72  THR A CG2  6  
ATOM 8575  H H    . THR A 1 72 ? 9.982   -3.244  0.275   1.00 0.46 ? 72  THR A H    6  
ATOM 8576  H HA   . THR A 1 72 ? 11.733  -1.225  -0.591  1.00 0.51 ? 72  THR A HA   6  
ATOM 8577  H HB   . THR A 1 72 ? 11.054  -3.856  -1.916  1.00 0.53 ? 72  THR A HB   6  
ATOM 8578  H HG1  . THR A 1 72 ? 12.179  -4.685  -0.373  1.00 0.98 ? 72  THR A HG1  6  
ATOM 8579  H HG21 . THR A 1 72 ? 12.252  -2.393  -3.459  1.00 1.16 ? 72  THR A HG21 6  
ATOM 8580  H HG22 . THR A 1 72 ? 13.262  -3.740  -2.930  1.00 0.86 ? 72  THR A HG22 6  
ATOM 8581  H HG23 . THR A 1 72 ? 13.503  -2.134  -2.243  1.00 1.27 ? 72  THR A HG23 6  
ATOM 8582  N N    . ALA A 1 73 ? 9.047   -1.664  -2.421  1.00 0.37 ? 73  ALA A N    6  
ATOM 8583  C CA   . ALA A 1 73 ? 8.244   -1.097  -3.502  1.00 0.36 ? 73  ALA A CA   6  
ATOM 8584  C C    . ALA A 1 73 ? 7.650   0.244   -3.094  1.00 0.34 ? 73  ALA A C    6  
ATOM 8585  O O    . ALA A 1 73 ? 7.589   1.173   -3.901  1.00 0.36 ? 73  ALA A O    6  
ATOM 8586  C CB   . ALA A 1 73 ? 7.139   -2.065  -3.904  1.00 0.41 ? 73  ALA A CB   6  
ATOM 8587  H H    . ALA A 1 73 ? 8.658   -2.382  -1.887  1.00 0.37 ? 73  ALA A H    6  
ATOM 8588  H HA   . ALA A 1 73 ? 8.889   -0.950  -4.356  1.00 0.39 ? 73  ALA A HA   6  
ATOM 8589  H HB1  . ALA A 1 73 ? 6.593   -1.659  -4.742  1.00 1.15 ? 73  ALA A HB1  6  
ATOM 8590  H HB2  . ALA A 1 73 ? 6.466   -2.209  -3.071  1.00 1.01 ? 73  ALA A HB2  6  
ATOM 8591  H HB3  . ALA A 1 73 ? 7.576   -3.012  -4.183  1.00 1.08 ? 73  ALA A HB3  6  
ATOM 8592  N N    . LEU A 1 74 ? 7.245   0.352   -1.827  1.00 0.33 ? 74  LEU A N    6  
ATOM 8593  C CA   . LEU A 1 74 ? 6.692   1.595   -1.303  1.00 0.37 ? 74  LEU A CA   6  
ATOM 8594  C C    . LEU A 1 74 ? 7.788   2.646   -1.195  1.00 0.38 ? 74  LEU A C    6  
ATOM 8595  O O    . LEU A 1 74 ? 7.558   3.835   -1.426  1.00 0.44 ? 74  LEU A O    6  
ATOM 8596  C CB   . LEU A 1 74 ? 6.092   1.356   0.082   1.00 0.41 ? 74  LEU A CB   6  
ATOM 8597  C CG   . LEU A 1 74 ? 4.590   1.096   0.118   1.00 0.61 ? 74  LEU A CG   6  
ATOM 8598  C CD1  . LEU A 1 74 ? 3.820   2.284   -0.439  1.00 1.73 ? 74  LEU A CD1  6  
ATOM 8599  C CD2  . LEU A 1 74 ? 4.242   -0.177  -0.641  1.00 1.13 ? 74  LEU A CD2  6  
ATOM 8600  H H    . LEU A 1 74 ? 7.347   -0.410  -1.211  1.00 0.33 ? 74  LEU A H    6  
ATOM 8601  H HA   . LEU A 1 74 ? 5.923   1.941   -1.977  1.00 0.42 ? 74  LEU A HA   6  
ATOM 8602  H HB2  . LEU A 1 74 ? 6.591   0.505   0.522   1.00 0.61 ? 74  LEU A HB2  6  
ATOM 8603  H HB3  . LEU A 1 74 ? 6.298   2.221   0.693   1.00 0.47 ? 74  LEU A HB3  6  
ATOM 8604  H HG   . LEU A 1 74 ? 4.298   0.961   1.144   1.00 1.29 ? 74  LEU A HG   6  
ATOM 8605  H HD11 . LEU A 1 74 ? 4.166   3.192   0.034   1.00 2.20 ? 74  LEU A HD11 6  
ATOM 8606  H HD12 . LEU A 1 74 ? 2.766   2.156   -0.242  1.00 2.34 ? 74  LEU A HD12 6  
ATOM 8607  H HD13 . LEU A 1 74 ? 3.982   2.351   -1.505  1.00 2.24 ? 74  LEU A HD13 6  
ATOM 8608  H HD21 . LEU A 1 74 ? 4.979   -0.352  -1.410  1.00 1.57 ? 74  LEU A HD21 6  
ATOM 8609  H HD22 . LEU A 1 74 ? 3.268   -0.071  -1.095  1.00 1.72 ? 74  LEU A HD22 6  
ATOM 8610  H HD23 . LEU A 1 74 ? 4.231   -1.011  0.044   1.00 1.75 ? 74  LEU A HD23 6  
ATOM 8611  N N    . LYS A 1 75 ? 8.983   2.181   -0.838  1.00 0.38 ? 75  LYS A N    6  
ATOM 8612  C CA   . LYS A 1 75 ? 10.142  3.063   -0.684  1.00 0.47 ? 75  LYS A CA   6  
ATOM 8613  C C    . LYS A 1 75 ? 10.822  3.363   -2.028  1.00 0.49 ? 75  LYS A C    6  
ATOM 8614  O O    . LYS A 1 75 ? 11.530  4.364   -2.152  1.00 0.59 ? 75  LYS A O    6  
ATOM 8615  C CB   . LYS A 1 75 ? 11.151  2.458   0.302   1.00 0.57 ? 75  LYS A CB   6  
ATOM 8616  C CG   . LYS A 1 75 ? 11.984  1.320   -0.272  1.00 0.64 ? 75  LYS A CG   6  
ATOM 8617  C CD   . LYS A 1 75 ? 13.471  1.567   -0.084  1.00 1.05 ? 75  LYS A CD   6  
ATOM 8618  C CE   . LYS A 1 75 ? 13.909  1.280   1.346   1.00 0.88 ? 75  LYS A CE   6  
ATOM 8619  N NZ   . LYS A 1 75 ? 14.455  2.493   2.016   1.00 1.44 ? 75  LYS A NZ   6  
ATOM 8620  H H    . LYS A 1 75 ? 9.077   1.211   -0.675  1.00 0.37 ? 75  LYS A H    6  
ATOM 8621  H HA   . LYS A 1 75 ? 9.782   3.995   -0.274  1.00 0.54 ? 75  LYS A HA   6  
ATOM 8622  H HB2  . LYS A 1 75 ? 11.824  3.236   0.628   1.00 0.67 ? 75  LYS A HB2  6  
ATOM 8623  H HB3  . LYS A 1 75 ? 10.612  2.082   1.159   1.00 0.62 ? 75  LYS A HB3  6  
ATOM 8624  H HG2  . LYS A 1 75 ? 11.717  0.404   0.231   1.00 0.87 ? 75  LYS A HG2  6  
ATOM 8625  H HG3  . LYS A 1 75 ? 11.773  1.227   -1.327  1.00 0.88 ? 75  LYS A HG3  6  
ATOM 8626  H HD2  . LYS A 1 75 ? 14.021  0.924   -0.753  1.00 1.90 ? 75  LYS A HD2  6  
ATOM 8627  H HD3  . LYS A 1 75 ? 13.687  2.600   -0.316  1.00 1.62 ? 75  LYS A HD3  6  
ATOM 8628  H HE2  . LYS A 1 75 ? 13.057  0.925   1.906   1.00 1.04 ? 75  LYS A HE2  6  
ATOM 8629  H HE3  . LYS A 1 75 ? 14.670  0.515   1.328   1.00 1.51 ? 75  LYS A HE3  6  
ATOM 8630  H HZ1  . LYS A 1 75 ? 13.742  3.250   2.025   1.00 1.72 ? 75  LYS A HZ1  6  
ATOM 8631  H HZ2  . LYS A 1 75 ? 15.299  2.831   1.510   1.00 1.94 ? 75  LYS A HZ2  6  
ATOM 8632  H HZ3  . LYS A 1 75 ? 14.719  2.270   2.997   1.00 1.92 ? 75  LYS A HZ3  6  
ATOM 8633  N N    . ASN A 1 76 ? 10.609  2.498   -3.028  1.00 0.48 ? 76  ASN A N    6  
ATOM 8634  C CA   . ASN A 1 76 ? 11.212  2.684   -4.352  1.00 0.59 ? 76  ASN A CA   6  
ATOM 8635  C C    . ASN A 1 76 ? 10.468  3.761   -5.150  1.00 0.69 ? 76  ASN A C    6  
ATOM 8636  O O    . ASN A 1 76 ? 9.807   3.469   -6.151  1.00 1.15 ? 76  ASN A O    6  
ATOM 8637  C CB   . ASN A 1 76 ? 11.223  1.356   -5.124  1.00 0.64 ? 76  ASN A CB   6  
ATOM 8638  C CG   . ASN A 1 76 ? 11.807  1.494   -6.520  1.00 0.85 ? 76  ASN A CG   6  
ATOM 8639  O OD1  . ASN A 1 76 ? 11.181  1.100   -7.505  1.00 0.90 ? 76  ASN A OD1  6  
ATOM 8640  N ND2  . ASN A 1 76 ? 13.009  2.055   -6.615  1.00 1.55 ? 76  ASN A ND2  6  
ATOM 8641  H H    . ASN A 1 76 ? 10.042  1.715   -2.868  1.00 0.45 ? 76  ASN A H    6  
ATOM 8642  H HA   . ASN A 1 76 ? 12.230  3.009   -4.203  1.00 0.73 ? 76  ASN A HA   6  
ATOM 8643  H HB2  . ASN A 1 76 ? 11.817  0.637   -4.579  1.00 0.71 ? 76  ASN A HB2  6  
ATOM 8644  H HB3  . ASN A 1 76 ? 10.212  0.989   -5.210  1.00 0.75 ? 76  ASN A HB3  6  
ATOM 8645  H HD21 . ASN A 1 76 ? 13.452  2.345   -5.790  1.00 1.95 ? 76  ASN A HD21 6  
ATOM 8646  H HD22 . ASN A 1 76 ? 13.398  2.160   -7.506  1.00 1.75 ? 76  ASN A HD22 6  
ATOM 8647  N N    . THR A 1 77 ? 10.569  5.006   -4.687  1.00 0.90 ? 77  THR A N    6  
ATOM 8648  C CA   . THR A 1 77 ? 9.901   6.129   -5.338  1.00 1.07 ? 77  THR A CA   6  
ATOM 8649  C C    . THR A 1 77 ? 10.879  7.276   -5.611  1.00 0.80 ? 77  THR A C    6  
ATOM 8650  O O    . THR A 1 77 ? 11.789  7.528   -4.819  1.00 1.47 ? 77  THR A O    6  
ATOM 8651  C CB   . THR A 1 77 ? 8.737   6.607   -4.466  1.00 2.00 ? 77  THR A CB   6  
ATOM 8652  O OG1  . THR A 1 77 ? 9.186   6.919   -3.156  1.00 2.60 ? 77  THR A OG1  6  
ATOM 8653  C CG2  . THR A 1 77 ? 7.637   5.574   -4.338  1.00 2.53 ? 77  THR A CG2  6  
ATOM 8654  H H    . THR A 1 77 ? 11.090  5.166   -3.873  1.00 1.26 ? 77  THR A H    6  
ATOM 8655  H HA   . THR A 1 77 ? 9.508   5.779   -6.281  1.00 1.56 ? 77  THR A HA   6  
ATOM 8656  H HB   . THR A 1 77 ? 8.310   7.497   -4.904  1.00 2.59 ? 77  THR A HB   6  
ATOM 8657  H HG1  . THR A 1 77 ? 8.457   7.277   -2.643  1.00 2.91 ? 77  THR A HG1  6  
ATOM 8658  H HG21 . THR A 1 77 ? 6.942   5.881   -3.571  1.00 2.58 ? 77  THR A HG21 6  
ATOM 8659  H HG22 . THR A 1 77 ? 8.067   4.619   -4.072  1.00 3.13 ? 77  THR A HG22 6  
ATOM 8660  H HG23 . THR A 1 77 ? 7.116   5.483   -5.279  1.00 2.95 ? 77  THR A HG23 6  
ATOM 8661  N N    . SER A 1 78 ? 10.685  7.961   -6.742  1.00 1.14 ? 78  SER A N    6  
ATOM 8662  C CA   . SER A 1 78 ? 11.554  9.075   -7.128  1.00 1.74 ? 78  SER A CA   6  
ATOM 8663  C C    . SER A 1 78 ? 10.762  10.375  -7.301  1.00 1.42 ? 78  SER A C    6  
ATOM 8664  O O    . SER A 1 78 ? 10.754  11.222  -6.408  1.00 1.44 ? 78  SER A O    6  
ATOM 8665  C CB   . SER A 1 78 ? 12.314  8.735   -8.416  1.00 2.76 ? 78  SER A CB   6  
ATOM 8666  O OG   . SER A 1 78 ? 13.140  9.812   -8.825  1.00 3.36 ? 78  SER A OG   6  
ATOM 8667  H H    . SER A 1 78 ? 9.943   7.705   -7.330  1.00 1.57 ? 78  SER A H    6  
ATOM 8668  H HA   . SER A 1 78 ? 12.271  9.217   -6.333  1.00 2.08 ? 78  SER A HA   6  
ATOM 8669  H HB2  . SER A 1 78 ? 12.937  7.870   -8.244  1.00 3.05 ? 78  SER A HB2  6  
ATOM 8670  H HB3  . SER A 1 78 ? 11.608  8.518   -9.203  1.00 3.31 ? 78  SER A HB3  6  
ATOM 8671  H HG   . SER A 1 78 ? 12.751  10.242  -9.591  1.00 3.89 ? 78  SER A HG   6  
ATOM 8672  N N    . ASP A 1 79 ? 10.111  10.537  -8.456  1.00 1.32 ? 79  ASP A N    6  
ATOM 8673  C CA   . ASP A 1 79 ? 9.332   11.744  -8.738  1.00 1.18 ? 79  ASP A CA   6  
ATOM 8674  C C    . ASP A 1 79 ? 7.857   11.538  -8.400  1.00 0.99 ? 79  ASP A C    6  
ATOM 8675  O O    . ASP A 1 79 ? 7.262   12.332  -7.666  1.00 0.92 ? 79  ASP A O    6  
ATOM 8676  C CB   . ASP A 1 79 ? 9.481   12.142  -10.209 1.00 1.46 ? 79  ASP A CB   6  
ATOM 8677  C CG   . ASP A 1 79 ? 10.897  12.566  -10.553 1.00 1.61 ? 79  ASP A CG   6  
ATOM 8678  O OD1  . ASP A 1 79 ? 11.710  11.688  -10.908 1.00 2.07 ? 79  ASP A OD1  6  
ATOM 8679  O OD2  . ASP A 1 79 ? 11.192  13.777  -10.465 1.00 2.23 ? 79  ASP A OD2  6  
ATOM 8680  H H    . ASP A 1 79 ? 10.163  9.836   -9.138  1.00 1.49 ? 79  ASP A H    6  
ATOM 8681  H HA   . ASP A 1 79 ? 9.720   12.540  -8.119  1.00 1.15 ? 79  ASP A HA   6  
ATOM 8682  H HB2  . ASP A 1 79 ? 9.217   11.300  -10.831 1.00 2.06 ? 79  ASP A HB2  6  
ATOM 8683  H HB3  . ASP A 1 79 ? 8.816   12.965  -10.422 1.00 1.75 ? 79  ASP A HB3  6  
ATOM 8684  N N    . PHE A 1 80 ? 7.275   10.465  -8.933  1.00 0.97 ? 80  PHE A N    6  
ATOM 8685  C CA   . PHE A 1 80 ? 5.873   10.147  -8.683  1.00 0.85 ? 80  PHE A CA   6  
ATOM 8686  C C    . PHE A 1 80 ? 5.728   8.758   -8.079  1.00 0.82 ? 80  PHE A C    6  
ATOM 8687  O O    . PHE A 1 80 ? 6.697   7.998   -8.009  1.00 0.92 ? 80  PHE A O    6  
ATOM 8688  C CB   . PHE A 1 80 ? 5.058   10.252  -9.973  1.00 0.92 ? 80  PHE A CB   6  
ATOM 8689  C CG   . PHE A 1 80 ? 3.953   11.258  -9.874  1.00 0.94 ? 80  PHE A CG   6  
ATOM 8690  C CD1  . PHE A 1 80 ? 2.717   10.892  -9.372  1.00 1.39 ? 80  PHE A CD1  6  
ATOM 8691  C CD2  . PHE A 1 80 ? 4.157   12.571  -10.263 1.00 1.68 ? 80  PHE A CD2  6  
ATOM 8692  C CE1  . PHE A 1 80 ? 1.701   11.817  -9.260  1.00 1.43 ? 80  PHE A CE1  6  
ATOM 8693  C CE2  . PHE A 1 80 ? 3.145   13.502  -10.150 1.00 1.77 ? 80  PHE A CE2  6  
ATOM 8694  C CZ   . PHE A 1 80 ? 1.915   13.122  -9.648  1.00 1.14 ? 80  PHE A CZ   6  
ATOM 8695  H H    . PHE A 1 80 ? 7.804   9.870   -9.504  1.00 1.09 ? 80  PHE A H    6  
ATOM 8696  H HA   . PHE A 1 80 ? 5.495   10.869  -7.974  1.00 0.81 ? 80  PHE A HA   6  
ATOM 8697  H HB2  . PHE A 1 80 ? 5.709   10.546  -10.784 1.00 1.04 ? 80  PHE A HB2  6  
ATOM 8698  H HB3  . PHE A 1 80 ? 4.619   9.291   -10.197 1.00 0.93 ? 80  PHE A HB3  6  
ATOM 8699  H HD1  . PHE A 1 80 ? 2.548   9.869   -9.068  1.00 2.16 ? 80  PHE A HD1  6  
ATOM 8700  H HD2  . PHE A 1 80 ? 5.118   12.865  -10.657 1.00 2.48 ? 80  PHE A HD2  6  
ATOM 8701  H HE1  . PHE A 1 80 ? 0.739   11.520  -8.868  1.00 2.19 ? 80  PHE A HE1  6  
ATOM 8702  H HE2  . PHE A 1 80 ? 3.313   14.523  -10.454 1.00 2.61 ? 80  PHE A HE2  6  
ATOM 8703  H HZ   . PHE A 1 80 ? 1.127   13.848  -9.551  1.00 1.26 ? 80  PHE A HZ   6  
ATOM 8704  N N    . VAL A 1 81 ? 4.514   8.426   -7.641  1.00 0.75 ? 81  VAL A N    6  
ATOM 8705  C CA   . VAL A 1 81 ? 4.233   7.130   -7.042  1.00 0.77 ? 81  VAL A CA   6  
ATOM 8706  C C    . VAL A 1 81 ? 2.862   6.639   -7.502  1.00 0.65 ? 81  VAL A C    6  
ATOM 8707  O O    . VAL A 1 81 ? 1.851   7.299   -7.248  1.00 0.59 ? 81  VAL A O    6  
ATOM 8708  C CB   . VAL A 1 81 ? 4.242   7.228   -5.500  1.00 0.88 ? 81  VAL A CB   6  
ATOM 8709  C CG1  . VAL A 1 81 ? 3.877   5.895   -4.864  1.00 1.19 ? 81  VAL A CG1  6  
ATOM 8710  C CG2  . VAL A 1 81 ? 5.592   7.722   -5.000  1.00 1.58 ? 81  VAL A CG2  6  
ATOM 8711  H H    . VAL A 1 81 ? 3.764   9.052   -7.715  1.00 0.74 ? 81  VAL A H    6  
ATOM 8712  H HA   . VAL A 1 81 ? 4.993   6.429   -7.355  1.00 0.89 ? 81  VAL A HA   6  
ATOM 8713  H HB   . VAL A 1 81 ? 3.493   7.951   -5.207  1.00 1.14 ? 81  VAL A HB   6  
ATOM 8714  H HG11 . VAL A 1 81 ? 2.804   5.773   -4.879  1.00 1.78 ? 81  VAL A HG11 6  
ATOM 8715  H HG12 . VAL A 1 81 ? 4.227   5.876   -3.842  1.00 1.62 ? 81  VAL A HG12 6  
ATOM 8716  H HG13 . VAL A 1 81 ? 4.339   5.092   -5.418  1.00 1.67 ? 81  VAL A HG13 6  
ATOM 8717  H HG21 . VAL A 1 81 ? 6.376   7.318   -5.624  1.00 1.98 ? 81  VAL A HG21 6  
ATOM 8718  H HG22 . VAL A 1 81 ? 5.740   7.399   -3.981  1.00 2.06 ? 81  VAL A HG22 6  
ATOM 8719  H HG23 . VAL A 1 81 ? 5.619   8.801   -5.043  1.00 2.07 ? 81  VAL A HG23 6  
ATOM 8720  N N    . TYR A 1 82 ? 2.821   5.490   -8.174  1.00 0.72 ? 82  TYR A N    6  
ATOM 8721  C CA   . TYR A 1 82 ? 1.552   4.950   -8.651  1.00 0.69 ? 82  TYR A CA   6  
ATOM 8722  C C    . TYR A 1 82 ? 1.076   3.814   -7.755  1.00 0.67 ? 82  TYR A C    6  
ATOM 8723  O O    . TYR A 1 82 ? 1.533   2.674   -7.868  1.00 0.77 ? 82  TYR A O    6  
ATOM 8724  C CB   . TYR A 1 82 ? 1.679   4.467   -10.096 1.00 0.85 ? 82  TYR A CB   6  
ATOM 8725  C CG   . TYR A 1 82 ? 0.359   4.384   -10.822 1.00 0.93 ? 82  TYR A CG   6  
ATOM 8726  C CD1  . TYR A 1 82 ? -0.425  3.245   -10.734 1.00 1.57 ? 82  TYR A CD1  6  
ATOM 8727  C CD2  . TYR A 1 82 ? -0.103  5.443   -11.593 1.00 1.41 ? 82  TYR A CD2  6  
ATOM 8728  C CE1  . TYR A 1 82 ? -1.632  3.158   -11.394 1.00 1.72 ? 82  TYR A CE1  6  
ATOM 8729  C CE2  . TYR A 1 82 ? -1.311  5.366   -12.257 1.00 1.55 ? 82  TYR A CE2  6  
ATOM 8730  C CZ   . TYR A 1 82 ? -2.072  4.220   -12.154 1.00 1.33 ? 82  TYR A CZ   6  
ATOM 8731  O OH   . TYR A 1 82 ? -3.279  4.139   -12.813 1.00 1.58 ? 82  TYR A OH   6  
ATOM 8732  H H    . TYR A 1 82 ? 3.651   5.000   -8.354  1.00 0.85 ? 82  TYR A H    6  
ATOM 8733  H HA   . TYR A 1 82 ? 0.823   5.745   -8.613  1.00 0.64 ? 82  TYR A HA   6  
ATOM 8734  H HB2  . TYR A 1 82 ? 2.315   5.146   -10.638 1.00 0.88 ? 82  TYR A HB2  6  
ATOM 8735  H HB3  . TYR A 1 82 ? 2.119   3.482   -10.103 1.00 0.99 ? 82  TYR A HB3  6  
ATOM 8736  H HD1  . TYR A 1 82 ? -0.078  2.414   -10.138 1.00 2.27 ? 82  TYR A HD1  6  
ATOM 8737  H HD2  . TYR A 1 82 ? 0.498   6.338   -11.673 1.00 2.08 ? 82  TYR A HD2  6  
ATOM 8738  H HE1  . TYR A 1 82 ? -2.223  2.262   -11.312 1.00 2.47 ? 82  TYR A HE1  6  
ATOM 8739  H HE2  . TYR A 1 82 ? -1.653  6.198   -12.852 1.00 2.24 ? 82  TYR A HE2  6  
ATOM 8740  H HH   . TYR A 1 82 ? -3.143  3.761   -13.685 1.00 1.97 ? 82  TYR A HH   6  
ATOM 8741  N N    . LEU A 1 83 ? 0.165   4.153   -6.850  1.00 0.62 ? 83  LEU A N    6  
ATOM 8742  C CA   . LEU A 1 83 ? -0.378  3.188   -5.903  1.00 0.65 ? 83  LEU A CA   6  
ATOM 8743  C C    . LEU A 1 83 ? -1.545  2.408   -6.503  1.00 0.66 ? 83  LEU A C    6  
ATOM 8744  O O    . LEU A 1 83 ? -2.540  2.991   -6.936  1.00 0.71 ? 83  LEU A O    6  
ATOM 8745  C CB   . LEU A 1 83 ? -0.828  3.908   -4.628  1.00 0.74 ? 83  LEU A CB   6  
ATOM 8746  C CG   . LEU A 1 83 ? -1.200  2.994   -3.458  1.00 0.74 ? 83  LEU A CG   6  
ATOM 8747  C CD1  . LEU A 1 83 ? -0.077  2.951   -2.431  1.00 1.34 ? 83  LEU A CD1  6  
ATOM 8748  C CD2  . LEU A 1 83 ? -2.497  3.462   -2.816  1.00 1.38 ? 83  LEU A CD2  6  
ATOM 8749  H H    . LEU A 1 83 ? -0.124  5.089   -6.801  1.00 0.62 ? 83  LEU A H    6  
ATOM 8750  H HA   . LEU A 1 83 ? 0.410   2.495   -5.651  1.00 0.69 ? 83  LEU A HA   6  
ATOM 8751  H HB2  . LEU A 1 83 ? -0.026  4.558   -4.307  1.00 0.88 ? 83  LEU A HB2  6  
ATOM 8752  H HB3  . LEU A 1 83 ? -1.686  4.516   -4.867  1.00 0.80 ? 83  LEU A HB3  6  
ATOM 8753  H HG   . LEU A 1 83 ? -1.352  1.989   -3.827  1.00 1.48 ? 83  LEU A HG   6  
ATOM 8754  H HD11 . LEU A 1 83 ? 0.062   3.936   -2.009  1.00 1.81 ? 83  LEU A HD11 6  
ATOM 8755  H HD12 . LEU A 1 83 ? 0.836   2.632   -2.910  1.00 1.91 ? 83  LEU A HD12 6  
ATOM 8756  H HD13 . LEU A 1 83 ? -0.334  2.255   -1.645  1.00 1.85 ? 83  LEU A HD13 6  
ATOM 8757  H HD21 . LEU A 1 83 ? -2.720  2.841   -1.960  1.00 1.83 ? 83  LEU A HD21 6  
ATOM 8758  H HD22 . LEU A 1 83 ? -3.300  3.389   -3.534  1.00 2.00 ? 83  LEU A HD22 6  
ATOM 8759  H HD23 . LEU A 1 83 ? -2.391  4.488   -2.498  1.00 1.85 ? 83  LEU A HD23 6  
ATOM 8760  N N    . LYS A 1 84 ? -1.421  1.079   -6.496  1.00 0.66 ? 84  LYS A N    6  
ATOM 8761  C CA   . LYS A 1 84 ? -2.468  0.199   -7.006  1.00 0.68 ? 84  LYS A CA   6  
ATOM 8762  C C    . LYS A 1 84 ? -3.057  -0.601  -5.856  1.00 0.65 ? 84  LYS A C    6  
ATOM 8763  O O    . LYS A 1 84 ? -2.387  -1.458  -5.286  1.00 0.68 ? 84  LYS A O    6  
ATOM 8764  C CB   . LYS A 1 84 ? -1.928  -0.736  -8.094  1.00 0.69 ? 84  LYS A CB   6  
ATOM 8765  C CG   . LYS A 1 84 ? -1.488  -0.014  -9.358  1.00 0.76 ? 84  LYS A CG   6  
ATOM 8766  C CD   . LYS A 1 84 ? -2.390  -0.349  -10.537 1.00 0.99 ? 84  LYS A CD   6  
ATOM 8767  C CE   . LYS A 1 84 ? -3.813  0.138   -10.309 1.00 1.18 ? 84  LYS A CE   6  
ATOM 8768  N NZ   . LYS A 1 84 ? -4.479  0.533   -11.582 1.00 1.56 ? 84  LYS A NZ   6  
ATOM 8769  H H    . LYS A 1 84 ? -0.614  0.677   -6.113  1.00 0.68 ? 84  LYS A H    6  
ATOM 8770  H HA   . LYS A 1 84 ? -3.242  0.811   -7.426  1.00 0.72 ? 84  LYS A HA   6  
ATOM 8771  H HB2  . LYS A 1 84 ? -1.083  -1.277  -7.702  1.00 0.66 ? 84  LYS A HB2  6  
ATOM 8772  H HB3  . LYS A 1 84 ? -2.700  -1.442  -8.359  1.00 0.73 ? 84  LYS A HB3  6  
ATOM 8773  H HG2  . LYS A 1 84 ? -1.522  1.051   -9.185  1.00 0.93 ? 84  LYS A HG2  6  
ATOM 8774  H HG3  . LYS A 1 84 ? -0.476  -0.309  -9.596  1.00 0.86 ? 84  LYS A HG3  6  
ATOM 8775  H HD2  . LYS A 1 84 ? -1.996  0.123   -11.424 1.00 1.65 ? 84  LYS A HD2  6  
ATOM 8776  H HD3  . LYS A 1 84 ? -2.403  -1.421  -10.674 1.00 1.42 ? 84  LYS A HD3  6  
ATOM 8777  H HE2  . LYS A 1 84 ? -4.382  -0.657  -9.849  1.00 1.51 ? 84  LYS A HE2  6  
ATOM 8778  H HE3  . LYS A 1 84 ? -3.787  0.989   -9.646  1.00 1.85 ? 84  LYS A HE3  6  
ATOM 8779  H HZ1  . LYS A 1 84 ? -4.379  -0.222  -12.290 1.00 2.19 ? 84  LYS A HZ1  6  
ATOM 8780  H HZ2  . LYS A 1 84 ? -4.048  1.404   -11.955 1.00 1.68 ? 84  LYS A HZ2  6  
ATOM 8781  H HZ3  . LYS A 1 84 ? -5.491  0.705   -11.417 1.00 2.00 ? 84  LYS A HZ3  6  
ATOM 8782  N N    . VAL A 1 85 ? -4.300  -0.289  -5.497  1.00 0.76 ? 85  VAL A N    6  
ATOM 8783  C CA   . VAL A 1 85 ? -4.970  -0.961  -4.389  1.00 0.74 ? 85  VAL A CA   6  
ATOM 8784  C C    . VAL A 1 85 ? -6.051  -1.920  -4.888  1.00 0.91 ? 85  VAL A C    6  
ATOM 8785  O O    . VAL A 1 85 ? -6.840  -1.579  -5.770  1.00 1.17 ? 85  VAL A O    6  
ATOM 8786  C CB   . VAL A 1 85 ? -5.602  0.071   -3.419  1.00 0.99 ? 85  VAL A CB   6  
ATOM 8787  C CG1  . VAL A 1 85 ? -6.345  -0.612  -2.278  1.00 1.92 ? 85  VAL A CG1  6  
ATOM 8788  C CG2  . VAL A 1 85 ? -4.537  1.010   -2.870  1.00 0.65 ? 85  VAL A CG2  6  
ATOM 8789  H H    . VAL A 1 85 ? -4.772  0.425   -5.974  1.00 0.92 ? 85  VAL A H    6  
ATOM 8790  H HA   . VAL A 1 85 ? -4.224  -1.525  -3.847  1.00 0.62 ? 85  VAL A HA   6  
ATOM 8791  H HB   . VAL A 1 85 ? -6.314  0.662   -3.974  1.00 1.45 ? 85  VAL A HB   6  
ATOM 8792  H HG11 . VAL A 1 85 ? -6.680  -1.588  -2.596  1.00 2.23 ? 85  VAL A HG11 6  
ATOM 8793  H HG12 . VAL A 1 85 ? -7.196  -0.013  -1.993  1.00 2.51 ? 85  VAL A HG12 6  
ATOM 8794  H HG13 . VAL A 1 85 ? -5.681  -0.719  -1.430  1.00 2.42 ? 85  VAL A HG13 6  
ATOM 8795  H HG21 . VAL A 1 85 ? -4.136  0.602   -1.953  1.00 1.26 ? 85  VAL A HG21 6  
ATOM 8796  H HG22 . VAL A 1 85 ? -4.977  1.976   -2.671  1.00 1.21 ? 85  VAL A HG22 6  
ATOM 8797  H HG23 . VAL A 1 85 ? -3.742  1.119   -3.594  1.00 1.21 ? 85  VAL A HG23 6  
ATOM 8798  N N    . ALA A 1 86 ? -6.078  -3.121  -4.308  1.00 0.91 ? 86  ALA A N    6  
ATOM 8799  C CA   . ALA A 1 86 ? -7.060  -4.137  -4.681  1.00 1.24 ? 86  ALA A CA   6  
ATOM 8800  C C    . ALA A 1 86 ? -8.369  -3.929  -3.921  1.00 1.27 ? 86  ALA A C    6  
ATOM 8801  O O    . ALA A 1 86 ? -8.363  -3.528  -2.756  1.00 1.09 ? 86  ALA A O    6  
ATOM 8802  C CB   . ALA A 1 86 ? -6.506  -5.532  -4.420  1.00 1.46 ? 86  ALA A CB   6  
ATOM 8803  H H    . ALA A 1 86 ? -5.419  -3.326  -3.612  1.00 0.76 ? 86  ALA A H    6  
ATOM 8804  H HA   . ALA A 1 86 ? -7.252  -4.043  -5.741  1.00 1.52 ? 86  ALA A HA   6  
ATOM 8805  H HB1  . ALA A 1 86 ? -6.327  -6.030  -5.361  1.00 1.81 ? 86  ALA A HB1  6  
ATOM 8806  H HB2  . ALA A 1 86 ? -7.220  -6.101  -3.842  1.00 2.07 ? 86  ALA A HB2  6  
ATOM 8807  H HB3  . ALA A 1 86 ? -5.579  -5.456  -3.872  1.00 1.62 ? 86  ALA A HB3  6  
ATOM 8808  N N    . LYS A 1 87 ? -9.491  -4.198  -4.592  1.00 1.68 ? 87  LYS A N    6  
ATOM 8809  C CA   . LYS A 1 87 ? -10.808 -4.031  -3.982  1.00 1.86 ? 87  LYS A CA   6  
ATOM 8810  C C    . LYS A 1 87 ? -11.433 -5.384  -3.635  1.00 1.91 ? 87  LYS A C    6  
ATOM 8811  O O    . LYS A 1 87 ? -11.816 -6.148  -4.524  1.00 2.04 ? 87  LYS A O    6  
ATOM 8812  C CB   . LYS A 1 87 ? -11.731 -3.249  -4.921  1.00 2.22 ? 87  LYS A CB   6  
ATOM 8813  C CG   . LYS A 1 87 ? -12.564 -2.192  -4.214  1.00 2.53 ? 87  LYS A CG   6  
ATOM 8814  C CD   . LYS A 1 87 ? -14.023 -2.607  -4.111  1.00 2.89 ? 87  LYS A CD   6  
ATOM 8815  C CE   . LYS A 1 87 ? -14.779 -1.748  -3.110  1.00 3.28 ? 87  LYS A CE   6  
ATOM 8816  N NZ   . LYS A 1 87 ? -16.250 -1.791  -3.336  1.00 4.20 ? 87  LYS A NZ   6  
ATOM 8817  H H    . LYS A 1 87 ? -9.431  -4.511  -5.519  1.00 1.92 ? 87  LYS A H    6  
ATOM 8818  H HA   . LYS A 1 87 ? -10.679 -3.466  -3.072  1.00 1.79 ? 87  LYS A HA   6  
ATOM 8819  H HB2  . LYS A 1 87 ? -11.130 -2.758  -5.673  1.00 2.44 ? 87  LYS A HB2  6  
ATOM 8820  H HB3  . LYS A 1 87 ? -12.404 -3.941  -5.408  1.00 2.56 ? 87  LYS A HB3  6  
ATOM 8821  H HG2  . LYS A 1 87 ? -12.172 -2.044  -3.219  1.00 2.95 ? 87  LYS A HG2  6  
ATOM 8822  H HG3  . LYS A 1 87 ? -12.500 -1.267  -4.769  1.00 2.69 ? 87  LYS A HG3  6  
ATOM 8823  H HD2  . LYS A 1 87 ? -14.486 -2.501  -5.082  1.00 3.05 ? 87  LYS A HD2  6  
ATOM 8824  H HD3  . LYS A 1 87 ? -14.073 -3.639  -3.797  1.00 3.28 ? 87  LYS A HD3  6  
ATOM 8825  H HE2  . LYS A 1 87 ? -14.566 -2.107  -2.114  1.00 3.46 ? 87  LYS A HE2  6  
ATOM 8826  H HE3  . LYS A 1 87 ? -14.438 -0.726  -3.203  1.00 3.29 ? 87  LYS A HE3  6  
ATOM 8827  H HZ1  . LYS A 1 87 ? -16.740 -1.239  -2.605  1.00 4.41 ? 87  LYS A HZ1  6  
ATOM 8828  H HZ2  . LYS A 1 87 ? -16.590 -2.774  -3.300  1.00 4.48 ? 87  LYS A HZ2  6  
ATOM 8829  H HZ3  . LYS A 1 87 ? -16.481 -1.392  -4.268  1.00 4.70 ? 87  LYS A HZ3  6  
ATOM 8830  N N    . PRO A 1 88 ? -11.548 -5.697  -2.327  1.00 1.88 ? 88  PRO A N    6  
ATOM 8831  C CA   . PRO A 1 88 ? -12.133 -6.961  -1.858  1.00 2.01 ? 88  PRO A CA   6  
ATOM 8832  C C    . PRO A 1 88 ? -13.645 -7.018  -2.071  1.00 2.20 ? 88  PRO A C    6  
ATOM 8833  O O    . PRO A 1 88 ? -14.325 -5.989  -2.044  1.00 2.28 ? 88  PRO A O    6  
ATOM 8834  C CB   . PRO A 1 88 ? -11.796 -6.975  -0.366  1.00 1.98 ? 88  PRO A CB   6  
ATOM 8835  C CG   . PRO A 1 88 ? -11.676 -5.538  0.007   1.00 1.91 ? 88  PRO A CG   6  
ATOM 8836  C CD   . PRO A 1 88 ? -11.121 -4.839  -1.204  1.00 1.79 ? 88  PRO A CD   6  
ATOM 8837  H HA   . PRO A 1 88 ? -11.672 -7.809  -2.342  1.00 2.04 ? 88  PRO A HA   6  
ATOM 8838  H HB2  . PRO A 1 88 ? -12.589 -7.462  0.181   1.00 2.18 ? 88  PRO A HB2  6  
ATOM 8839  H HB3  . PRO A 1 88 ? -10.867 -7.501  -0.210  1.00 1.96 ? 88  PRO A HB3  6  
ATOM 8840  H HG2  . PRO A 1 88 ? -12.649 -5.141  0.255   1.00 2.24 ? 88  PRO A HG2  6  
ATOM 8841  H HG3  . PRO A 1 88 ? -11.001 -5.431  0.843   1.00 1.85 ? 88  PRO A HG3  6  
ATOM 8842  H HD2  . PRO A 1 88 ? -11.544 -3.849  -1.293  1.00 1.89 ? 88  PRO A HD2  6  
ATOM 8843  H HD3  . PRO A 1 88 ? -10.044 -4.785  -1.149  1.00 1.68 ? 88  PRO A HD3  6  
ATOM 8844  N N    . THR A 1 89 ? -14.165 -8.228  -2.282  1.00 2.38 ? 89  THR A N    6  
ATOM 8845  C CA   . THR A 1 89 ? -15.597 -8.425  -2.504  1.00 2.59 ? 89  THR A CA   6  
ATOM 8846  C C    . THR A 1 89 ? -16.146 -9.528  -1.597  1.00 2.77 ? 89  THR A C    6  
ATOM 8847  O O    . THR A 1 89 ? -17.007 -9.271  -0.751  1.00 3.51 ? 89  THR A O    6  
ATOM 8848  C CB   . THR A 1 89 ? -15.864 -8.761  -3.976  1.00 3.08 ? 89  THR A CB   6  
ATOM 8849  O OG1  . THR A 1 89 ? -15.211 -7.837  -4.832  1.00 3.51 ? 89  THR A OG1  6  
ATOM 8850  C CG2  . THR A 1 89 ? -17.335 -8.758  -4.339  1.00 3.88 ? 89  THR A CG2  6  
ATOM 8851  H H    . THR A 1 89 ? -13.571 -9.007  -2.294  1.00 2.41 ? 89  THR A H    6  
ATOM 8852  H HA   . THR A 1 89 ? -16.098 -7.498  -2.261  1.00 2.82 ? 89  THR A HA   6  
ATOM 8853  H HB   . THR A 1 89 ? -15.475 -9.747  -4.184  1.00 3.20 ? 89  THR A HB   6  
ATOM 8854  H HG1  . THR A 1 89 ? -15.485 -6.942  -4.610  1.00 3.87 ? 89  THR A HG1  6  
ATOM 8855  H HG21 . THR A 1 89 ? -17.442 -8.663  -5.410  1.00 4.03 ? 89  THR A HG21 6  
ATOM 8856  H HG22 . THR A 1 89 ? -17.825 -7.928  -3.853  1.00 4.36 ? 89  THR A HG22 6  
ATOM 8857  H HG23 . THR A 1 89 ? -17.788 -9.684  -4.014  1.00 4.30 ? 89  THR A HG23 6  
ATOM 8858  N N    . GLY A 1 90 ? -15.645 -10.752 -1.777  1.00 2.75 ? 90  GLY A N    6  
ATOM 8859  C CA   . GLY A 1 90 ? -16.100 -11.870 -0.967  1.00 3.54 ? 90  GLY A CA   6  
ATOM 8860  C C    . GLY A 1 90 ? -15.655 -13.212 -1.521  1.00 4.20 ? 90  GLY A C    6  
ATOM 8861  O O    . GLY A 1 90 ? -16.253 -13.725 -2.469  1.00 4.69 ? 90  GLY A O    6  
ATOM 8862  H H    . GLY A 1 90 ? -14.963 -10.896 -2.465  1.00 2.65 ? 90  GLY A H    6  
ATOM 8863  H HA2  . GLY A 1 90 ? -15.708 -11.759 0.033   1.00 3.91 ? 90  GLY A HA2  6  
ATOM 8864  H HA3  . GLY A 1 90 ? -17.179 -11.853 -0.922  1.00 3.79 ? 90  GLY A HA3  6  
ATOM 8865  N N    . SER A 1 91 ? -14.605 -13.780 -0.927  1.00 4.69 ? 91  SER A N    6  
ATOM 8866  C CA   . SER A 1 91 ? -14.076 -15.074 -1.363  1.00 5.64 ? 91  SER A CA   6  
ATOM 8867  C C    . SER A 1 91 ? -14.959 -16.225 -0.877  1.00 5.73 ? 91  SER A C    6  
ATOM 8868  O O    . SER A 1 91 ? -15.189 -17.189 -1.609  1.00 6.47 ? 91  SER A O    6  
ATOM 8869  C CB   . SER A 1 91 ? -12.645 -15.264 -0.856  1.00 6.57 ? 91  SER A CB   6  
ATOM 8870  O OG   . SER A 1 91 ? -11.883 -16.048 -1.758  1.00 7.06 ? 91  SER A OG   6  
ATOM 8871  H H    . SER A 1 91 ? -14.175 -13.320 -0.175  1.00 4.66 ? 91  SER A H    6  
ATOM 8872  H HA   . SER A 1 91 ? -14.067 -15.078 -2.443  1.00 5.94 ? 91  SER A HA   6  
ATOM 8873  H HB2  . SER A 1 91 ? -12.171 -14.300 -0.748  1.00 6.78 ? 91  SER A HB2  6  
ATOM 8874  H HB3  . SER A 1 91 ? -12.668 -15.763 0.103   1.00 6.97 ? 91  SER A HB3  6  
ATOM 8875  H HG   . SER A 1 91 ? -11.432 -15.473 -2.381  1.00 7.36 ? 91  SER A HG   6  
ATOM 8876  N N    . HIS A 1 92 ? -15.451 -16.116 0.360   1.00 5.26 ? 92  HIS A N    6  
ATOM 8877  C CA   . HIS A 1 92 ? -16.308 -17.148 0.942   1.00 5.60 ? 92  HIS A CA   6  
ATOM 8878  C C    . HIS A 1 92 ? -17.703 -17.112 0.325   1.00 5.37 ? 92  HIS A C    6  
ATOM 8879  O O    . HIS A 1 92 ? -18.013 -17.887 -0.580  1.00 5.46 ? 92  HIS A O    6  
ATOM 8880  C CB   . HIS A 1 92 ? -16.409 -16.967 2.460   1.00 5.86 ? 92  HIS A CB   6  
ATOM 8881  C CG   . HIS A 1 92 ? -15.113 -17.187 3.180   1.00 6.59 ? 92  HIS A CG   6  
ATOM 8882  N ND1  . HIS A 1 92 ? -14.783 -18.376 3.795   1.00 7.09 ? 92  HIS A ND1  6  
ATOM 8883  C CD2  . HIS A 1 92 ? -14.061 -16.358 3.384   1.00 7.14 ? 92  HIS A CD2  6  
ATOM 8884  C CE1  . HIS A 1 92 ? -13.587 -18.269 4.345   1.00 7.83 ? 92  HIS A CE1  6  
ATOM 8885  N NE2  . HIS A 1 92 ? -13.127 -17.055 4.110   1.00 7.84 ? 92  HIS A NE2  6  
ATOM 8886  H H    . HIS A 1 92 ? -15.232 -15.324 0.894   1.00 4.89 ? 92  HIS A H    6  
ATOM 8887  H HA   . HIS A 1 92 ? -15.859 -18.108 0.733   1.00 6.24 ? 92  HIS A HA   6  
ATOM 8888  H HB2  . HIS A 1 92 ? -16.740 -15.962 2.674   1.00 5.88 ? 92  HIS A HB2  6  
ATOM 8889  H HB3  . HIS A 1 92 ? -17.130 -17.670 2.852   1.00 5.88 ? 92  HIS A HB3  6  
ATOM 8890  H HD1  . HIS A 1 92 ? -15.344 -19.180 3.825   1.00 7.08 ? 92  HIS A HD1  6  
ATOM 8891  H HD2  . HIS A 1 92 ? -13.974 -15.337 3.039   1.00 7.21 ? 92  HIS A HD2  6  
ATOM 8892  H HE1  . HIS A 1 92 ? -13.073 -19.044 4.895   1.00 8.46 ? 92  HIS A HE1  6  
ATOM 8893  H HE2  . HIS A 1 92 ? -12.301 -16.683 4.481   1.00 8.38 ? 92  HIS A HE2  6  
ATOM 8894  N N    . ARG B 2 1  ? 2.527   -12.549 11.187  1.00 1.88 ? 301 ARG B N    6  
ATOM 8895  C CA   . ARG B 2 1  ? 2.110   -11.129 11.016  1.00 1.27 ? 301 ARG B CA   6  
ATOM 8896  C C    . ARG B 2 1  ? 3.226   -10.166 11.422  1.00 1.29 ? 301 ARG B C    6  
ATOM 8897  O O    . ARG B 2 1  ? 3.845   -10.326 12.475  1.00 2.06 ? 301 ARG B O    6  
ATOM 8898  C CB   . ARG B 2 1  ? 0.851   -10.869 11.855  1.00 1.61 ? 301 ARG B CB   6  
ATOM 8899  C CG   . ARG B 2 1  ? 0.949   -11.348 13.298  1.00 2.13 ? 301 ARG B CG   6  
ATOM 8900  C CD   . ARG B 2 1  ? 0.306   -12.716 13.480  1.00 2.72 ? 301 ARG B CD   6  
ATOM 8901  N NE   . ARG B 2 1  ? -0.745  -12.699 14.499  1.00 3.09 ? 301 ARG B NE   6  
ATOM 8902  C CZ   . ARG B 2 1  ? -2.020  -12.373 14.260  1.00 3.70 ? 301 ARG B CZ   6  
ATOM 8903  N NH1  . ARG B 2 1  ? -2.414  -12.028 13.037  1.00 4.18 ? 301 ARG B NH1  6  
ATOM 8904  N NH2  . ARG B 2 1  ? -2.904  -12.392 15.253  1.00 4.22 ? 301 ARG B NH2  6  
ATOM 8905  H H1   . ARG B 2 1  ? 1.688   -13.147 11.042  1.00 2.43 ? 301 ARG B H1   6  
ATOM 8906  H H2   . ARG B 2 1  ? 2.904   -12.658 12.150  1.00 1.96 ? 301 ARG B H2   6  
ATOM 8907  H H3   . ARG B 2 1  ? 3.256   -12.753 10.474  1.00 2.41 ? 301 ARG B H3   6  
ATOM 8908  H HA   . ARG B 2 1  ? 1.877   -10.969 9.974   1.00 1.25 ? 301 ARG B HA   6  
ATOM 8909  H HB2  . ARG B 2 1  ? 0.656   -9.806  11.867  1.00 1.79 ? 301 ARG B HB2  6  
ATOM 8910  H HB3  . ARG B 2 1  ? 0.015   -11.370 11.388  1.00 2.19 ? 301 ARG B HB3  6  
ATOM 8911  H HG2  . ARG B 2 1  ? 1.990   -11.412 13.576  1.00 2.63 ? 301 ARG B HG2  6  
ATOM 8912  H HG3  . ARG B 2 1  ? 0.447   -10.636 13.937  1.00 2.48 ? 301 ARG B HG3  6  
ATOM 8913  H HD2  . ARG B 2 1  ? -0.123  -13.028 12.540  1.00 3.13 ? 301 ARG B HD2  6  
ATOM 8914  H HD3  . ARG B 2 1  ? 1.070   -13.419 13.777  1.00 3.11 ? 301 ARG B HD3  6  
ATOM 8915  H HE   . ARG B 2 1  ? -0.488  -12.947 15.412  1.00 3.22 ? 301 ARG B HE   6  
ATOM 8916  H HH11 . ARG B 2 1  ? -1.759  -12.010 12.283  1.00 4.11 ? 301 ARG B HH11 6  
ATOM 8917  H HH12 . ARG B 2 1  ? -3.372  -11.787 12.871  1.00 4.83 ? 301 ARG B HH12 6  
ATOM 8918  H HH21 . ARG B 2 1  ? -2.615  -12.649 16.175  1.00 4.29 ? 301 ARG B HH21 6  
ATOM 8919  H HH22 . ARG B 2 1  ? -3.858  -12.149 15.078  1.00 4.75 ? 301 ARG B HH22 6  
ATOM 8920  N N    . ARG B 2 2  ? 3.474   -9.166  10.575  1.00 1.12 ? 302 ARG B N    6  
ATOM 8921  C CA   . ARG B 2 2  ? 4.513   -8.171  10.834  1.00 1.03 ? 302 ARG B CA   6  
ATOM 8922  C C    . ARG B 2 2  ? 4.204   -6.860  10.114  1.00 1.02 ? 302 ARG B C    6  
ATOM 8923  O O    . ARG B 2 2  ? 3.789   -6.860  8.953   1.00 1.45 ? 302 ARG B O    6  
ATOM 8924  C CB   . ARG B 2 2  ? 5.880   -8.699  10.393  1.00 1.13 ? 302 ARG B CB   6  
ATOM 8925  C CG   . ARG B 2 2  ? 7.024   -7.727  10.645  1.00 1.12 ? 302 ARG B CG   6  
ATOM 8926  C CD   . ARG B 2 2  ? 8.377   -8.414  10.530  1.00 1.50 ? 302 ARG B CD   6  
ATOM 8927  N NE   . ARG B 2 2  ? 8.594   -9.385  11.603  1.00 2.09 ? 302 ARG B NE   6  
ATOM 8928  C CZ   . ARG B 2 2  ? 8.965   -9.061  12.845  1.00 2.72 ? 302 ARG B CZ   6  
ATOM 8929  N NH1  . ARG B 2 2  ? 9.159   -7.789  13.185  1.00 2.99 ? 302 ARG B NH1  6  
ATOM 8930  N NH2  . ARG B 2 2  ? 9.140   -10.016 13.754  1.00 3.57 ? 302 ARG B NH2  6  
ATOM 8931  H H    . ARG B 2 2  ? 2.944   -9.096  9.753   1.00 1.61 ? 302 ARG B H    6  
ATOM 8932  H HA   . ARG B 2 2  ? 4.535   -7.986  11.898  1.00 1.03 ? 302 ARG B HA   6  
ATOM 8933  H HB2  . ARG B 2 2  ? 6.089   -9.613  10.927  1.00 1.20 ? 302 ARG B HB2  6  
ATOM 8934  H HB3  . ARG B 2 2  ? 5.845   -8.911  9.336   1.00 1.34 ? 302 ARG B HB3  6  
ATOM 8935  H HG2  . ARG B 2 2  ? 6.973   -6.932  9.916   1.00 1.33 ? 302 ARG B HG2  6  
ATOM 8936  H HG3  . ARG B 2 2  ? 6.921   -7.315  11.638  1.00 1.30 ? 302 ARG B HG3  6  
ATOM 8937  H HD2  . ARG B 2 2  ? 8.427   -8.925  9.580   1.00 1.82 ? 302 ARG B HD2  6  
ATOM 8938  H HD3  . ARG B 2 2  ? 9.151   -7.662  10.574  1.00 1.86 ? 302 ARG B HD3  6  
ATOM 8939  H HE   . ARG B 2 2  ? 8.459   -10.331 11.386  1.00 2.48 ? 302 ARG B HE   6  
ATOM 8940  H HH11 . ARG B 2 2  ? 9.029   -7.062  12.510  1.00 2.71 ? 302 ARG B HH11 6  
ATOM 8941  H HH12 . ARG B 2 2  ? 9.435   -7.557  14.119  1.00 3.75 ? 302 ARG B HH12 6  
ATOM 8942  H HH21 . ARG B 2 2  ? 8.995   -10.974 13.506  1.00 3.78 ? 302 ARG B HH21 6  
ATOM 8943  H HH22 . ARG B 2 2  ? 9.418   -9.776  14.684  1.00 4.18 ? 302 ARG B HH22 6  
ATOM 8944  N N    . GLU B 2 3  ? 4.415   -5.746  10.812  1.00 0.69 ? 303 GLU B N    6  
ATOM 8945  C CA   . GLU B 2 3  ? 4.164   -4.421  10.249  1.00 0.66 ? 303 GLU B CA   6  
ATOM 8946  C C    . GLU B 2 3  ? 5.425   -3.562  10.303  1.00 0.71 ? 303 GLU B C    6  
ATOM 8947  O O    . GLU B 2 3  ? 6.244   -3.703  11.215  1.00 1.16 ? 303 GLU B O    6  
ATOM 8948  C CB   . GLU B 2 3  ? 3.027   -3.723  11.005  1.00 0.71 ? 303 GLU B CB   6  
ATOM 8949  C CG   . GLU B 2 3  ? 1.797   -4.597  11.215  1.00 1.12 ? 303 GLU B CG   6  
ATOM 8950  C CD   . GLU B 2 3  ? 1.837   -5.368  12.522  1.00 1.54 ? 303 GLU B CD   6  
ATOM 8951  O OE1  . GLU B 2 3  ? 1.695   -4.734  13.591  1.00 2.08 ? 303 GLU B OE1  6  
ATOM 8952  O OE2  . GLU B 2 3  ? 2.009   -6.605  12.478  1.00 1.99 ? 303 GLU B OE2  6  
ATOM 8953  H H    . GLU B 2 3  ? 4.749   -5.815  11.732  1.00 0.73 ? 303 GLU B H    6  
ATOM 8954  H HA   . GLU B 2 3  ? 3.876   -4.548  9.217   1.00 0.62 ? 303 GLU B HA   6  
ATOM 8955  H HB2  . GLU B 2 3  ? 3.391   -3.415  11.973  1.00 1.19 ? 303 GLU B HB2  6  
ATOM 8956  H HB3  . GLU B 2 3  ? 2.727   -2.847  10.448  1.00 0.81 ? 303 GLU B HB3  6  
ATOM 8957  H HG2  . GLU B 2 3  ? 0.920   -3.966  11.216  1.00 1.28 ? 303 GLU B HG2  6  
ATOM 8958  H HG3  . GLU B 2 3  ? 1.729   -5.302  10.399  1.00 1.65 ? 303 GLU B HG3  6  
ATOM 8959  N N    . THR B 2 4  ? 5.576   -2.675  9.321   1.00 0.55 ? 304 THR B N    6  
ATOM 8960  C CA   . THR B 2 4  ? 6.741   -1.794  9.252   1.00 0.55 ? 304 THR B CA   6  
ATOM 8961  C C    . THR B 2 4  ? 6.395   -0.487  8.539   1.00 0.53 ? 304 THR B C    6  
ATOM 8962  O O    . THR B 2 4  ? 5.657   -0.484  7.552   1.00 0.54 ? 304 THR B O    6  
ATOM 8963  C CB   . THR B 2 4  ? 7.898   -2.515  8.545   1.00 0.55 ? 304 THR B CB   6  
ATOM 8964  O OG1  . THR B 2 4  ? 8.821   -3.025  9.491   1.00 0.65 ? 304 THR B OG1  6  
ATOM 8965  C CG2  . THR B 2 4  ? 8.672   -1.648  7.574   1.00 0.56 ? 304 THR B CG2  6  
ATOM 8966  H H    . THR B 2 4  ? 4.890   -2.613  8.622   1.00 0.76 ? 304 THR B H    6  
ATOM 8967  H HA   . THR B 2 4  ? 7.037   -1.568  10.265  1.00 0.59 ? 304 THR B HA   6  
ATOM 8968  H HB   . THR B 2 4  ? 7.495   -3.348  7.989   1.00 0.56 ? 304 THR B HB   6  
ATOM 8969  H HG1  . THR B 2 4  ? 8.605   -3.939  9.689   1.00 0.96 ? 304 THR B HG1  6  
ATOM 8970  H HG21 . THR B 2 4  ? 8.026   -1.364  6.757   1.00 1.05 ? 304 THR B HG21 6  
ATOM 8971  H HG22 . THR B 2 4  ? 9.515   -2.203  7.190   1.00 1.13 ? 304 THR B HG22 6  
ATOM 8972  H HG23 . THR B 2 4  ? 9.024   -0.763  8.083   1.00 1.23 ? 304 THR B HG23 6  
ATOM 8973  N N    . GLN B 2 5  ? 6.940   0.622   9.044   1.00 0.58 ? 305 GLN B N    6  
ATOM 8974  C CA   . GLN B 2 5  ? 6.695   1.936   8.455   1.00 0.60 ? 305 GLN B CA   6  
ATOM 8975  C C    . GLN B 2 5  ? 7.542   2.147   7.206   1.00 0.58 ? 305 GLN B C    6  
ATOM 8976  O O    . GLN B 2 5  ? 8.626   1.574   7.070   1.00 0.74 ? 305 GLN B O    6  
ATOM 8977  C CB   . GLN B 2 5  ? 6.970   3.048   9.468   1.00 0.76 ? 305 GLN B CB   6  
ATOM 8978  C CG   . GLN B 2 5  ? 5.760   3.404   10.320  1.00 0.89 ? 305 GLN B CG   6  
ATOM 8979  C CD   . GLN B 2 5  ? 6.113   4.257   11.526  1.00 1.13 ? 305 GLN B CD   6  
ATOM 8980  O OE1  . GLN B 2 5  ? 7.276   4.350   11.921  1.00 1.67 ? 305 GLN B OE1  6  
ATOM 8981  N NE2  . GLN B 2 5  ? 5.106   4.887   12.123  1.00 1.50 ? 305 GLN B NE2  6  
ATOM 8982  H H    . GLN B 2 5  ? 7.523   0.552   9.830   1.00 0.64 ? 305 GLN B H    6  
ATOM 8983  H HA   . GLN B 2 5  ? 5.656   1.976   8.168   1.00 0.57 ? 305 GLN B HA   6  
ATOM 8984  H HB2  . GLN B 2 5  ? 7.768   2.735   10.124  1.00 0.76 ? 305 GLN B HB2  6  
ATOM 8985  H HB3  . GLN B 2 5  ? 7.279   3.934   8.933   1.00 0.88 ? 305 GLN B HB3  6  
ATOM 8986  H HG2  . GLN B 2 5  ? 5.056   3.948   9.710   1.00 0.96 ? 305 GLN B HG2  6  
ATOM 8987  H HG3  . GLN B 2 5  ? 5.301   2.490   10.667  1.00 0.87 ? 305 GLN B HG3  6  
ATOM 8988  H HE21 . GLN B 2 5  ? 4.202   4.769   11.759  1.00 1.97 ? 305 GLN B HE21 6  
ATOM 8989  H HE22 . GLN B 2 5  ? 5.307   5.446   12.903  1.00 1.62 ? 305 GLN B HE22 6  
ATOM 8990  N N    . VAL B 2 6  ? 7.031   2.967   6.293   1.00 0.58 ? 306 VAL B N    6  
ATOM 8991  C CA   . VAL B 2 6  ? 7.721   3.260   5.041   1.00 0.63 ? 306 VAL B CA   6  
ATOM 8992  C C    . VAL B 2 6  ? 7.607   4.740   4.667   1.00 0.77 ? 306 VAL B C    6  
ATOM 8993  O O    . VAL B 2 6  ? 6.622   5.389   5.084   1.00 1.47 ? 306 VAL B O    6  
ATOM 8994  C CB   . VAL B 2 6  ? 7.162   2.395   3.890   1.00 0.54 ? 306 VAL B CB   6  
ATOM 8995  C CG1  . VAL B 2 6  ? 7.583   0.942   4.064   1.00 0.51 ? 306 VAL B CG1  6  
ATOM 8996  C CG2  . VAL B 2 6  ? 5.644   2.511   3.816   1.00 0.49 ? 306 VAL B CG2  6  
ATOM 8997  O OXT  . VAL B 2 6  ? 8.507   5.240   3.960   1.00 1.14 ? 306 VAL B OXT  6  
ATOM 8998  H H    . VAL B 2 6  ? 6.159   3.384   6.464   1.00 0.70 ? 306 VAL B H    6  
ATOM 8999  H HA   . VAL B 2 6  ? 8.765   3.013   5.171   1.00 0.71 ? 306 VAL B HA   6  
ATOM 9000  H HB   . VAL B 2 6  ? 7.576   2.756   2.960   1.00 0.63 ? 306 VAL B HB   6  
ATOM 9001  H HG11 . VAL B 2 6  ? 7.308   0.379   3.184   1.00 1.08 ? 306 VAL B HG11 6  
ATOM 9002  H HG12 . VAL B 2 6  ? 7.087   0.523   4.929   1.00 1.13 ? 306 VAL B HG12 6  
ATOM 9003  H HG13 . VAL B 2 6  ? 8.652   0.891   4.204   1.00 1.04 ? 306 VAL B HG13 6  
ATOM 9004  H HG21 . VAL B 2 6  ? 5.325   3.398   4.344   1.00 1.09 ? 306 VAL B HG21 6  
ATOM 9005  H HG22 . VAL B 2 6  ? 5.193   1.642   4.272   1.00 1.15 ? 306 VAL B HG22 6  
ATOM 9006  H HG23 . VAL B 2 6  ? 5.337   2.576   2.783   1.00 1.15 ? 306 VAL B HG23 6  
ATOM 9007  N N    . MET A 1 1  ? -10.126 2.680   -9.218  1.00 1.83 ? 1   MET A N    7  
ATOM 9008  C CA   . MET A 1 1  ? -9.470  3.471   -8.140  1.00 1.38 ? 1   MET A CA   7  
ATOM 9009  C C    . MET A 1 1  ? -7.951  3.470   -8.299  1.00 1.20 ? 1   MET A C    7  
ATOM 9010  O O    . MET A 1 1  ? -7.302  2.435   -8.131  1.00 1.07 ? 1   MET A O    7  
ATOM 9011  C CB   . MET A 1 1  ? -9.856  2.868   -6.782  1.00 1.81 ? 1   MET A CB   7  
ATOM 9012  C CG   . MET A 1 1  ? -11.258 3.239   -6.322  1.00 2.04 ? 1   MET A CG   7  
ATOM 9013  S SD   . MET A 1 1  ? -12.220 1.805   -5.800  1.00 2.69 ? 1   MET A SD   7  
ATOM 9014  C CE   . MET A 1 1  ? -11.357 1.344   -4.299  1.00 3.17 ? 1   MET A CE   7  
ATOM 9015  H H1   . MET A 1 1  ? -9.806  1.695   -9.129  1.00 2.20 ? 1   MET A H1   7  
ATOM 9016  H H2   . MET A 1 1  ? -9.837  3.089   -10.131 1.00 2.22 ? 1   MET A H2   7  
ATOM 9017  H H3   . MET A 1 1  ? -11.154 2.752   -9.085  1.00 1.92 ? 1   MET A H3   7  
ATOM 9018  H HA   . MET A 1 1  ? -9.830  4.488   -8.192  1.00 1.47 ? 1   MET A HA   7  
ATOM 9019  H HB2  . MET A 1 1  ? -9.795  1.793   -6.851  1.00 2.32 ? 1   MET A HB2  7  
ATOM 9020  H HB3  . MET A 1 1  ? -9.153  3.212   -6.038  1.00 2.16 ? 1   MET A HB3  7  
ATOM 9021  H HG2  . MET A 1 1  ? -11.179 3.922   -5.491  1.00 2.47 ? 1   MET A HG2  7  
ATOM 9022  H HG3  . MET A 1 1  ? -11.774 3.724   -7.137  1.00 2.24 ? 1   MET A HG3  7  
ATOM 9023  H HE1  . MET A 1 1  ? -11.099 2.235   -3.744  1.00 3.35 ? 1   MET A HE1  7  
ATOM 9024  H HE2  . MET A 1 1  ? -10.457 0.805   -4.553  1.00 3.35 ? 1   MET A HE2  7  
ATOM 9025  H HE3  . MET A 1 1  ? -11.995 0.717   -3.695  1.00 3.67 ? 1   MET A HE3  7  
ATOM 9026  N N    . GLU A 1 2  ? -7.388  4.636   -8.626  1.00 1.25 ? 2   GLU A N    7  
ATOM 9027  C CA   . GLU A 1 2  ? -5.944  4.764   -8.806  1.00 1.15 ? 2   GLU A CA   7  
ATOM 9028  C C    . GLU A 1 2  ? -5.374  5.891   -7.944  1.00 1.12 ? 2   GLU A C    7  
ATOM 9029  O O    . GLU A 1 2  ? -5.804  7.043   -8.029  1.00 1.17 ? 2   GLU A O    7  
ATOM 9030  C CB   . GLU A 1 2  ? -5.595  4.991   -10.281 1.00 1.22 ? 2   GLU A CB   7  
ATOM 9031  C CG   . GLU A 1 2  ? -6.312  6.171   -10.911 1.00 1.74 ? 2   GLU A CG   7  
ATOM 9032  C CD   . GLU A 1 2  ? -7.439  5.744   -11.832 1.00 1.63 ? 2   GLU A CD   7  
ATOM 9033  O OE1  . GLU A 1 2  ? -8.577  5.579   -11.343 1.00 1.88 ? 2   GLU A OE1  7  
ATOM 9034  O OE2  . GLU A 1 2  ? -7.184  5.573   -13.043 1.00 1.97 ? 2   GLU A OE2  7  
ATOM 9035  H H    . GLU A 1 2  ? -7.957  5.425   -8.747  1.00 1.40 ? 2   GLU A H    7  
ATOM 9036  H HA   . GLU A 1 2  ? -5.494  3.835   -8.486  1.00 1.06 ? 2   GLU A HA   7  
ATOM 9037  H HB2  . GLU A 1 2  ? -4.531  5.160   -10.363 1.00 1.76 ? 2   GLU A HB2  7  
ATOM 9038  H HB3  . GLU A 1 2  ? -5.851  4.102   -10.838 1.00 1.34 ? 2   GLU A HB3  7  
ATOM 9039  H HG2  . GLU A 1 2  ? -6.723  6.784   -10.125 1.00 2.14 ? 2   GLU A HG2  7  
ATOM 9040  H HG3  . GLU A 1 2  ? -5.597  6.747   -11.481 1.00 2.47 ? 2   GLU A HG3  7  
ATOM 9041  N N    . ILE A 1 3  ? -4.409  5.526   -7.108  1.00 1.09 ? 3   ILE A N    7  
ATOM 9042  C CA   . ILE A 1 3  ? -3.767  6.475   -6.206  1.00 1.10 ? 3   ILE A CA   7  
ATOM 9043  C C    . ILE A 1 3  ? -2.456  6.989   -6.797  1.00 1.02 ? 3   ILE A C    7  
ATOM 9044  O O    . ILE A 1 3  ? -1.461  6.262   -6.844  1.00 1.07 ? 3   ILE A O    7  
ATOM 9045  C CB   . ILE A 1 3  ? -3.487  5.841   -4.824  1.00 1.18 ? 3   ILE A CB   7  
ATOM 9046  C CG1  . ILE A 1 3  ? -4.780  5.296   -4.209  1.00 1.34 ? 3   ILE A CG1  7  
ATOM 9047  C CG2  . ILE A 1 3  ? -2.840  6.856   -3.893  1.00 1.22 ? 3   ILE A CG2  7  
ATOM 9048  C CD1  . ILE A 1 3  ? -4.989  3.816   -4.447  1.00 1.10 ? 3   ILE A CD1  7  
ATOM 9049  H H    . ILE A 1 3  ? -4.154  4.580   -7.103  1.00 1.08 ? 3   ILE A H    7  
ATOM 9050  H HA   . ILE A 1 3  ? -4.438  7.309   -6.066  1.00 1.15 ? 3   ILE A HA   7  
ATOM 9051  H HB   . ILE A 1 3  ? -2.793  5.026   -4.963  1.00 1.17 ? 3   ILE A HB   7  
ATOM 9052  H HG12 . ILE A 1 3  ? -4.760  5.458   -3.141  1.00 1.83 ? 3   ILE A HG12 7  
ATOM 9053  H HG13 . ILE A 1 3  ? -5.622  5.823   -4.631  1.00 1.86 ? 3   ILE A HG13 7  
ATOM 9054  H HG21 . ILE A 1 3  ? -2.840  6.471   -2.884  1.00 1.72 ? 3   ILE A HG21 7  
ATOM 9055  H HG22 . ILE A 1 3  ? -3.396  7.780   -3.926  1.00 1.51 ? 3   ILE A HG22 7  
ATOM 9056  H HG23 . ILE A 1 3  ? -1.823  7.036   -4.210  1.00 1.55 ? 3   ILE A HG23 7  
ATOM 9057  H HD11 . ILE A 1 3  ? -4.070  3.373   -4.799  1.00 1.47 ? 3   ILE A HD11 7  
ATOM 9058  H HD12 . ILE A 1 3  ? -5.762  3.677   -5.189  1.00 1.61 ? 3   ILE A HD12 7  
ATOM 9059  H HD13 . ILE A 1 3  ? -5.288  3.341   -3.523  1.00 1.54 ? 3   ILE A HD13 7  
ATOM 9060  N N    . LYS A 1 4  ? -2.458  8.252   -7.238  1.00 0.98 ? 4   LYS A N    7  
ATOM 9061  C CA   . LYS A 1 4  ? -1.259  8.854   -7.812  1.00 0.96 ? 4   LYS A CA   7  
ATOM 9062  C C    . LYS A 1 4  ? -0.633  9.836   -6.822  1.00 0.96 ? 4   LYS A C    7  
ATOM 9063  O O    . LYS A 1 4  ? -0.980  11.019  -6.782  1.00 1.08 ? 4   LYS A O    7  
ATOM 9064  C CB   . LYS A 1 4  ? -1.595  9.563   -9.130  1.00 1.07 ? 4   LYS A CB   7  
ATOM 9065  C CG   . LYS A 1 4  ? -0.954  8.920   -10.349 1.00 1.35 ? 4   LYS A CG   7  
ATOM 9066  C CD   . LYS A 1 4  ? -1.798  9.127   -11.598 1.00 1.59 ? 4   LYS A CD   7  
ATOM 9067  C CE   . LYS A 1 4  ? -1.055  8.694   -12.853 1.00 2.29 ? 4   LYS A CE   7  
ATOM 9068  N NZ   . LYS A 1 4  ? -0.552  9.857   -13.635 1.00 2.93 ? 4   LYS A NZ   7  
ATOM 9069  H H    . LYS A 1 4  ? -3.274  8.790   -7.166  1.00 1.01 ? 4   LYS A H    7  
ATOM 9070  H HA   . LYS A 1 4  ? -0.551  8.062   -8.008  1.00 0.96 ? 4   LYS A HA   7  
ATOM 9071  H HB2  . LYS A 1 4  ? -2.667  9.553   -9.266  1.00 1.56 ? 4   LYS A HB2  7  
ATOM 9072  H HB3  . LYS A 1 4  ? -1.260  10.588  -9.071  1.00 1.61 ? 4   LYS A HB3  7  
ATOM 9073  H HG2  . LYS A 1 4  ? 0.018   9.363   -10.508 1.00 1.93 ? 4   LYS A HG2  7  
ATOM 9074  H HG3  . LYS A 1 4  ? -0.845  7.861   -10.170 1.00 1.87 ? 4   LYS A HG3  7  
ATOM 9075  H HD2  . LYS A 1 4  ? -2.703  8.545   -11.509 1.00 1.98 ? 4   LYS A HD2  7  
ATOM 9076  H HD3  . LYS A 1 4  ? -2.048  10.175  -11.682 1.00 1.90 ? 4   LYS A HD3  7  
ATOM 9077  H HE2  . LYS A 1 4  ? -0.217  8.076   -12.566 1.00 2.72 ? 4   LYS A HE2  7  
ATOM 9078  H HE3  . LYS A 1 4  ? -1.728  8.119   -13.473 1.00 2.70 ? 4   LYS A HE3  7  
ATOM 9079  H HZ1  . LYS A 1 4  ? 0.096   10.426  -13.053 1.00 3.17 ? 4   LYS A HZ1  7  
ATOM 9080  H HZ2  . LYS A 1 4  ? -1.347  10.457  -13.936 1.00 3.54 ? 4   LYS A HZ2  7  
ATOM 9081  H HZ3  . LYS A 1 4  ? -0.042  9.527   -14.479 1.00 3.06 ? 4   LYS A HZ3  7  
ATOM 9082  N N    . LEU A 1 5  ? 0.270   9.307   -6.004  1.00 0.89 ? 5   LEU A N    7  
ATOM 9083  C CA   . LEU A 1 5  ? 0.941   10.098  -4.976  1.00 0.97 ? 5   LEU A CA   7  
ATOM 9084  C C    . LEU A 1 5  ? 2.237   10.717  -5.489  1.00 0.88 ? 5   LEU A C    7  
ATOM 9085  O O    . LEU A 1 5  ? 3.070   10.037  -6.090  1.00 0.82 ? 5   LEU A O    7  
ATOM 9086  C CB   . LEU A 1 5  ? 1.215   9.240   -3.739  1.00 1.11 ? 5   LEU A CB   7  
ATOM 9087  C CG   . LEU A 1 5  ? 0.104   9.255   -2.685  1.00 1.42 ? 5   LEU A CG   7  
ATOM 9088  C CD1  . LEU A 1 5  ? 0.350   8.187   -1.630  1.00 1.50 ? 5   LEU A CD1  7  
ATOM 9089  C CD2  . LEU A 1 5  ? -0.002  10.630  -2.041  1.00 2.09 ? 5   LEU A CD2  7  
ATOM 9090  H H    . LEU A 1 5  ? 0.433   8.343   -6.083  1.00 0.85 ? 5   LEU A H    7  
ATOM 9091  H HA   . LEU A 1 5  ? 0.271   10.897  -4.697  1.00 1.10 ? 5   LEU A HA   7  
ATOM 9092  H HB2  . LEU A 1 5  ? 1.367   8.220   -4.059  1.00 1.26 ? 5   LEU A HB2  7  
ATOM 9093  H HB3  . LEU A 1 5  ? 2.124   9.593   -3.275  1.00 1.25 ? 5   LEU A HB3  7  
ATOM 9094  H HG   . LEU A 1 5  ? -0.839  9.037   -3.165  1.00 1.86 ? 5   LEU A HG   7  
ATOM 9095  H HD11 . LEU A 1 5  ? -0.191  8.437   -0.730  1.00 1.87 ? 5   LEU A HD11 7  
ATOM 9096  H HD12 . LEU A 1 5  ? 1.407   8.133   -1.412  1.00 2.01 ? 5   LEU A HD12 7  
ATOM 9097  H HD13 . LEU A 1 5  ? 0.011   7.230   -2.001  1.00 1.76 ? 5   LEU A HD13 7  
ATOM 9098  H HD21 . LEU A 1 5  ? 0.978   10.958  -1.728  1.00 2.37 ? 5   LEU A HD21 7  
ATOM 9099  H HD22 . LEU A 1 5  ? -0.656  10.577  -1.183  1.00 2.53 ? 5   LEU A HD22 7  
ATOM 9100  H HD23 . LEU A 1 5  ? -0.405  11.333  -2.756  1.00 2.63 ? 5   LEU A HD23 7  
ATOM 9101  N N    . ILE A 1 6  ? 2.398   12.018  -5.239  1.00 0.95 ? 6   ILE A N    7  
ATOM 9102  C CA   . ILE A 1 6  ? 3.594   12.741  -5.664  1.00 0.90 ? 6   ILE A CA   7  
ATOM 9103  C C    . ILE A 1 6  ? 4.669   12.665  -4.580  1.00 0.93 ? 6   ILE A C    7  
ATOM 9104  O O    . ILE A 1 6  ? 4.420   13.002  -3.419  1.00 1.06 ? 6   ILE A O    7  
ATOM 9105  C CB   . ILE A 1 6  ? 3.289   14.225  -5.986  1.00 1.04 ? 6   ILE A CB   7  
ATOM 9106  C CG1  . ILE A 1 6  ? 4.517   14.892  -6.614  1.00 1.29 ? 6   ILE A CG1  7  
ATOM 9107  C CG2  . ILE A 1 6  ? 2.849   14.976  -4.734  1.00 1.21 ? 6   ILE A CG2  7  
ATOM 9108  C CD1  . ILE A 1 6  ? 4.272   16.315  -7.071  1.00 1.94 ? 6   ILE A CD1  7  
ATOM 9109  H H    . ILE A 1 6  ? 1.693   12.500  -4.759  1.00 1.06 ? 6   ILE A H    7  
ATOM 9110  H HA   . ILE A 1 6  ? 3.962   12.269  -6.565  1.00 0.86 ? 6   ILE A HA   7  
ATOM 9111  H HB   . ILE A 1 6  ? 2.474   14.253  -6.693  1.00 1.27 ? 6   ILE A HB   7  
ATOM 9112  H HG12 . ILE A 1 6  ? 5.318   14.912  -5.891  1.00 1.47 ? 6   ILE A HG12 7  
ATOM 9113  H HG13 . ILE A 1 6  ? 4.829   14.316  -7.474  1.00 1.34 ? 6   ILE A HG13 7  
ATOM 9114  H HG21 . ILE A 1 6  ? 3.717   15.235  -4.147  1.00 1.62 ? 6   ILE A HG21 7  
ATOM 9115  H HG22 . ILE A 1 6  ? 2.193   14.350  -4.149  1.00 1.62 ? 6   ILE A HG22 7  
ATOM 9116  H HG23 . ILE A 1 6  ? 2.326   15.877  -5.021  1.00 1.45 ? 6   ILE A HG23 7  
ATOM 9117  H HD11 . ILE A 1 6  ? 4.860   16.515  -7.956  1.00 2.44 ? 6   ILE A HD11 7  
ATOM 9118  H HD12 . ILE A 1 6  ? 4.560   16.999  -6.287  1.00 2.21 ? 6   ILE A HD12 7  
ATOM 9119  H HD13 . ILE A 1 6  ? 3.224   16.446  -7.299  1.00 2.30 ? 6   ILE A HD13 7  
ATOM 9120  N N    . LYS A 1 7  ? 5.857   12.198  -4.958  1.00 0.91 ? 7   LYS A N    7  
ATOM 9121  C CA   . LYS A 1 7  ? 6.963   12.054  -4.012  1.00 1.06 ? 7   LYS A CA   7  
ATOM 9122  C C    . LYS A 1 7  ? 7.486   13.409  -3.540  1.00 1.18 ? 7   LYS A C    7  
ATOM 9123  O O    . LYS A 1 7  ? 8.076   14.166  -4.315  1.00 1.29 ? 7   LYS A O    7  
ATOM 9124  C CB   . LYS A 1 7  ? 8.103   11.241  -4.633  1.00 1.26 ? 7   LYS A CB   7  
ATOM 9125  C CG   . LYS A 1 7  ? 8.227   9.832   -4.072  1.00 1.78 ? 7   LYS A CG   7  
ATOM 9126  C CD   . LYS A 1 7  ? 8.330   9.833   -2.553  1.00 2.30 ? 7   LYS A CD   7  
ATOM 9127  C CE   . LYS A 1 7  ? 9.644   10.434  -2.078  1.00 2.50 ? 7   LYS A CE   7  
ATOM 9128  N NZ   . LYS A 1 7  ? 9.668   10.627  -0.602  1.00 3.10 ? 7   LYS A NZ   7  
ATOM 9129  H H    . LYS A 1 7  ? 5.989   11.928  -5.891  1.00 0.88 ? 7   LYS A H    7  
ATOM 9130  H HA   . LYS A 1 7  ? 6.585   11.518  -3.156  1.00 1.12 ? 7   LYS A HA   7  
ATOM 9131  H HB2  . LYS A 1 7  ? 7.940   11.167  -5.698  1.00 1.17 ? 7   LYS A HB2  7  
ATOM 9132  H HB3  . LYS A 1 7  ? 9.036   11.758  -4.458  1.00 1.45 ? 7   LYS A HB3  7  
ATOM 9133  H HG2  . LYS A 1 7  ? 7.356   9.263   -4.363  1.00 2.05 ? 7   LYS A HG2  7  
ATOM 9134  H HG3  . LYS A 1 7  ? 9.113   9.370   -4.484  1.00 2.37 ? 7   LYS A HG3  7  
ATOM 9135  H HD2  . LYS A 1 7  ? 7.515   10.413  -2.146  1.00 2.80 ? 7   LYS A HD2  7  
ATOM 9136  H HD3  . LYS A 1 7  ? 8.260   8.816   -2.197  1.00 2.70 ? 7   LYS A HD3  7  
ATOM 9137  H HE2  . LYS A 1 7  ? 10.450  9.772   -2.358  1.00 3.04 ? 7   LYS A HE2  7  
ATOM 9138  H HE3  . LYS A 1 7  ? 9.783   11.391  -2.561  1.00 2.26 ? 7   LYS A HE3  7  
ATOM 9139  H HZ1  . LYS A 1 7  ? 9.060   11.428  -0.336  1.00 3.61 ? 7   LYS A HZ1  7  
ATOM 9140  H HZ2  . LYS A 1 7  ? 10.639  10.823  -0.283  1.00 3.37 ? 7   LYS A HZ2  7  
ATOM 9141  H HZ3  . LYS A 1 7  ? 9.325   9.771   -0.122  1.00 3.30 ? 7   LYS A HZ3  7  
ATOM 9142  N N    . GLY A 1 8  ? 7.266   13.699  -2.257  1.00 1.38 ? 8   GLY A N    7  
ATOM 9143  C CA   . GLY A 1 8  ? 7.718   14.954  -1.677  1.00 1.62 ? 8   GLY A CA   7  
ATOM 9144  C C    . GLY A 1 8  ? 8.849   14.757  -0.680  1.00 1.78 ? 8   GLY A C    7  
ATOM 9145  O O    . GLY A 1 8  ? 9.402   13.660  -0.574  1.00 1.78 ? 8   GLY A O    7  
ATOM 9146  H H    . GLY A 1 8  ? 6.790   13.049  -1.697  1.00 1.48 ? 8   GLY A H    7  
ATOM 9147  H HA2  . GLY A 1 8  ? 8.060   15.603  -2.470  1.00 1.65 ? 8   GLY A HA2  7  
ATOM 9148  H HA3  . GLY A 1 8  ? 6.888   15.424  -1.173  1.00 1.79 ? 8   GLY A HA3  7  
ATOM 9149  N N    . PRO A 1 9  ? 9.218   15.812  0.073   1.00 2.05 ? 9   PRO A N    7  
ATOM 9150  C CA   . PRO A 1 9  ? 10.298  15.742  1.072   1.00 2.32 ? 9   PRO A CA   7  
ATOM 9151  C C    . PRO A 1 9  ? 10.046  14.670  2.132   1.00 2.37 ? 9   PRO A C    7  
ATOM 9152  O O    . PRO A 1 9  ? 10.954  13.918  2.492   1.00 2.77 ? 9   PRO A O    7  
ATOM 9153  C CB   . PRO A 1 9  ? 10.295  17.137  1.709   1.00 2.68 ? 9   PRO A CB   7  
ATOM 9154  C CG   . PRO A 1 9  ? 9.632   18.017  0.706   1.00 2.59 ? 9   PRO A CG   7  
ATOM 9155  C CD   . PRO A 1 9  ? 8.616   17.157  0.012   1.00 2.24 ? 9   PRO A CD   7  
ATOM 9156  H HA   . PRO A 1 9  ? 11.255  15.561  0.603   1.00 2.37 ? 9   PRO A HA   7  
ATOM 9157  H HB2  . PRO A 1 9  ? 9.743   17.111  2.638   1.00 2.85 ? 9   PRO A HB2  7  
ATOM 9158  H HB3  . PRO A 1 9  ? 11.311  17.451  1.898   1.00 2.89 ? 9   PRO A HB3  7  
ATOM 9159  H HG2  . PRO A 1 9  ? 9.148   18.842  1.205   1.00 2.84 ? 9   PRO A HG2  7  
ATOM 9160  H HG3  . PRO A 1 9  ? 10.362  18.382  -0.002  1.00 2.61 ? 9   PRO A HG3  7  
ATOM 9161  H HD2  . PRO A 1 9  ? 7.675   17.183  0.540   1.00 2.35 ? 9   PRO A HD2  7  
ATOM 9162  H HD3  . PRO A 1 9  ? 8.488   17.474  -1.012  1.00 2.14 ? 9   PRO A HD3  7  
ATOM 9163  N N    . LYS A 1 10 ? 8.807   14.601  2.624   1.00 2.38 ? 10  LYS A N    7  
ATOM 9164  C CA   . LYS A 1 10 ? 8.434   13.617  3.639   1.00 2.57 ? 10  LYS A CA   7  
ATOM 9165  C C    . LYS A 1 10 ? 8.260   12.235  3.008   1.00 2.26 ? 10  LYS A C    7  
ATOM 9166  O O    . LYS A 1 10 ? 9.049   11.325  3.269   1.00 2.45 ? 10  LYS A O    7  
ATOM 9167  C CB   . LYS A 1 10 ? 7.146   14.042  4.355   1.00 2.99 ? 10  LYS A CB   7  
ATOM 9168  C CG   . LYS A 1 10 ? 7.143   13.730  5.844   1.00 3.71 ? 10  LYS A CG   7  
ATOM 9169  C CD   . LYS A 1 10 ? 6.007   12.789  6.220   1.00 4.04 ? 10  LYS A CD   7  
ATOM 9170  C CE   . LYS A 1 10 ? 4.953   13.493  7.064   1.00 4.40 ? 10  LYS A CE   7  
ATOM 9171  N NZ   . LYS A 1 10 ? 5.363   13.607  8.492   1.00 4.92 ? 10  LYS A NZ   7  
ATOM 9172  H H    . LYS A 1 10 ? 8.129   15.227  2.291   1.00 2.55 ? 10  LYS A H    7  
ATOM 9173  H HA   . LYS A 1 10 ? 9.236   13.569  4.360   1.00 2.82 ? 10  LYS A HA   7  
ATOM 9174  H HB2  . LYS A 1 10 ? 7.016   15.108  4.234   1.00 3.13 ? 10  LYS A HB2  7  
ATOM 9175  H HB3  . LYS A 1 10 ? 6.308   13.534  3.900   1.00 2.88 ? 10  LYS A HB3  7  
ATOM 9176  H HG2  . LYS A 1 10 ? 8.081   13.264  6.105   1.00 3.97 ? 10  LYS A HG2  7  
ATOM 9177  H HG3  . LYS A 1 10 ? 7.033   14.653  6.395   1.00 4.13 ? 10  LYS A HG3  7  
ATOM 9178  H HD2  . LYS A 1 10 ? 5.542   12.421  5.319   1.00 4.48 ? 10  LYS A HD2  7  
ATOM 9179  H HD3  . LYS A 1 10 ? 6.411   11.961  6.783   1.00 4.00 ? 10  LYS A HD3  7  
ATOM 9180  H HE2  . LYS A 1 10 ? 4.793   14.483  6.665   1.00 4.59 ? 10  LYS A HE2  7  
ATOM 9181  H HE3  . LYS A 1 10 ? 4.033   12.930  7.007   1.00 4.53 ? 10  LYS A HE3  7  
ATOM 9182  H HZ1  . LYS A 1 10 ? 4.586   14.009  9.055   1.00 5.28 ? 10  LYS A HZ1  7  
ATOM 9183  H HZ2  . LYS A 1 10 ? 6.194   14.227  8.577   1.00 5.13 ? 10  LYS A HZ2  7  
ATOM 9184  H HZ3  . LYS A 1 10 ? 5.603   12.670  8.873   1.00 5.08 ? 10  LYS A HZ3  7  
ATOM 9185  N N    . GLY A 1 11 ? 7.228   12.088  2.174   1.00 2.10 ? 11  GLY A N    7  
ATOM 9186  C CA   . GLY A 1 11 ? 6.972   10.817  1.514   1.00 2.10 ? 11  GLY A CA   7  
ATOM 9187  C C    . GLY A 1 11 ? 5.714   10.131  2.016   1.00 2.08 ? 11  GLY A C    7  
ATOM 9188  O O    . GLY A 1 11 ? 4.835   10.776  2.594   1.00 2.30 ? 11  GLY A O    7  
ATOM 9189  H H    . GLY A 1 11 ? 6.635   12.850  2.006   1.00 2.22 ? 11  GLY A H    7  
ATOM 9190  H HA2  . GLY A 1 11 ? 6.872   10.992  0.454   1.00 2.53 ? 11  GLY A HA2  7  
ATOM 9191  H HA3  . GLY A 1 11 ? 7.815   10.162  1.681   1.00 2.21 ? 11  GLY A HA3  7  
ATOM 9192  N N    . LEU A 1 12 ? 5.633   8.818   1.778   1.00 2.47 ? 12  LEU A N    7  
ATOM 9193  C CA   . LEU A 1 12 ? 4.480   8.002   2.186   1.00 2.77 ? 12  LEU A CA   7  
ATOM 9194  C C    . LEU A 1 12 ? 3.947   8.417   3.561   1.00 1.92 ? 12  LEU A C    7  
ATOM 9195  O O    . LEU A 1 12 ? 2.801   8.850   3.681   1.00 2.52 ? 12  LEU A O    7  
ATOM 9196  C CB   . LEU A 1 12 ? 4.863   6.517   2.195   1.00 3.62 ? 12  LEU A CB   7  
ATOM 9197  C CG   . LEU A 1 12 ? 5.395   5.973   0.866   1.00 4.87 ? 12  LEU A CG   7  
ATOM 9198  C CD1  . LEU A 1 12 ? 6.913   5.863   0.897   1.00 5.33 ? 12  LEU A CD1  7  
ATOM 9199  C CD2  . LEU A 1 12 ? 4.770   4.624   0.551   1.00 5.70 ? 12  LEU A CD2  7  
ATOM 9200  H H    . LEU A 1 12 ? 6.369   8.382   1.301   1.00 2.84 ? 12  LEU A H    7  
ATOM 9201  H HA   . LEU A 1 12 ? 3.699   8.153   1.455   1.00 3.41 ? 12  LEU A HA   7  
ATOM 9202  H HB2  . LEU A 1 12 ? 5.621   6.370   2.950   1.00 3.58 ? 12  LEU A HB2  7  
ATOM 9203  H HB3  . LEU A 1 12 ? 3.990   5.944   2.471   1.00 3.65 ? 12  LEU A HB3  7  
ATOM 9204  H HG   . LEU A 1 12 ? 5.127   6.657   0.072   1.00 5.19 ? 12  LEU A HG   7  
ATOM 9205  H HD11 . LEU A 1 12 ? 7.195   4.852   1.155   1.00 5.40 ? 12  LEU A HD11 7  
ATOM 9206  H HD12 . LEU A 1 12 ? 7.308   6.546   1.635   1.00 5.57 ? 12  LEU A HD12 7  
ATOM 9207  H HD13 . LEU A 1 12 ? 7.312   6.112   -0.074  1.00 5.68 ? 12  LEU A HD13 7  
ATOM 9208  H HD21 . LEU A 1 12 ? 4.785   4.005   1.437   1.00 6.03 ? 12  LEU A HD21 7  
ATOM 9209  H HD22 . LEU A 1 12 ? 5.332   4.140   -0.234  1.00 5.93 ? 12  LEU A HD22 7  
ATOM 9210  H HD23 . LEU A 1 12 ? 3.751   4.766   0.228   1.00 6.06 ? 12  LEU A HD23 7  
ATOM 9211  N N    . GLY A 1 13 ? 4.784   8.284   4.589   1.00 1.13 ? 13  GLY A N    7  
ATOM 9212  C CA   . GLY A 1 13 ? 4.381   8.657   5.933   1.00 1.11 ? 13  GLY A CA   7  
ATOM 9213  C C    . GLY A 1 13 ? 3.328   7.735   6.525   1.00 0.96 ? 13  GLY A C    7  
ATOM 9214  O O    . GLY A 1 13 ? 2.308   8.203   7.028   1.00 1.03 ? 13  GLY A O    7  
ATOM 9215  H H    . GLY A 1 13 ? 5.683   7.929   4.432   1.00 1.49 ? 13  GLY A H    7  
ATOM 9216  H HA2  . GLY A 1 13 ? 5.251   8.640   6.572   1.00 1.58 ? 13  GLY A HA2  7  
ATOM 9217  H HA3  . GLY A 1 13 ? 3.988   9.663   5.910   1.00 1.81 ? 13  GLY A HA3  7  
ATOM 9218  N N    . PHE A 1 14 ? 3.574   6.427   6.465   1.00 0.81 ? 14  PHE A N    7  
ATOM 9219  C CA   . PHE A 1 14 ? 2.645   5.434   7.010   1.00 0.71 ? 14  PHE A CA   7  
ATOM 9220  C C    . PHE A 1 14 ? 3.349   4.094   7.207   1.00 0.56 ? 14  PHE A C    7  
ATOM 9221  O O    . PHE A 1 14 ? 4.559   3.989   6.991   1.00 0.52 ? 14  PHE A O    7  
ATOM 9222  C CB   . PHE A 1 14 ? 1.400   5.272   6.119   1.00 0.74 ? 14  PHE A CB   7  
ATOM 9223  C CG   . PHE A 1 14 ? 1.668   4.849   4.696   1.00 0.63 ? 14  PHE A CG   7  
ATOM 9224  C CD1  . PHE A 1 14 ? 2.164   3.582   4.398   1.00 1.27 ? 14  PHE A CD1  7  
ATOM 9225  C CD2  . PHE A 1 14 ? 1.393   5.716   3.648   1.00 1.41 ? 14  PHE A CD2  7  
ATOM 9226  C CE1  . PHE A 1 14 ? 2.382   3.202   3.089   1.00 1.33 ? 14  PHE A CE1  7  
ATOM 9227  C CE2  . PHE A 1 14 ? 1.607   5.335   2.340   1.00 1.46 ? 14  PHE A CE2  7  
ATOM 9228  C CZ   . PHE A 1 14 ? 2.102   4.078   2.059   1.00 0.83 ? 14  PHE A CZ   7  
ATOM 9229  H H    . PHE A 1 14 ? 4.402   6.115   6.043   1.00 0.79 ? 14  PHE A H    7  
ATOM 9230  H HA   . PHE A 1 14 ? 2.330   5.792   7.980   1.00 0.81 ? 14  PHE A HA   7  
ATOM 9231  H HB2  . PHE A 1 14 ? 0.752   4.531   6.559   1.00 0.84 ? 14  PHE A HB2  7  
ATOM 9232  H HB3  . PHE A 1 14 ? 0.874   6.217   6.087   1.00 0.89 ? 14  PHE A HB3  7  
ATOM 9233  H HD1  . PHE A 1 14 ? 2.387   2.890   5.199   1.00 2.12 ? 14  PHE A HD1  7  
ATOM 9234  H HD2  . PHE A 1 14 ? 1.008   6.702   3.865   1.00 2.28 ? 14  PHE A HD2  7  
ATOM 9235  H HE1  . PHE A 1 14 ? 2.771   2.216   2.870   1.00 2.19 ? 14  PHE A HE1  7  
ATOM 9236  H HE2  . PHE A 1 14 ? 1.388   6.021   1.535   1.00 2.33 ? 14  PHE A HE2  7  
ATOM 9237  H HZ   . PHE A 1 14 ? 2.268   3.779   1.035   1.00 0.99 ? 14  PHE A HZ   7  
ATOM 9238  N N    . SER A 1 15 ? 2.594   3.062   7.583   1.00 0.55 ? 15  SER A N    7  
ATOM 9239  C CA   . SER A 1 15 ? 3.152   1.734   7.763   1.00 0.47 ? 15  SER A CA   7  
ATOM 9240  C C    . SER A 1 15 ? 2.342   0.728   6.959   1.00 0.47 ? 15  SER A C    7  
ATOM 9241  O O    . SER A 1 15 ? 1.285   1.060   6.421   1.00 0.52 ? 15  SER A O    7  
ATOM 9242  C CB   . SER A 1 15 ? 3.198   1.327   9.236   1.00 0.50 ? 15  SER A CB   7  
ATOM 9243  O OG   . SER A 1 15 ? 2.160   1.927   9.978   1.00 0.57 ? 15  SER A OG   7  
ATOM 9244  H H    . SER A 1 15 ? 1.628   3.169   7.699   1.00 0.65 ? 15  SER A H    7  
ATOM 9245  H HA   . SER A 1 15 ? 4.155   1.751   7.375   1.00 0.48 ? 15  SER A HA   7  
ATOM 9246  H HB2  . SER A 1 15 ? 3.094   0.258   9.307   1.00 0.52 ? 15  SER A HB2  7  
ATOM 9247  H HB3  . SER A 1 15 ? 4.145   1.623   9.660   1.00 0.54 ? 15  SER A HB3  7  
ATOM 9248  H HG   . SER A 1 15 ? 2.215   1.632   10.890  1.00 1.10 ? 15  SER A HG   7  
ATOM 9249  N N    . ILE A 1 16 ? 2.854   -0.489  6.857   1.00 0.44 ? 16  ILE A N    7  
ATOM 9250  C CA   . ILE A 1 16 ? 2.194   -1.537  6.084   1.00 0.46 ? 16  ILE A CA   7  
ATOM 9251  C C    . ILE A 1 16 ? 2.677   -2.925  6.497   1.00 0.46 ? 16  ILE A C    7  
ATOM 9252  O O    . ILE A 1 16 ? 3.642   -3.063  7.246   1.00 0.45 ? 16  ILE A O    7  
ATOM 9253  C CB   . ILE A 1 16 ? 2.525   -1.371  4.584   1.00 0.47 ? 16  ILE A CB   7  
ATOM 9254  C CG1  . ILE A 1 16 ? 4.010   -1.019  4.424   1.00 0.67 ? 16  ILE A CG1  7  
ATOM 9255  C CG2  . ILE A 1 16 ? 1.644   -0.305  3.947   1.00 0.57 ? 16  ILE A CG2  7  
ATOM 9256  C CD1  . ILE A 1 16 ? 4.775   -1.963  3.530   1.00 0.64 ? 16  ILE A CD1  7  
ATOM 9257  H H    . ILE A 1 16 ? 3.710   -0.687  7.292   1.00 0.44 ? 16  ILE A H    7  
ATOM 9258  H HA   . ILE A 1 16 ? 1.116   -1.458  6.211   1.00 0.49 ? 16  ILE A HA   7  
ATOM 9259  H HB   . ILE A 1 16 ? 2.329   -2.309  4.088   1.00 0.59 ? 16  ILE A HB   7  
ATOM 9260  H HG12 . ILE A 1 16 ? 4.097   -0.029  4.007   1.00 1.45 ? 16  ILE A HG12 7  
ATOM 9261  H HG13 . ILE A 1 16 ? 4.482   -1.038  5.396   1.00 1.37 ? 16  ILE A HG13 7  
ATOM 9262  H HG21 . ILE A 1 16 ? 0.619   -0.457  4.250   1.00 1.32 ? 16  ILE A HG21 7  
ATOM 9263  H HG22 . ILE A 1 16 ? 1.715   -0.376  2.871   1.00 1.06 ? 16  ILE A HG22 7  
ATOM 9264  H HG23 . ILE A 1 16 ? 1.974   0.672   4.266   1.00 1.09 ? 16  ILE A HG23 7  
ATOM 9265  H HD11 . ILE A 1 16 ? 4.096   -2.681  3.098   1.00 1.34 ? 16  ILE A HD11 7  
ATOM 9266  H HD12 . ILE A 1 16 ? 5.529   -2.480  4.113   1.00 1.24 ? 16  ILE A HD12 7  
ATOM 9267  H HD13 . ILE A 1 16 ? 5.251   -1.397  2.743   1.00 1.38 ? 16  ILE A HD13 7  
ATOM 9268  N N    . ALA A 1 17 ? 2.013   -3.937  5.955   1.00 0.51 ? 17  ALA A N    7  
ATOM 9269  C CA   . ALA A 1 17 ? 2.359   -5.336  6.177   1.00 0.55 ? 17  ALA A CA   7  
ATOM 9270  C C    . ALA A 1 17 ? 2.256   -6.044  4.827   1.00 0.73 ? 17  ALA A C    7  
ATOM 9271  O O    . ALA A 1 17 ? 1.707   -5.467  3.897   1.00 1.19 ? 17  ALA A O    7  
ATOM 9272  C CB   . ALA A 1 17 ? 1.443   -5.964  7.218   1.00 0.71 ? 17  ALA A CB   7  
ATOM 9273  H H    . ALA A 1 17 ? 1.266   -3.740  5.350   1.00 0.55 ? 17  ALA A H    7  
ATOM 9274  H HA   . ALA A 1 17 ? 3.379   -5.385  6.530   1.00 0.50 ? 17  ALA A HA   7  
ATOM 9275  H HB1  . ALA A 1 17 ? 1.147   -6.949  6.893   1.00 1.21 ? 17  ALA A HB1  7  
ATOM 9276  H HB2  . ALA A 1 17 ? 0.564   -5.345  7.345   1.00 1.22 ? 17  ALA A HB2  7  
ATOM 9277  H HB3  . ALA A 1 17 ? 1.967   -6.039  8.159   1.00 1.33 ? 17  ALA A HB3  7  
ATOM 9278  N N    . GLY A 1 18 ? 2.753   -7.273  4.687   1.00 0.60 ? 18  GLY A N    7  
ATOM 9279  C CA   . GLY A 1 18 ? 2.615   -7.923  3.389   1.00 0.77 ? 18  GLY A CA   7  
ATOM 9280  C C    . GLY A 1 18 ? 3.476   -9.149  3.174   1.00 0.85 ? 18  GLY A C    7  
ATOM 9281  O O    . GLY A 1 18 ? 4.686   -9.083  3.364   1.00 1.29 ? 18  GLY A O    7  
ATOM 9282  H H    . GLY A 1 18 ? 3.147   -7.730  5.459   1.00 0.67 ? 18  GLY A H    7  
ATOM 9283  H HA2  . GLY A 1 18 ? 1.586   -8.209  3.267   1.00 0.96 ? 18  GLY A HA2  7  
ATOM 9284  H HA3  . GLY A 1 18 ? 2.856   -7.200  2.626   1.00 1.37 ? 18  GLY A HA3  7  
ATOM 9285  N N    . GLY A 1 19 ? 2.875   -10.262 2.737   1.00 1.01 ? 19  GLY A N    7  
ATOM 9286  C CA   . GLY A 1 19 ? 3.653   -11.462 2.467   1.00 1.61 ? 19  GLY A CA   7  
ATOM 9287  C C    . GLY A 1 19 ? 3.430   -12.560 3.482   1.00 0.89 ? 19  GLY A C    7  
ATOM 9288  O O    . GLY A 1 19 ? 3.000   -12.294 4.601   1.00 0.76 ? 19  GLY A O    7  
ATOM 9289  H H    . GLY A 1 19 ? 1.908   -10.285 2.581   1.00 1.01 ? 19  GLY A H    7  
ATOM 9290  H HA2  . GLY A 1 19 ? 3.385   -11.835 1.490   1.00 2.30 ? 19  GLY A HA2  7  
ATOM 9291  H HA3  . GLY A 1 19 ? 4.702   -11.202 2.462   1.00 2.32 ? 19  GLY A HA3  7  
ATOM 9292  N N    . VAL A 1 20 ? 3.726   -13.800 3.087   1.00 0.97 ? 20  VAL A N    7  
ATOM 9293  C CA   . VAL A 1 20 ? 3.561   -14.949 3.976   1.00 1.05 ? 20  VAL A CA   7  
ATOM 9294  C C    . VAL A 1 20 ? 4.528   -14.856 5.161   1.00 1.18 ? 20  VAL A C    7  
ATOM 9295  O O    . VAL A 1 20 ? 5.667   -14.406 5.005   1.00 1.35 ? 20  VAL A O    7  
ATOM 9296  C CB   . VAL A 1 20 ? 3.782   -16.290 3.240   1.00 1.68 ? 20  VAL A CB   7  
ATOM 9297  C CG1  . VAL A 1 20 ? 2.634   -16.570 2.280   1.00 1.76 ? 20  VAL A CG1  7  
ATOM 9298  C CG2  . VAL A 1 20 ? 5.116   -16.296 2.502   1.00 2.72 ? 20  VAL A CG2  7  
ATOM 9299  H H    . VAL A 1 20 ? 4.063   -13.941 2.177   1.00 1.38 ? 20  VAL A H    7  
ATOM 9300  H HA   . VAL A 1 20 ? 2.544   -14.928 4.349   1.00 0.98 ? 20  VAL A HA   7  
ATOM 9301  H HB   . VAL A 1 20 ? 3.802   -17.080 3.976   1.00 2.13 ? 20  VAL A HB   7  
ATOM 9302  H HG11 . VAL A 1 20 ? 2.928   -17.340 1.583   1.00 2.30 ? 20  VAL A HG11 7  
ATOM 9303  H HG12 . VAL A 1 20 ? 2.389   -15.668 1.738   1.00 1.97 ? 20  VAL A HG12 7  
ATOM 9304  H HG13 . VAL A 1 20 ? 1.771   -16.900 2.839   1.00 2.15 ? 20  VAL A HG13 7  
ATOM 9305  H HG21 . VAL A 1 20 ? 5.876   -15.852 3.125   1.00 3.33 ? 20  VAL A HG21 7  
ATOM 9306  H HG22 . VAL A 1 20 ? 5.024   -15.730 1.587   1.00 3.14 ? 20  VAL A HG22 7  
ATOM 9307  H HG23 . VAL A 1 20 ? 5.393   -17.314 2.267   1.00 3.02 ? 20  VAL A HG23 7  
ATOM 9308  N N    . GLY A 1 21 ? 4.067   -15.264 6.346   1.00 1.30 ? 21  GLY A N    7  
ATOM 9309  C CA   . GLY A 1 21 ? 4.905   -15.196 7.541   1.00 1.54 ? 21  GLY A CA   7  
ATOM 9310  C C    . GLY A 1 21 ? 4.905   -13.809 8.182   1.00 1.24 ? 21  GLY A C    7  
ATOM 9311  O O    . GLY A 1 21 ? 5.286   -13.655 9.344   1.00 1.56 ? 21  GLY A O    7  
ATOM 9312  H H    . GLY A 1 21 ? 3.149   -15.603 6.411   1.00 1.35 ? 21  GLY A H    7  
ATOM 9313  H HA2  . GLY A 1 21 ? 4.540   -15.912 8.262   1.00 1.90 ? 21  GLY A HA2  7  
ATOM 9314  H HA3  . GLY A 1 21 ? 5.918   -15.455 7.272   1.00 1.72 ? 21  GLY A HA3  7  
ATOM 9315  N N    . ASN A 1 22 ? 4.463   -12.809 7.419   1.00 0.73 ? 22  ASN A N    7  
ATOM 9316  C CA   . ASN A 1 22 ? 4.384   -11.425 7.881   1.00 0.61 ? 22  ASN A CA   7  
ATOM 9317  C C    . ASN A 1 22 ? 3.097   -10.767 7.360   1.00 0.65 ? 22  ASN A C    7  
ATOM 9318  O O    . ASN A 1 22 ? 3.043   -9.549  7.170   1.00 0.67 ? 22  ASN A O    7  
ATOM 9319  C CB   . ASN A 1 22 ? 5.617   -10.624 7.412   1.00 0.47 ? 22  ASN A CB   7  
ATOM 9320  C CG   . ASN A 1 22 ? 6.202   -11.136 6.107   1.00 0.74 ? 22  ASN A CG   7  
ATOM 9321  O OD1  . ASN A 1 22 ? 7.324   -11.639 6.075   1.00 1.27 ? 22  ASN A OD1  7  
ATOM 9322  N ND2  . ASN A 1 22 ? 5.448   -11.011 5.025   1.00 1.63 ? 22  ASN A ND2  7  
ATOM 9323  H H    . ASN A 1 22 ? 4.165   -13.010 6.514   1.00 0.63 ? 22  ASN A H    7  
ATOM 9324  H HA   . ASN A 1 22 ? 4.359   -11.435 8.960   1.00 0.88 ? 22  ASN A HA   7  
ATOM 9325  H HB2  . ASN A 1 22 ? 5.329   -9.595  7.271   1.00 0.82 ? 22  ASN A HB2  7  
ATOM 9326  H HB3  . ASN A 1 22 ? 6.388   -10.669 8.165   1.00 0.63 ? 22  ASN A HB3  7  
ATOM 9327  H HD21 . ASN A 1 22 ? 4.564   -10.601 5.121   1.00 2.15 ? 22  ASN A HD21 7  
ATOM 9328  H HD22 . ASN A 1 22 ? 5.805   -11.336 4.173   1.00 1.98 ? 22  ASN A HD22 7  
ATOM 9329  N N    . GLN A 1 23 ? 2.067   -11.591 7.105   1.00 0.77 ? 23  GLN A N    7  
ATOM 9330  C CA   . GLN A 1 23 ? 0.787   -11.110 6.576   1.00 0.94 ? 23  GLN A CA   7  
ATOM 9331  C C    . GLN A 1 23 ? 0.071   -10.170 7.542   1.00 0.88 ? 23  GLN A C    7  
ATOM 9332  O O    . GLN A 1 23 ? 0.178   -10.306 8.762   1.00 0.87 ? 23  GLN A O    7  
ATOM 9333  C CB   . GLN A 1 23 ? -0.139  -12.291 6.253   1.00 1.19 ? 23  GLN A CB   7  
ATOM 9334  C CG   . GLN A 1 23 ? 0.494   -13.360 5.373   1.00 1.42 ? 23  GLN A CG   7  
ATOM 9335  C CD   . GLN A 1 23 ? -0.260  -14.680 5.408   1.00 1.55 ? 23  GLN A CD   7  
ATOM 9336  O OE1  . GLN A 1 23 ? -1.068  -14.927 6.306   1.00 1.62 ? 23  GLN A OE1  7  
ATOM 9337  N NE2  . GLN A 1 23 ? 0.003   -15.539 4.430   1.00 2.34 ? 23  GLN A NE2  7  
ATOM 9338  H H    . GLN A 1 23 ? 2.172   -12.553 7.251   1.00 0.79 ? 23  GLN A H    7  
ATOM 9339  H HA   . GLN A 1 23 ? 0.992   -10.574 5.662   1.00 1.04 ? 23  GLN A HA   7  
ATOM 9340  H HB2  . GLN A 1 23 ? -0.444  -12.755 7.179   1.00 1.46 ? 23  GLN A HB2  7  
ATOM 9341  H HB3  . GLN A 1 23 ? -1.016  -11.914 5.747   1.00 1.49 ? 23  GLN A HB3  7  
ATOM 9342  H HG2  . GLN A 1 23 ? 0.513   -13.004 4.354   1.00 1.80 ? 23  GLN A HG2  7  
ATOM 9343  H HG3  . GLN A 1 23 ? 1.505   -13.534 5.711   1.00 1.68 ? 23  GLN A HG3  7  
ATOM 9344  H HE21 . GLN A 1 23 ? 0.657   -15.280 3.748   1.00 2.92 ? 23  GLN A HE21 7  
ATOM 9345  H HE22 . GLN A 1 23 ? -0.468  -16.398 4.430   1.00 2.51 ? 23  GLN A HE22 7  
ATOM 9346  N N    . HIS A 1 24 ? -0.667  -9.221  6.969   1.00 0.86 ? 24  HIS A N    7  
ATOM 9347  C CA   . HIS A 1 24 ? -1.426  -8.241  7.749   1.00 0.83 ? 24  HIS A CA   7  
ATOM 9348  C C    . HIS A 1 24 ? -2.837  -8.742  8.062   1.00 0.84 ? 24  HIS A C    7  
ATOM 9349  O O    . HIS A 1 24 ? -3.459  -8.296  9.028   1.00 0.92 ? 24  HIS A O    7  
ATOM 9350  C CB   . HIS A 1 24 ? -1.532  -6.922  6.981   1.00 0.85 ? 24  HIS A CB   7  
ATOM 9351  C CG   . HIS A 1 24 ? -2.107  -5.810  7.783   1.00 0.83 ? 24  HIS A CG   7  
ATOM 9352  N ND1  . HIS A 1 24 ? -1.383  -5.093  8.703   1.00 0.90 ? 24  HIS A ND1  7  
ATOM 9353  C CD2  . HIS A 1 24 ? -3.351  -5.284  7.786   1.00 0.81 ? 24  HIS A CD2  7  
ATOM 9354  C CE1  . HIS A 1 24 ? -2.151  -4.171  9.237   1.00 0.88 ? 24  HIS A CE1  7  
ATOM 9355  N NE2  . HIS A 1 24 ? -3.354  -4.261  8.700   1.00 0.82 ? 24  HIS A NE2  7  
ATOM 9356  H H    . HIS A 1 24 ? -0.698  -9.173  5.990   1.00 0.90 ? 24  HIS A H    7  
ATOM 9357  H HA   . HIS A 1 24 ? -0.900  -8.068  8.675   1.00 0.84 ? 24  HIS A HA   7  
ATOM 9358  H HB2  . HIS A 1 24 ? -0.558  -6.618  6.650   1.00 0.91 ? 24  HIS A HB2  7  
ATOM 9359  H HB3  . HIS A 1 24 ? -2.169  -7.061  6.124   1.00 0.87 ? 24  HIS A HB3  7  
ATOM 9360  H HD1  . HIS A 1 24 ? -0.444  -5.244  8.937   1.00 0.98 ? 24  HIS A HD1  7  
ATOM 9361  H HD2  . HIS A 1 24 ? -4.183  -5.609  7.174   1.00 0.82 ? 24  HIS A HD2  7  
ATOM 9362  H HE1  . HIS A 1 24 ? -1.844  -3.458  9.974   1.00 0.95 ? 24  HIS A HE1  7  
ATOM 9363  H HE2  . HIS A 1 24 ? -4.077  -3.611  8.822   1.00 0.82 ? 24  HIS A HE2  7  
ATOM 9364  N N    . ILE A 1 25 ? -3.334  -9.668  7.240   1.00 0.80 ? 25  ILE A N    7  
ATOM 9365  C CA   . ILE A 1 25 ? -4.670  -10.225 7.426   1.00 0.86 ? 25  ILE A CA   7  
ATOM 9366  C C    . ILE A 1 25 ? -4.729  -11.668 6.921   1.00 0.81 ? 25  ILE A C    7  
ATOM 9367  O O    . ILE A 1 25 ? -4.347  -11.947 5.783   1.00 0.80 ? 25  ILE A O    7  
ATOM 9368  C CB   . ILE A 1 25 ? -5.744  -9.382  6.696   1.00 0.95 ? 25  ILE A CB   7  
ATOM 9369  C CG1  . ILE A 1 25 ? -5.529  -7.885  6.955   1.00 1.01 ? 25  ILE A CG1  7  
ATOM 9370  C CG2  . ILE A 1 25 ? -7.138  -9.801  7.139   1.00 1.51 ? 25  ILE A CG2  7  
ATOM 9371  C CD1  . ILE A 1 25 ? -6.590  -6.999  6.338   1.00 1.16 ? 25  ILE A CD1  7  
ATOM 9372  H H    . ILE A 1 25 ? -2.781  -9.989  6.498   1.00 0.77 ? 25  ILE A H    7  
ATOM 9373  H HA   . ILE A 1 25 ? -4.890  -10.213 8.483   1.00 0.92 ? 25  ILE A HA   7  
ATOM 9374  H HB   . ILE A 1 25 ? -5.658  -9.570  5.636   1.00 1.28 ? 25  ILE A HB   7  
ATOM 9375  H HG12 . ILE A 1 25 ? -5.530  -7.708  8.019   1.00 1.40 ? 25  ILE A HG12 7  
ATOM 9376  H HG13 . ILE A 1 25 ? -4.573  -7.590  6.547   1.00 1.51 ? 25  ILE A HG13 7  
ATOM 9377  H HG21 . ILE A 1 25 ? -7.454  -10.660 6.568   1.00 1.96 ? 25  ILE A HG21 7  
ATOM 9378  H HG22 . ILE A 1 25 ? -7.826  -8.985  6.976   1.00 1.82 ? 25  ILE A HG22 7  
ATOM 9379  H HG23 . ILE A 1 25 ? -7.120  -10.051 8.189   1.00 1.95 ? 25  ILE A HG23 7  
ATOM 9380  H HD11 . ILE A 1 25 ? -7.489  -7.046  6.935   1.00 1.53 ? 25  ILE A HD11 7  
ATOM 9381  H HD12 . ILE A 1 25 ? -6.806  -7.340  5.336   1.00 1.45 ? 25  ILE A HD12 7  
ATOM 9382  H HD13 . ILE A 1 25 ? -6.234  -5.981  6.304   1.00 1.78 ? 25  ILE A HD13 7  
ATOM 9383  N N    . PRO A 1 26 ? -5.203  -12.609 7.769   1.00 0.82 ? 26  PRO A N    7  
ATOM 9384  C CA   . PRO A 1 26 ? -5.304  -14.028 7.404   1.00 0.82 ? 26  PRO A CA   7  
ATOM 9385  C C    . PRO A 1 26 ? -6.051  -14.242 6.089   1.00 0.86 ? 26  PRO A C    7  
ATOM 9386  O O    . PRO A 1 26 ? -7.183  -13.780 5.926   1.00 0.95 ? 26  PRO A O    7  
ATOM 9387  C CB   . PRO A 1 26 ? -6.081  -14.645 8.570   1.00 0.88 ? 26  PRO A CB   7  
ATOM 9388  C CG   . PRO A 1 26 ? -5.809  -13.744 9.724   1.00 0.98 ? 26  PRO A CG   7  
ATOM 9389  C CD   . PRO A 1 26 ? -5.670  -12.362 9.147   1.00 0.87 ? 26  PRO A CD   7  
ATOM 9390  H HA   . PRO A 1 26 ? -4.328  -14.488 7.338   1.00 0.79 ? 26  PRO A HA   7  
ATOM 9391  H HB2  . PRO A 1 26 ? -7.135  -14.673 8.330   1.00 1.04 ? 26  PRO A HB2  7  
ATOM 9392  H HB3  . PRO A 1 26 ? -5.722  -15.645 8.758   1.00 0.96 ? 26  PRO A HB3  7  
ATOM 9393  H HG2  . PRO A 1 26 ? -6.635  -13.779 10.419  1.00 1.27 ? 26  PRO A HG2  7  
ATOM 9394  H HG3  . PRO A 1 26 ? -4.893  -14.040 10.212  1.00 1.26 ? 26  PRO A HG3  7  
ATOM 9395  H HD2  . PRO A 1 26 ? -6.625  -11.856 9.146   1.00 0.94 ? 26  PRO A HD2  7  
ATOM 9396  H HD3  . PRO A 1 26 ? -4.941  -11.792 9.705   1.00 0.95 ? 26  PRO A HD3  7  
ATOM 9397  N N    . GLY A 1 27 ? -5.403  -14.936 5.153   1.00 0.85 ? 27  GLY A N    7  
ATOM 9398  C CA   . GLY A 1 27 ? -6.011  -15.196 3.859   1.00 0.94 ? 27  GLY A CA   7  
ATOM 9399  C C    . GLY A 1 27 ? -5.450  -14.304 2.767   1.00 0.92 ? 27  GLY A C    7  
ATOM 9400  O O    . GLY A 1 27 ? -4.913  -14.796 1.774   1.00 1.06 ? 27  GLY A O    7  
ATOM 9401  H H    . GLY A 1 27 ? -4.501  -15.271 5.342   1.00 0.81 ? 27  GLY A H    7  
ATOM 9402  H HA2  . GLY A 1 27 ? -5.835  -16.227 3.592   1.00 1.04 ? 27  GLY A HA2  7  
ATOM 9403  H HA3  . GLY A 1 27 ? -7.075  -15.031 3.932   1.00 1.00 ? 27  GLY A HA3  7  
ATOM 9404  N N    . ASP A 1 28 ? -5.572  -12.988 2.953   1.00 0.80 ? 28  ASP A N    7  
ATOM 9405  C CA   . ASP A 1 28 ? -5.072  -12.025 1.976   1.00 0.80 ? 28  ASP A CA   7  
ATOM 9406  C C    . ASP A 1 28 ? -3.602  -11.701 2.237   1.00 0.65 ? 28  ASP A C    7  
ATOM 9407  O O    . ASP A 1 28 ? -3.264  -11.040 3.221   1.00 0.57 ? 28  ASP A O    7  
ATOM 9408  C CB   . ASP A 1 28 ? -5.909  -10.744 2.006   1.00 0.91 ? 28  ASP A CB   7  
ATOM 9409  C CG   . ASP A 1 28 ? -6.118  -10.161 0.621   1.00 1.08 ? 28  ASP A CG   7  
ATOM 9410  O OD1  . ASP A 1 28 ? -7.104  -10.542 -0.041  1.00 1.48 ? 28  ASP A OD1  7  
ATOM 9411  O OD2  . ASP A 1 28 ? -5.292  -9.325  0.200   1.00 1.68 ? 28  ASP A OD2  7  
ATOM 9412  H H    . ASP A 1 28 ? -6.009  -12.659 3.768   1.00 0.76 ? 28  ASP A H    7  
ATOM 9413  H HA   . ASP A 1 28 ? -5.158  -12.476 0.999   1.00 0.92 ? 28  ASP A HA   7  
ATOM 9414  H HB2  . ASP A 1 28 ? -6.878  -10.963 2.434   1.00 1.05 ? 28  ASP A HB2  7  
ATOM 9415  H HB3  . ASP A 1 28 ? -5.410  -10.007 2.617   1.00 0.85 ? 28  ASP A HB3  7  
ATOM 9416  N N    . ASN A 1 29 ? -2.734  -12.181 1.347   1.00 0.69 ? 29  ASN A N    7  
ATOM 9417  C CA   . ASN A 1 29 ? -1.291  -11.956 1.472   1.00 0.63 ? 29  ASN A CA   7  
ATOM 9418  C C    . ASN A 1 29 ? -0.853  -10.641 0.813   1.00 0.59 ? 29  ASN A C    7  
ATOM 9419  O O    . ASN A 1 29 ? 0.344   -10.410 0.625   1.00 0.65 ? 29  ASN A O    7  
ATOM 9420  C CB   . ASN A 1 29 ? -0.514  -13.122 0.855   1.00 0.79 ? 29  ASN A CB   7  
ATOM 9421  C CG   . ASN A 1 29 ? -1.163  -14.473 1.115   1.00 1.36 ? 29  ASN A CG   7  
ATOM 9422  O OD1  . ASN A 1 29 ? -1.613  -14.755 2.225   1.00 2.11 ? 29  ASN A OD1  7  
ATOM 9423  N ND2  . ASN A 1 29 ? -1.213  -15.315 0.088   1.00 1.98 ? 29  ASN A ND2  7  
ATOM 9424  H H    . ASN A 1 29 ? -3.072  -12.708 0.592   1.00 0.80 ? 29  ASN A H    7  
ATOM 9425  H HA   . ASN A 1 29 ? -1.056  -11.909 2.527   1.00 0.58 ? 29  ASN A HA   7  
ATOM 9426  H HB2  . ASN A 1 29 ? -0.452  -12.974 -0.211  1.00 1.38 ? 29  ASN A HB2  7  
ATOM 9427  H HB3  . ASN A 1 29 ? 0.483   -13.136 1.272   1.00 1.03 ? 29  ASN A HB3  7  
ATOM 9428  H HD21 . ASN A 1 29 ? -0.835  -15.026 -0.769  1.00 2.27 ? 29  ASN A HD21 7  
ATOM 9429  H HD22 . ASN A 1 29 ? -1.626  -16.192 0.230   1.00 2.54 ? 29  ASN A HD22 7  
ATOM 9430  N N    . SER A 1 30 ? -1.814  -9.769  0.486   1.00 0.56 ? 30  SER A N    7  
ATOM 9431  C CA   . SER A 1 30 ? -1.499  -8.477  -0.123  1.00 0.56 ? 30  SER A CA   7  
ATOM 9432  C C    . SER A 1 30 ? -1.112  -7.480  0.961   1.00 0.55 ? 30  SER A C    7  
ATOM 9433  O O    . SER A 1 30 ? -1.437  -7.680  2.130   1.00 0.55 ? 30  SER A O    7  
ATOM 9434  C CB   . SER A 1 30 ? -2.690  -7.947  -0.925  1.00 0.60 ? 30  SER A CB   7  
ATOM 9435  O OG   . SER A 1 30 ? -3.228  -8.951  -1.770  1.00 1.39 ? 30  SER A OG   7  
ATOM 9436  H H    . SER A 1 30 ? -2.749  -9.986  0.677   1.00 0.58 ? 30  SER A H    7  
ATOM 9437  H HA   . SER A 1 30 ? -0.657  -8.617  -0.787  1.00 0.60 ? 30  SER A HA   7  
ATOM 9438  H HB2  . SER A 1 30 ? -3.462  -7.618  -0.245  1.00 1.26 ? 30  SER A HB2  7  
ATOM 9439  H HB3  . SER A 1 30 ? -2.370  -7.115  -1.535  1.00 1.02 ? 30  SER A HB3  7  
ATOM 9440  H HG   . SER A 1 30 ? -2.534  -9.304  -2.333  1.00 1.77 ? 30  SER A HG   7  
ATOM 9441  N N    . ILE A 1 31 ? -0.368  -6.439  0.593   1.00 0.55 ? 31  ILE A N    7  
ATOM 9442  C CA   . ILE A 1 31 ? 0.103   -5.460  1.572   1.00 0.55 ? 31  ILE A CA   7  
ATOM 9443  C C    . ILE A 1 31 ? -1.016  -4.524  2.062   1.00 0.57 ? 31  ILE A C    7  
ATOM 9444  O O    . ILE A 1 31 ? -1.716  -3.904  1.267   1.00 0.65 ? 31  ILE A O    7  
ATOM 9445  C CB   . ILE A 1 31 ? 1.268   -4.613  0.988   1.00 0.53 ? 31  ILE A CB   7  
ATOM 9446  C CG1  . ILE A 1 31 ? 2.595   -5.378  1.047   1.00 0.62 ? 31  ILE A CG1  7  
ATOM 9447  C CG2  . ILE A 1 31 ? 1.403   -3.284  1.724   1.00 0.60 ? 31  ILE A CG2  7  
ATOM 9448  C CD1  . ILE A 1 31 ? 2.566   -6.744  0.393   1.00 0.80 ? 31  ILE A CD1  7  
ATOM 9449  H H    . ILE A 1 31 ? -0.069  -6.355  -0.340  1.00 0.57 ? 31  ILE A H    7  
ATOM 9450  H HA   . ILE A 1 31 ? 0.478   -6.011  2.416   1.00 0.54 ? 31  ILE A HA   7  
ATOM 9451  H HB   . ILE A 1 31 ? 1.043   -4.396  -0.044  1.00 0.74 ? 31  ILE A HB   7  
ATOM 9452  H HG12 . ILE A 1 31 ? 3.348   -4.797  0.540   1.00 1.20 ? 31  ILE A HG12 7  
ATOM 9453  H HG13 . ILE A 1 31 ? 2.883   -5.509  2.078   1.00 1.19 ? 31  ILE A HG13 7  
ATOM 9454  H HG21 . ILE A 1 31 ? 0.606   -2.622  1.418   1.00 1.13 ? 31  ILE A HG21 7  
ATOM 9455  H HG22 . ILE A 1 31 ? 2.355   -2.834  1.484   1.00 1.21 ? 31  ILE A HG22 7  
ATOM 9456  H HG23 . ILE A 1 31 ? 1.343   -3.453  2.788   1.00 1.13 ? 31  ILE A HG23 7  
ATOM 9457  H HD11 . ILE A 1 31 ? 3.441   -7.303  0.689   1.00 1.15 ? 31  ILE A HD11 7  
ATOM 9458  H HD12 . ILE A 1 31 ? 2.562   -6.629  -0.679  1.00 1.28 ? 31  ILE A HD12 7  
ATOM 9459  H HD13 . ILE A 1 31 ? 1.679   -7.277  0.702   1.00 1.46 ? 31  ILE A HD13 7  
ATOM 9460  N N    . TYR A 1 32 ? -1.154  -4.427  3.392   1.00 0.60 ? 32  TYR A N    7  
ATOM 9461  C CA   . TYR A 1 32 ? -2.158  -3.567  4.020   1.00 0.62 ? 32  TYR A CA   7  
ATOM 9462  C C    . TYR A 1 32 ? -1.492  -2.509  4.899   1.00 0.59 ? 32  TYR A C    7  
ATOM 9463  O O    . TYR A 1 32 ? -0.458  -2.766  5.512   1.00 0.61 ? 32  TYR A O    7  
ATOM 9464  C CB   . TYR A 1 32 ? -3.104  -4.399  4.883   1.00 0.69 ? 32  TYR A CB   7  
ATOM 9465  C CG   . TYR A 1 32 ? -4.074  -5.249  4.104   1.00 0.71 ? 32  TYR A CG   7  
ATOM 9466  C CD1  . TYR A 1 32 ? -3.645  -6.382  3.432   1.00 1.28 ? 32  TYR A CD1  7  
ATOM 9467  C CD2  . TYR A 1 32 ? -5.418  -4.920  4.049   1.00 1.34 ? 32  TYR A CD2  7  
ATOM 9468  C CE1  . TYR A 1 32 ? -4.527  -7.168  2.721   1.00 1.30 ? 32  TYR A CE1  7  
ATOM 9469  C CE2  . TYR A 1 32 ? -6.313  -5.698  3.344   1.00 1.38 ? 32  TYR A CE2  7  
ATOM 9470  C CZ   . TYR A 1 32 ? -5.865  -6.823  2.681   1.00 0.80 ? 32  TYR A CZ   7  
ATOM 9471  O OH   . TYR A 1 32 ? -6.755  -7.601  1.977   1.00 0.86 ? 32  TYR A OH   7  
ATOM 9472  H H    . TYR A 1 32 ? -0.557  -4.942  3.969   1.00 0.66 ? 32  TYR A H    7  
ATOM 9473  H HA   . TYR A 1 32 ? -2.722  -3.077  3.242   1.00 0.64 ? 32  TYR A HA   7  
ATOM 9474  H HB2  . TYR A 1 32 ? -2.520  -5.058  5.504   1.00 0.68 ? 32  TYR A HB2  7  
ATOM 9475  H HB3  . TYR A 1 32 ? -3.678  -3.735  5.514   1.00 0.74 ? 32  TYR A HB3  7  
ATOM 9476  H HD1  . TYR A 1 32 ? -2.601  -6.646  3.472   1.00 2.05 ? 32  TYR A HD1  7  
ATOM 9477  H HD2  . TYR A 1 32 ? -5.764  -4.039  4.567   1.00 2.10 ? 32  TYR A HD2  7  
ATOM 9478  H HE1  . TYR A 1 32 ? -4.166  -8.048  2.200   1.00 2.06 ? 32  TYR A HE1  7  
ATOM 9479  H HE2  . TYR A 1 32 ? -7.357  -5.421  3.315   1.00 2.17 ? 32  TYR A HE2  7  
ATOM 9480  H HH   . TYR A 1 32 ? -7.218  -8.186  2.583   1.00 1.32 ? 32  TYR A HH   7  
ATOM 9481  N N    . VAL A 1 33 ? -2.107  -1.329  4.974   1.00 0.57 ? 33  VAL A N    7  
ATOM 9482  C CA   . VAL A 1 33 ? -1.586  -0.237  5.799   1.00 0.55 ? 33  VAL A CA   7  
ATOM 9483  C C    . VAL A 1 33 ? -1.969  -0.444  7.266   1.00 0.59 ? 33  VAL A C    7  
ATOM 9484  O O    . VAL A 1 33 ? -3.128  -0.721  7.582   1.00 0.65 ? 33  VAL A O    7  
ATOM 9485  C CB   . VAL A 1 33 ? -2.096  1.139   5.316   1.00 0.59 ? 33  VAL A CB   7  
ATOM 9486  C CG1  . VAL A 1 33 ? -1.686  2.245   6.280   1.00 0.62 ? 33  VAL A CG1  7  
ATOM 9487  C CG2  . VAL A 1 33 ? -1.581  1.432   3.913   1.00 0.56 ? 33  VAL A CG2  7  
ATOM 9488  H H    . VAL A 1 33 ? -2.930  -1.194  4.481   1.00 0.61 ? 33  VAL A H    7  
ATOM 9489  H HA   . VAL A 1 33 ? -0.508  -0.247  5.717   1.00 0.51 ? 33  VAL A HA   7  
ATOM 9490  H HB   . VAL A 1 33 ? -3.176  1.107   5.278   1.00 0.67 ? 33  VAL A HB   7  
ATOM 9491  H HG11 . VAL A 1 33 ? -2.132  3.177   5.967   1.00 1.13 ? 33  VAL A HG11 7  
ATOM 9492  H HG12 . VAL A 1 33 ? -0.611  2.343   6.278   1.00 1.12 ? 33  VAL A HG12 7  
ATOM 9493  H HG13 . VAL A 1 33 ? -2.024  1.999   7.275   1.00 1.21 ? 33  VAL A HG13 7  
ATOM 9494  H HG21 . VAL A 1 33 ? -1.539  2.500   3.761   1.00 1.23 ? 33  VAL A HG21 7  
ATOM 9495  H HG22 . VAL A 1 33 ? -2.244  0.991   3.186   1.00 0.96 ? 33  VAL A HG22 7  
ATOM 9496  H HG23 . VAL A 1 33 ? -0.592  1.015   3.799   1.00 1.26 ? 33  VAL A HG23 7  
ATOM 9497  N N    . THR A 1 34 ? -0.976  -0.343  8.151   1.00 0.62 ? 34  THR A N    7  
ATOM 9498  C CA   . THR A 1 34 ? -1.193  -0.559  9.585   1.00 0.71 ? 34  THR A CA   7  
ATOM 9499  C C    . THR A 1 34 ? -1.311  0.750   10.384  1.00 0.72 ? 34  THR A C    7  
ATOM 9500  O O    . THR A 1 34 ? -1.993  0.778   11.408  1.00 0.84 ? 34  THR A O    7  
ATOM 9501  C CB   . THR A 1 34 ? -0.067  -1.434  10.167  1.00 0.74 ? 34  THR A CB   7  
ATOM 9502  O OG1  . THR A 1 34 ? 0.931   -0.645  10.792  1.00 1.39 ? 34  THR A OG1  7  
ATOM 9503  C CG2  . THR A 1 34 ? 0.623   -2.305  9.135   1.00 1.29 ? 34  THR A CG2  7  
ATOM 9504  H H    . THR A 1 34 ? -0.073  -0.153  7.820   1.00 0.62 ? 34  THR A H    7  
ATOM 9505  H HA   . THR A 1 34 ? -2.123  -1.097  9.688   1.00 0.81 ? 34  THR A HA   7  
ATOM 9506  H HB   . THR A 1 34 ? -0.492  -2.089  10.915  1.00 1.08 ? 34  THR A HB   7  
ATOM 9507  H HG1  . THR A 1 34 ? 1.318   -0.050  10.147  1.00 1.62 ? 34  THR A HG1  7  
ATOM 9508  H HG21 . THR A 1 34 ? 1.291   -2.990  9.630   1.00 1.65 ? 34  THR A HG21 7  
ATOM 9509  H HG22 . THR A 1 34 ? 1.188   -1.680  8.459   1.00 1.98 ? 34  THR A HG22 7  
ATOM 9510  H HG23 . THR A 1 34 ? -0.117  -2.860  8.578   1.00 1.56 ? 34  THR A HG23 7  
ATOM 9511  N N    . LYS A 1 35 ? -0.663  1.825   9.916   1.00 0.65 ? 35  LYS A N    7  
ATOM 9512  C CA   . LYS A 1 35 ? -0.717  3.123   10.611  1.00 0.71 ? 35  LYS A CA   7  
ATOM 9513  C C    . LYS A 1 35 ? -0.259  4.259   9.703   1.00 0.69 ? 35  LYS A C    7  
ATOM 9514  O O    . LYS A 1 35 ? 0.842   4.218   9.159   1.00 0.62 ? 35  LYS A O    7  
ATOM 9515  C CB   . LYS A 1 35 ? 0.172   3.118   11.863  1.00 0.72 ? 35  LYS A CB   7  
ATOM 9516  C CG   . LYS A 1 35 ? -0.284  2.166   12.959  1.00 1.32 ? 35  LYS A CG   7  
ATOM 9517  C CD   . LYS A 1 35 ? 0.433   2.441   14.270  1.00 1.46 ? 35  LYS A CD   7  
ATOM 9518  C CE   . LYS A 1 35 ? -0.086  1.547   15.387  1.00 2.02 ? 35  LYS A CE   7  
ATOM 9519  N NZ   . LYS A 1 35 ? 1.013   0.798   16.060  1.00 2.54 ? 35  LYS A NZ   7  
ATOM 9520  H H    . LYS A 1 35 ? -0.156  1.750   9.081   1.00 0.59 ? 35  LYS A H    7  
ATOM 9521  H HA   . LYS A 1 35 ? -1.740  3.300   10.906  1.00 0.80 ? 35  LYS A HA   7  
ATOM 9522  H HB2  . LYS A 1 35 ? 1.173   2.844   11.574  1.00 0.98 ? 35  LYS A HB2  7  
ATOM 9523  H HB3  . LYS A 1 35 ? 0.191   4.117   12.273  1.00 1.18 ? 35  LYS A HB3  7  
ATOM 9524  H HG2  . LYS A 1 35 ? -1.346  2.288   13.109  1.00 1.91 ? 35  LYS A HG2  7  
ATOM 9525  H HG3  . LYS A 1 35 ? -0.075  1.153   12.650  1.00 2.08 ? 35  LYS A HG3  7  
ATOM 9526  H HD2  . LYS A 1 35 ? 1.489   2.258   14.137  1.00 1.89 ? 35  LYS A HD2  7  
ATOM 9527  H HD3  . LYS A 1 35 ? 0.277   3.473   14.546  1.00 1.86 ? 35  LYS A HD3  7  
ATOM 9528  H HE2  . LYS A 1 35 ? -0.588  2.162   16.118  1.00 2.47 ? 35  LYS A HE2  7  
ATOM 9529  H HE3  . LYS A 1 35 ? -0.788  0.840   14.969  1.00 2.40 ? 35  LYS A HE3  7  
ATOM 9530  H HZ1  . LYS A 1 35 ? 1.491   0.173   15.379  1.00 2.55 ? 35  LYS A HZ1  7  
ATOM 9531  H HZ2  . LYS A 1 35 ? 0.628   0.218   16.835  1.00 2.90 ? 35  LYS A HZ2  7  
ATOM 9532  H HZ3  . LYS A 1 35 ? 1.710   1.461   16.454  1.00 3.18 ? 35  LYS A HZ3  7  
ATOM 9533  N N    . ILE A 1 36 ? -1.096  5.283   9.557   1.00 0.86 ? 36  ILE A N    7  
ATOM 9534  C CA   . ILE A 1 36 ? -0.749  6.431   8.726   1.00 0.92 ? 36  ILE A CA   7  
ATOM 9535  C C    . ILE A 1 36 ? -0.265  7.600   9.590   1.00 0.98 ? 36  ILE A C    7  
ATOM 9536  O O    . ILE A 1 36 ? -0.961  8.035   10.510  1.00 1.06 ? 36  ILE A O    7  
ATOM 9537  C CB   . ILE A 1 36 ? -1.941  6.875   7.847   1.00 1.03 ? 36  ILE A CB   7  
ATOM 9538  C CG1  . ILE A 1 36 ? -2.096  5.919   6.661   1.00 1.40 ? 36  ILE A CG1  7  
ATOM 9539  C CG2  . ILE A 1 36 ? -1.753  8.306   7.356   1.00 1.12 ? 36  ILE A CG2  7  
ATOM 9540  C CD1  . ILE A 1 36 ? -3.367  6.127   5.871   1.00 1.35 ? 36  ILE A CD1  7  
ATOM 9541  H H    . ILE A 1 36 ? -1.959  5.270   10.022  1.00 0.98 ? 36  ILE A H    7  
ATOM 9542  H HA   . ILE A 1 36 ? 0.053   6.125   8.072   1.00 0.85 ? 36  ILE A HA   7  
ATOM 9543  H HB   . ILE A 1 36 ? -2.837  6.841   8.448   1.00 0.95 ? 36  ILE A HB   7  
ATOM 9544  H HG12 . ILE A 1 36 ? -1.262  6.054   5.988   1.00 1.63 ? 36  ILE A HG12 7  
ATOM 9545  H HG13 . ILE A 1 36 ? -2.094  4.902   7.026   1.00 1.62 ? 36  ILE A HG13 7  
ATOM 9546  H HG21 . ILE A 1 36 ? -2.470  8.515   6.576   1.00 1.46 ? 36  ILE A HG21 7  
ATOM 9547  H HG22 . ILE A 1 36 ? -0.753  8.426   6.966   1.00 1.45 ? 36  ILE A HG22 7  
ATOM 9548  H HG23 . ILE A 1 36 ? -1.904  8.992   8.177   1.00 1.44 ? 36  ILE A HG23 7  
ATOM 9549  H HD11 . ILE A 1 36 ? -3.757  7.115   6.068   1.00 1.87 ? 36  ILE A HD11 7  
ATOM 9550  H HD12 . ILE A 1 36 ? -4.096  5.388   6.164   1.00 1.71 ? 36  ILE A HD12 7  
ATOM 9551  H HD13 . ILE A 1 36 ? -3.155  6.026   4.817   1.00 1.41 ? 36  ILE A HD13 7  
ATOM 9552  N N    . ILE A 1 37 ? 0.933   8.103   9.281   1.00 1.03 ? 37  ILE A N    7  
ATOM 9553  C CA   . ILE A 1 37 ? 1.523   9.221   10.013  1.00 1.10 ? 37  ILE A CA   7  
ATOM 9554  C C    . ILE A 1 37 ? 0.898   10.548  9.576   1.00 1.10 ? 37  ILE A C    7  
ATOM 9555  O O    . ILE A 1 37 ? 0.510   10.707  8.416   1.00 1.37 ? 37  ILE A O    7  
ATOM 9556  C CB   . ILE A 1 37 ? 3.062   9.263   9.809   1.00 1.14 ? 37  ILE A CB   7  
ATOM 9557  C CG1  . ILE A 1 37 ? 3.743   8.221   10.700  1.00 1.47 ? 37  ILE A CG1  7  
ATOM 9558  C CG2  . ILE A 1 37 ? 3.627   10.651  10.087  1.00 1.32 ? 37  ILE A CG2  7  
ATOM 9559  C CD1  . ILE A 1 37 ? 3.931   6.877   10.027  1.00 1.68 ? 37  ILE A CD1  7  
ATOM 9560  H H    . ILE A 1 37 ? 1.435   7.715   8.534   1.00 1.06 ? 37  ILE A H    7  
ATOM 9561  H HA   . ILE A 1 37 ? 1.325   9.070   11.066  1.00 1.17 ? 37  ILE A HA   7  
ATOM 9562  H HB   . ILE A 1 37 ? 3.268   9.027   8.777   1.00 1.07 ? 37  ILE A HB   7  
ATOM 9563  H HG12 . ILE A 1 37 ? 4.718   8.583   10.988  1.00 1.63 ? 37  ILE A HG12 7  
ATOM 9564  H HG13 . ILE A 1 37 ? 3.145   8.068   11.587  1.00 1.84 ? 37  ILE A HG13 7  
ATOM 9565  H HG21 . ILE A 1 37 ? 3.242   11.016  11.027  1.00 1.40 ? 37  ILE A HG21 7  
ATOM 9566  H HG22 . ILE A 1 37 ? 3.337   11.323  9.293   1.00 1.79 ? 37  ILE A HG22 7  
ATOM 9567  H HG23 . ILE A 1 37 ? 4.704   10.597  10.135  1.00 1.90 ? 37  ILE A HG23 7  
ATOM 9568  H HD11 . ILE A 1 37 ? 4.552   6.248   10.648  1.00 2.18 ? 37  ILE A HD11 7  
ATOM 9569  H HD12 . ILE A 1 37 ? 4.406   7.017   9.068   1.00 1.92 ? 37  ILE A HD12 7  
ATOM 9570  H HD13 . ILE A 1 37 ? 2.968   6.407   9.887   1.00 1.93 ? 37  ILE A HD13 7  
ATOM 9571  N N    . GLU A 1 38 ? 0.801   11.494  10.514  1.00 0.96 ? 38  GLU A N    7  
ATOM 9572  C CA   . GLU A 1 38 ? 0.220   12.808  10.231  1.00 0.99 ? 38  GLU A CA   7  
ATOM 9573  C C    . GLU A 1 38 ? 1.012   13.547  9.153   1.00 1.31 ? 38  GLU A C    7  
ATOM 9574  O O    . GLU A 1 38 ? 2.239   13.442  9.084   1.00 1.64 ? 38  GLU A O    7  
ATOM 9575  C CB   . GLU A 1 38 ? 0.164   13.651  11.508  1.00 1.23 ? 38  GLU A CB   7  
ATOM 9576  C CG   . GLU A 1 38 ? -1.048  13.357  12.377  1.00 1.71 ? 38  GLU A CG   7  
ATOM 9577  C CD   . GLU A 1 38 ? -0.873  13.837  13.805  1.00 2.41 ? 38  GLU A CD   7  
ATOM 9578  O OE1  . GLU A 1 38 ? -0.356  13.058  14.634  1.00 3.11 ? 38  GLU A OE1  7  
ATOM 9579  O OE2  . GLU A 1 38 ? -1.252  14.991  14.094  1.00 2.79 ? 38  GLU A OE2  7  
ATOM 9580  H H    . GLU A 1 38 ? 1.128   11.303  11.418  1.00 0.97 ? 38  GLU A H    7  
ATOM 9581  H HA   . GLU A 1 38 ? -0.786  12.650  9.873   1.00 1.23 ? 38  GLU A HA   7  
ATOM 9582  H HB2  . GLU A 1 38 ? 1.053   13.461  12.092  1.00 1.66 ? 38  GLU A HB2  7  
ATOM 9583  H HB3  . GLU A 1 38 ? 0.139   14.695  11.235  1.00 1.49 ? 38  GLU A HB3  7  
ATOM 9584  H HG2  . GLU A 1 38 ? -1.909  13.850  11.952  1.00 2.01 ? 38  GLU A HG2  7  
ATOM 9585  H HG3  . GLU A 1 38 ? -1.216  12.289  12.389  1.00 1.90 ? 38  GLU A HG3  7  
ATOM 9586  N N    . GLY A 1 39 ? 0.294   14.299  8.317   1.00 1.69 ? 39  GLY A N    7  
ATOM 9587  C CA   . GLY A 1 39 ? 0.924   15.059  7.248   1.00 2.36 ? 39  GLY A CA   7  
ATOM 9588  C C    . GLY A 1 39 ? 1.660   14.190  6.234   1.00 2.68 ? 39  GLY A C    7  
ATOM 9589  O O    . GLY A 1 39 ? 2.535   14.683  5.520   1.00 3.15 ? 39  GLY A O    7  
ATOM 9590  H H    . GLY A 1 39 ? -0.676  14.345  8.433   1.00 1.72 ? 39  GLY A H    7  
ATOM 9591  H HA2  . GLY A 1 39 ? 0.160   15.619  6.728   1.00 2.72 ? 39  GLY A HA2  7  
ATOM 9592  H HA3  . GLY A 1 39 ? 1.624   15.753  7.684   1.00 2.45 ? 39  GLY A HA3  7  
ATOM 9593  N N    . GLY A 1 40 ? 1.311   12.902  6.170   1.00 2.49 ? 40  GLY A N    7  
ATOM 9594  C CA   . GLY A 1 40 ? 1.958   11.997  5.234   1.00 2.80 ? 40  GLY A CA   7  
ATOM 9595  C C    . GLY A 1 40 ? 1.211   11.880  3.917   1.00 2.61 ? 40  GLY A C    7  
ATOM 9596  O O    . GLY A 1 40 ? 0.085   12.362  3.792   1.00 2.37 ? 40  GLY A O    7  
ATOM 9597  H H    . GLY A 1 40 ? 0.609   12.563  6.762   1.00 2.19 ? 40  GLY A H    7  
ATOM 9598  H HA2  . GLY A 1 40 ? 2.958   12.354  5.037   1.00 3.27 ? 40  GLY A HA2  7  
ATOM 9599  H HA3  . GLY A 1 40 ? 2.022   11.017  5.685   1.00 2.80 ? 40  GLY A HA3  7  
ATOM 9600  N N    . ALA A 1 41 ? 1.849   11.243  2.933   1.00 2.83 ? 41  ALA A N    7  
ATOM 9601  C CA   . ALA A 1 41 ? 1.260   11.055  1.603   1.00 2.70 ? 41  ALA A CA   7  
ATOM 9602  C C    . ALA A 1 41 ? -0.199  10.600  1.682   1.00 2.11 ? 41  ALA A C    7  
ATOM 9603  O O    . ALA A 1 41 ? -1.092  11.280  1.180   1.00 2.06 ? 41  ALA A O    7  
ATOM 9604  C CB   . ALA A 1 41 ? 2.080   10.050  0.805   1.00 3.00 ? 41  ALA A CB   7  
ATOM 9605  H H    . ALA A 1 41 ? 2.750   10.894  3.103   1.00 3.11 ? 41  ALA A H    7  
ATOM 9606  H HA   . ALA A 1 41 ? 1.301   12.003  1.087   1.00 2.91 ? 41  ALA A HA   7  
ATOM 9607  H HB1  . ALA A 1 41 ? 3.118   10.347  0.809   1.00 3.45 ? 41  ALA A HB1  7  
ATOM 9608  H HB2  . ALA A 1 41 ? 1.719   10.018  -0.211  1.00 3.26 ? 41  ALA A HB2  7  
ATOM 9609  H HB3  . ALA A 1 41 ? 1.984   9.071   1.254   1.00 2.99 ? 41  ALA A HB3  7  
ATOM 9610  N N    . ALA A 1 42 ? -0.430  9.445   2.313   1.00 1.82 ? 42  ALA A N    7  
ATOM 9611  C CA   . ALA A 1 42 ? -1.781  8.900   2.453   1.00 1.36 ? 42  ALA A CA   7  
ATOM 9612  C C    . ALA A 1 42 ? -2.668  9.816   3.297   1.00 1.16 ? 42  ALA A C    7  
ATOM 9613  O O    . ALA A 1 42 ? -3.791  10.133  2.906   1.00 1.02 ? 42  ALA A O    7  
ATOM 9614  C CB   . ALA A 1 42 ? -1.729  7.505   3.061   1.00 1.50 ? 42  ALA A CB   7  
ATOM 9615  H H    . ALA A 1 42 ? 0.326   8.949   2.692   1.00 2.06 ? 42  ALA A H    7  
ATOM 9616  H HA   . ALA A 1 42 ? -2.209  8.818   1.464   1.00 1.30 ? 42  ALA A HA   7  
ATOM 9617  H HB1  . ALA A 1 42 ? -2.727  7.191   3.329   1.00 1.77 ? 42  ALA A HB1  7  
ATOM 9618  H HB2  . ALA A 1 42 ? -1.107  7.520   3.944   1.00 1.88 ? 42  ALA A HB2  7  
ATOM 9619  H HB3  . ALA A 1 42 ? -1.316  6.814   2.342   1.00 1.93 ? 42  ALA A HB3  7  
ATOM 9620  N N    . HIS A 1 43 ? -2.154  10.227  4.458   1.00 1.34 ? 43  HIS A N    7  
ATOM 9621  C CA   . HIS A 1 43 ? -2.889  11.103  5.375   1.00 1.21 ? 43  HIS A CA   7  
ATOM 9622  C C    . HIS A 1 43 ? -3.419  12.352  4.663   1.00 1.08 ? 43  HIS A C    7  
ATOM 9623  O O    . HIS A 1 43 ? -4.601  12.680  4.770   1.00 1.15 ? 43  HIS A O    7  
ATOM 9624  C CB   . HIS A 1 43 ? -1.982  11.516  6.537   1.00 1.39 ? 43  HIS A CB   7  
ATOM 9625  C CG   . HIS A 1 43 ? -2.688  12.267  7.622   1.00 1.16 ? 43  HIS A CG   7  
ATOM 9626  N ND1  . HIS A 1 43 ? -2.804  13.641  7.631   1.00 1.34 ? 43  HIS A ND1  7  
ATOM 9627  C CD2  . HIS A 1 43 ? -3.310  11.831  8.743   1.00 1.15 ? 43  HIS A CD2  7  
ATOM 9628  C CE1  . HIS A 1 43 ? -3.460  14.018  8.712   1.00 1.22 ? 43  HIS A CE1  7  
ATOM 9629  N NE2  . HIS A 1 43 ? -3.781  12.940  9.403   1.00 1.28 ? 43  HIS A NE2  7  
ATOM 9630  H H    . HIS A 1 43 ? -1.256  9.926   4.711   1.00 1.62 ? 43  HIS A H    7  
ATOM 9631  H HA   . HIS A 1 43 ? -3.725  10.545  5.766   1.00 1.26 ? 43  HIS A HA   7  
ATOM 9632  H HB2  . HIS A 1 43 ? -1.547  10.633  6.977   1.00 1.74 ? 43  HIS A HB2  7  
ATOM 9633  H HB3  . HIS A 1 43 ? -1.191  12.147  6.157   1.00 1.58 ? 43  HIS A HB3  7  
ATOM 9634  H HD1  . HIS A 1 43 ? -2.454  14.249  6.946   1.00 1.69 ? 43  HIS A HD1  7  
ATOM 9635  H HD2  . HIS A 1 43 ? -3.416  10.803  9.058   1.00 1.32 ? 43  HIS A HD2  7  
ATOM 9636  H HE1  . HIS A 1 43 ? -3.690  15.037  8.986   1.00 1.34 ? 43  HIS A HE1  7  
ATOM 9637  H HE2  . HIS A 1 43 ? -4.197  12.940  10.290  1.00 1.60 ? 43  HIS A HE2  7  
ATOM 9638  N N    . LYS A 1 44 ? -2.534  13.044  3.944   1.00 1.15 ? 44  LYS A N    7  
ATOM 9639  C CA   . LYS A 1 44 ? -2.902  14.261  3.219   1.00 1.31 ? 44  LYS A CA   7  
ATOM 9640  C C    . LYS A 1 44 ? -3.845  13.957  2.053   1.00 1.39 ? 44  LYS A C    7  
ATOM 9641  O O    . LYS A 1 44 ? -4.789  14.709  1.800   1.00 1.46 ? 44  LYS A O    7  
ATOM 9642  C CB   . LYS A 1 44 ? -1.648  14.971  2.700   1.00 1.74 ? 44  LYS A CB   7  
ATOM 9643  C CG   . LYS A 1 44 ? -0.707  15.435  3.803   1.00 1.89 ? 44  LYS A CG   7  
ATOM 9644  C CD   . LYS A 1 44 ? -0.365  16.911  3.664   1.00 2.36 ? 44  LYS A CD   7  
ATOM 9645  C CE   . LYS A 1 44 ? 1.031   17.212  4.188   1.00 2.17 ? 44  LYS A CE   7  
ATOM 9646  N NZ   . LYS A 1 44 ? 1.523   18.542  3.731   1.00 2.66 ? 44  LYS A NZ   7  
ATOM 9647  H H    . LYS A 1 44 ? -1.606  12.729  3.903   1.00 1.26 ? 44  LYS A H    7  
ATOM 9648  H HA   . LYS A 1 44 ? -3.411  14.915  3.912   1.00 1.30 ? 44  LYS A HA   7  
ATOM 9649  H HB2  . LYS A 1 44 ? -1.106  14.294  2.058   1.00 2.10 ? 44  LYS A HB2  7  
ATOM 9650  H HB3  . LYS A 1 44 ? -1.949  15.835  2.126   1.00 2.02 ? 44  LYS A HB3  7  
ATOM 9651  H HG2  . LYS A 1 44 ? -1.182  15.276  4.760   1.00 1.94 ? 44  LYS A HG2  7  
ATOM 9652  H HG3  . LYS A 1 44 ? 0.204   14.857  3.752   1.00 2.08 ? 44  LYS A HG3  7  
ATOM 9653  H HD2  . LYS A 1 44 ? -0.413  17.184  2.620   1.00 2.71 ? 44  LYS A HD2  7  
ATOM 9654  H HD3  . LYS A 1 44 ? -1.084  17.491  4.224   1.00 2.84 ? 44  LYS A HD3  7  
ATOM 9655  H HE2  . LYS A 1 44 ? 1.007   17.199  5.267   1.00 2.08 ? 44  LYS A HE2  7  
ATOM 9656  H HE3  . LYS A 1 44 ? 1.707   16.446  3.835   1.00 2.50 ? 44  LYS A HE3  7  
ATOM 9657  H HZ1  . LYS A 1 44 ? 0.895   19.294  4.077   1.00 3.12 ? 44  LYS A HZ1  7  
ATOM 9658  H HZ2  . LYS A 1 44 ? 1.547   18.576  2.691   1.00 3.21 ? 44  LYS A HZ2  7  
ATOM 9659  H HZ3  . LYS A 1 44 ? 2.483   18.712  4.094   1.00 2.66 ? 44  LYS A HZ3  7  
ATOM 9660  N N    . ASP A 1 45 ? -3.584  12.854  1.346   1.00 1.59 ? 45  ASP A N    7  
ATOM 9661  C CA   . ASP A 1 45 ? -4.409  12.451  0.206   1.00 1.86 ? 45  ASP A CA   7  
ATOM 9662  C C    . ASP A 1 45 ? -5.849  12.171  0.636   1.00 1.89 ? 45  ASP A C    7  
ATOM 9663  O O    . ASP A 1 45 ? -6.794  12.712  0.059   1.00 1.97 ? 45  ASP A O    7  
ATOM 9664  C CB   . ASP A 1 45 ? -3.815  11.207  -0.463  1.00 2.33 ? 45  ASP A CB   7  
ATOM 9665  C CG   . ASP A 1 45 ? -4.212  11.082  -1.923  1.00 2.69 ? 45  ASP A CG   7  
ATOM 9666  O OD1  . ASP A 1 45 ? -5.373  10.710  -2.193  1.00 2.80 ? 45  ASP A OD1  7  
ATOM 9667  O OD2  . ASP A 1 45 ? -3.359  11.351  -2.795  1.00 3.24 ? 45  ASP A OD2  7  
ATOM 9668  H H    . ASP A 1 45 ? -2.818  12.298  1.598   1.00 1.67 ? 45  ASP A H    7  
ATOM 9669  H HA   . ASP A 1 45 ? -4.410  13.264  -0.504  1.00 1.92 ? 45  ASP A HA   7  
ATOM 9670  H HB2  . ASP A 1 45 ? -2.738  11.256  -0.408  1.00 2.40 ? 45  ASP A HB2  7  
ATOM 9671  H HB3  . ASP A 1 45 ? -4.156  10.326  0.060   1.00 2.46 ? 45  ASP A HB3  7  
ATOM 9672  N N    . GLY A 1 46 ? -6.005  11.318  1.650   1.00 2.08 ? 46  GLY A N    7  
ATOM 9673  C CA   . GLY A 1 46 ? -7.328  10.970  2.144   1.00 2.49 ? 46  GLY A CA   7  
ATOM 9674  C C    . GLY A 1 46 ? -7.897  9.718   1.491   1.00 2.11 ? 46  GLY A C    7  
ATOM 9675  O O    . GLY A 1 46 ? -8.720  9.025   2.091   1.00 2.47 ? 46  GLY A O    7  
ATOM 9676  H H    . GLY A 1 46 ? -5.208  10.922  2.062   1.00 2.09 ? 46  GLY A H    7  
ATOM 9677  H HA2  . GLY A 1 46 ? -7.270  10.809  3.210   1.00 2.83 ? 46  GLY A HA2  7  
ATOM 9678  H HA3  . GLY A 1 46 ? -7.999  11.796  1.954   1.00 3.17 ? 46  GLY A HA3  7  
ATOM 9679  N N    . LYS A 1 47 ? -7.455  9.426   0.263   1.00 1.87 ? 47  LYS A N    7  
ATOM 9680  C CA   . LYS A 1 47 ? -7.922  8.248   -0.467  1.00 2.32 ? 47  LYS A CA   7  
ATOM 9681  C C    . LYS A 1 47 ? -7.508  6.960   0.245   1.00 1.93 ? 47  LYS A C    7  
ATOM 9682  O O    . LYS A 1 47 ? -8.293  6.016   0.340   1.00 1.95 ? 47  LYS A O    7  
ATOM 9683  C CB   . LYS A 1 47 ? -7.369  8.256   -1.897  1.00 2.80 ? 47  LYS A CB   7  
ATOM 9684  C CG   . LYS A 1 47 ? -8.075  7.290   -2.836  1.00 3.64 ? 47  LYS A CG   7  
ATOM 9685  C CD   . LYS A 1 47 ? -7.861  7.673   -4.293  1.00 4.17 ? 47  LYS A CD   7  
ATOM 9686  C CE   . LYS A 1 47 ? -8.010  6.474   -5.218  1.00 5.03 ? 47  LYS A CE   7  
ATOM 9687  N NZ   . LYS A 1 47 ? -9.435  6.185   -5.539  1.00 5.67 ? 47  LYS A NZ   7  
ATOM 9688  H H    . LYS A 1 47 ? -6.796  10.014  -0.158  1.00 1.83 ? 47  LYS A H    7  
ATOM 9689  H HA   . LYS A 1 47 ? -9.000  8.290   -0.509  1.00 3.00 ? 47  LYS A HA   7  
ATOM 9690  H HB2  . LYS A 1 47 ? -7.468  9.253   -2.302  1.00 2.86 ? 47  LYS A HB2  7  
ATOM 9691  H HB3  . LYS A 1 47 ? -6.321  7.994   -1.866  1.00 3.00 ? 47  LYS A HB3  7  
ATOM 9692  H HG2  . LYS A 1 47 ? -7.685  6.296   -2.674  1.00 4.05 ? 47  LYS A HG2  7  
ATOM 9693  H HG3  . LYS A 1 47 ? -9.134  7.302   -2.621  1.00 3.92 ? 47  LYS A HG3  7  
ATOM 9694  H HD2  . LYS A 1 47 ? -8.591  8.420   -4.569  1.00 4.28 ? 47  LYS A HD2  7  
ATOM 9695  H HD3  . LYS A 1 47 ? -6.868  8.082   -4.405  1.00 4.30 ? 47  LYS A HD3  7  
ATOM 9696  H HE2  . LYS A 1 47 ? -7.479  6.678   -6.137  1.00 5.17 ? 47  LYS A HE2  7  
ATOM 9697  H HE3  . LYS A 1 47 ? -7.575  5.609   -4.738  1.00 5.45 ? 47  LYS A HE3  7  
ATOM 9698  H HZ1  . LYS A 1 47 ? -9.860  5.607   -4.785  1.00 5.78 ? 47  LYS A HZ1  7  
ATOM 9699  H HZ2  . LYS A 1 47 ? -9.501  5.667   -6.437  1.00 5.80 ? 47  LYS A HZ2  7  
ATOM 9700  H HZ3  . LYS A 1 47 ? -9.972  7.072   -5.624  1.00 6.21 ? 47  LYS A HZ3  7  
ATOM 9701  N N    . LEU A 1 48 ? -6.270  6.931   0.746   1.00 1.68 ? 48  LEU A N    7  
ATOM 9702  C CA   . LEU A 1 48 ? -5.755  5.760   1.452   1.00 1.38 ? 48  LEU A CA   7  
ATOM 9703  C C    . LEU A 1 48 ? -6.101  5.817   2.940   1.00 1.28 ? 48  LEU A C    7  
ATOM 9704  O O    . LEU A 1 48 ? -5.834  6.813   3.615   1.00 1.35 ? 48  LEU A O    7  
ATOM 9705  C CB   . LEU A 1 48 ? -4.238  5.643   1.269   1.00 1.19 ? 48  LEU A CB   7  
ATOM 9706  C CG   . LEU A 1 48 ? -3.697  4.210   1.264   1.00 1.09 ? 48  LEU A CG   7  
ATOM 9707  C CD1  . LEU A 1 48 ? -2.428  4.120   0.428   1.00 1.56 ? 48  LEU A CD1  7  
ATOM 9708  C CD2  . LEU A 1 48 ? -3.436  3.734   2.684   1.00 1.06 ? 48  LEU A CD2  7  
ATOM 9709  H H    . LEU A 1 48 ? -5.694  7.717   0.638   1.00 1.80 ? 48  LEU A H    7  
ATOM 9710  H HA   . LEU A 1 48 ? -6.225  4.888   1.022   1.00 1.52 ? 48  LEU A HA   7  
ATOM 9711  H HB2  . LEU A 1 48 ? -3.972  6.109   0.332   1.00 1.43 ? 48  LEU A HB2  7  
ATOM 9712  H HB3  . LEU A 1 48 ? -3.756  6.183   2.069   1.00 1.29 ? 48  LEU A HB3  7  
ATOM 9713  H HG   . LEU A 1 48 ? -4.434  3.554   0.824   1.00 1.25 ? 48  LEU A HG   7  
ATOM 9714  H HD11 . LEU A 1 48 ? -1.791  4.965   0.645   1.00 2.04 ? 48  LEU A HD11 7  
ATOM 9715  H HD12 . LEU A 1 48 ? -2.688  4.125   -0.621  1.00 1.85 ? 48  LEU A HD12 7  
ATOM 9716  H HD13 . LEU A 1 48 ? -1.906  3.205   0.664   1.00 2.03 ? 48  LEU A HD13 7  
ATOM 9717  H HD21 . LEU A 1 48 ? -3.369  2.656   2.691   1.00 1.74 ? 48  LEU A HD21 7  
ATOM 9718  H HD22 . LEU A 1 48 ? -4.250  4.047   3.323   1.00 1.43 ? 48  LEU A HD22 7  
ATOM 9719  H HD23 . LEU A 1 48 ? -2.510  4.157   3.045   1.00 1.30 ? 48  LEU A HD23 7  
ATOM 9720  N N    . GLN A 1 49 ? -6.697  4.733   3.435   1.00 1.21 ? 49  GLN A N    7  
ATOM 9721  C CA   . GLN A 1 49 ? -7.090  4.624   4.836   1.00 1.17 ? 49  GLN A CA   7  
ATOM 9722  C C    . GLN A 1 49 ? -6.682  3.264   5.402   1.00 1.09 ? 49  GLN A C    7  
ATOM 9723  O O    . GLN A 1 49 ? -6.690  2.261   4.687   1.00 1.14 ? 49  GLN A O    7  
ATOM 9724  C CB   . GLN A 1 49 ? -8.603  4.819   4.977   1.00 1.30 ? 49  GLN A CB   7  
ATOM 9725  C CG   . GLN A 1 49 ? -9.436  3.799   4.211   1.00 1.46 ? 49  GLN A CG   7  
ATOM 9726  C CD   . GLN A 1 49 ? -9.639  4.180   2.755   1.00 1.45 ? 49  GLN A CD   7  
ATOM 9727  O OE1  . GLN A 1 49 ? -10.332 5.150   2.448   1.00 1.54 ? 49  GLN A OE1  7  
ATOM 9728  N NE2  . GLN A 1 49 ? -9.036  3.416   1.849   1.00 1.52 ? 49  GLN A NE2  7  
ATOM 9729  H H    . GLN A 1 49 ? -6.876  3.979   2.840   1.00 1.26 ? 49  GLN A H    7  
ATOM 9730  H HA   . GLN A 1 49 ? -6.582  5.400   5.387   1.00 1.19 ? 49  GLN A HA   7  
ATOM 9731  H HB2  . GLN A 1 49 ? -8.861  4.746   6.021   1.00 1.32 ? 49  GLN A HB2  7  
ATOM 9732  H HB3  . GLN A 1 49 ? -8.862  5.804   4.620   1.00 1.34 ? 49  GLN A HB3  7  
ATOM 9733  H HG2  . GLN A 1 49 ? -8.936  2.843   4.249   1.00 1.57 ? 49  GLN A HG2  7  
ATOM 9734  H HG3  . GLN A 1 49 ? -10.402 3.716   4.685   1.00 1.59 ? 49  GLN A HG3  7  
ATOM 9735  H HE21 . GLN A 1 49 ? -8.498  2.659   2.164   1.00 1.62 ? 49  GLN A HE21 7  
ATOM 9736  H HE22 . GLN A 1 49 ? -9.152  3.643   0.903   1.00 1.56 ? 49  GLN A HE22 7  
ATOM 9737  N N    . ILE A 1 50 ? -6.327  3.235   6.687   1.00 1.06 ? 50  ILE A N    7  
ATOM 9738  C CA   . ILE A 1 50 ? -5.915  1.991   7.346   1.00 1.03 ? 50  ILE A CA   7  
ATOM 9739  C C    . ILE A 1 50 ? -6.907  0.863   7.055   1.00 1.05 ? 50  ILE A C    7  
ATOM 9740  O O    . ILE A 1 50 ? -8.098  0.987   7.346   1.00 1.16 ? 50  ILE A O    7  
ATOM 9741  C CB   . ILE A 1 50 ? -5.790  2.159   8.882   1.00 1.08 ? 50  ILE A CB   7  
ATOM 9742  C CG1  . ILE A 1 50 ? -5.005  3.428   9.241   1.00 1.76 ? 50  ILE A CG1  7  
ATOM 9743  C CG2  . ILE A 1 50 ? -5.126  0.934   9.500   1.00 1.14 ? 50  ILE A CG2  7  
ATOM 9744  C CD1  . ILE A 1 50 ? -3.668  3.544   8.540   1.00 2.56 ? 50  ILE A CD1  7  
ATOM 9745  H H    . ILE A 1 50 ? -6.339  4.069   7.202   1.00 1.12 ? 50  ILE A H    7  
ATOM 9746  H HA   . ILE A 1 50 ? -4.947  1.714   6.954   1.00 1.00 ? 50  ILE A HA   7  
ATOM 9747  H HB   . ILE A 1 50 ? -6.787  2.237   9.291   1.00 1.51 ? 50  ILE A HB   7  
ATOM 9748  H HG12 . ILE A 1 50 ? -5.592  4.294   8.974   1.00 1.94 ? 50  ILE A HG12 7  
ATOM 9749  H HG13 . ILE A 1 50 ? -4.822  3.439   10.306  1.00 2.32 ? 50  ILE A HG13 7  
ATOM 9750  H HG21 . ILE A 1 50 ? -5.279  0.078   8.858   1.00 1.55 ? 50  ILE A HG21 7  
ATOM 9751  H HG22 . ILE A 1 50 ? -5.564  0.738   10.469  1.00 1.63 ? 50  ILE A HG22 7  
ATOM 9752  H HG23 . ILE A 1 50 ? -4.068  1.115   9.613   1.00 1.57 ? 50  ILE A HG23 7  
ATOM 9753  H HD11 . ILE A 1 50 ? -3.794  3.339   7.487   1.00 3.13 ? 50  ILE A HD11 7  
ATOM 9754  H HD12 . ILE A 1 50 ? -2.976  2.830   8.965   1.00 2.96 ? 50  ILE A HD12 7  
ATOM 9755  H HD13 . ILE A 1 50 ? -3.280  4.542   8.669   1.00 2.79 ? 50  ILE A HD13 7  
ATOM 9756  N N    . GLY A 1 51 ? -6.410  -0.234  6.476   1.00 1.02 ? 51  GLY A N    7  
ATOM 9757  C CA   . GLY A 1 51 ? -7.268  -1.364  6.153   1.00 1.10 ? 51  GLY A CA   7  
ATOM 9758  C C    . GLY A 1 51 ? -7.279  -1.719  4.674   1.00 1.04 ? 51  GLY A C    7  
ATOM 9759  O O    . GLY A 1 51 ? -7.594  -2.856  4.321   1.00 1.03 ? 51  GLY A O    7  
ATOM 9760  H H    . GLY A 1 51 ? -5.456  -0.280  6.255   1.00 0.99 ? 51  GLY A H    7  
ATOM 9761  H HA2  . GLY A 1 51 ? -6.927  -2.223  6.709   1.00 1.22 ? 51  GLY A HA2  7  
ATOM 9762  H HA3  . GLY A 1 51 ? -8.277  -1.137  6.459   1.00 1.14 ? 51  GLY A HA3  7  
ATOM 9763  N N    . ASP A 1 52 ? -6.940  -0.764  3.799   1.00 1.04 ? 52  ASP A N    7  
ATOM 9764  C CA   . ASP A 1 52 ? -6.922  -1.030  2.367   1.00 1.01 ? 52  ASP A CA   7  
ATOM 9765  C C    . ASP A 1 52 ? -5.786  -1.983  1.998   1.00 0.91 ? 52  ASP A C    7  
ATOM 9766  O O    . ASP A 1 52 ? -4.797  -2.110  2.734   1.00 0.88 ? 52  ASP A O    7  
ATOM 9767  C CB   . ASP A 1 52 ? -6.805  0.271   1.561   1.00 1.03 ? 52  ASP A CB   7  
ATOM 9768  C CG   . ASP A 1 52 ? -5.768  1.237   2.098   1.00 1.11 ? 52  ASP A CG   7  
ATOM 9769  O OD1  . ASP A 1 52 ? -4.717  0.782   2.601   1.00 1.55 ? 52  ASP A OD1  7  
ATOM 9770  O OD2  . ASP A 1 52 ? -6.010  2.454   2.006   1.00 1.56 ? 52  ASP A OD2  7  
ATOM 9771  H H    . ASP A 1 52 ? -6.700  0.128   4.118   1.00 1.07 ? 52  ASP A H    7  
ATOM 9772  H HA   . ASP A 1 52 ? -7.857  -1.501  2.124   1.00 1.08 ? 52  ASP A HA   7  
ATOM 9773  H HB2  . ASP A 1 52 ? -6.540  0.033   0.544   1.00 0.99 ? 52  ASP A HB2  7  
ATOM 9774  H HB3  . ASP A 1 52 ? -7.764  0.766   1.569   1.00 1.18 ? 52  ASP A HB3  7  
ATOM 9775  N N    . LYS A 1 53 ? -5.938  -2.646  0.851   1.00 0.88 ? 53  LYS A N    7  
ATOM 9776  C CA   . LYS A 1 53 ? -4.934  -3.591  0.370   1.00 0.82 ? 53  LYS A CA   7  
ATOM 9777  C C    . LYS A 1 53 ? -4.181  -3.034  -0.833  1.00 0.76 ? 53  LYS A C    7  
ATOM 9778  O O    . LYS A 1 53 ? -4.706  -2.236  -1.602  1.00 0.87 ? 53  LYS A O    7  
ATOM 9779  C CB   . LYS A 1 53 ? -5.571  -4.938  0.003   1.00 0.94 ? 53  LYS A CB   7  
ATOM 9780  C CG   . LYS A 1 53 ? -6.948  -4.833  -0.634  1.00 1.33 ? 53  LYS A CG   7  
ATOM 9781  C CD   . LYS A 1 53 ? -8.055  -4.948  0.405   1.00 1.83 ? 53  LYS A CD   7  
ATOM 9782  C CE   . LYS A 1 53 ? -9.369  -4.382  -0.112  1.00 2.37 ? 53  LYS A CE   7  
ATOM 9783  N NZ   . LYS A 1 53 ? -9.433  -2.900  0.032   1.00 3.23 ? 53  LYS A NZ   7  
ATOM 9784  H H    . LYS A 1 53 ? -6.742  -2.490  0.312   1.00 0.92 ? 53  LYS A H    7  
ATOM 9785  H HA   . LYS A 1 53 ? -4.228  -3.750  1.170   1.00 0.82 ? 53  LYS A HA   7  
ATOM 9786  H HB2  . LYS A 1 53 ? -4.921  -5.450  -0.690  1.00 1.54 ? 53  LYS A HB2  7  
ATOM 9787  H HB3  . LYS A 1 53 ? -5.658  -5.531  0.897   1.00 1.39 ? 53  LYS A HB3  7  
ATOM 9788  H HG2  . LYS A 1 53 ? -7.033  -3.879  -1.132  1.00 1.78 ? 53  LYS A HG2  7  
ATOM 9789  H HG3  . LYS A 1 53 ? -7.060  -5.628  -1.355  1.00 1.86 ? 53  LYS A HG3  7  
ATOM 9790  H HD2  . LYS A 1 53 ? -8.197  -5.990  0.650   1.00 2.39 ? 53  LYS A HD2  7  
ATOM 9791  H HD3  . LYS A 1 53 ? -7.762  -4.405  1.291   1.00 2.03 ? 53  LYS A HD3  7  
ATOM 9792  H HE2  . LYS A 1 53 ? -9.472  -4.637  -1.155  1.00 2.44 ? 53  LYS A HE2  7  
ATOM 9793  H HE3  . LYS A 1 53 ? -10.180 -4.824  0.448   1.00 2.77 ? 53  LYS A HE3  7  
ATOM 9794  H HZ1  . LYS A 1 53 ? -8.754  -2.448  -0.613  1.00 3.81 ? 53  LYS A HZ1  7  
ATOM 9795  H HZ2  . LYS A 1 53 ? -9.206  -2.624  1.009   1.00 3.55 ? 53  LYS A HZ2  7  
ATOM 9796  H HZ3  . LYS A 1 53 ? -10.389 -2.560  -0.198  1.00 3.45 ? 53  LYS A HZ3  7  
ATOM 9797  N N    . LEU A 1 54 ? -2.931  -3.446  -0.958  1.00 0.64 ? 54  LEU A N    7  
ATOM 9798  C CA   . LEU A 1 54 ? -2.074  -2.982  -2.041  1.00 0.66 ? 54  LEU A CA   7  
ATOM 9799  C C    . LEU A 1 54 ? -1.979  -4.005  -3.170  1.00 0.64 ? 54  LEU A C    7  
ATOM 9800  O O    . LEU A 1 54 ? -1.475  -5.115  -2.981  1.00 0.79 ? 54  LEU A O    7  
ATOM 9801  C CB   . LEU A 1 54 ? -0.679  -2.636  -1.515  1.00 0.73 ? 54  LEU A CB   7  
ATOM 9802  C CG   . LEU A 1 54 ? -0.233  -1.199  -1.794  1.00 0.83 ? 54  LEU A CG   7  
ATOM 9803  C CD1  . LEU A 1 54 ? 0.960   -0.823  -0.929  1.00 1.11 ? 54  LEU A CD1  7  
ATOM 9804  C CD2  . LEU A 1 54 ? 0.094   -1.024  -3.270  1.00 1.72 ? 54  LEU A CD2  7  
ATOM 9805  H H    . LEU A 1 54 ? -2.583  -4.053  -0.272  1.00 0.62 ? 54  LEU A H    7  
ATOM 9806  H HA   . LEU A 1 54 ? -2.520  -2.083  -2.440  1.00 0.75 ? 54  LEU A HA   7  
ATOM 9807  H HB2  . LEU A 1 54 ? -0.670  -2.795  -0.445  1.00 1.24 ? 54  LEU A HB2  7  
ATOM 9808  H HB3  . LEU A 1 54 ? 0.034   -3.307  -1.969  1.00 1.21 ? 54  LEU A HB3  7  
ATOM 9809  H HG   . LEU A 1 54 ? -1.043  -0.526  -1.551  1.00 1.18 ? 54  LEU A HG   7  
ATOM 9810  H HD11 . LEU A 1 54 ? 1.844   -0.751  -1.544  1.00 1.58 ? 54  LEU A HD11 7  
ATOM 9811  H HD12 . LEU A 1 54 ? 1.109   -1.578  -0.172  1.00 1.88 ? 54  LEU A HD12 7  
ATOM 9812  H HD13 . LEU A 1 54 ? 0.774   0.130   -0.455  1.00 1.17 ? 54  LEU A HD13 7  
ATOM 9813  H HD21 . LEU A 1 54 ? 0.769   -0.192  -3.393  1.00 2.31 ? 54  LEU A HD21 7  
ATOM 9814  H HD22 . LEU A 1 54 ? -0.816  -0.836  -3.820  1.00 2.00 ? 54  LEU A HD22 7  
ATOM 9815  H HD23 . LEU A 1 54 ? 0.561   -1.925  -3.645  1.00 2.08 ? 54  LEU A HD23 7  
ATOM 9816  N N    . LEU A 1 55 ? -2.456  -3.605  -4.348  1.00 0.56 ? 55  LEU A N    7  
ATOM 9817  C CA   . LEU A 1 55 ? -2.424  -4.456  -5.533  1.00 0.58 ? 55  LEU A CA   7  
ATOM 9818  C C    . LEU A 1 55 ? -1.085  -4.314  -6.242  1.00 0.54 ? 55  LEU A C    7  
ATOM 9819  O O    . LEU A 1 55 ? -0.380  -5.302  -6.444  1.00 0.56 ? 55  LEU A O    7  
ATOM 9820  C CB   . LEU A 1 55 ? -3.562  -4.097  -6.493  1.00 0.66 ? 55  LEU A CB   7  
ATOM 9821  C CG   . LEU A 1 55 ? -3.723  -5.025  -7.703  1.00 0.91 ? 55  LEU A CG   7  
ATOM 9822  C CD1  . LEU A 1 55 ? -5.143  -4.956  -8.244  1.00 1.27 ? 55  LEU A CD1  7  
ATOM 9823  C CD2  . LEU A 1 55 ? -2.720  -4.669  -8.793  1.00 1.87 ? 55  LEU A CD2  7  
ATOM 9824  H H    . LEU A 1 55 ? -2.829  -2.703  -4.426  1.00 0.58 ? 55  LEU A H    7  
ATOM 9825  H HA   . LEU A 1 55 ? -2.542  -5.481  -5.211  1.00 0.62 ? 55  LEU A HA   7  
ATOM 9826  H HB2  . LEU A 1 55 ? -4.484  -4.106  -5.937  1.00 0.75 ? 55  LEU A HB2  7  
ATOM 9827  H HB3  . LEU A 1 55 ? -3.394  -3.095  -6.858  1.00 0.98 ? 55  LEU A HB3  7  
ATOM 9828  H HG   . LEU A 1 55 ? -3.534  -6.042  -7.394  1.00 1.50 ? 55  LEU A HG   7  
ATOM 9829  H HD11 . LEU A 1 55 ? -5.444  -5.935  -8.589  1.00 1.70 ? 55  LEU A HD11 7  
ATOM 9830  H HD12 . LEU A 1 55 ? -5.182  -4.258  -9.067  1.00 1.74 ? 55  LEU A HD12 7  
ATOM 9831  H HD13 . LEU A 1 55 ? -5.812  -4.630  -7.463  1.00 1.86 ? 55  LEU A HD13 7  
ATOM 9832  H HD21 . LEU A 1 55 ? -3.131  -4.927  -9.757  1.00 2.39 ? 55  LEU A HD21 7  
ATOM 9833  H HD22 . LEU A 1 55 ? -1.805  -5.219  -8.632  1.00 2.39 ? 55  LEU A HD22 7  
ATOM 9834  H HD23 . LEU A 1 55 ? -2.515  -3.610  -8.761  1.00 2.37 ? 55  LEU A HD23 7  
ATOM 9835  N N    . ALA A 1 56 ? -0.739  -3.079  -6.627  1.00 0.51 ? 56  ALA A N    7  
ATOM 9836  C CA   . ALA A 1 56 ? 0.527   -2.838  -7.319  1.00 0.49 ? 56  ALA A CA   7  
ATOM 9837  C C    . ALA A 1 56 ? 1.170   -1.512  -6.900  1.00 0.53 ? 56  ALA A C    7  
ATOM 9838  O O    . ALA A 1 56 ? 0.475   -0.532  -6.632  1.00 0.67 ? 56  ALA A O    7  
ATOM 9839  C CB   . ALA A 1 56 ? 0.310   -2.867  -8.833  1.00 0.54 ? 56  ALA A CB   7  
ATOM 9840  H H    . ALA A 1 56 ? -1.352  -2.320  -6.444  1.00 0.53 ? 56  ALA A H    7  
ATOM 9841  H HA   . ALA A 1 56 ? 1.200   -3.651  -7.056  1.00 0.52 ? 56  ALA A HA   7  
ATOM 9842  H HB1  . ALA A 1 56 ? 1.212   -2.548  -9.336  1.00 1.19 ? 56  ALA A HB1  7  
ATOM 9843  H HB2  . ALA A 1 56 ? -0.499  -2.198  -9.090  1.00 0.99 ? 56  ALA A HB2  7  
ATOM 9844  H HB3  . ALA A 1 56 ? 0.057   -3.871  -9.147  1.00 1.25 ? 56  ALA A HB3  7  
ATOM 9845  N N    . VAL A 1 57 ? 2.508   -1.491  -6.854  1.00 0.50 ? 57  VAL A N    7  
ATOM 9846  C CA   . VAL A 1 57 ? 3.253   -0.288  -6.477  1.00 0.59 ? 57  VAL A CA   7  
ATOM 9847  C C    . VAL A 1 57 ? 4.295   0.068   -7.536  1.00 0.53 ? 57  VAL A C    7  
ATOM 9848  O O    . VAL A 1 57 ? 5.293   -0.634  -7.695  1.00 0.52 ? 57  VAL A O    7  
ATOM 9849  C CB   . VAL A 1 57 ? 3.976   -0.455  -5.121  1.00 0.77 ? 57  VAL A CB   7  
ATOM 9850  C CG1  . VAL A 1 57 ? 4.472   0.891   -4.613  1.00 1.42 ? 57  VAL A CG1  7  
ATOM 9851  C CG2  . VAL A 1 57 ? 3.071   -1.113  -4.093  1.00 1.47 ? 57  VAL A CG2  7  
ATOM 9852  H H    . VAL A 1 57 ? 3.006   -2.309  -7.081  1.00 0.48 ? 57  VAL A H    7  
ATOM 9853  H HA   . VAL A 1 57 ? 2.550   0.528   -6.388  1.00 0.66 ? 57  VAL A HA   7  
ATOM 9854  H HB   . VAL A 1 57 ? 4.834   -1.093  -5.272  1.00 1.34 ? 57  VAL A HB   7  
ATOM 9855  H HG11 . VAL A 1 57 ? 3.630   1.540   -4.428  1.00 1.89 ? 57  VAL A HG11 7  
ATOM 9856  H HG12 . VAL A 1 57 ? 5.117   1.340   -5.354  1.00 1.82 ? 57  VAL A HG12 7  
ATOM 9857  H HG13 . VAL A 1 57 ? 5.024   0.749   -3.695  1.00 2.12 ? 57  VAL A HG13 7  
ATOM 9858  H HG21 . VAL A 1 57 ? 2.277   -1.645  -4.596  1.00 1.95 ? 57  VAL A HG21 7  
ATOM 9859  H HG22 . VAL A 1 57 ? 2.646   -0.357  -3.449  1.00 1.95 ? 57  VAL A HG22 7  
ATOM 9860  H HG23 . VAL A 1 57 ? 3.649   -1.806  -3.502  1.00 2.01 ? 57  VAL A HG23 7  
ATOM 9861  N N    . ASN A 1 58 ? 4.065   1.167   -8.254  1.00 0.57 ? 58  ASN A N    7  
ATOM 9862  C CA   . ASN A 1 58 ? 4.992   1.620   -9.296  1.00 0.58 ? 58  ASN A CA   7  
ATOM 9863  C C    . ASN A 1 58 ? 5.101   0.599   -10.436 1.00 0.59 ? 58  ASN A C    7  
ATOM 9864  O O    . ASN A 1 58 ? 6.197   0.310   -10.923 1.00 0.60 ? 58  ASN A O    7  
ATOM 9865  C CB   . ASN A 1 58 ? 6.375   1.902   -8.691  1.00 0.57 ? 58  ASN A CB   7  
ATOM 9866  C CG   . ASN A 1 58 ? 6.654   3.386   -8.545  1.00 0.80 ? 58  ASN A CG   7  
ATOM 9867  O OD1  . ASN A 1 58 ? 6.340   3.990   -7.518  1.00 1.39 ? 58  ASN A OD1  7  
ATOM 9868  N ND2  . ASN A 1 58 ? 7.249   3.984   -9.573  1.00 1.49 ? 58  ASN A ND2  7  
ATOM 9869  H H    . ASN A 1 58 ? 3.254   1.689   -8.080  1.00 0.63 ? 58  ASN A H    7  
ATOM 9870  H HA   . ASN A 1 58 ? 4.598   2.541   -9.700  1.00 0.65 ? 58  ASN A HA   7  
ATOM 9871  H HB2  . ASN A 1 58 ? 6.433   1.448   -7.712  1.00 0.64 ? 58  ASN A HB2  7  
ATOM 9872  H HB3  . ASN A 1 58 ? 7.135   1.472   -9.326  1.00 0.74 ? 58  ASN A HB3  7  
ATOM 9873  H HD21 . ASN A 1 58 ? 7.472   3.443   -10.358 1.00 2.05 ? 58  ASN A HD21 7  
ATOM 9874  H HD22 . ASN A 1 58 ? 7.439   4.943   -9.502  1.00 1.75 ? 58  ASN A HD22 7  
ATOM 9875  N N    . ASN A 1 59 ? 3.946   0.068   -10.861 1.00 0.60 ? 59  ASN A N    7  
ATOM 9876  C CA   . ASN A 1 59 ? 3.869   -0.914  -11.956 1.00 0.65 ? 59  ASN A CA   7  
ATOM 9877  C C    . ASN A 1 59 ? 4.087   -2.359  -11.482 1.00 0.61 ? 59  ASN A C    7  
ATOM 9878  O O    . ASN A 1 59 ? 3.684   -3.297  -12.173 1.00 0.67 ? 59  ASN A O    7  
ATOM 9879  C CB   . ASN A 1 59 ? 4.870   -0.576  -13.068 1.00 0.71 ? 59  ASN A CB   7  
ATOM 9880  C CG   . ASN A 1 59 ? 4.381   -1.007  -14.439 1.00 1.18 ? 59  ASN A CG   7  
ATOM 9881  O OD1  . ASN A 1 59 ? 4.635   -2.129  -14.876 1.00 1.74 ? 59  ASN A OD1  7  
ATOM 9882  N ND2  . ASN A 1 59 ? 3.677   -0.113  -15.127 1.00 1.52 ? 59  ASN A ND2  7  
ATOM 9883  H H    . ASN A 1 59 ? 3.116   0.355   -10.425 1.00 0.61 ? 59  ASN A H    7  
ATOM 9884  H HA   . ASN A 1 59 ? 2.872   -0.847  -12.367 1.00 0.68 ? 59  ASN A HA   7  
ATOM 9885  H HB2  . ASN A 1 59 ? 5.035   0.490   -13.085 1.00 0.83 ? 59  ASN A HB2  7  
ATOM 9886  H HB3  . ASN A 1 59 ? 5.806   -1.077  -12.866 1.00 0.74 ? 59  ASN A HB3  7  
ATOM 9887  H HD21 . ASN A 1 59 ? 3.512   0.763   -14.719 1.00 1.74 ? 59  ASN A HD21 7  
ATOM 9888  H HD22 . ASN A 1 59 ? 3.350   -0.367  -16.016 1.00 1.84 ? 59  ASN A HD22 7  
ATOM 9889  N N    . VAL A 1 60 ? 4.706   -2.550  -10.311 1.00 0.53 ? 60  VAL A N    7  
ATOM 9890  C CA   . VAL A 1 60 ? 4.940   -3.899  -9.788  1.00 0.52 ? 60  VAL A CA   7  
ATOM 9891  C C    . VAL A 1 60 ? 3.776   -4.342  -8.908  1.00 0.51 ? 60  VAL A C    7  
ATOM 9892  O O    . VAL A 1 60 ? 3.086   -3.510  -8.332  1.00 0.50 ? 60  VAL A O    7  
ATOM 9893  C CB   . VAL A 1 60 ? 6.253   -3.997  -8.975  1.00 0.50 ? 60  VAL A CB   7  
ATOM 9894  C CG1  . VAL A 1 60 ? 7.442   -3.533  -9.803  1.00 0.51 ? 60  VAL A CG1  7  
ATOM 9895  C CG2  . VAL A 1 60 ? 6.163   -3.211  -7.672  1.00 0.54 ? 60  VAL A CG2  7  
ATOM 9896  H H    . VAL A 1 60 ? 4.999   -1.776  -9.787  1.00 0.52 ? 60  VAL A H    7  
ATOM 9897  H HA   . VAL A 1 60 ? 5.012   -4.572  -10.630 1.00 0.56 ? 60  VAL A HA   7  
ATOM 9898  H HB   . VAL A 1 60 ? 6.407   -5.035  -8.723  1.00 0.58 ? 60  VAL A HB   7  
ATOM 9899  H HG11 . VAL A 1 60 ? 7.607   -4.225  -10.615 1.00 1.18 ? 60  VAL A HG11 7  
ATOM 9900  H HG12 . VAL A 1 60 ? 8.322   -3.493  -9.179  1.00 0.93 ? 60  VAL A HG12 7  
ATOM 9901  H HG13 . VAL A 1 60 ? 7.240   -2.550  -10.203 1.00 1.23 ? 60  VAL A HG13 7  
ATOM 9902  H HG21 . VAL A 1 60 ? 6.449   -3.847  -6.848  1.00 0.98 ? 60  VAL A HG21 7  
ATOM 9903  H HG22 . VAL A 1 60 ? 5.150   -2.868  -7.527  1.00 1.15 ? 60  VAL A HG22 7  
ATOM 9904  H HG23 . VAL A 1 60 ? 6.828   -2.362  -7.719  1.00 1.17 ? 60  VAL A HG23 7  
ATOM 9905  N N    . CYS A 1 61 ? 3.566   -5.651  -8.797  1.00 0.53 ? 61  CYS A N    7  
ATOM 9906  C CA   . CYS A 1 61 ? 2.481   -6.173  -7.968  1.00 0.54 ? 61  CYS A CA   7  
ATOM 9907  C C    . CYS A 1 61 ? 2.953   -6.374  -6.532  1.00 0.58 ? 61  CYS A C    7  
ATOM 9908  O O    . CYS A 1 61 ? 3.973   -7.023  -6.287  1.00 0.72 ? 61  CYS A O    7  
ATOM 9909  C CB   . CYS A 1 61 ? 1.938   -7.482  -8.539  1.00 0.56 ? 61  CYS A CB   7  
ATOM 9910  S SG   . CYS A 1 61 ? 3.174   -8.790  -8.727  1.00 0.71 ? 61  CYS A SG   7  
ATOM 9911  H H    . CYS A 1 61 ? 4.155   -6.276  -9.270  1.00 0.55 ? 61  CYS A H    7  
ATOM 9912  H HA   . CYS A 1 61 ? 1.689   -5.439  -7.969  1.00 0.53 ? 61  CYS A HA   7  
ATOM 9913  H HB2  . CYS A 1 61 ? 1.165   -7.853  -7.884  1.00 0.91 ? 61  CYS A HB2  7  
ATOM 9914  H HB3  . CYS A 1 61 ? 1.512   -7.288  -9.513  1.00 0.84 ? 61  CYS A HB3  7  
ATOM 9915  H HG   . CYS A 1 61 ? 3.716   -8.578  -9.491  1.00 1.12 ? 61  CYS A HG   7  
ATOM 9916  N N    . LEU A 1 62 ? 2.193   -5.831  -5.582  1.00 0.55 ? 62  LEU A N    7  
ATOM 9917  C CA   . LEU A 1 62 ? 2.509   -5.962  -4.165  1.00 0.62 ? 62  LEU A CA   7  
ATOM 9918  C C    . LEU A 1 62 ? 1.616   -7.013  -3.485  1.00 0.58 ? 62  LEU A C    7  
ATOM 9919  O O    . LEU A 1 62 ? 1.286   -6.885  -2.302  1.00 0.51 ? 62  LEU A O    7  
ATOM 9920  C CB   . LEU A 1 62 ? 2.373   -4.604  -3.474  1.00 0.77 ? 62  LEU A CB   7  
ATOM 9921  C CG   . LEU A 1 62 ? 3.346   -4.371  -2.316  1.00 0.95 ? 62  LEU A CG   7  
ATOM 9922  C CD1  . LEU A 1 62 ? 4.749   -4.110  -2.844  1.00 1.71 ? 62  LEU A CD1  7  
ATOM 9923  C CD2  . LEU A 1 62 ? 2.878   -3.215  -1.446  1.00 1.08 ? 62  LEU A CD2  7  
ATOM 9924  H H    . LEU A 1 62 ? 1.369   -5.362  -5.835  1.00 0.55 ? 62  LEU A H    7  
ATOM 9925  H HA   . LEU A 1 62 ? 3.536   -6.288  -4.089  1.00 0.72 ? 62  LEU A HA   7  
ATOM 9926  H HB2  . LEU A 1 62 ? 2.536   -3.832  -4.213  1.00 1.26 ? 62  LEU A HB2  7  
ATOM 9927  H HB3  . LEU A 1 62 ? 1.366   -4.510  -3.100  1.00 1.09 ? 62  LEU A HB3  7  
ATOM 9928  H HG   . LEU A 1 62 ? 3.382   -5.259  -1.703  1.00 1.61 ? 62  LEU A HG   7  
ATOM 9929  H HD11 . LEU A 1 62 ? 4.689   -3.727  -3.852  1.00 2.12 ? 62  LEU A HD11 7  
ATOM 9930  H HD12 . LEU A 1 62 ? 5.312   -5.032  -2.842  1.00 2.04 ? 62  LEU A HD12 7  
ATOM 9931  H HD13 . LEU A 1 62 ? 5.243   -3.386  -2.214  1.00 2.37 ? 62  LEU A HD13 7  
ATOM 9932  H HD21 . LEU A 1 62 ? 3.404   -3.237  -0.504  1.00 1.44 ? 62  LEU A HD21 7  
ATOM 9933  H HD22 . LEU A 1 62 ? 1.817   -3.306  -1.268  1.00 1.77 ? 62  LEU A HD22 7  
ATOM 9934  H HD23 . LEU A 1 62 ? 3.080   -2.282  -1.947  1.00 1.57 ? 62  LEU A HD23 7  
ATOM 9935  N N    . GLU A 1 63 ? 1.196   -8.031  -4.242  1.00 0.72 ? 63  GLU A N    7  
ATOM 9936  C CA   . GLU A 1 63 ? 0.317   -9.073  -3.706  1.00 0.80 ? 63  GLU A CA   7  
ATOM 9937  C C    . GLU A 1 63 ? 1.003   -10.442 -3.623  1.00 0.95 ? 63  GLU A C    7  
ATOM 9938  O O    . GLU A 1 63 ? 0.567   -11.306 -2.861  1.00 1.83 ? 63  GLU A O    7  
ATOM 9939  C CB   . GLU A 1 63 ? -0.946  -9.181  -4.564  1.00 0.86 ? 63  GLU A CB   7  
ATOM 9940  C CG   . GLU A 1 63 ? -1.762  -7.898  -4.608  1.00 1.12 ? 63  GLU A CG   7  
ATOM 9941  C CD   . GLU A 1 63 ? -3.151  -8.108  -5.179  1.00 1.31 ? 63  GLU A CD   7  
ATOM 9942  O OE1  . GLU A 1 63 ? -3.276  -8.208  -6.417  1.00 1.96 ? 63  GLU A OE1  7  
ATOM 9943  O OE2  . GLU A 1 63 ? -4.114  -8.172  -4.387  1.00 1.65 ? 63  GLU A OE2  7  
ATOM 9944  H H    . GLU A 1 63 ? 1.458   -8.069  -5.186  1.00 0.83 ? 63  GLU A H    7  
ATOM 9945  H HA   . GLU A 1 63 ? 0.029   -8.777  -2.709  1.00 0.80 ? 63  GLU A HA   7  
ATOM 9946  H HB2  . GLU A 1 63 ? -0.660  -9.435  -5.574  1.00 1.08 ? 63  GLU A HB2  7  
ATOM 9947  H HB3  . GLU A 1 63 ? -1.572  -9.967  -4.168  1.00 1.32 ? 63  GLU A HB3  7  
ATOM 9948  H HG2  . GLU A 1 63 ? -1.858  -7.512  -3.604  1.00 1.64 ? 63  GLU A HG2  7  
ATOM 9949  H HG3  . GLU A 1 63 ? -1.243  -7.177  -5.221  1.00 1.48 ? 63  GLU A HG3  7  
ATOM 9950  N N    . GLU A 1 64 ? 2.070   -10.642 -4.403  1.00 1.04 ? 64  GLU A N    7  
ATOM 9951  C CA   . GLU A 1 64 ? 2.793   -11.917 -4.399  1.00 1.08 ? 64  GLU A CA   7  
ATOM 9952  C C    . GLU A 1 64 ? 4.270   -11.710 -4.050  1.00 0.90 ? 64  GLU A C    7  
ATOM 9953  O O    . GLU A 1 64 ? 5.164   -12.183 -4.757  1.00 0.96 ? 64  GLU A O    7  
ATOM 9954  C CB   . GLU A 1 64 ? 2.651   -12.626 -5.756  1.00 1.28 ? 64  GLU A CB   7  
ATOM 9955  C CG   . GLU A 1 64 ? 2.286   -11.701 -6.905  1.00 1.53 ? 64  GLU A CG   7  
ATOM 9956  C CD   . GLU A 1 64 ? 2.238   -12.416 -8.241  1.00 2.14 ? 64  GLU A CD   7  
ATOM 9957  O OE1  . GLU A 1 64 ? 1.173   -12.974 -8.580  1.00 2.93 ? 64  GLU A OE1  7  
ATOM 9958  O OE2  . GLU A 1 64 ? 3.267   -12.419 -8.950  1.00 2.40 ? 64  GLU A OE2  7  
ATOM 9959  H H    . GLU A 1 64 ? 2.379   -9.921  -4.989  1.00 1.69 ? 64  GLU A H    7  
ATOM 9960  H HA   . GLU A 1 64 ? 2.348   -12.538 -3.638  1.00 1.19 ? 64  GLU A HA   7  
ATOM 9961  H HB2  . GLU A 1 64 ? 3.587   -13.108 -5.998  1.00 1.35 ? 64  GLU A HB2  7  
ATOM 9962  H HB3  . GLU A 1 64 ? 1.883   -13.380 -5.673  1.00 1.23 ? 64  GLU A HB3  7  
ATOM 9963  H HG2  . GLU A 1 64 ? 1.313   -11.273 -6.709  1.00 1.77 ? 64  GLU A HG2  7  
ATOM 9964  H HG3  . GLU A 1 64 ? 3.020   -10.911 -6.961  1.00 1.72 ? 64  GLU A HG3  7  
ATOM 9965  N N    . VAL A 1 65 ? 4.515   -10.993 -2.953  1.00 0.80 ? 65  VAL A N    7  
ATOM 9966  C CA   . VAL A 1 65 ? 5.879   -10.713 -2.506  1.00 0.64 ? 65  VAL A CA   7  
ATOM 9967  C C    . VAL A 1 65 ? 5.991   -10.663 -0.985  1.00 0.64 ? 65  VAL A C    7  
ATOM 9968  O O    . VAL A 1 65 ? 5.035   -10.310 -0.290  1.00 0.70 ? 65  VAL A O    7  
ATOM 9969  C CB   . VAL A 1 65 ? 6.401   -9.375  -3.076  1.00 0.56 ? 65  VAL A CB   7  
ATOM 9970  C CG1  . VAL A 1 65 ? 6.676   -9.493  -4.567  1.00 0.64 ? 65  VAL A CG1  7  
ATOM 9971  C CG2  . VAL A 1 65 ? 5.419   -8.245  -2.792  1.00 0.59 ? 65  VAL A CG2  7  
ATOM 9972  H H    . VAL A 1 65 ? 3.753   -10.642 -2.444  1.00 0.90 ? 65  VAL A H    7  
ATOM 9973  H HA   . VAL A 1 65 ? 6.516   -11.504 -2.875  1.00 0.65 ? 65  VAL A HA   7  
ATOM 9974  H HB   . VAL A 1 65 ? 7.333   -9.143  -2.579  1.00 0.50 ? 65  VAL A HB   7  
ATOM 9975  H HG11 . VAL A 1 65 ? 7.325   -10.336 -4.749  1.00 1.20 ? 65  VAL A HG11 7  
ATOM 9976  H HG12 . VAL A 1 65 ? 7.151   -8.589  -4.918  1.00 1.37 ? 65  VAL A HG12 7  
ATOM 9977  H HG13 . VAL A 1 65 ? 5.743   -9.635  -5.095  1.00 0.86 ? 65  VAL A HG13 7  
ATOM 9978  H HG21 . VAL A 1 65 ? 4.446   -8.504  -3.182  1.00 0.99 ? 65  VAL A HG21 7  
ATOM 9979  H HG22 . VAL A 1 65 ? 5.767   -7.339  -3.267  1.00 1.30 ? 65  VAL A HG22 7  
ATOM 9980  H HG23 . VAL A 1 65 ? 5.349   -8.087  -1.726  1.00 1.16 ? 65  VAL A HG23 7  
ATOM 9981  N N    . THR A 1 66 ? 7.182   -10.997 -0.482  1.00 0.63 ? 66  THR A N    7  
ATOM 9982  C CA   . THR A 1 66 ? 7.450   -10.971 0.956   1.00 0.69 ? 66  THR A CA   7  
ATOM 9983  C C    . THR A 1 66 ? 7.359   -9.537  1.475   1.00 0.61 ? 66  THR A C    7  
ATOM 9984  O O    . THR A 1 66 ? 7.278   -8.590  0.685   1.00 0.66 ? 66  THR A O    7  
ATOM 9985  C CB   . THR A 1 66 ? 8.835   -11.553 1.263   1.00 0.74 ? 66  THR A CB   7  
ATOM 9986  O OG1  . THR A 1 66 ? 9.837   -10.905 0.496   1.00 1.53 ? 66  THR A OG1  7  
ATOM 9987  C CG2  . THR A 1 66 ? 8.937   -13.038 0.987   1.00 1.17 ? 66  THR A CG2  7  
ATOM 9988  H H    . THR A 1 66 ? 7.901   -11.252 -1.099  1.00 0.62 ? 66  THR A H    7  
ATOM 9989  H HA   . THR A 1 66 ? 6.696   -11.569 1.447   1.00 0.80 ? 66  THR A HA   7  
ATOM 9990  H HB   . THR A 1 66 ? 9.055   -11.395 2.309   1.00 1.20 ? 66  THR A HB   7  
ATOM 9991  H HG1  . THR A 1 66 ? 10.032  -10.047 0.882   1.00 1.88 ? 66  THR A HG1  7  
ATOM 9992  H HG21 . THR A 1 66 ? 9.926   -13.384 1.245   1.00 1.74 ? 66  THR A HG21 7  
ATOM 9993  H HG22 . THR A 1 66 ? 8.751   -13.224 -0.060  1.00 1.61 ? 66  THR A HG22 7  
ATOM 9994  H HG23 . THR A 1 66 ? 8.204   -13.565 1.581   1.00 1.74 ? 66  THR A HG23 7  
ATOM 9995  N N    . HIS A 1 67 ? 7.357   -9.370  2.797   1.00 0.51 ? 67  HIS A N    7  
ATOM 9996  C CA   . HIS A 1 67 ? 7.258   -8.028  3.371   1.00 0.45 ? 67  HIS A CA   7  
ATOM 9997  C C    . HIS A 1 67 ? 8.368   -7.124  2.840   1.00 0.43 ? 67  HIS A C    7  
ATOM 9998  O O    . HIS A 1 67 ? 8.129   -5.950  2.566   1.00 0.41 ? 67  HIS A O    7  
ATOM 9999  C CB   . HIS A 1 67 ? 7.230   -8.031  4.904   1.00 0.45 ? 67  HIS A CB   7  
ATOM 10000 C CG   . HIS A 1 67 ? 6.964   -6.665  5.454   1.00 0.46 ? 67  HIS A CG   7  
ATOM 10001 N ND1  . HIS A 1 67 ? 5.722   -6.266  5.886   1.00 0.51 ? 67  HIS A ND1  7  
ATOM 10002 C CD2  . HIS A 1 67 ? 7.762   -5.577  5.561   1.00 0.49 ? 67  HIS A CD2  7  
ATOM 10003 C CE1  . HIS A 1 67 ? 5.768   -4.992  6.228   1.00 0.54 ? 67  HIS A CE1  7  
ATOM 10004 N NE2  . HIS A 1 67 ? 6.994   -4.551  6.042   1.00 0.52 ? 67  HIS A NE2  7  
ATOM 10005 H H    . HIS A 1 67 ? 7.409   -10.159 3.378   1.00 0.50 ? 67  HIS A H    7  
ATOM 10006 H HA   . HIS A 1 67 ? 6.320   -7.619  3.024   1.00 0.44 ? 67  HIS A HA   7  
ATOM 10007 H HB2  . HIS A 1 67 ? 6.436   -8.679  5.240   1.00 0.46 ? 67  HIS A HB2  7  
ATOM 10008 H HB3  . HIS A 1 67 ? 8.169   -8.385  5.298   1.00 0.44 ? 67  HIS A HB3  7  
ATOM 10009 H HD1  . HIS A 1 67 ? 4.926   -6.831  5.939   1.00 0.56 ? 67  HIS A HD1  7  
ATOM 10010 H HD2  . HIS A 1 67 ? 8.808   -5.524  5.307   1.00 0.54 ? 67  HIS A HD2  7  
ATOM 10011 H HE1  . HIS A 1 67 ? 4.938   -4.405  6.578   1.00 0.61 ? 67  HIS A HE1  7  
ATOM 10012 H HE2  . HIS A 1 67 ? 7.241   -3.605  6.005   1.00 0.56 ? 67  HIS A HE2  7  
ATOM 10013 N N    . GLU A 1 68 ? 9.580   -7.665  2.689   1.00 0.45 ? 68  GLU A N    7  
ATOM 10014 C CA   . GLU A 1 68 ? 10.707  -6.883  2.173   1.00 0.45 ? 68  GLU A CA   7  
ATOM 10015 C C    . GLU A 1 68 ? 10.278  -6.094  0.933   1.00 0.42 ? 68  GLU A C    7  
ATOM 10016 O O    . GLU A 1 68 ? 10.428  -4.875  0.883   1.00 0.41 ? 68  GLU A O    7  
ATOM 10017 C CB   . GLU A 1 68 ? 11.887  -7.799  1.828   1.00 0.49 ? 68  GLU A CB   7  
ATOM 10018 C CG   . GLU A 1 68 ? 12.399  -8.612  3.009   1.00 1.43 ? 68  GLU A CG   7  
ATOM 10019 C CD   . GLU A 1 68 ? 11.834  -10.021 3.039   1.00 2.13 ? 68  GLU A CD   7  
ATOM 10020 O OE1  . GLU A 1 68 ? 12.408  -10.905 2.369   1.00 2.59 ? 68  GLU A OE1  7  
ATOM 10021 O OE2  . GLU A 1 68 ? 10.815  -10.237 3.728   1.00 2.90 ? 68  GLU A OE2  7  
ATOM 10022 H H    . GLU A 1 68 ? 9.726   -8.600  2.938   1.00 0.47 ? 68  GLU A H    7  
ATOM 10023 H HA   . GLU A 1 68 ? 11.010  -6.188  2.941   1.00 0.47 ? 68  GLU A HA   7  
ATOM 10024 H HB2  . GLU A 1 68 ? 11.580  -8.484  1.052   1.00 1.08 ? 68  GLU A HB2  7  
ATOM 10025 H HB3  . GLU A 1 68 ? 12.701  -7.192  1.458   1.00 1.21 ? 68  GLU A HB3  7  
ATOM 10026 H HG2  . GLU A 1 68 ? 13.475  -8.675  2.946   1.00 2.02 ? 68  GLU A HG2  7  
ATOM 10027 H HG3  . GLU A 1 68 ? 12.122  -8.109  3.923   1.00 2.08 ? 68  GLU A HG3  7  
ATOM 10028 N N    . GLU A 1 69 ? 9.731   -6.807  -0.059  1.00 0.44 ? 69  GLU A N    7  
ATOM 10029 C CA   . GLU A 1 69 ? 9.262   -6.182  -1.298  1.00 0.43 ? 69  GLU A CA   7  
ATOM 10030 C C    . GLU A 1 69 ? 8.175   -5.139  -1.017  1.00 0.41 ? 69  GLU A C    7  
ATOM 10031 O O    . GLU A 1 69 ? 8.086   -4.129  -1.715  1.00 0.41 ? 69  GLU A O    7  
ATOM 10032 C CB   . GLU A 1 69 ? 8.737   -7.241  -2.273  1.00 0.46 ? 69  GLU A CB   7  
ATOM 10033 C CG   . GLU A 1 69 ? 9.138   -6.989  -3.719  1.00 0.76 ? 69  GLU A CG   7  
ATOM 10034 C CD   . GLU A 1 69 ? 8.508   -5.733  -4.293  1.00 1.07 ? 69  GLU A CD   7  
ATOM 10035 O OE1  . GLU A 1 69 ? 7.299   -5.762  -4.603  1.00 1.70 ? 69  GLU A OE1  7  
ATOM 10036 O OE2  . GLU A 1 69 ? 9.225   -4.719  -4.430  1.00 1.84 ? 69  GLU A OE2  7  
ATOM 10037 H H    . GLU A 1 69 ? 9.645   -7.777  0.057   1.00 0.48 ? 69  GLU A H    7  
ATOM 10038 H HA   . GLU A 1 69 ? 10.107  -5.683  -1.751  1.00 0.46 ? 69  GLU A HA   7  
ATOM 10039 H HB2  . GLU A 1 69 ? 9.119   -8.206  -1.979  1.00 0.64 ? 69  GLU A HB2  7  
ATOM 10040 H HB3  . GLU A 1 69 ? 7.659   -7.259  -2.221  1.00 0.63 ? 69  GLU A HB3  7  
ATOM 10041 H HG2  . GLU A 1 69 ? 10.212  -6.889  -3.768  1.00 1.51 ? 69  GLU A HG2  7  
ATOM 10042 H HG3  . GLU A 1 69 ? 8.830   -7.834  -4.317  1.00 1.43 ? 69  GLU A HG3  7  
ATOM 10043 N N    . ALA A 1 70 ? 7.367   -5.375  0.024   1.00 0.41 ? 70  ALA A N    7  
ATOM 10044 C CA   . ALA A 1 70 ? 6.308   -4.441  0.415   1.00 0.41 ? 70  ALA A CA   7  
ATOM 10045 C C    . ALA A 1 70 ? 6.895   -3.065  0.726   1.00 0.40 ? 70  ALA A C    7  
ATOM 10046 O O    . ALA A 1 70 ? 6.379   -2.038  0.287   1.00 0.42 ? 70  ALA A O    7  
ATOM 10047 C CB   . ALA A 1 70 ? 5.565   -4.969  1.634   1.00 0.44 ? 70  ALA A CB   7  
ATOM 10048 H H    . ALA A 1 70 ? 7.499   -6.188  0.557   1.00 0.44 ? 70  ALA A H    7  
ATOM 10049 H HA   . ALA A 1 70 ? 5.601   -4.355  -0.402  1.00 0.42 ? 70  ALA A HA   7  
ATOM 10050 H HB1  . ALA A 1 70 ? 5.146   -5.938  1.410   1.00 1.00 ? 70  ALA A HB1  7  
ATOM 10051 H HB2  . ALA A 1 70 ? 4.777   -4.284  1.901   1.00 1.28 ? 70  ALA A HB2  7  
ATOM 10052 H HB3  . ALA A 1 70 ? 6.252   -5.059  2.461   1.00 0.98 ? 70  ALA A HB3  7  
ATOM 10053 N N    . VAL A 1 71 ? 7.996   -3.067  1.474   1.00 0.40 ? 71  VAL A N    7  
ATOM 10054 C CA   . VAL A 1 71 ? 8.685   -1.833  1.839   1.00 0.42 ? 71  VAL A CA   7  
ATOM 10055 C C    . VAL A 1 71 ? 9.577   -1.344  0.699   1.00 0.41 ? 71  VAL A C    7  
ATOM 10056 O O    . VAL A 1 71 ? 9.714   -0.140  0.484   1.00 0.42 ? 71  VAL A O    7  
ATOM 10057 C CB   . VAL A 1 71 ? 9.531   -2.019  3.121   1.00 0.48 ? 71  VAL A CB   7  
ATOM 10058 C CG1  . VAL A 1 71 ? 10.409  -0.802  3.383   1.00 0.52 ? 71  VAL A CG1  7  
ATOM 10059 C CG2  . VAL A 1 71 ? 8.634   -2.298  4.318   1.00 0.50 ? 71  VAL A CG2  7  
ATOM 10060 H H    . VAL A 1 71 ? 8.366   -3.930  1.758   1.00 0.41 ? 71  VAL A H    7  
ATOM 10061 H HA   . VAL A 1 71 ? 7.930   -1.083  2.034   1.00 0.43 ? 71  VAL A HA   7  
ATOM 10062 H HB   . VAL A 1 71 ? 10.177  -2.874  2.978   1.00 0.51 ? 71  VAL A HB   7  
ATOM 10063 H HG11 . VAL A 1 71 ? 11.343  -0.911  2.853   1.00 1.18 ? 71  VAL A HG11 7  
ATOM 10064 H HG12 . VAL A 1 71 ? 10.605  -0.720  4.442   1.00 1.21 ? 71  VAL A HG12 7  
ATOM 10065 H HG13 . VAL A 1 71 ? 9.903   0.089   3.041   1.00 1.02 ? 71  VAL A HG13 7  
ATOM 10066 H HG21 . VAL A 1 71 ? 9.034   -3.128  4.882   1.00 1.07 ? 71  VAL A HG21 7  
ATOM 10067 H HG22 . VAL A 1 71 ? 7.640   -2.543  3.975   1.00 1.12 ? 71  VAL A HG22 7  
ATOM 10068 H HG23 . VAL A 1 71 ? 8.591   -1.423  4.948   1.00 1.00 ? 71  VAL A HG23 7  
ATOM 10069 N N    . THR A 1 72 ? 10.178  -2.288  -0.031  1.00 0.43 ? 72  THR A N    7  
ATOM 10070 C CA   . THR A 1 72 ? 11.056  -1.963  -1.151  1.00 0.47 ? 72  THR A CA   7  
ATOM 10071 C C    . THR A 1 72 ? 10.296  -1.233  -2.259  1.00 0.42 ? 72  THR A C    7  
ATOM 10072 O O    . THR A 1 72 ? 10.828  -0.310  -2.874  1.00 0.44 ? 72  THR A O    7  
ATOM 10073 C CB   . THR A 1 72 ? 11.701  -3.238  -1.711  1.00 0.53 ? 72  THR A CB   7  
ATOM 10074 O OG1  . THR A 1 72 ? 12.473  -3.891  -0.717  1.00 0.60 ? 72  THR A OG1  7  
ATOM 10075 C CG2  . THR A 1 72 ? 12.608  -2.984  -2.900  1.00 0.61 ? 72  THR A CG2  7  
ATOM 10076 H H    . THR A 1 72 ? 10.023  -3.229  0.189   1.00 0.46 ? 72  THR A H    7  
ATOM 10077 H HA   . THR A 1 72 ? 11.834  -1.316  -0.779  1.00 0.51 ? 72  THR A HA   7  
ATOM 10078 H HB   . THR A 1 72 ? 10.918  -3.913  -2.029  1.00 0.53 ? 72  THR A HB   7  
ATOM 10079 H HG1  . THR A 1 72 ? 13.107  -3.274  -0.343  1.00 0.98 ? 72  THR A HG1  7  
ATOM 10080 H HG21 . THR A 1 72 ? 13.314  -2.205  -2.654  1.00 1.16 ? 72  THR A HG21 7  
ATOM 10081 H HG22 . THR A 1 72 ? 12.013  -2.677  -3.749  1.00 0.86 ? 72  THR A HG22 7  
ATOM 10082 H HG23 . THR A 1 72 ? 13.144  -3.889  -3.145  1.00 1.27 ? 72  THR A HG23 7  
ATOM 10083 N N    . ALA A 1 73 ? 9.057   -1.656  -2.513  1.00 0.37 ? 73  ALA A N    7  
ATOM 10084 C CA   . ALA A 1 73 ? 8.226   -1.049  -3.550  1.00 0.36 ? 73  ALA A CA   7  
ATOM 10085 C C    . ALA A 1 73 ? 7.667   0.290   -3.092  1.00 0.34 ? 73  ALA A C    7  
ATOM 10086 O O    . ALA A 1 73 ? 7.578   1.232   -3.881  1.00 0.36 ? 73  ALA A O    7  
ATOM 10087 C CB   . ALA A 1 73 ? 7.093   -1.990  -3.940  1.00 0.41 ? 73  ALA A CB   7  
ATOM 10088 H H    . ALA A 1 73 ? 8.685   -2.395  -1.997  1.00 0.37 ? 73  ALA A H    7  
ATOM 10089 H HA   . ALA A 1 73 ? 8.844   -0.891  -4.423  1.00 0.39 ? 73  ALA A HA   7  
ATOM 10090 H HB1  . ALA A 1 73 ? 7.463   -3.004  -3.979  1.00 1.15 ? 73  ALA A HB1  7  
ATOM 10091 H HB2  . ALA A 1 73 ? 6.711   -1.709  -4.910  1.00 1.01 ? 73  ALA A HB2  7  
ATOM 10092 H HB3  . ALA A 1 73 ? 6.302   -1.923  -3.208  1.00 1.08 ? 73  ALA A HB3  7  
ATOM 10093 N N    . LEU A 1 74 ? 7.313   0.381   -1.807  1.00 0.33 ? 74  LEU A N    7  
ATOM 10094 C CA   . LEU A 1 74 ? 6.792   1.623   -1.249  1.00 0.37 ? 74  LEU A CA   7  
ATOM 10095 C C    . LEU A 1 74 ? 7.904   2.664   -1.167  1.00 0.38 ? 74  LEU A C    7  
ATOM 10096 O O    . LEU A 1 74 ? 7.649   3.866   -1.254  1.00 0.44 ? 74  LEU A O    7  
ATOM 10097 C CB   . LEU A 1 74 ? 6.209   1.381   0.150   1.00 0.41 ? 74  LEU A CB   7  
ATOM 10098 C CG   . LEU A 1 74 ? 4.841   0.687   0.200   1.00 0.61 ? 74  LEU A CG   7  
ATOM 10099 C CD1  . LEU A 1 74 ? 3.721   1.711   0.295   1.00 1.73 ? 74  LEU A CD1  7  
ATOM 10100 C CD2  . LEU A 1 74 ? 4.631   -0.216  -1.006  1.00 1.13 ? 74  LEU A CD2  7  
ATOM 10101 H H    . LEU A 1 74 ? 7.428   -0.393  -1.208  1.00 0.33 ? 74  LEU A H    7  
ATOM 10102 H HA   . LEU A 1 74 ? 6.013   1.986   -1.902  1.00 0.42 ? 74  LEU A HA   7  
ATOM 10103 H HB2  . LEU A 1 74 ? 6.912   0.778   0.706   1.00 0.61 ? 74  LEU A HB2  7  
ATOM 10104 H HB3  . LEU A 1 74 ? 6.118   2.337   0.644   1.00 0.47 ? 74  LEU A HB3  7  
ATOM 10105 H HG   . LEU A 1 74 ? 4.801   0.072   1.086   1.00 1.29 ? 74  LEU A HG   7  
ATOM 10106 H HD11 . LEU A 1 74 ? 3.749   2.355   -0.572  1.00 2.20 ? 74  LEU A HD11 7  
ATOM 10107 H HD12 . LEU A 1 74 ? 3.851   2.303   1.188   1.00 2.34 ? 74  LEU A HD12 7  
ATOM 10108 H HD13 . LEU A 1 74 ? 2.770   1.202   0.335   1.00 2.24 ? 74  LEU A HD13 7  
ATOM 10109 H HD21 . LEU A 1 74 ? 3.778   -0.854  -0.832  1.00 1.57 ? 74  LEU A HD21 7  
ATOM 10110 H HD22 . LEU A 1 74 ? 5.510   -0.824  -1.156  1.00 1.72 ? 74  LEU A HD22 7  
ATOM 10111 H HD23 . LEU A 1 74 ? 4.458   0.389   -1.884  1.00 1.75 ? 74  LEU A HD23 7  
ATOM 10112 N N    . LYS A 1 75 ? 9.141   2.187   -0.996  1.00 0.38 ? 75  LYS A N    7  
ATOM 10113 C CA   . LYS A 1 75 ? 10.302  3.076   -0.897  1.00 0.47 ? 75  LYS A CA   7  
ATOM 10114 C C    . LYS A 1 75 ? 10.931  3.363   -2.267  1.00 0.49 ? 75  LYS A C    7  
ATOM 10115 O O    . LYS A 1 75 ? 11.662  4.343   -2.418  1.00 0.59 ? 75  LYS A O    7  
ATOM 10116 C CB   . LYS A 1 75 ? 11.353  2.480   0.049   1.00 0.57 ? 75  LYS A CB   7  
ATOM 10117 C CG   . LYS A 1 75 ? 12.213  1.393   -0.584  1.00 0.64 ? 75  LYS A CG   7  
ATOM 10118 C CD   . LYS A 1 75 ? 13.506  1.183   0.189   1.00 1.05 ? 75  LYS A CD   7  
ATOM 10119 C CE   . LYS A 1 75 ? 13.287  0.320   1.422   1.00 0.88 ? 75  LYS A CE   7  
ATOM 10120 N NZ   . LYS A 1 75 ? 14.564  0.021   2.125   1.00 1.44 ? 75  LYS A NZ   7  
ATOM 10121 H H    . LYS A 1 75 ? 9.276   1.210   -0.933  1.00 0.37 ? 75  LYS A H    7  
ATOM 10122 H HA   . LYS A 1 75 ? 9.959   4.011   -0.480  1.00 0.54 ? 75  LYS A HA   7  
ATOM 10123 H HB2  . LYS A 1 75 ? 12.005  3.273   0.385   1.00 0.67 ? 75  LYS A HB2  7  
ATOM 10124 H HB3  . LYS A 1 75 ? 10.848  2.056   0.905   1.00 0.62 ? 75  LYS A HB3  7  
ATOM 10125 H HG2  . LYS A 1 75 ? 11.657  0.469   -0.592  1.00 0.87 ? 75  LYS A HG2  7  
ATOM 10126 H HG3  . LYS A 1 75 ? 12.453  1.680   -1.596  1.00 0.88 ? 75  LYS A HG3  7  
ATOM 10127 H HD2  . LYS A 1 75 ? 14.223  0.695   -0.455  1.00 1.90 ? 75  LYS A HD2  7  
ATOM 10128 H HD3  . LYS A 1 75 ? 13.890  2.143   0.495   1.00 1.62 ? 75  LYS A HD3  7  
ATOM 10129 H HE2  . LYS A 1 75 ? 12.628  0.844   2.099   1.00 1.04 ? 75  LYS A HE2  7  
ATOM 10130 H HE3  . LYS A 1 75 ? 12.826  -0.608  1.118   1.00 1.51 ? 75  LYS A HE3  7  
ATOM 10131 H HZ1  . LYS A 1 75 ? 15.178  -0.563  1.521   1.00 1.72 ? 75  LYS A HZ1  7  
ATOM 10132 H HZ2  . LYS A 1 75 ? 14.373  -0.497  3.008   1.00 1.94 ? 75  LYS A HZ2  7  
ATOM 10133 H HZ3  . LYS A 1 75 ? 15.062  0.904   2.356   1.00 1.92 ? 75  LYS A HZ3  7  
ATOM 10134 N N    . ASN A 1 76 ? 10.651  2.511   -3.261  1.00 0.48 ? 76  ASN A N    7  
ATOM 10135 C CA   . ASN A 1 76 ? 11.202  2.693   -4.606  1.00 0.59 ? 76  ASN A CA   7  
ATOM 10136 C C    . ASN A 1 76 ? 10.412  3.752   -5.379  1.00 0.69 ? 76  ASN A C    7  
ATOM 10137 O O    . ASN A 1 76 ? 9.772   3.459   -6.392  1.00 1.15 ? 76  ASN A O    7  
ATOM 10138 C CB   . ASN A 1 76 ? 11.202  1.362   -5.370  1.00 0.64 ? 76  ASN A CB   7  
ATOM 10139 C CG   . ASN A 1 76 ? 12.050  1.411   -6.628  1.00 0.85 ? 76  ASN A CG   7  
ATOM 10140 O OD1  . ASN A 1 76 ? 13.277  1.491   -6.560  1.00 0.90 ? 76  ASN A OD1  7  
ATOM 10141 N ND2  . ASN A 1 76 ? 11.401  1.365   -7.788  1.00 1.55 ? 76  ASN A ND2  7  
ATOM 10142 H H    . ASN A 1 76 ? 10.065  1.745   -3.088  1.00 0.45 ? 76  ASN A H    7  
ATOM 10143 H HA   . ASN A 1 76 ? 12.222  3.033   -4.499  1.00 0.73 ? 76  ASN A HA   7  
ATOM 10144 H HB2  . ASN A 1 76 ? 11.594  0.587   -4.729  1.00 0.71 ? 76  ASN A HB2  7  
ATOM 10145 H HB3  . ASN A 1 76 ? 10.189  1.113   -5.649  1.00 0.75 ? 76  ASN A HB3  7  
ATOM 10146 H HD21 . ASN A 1 76 ? 10.422  1.302   -7.770  1.00 1.95 ? 76  ASN A HD21 7  
ATOM 10147 H HD22 . ASN A 1 76 ? 11.927  1.395   -8.614  1.00 1.75 ? 76  ASN A HD22 7  
ATOM 10148 N N    . THR A 1 77 ? 10.458  4.988   -4.881  1.00 0.90 ? 77  THR A N    7  
ATOM 10149 C CA   . THR A 1 77 ? 9.749   6.101   -5.504  1.00 1.07 ? 77  THR A CA   7  
ATOM 10150 C C    . THR A 1 77 ? 10.702  7.257   -5.803  1.00 0.80 ? 77  THR A C    7  
ATOM 10151 O O    . THR A 1 77 ? 11.553  7.601   -4.981  1.00 1.47 ? 77  THR A O    7  
ATOM 10152 C CB   . THR A 1 77 ? 8.612   6.577   -4.593  1.00 2.00 ? 77  THR A CB   7  
ATOM 10153 O OG1  . THR A 1 77 ? 9.079   6.787   -3.270  1.00 2.60 ? 77  THR A OG1  7  
ATOM 10154 C CG2  . THR A 1 77 ? 7.458   5.602   -4.518  1.00 2.53 ? 77  THR A CG2  7  
ATOM 10155 H H    . THR A 1 77 ? 10.976  5.152   -4.066  1.00 1.26 ? 77  THR A H    7  
ATOM 10156 H HA   . THR A 1 77 ? 9.328   5.747   -6.434  1.00 1.56 ? 77  THR A HA   7  
ATOM 10157 H HB   . THR A 1 77 ? 8.230   7.513   -4.972  1.00 2.59 ? 77  THR A HB   7  
ATOM 10158 H HG1  . THR A 1 77 ? 9.651   7.558   -3.249  1.00 2.91 ? 77  THR A HG1  7  
ATOM 10159 H HG21 . THR A 1 77 ? 7.777   4.702   -4.012  1.00 2.58 ? 77  THR A HG21 7  
ATOM 10160 H HG22 . THR A 1 77 ? 7.129   5.355   -5.517  1.00 3.13 ? 77  THR A HG22 7  
ATOM 10161 H HG23 . THR A 1 77 ? 6.641   6.051   -3.972  1.00 2.95 ? 77  THR A HG23 7  
ATOM 10162 N N    . SER A 1 78 ? 10.549  7.853   -6.986  1.00 1.14 ? 78  SER A N    7  
ATOM 10163 C CA   . SER A 1 78 ? 11.391  8.973   -7.399  1.00 1.74 ? 78  SER A CA   7  
ATOM 10164 C C    . SER A 1 78 ? 10.585  10.272  -7.431  1.00 1.42 ? 78  SER A C    7  
ATOM 10165 O O    . SER A 1 78 ? 10.643  11.065  -6.490  1.00 1.44 ? 78  SER A O    7  
ATOM 10166 C CB   . SER A 1 78 ? 12.019  8.695   -8.769  1.00 2.76 ? 78  SER A CB   7  
ATOM 10167 O OG   . SER A 1 78 ? 13.153  7.853   -8.648  1.00 3.36 ? 78  SER A OG   7  
ATOM 10168 H H    . SER A 1 78 ? 9.848   7.532   -7.592  1.00 1.57 ? 78  SER A H    7  
ATOM 10169 H HA   . SER A 1 78 ? 12.180  9.078   -6.669  1.00 2.08 ? 78  SER A HA   7  
ATOM 10170 H HB2  . SER A 1 78 ? 11.292  8.210   -9.404  1.00 3.05 ? 78  SER A HB2  7  
ATOM 10171 H HB3  . SER A 1 78 ? 12.325  9.627   -9.219  1.00 3.31 ? 78  SER A HB3  7  
ATOM 10172 H HG   . SER A 1 78 ? 12.871  6.935   -8.640  1.00 3.89 ? 78  SER A HG   7  
ATOM 10173 N N    . ASP A 1 79 ? 9.828   10.481  -8.512  1.00 1.32 ? 79  ASP A N    7  
ATOM 10174 C CA   . ASP A 1 79 ? 9.007   11.683  -8.651  1.00 1.18 ? 79  ASP A CA   7  
ATOM 10175 C C    . ASP A 1 79 ? 7.549   11.386  -8.297  1.00 0.99 ? 79  ASP A C    7  
ATOM 10176 O O    . ASP A 1 79 ? 6.926   12.133  -7.543  1.00 0.92 ? 79  ASP A O    7  
ATOM 10177 C CB   . ASP A 1 79 ? 9.111   12.254  -10.073 1.00 1.46 ? 79  ASP A CB   7  
ATOM 10178 C CG   . ASP A 1 79 ? 8.638   11.286  -11.144 1.00 1.61 ? 79  ASP A CG   7  
ATOM 10179 O OD1  . ASP A 1 79 ? 9.444   10.432  -11.570 1.00 2.23 ? 79  ASP A OD1  7  
ATOM 10180 O OD2  . ASP A 1 79 ? 7.464   11.384  -11.558 1.00 2.07 ? 79  ASP A OD2  7  
ATOM 10181 H H    . ASP A 1 79 ? 9.818   9.811   -9.228  1.00 1.49 ? 79  ASP A H    7  
ATOM 10182 H HA   . ASP A 1 79 ? 9.384   12.417  -7.954  1.00 1.15 ? 79  ASP A HA   7  
ATOM 10183 H HB2  . ASP A 1 79 ? 8.510   13.148  -10.137 1.00 2.06 ? 79  ASP A HB2  7  
ATOM 10184 H HB3  . ASP A 1 79 ? 10.142  12.508  -10.275 1.00 1.75 ? 79  ASP A HB3  7  
ATOM 10185 N N    . PHE A 1 80 ? 7.015   10.287  -8.837  1.00 0.97 ? 80  PHE A N    7  
ATOM 10186 C CA   . PHE A 1 80 ? 5.637   9.887   -8.568  1.00 0.85 ? 80  PHE A CA   7  
ATOM 10187 C C    . PHE A 1 80 ? 5.557   8.412   -8.179  1.00 0.82 ? 80  PHE A C    7  
ATOM 10188 O O    . PHE A 1 80 ? 6.526   7.666   -8.338  1.00 0.92 ? 80  PHE A O    7  
ATOM 10189 C CB   . PHE A 1 80 ? 4.750   10.164  -9.782  1.00 0.92 ? 80  PHE A CB   7  
ATOM 10190 C CG   . PHE A 1 80 ? 3.675   11.167  -9.494  1.00 0.94 ? 80  PHE A CG   7  
ATOM 10191 C CD1  . PHE A 1 80 ? 3.949   12.524  -9.541  1.00 1.68 ? 80  PHE A CD1  7  
ATOM 10192 C CD2  . PHE A 1 80 ? 2.397   10.754  -9.156  1.00 1.39 ? 80  PHE A CD2  7  
ATOM 10193 C CE1  . PHE A 1 80 ? 2.969   13.451  -9.255  1.00 1.77 ? 80  PHE A CE1  7  
ATOM 10194 C CE2  . PHE A 1 80 ? 1.412   11.678  -8.873  1.00 1.43 ? 80  PHE A CE2  7  
ATOM 10195 C CZ   . PHE A 1 80 ? 1.698   13.028  -8.921  1.00 1.14 ? 80  PHE A CZ   7  
ATOM 10196 H H    . PHE A 1 80 ? 7.566   9.727   -9.424  1.00 1.09 ? 80  PHE A H    7  
ATOM 10197 H HA   . PHE A 1 80 ? 5.283   10.478  -7.737  1.00 0.81 ? 80  PHE A HA   7  
ATOM 10198 H HB2  . PHE A 1 80 ? 5.358   10.546  -10.589 1.00 1.04 ? 80  PHE A HB2  7  
ATOM 10199 H HB3  . PHE A 1 80 ? 4.276   9.245   -10.096 1.00 0.93 ? 80  PHE A HB3  7  
ATOM 10200 H HD1  . PHE A 1 80 ? 4.943   12.855  -9.805  1.00 2.48 ? 80  PHE A HD1  7  
ATOM 10201 H HD2  . PHE A 1 80 ? 2.173   9.697   -9.119  1.00 2.16 ? 80  PHE A HD2  7  
ATOM 10202 H HE1  . PHE A 1 80 ? 3.193   14.506  -9.296  1.00 2.61 ? 80  PHE A HE1  7  
ATOM 10203 H HE2  . PHE A 1 80 ? 0.419   11.346  -8.611  1.00 2.19 ? 80  PHE A HE2  7  
ATOM 10204 H HZ   . PHE A 1 80 ? 0.933   13.750  -8.691  1.00 1.26 ? 80  PHE A HZ   7  
ATOM 10205 N N    . VAL A 1 81 ? 4.386   7.989   -7.698  1.00 0.75 ? 81  VAL A N    7  
ATOM 10206 C CA   . VAL A 1 81 ? 4.161   6.598   -7.320  1.00 0.77 ? 81  VAL A CA   7  
ATOM 10207 C C    . VAL A 1 81 ? 2.739   6.177   -7.699  1.00 0.65 ? 81  VAL A C    7  
ATOM 10208 O O    . VAL A 1 81 ? 1.765   6.791   -7.258  1.00 0.59 ? 81  VAL A O    7  
ATOM 10209 C CB   . VAL A 1 81 ? 4.399   6.360   -5.808  1.00 0.88 ? 81  VAL A CB   7  
ATOM 10210 C CG1  . VAL A 1 81 ? 3.645   7.376   -4.962  1.00 1.19 ? 81  VAL A CG1  7  
ATOM 10211 C CG2  . VAL A 1 81 ? 4.013   4.938   -5.417  1.00 1.58 ? 81  VAL A CG2  7  
ATOM 10212 H H    . VAL A 1 81 ? 3.630   8.608   -7.623  1.00 0.74 ? 81  VAL A H    7  
ATOM 10213 H HA   . VAL A 1 81 ? 4.862   5.988   -7.874  1.00 0.89 ? 81  VAL A HA   7  
ATOM 10214 H HB   . VAL A 1 81 ? 5.453   6.485   -5.612  1.00 1.14 ? 81  VAL A HB   7  
ATOM 10215 H HG11 . VAL A 1 81 ? 3.512   6.986   -3.964  1.00 1.78 ? 81  VAL A HG11 7  
ATOM 10216 H HG12 . VAL A 1 81 ? 2.681   7.570   -5.404  1.00 1.62 ? 81  VAL A HG12 7  
ATOM 10217 H HG13 . VAL A 1 81 ? 4.212   8.295   -4.915  1.00 1.67 ? 81  VAL A HG13 7  
ATOM 10218 H HG21 . VAL A 1 81 ? 2.939   4.868   -5.328  1.00 1.98 ? 81  VAL A HG21 7  
ATOM 10219 H HG22 . VAL A 1 81 ? 4.470   4.689   -4.472  1.00 2.06 ? 81  VAL A HG22 7  
ATOM 10220 H HG23 . VAL A 1 81 ? 4.357   4.250   -6.176  1.00 2.07 ? 81  VAL A HG23 7  
ATOM 10221 N N    . TYR A 1 82 ? 2.622   5.134   -8.518  1.00 0.72 ? 82  TYR A N    7  
ATOM 10222 C CA   . TYR A 1 82 ? 1.309   4.653   -8.944  1.00 0.69 ? 82  TYR A CA   7  
ATOM 10223 C C    . TYR A 1 82 ? 0.874   3.452   -8.111  1.00 0.67 ? 82  TYR A C    7  
ATOM 10224 O O    . TYR A 1 82 ? 1.306   2.321   -8.346  1.00 0.77 ? 82  TYR A O    7  
ATOM 10225 C CB   . TYR A 1 82 ? 1.311   4.300   -10.431 1.00 0.85 ? 82  TYR A CB   7  
ATOM 10226 C CG   . TYR A 1 82 ? -0.073  4.155   -11.023 1.00 0.93 ? 82  TYR A CG   7  
ATOM 10227 C CD1  . TYR A 1 82 ? -0.729  2.933   -10.987 1.00 1.57 ? 82  TYR A CD1  7  
ATOM 10228 C CD2  . TYR A 1 82 ? -0.722  5.232   -11.615 1.00 1.41 ? 82  TYR A CD2  7  
ATOM 10229 C CE1  . TYR A 1 82 ? -1.990  2.785   -11.524 1.00 1.72 ? 82  TYR A CE1  7  
ATOM 10230 C CE2  . TYR A 1 82 ? -1.986  5.092   -12.154 1.00 1.55 ? 82  TYR A CE2  7  
ATOM 10231 C CZ   . TYR A 1 82 ? -2.616  3.867   -12.106 1.00 1.33 ? 82  TYR A CZ   7  
ATOM 10232 O OH   . TYR A 1 82 ? -3.875  3.722   -12.642 1.00 1.58 ? 82  TYR A OH   7  
ATOM 10233 H H    . TYR A 1 82 ? 3.435   4.685   -8.834  1.00 0.85 ? 82  TYR A H    7  
ATOM 10234 H HA   . TYR A 1 82 ? 0.603   5.454   -8.778  1.00 0.64 ? 82  TYR A HA   7  
ATOM 10235 H HB2  . TYR A 1 82 ? 1.826   5.076   -10.977 1.00 0.88 ? 82  TYR A HB2  7  
ATOM 10236 H HB3  . TYR A 1 82 ? 1.825   3.364   -10.568 1.00 0.99 ? 82  TYR A HB3  7  
ATOM 10237 H HD1  . TYR A 1 82 ? -0.238  2.086   -10.531 1.00 2.27 ? 82  TYR A HD1  7  
ATOM 10238 H HD2  . TYR A 1 82 ? -0.228  6.191   -11.654 1.00 2.08 ? 82  TYR A HD2  7  
ATOM 10239 H HE1  . TYR A 1 82 ? -2.479  1.826   -11.485 1.00 2.47 ? 82  TYR A HE1  7  
ATOM 10240 H HE2  . TYR A 1 82 ? -2.475  5.939   -12.609 1.00 2.24 ? 82  TYR A HE2  7  
ATOM 10241 H HH   . TYR A 1 82 ? -3.804  3.494   -13.573 1.00 1.97 ? 82  TYR A HH   7  
ATOM 10242 N N    . LEU A 1 83 ? 0.027   3.723   -7.123  1.00 0.62 ? 83  LEU A N    7  
ATOM 10243 C CA   . LEU A 1 83 ? -0.471  2.690   -6.223  1.00 0.65 ? 83  LEU A CA   7  
ATOM 10244 C C    . LEU A 1 83 ? -1.812  2.126   -6.694  1.00 0.66 ? 83  LEU A C    7  
ATOM 10245 O O    . LEU A 1 83 ? -2.765  2.871   -6.933  1.00 0.71 ? 83  LEU A O    7  
ATOM 10246 C CB   . LEU A 1 83 ? -0.613  3.252   -4.805  1.00 0.74 ? 83  LEU A CB   7  
ATOM 10247 C CG   . LEU A 1 83 ? -0.701  2.203   -3.694  1.00 0.74 ? 83  LEU A CG   7  
ATOM 10248 C CD1  . LEU A 1 83 ? 0.032   2.679   -2.449  1.00 1.34 ? 83  LEU A CD1  7  
ATOM 10249 C CD2  . LEU A 1 83 ? -2.154  1.889   -3.373  1.00 1.38 ? 83  LEU A CD2  7  
ATOM 10250 H H    . LEU A 1 83 ? -0.251  4.652   -6.988  1.00 0.62 ? 83  LEU A H    7  
ATOM 10251 H HA   . LEU A 1 83 ? 0.254   1.891   -6.207  1.00 0.69 ? 83  LEU A HA   7  
ATOM 10252 H HB2  . LEU A 1 83 ? 0.240   3.886   -4.607  1.00 0.88 ? 83  LEU A HB2  7  
ATOM 10253 H HB3  . LEU A 1 83 ? -1.505  3.858   -4.768  1.00 0.80 ? 83  LEU A HB3  7  
ATOM 10254 H HG   . LEU A 1 83 ? -0.227  1.293   -4.031  1.00 1.48 ? 83  LEU A HG   7  
ATOM 10255 H HD11 . LEU A 1 83 ? 1.081   2.801   -2.672  1.00 1.81 ? 83  LEU A HD11 7  
ATOM 10256 H HD12 . LEU A 1 83 ? -0.087  1.951   -1.660  1.00 1.91 ? 83  LEU A HD12 7  
ATOM 10257 H HD13 . LEU A 1 83 ? -0.381  3.625   -2.127  1.00 1.85 ? 83  LEU A HD13 7  
ATOM 10258 H HD21 . LEU A 1 83 ? -2.686  1.670   -4.287  1.00 1.83 ? 83  LEU A HD21 7  
ATOM 10259 H HD22 . LEU A 1 83 ? -2.609  2.740   -2.888  1.00 2.00 ? 83  LEU A HD22 7  
ATOM 10260 H HD23 . LEU A 1 83 ? -2.200  1.032   -2.717  1.00 1.85 ? 83  LEU A HD23 7  
ATOM 10261 N N    . LYS A 1 84 ? -1.871  0.800   -6.803  1.00 0.66 ? 84  LYS A N    7  
ATOM 10262 C CA   . LYS A 1 84 ? -3.084  0.102   -7.218  1.00 0.68 ? 84  LYS A CA   7  
ATOM 10263 C C    . LYS A 1 84 ? -3.612  -0.736  -6.061  1.00 0.65 ? 84  LYS A C    7  
ATOM 10264 O O    . LYS A 1 84 ? -2.842  -1.127  -5.183  1.00 0.68 ? 84  LYS A O    7  
ATOM 10265 C CB   . LYS A 1 84 ? -2.801  -0.792  -8.428  1.00 0.69 ? 84  LYS A CB   7  
ATOM 10266 C CG   . LYS A 1 84 ? -3.190  -0.162  -9.756  1.00 0.76 ? 84  LYS A CG   7  
ATOM 10267 C CD   . LYS A 1 84 ? -4.675  -0.329  -10.041 1.00 0.99 ? 84  LYS A CD   7  
ATOM 10268 C CE   . LYS A 1 84 ? -4.992  -1.719  -10.571 1.00 1.18 ? 84  LYS A CE   7  
ATOM 10269 N NZ   . LYS A 1 84 ? -4.886  -1.789  -12.054 1.00 1.56 ? 84  LYS A NZ   7  
ATOM 10270 H H    . LYS A 1 84 ? -1.076  0.271   -6.581  1.00 0.68 ? 84  LYS A H    7  
ATOM 10271 H HA   . LYS A 1 84 ? -3.820  0.835   -7.482  1.00 0.72 ? 84  LYS A HA   7  
ATOM 10272 H HB2  . LYS A 1 84 ? -1.745  -1.015  -8.456  1.00 0.66 ? 84  LYS A HB2  7  
ATOM 10273 H HB3  . LYS A 1 84 ? -3.351  -1.714  -8.317  1.00 0.73 ? 84  LYS A HB3  7  
ATOM 10274 H HG2  . LYS A 1 84 ? -2.956  0.891   -9.725  1.00 0.93 ? 84  LYS A HG2  7  
ATOM 10275 H HG3  . LYS A 1 84 ? -2.625  -0.635  -10.546 1.00 0.86 ? 84  LYS A HG3  7  
ATOM 10276 H HD2  . LYS A 1 84 ? -5.227  -0.169  -9.127  1.00 1.65 ? 84  LYS A HD2  7  
ATOM 10277 H HD3  . LYS A 1 84 ? -4.974  0.405   -10.776 1.00 1.42 ? 84  LYS A HD3  7  
ATOM 10278 H HE2  . LYS A 1 84 ? -4.299  -2.424  -10.137 1.00 1.51 ? 84  LYS A HE2  7  
ATOM 10279 H HE3  . LYS A 1 84 ? -5.999  -1.981  -10.277 1.00 1.85 ? 84  LYS A HE3  7  
ATOM 10280 H HZ1  . LYS A 1 84 ? -5.576  -1.146  -12.493 1.00 2.19 ? 84  LYS A HZ1  7  
ATOM 10281 H HZ2  . LYS A 1 84 ? -5.076  -2.758  -12.381 1.00 1.68 ? 84  LYS A HZ2  7  
ATOM 10282 H HZ3  . LYS A 1 84 ? -3.931  -1.514  -12.359 1.00 2.00 ? 84  LYS A HZ3  7  
ATOM 10283 N N    . VAL A 1 85 ? -4.919  -1.007  -6.041  1.00 0.76 ? 85  VAL A N    7  
ATOM 10284 C CA   . VAL A 1 85 ? -5.510  -1.797  -4.964  1.00 0.74 ? 85  VAL A CA   7  
ATOM 10285 C C    . VAL A 1 85 ? -6.458  -2.865  -5.514  1.00 0.91 ? 85  VAL A C    7  
ATOM 10286 O O    . VAL A 1 85 ? -7.234  -2.605  -6.436  1.00 1.17 ? 85  VAL A O    7  
ATOM 10287 C CB   . VAL A 1 85 ? -6.280  -0.903  -3.966  1.00 0.99 ? 85  VAL A CB   7  
ATOM 10288 C CG1  . VAL A 1 85 ? -6.977  -1.747  -2.904  1.00 1.92 ? 85  VAL A CG1  7  
ATOM 10289 C CG2  . VAL A 1 85 ? -5.344  0.112   -3.323  1.00 0.65 ? 85  VAL A CG2  7  
ATOM 10290 H H    . VAL A 1 85 ? -5.514  -0.673  -6.746  1.00 0.92 ? 85  VAL A H    7  
ATOM 10291 H HA   . VAL A 1 85 ? -4.702  -2.285  -4.434  1.00 0.62 ? 85  VAL A HA   7  
ATOM 10292 H HB   . VAL A 1 85 ? -7.038  -0.363  -4.514  1.00 1.45 ? 85  VAL A HB   7  
ATOM 10293 H HG11 . VAL A 1 85 ? -6.990  -1.209  -1.968  1.00 2.23 ? 85  VAL A HG11 7  
ATOM 10294 H HG12 . VAL A 1 85 ? -6.442  -2.679  -2.776  1.00 2.51 ? 85  VAL A HG12 7  
ATOM 10295 H HG13 . VAL A 1 85 ? -7.990  -1.953  -3.215  1.00 2.42 ? 85  VAL A HG13 7  
ATOM 10296 H HG21 . VAL A 1 85 ? -4.398  -0.358  -3.102  1.00 1.26 ? 85  VAL A HG21 7  
ATOM 10297 H HG22 . VAL A 1 85 ? -5.786  0.481   -2.409  1.00 1.21 ? 85  VAL A HG22 7  
ATOM 10298 H HG23 . VAL A 1 85 ? -5.187  0.936   -4.003  1.00 1.21 ? 85  VAL A HG23 7  
ATOM 10299 N N    . ALA A 1 86 ? -6.384  -4.065  -4.937  1.00 0.91 ? 86  ALA A N    7  
ATOM 10300 C CA   . ALA A 1 86 ? -7.227  -5.182  -5.356  1.00 1.24 ? 86  ALA A CA   7  
ATOM 10301 C C    . ALA A 1 86 ? -8.369  -5.412  -4.372  1.00 1.27 ? 86  ALA A C    7  
ATOM 10302 O O    . ALA A 1 86 ? -8.270  -5.054  -3.198  1.00 1.09 ? 86  ALA A O    7  
ATOM 10303 C CB   . ALA A 1 86 ? -6.392  -6.447  -5.503  1.00 1.46 ? 86  ALA A CB   7  
ATOM 10304 H H    . ALA A 1 86 ? -5.741  -4.201  -4.209  1.00 0.76 ? 86  ALA A H    7  
ATOM 10305 H HA   . ALA A 1 86 ? -7.643  -4.942  -6.324  1.00 1.52 ? 86  ALA A HA   7  
ATOM 10306 H HB1  . ALA A 1 86 ? -6.667  -6.956  -6.415  1.00 1.81 ? 86  ALA A HB1  7  
ATOM 10307 H HB2  . ALA A 1 86 ? -6.570  -7.097  -4.660  1.00 2.07 ? 86  ALA A HB2  7  
ATOM 10308 H HB3  . ALA A 1 86 ? -5.345  -6.185  -5.541  1.00 1.62 ? 86  ALA A HB3  7  
ATOM 10309 N N    . LYS A 1 87 ? -9.454  -6.017  -4.856  1.00 1.68 ? 87  LYS A N    7  
ATOM 10310 C CA   . LYS A 1 87 ? -10.615 -6.300  -4.018  1.00 1.86 ? 87  LYS A CA   7  
ATOM 10311 C C    . LYS A 1 87 ? -10.816 -7.809  -3.868  1.00 1.91 ? 87  LYS A C    7  
ATOM 10312 O O    . LYS A 1 87 ? -11.163 -8.494  -4.833  1.00 2.04 ? 87  LYS A O    7  
ATOM 10313 C CB   . LYS A 1 87 ? -11.870 -5.656  -4.612  1.00 2.22 ? 87  LYS A CB   7  
ATOM 10314 C CG   . LYS A 1 87 ? -11.932 -4.150  -4.413  1.00 2.53 ? 87  LYS A CG   7  
ATOM 10315 C CD   . LYS A 1 87 ? -13.195 -3.558  -5.016  1.00 2.89 ? 87  LYS A CD   7  
ATOM 10316 C CE   . LYS A 1 87 ? -13.054 -3.345  -6.516  1.00 3.28 ? 87  LYS A CE   7  
ATOM 10317 N NZ   . LYS A 1 87 ? -14.290 -3.729  -7.253  1.00 4.20 ? 87  LYS A NZ   7  
ATOM 10318 H H    . LYS A 1 87 ? -9.473  -6.284  -5.800  1.00 1.92 ? 87  LYS A H    7  
ATOM 10319 H HA   . LYS A 1 87 ? -10.431 -5.874  -3.043  1.00 1.79 ? 87  LYS A HA   7  
ATOM 10320 H HB2  . LYS A 1 87 ? -11.898 -5.859  -5.672  1.00 2.44 ? 87  LYS A HB2  7  
ATOM 10321 H HB3  . LYS A 1 87 ? -12.741 -6.095  -4.147  1.00 2.56 ? 87  LYS A HB3  7  
ATOM 10322 H HG2  . LYS A 1 87 ? -11.917 -3.936  -3.355  1.00 2.95 ? 87  LYS A HG2  7  
ATOM 10323 H HG3  . LYS A 1 87 ? -11.071 -3.699  -4.885  1.00 2.69 ? 87  LYS A HG3  7  
ATOM 10324 H HD2  . LYS A 1 87 ? -14.019 -4.231  -4.835  1.00 3.05 ? 87  LYS A HD2  7  
ATOM 10325 H HD3  . LYS A 1 87 ? -13.395 -2.607  -4.543  1.00 3.28 ? 87  LYS A HD3  7  
ATOM 10326 H HE2  . LYS A 1 87 ? -12.847 -2.301  -6.700  1.00 3.46 ? 87  LYS A HE2  7  
ATOM 10327 H HE3  . LYS A 1 87 ? -12.230 -3.943  -6.876  1.00 3.29 ? 87  LYS A HE3  7  
ATOM 10328 H HZ1  . LYS A 1 87 ? -15.091 -3.142  -6.941  1.00 4.41 ? 87  LYS A HZ1  7  
ATOM 10329 H HZ2  . LYS A 1 87 ? -14.517 -4.729  -7.075  1.00 4.48 ? 87  LYS A HZ2  7  
ATOM 10330 H HZ3  . LYS A 1 87 ? -14.153 -3.594  -8.275  1.00 4.70 ? 87  LYS A HZ3  7  
ATOM 10331 N N    . PRO A 1 88 ? -10.592 -8.350  -2.652  1.00 1.88 ? 88  PRO A N    7  
ATOM 10332 C CA   . PRO A 1 88 ? -10.746 -9.787  -2.381  1.00 2.01 ? 88  PRO A CA   7  
ATOM 10333 C C    . PRO A 1 88 ? -12.184 -10.271 -2.586  1.00 2.20 ? 88  PRO A C    7  
ATOM 10334 O O    . PRO A 1 88 ? -13.109 -9.781  -1.936  1.00 2.28 ? 88  PRO A O    7  
ATOM 10335 C CB   . PRO A 1 88 ? -10.339 -9.927  -0.908  1.00 1.98 ? 88  PRO A CB   7  
ATOM 10336 C CG   . PRO A 1 88 ? -10.479 -8.560  -0.333  1.00 1.91 ? 88  PRO A CG   7  
ATOM 10337 C CD   . PRO A 1 88 ? -10.170 -7.607  -1.451  1.00 1.79 ? 88  PRO A CD   7  
ATOM 10338 H HA   . PRO A 1 88 ? -10.077 -10.371 -2.995  1.00 2.04 ? 88  PRO A HA   7  
ATOM 10339 H HB2  . PRO A 1 88 ? -10.994 -10.631 -0.417  1.00 2.18 ? 88  PRO A HB2  7  
ATOM 10340 H HB3  . PRO A 1 88 ? -9.319  -10.276 -0.848  1.00 1.96 ? 88  PRO A HB3  7  
ATOM 10341 H HG2  . PRO A 1 88 ? -11.490 -8.411  0.018   1.00 2.24 ? 88  PRO A HG2  7  
ATOM 10342 H HG3  . PRO A 1 88 ? -9.777  -8.428  0.477   1.00 1.85 ? 88  PRO A HG3  7  
ATOM 10343 H HD2  . PRO A 1 88 ? -10.740 -6.696  -1.338  1.00 1.89 ? 88  PRO A HD2  7  
ATOM 10344 H HD3  . PRO A 1 88 ? -9.112  -7.391  -1.483  1.00 1.68 ? 88  PRO A HD3  7  
ATOM 10345 N N    . THR A 1 89 ? -12.366 -11.235 -3.495  1.00 2.38 ? 89  THR A N    7  
ATOM 10346 C CA   . THR A 1 89 ? -13.690 -11.783 -3.784  1.00 2.59 ? 89  THR A CA   7  
ATOM 10347 C C    . THR A 1 89 ? -13.623 -13.297 -3.983  1.00 2.77 ? 89  THR A C    7  
ATOM 10348 O O    . THR A 1 89 ? -12.847 -13.788 -4.806  1.00 3.51 ? 89  THR A O    7  
ATOM 10349 C CB   . THR A 1 89 ? -14.285 -11.117 -5.031  1.00 3.08 ? 89  THR A CB   7  
ATOM 10350 O OG1  . THR A 1 89 ? -13.364 -11.144 -6.108  1.00 3.51 ? 89  THR A OG1  7  
ATOM 10351 C CG2  . THR A 1 89 ? -14.684 -9.672  -4.808  1.00 3.88 ? 89  THR A CG2  7  
ATOM 10352 H H    . THR A 1 89 ? -11.592 -11.586 -3.984  1.00 2.41 ? 89  THR A H    7  
ATOM 10353 H HA   . THR A 1 89 ? -14.328 -11.572 -2.937  1.00 2.82 ? 89  THR A HA   7  
ATOM 10354 H HB   . THR A 1 89 ? -15.170 -11.661 -5.328  1.00 3.20 ? 89  THR A HB   7  
ATOM 10355 H HG1  . THR A 1 89 ? -13.527 -11.919 -6.651  1.00 3.87 ? 89  THR A HG1  7  
ATOM 10356 H HG21 . THR A 1 89 ? -15.323 -9.347  -5.616  1.00 4.03 ? 89  THR A HG21 7  
ATOM 10357 H HG22 . THR A 1 89 ? -13.800 -9.054  -4.777  1.00 4.36 ? 89  THR A HG22 7  
ATOM 10358 H HG23 . THR A 1 89 ? -15.216 -9.587  -3.872  1.00 4.30 ? 89  THR A HG23 7  
ATOM 10359 N N    . GLY A 1 90 ? -14.438 -14.029 -3.223  1.00 2.75 ? 90  GLY A N    7  
ATOM 10360 C CA   . GLY A 1 90 ? -14.455 -15.480 -3.328  1.00 3.54 ? 90  GLY A CA   7  
ATOM 10361 C C    . GLY A 1 90 ? -15.832 -16.071 -3.082  1.00 4.20 ? 90  GLY A C    7  
ATOM 10362 O O    . GLY A 1 90 ? -16.846 -15.469 -3.440  1.00 4.69 ? 90  GLY A O    7  
ATOM 10363 H H    . GLY A 1 90 ? -15.032 -13.581 -2.584  1.00 2.65 ? 90  GLY A H    7  
ATOM 10364 H HA2  . GLY A 1 90 ? -14.128 -15.761 -4.318  1.00 3.91 ? 90  GLY A HA2  7  
ATOM 10365 H HA3  . GLY A 1 90 ? -13.766 -15.888 -2.605  1.00 3.79 ? 90  GLY A HA3  7  
ATOM 10366 N N    . SER A 1 91 ? -15.864 -17.255 -2.471  1.00 4.69 ? 91  SER A N    7  
ATOM 10367 C CA   . SER A 1 91 ? -17.123 -17.938 -2.175  1.00 5.64 ? 91  SER A CA   7  
ATOM 10368 C C    . SER A 1 91 ? -17.744 -17.415 -0.880  1.00 5.73 ? 91  SER A C    7  
ATOM 10369 O O    . SER A 1 91 ? -18.946 -17.148 -0.824  1.00 6.47 ? 91  SER A O    7  
ATOM 10370 C CB   . SER A 1 91 ? -16.900 -19.449 -2.071  1.00 6.57 ? 91  SER A CB   7  
ATOM 10371 O OG   . SER A 1 91 ? -16.689 -20.023 -3.351  1.00 7.06 ? 91  SER A OG   7  
ATOM 10372 H H    . SER A 1 91 ? -15.019 -17.682 -2.213  1.00 4.66 ? 91  SER A H    7  
ATOM 10373 H HA   . SER A 1 91 ? -17.805 -17.741 -2.988  1.00 5.94 ? 91  SER A HA   7  
ATOM 10374 H HB2  . SER A 1 91 ? -16.032 -19.642 -1.458  1.00 6.78 ? 91  SER A HB2  7  
ATOM 10375 H HB3  . SER A 1 91 ? -17.767 -19.910 -1.622  1.00 6.97 ? 91  SER A HB3  7  
ATOM 10376 H HG   . SER A 1 91 ? -17.529 -20.320 -3.711  1.00 7.36 ? 91  SER A HG   7  
ATOM 10377 N N    . HIS A 1 92 ? -16.918 -17.270 0.159   1.00 5.26 ? 92  HIS A N    7  
ATOM 10378 C CA   . HIS A 1 92 ? -17.387 -16.778 1.454   1.00 5.60 ? 92  HIS A CA   7  
ATOM 10379 C C    . HIS A 1 92 ? -17.631 -15.272 1.410   1.00 5.37 ? 92  HIS A C    7  
ATOM 10380 O O    . HIS A 1 92 ? -18.754 -14.821 1.181   1.00 5.46 ? 92  HIS A O    7  
ATOM 10381 C CB   . HIS A 1 92 ? -16.371 -17.106 2.553   1.00 5.86 ? 92  HIS A CB   7  
ATOM 10382 C CG   . HIS A 1 92 ? -16.162 -18.575 2.763   1.00 6.59 ? 92  HIS A CG   7  
ATOM 10383 N ND1  . HIS A 1 92 ? -17.199 -19.472 2.911   1.00 7.09 ? 92  HIS A ND1  7  
ATOM 10384 C CD2  . HIS A 1 92 ? -15.023 -19.304 2.848   1.00 7.14 ? 92  HIS A CD2  7  
ATOM 10385 C CE1  . HIS A 1 92 ? -16.707 -20.687 3.080   1.00 7.83 ? 92  HIS A CE1  7  
ATOM 10386 N NE2  . HIS A 1 92 ? -15.390 -20.612 3.046   1.00 7.84 ? 92  HIS A NE2  7  
ATOM 10387 H H    . HIS A 1 92 ? -15.971 -17.499 0.052   1.00 4.89 ? 92  HIS A H    7  
ATOM 10388 H HA   . HIS A 1 92 ? -18.319 -17.274 1.679   1.00 6.24 ? 92  HIS A HA   7  
ATOM 10389 H HB2  . HIS A 1 92 ? -15.418 -16.669 2.295   1.00 5.88 ? 92  HIS A HB2  7  
ATOM 10390 H HB3  . HIS A 1 92 ? -16.713 -16.683 3.487   1.00 5.88 ? 92  HIS A HB3  7  
ATOM 10391 H HD1  . HIS A 1 92 ? -18.153 -19.252 2.896   1.00 7.08 ? 92  HIS A HD1  7  
ATOM 10392 H HD2  . HIS A 1 92 ? -14.013 -18.925 2.776   1.00 7.21 ? 92  HIS A HD2  7  
ATOM 10393 H HE1  . HIS A 1 92 ? -17.285 -21.588 3.221   1.00 8.46 ? 92  HIS A HE1  7  
ATOM 10394 H HE2  . HIS A 1 92 ? -14.777 -21.351 3.241   1.00 8.38 ? 92  HIS A HE2  7  
ATOM 10395 N N    . ARG B 2 1  ? 2.823   -12.337 11.091  1.00 1.88 ? 301 ARG B N    7  
ATOM 10396 C CA   . ARG B 2 1  ? 2.416   -10.903 11.097  1.00 1.27 ? 301 ARG B CA   7  
ATOM 10397 C C    . ARG B 2 1  ? 3.605   -9.986  11.391  1.00 1.29 ? 301 ARG B C    7  
ATOM 10398 O O    . ARG B 2 1  ? 4.112   -9.947  12.514  1.00 2.06 ? 301 ARG B O    7  
ATOM 10399 C CB   . ARG B 2 1  ? 1.309   -10.699 12.143  1.00 1.61 ? 301 ARG B CB   7  
ATOM 10400 C CG   . ARG B 2 1  ? 1.639   -11.261 13.521  1.00 2.13 ? 301 ARG B CG   7  
ATOM 10401 C CD   . ARG B 2 1  ? 0.738   -12.436 13.878  1.00 2.72 ? 301 ARG B CD   7  
ATOM 10402 N NE   . ARG B 2 1  ? 1.239   -13.181 15.033  1.00 3.09 ? 301 ARG B NE   7  
ATOM 10403 C CZ   . ARG B 2 1  ? 2.132   -14.174 14.959  1.00 3.70 ? 301 ARG B CZ   7  
ATOM 10404 N NH1  . ARG B 2 1  ? 2.627   -14.555 13.785  1.00 4.18 ? 301 ARG B NH1  7  
ATOM 10405 N NH2  . ARG B 2 1  ? 2.529   -14.790 16.068  1.00 4.22 ? 301 ARG B NH2  7  
ATOM 10406 H H1   . ARG B 2 1  ? 3.332   -12.518 10.203  1.00 2.43 ? 301 ARG B H1   7  
ATOM 10407 H H2   . ARG B 2 1  ? 1.958   -12.913 11.148  1.00 1.96 ? 301 ARG B H2   7  
ATOM 10408 H H3   . ARG B 2 1  ? 3.439   -12.499 11.912  1.00 2.41 ? 301 ARG B H3   7  
ATOM 10409 H HA   . ARG B 2 1  ? 2.026   -10.659 10.121  1.00 1.25 ? 301 ARG B HA   7  
ATOM 10410 H HB2  . ARG B 2 1  ? 1.124   -9.641  12.250  1.00 1.79 ? 301 ARG B HB2  7  
ATOM 10411 H HB3  . ARG B 2 1  ? 0.408   -11.177 11.790  1.00 2.19 ? 301 ARG B HB3  7  
ATOM 10412 H HG2  . ARG B 2 1  ? 2.666   -11.595 13.529  1.00 2.63 ? 301 ARG B HG2  7  
ATOM 10413 H HG3  . ARG B 2 1  ? 1.507   -10.482 14.257  1.00 2.48 ? 301 ARG B HG3  7  
ATOM 10414 H HD2  . ARG B 2 1  ? -0.248  -12.057 14.107  1.00 3.13 ? 301 ARG B HD2  7  
ATOM 10415 H HD3  . ARG B 2 1  ? 0.678   -13.100 13.029  1.00 3.11 ? 301 ARG B HD3  7  
ATOM 10416 H HE   . ARG B 2 1  ? 0.892   -12.929 15.915  1.00 3.22 ? 301 ARG B HE   7  
ATOM 10417 H HH11 . ARG B 2 1  ? 2.334   -14.100 12.944  1.00 4.11 ? 301 ARG B HH11 7  
ATOM 10418 H HH12 . ARG B 2 1  ? 3.294   -15.298 13.741  1.00 4.83 ? 301 ARG B HH12 7  
ATOM 10419 H HH21 . ARG B 2 1  ? 2.161   -14.512 16.955  1.00 4.29 ? 301 ARG B HH21 7  
ATOM 10420 H HH22 . ARG B 2 1  ? 3.196   -15.534 16.015  1.00 4.75 ? 301 ARG B HH22 7  
ATOM 10421 N N    . ARG B 2 2  ? 4.038   -9.245  10.371  1.00 1.12 ? 302 ARG B N    7  
ATOM 10422 C CA   . ARG B 2 2  ? 5.159   -8.319  10.507  1.00 1.03 ? 302 ARG B CA   7  
ATOM 10423 C C    . ARG B 2 2  ? 4.822   -6.977  9.865   1.00 1.02 ? 302 ARG B C    7  
ATOM 10424 O O    . ARG B 2 2  ? 4.708   -6.873  8.642   1.00 1.45 ? 302 ARG B O    7  
ATOM 10425 C CB   . ARG B 2 2  ? 6.421   -8.904  9.867   1.00 1.13 ? 302 ARG B CB   7  
ATOM 10426 C CG   . ARG B 2 2  ? 7.709   -8.241  10.333  1.00 1.12 ? 302 ARG B CG   7  
ATOM 10427 C CD   . ARG B 2 2  ? 8.934   -8.896  9.710   1.00 1.50 ? 302 ARG B CD   7  
ATOM 10428 N NE   . ARG B 2 2  ? 9.137   -10.263 10.196  1.00 2.09 ? 302 ARG B NE   7  
ATOM 10429 C CZ   . ARG B 2 2  ? 10.115  -11.069 9.773   1.00 2.72 ? 302 ARG B CZ   7  
ATOM 10430 N NH1  . ARG B 2 2  ? 10.983  -10.656 8.852   1.00 2.99 ? 302 ARG B NH1  7  
ATOM 10431 N NH2  . ARG B 2 2  ? 10.224  -12.295 10.273  1.00 3.57 ? 302 ARG B NH2  7  
ATOM 10432 H H    . ARG B 2 2  ? 3.587   -9.320  9.504   1.00 1.61 ? 302 ARG B H    7  
ATOM 10433 H HA   . ARG B 2 2  ? 5.338   -8.165  11.561  1.00 1.03 ? 302 ARG B HA   7  
ATOM 10434 H HB2  . ARG B 2 2  ? 6.476   -9.956  10.104  1.00 1.20 ? 302 ARG B HB2  7  
ATOM 10435 H HB3  . ARG B 2 2  ? 6.351   -8.789  8.795   1.00 1.34 ? 302 ARG B HB3  7  
ATOM 10436 H HG2  . ARG B 2 2  ? 7.688   -7.199  10.050  1.00 1.33 ? 302 ARG B HG2  7  
ATOM 10437 H HG3  . ARG B 2 2  ? 7.774   -8.323  11.408  1.00 1.30 ? 302 ARG B HG3  7  
ATOM 10438 H HD2  . ARG B 2 2  ? 8.808   -8.921  8.638   1.00 1.82 ? 302 ARG B HD2  7  
ATOM 10439 H HD3  . ARG B 2 2  ? 9.804   -8.304  9.956   1.00 1.86 ? 302 ARG B HD3  7  
ATOM 10440 H HE   . ARG B 2 2  ? 8.513   -10.599 10.874  1.00 2.48 ? 302 ARG B HE   7  
ATOM 10441 H HH11 . ARG B 2 2  ? 10.910  -9.735  8.470   1.00 2.71 ? 302 ARG B HH11 7  
ATOM 10442 H HH12 . ARG B 2 2  ? 11.712  -11.266 8.543   1.00 3.75 ? 302 ARG B HH12 7  
ATOM 10443 H HH21 . ARG B 2 2  ? 9.576   -12.613 10.965  1.00 3.78 ? 302 ARG B HH21 7  
ATOM 10444 H HH22 . ARG B 2 2  ? 10.955  -12.901 9.960   1.00 4.18 ? 302 ARG B HH22 7  
ATOM 10445 N N    . GLU B 2 3  ? 4.656   -5.955  10.701  1.00 0.69 ? 303 GLU B N    7  
ATOM 10446 C CA   . GLU B 2 3  ? 4.324   -4.616  10.223  1.00 0.66 ? 303 GLU B CA   7  
ATOM 10447 C C    . GLU B 2 3  ? 5.545   -3.703  10.279  1.00 0.71 ? 303 GLU B C    7  
ATOM 10448 O O    . GLU B 2 3  ? 6.348   -3.778  11.211  1.00 1.16 ? 303 GLU B O    7  
ATOM 10449 C CB   . GLU B 2 3  ? 3.180   -4.026  11.053  1.00 0.71 ? 303 GLU B CB   7  
ATOM 10450 C CG   . GLU B 2 3  ? 1.879   -4.812  10.949  1.00 1.12 ? 303 GLU B CG   7  
ATOM 10451 C CD   . GLU B 2 3  ? 1.807   -5.968  11.927  1.00 1.54 ? 303 GLU B CD   7  
ATOM 10452 O OE1  . GLU B 2 3  ? 1.609   -5.714  13.135  1.00 2.08 ? 303 GLU B OE1  7  
ATOM 10453 O OE2  . GLU B 2 3  ? 1.948   -7.129  11.486  1.00 1.99 ? 303 GLU B OE2  7  
ATOM 10454 H H    . GLU B 2 3  ? 4.755   -6.105  11.664  1.00 0.73 ? 303 GLU B H    7  
ATOM 10455 H HA   . GLU B 2 3  ? 4.004   -4.703  9.194   1.00 0.62 ? 303 GLU B HA   7  
ATOM 10456 H HB2  . GLU B 2 3  ? 3.479   -4.003  12.091  1.00 1.19 ? 303 GLU B HB2  7  
ATOM 10457 H HB3  . GLU B 2 3  ? 2.993   -3.016  10.720  1.00 0.81 ? 303 GLU B HB3  7  
ATOM 10458 H HG2  . GLU B 2 3  ? 1.054   -4.145  11.146  1.00 1.28 ? 303 GLU B HG2  7  
ATOM 10459 H HG3  . GLU B 2 3  ? 1.790   -5.203  9.946   1.00 1.65 ? 303 GLU B HG3  7  
ATOM 10460 N N    . THR B 2 4  ? 5.684   -2.849  9.264   1.00 0.55 ? 304 THR B N    7  
ATOM 10461 C CA   . THR B 2 4  ? 6.812   -1.927  9.181   1.00 0.55 ? 304 THR B CA   7  
ATOM 10462 C C    . THR B 2 4  ? 6.411   -0.629  8.481   1.00 0.53 ? 304 THR B C    7  
ATOM 10463 O O    . THR B 2 4  ? 5.564   -0.633  7.587   1.00 0.54 ? 304 THR B O    7  
ATOM 10464 C CB   . THR B 2 4  ? 7.968   -2.598  8.432   1.00 0.55 ? 304 THR B CB   7  
ATOM 10465 O OG1  . THR B 2 4  ? 8.814   -3.293  9.331   1.00 0.65 ? 304 THR B OG1  7  
ATOM 10466 C CG2  . THR B 2 4  ? 8.833   -1.637  7.641   1.00 0.56 ? 304 THR B CG2  7  
ATOM 10467 H H    . THR B 2 4  ? 5.013   -2.846  8.549   1.00 0.76 ? 304 THR B H    7  
ATOM 10468 H HA   . THR B 2 4  ? 7.131   -1.698  10.187  1.00 0.59 ? 304 THR B HA   7  
ATOM 10469 H HB   . THR B 2 4  ? 7.555   -3.312  7.736   1.00 0.56 ? 304 THR B HB   7  
ATOM 10470 H HG1  . THR B 2 4  ? 8.547   -4.215  9.375   1.00 0.96 ? 304 THR B HG1  7  
ATOM 10471 H HG21 . THR B 2 4  ? 9.239   -0.888  8.305   1.00 1.05 ? 304 THR B HG21 7  
ATOM 10472 H HG22 . THR B 2 4  ? 8.232   -1.157  6.882   1.00 1.13 ? 304 THR B HG22 7  
ATOM 10473 H HG23 . THR B 2 4  ? 9.640   -2.180  7.174   1.00 1.23 ? 304 THR B HG23 7  
ATOM 10474 N N    . GLN B 2 5  ? 7.039   0.479   8.882   1.00 0.58 ? 305 GLN B N    7  
ATOM 10475 C CA   . GLN B 2 5  ? 6.754   1.776   8.276   1.00 0.60 ? 305 GLN B CA   7  
ATOM 10476 C C    . GLN B 2 5  ? 7.476   1.925   6.941   1.00 0.58 ? 305 GLN B C    7  
ATOM 10477 O O    . GLN B 2 5  ? 8.492   1.271   6.695   1.00 0.74 ? 305 GLN B O    7  
ATOM 10478 C CB   . GLN B 2 5  ? 7.147   2.921   9.207   1.00 0.76 ? 305 GLN B CB   7  
ATOM 10479 C CG   . GLN B 2 5  ? 5.956   3.615   9.848   1.00 0.89 ? 305 GLN B CG   7  
ATOM 10480 C CD   . GLN B 2 5  ? 6.075   3.711   11.357  1.00 1.13 ? 305 GLN B CD   7  
ATOM 10481 O OE1  . GLN B 2 5  ? 6.511   4.730   11.894  1.00 1.67 ? 305 GLN B OE1  7  
ATOM 10482 N NE2  . GLN B 2 5  ? 5.686   2.646   12.054  1.00 1.50 ? 305 GLN B NE2  7  
ATOM 10483 H H    . GLN B 2 5  ? 7.714   0.420   9.590   1.00 0.64 ? 305 GLN B H    7  
ATOM 10484 H HA   . GLN B 2 5  ? 5.693   1.824   8.098   1.00 0.57 ? 305 GLN B HA   7  
ATOM 10485 H HB2  . GLN B 2 5  ? 7.781   2.534   9.992   1.00 0.76 ? 305 GLN B HB2  7  
ATOM 10486 H HB3  . GLN B 2 5  ? 7.698   3.654   8.636   1.00 0.88 ? 305 GLN B HB3  7  
ATOM 10487 H HG2  . GLN B 2 5  ? 5.878   4.612   9.443   1.00 0.96 ? 305 GLN B HG2  7  
ATOM 10488 H HG3  . GLN B 2 5  ? 5.062   3.062   9.607   1.00 0.87 ? 305 GLN B HG3  7  
ATOM 10489 H HE21 . GLN B 2 5  ? 5.347   1.869   11.561  1.00 1.97 ? 305 GLN B HE21 7  
ATOM 10490 H HE22 . GLN B 2 5  ? 5.752   2.683   13.030  1.00 1.62 ? 305 GLN B HE22 7  
ATOM 10491 N N    . VAL B 2 6  ? 6.941   2.788   6.084   1.00 0.58 ? 306 VAL B N    7  
ATOM 10492 C CA   . VAL B 2 6  ? 7.522   3.027   4.767   1.00 0.63 ? 306 VAL B CA   7  
ATOM 10493 C C    . VAL B 2 6  ? 7.428   4.503   4.374   1.00 0.77 ? 306 VAL B C    7  
ATOM 10494 O O    . VAL B 2 6  ? 8.353   4.991   3.691   1.00 1.47 ? 306 VAL B O    7  
ATOM 10495 C CB   . VAL B 2 6  ? 6.826   2.167   3.691   1.00 0.54 ? 306 VAL B CB   7  
ATOM 10496 C CG1  . VAL B 2 6  ? 7.178   0.698   3.866   1.00 0.51 ? 306 VAL B CG1  7  
ATOM 10497 C CG2  . VAL B 2 6  ? 5.321   2.369   3.738   1.00 0.49 ? 306 VAL B CG2  7  
ATOM 10498 O OXT  . VAL B 2 6  ? 6.431   5.159   4.751   1.00 1.14 ? 306 VAL B OXT  7  
ATOM 10499 H H    . VAL B 2 6  ? 6.129   3.274   6.340   1.00 0.70 ? 306 VAL B H    7  
ATOM 10500 H HA   . VAL B 2 6  ? 8.564   2.743   4.805   1.00 0.71 ? 306 VAL B HA   7  
ATOM 10501 H HB   . VAL B 2 6  ? 7.177   2.483   2.723   1.00 0.63 ? 306 VAL B HB   7  
ATOM 10502 H HG11 . VAL B 2 6  ? 8.249   0.594   3.964   1.00 1.08 ? 306 VAL B HG11 7  
ATOM 10503 H HG12 . VAL B 2 6  ? 6.840   0.142   3.005   1.00 1.13 ? 306 VAL B HG12 7  
ATOM 10504 H HG13 . VAL B 2 6  ? 6.698   0.316   4.754   1.00 1.04 ? 306 VAL B HG13 7  
ATOM 10505 H HG21 . VAL B 2 6  ? 4.847   1.713   3.023   1.00 1.09 ? 306 VAL B HG21 7  
ATOM 10506 H HG22 . VAL B 2 6  ? 5.088   3.395   3.495   1.00 1.15 ? 306 VAL B HG22 7  
ATOM 10507 H HG23 . VAL B 2 6  ? 4.959   2.145   4.732   1.00 1.15 ? 306 VAL B HG23 7  
ATOM 10508 N N    . MET A 1 1  ? -10.120 2.898   -8.706  1.00 1.83 ? 1   MET A N    8  
ATOM 10509 C CA   . MET A 1 1  ? -9.469  3.917   -7.836  1.00 1.38 ? 1   MET A CA   8  
ATOM 10510 C C    . MET A 1 1  ? -7.946  3.823   -7.916  1.00 1.20 ? 1   MET A C    8  
ATOM 10511 O O    . MET A 1 1  ? -7.374  2.747   -7.727  1.00 1.07 ? 1   MET A O    8  
ATOM 10512 C CB   . MET A 1 1  ? -9.933  3.701   -6.391  1.00 1.81 ? 1   MET A CB   8  
ATOM 10513 C CG   . MET A 1 1  ? -11.337 4.218   -6.113  1.00 2.04 ? 1   MET A CG   8  
ATOM 10514 S SD   . MET A 1 1  ? -12.519 2.890   -5.814  1.00 2.69 ? 1   MET A SD   8  
ATOM 10515 C CE   . MET A 1 1  ? -14.020 3.827   -5.529  1.00 3.17 ? 1   MET A CE   8  
ATOM 10516 H H1   . MET A 1 1  ? -9.768  3.037   -9.676  1.00 2.20 ? 1   MET A H1   8  
ATOM 10517 H H2   . MET A 1 1  ? -11.149 3.048   -8.656  1.00 2.22 ? 1   MET A H2   8  
ATOM 10518 H H3   . MET A 1 1  ? -9.859  1.958   -8.347  1.00 1.92 ? 1   MET A H3   8  
ATOM 10519 H HA   . MET A 1 1  ? -9.779  4.898   -8.167  1.00 1.47 ? 1   MET A HA   8  
ATOM 10520 H HB2  . MET A 1 1  ? -9.915  2.643   -6.174  1.00 2.32 ? 1   MET A HB2  8  
ATOM 10521 H HB3  . MET A 1 1  ? -9.249  4.208   -5.727  1.00 2.16 ? 1   MET A HB3  8  
ATOM 10522 H HG2  . MET A 1 1  ? -11.304 4.854   -5.241  1.00 2.47 ? 1   MET A HG2  8  
ATOM 10523 H HG3  . MET A 1 1  ? -11.669 4.794   -6.965  1.00 2.24 ? 1   MET A HG3  8  
ATOM 10524 H HE1  . MET A 1 1  ? -14.857 3.309   -5.974  1.00 3.35 ? 1   MET A HE1  8  
ATOM 10525 H HE2  . MET A 1 1  ? -13.924 4.806   -5.973  1.00 3.35 ? 1   MET A HE2  8  
ATOM 10526 H HE3  . MET A 1 1  ? -14.184 3.928   -4.466  1.00 3.67 ? 1   MET A HE3  8  
ATOM 10527 N N    . GLU A 1 2  ? -7.296  4.954   -8.194  1.00 1.25 ? 2   GLU A N    8  
ATOM 10528 C CA   . GLU A 1 2  ? -5.838  4.997   -8.294  1.00 1.15 ? 2   GLU A CA   8  
ATOM 10529 C C    . GLU A 1 2  ? -5.261  6.156   -7.481  1.00 1.12 ? 2   GLU A C    8  
ATOM 10530 O O    . GLU A 1 2  ? -5.720  7.297   -7.580  1.00 1.17 ? 2   GLU A O    8  
ATOM 10531 C CB   . GLU A 1 2  ? -5.391  5.105   -9.757  1.00 1.22 ? 2   GLU A CB   8  
ATOM 10532 C CG   . GLU A 1 2  ? -6.077  6.217   -10.535 1.00 1.74 ? 2   GLU A CG   8  
ATOM 10533 C CD   . GLU A 1 2  ? -7.178  5.701   -11.443 1.00 1.63 ? 2   GLU A CD   8  
ATOM 10534 O OE1  . GLU A 1 2  ? -6.875  5.345   -12.602 1.00 1.97 ? 2   GLU A OE1  8  
ATOM 10535 O OE2  . GLU A 1 2  ? -8.343  5.651   -10.995 1.00 1.88 ? 2   GLU A OE2  8  
ATOM 10536 H H    . GLU A 1 2  ? -7.809  5.778   -8.331  1.00 1.40 ? 2   GLU A H    8  
ATOM 10537 H HA   . GLU A 1 2  ? -5.455  4.071   -7.884  1.00 1.06 ? 2   GLU A HA   8  
ATOM 10538 H HB2  . GLU A 1 2  ? -4.327  5.285   -9.782  1.00 1.76 ? 2   GLU A HB2  8  
ATOM 10539 H HB3  . GLU A 1 2  ? -5.598  4.168   -10.252 1.00 1.34 ? 2   GLU A HB3  8  
ATOM 10540 H HG2  . GLU A 1 2  ? -6.508  6.916   -9.834  1.00 2.14 ? 2   GLU A HG2  8  
ATOM 10541 H HG3  . GLU A 1 2  ? -5.340  6.723   -11.140 1.00 2.47 ? 2   GLU A HG3  8  
ATOM 10542 N N    . ILE A 1 3  ? -4.255  5.837   -6.674  1.00 1.09 ? 3   ILE A N    8  
ATOM 10543 C CA   . ILE A 1 3  ? -3.600  6.828   -5.826  1.00 1.10 ? 3   ILE A CA   8  
ATOM 10544 C C    . ILE A 1 3  ? -2.322  7.350   -6.481  1.00 1.02 ? 3   ILE A C    8  
ATOM 10545 O O    . ILE A 1 3  ? -1.288  6.679   -6.467  1.00 1.07 ? 3   ILE A O    8  
ATOM 10546 C CB   . ILE A 1 3  ? -3.264  6.243   -4.433  1.00 1.18 ? 3   ILE A CB   8  
ATOM 10547 C CG1  . ILE A 1 3  ? -4.544  5.808   -3.713  1.00 1.34 ? 3   ILE A CG1  8  
ATOM 10548 C CG2  . ILE A 1 3  ? -2.497  7.259   -3.595  1.00 1.22 ? 3   ILE A CG2  8  
ATOM 10549 C CD1  . ILE A 1 3  ? -4.773  4.312   -3.736  1.00 1.10 ? 3   ILE A CD1  8  
ATOM 10550 H H    . ILE A 1 3  ? -3.968  4.900   -6.654  1.00 1.08 ? 3   ILE A H    8  
ATOM 10551 H HA   . ILE A 1 3  ? -4.284  7.652   -5.689  1.00 1.15 ? 3   ILE A HA   8  
ATOM 10552 H HB   . ILE A 1 3  ? -2.629  5.382   -4.576  1.00 1.17 ? 3   ILE A HB   8  
ATOM 10553 H HG12 . ILE A 1 3  ? -4.490  6.117   -2.680  1.00 1.83 ? 3   ILE A HG12 8  
ATOM 10554 H HG13 . ILE A 1 3  ? -5.393  6.283   -4.183  1.00 1.86 ? 3   ILE A HG13 8  
ATOM 10555 H HG21 . ILE A 1 3  ? -1.449  7.217   -3.850  1.00 1.72 ? 3   ILE A HG21 8  
ATOM 10556 H HG22 . ILE A 1 3  ? -2.623  7.029   -2.548  1.00 1.51 ? 3   ILE A HG22 8  
ATOM 10557 H HG23 . ILE A 1 3  ? -2.876  8.250   -3.795  1.00 1.55 ? 3   ILE A HG23 8  
ATOM 10558 H HD11 . ILE A 1 3  ? -4.111  3.855   -4.456  1.00 1.47 ? 3   ILE A HD11 8  
ATOM 10559 H HD12 . ILE A 1 3  ? -5.798  4.110   -4.012  1.00 1.61 ? 3   ILE A HD12 8  
ATOM 10560 H HD13 . ILE A 1 3  ? -4.578  3.903   -2.756  1.00 1.54 ? 3   ILE A HD13 8  
ATOM 10561 N N    . LYS A 1 4  ? -2.400  8.556   -7.054  1.00 0.98 ? 4   LYS A N    8  
ATOM 10562 C CA   . LYS A 1 4  ? -1.244  9.163   -7.707  1.00 0.96 ? 4   LYS A CA   8  
ATOM 10563 C C    . LYS A 1 4  ? -0.577  10.183  -6.785  1.00 0.96 ? 4   LYS A C    8  
ATOM 10564 O O    . LYS A 1 4  ? -0.940  11.361  -6.760  1.00 1.08 ? 4   LYS A O    8  
ATOM 10565 C CB   . LYS A 1 4  ? -1.658  9.825   -9.025  1.00 1.07 ? 4   LYS A CB   8  
ATOM 10566 C CG   . LYS A 1 4  ? -0.619  9.684   -10.126 1.00 1.35 ? 4   LYS A CG   8  
ATOM 10567 C CD   . LYS A 1 4  ? -0.864  10.666  -11.259 1.00 1.59 ? 4   LYS A CD   8  
ATOM 10568 C CE   . LYS A 1 4  ? 0.360   10.807  -12.150 1.00 2.29 ? 4   LYS A CE   8  
ATOM 10569 N NZ   . LYS A 1 4  ? 0.276   12.005  -13.030 1.00 2.93 ? 4   LYS A NZ   8  
ATOM 10570 H H    . LYS A 1 4  ? -3.251  9.046   -7.031  1.00 1.01 ? 4   LYS A H    8  
ATOM 10571 H HA   . LYS A 1 4  ? -0.537  8.375   -7.920  1.00 0.96 ? 4   LYS A HA   8  
ATOM 10572 H HB2  . LYS A 1 4  ? -2.578  9.375   -9.369  1.00 1.56 ? 4   LYS A HB2  8  
ATOM 10573 H HB3  . LYS A 1 4  ? -1.827  10.878  -8.851  1.00 1.61 ? 4   LYS A HB3  8  
ATOM 10574 H HG2  . LYS A 1 4  ? 0.360   9.871   -9.708  1.00 1.93 ? 4   LYS A HG2  8  
ATOM 10575 H HG3  . LYS A 1 4  ? -0.659  8.677   -10.517 1.00 1.87 ? 4   LYS A HG3  8  
ATOM 10576 H HD2  . LYS A 1 4  ? -1.691  10.312  -11.856 1.00 1.98 ? 4   LYS A HD2  8  
ATOM 10577 H HD3  . LYS A 1 4  ? -1.108  11.632  -10.841 1.00 1.90 ? 4   LYS A HD3  8  
ATOM 10578 H HE2  . LYS A 1 4  ? 1.237   10.893  -11.525 1.00 2.72 ? 4   LYS A HE2  8  
ATOM 10579 H HE3  . LYS A 1 4  ? 0.445   9.923   -12.767 1.00 2.70 ? 4   LYS A HE3  8  
ATOM 10580 H HZ1  . LYS A 1 4  ? 0.177   12.866  -12.455 1.00 3.17 ? 4   LYS A HZ1  8  
ATOM 10581 H HZ2  . LYS A 1 4  ? -0.547  11.927  -13.662 1.00 3.54 ? 4   LYS A HZ2  8  
ATOM 10582 H HZ3  . LYS A 1 4  ? 1.136   12.086  -13.608 1.00 3.06 ? 4   LYS A HZ3  8  
ATOM 10583 N N    . LEU A 1 5  ? 0.393   9.697   -6.019  1.00 0.89 ? 5   LEU A N    8  
ATOM 10584 C CA   . LEU A 1 5  ? 1.124   10.532  -5.070  1.00 0.97 ? 5   LEU A CA   8  
ATOM 10585 C C    . LEU A 1 5  ? 2.447   11.013  -5.656  1.00 0.88 ? 5   LEU A C    8  
ATOM 10586 O O    . LEU A 1 5  ? 3.206   10.227  -6.213  1.00 0.82 ? 5   LEU A O    8  
ATOM 10587 C CB   . LEU A 1 5  ? 1.369   9.761   -3.769  1.00 1.11 ? 5   LEU A CB   8  
ATOM 10588 C CG   . LEU A 1 5  ? 0.128   9.561   -2.896  1.00 1.42 ? 5   LEU A CG   8  
ATOM 10589 C CD1  . LEU A 1 5  ? 0.370   8.469   -1.863  1.00 1.50 ? 5   LEU A CD1  8  
ATOM 10590 C CD2  . LEU A 1 5  ? -0.262  10.867  -2.218  1.00 2.09 ? 5   LEU A CD2  8  
ATOM 10591 H H    . LEU A 1 5  ? 0.589   8.740   -6.088  1.00 0.85 ? 5   LEU A H    8  
ATOM 10592 H HA   . LEU A 1 5  ? 0.512   11.392  -4.851  1.00 1.10 ? 5   LEU A HA   8  
ATOM 10593 H HB2  . LEU A 1 5  ? 1.769   8.790   -4.022  1.00 1.26 ? 5   LEU A HB2  8  
ATOM 10594 H HB3  . LEU A 1 5  ? 2.107   10.296  -3.191  1.00 1.25 ? 5   LEU A HB3  8  
ATOM 10595 H HG   . LEU A 1 5  ? -0.696  9.249   -3.521  1.00 1.86 ? 5   LEU A HG   8  
ATOM 10596 H HD11 . LEU A 1 5  ? -0.311  8.599   -1.035  1.00 1.87 ? 5   LEU A HD11 8  
ATOM 10597 H HD12 . LEU A 1 5  ? 1.387   8.532   -1.504  1.00 2.01 ? 5   LEU A HD12 8  
ATOM 10598 H HD13 . LEU A 1 5  ? 0.207   7.503   -2.316  1.00 1.76 ? 5   LEU A HD13 8  
ATOM 10599 H HD21 . LEU A 1 5  ? -1.078  10.687  -1.534  1.00 2.37 ? 5   LEU A HD21 8  
ATOM 10600 H HD22 . LEU A 1 5  ? -0.571  11.582  -2.967  1.00 2.53 ? 5   LEU A HD22 8  
ATOM 10601 H HD23 . LEU A 1 5  ? 0.584   11.258  -1.674  1.00 2.63 ? 5   LEU A HD23 8  
ATOM 10602 N N    . ILE A 1 6  ? 2.713   12.314  -5.533  1.00 0.95 ? 6   ILE A N    8  
ATOM 10603 C CA   . ILE A 1 6  ? 3.945   12.896  -6.063  1.00 0.90 ? 6   ILE A CA   8  
ATOM 10604 C C    . ILE A 1 6  ? 5.064   12.819  -5.026  1.00 0.93 ? 6   ILE A C    8  
ATOM 10605 O O    . ILE A 1 6  ? 4.866   13.163  -3.859  1.00 1.06 ? 6   ILE A O    8  
ATOM 10606 C CB   . ILE A 1 6  ? 3.740   14.371  -6.490  1.00 1.04 ? 6   ILE A CB   8  
ATOM 10607 C CG1  . ILE A 1 6  ? 4.985   14.891  -7.217  1.00 1.29 ? 6   ILE A CG1  8  
ATOM 10608 C CG2  . ILE A 1 6  ? 3.415   15.247  -5.285  1.00 1.21 ? 6   ILE A CG2  8  
ATOM 10609 C CD1  . ILE A 1 6  ? 4.777   16.224  -7.904  1.00 1.94 ? 6   ILE A CD1  8  
ATOM 10610 H H    . ILE A 1 6  ? 2.057   12.898  -5.096  1.00 1.06 ? 6   ILE A H    8  
ATOM 10611 H HA   . ILE A 1 6  ? 4.231   12.328  -6.937  1.00 0.86 ? 6   ILE A HA   8  
ATOM 10612 H HB   . ILE A 1 6  ? 2.899   14.411  -7.164  1.00 1.27 ? 6   ILE A HB   8  
ATOM 10613 H HG12 . ILE A 1 6  ? 5.787   15.010  -6.502  1.00 1.47 ? 6   ILE A HG12 8  
ATOM 10614 H HG13 . ILE A 1 6  ? 5.283   14.172  -7.966  1.00 1.34 ? 6   ILE A HG13 8  
ATOM 10615 H HG21 . ILE A 1 6  ? 2.686   14.750  -4.662  1.00 1.62 ? 6   ILE A HG21 8  
ATOM 10616 H HG22 . ILE A 1 6  ? 3.012   16.190  -5.624  1.00 1.62 ? 6   ILE A HG22 8  
ATOM 10617 H HG23 . ILE A 1 6  ? 4.314   15.425  -4.714  1.00 1.45 ? 6   ILE A HG23 8  
ATOM 10618 H HD11 . ILE A 1 6  ? 5.513   16.344  -8.686  1.00 2.44 ? 6   ILE A HD11 8  
ATOM 10619 H HD12 . ILE A 1 6  ? 4.885   17.022  -7.184  1.00 2.21 ? 6   ILE A HD12 8  
ATOM 10620 H HD13 . ILE A 1 6  ? 3.786   16.257  -8.333  1.00 2.30 ? 6   ILE A HD13 8  
ATOM 10621 N N    . LYS A 1 7  ? 6.234   12.343  -5.455  1.00 0.91 ? 7   LYS A N    8  
ATOM 10622 C CA   . LYS A 1 7  ? 7.376   12.199  -4.556  1.00 1.06 ? 7   LYS A CA   8  
ATOM 10623 C C    . LYS A 1 7  ? 7.981   13.555  -4.194  1.00 1.18 ? 7   LYS A C    8  
ATOM 10624 O O    . LYS A 1 7  ? 8.674   14.175  -5.004  1.00 1.29 ? 7   LYS A O    8  
ATOM 10625 C CB   . LYS A 1 7  ? 8.444   11.294  -5.181  1.00 1.26 ? 7   LYS A CB   8  
ATOM 10626 C CG   . LYS A 1 7  ? 9.351   10.627  -4.157  1.00 1.78 ? 7   LYS A CG   8  
ATOM 10627 C CD   . LYS A 1 7  ? 8.588   9.625   -3.301  1.00 2.30 ? 7   LYS A CD   8  
ATOM 10628 C CE   . LYS A 1 7  ? 9.040   9.660   -1.847  1.00 2.50 ? 7   LYS A CE   8  
ATOM 10629 N NZ   . LYS A 1 7  ? 10.221  8.784   -1.604  1.00 3.10 ? 7   LYS A NZ   8  
ATOM 10630 H H    . LYS A 1 7  ? 6.326   12.068  -6.394  1.00 0.88 ? 7   LYS A H    8  
ATOM 10631 H HA   . LYS A 1 7  ? 7.018   11.734  -3.651  1.00 1.12 ? 7   LYS A HA   8  
ATOM 10632 H HB2  . LYS A 1 7  ? 7.954   10.522  -5.754  1.00 1.17 ? 7   LYS A HB2  8  
ATOM 10633 H HB3  . LYS A 1 7  ? 9.059   11.886  -5.843  1.00 1.45 ? 7   LYS A HB3  8  
ATOM 10634 H HG2  . LYS A 1 7  ? 10.144  10.111  -4.676  1.00 2.05 ? 7   LYS A HG2  8  
ATOM 10635 H HG3  . LYS A 1 7  ? 9.773   11.387  -3.516  1.00 2.37 ? 7   LYS A HG3  8  
ATOM 10636 H HD2  . LYS A 1 7  ? 7.535   9.858   -3.343  1.00 2.80 ? 7   LYS A HD2  8  
ATOM 10637 H HD3  . LYS A 1 7  ? 8.754   8.634   -3.696  1.00 2.70 ? 7   LYS A HD3  8  
ATOM 10638 H HE2  . LYS A 1 7  ? 9.301   10.675  -1.587  1.00 3.04 ? 7   LYS A HE2  8  
ATOM 10639 H HE3  . LYS A 1 7  ? 8.224   9.328   -1.223  1.00 2.26 ? 7   LYS A HE3  8  
ATOM 10640 H HZ1  . LYS A 1 7  ? 10.853  8.794   -2.430  1.00 3.61 ? 7   LYS A HZ1  8  
ATOM 10641 H HZ2  . LYS A 1 7  ? 9.910   7.807   -1.429  1.00 3.37 ? 7   LYS A HZ2  8  
ATOM 10642 H HZ3  . LYS A 1 7  ? 10.749  9.120   -0.774  1.00 3.30 ? 7   LYS A HZ3  8  
ATOM 10643 N N    . GLY A 1 8  ? 7.711   14.001  -2.967  1.00 1.38 ? 8   GLY A N    8  
ATOM 10644 C CA   . GLY A 1 8  ? 8.231   15.274  -2.497  1.00 1.62 ? 8   GLY A CA   8  
ATOM 10645 C C    . GLY A 1 8  ? 9.373   15.107  -1.506  1.00 1.78 ? 8   GLY A C    8  
ATOM 10646 O O    . GLY A 1 8  ? 10.001  14.047  -1.456  1.00 1.78 ? 8   GLY A O    8  
ATOM 10647 H H    . GLY A 1 8  ? 7.153   13.456  -2.373  1.00 1.48 ? 8   GLY A H    8  
ATOM 10648 H HA2  . GLY A 1 8  ? 8.584   15.844  -3.345  1.00 1.65 ? 8   GLY A HA2  8  
ATOM 10649 H HA3  . GLY A 1 8  ? 7.432   15.821  -2.018  1.00 1.79 ? 8   GLY A HA3  8  
ATOM 10650 N N    . PRO A 1 9  ? 9.669   16.148  -0.701  1.00 2.05 ? 9   PRO A N    8  
ATOM 10651 C CA   . PRO A 1 9  ? 10.751  16.108  0.296   1.00 2.32 ? 9   PRO A CA   8  
ATOM 10652 C C    . PRO A 1 9  ? 10.546  15.015  1.349   1.00 2.37 ? 9   PRO A C    8  
ATOM 10653 O O    . PRO A 1 9  ? 11.510  14.395  1.802   1.00 2.77 ? 9   PRO A O    8  
ATOM 10654 C CB   . PRO A 1 9  ? 10.697  17.494  0.952   1.00 2.68 ? 9   PRO A CB   8  
ATOM 10655 C CG   . PRO A 1 9  ? 9.954   18.353  -0.014  1.00 2.59 ? 9   PRO A CG   8  
ATOM 10656 C CD   . PRO A 1 9  ? 8.974   17.447  -0.699  1.00 2.24 ? 9   PRO A CD   8  
ATOM 10657 H HA   . PRO A 1 9  ? 11.713  15.969  -0.175  1.00 2.37 ? 9   PRO A HA   8  
ATOM 10658 H HB2  . PRO A 1 9  ? 10.180  17.427  1.898   1.00 2.85 ? 9   PRO A HB2  8  
ATOM 10659 H HB3  . PRO A 1 9  ? 11.701  17.859  1.111   1.00 2.89 ? 9   PRO A HB3  8  
ATOM 10660 H HG2  . PRO A 1 9  ? 9.434   19.136  0.517   1.00 2.84 ? 9   PRO A HG2  8  
ATOM 10661 H HG3  . PRO A 1 9  ? 10.641  18.775  -0.733  1.00 2.61 ? 9   PRO A HG3  8  
ATOM 10662 H HD2  . PRO A 1 9  ? 8.052   17.393  -0.139  1.00 2.35 ? 9   PRO A HD2  8  
ATOM 10663 H HD3  . PRO A 1 9  ? 8.787   17.786  -1.708  1.00 2.14 ? 9   PRO A HD3  8  
ATOM 10664 N N    . LYS A 1 10 ? 9.287   14.786  1.733   1.00 2.38 ? 10  LYS A N    8  
ATOM 10665 C CA   . LYS A 1 10 ? 8.957   13.769  2.729   1.00 2.57 ? 10  LYS A CA   8  
ATOM 10666 C C    . LYS A 1 10 ? 8.939   12.369  2.089   1.00 2.26 ? 10  LYS A C    8  
ATOM 10667 O O    . LYS A 1 10 ? 9.937   11.952  1.498   1.00 2.45 ? 10  LYS A O    8  
ATOM 10668 C CB   . LYS A 1 10 ? 7.617   14.111  3.399   1.00 2.99 ? 10  LYS A CB   8  
ATOM 10669 C CG   . LYS A 1 10 ? 7.432   13.468  4.766   1.00 3.71 ? 10  LYS A CG   8  
ATOM 10670 C CD   . LYS A 1 10 ? 6.679   14.385  5.718   1.00 4.04 ? 10  LYS A CD   8  
ATOM 10671 C CE   . LYS A 1 10 ? 5.172   14.189  5.615   1.00 4.40 ? 10  LYS A CE   8  
ATOM 10672 N NZ   . LYS A 1 10 ? 4.716   12.967  6.337   1.00 4.92 ? 10  LYS A NZ   8  
ATOM 10673 H H    . LYS A 1 10 ? 8.563   15.314  1.334   1.00 2.55 ? 10  LYS A H    8  
ATOM 10674 H HA   . LYS A 1 10 ? 9.734   13.789  3.481   1.00 2.82 ? 10  LYS A HA   8  
ATOM 10675 H HB2  . LYS A 1 10 ? 7.556   15.183  3.521   1.00 3.13 ? 10  LYS A HB2  8  
ATOM 10676 H HB3  . LYS A 1 10 ? 6.812   13.787  2.758   1.00 2.88 ? 10  LYS A HB3  8  
ATOM 10677 H HG2  . LYS A 1 10 ? 6.875   12.550  4.650   1.00 3.97 ? 10  LYS A HG2  8  
ATOM 10678 H HG3  . LYS A 1 10 ? 8.404   13.250  5.185   1.00 4.13 ? 10  LYS A HG3  8  
ATOM 10679 H HD2  . LYS A 1 10 ? 6.990   14.171  6.730   1.00 4.48 ? 10  LYS A HD2  8  
ATOM 10680 H HD3  . LYS A 1 10 ? 6.916   15.411  5.477   1.00 4.00 ? 10  LYS A HD3  8  
ATOM 10681 H HE2  . LYS A 1 10 ? 4.681   15.051  6.042   1.00 4.59 ? 10  LYS A HE2  8  
ATOM 10682 H HE3  . LYS A 1 10 ? 4.903   14.103  4.572   1.00 4.53 ? 10  LYS A HE3  8  
ATOM 10683 H HZ1  . LYS A 1 10 ? 4.825   12.131  5.729   1.00 5.28 ? 10  LYS A HZ1  8  
ATOM 10684 H HZ2  . LYS A 1 10 ? 3.714   13.063  6.600   1.00 5.13 ? 10  LYS A HZ2  8  
ATOM 10685 H HZ3  . LYS A 1 10 ? 5.276   12.830  7.202   1.00 5.08 ? 10  LYS A HZ3  8  
ATOM 10686 N N    . GLY A 1 11 ? 7.820   11.639  2.202   1.00 2.10 ? 11  GLY A N    8  
ATOM 10687 C CA   . GLY A 1 11 ? 7.743   10.310  1.621   1.00 2.10 ? 11  GLY A CA   8  
ATOM 10688 C C    . GLY A 1 11 ? 6.323   9.773   1.564   1.00 2.08 ? 11  GLY A C    8  
ATOM 10689 O O    . GLY A 1 11 ? 5.432   10.414  1.004   1.00 2.30 ? 11  GLY A O    8  
ATOM 10690 H H    . GLY A 1 11 ? 7.048   12.001  2.682   1.00 2.22 ? 11  GLY A H    8  
ATOM 10691 H HA2  . GLY A 1 11 ? 8.140   10.345  0.618   1.00 2.53 ? 11  GLY A HA2  8  
ATOM 10692 H HA3  . GLY A 1 11 ? 8.347   9.636   2.210   1.00 2.21 ? 11  GLY A HA3  8  
ATOM 10693 N N    . LEU A 1 12 ? 6.117   8.590   2.145   1.00 2.47 ? 12  LEU A N    8  
ATOM 10694 C CA   . LEU A 1 12 ? 4.798   7.955   2.162   1.00 2.77 ? 12  LEU A CA   8  
ATOM 10695 C C    . LEU A 1 12 ? 3.960   8.466   3.333   1.00 1.92 ? 12  LEU A C    8  
ATOM 10696 O O    . LEU A 1 12 ? 2.810   8.866   3.154   1.00 2.52 ? 12  LEU A O    8  
ATOM 10697 C CB   . LEU A 1 12 ? 4.943   6.431   2.243   1.00 3.62 ? 12  LEU A CB   8  
ATOM 10698 C CG   . LEU A 1 12 ? 5.375   5.734   0.947   1.00 4.87 ? 12  LEU A CG   8  
ATOM 10699 C CD1  . LEU A 1 12 ? 4.664   6.333   -0.258  1.00 5.33 ? 12  LEU A CD1  8  
ATOM 10700 C CD2  . LEU A 1 12 ? 6.886   5.817   0.774   1.00 5.70 ? 12  LEU A CD2  8  
ATOM 10701 H H    . LEU A 1 12 ? 6.871   8.133   2.571   1.00 2.84 ? 12  LEU A H    8  
ATOM 10702 H HA   . LEU A 1 12 ? 4.297   8.211   1.241   1.00 3.41 ? 12  LEU A HA   8  
ATOM 10703 H HB2  . LEU A 1 12 ? 5.671   6.204   3.006   1.00 3.58 ? 12  LEU A HB2  8  
ATOM 10704 H HB3  . LEU A 1 12 ? 3.992   6.018   2.546   1.00 3.65 ? 12  LEU A HB3  8  
ATOM 10705 H HG   . LEU A 1 12 ? 5.104   4.690   1.005   1.00 5.19 ? 12  LEU A HG   8  
ATOM 10706 H HD11 . LEU A 1 12 ? 3.610   6.428   -0.044  1.00 5.40 ? 12  LEU A HD11 8  
ATOM 10707 H HD12 . LEU A 1 12 ? 4.800   5.689   -1.115  1.00 5.57 ? 12  LEU A HD12 8  
ATOM 10708 H HD13 . LEU A 1 12 ? 5.076   7.309   -0.473  1.00 5.68 ? 12  LEU A HD13 8  
ATOM 10709 H HD21 . LEU A 1 12 ? 7.354   5.932   1.740   1.00 6.03 ? 12  LEU A HD21 8  
ATOM 10710 H HD22 . LEU A 1 12 ? 7.133   6.663   0.151   1.00 5.93 ? 12  LEU A HD22 8  
ATOM 10711 H HD23 . LEU A 1 12 ? 7.245   4.911   0.308   1.00 6.06 ? 12  LEU A HD23 8  
ATOM 10712 N N    . GLY A 1 13 ? 4.544   8.445   4.533   1.00 1.13 ? 13  GLY A N    8  
ATOM 10713 C CA   . GLY A 1 13 ? 3.841   8.908   5.719   1.00 1.11 ? 13  GLY A CA   8  
ATOM 10714 C C    . GLY A 1 13 ? 2.858   7.887   6.266   1.00 0.96 ? 13  GLY A C    8  
ATOM 10715 O O    . GLY A 1 13 ? 1.796   8.256   6.766   1.00 1.03 ? 13  GLY A O    8  
ATOM 10716 H H    . GLY A 1 13 ? 5.460   8.109   4.614   1.00 1.49 ? 13  GLY A H    8  
ATOM 10717 H HA2  . GLY A 1 13 ? 4.568   9.131   6.485   1.00 1.58 ? 13  GLY A HA2  8  
ATOM 10718 H HA3  . GLY A 1 13 ? 3.305   9.813   5.478   1.00 1.81 ? 13  GLY A HA3  8  
ATOM 10719 N N    . PHE A 1 14 ? 3.211   6.604   6.170   1.00 0.81 ? 14  PHE A N    8  
ATOM 10720 C CA   . PHE A 1 14 ? 2.360   5.520   6.662   1.00 0.71 ? 14  PHE A CA   8  
ATOM 10721 C C    . PHE A 1 14 ? 3.173   4.231   6.822   1.00 0.56 ? 14  PHE A C    8  
ATOM 10722 O O    . PHE A 1 14 ? 4.392   4.239   6.645   1.00 0.52 ? 14  PHE A O    8  
ATOM 10723 C CB   . PHE A 1 14 ? 1.144   5.306   5.744   1.00 0.74 ? 14  PHE A CB   8  
ATOM 10724 C CG   . PHE A 1 14 ? 1.476   4.964   4.318   1.00 0.63 ? 14  PHE A CG   8  
ATOM 10725 C CD1  . PHE A 1 14 ? 1.912   3.694   3.977   1.00 1.27 ? 14  PHE A CD1  8  
ATOM 10726 C CD2  . PHE A 1 14 ? 1.333   5.910   3.314   1.00 1.41 ? 14  PHE A CD2  8  
ATOM 10727 C CE1  . PHE A 1 14 ? 2.204   3.374   2.666   1.00 1.33 ? 14  PHE A CE1  8  
ATOM 10728 C CE2  . PHE A 1 14 ? 1.621   5.596   2.001   1.00 1.46 ? 14  PHE A CE2  8  
ATOM 10729 C CZ   . PHE A 1 14 ? 2.058   4.326   1.675   1.00 0.83 ? 14  PHE A CZ   8  
ATOM 10730 H H    . PHE A 1 14 ? 4.067   6.375   5.751   1.00 0.79 ? 14  PHE A H    8  
ATOM 10731 H HA   . PHE A 1 14 ? 2.005   5.814   7.639   1.00 0.81 ? 14  PHE A HA   8  
ATOM 10732 H HB2  . PHE A 1 14 ? 0.545   4.501   6.141   1.00 0.84 ? 14  PHE A HB2  8  
ATOM 10733 H HB3  . PHE A 1 14 ? 0.552   6.210   5.738   1.00 0.89 ? 14  PHE A HB3  8  
ATOM 10734 H HD1  . PHE A 1 14 ? 2.027   2.948   4.749   1.00 2.12 ? 14  PHE A HD1  8  
ATOM 10735 H HD2  . PHE A 1 14 ? 0.994   6.904   3.567   1.00 2.28 ? 14  PHE A HD2  8  
ATOM 10736 H HE1  . PHE A 1 14 ? 2.544   2.380   2.415   1.00 2.19 ? 14  PHE A HE1  8  
ATOM 10737 H HE2  . PHE A 1 14 ? 1.505   6.341   1.228   1.00 2.33 ? 14  PHE A HE2  8  
ATOM 10738 H HZ   . PHE A 1 14 ? 2.283   4.079   0.649   1.00 0.99 ? 14  PHE A HZ   8  
ATOM 10739 N N    . SER A 1 15 ? 2.503   3.125   7.144   1.00 0.55 ? 15  SER A N    8  
ATOM 10740 C CA   . SER A 1 15 ? 3.162   1.840   7.311   1.00 0.47 ? 15  SER A CA   8  
ATOM 10741 C C    . SER A 1 15 ? 2.405   0.772   6.525   1.00 0.47 ? 15  SER A C    8  
ATOM 10742 O O    . SER A 1 15 ? 1.309   1.030   6.022   1.00 0.52 ? 15  SER A O    8  
ATOM 10743 C CB   . SER A 1 15 ? 3.211   1.458   8.789   1.00 0.50 ? 15  SER A CB   8  
ATOM 10744 O OG   . SER A 1 15 ? 1.968   1.678   9.413   1.00 0.57 ? 15  SER A OG   8  
ATOM 10745 H H    . SER A 1 15 ? 1.534   3.149   7.253   1.00 0.65 ? 15  SER A H    8  
ATOM 10746 H HA   . SER A 1 15 ? 4.168   1.919   6.926   1.00 0.48 ? 15  SER A HA   8  
ATOM 10747 H HB2  . SER A 1 15 ? 3.455   0.419   8.874   1.00 0.52 ? 15  SER A HB2  8  
ATOM 10748 H HB3  . SER A 1 15 ? 3.957   2.049   9.294   1.00 0.54 ? 15  SER A HB3  8  
ATOM 10749 H HG   . SER A 1 15 ? 1.836   2.619   9.528   1.00 1.10 ? 15  SER A HG   8  
ATOM 10750 N N    . ILE A 1 16 ? 2.979   -0.423  6.421   1.00 0.44 ? 16  ILE A N    8  
ATOM 10751 C CA   . ILE A 1 16 ? 2.335   -1.516  5.692   1.00 0.46 ? 16  ILE A CA   8  
ATOM 10752 C C    . ILE A 1 16 ? 2.808   -2.878  6.187   1.00 0.46 ? 16  ILE A C    8  
ATOM 10753 O O    . ILE A 1 16 ? 3.793   -2.981  6.915   1.00 0.45 ? 16  ILE A O    8  
ATOM 10754 C CB   . ILE A 1 16 ? 2.614   -1.452  4.164   1.00 0.47 ? 16  ILE A CB   8  
ATOM 10755 C CG1  . ILE A 1 16 ? 3.963   -2.094  3.803   1.00 0.67 ? 16  ILE A CG1  8  
ATOM 10756 C CG2  . ILE A 1 16 ? 2.537   -0.026  3.637   1.00 0.57 ? 16  ILE A CG2  8  
ATOM 10757 C CD1  . ILE A 1 16 ? 5.163   -1.307  4.265   1.00 0.64 ? 16  ILE A CD1  8  
ATOM 10758 H H    . ILE A 1 16 ? 3.848   -0.580  6.847   1.00 0.44 ? 16  ILE A H    8  
ATOM 10759 H HA   . ILE A 1 16 ? 1.258   -1.437  5.839   1.00 0.49 ? 16  ILE A HA   8  
ATOM 10760 H HB   . ILE A 1 16 ? 1.844   -2.016  3.683   1.00 0.59 ? 16  ILE A HB   8  
ATOM 10761 H HG12 . ILE A 1 16 ? 4.022   -3.075  4.249   1.00 1.45 ? 16  ILE A HG12 8  
ATOM 10762 H HG13 . ILE A 1 16 ? 4.027   -2.193  2.728   1.00 1.37 ? 16  ILE A HG13 8  
ATOM 10763 H HG21 . ILE A 1 16 ? 2.757   -0.020  2.579   1.00 1.32 ? 16  ILE A HG21 8  
ATOM 10764 H HG22 . ILE A 1 16 ? 3.257   0.591   4.156   1.00 1.06 ? 16  ILE A HG22 8  
ATOM 10765 H HG23 . ILE A 1 16 ? 1.544   0.366   3.800   1.00 1.09 ? 16  ILE A HG23 8  
ATOM 10766 H HD11 . ILE A 1 16 ? 5.677   -0.904  3.405   1.00 1.34 ? 16  ILE A HD11 8  
ATOM 10767 H HD12 . ILE A 1 16 ? 5.829   -1.957  4.815   1.00 1.24 ? 16  ILE A HD12 8  
ATOM 10768 H HD13 . ILE A 1 16 ? 4.833   -0.503  4.901   1.00 1.38 ? 16  ILE A HD13 8  
ATOM 10769 N N    . ALA A 1 17 ? 2.110   -3.910  5.730   1.00 0.51 ? 17  ALA A N    8  
ATOM 10770 C CA   . ALA A 1 17 ? 2.429   -5.299  6.031   1.00 0.55 ? 17  ALA A CA   8  
ATOM 10771 C C    . ALA A 1 17 ? 2.361   -6.069  4.713   1.00 0.73 ? 17  ALA A C    8  
ATOM 10772 O O    . ALA A 1 17 ? 1.787   -5.561  3.757   1.00 1.19 ? 17  ALA A O    8  
ATOM 10773 C CB   . ALA A 1 17 ? 1.471   -5.862  7.069   1.00 0.71 ? 17  ALA A CB   8  
ATOM 10774 H H    . ALA A 1 17 ? 1.351   -3.736  5.133   1.00 0.55 ? 17  ALA A H    8  
ATOM 10775 H HA   . ALA A 1 17 ? 3.433   -5.344  6.419   1.00 0.50 ? 17  ALA A HA   8  
ATOM 10776 H HB1  . ALA A 1 17 ? 1.263   -6.897  6.843   1.00 1.21 ? 17  ALA A HB1  8  
ATOM 10777 H HB2  . ALA A 1 17 ? 0.550   -5.296  7.058   1.00 1.22 ? 17  ALA A HB2  8  
ATOM 10778 H HB3  . ALA A 1 17 ? 1.923   -5.792  8.048   1.00 1.33 ? 17  ALA A HB3  8  
ATOM 10779 N N    . GLY A 1 18 ? 2.915   -7.277  4.635   1.00 0.60 ? 18  GLY A N    8  
ATOM 10780 C CA   . GLY A 1 18 ? 2.817   -8.003  3.373   1.00 0.77 ? 18  GLY A CA   8  
ATOM 10781 C C    . GLY A 1 18 ? 3.745   -9.190  3.240   1.00 0.85 ? 18  GLY A C    8  
ATOM 10782 O O    . GLY A 1 18 ? 4.945   -9.044  3.442   1.00 1.29 ? 18  GLY A O    8  
ATOM 10783 H H    . GLY A 1 18 ? 3.323   -7.677  5.430   1.00 0.67 ? 18  GLY A H    8  
ATOM 10784 H HA2  . GLY A 1 18 ? 1.806   -8.351  3.266   1.00 0.96 ? 18  GLY A HA2  8  
ATOM 10785 H HA3  . GLY A 1 18 ? 3.026   -7.313  2.568   1.00 1.37 ? 18  GLY A HA3  8  
ATOM 10786 N N    . GLY A 1 19 ? 3.216   -10.361 2.867   1.00 1.01 ? 19  GLY A N    8  
ATOM 10787 C CA   . GLY A 1 19 ? 4.066   -11.527 2.684   1.00 1.61 ? 19  GLY A CA   8  
ATOM 10788 C C    . GLY A 1 19 ? 3.873   -12.581 3.752   1.00 0.89 ? 19  GLY A C    8  
ATOM 10789 O O    . GLY A 1 19 ? 3.417   -12.276 4.851   1.00 0.76 ? 19  GLY A O    8  
ATOM 10790 H H    . GLY A 1 19 ? 2.254   -10.452 2.702   1.00 1.01 ? 19  GLY A H    8  
ATOM 10791 H HA2  . GLY A 1 19 ? 3.847   -11.967 1.723   1.00 2.30 ? 19  GLY A HA2  8  
ATOM 10792 H HA3  . GLY A 1 19 ? 5.099   -11.210 2.691   1.00 2.32 ? 19  GLY A HA3  8  
ATOM 10793 N N    . VAL A 1 20 ? 4.226   -13.826 3.424   1.00 0.97 ? 20  VAL A N    8  
ATOM 10794 C CA   . VAL A 1 20 ? 4.095   -14.936 4.366   1.00 1.05 ? 20  VAL A CA   8  
ATOM 10795 C C    . VAL A 1 20 ? 5.033   -14.740 5.560   1.00 1.18 ? 20  VAL A C    8  
ATOM 10796 O O    . VAL A 1 20 ? 6.135   -14.206 5.411   1.00 1.35 ? 20  VAL A O    8  
ATOM 10797 C CB   . VAL A 1 20 ? 4.390   -16.299 3.700   1.00 1.68 ? 20  VAL A CB   8  
ATOM 10798 C CG1  . VAL A 1 20 ? 3.354   -16.604 2.627   1.00 1.76 ? 20  VAL A CG1  8  
ATOM 10799 C CG2  . VAL A 1 20 ? 5.798   -16.329 3.118   1.00 2.72 ? 20  VAL A CG2  8  
ATOM 10800 H H    . VAL A 1 20 ? 4.580   -13.997 2.525   1.00 1.38 ? 20  VAL A H    8  
ATOM 10801 H HA   . VAL A 1 20 ? 3.072   -14.942 4.719   1.00 0.98 ? 20  VAL A HA   8  
ATOM 10802 H HB   . VAL A 1 20 ? 4.322   -17.066 4.457   1.00 2.13 ? 20  VAL A HB   8  
ATOM 10803 H HG11 . VAL A 1 20 ? 3.006   -17.621 2.740   1.00 2.30 ? 20  VAL A HG11 8  
ATOM 10804 H HG12 . VAL A 1 20 ? 3.799   -16.482 1.650   1.00 1.97 ? 20  VAL A HG12 8  
ATOM 10805 H HG13 . VAL A 1 20 ? 2.519   -15.926 2.727   1.00 2.15 ? 20  VAL A HG13 8  
ATOM 10806 H HG21 . VAL A 1 20 ? 5.941   -15.473 2.474   1.00 3.33 ? 20  VAL A HG21 8  
ATOM 10807 H HG22 . VAL A 1 20 ? 5.932   -17.235 2.545   1.00 3.14 ? 20  VAL A HG22 8  
ATOM 10808 H HG23 . VAL A 1 20 ? 6.520   -16.300 3.920   1.00 3.02 ? 20  VAL A HG23 8  
ATOM 10809 N N    . GLY A 1 21 ? 4.583   -15.153 6.749   1.00 1.30 ? 21  GLY A N    8  
ATOM 10810 C CA   . GLY A 1 21 ? 5.393   -14.989 7.954   1.00 1.54 ? 21  GLY A CA   8  
ATOM 10811 C C    . GLY A 1 21 ? 5.293   -13.581 8.538   1.00 1.24 ? 21  GLY A C    8  
ATOM 10812 O O    . GLY A 1 21 ? 5.612   -13.362 9.708   1.00 1.56 ? 21  GLY A O    8  
ATOM 10813 H H    . GLY A 1 21 ? 3.694   -15.560 6.807   1.00 1.35 ? 21  GLY A H    8  
ATOM 10814 H HA2  . GLY A 1 21 ? 5.060   -15.698 8.696   1.00 1.90 ? 21  GLY A HA2  8  
ATOM 10815 H HA3  . GLY A 1 21 ? 6.425   -15.194 7.712   1.00 1.72 ? 21  GLY A HA3  8  
ATOM 10816 N N    . ASN A 1 22 ? 4.833   -12.636 7.716   1.00 0.73 ? 22  ASN A N    8  
ATOM 10817 C CA   . ASN A 1 22 ? 4.658   -11.242 8.115   1.00 0.61 ? 22  ASN A CA   8  
ATOM 10818 C C    . ASN A 1 22 ? 3.339   -10.692 7.548   1.00 0.65 ? 22  ASN A C    8  
ATOM 10819 O O    . ASN A 1 22 ? 3.204   -9.486  7.327   1.00 0.67 ? 22  ASN A O    8  
ATOM 10820 C CB   . ASN A 1 22 ? 5.843   -10.383 7.626   1.00 0.47 ? 22  ASN A CB   8  
ATOM 10821 C CG   . ASN A 1 22 ? 6.475   -10.912 6.350   1.00 0.74 ? 22  ASN A CG   8  
ATOM 10822 O OD1  . ASN A 1 22 ? 7.598   -11.414 6.366   1.00 1.27 ? 22  ASN A OD1  8  
ATOM 10823 N ND2  . ASN A 1 22 ? 5.761   -10.803 5.242   1.00 1.63 ? 22  ASN A ND2  8  
ATOM 10824 H H    . ASN A 1 22 ? 4.584   -12.887 6.809   1.00 0.63 ? 22  ASN A H    8  
ATOM 10825 H HA   . ASN A 1 22 ? 4.617   -11.208 9.193   1.00 0.88 ? 22  ASN A HA   8  
ATOM 10826 H HB2  . ASN A 1 22 ? 5.490   -9.383  7.438   1.00 0.82 ? 22  ASN A HB2  8  
ATOM 10827 H HB3  . ASN A 1 22 ? 6.607   -10.345 8.388   1.00 0.63 ? 22  ASN A HB3  8  
ATOM 10828 H HD21 . ASN A 1 22 ? 4.873   -10.393 5.299   1.00 2.15 ? 22  ASN A HD21 8  
ATOM 10829 H HD22 . ASN A 1 22 ? 6.150   -11.136 4.407   1.00 1.98 ? 22  ASN A HD22 8  
ATOM 10830 N N    . GLN A 1 23 ? 2.376   -11.592 7.287   1.00 0.77 ? 23  GLN A N    8  
ATOM 10831 C CA   . GLN A 1 23 ? 1.079   -11.215 6.715   1.00 0.94 ? 23  GLN A CA   8  
ATOM 10832 C C    . GLN A 1 23 ? 0.298   -10.264 7.615   1.00 0.88 ? 23  GLN A C    8  
ATOM 10833 O O    . GLN A 1 23 ? 0.367   -10.347 8.841   1.00 0.87 ? 23  GLN A O    8  
ATOM 10834 C CB   . GLN A 1 23 ? 0.223   -12.463 6.460   1.00 1.19 ? 23  GLN A CB   8  
ATOM 10835 C CG   . GLN A 1 23 ? 0.893   -13.521 5.596   1.00 1.42 ? 23  GLN A CG   8  
ATOM 10836 C CD   . GLN A 1 23 ? 0.295   -14.902 5.795   1.00 1.55 ? 23  GLN A CD   8  
ATOM 10837 O OE1  . GLN A 1 23 ? 0.989   -15.837 6.195   1.00 1.62 ? 23  GLN A OE1  8  
ATOM 10838 N NE2  . GLN A 1 23 ? -0.998  -15.041 5.515   1.00 2.34 ? 23  GLN A NE2  8  
ATOM 10839 H H    . GLN A 1 23 ? 2.541   -12.542 7.458   1.00 0.79 ? 23  GLN A H    8  
ATOM 10840 H HA   . GLN A 1 23 ? 1.265   -10.726 5.771   1.00 1.04 ? 23  GLN A HA   8  
ATOM 10841 H HB2  . GLN A 1 23 ? -0.022  -12.914 7.410   1.00 1.46 ? 23  GLN A HB2  8  
ATOM 10842 H HB3  . GLN A 1 23 ? -0.693  -12.161 5.972   1.00 1.49 ? 23  GLN A HB3  8  
ATOM 10843 H HG2  . GLN A 1 23 ? 0.782   -13.244 4.559   1.00 1.80 ? 23  GLN A HG2  8  
ATOM 10844 H HG3  . GLN A 1 23 ? 1.942   -13.560 5.847   1.00 1.68 ? 23  GLN A HG3  8  
ATOM 10845 H HE21 . GLN A 1 23 ? -1.493  -14.255 5.199   1.00 2.92 ? 23  GLN A HE21 8  
ATOM 10846 H HE22 . GLN A 1 23 ? -1.406  -15.924 5.637   1.00 2.51 ? 23  GLN A HE22 8  
ATOM 10847 N N    . HIS A 1 24 ? -0.454  -9.364  6.984   1.00 0.86 ? 24  HIS A N    8  
ATOM 10848 C CA   . HIS A 1 24 ? -1.268  -8.387  7.707   1.00 0.83 ? 24  HIS A CA   8  
ATOM 10849 C C    . HIS A 1 24 ? -2.668  -8.931  8.001   1.00 0.84 ? 24  HIS A C    8  
ATOM 10850 O O    . HIS A 1 24 ? -3.344  -8.451  8.912   1.00 0.92 ? 24  HIS A O    8  
ATOM 10851 C CB   . HIS A 1 24 ? -1.399  -7.098  6.894   1.00 0.85 ? 24  HIS A CB   8  
ATOM 10852 C CG   . HIS A 1 24 ? -2.059  -5.993  7.637   1.00 0.83 ? 24  HIS A CG   8  
ATOM 10853 N ND1  . HIS A 1 24 ? -1.395  -5.184  8.526   1.00 0.90 ? 24  HIS A ND1  8  
ATOM 10854 C CD2  . HIS A 1 24 ? -3.333  -5.556  7.602   1.00 0.81 ? 24  HIS A CD2  8  
ATOM 10855 C CE1  . HIS A 1 24 ? -2.232  -4.291  9.007   1.00 0.88 ? 24  HIS A CE1  8  
ATOM 10856 N NE2  . HIS A 1 24 ? -3.419  -4.494  8.464   1.00 0.82 ? 24  HIS A NE2  8  
ATOM 10857 H H    . HIS A 1 24 ? -0.457  -9.351  6.003   1.00 0.90 ? 24  HIS A H    8  
ATOM 10858 H HA   . HIS A 1 24 ? -0.775  -8.165  8.641   1.00 0.84 ? 24  HIS A HA   8  
ATOM 10859 H HB2  . HIS A 1 24 ? -0.427  -6.758  6.597   1.00 0.91 ? 24  HIS A HB2  8  
ATOM 10860 H HB3  . HIS A 1 24 ? -1.991  -7.290  6.015   1.00 0.87 ? 24  HIS A HB3  8  
ATOM 10861 H HD1  . HIS A 1 24 ? -0.451  -5.258  8.775   1.00 0.98 ? 24  HIS A HD1  8  
ATOM 10862 H HD2  . HIS A 1 24 ? -4.130  -5.968  6.997   1.00 0.82 ? 24  HIS A HD2  8  
ATOM 10863 H HE1  . HIS A 1 24 ? -1.984  -3.521  9.710   1.00 0.95 ? 24  HIS A HE1  8  
ATOM 10864 H HE2  . HIS A 1 24 ? -4.242  -4.021  8.709   1.00 0.82 ? 24  HIS A HE2  8  
ATOM 10865 N N    . ILE A 1 25 ? -3.099  -9.925  7.227   1.00 0.80 ? 25  ILE A N    8  
ATOM 10866 C CA   . ILE A 1 25 ? -4.417  -10.515 7.410   1.00 0.86 ? 25  ILE A CA   8  
ATOM 10867 C C    . ILE A 1 25 ? -4.407  -12.000 7.026   1.00 0.81 ? 25  ILE A C    8  
ATOM 10868 O O    . ILE A 1 25 ? -3.903  -12.367 5.962   1.00 0.80 ? 25  ILE A O    8  
ATOM 10869 C CB   . ILE A 1 25 ? -5.485  -9.732  6.598   1.00 0.95 ? 25  ILE A CB   8  
ATOM 10870 C CG1  . ILE A 1 25 ? -6.731  -9.492  7.454   1.00 1.01 ? 25  ILE A CG1  8  
ATOM 10871 C CG2  . ILE A 1 25 ? -5.847  -10.439 5.298   1.00 1.51 ? 25  ILE A CG2  8  
ATOM 10872 C CD1  . ILE A 1 25 ? -7.786  -8.644  6.772   1.00 1.16 ? 25  ILE A CD1  8  
ATOM 10873 H H    . ILE A 1 25 ? -2.516  -10.269 6.517   1.00 0.77 ? 25  ILE A H    8  
ATOM 10874 H HA   . ILE A 1 25 ? -4.665  -10.431 8.458   1.00 0.92 ? 25  ILE A HA   8  
ATOM 10875 H HB   . ILE A 1 25 ? -5.060  -8.774  6.338   1.00 1.28 ? 25  ILE A HB   8  
ATOM 10876 H HG12 . ILE A 1 25 ? -7.180  -10.442 7.702   1.00 1.40 ? 25  ILE A HG12 8  
ATOM 10877 H HG13 . ILE A 1 25 ? -6.439  -8.986  8.364   1.00 1.51 ? 25  ILE A HG13 8  
ATOM 10878 H HG21 . ILE A 1 25 ? -4.947  -10.638 4.735   1.00 1.96 ? 25  ILE A HG21 8  
ATOM 10879 H HG22 . ILE A 1 25 ? -6.501  -9.805  4.718   1.00 1.82 ? 25  ILE A HG22 8  
ATOM 10880 H HG23 . ILE A 1 25 ? -6.348  -11.369 5.520   1.00 1.95 ? 25  ILE A HG23 8  
ATOM 10881 H HD11 . ILE A 1 25 ? -7.377  -7.669  6.551   1.00 1.53 ? 25  ILE A HD11 8  
ATOM 10882 H HD12 . ILE A 1 25 ? -8.639  -8.536  7.426   1.00 1.45 ? 25  ILE A HD12 8  
ATOM 10883 H HD13 . ILE A 1 25 ? -8.095  -9.122  5.854   1.00 1.78 ? 25  ILE A HD13 8  
ATOM 10884 N N    . PRO A 1 26 ? -4.949  -12.876 7.899   1.00 0.82 ? 26  PRO A N    8  
ATOM 10885 C CA   . PRO A 1 26 ? -4.986  -14.324 7.649   1.00 0.82 ? 26  PRO A CA   8  
ATOM 10886 C C    . PRO A 1 26 ? -5.610  -14.669 6.299   1.00 0.86 ? 26  PRO A C    8  
ATOM 10887 O O    . PRO A 1 26 ? -6.768  -14.336 6.038   1.00 0.95 ? 26  PRO A O    8  
ATOM 10888 C CB   . PRO A 1 26 ? -5.846  -14.867 8.792   1.00 0.88 ? 26  PRO A CB   8  
ATOM 10889 C CG   . PRO A 1 26 ? -5.710  -13.862 9.881   1.00 0.98 ? 26  PRO A CG   8  
ATOM 10890 C CD   . PRO A 1 26 ? -5.553  -12.530 9.201   1.00 0.87 ? 26  PRO A CD   8  
ATOM 10891 H HA   . PRO A 1 26 ? -3.997  -14.758 7.704   1.00 0.79 ? 26  PRO A HA   8  
ATOM 10892 H HB2  . PRO A 1 26 ? -6.871  -14.959 8.463   1.00 1.04 ? 26  PRO A HB2  8  
ATOM 10893 H HB3  . PRO A 1 26 ? -5.473  -15.834 9.099   1.00 0.96 ? 26  PRO A HB3  8  
ATOM 10894 H HG2  . PRO A 1 26 ? -6.598  -13.867 10.496  1.00 1.27 ? 26  PRO A HG2  8  
ATOM 10895 H HG3  . PRO A 1 26 ? -4.838  -14.083 10.479  1.00 1.26 ? 26  PRO A HG3  8  
ATOM 10896 H HD2  . PRO A 1 26 ? -6.517  -12.060 9.067   1.00 0.94 ? 26  PRO A HD2  8  
ATOM 10897 H HD3  . PRO A 1 26 ? -4.897  -11.892 9.774   1.00 0.95 ? 26  PRO A HD3  8  
ATOM 10898 N N    . GLY A 1 27 ? -4.833  -15.340 5.448   1.00 0.85 ? 27  GLY A N    8  
ATOM 10899 C CA   . GLY A 1 27 ? -5.320  -15.727 4.136   1.00 0.94 ? 27  GLY A CA   8  
ATOM 10900 C C    . GLY A 1 27 ? -4.796  -14.835 3.024   1.00 0.92 ? 27  GLY A C    8  
ATOM 10901 O O    . GLY A 1 27 ? -4.214  -15.324 2.055   1.00 1.06 ? 27  GLY A O    8  
ATOM 10902 H H    . GLY A 1 27 ? -3.920  -15.578 5.717   1.00 0.81 ? 27  GLY A H    8  
ATOM 10903 H HA2  . GLY A 1 27 ? -5.015  -16.744 3.937   1.00 1.04 ? 27  GLY A HA2  8  
ATOM 10904 H HA3  . GLY A 1 27 ? -6.400  -15.683 4.137   1.00 1.00 ? 27  GLY A HA3  8  
ATOM 10905 N N    . ASP A 1 28 ? -5.007  -13.524 3.162   1.00 0.80 ? 28  ASP A N    8  
ATOM 10906 C CA   . ASP A 1 28 ? -4.554  -12.564 2.156   1.00 0.80 ? 28  ASP A CA   8  
ATOM 10907 C C    . ASP A 1 28 ? -3.132  -12.089 2.458   1.00 0.65 ? 28  ASP A C    8  
ATOM 10908 O O    . ASP A 1 28 ? -2.901  -11.355 3.421   1.00 0.57 ? 28  ASP A O    8  
ATOM 10909 C CB   . ASP A 1 28 ? -5.514  -11.368 2.094   1.00 0.91 ? 28  ASP A CB   8  
ATOM 10910 C CG   . ASP A 1 28 ? -6.153  -11.206 0.727   1.00 1.08 ? 28  ASP A CG   8  
ATOM 10911 O OD1  . ASP A 1 28 ? -6.827  -12.154 0.268   1.00 1.68 ? 28  ASP A OD1  8  
ATOM 10912 O OD2  . ASP A 1 28 ? -5.986  -10.131 0.115   1.00 1.48 ? 28  ASP A OD2  8  
ATOM 10913 H H    . ASP A 1 28 ? -5.476  -13.197 3.958   1.00 0.76 ? 28  ASP A H    8  
ATOM 10914 H HA   . ASP A 1 28 ? -4.554  -13.064 1.199   1.00 0.92 ? 28  ASP A HA   8  
ATOM 10915 H HB2  . ASP A 1 28 ? -6.298  -11.504 2.822   1.00 1.05 ? 28  ASP A HB2  8  
ATOM 10916 H HB3  . ASP A 1 28 ? -4.968  -10.465 2.325   1.00 0.85 ? 28  ASP A HB3  8  
ATOM 10917 N N    . ASN A 1 29 ? -2.181  -12.523 1.627   1.00 0.69 ? 29  ASN A N    8  
ATOM 10918 C CA   . ASN A 1 29 ? -0.773  -12.151 1.800   1.00 0.63 ? 29  ASN A CA   8  
ATOM 10919 C C    . ASN A 1 29 ? -0.440  -10.827 1.099   1.00 0.59 ? 29  ASN A C    8  
ATOM 10920 O O    . ASN A 1 29 ? 0.736   -10.509 0.902   1.00 0.65 ? 29  ASN A O    8  
ATOM 10921 C CB   . ASN A 1 29 ? 0.140   -13.260 1.267   1.00 0.79 ? 29  ASN A CB   8  
ATOM 10922 C CG   . ASN A 1 29 ? -0.261  -14.640 1.757   1.00 1.36 ? 29  ASN A CG   8  
ATOM 10923 O OD1  . ASN A 1 29 ? 0.169   -15.080 2.822   1.00 2.11 ? 29  ASN A OD1  8  
ATOM 10924 N ND2  . ASN A 1 29 ? -1.087  -15.333 0.979   1.00 1.98 ? 29  ASN A ND2  8  
ATOM 10925 H H    . ASN A 1 29 ? -2.432  -13.111 0.885   1.00 0.80 ? 29  ASN A H    8  
ATOM 10926 H HA   . ASN A 1 29 ? -0.591  -12.037 2.859   1.00 0.58 ? 29  ASN A HA   8  
ATOM 10927 H HB2  . ASN A 1 29 ? 0.105   -13.255 0.189   1.00 1.38 ? 29  ASN A HB2  8  
ATOM 10928 H HB3  . ASN A 1 29 ? 1.151   -13.063 1.592   1.00 1.03 ? 29  ASN A HB3  8  
ATOM 10929 H HD21 . ASN A 1 29 ? -1.389  -14.926 0.140   1.00 2.27 ? 29  ASN A HD21 8  
ATOM 10930 H HD22 . ASN A 1 29 ? -1.360  -16.226 1.276   1.00 2.54 ? 29  ASN A HD22 8  
ATOM 10931 N N    . SER A 1 30 ? -1.467  -10.051 0.735   1.00 0.56 ? 30  SER A N    8  
ATOM 10932 C CA   . SER A 1 30 ? -1.264  -8.763  0.072   1.00 0.56 ? 30  SER A CA   8  
ATOM 10933 C C    . SER A 1 30 ? -0.585  -7.776  1.017   1.00 0.55 ? 30  SER A C    8  
ATOM 10934 O O    . SER A 1 30 ? -0.300  -8.106  2.171   1.00 0.55 ? 30  SER A O    8  
ATOM 10935 C CB   . SER A 1 30 ? -2.598  -8.178  -0.410  1.00 0.60 ? 30  SER A CB   8  
ATOM 10936 O OG   . SER A 1 30 ? -3.502  -9.197  -0.794  1.00 1.39 ? 30  SER A OG   8  
ATOM 10937 H H    . SER A 1 30 ? -2.382  -10.346 0.925   1.00 0.58 ? 30  SER A H    8  
ATOM 10938 H HA   . SER A 1 30 ? -0.622  -8.925  -0.780  1.00 0.60 ? 30  SER A HA   8  
ATOM 10939 H HB2  . SER A 1 30 ? -3.044  -7.602  0.386   1.00 1.26 ? 30  SER A HB2  8  
ATOM 10940 H HB3  . SER A 1 30 ? -2.417  -7.535  -1.259  1.00 1.02 ? 30  SER A HB3  8  
ATOM 10941 H HG   . SER A 1 30 ? -4.237  -9.222  -0.177  1.00 1.77 ? 30  SER A HG   8  
ATOM 10942 N N    . ILE A 1 31 ? -0.354  -6.555  0.537   1.00 0.55 ? 31  ILE A N    8  
ATOM 10943 C CA   . ILE A 1 31 ? 0.262   -5.540  1.377   1.00 0.55 ? 31  ILE A CA   8  
ATOM 10944 C C    . ILE A 1 31 ? -0.789  -4.561  1.904   1.00 0.57 ? 31  ILE A C    8  
ATOM 10945 O O    . ILE A 1 31 ? -1.356  -3.765  1.158   1.00 0.65 ? 31  ILE A O    8  
ATOM 10946 C CB   . ILE A 1 31 ? 1.403   -4.778  0.653   1.00 0.53 ? 31  ILE A CB   8  
ATOM 10947 C CG1  . ILE A 1 31 ? 2.727   -5.549  0.740   1.00 0.62 ? 31  ILE A CG1  8  
ATOM 10948 C CG2  . ILE A 1 31 ? 1.581   -3.381  1.239   1.00 0.60 ? 31  ILE A CG2  8  
ATOM 10949 C CD1  . ILE A 1 31 ? 2.675   -6.961  0.190   1.00 0.80 ? 31  ILE A CD1  8  
ATOM 10950 H H    . ILE A 1 31 ? -0.638  -6.338  -0.378  1.00 0.57 ? 31  ILE A H    8  
ATOM 10951 H HA   . ILE A 1 31 ? 0.686   -6.056  2.221   1.00 0.54 ? 31  ILE A HA   8  
ATOM 10952 H HB   . ILE A 1 31 ? 1.131   -4.673  -0.379  1.00 0.74 ? 31  ILE A HB   8  
ATOM 10953 H HG12 . ILE A 1 31 ? 3.477   -5.012  0.179   1.00 1.20 ? 31  ILE A HG12 8  
ATOM 10954 H HG13 . ILE A 1 31 ? 3.036   -5.607  1.774   1.00 1.19 ? 31  ILE A HG13 8  
ATOM 10955 H HG21 . ILE A 1 31 ? 1.399   -3.409  2.303   1.00 1.13 ? 31  ILE A HG21 8  
ATOM 10956 H HG22 . ILE A 1 31 ? 0.884   -2.704  0.772   1.00 1.21 ? 31  ILE A HG22 8  
ATOM 10957 H HG23 . ILE A 1 31 ? 2.590   -3.039  1.057   1.00 1.13 ? 31  ILE A HG23 8  
ATOM 10958 H HD11 . ILE A 1 31 ? 1.705   -7.389  0.380   1.00 1.15 ? 31  ILE A HD11 8  
ATOM 10959 H HD12 . ILE A 1 31 ? 3.434   -7.562  0.670   1.00 1.28 ? 31  ILE A HD12 8  
ATOM 10960 H HD13 . ILE A 1 31 ? 2.857   -6.939  -0.874  1.00 1.46 ? 31  ILE A HD13 8  
ATOM 10961 N N    . TYR A 1 32 ? -1.043  -4.655  3.203   1.00 0.60 ? 32  TYR A N    8  
ATOM 10962 C CA   . TYR A 1 32 ? -2.028  -3.812  3.874   1.00 0.62 ? 32  TYR A CA   8  
ATOM 10963 C C    . TYR A 1 32 ? -1.370  -2.712  4.703   1.00 0.59 ? 32  TYR A C    8  
ATOM 10964 O O    . TYR A 1 32 ? -0.336  -2.931  5.332   1.00 0.61 ? 32  TYR A O    8  
ATOM 10965 C CB   . TYR A 1 32 ? -2.900  -4.664  4.793   1.00 0.69 ? 32  TYR A CB   8  
ATOM 10966 C CG   . TYR A 1 32 ? -3.847  -5.594  4.075   1.00 0.71 ? 32  TYR A CG   8  
ATOM 10967 C CD1  . TYR A 1 32 ? -3.373  -6.633  3.283   1.00 1.28 ? 32  TYR A CD1  8  
ATOM 10968 C CD2  . TYR A 1 32 ? -5.218  -5.437  4.203   1.00 1.34 ? 32  TYR A CD2  8  
ATOM 10969 C CE1  . TYR A 1 32 ? -4.241  -7.487  2.634   1.00 1.30 ? 32  TYR A CE1  8  
ATOM 10970 C CE2  . TYR A 1 32 ? -6.097  -6.285  3.562   1.00 1.38 ? 32  TYR A CE2  8  
ATOM 10971 C CZ   . TYR A 1 32 ? -5.605  -7.311  2.778   1.00 0.80 ? 32  TYR A CZ   8  
ATOM 10972 O OH   . TYR A 1 32 ? -6.478  -8.160  2.136   1.00 0.86 ? 32  TYR A OH   8  
ATOM 10973 H H    . TYR A 1 32 ? -0.554  -5.327  3.716   1.00 0.66 ? 32  TYR A H    8  
ATOM 10974 H HA   . TYR A 1 32 ? -2.653  -3.359  3.122   1.00 0.64 ? 32  TYR A HA   8  
ATOM 10975 H HB2  . TYR A 1 32 ? -2.259  -5.268  5.416   1.00 0.68 ? 32  TYR A HB2  8  
ATOM 10976 H HB3  . TYR A 1 32 ? -3.488  -4.011  5.422   1.00 0.74 ? 32  TYR A HB3  8  
ATOM 10977 H HD1  . TYR A 1 32 ? -2.307  -6.767  3.176   1.00 2.05 ? 32  TYR A HD1  8  
ATOM 10978 H HD2  . TYR A 1 32 ? -5.598  -4.635  4.816   1.00 2.10 ? 32  TYR A HD2  8  
ATOM 10979 H HE1  . TYR A 1 32 ? -3.851  -8.287  2.019   1.00 2.06 ? 32  TYR A HE1  8  
ATOM 10980 H HE2  . TYR A 1 32 ? -7.162  -6.140  3.676   1.00 2.17 ? 32  TYR A HE2  8  
ATOM 10981 H HH   . TYR A 1 32 ? -6.446  -7.999  1.189   1.00 1.32 ? 32  TYR A HH   8  
ATOM 10982 N N    . VAL A 1 33 ? -2.007  -1.541  4.732   1.00 0.57 ? 33  VAL A N    8  
ATOM 10983 C CA   . VAL A 1 33 ? -1.517  -0.413  5.520   1.00 0.55 ? 33  VAL A CA   8  
ATOM 10984 C C    . VAL A 1 33 ? -1.889  -0.625  6.986   1.00 0.59 ? 33  VAL A C    8  
ATOM 10985 O O    . VAL A 1 33 ? -3.039  -0.944  7.300   1.00 0.65 ? 33  VAL A O    8  
ATOM 10986 C CB   . VAL A 1 33 ? -2.093  0.930   5.014   1.00 0.59 ? 33  VAL A CB   8  
ATOM 10987 C CG1  . VAL A 1 33 ? -1.781  2.064   5.983   1.00 0.62 ? 33  VAL A CG1  8  
ATOM 10988 C CG2  . VAL A 1 33 ? -1.555  1.246   3.625   1.00 0.56 ? 33  VAL A CG2  8  
ATOM 10989 H H    . VAL A 1 33 ? -2.838  -1.447  4.240   1.00 0.61 ? 33  VAL A H    8  
ATOM 10990 H HA   . VAL A 1 33 ? -0.440  -0.383  5.427   1.00 0.51 ? 33  VAL A HA   8  
ATOM 10991 H HB   . VAL A 1 33 ? -3.167  0.835   4.945   1.00 0.67 ? 33  VAL A HB   8  
ATOM 10992 H HG11 . VAL A 1 33 ? -1.771  3.002   5.449   1.00 1.13 ? 33  VAL A HG11 8  
ATOM 10993 H HG12 . VAL A 1 33 ? -0.814  1.897   6.435   1.00 1.12 ? 33  VAL A HG12 8  
ATOM 10994 H HG13 . VAL A 1 33 ? -2.536  2.098   6.754   1.00 1.21 ? 33  VAL A HG13 8  
ATOM 10995 H HG21 . VAL A 1 33 ? -1.278  2.290   3.574   1.00 1.23 ? 33  VAL A HG21 8  
ATOM 10996 H HG22 . VAL A 1 33 ? -2.316  1.039   2.888   1.00 0.96 ? 33  VAL A HG22 8  
ATOM 10997 H HG23 . VAL A 1 33 ? -0.686  0.634   3.427   1.00 1.26 ? 33  VAL A HG23 8  
ATOM 10998 N N    . THR A 1 34 ? -0.908  -0.494  7.875   1.00 0.62 ? 34  THR A N    8  
ATOM 10999 C CA   . THR A 1 34 ? -1.137  -0.726  9.303   1.00 0.71 ? 34  THR A CA   8  
ATOM 11000 C C    . THR A 1 34 ? -1.247  0.567   10.123  1.00 0.72 ? 34  THR A C    8  
ATOM 11001 O O    . THR A 1 34 ? -1.886  0.574   11.176  1.00 0.84 ? 34  THR A O    8  
ATOM 11002 C CB   . THR A 1 34 ? -0.014  -1.607  9.874   1.00 0.74 ? 34  THR A CB   8  
ATOM 11003 O OG1  . THR A 1 34 ? 1.097   -0.823  10.278  1.00 1.39 ? 34  THR A OG1  8  
ATOM 11004 C CG2  . THR A 1 34 ? 0.498   -2.647  8.897   1.00 1.29 ? 34  THR A CG2  8  
ATOM 11005 H H    . THR A 1 34 ? -0.006  -0.273  7.563   1.00 0.62 ? 34  THR A H    8  
ATOM 11006 H HA   . THR A 1 34 ? -2.067  -1.264  9.396   1.00 0.81 ? 34  THR A HA   8  
ATOM 11007 H HB   . THR A 1 34 ? -0.392  -2.130  10.742  1.00 1.08 ? 34  THR A HB   8  
ATOM 11008 H HG1  . THR A 1 34 ? 1.140   -0.801  11.236  1.00 1.62 ? 34  THR A HG1  8  
ATOM 11009 H HG21 . THR A 1 34 ? -0.117  -2.644  8.008   1.00 1.65 ? 34  THR A HG21 8  
ATOM 11010 H HG22 . THR A 1 34 ? 0.456   -3.621  9.356   1.00 1.98 ? 34  THR A HG22 8  
ATOM 11011 H HG23 . THR A 1 34 ? 1.519   -2.419  8.628   1.00 1.56 ? 34  THR A HG23 8  
ATOM 11012 N N    . LYS A 1 35 ? -0.606  1.642   9.666   1.00 0.65 ? 35  LYS A N    8  
ATOM 11013 C CA   . LYS A 1 35 ? -0.625  2.908   10.403  1.00 0.71 ? 35  LYS A CA   8  
ATOM 11014 C C    . LYS A 1 35 ? -0.293  4.096   9.501   1.00 0.69 ? 35  LYS A C    8  
ATOM 11015 O O    . LYS A 1 35 ? 0.805   4.176   8.951   1.00 0.62 ? 35  LYS A O    8  
ATOM 11016 C CB   . LYS A 1 35 ? 0.388   2.836   11.552  1.00 0.72 ? 35  LYS A CB   8  
ATOM 11017 C CG   . LYS A 1 35 ? -0.058  3.530   12.824  1.00 1.32 ? 35  LYS A CG   8  
ATOM 11018 C CD   . LYS A 1 35 ? -0.876  2.599   13.710  1.00 1.46 ? 35  LYS A CD   8  
ATOM 11019 C CE   . LYS A 1 35 ? -0.244  2.432   15.085  1.00 2.02 ? 35  LYS A CE   8  
ATOM 11020 N NZ   . LYS A 1 35 ? 0.958   1.550   15.047  1.00 2.54 ? 35  LYS A NZ   8  
ATOM 11021 H H    . LYS A 1 35 ? -0.091  1.581   8.833   1.00 0.59 ? 35  LYS A H    8  
ATOM 11022 H HA   . LYS A 1 35 ? -1.613  3.043   10.815  1.00 0.80 ? 35  LYS A HA   8  
ATOM 11023 H HB2  . LYS A 1 35 ? 0.577   1.799   11.784  1.00 0.98 ? 35  LYS A HB2  8  
ATOM 11024 H HB3  . LYS A 1 35 ? 1.312   3.294   11.227  1.00 1.18 ? 35  LYS A HB3  8  
ATOM 11025 H HG2  . LYS A 1 35 ? 0.820   3.850   13.365  1.00 1.91 ? 35  LYS A HG2  8  
ATOM 11026 H HG3  . LYS A 1 35 ? -0.657  4.389   12.563  1.00 2.08 ? 35  LYS A HG3  8  
ATOM 11027 H HD2  . LYS A 1 35 ? -1.867  3.011   13.829  1.00 1.89 ? 35  LYS A HD2  8  
ATOM 11028 H HD3  . LYS A 1 35 ? -0.943  1.631   13.234  1.00 1.86 ? 35  LYS A HD3  8  
ATOM 11029 H HE2  . LYS A 1 35 ? 0.046   3.404   15.455  1.00 2.47 ? 35  LYS A HE2  8  
ATOM 11030 H HE3  . LYS A 1 35 ? -0.976  1.999   15.752  1.00 2.40 ? 35  LYS A HE3  8  
ATOM 11031 H HZ1  . LYS A 1 35 ? 0.735   0.661   14.557  1.00 2.55 ? 35  LYS A HZ1  8  
ATOM 11032 H HZ2  . LYS A 1 35 ? 1.271   1.331   16.015  1.00 2.90 ? 35  LYS A HZ2  8  
ATOM 11033 H HZ3  . LYS A 1 35 ? 1.734   2.024   14.544  1.00 3.18 ? 35  LYS A HZ3  8  
ATOM 11034 N N    . ILE A 1 36 ? -1.242  5.019   9.357   1.00 0.86 ? 36  ILE A N    8  
ATOM 11035 C CA   . ILE A 1 36 ? -1.037  6.201   8.525   1.00 0.92 ? 36  ILE A CA   8  
ATOM 11036 C C    . ILE A 1 36 ? -0.641  7.414   9.377   1.00 0.98 ? 36  ILE A C    8  
ATOM 11037 O O    . ILE A 1 36 ? -1.382  7.819   10.275  1.00 1.06 ? 36  ILE A O    8  
ATOM 11038 C CB   . ILE A 1 36 ? -2.298  6.542   7.697   1.00 1.03 ? 36  ILE A CB   8  
ATOM 11039 C CG1  . ILE A 1 36 ? -2.645  5.377   6.762   1.00 1.40 ? 36  ILE A CG1  8  
ATOM 11040 C CG2  . ILE A 1 36 ? -2.085  7.828   6.906   1.00 1.12 ? 36  ILE A CG2  8  
ATOM 11041 C CD1  . ILE A 1 36 ? -3.594  5.747   5.640   1.00 1.35 ? 36  ILE A CD1  8  
ATOM 11042 H H    . ILE A 1 36 ? -2.099  4.903   9.820   1.00 0.98 ? 36  ILE A H    8  
ATOM 11043 H HA   . ILE A 1 36 ? -0.235  5.981   7.835   1.00 0.85 ? 36  ILE A HA   8  
ATOM 11044 H HB   . ILE A 1 36 ? -3.118  6.702   8.382   1.00 0.95 ? 36  ILE A HB   8  
ATOM 11045 H HG12 . ILE A 1 36 ? -1.737  5.003   6.313   1.00 1.63 ? 36  ILE A HG12 8  
ATOM 11046 H HG13 . ILE A 1 36 ? -3.105  4.589   7.339   1.00 1.62 ? 36  ILE A HG13 8  
ATOM 11047 H HG21 . ILE A 1 36 ? -1.270  7.692   6.210   1.00 1.46 ? 36  ILE A HG21 8  
ATOM 11048 H HG22 . ILE A 1 36 ? -1.848  8.634   7.584   1.00 1.45 ? 36  ILE A HG22 8  
ATOM 11049 H HG23 . ILE A 1 36 ? -2.986  8.070   6.363   1.00 1.44 ? 36  ILE A HG23 8  
ATOM 11050 H HD11 . ILE A 1 36 ? -4.229  6.560   5.959   1.00 1.87 ? 36  ILE A HD11 8  
ATOM 11051 H HD12 . ILE A 1 36 ? -4.202  4.891   5.388   1.00 1.71 ? 36  ILE A HD12 8  
ATOM 11052 H HD13 . ILE A 1 36 ? -3.024  6.051   4.774   1.00 1.41 ? 36  ILE A HD13 8  
ATOM 11053 N N    . ILE A 1 37 ? 0.528   7.990   9.080   1.00 1.03 ? 37  ILE A N    8  
ATOM 11054 C CA   . ILE A 1 37 ? 1.028   9.159   9.804   1.00 1.10 ? 37  ILE A CA   8  
ATOM 11055 C C    . ILE A 1 37 ? 0.332   10.434  9.320   1.00 1.10 ? 37  ILE A C    8  
ATOM 11056 O O    . ILE A 1 37 ? -0.026  10.547  8.145   1.00 1.37 ? 37  ILE A O    8  
ATOM 11057 C CB   . ILE A 1 37 ? 2.561   9.312   9.628   1.00 1.14 ? 37  ILE A CB   8  
ATOM 11058 C CG1  . ILE A 1 37 ? 3.306   8.217   10.400  1.00 1.47 ? 37  ILE A CG1  8  
ATOM 11059 C CG2  . ILE A 1 37 ? 3.029   10.688  10.086  1.00 1.32 ? 37  ILE A CG2  8  
ATOM 11060 C CD1  . ILE A 1 37 ? 3.374   6.891   9.674   1.00 1.68 ? 37  ILE A CD1  8  
ATOM 11061 H H    . ILE A 1 37 ? 1.066   7.624   8.348   1.00 1.06 ? 37  ILE A H    8  
ATOM 11062 H HA   . ILE A 1 37 ? 0.816   9.019   10.854  1.00 1.17 ? 37  ILE A HA   8  
ATOM 11063 H HB   . ILE A 1 37 ? 2.790   9.218   8.578   1.00 1.07 ? 37  ILE A HB   8  
ATOM 11064 H HG12 . ILE A 1 37 ? 4.318   8.544   10.580  1.00 1.63 ? 37  ILE A HG12 8  
ATOM 11065 H HG13 . ILE A 1 37 ? 2.812   8.054   11.346  1.00 1.84 ? 37  ILE A HG13 8  
ATOM 11066 H HG21 . ILE A 1 37 ? 2.571   10.928  11.035  1.00 1.40 ? 37  ILE A HG21 8  
ATOM 11067 H HG22 . ILE A 1 37 ? 2.746   11.427  9.352   1.00 1.79 ? 37  ILE A HG22 8  
ATOM 11068 H HG23 . ILE A 1 37 ? 4.103   10.685  10.196  1.00 1.90 ? 37  ILE A HG23 8  
ATOM 11069 H HD11 . ILE A 1 37 ? 4.125   6.267   10.135  1.00 2.18 ? 37  ILE A HD11 8  
ATOM 11070 H HD12 . ILE A 1 37 ? 3.630   7.060   8.638   1.00 1.92 ? 37  ILE A HD12 8  
ATOM 11071 H HD13 . ILE A 1 37 ? 2.414   6.399   9.732   1.00 1.93 ? 37  ILE A HD13 8  
ATOM 11072 N N    . GLU A 1 38 ? 0.149   11.394  10.231  1.00 0.96 ? 38  GLU A N    8  
ATOM 11073 C CA   . GLU A 1 38 ? -0.497  12.663  9.895   1.00 0.99 ? 38  GLU A CA   8  
ATOM 11074 C C    . GLU A 1 38 ? 0.337   13.456  8.887   1.00 1.31 ? 38  GLU A C    8  
ATOM 11075 O O    . GLU A 1 38 ? 1.568   13.410  8.913   1.00 1.64 ? 38  GLU A O    8  
ATOM 11076 C CB   . GLU A 1 38 ? -0.726  13.498  11.158  1.00 1.23 ? 38  GLU A CB   8  
ATOM 11077 C CG   . GLU A 1 38 ? -1.977  13.106  11.930  1.00 1.71 ? 38  GLU A CG   8  
ATOM 11078 C CD   . GLU A 1 38 ? -2.184  13.948  13.174  1.00 2.41 ? 38  GLU A CD   8  
ATOM 11079 O OE1  . GLU A 1 38 ? -1.674  13.560  14.247  1.00 2.79 ? 38  GLU A OE1  8  
ATOM 11080 O OE2  . GLU A 1 38 ? -2.856  14.996  13.076  1.00 3.11 ? 38  GLU A OE2  8  
ATOM 11081 H H    . GLU A 1 38 ? 0.461   11.247  11.148  1.00 0.97 ? 38  GLU A H    8  
ATOM 11082 H HA   . GLU A 1 38 ? -1.454  12.435  9.449   1.00 1.23 ? 38  GLU A HA   8  
ATOM 11083 H HB2  . GLU A 1 38 ? 0.125   13.384  11.811  1.00 1.66 ? 38  GLU A HB2  8  
ATOM 11084 H HB3  . GLU A 1 38 ? -0.815  14.538  10.877  1.00 1.49 ? 38  GLU A HB3  8  
ATOM 11085 H HG2  . GLU A 1 38 ? -2.835  13.225  11.286  1.00 2.01 ? 38  GLU A HG2  8  
ATOM 11086 H HG3  . GLU A 1 38 ? -1.891  12.070  12.224  1.00 1.90 ? 38  GLU A HG3  8  
ATOM 11087 N N    . GLY A 1 39 ? -0.349  14.185  8.005   1.00 1.69 ? 39  GLY A N    8  
ATOM 11088 C CA   . GLY A 1 39 ? 0.328   14.986  6.995   1.00 2.36 ? 39  GLY A CA   8  
ATOM 11089 C C    . GLY A 1 39 ? 1.137   14.162  5.998   1.00 2.68 ? 39  GLY A C    8  
ATOM 11090 O O    . GLY A 1 39 ? 1.993   14.707  5.299   1.00 3.15 ? 39  GLY A O    8  
ATOM 11091 H H    . GLY A 1 39 ? -1.326  14.187  8.044   1.00 1.72 ? 39  GLY A H    8  
ATOM 11092 H HA2  . GLY A 1 39 ? -0.414  15.552  6.451   1.00 2.72 ? 39  GLY A HA2  8  
ATOM 11093 H HA3  . GLY A 1 39 ? 0.992   15.678  7.493   1.00 2.45 ? 39  GLY A HA3  8  
ATOM 11094 N N    . GLY A 1 40 ? 0.869   12.853  5.929   1.00 2.49 ? 40  GLY A N    8  
ATOM 11095 C CA   . GLY A 1 40 ? 1.592   11.990  5.007   1.00 2.80 ? 40  GLY A CA   8  
ATOM 11096 C C    . GLY A 1 40 ? 0.896   11.848  3.665   1.00 2.61 ? 40  GLY A C    8  
ATOM 11097 O O    . GLY A 1 40 ? -0.260  12.240  3.516   1.00 2.37 ? 40  GLY A O    8  
ATOM 11098 H H    . GLY A 1 40 ? 0.180   12.471  6.509   1.00 2.19 ? 40  GLY A H    8  
ATOM 11099 H HA2  . GLY A 1 40 ? 2.579   12.398  4.847   1.00 3.27 ? 40  GLY A HA2  8  
ATOM 11100 H HA3  . GLY A 1 40 ? 1.689   11.010  5.454   1.00 2.80 ? 40  GLY A HA3  8  
ATOM 11101 N N    . ALA A 1 41 ? 1.612   11.289  2.684   1.00 2.83 ? 41  ALA A N    8  
ATOM 11102 C CA   . ALA A 1 41 ? 1.075   11.092  1.334   1.00 2.70 ? 41  ALA A CA   8  
ATOM 11103 C C    . ALA A 1 41 ? -0.340  10.509  1.359   1.00 2.11 ? 41  ALA A C    8  
ATOM 11104 O O    . ALA A 1 41 ? -1.273  11.113  0.827   1.00 2.06 ? 41  ALA A O    8  
ATOM 11105 C CB   . ALA A 1 41 ? 2.004   10.193  0.529   1.00 3.00 ? 41  ALA A CB   8  
ATOM 11106 H H    . ALA A 1 41 ? 2.533   11.010  2.871   1.00 3.11 ? 41  ALA A H    8  
ATOM 11107 H HA   . ALA A 1 41 ? 1.043   12.057  0.848   1.00 2.91 ? 41  ALA A HA   8  
ATOM 11108 H HB1  . ALA A 1 41 ? 1.856   9.165   0.824   1.00 3.45 ? 41  ALA A HB1  8  
ATOM 11109 H HB2  . ALA A 1 41 ? 3.029   10.477  0.714   1.00 3.26 ? 41  ALA A HB2  8  
ATOM 11110 H HB3  . ALA A 1 41 ? 1.785   10.300  -0.523  1.00 2.99 ? 41  ALA A HB3  8  
ATOM 11111 N N    . ALA A 1 42 ? -0.492  9.336   1.979   1.00 1.82 ? 42  ALA A N    8  
ATOM 11112 C CA   . ALA A 1 42 ? -1.795  8.675   2.071   1.00 1.36 ? 42  ALA A CA   8  
ATOM 11113 C C    . ALA A 1 42 ? -2.779  9.499   2.901   1.00 1.16 ? 42  ALA A C    8  
ATOM 11114 O O    . ALA A 1 42 ? -3.913  9.726   2.480   1.00 1.02 ? 42  ALA A O    8  
ATOM 11115 C CB   . ALA A 1 42 ? -1.644  7.279   2.662   1.00 1.50 ? 42  ALA A CB   8  
ATOM 11116 H H    . ALA A 1 42 ? 0.289   8.906   2.385   1.00 2.06 ? 42  ALA A H    8  
ATOM 11117 H HA   . ALA A 1 42 ? -2.185  8.573   1.069   1.00 1.30 ? 42  ALA A HA   8  
ATOM 11118 H HB1  . ALA A 1 42 ? -1.111  6.650   1.964   1.00 1.77 ? 42  ALA A HB1  8  
ATOM 11119 H HB2  . ALA A 1 42 ? -2.621  6.861   2.851   1.00 1.88 ? 42  ALA A HB2  8  
ATOM 11120 H HB3  . ALA A 1 42 ? -1.091  7.338   3.588   1.00 1.93 ? 42  ALA A HB3  8  
ATOM 11121 N N    . HIS A 1 43 ? -2.335  9.935   4.082   1.00 1.34 ? 43  HIS A N    8  
ATOM 11122 C CA   . HIS A 1 43 ? -3.168  10.732  4.985   1.00 1.21 ? 43  HIS A CA   8  
ATOM 11123 C C    . HIS A 1 43 ? -3.751  11.959  4.277   1.00 1.08 ? 43  HIS A C    8  
ATOM 11124 O O    . HIS A 1 43 ? -4.960  12.192  4.321   1.00 1.15 ? 43  HIS A O    8  
ATOM 11125 C CB   . HIS A 1 43 ? -2.345  11.171  6.199   1.00 1.39 ? 43  HIS A CB   8  
ATOM 11126 C CG   . HIS A 1 43 ? -3.132  11.914  7.231   1.00 1.16 ? 43  HIS A CG   8  
ATOM 11127 N ND1  . HIS A 1 43 ? -3.330  13.278  7.186   1.00 1.34 ? 43  HIS A ND1  8  
ATOM 11128 C CD2  . HIS A 1 43 ? -3.765  11.481  8.348   1.00 1.15 ? 43  HIS A CD2  8  
ATOM 11129 C CE1  . HIS A 1 43 ? -4.046  13.653  8.229   1.00 1.22 ? 43  HIS A CE1  8  
ATOM 11130 N NE2  . HIS A 1 43 ? -4.325  12.581  8.949   1.00 1.28 ? 43  HIS A NE2  8  
ATOM 11131 H H    . HIS A 1 43 ? -1.421  9.707   4.359   1.00 1.62 ? 43  HIS A H    8  
ATOM 11132 H HA   . HIS A 1 43 ? -3.982  10.107  5.322   1.00 1.26 ? 43  HIS A HA   8  
ATOM 11133 H HB2  . HIS A 1 43 ? -1.923  10.297  6.672   1.00 1.74 ? 43  HIS A HB2  8  
ATOM 11134 H HB3  . HIS A 1 43 ? -1.544  11.812  5.866   1.00 1.58 ? 43  HIS A HB3  8  
ATOM 11135 H HD1  . HIS A 1 43 ? -2.993  13.881  6.491   1.00 1.69 ? 43  HIS A HD1  8  
ATOM 11136 H HD2  . HIS A 1 43 ? -3.818  10.459  8.698   1.00 1.32 ? 43  HIS A HD2  8  
ATOM 11137 H HE1  . HIS A 1 43 ? -4.345  14.664  8.459   1.00 1.34 ? 43  HIS A HE1  8  
ATOM 11138 H HE2  . HIS A 1 43 ? -4.774  12.586  9.820   1.00 1.60 ? 43  HIS A HE2  8  
ATOM 11139 N N    . LYS A 1 44 ? -2.883  12.735  3.625   1.00 1.15 ? 44  LYS A N    8  
ATOM 11140 C CA   . LYS A 1 44 ? -3.304  13.939  2.904   1.00 1.31 ? 44  LYS A CA   8  
ATOM 11141 C C    . LYS A 1 44 ? -4.229  13.588  1.737   1.00 1.39 ? 44  LYS A C    8  
ATOM 11142 O O    . LYS A 1 44 ? -5.217  14.283  1.491   1.00 1.46 ? 44  LYS A O    8  
ATOM 11143 C CB   . LYS A 1 44 ? -2.082  14.706  2.390   1.00 1.74 ? 44  LYS A CB   8  
ATOM 11144 C CG   . LYS A 1 44 ? -1.325  15.447  3.481   1.00 1.89 ? 44  LYS A CG   8  
ATOM 11145 C CD   . LYS A 1 44 ? -0.081  16.127  2.934   1.00 2.36 ? 44  LYS A CD   8  
ATOM 11146 C CE   . LYS A 1 44 ? 0.349   17.294  3.813   1.00 2.17 ? 44  LYS A CE   8  
ATOM 11147 N NZ   . LYS A 1 44 ? 0.578   18.535  3.019   1.00 2.66 ? 44  LYS A NZ   8  
ATOM 11148 H H    . LYS A 1 44 ? -1.934  12.490  3.627   1.00 1.26 ? 44  LYS A H    8  
ATOM 11149 H HA   . LYS A 1 44 ? -3.844  14.565  3.597   1.00 1.30 ? 44  LYS A HA   8  
ATOM 11150 H HB2  . LYS A 1 44 ? -1.404  14.007  1.922   1.00 2.10 ? 44  LYS A HB2  8  
ATOM 11151 H HB3  . LYS A 1 44 ? -2.407  15.426  1.653   1.00 2.02 ? 44  LYS A HB3  8  
ATOM 11152 H HG2  . LYS A 1 44 ? -1.974  16.196  3.911   1.00 1.94 ? 44  LYS A HG2  8  
ATOM 11153 H HG3  . LYS A 1 44 ? -1.033  14.742  4.246   1.00 2.08 ? 44  LYS A HG3  8  
ATOM 11154 H HD2  . LYS A 1 44 ? 0.722   15.407  2.892   1.00 2.71 ? 44  LYS A HD2  8  
ATOM 11155 H HD3  . LYS A 1 44 ? -0.291  16.495  1.941   1.00 2.84 ? 44  LYS A HD3  8  
ATOM 11156 H HE2  . LYS A 1 44 ? -0.422  17.483  4.544   1.00 2.08 ? 44  LYS A HE2  8  
ATOM 11157 H HE3  . LYS A 1 44 ? 1.265   17.027  4.319   1.00 2.50 ? 44  LYS A HE3  8  
ATOM 11158 H HZ1  . LYS A 1 44 ? 1.320   18.374  2.309   1.00 3.12 ? 44  LYS A HZ1  8  
ATOM 11159 H HZ2  . LYS A 1 44 ? 0.874   19.309  3.647   1.00 3.21 ? 44  LYS A HZ2  8  
ATOM 11160 H HZ3  . LYS A 1 44 ? -0.298  18.814  2.533   1.00 2.66 ? 44  LYS A HZ3  8  
ATOM 11161 N N    . ASP A 1 45 ? -3.904  12.504  1.028   1.00 1.59 ? 45  ASP A N    8  
ATOM 11162 C CA   . ASP A 1 45 ? -4.705  12.052  -0.109  1.00 1.86 ? 45  ASP A CA   8  
ATOM 11163 C C    . ASP A 1 45 ? -6.133  11.722  0.330   1.00 1.89 ? 45  ASP A C    8  
ATOM 11164 O O    . ASP A 1 45 ? -7.101  12.163  -0.295  1.00 1.97 ? 45  ASP A O    8  
ATOM 11165 C CB   . ASP A 1 45 ? -4.048  10.823  -0.754  1.00 2.33 ? 45  ASP A CB   8  
ATOM 11166 C CG   . ASP A 1 45 ? -4.745  10.366  -2.026  1.00 2.69 ? 45  ASP A CG   8  
ATOM 11167 O OD1  . ASP A 1 45 ? -5.279  11.224  -2.763  1.00 2.80 ? 45  ASP A OD1  8  
ATOM 11168 O OD2  . ASP A 1 45 ? -4.748  9.146   -2.289  1.00 3.24 ? 45  ASP A OD2  8  
ATOM 11169 H H    . ASP A 1 45 ? -3.106  11.993  1.279   1.00 1.67 ? 45  ASP A H    8  
ATOM 11170 H HA   . ASP A 1 45 ? -4.739  12.853  -0.832  1.00 1.92 ? 45  ASP A HA   8  
ATOM 11171 H HB2  . ASP A 1 45 ? -3.025  11.061  -0.998  1.00 2.40 ? 45  ASP A HB2  8  
ATOM 11172 H HB3  . ASP A 1 45 ? -4.061  10.007  -0.047  1.00 2.46 ? 45  ASP A HB3  8  
ATOM 11173 N N    . GLY A 1 46 ? -6.254  10.950  1.412   1.00 2.08 ? 46  GLY A N    8  
ATOM 11174 C CA   . GLY A 1 46 ? -7.562  10.577  1.930   1.00 2.49 ? 46  GLY A CA   8  
ATOM 11175 C C    . GLY A 1 46 ? -8.130  9.315   1.297   1.00 2.11 ? 46  GLY A C    8  
ATOM 11176 O O    . GLY A 1 46 ? -8.975  8.648   1.897   1.00 2.47 ? 46  GLY A O    8  
ATOM 11177 H H    . GLY A 1 46 ? -5.440  10.640  1.866   1.00 2.09 ? 46  GLY A H    8  
ATOM 11178 H HA2  . GLY A 1 46 ? -7.479  10.419  2.996   1.00 2.83 ? 46  GLY A HA2  8  
ATOM 11179 H HA3  . GLY A 1 46 ? -8.249  11.393  1.755   1.00 3.17 ? 46  GLY A HA3  8  
ATOM 11180 N N    . LYS A 1 47 ? -7.671  8.981   0.086   1.00 1.87 ? 47  LYS A N    8  
ATOM 11181 C CA   . LYS A 1 47 ? -8.147  7.788   -0.612  1.00 2.32 ? 47  LYS A CA   8  
ATOM 11182 C C    . LYS A 1 47 ? -7.726  6.519   0.128   1.00 1.93 ? 47  LYS A C    8  
ATOM 11183 O O    . LYS A 1 47 ? -8.523  5.595   0.289   1.00 1.95 ? 47  LYS A O    8  
ATOM 11184 C CB   . LYS A 1 47 ? -7.617  7.758   -2.050  1.00 2.80 ? 47  LYS A CB   8  
ATOM 11185 C CG   . LYS A 1 47 ? -8.709  7.831   -3.106  1.00 3.64 ? 47  LYS A CG   8  
ATOM 11186 C CD   . LYS A 1 47 ? -8.931  9.259   -3.580  1.00 4.17 ? 47  LYS A CD   8  
ATOM 11187 C CE   . LYS A 1 47 ? -9.962  9.323   -4.698  1.00 5.03 ? 47  LYS A CE   8  
ATOM 11188 N NZ   . LYS A 1 47 ? -11.354 9.392   -4.172  1.00 5.67 ? 47  LYS A NZ   8  
ATOM 11189 H H    . LYS A 1 47 ? -6.996  9.546   -0.342  1.00 1.83 ? 47  LYS A H    8  
ATOM 11190 H HA   . LYS A 1 47 ? -9.226  7.830   -0.638  1.00 3.00 ? 47  LYS A HA   8  
ATOM 11191 H HB2  . LYS A 1 47 ? -6.954  8.595   -2.193  1.00 2.86 ? 47  LYS A HB2  8  
ATOM 11192 H HB3  . LYS A 1 47 ? -7.063  6.842   -2.199  1.00 3.00 ? 47  LYS A HB3  8  
ATOM 11193 H HG2  . LYS A 1 47 ? -8.421  7.223   -3.950  1.00 4.05 ? 47  LYS A HG2  8  
ATOM 11194 H HG3  . LYS A 1 47 ? -9.630  7.453   -2.685  1.00 3.92 ? 47  LYS A HG3  8  
ATOM 11195 H HD2  . LYS A 1 47 ? -9.280  9.854   -2.749  1.00 4.28 ? 47  LYS A HD2  8  
ATOM 11196 H HD3  . LYS A 1 47 ? -7.995  9.657   -3.942  1.00 4.30 ? 47  LYS A HD3  8  
ATOM 11197 H HE2  . LYS A 1 47 ? -9.770  10.202  -5.296  1.00 5.17 ? 47  LYS A HE2  8  
ATOM 11198 H HE3  . LYS A 1 47 ? -9.861  8.441   -5.314  1.00 5.45 ? 47  LYS A HE3  8  
ATOM 11199 H HZ1  . LYS A 1 47 ? -11.464 10.225  -3.560  1.00 5.78 ? 47  LYS A HZ1  8  
ATOM 11200 H HZ2  . LYS A 1 47 ? -11.570 8.537   -3.619  1.00 5.80 ? 47  LYS A HZ2  8  
ATOM 11201 H HZ3  . LYS A 1 47 ? -12.030 9.462   -4.959  1.00 6.21 ? 47  LYS A HZ3  8  
ATOM 11202 N N    . LEU A 1 48 ? -6.469  6.483   0.579   1.00 1.68 ? 48  LEU A N    8  
ATOM 11203 C CA   . LEU A 1 48 ? -5.950  5.326   1.304   1.00 1.38 ? 48  LEU A CA   8  
ATOM 11204 C C    . LEU A 1 48 ? -6.330  5.389   2.785   1.00 1.28 ? 48  LEU A C    8  
ATOM 11205 O O    . LEU A 1 48 ? -6.146  6.414   3.444   1.00 1.35 ? 48  LEU A O    8  
ATOM 11206 C CB   . LEU A 1 48 ? -4.427  5.226   1.157   1.00 1.19 ? 48  LEU A CB   8  
ATOM 11207 C CG   . LEU A 1 48 ? -3.857  3.809   1.282   1.00 1.09 ? 48  LEU A CG   8  
ATOM 11208 C CD1  . LEU A 1 48 ? -2.529  3.696   0.550   1.00 1.56 ? 48  LEU A CD1  8  
ATOM 11209 C CD2  . LEU A 1 48 ? -3.697  3.423   2.745   1.00 1.06 ? 48  LEU A CD2  8  
ATOM 11210 H H    . LEU A 1 48 ? -5.882  7.252   0.419   1.00 1.80 ? 48  LEU A H    8  
ATOM 11211 H HA   . LEU A 1 48 ? -6.399  4.444   0.873   1.00 1.52 ? 48  LEU A HA   8  
ATOM 11212 H HB2  . LEU A 1 48 ? -4.153  5.617   0.187   1.00 1.43 ? 48  LEU A HB2  8  
ATOM 11213 H HB3  . LEU A 1 48 ? -3.970  5.842   1.916   1.00 1.29 ? 48  LEU A HB3  8  
ATOM 11214 H HG   . LEU A 1 48 ? -4.546  3.110   0.829   1.00 1.25 ? 48  LEU A HG   8  
ATOM 11215 H HD11 . LEU A 1 48 ? -2.628  4.112   -0.442  1.00 2.04 ? 48  LEU A HD11 8  
ATOM 11216 H HD12 . LEU A 1 48 ? -2.246  2.656   0.478   1.00 1.85 ? 48  LEU A HD12 8  
ATOM 11217 H HD13 . LEU A 1 48 ? -1.770  4.238   1.095   1.00 2.03 ? 48  LEU A HD13 8  
ATOM 11218 H HD21 . LEU A 1 48 ? -2.664  3.536   3.038   1.00 1.74 ? 48  LEU A HD21 8  
ATOM 11219 H HD22 . LEU A 1 48 ? -3.999  2.394   2.877   1.00 1.43 ? 48  LEU A HD22 8  
ATOM 11220 H HD23 . LEU A 1 48 ? -4.318  4.061   3.356   1.00 1.30 ? 48  LEU A HD23 8  
ATOM 11221 N N    . GLN A 1 49 ? -6.857  4.275   3.292   1.00 1.21 ? 49  GLN A N    8  
ATOM 11222 C CA   . GLN A 1 49 ? -7.268  4.165   4.688   1.00 1.17 ? 49  GLN A CA   8  
ATOM 11223 C C    . GLN A 1 49 ? -6.777  2.846   5.287   1.00 1.09 ? 49  GLN A C    8  
ATOM 11224 O O    . GLN A 1 49 ? -6.699  1.832   4.593   1.00 1.14 ? 49  GLN A O    8  
ATOM 11225 C CB   . GLN A 1 49 ? -8.793  4.259   4.801   1.00 1.30 ? 49  GLN A CB   8  
ATOM 11226 C CG   . GLN A 1 49 ? -9.543  3.209   3.993   1.00 1.46 ? 49  GLN A CG   8  
ATOM 11227 C CD   . GLN A 1 49 ? -9.809  3.647   2.563   1.00 1.45 ? 49  GLN A CD   8  
ATOM 11228 O OE1  . GLN A 1 49 ? -10.562 4.592   2.322   1.00 1.54 ? 49  GLN A OE1  8  
ATOM 11229 N NE2  . GLN A 1 49 ? -9.192  2.962   1.606   1.00 1.52 ? 49  GLN A NE2  8  
ATOM 11230 H H    . GLN A 1 49 ? -6.968  3.499   2.707   1.00 1.26 ? 49  GLN A H    8  
ATOM 11231 H HA   . GLN A 1 49 ? -6.824  4.984   5.232   1.00 1.19 ? 49  GLN A HA   8  
ATOM 11232 H HB2  . GLN A 1 49 ? -9.068  4.144   5.837   1.00 1.32 ? 49  GLN A HB2  8  
ATOM 11233 H HB3  . GLN A 1 49 ? -9.107  5.235   4.464   1.00 1.34 ? 49  GLN A HB3  8  
ATOM 11234 H HG2  . GLN A 1 49 ? -8.957  2.303   3.971   1.00 1.57 ? 49  GLN A HG2  8  
ATOM 11235 H HG3  . GLN A 1 49 ? -10.489 3.011   4.475   1.00 1.59 ? 49  GLN A HG3  8  
ATOM 11236 H HE21 . GLN A 1 49 ? -8.606  2.222   1.869   1.00 1.62 ? 49  GLN A HE21 8  
ATOM 11237 H HE22 . GLN A 1 49 ? -9.347  3.226   0.675   1.00 1.56 ? 49  GLN A HE22 8  
ATOM 11238 N N    . ILE A 1 50 ? -6.444  2.865   6.578   1.00 1.06 ? 50  ILE A N    8  
ATOM 11239 C CA   . ILE A 1 50 ? -5.957  1.666   7.266   1.00 1.03 ? 50  ILE A CA   8  
ATOM 11240 C C    . ILE A 1 50 ? -6.885  0.472   7.034   1.00 1.05 ? 50  ILE A C    8  
ATOM 11241 O O    . ILE A 1 50 ? -8.074  0.524   7.360   1.00 1.16 ? 50  ILE A O    8  
ATOM 11242 C CB   . ILE A 1 50 ? -5.802  1.898   8.787   1.00 1.08 ? 50  ILE A CB   8  
ATOM 11243 C CG1  . ILE A 1 50 ? -7.061  2.555   9.367   1.00 1.76 ? 50  ILE A CG1  8  
ATOM 11244 C CG2  . ILE A 1 50 ? -4.572  2.749   9.073   1.00 1.14 ? 50  ILE A CG2  8  
ATOM 11245 C CD1  . ILE A 1 50 ? -7.629  1.821   10.563  1.00 2.56 ? 50  ILE A CD1  8  
ATOM 11246 H H    . ILE A 1 50 ? -6.525  3.704   7.079   1.00 1.12 ? 50  ILE A H    8  
ATOM 11247 H HA   . ILE A 1 50 ? -4.982  1.429   6.862   1.00 1.00 ? 50  ILE A HA   8  
ATOM 11248 H HB   . ILE A 1 50 ? -5.658  0.938   9.259   1.00 1.51 ? 50  ILE A HB   8  
ATOM 11249 H HG12 . ILE A 1 50 ? -6.826  3.561   9.678   1.00 1.94 ? 50  ILE A HG12 8  
ATOM 11250 H HG13 . ILE A 1 50 ? -7.826  2.588   8.605   1.00 2.32 ? 50  ILE A HG13 8  
ATOM 11251 H HG21 . ILE A 1 50 ? -4.485  2.910   10.138  1.00 1.55 ? 50  ILE A HG21 8  
ATOM 11252 H HG22 . ILE A 1 50 ? -4.667  3.701   8.571   1.00 1.63 ? 50  ILE A HG22 8  
ATOM 11253 H HG23 . ILE A 1 50 ? -3.691  2.240   8.713   1.00 1.57 ? 50  ILE A HG23 8  
ATOM 11254 H HD11 . ILE A 1 50 ? -7.923  0.825   10.268  1.00 3.13 ? 50  ILE A HD11 8  
ATOM 11255 H HD12 . ILE A 1 50 ? -8.490  2.354   10.937  1.00 2.96 ? 50  ILE A HD12 8  
ATOM 11256 H HD13 . ILE A 1 50 ? -6.878  1.760   11.338  1.00 2.79 ? 50  ILE A HD13 8  
ATOM 11257 N N    . GLY A 1 51 ? -6.328  -0.604  6.471   1.00 1.02 ? 51  GLY A N    8  
ATOM 11258 C CA   . GLY A 1 51 ? -7.109  -1.805  6.204   1.00 1.10 ? 51  GLY A CA   8  
ATOM 11259 C C    . GLY A 1 51 ? -7.151  -2.189  4.734   1.00 1.04 ? 51  GLY A C    8  
ATOM 11260 O O    . GLY A 1 51 ? -7.360  -3.361  4.415   1.00 1.03 ? 51  GLY A O    8  
ATOM 11261 H H    . GLY A 1 51 ? -5.376  -0.582  6.240   1.00 0.99 ? 51  GLY A H    8  
ATOM 11262 H HA2  . GLY A 1 51 ? -6.679  -2.624  6.759   1.00 1.22 ? 51  GLY A HA2  8  
ATOM 11263 H HA3  . GLY A 1 51 ? -8.120  -1.652  6.548   1.00 1.14 ? 51  GLY A HA3  8  
ATOM 11264 N N    . ASP A 1 52 ? -6.960  -1.221  3.832   1.00 1.04 ? 52  ASP A N    8  
ATOM 11265 C CA   . ASP A 1 52 ? -6.985  -1.506  2.402   1.00 1.01 ? 52  ASP A CA   8  
ATOM 11266 C C    . ASP A 1 52 ? -5.822  -2.412  2.006   1.00 0.91 ? 52  ASP A C    8  
ATOM 11267 O O    . ASP A 1 52 ? -4.813  -2.494  2.722   1.00 0.88 ? 52  ASP A O    8  
ATOM 11268 C CB   . ASP A 1 52 ? -6.949  -0.214  1.572   1.00 1.03 ? 52  ASP A CB   8  
ATOM 11269 C CG   . ASP A 1 52 ? -5.912  0.787   2.039   1.00 1.11 ? 52  ASP A CG   8  
ATOM 11270 O OD1  . ASP A 1 52 ? -4.851  0.368   2.555   1.00 1.55 ? 52  ASP A OD1  8  
ATOM 11271 O OD2  . ASP A 1 52 ? -6.161  1.995   1.876   1.00 1.56 ? 52  ASP A OD2  8  
ATOM 11272 H H    . ASP A 1 52 ? -6.802  -0.303  4.130   1.00 1.07 ? 52  ASP A H    8  
ATOM 11273 H HA   . ASP A 1 52 ? -7.908  -2.021  2.197   1.00 1.08 ? 52  ASP A HA   8  
ATOM 11274 H HB2  . ASP A 1 52 ? -6.727  -0.460  0.549   1.00 0.99 ? 52  ASP A HB2  8  
ATOM 11275 H HB3  . ASP A 1 52 ? -7.919  0.257   1.619   1.00 1.18 ? 52  ASP A HB3  8  
ATOM 11276 N N    . LYS A 1 53 ? -5.955  -3.075  0.855   1.00 0.88 ? 53  LYS A N    8  
ATOM 11277 C CA   . LYS A 1 53 ? -4.900  -3.956  0.367   1.00 0.82 ? 53  LYS A CA   8  
ATOM 11278 C C    . LYS A 1 53 ? -4.214  -3.351  -0.851  1.00 0.76 ? 53  LYS A C    8  
ATOM 11279 O O    . LYS A 1 53 ? -4.826  -2.643  -1.641  1.00 0.87 ? 53  LYS A O    8  
ATOM 11280 C CB   . LYS A 1 53 ? -5.456  -5.343  0.014   1.00 0.94 ? 53  LYS A CB   8  
ATOM 11281 C CG   . LYS A 1 53 ? -6.866  -5.333  -0.561  1.00 1.33 ? 53  LYS A CG   8  
ATOM 11282 C CD   . LYS A 1 53 ? -7.904  -5.673  0.499   1.00 1.83 ? 53  LYS A CD   8  
ATOM 11283 C CE   . LYS A 1 53 ? -8.901  -4.540  0.698   1.00 2.37 ? 53  LYS A CE   8  
ATOM 11284 N NZ   . LYS A 1 53 ? -9.096  -4.219  2.139   1.00 3.23 ? 53  LYS A NZ   8  
ATOM 11285 H H    . LYS A 1 53 ? -6.767  -2.953  0.321   1.00 0.92 ? 53  LYS A H    8  
ATOM 11286 H HA   . LYS A 1 53 ? -4.171  -4.062  1.156   1.00 0.82 ? 53  LYS A HA   8  
ATOM 11287 H HB2  . LYS A 1 53 ? -4.802  -5.802  -0.712  1.00 1.54 ? 53  LYS A HB2  8  
ATOM 11288 H HB3  . LYS A 1 53 ? -5.460  -5.949  0.906   1.00 1.39 ? 53  LYS A HB3  8  
ATOM 11289 H HG2  . LYS A 1 53 ? -7.077  -4.351  -0.958  1.00 1.78 ? 53  LYS A HG2  8  
ATOM 11290 H HG3  . LYS A 1 53 ? -6.924  -6.063  -1.355  1.00 1.86 ? 53  LYS A HG3  8  
ATOM 11291 H HD2  . LYS A 1 53 ? -8.438  -6.559  0.192   1.00 2.39 ? 53  LYS A HD2  8  
ATOM 11292 H HD3  . LYS A 1 53 ? -7.398  -5.863  1.435   1.00 2.03 ? 53  LYS A HD3  8  
ATOM 11293 H HE2  . LYS A 1 53 ? -8.537  -3.661  0.189   1.00 2.44 ? 53  LYS A HE2  8  
ATOM 11294 H HE3  . LYS A 1 53 ? -9.849  -4.834  0.273   1.00 2.77 ? 53  LYS A HE3  8  
ATOM 11295 H HZ1  . LYS A 1 53 ? -8.176  -4.126  2.614   1.00 3.81 ? 53  LYS A HZ1  8  
ATOM 11296 H HZ2  . LYS A 1 53 ? -9.638  -4.976  2.603   1.00 3.55 ? 53  LYS A HZ2  8  
ATOM 11297 H HZ3  . LYS A 1 53 ? -9.617  -3.324  2.239   1.00 3.45 ? 53  LYS A HZ3  8  
ATOM 11298 N N    . LEU A 1 54 ? -2.932  -3.630  -0.970  1.00 0.64 ? 54  LEU A N    8  
ATOM 11299 C CA   . LEU A 1 54 ? -2.135  -3.100  -2.065  1.00 0.66 ? 54  LEU A CA   8  
ATOM 11300 C C    . LEU A 1 54 ? -2.018  -4.089  -3.216  1.00 0.64 ? 54  LEU A C    8  
ATOM 11301 O O    . LEU A 1 54 ? -1.260  -5.059  -3.147  1.00 0.79 ? 54  LEU A O    8  
ATOM 11302 C CB   . LEU A 1 54 ? -0.750  -2.684  -1.565  1.00 0.73 ? 54  LEU A CB   8  
ATOM 11303 C CG   . LEU A 1 54 ? -0.710  -1.423  -0.681  1.00 0.83 ? 54  LEU A CG   8  
ATOM 11304 C CD1  . LEU A 1 54 ? 0.470   -0.541  -1.059  1.00 1.11 ? 54  LEU A CD1  8  
ATOM 11305 C CD2  . LEU A 1 54 ? -2.012  -0.636  -0.780  1.00 1.72 ? 54  LEU A CD2  8  
ATOM 11306 H H    . LEU A 1 54 ? -2.523  -4.173  -0.269  1.00 0.62 ? 54  LEU A H    8  
ATOM 11307 H HA   . LEU A 1 54 ? -2.642  -2.219  -2.433  1.00 0.75 ? 54  LEU A HA   8  
ATOM 11308 H HB2  . LEU A 1 54 ? -0.339  -3.505  -0.998  1.00 1.24 ? 54  LEU A HB2  8  
ATOM 11309 H HB3  . LEU A 1 54 ? -0.121  -2.515  -2.422  1.00 1.21 ? 54  LEU A HB3  8  
ATOM 11310 H HG   . LEU A 1 54 ? -0.580  -1.722  0.348   1.00 1.18 ? 54  LEU A HG   8  
ATOM 11311 H HD11 . LEU A 1 54 ? 0.315   0.454   -0.669  1.00 1.58 ? 54  LEU A HD11 8  
ATOM 11312 H HD12 . LEU A 1 54 ? 0.557   -0.497  -2.134  1.00 1.88 ? 54  LEU A HD12 8  
ATOM 11313 H HD13 . LEU A 1 54 ? 1.376   -0.954  -0.641  1.00 1.17 ? 54  LEU A HD13 8  
ATOM 11314 H HD21 . LEU A 1 54 ? -2.272  -0.497  -1.819  1.00 2.31 ? 54  LEU A HD21 8  
ATOM 11315 H HD22 . LEU A 1 54 ? -1.887  0.327   -0.307  1.00 2.00 ? 54  LEU A HD22 8  
ATOM 11316 H HD23 . LEU A 1 54 ? -2.800  -1.181  -0.282  1.00 2.08 ? 54  LEU A HD23 8  
ATOM 11317 N N    . LEU A 1 55 ? -2.766  -3.814  -4.285  1.00 0.56 ? 55  LEU A N    8  
ATOM 11318 C CA   . LEU A 1 55 ? -2.741  -4.652  -5.478  1.00 0.58 ? 55  LEU A CA   8  
ATOM 11319 C C    . LEU A 1 55 ? -1.391  -4.517  -6.169  1.00 0.54 ? 55  LEU A C    8  
ATOM 11320 O O    . LEU A 1 55 ? -0.726  -5.518  -6.440  1.00 0.56 ? 55  LEU A O    8  
ATOM 11321 C CB   . LEU A 1 55 ? -3.871  -4.262  -6.442  1.00 0.66 ? 55  LEU A CB   8  
ATOM 11322 C CG   . LEU A 1 55 ? -4.117  -5.234  -7.607  1.00 0.91 ? 55  LEU A CG   8  
ATOM 11323 C CD1  . LEU A 1 55 ? -3.110  -5.001  -8.726  1.00 1.27 ? 55  LEU A CD1  8  
ATOM 11324 C CD2  . LEU A 1 55 ? -4.062  -6.680  -7.130  1.00 1.87 ? 55  LEU A CD2  8  
ATOM 11325 H H    . LEU A 1 55 ? -3.332  -3.014  -4.276  1.00 0.58 ? 55  LEU A H    8  
ATOM 11326 H HA   . LEU A 1 55 ? -2.877  -5.678  -5.168  1.00 0.62 ? 55  LEU A HA   8  
ATOM 11327 H HB2  . LEU A 1 55 ? -4.786  -4.181  -5.876  1.00 0.75 ? 55  LEU A HB2  8  
ATOM 11328 H HB3  . LEU A 1 55 ? -3.641  -3.292  -6.858  1.00 0.98 ? 55  LEU A HB3  8  
ATOM 11329 H HG   . LEU A 1 55 ? -5.104  -5.053  -8.009  1.00 1.50 ? 55  LEU A HG   8  
ATOM 11330 H HD11 . LEU A 1 55 ? -2.910  -3.944  -8.817  1.00 1.70 ? 55  LEU A HD11 8  
ATOM 11331 H HD12 . LEU A 1 55 ? -3.515  -5.373  -9.656  1.00 1.74 ? 55  LEU A HD12 8  
ATOM 11332 H HD13 . LEU A 1 55 ? -2.192  -5.522  -8.499  1.00 1.86 ? 55  LEU A HD13 8  
ATOM 11333 H HD21 . LEU A 1 55 ? -3.035  -6.964  -6.956  1.00 2.39 ? 55  LEU A HD21 8  
ATOM 11334 H HD22 . LEU A 1 55 ? -4.491  -7.323  -7.885  1.00 2.39 ? 55  LEU A HD22 8  
ATOM 11335 H HD23 . LEU A 1 55 ? -4.623  -6.778  -6.213  1.00 2.37 ? 55  LEU A HD23 8  
ATOM 11336 N N    . ALA A 1 56 ? -0.982  -3.272  -6.445  1.00 0.51 ? 56  ALA A N    8  
ATOM 11337 C CA   . ALA A 1 56 ? 0.306   -3.031  -7.095  1.00 0.49 ? 56  ALA A CA   8  
ATOM 11338 C C    . ALA A 1 56 ? 0.890   -1.670  -6.709  1.00 0.53 ? 56  ALA A C    8  
ATOM 11339 O O    . ALA A 1 56 ? 0.156   -0.747  -6.371  1.00 0.67 ? 56  ALA A O    8  
ATOM 11340 C CB   . ALA A 1 56 ? 0.154   -3.129  -8.614  1.00 0.54 ? 56  ALA A CB   8  
ATOM 11341 H H    . ALA A 1 56 ? -1.559  -2.499  -6.200  1.00 0.53 ? 56  ALA A H    8  
ATOM 11342 H HA   . ALA A 1 56 ? 0.988   -3.809  -6.767  1.00 0.52 ? 56  ALA A HA   8  
ATOM 11343 H HB1  . ALA A 1 56 ? -0.640  -2.470  -8.937  1.00 1.19 ? 56  ALA A HB1  8  
ATOM 11344 H HB2  . ALA A 1 56 ? -0.090  -4.146  -8.892  1.00 0.99 ? 56  ALA A HB2  8  
ATOM 11345 H HB3  . ALA A 1 56 ? 1.078   -2.836  -9.092  1.00 1.25 ? 56  ALA A HB3  8  
ATOM 11346 N N    . VAL A 1 57 ? 2.219   -1.558  -6.756  1.00 0.50 ? 57  VAL A N    8  
ATOM 11347 C CA   . VAL A 1 57 ? 2.896   -0.309  -6.408  1.00 0.59 ? 57  VAL A CA   8  
ATOM 11348 C C    . VAL A 1 57 ? 4.086   -0.048  -7.334  1.00 0.53 ? 57  VAL A C    8  
ATOM 11349 O O    . VAL A 1 57 ? 5.055   -0.804  -7.343  1.00 0.52 ? 57  VAL A O    8  
ATOM 11350 C CB   . VAL A 1 57 ? 3.379   -0.314  -4.939  1.00 0.77 ? 57  VAL A CB   8  
ATOM 11351 C CG1  . VAL A 1 57 ? 4.130   0.970   -4.605  1.00 1.42 ? 57  VAL A CG1  8  
ATOM 11352 C CG2  . VAL A 1 57 ? 2.205   -0.507  -3.990  1.00 1.47 ? 57  VAL A CG2  8  
ATOM 11353 H H    . VAL A 1 57 ? 2.754   -2.338  -7.023  1.00 0.48 ? 57  VAL A H    8  
ATOM 11354 H HA   . VAL A 1 57 ? 2.183   0.495   -6.527  1.00 0.66 ? 57  VAL A HA   8  
ATOM 11355 H HB   . VAL A 1 57 ? 4.058   -1.144  -4.808  1.00 1.34 ? 57  VAL A HB   8  
ATOM 11356 H HG11 . VAL A 1 57 ? 3.905   1.723   -5.347  1.00 1.89 ? 57  VAL A HG11 8  
ATOM 11357 H HG12 . VAL A 1 57 ? 5.192   0.776   -4.602  1.00 1.82 ? 57  VAL A HG12 8  
ATOM 11358 H HG13 . VAL A 1 57 ? 3.826   1.325   -3.631  1.00 2.12 ? 57  VAL A HG13 8  
ATOM 11359 H HG21 . VAL A 1 57 ? 1.858   -1.528  -4.048  1.00 1.95 ? 57  VAL A HG21 8  
ATOM 11360 H HG22 . VAL A 1 57 ? 1.403   0.162   -4.265  1.00 1.95 ? 57  VAL A HG22 8  
ATOM 11361 H HG23 . VAL A 1 57 ? 2.520   -0.292  -2.979  1.00 2.01 ? 57  VAL A HG23 8  
ATOM 11362 N N    . ASN A 1 58 ? 3.991   1.024   -8.121  1.00 0.57 ? 58  ASN A N    8  
ATOM 11363 C CA   . ASN A 1 58 ? 5.050   1.396   -9.064  1.00 0.58 ? 58  ASN A CA   8  
ATOM 11364 C C    . ASN A 1 58 ? 5.236   0.317   -10.138 1.00 0.59 ? 58  ASN A C    8  
ATOM 11365 O O    . ASN A 1 58 ? 6.353   -0.145  -10.385 1.00 0.60 ? 58  ASN A O    8  
ATOM 11366 C CB   . ASN A 1 58 ? 6.372   1.648   -8.326  1.00 0.57 ? 58  ASN A CB   8  
ATOM 11367 C CG   . ASN A 1 58 ? 6.332   2.901   -7.470  1.00 0.80 ? 58  ASN A CG   8  
ATOM 11368 O OD1  . ASN A 1 58 ? 6.075   2.836   -6.268  1.00 1.39 ? 58  ASN A OD1  8  
ATOM 11369 N ND2  . ASN A 1 58 ? 6.586   4.052   -8.086  1.00 1.49 ? 58  ASN A ND2  8  
ATOM 11370 H H    . ASN A 1 58 ? 3.177   1.569   -8.077  1.00 0.63 ? 58  ASN A H    8  
ATOM 11371 H HA   . ASN A 1 58 ? 4.745   2.311   -9.551  1.00 0.65 ? 58  ASN A HA   8  
ATOM 11372 H HB2  . ASN A 1 58 ? 6.587   0.806   -7.686  1.00 0.64 ? 58  ASN A HB2  8  
ATOM 11373 H HB3  . ASN A 1 58 ? 7.167   1.755   -9.049  1.00 0.74 ? 58  ASN A HB3  8  
ATOM 11374 H HD21 . ASN A 1 58 ? 6.784   4.031   -9.046  1.00 2.05 ? 58  ASN A HD21 8  
ATOM 11375 H HD22 . ASN A 1 58 ? 6.567   4.874   -7.555  1.00 1.75 ? 58  ASN A HD22 8  
ATOM 11376 N N    . ASN A 1 59 ? 4.122   -0.066  -10.772 1.00 0.60 ? 59  ASN A N    8  
ATOM 11377 C CA   . ASN A 1 59 ? 4.115   -1.076  -11.840 1.00 0.65 ? 59  ASN A CA   8  
ATOM 11378 C C    . ASN A 1 59 ? 4.258   -2.518  -11.322 1.00 0.61 ? 59  ASN A C    8  
ATOM 11379 O O    . ASN A 1 59 ? 3.917   -3.458  -12.043 1.00 0.67 ? 59  ASN A O    8  
ATOM 11380 C CB   . ASN A 1 59 ? 5.213   -0.786  -12.872 1.00 0.71 ? 59  ASN A CB   8  
ATOM 11381 C CG   . ASN A 1 59 ? 4.657   -0.219  -14.164 1.00 1.18 ? 59  ASN A CG   8  
ATOM 11382 O OD1  . ASN A 1 59 ? 4.428   -0.949  -15.128 1.00 1.74 ? 59  ASN A OD1  8  
ATOM 11383 N ND2  . ASN A 1 59 ? 4.436   1.093   -14.191 1.00 1.52 ? 59  ASN A ND2  8  
ATOM 11384 H H    . ASN A 1 59 ? 3.276   0.358   -10.518 1.00 0.61 ? 59  ASN A H    8  
ATOM 11385 H HA   . ASN A 1 59 ? 3.160   -0.999  -12.338 1.00 0.68 ? 59  ASN A HA   8  
ATOM 11386 H HB2  . ASN A 1 59 ? 5.909   -0.073  -12.460 1.00 0.83 ? 59  ASN A HB2  8  
ATOM 11387 H HB3  . ASN A 1 59 ? 5.737   -1.704  -13.099 1.00 0.74 ? 59  ASN A HB3  8  
ATOM 11388 H HD21 . ASN A 1 59 ? 4.640   1.614   -13.387 1.00 1.74 ? 59  ASN A HD21 8  
ATOM 11389 H HD22 . ASN A 1 59 ? 4.078   1.484   -15.015 1.00 1.84 ? 59  ASN A HD22 8  
ATOM 11390 N N    . VAL A 1 60 ? 4.752   -2.707  -10.091 1.00 0.53 ? 60  VAL A N    8  
ATOM 11391 C CA   . VAL A 1 60 ? 4.910   -4.060  -9.546  1.00 0.52 ? 60  VAL A CA   8  
ATOM 11392 C C    . VAL A 1 60 ? 3.716   -4.448  -8.680  1.00 0.51 ? 60  VAL A C    8  
ATOM 11393 O O    . VAL A 1 60 ? 3.058   -3.587  -8.107  1.00 0.50 ? 60  VAL A O    8  
ATOM 11394 C CB   . VAL A 1 60 ? 6.206   -4.210  -8.715  1.00 0.50 ? 60  VAL A CB   8  
ATOM 11395 C CG1  . VAL A 1 60 ? 7.435   -4.108  -9.604  1.00 0.51 ? 60  VAL A CG1  8  
ATOM 11396 C CG2  . VAL A 1 60 ? 6.270   -3.183  -7.595  1.00 0.54 ? 60  VAL A CG2  8  
ATOM 11397 H H    . VAL A 1 60 ? 5.010   -1.936  -9.542  1.00 0.52 ? 60  VAL A H    8  
ATOM 11398 H HA   . VAL A 1 60 ? 4.967   -4.745  -10.380 1.00 0.56 ? 60  VAL A HA   8  
ATOM 11399 H HB   . VAL A 1 60 ? 6.199   -5.192  -8.265  1.00 0.58 ? 60  VAL A HB   8  
ATOM 11400 H HG11 . VAL A 1 60 ? 7.591   -5.048  -10.114 1.00 1.18 ? 60  VAL A HG11 8  
ATOM 11401 H HG12 . VAL A 1 60 ? 8.299   -3.879  -8.998  1.00 0.93 ? 60  VAL A HG12 8  
ATOM 11402 H HG13 . VAL A 1 60 ? 7.288   -3.324  -10.333 1.00 1.23 ? 60  VAL A HG13 8  
ATOM 11403 H HG21 . VAL A 1 60 ? 6.934   -3.536  -6.821  1.00 0.98 ? 60  VAL A HG21 8  
ATOM 11404 H HG22 . VAL A 1 60 ? 5.283   -3.037  -7.184  1.00 1.15 ? 60  VAL A HG22 8  
ATOM 11405 H HG23 . VAL A 1 60 ? 6.639   -2.247  -7.988  1.00 1.17 ? 60  VAL A HG23 8  
ATOM 11406 N N    . CYS A 1 61 ? 3.450   -5.751  -8.577  1.00 0.53 ? 61  CYS A N    8  
ATOM 11407 C CA   . CYS A 1 61 ? 2.337   -6.239  -7.763  1.00 0.54 ? 61  CYS A CA   8  
ATOM 11408 C C    . CYS A 1 61 ? 2.765   -6.373  -6.307  1.00 0.58 ? 61  CYS A C    8  
ATOM 11409 O O    . CYS A 1 61 ? 3.829   -6.924  -6.011  1.00 0.72 ? 61  CYS A O    8  
ATOM 11410 C CB   . CYS A 1 61 ? 1.824   -7.580  -8.291  1.00 0.56 ? 61  CYS A CB   8  
ATOM 11411 S SG   . CYS A 1 61 ? 3.007   -8.942  -8.151  1.00 0.71 ? 61  CYS A SG   8  
ATOM 11412 H H    . CYS A 1 61 ? 4.019   -6.397  -9.047  1.00 0.55 ? 61  CYS A H    8  
ATOM 11413 H HA   . CYS A 1 61 ? 1.542   -5.511  -7.824  1.00 0.53 ? 61  CYS A HA   8  
ATOM 11414 H HB2  . CYS A 1 61 ? 0.940   -7.856  -7.736  1.00 0.91 ? 61  CYS A HB2  8  
ATOM 11415 H HB3  . CYS A 1 61 ? 1.566   -7.472  -9.334  1.00 0.84 ? 61  CYS A HB3  8  
ATOM 11416 H HG   . CYS A 1 61 ? 2.982   -9.265  -7.247  1.00 1.12 ? 61  CYS A HG   8  
ATOM 11417 N N    . LEU A 1 62 ? 1.926   -5.882  -5.396  1.00 0.55 ? 62  LEU A N    8  
ATOM 11418 C CA   . LEU A 1 62 ? 2.211   -5.967  -3.969  1.00 0.62 ? 62  LEU A CA   8  
ATOM 11419 C C    . LEU A 1 62 ? 1.393   -7.078  -3.289  1.00 0.58 ? 62  LEU A C    8  
ATOM 11420 O O    . LEU A 1 62 ? 1.005   -6.951  -2.121  1.00 0.51 ? 62  LEU A O    8  
ATOM 11421 C CB   . LEU A 1 62 ? 1.967   -4.608  -3.309  1.00 0.77 ? 62  LEU A CB   8  
ATOM 11422 C CG   . LEU A 1 62 ? 3.058   -4.174  -2.328  1.00 0.95 ? 62  LEU A CG   8  
ATOM 11423 C CD1  . LEU A 1 62 ? 4.401   -4.056  -3.034  1.00 1.71 ? 62  LEU A CD1  8  
ATOM 11424 C CD2  . LEU A 1 62 ? 2.692   -2.857  -1.666  1.00 1.08 ? 62  LEU A CD2  8  
ATOM 11425 H H    . LEU A 1 62 ? 1.075   -5.492  -5.682  1.00 0.55 ? 62  LEU A H    8  
ATOM 11426 H HA   . LEU A 1 62 ? 3.257   -6.212  -3.866  1.00 0.72 ? 62  LEU A HA   8  
ATOM 11427 H HB2  . LEU A 1 62 ? 1.894   -3.862  -4.088  1.00 1.26 ? 62  LEU A HB2  8  
ATOM 11428 H HB3  . LEU A 1 62 ? 1.028   -4.645  -2.784  1.00 1.09 ? 62  LEU A HB3  8  
ATOM 11429 H HG   . LEU A 1 62 ? 3.154   -4.922  -1.556  1.00 1.61 ? 62  LEU A HG   8  
ATOM 11430 H HD11 . LEU A 1 62 ? 4.329   -3.324  -3.825  1.00 2.12 ? 62  LEU A HD11 8  
ATOM 11431 H HD12 . LEU A 1 62 ? 4.674   -5.014  -3.452  1.00 2.04 ? 62  LEU A HD12 8  
ATOM 11432 H HD13 . LEU A 1 62 ? 5.154   -3.746  -2.325  1.00 2.37 ? 62  LEU A HD13 8  
ATOM 11433 H HD21 . LEU A 1 62 ? 3.264   -2.742  -0.757  1.00 1.44 ? 62  LEU A HD21 8  
ATOM 11434 H HD22 . LEU A 1 62 ? 1.640   -2.852  -1.431  1.00 1.77 ? 62  LEU A HD22 8  
ATOM 11435 H HD23 . LEU A 1 62 ? 2.917   -2.043  -2.336  1.00 1.57 ? 62  LEU A HD23 8  
ATOM 11436 N N    . GLU A 1 63 ? 1.108   -8.151  -4.033  1.00 0.72 ? 63  GLU A N    8  
ATOM 11437 C CA   . GLU A 1 63 ? 0.317   -9.268  -3.509  1.00 0.80 ? 63  GLU A CA   8  
ATOM 11438 C C    . GLU A 1 63 ? 1.106   -10.586 -3.487  1.00 0.95 ? 63  GLU A C    8  
ATOM 11439 O O    . GLU A 1 63 ? 0.762   -11.498 -2.734  1.00 1.83 ? 63  GLU A O    8  
ATOM 11440 C CB   . GLU A 1 63 ? -0.953  -9.444  -4.349  1.00 0.86 ? 63  GLU A CB   8  
ATOM 11441 C CG   . GLU A 1 63 ? -2.187  -9.791  -3.529  1.00 1.12 ? 63  GLU A CG   8  
ATOM 11442 C CD   . GLU A 1 63 ? -2.210  -11.242 -3.080  1.00 1.31 ? 63  GLU A CD   8  
ATOM 11443 O OE1  . GLU A 1 63 ? -2.407  -12.127 -3.939  1.00 1.65 ? 63  GLU A OE1  8  
ATOM 11444 O OE2  . GLU A 1 63 ? -2.032  -11.494 -1.869  1.00 1.96 ? 63  GLU A OE2  8  
ATOM 11445 H H    . GLU A 1 63 ? 1.412   -8.183  -4.964  1.00 0.83 ? 63  GLU A H    8  
ATOM 11446 H HA   . GLU A 1 63 ? 0.031   -9.023  -2.499  1.00 0.80 ? 63  GLU A HA   8  
ATOM 11447 H HB2  . GLU A 1 63 ? -1.149  -8.525  -4.879  1.00 1.08 ? 63  GLU A HB2  8  
ATOM 11448 H HB3  . GLU A 1 63 ? -0.790  -10.235 -5.066  1.00 1.32 ? 63  GLU A HB3  8  
ATOM 11449 H HG2  . GLU A 1 63 ? -2.208  -9.161  -2.653  1.00 1.64 ? 63  GLU A HG2  8  
ATOM 11450 H HG3  . GLU A 1 63 ? -3.065  -9.601  -4.127  1.00 1.48 ? 63  GLU A HG3  8  
ATOM 11451 N N    . GLU A 1 64 ? 2.153   -10.691 -4.312  1.00 1.04 ? 64  GLU A N    8  
ATOM 11452 C CA   . GLU A 1 64 ? 2.962   -11.909 -4.373  1.00 1.08 ? 64  GLU A CA   8  
ATOM 11453 C C    . GLU A 1 64 ? 4.408   -11.651 -3.938  1.00 0.90 ? 64  GLU A C    8  
ATOM 11454 O O    . GLU A 1 64 ? 5.354   -12.024 -4.638  1.00 0.96 ? 64  GLU A O    8  
ATOM 11455 C CB   . GLU A 1 64 ? 2.921   -12.492 -5.787  1.00 1.28 ? 64  GLU A CB   8  
ATOM 11456 C CG   . GLU A 1 64 ? 2.424   -13.928 -5.840  1.00 1.53 ? 64  GLU A CG   8  
ATOM 11457 C CD   . GLU A 1 64 ? 3.443   -14.921 -5.308  1.00 2.14 ? 64  GLU A CD   8  
ATOM 11458 O OE1  . GLU A 1 64 ? 3.447   -15.168 -4.084  1.00 2.40 ? 64  GLU A OE1  8  
ATOM 11459 O OE2  . GLU A 1 64 ? 4.235   -15.449 -6.116  1.00 2.93 ? 64  GLU A OE2  8  
ATOM 11460 H H    . GLU A 1 64 ? 2.386   -9.936  -4.892  1.00 1.69 ? 64  GLU A H    8  
ATOM 11461 H HA   . GLU A 1 64 ? 2.526   -12.625 -3.697  1.00 1.19 ? 64  GLU A HA   8  
ATOM 11462 H HB2  . GLU A 1 64 ? 2.269   -11.886 -6.396  1.00 1.35 ? 64  GLU A HB2  8  
ATOM 11463 H HB3  . GLU A 1 64 ? 3.915   -12.464 -6.199  1.00 1.23 ? 64  GLU A HB3  8  
ATOM 11464 H HG2  . GLU A 1 64 ? 1.525   -14.007 -5.247  1.00 1.77 ? 64  GLU A HG2  8  
ATOM 11465 H HG3  . GLU A 1 64 ? 2.199   -14.180 -6.866  1.00 1.72 ? 64  GLU A HG3  8  
ATOM 11466 N N    . VAL A 1 65 ? 4.573   -11.013 -2.777  1.00 0.80 ? 65  VAL A N    8  
ATOM 11467 C CA   . VAL A 1 65 ? 5.908   -10.710 -2.257  1.00 0.64 ? 65  VAL A CA   8  
ATOM 11468 C C    . VAL A 1 65 ? 5.959   -10.705 -0.733  1.00 0.64 ? 65  VAL A C    8  
ATOM 11469 O O    . VAL A 1 65 ? 4.955   -10.458 -0.061  1.00 0.70 ? 65  VAL A O    8  
ATOM 11470 C CB   . VAL A 1 65 ? 6.424   -9.344  -2.756  1.00 0.56 ? 65  VAL A CB   8  
ATOM 11471 C CG1  . VAL A 1 65 ? 6.704   -9.378  -4.251  1.00 0.64 ? 65  VAL A CG1  8  
ATOM 11472 C CG2  . VAL A 1 65 ? 5.440   -8.231  -2.411  1.00 0.59 ? 65  VAL A CG2  8  
ATOM 11473 H H    . VAL A 1 65 ? 3.777   -10.745 -2.272  1.00 0.90 ? 65  VAL A H    8  
ATOM 11474 H HA   . VAL A 1 65 ? 6.582   -11.472 -2.621  1.00 0.65 ? 65  VAL A HA   8  
ATOM 11475 H HB   . VAL A 1 65 ? 7.354   -9.136  -2.244  1.00 0.50 ? 65  VAL A HB   8  
ATOM 11476 H HG11 . VAL A 1 65 ? 5.769   -9.417  -4.791  1.00 1.20 ? 65  VAL A HG11 8  
ATOM 11477 H HG12 . VAL A 1 65 ? 7.292   -10.252 -4.487  1.00 1.37 ? 65  VAL A HG12 8  
ATOM 11478 H HG13 . VAL A 1 65 ? 7.247   -8.489  -4.537  1.00 0.86 ? 65  VAL A HG13 8  
ATOM 11479 H HG21 . VAL A 1 65 ? 5.467   -8.045  -1.347  1.00 0.99 ? 65  VAL A HG21 8  
ATOM 11480 H HG22 . VAL A 1 65 ? 4.443   -8.529  -2.699  1.00 1.30 ? 65  VAL A HG22 8  
ATOM 11481 H HG23 . VAL A 1 65 ? 5.714   -7.331  -2.941  1.00 1.16 ? 65  VAL A HG23 8  
ATOM 11482 N N    . THR A 1 66 ? 7.160   -10.950 -0.204  1.00 0.63 ? 66  THR A N    8  
ATOM 11483 C CA   . THR A 1 66 ? 7.392   -10.948 1.239   1.00 0.69 ? 66  THR A CA   8  
ATOM 11484 C C    . THR A 1 66 ? 7.262   -9.522  1.777   1.00 0.61 ? 66  THR A C    8  
ATOM 11485 O O    . THR A 1 66 ? 6.839   -8.618  1.050   1.00 0.66 ? 66  THR A O    8  
ATOM 11486 C CB   . THR A 1 66 ? 8.781   -11.516 1.558   1.00 0.74 ? 66  THR A CB   8  
ATOM 11487 O OG1  . THR A 1 66 ? 9.790   -10.804 0.862   1.00 1.53 ? 66  THR A OG1  8  
ATOM 11488 C CG2  . THR A 1 66 ? 8.925   -12.981 1.204   1.00 1.17 ? 66  THR A CG2  8  
ATOM 11489 H H    . THR A 1 66 ? 7.911   -11.118 -0.811  1.00 0.62 ? 66  THR A H    8  
ATOM 11490 H HA   . THR A 1 66 ? 6.637   -11.568 1.701   1.00 0.80 ? 66  THR A HA   8  
ATOM 11491 H HB   . THR A 1 66 ? 8.966   -11.415 2.618   1.00 1.20 ? 66  THR A HB   8  
ATOM 11492 H HG1  . THR A 1 66 ? 10.091  -10.066 1.398   1.00 1.88 ? 66  THR A HG1  8  
ATOM 11493 H HG21 . THR A 1 66 ? 9.845   -13.364 1.618   1.00 1.74 ? 66  THR A HG21 8  
ATOM 11494 H HG22 . THR A 1 66 ? 8.940   -13.093 0.129   1.00 1.61 ? 66  THR A HG22 8  
ATOM 11495 H HG23 . THR A 1 66 ? 8.090   -13.533 1.611   1.00 1.74 ? 66  THR A HG23 8  
ATOM 11496 N N    . HIS A 1 67 ? 7.629   -9.304  3.039   1.00 0.51 ? 67  HIS A N    8  
ATOM 11497 C CA   . HIS A 1 67 ? 7.536   -7.961  3.602   1.00 0.45 ? 67  HIS A CA   8  
ATOM 11498 C C    . HIS A 1 67 ? 8.618   -7.061  3.013   1.00 0.43 ? 67  HIS A C    8  
ATOM 11499 O O    . HIS A 1 67 ? 8.349   -5.907  2.684   1.00 0.41 ? 67  HIS A O    8  
ATOM 11500 C CB   . HIS A 1 67 ? 7.565   -7.956  5.134   1.00 0.45 ? 67  HIS A CB   8  
ATOM 11501 C CG   . HIS A 1 67 ? 7.165   -6.626  5.692   1.00 0.46 ? 67  HIS A CG   8  
ATOM 11502 N ND1  . HIS A 1 67 ? 5.889   -6.354  6.128   1.00 0.51 ? 67  HIS A ND1  8  
ATOM 11503 C CD2  . HIS A 1 67 ? 7.854   -5.465  5.816   1.00 0.49 ? 67  HIS A CD2  8  
ATOM 11504 C CE1  . HIS A 1 67 ? 5.809   -5.087  6.487   1.00 0.54 ? 67  HIS A CE1  8  
ATOM 11505 N NE2  . HIS A 1 67 ? 6.986   -4.526  6.311   1.00 0.52 ? 67  HIS A NE2  8  
ATOM 11506 H H    . HIS A 1 67 ? 7.971   -10.048 3.577   1.00 0.50 ? 67  HIS A H    8  
ATOM 11507 H HA   . HIS A 1 67 ? 6.583   -7.563  3.286   1.00 0.44 ? 67  HIS A HA   8  
ATOM 11508 H HB2  . HIS A 1 67 ? 6.864   -8.689  5.497   1.00 0.46 ? 67  HIS A HB2  8  
ATOM 11509 H HB3  . HIS A 1 67 ? 8.551   -8.199  5.494   1.00 0.44 ? 67  HIS A HB3  8  
ATOM 11510 H HD1  . HIS A 1 67 ? 5.149   -6.995  6.170   1.00 0.56 ? 67  HIS A HD1  8  
ATOM 11511 H HD2  . HIS A 1 67 ? 8.889   -5.302  5.559   1.00 0.54 ? 67  HIS A HD2  8  
ATOM 11512 H HE1  . HIS A 1 67 ? 4.923   -4.587  6.840   1.00 0.61 ? 67  HIS A HE1  8  
ATOM 11513 H HE2  . HIS A 1 67 ? 7.148   -3.559  6.317   1.00 0.56 ? 67  HIS A HE2  8  
ATOM 11514 N N    . GLU A 1 68 ? 9.837   -7.587  2.877   1.00 0.45 ? 68  GLU A N    8  
ATOM 11515 C CA   . GLU A 1 68 ? 10.948  -6.804  2.304   1.00 0.45 ? 68  GLU A CA   8  
ATOM 11516 C C    . GLU A 1 68 ? 10.483  -6.105  1.025   1.00 0.42 ? 68  GLU A C    8  
ATOM 11517 O O    . GLU A 1 68 ? 10.611  -4.891  0.891   1.00 0.41 ? 68  GLU A O    8  
ATOM 11518 C CB   . GLU A 1 68 ? 12.178  -7.681  1.998   1.00 0.49 ? 68  GLU A CB   8  
ATOM 11519 C CG   . GLU A 1 68 ? 13.319  -6.920  1.339   1.00 1.43 ? 68  GLU A CG   8  
ATOM 11520 C CD   . GLU A 1 68 ? 14.504  -7.811  1.015   1.00 2.13 ? 68  GLU A CD   8  
ATOM 11521 O OE1  . GLU A 1 68 ? 14.483  -8.463  -0.051  1.00 2.59 ? 68  GLU A OE1  8  
ATOM 11522 O OE2  . GLU A 1 68 ? 15.452  -7.857  1.826   1.00 2.90 ? 68  GLU A OE2  8  
ATOM 11523 H H    . GLU A 1 68 ? 9.995   -8.505  3.177   1.00 0.47 ? 68  GLU A H    8  
ATOM 11524 H HA   . GLU A 1 68 ? 11.224  -6.050  3.028   1.00 0.47 ? 68  GLU A HA   8  
ATOM 11525 H HB2  . GLU A 1 68 ? 12.554  -8.104  2.919   1.00 1.08 ? 68  GLU A HB2  8  
ATOM 11526 H HB3  . GLU A 1 68 ? 11.887  -8.483  1.333   1.00 1.21 ? 68  GLU A HB3  8  
ATOM 11527 H HG2  . GLU A 1 68 ? 12.958  -6.481  0.421   1.00 2.02 ? 68  GLU A HG2  8  
ATOM 11528 H HG3  . GLU A 1 68 ? 13.646  -6.136  2.009   1.00 2.08 ? 68  GLU A HG3  8  
ATOM 11529 N N    . GLU A 1 69 ? 9.930   -6.893  0.097   1.00 0.44 ? 69  GLU A N    8  
ATOM 11530 C CA   . GLU A 1 69 ? 9.424   -6.368  -1.174  1.00 0.43 ? 69  GLU A CA   8  
ATOM 11531 C C    . GLU A 1 69 ? 8.296   -5.356  -0.947  1.00 0.41 ? 69  GLU A C    8  
ATOM 11532 O O    . GLU A 1 69 ? 8.187   -4.370  -1.677  1.00 0.41 ? 69  GLU A O    8  
ATOM 11533 C CB   . GLU A 1 69 ? 8.935   -7.511  -2.061  1.00 0.46 ? 69  GLU A CB   8  
ATOM 11534 C CG   . GLU A 1 69 ? 10.021  -8.110  -2.941  1.00 0.76 ? 69  GLU A CG   8  
ATOM 11535 C CD   . GLU A 1 69 ? 11.133  -8.760  -2.136  1.00 1.07 ? 69  GLU A CD   8  
ATOM 11536 O OE1  . GLU A 1 69 ? 10.965  -9.930  -1.728  1.00 1.70 ? 69  GLU A OE1  8  
ATOM 11537 O OE2  . GLU A 1 69 ? 12.168  -8.099  -1.911  1.00 1.84 ? 69  GLU A OE2  8  
ATOM 11538 H H    . GLU A 1 69 ? 9.861   -7.852  0.284   1.00 0.48 ? 69  GLU A H    8  
ATOM 11539 H HA   . GLU A 1 69 ? 10.242  -5.866  -1.670  1.00 0.46 ? 69  GLU A HA   8  
ATOM 11540 H HB2  . GLU A 1 69 ? 8.542   -8.293  -1.428  1.00 0.64 ? 69  GLU A HB2  8  
ATOM 11541 H HB3  . GLU A 1 69 ? 8.144   -7.144  -2.700  1.00 0.63 ? 69  GLU A HB3  8  
ATOM 11542 H HG2  . GLU A 1 69 ? 9.576   -8.858  -3.580  1.00 1.51 ? 69  GLU A HG2  8  
ATOM 11543 H HG3  . GLU A 1 69 ? 10.447  -7.324  -3.549  1.00 1.43 ? 69  GLU A HG3  8  
ATOM 11544 N N    . ALA A 1 70 ? 7.478   -5.593  0.083   1.00 0.41 ? 70  ALA A N    8  
ATOM 11545 C CA   . ALA A 1 70 ? 6.377   -4.691  0.432   1.00 0.41 ? 70  ALA A CA   8  
ATOM 11546 C C    . ALA A 1 70 ? 6.910   -3.293  0.747   1.00 0.40 ? 70  ALA A C    8  
ATOM 11547 O O    . ALA A 1 70 ? 6.363   -2.285  0.296   1.00 0.42 ? 70  ALA A O    8  
ATOM 11548 C CB   . ALA A 1 70 ? 5.621   -5.234  1.635   1.00 0.44 ? 70  ALA A CB   8  
ATOM 11549 H H    . ALA A 1 70 ? 7.633   -6.384  0.641   1.00 0.44 ? 70  ALA A H    8  
ATOM 11550 H HA   . ALA A 1 70 ? 5.692   -4.637  -0.407  1.00 0.42 ? 70  ALA A HA   8  
ATOM 11551 H HB1  . ALA A 1 70 ? 6.290   -5.301  2.478   1.00 1.00 ? 70  ALA A HB1  8  
ATOM 11552 H HB2  . ALA A 1 70 ? 5.233   -6.215  1.404   1.00 1.28 ? 70  ALA A HB2  8  
ATOM 11553 H HB3  . ALA A 1 70 ? 4.807   -4.569  1.877   1.00 0.98 ? 70  ALA A HB3  8  
ATOM 11554 N N    . VAL A 1 71 ? 8.002   -3.258  1.511   1.00 0.40 ? 71  VAL A N    8  
ATOM 11555 C CA   . VAL A 1 71 ? 8.642   -2.004  1.890   1.00 0.42 ? 71  VAL A CA   8  
ATOM 11556 C C    . VAL A 1 71 ? 9.514   -1.477  0.752   1.00 0.41 ? 71  VAL A C    8  
ATOM 11557 O O    . VAL A 1 71 ? 9.575   -0.272  0.518   1.00 0.42 ? 71  VAL A O    8  
ATOM 11558 C CB   . VAL A 1 71 ? 9.504   -2.172  3.163   1.00 0.48 ? 71  VAL A CB   8  
ATOM 11559 C CG1  . VAL A 1 71 ? 10.409  -0.965  3.375   1.00 0.52 ? 71  VAL A CG1  8  
ATOM 11560 C CG2  . VAL A 1 71 ? 8.619   -2.399  4.380   1.00 0.50 ? 71  VAL A CG2  8  
ATOM 11561 H H    . VAL A 1 71 ? 8.394   -4.107  1.808   1.00 0.41 ? 71  VAL A H    8  
ATOM 11562 H HA   . VAL A 1 71 ? 7.865   -1.282  2.098   1.00 0.43 ? 71  VAL A HA   8  
ATOM 11563 H HB   . VAL A 1 71 ? 10.131  -3.043  3.036   1.00 0.51 ? 71  VAL A HB   8  
ATOM 11564 H HG11 . VAL A 1 71 ? 10.658  -0.882  4.423   1.00 1.18 ? 71  VAL A HG11 8  
ATOM 11565 H HG12 . VAL A 1 71 ? 9.897   -0.070  3.055   1.00 1.21 ? 71  VAL A HG12 8  
ATOM 11566 H HG13 . VAL A 1 71 ? 11.314  -1.088  2.799   1.00 1.02 ? 71  VAL A HG13 8  
ATOM 11567 H HG21 . VAL A 1 71 ? 9.139   -3.023  5.091   1.00 1.07 ? 71  VAL A HG21 8  
ATOM 11568 H HG22 . VAL A 1 71 ? 7.703   -2.885  4.077   1.00 1.12 ? 71  VAL A HG22 8  
ATOM 11569 H HG23 . VAL A 1 71 ? 8.387   -1.448  4.836   1.00 1.00 ? 71  VAL A HG23 8  
ATOM 11570 N N    . THR A 1 72 ? 10.181  -2.394  0.045   1.00 0.43 ? 72  THR A N    8  
ATOM 11571 C CA   . THR A 1 72 ? 11.045  -2.031  -1.073  1.00 0.47 ? 72  THR A CA   8  
ATOM 11572 C C    . THR A 1 72 ? 10.249  -1.362  -2.193  1.00 0.42 ? 72  THR A C    8  
ATOM 11573 O O    . THR A 1 72 ? 10.735  -0.431  -2.829  1.00 0.44 ? 72  THR A O    8  
ATOM 11574 C CB   . THR A 1 72 ? 11.773  -3.268  -1.615  1.00 0.53 ? 72  THR A CB   8  
ATOM 11575 O OG1  . THR A 1 72 ? 12.642  -3.806  -0.634  1.00 0.60 ? 72  THR A OG1  8  
ATOM 11576 C CG2  . THR A 1 72 ? 12.603  -2.985  -2.852  1.00 0.61 ? 72  THR A CG2  8  
ATOM 11577 H H    . THR A 1 72 ? 10.084  -3.339  0.280   1.00 0.46 ? 72  THR A H    8  
ATOM 11578 H HA   . THR A 1 72 ? 11.778  -1.333  -0.703  1.00 0.51 ? 72  THR A HA   8  
ATOM 11579 H HB   . THR A 1 72 ? 11.040  -4.020  -1.870  1.00 0.53 ? 72  THR A HB   8  
ATOM 11580 H HG1  . THR A 1 72 ? 12.373  -4.705  -0.426  1.00 0.98 ? 72  THR A HG1  8  
ATOM 11581 H HG21 . THR A 1 72 ? 11.950  -2.762  -3.682  1.00 1.16 ? 72  THR A HG21 8  
ATOM 11582 H HG22 . THR A 1 72 ? 13.204  -3.850  -3.089  1.00 0.86 ? 72  THR A HG22 8  
ATOM 11583 H HG23 . THR A 1 72 ? 13.249  -2.139  -2.665  1.00 1.27 ? 72  THR A HG23 8  
ATOM 11584 N N    . ALA A 1 73 ? 9.028   -1.848  -2.435  1.00 0.37 ? 73  ALA A N    8  
ATOM 11585 C CA   . ALA A 1 73 ? 8.169   -1.307  -3.485  1.00 0.36 ? 73  ALA A CA   8  
ATOM 11586 C C    . ALA A 1 73 ? 7.581   0.032   -3.070  1.00 0.34 ? 73  ALA A C    8  
ATOM 11587 O O    . ALA A 1 73 ? 7.485   0.953   -3.885  1.00 0.36 ? 73  ALA A O    8  
ATOM 11588 C CB   . ALA A 1 73 ? 7.059   -2.290  -3.823  1.00 0.41 ? 73  ALA A CB   8  
ATOM 11589 H H    . ALA A 1 73 ? 8.692   -2.594  -1.907  1.00 0.37 ? 73  ALA A H    8  
ATOM 11590 H HA   . ALA A 1 73 ? 8.772   -1.165  -4.371  1.00 0.39 ? 73  ALA A HA   8  
ATOM 11591 H HB1  . ALA A 1 73 ? 7.489   -3.194  -4.230  1.00 1.15 ? 73  ALA A HB1  8  
ATOM 11592 H HB2  . ALA A 1 73 ? 6.395   -1.849  -4.551  1.00 1.01 ? 73  ALA A HB2  8  
ATOM 11593 H HB3  . ALA A 1 73 ? 6.504   -2.528  -2.927  1.00 1.08 ? 73  ALA A HB3  8  
ATOM 11594 N N    . LEU A 1 74 ? 7.220   0.153   -1.790  1.00 0.33 ? 74  LEU A N    8  
ATOM 11595 C CA   . LEU A 1 74 ? 6.683   1.403   -1.268  1.00 0.37 ? 74  LEU A CA   8  
ATOM 11596 C C    . LEU A 1 74 ? 7.773   2.463   -1.270  1.00 0.38 ? 74  LEU A C    8  
ATOM 11597 O O    . LEU A 1 74 ? 7.517   3.640   -1.531  1.00 0.44 ? 74  LEU A O    8  
ATOM 11598 C CB   . LEU A 1 74 ? 6.177   1.206   0.161   1.00 0.41 ? 74  LEU A CB   8  
ATOM 11599 C CG   . LEU A 1 74 ? 4.685   0.927   0.300   1.00 0.61 ? 74  LEU A CG   8  
ATOM 11600 C CD1  . LEU A 1 74 ? 3.869   2.138   -0.127  1.00 1.73 ? 74  LEU A CD1  8  
ATOM 11601 C CD2  . LEU A 1 74 ? 4.283   -0.303  -0.503  1.00 1.13 ? 74  LEU A CD2  8  
ATOM 11602 H H    . LEU A 1 74 ? 7.348   -0.600  -1.168  1.00 0.33 ? 74  LEU A H    8  
ATOM 11603 H HA   . LEU A 1 74 ? 5.868   1.719   -1.902  1.00 0.42 ? 74  LEU A HA   8  
ATOM 11604 H HB2  . LEU A 1 74 ? 6.716   0.379   0.599   1.00 0.61 ? 74  LEU A HB2  8  
ATOM 11605 H HB3  . LEU A 1 74 ? 6.406   2.097   0.725   1.00 0.47 ? 74  LEU A HB3  8  
ATOM 11606 H HG   . LEU A 1 74 ? 4.473   0.732   1.336   1.00 1.29 ? 74  LEU A HG   8  
ATOM 11607 H HD11 . LEU A 1 74 ? 3.993   2.301   -1.188  1.00 2.20 ? 74  LEU A HD11 8  
ATOM 11608 H HD12 . LEU A 1 74 ? 4.210   3.010   0.413   1.00 2.34 ? 74  LEU A HD12 8  
ATOM 11609 H HD13 . LEU A 1 74 ? 2.826   1.965   0.091   1.00 2.24 ? 74  LEU A HD13 8  
ATOM 11610 H HD21 . LEU A 1 74 ? 3.272   -0.184  -0.862  1.00 1.57 ? 74  LEU A HD21 8  
ATOM 11611 H HD22 . LEU A 1 74 ? 4.342   -1.177  0.126   1.00 1.72 ? 74  LEU A HD22 8  
ATOM 11612 H HD23 . LEU A 1 74 ? 4.950   -0.419  -1.344  1.00 1.75 ? 74  LEU A HD23 8  
ATOM 11613 N N    . LYS A 1 75 ? 8.993   2.018   -0.977  1.00 0.38 ? 75  LYS A N    8  
ATOM 11614 C CA   . LYS A 1 75 ? 10.152  2.911   -0.939  1.00 0.47 ? 75  LYS A CA   8  
ATOM 11615 C C    . LYS A 1 75 ? 10.744  3.144   -2.336  1.00 0.49 ? 75  LYS A C    8  
ATOM 11616 O O    . LYS A 1 75 ? 11.497  4.099   -2.538  1.00 0.59 ? 75  LYS A O    8  
ATOM 11617 C CB   . LYS A 1 75 ? 11.223  2.366   0.014   1.00 0.57 ? 75  LYS A CB   8  
ATOM 11618 C CG   . LYS A 1 75 ? 12.044  1.219   -0.558  1.00 0.64 ? 75  LYS A CG   8  
ATOM 11619 C CD   . LYS A 1 75 ? 13.510  1.329   -0.167  1.00 1.05 ? 75  LYS A CD   8  
ATOM 11620 C CE   . LYS A 1 75 ? 13.772  0.713   1.199   1.00 0.88 ? 75  LYS A CE   8  
ATOM 11621 N NZ   . LYS A 1 75 ? 14.317  1.709   2.165   1.00 1.44 ? 75  LYS A NZ   8  
ATOM 11622 H H    . LYS A 1 75 ? 9.111   1.054   -0.787  1.00 0.37 ? 75  LYS A H    8  
ATOM 11623 H HA   . LYS A 1 75 ? 9.810   3.862   -0.557  1.00 0.54 ? 75  LYS A HA   8  
ATOM 11624 H HB2  . LYS A 1 75 ? 11.899  3.167   0.270   1.00 0.67 ? 75  LYS A HB2  8  
ATOM 11625 H HB3  . LYS A 1 75 ? 10.740  2.017   0.915   1.00 0.62 ? 75  LYS A HB3  8  
ATOM 11626 H HG2  . LYS A 1 75 ? 11.653  0.288   -0.181  1.00 0.87 ? 75  LYS A HG2  8  
ATOM 11627 H HG3  . LYS A 1 75 ? 11.967  1.232   -1.635  1.00 0.88 ? 75  LYS A HG3  8  
ATOM 11628 H HD2  . LYS A 1 75 ? 14.108  0.814   -0.903  1.00 1.90 ? 75  LYS A HD2  8  
ATOM 11629 H HD3  . LYS A 1 75 ? 13.788  2.373   -0.142  1.00 1.62 ? 75  LYS A HD3  8  
ATOM 11630 H HE2  . LYS A 1 75 ? 12.845  0.320   1.589   1.00 1.04 ? 75  LYS A HE2  8  
ATOM 11631 H HE3  . LYS A 1 75 ? 14.484  -0.091  1.086   1.00 1.51 ? 75  LYS A HE3  8  
ATOM 11632 H HZ1  . LYS A 1 75 ? 13.588  2.412   2.400   1.00 1.72 ? 75  LYS A HZ1  8  
ATOM 11633 H HZ2  . LYS A 1 75 ? 15.135  2.199   1.751   1.00 1.94 ? 75  LYS A HZ2  8  
ATOM 11634 H HZ3  . LYS A 1 75 ? 14.617  1.234   3.039   1.00 1.92 ? 75  LYS A HZ3  8  
ATOM 11635 N N    . ASN A 1 76 ? 10.403  2.276   -3.299  1.00 0.48 ? 76  ASN A N    8  
ATOM 11636 C CA   . ASN A 1 76 ? 10.906  2.408   -4.668  1.00 0.59 ? 76  ASN A CA   8  
ATOM 11637 C C    . ASN A 1 76 ? 10.071  3.423   -5.456  1.00 0.69 ? 76  ASN A C    8  
ATOM 11638 O O    . ASN A 1 76 ? 9.465   3.092   -6.478  1.00 1.15 ? 76  ASN A O    8  
ATOM 11639 C CB   . ASN A 1 76 ? 10.906  1.048   -5.379  1.00 0.64 ? 76  ASN A CB   8  
ATOM 11640 C CG   . ASN A 1 76 ? 11.689  1.071   -6.680  1.00 0.85 ? 76  ASN A CG   8  
ATOM 11641 O OD1  . ASN A 1 76 ? 12.918  1.146   -6.674  1.00 0.90 ? 76  ASN A OD1  8  
ATOM 11642 N ND2  . ASN A 1 76 ? 10.982  1.005   -7.804  1.00 1.55 ? 76  ASN A ND2  8  
ATOM 11643 H H    . ASN A 1 76 ? 9.799   1.535   -3.084  1.00 0.45 ? 76  ASN A H    8  
ATOM 11644 H HA   . ASN A 1 76 ? 11.922  2.771   -4.608  1.00 0.73 ? 76  ASN A HA   8  
ATOM 11645 H HB2  . ASN A 1 76 ? 11.349  0.310   -4.730  1.00 0.71 ? 76  ASN A HB2  8  
ATOM 11646 H HB3  . ASN A 1 76 ? 9.886   0.762   -5.597  1.00 0.75 ? 76  ASN A HB3  8  
ATOM 11647 H HD21 . ASN A 1 76 ? 10.006  0.947   -7.736  1.00 1.95 ? 76  ASN A HD21 8  
ATOM 11648 H HD22 . ASN A 1 76 ? 11.467  1.020   -8.655  1.00 1.75 ? 76  ASN A HD22 8  
ATOM 11649 N N    . THR A 1 77 ? 10.046  4.659   -4.966  1.00 0.90 ? 77  THR A N    8  
ATOM 11650 C CA   . THR A 1 77 ? 9.293