data_2OR4
# 
_entry.id   2OR4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OR4         
RCSB  RCSB041483   
WWPDB D_1000041483 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OR4 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barinka, C.'   1 
'Lubkowski, J.' 2 
# 
_citation.id                        primary 
_citation.title                     'Structural insight into the pharmacophore pocket of human glutamate carboxypeptidase II.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            50 
_citation.page_first                3267 
_citation.page_last                 3273 
_citation.year                      2007 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17567119 
_citation.pdbx_database_id_DOI      10.1021/jm070133w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Barinka, C.'      1  
primary 'Rovenska, M.'     2  
primary 'Mlcochova, P.'    3  
primary 'Hlouchova, K.'    4  
primary 'Plechanovova, A.' 5  
primary 'Majer, P.'        6  
primary 'Tsukamoto, T.'    7  
primary 'Slusher, B.S.'    8  
primary 'Konvalinka, J.'   9  
primary 'Lubkowski, J.'    10 
# 
_cell.entry_id           2OR4 
_cell.length_a           102.007 
_cell.length_b           130.437 
_cell.length_c           159.508 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OR4 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glutamate carboxypeptidase 2'                                       79859.031 1   3.4.17.21 ? 
'recombinant human GCPII, extracellular part' ? 
2 non-polymer syn N-ACETYL-D-GLUCOSAMINE                                               221.208   11  ?         ? ? ? 
3 non-polymer man BETA-D-MANNOSE                                                       180.156   1   ?         ? ? ? 
4 non-polymer man ALPHA-D-MANNOSE                                                      180.156   1   ?         ? ? ? 
5 non-polymer syn 'ZINC ION'                                                           65.409    2   ?         ? ? ? 
6 non-polymer syn 'CALCIUM ION'                                                        40.078    1   ?         ? ? ? 
7 non-polymer syn 'CHLORIDE ION'                                                       35.453    1   ?         ? ? ? 
8 non-polymer syn '(S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID' 189.126   1   ?         ? ? ? 
9 water       nat water                                                                18.015    874 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, mGCP, N- acetylated-alpha-linked acidic dipeptidase I, NAALADase I, Pteroylpoly-gamma-glutamate carboxypeptidase, Folylpoly-gamma- glutamate carboxypeptidase, FGCP, Folate hydrolase 1, Prostate- specific membrane antigen, PSMA, PSM
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RSKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPN
KTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIV
IARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRR
GIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGT
LRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRL
LQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDF
EVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYA
VVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGL
PDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RSKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPN
KTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIV
IARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRR
GIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGT
LRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRL
LQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDF
EVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYA
VVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGL
PDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   SER n 
1 3   LYS n 
1 4   SER n 
1 5   SER n 
1 6   ASN n 
1 7   GLU n 
1 8   ALA n 
1 9   THR n 
1 10  ASN n 
1 11  ILE n 
1 12  THR n 
1 13  PRO n 
1 14  LYS n 
1 15  HIS n 
1 16  ASN n 
1 17  MET n 
1 18  LYS n 
1 19  ALA n 
1 20  PHE n 
1 21  LEU n 
1 22  ASP n 
1 23  GLU n 
1 24  LEU n 
1 25  LYS n 
1 26  ALA n 
1 27  GLU n 
1 28  ASN n 
1 29  ILE n 
1 30  LYS n 
1 31  LYS n 
1 32  PHE n 
1 33  LEU n 
1 34  TYR n 
1 35  ASN n 
1 36  PHE n 
1 37  THR n 
1 38  GLN n 
1 39  ILE n 
1 40  PRO n 
1 41  HIS n 
1 42  LEU n 
1 43  ALA n 
1 44  GLY n 
1 45  THR n 
1 46  GLU n 
1 47  GLN n 
1 48  ASN n 
1 49  PHE n 
1 50  GLN n 
1 51  LEU n 
1 52  ALA n 
1 53  LYS n 
1 54  GLN n 
1 55  ILE n 
1 56  GLN n 
1 57  SER n 
1 58  GLN n 
1 59  TRP n 
1 60  LYS n 
1 61  GLU n 
1 62  PHE n 
1 63  GLY n 
1 64  LEU n 
1 65  ASP n 
1 66  SER n 
1 67  VAL n 
1 68  GLU n 
1 69  LEU n 
1 70  ALA n 
1 71  HIS n 
1 72  TYR n 
1 73  ASP n 
1 74  VAL n 
1 75  LEU n 
1 76  LEU n 
1 77  SER n 
1 78  TYR n 
1 79  PRO n 
1 80  ASN n 
1 81  LYS n 
1 82  THR n 
1 83  HIS n 
1 84  PRO n 
1 85  ASN n 
1 86  TYR n 
1 87  ILE n 
1 88  SER n 
1 89  ILE n 
1 90  ILE n 
1 91  ASN n 
1 92  GLU n 
1 93  ASP n 
1 94  GLY n 
1 95  ASN n 
1 96  GLU n 
1 97  ILE n 
1 98  PHE n 
1 99  ASN n 
1 100 THR n 
1 101 SER n 
1 102 LEU n 
1 103 PHE n 
1 104 GLU n 
1 105 PRO n 
1 106 PRO n 
1 107 PRO n 
1 108 PRO n 
1 109 GLY n 
1 110 TYR n 
1 111 GLU n 
1 112 ASN n 
1 113 VAL n 
1 114 SER n 
1 115 ASP n 
1 116 ILE n 
1 117 VAL n 
1 118 PRO n 
1 119 PRO n 
1 120 PHE n 
1 121 SER n 
1 122 ALA n 
1 123 PHE n 
1 124 SER n 
1 125 PRO n 
1 126 GLN n 
1 127 GLY n 
1 128 MET n 
1 129 PRO n 
1 130 GLU n 
1 131 GLY n 
1 132 ASP n 
1 133 LEU n 
1 134 VAL n 
1 135 TYR n 
1 136 VAL n 
1 137 ASN n 
1 138 TYR n 
1 139 ALA n 
1 140 ARG n 
1 141 THR n 
1 142 GLU n 
1 143 ASP n 
1 144 PHE n 
1 145 PHE n 
1 146 LYS n 
1 147 LEU n 
1 148 GLU n 
1 149 ARG n 
1 150 ASP n 
1 151 MET n 
1 152 LYS n 
1 153 ILE n 
1 154 ASN n 
1 155 CYS n 
1 156 SER n 
1 157 GLY n 
1 158 LYS n 
1 159 ILE n 
1 160 VAL n 
1 161 ILE n 
1 162 ALA n 
1 163 ARG n 
1 164 TYR n 
1 165 GLY n 
1 166 LYS n 
1 167 VAL n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 ASN n 
1 172 LYS n 
1 173 VAL n 
1 174 LYS n 
1 175 ASN n 
1 176 ALA n 
1 177 GLN n 
1 178 LEU n 
1 179 ALA n 
1 180 GLY n 
1 181 ALA n 
1 182 LYS n 
1 183 GLY n 
1 184 VAL n 
1 185 ILE n 
1 186 LEU n 
1 187 TYR n 
1 188 SER n 
1 189 ASP n 
1 190 PRO n 
1 191 ALA n 
1 192 ASP n 
1 193 TYR n 
1 194 PHE n 
1 195 ALA n 
1 196 PRO n 
1 197 GLY n 
1 198 VAL n 
1 199 LYS n 
1 200 SER n 
1 201 TYR n 
1 202 PRO n 
1 203 ASP n 
1 204 GLY n 
1 205 TRP n 
1 206 ASN n 
1 207 LEU n 
1 208 PRO n 
1 209 GLY n 
1 210 GLY n 
1 211 GLY n 
1 212 VAL n 
1 213 GLN n 
1 214 ARG n 
1 215 GLY n 
1 216 ASN n 
1 217 ILE n 
1 218 LEU n 
1 219 ASN n 
1 220 LEU n 
1 221 ASN n 
1 222 GLY n 
1 223 ALA n 
1 224 GLY n 
1 225 ASP n 
1 226 PRO n 
1 227 LEU n 
1 228 THR n 
1 229 PRO n 
1 230 GLY n 
1 231 TYR n 
1 232 PRO n 
1 233 ALA n 
1 234 ASN n 
1 235 GLU n 
1 236 TYR n 
1 237 ALA n 
1 238 TYR n 
1 239 ARG n 
1 240 ARG n 
1 241 GLY n 
1 242 ILE n 
1 243 ALA n 
1 244 GLU n 
1 245 ALA n 
1 246 VAL n 
1 247 GLY n 
1 248 LEU n 
1 249 PRO n 
1 250 SER n 
1 251 ILE n 
1 252 PRO n 
1 253 VAL n 
1 254 HIS n 
1 255 PRO n 
1 256 ILE n 
1 257 GLY n 
1 258 TYR n 
1 259 TYR n 
1 260 ASP n 
1 261 ALA n 
1 262 GLN n 
1 263 LYS n 
1 264 LEU n 
1 265 LEU n 
1 266 GLU n 
1 267 LYS n 
1 268 MET n 
1 269 GLY n 
1 270 GLY n 
1 271 SER n 
1 272 ALA n 
1 273 PRO n 
1 274 PRO n 
1 275 ASP n 
1 276 SER n 
1 277 SER n 
1 278 TRP n 
1 279 ARG n 
1 280 GLY n 
1 281 SER n 
1 282 LEU n 
1 283 LYS n 
1 284 VAL n 
1 285 PRO n 
1 286 TYR n 
1 287 ASN n 
1 288 VAL n 
1 289 GLY n 
1 290 PRO n 
1 291 GLY n 
1 292 PHE n 
1 293 THR n 
1 294 GLY n 
1 295 ASN n 
1 296 PHE n 
1 297 SER n 
1 298 THR n 
1 299 GLN n 
1 300 LYS n 
1 301 VAL n 
1 302 LYS n 
1 303 MET n 
1 304 HIS n 
1 305 ILE n 
1 306 HIS n 
1 307 SER n 
1 308 THR n 
1 309 ASN n 
1 310 GLU n 
1 311 VAL n 
1 312 THR n 
1 313 ARG n 
1 314 ILE n 
1 315 TYR n 
1 316 ASN n 
1 317 VAL n 
1 318 ILE n 
1 319 GLY n 
1 320 THR n 
1 321 LEU n 
1 322 ARG n 
1 323 GLY n 
1 324 ALA n 
1 325 VAL n 
1 326 GLU n 
1 327 PRO n 
1 328 ASP n 
1 329 ARG n 
1 330 TYR n 
1 331 VAL n 
1 332 ILE n 
1 333 LEU n 
1 334 GLY n 
1 335 GLY n 
1 336 HIS n 
1 337 ARG n 
1 338 ASP n 
1 339 SER n 
1 340 TRP n 
1 341 VAL n 
1 342 PHE n 
1 343 GLY n 
1 344 GLY n 
1 345 ILE n 
1 346 ASP n 
1 347 PRO n 
1 348 GLN n 
1 349 SER n 
1 350 GLY n 
1 351 ALA n 
1 352 ALA n 
1 353 VAL n 
1 354 VAL n 
1 355 HIS n 
1 356 GLU n 
1 357 ILE n 
1 358 VAL n 
1 359 ARG n 
1 360 SER n 
1 361 PHE n 
1 362 GLY n 
1 363 THR n 
1 364 LEU n 
1 365 LYS n 
1 366 LYS n 
1 367 GLU n 
1 368 GLY n 
1 369 TRP n 
1 370 ARG n 
1 371 PRO n 
1 372 ARG n 
1 373 ARG n 
1 374 THR n 
1 375 ILE n 
1 376 LEU n 
1 377 PHE n 
1 378 ALA n 
1 379 SER n 
1 380 TRP n 
1 381 ASP n 
1 382 ALA n 
1 383 GLU n 
1 384 GLU n 
1 385 PHE n 
1 386 GLY n 
1 387 LEU n 
1 388 LEU n 
1 389 GLY n 
1 390 SER n 
1 391 THR n 
1 392 GLU n 
1 393 TRP n 
1 394 ALA n 
1 395 GLU n 
1 396 GLU n 
1 397 ASN n 
1 398 SER n 
1 399 ARG n 
1 400 LEU n 
1 401 LEU n 
1 402 GLN n 
1 403 GLU n 
1 404 ARG n 
1 405 GLY n 
1 406 VAL n 
1 407 ALA n 
1 408 TYR n 
1 409 ILE n 
1 410 ASN n 
1 411 ALA n 
1 412 ASP n 
1 413 SER n 
1 414 SER n 
1 415 ILE n 
1 416 GLU n 
1 417 GLY n 
1 418 ASN n 
1 419 TYR n 
1 420 THR n 
1 421 LEU n 
1 422 ARG n 
1 423 VAL n 
1 424 ASP n 
1 425 CYS n 
1 426 THR n 
1 427 PRO n 
1 428 LEU n 
1 429 MET n 
1 430 TYR n 
1 431 SER n 
1 432 LEU n 
1 433 VAL n 
1 434 HIS n 
1 435 ASN n 
1 436 LEU n 
1 437 THR n 
1 438 LYS n 
1 439 GLU n 
1 440 LEU n 
1 441 LYS n 
1 442 SER n 
1 443 PRO n 
1 444 ASP n 
1 445 GLU n 
1 446 GLY n 
1 447 PHE n 
1 448 GLU n 
1 449 GLY n 
1 450 LYS n 
1 451 SER n 
1 452 LEU n 
1 453 TYR n 
1 454 GLU n 
1 455 SER n 
1 456 TRP n 
1 457 THR n 
1 458 LYS n 
1 459 LYS n 
1 460 SER n 
1 461 PRO n 
1 462 SER n 
1 463 PRO n 
1 464 GLU n 
1 465 PHE n 
1 466 SER n 
1 467 GLY n 
1 468 MET n 
1 469 PRO n 
1 470 ARG n 
1 471 ILE n 
1 472 SER n 
1 473 LYS n 
1 474 LEU n 
1 475 GLY n 
1 476 SER n 
1 477 GLY n 
1 478 ASN n 
1 479 ASP n 
1 480 PHE n 
1 481 GLU n 
1 482 VAL n 
1 483 PHE n 
1 484 PHE n 
1 485 GLN n 
1 486 ARG n 
1 487 LEU n 
1 488 GLY n 
1 489 ILE n 
1 490 ALA n 
1 491 SER n 
1 492 GLY n 
1 493 ARG n 
1 494 ALA n 
1 495 ARG n 
1 496 TYR n 
1 497 THR n 
1 498 LYS n 
1 499 ASN n 
1 500 TRP n 
1 501 GLU n 
1 502 THR n 
1 503 ASN n 
1 504 LYS n 
1 505 PHE n 
1 506 SER n 
1 507 GLY n 
1 508 TYR n 
1 509 PRO n 
1 510 LEU n 
1 511 TYR n 
1 512 HIS n 
1 513 SER n 
1 514 VAL n 
1 515 TYR n 
1 516 GLU n 
1 517 THR n 
1 518 TYR n 
1 519 GLU n 
1 520 LEU n 
1 521 VAL n 
1 522 GLU n 
1 523 LYS n 
1 524 PHE n 
1 525 TYR n 
1 526 ASP n 
1 527 PRO n 
1 528 MET n 
1 529 PHE n 
1 530 LYS n 
1 531 TYR n 
1 532 HIS n 
1 533 LEU n 
1 534 THR n 
1 535 VAL n 
1 536 ALA n 
1 537 GLN n 
1 538 VAL n 
1 539 ARG n 
1 540 GLY n 
1 541 GLY n 
1 542 MET n 
1 543 VAL n 
1 544 PHE n 
1 545 GLU n 
1 546 LEU n 
1 547 ALA n 
1 548 ASN n 
1 549 SER n 
1 550 ILE n 
1 551 VAL n 
1 552 LEU n 
1 553 PRO n 
1 554 PHE n 
1 555 ASP n 
1 556 CYS n 
1 557 ARG n 
1 558 ASP n 
1 559 TYR n 
1 560 ALA n 
1 561 VAL n 
1 562 VAL n 
1 563 LEU n 
1 564 ARG n 
1 565 LYS n 
1 566 TYR n 
1 567 ALA n 
1 568 ASP n 
1 569 LYS n 
1 570 ILE n 
1 571 TYR n 
1 572 SER n 
1 573 ILE n 
1 574 SER n 
1 575 MET n 
1 576 LYS n 
1 577 HIS n 
1 578 PRO n 
1 579 GLN n 
1 580 GLU n 
1 581 MET n 
1 582 LYS n 
1 583 THR n 
1 584 TYR n 
1 585 SER n 
1 586 VAL n 
1 587 SER n 
1 588 PHE n 
1 589 ASP n 
1 590 SER n 
1 591 LEU n 
1 592 PHE n 
1 593 SER n 
1 594 ALA n 
1 595 VAL n 
1 596 LYS n 
1 597 ASN n 
1 598 PHE n 
1 599 THR n 
1 600 GLU n 
1 601 ILE n 
1 602 ALA n 
1 603 SER n 
1 604 LYS n 
1 605 PHE n 
1 606 SER n 
1 607 GLU n 
1 608 ARG n 
1 609 LEU n 
1 610 GLN n 
1 611 ASP n 
1 612 PHE n 
1 613 ASP n 
1 614 LYS n 
1 615 SER n 
1 616 ASN n 
1 617 PRO n 
1 618 ILE n 
1 619 VAL n 
1 620 LEU n 
1 621 ARG n 
1 622 MET n 
1 623 MET n 
1 624 ASN n 
1 625 ASP n 
1 626 GLN n 
1 627 LEU n 
1 628 MET n 
1 629 PHE n 
1 630 LEU n 
1 631 GLU n 
1 632 ARG n 
1 633 ALA n 
1 634 PHE n 
1 635 ILE n 
1 636 ASP n 
1 637 PRO n 
1 638 LEU n 
1 639 GLY n 
1 640 LEU n 
1 641 PRO n 
1 642 ASP n 
1 643 ARG n 
1 644 PRO n 
1 645 PHE n 
1 646 TYR n 
1 647 ARG n 
1 648 HIS n 
1 649 VAL n 
1 650 ILE n 
1 651 TYR n 
1 652 ALA n 
1 653 PRO n 
1 654 SER n 
1 655 SER n 
1 656 HIS n 
1 657 ASN n 
1 658 LYS n 
1 659 TYR n 
1 660 ALA n 
1 661 GLY n 
1 662 GLU n 
1 663 SER n 
1 664 PHE n 
1 665 PRO n 
1 666 GLY n 
1 667 ILE n 
1 668 TYR n 
1 669 ASP n 
1 670 ALA n 
1 671 LEU n 
1 672 PHE n 
1 673 ASP n 
1 674 ILE n 
1 675 GLU n 
1 676 SER n 
1 677 LYS n 
1 678 VAL n 
1 679 ASP n 
1 680 PRO n 
1 681 SER n 
1 682 LYS n 
1 683 ALA n 
1 684 TRP n 
1 685 GLY n 
1 686 GLU n 
1 687 VAL n 
1 688 LYS n 
1 689 ARG n 
1 690 GLN n 
1 691 ILE n 
1 692 TYR n 
1 693 VAL n 
1 694 ALA n 
1 695 ALA n 
1 696 PHE n 
1 697 THR n 
1 698 VAL n 
1 699 GLN n 
1 700 ALA n 
1 701 ALA n 
1 702 ALA n 
1 703 GLU n 
1 704 THR n 
1 705 LEU n 
1 706 SER n 
1 707 GLU n 
1 708 VAL n 
1 709 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'FOLH1, FOLH, NAALAD1, PSM, PSMA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fruit fly' 
_entity_src_gen.pdbx_host_org_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7227 
_entity_src_gen.host_org_genus                     Drosophila 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               
;Schneider's S2 cells
;
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pMT/BiP/V5-His A' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FOLH1_HUMAN 
_struct_ref.pdbx_db_accession          Q04609 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKT
HPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIA
RYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGI
AEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLR
GAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQ
ERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEV
FFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVV
LRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPD
RPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
;
_struct_ref.pdbx_align_begin           44 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2OR4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 709 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q04609 
_struct_ref_seq.db_align_beg                  44 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  750 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       44 
_struct_ref_seq.pdbx_auth_seq_align_end       750 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OR4 ARG A 1 ? UNP Q04609 ? ? 'EXPRESSION TAG' 42 1 
1 2OR4 SER A 2 ? UNP Q04609 ? ? 'EXPRESSION TAG' 43 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                              ?           'C3 H7 N O2'     89.093 
ARG 'L-peptide linking' y ARGININE                                                             ?           'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                           ?           'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                      ?           'C4 H7 N O4'     
133.103 
BMA D-saccharide        . BETA-D-MANNOSE                                                       ?           'C6 H12 O6'      
180.156 
CA  non-polymer         . 'CALCIUM ION'                                                        ?           'Ca 2'           40.078 
CL  non-polymer         . 'CHLORIDE ION'                                                       ?           'Cl -1'          35.453 
CYS 'L-peptide linking' y CYSTEINE                                                             ?           'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                            ?           'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                      ?           'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                              ?           'C2 H5 N O2'     75.067 
HIS 'L-peptide linking' y HISTIDINE                                                            ?           'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                                ?           'H2 O'           18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                           ?           'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                              ?           'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                               ?           'C6 H15 N2 O2 1' 
147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE                                                      ?           'C6 H12 O6'      
180.156 
MET 'L-peptide linking' y METHIONINE                                                           ?           'C5 H11 N O2 S'  
149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                               ?           'C8 H15 N O6'    
221.208 
PHE 'L-peptide linking' y PHENYLALANINE                                                        ?           'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                              ?           'C5 H9 N O2'     
115.130 
QUS non-polymer         . '(S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID' QUISQUALATE 'C5 H7 N3 O5'    
189.126 
SER 'L-peptide linking' y SERINE                                                               ?           'C3 H7 N O3'     
105.093 
THR 'L-peptide linking' y THREONINE                                                            ?           'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                           ?           'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                             ?           'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                               ?           'C5 H11 N O2'    
117.146 
ZN  non-polymer         . 'ZINC ION'                                                           ?           'Zn 2'           65.409 
# 
_exptl.entry_id          2OR4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.32 
_exptl_crystal.density_percent_sol   62.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;33% (v/v) pentaerythritol propoxylate PO/OH 5/4, 13% (w/v) PEG 3350, 100 mM Tris-HCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 225 mm' 
_diffrn_detector.pdbx_collection_date   2006-07-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     2OR4 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.62 
_reflns.number_obs                   129603 
_reflns.number_all                   129603 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.2 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              11.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.62 
_reflns_shell.d_res_low              1.68 
_reflns_shell.percent_possible_all   74.8 
_reflns_shell.Rmerge_I_obs           0.465 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OR4 
_refine.ls_number_reflns_obs                     123053 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.62 
_refine.ls_percent_reflns_obs                    96.59 
_refine.ls_R_factor_obs                          0.18593 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18420 
_refine.ls_R_factor_R_free                       0.21908 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  6521 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.952 
_refine.B_iso_mean                               27.218 
_refine.aniso_B[1][1]                            0.94 
_refine.aniso_B[2][2]                            -1.85 
_refine.aniso_B[3][3]                            0.91 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 2OOT' 
_refine.pdbx_method_to_determine_struct          'Rigid body' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.082 
_refine.pdbx_overall_ESU_R_Free                  0.086 
_refine.overall_SU_ML                            0.057 
_refine.overall_SU_B                             1.642 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5486 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         193 
_refine_hist.number_atoms_solvent             874 
_refine_hist.number_atoms_total               6553 
_refine_hist.d_res_high                       1.62 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.020  0.022  ? 6064 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.939  1.995  ? 8229 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.774  5.000  ? 699  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.264 23.825 ? 285  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       14.406 15.000 ? 1002 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.007 15.000 ? 35   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.137  0.200  ? 891  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.020  ? 4585 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.228  0.200  ? 3202 'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.320  0.200  ? 4167 'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.168  0.200  ? 771  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          0.057  0.200  ? 6    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.234  0.200  ? 88   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.218  0.200  ? 43   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.222  1.500  ? 3601 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.797  2.000  ? 5702 'X-RAY DIFFRACTION' ? 
r_scbond_it                  2.681  3.000  ? 2799 'X-RAY DIFFRACTION' ? 
r_scangle_it                 3.989  4.500  ? 2527 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            7.115  3.000  ? 4    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.62 
_refine_ls_shell.d_res_low                        1.663 
_refine_ls_shell.number_reflns_R_work             6550 
_refine_ls_shell.R_factor_R_work                  0.276 
_refine_ls_shell.percent_reflns_obs               70.35 
_refine_ls_shell.R_factor_R_free                  0.342 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             360 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OR4 
_struct.title                     
'A high resolution crystal structure of human glutamate carboxypeptidase II in complex with quisqualic acid' 
_struct.pdbx_descriptor           'Glutamate carboxypeptidase 2 (E.C.3.4.17.21)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OR4 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'prostate specific membrane antigen, metallopeptidase, folate hydrolase, glutamate carboxypeptidase II, Naaladase, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 7 ? 
S N N 8 ? 
T N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 16  ? LEU A 24  ? ASN A 57  LEU A 65  1 ? 9  
HELX_P HELX_P2  2  LYS A 25  ? THR A 37  ? LYS A 66  THR A 78  1 ? 13 
HELX_P HELX_P3  3  THR A 45  ? PHE A 62  ? THR A 86  PHE A 103 1 ? 18 
HELX_P HELX_P4  4  ARG A 140 ? ASP A 150 ? ARG A 181 ASP A 191 1 ? 11 
HELX_P HELX_P5  5  PHE A 168 ? ALA A 179 ? PHE A 209 ALA A 220 1 ? 12 
HELX_P HELX_P6  6  ASP A 189 ? PHE A 194 ? ASP A 230 PHE A 235 1 ? 6  
HELX_P HELX_P7  7  GLY A 241 ? ALA A 245 ? GLY A 282 ALA A 286 5 ? 5  
HELX_P HELX_P8  8  GLY A 257 ? GLU A 266 ? GLY A 298 GLU A 307 1 ? 10 
HELX_P HELX_P9  9  ASP A 275 ? ARG A 279 ? ASP A 316 ARG A 320 5 ? 5  
HELX_P HELX_P10 10 THR A 293 ? SER A 297 ? THR A 334 SER A 338 5 ? 5  
HELX_P HELX_P11 11 PRO A 347 ? GLU A 367 ? PRO A 388 GLU A 408 1 ? 21 
HELX_P HELX_P12 12 ALA A 382 ? GLY A 386 ? ALA A 423 GLY A 427 5 ? 5  
HELX_P HELX_P13 13 LEU A 387 ? ASN A 397 ? LEU A 428 ASN A 438 1 ? 11 
HELX_P HELX_P14 14 ASN A 397 ? ARG A 404 ? ASN A 438 ARG A 445 1 ? 8  
HELX_P HELX_P15 15 MET A 429 ? GLU A 439 ? MET A 470 GLU A 480 1 ? 11 
HELX_P HELX_P16 16 SER A 451 ? SER A 460 ? SER A 492 SER A 501 1 ? 10 
HELX_P HELX_P17 17 PHE A 480 ? ARG A 486 ? PHE A 521 ARG A 527 1 ? 7  
HELX_P HELX_P18 18 THR A 517 ? TYR A 525 ? THR A 558 TYR A 566 1 ? 9  
HELX_P HELX_P19 19 PHE A 529 ? SER A 549 ? PHE A 570 SER A 590 1 ? 21 
HELX_P HELX_P20 20 ASP A 555 ? MET A 575 ? ASP A 596 MET A 616 1 ? 21 
HELX_P HELX_P21 21 HIS A 577 ? TYR A 584 ? HIS A 618 TYR A 625 1 ? 8  
HELX_P HELX_P22 22 PHE A 588 ? PHE A 612 ? PHE A 629 PHE A 653 1 ? 25 
HELX_P HELX_P23 23 ASN A 616 ? ALA A 633 ? ASN A 657 ALA A 674 1 ? 18 
HELX_P HELX_P24 24 PHE A 664 ? PHE A 672 ? PHE A 705 PHE A 713 1 ? 9  
HELX_P HELX_P25 25 ASP A 673 ? LYS A 677 ? ASP A 714 LYS A 718 5 ? 5  
HELX_P HELX_P26 26 ASP A 679 ? THR A 704 ? ASP A 720 THR A 745 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A ASN 35  ND2 ? ? ? 1_555 B NAG .   C1  ? ? A ASN 76   A NAG 1755 1_555 ? ? ? ? ? ? ? 1.442 ? 
covale2  covale ? ? A ASN 80  ND2 ? ? ? 1_555 D NAG .   C1  ? ? A ASN 121  A NAG 1757 1_555 ? ? ? ? ? ? ? 1.459 ? 
covale3  covale ? ? A ASN 99  ND2 ? ? ? 1_555 E NAG .   C1  ? ? A ASN 140  A NAG 1758 1_555 ? ? ? ? ? ? ? 1.444 ? 
covale4  covale ? ? A ASN 154 ND2 ? ? ? 1_555 G NAG .   C1  ? ? A ASN 195  A NAG 1759 1_555 ? ? ? ? ? ? ? 1.448 ? 
covale5  covale ? ? A ASN 418 ND2 ? ? ? 1_555 H NAG .   C1  ? ? A ASN 459  A NAG 1760 1_555 ? ? ? ? ? ? ? 1.452 ? 
covale6  covale ? ? A ASN 435 ND2 ? ? ? 1_555 I NAG .   C1  ? ? A ASN 476  A NAG 1761 1_555 ? ? ? ? ? ? ? 1.455 ? 
covale7  covale ? ? A ASN 597 ND2 ? ? ? 1_555 K NAG .   C1  ? ? A ASN 638  A NAG 1763 1_555 ? ? ? ? ? ? ? 1.455 ? 
covale8  covale ? ? B NAG .   O4  ? ? ? 1_555 C NAG .   C1  ? ? A NAG 1755 A NAG 1756 1_555 ? ? ? ? ? ? ? 1.440 ? 
covale9  covale ? ? E NAG .   O4  ? ? ? 1_555 F NAG .   C1  ? ? A NAG 1758 A NAG 1767 1_555 ? ? ? ? ? ? ? 1.452 ? 
covale10 covale ? ? I NAG .   O4  ? ? ? 1_555 J NAG .   C1  ? ? A NAG 1761 A NAG 1762 1_555 ? ? ? ? ? ? ? 1.461 ? 
covale11 covale ? ? K NAG .   O4  ? ? ? 1_555 L NAG .   C1  ? ? A NAG 1763 A NAG 1764 1_555 ? ? ? ? ? ? ? 1.436 ? 
covale12 covale ? ? L NAG .   O4  ? ? ? 1_555 M BMA .   C1  ? ? A NAG 1764 A BMA 1765 1_555 ? ? ? ? ? ? ? 1.428 ? 
covale13 covale ? ? M BMA .   O3  ? ? ? 1_555 N MAN .   C1  ? ? A BMA 1765 A MAN 1766 1_555 ? ? ? ? ? ? ? 1.430 ? 
metalc1  metalc ? ? O ZN  .   ZN  ? ? ? 1_555 A GLU 384 OE1 ? ? A ZN  1751 A GLU 425  1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc2  metalc ? ? O ZN  .   ZN  ? ? ? 1_555 A GLU 384 OE2 ? ? A ZN  1751 A GLU 425  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc3  metalc ? ? O ZN  .   ZN  ? ? ? 1_555 A HIS 512 NE2 ? ? A ZN  1751 A HIS 553  1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc4  metalc ? ? O ZN  .   ZN  ? ? ? 1_555 A ASP 346 OD2 ? ? A ZN  1751 A ASP 387  1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc5  metalc ? ? O ZN  .   ZN  ? ? ? 1_555 T HOH .   O   ? ? A ZN  1751 A HOH 2675 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc6  metalc ? ? P ZN  .   ZN  ? ? ? 1_555 T HOH .   O   ? ? A ZN  1752 A HOH 2675 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc7  metalc ? ? P ZN  .   ZN  ? ? ? 1_555 A HIS 336 NE2 ? ? A ZN  1752 A HIS 377  1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc8  metalc ? ? P ZN  .   ZN  ? ? ? 1_555 A ASP 346 OD1 ? ? A ZN  1752 A ASP 387  1_555 ? ? ? ? ? ? ? 1.985 ? 
metalc9  metalc ? ? P ZN  .   ZN  ? ? ? 1_555 A ASP 412 OD2 ? ? A ZN  1752 A ASP 453  1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc10 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A GLU 395 OE2 ? ? A CA  1753 A GLU 436  1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc11 metalc ? ? Q CA  .   CA  ? ? ? 1_555 T HOH .   O   ? ? A CA  1753 A HOH 1806 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc12 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A GLU 392 OE1 ? ? A CA  1753 A GLU 433  1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc13 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A GLU 392 OE2 ? ? A CA  1753 A GLU 433  1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc14 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A THR 228 O   ? ? A CA  1753 A THR 269  1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc15 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A THR 228 OG1 ? ? A CA  1753 A THR 269  1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc16 metalc ? ? Q CA  .   CA  ? ? ? 1_555 A TYR 231 O   ? ? A CA  1753 A TYR 272  1_555 ? ? ? ? ? ? ? 2.391 ? 
covale14 covale ? ? A GLU 235 OE1 D ? ? 2_565 M BMA .   O2  ? ? A GLU 276  A BMA 1765 1_555 ? ? ? ? ? ? ? 2.010 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 201 A . ? TYR 242 A PRO 202 A ? PRO 243 A 1 9.88  
2 GLY 289 A . ? GLY 330 A PRO 290 A ? PRO 331 A 1 -2.73 
3 ASP 346 A . ? ASP 387 A PRO 347 A ? PRO 388 A 1 5.33  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 4 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? parallel      
D 1 2 ? parallel      
D 2 3 ? parallel      
D 3 4 ? parallel      
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 66  ? TYR A 78  ? SER A 107 TYR A 119 
A 2 THR A 308 ? LEU A 321 ? THR A 349 LEU A 362 
A 3 ARG A 373 ? TRP A 380 ? ARG A 414 TRP A 421 
A 4 GLU A 326 ? HIS A 336 ? GLU A 367 HIS A 377 
A 5 GLY A 405 ? ASN A 410 ? GLY A 446 ASN A 451 
A 6 ALA A 490 ? THR A 497 ? ALA A 531 THR A 538 
A 7 THR A 420 ? CYS A 425 ? THR A 461 CYS A 466 
B 1 GLU A 96  ? ASN A 99  ? GLU A 137 ASN A 140 
B 2 TYR A 86  ? ILE A 90  ? TYR A 127 ILE A 131 
B 3 LYS A 300 ? HIS A 304 ? LYS A 341 HIS A 345 
B 4 GLU A 130 ? GLY A 131 ? GLU A 171 GLY A 172 
C 1 SER A 121 ? ALA A 122 ? SER A 162 ALA A 163 
C 2 GLY A 215 ? ASN A 216 ? GLY A 256 ASN A 257 
D 1 LEU A 133 ? TYR A 135 ? LEU A 174 TYR A 176 
D 2 ILE A 159 ? ARG A 163 ? ILE A 200 ARG A 204 
D 3 GLY A 183 ? TYR A 187 ? GLY A 224 TYR A 228 
D 4 VAL A 253 ? ILE A 256 ? VAL A 294 ILE A 297 
E 1 TYR A 651 ? SER A 654 ? TYR A 692 SER A 695 
E 2 ASN A 657 ? SER A 663 ? ASN A 698 SER A 704 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ALA A 70  ? N ALA A 111 O ASN A 316 ? O ASN A 357 
A 2 3 N GLY A 319 ? N GLY A 360 O PHE A 377 ? O PHE A 418 
A 3 4 O LEU A 376 ? O LEU A 417 N LEU A 333 ? N LEU A 374 
A 4 5 N ILE A 332 ? N ILE A 373 O ILE A 409 ? O ILE A 450 
A 5 6 N ASN A 410 ? N ASN A 451 O GLY A 492 ? O GLY A 533 
A 6 7 O THR A 497 ? O THR A 538 N THR A 420 ? N THR A 461 
B 1 2 O PHE A 98  ? O PHE A 139 N ILE A 89  ? N ILE A 130 
B 2 3 N SER A 88  ? N SER A 129 O LYS A 302 ? O LYS A 343 
B 3 4 O VAL A 301 ? O VAL A 342 N GLY A 131 ? N GLY A 172 
C 1 2 N ALA A 122 ? N ALA A 163 O GLY A 215 ? O GLY A 256 
D 1 2 N VAL A 134 ? N VAL A 175 O ILE A 161 ? O ILE A 202 
D 2 3 N VAL A 160 ? N VAL A 201 O ILE A 185 ? O ILE A 226 
D 3 4 N LEU A 186 ? N LEU A 227 O HIS A 254 ? O HIS A 295 
E 1 2 N SER A 654 ? N SER A 695 O ALA A 660 ? O ALA A 701 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NAG A 1755' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NAG A 1756' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE NAG A 1757' 
AC4 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE NAG A 1758' 
AC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG A 1767' 
AC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG A 1759' 
AC7 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE NAG A 1760' 
AC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NAG A 1761' 
AC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NAG A 1762' 
BC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE NAG A 1763' 
BC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NAG A 1764' 
BC3 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE BMA A 1765' 
BC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MAN A 1766' 
BC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN A 1751'  
BC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE ZN A 1752'  
BC7 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA A 1753'  
BC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE CL A 1754'  
BC9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE QUS A 1801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 8  ASN A 35  ? ASN A 76   . ? 1_555 ? 
2   AC1 8  GLN A 54  ? GLN A 95   . ? 1_555 ? 
3   AC1 8  GLN A 58  ? GLN A 99   . ? 1_555 ? 
4   AC1 8  NAG C .   ? NAG A 1756 . ? 1_555 ? 
5   AC1 8  HOH T .   ? HOH A 2042 . ? 1_555 ? 
6   AC1 8  HOH T .   ? HOH A 2076 . ? 1_555 ? 
7   AC1 8  HOH T .   ? HOH A 2579 . ? 1_555 ? 
8   AC1 8  HOH T .   ? HOH A 2644 . ? 1_555 ? 
9   AC2 5  NAG B .   ? NAG A 1755 . ? 1_555 ? 
10  AC2 5  HOH T .   ? HOH A 2051 . ? 1_555 ? 
11  AC2 5  HOH T .   ? HOH A 2416 . ? 1_555 ? 
12  AC2 5  HOH T .   ? HOH A 2574 . ? 1_555 ? 
13  AC2 5  HOH T .   ? HOH A 2647 . ? 1_555 ? 
14  AC3 6  ASN A 80  ? ASN A 121  . ? 1_555 ? 
15  AC3 6  THR A 82  ? THR A 123  . ? 1_555 ? 
16  AC3 6  HIS A 83  ? HIS A 124  . ? 1_555 ? 
17  AC3 6  HOH T .   ? HOH A 2402 . ? 1_555 ? 
18  AC3 6  HOH T .   ? HOH A 2558 . ? 1_555 ? 
19  AC3 6  HOH T .   ? HOH A 2564 . ? 1_555 ? 
20  AC4 9  TYR A 86  ? TYR A 127  . ? 1_555 ? 
21  AC4 9  GLU A 96  ? GLU A 137  . ? 1_555 ? 
22  AC4 9  ILE A 97  ? ILE A 138  . ? 1_555 ? 
23  AC4 9  ASN A 99  ? ASN A 140  . ? 1_555 ? 
24  AC4 9  NAG F .   ? NAG A 1767 . ? 1_555 ? 
25  AC4 9  HOH T .   ? HOH A 2247 . ? 1_555 ? 
26  AC4 9  HOH T .   ? HOH A 2520 . ? 1_555 ? 
27  AC4 9  HOH T .   ? HOH A 2552 . ? 1_555 ? 
28  AC4 9  HOH T .   ? HOH A 2560 . ? 1_555 ? 
29  AC5 4  NAG E .   ? NAG A 1758 . ? 1_555 ? 
30  AC5 4  HOH T .   ? HOH A 2171 . ? 1_555 ? 
31  AC5 4  HOH T .   ? HOH A 2285 . ? 1_555 ? 
32  AC5 4  HOH T .   ? HOH A 2398 . ? 1_555 ? 
33  AC6 4  ASN A 154 ? ASN A 195  . ? 1_555 ? 
34  AC6 4  SER A 156 ? SER A 197  . ? 1_555 ? 
35  AC6 4  HOH T .   ? HOH A 2572 . ? 1_555 ? 
36  AC6 4  HOH T .   ? HOH A 2583 . ? 1_555 ? 
37  AC7 9  TRP A 205 ? TRP A 246  . ? 1_555 ? 
38  AC7 9  ASN A 418 ? ASN A 459  . ? 1_555 ? 
39  AC7 9  PHE A 524 ? PHE A 565  . ? 1_555 ? 
40  AC7 9  TYR A 525 ? TYR A 566  . ? 1_555 ? 
41  AC7 9  HOH T .   ? HOH A 1877 . ? 1_555 ? 
42  AC7 9  HOH T .   ? HOH A 2066 . ? 1_555 ? 
43  AC7 9  HOH T .   ? HOH A 2317 . ? 1_555 ? 
44  AC7 9  HOH T .   ? HOH A 2360 . ? 1_555 ? 
45  AC7 9  HOH T .   ? HOH A 2426 . ? 1_555 ? 
46  AC8 8  SER A 431 ? SER A 472  . ? 1_555 ? 
47  AC8 8  ASN A 435 ? ASN A 476  . ? 1_555 ? 
48  AC8 8  PRO A 553 ? PRO A 594  . ? 1_555 ? 
49  AC8 8  NAG J .   ? NAG A 1762 . ? 1_555 ? 
50  AC8 8  HOH T .   ? HOH A 2328 . ? 1_555 ? 
51  AC8 8  HOH T .   ? HOH A 2346 . ? 1_555 ? 
52  AC8 8  HOH T .   ? HOH A 2394 . ? 1_555 ? 
53  AC8 8  HOH T .   ? HOH A 2657 . ? 1_555 ? 
54  AC9 8  GLN A 610 ? GLN A 651  . ? 1_555 ? 
55  AC9 8  NAG I .   ? NAG A 1761 . ? 1_555 ? 
56  AC9 8  HOH T .   ? HOH A 2276 . ? 1_555 ? 
57  AC9 8  HOH T .   ? HOH A 2315 . ? 1_555 ? 
58  AC9 8  HOH T .   ? HOH A 2324 . ? 1_555 ? 
59  AC9 8  HOH T .   ? HOH A 2382 . ? 1_555 ? 
60  AC9 8  HOH T .   ? HOH A 2546 . ? 1_555 ? 
61  AC9 8  HOH T .   ? HOH A 2559 . ? 1_555 ? 
62  BC1 10 SER A 590 ? SER A 631  . ? 1_555 ? 
63  BC1 10 SER A 593 ? SER A 634  . ? 1_555 ? 
64  BC1 10 ASN A 597 ? ASN A 638  . ? 1_555 ? 
65  BC1 10 GLN A 699 ? GLN A 740  . ? 1_555 ? 
66  BC1 10 NAG L .   ? NAG A 1764 . ? 1_555 ? 
67  BC1 10 HOH T .   ? HOH A 1926 . ? 1_555 ? 
68  BC1 10 HOH T .   ? HOH A 1960 . ? 2_565 ? 
69  BC1 10 HOH T .   ? HOH A 2141 . ? 1_555 ? 
70  BC1 10 HOH T .   ? HOH A 2361 . ? 1_555 ? 
71  BC1 10 HOH T .   ? HOH A 2570 . ? 1_555 ? 
72  BC2 4  GLU A 235 ? GLU A 276  . ? 2_565 ? 
73  BC2 4  NAG K .   ? NAG A 1763 . ? 1_555 ? 
74  BC2 4  BMA M .   ? BMA A 1765 . ? 1_555 ? 
75  BC2 4  HOH T .   ? HOH A 2361 . ? 1_555 ? 
76  BC3 8  HIS A 71  ? HIS A 112  . ? 2_565 ? 
77  BC3 8  GLU A 235 ? GLU A 276  . ? 2_565 ? 
78  BC3 8  LYS A 283 ? LYS A 324  . ? 7_555 ? 
79  BC3 8  ARG A 313 ? ARG A 354  . ? 2_565 ? 
80  BC3 8  NAG L .   ? NAG A 1764 . ? 1_555 ? 
81  BC3 8  MAN N .   ? MAN A 1766 . ? 1_555 ? 
82  BC3 8  HOH T .   ? HOH A 2329 . ? 1_555 ? 
83  BC3 8  HOH T .   ? HOH A 2356 . ? 1_555 ? 
84  BC4 10 PHE A 194 ? PHE A 235  . ? 7_555 ? 
85  BC4 10 LYS A 199 ? LYS A 240  . ? 7_555 ? 
86  BC4 10 SER A 200 ? SER A 241  . ? 7_555 ? 
87  BC4 10 GLU A 235 ? GLU A 276  . ? 2_565 ? 
88  BC4 10 BMA M .   ? BMA A 1765 . ? 1_555 ? 
89  BC4 10 HOH T .   ? HOH A 1990 . ? 1_555 ? 
90  BC4 10 HOH T .   ? HOH A 2139 . ? 1_555 ? 
91  BC4 10 HOH T .   ? HOH A 2142 . ? 1_555 ? 
92  BC4 10 HOH T .   ? HOH A 2300 . ? 1_555 ? 
93  BC4 10 HOH T .   ? HOH A 2478 . ? 1_555 ? 
94  BC5 5  ASP A 346 ? ASP A 387  . ? 1_555 ? 
95  BC5 5  GLU A 384 ? GLU A 425  . ? 1_555 ? 
96  BC5 5  HIS A 512 ? HIS A 553  . ? 1_555 ? 
97  BC5 5  ZN  P .   ? ZN  A 1752 . ? 1_555 ? 
98  BC5 5  HOH T .   ? HOH A 2675 . ? 1_555 ? 
99  BC6 6  HIS A 336 ? HIS A 377  . ? 1_555 ? 
100 BC6 6  ASP A 346 ? ASP A 387  . ? 1_555 ? 
101 BC6 6  GLU A 383 ? GLU A 424  . ? 1_555 ? 
102 BC6 6  ASP A 412 ? ASP A 453  . ? 1_555 ? 
103 BC6 6  ZN  O .   ? ZN  A 1751 . ? 1_555 ? 
104 BC6 6  HOH T .   ? HOH A 2675 . ? 1_555 ? 
105 BC7 5  THR A 228 ? THR A 269  . ? 1_555 ? 
106 BC7 5  TYR A 231 ? TYR A 272  . ? 1_555 ? 
107 BC7 5  GLU A 392 ? GLU A 433  . ? 1_555 ? 
108 BC7 5  GLU A 395 ? GLU A 436  . ? 1_555 ? 
109 BC7 5  HOH T .   ? HOH A 1806 . ? 1_555 ? 
110 BC8 4  ASN A 410 ? ASN A 451  . ? 1_555 ? 
111 BC8 4  ASP A 412 ? ASP A 453  . ? 1_555 ? 
112 BC8 4  ARG A 493 ? ARG A 534  . ? 1_555 ? 
113 BC8 4  ARG A 495 ? ARG A 536  . ? 1_555 ? 
114 BC9 15 ARG A 169 ? ARG A 210  . ? 1_555 ? 
115 BC9 15 ASN A 216 ? ASN A 257  . ? 1_555 ? 
116 BC9 15 GLU A 383 ? GLU A 424  . ? 1_555 ? 
117 BC9 15 GLY A 386 ? GLY A 427  . ? 1_555 ? 
118 BC9 15 LEU A 387 ? LEU A 428  . ? 1_555 ? 
119 BC9 15 SER A 476 ? SER A 517  . ? 1_555 ? 
120 BC9 15 GLY A 477 ? GLY A 518  . ? 1_555 ? 
121 BC9 15 ASN A 478 ? ASN A 519  . ? 1_555 ? 
122 BC9 15 TYR A 511 ? TYR A 552  . ? 1_555 ? 
123 BC9 15 HIS A 512 ? HIS A 553  . ? 1_555 ? 
124 BC9 15 LYS A 658 ? LYS A 699  . ? 1_555 ? 
125 BC9 15 TYR A 659 ? TYR A 700  . ? 1_555 ? 
126 BC9 15 HOH T .   ? HOH A 1809 . ? 1_555 ? 
127 BC9 15 HOH T .   ? HOH A 1974 . ? 1_555 ? 
128 BC9 15 HOH T .   ? HOH A 2296 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2OR4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OR4 
_atom_sites.fract_transf_matrix[1][1]   0.009803 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007667 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006269 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 14  ? 16.981  45.870 82.795 1.00 50.00 ? 55   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 14  ? 16.170  46.903 82.087 1.00 49.74 ? 55   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 14  ? 15.773  46.428 80.683 1.00 48.95 ? 55   LYS A C   1 
ATOM   4    O  O   . LYS A 1 14  ? 16.264  45.393 80.192 1.00 49.42 ? 55   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 14  ? 16.930  48.237 81.978 1.00 50.58 ? 55   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 14  ? 17.581  48.738 83.272 1.00 53.34 ? 55   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 14  ? 17.727  50.268 83.260 1.00 56.63 ? 55   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 14  ? 19.086  50.707 83.805 1.00 58.27 ? 55   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 14  ? 19.471  52.045 83.240 1.00 60.14 ? 55   LYS A NZ  1 
ATOM   10   N  N   . HIS A 1 15  ? 14.870  47.183 80.060 1.00 46.94 ? 56   HIS A N   1 
ATOM   11   C  CA  . HIS A 1 15  ? 14.499  46.987 78.663 1.00 44.90 ? 56   HIS A CA  1 
ATOM   12   C  C   . HIS A 1 15  ? 14.908  48.240 77.915 1.00 42.83 ? 56   HIS A C   1 
ATOM   13   O  O   . HIS A 1 15  ? 14.113  49.176 77.739 1.00 43.47 ? 56   HIS A O   1 
ATOM   14   C  CB  . HIS A 1 15  ? 13.003  46.768 78.521 1.00 45.31 ? 56   HIS A CB  1 
ATOM   15   C  CG  . HIS A 1 15  ? 12.533  45.425 78.984 1.00 47.48 ? 56   HIS A CG  1 
ATOM   16   N  ND1 . HIS A 1 15  ? 11.312  45.244 79.598 1.00 48.53 ? 56   HIS A ND1 1 
ATOM   17   C  CD2 . HIS A 1 15  ? 13.110  44.200 78.914 1.00 47.62 ? 56   HIS A CD2 1 
ATOM   18   C  CE1 . HIS A 1 15  ? 11.147  43.960 79.874 1.00 50.59 ? 56   HIS A CE1 1 
ATOM   19   N  NE2 . HIS A 1 15  ? 12.224  43.305 79.470 1.00 50.68 ? 56   HIS A NE2 1 
ATOM   20   N  N   . ASN A 1 16  ? 16.168  48.257 77.499 1.00 38.74 ? 57   ASN A N   1 
ATOM   21   C  CA  . ASN A 1 16  ? 16.764  49.381 76.812 1.00 35.17 ? 57   ASN A CA  1 
ATOM   22   C  C   . ASN A 1 16  ? 17.357  48.834 75.530 1.00 32.28 ? 57   ASN A C   1 
ATOM   23   O  O   . ASN A 1 16  ? 17.112  47.655 75.211 1.00 30.11 ? 57   ASN A O   1 
ATOM   24   C  CB  . ASN A 1 16  ? 17.858  50.026 77.669 1.00 34.62 ? 57   ASN A CB  1 
ATOM   25   C  CG  . ASN A 1 16  ? 18.796  49.000 78.297 1.00 35.75 ? 57   ASN A CG  1 
ATOM   26   O  OD1 . ASN A 1 16  ? 18.887  47.855 77.850 1.00 31.53 ? 57   ASN A OD1 1 
ATOM   27   N  ND2 . ASN A 1 16  ? 19.497  49.417 79.351 1.00 36.39 ? 57   ASN A ND2 1 
ATOM   28   N  N   . MET A 1 17  ? 18.120  49.661 74.808 1.00 31.02 ? 58   MET A N   1 
ATOM   29   C  CA  . MET A 1 17  ? 18.610  49.197 73.513 1.00 31.51 ? 58   MET A CA  1 
ATOM   30   C  C   . MET A 1 17  ? 19.535  47.992 73.707 1.00 30.75 ? 58   MET A C   1 
ATOM   31   O  O   . MET A 1 17  ? 19.477  47.030 72.939 1.00 29.65 ? 58   MET A O   1 
ATOM   32   C  CB  . MET A 1 17  ? 19.343  50.244 72.678 1.00 30.70 ? 58   MET A CB  1 
ATOM   33   C  CG  . MET A 1 17  ? 19.455  49.763 71.182 1.00 30.65 ? 58   MET A CG  1 
ATOM   34   S  SD  . MET A 1 17  ? 20.344  50.891 70.182 1.00 36.27 ? 58   MET A SD  1 
ATOM   35   C  CE  . MET A 1 17  ? 21.486  51.667 71.349 1.00 39.43 ? 58   MET A CE  1 
ATOM   36   N  N   . LYS A 1 18  ? 20.352  48.045 74.751 1.00 29.91 ? 59   LYS A N   1 
ATOM   37   C  CA  . LYS A 1 18  ? 21.316  46.979 75.010 1.00 30.89 ? 59   LYS A CA  1 
ATOM   38   C  C   . LYS A 1 18  ? 20.651  45.615 75.167 1.00 29.27 ? 59   LYS A C   1 
ATOM   39   O  O   . LYS A 1 18  ? 21.151  44.635 74.619 1.00 29.74 ? 59   LYS A O   1 
ATOM   40   C  CB  . LYS A 1 18  ? 22.159  47.311 76.246 1.00 31.73 ? 59   LYS A CB  1 
ATOM   41   C  CG  . LYS A 1 18  ? 23.297  46.336 76.468 1.00 35.26 ? 59   LYS A CG  1 
ATOM   42   C  CD  . LYS A 1 18  ? 24.184  46.778 77.631 1.00 41.19 ? 59   LYS A CD  1 
ATOM   43   C  CE  . LYS A 1 18  ? 25.406  45.855 77.754 1.00 44.76 ? 59   LYS A CE  1 
ATOM   44   N  NZ  . LYS A 1 18  ? 24.985  44.469 78.122 1.00 46.07 ? 59   LYS A NZ  1 
ATOM   45   N  N   . ALA A 1 19  ? 19.542  45.561 75.907 1.00 28.59 ? 60   ALA A N   1 
ATOM   46   C  CA  . ALA A 1 19  ? 18.726  44.354 76.082 1.00 29.32 ? 60   ALA A CA  1 
ATOM   47   C  C   . ALA A 1 19  ? 18.248  43.833 74.722 1.00 29.08 ? 60   ALA A C   1 
ATOM   48   O  O   . ALA A 1 19  ? 18.345  42.648 74.417 1.00 28.94 ? 60   ALA A O   1 
ATOM   49   C  CB  . ALA A 1 19  ? 17.532  44.609 76.982 1.00 29.79 ? 60   ALA A CB  1 
ATOM   50   N  N   . PHE A 1 20  ? 17.758  44.752 73.894 1.00 26.68 ? 61   PHE A N   1 
ATOM   51   C  CA  . PHE A 1 20  ? 17.374  44.381 72.541 1.00 25.24 ? 61   PHE A CA  1 
ATOM   52   C  C   . PHE A 1 20  ? 18.543  43.795 71.741 1.00 23.64 ? 61   PHE A C   1 
ATOM   53   O  O   . PHE A 1 20  ? 18.425  42.708 71.131 1.00 24.16 ? 61   PHE A O   1 
ATOM   54   C  CB  . PHE A 1 20  ? 16.784  45.593 71.795 1.00 23.81 ? 61   PHE A CB  1 
ATOM   55   C  CG  . PHE A 1 20  ? 16.643  45.338 70.320 1.00 23.95 ? 61   PHE A CG  1 
ATOM   56   C  CD1 . PHE A 1 20  ? 15.618  44.509 69.847 1.00 25.38 ? 61   PHE A CD1 1 
ATOM   57   C  CD2 . PHE A 1 20  ? 17.568  45.831 69.452 1.00 23.66 ? 61   PHE A CD2 1 
ATOM   58   C  CE1 . PHE A 1 20  ? 15.529  44.205 68.444 1.00 23.47 ? 61   PHE A CE1 1 
ATOM   59   C  CE2 . PHE A 1 20  ? 17.499  45.532 68.068 1.00 22.60 ? 61   PHE A CE2 1 
ATOM   60   C  CZ  . PHE A 1 20  ? 16.499  44.747 67.594 1.00 21.29 ? 61   PHE A CZ  1 
ATOM   61   N  N   . LEU A 1 21  ? 19.649  44.521 71.717 1.00 23.92 ? 62   LEU A N   1 
ATOM   62   C  CA  . LEU A 1 21  ? 20.801  44.143 70.908 1.00 25.38 ? 62   LEU A CA  1 
ATOM   63   C  C   . LEU A 1 21  ? 21.348  42.796 71.380 1.00 26.76 ? 62   LEU A C   1 
ATOM   64   O  O   . LEU A 1 21  ? 21.680  41.948 70.558 1.00 25.74 ? 62   LEU A O   1 
ATOM   65   C  CB  . LEU A 1 21  ? 21.890  45.197 70.968 1.00 26.06 ? 62   LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 21  ? 21.486  46.515 70.307 1.00 24.59 ? 62   LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 21  ? 22.554  47.537 70.469 1.00 28.29 ? 62   LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 21  ? 21.198  46.312 68.784 1.00 25.76 ? 62   LEU A CD2 1 
ATOM   69   N  N   . ASP A 1 22  ? 21.394  42.594 72.701 1.00 28.24 ? 63   ASP A N   1 
ATOM   70   C  CA  . ASP A 1 22  ? 22.054  41.380 73.243 1.00 29.51 ? 63   ASP A CA  1 
ATOM   71   C  C   . ASP A 1 22  ? 21.283  40.127 72.928 1.00 29.68 ? 63   ASP A C   1 
ATOM   72   O  O   . ASP A 1 22  ? 21.866  39.023 72.868 1.00 29.89 ? 63   ASP A O   1 
ATOM   73   C  CB  . ASP A 1 22  ? 22.243  41.481 74.758 1.00 30.58 ? 63   ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 22  ? 23.355  42.414 75.146 1.00 32.50 ? 63   ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 22  ? 24.228  42.777 74.305 1.00 34.50 ? 63   ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 22  ? 23.339  42.811 76.331 1.00 38.72 ? 63   ASP A OD2 1 
ATOM   77   N  N   . GLU A 1 23  ? 19.978  40.274 72.730 1.00 27.90 ? 64   GLU A N   1 
ATOM   78   C  CA  . GLU A 1 23  ? 19.123  39.160 72.446 1.00 27.59 ? 64   GLU A CA  1 
ATOM   79   C  C   . GLU A 1 23  ? 19.405  38.591 71.056 1.00 27.17 ? 64   GLU A C   1 
ATOM   80   O  O   . GLU A 1 23  ? 19.161  37.395 70.835 1.00 27.17 ? 64   GLU A O   1 
ATOM   81   C  CB  . GLU A 1 23  ? 17.656  39.530 72.658 1.00 28.09 ? 64   GLU A CB  1 
ATOM   82   C  CG  . GLU A 1 23  ? 16.622  38.458 72.454 1.00 28.27 ? 64   GLU A CG  1 
ATOM   83   C  CD  . GLU A 1 23  ? 16.861  37.218 73.331 1.00 35.10 ? 64   GLU A CD  1 
ATOM   84   O  OE1 . GLU A 1 23  ? 17.253  37.398 74.515 1.00 36.86 ? 64   GLU A OE1 1 
ATOM   85   O  OE2 . GLU A 1 23  ? 16.652  36.084 72.835 1.00 32.74 ? 64   GLU A OE2 1 
ATOM   86   N  N   . LEU A 1 24  ? 19.909  39.434 70.147 1.00 26.22 ? 65   LEU A N   1 
ATOM   87   C  CA  . LEU A 1 24  ? 20.141  39.035 68.735 1.00 26.23 ? 65   LEU A CA  1 
ATOM   88   C  C   . LEU A 1 24  ? 21.284  37.993 68.683 1.00 26.74 ? 65   LEU A C   1 
ATOM   89   O  O   . LEU A 1 24  ? 22.333  38.252 69.241 1.00 27.38 ? 65   LEU A O   1 
ATOM   90   C  CB  . LEU A 1 24  ? 20.538  40.254 67.894 1.00 25.51 ? 65   LEU A CB  1 
ATOM   91   C  CG  . LEU A 1 24  ? 19.531  41.418 67.673 1.00 23.37 ? 65   LEU A CG  1 
ATOM   92   C  CD1 . LEU A 1 24  ? 20.288  42.632 67.132 1.00 21.64 ? 65   LEU A CD1 1 
ATOM   93   C  CD2 . LEU A 1 24  ? 18.323  40.968 66.828 1.00 21.83 ? 65   LEU A CD2 1 
ATOM   94   N  N   . LYS A 1 25  ? 21.102  36.894 67.934 1.00 26.28 ? 66   LYS A N   1 
ATOM   95   C  CA  . LYS A 1 25  ? 22.127  35.828 67.891 1.00 27.06 ? 66   LYS A CA  1 
ATOM   96   C  C   . LYS A 1 25  ? 22.509  35.461 66.466 1.00 25.86 ? 66   LYS A C   1 
ATOM   97   O  O   . LYS A 1 25  ? 21.618  35.152 65.663 1.00 25.43 ? 66   LYS A O   1 
ATOM   98   C  CB  . LYS A 1 25  ? 21.572  34.575 68.593 1.00 27.34 ? 66   LYS A CB  1 
ATOM   99   C  CG  . LYS A 1 25  ? 21.182  34.769 70.083 1.00 29.87 ? 66   LYS A CG  1 
ATOM   100  C  CD  . LYS A 1 25  ? 22.386  35.246 70.871 1.00 35.63 ? 66   LYS A CD  1 
ATOM   101  C  CE  . LYS A 1 25  ? 22.223  35.106 72.386 1.00 38.89 ? 66   LYS A CE  1 
ATOM   102  N  NZ  . LYS A 1 25  ? 21.230  36.071 72.950 1.00 38.44 ? 66   LYS A NZ  1 
ATOM   103  N  N   . ALA A 1 26  ? 23.803  35.449 66.182 1.00 25.75 ? 67   ALA A N   1 
ATOM   104  C  CA  . ALA A 1 26  ? 24.351  34.959 64.913 1.00 26.30 ? 67   ALA A CA  1 
ATOM   105  C  C   . ALA A 1 26  ? 23.823  33.567 64.561 1.00 26.25 ? 67   ALA A C   1 
ATOM   106  O  O   . ALA A 1 26  ? 23.468  33.290 63.395 1.00 24.85 ? 67   ALA A O   1 
ATOM   107  C  CB  . ALA A 1 26  ? 25.895  34.979 64.926 1.00 25.92 ? 67   ALA A CB  1 
ATOM   108  N  N   . GLU A 1 27  ? 23.769  32.688 65.562 1.00 26.14 ? 68   GLU A N   1 
ATOM   109  C  CA  . GLU A 1 27  ? 23.269  31.315 65.360 1.00 27.99 ? 68   GLU A CA  1 
ATOM   110  C  C   . GLU A 1 27  ? 21.843  31.247 64.810 1.00 26.88 ? 68   GLU A C   1 
ATOM   111  O  O   . GLU A 1 27  ? 21.542  30.421 63.955 1.00 26.25 ? 68   GLU A O   1 
ATOM   112  C  CB  . GLU A 1 27  ? 23.441  30.473 66.662 1.00 28.40 ? 68   GLU A CB  1 
ATOM   113  C  CG  A GLU A 1 27  ? 23.113  28.975 66.466 0.50 30.39 ? 68   GLU A CG  1 
ATOM   114  C  CG  B GLU A 1 27  ? 22.408  30.807 67.776 0.50 29.32 ? 68   GLU A CG  1 
ATOM   115  C  CD  A GLU A 1 27  ? 23.993  28.287 65.427 0.50 32.71 ? 68   GLU A CD  1 
ATOM   116  C  CD  B GLU A 1 27  ? 22.914  30.866 69.247 0.50 30.43 ? 68   GLU A CD  1 
ATOM   117  O  OE1 A GLU A 1 27  ? 25.181  28.656 65.273 0.50 31.02 ? 68   GLU A OE1 1 
ATOM   118  O  OE1 B GLU A 1 27  ? 24.027  31.371 69.555 0.50 33.89 ? 68   GLU A OE1 1 
ATOM   119  O  OE2 A GLU A 1 27  ? 23.479  27.362 64.757 0.50 36.39 ? 68   GLU A OE2 1 
ATOM   120  O  OE2 B GLU A 1 27  ? 22.132  30.440 70.120 0.50 31.81 ? 68   GLU A OE2 1 
ATOM   121  N  N   . ASN A 1 28  ? 20.979  32.157 65.276 1.00 25.32 ? 69   ASN A N   1 
ATOM   122  C  CA  . ASN A 1 28  ? 19.577  32.185 64.865 1.00 24.30 ? 69   ASN A CA  1 
ATOM   123  C  C   . ASN A 1 28  ? 19.466  32.680 63.443 1.00 22.62 ? 69   ASN A C   1 
ATOM   124  O  O   . ASN A 1 28  ? 18.660  32.143 62.671 1.00 22.25 ? 69   ASN A O   1 
ATOM   125  C  CB  . ASN A 1 28  ? 18.786  33.117 65.775 1.00 25.97 ? 69   ASN A CB  1 
ATOM   126  C  CG  . ASN A 1 28  ? 18.480  32.470 67.148 1.00 28.86 ? 69   ASN A CG  1 
ATOM   127  O  OD1 . ASN A 1 28  ? 18.365  31.242 67.245 1.00 32.37 ? 69   ASN A OD1 1 
ATOM   128  N  ND2 . ASN A 1 28  ? 18.340  33.294 68.193 1.00 28.60 ? 69   ASN A ND2 1 
ATOM   129  N  N   . ILE A 1 29  ? 20.255  33.693 63.119 1.00 21.10 ? 70   ILE A N   1 
ATOM   130  C  CA  . ILE A 1 29  ? 20.298  34.241 61.737 1.00 20.83 ? 70   ILE A CA  1 
ATOM   131  C  C   . ILE A 1 29  ? 20.722  33.103 60.777 1.00 22.43 ? 70   ILE A C   1 
ATOM   132  O  O   . ILE A 1 29  ? 20.102  32.891 59.734 1.00 22.12 ? 70   ILE A O   1 
ATOM   133  C  CB  . ILE A 1 29  ? 21.253  35.482 61.622 1.00 21.84 ? 70   ILE A CB  1 
ATOM   134  C  CG1 . ILE A 1 29  ? 20.780  36.627 62.555 1.00 21.27 ? 70   ILE A CG1 1 
ATOM   135  C  CG2 . ILE A 1 29  ? 21.415  35.958 60.150 1.00 21.56 ? 70   ILE A CG2 1 
ATOM   136  C  CD1 . ILE A 1 29  ? 21.787  37.747 62.628 1.00 22.15 ? 70   ILE A CD1 1 
ATOM   137  N  N   . LYS A 1 30  ? 21.747  32.331 61.175 1.00 21.18 ? 71   LYS A N   1 
ATOM   138  C  CA  . LYS A 1 30  ? 22.227  31.185 60.345 1.00 22.94 ? 71   LYS A CA  1 
ATOM   139  C  C   . LYS A 1 30  ? 21.113  30.150 60.128 1.00 23.01 ? 71   LYS A C   1 
ATOM   140  O  O   . LYS A 1 30  ? 20.852  29.721 58.978 1.00 23.74 ? 71   LYS A O   1 
ATOM   141  C  CB  . LYS A 1 30  ? 23.439  30.525 61.048 1.00 23.93 ? 71   LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 30  ? 24.033  29.368 60.244 1.00 24.72 ? 71   LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 30  ? 25.163  28.783 61.095 1.00 27.99 ? 71   LYS A CD  1 
ATOM   144  C  CE  . LYS A 1 30  ? 25.909  27.714 60.321 1.00 34.81 ? 71   LYS A CE  1 
ATOM   145  N  NZ  . LYS A 1 30  ? 26.992  27.140 61.196 1.00 31.96 ? 71   LYS A NZ  1 
ATOM   146  N  N   . LYS A 1 31  ? 20.394  29.780 61.183 1.00 23.22 ? 72   LYS A N   1 
ATOM   147  C  CA  . LYS A 1 31  ? 19.295  28.812 61.064 1.00 24.03 ? 72   LYS A CA  1 
ATOM   148  C  C   . LYS A 1 31  ? 18.159  29.313 60.170 1.00 23.09 ? 72   LYS A C   1 
ATOM   149  O  O   . LYS A 1 31  ? 17.661  28.595 59.322 1.00 21.96 ? 72   LYS A O   1 
ATOM   150  C  CB  . LYS A 1 31  ? 18.741  28.447 62.447 1.00 25.28 ? 72   LYS A CB  1 
ATOM   151  C  CG  . LYS A 1 31  ? 19.807  27.823 63.335 1.00 31.97 ? 72   LYS A CG  1 
ATOM   152  C  CD  . LYS A 1 31  ? 19.213  27.399 64.667 1.00 36.99 ? 72   LYS A CD  1 
ATOM   153  C  CE  . LYS A 1 31  ? 20.273  26.683 65.520 1.00 43.02 ? 72   LYS A CE  1 
ATOM   154  N  NZ  . LYS A 1 31  ? 19.837  26.720 66.953 1.00 45.02 ? 72   LYS A NZ  1 
ATOM   155  N  N   . PHE A 1 32  ? 17.790  30.593 60.321 1.00 21.83 ? 73   PHE A N   1 
ATOM   156  C  CA  . PHE A 1 32  ? 16.736  31.110 59.439 1.00 20.69 ? 73   PHE A CA  1 
ATOM   157  C  C   . PHE A 1 32  ? 17.172  31.177 57.959 1.00 19.76 ? 73   PHE A C   1 
ATOM   158  O  O   . PHE A 1 32  ? 16.389  30.859 57.019 1.00 20.81 ? 73   PHE A O   1 
ATOM   159  C  CB  . PHE A 1 32  ? 16.315  32.511 59.929 1.00 21.33 ? 73   PHE A CB  1 
ATOM   160  C  CG  . PHE A 1 32  ? 15.749  32.545 61.315 1.00 20.91 ? 73   PHE A CG  1 
ATOM   161  C  CD1 . PHE A 1 32  ? 15.006  31.462 61.839 1.00 22.82 ? 73   PHE A CD1 1 
ATOM   162  C  CD2 . PHE A 1 32  ? 15.964  33.668 62.131 1.00 19.00 ? 73   PHE A CD2 1 
ATOM   163  C  CE1 . PHE A 1 32  ? 14.467  31.513 63.135 1.00 25.37 ? 73   PHE A CE1 1 
ATOM   164  C  CE2 . PHE A 1 32  ? 15.430  33.731 63.429 1.00 21.92 ? 73   PHE A CE2 1 
ATOM   165  C  CZ  . PHE A 1 32  ? 14.688  32.674 63.931 1.00 23.65 ? 73   PHE A CZ  1 
ATOM   166  N  N   . LEU A 1 33  ? 18.398  31.594 57.736 1.00 19.43 ? 74   LEU A N   1 
ATOM   167  C  CA  . LEU A 1 33  ? 18.948  31.678 56.380 1.00 19.46 ? 74   LEU A CA  1 
ATOM   168  C  C   . LEU A 1 33  ? 18.901  30.285 55.728 1.00 19.77 ? 74   LEU A C   1 
ATOM   169  O  O   . LEU A 1 33  ? 18.382  30.131 54.648 1.00 20.16 ? 74   LEU A O   1 
ATOM   170  C  CB  . LEU A 1 33  ? 20.370  32.204 56.353 1.00 19.76 ? 74   LEU A CB  1 
ATOM   171  C  CG  . LEU A 1 33  ? 20.910  32.354 54.908 1.00 18.68 ? 74   LEU A CG  1 
ATOM   172  C  CD1 . LEU A 1 33  ? 20.121  33.424 54.044 1.00 22.34 ? 74   LEU A CD1 1 
ATOM   173  C  CD2 . LEU A 1 33  ? 22.384  32.629 54.851 1.00 21.65 ? 74   LEU A CD2 1 
ATOM   174  N  N   . TYR A 1 34  ? 19.400  29.270 56.438 1.00 21.94 ? 75   TYR A N   1 
ATOM   175  C  CA  . TYR A 1 34  ? 19.260  27.901 55.920 1.00 21.84 ? 75   TYR A CA  1 
ATOM   176  C  C   . TYR A 1 34  ? 17.797  27.582 55.594 1.00 21.93 ? 75   TYR A C   1 
ATOM   177  O  O   . TYR A 1 34  ? 17.495  27.064 54.529 1.00 22.85 ? 75   TYR A O   1 
ATOM   178  C  CB  . TYR A 1 34  ? 19.768  26.891 56.989 1.00 22.92 ? 75   TYR A CB  1 
ATOM   179  C  CG  . TYR A 1 34  ? 19.733  25.470 56.443 1.00 23.68 ? 75   TYR A CG  1 
ATOM   180  C  CD1 . TYR A 1 34  ? 20.762  25.015 55.615 1.00 26.61 ? 75   TYR A CD1 1 
ATOM   181  C  CD2 . TYR A 1 34  ? 18.646  24.645 56.706 1.00 29.50 ? 75   TYR A CD2 1 
ATOM   182  C  CE1 . TYR A 1 34  ? 20.738  23.723 55.096 1.00 27.31 ? 75   TYR A CE1 1 
ATOM   183  C  CE2 . TYR A 1 34  ? 18.601  23.351 56.190 1.00 28.92 ? 75   TYR A CE2 1 
ATOM   184  C  CZ  . TYR A 1 34  ? 19.649  22.916 55.389 1.00 29.29 ? 75   TYR A CZ  1 
ATOM   185  O  OH  . TYR A 1 34  ? 19.581  21.635 54.880 1.00 30.91 ? 75   TYR A OH  1 
ATOM   186  N  N   . ASN A 1 35  ? 16.891  27.894 56.510 1.00 20.74 ? 76   ASN A N   1 
ATOM   187  C  CA  . ASN A 1 35  ? 15.469  27.592 56.366 1.00 21.28 ? 76   ASN A CA  1 
ATOM   188  C  C   . ASN A 1 35  ? 14.831  28.281 55.149 1.00 19.78 ? 76   ASN A C   1 
ATOM   189  O  O   . ASN A 1 35  ? 13.919  27.714 54.535 1.00 19.52 ? 76   ASN A O   1 
ATOM   190  C  CB  . ASN A 1 35  ? 14.727  28.067 57.614 1.00 21.70 ? 76   ASN A CB  1 
ATOM   191  C  CG  . ASN A 1 35  ? 13.262  27.686 57.607 1.00 25.95 ? 76   ASN A CG  1 
ATOM   192  O  OD1 . ASN A 1 35  ? 12.384  28.472 57.213 1.00 23.97 ? 76   ASN A OD1 1 
ATOM   193  N  ND2 . ASN A 1 35  ? 12.984  26.431 58.014 1.00 28.83 ? 76   ASN A ND2 1 
ATOM   194  N  N   . PHE A 1 36  ? 15.329  29.481 54.809 1.00 20.13 ? 77   PHE A N   1 
ATOM   195  C  CA  . PHE A 1 36  ? 14.693  30.281 53.726 1.00 19.46 ? 77   PHE A CA  1 
ATOM   196  C  C   . PHE A 1 36  ? 15.284  30.008 52.333 1.00 19.80 ? 77   PHE A C   1 
ATOM   197  O  O   . PHE A 1 36  ? 14.828  30.586 51.348 1.00 19.36 ? 77   PHE A O   1 
ATOM   198  C  CB  . PHE A 1 36  ? 14.847  31.810 53.998 1.00 19.75 ? 77   PHE A CB  1 
ATOM   199  C  CG  . PHE A 1 36  ? 14.160  32.320 55.235 1.00 21.28 ? 77   PHE A CG  1 
ATOM   200  C  CD1 . PHE A 1 36  ? 13.207  31.554 55.927 1.00 19.58 ? 77   PHE A CD1 1 
ATOM   201  C  CD2 . PHE A 1 36  ? 14.458  33.638 55.695 1.00 18.45 ? 77   PHE A CD2 1 
ATOM   202  C  CE1 . PHE A 1 36  ? 12.552  32.074 57.070 1.00 19.83 ? 77   PHE A CE1 1 
ATOM   203  C  CE2 . PHE A 1 36  ? 13.828  34.166 56.865 1.00 19.51 ? 77   PHE A CE2 1 
ATOM   204  C  CZ  . PHE A 1 36  ? 12.895  33.405 57.541 1.00 20.12 ? 77   PHE A CZ  1 
ATOM   205  N  N   . THR A 1 37  ? 16.310  29.118 52.234 1.00 19.74 ? 78   THR A N   1 
ATOM   206  C  CA  . THR A 1 37  ? 17.049  29.053 51.005 1.00 19.28 ? 78   THR A CA  1 
ATOM   207  C  C   . THR A 1 37  ? 17.170  27.630 50.430 1.00 20.82 ? 78   THR A C   1 
ATOM   208  O  O   . THR A 1 37  ? 17.996  27.432 49.550 1.00 20.69 ? 78   THR A O   1 
ATOM   209  C  CB  . THR A 1 37  ? 18.460  29.574 51.215 1.00 20.84 ? 78   THR A CB  1 
ATOM   210  O  OG1 . THR A 1 37  ? 19.042  28.888 52.331 1.00 20.43 ? 78   THR A OG1 1 
ATOM   211  C  CG2 . THR A 1 37  ? 18.446  31.080 51.499 1.00 17.92 ? 78   THR A CG2 1 
ATOM   212  N  N   . GLN A 1 38  ? 16.301  26.728 50.887 1.00 21.03 ? 79   GLN A N   1 
ATOM   213  C  CA  . GLN A 1 38  ? 16.372  25.303 50.419 1.00 21.92 ? 79   GLN A CA  1 
ATOM   214  C  C   . GLN A 1 38  ? 15.687  25.083 49.092 1.00 23.65 ? 79   GLN A C   1 
ATOM   215  O  O   . GLN A 1 38  ? 16.030  24.132 48.360 1.00 24.34 ? 79   GLN A O   1 
ATOM   216  C  CB  . GLN A 1 38  ? 15.813  24.354 51.481 1.00 21.73 ? 79   GLN A CB  1 
ATOM   217  C  CG  . GLN A 1 38  ? 16.623  24.403 52.770 1.00 24.06 ? 79   GLN A CG  1 
ATOM   218  C  CD  . GLN A 1 38  ? 18.140  24.264 52.488 1.00 31.82 ? 79   GLN A CD  1 
ATOM   219  O  OE1 . GLN A 1 38  ? 18.572  23.189 52.038 1.00 34.93 ? 79   GLN A OE1 1 
ATOM   220  N  NE2 . GLN A 1 38  ? 18.939  25.330 52.720 1.00 31.49 ? 79   GLN A NE2 1 
ATOM   221  N  N   . ILE A 1 39  ? 14.678  25.921 48.776 1.00 22.51 ? 80   ILE A N   1 
ATOM   222  C  CA  . ILE A 1 39  ? 13.922  25.792 47.496 1.00 22.48 ? 80   ILE A CA  1 
ATOM   223  C  C   . ILE A 1 39  ? 13.760  27.210 46.954 1.00 21.46 ? 80   ILE A C   1 
ATOM   224  O  O   . ILE A 1 39  ? 13.864  28.167 47.766 1.00 19.59 ? 80   ILE A O   1 
ATOM   225  C  CB  . ILE A 1 39  ? 12.501  25.159 47.699 1.00 22.53 ? 80   ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 39  ? 11.600  26.041 48.586 1.00 22.38 ? 80   ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 39  ? 12.597  23.710 48.285 1.00 25.85 ? 80   ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 39  ? 10.164  25.544 48.708 1.00 24.72 ? 80   ILE A CD1 1 
ATOM   229  N  N   . PRO A 1 40  ? 13.513  27.352 45.641 1.00 21.02 ? 81   PRO A N   1 
ATOM   230  C  CA  . PRO A 1 40  ? 13.277  28.709 45.101 1.00 20.50 ? 81   PRO A CA  1 
ATOM   231  C  C   . PRO A 1 40  ? 11.993  29.307 45.662 1.00 20.82 ? 81   PRO A C   1 
ATOM   232  O  O   . PRO A 1 40  ? 11.005  28.589 45.976 1.00 20.28 ? 81   PRO A O   1 
ATOM   233  C  CB  . PRO A 1 40  ? 13.083  28.476 43.598 1.00 22.22 ? 81   PRO A CB  1 
ATOM   234  C  CG  . PRO A 1 40  ? 13.837  27.129 43.333 1.00 22.81 ? 81   PRO A CG  1 
ATOM   235  C  CD  . PRO A 1 40  ? 13.489  26.328 44.570 1.00 21.01 ? 81   PRO A CD  1 
ATOM   236  N  N   . HIS A 1 41  ? 12.016  30.653 45.755 1.00 18.60 ? 82   HIS A N   1 
ATOM   237  C  CA  . HIS A 1 41  ? 10.832  31.397 46.213 1.00 17.75 ? 82   HIS A CA  1 
ATOM   238  C  C   . HIS A 1 41  ? 10.465  32.511 45.221 1.00 18.12 ? 82   HIS A C   1 
ATOM   239  O  O   . HIS A 1 41  ? 10.358  33.697 45.622 1.00 18.13 ? 82   HIS A O   1 
ATOM   240  C  CB  . HIS A 1 41  ? 11.059  31.968 47.630 1.00 18.40 ? 82   HIS A CB  1 
ATOM   241  C  CG  . HIS A 1 41  ? 11.211  30.884 48.655 1.00 15.98 ? 82   HIS A CG  1 
ATOM   242  N  ND1 . HIS A 1 41  ? 12.436  30.565 49.199 1.00 19.61 ? 82   HIS A ND1 1 
ATOM   243  C  CD2 . HIS A 1 41  ? 10.323  29.983 49.146 1.00 18.55 ? 82   HIS A CD2 1 
ATOM   244  C  CE1 . HIS A 1 41  ? 12.275  29.575 50.070 1.00 19.61 ? 82   HIS A CE1 1 
ATOM   245  N  NE2 . HIS A 1 41  ? 11.015  29.182 50.032 1.00 19.58 ? 82   HIS A NE2 1 
ATOM   246  N  N   . LEU A 1 42  ? 10.314  32.152 43.958 1.00 18.01 ? 83   LEU A N   1 
ATOM   247  C  CA  . LEU A 1 42  ? 9.983   33.115 42.884 1.00 17.22 ? 83   LEU A CA  1 
ATOM   248  C  C   . LEU A 1 42  ? 8.661   33.758 43.162 1.00 17.09 ? 83   LEU A C   1 
ATOM   249  O  O   . LEU A 1 42  ? 7.692   33.115 43.535 1.00 18.09 ? 83   LEU A O   1 
ATOM   250  C  CB  . LEU A 1 42  ? 9.868   32.449 41.482 1.00 16.88 ? 83   LEU A CB  1 
ATOM   251  C  CG  . LEU A 1 42  ? 9.810   33.390 40.262 1.00 18.47 ? 83   LEU A CG  1 
ATOM   252  C  CD1 . LEU A 1 42  ? 11.032  34.255 40.121 1.00 19.02 ? 83   LEU A CD1 1 
ATOM   253  C  CD2 . LEU A 1 42  ? 9.737   32.372 38.934 1.00 18.24 ? 83   LEU A CD2 1 
ATOM   254  N  N   . ALA A 1 43  ? 8.603   35.079 42.960 1.00 16.71 ? 84   ALA A N   1 
ATOM   255  C  CA  . ALA A 1 43  ? 7.319   35.762 43.126 1.00 16.77 ? 84   ALA A CA  1 
ATOM   256  C  C   . ALA A 1 43  ? 6.208   35.141 42.285 1.00 18.10 ? 84   ALA A C   1 
ATOM   257  O  O   . ALA A 1 43  ? 6.419   34.791 41.103 1.00 17.68 ? 84   ALA A O   1 
ATOM   258  C  CB  . ALA A 1 43  ? 7.459   37.241 42.758 1.00 16.08 ? 84   ALA A CB  1 
ATOM   259  N  N   . GLY A 1 44  ? 5.055   34.976 42.918 1.00 17.51 ? 85   GLY A N   1 
ATOM   260  C  CA  . GLY A 1 44  ? 3.857   34.528 42.257 1.00 19.46 ? 85   GLY A CA  1 
ATOM   261  C  C   . GLY A 1 44  ? 3.781   33.015 42.227 1.00 21.18 ? 85   GLY A C   1 
ATOM   262  O  O   . GLY A 1 44  ? 2.849   32.474 41.606 1.00 23.08 ? 85   GLY A O   1 
ATOM   263  N  N   . THR A 1 45  ? 4.740   32.323 42.846 1.00 19.60 ? 86   THR A N   1 
ATOM   264  C  CA  . THR A 1 45  ? 4.689   30.842 42.850 1.00 20.32 ? 86   THR A CA  1 
ATOM   265  C  C   . THR A 1 45  ? 4.176   30.289 44.173 1.00 20.56 ? 86   THR A C   1 
ATOM   266  O  O   . THR A 1 45  ? 4.198   30.945 45.214 1.00 21.00 ? 86   THR A O   1 
ATOM   267  C  CB  . THR A 1 45  ? 6.096   30.211 42.545 1.00 19.43 ? 86   THR A CB  1 
ATOM   268  O  OG1 . THR A 1 45  ? 6.995   30.502 43.611 1.00 21.87 ? 86   THR A OG1 1 
ATOM   269  C  CG2 . THR A 1 45  ? 6.658   30.635 41.171 1.00 21.19 ? 86   THR A CG2 1 
ATOM   270  N  N   . GLU A 1 46  ? 3.721   29.023 44.172 1.00 21.75 ? 87   GLU A N   1 
ATOM   271  C  CA  . GLU A 1 46  ? 3.185   28.425 45.406 1.00 22.73 ? 87   GLU A CA  1 
ATOM   272  C  C   . GLU A 1 46  ? 4.170   28.363 46.581 1.00 22.43 ? 87   GLU A C   1 
ATOM   273  O  O   . GLU A 1 46  ? 3.790   28.586 47.739 1.00 22.11 ? 87   GLU A O   1 
ATOM   274  C  CB  . GLU A 1 46  ? 2.632   27.019 45.090 1.00 25.03 ? 87   GLU A CB  1 
ATOM   275  C  CG  . GLU A 1 46  ? 2.138   26.269 46.357 1.00 29.50 ? 87   GLU A CG  1 
ATOM   276  C  CD  . GLU A 1 46  ? 0.857   26.830 46.986 1.00 40.41 ? 87   GLU A CD  1 
ATOM   277  O  OE1 . GLU A 1 46  ? 0.564   26.466 48.156 1.00 43.14 ? 87   GLU A OE1 1 
ATOM   278  O  OE2 . GLU A 1 46  ? 0.128   27.610 46.329 1.00 43.78 ? 87   GLU A OE2 1 
ATOM   279  N  N   . GLN A 1 47  ? 5.444   28.084 46.267 1.00 21.98 ? 88   GLN A N   1 
ATOM   280  C  CA  . GLN A 1 47  ? 6.532   27.984 47.223 1.00 21.93 ? 88   GLN A CA  1 
ATOM   281  C  C   . GLN A 1 47  ? 6.704   29.334 47.949 1.00 20.28 ? 88   GLN A C   1 
ATOM   282  O  O   . GLN A 1 47  ? 6.971   29.364 49.147 1.00 19.65 ? 88   GLN A O   1 
ATOM   283  C  CB  A GLN A 1 47  ? 7.812   27.560 46.498 0.65 23.54 ? 88   GLN A CB  1 
ATOM   284  C  CB  B GLN A 1 47  ? 7.846   27.580 46.512 0.35 22.40 ? 88   GLN A CB  1 
ATOM   285  C  CG  A GLN A 1 47  ? 7.715   26.135 45.876 0.65 26.00 ? 88   GLN A CG  1 
ATOM   286  C  CG  B GLN A 1 47  ? 7.810   26.196 45.786 0.35 23.28 ? 88   GLN A CG  1 
ATOM   287  C  CD  A GLN A 1 47  ? 7.097   26.076 44.464 0.65 29.63 ? 88   GLN A CD  1 
ATOM   288  C  CD  B GLN A 1 47  ? 9.093   25.851 45.008 0.35 22.76 ? 88   GLN A CD  1 
ATOM   289  O  OE1 A GLN A 1 47  ? 6.639   27.067 43.895 0.65 22.81 ? 88   GLN A OE1 1 
ATOM   290  O  OE1 B GLN A 1 47  ? 9.639   26.676 44.267 0.35 20.77 ? 88   GLN A OE1 1 
ATOM   291  N  NE2 A GLN A 1 47  ? 7.098   24.871 43.888 0.65 31.08 ? 88   GLN A NE2 1 
ATOM   292  N  NE2 B GLN A 1 47  ? 9.561   24.598 45.157 0.35 25.22 ? 88   GLN A NE2 1 
ATOM   293  N  N   . ASN A 1 48  ? 6.509   30.435 47.209 1.00 18.80 ? 89   ASN A N   1 
ATOM   294  C  CA  . ASN A 1 48  ? 6.630   31.749 47.903 1.00 20.12 ? 89   ASN A CA  1 
ATOM   295  C  C   . ASN A 1 48  ? 5.417   32.102 48.777 1.00 20.75 ? 89   ASN A C   1 
ATOM   296  O  O   . ASN A 1 48  ? 5.592   32.779 49.821 1.00 21.41 ? 89   ASN A O   1 
ATOM   297  C  CB  . ASN A 1 48  ? 6.910   32.871 46.935 1.00 20.27 ? 89   ASN A CB  1 
ATOM   298  C  CG  . ASN A 1 48  ? 7.511   34.082 47.639 1.00 22.26 ? 89   ASN A CG  1 
ATOM   299  O  OD1 . ASN A 1 48  ? 8.308   33.944 48.613 1.00 22.57 ? 89   ASN A OD1 1 
ATOM   300  N  ND2 . ASN A 1 48  ? 7.239   35.249 47.111 1.00 22.17 ? 89   ASN A ND2 1 
ATOM   301  N  N   . PHE A 1 49  ? 4.217   31.660 48.373 1.00 20.53 ? 90   PHE A N   1 
ATOM   302  C  CA  . PHE A 1 49  ? 3.006   31.775 49.199 1.00 20.89 ? 90   PHE A CA  1 
ATOM   303  C  C   . PHE A 1 49  ? 3.176   30.941 50.468 1.00 20.49 ? 90   PHE A C   1 
ATOM   304  O  O   . PHE A 1 49  ? 2.947   31.412 51.613 1.00 20.69 ? 90   PHE A O   1 
ATOM   305  C  CB  A PHE A 1 49  ? 1.821   31.298 48.363 0.65 21.09 ? 90   PHE A CB  1 
ATOM   306  C  CB  B PHE A 1 49  ? 1.757   31.341 48.442 0.35 20.44 ? 90   PHE A CB  1 
ATOM   307  C  CG  A PHE A 1 49  ? 0.510   31.308 49.071 0.65 21.64 ? 90   PHE A CG  1 
ATOM   308  C  CG  B PHE A 1 49  ? 0.531   31.247 49.304 0.35 20.28 ? 90   PHE A CG  1 
ATOM   309  C  CD1 A PHE A 1 49  ? 0.216   32.273 50.045 0.65 21.91 ? 90   PHE A CD1 1 
ATOM   310  C  CD1 B PHE A 1 49  ? -0.034  32.394 49.865 0.35 21.13 ? 90   PHE A CD1 1 
ATOM   311  C  CD2 A PHE A 1 49  ? -0.451  30.351 48.738 0.65 22.72 ? 90   PHE A CD2 1 
ATOM   312  C  CD2 B PHE A 1 49  ? -0.060  30.011 49.555 0.35 20.09 ? 90   PHE A CD2 1 
ATOM   313  C  CE1 A PHE A 1 49  ? -1.022  32.304 50.665 0.65 22.15 ? 90   PHE A CE1 1 
ATOM   314  C  CE1 B PHE A 1 49  ? -1.168  32.329 50.650 0.35 19.37 ? 90   PHE A CE1 1 
ATOM   315  C  CE2 A PHE A 1 49  ? -1.692  30.343 49.388 0.65 26.42 ? 90   PHE A CE2 1 
ATOM   316  C  CE2 B PHE A 1 49  ? -1.204  29.930 50.336 0.35 18.73 ? 90   PHE A CE2 1 
ATOM   317  C  CZ  A PHE A 1 49  ? -1.979  31.313 50.340 0.65 24.52 ? 90   PHE A CZ  1 
ATOM   318  C  CZ  B PHE A 1 49  ? -1.761  31.081 50.896 0.35 20.40 ? 90   PHE A CZ  1 
ATOM   319  N  N   . GLN A 1 50  ? 3.726   29.717 50.298 1.00 20.76 ? 91   GLN A N   1 
ATOM   320  C  CA  . GLN A 1 50  ? 3.918   28.918 51.500 1.00 21.16 ? 91   GLN A CA  1 
ATOM   321  C  C   . GLN A 1 50  ? 4.919   29.556 52.475 1.00 19.53 ? 91   GLN A C   1 
ATOM   322  O  O   . GLN A 1 50  ? 4.737   29.537 53.686 1.00 20.62 ? 91   GLN A O   1 
ATOM   323  C  CB  . GLN A 1 50  ? 4.319   27.487 51.097 1.00 22.24 ? 91   GLN A CB  1 
ATOM   324  C  CG  . GLN A 1 50  ? 3.137   26.713 50.463 1.00 25.31 ? 91   GLN A CG  1 
ATOM   325  C  CD  . GLN A 1 50  ? 1.867   26.583 51.374 1.00 34.99 ? 91   GLN A CD  1 
ATOM   326  O  OE1 . GLN A 1 50  ? 1.941   26.480 52.614 1.00 39.44 ? 91   GLN A OE1 1 
ATOM   327  N  NE2 . GLN A 1 50  ? 0.701   26.558 50.731 1.00 38.47 ? 91   GLN A NE2 1 
ATOM   328  N  N   . LEU A 1 51  ? 6.007   30.128 51.949 1.00 18.92 ? 92   LEU A N   1 
ATOM   329  C  CA  . LEU A 1 51  ? 6.970   30.795 52.838 1.00 18.42 ? 92   LEU A CA  1 
ATOM   330  C  C   . LEU A 1 51  ? 6.270   32.010 53.510 1.00 17.94 ? 92   LEU A C   1 
ATOM   331  O  O   . LEU A 1 51  ? 6.507   32.287 54.703 1.00 19.01 ? 92   LEU A O   1 
ATOM   332  C  CB  . LEU A 1 51  ? 8.198   31.277 52.038 1.00 18.08 ? 92   LEU A CB  1 
ATOM   333  C  CG  . LEU A 1 51  ? 9.287   31.882 52.910 1.00 18.14 ? 92   LEU A CG  1 
ATOM   334  C  CD1 . LEU A 1 51  ? 9.814   30.922 54.062 1.00 21.46 ? 92   LEU A CD1 1 
ATOM   335  C  CD2 . LEU A 1 51  ? 10.474  32.331 52.114 1.00 20.21 ? 92   LEU A CD2 1 
ATOM   336  N  N   . ALA A 1 52  ? 5.468   32.756 52.743 1.00 18.45 ? 93   ALA A N   1 
ATOM   337  C  CA  . ALA A 1 52  ? 4.690   33.863 53.376 1.00 19.69 ? 93   ALA A CA  1 
ATOM   338  C  C   . ALA A 1 52  ? 3.877   33.413 54.598 1.00 19.61 ? 93   ALA A C   1 
ATOM   339  O  O   . ALA A 1 52  ? 3.866   34.060 55.649 1.00 20.01 ? 93   ALA A O   1 
ATOM   340  C  CB  . ALA A 1 52  ? 3.792   34.526 52.381 1.00 20.87 ? 93   ALA A CB  1 
ATOM   341  N  N   . LYS A 1 53  ? 3.179   32.306 54.434 1.00 21.08 ? 94   LYS A N   1 
ATOM   342  C  CA  . LYS A 1 53  ? 2.349   31.758 55.514 1.00 21.98 ? 94   LYS A CA  1 
ATOM   343  C  C   . LYS A 1 53  ? 3.221   31.308 56.705 1.00 20.40 ? 94   LYS A C   1 
ATOM   344  O  O   . LYS A 1 53  ? 2.838   31.428 57.887 1.00 19.29 ? 94   LYS A O   1 
ATOM   345  C  CB  . LYS A 1 53  ? 1.489   30.629 54.916 1.00 22.31 ? 94   LYS A CB  1 
ATOM   346  C  CG  . LYS A 1 53  ? 0.282   31.113 54.073 1.00 23.73 ? 94   LYS A CG  1 
ATOM   347  C  CD  . LYS A 1 53  ? -0.734  30.016 53.855 1.00 27.69 ? 94   LYS A CD  1 
ATOM   348  C  CE  . LYS A 1 53  ? -0.121  29.028 52.897 1.00 34.21 ? 94   LYS A CE  1 
ATOM   349  N  NZ  . LYS A 1 53  ? -1.095  28.070 52.249 1.00 38.90 ? 94   LYS A NZ  1 
ATOM   350  N  N   . GLN A 1 54  ? 4.385   30.746 56.397 1.00 20.05 ? 95   GLN A N   1 
ATOM   351  C  CA  . GLN A 1 54  ? 5.338   30.366 57.467 1.00 20.15 ? 95   GLN A CA  1 
ATOM   352  C  C   . GLN A 1 54  ? 5.817   31.569 58.299 1.00 20.57 ? 95   GLN A C   1 
ATOM   353  O  O   . GLN A 1 54  ? 5.798   31.557 59.536 1.00 21.39 ? 95   GLN A O   1 
ATOM   354  C  CB  . GLN A 1 54  ? 6.531   29.604 56.867 1.00 20.07 ? 95   GLN A CB  1 
ATOM   355  C  CG  . GLN A 1 54  ? 7.552   29.281 57.957 1.00 20.96 ? 95   GLN A CG  1 
ATOM   356  C  CD  . GLN A 1 54  ? 8.919   28.926 57.398 1.00 20.89 ? 95   GLN A CD  1 
ATOM   357  O  OE1 . GLN A 1 54  ? 9.024   28.215 56.382 1.00 23.83 ? 95   GLN A OE1 1 
ATOM   358  N  NE2 . GLN A 1 54  ? 9.955   29.425 58.037 1.00 21.79 ? 95   GLN A NE2 1 
ATOM   359  N  N   . ILE A 1 55  ? 6.220   32.632 57.595 1.00 19.53 ? 96   ILE A N   1 
ATOM   360  C  CA  . ILE A 1 55  ? 6.641   33.861 58.244 1.00 20.12 ? 96   ILE A CA  1 
ATOM   361  C  C   . ILE A 1 55  ? 5.493   34.465 59.042 1.00 18.41 ? 96   ILE A C   1 
ATOM   362  O  O   . ILE A 1 55  ? 5.691   34.858 60.193 1.00 20.30 ? 96   ILE A O   1 
ATOM   363  C  CB  . ILE A 1 55  ? 7.184   34.867 57.197 1.00 18.92 ? 96   ILE A CB  1 
ATOM   364  C  CG1 A ILE A 1 55  ? 8.357   34.281 56.411 0.65 21.21 ? 96   ILE A CG1 1 
ATOM   365  C  CG1 B ILE A 1 55  ? 8.455   34.250 56.588 0.35 19.03 ? 96   ILE A CG1 1 
ATOM   366  C  CG2 . ILE A 1 55  ? 7.582   36.251 57.826 1.00 20.29 ? 96   ILE A CG2 1 
ATOM   367  C  CD1 A ILE A 1 55  ? 9.583   34.110 57.224 0.65 21.70 ? 96   ILE A CD1 1 
ATOM   368  C  CD1 B ILE A 1 55  ? 9.005   34.904 55.341 0.35 13.32 ? 96   ILE A CD1 1 
ATOM   369  N  N   . GLN A 1 56  ? 4.302   34.480 58.469 1.00 19.92 ? 97   GLN A N   1 
ATOM   370  C  CA  . GLN A 1 56  ? 3.138   34.986 59.204 1.00 19.94 ? 97   GLN A CA  1 
ATOM   371  C  C   . GLN A 1 56  ? 2.949   34.211 60.541 1.00 21.28 ? 97   GLN A C   1 
ATOM   372  O  O   . GLN A 1 56  ? 2.822   34.809 61.620 1.00 22.34 ? 97   GLN A O   1 
ATOM   373  C  CB  . GLN A 1 56  ? 1.921   34.942 58.329 1.00 20.71 ? 97   GLN A CB  1 
ATOM   374  C  CG  . GLN A 1 56  ? 0.658   35.335 59.070 1.00 20.31 ? 97   GLN A CG  1 
ATOM   375  C  CD  . GLN A 1 56  ? -0.598  35.080 58.286 1.00 20.42 ? 97   GLN A CD  1 
ATOM   376  O  OE1 . GLN A 1 56  ? -0.699  34.147 57.446 1.00 22.15 ? 97   GLN A OE1 1 
ATOM   377  N  NE2 . GLN A 1 56  ? -1.608  35.903 58.560 1.00 23.50 ? 97   GLN A NE2 1 
ATOM   378  N  N   . SER A 1 57  ? 3.006   32.891 60.458 1.00 21.96 ? 98   SER A N   1 
ATOM   379  C  CA  . SER A 1 57  ? 2.883   32.076 61.683 1.00 23.03 ? 98   SER A CA  1 
ATOM   380  C  C   . SER A 1 57  ? 3.984   32.331 62.707 1.00 22.26 ? 98   SER A C   1 
ATOM   381  O  O   . SER A 1 57  ? 3.739   32.425 63.918 1.00 23.43 ? 98   SER A O   1 
ATOM   382  C  CB  . SER A 1 57  ? 2.920   30.587 61.284 1.00 22.58 ? 98   SER A CB  1 
ATOM   383  O  OG  A SER A 1 57  ? 2.716   29.838 62.462 0.50 21.43 ? 98   SER A OG  1 
ATOM   384  O  OG  B SER A 1 57  ? 1.660   30.175 60.834 0.50 25.25 ? 98   SER A OG  1 
ATOM   385  N  N   . GLN A 1 58  ? 5.223   32.410 62.229 1.00 21.14 ? 99   GLN A N   1 
ATOM   386  C  CA  . GLN A 1 58  ? 6.330   32.589 63.111 1.00 20.92 ? 99   GLN A CA  1 
ATOM   387  C  C   . GLN A 1 58  ? 6.295   33.961 63.771 1.00 21.67 ? 99   GLN A C   1 
ATOM   388  O  O   . GLN A 1 58  ? 6.593   34.113 64.946 1.00 21.54 ? 99   GLN A O   1 
ATOM   389  C  CB  . GLN A 1 58  ? 7.646   32.333 62.400 1.00 22.88 ? 99   GLN A CB  1 
ATOM   390  C  CG  . GLN A 1 58  ? 7.790   30.856 61.982 1.00 24.39 ? 99   GLN A CG  1 
ATOM   391  C  CD  . GLN A 1 58  ? 9.188   30.558 61.440 1.00 29.59 ? 99   GLN A CD  1 
ATOM   392  O  OE1 . GLN A 1 58  ? 9.577   31.037 60.374 1.00 27.68 ? 99   GLN A OE1 1 
ATOM   393  N  NE2 . GLN A 1 58  ? 9.940   29.742 62.174 1.00 35.09 ? 99   GLN A NE2 1 
ATOM   394  N  N   . TRP A 1 59  ? 5.997   35.011 62.992 1.00 19.86 ? 100  TRP A N   1 
ATOM   395  C  CA  . TRP A 1 59  ? 5.905   36.342 63.614 1.00 20.44 ? 100  TRP A CA  1 
ATOM   396  C  C   . TRP A 1 59  ? 4.830   36.431 64.708 1.00 20.76 ? 100  TRP A C   1 
ATOM   397  O  O   . TRP A 1 59  ? 4.993   37.180 65.665 1.00 21.10 ? 100  TRP A O   1 
ATOM   398  C  CB  . TRP A 1 59  ? 5.654   37.387 62.489 1.00 19.87 ? 100  TRP A CB  1 
ATOM   399  C  CG  . TRP A 1 59  ? 6.887   37.684 61.708 1.00 19.01 ? 100  TRP A CG  1 
ATOM   400  C  CD1 . TRP A 1 59  ? 8.138   37.042 61.762 1.00 20.20 ? 100  TRP A CD1 1 
ATOM   401  C  CD2 . TRP A 1 59  ? 7.005   38.682 60.671 1.00 18.32 ? 100  TRP A CD2 1 
ATOM   402  N  NE1 . TRP A 1 59  ? 8.998   37.595 60.836 1.00 19.46 ? 100  TRP A NE1 1 
ATOM   403  C  CE2 . TRP A 1 59  ? 8.341   38.597 60.157 1.00 18.38 ? 100  TRP A CE2 1 
ATOM   404  C  CE3 . TRP A 1 59  ? 6.102   39.614 60.124 1.00 19.58 ? 100  TRP A CE3 1 
ATOM   405  C  CZ2 . TRP A 1 59  ? 8.817   39.425 59.151 1.00 18.46 ? 100  TRP A CZ2 1 
ATOM   406  C  CZ3 . TRP A 1 59  ? 6.585   40.468 59.069 1.00 17.26 ? 100  TRP A CZ3 1 
ATOM   407  C  CH2 . TRP A 1 59  ? 7.923   40.342 58.605 1.00 19.15 ? 100  TRP A CH2 1 
ATOM   408  N  N   . LYS A 1 60  ? 3.729   35.725 64.516 1.00 21.74 ? 101  LYS A N   1 
ATOM   409  C  CA  . LYS A 1 60  ? 2.661   35.574 65.557 1.00 24.37 ? 101  LYS A CA  1 
ATOM   410  C  C   . LYS A 1 60  ? 3.264   34.889 66.785 1.00 25.61 ? 101  LYS A C   1 
ATOM   411  O  O   . LYS A 1 60  ? 3.203   35.417 67.905 1.00 25.40 ? 101  LYS A O   1 
ATOM   412  C  CB  . LYS A 1 60  ? 1.490   34.786 65.015 1.00 26.11 ? 101  LYS A CB  1 
ATOM   413  C  CG  . LYS A 1 60  ? 0.613   35.604 64.173 1.00 28.23 ? 101  LYS A CG  1 
ATOM   414  C  CD  . LYS A 1 60  ? -0.485  34.795 63.524 1.00 33.60 ? 101  LYS A CD  1 
ATOM   415  C  CE  . LYS A 1 60  ? -1.462  35.734 62.810 1.00 34.02 ? 101  LYS A CE  1 
ATOM   416  N  NZ  . LYS A 1 60  ? -2.518  34.955 62.121 1.00 40.82 ? 101  LYS A NZ  1 
ATOM   417  N  N   . GLU A 1 61  ? 3.938   33.759 66.556 1.00 25.26 ? 102  GLU A N   1 
ATOM   418  C  CA  . GLU A 1 61  ? 4.582   33.017 67.642 1.00 26.75 ? 102  GLU A CA  1 
ATOM   419  C  C   . GLU A 1 61  ? 5.628   33.884 68.360 1.00 25.85 ? 102  GLU A C   1 
ATOM   420  O  O   . GLU A 1 61  ? 5.779   33.831 69.593 1.00 27.39 ? 102  GLU A O   1 
ATOM   421  C  CB  . GLU A 1 61  ? 5.228   31.711 67.129 1.00 26.80 ? 102  GLU A CB  1 
ATOM   422  C  CG  A GLU A 1 61  ? 4.358   30.789 66.251 0.50 28.74 ? 102  GLU A CG  1 
ATOM   423  C  CG  B GLU A 1 61  ? 5.868   30.893 68.250 0.50 29.00 ? 102  GLU A CG  1 
ATOM   424  C  CD  A GLU A 1 61  ? 5.150   29.762 65.379 0.50 28.82 ? 102  GLU A CD  1 
ATOM   425  C  CD  B GLU A 1 61  ? 6.171   29.462 67.837 0.50 33.71 ? 102  GLU A CD  1 
ATOM   426  O  OE1 A GLU A 1 61  ? 6.374   29.568 65.583 0.50 31.66 ? 102  GLU A OE1 1 
ATOM   427  O  OE1 B GLU A 1 61  ? 5.488   28.935 66.929 0.50 35.62 ? 102  GLU A OE1 1 
ATOM   428  O  OE2 A GLU A 1 61  ? 4.537   29.142 64.463 0.50 32.00 ? 102  GLU A OE2 1 
ATOM   429  O  OE2 B GLU A 1 61  ? 7.084   28.858 68.443 0.50 36.71 ? 102  GLU A OE2 1 
ATOM   430  N  N   . PHE A 1 62  ? 6.356   34.726 67.612 1.00 24.11 ? 103  PHE A N   1 
ATOM   431  C  CA  . PHE A 1 62  ? 7.383   35.566 68.207 1.00 23.64 ? 103  PHE A CA  1 
ATOM   432  C  C   . PHE A 1 62  ? 6.818   36.671 69.118 1.00 22.61 ? 103  PHE A C   1 
ATOM   433  O  O   . PHE A 1 62  ? 7.570   37.269 69.850 1.00 24.00 ? 103  PHE A O   1 
ATOM   434  C  CB  . PHE A 1 62  ? 8.235   36.254 67.136 1.00 24.12 ? 103  PHE A CB  1 
ATOM   435  C  CG  . PHE A 1 62  ? 9.153   35.324 66.351 1.00 23.82 ? 103  PHE A CG  1 
ATOM   436  C  CD1 . PHE A 1 62  ? 9.427   34.001 66.764 1.00 23.30 ? 103  PHE A CD1 1 
ATOM   437  C  CD2 . PHE A 1 62  ? 9.752   35.793 65.175 1.00 21.25 ? 103  PHE A CD2 1 
ATOM   438  C  CE1 . PHE A 1 62  ? 10.319  33.166 65.958 1.00 25.40 ? 103  PHE A CE1 1 
ATOM   439  C  CE2 . PHE A 1 62  ? 10.649  34.980 64.348 1.00 25.15 ? 103  PHE A CE2 1 
ATOM   440  C  CZ  . PHE A 1 62  ? 10.923  33.670 64.742 1.00 25.35 ? 103  PHE A CZ  1 
ATOM   441  N  N   . GLY A 1 63  ? 5.538   37.001 68.985 1.00 23.94 ? 104  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 63  ? 4.937   37.967 69.897 1.00 24.74 ? 104  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 63  ? 4.225   39.167 69.289 1.00 24.54 ? 104  GLY A C   1 
ATOM   444  O  O   . GLY A 1 63  ? 3.624   39.961 70.035 1.00 25.12 ? 104  GLY A O   1 
ATOM   445  N  N   . LEU A 1 64  ? 4.279   39.321 67.957 1.00 24.37 ? 105  LEU A N   1 
ATOM   446  C  CA  . LEU A 1 64  ? 3.622   40.505 67.385 1.00 22.78 ? 105  LEU A CA  1 
ATOM   447  C  C   . LEU A 1 64  ? 2.117   40.525 67.664 1.00 22.83 ? 105  LEU A C   1 
ATOM   448  O  O   . LEU A 1 64  ? 1.412   39.481 67.682 1.00 24.55 ? 105  LEU A O   1 
ATOM   449  C  CB  . LEU A 1 64  ? 3.904   40.564 65.867 1.00 22.24 ? 105  LEU A CB  1 
ATOM   450  C  CG  . LEU A 1 64  ? 5.391   40.779 65.518 1.00 19.82 ? 105  LEU A CG  1 
ATOM   451  C  CD1 . LEU A 1 64  ? 5.503   41.103 63.975 1.00 18.86 ? 105  LEU A CD1 1 
ATOM   452  C  CD2 . LEU A 1 64  ? 6.198   41.806 66.312 1.00 18.48 ? 105  LEU A CD2 1 
ATOM   453  N  N   . ASP A 1 65  ? 1.580   41.750 67.813 1.00 24.20 ? 106  ASP A N   1 
ATOM   454  C  CA  . ASP A 1 65  ? 0.147   41.935 68.085 1.00 24.74 ? 106  ASP A CA  1 
ATOM   455  C  C   . ASP A 1 65  ? -0.775  41.488 66.994 1.00 25.08 ? 106  ASP A C   1 
ATOM   456  O  O   . ASP A 1 65  ? -1.842  40.939 67.240 1.00 26.09 ? 106  ASP A O   1 
ATOM   457  C  CB  . ASP A 1 65  ? -0.137  43.410 68.377 1.00 23.70 ? 106  ASP A CB  1 
ATOM   458  C  CG  . ASP A 1 65  ? 0.560   43.877 69.610 1.00 25.92 ? 106  ASP A CG  1 
ATOM   459  O  OD1 . ASP A 1 65  ? 0.219   43.303 70.685 1.00 29.09 ? 106  ASP A OD1 1 
ATOM   460  O  OD2 . ASP A 1 65  ? 1.473   44.706 69.540 1.00 23.16 ? 106  ASP A OD2 1 
ATOM   461  N  N   . SER A 1 66  ? -0.385  41.754 65.748 1.00 22.00 ? 107  SER A N   1 
ATOM   462  C  CA  . SER A 1 66  ? -1.183  41.312 64.615 1.00 21.89 ? 107  SER A CA  1 
ATOM   463  C  C   . SER A 1 66  ? -0.223  40.971 63.445 1.00 20.08 ? 107  SER A C   1 
ATOM   464  O  O   . SER A 1 66  ? 0.861   41.581 63.333 1.00 20.05 ? 107  SER A O   1 
ATOM   465  C  CB  . SER A 1 66  ? -2.189  42.431 64.302 1.00 23.51 ? 107  SER A CB  1 
ATOM   466  O  OG  A SER A 1 66  ? -1.615  43.548 63.690 0.50 21.93 ? 107  SER A OG  1 
ATOM   467  O  OG  B SER A 1 66  ? -2.528  42.482 62.950 0.50 23.04 ? 107  SER A OG  1 
ATOM   468  N  N   . VAL A 1 67  ? -0.576  39.964 62.646 1.00 19.48 ? 108  VAL A N   1 
ATOM   469  C  CA  . VAL A 1 67  ? 0.289   39.654 61.470 1.00 19.37 ? 108  VAL A CA  1 
ATOM   470  C  C   . VAL A 1 67  ? -0.652  39.222 60.379 1.00 20.44 ? 108  VAL A C   1 
ATOM   471  O  O   . VAL A 1 67  ? -1.383  38.216 60.518 1.00 20.84 ? 108  VAL A O   1 
ATOM   472  C  CB  . VAL A 1 67  ? 1.355   38.521 61.709 1.00 20.94 ? 108  VAL A CB  1 
ATOM   473  C  CG1 . VAL A 1 67  ? 2.280   38.497 60.534 1.00 20.27 ? 108  VAL A CG1 1 
ATOM   474  C  CG2 . VAL A 1 67  ? 2.149   38.785 62.923 1.00 18.53 ? 108  VAL A CG2 1 
ATOM   475  N  N   . GLU A 1 68  ? -0.683  39.987 59.292 1.00 20.07 ? 109  GLU A N   1 
ATOM   476  C  CA  . GLU A 1 68  ? -1.669  39.728 58.261 1.00 21.36 ? 109  GLU A CA  1 
ATOM   477  C  C   . GLU A 1 68  ? -0.984  39.573 56.918 1.00 20.55 ? 109  GLU A C   1 
ATOM   478  O  O   . GLU A 1 68  ? 0.122   40.087 56.771 1.00 22.18 ? 109  GLU A O   1 
ATOM   479  C  CB  . GLU A 1 68  ? -2.666  40.893 58.142 1.00 24.42 ? 109  GLU A CB  1 
ATOM   480  C  CG  . GLU A 1 68  ? -3.537  41.133 59.414 1.00 28.79 ? 109  GLU A CG  1 
ATOM   481  C  CD  . GLU A 1 68  ? -4.374  39.902 59.836 1.00 39.44 ? 109  GLU A CD  1 
ATOM   482  O  OE1 . GLU A 1 68  ? -4.917  39.170 58.965 1.00 41.12 ? 109  GLU A OE1 1 
ATOM   483  O  OE2 . GLU A 1 68  ? -4.501  39.665 61.072 1.00 44.83 ? 109  GLU A OE2 1 
ATOM   484  N  N   . LEU A 1 69  ? -1.613  38.865 55.973 1.00 20.13 ? 110  LEU A N   1 
ATOM   485  C  CA  . LEU A 1 69  ? -1.130  38.855 54.594 1.00 20.93 ? 110  LEU A CA  1 
ATOM   486  C  C   . LEU A 1 69  ? -1.911  39.938 53.852 1.00 21.02 ? 110  LEU A C   1 
ATOM   487  O  O   . LEU A 1 69  ? -3.154  40.003 53.967 1.00 23.25 ? 110  LEU A O   1 
ATOM   488  C  CB  . LEU A 1 69  ? -1.384  37.529 53.858 1.00 21.78 ? 110  LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 69  ? -0.603  36.338 54.456 1.00 24.33 ? 110  LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 69  ? -0.863  35.148 53.545 1.00 25.60 ? 110  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 69  ? 0.850   36.579 54.611 1.00 25.38 ? 110  LEU A CD2 1 
ATOM   492  N  N   . ALA A 1 70  ? -1.203  40.776 53.100 1.00 18.88 ? 111  ALA A N   1 
ATOM   493  C  CA  . ALA A 1 70  ? -1.858  41.754 52.177 1.00 18.87 ? 111  ALA A CA  1 
ATOM   494  C  C   . ALA A 1 70  ? -1.559  41.285 50.778 1.00 17.99 ? 111  ALA A C   1 
ATOM   495  O  O   . ALA A 1 70  ? -0.371  41.212 50.407 1.00 21.11 ? 111  ALA A O   1 
ATOM   496  C  CB  . ALA A 1 70  ? -1.292  43.165 52.368 1.00 18.91 ? 111  ALA A CB  1 
ATOM   497  N  N   . HIS A 1 71  ? -2.586  40.924 50.018 1.00 17.94 ? 112  HIS A N   1 
ATOM   498  C  CA  . HIS A 1 71  ? -2.295  40.388 48.687 1.00 17.93 ? 112  HIS A CA  1 
ATOM   499  C  C   . HIS A 1 71  ? -2.771  41.370 47.605 1.00 18.34 ? 112  HIS A C   1 
ATOM   500  O  O   . HIS A 1 71  ? -3.676  42.201 47.862 1.00 18.69 ? 112  HIS A O   1 
ATOM   501  C  CB  . HIS A 1 71  ? -2.957  39.015 48.502 1.00 19.48 ? 112  HIS A CB  1 
ATOM   502  C  CG  . HIS A 1 71  ? -4.449  39.067 48.522 1.00 22.16 ? 112  HIS A CG  1 
ATOM   503  N  ND1 . HIS A 1 71  ? -5.194  38.854 49.670 1.00 26.55 ? 112  HIS A ND1 1 
ATOM   504  C  CD2 . HIS A 1 71  ? -5.337  39.307 47.528 1.00 22.87 ? 112  HIS A CD2 1 
ATOM   505  C  CE1 . HIS A 1 71  ? -6.480  38.953 49.369 1.00 24.45 ? 112  HIS A CE1 1 
ATOM   506  N  NE2 . HIS A 1 71  ? -6.595  39.209 48.081 1.00 27.82 ? 112  HIS A NE2 1 
ATOM   507  N  N   . TYR A 1 72  ? -2.184  41.234 46.415 1.00 17.87 ? 113  TYR A N   1 
ATOM   508  C  CA  . TYR A 1 72  ? -2.478  42.072 45.255 1.00 17.12 ? 113  TYR A CA  1 
ATOM   509  C  C   . TYR A 1 72  ? -2.334  41.212 44.043 1.00 17.15 ? 113  TYR A C   1 
ATOM   510  O  O   . TYR A 1 72  ? -1.561  40.238 44.095 1.00 16.76 ? 113  TYR A O   1 
ATOM   511  C  CB  . TYR A 1 72  ? -1.499  43.274 45.156 1.00 17.04 ? 113  TYR A CB  1 
ATOM   512  C  CG  . TYR A 1 72  ? -1.471  44.063 46.427 1.00 16.96 ? 113  TYR A CG  1 
ATOM   513  C  CD1 . TYR A 1 72  ? -2.418  45.064 46.628 1.00 16.35 ? 113  TYR A CD1 1 
ATOM   514  C  CD2 . TYR A 1 72  ? -0.558  43.766 47.420 1.00 16.51 ? 113  TYR A CD2 1 
ATOM   515  C  CE1 . TYR A 1 72  ? -2.509  45.748 47.837 1.00 19.03 ? 113  TYR A CE1 1 
ATOM   516  C  CE2 . TYR A 1 72  ? -0.575  44.446 48.610 1.00 20.22 ? 113  TYR A CE2 1 
ATOM   517  C  CZ  . TYR A 1 72  ? -1.582  45.423 48.817 1.00 18.52 ? 113  TYR A CZ  1 
ATOM   518  O  OH  . TYR A 1 72  ? -1.521  46.050 50.050 1.00 20.23 ? 113  TYR A OH  1 
ATOM   519  N  N   . ASP A 1 73  ? -2.998  41.597 42.965 1.00 16.75 ? 114  ASP A N   1 
ATOM   520  C  CA  . ASP A 1 73  ? -2.871  40.889 41.664 1.00 17.15 ? 114  ASP A CA  1 
ATOM   521  C  C   . ASP A 1 73  ? -2.197  41.782 40.679 1.00 17.32 ? 114  ASP A C   1 
ATOM   522  O  O   . ASP A 1 73  ? -2.805  42.740 40.189 1.00 17.20 ? 114  ASP A O   1 
ATOM   523  C  CB  . ASP A 1 73  ? -4.254  40.466 41.145 1.00 18.52 ? 114  ASP A CB  1 
ATOM   524  C  CG  . ASP A 1 73  ? -4.958  39.513 42.106 1.00 22.05 ? 114  ASP A CG  1 
ATOM   525  O  OD1 . ASP A 1 73  ? -4.328  38.535 42.519 1.00 22.97 ? 114  ASP A OD1 1 
ATOM   526  O  OD2 . ASP A 1 73  ? -6.139  39.784 42.485 1.00 26.24 ? 114  ASP A OD2 1 
ATOM   527  N  N   . VAL A 1 74  ? -0.944  41.455 40.393 1.00 16.83 ? 115  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 74  ? -0.083  42.351 39.624 1.00 16.23 ? 115  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 74  ? 0.533   41.680 38.392 1.00 17.59 ? 115  VAL A C   1 
ATOM   530  O  O   . VAL A 1 74  ? 0.590   40.434 38.319 1.00 18.14 ? 115  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 74  ? 1.128   42.832 40.484 1.00 16.33 ? 115  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 74  ? 0.617   43.628 41.697 1.00 15.38 ? 115  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 74  ? 2.049   41.657 40.993 1.00 17.29 ? 115  VAL A CG2 1 
ATOM   534  N  N   . LEU A 1 75  ? 0.960   42.501 37.444 1.00 16.33 ? 116  LEU A N   1 
ATOM   535  C  CA  . LEU A 1 75  ? 1.561   41.918 36.221 1.00 15.57 ? 116  LEU A CA  1 
ATOM   536  C  C   . LEU A 1 75  ? 2.928   41.344 36.505 1.00 15.96 ? 116  LEU A C   1 
ATOM   537  O  O   . LEU A 1 75  ? 3.868   42.076 36.931 1.00 16.82 ? 116  LEU A O   1 
ATOM   538  C  CB  . LEU A 1 75  ? 1.659   42.926 35.100 1.00 14.93 ? 116  LEU A CB  1 
ATOM   539  C  CG  . LEU A 1 75  ? 2.004   42.350 33.724 1.00 16.96 ? 116  LEU A CG  1 
ATOM   540  C  CD1 . LEU A 1 75  ? 0.720   41.693 33.163 1.00 19.66 ? 116  LEU A CD1 1 
ATOM   541  C  CD2 . LEU A 1 75  ? 2.420   43.453 32.807 1.00 18.43 ? 116  LEU A CD2 1 
ATOM   542  N  N   . LEU A 1 76  ? 3.064   40.006 36.333 1.00 16.45 ? 117  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 76  ? 4.416   39.377 36.393 1.00 16.11 ? 117  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 76  ? 4.796   38.791 35.021 1.00 17.11 ? 117  LEU A C   1 
ATOM   545  O  O   . LEU A 1 76  ? 4.067   38.980 34.031 1.00 19.57 ? 117  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 76  ? 4.544   38.321 37.475 1.00 16.41 ? 117  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 76  ? 4.188   38.707 38.928 1.00 16.85 ? 117  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 76  ? 4.327   37.522 39.889 1.00 17.39 ? 117  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 76  ? 5.081   39.892 39.385 1.00 18.49 ? 117  LEU A CD2 1 
ATOM   550  N  N   . SER A 1 77  ? 5.997   38.216 34.959 1.00 17.82 ? 118  SER A N   1 
ATOM   551  C  CA  . SER A 1 77  ? 6.534   37.737 33.675 1.00 18.85 ? 118  SER A CA  1 
ATOM   552  C  C   . SER A 1 77  ? 7.336   36.458 33.885 1.00 19.68 ? 118  SER A C   1 
ATOM   553  O  O   . SER A 1 77  ? 8.196   36.423 34.738 1.00 18.47 ? 118  SER A O   1 
ATOM   554  C  CB  . SER A 1 77  ? 7.393   38.834 33.039 1.00 21.03 ? 118  SER A CB  1 
ATOM   555  O  OG  . SER A 1 77  ? 8.276   38.342 31.993 1.00 21.07 ? 118  SER A OG  1 
ATOM   556  N  N   . TYR A 1 78  ? 7.110   35.440 33.018 1.00 19.76 ? 119  TYR A N   1 
ATOM   557  C  CA  . TYR A 1 78  ? 7.765   34.138 33.198 1.00 20.74 ? 119  TYR A CA  1 
ATOM   558  C  C   . TYR A 1 78  ? 8.079   33.523 31.846 1.00 20.96 ? 119  TYR A C   1 
ATOM   559  O  O   . TYR A 1 78  ? 7.317   33.728 30.892 1.00 22.19 ? 119  TYR A O   1 
ATOM   560  C  CB  . TYR A 1 78  ? 6.829   33.168 33.856 1.00 20.24 ? 119  TYR A CB  1 
ATOM   561  C  CG  . TYR A 1 78  ? 6.339   33.525 35.229 1.00 18.98 ? 119  TYR A CG  1 
ATOM   562  C  CD1 . TYR A 1 78  ? 7.201   33.476 36.348 1.00 19.81 ? 119  TYR A CD1 1 
ATOM   563  C  CD2 . TYR A 1 78  ? 4.988   33.880 35.409 1.00 21.96 ? 119  TYR A CD2 1 
ATOM   564  C  CE1 . TYR A 1 78  ? 6.691   33.767 37.651 1.00 18.31 ? 119  TYR A CE1 1 
ATOM   565  C  CE2 . TYR A 1 78  ? 4.498   34.171 36.684 1.00 22.89 ? 119  TYR A CE2 1 
ATOM   566  C  CZ  . TYR A 1 78  ? 5.348   34.092 37.777 1.00 19.84 ? 119  TYR A CZ  1 
ATOM   567  O  OH  . TYR A 1 78  ? 4.890   34.347 39.062 1.00 21.65 ? 119  TYR A OH  1 
ATOM   568  N  N   . PRO A 1 79  ? 9.216   32.815 31.766 1.00 22.98 ? 120  PRO A N   1 
ATOM   569  C  CA  . PRO A 1 79  ? 9.484   32.121 30.477 1.00 23.37 ? 120  PRO A CA  1 
ATOM   570  C  C   . PRO A 1 79  ? 8.375   31.094 30.217 1.00 24.35 ? 120  PRO A C   1 
ATOM   571  O  O   . PRO A 1 79  ? 7.691   30.652 31.134 1.00 23.45 ? 120  PRO A O   1 
ATOM   572  C  CB  . PRO A 1 79  ? 10.845  31.429 30.706 1.00 23.53 ? 120  PRO A CB  1 
ATOM   573  C  CG  . PRO A 1 79  ? 11.448  31.987 31.941 1.00 24.78 ? 120  PRO A CG  1 
ATOM   574  C  CD  . PRO A 1 79  ? 10.278  32.605 32.766 1.00 21.09 ? 120  PRO A CD  1 
ATOM   575  N  N   . ASN A 1 80  ? 8.213   30.705 28.948 1.00 25.18 ? 121  ASN A N   1 
ATOM   576  C  CA  . ASN A 1 80  ? 7.318   29.614 28.581 1.00 27.80 ? 121  ASN A CA  1 
ATOM   577  C  C   . ASN A 1 80  ? 8.067   28.289 28.814 1.00 29.02 ? 121  ASN A C   1 
ATOM   578  O  O   . ASN A 1 80  ? 9.069   28.061 28.164 1.00 27.75 ? 121  ASN A O   1 
ATOM   579  C  CB  . ASN A 1 80  ? 6.960   29.762 27.112 1.00 27.70 ? 121  ASN A CB  1 
ATOM   580  C  CG  . ASN A 1 80  ? 5.931   28.730 26.663 1.00 31.59 ? 121  ASN A CG  1 
ATOM   581  O  OD1 . ASN A 1 80  ? 5.944   27.585 27.132 1.00 33.62 ? 121  ASN A OD1 1 
ATOM   582  N  ND2 . ASN A 1 80  ? 5.017   29.145 25.787 1.00 34.83 ? 121  ASN A ND2 1 
ATOM   583  N  N   . LYS A 1 81  ? 7.597   27.467 29.753 1.00 31.24 ? 122  LYS A N   1 
ATOM   584  C  CA  . LYS A 1 81  ? 8.231   26.172 30.107 1.00 34.23 ? 122  LYS A CA  1 
ATOM   585  C  C   . LYS A 1 81  ? 8.409   25.193 28.926 1.00 35.15 ? 122  LYS A C   1 
ATOM   586  O  O   . LYS A 1 81  ? 9.311   24.340 28.950 1.00 36.28 ? 122  LYS A O   1 
ATOM   587  C  CB  . LYS A 1 81  ? 7.430   25.450 31.185 1.00 35.16 ? 122  LYS A CB  1 
ATOM   588  C  CG  . LYS A 1 81  ? 7.783   25.803 32.617 1.00 39.94 ? 122  LYS A CG  1 
ATOM   589  C  CD  . LYS A 1 81  ? 6.503   25.734 33.458 1.00 44.57 ? 122  LYS A CD  1 
ATOM   590  C  CE  . LYS A 1 81  ? 6.637   26.528 34.755 1.00 47.45 ? 122  LYS A CE  1 
ATOM   591  N  NZ  . LYS A 1 81  ? 5.588   27.589 34.847 1.00 49.05 ? 122  LYS A NZ  1 
ATOM   592  N  N   . THR A 1 82  ? 7.552   25.300 27.916 1.00 35.57 ? 123  THR A N   1 
ATOM   593  C  CA  . THR A 1 82  ? 7.632   24.379 26.758 1.00 36.40 ? 123  THR A CA  1 
ATOM   594  C  C   . THR A 1 82  ? 8.147   25.036 25.472 1.00 36.77 ? 123  THR A C   1 
ATOM   595  O  O   . THR A 1 82  ? 8.114   24.449 24.397 1.00 37.38 ? 123  THR A O   1 
ATOM   596  C  CB  . THR A 1 82  ? 6.281   23.640 26.506 1.00 37.09 ? 123  THR A CB  1 
ATOM   597  O  OG1 . THR A 1 82  ? 5.273   24.564 26.081 1.00 38.43 ? 123  THR A OG1 1 
ATOM   598  C  CG2 . THR A 1 82  ? 5.834   22.947 27.750 1.00 35.93 ? 123  THR A CG2 1 
ATOM   599  N  N   . HIS A 1 83  ? 8.650   26.256 25.577 1.00 35.75 ? 124  HIS A N   1 
ATOM   600  C  CA  . HIS A 1 83  ? 9.101   27.002 24.423 1.00 34.41 ? 124  HIS A CA  1 
ATOM   601  C  C   . HIS A 1 83  ? 10.238  27.939 24.871 1.00 33.04 ? 124  HIS A C   1 
ATOM   602  O  O   . HIS A 1 83  ? 10.057  29.164 24.983 1.00 32.39 ? 124  HIS A O   1 
ATOM   603  C  CB  . HIS A 1 83  ? 7.930   27.782 23.855 1.00 35.41 ? 124  HIS A CB  1 
ATOM   604  C  CG  . HIS A 1 83  ? 8.152   28.297 22.478 1.00 38.22 ? 124  HIS A CG  1 
ATOM   605  N  ND1 . HIS A 1 83  ? 7.257   29.140 21.851 1.00 40.69 ? 124  HIS A ND1 1 
ATOM   606  C  CD2 . HIS A 1 83  ? 9.160   28.091 21.594 1.00 42.05 ? 124  HIS A CD2 1 
ATOM   607  C  CE1 . HIS A 1 83  ? 7.697   29.421 20.636 1.00 43.09 ? 124  HIS A CE1 1 
ATOM   608  N  NE2 . HIS A 1 83  ? 8.852   28.801 20.457 1.00 43.13 ? 124  HIS A NE2 1 
ATOM   609  N  N   . PRO A 1 84  ? 11.418  27.361 25.113 1.00 32.21 ? 125  PRO A N   1 
ATOM   610  C  CA  . PRO A 1 84  ? 12.510  28.067 25.804 1.00 30.66 ? 125  PRO A CA  1 
ATOM   611  C  C   . PRO A 1 84  ? 13.138  29.199 25.040 1.00 29.41 ? 125  PRO A C   1 
ATOM   612  O  O   . PRO A 1 84  ? 13.119  29.273 23.796 1.00 29.37 ? 125  PRO A O   1 
ATOM   613  C  CB  . PRO A 1 84  ? 13.518  26.960 26.152 1.00 31.67 ? 125  PRO A CB  1 
ATOM   614  C  CG  . PRO A 1 84  ? 12.864  25.659 25.737 1.00 32.51 ? 125  PRO A CG  1 
ATOM   615  C  CD  . PRO A 1 84  ? 11.806  25.985 24.750 1.00 31.65 ? 125  PRO A CD  1 
ATOM   616  N  N   . ASN A 1 85  ? 13.601  30.177 25.821 1.00 27.34 ? 126  ASN A N   1 
ATOM   617  C  CA  . ASN A 1 85  ? 14.282  31.322 25.246 1.00 26.02 ? 126  ASN A CA  1 
ATOM   618  C  C   . ASN A 1 85  ? 15.730  30.973 24.955 1.00 25.84 ? 126  ASN A C   1 
ATOM   619  O  O   . ASN A 1 85  ? 16.373  30.255 25.733 1.00 27.42 ? 126  ASN A O   1 
ATOM   620  C  CB  . ASN A 1 85  ? 14.256  32.515 26.249 1.00 25.32 ? 126  ASN A CB  1 
ATOM   621  C  CG  . ASN A 1 85  ? 12.843  32.964 26.588 1.00 25.02 ? 126  ASN A CG  1 
ATOM   622  O  OD1 . ASN A 1 85  ? 11.972  33.038 25.735 1.00 23.99 ? 126  ASN A OD1 1 
ATOM   623  N  ND2 . ASN A 1 85  ? 12.613  33.303 27.866 1.00 24.08 ? 126  ASN A ND2 1 
ATOM   624  N  N   . TYR A 1 86  ? 16.244  31.488 23.845 1.00 26.60 ? 127  TYR A N   1 
ATOM   625  C  CA  . TYR A 1 86  ? 17.689  31.286 23.532 1.00 27.01 ? 127  TYR A CA  1 
ATOM   626  C  C   . TYR A 1 86  ? 18.116  32.213 22.413 1.00 25.86 ? 127  TYR A C   1 
ATOM   627  O  O   . TYR A 1 86  ? 17.271  32.822 21.738 1.00 25.48 ? 127  TYR A O   1 
ATOM   628  C  CB  . TYR A 1 86  ? 18.004  29.816 23.161 1.00 28.37 ? 127  TYR A CB  1 
ATOM   629  C  CG  . TYR A 1 86  ? 17.453  29.340 21.822 1.00 29.10 ? 127  TYR A CG  1 
ATOM   630  C  CD1 . TYR A 1 86  ? 18.315  29.094 20.738 1.00 34.51 ? 127  TYR A CD1 1 
ATOM   631  C  CD2 . TYR A 1 86  ? 16.097  29.075 21.657 1.00 30.89 ? 127  TYR A CD2 1 
ATOM   632  C  CE1 . TYR A 1 86  ? 17.805  28.621 19.503 1.00 33.66 ? 127  TYR A CE1 1 
ATOM   633  C  CE2 . TYR A 1 86  ? 15.587  28.609 20.448 1.00 32.71 ? 127  TYR A CE2 1 
ATOM   634  C  CZ  . TYR A 1 86  ? 16.455  28.395 19.375 1.00 33.55 ? 127  TYR A CZ  1 
ATOM   635  O  OH  . TYR A 1 86  ? 15.943  27.934 18.176 1.00 32.20 ? 127  TYR A OH  1 
ATOM   636  N  N   . ILE A 1 87  ? 19.420  32.351 22.225 1.00 25.87 ? 128  ILE A N   1 
ATOM   637  C  CA  . ILE A 1 87  ? 19.947  33.147 21.123 1.00 27.09 ? 128  ILE A CA  1 
ATOM   638  C  C   . ILE A 1 87  ? 20.808  32.220 20.238 1.00 27.60 ? 128  ILE A C   1 
ATOM   639  O  O   . ILE A 1 87  ? 21.459  31.291 20.747 1.00 27.24 ? 128  ILE A O   1 
ATOM   640  C  CB  . ILE A 1 87  ? 20.810  34.306 21.658 1.00 28.15 ? 128  ILE A CB  1 
ATOM   641  C  CG1 . ILE A 1 87  ? 19.948  35.215 22.591 1.00 26.19 ? 128  ILE A CG1 1 
ATOM   642  C  CG2 . ILE A 1 87  ? 21.448  35.151 20.531 1.00 28.05 ? 128  ILE A CG2 1 
ATOM   643  C  CD1 . ILE A 1 87  ? 20.855  35.965 23.549 1.00 27.89 ? 128  ILE A CD1 1 
ATOM   644  N  N   . SER A 1 88  ? 20.760  32.496 18.946 1.00 28.24 ? 129  SER A N   1 
ATOM   645  C  CA  . SER A 1 88  ? 21.571  31.757 17.934 1.00 29.80 ? 129  SER A CA  1 
ATOM   646  C  C   . SER A 1 88  ? 22.485  32.637 17.117 1.00 30.33 ? 129  SER A C   1 
ATOM   647  O  O   . SER A 1 88  ? 22.184  33.817 16.873 1.00 29.10 ? 129  SER A O   1 
ATOM   648  C  CB  . SER A 1 88  ? 20.620  31.048 16.972 1.00 28.27 ? 129  SER A CB  1 
ATOM   649  O  OG  . SER A 1 88  ? 19.855  30.047 17.624 1.00 32.82 ? 129  SER A OG  1 
ATOM   650  N  N   . ILE A 1 89  ? 23.599  32.055 16.626 1.00 31.96 ? 130  ILE A N   1 
ATOM   651  C  CA  . ILE A 1 89  ? 24.237  32.595 15.410 1.00 33.10 ? 130  ILE A CA  1 
ATOM   652  C  C   . ILE A 1 89  ? 23.658  31.724 14.289 1.00 34.28 ? 130  ILE A C   1 
ATOM   653  O  O   . ILE A 1 89  ? 23.579  30.498 14.415 1.00 33.00 ? 130  ILE A O   1 
ATOM   654  C  CB  . ILE A 1 89  ? 25.771  32.529 15.382 1.00 33.57 ? 130  ILE A CB  1 
ATOM   655  C  CG1 . ILE A 1 89  ? 26.387  33.360 16.517 1.00 32.85 ? 130  ILE A CG1 1 
ATOM   656  C  CG2 . ILE A 1 89  ? 26.290  32.988 13.971 1.00 32.15 ? 130  ILE A CG2 1 
ATOM   657  C  CD1 . ILE A 1 89  ? 27.829  33.077 16.786 1.00 34.39 ? 130  ILE A CD1 1 
ATOM   658  N  N   . ILE A 1 90  ? 23.169  32.403 13.259 1.00 36.57 ? 131  ILE A N   1 
ATOM   659  C  CA  . ILE A 1 90  ? 22.452  31.775 12.160 1.00 39.89 ? 131  ILE A CA  1 
ATOM   660  C  C   . ILE A 1 90  ? 23.259  32.023 10.862 1.00 41.57 ? 131  ILE A C   1 
ATOM   661  O  O   . ILE A 1 90  ? 23.707  33.143 10.601 1.00 41.12 ? 131  ILE A O   1 
ATOM   662  C  CB  . ILE A 1 90  ? 20.947  32.270 12.122 1.00 39.57 ? 131  ILE A CB  1 
ATOM   663  C  CG1 . ILE A 1 90  ? 20.041  31.286 11.373 1.00 41.79 ? 131  ILE A CG1 1 
ATOM   664  C  CG2 . ILE A 1 90  ? 20.815  33.730 11.677 1.00 39.43 ? 131  ILE A CG2 1 
ATOM   665  C  CD1 . ILE A 1 90  ? 18.582  31.772 11.203 1.00 40.86 ? 131  ILE A CD1 1 
ATOM   666  N  N   . ASN A 1 91  ? 23.502  30.966 10.080 1.00 43.87 ? 132  ASN A N   1 
ATOM   667  C  CA  . ASN A 1 91  ? 24.185  31.163 8.790  1.00 46.57 ? 132  ASN A CA  1 
ATOM   668  C  C   . ASN A 1 91  ? 23.219  31.614 7.694  1.00 48.33 ? 132  ASN A C   1 
ATOM   669  O  O   . ASN A 1 91  ? 22.000  31.597 7.897  1.00 49.17 ? 132  ASN A O   1 
ATOM   670  C  CB  . ASN A 1 91  ? 25.015  29.924 8.379  1.00 46.24 ? 132  ASN A CB  1 
ATOM   671  C  CG  . ASN A 1 91  ? 24.152  28.718 8.002  1.00 45.86 ? 132  ASN A CG  1 
ATOM   672  O  OD1 . ASN A 1 91  ? 22.995  28.855 7.596  1.00 44.20 ? 132  ASN A OD1 1 
ATOM   673  N  ND2 . ASN A 1 91  ? 24.736  27.519 8.125  1.00 45.68 ? 132  ASN A ND2 1 
ATOM   674  N  N   . GLU A 1 92  ? 23.765  31.978 6.529  1.00 50.69 ? 133  GLU A N   1 
ATOM   675  C  CA  . GLU A 1 92  ? 22.995  32.476 5.380  1.00 53.10 ? 133  GLU A CA  1 
ATOM   676  C  C   . GLU A 1 92  ? 21.811  31.598 4.946  1.00 52.96 ? 133  GLU A C   1 
ATOM   677  O  O   . GLU A 1 92  ? 20.859  32.098 4.346  1.00 53.49 ? 133  GLU A O   1 
ATOM   678  C  CB  . GLU A 1 92  ? 23.933  32.654 4.187  1.00 53.27 ? 133  GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 92  ? 23.710  33.940 3.405  1.00 55.72 ? 133  GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 92  ? 24.798  34.191 2.350  1.00 55.72 ? 133  GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 92  ? 25.883  33.549 2.409  1.00 57.80 ? 133  GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 92  ? 24.565  35.057 1.467  1.00 60.45 ? 133  GLU A OE2 1 
ATOM   683  N  N   . ASP A 1 93  ? 21.881  30.297 5.237  1.00 53.34 ? 134  ASP A N   1 
ATOM   684  C  CA  . ASP A 1 93  ? 20.844  29.335 4.833  1.00 53.66 ? 134  ASP A CA  1 
ATOM   685  C  C   . ASP A 1 93  ? 19.731  29.201 5.882  1.00 52.99 ? 134  ASP A C   1 
ATOM   686  O  O   . ASP A 1 93  ? 18.737  28.489 5.680  1.00 53.10 ? 134  ASP A O   1 
ATOM   687  C  CB  . ASP A 1 93  ? 21.474  27.956 4.552  1.00 54.25 ? 134  ASP A CB  1 
ATOM   688  C  CG  . ASP A 1 93  ? 22.622  28.016 3.526  1.00 56.50 ? 134  ASP A CG  1 
ATOM   689  O  OD1 . ASP A 1 93  ? 22.574  28.850 2.589  1.00 59.22 ? 134  ASP A OD1 1 
ATOM   690  O  OD2 . ASP A 1 93  ? 23.584  27.230 3.665  1.00 58.31 ? 134  ASP A OD2 1 
ATOM   691  N  N   . GLY A 1 94  ? 19.909  29.889 7.006  1.00 51.89 ? 135  GLY A N   1 
ATOM   692  C  CA  . GLY A 1 94  ? 18.957  29.837 8.096  1.00 50.56 ? 135  GLY A CA  1 
ATOM   693  C  C   . GLY A 1 94  ? 19.236  28.722 9.083  1.00 49.30 ? 135  GLY A C   1 
ATOM   694  O  O   . GLY A 1 94  ? 18.361  28.385 9.891  1.00 49.89 ? 135  GLY A O   1 
ATOM   695  N  N   . ASN A 1 95  ? 20.437  28.139 9.019  1.00 47.46 ? 136  ASN A N   1 
ATOM   696  C  CA  . ASN A 1 95  ? 20.844  27.124 9.989  1.00 46.12 ? 136  ASN A CA  1 
ATOM   697  C  C   . ASN A 1 95  ? 21.393  27.815 11.236 1.00 44.00 ? 136  ASN A C   1 
ATOM   698  O  O   . ASN A 1 95  ? 22.208  28.739 11.135 1.00 43.69 ? 136  ASN A O   1 
ATOM   699  C  CB  . ASN A 1 95  ? 21.911  26.166 9.429  1.00 47.19 ? 136  ASN A CB  1 
ATOM   700  C  CG  . ASN A 1 95  ? 21.436  25.401 8.189  1.00 49.85 ? 136  ASN A CG  1 
ATOM   701  O  OD1 . ASN A 1 95  ? 20.462  24.644 8.242  1.00 52.68 ? 136  ASN A OD1 1 
ATOM   702  N  ND2 . ASN A 1 95  ? 22.143  25.588 7.068  1.00 52.59 ? 136  ASN A ND2 1 
ATOM   703  N  N   . GLU A 1 96  ? 20.949  27.351 12.398 1.00 41.63 ? 137  GLU A N   1 
ATOM   704  C  CA  . GLU A 1 96  ? 21.433  27.895 13.666 1.00 39.86 ? 137  GLU A CA  1 
ATOM   705  C  C   . GLU A 1 96  ? 22.661  27.121 14.081 1.00 38.65 ? 137  GLU A C   1 
ATOM   706  O  O   . GLU A 1 96  ? 22.571  25.974 14.549 1.00 38.43 ? 137  GLU A O   1 
ATOM   707  C  CB  . GLU A 1 96  ? 20.315  27.883 14.723 1.00 39.39 ? 137  GLU A CB  1 
ATOM   708  C  CG  . GLU A 1 96  ? 19.114  28.744 14.270 1.00 38.87 ? 137  GLU A CG  1 
ATOM   709  C  CD  . GLU A 1 96  ? 17.970  28.821 15.295 1.00 39.08 ? 137  GLU A CD  1 
ATOM   710  O  OE1 . GLU A 1 96  ? 17.930  27.973 16.210 1.00 35.75 ? 137  GLU A OE1 1 
ATOM   711  O  OE2 . GLU A 1 96  ? 17.114  29.726 15.142 1.00 39.23 ? 137  GLU A OE2 1 
ATOM   712  N  N   . ILE A 1 97  ? 23.814  27.756 13.869 1.00 37.50 ? 138  ILE A N   1 
ATOM   713  C  CA  . ILE A 1 97  ? 25.128  27.124 14.024 1.00 37.33 ? 138  ILE A CA  1 
ATOM   714  C  C   . ILE A 1 97  ? 25.703  27.232 15.436 1.00 36.81 ? 138  ILE A C   1 
ATOM   715  O  O   . ILE A 1 97  ? 26.623  26.491 15.817 1.00 36.98 ? 138  ILE A O   1 
ATOM   716  C  CB  . ILE A 1 97  ? 26.162  27.604 12.945 1.00 37.65 ? 138  ILE A CB  1 
ATOM   717  C  CG1 . ILE A 1 97  ? 26.519  29.075 13.125 1.00 37.00 ? 138  ILE A CG1 1 
ATOM   718  C  CG2 . ILE A 1 97  ? 25.616  27.332 11.520 1.00 37.50 ? 138  ILE A CG2 1 
ATOM   719  C  CD1 . ILE A 1 97  ? 27.628  29.606 12.188 1.00 36.97 ? 138  ILE A CD1 1 
ATOM   720  N  N   . PHE A 1 98  ? 25.133  28.127 16.241 1.00 35.15 ? 139  PHE A N   1 
ATOM   721  C  CA  . PHE A 1 98  ? 25.500  28.199 17.654 1.00 33.02 ? 139  PHE A CA  1 
ATOM   722  C  C   . PHE A 1 98  ? 24.228  28.574 18.397 1.00 31.49 ? 139  PHE A C   1 
ATOM   723  O  O   . PHE A 1 98  ? 23.442  29.385 17.891 1.00 30.42 ? 139  PHE A O   1 
ATOM   724  C  CB  . PHE A 1 98  ? 26.566  29.265 17.927 1.00 33.72 ? 139  PHE A CB  1 
ATOM   725  C  CG  . PHE A 1 98  ? 26.719  29.592 19.383 1.00 34.32 ? 139  PHE A CG  1 
ATOM   726  C  CD1 . PHE A 1 98  ? 27.317  28.686 20.251 1.00 34.13 ? 139  PHE A CD1 1 
ATOM   727  C  CD2 . PHE A 1 98  ? 26.230  30.810 19.899 1.00 34.62 ? 139  PHE A CD2 1 
ATOM   728  C  CE1 . PHE A 1 98  ? 27.423  28.983 21.619 1.00 36.90 ? 139  PHE A CE1 1 
ATOM   729  C  CE2 . PHE A 1 98  ? 26.354  31.112 21.245 1.00 34.05 ? 139  PHE A CE2 1 
ATOM   730  C  CZ  . PHE A 1 98  ? 26.948  30.205 22.104 1.00 34.33 ? 139  PHE A CZ  1 
ATOM   731  N  N   . ASN A 1 99  ? 24.013  27.919 19.530 1.00 29.80 ? 140  ASN A N   1 
ATOM   732  C  CA  . ASN A 1 99  ? 22.892  28.264 20.423 1.00 30.45 ? 140  ASN A CA  1 
ATOM   733  C  C   . ASN A 1 99  ? 23.370  28.543 21.819 1.00 29.23 ? 140  ASN A C   1 
ATOM   734  O  O   . ASN A 1 99  ? 24.154  27.778 22.377 1.00 28.69 ? 140  ASN A O   1 
ATOM   735  C  CB  . ASN A 1 99  ? 21.938  27.107 20.549 1.00 30.49 ? 140  ASN A CB  1 
ATOM   736  C  CG  . ASN A 1 99  ? 21.173  26.838 19.282 1.00 31.32 ? 140  ASN A CG  1 
ATOM   737  O  OD1 . ASN A 1 99  ? 20.958  27.728 18.451 1.00 31.36 ? 140  ASN A OD1 1 
ATOM   738  N  ND2 . ASN A 1 99  ? 20.761  25.580 19.127 1.00 36.43 ? 140  ASN A ND2 1 
ATOM   739  N  N   . THR A 1 100 ? 22.830  29.607 22.436 1.00 28.75 ? 141  THR A N   1 
ATOM   740  C  CA  . THR A 1 100 ? 23.133  29.796 23.862 1.00 27.91 ? 141  THR A CA  1 
ATOM   741  C  C   . THR A 1 100 ? 22.407  28.772 24.721 1.00 26.78 ? 141  THR A C   1 
ATOM   742  O  O   . THR A 1 100 ? 21.417  28.147 24.263 1.00 27.00 ? 141  THR A O   1 
ATOM   743  C  CB  . THR A 1 100 ? 22.771  31.253 24.337 1.00 27.67 ? 141  THR A CB  1 
ATOM   744  O  OG1 . THR A 1 100 ? 21.371  31.491 24.124 1.00 29.04 ? 141  THR A OG1 1 
ATOM   745  C  CG2 . THR A 1 100 ? 23.625  32.286 23.605 1.00 28.48 ? 141  THR A CG2 1 
ATOM   746  N  N   . SER A 1 101 ? 22.877  28.643 25.965 1.00 26.93 ? 142  SER A N   1 
ATOM   747  C  CA  . SER A 1 101 ? 22.365  27.688 26.945 1.00 25.95 ? 142  SER A CA  1 
ATOM   748  C  C   . SER A 1 101 ? 20.871  27.861 27.270 1.00 26.85 ? 142  SER A C   1 
ATOM   749  O  O   . SER A 1 101 ? 20.356  28.989 27.323 1.00 26.48 ? 142  SER A O   1 
ATOM   750  C  CB  . SER A 1 101 ? 23.198  27.803 28.220 1.00 27.53 ? 142  SER A CB  1 
ATOM   751  O  OG  A SER A 1 101 ? 22.666  28.819 29.126 0.50 24.96 ? 142  SER A OG  1 
ATOM   752  O  OG  B SER A 1 101 ? 22.923  26.772 29.115 0.50 27.72 ? 142  SER A OG  1 
ATOM   753  N  N   . LEU A 1 102 ? 20.182  26.761 27.520 1.00 27.09 ? 143  LEU A N   1 
ATOM   754  C  CA  . LEU A 1 102 ? 18.784  26.835 27.934 1.00 27.14 ? 143  LEU A CA  1 
ATOM   755  C  C   . LEU A 1 102 ? 18.649  26.927 29.484 1.00 27.71 ? 143  LEU A C   1 
ATOM   756  O  O   . LEU A 1 102 ? 17.564  27.217 29.986 1.00 26.86 ? 143  LEU A O   1 
ATOM   757  C  CB  . LEU A 1 102 ? 17.951  25.666 27.357 1.00 28.85 ? 143  LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 102 ? 17.959  25.587 25.811 1.00 28.04 ? 143  LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 102 ? 16.939  24.546 25.354 1.00 33.52 ? 143  LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 102 ? 17.669  26.917 25.143 1.00 29.86 ? 143  LEU A CD2 1 
ATOM   761  N  N   . PHE A 1 103 ? 19.746  26.732 30.215 1.00 27.45 ? 144  PHE A N   1 
ATOM   762  C  CA  . PHE A 1 103 ? 19.723  26.815 31.698 1.00 26.89 ? 144  PHE A CA  1 
ATOM   763  C  C   . PHE A 1 103 ? 21.134  26.875 32.261 1.00 26.59 ? 144  PHE A C   1 
ATOM   764  O  O   . PHE A 1 103 ? 22.103  26.521 31.563 1.00 26.75 ? 144  PHE A O   1 
ATOM   765  C  CB  . PHE A 1 103 ? 18.970  25.628 32.315 1.00 28.14 ? 144  PHE A CB  1 
ATOM   766  C  CG  . PHE A 1 103 ? 19.597  24.279 32.008 1.00 28.85 ? 144  PHE A CG  1 
ATOM   767  C  CD1 . PHE A 1 103 ? 20.595  23.751 32.830 1.00 30.38 ? 144  PHE A CD1 1 
ATOM   768  C  CD2 . PHE A 1 103 ? 19.180  23.543 30.898 1.00 32.53 ? 144  PHE A CD2 1 
ATOM   769  C  CE1 . PHE A 1 103 ? 21.165  22.524 32.571 1.00 33.60 ? 144  PHE A CE1 1 
ATOM   770  C  CE2 . PHE A 1 103 ? 19.760  22.315 30.613 1.00 35.05 ? 144  PHE A CE2 1 
ATOM   771  C  CZ  . PHE A 1 103 ? 20.749  21.804 31.452 1.00 30.60 ? 144  PHE A CZ  1 
ATOM   772  N  N   . GLU A 1 104 ? 21.298  27.352 33.507 1.00 23.89 ? 145  GLU A N   1 
ATOM   773  C  CA  . GLU A 1 104 ? 22.631  27.363 34.138 1.00 24.25 ? 145  GLU A CA  1 
ATOM   774  C  C   . GLU A 1 104 ? 22.887  25.981 34.722 1.00 24.39 ? 145  GLU A C   1 
ATOM   775  O  O   . GLU A 1 104 ? 22.009  25.410 35.391 1.00 24.07 ? 145  GLU A O   1 
ATOM   776  C  CB  . GLU A 1 104 ? 22.705  28.323 35.361 1.00 24.88 ? 145  GLU A CB  1 
ATOM   777  C  CG  . GLU A 1 104 ? 22.596  29.780 35.049 1.00 25.01 ? 145  GLU A CG  1 
ATOM   778  C  CD  . GLU A 1 104 ? 22.551  30.609 36.367 1.00 22.91 ? 145  GLU A CD  1 
ATOM   779  O  OE1 . GLU A 1 104 ? 21.452  30.637 36.990 1.00 23.65 ? 145  GLU A OE1 1 
ATOM   780  O  OE2 . GLU A 1 104 ? 23.634  31.114 36.837 1.00 22.23 ? 145  GLU A OE2 1 
ATOM   781  N  N   . PRO A 1 105 ? 24.107  25.444 34.540 1.00 26.05 ? 146  PRO A N   1 
ATOM   782  C  CA  . PRO A 1 105 ? 24.436  24.170 35.212 1.00 25.71 ? 146  PRO A CA  1 
ATOM   783  C  C   . PRO A 1 105 ? 24.172  24.263 36.735 1.00 26.53 ? 146  PRO A C   1 
ATOM   784  O  O   . PRO A 1 105 ? 24.722  25.151 37.399 1.00 27.21 ? 146  PRO A O   1 
ATOM   785  C  CB  . PRO A 1 105 ? 25.943  24.018 34.922 1.00 26.47 ? 146  PRO A CB  1 
ATOM   786  C  CG  . PRO A 1 105 ? 26.070  24.702 33.565 1.00 27.94 ? 146  PRO A CG  1 
ATOM   787  C  CD  . PRO A 1 105 ? 25.201  25.933 33.696 1.00 27.30 ? 146  PRO A CD  1 
ATOM   788  N  N   . PRO A 1 106 ? 23.267  23.438 37.283 1.00 26.01 ? 147  PRO A N   1 
ATOM   789  C  CA  . PRO A 1 106 ? 22.958  23.622 38.707 1.00 26.98 ? 147  PRO A CA  1 
ATOM   790  C  C   . PRO A 1 106 ? 24.119  23.282 39.608 1.00 27.81 ? 147  PRO A C   1 
ATOM   791  O  O   . PRO A 1 106 ? 24.913  22.376 39.249 1.00 27.68 ? 147  PRO A O   1 
ATOM   792  C  CB  . PRO A 1 106 ? 21.796  22.667 38.951 1.00 28.06 ? 147  PRO A CB  1 
ATOM   793  C  CG  . PRO A 1 106 ? 21.877  21.689 37.839 1.00 27.43 ? 147  PRO A CG  1 
ATOM   794  C  CD  . PRO A 1 106 ? 22.405  22.421 36.661 1.00 27.17 ? 147  PRO A CD  1 
ATOM   795  N  N   . PRO A 1 107 ? 24.194  23.935 40.783 1.00 27.35 ? 148  PRO A N   1 
ATOM   796  C  CA  . PRO A 1 107 ? 25.289  23.649 41.700 1.00 26.75 ? 148  PRO A CA  1 
ATOM   797  C  C   . PRO A 1 107 ? 25.188  22.255 42.370 1.00 26.43 ? 148  PRO A C   1 
ATOM   798  O  O   . PRO A 1 107 ? 24.109  21.648 42.391 1.00 25.66 ? 148  PRO A O   1 
ATOM   799  C  CB  . PRO A 1 107 ? 25.161  24.768 42.754 1.00 27.82 ? 148  PRO A CB  1 
ATOM   800  C  CG  . PRO A 1 107 ? 23.692  25.085 42.798 1.00 27.89 ? 148  PRO A CG  1 
ATOM   801  C  CD  . PRO A 1 107 ? 23.245  24.927 41.345 1.00 27.67 ? 148  PRO A CD  1 
ATOM   802  N  N   . PRO A 1 108 ? 26.321  21.766 42.912 1.00 26.79 ? 149  PRO A N   1 
ATOM   803  C  CA  . PRO A 1 108 ? 26.366  20.435 43.530 1.00 26.94 ? 149  PRO A CA  1 
ATOM   804  C  C   . PRO A 1 108 ? 25.251  20.167 44.535 1.00 26.98 ? 149  PRO A C   1 
ATOM   805  O  O   . PRO A 1 108 ? 25.083  20.928 45.514 1.00 26.56 ? 149  PRO A O   1 
ATOM   806  C  CB  . PRO A 1 108 ? 27.747  20.403 44.204 1.00 27.40 ? 149  PRO A CB  1 
ATOM   807  C  CG  . PRO A 1 108 ? 28.587  21.330 43.377 1.00 26.80 ? 149  PRO A CG  1 
ATOM   808  C  CD  . PRO A 1 108 ? 27.639  22.427 42.910 1.00 27.20 ? 149  PRO A CD  1 
ATOM   809  N  N   . GLY A 1 109 ? 24.534  19.063 44.342 1.00 26.87 ? 150  GLY A N   1 
ATOM   810  C  CA  . GLY A 1 109 ? 23.515  18.661 45.297 1.00 28.30 ? 150  GLY A CA  1 
ATOM   811  C  C   . GLY A 1 109 ? 22.128  19.258 45.047 1.00 30.48 ? 150  GLY A C   1 
ATOM   812  O  O   . GLY A 1 109 ? 21.137  18.874 45.726 1.00 31.14 ? 150  GLY A O   1 
ATOM   813  N  N   . TYR A 1 110 ? 22.065  20.145 44.054 1.00 31.56 ? 151  TYR A N   1 
ATOM   814  C  CA  . TYR A 1 110 ? 20.812  20.803 43.632 1.00 33.22 ? 151  TYR A CA  1 
ATOM   815  C  C   . TYR A 1 110 ? 20.376  20.247 42.298 1.00 35.38 ? 151  TYR A C   1 
ATOM   816  O  O   . TYR A 1 110 ? 19.815  19.146 42.283 1.00 37.83 ? 151  TYR A O   1 
ATOM   817  C  CB  . TYR A 1 110 ? 21.000  22.316 43.520 1.00 31.37 ? 151  TYR A CB  1 
ATOM   818  C  CG  . TYR A 1 110 ? 21.189  23.002 44.861 1.00 29.75 ? 151  TYR A CG  1 
ATOM   819  C  CD1 . TYR A 1 110 ? 20.086  23.494 45.566 1.00 29.28 ? 151  TYR A CD1 1 
ATOM   820  C  CD2 . TYR A 1 110 ? 22.466  23.198 45.408 1.00 26.84 ? 151  TYR A CD2 1 
ATOM   821  C  CE1 . TYR A 1 110 ? 20.255  24.131 46.786 1.00 27.24 ? 151  TYR A CE1 1 
ATOM   822  C  CE2 . TYR A 1 110 ? 22.643  23.835 46.618 1.00 25.83 ? 151  TYR A CE2 1 
ATOM   823  C  CZ  . TYR A 1 110 ? 21.520  24.321 47.297 1.00 26.61 ? 151  TYR A CZ  1 
ATOM   824  O  OH  . TYR A 1 110 ? 21.724  24.925 48.494 1.00 25.71 ? 151  TYR A OH  1 
ATOM   825  N  N   . ASP A 1 115 ? 11.858  23.497 39.335 1.00 30.98 ? 156  ASP A N   1 
ATOM   826  C  CA  . ASP A 1 115 ? 11.324  24.849 39.518 1.00 30.86 ? 156  ASP A CA  1 
ATOM   827  C  C   . ASP A 1 115 ? 12.441  25.886 39.635 1.00 28.90 ? 156  ASP A C   1 
ATOM   828  O  O   . ASP A 1 115 ? 12.218  26.947 40.220 1.00 29.52 ? 156  ASP A O   1 
ATOM   829  C  CB  . ASP A 1 115 ? 10.427  24.957 40.768 1.00 33.23 ? 156  ASP A CB  1 
ATOM   830  C  CG  . ASP A 1 115 ? 9.080   24.225 40.619 1.00 38.78 ? 156  ASP A CG  1 
ATOM   831  O  OD1 . ASP A 1 115 ? 8.576   24.078 39.474 1.00 46.00 ? 156  ASP A OD1 1 
ATOM   832  O  OD2 . ASP A 1 115 ? 8.510   23.813 41.671 1.00 45.96 ? 156  ASP A OD2 1 
ATOM   833  N  N   . ILE A 1 116 ? 13.638  25.602 39.115 1.00 25.20 ? 157  ILE A N   1 
ATOM   834  C  CA  . ILE A 1 116 ? 14.590  26.702 38.967 1.00 22.21 ? 157  ILE A CA  1 
ATOM   835  C  C   . ILE A 1 116 ? 14.267  27.459 37.690 1.00 21.79 ? 157  ILE A C   1 
ATOM   836  O  O   . ILE A 1 116 ? 14.314  26.891 36.574 1.00 20.83 ? 157  ILE A O   1 
ATOM   837  C  CB  . ILE A 1 116 ? 16.038  26.189 38.906 1.00 20.41 ? 157  ILE A CB  1 
ATOM   838  C  CG1 . ILE A 1 116 ? 16.375  25.480 40.217 1.00 20.95 ? 157  ILE A CG1 1 
ATOM   839  C  CG2 . ILE A 1 116 ? 16.984  27.316 38.514 1.00 22.45 ? 157  ILE A CG2 1 
ATOM   840  C  CD1 . ILE A 1 116 ? 17.729  24.751 40.262 1.00 22.20 ? 157  ILE A CD1 1 
ATOM   841  N  N   . VAL A 1 117 ? 13.860  28.731 37.791 1.00 19.61 ? 158  VAL A N   1 
ATOM   842  C  CA  . VAL A 1 117 ? 13.488  29.441 36.586 1.00 20.38 ? 158  VAL A CA  1 
ATOM   843  C  C   . VAL A 1 117 ? 14.754  29.666 35.738 1.00 19.77 ? 158  VAL A C   1 
ATOM   844  O  O   . VAL A 1 117 ? 15.809  30.093 36.265 1.00 19.02 ? 158  VAL A O   1 
ATOM   845  C  CB  . VAL A 1 117 ? 12.765  30.812 36.941 1.00 21.40 ? 158  VAL A CB  1 
ATOM   846  C  CG1 . VAL A 1 117 ? 13.787  31.856 37.479 1.00 21.00 ? 158  VAL A CG1 1 
ATOM   847  C  CG2 . VAL A 1 117 ? 11.998  31.296 35.728 1.00 20.90 ? 158  VAL A CG2 1 
ATOM   848  N  N   . PRO A 1 118 ? 14.734  29.314 34.431 1.00 19.81 ? 159  PRO A N   1 
ATOM   849  C  CA  . PRO A 1 118 ? 15.976  29.556 33.683 1.00 21.36 ? 159  PRO A CA  1 
ATOM   850  C  C   . PRO A 1 118 ? 16.253  31.062 33.542 1.00 20.46 ? 159  PRO A C   1 
ATOM   851  O  O   . PRO A 1 118 ? 15.295  31.876 33.681 1.00 21.22 ? 159  PRO A O   1 
ATOM   852  C  CB  . PRO A 1 118 ? 15.650  29.017 32.266 1.00 22.93 ? 159  PRO A CB  1 
ATOM   853  C  CG  . PRO A 1 118 ? 14.192  28.890 32.180 1.00 22.72 ? 159  PRO A CG  1 
ATOM   854  C  CD  . PRO A 1 118 ? 13.655  28.765 33.591 1.00 21.69 ? 159  PRO A CD  1 
ATOM   855  N  N   . PRO A 1 119 ? 17.503  31.431 33.230 1.00 20.27 ? 160  PRO A N   1 
ATOM   856  C  CA  . PRO A 1 119 ? 17.818  32.840 32.988 1.00 19.96 ? 160  PRO A CA  1 
ATOM   857  C  C   . PRO A 1 119 ? 16.894  33.480 31.950 1.00 20.55 ? 160  PRO A C   1 
ATOM   858  O  O   . PRO A 1 119 ? 16.615  32.917 30.847 1.00 21.65 ? 160  PRO A O   1 
ATOM   859  C  CB  . PRO A 1 119 ? 19.325  32.812 32.553 1.00 19.90 ? 160  PRO A CB  1 
ATOM   860  C  CG  . PRO A 1 119 ? 19.866  31.523 33.214 1.00 20.44 ? 160  PRO A CG  1 
ATOM   861  C  CD  . PRO A 1 119 ? 18.693  30.563 32.977 1.00 20.18 ? 160  PRO A CD  1 
ATOM   862  N  N   . PHE A 1 120 ? 16.339  34.661 32.311 1.00 19.24 ? 161  PHE A N   1 
ATOM   863  C  CA  . PHE A 1 120 ? 15.572  35.446 31.359 1.00 17.47 ? 161  PHE A CA  1 
ATOM   864  C  C   . PHE A 1 120 ? 15.545  36.879 31.874 1.00 18.11 ? 161  PHE A C   1 
ATOM   865  O  O   . PHE A 1 120 ? 15.839  37.085 33.050 1.00 18.91 ? 161  PHE A O   1 
ATOM   866  C  CB  . PHE A 1 120 ? 14.143  34.931 31.216 1.00 17.51 ? 161  PHE A CB  1 
ATOM   867  C  CG  . PHE A 1 120 ? 13.210  35.230 32.426 1.00 16.99 ? 161  PHE A CG  1 
ATOM   868  C  CD1 . PHE A 1 120 ? 12.041  36.023 32.243 1.00 19.04 ? 161  PHE A CD1 1 
ATOM   869  C  CD2 . PHE A 1 120 ? 13.443  34.671 33.681 1.00 20.13 ? 161  PHE A CD2 1 
ATOM   870  C  CE1 . PHE A 1 120 ? 11.129  36.267 33.339 1.00 17.46 ? 161  PHE A CE1 1 
ATOM   871  C  CE2 . PHE A 1 120 ? 12.564  34.961 34.780 1.00 17.69 ? 161  PHE A CE2 1 
ATOM   872  C  CZ  . PHE A 1 120 ? 11.416  35.772 34.596 1.00 17.32 ? 161  PHE A CZ  1 
ATOM   873  N  N   . SER A 1 121 ? 15.033  37.754 31.003 1.00 18.08 ? 162  SER A N   1 
ATOM   874  C  CA  . SER A 1 121 ? 14.885  39.212 31.338 1.00 17.14 ? 162  SER A CA  1 
ATOM   875  C  C   . SER A 1 121 ? 13.373  39.433 31.536 1.00 18.12 ? 162  SER A C   1 
ATOM   876  O  O   . SER A 1 121 ? 12.606  39.403 30.581 1.00 18.75 ? 162  SER A O   1 
ATOM   877  C  CB  . SER A 1 121 ? 15.459  40.036 30.166 1.00 16.96 ? 162  SER A CB  1 
ATOM   878  O  OG  . SER A 1 121 ? 16.874  39.949 30.147 1.00 19.57 ? 162  SER A OG  1 
ATOM   879  N  N   . ALA A 1 122 ? 12.971  39.672 32.801 1.00 17.66 ? 163  ALA A N   1 
ATOM   880  C  CA  . ALA A 1 122 ? 11.535  39.815 33.118 1.00 17.34 ? 163  ALA A CA  1 
ATOM   881  C  C   . ALA A 1 122 ? 10.958  41.024 32.359 1.00 17.95 ? 163  ALA A C   1 
ATOM   882  O  O   . ALA A 1 122 ? 11.555  42.104 32.303 1.00 18.09 ? 163  ALA A O   1 
ATOM   883  C  CB  . ALA A 1 122 ? 11.288  39.930 34.664 1.00 18.47 ? 163  ALA A CB  1 
ATOM   884  N  N   . PHE A 1 123 ? 9.792   40.784 31.746 1.00 17.46 ? 164  PHE A N   1 
ATOM   885  C  CA  . PHE A 1 123 ? 8.966   41.738 30.978 1.00 17.97 ? 164  PHE A CA  1 
ATOM   886  C  C   . PHE A 1 123 ? 9.452   41.969 29.543 1.00 19.53 ? 164  PHE A C   1 
ATOM   887  O  O   . PHE A 1 123 ? 8.918   42.840 28.840 1.00 19.59 ? 164  PHE A O   1 
ATOM   888  C  CB  . PHE A 1 123 ? 8.708   43.058 31.722 1.00 16.09 ? 164  PHE A CB  1 
ATOM   889  C  CG  . PHE A 1 123 ? 8.005   42.857 33.019 1.00 18.97 ? 164  PHE A CG  1 
ATOM   890  C  CD1 . PHE A 1 123 ? 6.637   42.639 33.048 1.00 19.50 ? 164  PHE A CD1 1 
ATOM   891  C  CD2 . PHE A 1 123 ? 8.726   42.902 34.218 1.00 19.24 ? 164  PHE A CD2 1 
ATOM   892  C  CE1 . PHE A 1 123 ? 5.971   42.476 34.276 1.00 20.01 ? 164  PHE A CE1 1 
ATOM   893  C  CE2 . PHE A 1 123 ? 8.056   42.736 35.435 1.00 17.02 ? 164  PHE A CE2 1 
ATOM   894  C  CZ  . PHE A 1 123 ? 6.677   42.530 35.458 1.00 19.74 ? 164  PHE A CZ  1 
ATOM   895  N  N   . SER A 1 124 ? 10.458  41.203 29.111 1.00 21.14 ? 165  SER A N   1 
ATOM   896  C  CA  . SER A 1 124 ? 10.850  41.238 27.693 1.00 21.06 ? 165  SER A CA  1 
ATOM   897  C  C   . SER A 1 124 ? 9.569   40.946 26.875 1.00 21.49 ? 165  SER A C   1 
ATOM   898  O  O   . SER A 1 124 ? 8.787   40.045 27.229 1.00 22.83 ? 165  SER A O   1 
ATOM   899  C  CB  . SER A 1 124 ? 11.884  40.172 27.360 1.00 22.79 ? 165  SER A CB  1 
ATOM   900  O  OG  . SER A 1 124 ? 12.063  40.254 25.939 1.00 19.87 ? 165  SER A OG  1 
ATOM   901  N  N   . PRO A 1 125 ? 9.361   41.688 25.757 1.00 22.50 ? 166  PRO A N   1 
ATOM   902  C  CA  . PRO A 1 125 ? 8.287   41.268 24.844 1.00 24.40 ? 166  PRO A CA  1 
ATOM   903  C  C   . PRO A 1 125 ? 8.734   40.017 24.081 1.00 25.19 ? 166  PRO A C   1 
ATOM   904  O  O   . PRO A 1 125 ? 9.930   39.698 24.083 1.00 25.02 ? 166  PRO A O   1 
ATOM   905  C  CB  . PRO A 1 125 ? 8.189   42.434 23.852 1.00 24.73 ? 166  PRO A CB  1 
ATOM   906  C  CG  . PRO A 1 125 ? 9.505   43.030 23.804 1.00 23.43 ? 166  PRO A CG  1 
ATOM   907  C  CD  . PRO A 1 125 ? 10.066  42.891 25.270 1.00 23.17 ? 166  PRO A CD  1 
ATOM   908  N  N   . GLN A 1 126 ? 7.787   39.347 23.425 1.00 27.15 ? 167  GLN A N   1 
ATOM   909  C  CA  . GLN A 1 126 ? 8.129   38.184 22.587 1.00 28.97 ? 167  GLN A CA  1 
ATOM   910  C  C   . GLN A 1 126 ? 8.666   38.649 21.252 1.00 29.36 ? 167  GLN A C   1 
ATOM   911  O  O   . GLN A 1 126 ? 8.306   39.733 20.756 1.00 29.85 ? 167  GLN A O   1 
ATOM   912  C  CB  . GLN A 1 126 ? 6.904   37.300 22.346 1.00 28.58 ? 167  GLN A CB  1 
ATOM   913  C  CG  . GLN A 1 126 ? 6.340   36.640 23.589 1.00 30.34 ? 167  GLN A CG  1 
ATOM   914  C  CD  . GLN A 1 126 ? 5.012   35.948 23.371 1.00 32.60 ? 167  GLN A CD  1 
ATOM   915  O  OE1 . GLN A 1 126 ? 4.444   35.992 22.285 1.00 39.97 ? 167  GLN A OE1 1 
ATOM   916  N  NE2 . GLN A 1 126 ? 4.489   35.329 24.418 1.00 34.45 ? 167  GLN A NE2 1 
ATOM   917  N  N   . GLY A 1 127 ? 9.530   37.836 20.650 1.00 30.38 ? 168  GLY A N   1 
ATOM   918  C  CA  . GLY A 1 127 ? 10.004  38.142 19.305 1.00 31.40 ? 168  GLY A CA  1 
ATOM   919  C  C   . GLY A 1 127 ? 11.120  37.223 18.860 1.00 32.33 ? 168  GLY A C   1 
ATOM   920  O  O   . GLY A 1 127 ? 11.724  36.537 19.673 1.00 30.95 ? 168  GLY A O   1 
ATOM   921  N  N   . MET A 1 128 ? 11.401  37.230 17.551 1.00 33.78 ? 169  MET A N   1 
ATOM   922  C  CA  . MET A 1 128 ? 12.547  36.514 17.014 1.00 36.34 ? 169  MET A CA  1 
ATOM   923  C  C   . MET A 1 128 ? 13.357  37.387 16.045 1.00 35.03 ? 169  MET A C   1 
ATOM   924  O  O   . MET A 1 128 ? 13.592  36.987 14.898 1.00 35.24 ? 169  MET A O   1 
ATOM   925  C  CB  . MET A 1 128 ? 12.087  35.213 16.353 1.00 36.49 ? 169  MET A CB  1 
ATOM   926  C  CG  . MET A 1 128 ? 11.570  34.149 17.303 1.00 37.59 ? 169  MET A CG  1 
ATOM   927  S  SD  . MET A 1 128 ? 11.152  32.697 16.319 1.00 45.13 ? 169  MET A SD  1 
ATOM   928  C  CE  . MET A 1 128 ? 10.376  31.608 17.491 1.00 41.53 ? 169  MET A CE  1 
ATOM   929  N  N   . PRO A 1 129 ? 13.785  38.589 16.486 1.00 33.75 ? 170  PRO A N   1 
ATOM   930  C  CA  . PRO A 1 129 ? 14.585  39.491 15.661 1.00 33.78 ? 170  PRO A CA  1 
ATOM   931  C  C   . PRO A 1 129 ? 15.919  38.848 15.222 1.00 33.91 ? 170  PRO A C   1 
ATOM   932  O  O   . PRO A 1 129 ? 16.555  38.140 15.998 1.00 32.90 ? 170  PRO A O   1 
ATOM   933  C  CB  . PRO A 1 129 ? 14.845  40.685 16.601 1.00 33.31 ? 170  PRO A CB  1 
ATOM   934  C  CG  . PRO A 1 129 ? 14.673  40.113 17.964 1.00 31.88 ? 170  PRO A CG  1 
ATOM   935  C  CD  . PRO A 1 129 ? 13.534  39.179 17.822 1.00 33.57 ? 170  PRO A CD  1 
ATOM   936  N  N   . GLU A 1 130 ? 16.310  39.060 13.965 1.00 34.56 ? 171  GLU A N   1 
ATOM   937  C  CA  . GLU A 1 130 ? 17.651  38.662 13.522 1.00 36.74 ? 171  GLU A CA  1 
ATOM   938  C  C   . GLU A 1 130 ? 18.368  39.830 12.911 1.00 36.16 ? 171  GLU A C   1 
ATOM   939  O  O   . GLU A 1 130 ? 17.756  40.650 12.213 1.00 37.31 ? 171  GLU A O   1 
ATOM   940  C  CB  . GLU A 1 130 ? 17.659  37.470 12.542 1.00 37.15 ? 171  GLU A CB  1 
ATOM   941  C  CG  . GLU A 1 130 ? 16.365  37.168 11.844 1.00 39.04 ? 171  GLU A CG  1 
ATOM   942  C  CD  . GLU A 1 130 ? 16.501  35.952 10.915 1.00 41.14 ? 171  GLU A CD  1 
ATOM   943  O  OE1 . GLU A 1 130 ? 15.634  35.041 10.976 1.00 45.73 ? 171  GLU A OE1 1 
ATOM   944  O  OE2 . GLU A 1 130 ? 17.501  35.919 10.135 1.00 47.67 ? 171  GLU A OE2 1 
ATOM   945  N  N   . GLY A 1 131 ? 19.666  39.917 13.159 1.00 35.67 ? 172  GLY A N   1 
ATOM   946  C  CA  . GLY A 1 131 ? 20.406  41.006 12.591 1.00 35.35 ? 172  GLY A CA  1 
ATOM   947  C  C   . GLY A 1 131 ? 21.841  41.028 12.999 1.00 34.90 ? 172  GLY A C   1 
ATOM   948  O  O   . GLY A 1 131 ? 22.365  40.054 13.571 1.00 35.13 ? 172  GLY A O   1 
ATOM   949  N  N   . ASP A 1 132 ? 22.477  42.148 12.687 1.00 35.02 ? 173  ASP A N   1 
ATOM   950  C  CA  . ASP A 1 132 ? 23.885  42.352 12.946 1.00 35.70 ? 173  ASP A CA  1 
ATOM   951  C  C   . ASP A 1 132 ? 24.046  42.918 14.346 1.00 35.30 ? 173  ASP A C   1 
ATOM   952  O  O   . ASP A 1 132 ? 23.204  43.718 14.787 1.00 35.44 ? 173  ASP A O   1 
ATOM   953  C  CB  . ASP A 1 132 ? 24.443  43.357 11.960 1.00 37.22 ? 173  ASP A CB  1 
ATOM   954  C  CG  . ASP A 1 132 ? 24.314  42.889 10.515 1.00 40.64 ? 173  ASP A CG  1 
ATOM   955  O  OD1 . ASP A 1 132 ? 24.169  41.661 10.309 1.00 42.69 ? 173  ASP A OD1 1 
ATOM   956  O  OD2 . ASP A 1 132 ? 24.329  43.756 9.610  1.00 43.78 ? 173  ASP A OD2 1 
ATOM   957  N  N   . LEU A 1 133 ? 25.114  42.510 15.014 1.00 33.77 ? 174  LEU A N   1 
ATOM   958  C  CA  . LEU A 1 133 ? 25.420  42.948 16.370 1.00 33.37 ? 174  LEU A CA  1 
ATOM   959  C  C   . LEU A 1 133 ? 26.181  44.262 16.372 1.00 33.41 ? 174  LEU A C   1 
ATOM   960  O  O   . LEU A 1 133 ? 27.029  44.534 15.493 1.00 33.56 ? 174  LEU A O   1 
ATOM   961  C  CB  . LEU A 1 133 ? 26.274  41.897 17.067 1.00 32.99 ? 174  LEU A CB  1 
ATOM   962  C  CG  A LEU A 1 133 ? 26.129  41.329 18.478 0.50 32.52 ? 174  LEU A CG  1 
ATOM   963  C  CG  B LEU A 1 133 ? 25.650  40.576 17.536 0.50 31.85 ? 174  LEU A CG  1 
ATOM   964  C  CD1 A LEU A 1 133 ? 24.678  41.137 18.907 0.50 30.70 ? 174  LEU A CD1 1 
ATOM   965  C  CD1 B LEU A 1 133 ? 26.729  39.727 18.207 0.50 31.50 ? 174  LEU A CD1 1 
ATOM   966  C  CD2 A LEU A 1 133 ? 26.892  40.008 18.529 0.50 32.82 ? 174  LEU A CD2 1 
ATOM   967  C  CD2 B LEU A 1 133 ? 24.436  40.795 18.465 0.50 30.94 ? 174  LEU A CD2 1 
ATOM   968  N  N   . VAL A 1 134 ? 25.878  45.076 17.384 1.00 31.79 ? 175  VAL A N   1 
ATOM   969  C  CA  . VAL A 1 134 ? 26.707  46.200 17.750 1.00 30.78 ? 175  VAL A CA  1 
ATOM   970  C  C   . VAL A 1 134 ? 26.999  46.016 19.248 1.00 30.60 ? 175  VAL A C   1 
ATOM   971  O  O   . VAL A 1 134 ? 26.086  45.721 20.036 1.00 30.87 ? 175  VAL A O   1 
ATOM   972  C  CB  . VAL A 1 134 ? 25.981  47.546 17.436 1.00 30.81 ? 175  VAL A CB  1 
ATOM   973  C  CG1 . VAL A 1 134 ? 26.766  48.706 17.905 1.00 31.32 ? 175  VAL A CG1 1 
ATOM   974  C  CG2 . VAL A 1 134 ? 25.715  47.653 15.925 1.00 31.79 ? 175  VAL A CG2 1 
ATOM   975  N  N   . TYR A 1 135 ? 28.263  46.126 19.609 1.00 28.39 ? 176  TYR A N   1 
ATOM   976  C  CA  . TYR A 1 135 ? 28.677  46.058 20.989 1.00 28.03 ? 176  TYR A CA  1 
ATOM   977  C  C   . TYR A 1 135 ? 28.723  47.480 21.574 1.00 27.76 ? 176  TYR A C   1 
ATOM   978  O  O   . TYR A 1 135 ? 29.363  48.373 21.022 1.00 27.00 ? 176  TYR A O   1 
ATOM   979  C  CB  . TYR A 1 135 ? 30.042  45.393 21.124 1.00 27.37 ? 176  TYR A CB  1 
ATOM   980  C  CG  . TYR A 1 135 ? 30.673  45.531 22.485 1.00 27.37 ? 176  TYR A CG  1 
ATOM   981  C  CD1 . TYR A 1 135 ? 30.130  44.898 23.625 1.00 28.21 ? 176  TYR A CD1 1 
ATOM   982  C  CD2 . TYR A 1 135 ? 31.813  46.300 22.657 1.00 25.81 ? 176  TYR A CD2 1 
ATOM   983  C  CE1 . TYR A 1 135 ? 30.744  45.067 24.909 1.00 25.35 ? 176  TYR A CE1 1 
ATOM   984  C  CE2 . TYR A 1 135 ? 32.426  46.448 23.871 1.00 27.09 ? 176  TYR A CE2 1 
ATOM   985  C  CZ  . TYR A 1 135 ? 31.884  45.856 25.013 1.00 25.40 ? 176  TYR A CZ  1 
ATOM   986  O  OH  . TYR A 1 135 ? 32.542  46.034 26.217 1.00 27.31 ? 176  TYR A OH  1 
ATOM   987  N  N   . VAL A 1 136 ? 28.029  47.673 22.703 1.00 26.36 ? 177  VAL A N   1 
ATOM   988  C  CA  . VAL A 1 136 ? 27.802  49.029 23.280 1.00 26.39 ? 177  VAL A CA  1 
ATOM   989  C  C   . VAL A 1 136 ? 28.372  49.239 24.706 1.00 25.28 ? 177  VAL A C   1 
ATOM   990  O  O   . VAL A 1 136 ? 27.929  50.156 25.471 1.00 25.04 ? 177  VAL A O   1 
ATOM   991  C  CB  . VAL A 1 136 ? 26.280  49.365 23.251 1.00 26.97 ? 177  VAL A CB  1 
ATOM   992  C  CG1 . VAL A 1 136 ? 25.762  49.376 21.845 1.00 27.15 ? 177  VAL A CG1 1 
ATOM   993  C  CG2 . VAL A 1 136 ? 25.465  48.306 24.038 1.00 27.53 ? 177  VAL A CG2 1 
ATOM   994  N  N   . ASN A 1 137 ? 29.362  48.440 25.071 1.00 24.39 ? 178  ASN A N   1 
ATOM   995  C  CA  . ASN A 1 137 ? 30.020  48.527 26.349 1.00 23.86 ? 178  ASN A CA  1 
ATOM   996  C  C   . ASN A 1 137 ? 28.924  48.298 27.411 1.00 23.89 ? 178  ASN A C   1 
ATOM   997  O  O   . ASN A 1 137 ? 28.175  47.331 27.315 1.00 22.91 ? 178  ASN A O   1 
ATOM   998  C  CB  . ASN A 1 137 ? 30.716  49.893 26.479 1.00 24.55 ? 178  ASN A CB  1 
ATOM   999  C  CG  . ASN A 1 137 ? 31.786  49.915 27.528 1.00 24.27 ? 178  ASN A CG  1 
ATOM   1000 O  OD1 . ASN A 1 137 ? 32.316  48.880 27.957 1.00 26.46 ? 178  ASN A OD1 1 
ATOM   1001 N  ND2 . ASN A 1 137 ? 32.139  51.115 27.949 1.00 26.55 ? 178  ASN A ND2 1 
ATOM   1002 N  N   . TYR A 1 138 ? 28.772  49.235 28.351 1.00 23.25 ? 179  TYR A N   1 
ATOM   1003 C  CA  . TYR A 1 138 ? 27.766  49.049 29.408 1.00 22.98 ? 179  TYR A CA  1 
ATOM   1004 C  C   . TYR A 1 138 ? 26.389  49.620 29.037 1.00 22.34 ? 179  TYR A C   1 
ATOM   1005 O  O   . TYR A 1 138 ? 25.456  49.581 29.870 1.00 22.45 ? 179  TYR A O   1 
ATOM   1006 C  CB  . TYR A 1 138 ? 28.230  49.707 30.694 1.00 22.90 ? 179  TYR A CB  1 
ATOM   1007 C  CG  . TYR A 1 138 ? 29.474  49.137 31.307 1.00 22.65 ? 179  TYR A CG  1 
ATOM   1008 C  CD1 . TYR A 1 138 ? 29.416  47.976 32.074 1.00 23.92 ? 179  TYR A CD1 1 
ATOM   1009 C  CD2 . TYR A 1 138 ? 30.724  49.804 31.160 1.00 24.33 ? 179  TYR A CD2 1 
ATOM   1010 C  CE1 . TYR A 1 138 ? 30.570  47.465 32.711 1.00 24.30 ? 179  TYR A CE1 1 
ATOM   1011 C  CE2 . TYR A 1 138 ? 31.870  49.309 31.790 1.00 23.84 ? 179  TYR A CE2 1 
ATOM   1012 C  CZ  . TYR A 1 138 ? 31.788  48.133 32.560 1.00 25.93 ? 179  TYR A CZ  1 
ATOM   1013 O  OH  . TYR A 1 138 ? 32.873  47.624 33.195 1.00 26.40 ? 179  TYR A OH  1 
ATOM   1014 N  N   . ALA A 1 139 ? 26.219  50.104 27.800 1.00 21.26 ? 180  ALA A N   1 
ATOM   1015 C  CA  . ALA A 1 139 ? 24.950  50.628 27.311 1.00 21.52 ? 180  ALA A CA  1 
ATOM   1016 C  C   . ALA A 1 139 ? 24.493  51.862 28.134 1.00 22.56 ? 180  ALA A C   1 
ATOM   1017 O  O   . ALA A 1 139 ? 23.286  52.159 28.218 1.00 22.65 ? 180  ALA A O   1 
ATOM   1018 C  CB  . ALA A 1 139 ? 23.839  49.517 27.228 1.00 22.03 ? 180  ALA A CB  1 
ATOM   1019 N  N   . ARG A 1 140 ? 25.482  52.556 28.700 1.00 22.36 ? 181  ARG A N   1 
ATOM   1020 C  CA  . ARG A 1 140 ? 25.209  53.844 29.406 1.00 22.31 ? 181  ARG A CA  1 
ATOM   1021 C  C   . ARG A 1 140 ? 24.918  54.960 28.405 1.00 22.74 ? 181  ARG A C   1 
ATOM   1022 O  O   . ARG A 1 140 ? 25.228  54.868 27.199 1.00 22.92 ? 181  ARG A O   1 
ATOM   1023 C  CB  . ARG A 1 140 ? 26.362  54.220 30.298 1.00 21.49 ? 181  ARG A CB  1 
ATOM   1024 C  CG  . ARG A 1 140 ? 26.671  53.217 31.405 1.00 22.79 ? 181  ARG A CG  1 
ATOM   1025 C  CD  . ARG A 1 140 ? 28.016  53.432 32.026 1.00 26.31 ? 181  ARG A CD  1 
ATOM   1026 N  NE  . ARG A 1 140 ? 29.093  53.337 31.018 1.00 24.61 ? 181  ARG A NE  1 
ATOM   1027 C  CZ  . ARG A 1 140 ? 30.388  53.502 31.268 1.00 28.96 ? 181  ARG A CZ  1 
ATOM   1028 N  NH1 . ARG A 1 140 ? 30.833  53.770 32.490 1.00 25.59 ? 181  ARG A NH1 1 
ATOM   1029 N  NH2 . ARG A 1 140 ? 31.263  53.380 30.267 1.00 28.63 ? 181  ARG A NH2 1 
ATOM   1030 N  N   . THR A 1 141 ? 24.296  56.040 28.900 1.00 21.71 ? 182  THR A N   1 
ATOM   1031 C  CA  . THR A 1 141 ? 24.070  57.216 28.092 1.00 22.74 ? 182  THR A CA  1 
ATOM   1032 C  C   . THR A 1 141 ? 25.360  57.662 27.396 1.00 22.12 ? 182  THR A C   1 
ATOM   1033 O  O   . THR A 1 141 ? 25.323  57.883 26.191 1.00 25.19 ? 182  THR A O   1 
ATOM   1034 C  CB  . THR A 1 141 ? 23.564  58.366 28.997 1.00 22.87 ? 182  THR A CB  1 
ATOM   1035 O  OG1 . THR A 1 141 ? 22.288  57.976 29.513 1.00 23.71 ? 182  THR A OG1 1 
ATOM   1036 C  CG2 . THR A 1 141 ? 23.398  59.637 28.185 1.00 24.42 ? 182  THR A CG2 1 
ATOM   1037 N  N   . GLU A 1 142 ? 26.469  57.729 28.142 1.00 23.54 ? 183  GLU A N   1 
ATOM   1038 C  CA  . GLU A 1 142 ? 27.752  58.220 27.573 1.00 25.78 ? 183  GLU A CA  1 
ATOM   1039 C  C   . GLU A 1 142 ? 28.308  57.202 26.553 1.00 26.46 ? 183  GLU A C   1 
ATOM   1040 O  O   . GLU A 1 142 ? 28.933  57.600 25.576 1.00 27.42 ? 183  GLU A O   1 
ATOM   1041 C  CB  . GLU A 1 142 ? 28.751  58.525 28.663 1.00 26.36 ? 183  GLU A CB  1 
ATOM   1042 C  CG  . GLU A 1 142 ? 29.130  57.326 29.504 1.00 28.14 ? 183  GLU A CG  1 
ATOM   1043 C  CD  . GLU A 1 142 ? 28.324  57.239 30.801 1.00 30.62 ? 183  GLU A CD  1 
ATOM   1044 O  OE1 . GLU A 1 142 ? 27.082  57.579 30.813 1.00 30.46 ? 183  GLU A OE1 1 
ATOM   1045 O  OE2 . GLU A 1 142 ? 28.970  56.846 31.800 1.00 30.94 ? 183  GLU A OE2 1 
ATOM   1046 N  N   . ASP A 1 143 ? 28.029  55.907 26.764 1.00 26.53 ? 184  ASP A N   1 
ATOM   1047 C  CA  . ASP A 1 143 ? 28.466  54.880 25.784 1.00 26.79 ? 184  ASP A CA  1 
ATOM   1048 C  C   . ASP A 1 143 ? 27.739  55.075 24.448 1.00 28.05 ? 184  ASP A C   1 
ATOM   1049 O  O   . ASP A 1 143 ? 28.351  54.947 23.356 1.00 29.21 ? 184  ASP A O   1 
ATOM   1050 C  CB  . ASP A 1 143 ? 28.194  53.457 26.317 1.00 26.43 ? 184  ASP A CB  1 
ATOM   1051 C  CG  . ASP A 1 143 ? 29.018  53.118 27.498 1.00 25.43 ? 184  ASP A CG  1 
ATOM   1052 O  OD1 . ASP A 1 143 ? 30.195  53.562 27.626 1.00 27.15 ? 184  ASP A OD1 1 
ATOM   1053 O  OD2 . ASP A 1 143 ? 28.492  52.350 28.345 1.00 25.70 ? 184  ASP A OD2 1 
ATOM   1054 N  N   . PHE A 1 144 ? 26.427  55.365 24.503 1.00 27.67 ? 185  PHE A N   1 
ATOM   1055 C  CA  . PHE A 1 144 ? 25.667  55.645 23.293 1.00 27.53 ? 185  PHE A CA  1 
ATOM   1056 C  C   . PHE A 1 144 ? 26.025  56.980 22.654 1.00 28.27 ? 185  PHE A C   1 
ATOM   1057 O  O   . PHE A 1 144 ? 25.987  57.100 21.425 1.00 28.35 ? 185  PHE A O   1 
ATOM   1058 C  CB  . PHE A 1 144 ? 24.140  55.513 23.468 1.00 27.05 ? 185  PHE A CB  1 
ATOM   1059 C  CG  . PHE A 1 144 ? 23.662  54.103 23.482 1.00 26.85 ? 185  PHE A CG  1 
ATOM   1060 C  CD1 . PHE A 1 144 ? 23.406  53.460 24.696 1.00 25.70 ? 185  PHE A CD1 1 
ATOM   1061 C  CD2 . PHE A 1 144 ? 23.488  53.383 22.296 1.00 24.33 ? 185  PHE A CD2 1 
ATOM   1062 C  CE1 . PHE A 1 144 ? 22.933  52.133 24.736 1.00 26.69 ? 185  PHE A CE1 1 
ATOM   1063 C  CE2 . PHE A 1 144 ? 23.044  52.053 22.316 1.00 24.12 ? 185  PHE A CE2 1 
ATOM   1064 C  CZ  . PHE A 1 144 ? 22.763  51.418 23.536 1.00 26.98 ? 185  PHE A CZ  1 
ATOM   1065 N  N   . PHE A 1 145 ? 26.373  57.968 23.482 1.00 28.80 ? 186  PHE A N   1 
ATOM   1066 C  CA  . PHE A 1 145 ? 26.915  59.248 22.961 1.00 29.73 ? 186  PHE A CA  1 
ATOM   1067 C  C   . PHE A 1 145 ? 28.190  58.978 22.144 1.00 30.77 ? 186  PHE A C   1 
ATOM   1068 O  O   . PHE A 1 145 ? 28.302  59.480 21.020 1.00 31.12 ? 186  PHE A O   1 
ATOM   1069 C  CB  . PHE A 1 145 ? 27.253  60.238 24.072 1.00 29.10 ? 186  PHE A CB  1 
ATOM   1070 C  CG  . PHE A 1 145 ? 26.044  60.989 24.627 1.00 29.98 ? 186  PHE A CG  1 
ATOM   1071 C  CD1 . PHE A 1 145 ? 24.846  61.041 23.924 1.00 29.67 ? 186  PHE A CD1 1 
ATOM   1072 C  CD2 . PHE A 1 145 ? 26.134  61.672 25.844 1.00 26.53 ? 186  PHE A CD2 1 
ATOM   1073 C  CE1 . PHE A 1 145 ? 23.722  61.750 24.437 1.00 31.73 ? 186  PHE A CE1 1 
ATOM   1074 C  CE2 . PHE A 1 145 ? 24.992  62.380 26.366 1.00 24.97 ? 186  PHE A CE2 1 
ATOM   1075 C  CZ  . PHE A 1 145 ? 23.823  62.423 25.655 1.00 28.34 ? 186  PHE A CZ  1 
ATOM   1076 N  N   . LYS A 1 146 ? 29.120  58.210 22.723 1.00 32.35 ? 187  LYS A N   1 
ATOM   1077 C  CA  . LYS A 1 146 ? 30.398  57.835 22.065 1.00 33.22 ? 187  LYS A CA  1 
ATOM   1078 C  C   . LYS A 1 146 ? 30.162  57.151 20.714 1.00 34.48 ? 187  LYS A C   1 
ATOM   1079 O  O   . LYS A 1 146 ? 30.751  57.552 19.698 1.00 34.20 ? 187  LYS A O   1 
ATOM   1080 C  CB  . LYS A 1 146 ? 31.231  56.945 23.001 1.00 33.88 ? 187  LYS A CB  1 
ATOM   1081 C  CG  . LYS A 1 146 ? 32.577  56.402 22.436 1.00 34.54 ? 187  LYS A CG  1 
ATOM   1082 C  CD  . LYS A 1 146 ? 33.698  57.440 22.387 1.00 41.29 ? 187  LYS A CD  1 
ATOM   1083 C  CE  . LYS A 1 146 ? 34.366  57.565 23.751 1.00 46.67 ? 187  LYS A CE  1 
ATOM   1084 N  NZ  . LYS A 1 146 ? 35.162  58.820 23.849 1.00 50.27 ? 187  LYS A NZ  1 
ATOM   1085 N  N   . LEU A 1 147 ? 29.276  56.153 20.687 1.00 35.25 ? 188  LEU A N   1 
ATOM   1086 C  CA  . LEU A 1 147 ? 28.906  55.439 19.465 1.00 36.45 ? 188  LEU A CA  1 
ATOM   1087 C  C   . LEU A 1 147 ? 28.360  56.330 18.380 1.00 37.90 ? 188  LEU A C   1 
ATOM   1088 O  O   . LEU A 1 147 ? 28.858  56.318 17.242 1.00 37.81 ? 188  LEU A O   1 
ATOM   1089 C  CB  . LEU A 1 147 ? 27.848  54.370 19.771 1.00 36.72 ? 188  LEU A CB  1 
ATOM   1090 C  CG  . LEU A 1 147 ? 28.396  53.055 20.285 1.00 37.74 ? 188  LEU A CG  1 
ATOM   1091 C  CD1 . LEU A 1 147 ? 27.328  52.254 21.076 1.00 37.96 ? 188  LEU A CD1 1 
ATOM   1092 C  CD2 . LEU A 1 147 ? 28.917  52.235 19.105 1.00 35.98 ? 188  LEU A CD2 1 
ATOM   1093 N  N   . GLU A 1 148 ? 27.336  57.102 18.729 1.00 38.09 ? 189  GLU A N   1 
ATOM   1094 C  CA  . GLU A 1 148 ? 26.525  57.790 17.748 1.00 40.27 ? 189  GLU A CA  1 
ATOM   1095 C  C   . GLU A 1 148 ? 27.173  59.110 17.328 1.00 39.79 ? 189  GLU A C   1 
ATOM   1096 O  O   . GLU A 1 148 ? 27.183  59.455 16.126 1.00 40.08 ? 189  GLU A O   1 
ATOM   1097 C  CB  . GLU A 1 148 ? 25.098  57.974 18.299 1.00 40.16 ? 189  GLU A CB  1 
ATOM   1098 C  CG  . GLU A 1 148 ? 24.500  56.642 18.869 1.00 43.92 ? 189  GLU A CG  1 
ATOM   1099 C  CD  . GLU A 1 148 ? 23.015  56.726 19.286 1.00 44.81 ? 189  GLU A CD  1 
ATOM   1100 O  OE1 . GLU A 1 148 ? 22.720  56.519 20.486 1.00 50.79 ? 189  GLU A OE1 1 
ATOM   1101 O  OE2 . GLU A 1 148 ? 22.140  57.005 18.420 1.00 50.80 ? 189  GLU A OE2 1 
ATOM   1102 N  N   . ARG A 1 149 ? 27.747  59.819 18.301 1.00 38.96 ? 190  ARG A N   1 
ATOM   1103 C  CA  . ARG A 1 149 ? 28.271  61.162 18.079 1.00 39.33 ? 190  ARG A CA  1 
ATOM   1104 C  C   . ARG A 1 149 ? 29.717  61.185 17.633 1.00 39.75 ? 190  ARG A C   1 
ATOM   1105 O  O   . ARG A 1 149 ? 30.088  62.015 16.794 1.00 40.09 ? 190  ARG A O   1 
ATOM   1106 C  CB  . ARG A 1 149 ? 28.117  62.039 19.338 1.00 39.29 ? 190  ARG A CB  1 
ATOM   1107 C  CG  . ARG A 1 149 ? 26.679  62.316 19.698 1.00 36.56 ? 190  ARG A CG  1 
ATOM   1108 C  CD  . ARG A 1 149 ? 26.578  63.030 21.047 1.00 33.62 ? 190  ARG A CD  1 
ATOM   1109 N  NE  . ARG A 1 149 ? 25.185  63.358 21.303 1.00 33.61 ? 190  ARG A NE  1 
ATOM   1110 C  CZ  . ARG A 1 149 ? 24.765  64.148 22.298 1.00 33.77 ? 190  ARG A CZ  1 
ATOM   1111 N  NH1 . ARG A 1 149 ? 25.637  64.653 23.147 1.00 32.86 ? 190  ARG A NH1 1 
ATOM   1112 N  NH2 . ARG A 1 149 ? 23.468  64.383 22.452 1.00 30.99 ? 190  ARG A NH2 1 
ATOM   1113 N  N   . ASP A 1 150 ? 30.532  60.302 18.203 1.00 40.05 ? 191  ASP A N   1 
ATOM   1114 C  CA  . ASP A 1 150 ? 31.964  60.288 17.934 1.00 41.66 ? 191  ASP A CA  1 
ATOM   1115 C  C   . ASP A 1 150 ? 32.326  59.260 16.871 1.00 42.04 ? 191  ASP A C   1 
ATOM   1116 O  O   . ASP A 1 150 ? 33.082  59.569 15.935 1.00 42.50 ? 191  ASP A O   1 
ATOM   1117 C  CB  . ASP A 1 150 ? 32.757  60.012 19.211 1.00 41.68 ? 191  ASP A CB  1 
ATOM   1118 C  CG  . ASP A 1 150 ? 32.498  61.042 20.289 1.00 44.79 ? 191  ASP A CG  1 
ATOM   1119 O  OD1 . ASP A 1 150 ? 31.750  62.014 20.022 1.00 48.57 ? 191  ASP A OD1 1 
ATOM   1120 O  OD2 . ASP A 1 150 ? 33.025  60.872 21.411 1.00 46.75 ? 191  ASP A OD2 1 
ATOM   1121 N  N   . MET A 1 151 ? 31.783  58.049 17.008 1.00 41.57 ? 192  MET A N   1 
ATOM   1122 C  CA  . MET A 1 151 ? 32.149  56.951 16.107 1.00 41.90 ? 192  MET A CA  1 
ATOM   1123 C  C   . MET A 1 151 ? 31.215  56.884 14.915 1.00 41.58 ? 192  MET A C   1 
ATOM   1124 O  O   . MET A 1 151 ? 31.453  56.134 13.953 1.00 41.53 ? 192  MET A O   1 
ATOM   1125 C  CB  . MET A 1 151 ? 32.127  55.615 16.852 1.00 41.28 ? 192  MET A CB  1 
ATOM   1126 C  CG  . MET A 1 151 ? 33.100  55.525 17.987 1.00 41.36 ? 192  MET A CG  1 
ATOM   1127 S  SD  . MET A 1 151 ? 32.985  53.925 18.787 1.00 43.67 ? 192  MET A SD  1 
ATOM   1128 C  CE  . MET A 1 151 ? 33.962  52.926 17.637 1.00 42.48 ? 192  MET A CE  1 
ATOM   1129 N  N   . LYS A 1 152 ? 30.137  57.652 14.985 1.00 41.79 ? 193  LYS A N   1 
ATOM   1130 C  CA  . LYS A 1 152 ? 29.161  57.708 13.918 1.00 42.11 ? 193  LYS A CA  1 
ATOM   1131 C  C   . LYS A 1 152 ? 28.628  56.309 13.572 1.00 42.26 ? 193  LYS A C   1 
ATOM   1132 O  O   . LYS A 1 152 ? 28.323  56.012 12.409 1.00 42.65 ? 193  LYS A O   1 
ATOM   1133 C  CB  . LYS A 1 152 ? 29.751  58.453 12.688 1.00 43.25 ? 193  LYS A CB  1 
ATOM   1134 C  CG  . LYS A 1 152 ? 29.689  60.006 12.786 1.00 44.37 ? 193  LYS A CG  1 
ATOM   1135 C  CD  . LYS A 1 152 ? 30.695  60.618 13.766 1.00 46.41 ? 193  LYS A CD  1 
ATOM   1136 C  CE  . LYS A 1 152 ? 30.814  62.134 13.570 1.00 46.79 ? 193  LYS A CE  1 
ATOM   1137 N  NZ  . LYS A 1 152 ? 29.629  62.910 14.054 1.00 49.88 ? 193  LYS A NZ  1 
ATOM   1138 N  N   . ILE A 1 153 ? 28.495  55.451 14.590 1.00 41.18 ? 194  ILE A N   1 
ATOM   1139 C  CA  . ILE A 1 153 ? 27.909  54.123 14.407 1.00 41.34 ? 194  ILE A CA  1 
ATOM   1140 C  C   . ILE A 1 153 ? 26.437  54.198 14.733 1.00 41.48 ? 194  ILE A C   1 
ATOM   1141 O  O   . ILE A 1 153 ? 26.064  54.741 15.765 1.00 42.15 ? 194  ILE A O   1 
ATOM   1142 C  CB  . ILE A 1 153 ? 28.641  53.048 15.234 1.00 41.02 ? 194  ILE A CB  1 
ATOM   1143 C  CG1 . ILE A 1 153 ? 29.926  52.640 14.494 1.00 41.35 ? 194  ILE A CG1 1 
ATOM   1144 C  CG2 . ILE A 1 153 ? 27.764  51.799 15.444 1.00 41.42 ? 194  ILE A CG2 1 
ATOM   1145 C  CD1 . ILE A 1 153 ? 31.076  52.293 15.385 1.00 40.94 ? 194  ILE A CD1 1 
ATOM   1146 N  N   . ASN A 1 154 ? 25.612  53.684 13.831 1.00 41.44 ? 195  ASN A N   1 
ATOM   1147 C  CA  . ASN A 1 154 ? 24.166  53.742 13.950 1.00 41.60 ? 195  ASN A CA  1 
ATOM   1148 C  C   . ASN A 1 154 ? 23.605  52.407 14.451 1.00 40.82 ? 195  ASN A C   1 
ATOM   1149 O  O   . ASN A 1 154 ? 23.806  51.359 13.816 1.00 39.96 ? 195  ASN A O   1 
ATOM   1150 C  CB  . ASN A 1 154 ? 23.563  54.076 12.592 1.00 42.47 ? 195  ASN A CB  1 
ATOM   1151 C  CG  . ASN A 1 154 ? 22.116  54.546 12.677 1.00 46.39 ? 195  ASN A CG  1 
ATOM   1152 O  OD1 . ASN A 1 154 ? 21.377  54.224 13.624 1.00 45.99 ? 195  ASN A OD1 1 
ATOM   1153 N  ND2 . ASN A 1 154 ? 21.703  55.316 11.667 1.00 52.61 ? 195  ASN A ND2 1 
ATOM   1154 N  N   . CYS A 1 155 ? 22.895  52.447 15.584 1.00 39.36 ? 196  CYS A N   1 
ATOM   1155 C  CA  . CYS A 1 155 ? 22.322  51.224 16.150 1.00 38.71 ? 196  CYS A CA  1 
ATOM   1156 C  C   . CYS A 1 155 ? 20.959  50.851 15.594 1.00 37.73 ? 196  CYS A C   1 
ATOM   1157 O  O   . CYS A 1 155 ? 20.448  49.770 15.900 1.00 37.96 ? 196  CYS A O   1 
ATOM   1158 C  CB  . CYS A 1 155 ? 22.275  51.278 17.684 1.00 37.44 ? 196  CYS A CB  1 
ATOM   1159 S  SG  . CYS A 1 155 ? 23.865  51.393 18.385 1.00 39.66 ? 196  CYS A SG  1 
ATOM   1160 N  N   . SER A 1 156 ? 20.370  51.712 14.767 1.00 37.54 ? 197  SER A N   1 
ATOM   1161 C  CA  . SER A 1 156 ? 19.037  51.442 14.248 1.00 37.70 ? 197  SER A CA  1 
ATOM   1162 C  C   . SER A 1 156 ? 18.934  50.071 13.563 1.00 38.03 ? 197  SER A C   1 
ATOM   1163 O  O   . SER A 1 156 ? 19.730  49.757 12.664 1.00 38.85 ? 197  SER A O   1 
ATOM   1164 C  CB  . SER A 1 156 ? 18.582  52.553 13.302 1.00 37.59 ? 197  SER A CB  1 
ATOM   1165 O  OG  . SER A 1 156 ? 17.242  52.338 12.864 1.00 40.11 ? 197  SER A OG  1 
ATOM   1166 N  N   . GLY A 1 157 ? 17.955  49.267 13.979 1.00 36.59 ? 198  GLY A N   1 
ATOM   1167 C  CA  . GLY A 1 157 ? 17.763  47.935 13.420 1.00 36.35 ? 198  GLY A CA  1 
ATOM   1168 C  C   . GLY A 1 157 ? 18.879  46.948 13.721 1.00 35.74 ? 198  GLY A C   1 
ATOM   1169 O  O   . GLY A 1 157 ? 18.901  45.856 13.146 1.00 36.99 ? 198  GLY A O   1 
ATOM   1170 N  N   . LYS A 1 158 ? 19.820  47.317 14.588 1.00 35.06 ? 199  LYS A N   1 
ATOM   1171 C  CA  . LYS A 1 158 ? 20.864  46.373 15.029 1.00 33.84 ? 199  LYS A CA  1 
ATOM   1172 C  C   . LYS A 1 158 ? 20.397  45.651 16.293 1.00 33.52 ? 199  LYS A C   1 
ATOM   1173 O  O   . LYS A 1 158 ? 19.476  46.119 16.974 1.00 32.96 ? 199  LYS A O   1 
ATOM   1174 C  CB  . LYS A 1 158 ? 22.198  47.053 15.334 1.00 34.46 ? 199  LYS A CB  1 
ATOM   1175 C  CG  . LYS A 1 158 ? 22.783  47.904 14.212 1.00 36.73 ? 199  LYS A CG  1 
ATOM   1176 C  CD  . LYS A 1 158 ? 22.850  47.162 12.876 1.00 42.61 ? 199  LYS A CD  1 
ATOM   1177 C  CE  . LYS A 1 158 ? 23.546  48.044 11.841 1.00 45.21 ? 199  LYS A CE  1 
ATOM   1178 N  NZ  . LYS A 1 158 ? 22.694  48.152 10.637 1.00 47.55 ? 199  LYS A NZ  1 
ATOM   1179 N  N   . ILE A 1 159 ? 21.003  44.499 16.562 1.00 31.54 ? 200  ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 159 ? 20.927  43.861 17.882 1.00 30.93 ? 200  ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 159 ? 22.106  44.356 18.707 1.00 29.99 ? 200  ILE A C   1 
ATOM   1182 O  O   . ILE A 1 159 ? 23.274  44.270 18.298 1.00 30.21 ? 200  ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 159 ? 20.881  42.323 17.804 1.00 31.43 ? 200  ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 159 ? 19.586  41.887 17.075 1.00 31.80 ? 200  ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 159 ? 20.958  41.706 19.228 1.00 31.41 ? 200  ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 159 ? 19.515  40.402 16.807 1.00 33.97 ? 200  ILE A CD1 1 
ATOM   1187 N  N   . VAL A 1 160 ? 21.824  44.934 19.873 1.00 28.01 ? 201  VAL A N   1 
ATOM   1188 C  CA  . VAL A 1 160 ? 22.911  45.449 20.670 1.00 26.51 ? 201  VAL A CA  1 
ATOM   1189 C  C   . VAL A 1 160 ? 23.318  44.382 21.692 1.00 26.25 ? 201  VAL A C   1 
ATOM   1190 O  O   . VAL A 1 160 ? 22.463  43.678 22.205 1.00 26.80 ? 201  VAL A O   1 
ATOM   1191 C  CB  . VAL A 1 160 ? 22.486  46.814 21.282 1.00 27.50 ? 201  VAL A CB  1 
ATOM   1192 C  CG1 A VAL A 1 160 ? 22.050  47.813 20.171 0.50 24.42 ? 201  VAL A CG1 1 
ATOM   1193 C  CG1 B VAL A 1 160 ? 22.804  46.949 22.766 0.50 26.24 ? 201  VAL A CG1 1 
ATOM   1194 C  CG2 A VAL A 1 160 ? 21.384  46.630 22.277 0.50 25.96 ? 201  VAL A CG2 1 
ATOM   1195 C  CG2 B VAL A 1 160 ? 23.064  47.953 20.434 0.50 27.49 ? 201  VAL A CG2 1 
ATOM   1196 N  N   . ILE A 1 161 ? 24.612  44.262 21.965 1.00 24.98 ? 202  ILE A N   1 
ATOM   1197 C  CA  . ILE A 1 161 ? 25.082  43.423 23.042 1.00 24.55 ? 202  ILE A CA  1 
ATOM   1198 C  C   . ILE A 1 161 ? 25.858  44.327 24.016 1.00 24.14 ? 202  ILE A C   1 
ATOM   1199 O  O   . ILE A 1 161 ? 26.684  45.150 23.617 1.00 24.57 ? 202  ILE A O   1 
ATOM   1200 C  CB  . ILE A 1 161 ? 25.962  42.210 22.537 1.00 24.13 ? 202  ILE A CB  1 
ATOM   1201 C  CG1 . ILE A 1 161 ? 26.531  41.369 23.696 1.00 25.75 ? 202  ILE A CG1 1 
ATOM   1202 C  CG2 . ILE A 1 161 ? 27.067  42.701 21.479 1.00 25.85 ? 202  ILE A CG2 1 
ATOM   1203 C  CD1 . ILE A 1 161 ? 26.970  39.899 23.236 1.00 24.92 ? 202  ILE A CD1 1 
ATOM   1204 N  N   . ALA A 1 162 ? 25.552  44.184 25.304 1.00 23.65 ? 203  ALA A N   1 
ATOM   1205 C  CA  . ALA A 1 162 ? 26.053  45.090 26.320 1.00 23.07 ? 203  ALA A CA  1 
ATOM   1206 C  C   . ALA A 1 162 ? 26.466  44.272 27.509 1.00 22.31 ? 203  ALA A C   1 
ATOM   1207 O  O   . ALA A 1 162 ? 25.785  43.285 27.825 1.00 23.23 ? 203  ALA A O   1 
ATOM   1208 C  CB  . ALA A 1 162 ? 24.875  46.076 26.731 1.00 21.86 ? 203  ALA A CB  1 
ATOM   1209 N  N   . ARG A 1 163 ? 27.549  44.652 28.195 1.00 22.00 ? 204  ARG A N   1 
ATOM   1210 C  CA  . ARG A 1 163 ? 27.905  43.989 29.406 1.00 21.50 ? 204  ARG A CA  1 
ATOM   1211 C  C   . ARG A 1 163 ? 27.107  44.563 30.577 1.00 22.22 ? 204  ARG A C   1 
ATOM   1212 O  O   . ARG A 1 163 ? 26.806  45.768 30.621 1.00 21.88 ? 204  ARG A O   1 
ATOM   1213 C  CB  . ARG A 1 163 ? 29.409  44.060 29.714 1.00 22.70 ? 204  ARG A CB  1 
ATOM   1214 C  CG  . ARG A 1 163 ? 30.124  45.320 29.353 1.00 23.14 ? 204  ARG A CG  1 
ATOM   1215 C  CD  . ARG A 1 163 ? 31.503  45.156 29.962 1.00 25.97 ? 204  ARG A CD  1 
ATOM   1216 N  NE  . ARG A 1 163 ? 32.371  46.283 29.627 1.00 26.54 ? 204  ARG A NE  1 
ATOM   1217 C  CZ  . ARG A 1 163 ? 33.560  46.485 30.161 1.00 27.00 ? 204  ARG A CZ  1 
ATOM   1218 N  NH1 . ARG A 1 163 ? 34.036  45.666 31.091 1.00 26.73 ? 204  ARG A NH1 1 
ATOM   1219 N  NH2 . ARG A 1 163 ? 34.247  47.555 29.768 1.00 28.84 ? 204  ARG A NH2 1 
ATOM   1220 N  N   . TYR A 1 164 ? 26.752  43.681 31.503 1.00 21.59 ? 205  TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 164 ? 26.136  44.131 32.758 1.00 21.11 ? 205  TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 164 ? 27.135  44.956 33.540 1.00 22.46 ? 205  TYR A C   1 
ATOM   1223 O  O   . TYR A 1 164 ? 28.372  44.788 33.396 1.00 21.66 ? 205  TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 164 ? 25.810  42.925 33.589 1.00 19.76 ? 205  TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 164 ? 24.463  42.265 33.385 1.00 19.96 ? 205  TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 164 ? 24.347  40.879 33.093 1.00 19.33 ? 205  TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 164 ? 23.279  42.991 33.603 1.00 18.88 ? 205  TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 164 ? 23.100  40.257 33.004 1.00 18.07 ? 205  TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 164 ? 22.060  42.417 33.495 1.00 19.09 ? 205  TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 164 ? 21.941  41.027 33.236 1.00 20.90 ? 205  TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 164 ? 20.689  40.503 33.209 1.00 19.73 ? 205  TYR A OH  1 
ATOM   1232 N  N   . GLY A 1 165 ? 26.616  45.811 34.432 1.00 20.77 ? 206  GLY A N   1 
ATOM   1233 C  CA  . GLY A 1 165 ? 27.476  46.540 35.355 1.00 21.46 ? 206  GLY A CA  1 
ATOM   1234 C  C   . GLY A 1 165 ? 27.217  48.045 35.252 1.00 19.75 ? 206  GLY A C   1 
ATOM   1235 O  O   . GLY A 1 165 ? 26.615  48.539 34.267 1.00 20.73 ? 206  GLY A O   1 
ATOM   1236 N  N   . LYS A 1 166 ? 27.694  48.734 36.292 1.00 21.59 ? 207  LYS A N   1 
ATOM   1237 C  CA  . LYS A 1 166 ? 27.723  50.218 36.374 1.00 21.99 ? 207  LYS A CA  1 
ATOM   1238 C  C   . LYS A 1 166 ? 26.376  50.883 36.529 1.00 21.71 ? 207  LYS A C   1 
ATOM   1239 O  O   . LYS A 1 166 ? 26.276  51.820 37.331 1.00 20.98 ? 207  LYS A O   1 
ATOM   1240 C  CB  . LYS A 1 166 ? 28.348  50.883 35.143 1.00 22.10 ? 207  LYS A CB  1 
ATOM   1241 C  CG  . LYS A 1 166 ? 29.746  50.351 34.706 1.00 25.04 ? 207  LYS A CG  1 
ATOM   1242 C  CD  . LYS A 1 166 ? 30.735  50.640 35.771 1.00 28.44 ? 207  LYS A CD  1 
ATOM   1243 C  CE  . LYS A 1 166 ? 32.156  50.397 35.239 1.00 34.11 ? 207  LYS A CE  1 
ATOM   1244 N  NZ  . LYS A 1 166 ? 32.960  50.252 36.475 1.00 34.94 ? 207  LYS A NZ  1 
ATOM   1245 N  N   . VAL A 1 167 ? 25.371  50.440 35.780 1.00 20.44 ? 208  VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 167 ? 24.001  51.031 35.889 1.00 19.05 ? 208  VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 167 ? 22.914  49.950 35.903 1.00 18.79 ? 208  VAL A C   1 
ATOM   1248 O  O   . VAL A 1 167 ? 23.139  48.808 35.438 1.00 18.48 ? 208  VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 167 ? 23.683  52.070 34.769 1.00 18.97 ? 208  VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 167 ? 24.759  53.183 34.743 1.00 19.73 ? 208  VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 167 ? 23.483  51.390 33.355 1.00 19.84 ? 208  VAL A CG2 1 
ATOM   1252 N  N   . PHE A 1 168 ? 21.728  50.304 36.405 1.00 16.91 ? 209  PHE A N   1 
ATOM   1253 C  CA  . PHE A 1 168 ? 20.584  49.389 36.356 1.00 15.96 ? 209  PHE A CA  1 
ATOM   1254 C  C   . PHE A 1 168 ? 20.309  48.886 34.932 1.00 16.08 ? 209  PHE A C   1 
ATOM   1255 O  O   . PHE A 1 168 ? 20.278  49.673 33.936 1.00 17.14 ? 209  PHE A O   1 
ATOM   1256 C  CB  . PHE A 1 168 ? 19.336  50.176 36.841 1.00 15.92 ? 209  PHE A CB  1 
ATOM   1257 C  CG  . PHE A 1 168 ? 18.031  49.401 36.717 1.00 15.17 ? 209  PHE A CG  1 
ATOM   1258 C  CD1 . PHE A 1 168 ? 17.835  48.172 37.432 1.00 16.86 ? 209  PHE A CD1 1 
ATOM   1259 C  CD2 . PHE A 1 168 ? 16.939  49.951 35.998 1.00 18.55 ? 209  PHE A CD2 1 
ATOM   1260 C  CE1 . PHE A 1 168 ? 16.581  47.481 37.302 1.00 19.11 ? 209  PHE A CE1 1 
ATOM   1261 C  CE2 . PHE A 1 168 ? 15.754  49.239 35.895 1.00 19.77 ? 209  PHE A CE2 1 
ATOM   1262 C  CZ  . PHE A 1 168 ? 15.578  48.029 36.557 1.00 20.93 ? 209  PHE A CZ  1 
ATOM   1263 N  N   . ARG A 1 169 ? 20.055  47.580 34.820 1.00 17.31 ? 210  ARG A N   1 
ATOM   1264 C  CA  . ARG A 1 169 ? 19.830  46.976 33.468 1.00 17.82 ? 210  ARG A CA  1 
ATOM   1265 C  C   . ARG A 1 169 ? 18.670  47.585 32.659 1.00 17.75 ? 210  ARG A C   1 
ATOM   1266 O  O   . ARG A 1 169 ? 18.648  47.639 31.401 1.00 18.12 ? 210  ARG A O   1 
ATOM   1267 C  CB  . ARG A 1 169 ? 19.709  45.449 33.600 1.00 16.95 ? 210  ARG A CB  1 
ATOM   1268 C  CG  . ARG A 1 169 ? 18.453  44.995 34.346 1.00 17.74 ? 210  ARG A CG  1 
ATOM   1269 C  CD  . ARG A 1 169 ? 18.463  43.462 34.564 1.00 18.50 ? 210  ARG A CD  1 
ATOM   1270 N  NE  . ARG A 1 169 ? 19.241  43.066 35.737 1.00 16.76 ? 210  ARG A NE  1 
ATOM   1271 C  CZ  . ARG A 1 169 ? 18.821  43.283 36.994 1.00 17.52 ? 210  ARG A CZ  1 
ATOM   1272 N  NH1 . ARG A 1 169 ? 17.665  43.952 37.143 1.00 17.51 ? 210  ARG A NH1 1 
ATOM   1273 N  NH2 . ARG A 1 169 ? 19.555  42.927 38.046 1.00 17.96 ? 210  ARG A NH2 1 
ATOM   1274 N  N   . GLY A 1 170 ? 17.641  48.070 33.360 1.00 18.07 ? 211  GLY A N   1 
ATOM   1275 C  CA  . GLY A 1 170 ? 16.554  48.672 32.667 1.00 17.77 ? 211  GLY A CA  1 
ATOM   1276 C  C   . GLY A 1 170 ? 16.972  49.985 31.989 1.00 16.75 ? 211  GLY A C   1 
ATOM   1277 O  O   . GLY A 1 170 ? 16.383  50.322 30.962 1.00 18.17 ? 211  GLY A O   1 
ATOM   1278 N  N   . ASN A 1 171 ? 17.898  50.742 32.582 1.00 17.32 ? 212  ASN A N   1 
ATOM   1279 C  CA  . ASN A 1 171 ? 18.449  51.934 31.912 1.00 18.37 ? 212  ASN A CA  1 
ATOM   1280 C  C   . ASN A 1 171 ? 19.159  51.570 30.596 1.00 19.40 ? 212  ASN A C   1 
ATOM   1281 O  O   . ASN A 1 171 ? 19.040  52.294 29.576 1.00 20.14 ? 212  ASN A O   1 
ATOM   1282 C  CB  . ASN A 1 171 ? 19.355  52.717 32.807 1.00 18.79 ? 212  ASN A CB  1 
ATOM   1283 C  CG  . ASN A 1 171 ? 18.566  53.437 33.935 1.00 19.61 ? 212  ASN A CG  1 
ATOM   1284 O  OD1 . ASN A 1 171 ? 18.496  52.931 35.051 1.00 18.50 ? 212  ASN A OD1 1 
ATOM   1285 N  ND2 . ASN A 1 171 ? 17.952  54.587 33.618 1.00 20.91 ? 212  ASN A ND2 1 
ATOM   1286 N  N   . LYS A 1 172 ? 19.874  50.445 30.631 1.00 19.85 ? 213  LYS A N   1 
ATOM   1287 C  CA  . LYS A 1 172 ? 20.555  49.970 29.402 1.00 19.62 ? 213  LYS A CA  1 
ATOM   1288 C  C   . LYS A 1 172 ? 19.559  49.704 28.274 1.00 20.37 ? 213  LYS A C   1 
ATOM   1289 O  O   . LYS A 1 172 ? 19.806  50.076 27.095 1.00 21.54 ? 213  LYS A O   1 
ATOM   1290 C  CB  . LYS A 1 172 ? 21.310  48.667 29.707 1.00 18.80 ? 213  LYS A CB  1 
ATOM   1291 C  CG  . LYS A 1 172 ? 22.338  48.733 30.839 1.00 17.02 ? 213  LYS A CG  1 
ATOM   1292 C  CD  . LYS A 1 172 ? 22.975  47.335 31.083 1.00 17.59 ? 213  LYS A CD  1 
ATOM   1293 C  CE  . LYS A 1 172 ? 23.922  47.328 32.234 1.00 20.22 ? 213  LYS A CE  1 
ATOM   1294 N  NZ  . LYS A 1 172 ? 25.345  47.742 31.902 1.00 21.22 ? 213  LYS A NZ  1 
ATOM   1295 N  N   . VAL A 1 173 ? 18.456  49.018 28.602 1.00 19.52 ? 214  VAL A N   1 
ATOM   1296 C  CA  . VAL A 1 173 ? 17.447  48.631 27.635 1.00 19.65 ? 214  VAL A CA  1 
ATOM   1297 C  C   . VAL A 1 173 ? 16.741  49.898 27.115 1.00 21.93 ? 214  VAL A C   1 
ATOM   1298 O  O   . VAL A 1 173 ? 16.542  50.042 25.891 1.00 22.65 ? 214  VAL A O   1 
ATOM   1299 C  CB  . VAL A 1 173 ? 16.472  47.630 28.236 1.00 21.42 ? 214  VAL A CB  1 
ATOM   1300 C  CG1 . VAL A 1 173 ? 15.258  47.388 27.334 1.00 23.12 ? 214  VAL A CG1 1 
ATOM   1301 C  CG2 . VAL A 1 173 ? 17.253  46.336 28.608 1.00 19.40 ? 214  VAL A CG2 1 
ATOM   1302 N  N   . LYS A 1 174 ? 16.388  50.833 28.024 1.00 20.17 ? 215  LYS A N   1 
ATOM   1303 C  CA  . LYS A 1 174 ? 15.774  52.067 27.578 1.00 22.32 ? 215  LYS A CA  1 
ATOM   1304 C  C   . LYS A 1 174 ? 16.739  52.776 26.596 1.00 21.38 ? 215  LYS A C   1 
ATOM   1305 O  O   . LYS A 1 174 ? 16.288  53.241 25.522 1.00 22.80 ? 215  LYS A O   1 
ATOM   1306 C  CB  . LYS A 1 174 ? 15.452  52.968 28.769 1.00 22.41 ? 215  LYS A CB  1 
ATOM   1307 C  CG  . LYS A 1 174 ? 14.959  54.339 28.390 1.00 25.98 ? 215  LYS A CG  1 
ATOM   1308 C  CD  A LYS A 1 174 ? 14.443  55.093 29.585 0.65 31.69 ? 215  LYS A CD  1 
ATOM   1309 C  CD  B LYS A 1 174 ? 14.494  55.144 29.628 0.35 24.44 ? 215  LYS A CD  1 
ATOM   1310 C  CE  A LYS A 1 174 ? 14.286  56.571 29.249 0.65 32.66 ? 215  LYS A CE  1 
ATOM   1311 C  CE  B LYS A 1 174 ? 15.639  55.617 30.555 0.35 24.57 ? 215  LYS A CE  1 
ATOM   1312 N  NZ  A LYS A 1 174 ? 15.553  57.320 29.480 0.65 36.43 ? 215  LYS A NZ  1 
ATOM   1313 N  NZ  B LYS A 1 174 ? 15.286  56.812 31.444 0.35 26.84 ? 215  LYS A NZ  1 
ATOM   1314 N  N   . ASN A 1 175 ? 18.028  52.833 26.946 1.00 22.13 ? 216  ASN A N   1 
ATOM   1315 C  CA  . ASN A 1 175 ? 19.026  53.500 26.097 1.00 21.82 ? 216  ASN A CA  1 
ATOM   1316 C  C   . ASN A 1 175 ? 19.113  52.805 24.699 1.00 22.42 ? 216  ASN A C   1 
ATOM   1317 O  O   . ASN A 1 175 ? 19.190  53.481 23.653 1.00 23.08 ? 216  ASN A O   1 
ATOM   1318 C  CB  . ASN A 1 175 ? 20.395  53.545 26.755 1.00 21.14 ? 216  ASN A CB  1 
ATOM   1319 C  CG  . ASN A 1 175 ? 20.417  54.391 28.033 1.00 22.24 ? 216  ASN A CG  1 
ATOM   1320 O  OD1 . ASN A 1 175 ? 19.510  55.218 28.238 1.00 26.14 ? 216  ASN A OD1 1 
ATOM   1321 N  ND2 . ASN A 1 175 ? 21.468  54.231 28.865 1.00 22.22 ? 216  ASN A ND2 1 
ATOM   1322 N  N   . ALA A 1 176 ? 19.120  51.478 24.722 1.00 22.64 ? 217  ALA A N   1 
ATOM   1323 C  CA  . ALA A 1 176 ? 19.167  50.682 23.469 1.00 22.97 ? 217  ALA A CA  1 
ATOM   1324 C  C   . ALA A 1 176 ? 17.930  50.944 22.619 1.00 24.15 ? 217  ALA A C   1 
ATOM   1325 O  O   . ALA A 1 176 ? 18.054  51.135 21.407 1.00 25.38 ? 217  ALA A O   1 
ATOM   1326 C  CB  . ALA A 1 176 ? 19.332  49.165 23.761 1.00 23.27 ? 217  ALA A CB  1 
ATOM   1327 N  N   . GLN A 1 177 ? 16.741  50.992 23.245 1.00 23.93 ? 218  GLN A N   1 
ATOM   1328 C  CA  . GLN A 1 177 ? 15.491  51.230 22.531 1.00 25.99 ? 218  GLN A CA  1 
ATOM   1329 C  C   . GLN A 1 177 ? 15.516  52.597 21.829 1.00 27.13 ? 218  GLN A C   1 
ATOM   1330 O  O   . GLN A 1 177 ? 15.091  52.710 20.678 1.00 27.85 ? 218  GLN A O   1 
ATOM   1331 C  CB  A GLN A 1 177 ? 14.310  51.243 23.492 0.65 26.61 ? 218  GLN A CB  1 
ATOM   1332 C  CB  B GLN A 1 177 ? 14.299  51.109 23.486 0.35 25.40 ? 218  GLN A CB  1 
ATOM   1333 C  CG  A GLN A 1 177 ? 13.907  49.898 23.894 0.65 27.93 ? 218  GLN A CG  1 
ATOM   1334 C  CG  B GLN A 1 177 ? 12.964  51.033 22.793 0.35 23.46 ? 218  GLN A CG  1 
ATOM   1335 C  CD  A GLN A 1 177 ? 12.797  49.868 24.927 0.65 32.88 ? 218  GLN A CD  1 
ATOM   1336 C  CD  B GLN A 1 177 ? 11.821  50.765 23.758 0.35 20.38 ? 218  GLN A CD  1 
ATOM   1337 O  OE1 A GLN A 1 177 ? 12.489  48.798 25.450 0.65 35.18 ? 218  GLN A OE1 1 
ATOM   1338 O  OE1 B GLN A 1 177 ? 11.824  49.766 24.472 0.35 19.22 ? 218  GLN A OE1 1 
ATOM   1339 N  NE2 A GLN A 1 177 ? 12.187  51.028 25.226 0.65 35.83 ? 218  GLN A NE2 1 
ATOM   1340 N  NE2 B GLN A 1 177 ? 10.820  51.643 23.758 0.35 21.96 ? 218  GLN A NE2 1 
ATOM   1341 N  N   . LEU A 1 178 ? 15.994  53.627 22.528 1.00 27.60 ? 219  LEU A N   1 
ATOM   1342 C  CA  . LEU A 1 178 ? 15.965  54.989 21.983 1.00 29.67 ? 219  LEU A CA  1 
ATOM   1343 C  C   . LEU A 1 178 ? 17.003  55.184 20.886 1.00 29.94 ? 219  LEU A C   1 
ATOM   1344 O  O   . LEU A 1 178 ? 16.876  56.098 20.046 1.00 31.35 ? 219  LEU A O   1 
ATOM   1345 C  CB  . LEU A 1 178 ? 16.190  56.001 23.091 1.00 30.32 ? 219  LEU A CB  1 
ATOM   1346 C  CG  . LEU A 1 178 ? 14.959  56.021 24.018 1.00 33.24 ? 219  LEU A CG  1 
ATOM   1347 C  CD1 . LEU A 1 178 ? 15.202  56.838 25.277 1.00 37.72 ? 219  LEU A CD1 1 
ATOM   1348 C  CD2 . LEU A 1 178 ? 13.671  56.487 23.329 1.00 38.22 ? 219  LEU A CD2 1 
ATOM   1349 N  N   . ALA A 1 179 ? 18.037  54.355 20.927 1.00 28.82 ? 220  ALA A N   1 
ATOM   1350 C  CA  . ALA A 1 179 ? 19.043  54.279 19.853 1.00 28.90 ? 220  ALA A CA  1 
ATOM   1351 C  C   . ALA A 1 179 ? 18.563  53.515 18.617 1.00 29.84 ? 220  ALA A C   1 
ATOM   1352 O  O   . ALA A 1 179 ? 19.294  53.450 17.631 1.00 29.53 ? 220  ALA A O   1 
ATOM   1353 C  CB  . ALA A 1 179 ? 20.322  53.657 20.381 1.00 28.66 ? 220  ALA A CB  1 
ATOM   1354 N  N   . GLY A 1 180 ? 17.363  52.947 18.674 1.00 28.56 ? 221  GLY A N   1 
ATOM   1355 C  CA  . GLY A 1 180 ? 16.753  52.230 17.544 1.00 28.88 ? 221  GLY A CA  1 
ATOM   1356 C  C   . GLY A 1 180 ? 17.066  50.743 17.434 1.00 29.13 ? 221  GLY A C   1 
ATOM   1357 O  O   . GLY A 1 180 ? 16.730  50.106 16.411 1.00 29.29 ? 221  GLY A O   1 
ATOM   1358 N  N   . ALA A 1 181 ? 17.699  50.156 18.464 1.00 28.50 ? 222  ALA A N   1 
ATOM   1359 C  CA  . ALA A 1 181 ? 17.997  48.716 18.479 1.00 28.33 ? 222  ALA A CA  1 
ATOM   1360 C  C   . ALA A 1 181 ? 16.737  47.860 18.303 1.00 27.71 ? 222  ALA A C   1 
ATOM   1361 O  O   . ALA A 1 181 ? 15.627  48.268 18.690 1.00 28.20 ? 222  ALA A O   1 
ATOM   1362 C  CB  . ALA A 1 181 ? 18.701  48.350 19.749 1.00 27.90 ? 222  ALA A CB  1 
ATOM   1363 N  N   . LYS A 1 182 ? 16.869  46.670 17.710 1.00 27.32 ? 223  LYS A N   1 
ATOM   1364 C  CA  . LYS A 1 182 ? 15.712  45.788 17.648 1.00 27.48 ? 223  LYS A CA  1 
ATOM   1365 C  C   . LYS A 1 182 ? 15.755  44.616 18.652 1.00 25.66 ? 223  LYS A C   1 
ATOM   1366 O  O   . LYS A 1 182 ? 14.885  43.760 18.677 1.00 25.99 ? 223  LYS A O   1 
ATOM   1367 C  CB  . LYS A 1 182 ? 15.469  45.341 16.203 1.00 30.07 ? 223  LYS A CB  1 
ATOM   1368 C  CG  . LYS A 1 182 ? 16.430  44.328 15.692 1.00 33.29 ? 223  LYS A CG  1 
ATOM   1369 C  CD  . LYS A 1 182 ? 15.858  43.771 14.387 1.00 39.46 ? 223  LYS A CD  1 
ATOM   1370 C  CE  . LYS A 1 182 ? 16.940  43.362 13.428 1.00 41.34 ? 223  LYS A CE  1 
ATOM   1371 N  NZ  . LYS A 1 182 ? 16.268  43.046 12.107 1.00 44.78 ? 223  LYS A NZ  1 
ATOM   1372 N  N   . GLY A 1 183 ? 16.783  44.601 19.482 1.00 25.45 ? 224  GLY A N   1 
ATOM   1373 C  CA  . GLY A 1 183 ? 16.941  43.562 20.498 1.00 23.54 ? 224  GLY A CA  1 
ATOM   1374 C  C   . GLY A 1 183 ? 18.131  43.917 21.356 1.00 23.55 ? 224  GLY A C   1 
ATOM   1375 O  O   . GLY A 1 183 ? 18.995  44.672 20.943 1.00 23.07 ? 224  GLY A O   1 
ATOM   1376 N  N   . VAL A 1 184 ? 18.196  43.379 22.575 1.00 21.41 ? 225  VAL A N   1 
ATOM   1377 C  CA  . VAL A 1 184 ? 19.320  43.603 23.442 1.00 22.17 ? 225  VAL A CA  1 
ATOM   1378 C  C   . VAL A 1 184 ? 19.731  42.265 24.068 1.00 22.00 ? 225  VAL A C   1 
ATOM   1379 O  O   . VAL A 1 184 ? 18.887  41.507 24.564 1.00 22.49 ? 225  VAL A O   1 
ATOM   1380 C  CB  . VAL A 1 184 ? 18.965  44.562 24.639 1.00 22.52 ? 225  VAL A CB  1 
ATOM   1381 C  CG1 . VAL A 1 184 ? 20.195  44.835 25.478 1.00 23.03 ? 225  VAL A CG1 1 
ATOM   1382 C  CG2 . VAL A 1 184 ? 18.318  45.880 24.103 1.00 24.43 ? 225  VAL A CG2 1 
ATOM   1383 N  N   . ILE A 1 185 ? 21.025  41.993 24.036 1.00 22.73 ? 226  ILE A N   1 
ATOM   1384 C  CA  . ILE A 1 185 ? 21.607  40.824 24.699 1.00 22.33 ? 226  ILE A CA  1 
ATOM   1385 C  C   . ILE A 1 185 ? 22.487  41.385 25.804 1.00 22.44 ? 226  ILE A C   1 
ATOM   1386 O  O   . ILE A 1 185 ? 23.325  42.218 25.543 1.00 22.58 ? 226  ILE A O   1 
ATOM   1387 C  CB  . ILE A 1 185 ? 22.494  40.020 23.707 1.00 23.96 ? 226  ILE A CB  1 
ATOM   1388 C  CG1 . ILE A 1 185 ? 21.618  39.520 22.572 1.00 27.04 ? 226  ILE A CG1 1 
ATOM   1389 C  CG2 . ILE A 1 185 ? 23.191  38.904 24.435 1.00 24.02 ? 226  ILE A CG2 1 
ATOM   1390 C  CD1 . ILE A 1 185 ? 22.462  38.967 21.382 1.00 24.19 ? 226  ILE A CD1 1 
ATOM   1391 N  N   . LEU A 1 186 ? 22.247  40.947 27.045 1.00 22.13 ? 227  LEU A N   1 
ATOM   1392 C  CA  . LEU A 1 186 ? 23.016  41.377 28.194 1.00 21.50 ? 227  LEU A CA  1 
ATOM   1393 C  C   . LEU A 1 186 ? 23.919  40.231 28.600 1.00 21.88 ? 227  LEU A C   1 
ATOM   1394 O  O   . LEU A 1 186 ? 23.460  39.077 28.600 1.00 21.90 ? 227  LEU A O   1 
ATOM   1395 C  CB  . LEU A 1 186 ? 22.041  41.694 29.352 1.00 21.72 ? 227  LEU A CB  1 
ATOM   1396 C  CG  . LEU A 1 186 ? 21.105  42.893 29.137 1.00 22.52 ? 227  LEU A CG  1 
ATOM   1397 C  CD1 . LEU A 1 186 ? 19.984  42.977 30.247 1.00 23.35 ? 227  LEU A CD1 1 
ATOM   1398 C  CD2 . LEU A 1 186 ? 21.928  44.169 29.096 1.00 24.63 ? 227  LEU A CD2 1 
ATOM   1399 N  N   . TYR A 1 187 ? 25.166  40.513 28.970 1.00 22.49 ? 228  TYR A N   1 
ATOM   1400 C  CA  . TYR A 1 187 ? 26.007  39.437 29.474 1.00 22.31 ? 228  TYR A CA  1 
ATOM   1401 C  C   . TYR A 1 187 ? 26.919  39.882 30.595 1.00 22.00 ? 228  TYR A C   1 
ATOM   1402 O  O   . TYR A 1 187 ? 27.195  41.107 30.744 1.00 21.36 ? 228  TYR A O   1 
ATOM   1403 C  CB  . TYR A 1 187 ? 26.848  38.752 28.334 1.00 21.79 ? 228  TYR A CB  1 
ATOM   1404 C  CG  . TYR A 1 187 ? 28.097  39.563 28.009 1.00 21.86 ? 228  TYR A CG  1 
ATOM   1405 C  CD1 . TYR A 1 187 ? 29.337  39.236 28.592 1.00 23.45 ? 228  TYR A CD1 1 
ATOM   1406 C  CD2 . TYR A 1 187 ? 28.019  40.695 27.176 1.00 23.07 ? 228  TYR A CD2 1 
ATOM   1407 C  CE1 . TYR A 1 187 ? 30.484  40.032 28.339 1.00 23.78 ? 228  TYR A CE1 1 
ATOM   1408 C  CE2 . TYR A 1 187 ? 29.184  41.478 26.887 1.00 22.52 ? 228  TYR A CE2 1 
ATOM   1409 C  CZ  . TYR A 1 187 ? 30.381  41.137 27.506 1.00 23.52 ? 228  TYR A CZ  1 
ATOM   1410 O  OH  . TYR A 1 187 ? 31.520  41.890 27.323 1.00 25.93 ? 228  TYR A OH  1 
ATOM   1411 N  N   . SER A 1 188 ? 27.426  38.910 31.365 1.00 21.55 ? 229  SER A N   1 
ATOM   1412 C  CA  . SER A 1 188 ? 28.319  39.191 32.466 1.00 22.74 ? 229  SER A CA  1 
ATOM   1413 C  C   . SER A 1 188 ? 29.785  39.045 32.038 1.00 24.22 ? 229  SER A C   1 
ATOM   1414 O  O   . SER A 1 188 ? 30.255  37.926 31.817 1.00 23.95 ? 229  SER A O   1 
ATOM   1415 C  CB  . SER A 1 188 ? 27.999  38.243 33.609 1.00 22.33 ? 229  SER A CB  1 
ATOM   1416 O  OG  . SER A 1 188 ? 26.648  38.502 34.063 1.00 22.81 ? 229  SER A OG  1 
ATOM   1417 N  N   . ASP A 1 189 ? 30.505  40.158 31.938 1.00 22.96 ? 230  ASP A N   1 
ATOM   1418 C  CA  . ASP A 1 189 ? 31.949  40.055 31.588 1.00 24.17 ? 230  ASP A CA  1 
ATOM   1419 C  C   . ASP A 1 189 ? 32.783  39.704 32.818 1.00 24.54 ? 230  ASP A C   1 
ATOM   1420 O  O   . ASP A 1 189 ? 32.598  40.250 33.908 1.00 24.45 ? 230  ASP A O   1 
ATOM   1421 C  CB  . ASP A 1 189 ? 32.398  41.354 30.936 1.00 24.50 ? 230  ASP A CB  1 
ATOM   1422 C  CG  . ASP A 1 189 ? 33.694  41.204 30.086 1.00 23.51 ? 230  ASP A CG  1 
ATOM   1423 O  OD1 . ASP A 1 189 ? 33.604  41.320 28.855 1.00 25.35 ? 230  ASP A OD1 1 
ATOM   1424 O  OD2 . ASP A 1 189 ? 34.754  41.027 30.688 1.00 24.46 ? 230  ASP A OD2 1 
ATOM   1425 N  N   . PRO A 1 190 ? 33.766  38.776 32.685 1.00 24.95 ? 231  PRO A N   1 
ATOM   1426 C  CA  . PRO A 1 190 ? 34.633  38.537 33.829 1.00 25.67 ? 231  PRO A CA  1 
ATOM   1427 C  C   . PRO A 1 190 ? 35.336  39.782 34.362 1.00 25.51 ? 231  PRO A C   1 
ATOM   1428 O  O   . PRO A 1 190 ? 35.708  39.775 35.504 1.00 25.90 ? 231  PRO A O   1 
ATOM   1429 C  CB  . PRO A 1 190 ? 35.682  37.523 33.323 1.00 26.53 ? 231  PRO A CB  1 
ATOM   1430 C  CG  . PRO A 1 190 ? 35.263  37.142 31.924 1.00 27.00 ? 231  PRO A CG  1 
ATOM   1431 C  CD  . PRO A 1 190 ? 34.022  37.900 31.521 1.00 24.88 ? 231  PRO A CD  1 
ATOM   1432 N  N   . ALA A 1 191 ? 35.476  40.835 33.558 1.00 25.98 ? 232  ALA A N   1 
ATOM   1433 C  CA  . ALA A 1 191 ? 36.139  42.071 34.016 1.00 25.61 ? 232  ALA A CA  1 
ATOM   1434 C  C   . ALA A 1 191 ? 35.368  42.628 35.227 1.00 26.17 ? 232  ALA A C   1 
ATOM   1435 O  O   . ALA A 1 191 ? 35.944  43.112 36.224 1.00 26.33 ? 232  ALA A O   1 
ATOM   1436 C  CB  . ALA A 1 191 ? 36.183  43.107 32.885 1.00 26.93 ? 232  ALA A CB  1 
ATOM   1437 N  N   . ASP A 1 192 ? 34.055  42.483 35.143 1.00 24.92 ? 233  ASP A N   1 
ATOM   1438 C  CA  . ASP A 1 192 ? 33.135  43.036 36.165 1.00 25.21 ? 233  ASP A CA  1 
ATOM   1439 C  C   . ASP A 1 192 ? 32.665  41.982 37.176 1.00 26.04 ? 233  ASP A C   1 
ATOM   1440 O  O   . ASP A 1 192 ? 32.317  42.318 38.343 1.00 26.95 ? 233  ASP A O   1 
ATOM   1441 C  CB  . ASP A 1 192 ? 31.939  43.594 35.430 1.00 25.50 ? 233  ASP A CB  1 
ATOM   1442 C  CG  . ASP A 1 192 ? 32.340  44.603 34.370 1.00 23.69 ? 233  ASP A CG  1 
ATOM   1443 O  OD1 . ASP A 1 192 ? 32.677  45.742 34.781 1.00 29.65 ? 233  ASP A OD1 1 
ATOM   1444 O  OD2 . ASP A 1 192 ? 32.303  44.283 33.154 1.00 24.12 ? 233  ASP A OD2 1 
ATOM   1445 N  N   . TYR A 1 193 ? 32.670  40.705 36.774 1.00 24.23 ? 234  TYR A N   1 
ATOM   1446 C  CA  . TYR A 1 193 ? 32.096  39.621 37.591 1.00 23.88 ? 234  TYR A CA  1 
ATOM   1447 C  C   . TYR A 1 193 ? 33.023  38.456 37.961 1.00 25.47 ? 234  TYR A C   1 
ATOM   1448 O  O   . TYR A 1 193 ? 32.566  37.420 38.449 1.00 24.70 ? 234  TYR A O   1 
ATOM   1449 C  CB  . TYR A 1 193 ? 30.787  39.094 36.978 1.00 24.29 ? 234  TYR A CB  1 
ATOM   1450 C  CG  . TYR A 1 193 ? 29.736  40.186 36.950 1.00 23.29 ? 234  TYR A CG  1 
ATOM   1451 C  CD1 . TYR A 1 193 ? 29.569  40.948 35.797 1.00 25.01 ? 234  TYR A CD1 1 
ATOM   1452 C  CD2 . TYR A 1 193 ? 28.999  40.512 38.089 1.00 27.69 ? 234  TYR A CD2 1 
ATOM   1453 C  CE1 . TYR A 1 193 ? 28.646  42.001 35.739 1.00 24.51 ? 234  TYR A CE1 1 
ATOM   1454 C  CE2 . TYR A 1 193 ? 28.080  41.564 38.055 1.00 26.85 ? 234  TYR A CE2 1 
ATOM   1455 C  CZ  . TYR A 1 193 ? 27.909  42.280 36.882 1.00 25.76 ? 234  TYR A CZ  1 
ATOM   1456 O  OH  . TYR A 1 193 ? 27.013  43.328 36.815 1.00 23.03 ? 234  TYR A OH  1 
ATOM   1457 N  N   . PHE A 1 194 ? 34.328  38.625 37.754 1.00 26.43 ? 235  PHE A N   1 
ATOM   1458 C  CA  . PHE A 1 194 ? 35.263  37.549 38.157 1.00 27.53 ? 235  PHE A CA  1 
ATOM   1459 C  C   . PHE A 1 194 ? 36.459  38.223 38.807 1.00 28.32 ? 235  PHE A C   1 
ATOM   1460 O  O   . PHE A 1 194 ? 37.261  38.814 38.114 1.00 29.01 ? 235  PHE A O   1 
ATOM   1461 C  CB  . PHE A 1 194 ? 35.740  36.767 36.922 1.00 28.59 ? 235  PHE A CB  1 
ATOM   1462 C  CG  . PHE A 1 194 ? 36.460  35.517 37.272 1.00 29.00 ? 235  PHE A CG  1 
ATOM   1463 C  CD1 . PHE A 1 194 ? 35.748  34.307 37.387 1.00 29.12 ? 235  PHE A CD1 1 
ATOM   1464 C  CD2 . PHE A 1 194 ? 37.837  35.526 37.524 1.00 29.22 ? 235  PHE A CD2 1 
ATOM   1465 C  CE1 . PHE A 1 194 ? 36.422  33.101 37.745 1.00 31.07 ? 235  PHE A CE1 1 
ATOM   1466 C  CE2 . PHE A 1 194 ? 38.505  34.346 37.891 1.00 30.47 ? 235  PHE A CE2 1 
ATOM   1467 C  CZ  . PHE A 1 194 ? 37.790  33.113 37.998 1.00 30.45 ? 235  PHE A CZ  1 
ATOM   1468 N  N   . ALA A 1 195 ? 36.541  38.141 40.118 1.00 27.93 ? 236  ALA A N   1 
ATOM   1469 C  CA  . ALA A 1 195 ? 37.609  38.806 40.871 1.00 30.52 ? 236  ALA A CA  1 
ATOM   1470 C  C   . ALA A 1 195 ? 38.921  37.999 40.673 1.00 32.20 ? 236  ALA A C   1 
ATOM   1471 O  O   . ALA A 1 195 ? 38.908  36.796 40.828 1.00 31.03 ? 236  ALA A O   1 
ATOM   1472 C  CB  . ALA A 1 195 ? 37.233  38.834 42.307 1.00 31.14 ? 236  ALA A CB  1 
ATOM   1473 N  N   . PRO A 1 196 ? 40.029  38.665 40.279 1.00 33.53 ? 237  PRO A N   1 
ATOM   1474 C  CA  . PRO A 1 196 ? 41.343  37.995 40.209 1.00 35.13 ? 237  PRO A CA  1 
ATOM   1475 C  C   . PRO A 1 196 ? 41.715  37.142 41.421 1.00 35.08 ? 237  PRO A C   1 
ATOM   1476 O  O   . PRO A 1 196 ? 41.567  37.586 42.572 1.00 36.00 ? 237  PRO A O   1 
ATOM   1477 C  CB  . PRO A 1 196 ? 42.315  39.172 40.036 1.00 35.06 ? 237  PRO A CB  1 
ATOM   1478 C  CG  . PRO A 1 196 ? 41.491  40.125 39.124 1.00 36.30 ? 237  PRO A CG  1 
ATOM   1479 C  CD  . PRO A 1 196 ? 40.103  40.052 39.762 1.00 34.74 ? 237  PRO A CD  1 
ATOM   1480 N  N   . GLY A 1 197 ? 42.157  35.905 41.169 1.00 34.45 ? 238  GLY A N   1 
ATOM   1481 C  CA  . GLY A 1 197 ? 42.676  35.074 42.258 1.00 34.32 ? 238  GLY A CA  1 
ATOM   1482 C  C   . GLY A 1 197 ? 41.673  34.308 43.097 1.00 34.15 ? 238  GLY A C   1 
ATOM   1483 O  O   . GLY A 1 197 ? 42.051  33.662 44.068 1.00 35.63 ? 238  GLY A O   1 
ATOM   1484 N  N   . VAL A 1 198 ? 40.385  34.365 42.737 1.00 32.01 ? 239  VAL A N   1 
ATOM   1485 C  CA  . VAL A 1 198 ? 39.358  33.626 43.480 1.00 29.72 ? 239  VAL A CA  1 
ATOM   1486 C  C   . VAL A 1 198 ? 38.735  32.595 42.514 1.00 28.87 ? 239  VAL A C   1 
ATOM   1487 O  O   . VAL A 1 198 ? 38.612  32.834 41.317 1.00 28.01 ? 239  VAL A O   1 
ATOM   1488 C  CB  . VAL A 1 198 ? 38.281  34.599 44.213 1.00 30.10 ? 239  VAL A CB  1 
ATOM   1489 C  CG1 A VAL A 1 198 ? 38.683  36.073 44.118 0.50 28.59 ? 239  VAL A CG1 1 
ATOM   1490 C  CG1 B VAL A 1 198 ? 37.072  33.834 44.740 0.50 25.28 ? 239  VAL A CG1 1 
ATOM   1491 C  CG2 A VAL A 1 198 ? 36.867  34.306 43.818 0.50 28.98 ? 239  VAL A CG2 1 
ATOM   1492 C  CG2 B VAL A 1 198 ? 38.912  35.427 45.324 0.50 26.57 ? 239  VAL A CG2 1 
ATOM   1493 N  N   . LYS A 1 199 ? 38.364  31.451 43.064 1.00 31.08 ? 240  LYS A N   1 
ATOM   1494 C  CA  . LYS A 1 199 ? 37.771  30.386 42.267 1.00 32.83 ? 240  LYS A CA  1 
ATOM   1495 C  C   . LYS A 1 199 ? 36.268  30.598 41.992 1.00 32.48 ? 240  LYS A C   1 
ATOM   1496 O  O   . LYS A 1 199 ? 35.546  31.157 42.835 1.00 32.96 ? 240  LYS A O   1 
ATOM   1497 C  CB  . LYS A 1 199 ? 37.998  29.033 42.948 1.00 34.45 ? 240  LYS A CB  1 
ATOM   1498 C  CG  . LYS A 1 199 ? 39.505  28.582 42.948 1.00 38.59 ? 240  LYS A CG  1 
ATOM   1499 C  CD  . LYS A 1 199 ? 40.084  28.533 41.513 1.00 40.22 ? 240  LYS A CD  1 
ATOM   1500 C  CE  . LYS A 1 199 ? 41.549  28.003 41.453 1.00 41.87 ? 240  LYS A CE  1 
ATOM   1501 N  NZ  . LYS A 1 199 ? 42.098  28.080 40.029 1.00 44.05 ? 240  LYS A NZ  1 
ATOM   1502 N  N   . SER A 1 200 ? 35.832  30.137 40.826 1.00 30.81 ? 241  SER A N   1 
ATOM   1503 C  CA  . SER A 1 200 ? 34.425  30.037 40.450 1.00 30.00 ? 241  SER A CA  1 
ATOM   1504 C  C   . SER A 1 200 ? 33.665  29.151 41.419 1.00 29.44 ? 241  SER A C   1 
ATOM   1505 O  O   . SER A 1 200 ? 34.221  28.175 41.973 1.00 28.91 ? 241  SER A O   1 
ATOM   1506 C  CB  . SER A 1 200 ? 34.311  29.344 39.096 1.00 31.36 ? 241  SER A CB  1 
ATOM   1507 O  OG  . SER A 1 200 ? 34.684  30.183 38.042 1.00 35.48 ? 241  SER A OG  1 
ATOM   1508 N  N   . TYR A 1 201 ? 32.360  29.435 41.575 1.00 26.76 ? 242  TYR A N   1 
ATOM   1509 C  CA  . TYR A 1 201 ? 31.516  28.597 42.370 1.00 25.68 ? 242  TYR A CA  1 
ATOM   1510 C  C   . TYR A 1 201 ? 31.512  27.179 41.742 1.00 24.62 ? 242  TYR A C   1 
ATOM   1511 O  O   . TYR A 1 201 ? 31.397  27.085 40.526 1.00 24.98 ? 242  TYR A O   1 
ATOM   1512 C  CB  . TYR A 1 201 ? 30.068  29.175 42.418 1.00 26.14 ? 242  TYR A CB  1 
ATOM   1513 C  CG  . TYR A 1 201 ? 29.315  28.594 43.567 1.00 24.93 ? 242  TYR A CG  1 
ATOM   1514 C  CD1 . TYR A 1 201 ? 29.636  28.957 44.854 1.00 24.33 ? 242  TYR A CD1 1 
ATOM   1515 C  CD2 . TYR A 1 201 ? 28.374  27.558 43.379 1.00 25.89 ? 242  TYR A CD2 1 
ATOM   1516 C  CE1 . TYR A 1 201 ? 29.016  28.377 45.935 1.00 24.86 ? 242  TYR A CE1 1 
ATOM   1517 C  CE2 . TYR A 1 201 ? 27.748  26.963 44.442 1.00 24.36 ? 242  TYR A CE2 1 
ATOM   1518 C  CZ  . TYR A 1 201 ? 28.064  27.400 45.715 1.00 24.71 ? 242  TYR A CZ  1 
ATOM   1519 O  OH  . TYR A 1 201 ? 27.503  26.805 46.796 1.00 30.58 ? 242  TYR A OH  1 
ATOM   1520 N  N   . PRO A 1 202 ? 31.512  26.104 42.565 1.00 25.08 ? 243  PRO A N   1 
ATOM   1521 C  CA  . PRO A 1 202 ? 31.335  25.925 44.005 1.00 25.30 ? 243  PRO A CA  1 
ATOM   1522 C  C   . PRO A 1 202 ? 32.565  26.042 44.884 1.00 26.58 ? 243  PRO A C   1 
ATOM   1523 O  O   . PRO A 1 202 ? 32.467  25.812 46.076 1.00 27.64 ? 243  PRO A O   1 
ATOM   1524 C  CB  . PRO A 1 202 ? 30.738  24.509 44.111 1.00 27.38 ? 243  PRO A CB  1 
ATOM   1525 C  CG  . PRO A 1 202 ? 31.346  23.776 42.932 1.00 25.60 ? 243  PRO A CG  1 
ATOM   1526 C  CD  . PRO A 1 202 ? 31.553  24.792 41.853 1.00 25.88 ? 243  PRO A CD  1 
ATOM   1527 N  N   . ASP A 1 203 ? 33.702  26.380 44.296 1.00 28.02 ? 244  ASP A N   1 
ATOM   1528 C  CA  . ASP A 1 203 ? 34.948  26.378 45.033 1.00 30.65 ? 244  ASP A CA  1 
ATOM   1529 C  C   . ASP A 1 203 ? 35.389  27.768 45.449 1.00 30.51 ? 244  ASP A C   1 
ATOM   1530 O  O   . ASP A 1 203 ? 36.358  27.917 46.195 1.00 29.87 ? 244  ASP A O   1 
ATOM   1531 C  CB  . ASP A 1 203 ? 36.039  25.690 44.201 1.00 30.96 ? 244  ASP A CB  1 
ATOM   1532 C  CG  . ASP A 1 203 ? 35.644  24.267 43.820 1.00 33.80 ? 244  ASP A CG  1 
ATOM   1533 O  OD1 . ASP A 1 203 ? 35.373  23.459 44.747 1.00 33.65 ? 244  ASP A OD1 1 
ATOM   1534 O  OD2 . ASP A 1 203 ? 35.509  23.989 42.602 1.00 40.00 ? 244  ASP A OD2 1 
ATOM   1535 N  N   . GLY A 1 204 ? 34.677  28.799 44.963 1.00 30.22 ? 245  GLY A N   1 
ATOM   1536 C  CA  . GLY A 1 204 ? 34.913  30.142 45.461 1.00 27.76 ? 245  GLY A CA  1 
ATOM   1537 C  C   . GLY A 1 204 ? 33.666  30.967 45.171 1.00 26.65 ? 245  GLY A C   1 
ATOM   1538 O  O   . GLY A 1 204 ? 32.598  30.394 44.863 1.00 26.48 ? 245  GLY A O   1 
ATOM   1539 N  N   . TRP A 1 205 ? 33.791  32.284 45.301 1.00 25.76 ? 246  TRP A N   1 
ATOM   1540 C  CA  . TRP A 1 205 ? 32.597  33.159 45.092 1.00 25.51 ? 246  TRP A CA  1 
ATOM   1541 C  C   . TRP A 1 205 ? 32.468  33.816 43.740 1.00 25.83 ? 246  TRP A C   1 
ATOM   1542 O  O   . TRP A 1 205 ? 31.516  34.631 43.494 1.00 24.31 ? 246  TRP A O   1 
ATOM   1543 C  CB  . TRP A 1 205 ? 32.466  34.191 46.240 1.00 25.04 ? 246  TRP A CB  1 
ATOM   1544 C  CG  . TRP A 1 205 ? 33.708  34.944 46.574 1.00 27.30 ? 246  TRP A CG  1 
ATOM   1545 C  CD1 . TRP A 1 205 ? 34.624  34.612 47.545 1.00 29.10 ? 246  TRP A CD1 1 
ATOM   1546 C  CD2 . TRP A 1 205 ? 34.143  36.192 46.014 1.00 27.19 ? 246  TRP A CD2 1 
ATOM   1547 N  NE1 . TRP A 1 205 ? 35.621  35.579 47.599 1.00 29.19 ? 246  TRP A NE1 1 
ATOM   1548 C  CE2 . TRP A 1 205 ? 35.357  36.545 46.669 1.00 27.64 ? 246  TRP A CE2 1 
ATOM   1549 C  CE3 . TRP A 1 205 ? 33.651  37.029 45.004 1.00 27.87 ? 246  TRP A CE3 1 
ATOM   1550 C  CZ2 . TRP A 1 205 ? 36.052  37.706 46.369 1.00 27.97 ? 246  TRP A CZ2 1 
ATOM   1551 C  CZ3 . TRP A 1 205 ? 34.342  38.190 44.685 1.00 29.38 ? 246  TRP A CZ3 1 
ATOM   1552 C  CH2 . TRP A 1 205 ? 35.546  38.526 45.367 1.00 27.52 ? 246  TRP A CH2 1 
ATOM   1553 N  N   . ASN A 1 206 ? 33.346  33.438 42.801 1.00 24.10 ? 247  ASN A N   1 
ATOM   1554 C  CA  . ASN A 1 206 ? 33.281  33.924 41.433 1.00 25.01 ? 247  ASN A CA  1 
ATOM   1555 C  C   . ASN A 1 206 ? 32.215  33.327 40.532 1.00 23.48 ? 247  ASN A C   1 
ATOM   1556 O  O   . ASN A 1 206 ? 31.732  32.226 40.784 1.00 23.59 ? 247  ASN A O   1 
ATOM   1557 C  CB  . ASN A 1 206 ? 34.654  33.840 40.747 1.00 25.70 ? 247  ASN A CB  1 
ATOM   1558 C  CG  . ASN A 1 206 ? 35.468  35.110 40.912 1.00 28.98 ? 247  ASN A CG  1 
ATOM   1559 O  OD1 . ASN A 1 206 ? 34.943  36.186 41.275 1.00 27.84 ? 247  ASN A OD1 1 
ATOM   1560 N  ND2 . ASN A 1 206 ? 36.775  35.002 40.669 1.00 25.52 ? 247  ASN A ND2 1 
ATOM   1561 N  N   . LEU A 1 207 ? 31.854  34.093 39.500 1.00 23.74 ? 248  LEU A N   1 
ATOM   1562 C  CA  . LEU A 1 207 ? 30.869  33.694 38.532 1.00 22.75 ? 248  LEU A CA  1 
ATOM   1563 C  C   . LEU A 1 207 ? 31.513  32.723 37.512 1.00 22.41 ? 248  LEU A C   1 
ATOM   1564 O  O   . LEU A 1 207 ? 32.432  33.134 36.808 1.00 23.96 ? 248  LEU A O   1 
ATOM   1565 C  CB  . LEU A 1 207 ? 30.351  34.901 37.770 1.00 23.00 ? 248  LEU A CB  1 
ATOM   1566 C  CG  . LEU A 1 207 ? 29.209  34.636 36.808 1.00 24.30 ? 248  LEU A CG  1 
ATOM   1567 C  CD1 . LEU A 1 207 ? 27.948  34.141 37.550 1.00 23.66 ? 248  LEU A CD1 1 
ATOM   1568 C  CD2 . LEU A 1 207 ? 28.924  35.878 35.944 1.00 24.71 ? 248  LEU A CD2 1 
ATOM   1569 N  N   . PRO A 1 208 ? 30.967  31.502 37.392 1.00 22.11 ? 249  PRO A N   1 
ATOM   1570 C  CA  . PRO A 1 208 ? 31.438  30.608 36.307 1.00 22.40 ? 249  PRO A CA  1 
ATOM   1571 C  C   . PRO A 1 208 ? 30.928  31.017 34.949 1.00 22.27 ? 249  PRO A C   1 
ATOM   1572 O  O   . PRO A 1 208 ? 29.950  31.793 34.821 1.00 22.37 ? 249  PRO A O   1 
ATOM   1573 C  CB  . PRO A 1 208 ? 30.866  29.236 36.688 1.00 22.94 ? 249  PRO A CB  1 
ATOM   1574 C  CG  . PRO A 1 208 ? 29.927  29.392 37.724 1.00 24.15 ? 249  PRO A CG  1 
ATOM   1575 C  CD  . PRO A 1 208 ? 29.934  30.852 38.214 1.00 22.12 ? 249  PRO A CD  1 
ATOM   1576 N  N   . GLY A 1 209 ? 31.573  30.506 33.898 1.00 20.98 ? 250  GLY A N   1 
ATOM   1577 C  CA  . GLY A 1 209 ? 31.201  30.931 32.575 1.00 21.68 ? 250  GLY A CA  1 
ATOM   1578 C  C   . GLY A 1 209 ? 29.783  30.607 32.129 1.00 20.11 ? 250  GLY A C   1 
ATOM   1579 O  O   . GLY A 1 209 ? 29.325  31.198 31.151 1.00 23.39 ? 250  GLY A O   1 
ATOM   1580 N  N   . GLY A 1 210 ? 29.131  29.656 32.799 1.00 21.61 ? 251  GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 210 ? 27.768  29.263 32.490 1.00 22.08 ? 251  GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 210 ? 26.752  30.014 33.376 1.00 22.37 ? 251  GLY A C   1 
ATOM   1583 O  O   . GLY A 1 210 ? 25.554  29.890 33.161 1.00 23.17 ? 251  GLY A O   1 
ATOM   1584 N  N   . GLY A 1 211 ? 27.268  30.739 34.357 1.00 23.28 ? 252  GLY A N   1 
ATOM   1585 C  CA  . GLY A 1 211 ? 26.409  31.558 35.268 1.00 21.96 ? 252  GLY A CA  1 
ATOM   1586 C  C   . GLY A 1 211 ? 25.742  32.713 34.518 1.00 21.88 ? 252  GLY A C   1 
ATOM   1587 O  O   . GLY A 1 211 ? 26.306  33.319 33.578 1.00 20.05 ? 252  GLY A O   1 
ATOM   1588 N  N   . VAL A 1 212 ? 24.531  33.077 34.969 1.00 20.93 ? 253  VAL A N   1 
ATOM   1589 C  CA  . VAL A 1 212 ? 23.823  34.177 34.311 1.00 20.49 ? 253  VAL A CA  1 
ATOM   1590 C  C   . VAL A 1 212 ? 23.009  34.967 35.366 1.00 19.05 ? 253  VAL A C   1 
ATOM   1591 O  O   . VAL A 1 212 ? 22.370  34.393 36.230 1.00 19.75 ? 253  VAL A O   1 
ATOM   1592 C  CB  . VAL A 1 212 ? 22.757  33.696 33.267 1.00 20.15 ? 253  VAL A CB  1 
ATOM   1593 C  CG1 . VAL A 1 212 ? 22.223  34.867 32.403 1.00 22.25 ? 253  VAL A CG1 1 
ATOM   1594 C  CG2 . VAL A 1 212 ? 23.346  32.638 32.261 1.00 21.25 ? 253  VAL A CG2 1 
ATOM   1595 N  N   . GLN A 1 213 ? 22.952  36.260 35.111 1.00 19.43 ? 254  GLN A N   1 
ATOM   1596 C  CA  . GLN A 1 213 ? 22.235  37.166 36.030 1.00 18.67 ? 254  GLN A CA  1 
ATOM   1597 C  C   . GLN A 1 213 ? 20.849  37.411 35.459 1.00 17.86 ? 254  GLN A C   1 
ATOM   1598 O  O   . GLN A 1 213 ? 20.699  37.985 34.357 1.00 18.84 ? 254  GLN A O   1 
ATOM   1599 C  CB  . GLN A 1 213 ? 23.029  38.501 36.139 1.00 17.87 ? 254  GLN A CB  1 
ATOM   1600 C  CG  . GLN A 1 213 ? 22.221  39.600 36.974 1.00 16.91 ? 254  GLN A CG  1 
ATOM   1601 C  CD  . GLN A 1 213 ? 22.809  41.015 36.873 1.00 20.55 ? 254  GLN A CD  1 
ATOM   1602 O  OE1 . GLN A 1 213 ? 22.050  41.994 37.003 1.00 19.51 ? 254  GLN A OE1 1 
ATOM   1603 N  NE2 . GLN A 1 213 ? 24.144  41.147 36.672 1.00 19.25 ? 254  GLN A NE2 1 
ATOM   1604 N  N   . ARG A 1 214 ? 19.817  36.934 36.192 1.00 18.26 ? 255  ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 214 ? 18.415  37.252 35.912 1.00 18.35 ? 255  ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 214 ? 18.169  38.722 36.332 1.00 17.97 ? 255  ARG A C   1 
ATOM   1607 O  O   . ARG A 1 214 ? 18.980  39.304 37.106 1.00 17.23 ? 255  ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 214 ? 17.495  36.354 36.702 1.00 17.68 ? 255  ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 214 ? 17.452  34.897 36.176 1.00 16.43 ? 255  ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 214 ? 17.108  33.945 37.301 1.00 19.02 ? 255  ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 214 ? 17.370  32.526 36.912 1.00 20.97 ? 255  ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 214 ? 18.592  31.971 36.895 1.00 22.92 ? 255  ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 214 ? 19.717  32.682 37.179 1.00 20.44 ? 255  ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 214 ? 18.682  30.663 36.558 1.00 20.41 ? 255  ARG A NH2 1 
ATOM   1615 N  N   . GLY A 1 215 ? 17.035  39.236 35.894 1.00 17.45 ? 256  GLY A N   1 
ATOM   1616 C  CA  . GLY A 1 215 ? 16.604  40.571 36.367 1.00 17.42 ? 256  GLY A CA  1 
ATOM   1617 C  C   . GLY A 1 215 ? 15.591  41.231 35.468 1.00 17.48 ? 256  GLY A C   1 
ATOM   1618 O  O   . GLY A 1 215 ? 15.569  41.092 34.233 1.00 16.31 ? 256  GLY A O   1 
ATOM   1619 N  N   . ASN A 1 216 ? 14.767  42.033 36.139 1.00 16.90 ? 257  ASN A N   1 
ATOM   1620 C  CA  . ASN A 1 216 ? 13.767  42.880 35.538 1.00 18.88 ? 257  ASN A CA  1 
ATOM   1621 C  C   . ASN A 1 216 ? 14.426  43.955 34.681 1.00 17.09 ? 257  ASN A C   1 
ATOM   1622 O  O   . ASN A 1 216 ? 15.473  44.525 35.042 1.00 17.29 ? 257  ASN A O   1 
ATOM   1623 C  CB  . ASN A 1 216 ? 13.017  43.619 36.700 1.00 19.86 ? 257  ASN A CB  1 
ATOM   1624 C  CG  . ASN A 1 216 ? 11.928  44.471 36.202 1.00 25.17 ? 257  ASN A CG  1 
ATOM   1625 O  OD1 . ASN A 1 216 ? 11.479  44.309 35.061 1.00 26.44 ? 257  ASN A OD1 1 
ATOM   1626 N  ND2 . ASN A 1 216 ? 11.425  45.348 37.051 1.00 30.52 ? 257  ASN A ND2 1 
ATOM   1627 N  N   . ILE A 1 217 ? 13.815  44.207 33.529 1.00 17.32 ? 258  ILE A N   1 
ATOM   1628 C  CA  . ILE A 1 217 ? 14.302  45.252 32.653 1.00 18.50 ? 258  ILE A CA  1 
ATOM   1629 C  C   . ILE A 1 217 ? 13.298  46.385 32.417 1.00 19.79 ? 258  ILE A C   1 
ATOM   1630 O  O   . ILE A 1 217 ? 13.528  47.216 31.521 1.00 21.78 ? 258  ILE A O   1 
ATOM   1631 C  CB  . ILE A 1 217 ? 14.788  44.685 31.249 1.00 18.18 ? 258  ILE A CB  1 
ATOM   1632 C  CG1 A ILE A 1 217 ? 13.649  43.871 30.645 0.65 19.50 ? 258  ILE A CG1 1 
ATOM   1633 C  CG1 B ILE A 1 217 ? 13.757  43.756 30.643 0.35 16.92 ? 258  ILE A CG1 1 
ATOM   1634 C  CG2 . ILE A 1 217 ? 16.047  43.840 31.408 1.00 19.17 ? 258  ILE A CG2 1 
ATOM   1635 C  CD1 A ILE A 1 217 ? 13.851  43.443 29.228 0.65 26.57 ? 258  ILE A CD1 1 
ATOM   1636 C  CD1 B ILE A 1 217 ? 12.633  44.491 30.071 0.35 13.96 ? 258  ILE A CD1 1 
ATOM   1637 N  N   . LEU A 1 218 ? 12.200  46.441 33.191 1.00 21.38 ? 259  LEU A N   1 
ATOM   1638 C  CA  . LEU A 1 218 ? 11.197  47.528 33.136 1.00 23.69 ? 259  LEU A CA  1 
ATOM   1639 C  C   . LEU A 1 218 ? 11.800  48.830 33.672 1.00 24.22 ? 259  LEU A C   1 
ATOM   1640 O  O   . LEU A 1 218 ? 12.638  48.794 34.538 1.00 26.42 ? 259  LEU A O   1 
ATOM   1641 C  CB  . LEU A 1 218 ? 10.023  47.265 34.076 1.00 25.76 ? 259  LEU A CB  1 
ATOM   1642 C  CG  . LEU A 1 218 ? 9.032   46.123 33.966 1.00 28.15 ? 259  LEU A CG  1 
ATOM   1643 C  CD1 . LEU A 1 218 ? 8.191   46.209 35.258 1.00 30.03 ? 259  LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A 1 218 ? 8.141   46.338 32.802 1.00 32.13 ? 259  LEU A CD2 1 
ATOM   1645 N  N   . ASN A 1 219 ? 11.279  49.946 33.189 1.00 23.97 ? 260  ASN A N   1 
ATOM   1646 C  CA  . ASN A 1 219 ? 11.635  51.302 33.674 1.00 25.72 ? 260  ASN A CA  1 
ATOM   1647 C  C   . ASN A 1 219 ? 10.349  51.939 34.126 1.00 23.41 ? 260  ASN A C   1 
ATOM   1648 O  O   . ASN A 1 219 ? 9.800   52.710 33.376 1.00 25.68 ? 260  ASN A O   1 
ATOM   1649 C  CB  . ASN A 1 219 ? 12.097  52.140 32.462 1.00 27.89 ? 260  ASN A CB  1 
ATOM   1650 C  CG  . ASN A 1 219 ? 13.520  51.875 32.083 1.00 34.05 ? 260  ASN A CG  1 
ATOM   1651 O  OD1 . ASN A 1 219 ? 14.447  52.430 32.683 1.00 41.08 ? 260  ASN A OD1 1 
ATOM   1652 N  ND2 . ASN A 1 219 ? 13.715  51.037 31.061 1.00 34.05 ? 260  ASN A ND2 1 
ATOM   1653 N  N   . LEU A 1 220 ? 9.872   51.597 35.322 1.00 20.70 ? 261  LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 220 ? 8.583   52.034 35.862 1.00 20.90 ? 261  LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 220 ? 8.590   53.460 36.471 1.00 19.35 ? 261  LEU A C   1 
ATOM   1656 O  O   . LEU A 1 220 ? 7.529   54.054 36.669 1.00 18.17 ? 261  LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 220 ? 8.213   51.031 37.002 1.00 23.29 ? 261  LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 220 ? 7.892   49.562 36.677 1.00 23.33 ? 261  LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 220 ? 7.783   48.640 38.000 1.00 23.94 ? 261  LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 220 ? 6.543   49.543 35.891 1.00 25.19 ? 261  LEU A CD2 1 
ATOM   1661 N  N   . ASN A 1 221 ? 9.798   53.973 36.752 1.00 18.62 ? 262  ASN A N   1 
ATOM   1662 C  CA  . ASN A 1 221 ? 9.916   55.286 37.417 1.00 18.55 ? 262  ASN A CA  1 
ATOM   1663 C  C   . ASN A 1 221 ? 8.971   55.443 38.595 1.00 18.19 ? 262  ASN A C   1 
ATOM   1664 O  O   . ASN A 1 221 ? 8.298   56.490 38.794 1.00 16.49 ? 262  ASN A O   1 
ATOM   1665 C  CB  . ASN A 1 221 ? 9.680   56.398 36.421 1.00 18.61 ? 262  ASN A CB  1 
ATOM   1666 C  CG  . ASN A 1 221 ? 10.780  56.441 35.363 1.00 23.25 ? 262  ASN A CG  1 
ATOM   1667 O  OD1 . ASN A 1 221 ? 11.951  56.198 35.652 1.00 21.45 ? 262  ASN A OD1 1 
ATOM   1668 N  ND2 . ASN A 1 221 ? 10.390  56.733 34.118 1.00 27.21 ? 262  ASN A ND2 1 
ATOM   1669 N  N   . GLY A 1 222 ? 8.909   54.388 39.384 1.00 16.93 ? 263  GLY A N   1 
ATOM   1670 C  CA  . GLY A 1 222 ? 8.204   54.533 40.659 1.00 16.55 ? 263  GLY A CA  1 
ATOM   1671 C  C   . GLY A 1 222 ? 6.761   54.150 40.601 1.00 16.14 ? 263  GLY A C   1 
ATOM   1672 O  O   . GLY A 1 222 ? 6.077   54.243 41.641 1.00 16.82 ? 263  GLY A O   1 
ATOM   1673 N  N   . ALA A 1 223 ? 6.273   53.633 39.458 1.00 14.41 ? 264  ALA A N   1 
ATOM   1674 C  CA  . ALA A 1 223 ? 4.817   53.418 39.350 1.00 15.05 ? 264  ALA A CA  1 
ATOM   1675 C  C   . ALA A 1 223 ? 4.282   52.183 40.087 1.00 16.23 ? 264  ALA A C   1 
ATOM   1676 O  O   . ALA A 1 223 ? 3.079   52.160 40.416 1.00 17.07 ? 264  ALA A O   1 
ATOM   1677 C  CB  . ALA A 1 223 ? 4.386   53.332 37.823 1.00 16.95 ? 264  ALA A CB  1 
ATOM   1678 N  N   . GLY A 1 224 ? 5.110   51.163 40.271 1.00 15.12 ? 265  GLY A N   1 
ATOM   1679 C  CA  . GLY A 1 224 ? 4.608   49.895 40.852 1.00 15.43 ? 265  GLY A CA  1 
ATOM   1680 C  C   . GLY A 1 224 ? 4.047   48.955 39.771 1.00 14.56 ? 265  GLY A C   1 
ATOM   1681 O  O   . GLY A 1 224 ? 4.560   48.949 38.660 1.00 16.34 ? 265  GLY A O   1 
ATOM   1682 N  N   . ASP A 1 225 ? 2.988   48.211 40.111 1.00 14.69 ? 266  ASP A N   1 
ATOM   1683 C  CA  . ASP A 1 225 ? 2.345   47.325 39.108 1.00 16.84 ? 266  ASP A CA  1 
ATOM   1684 C  C   . ASP A 1 225 ? 2.113   48.115 37.809 1.00 17.50 ? 266  ASP A C   1 
ATOM   1685 O  O   . ASP A 1 225 ? 1.473   49.146 37.795 1.00 16.98 ? 266  ASP A O   1 
ATOM   1686 C  CB  . ASP A 1 225 ? 1.023   46.828 39.664 1.00 18.05 ? 266  ASP A CB  1 
ATOM   1687 C  CG  . ASP A 1 225 ? 0.158   46.163 38.615 1.00 18.60 ? 266  ASP A CG  1 
ATOM   1688 O  OD1 . ASP A 1 225 ? 0.699   45.354 37.800 1.00 19.62 ? 266  ASP A OD1 1 
ATOM   1689 O  OD2 . ASP A 1 225 ? -1.060  46.426 38.614 1.00 17.82 ? 266  ASP A OD2 1 
ATOM   1690 N  N   . PRO A 1 226 ? 2.609   47.581 36.676 1.00 18.20 ? 267  PRO A N   1 
ATOM   1691 C  CA  . PRO A 1 226 ? 2.424   48.289 35.428 1.00 19.40 ? 267  PRO A CA  1 
ATOM   1692 C  C   . PRO A 1 226 ? 0.981   48.618 35.040 1.00 18.29 ? 267  PRO A C   1 
ATOM   1693 O  O   . PRO A 1 226 ? 0.712   49.595 34.290 1.00 20.15 ? 267  PRO A O   1 
ATOM   1694 C  CB  . PRO A 1 226 ? 3.029   47.311 34.393 1.00 19.23 ? 267  PRO A CB  1 
ATOM   1695 C  CG  . PRO A 1 226 ? 3.995   46.517 35.125 1.00 20.98 ? 267  PRO A CG  1 
ATOM   1696 C  CD  . PRO A 1 226 ? 3.444   46.381 36.549 1.00 20.60 ? 267  PRO A CD  1 
ATOM   1697 N  N   . LEU A 1 227 ? 0.049   47.794 35.511 1.00 19.43 ? 268  LEU A N   1 
ATOM   1698 C  CA  . LEU A 1 227 ? -1.347  47.982 35.131 1.00 18.52 ? 268  LEU A CA  1 
ATOM   1699 C  C   . LEU A 1 227 ? -2.205  48.942 35.999 1.00 17.49 ? 268  LEU A C   1 
ATOM   1700 O  O   . LEU A 1 227 ? -3.307  49.343 35.609 1.00 16.93 ? 268  LEU A O   1 
ATOM   1701 C  CB  . LEU A 1 227 ? -2.042  46.606 35.072 1.00 18.19 ? 268  LEU A CB  1 
ATOM   1702 C  CG  . LEU A 1 227 ? -1.357  45.582 34.161 1.00 18.90 ? 268  LEU A CG  1 
ATOM   1703 C  CD1 . LEU A 1 227 ? -2.183  44.316 34.184 1.00 23.12 ? 268  LEU A CD1 1 
ATOM   1704 C  CD2 . LEU A 1 227 ? -1.259  46.131 32.721 1.00 21.20 ? 268  LEU A CD2 1 
ATOM   1705 N  N   . THR A 1 228 ? -1.692  49.334 37.169 1.00 15.99 ? 269  THR A N   1 
ATOM   1706 C  CA  . THR A 1 228 ? -2.551  50.116 38.075 1.00 15.67 ? 269  THR A CA  1 
ATOM   1707 C  C   . THR A 1 228 ? -1.802  51.304 38.718 1.00 15.94 ? 269  THR A C   1 
ATOM   1708 O  O   . THR A 1 228 ? -1.860  51.494 39.922 1.00 14.60 ? 269  THR A O   1 
ATOM   1709 C  CB  . THR A 1 228 ? -3.006  49.207 39.276 1.00 16.07 ? 269  THR A CB  1 
ATOM   1710 O  OG1 . THR A 1 228 ? -1.865  48.622 39.923 1.00 15.01 ? 269  THR A OG1 1 
ATOM   1711 C  CG2 . THR A 1 228 ? -3.980  48.073 38.771 1.00 16.56 ? 269  THR A CG2 1 
ATOM   1712 N  N   . PRO A 1 229 ? -1.146  52.120 37.902 1.00 16.64 ? 270  PRO A N   1 
ATOM   1713 C  CA  . PRO A 1 229 ? -0.349  53.227 38.546 1.00 15.24 ? 270  PRO A CA  1 
ATOM   1714 C  C   . PRO A 1 229 ? -1.229  54.197 39.326 1.00 15.46 ? 270  PRO A C   1 
ATOM   1715 O  O   . PRO A 1 229 ? -2.281  54.641 38.838 1.00 17.95 ? 270  PRO A O   1 
ATOM   1716 C  CB  . PRO A 1 229 ? 0.314   53.912 37.350 1.00 16.26 ? 270  PRO A CB  1 
ATOM   1717 C  CG  . PRO A 1 229 ? -0.656  53.573 36.180 1.00 17.82 ? 270  PRO A CG  1 
ATOM   1718 C  CD  . PRO A 1 229 ? -1.055  52.144 36.440 1.00 17.89 ? 270  PRO A CD  1 
ATOM   1719 N  N   . GLY A 1 230 ? -0.808  54.438 40.572 1.00 14.36 ? 271  GLY A N   1 
ATOM   1720 C  CA  . GLY A 1 230 ? -1.531  55.322 41.510 1.00 15.87 ? 271  GLY A CA  1 
ATOM   1721 C  C   . GLY A 1 230 ? -2.469  54.662 42.460 1.00 16.07 ? 271  GLY A C   1 
ATOM   1722 O  O   . GLY A 1 230 ? -2.883  55.325 43.440 1.00 17.01 ? 271  GLY A O   1 
ATOM   1723 N  N   . TYR A 1 231 ? -2.845  53.397 42.216 1.00 14.40 ? 272  TYR A N   1 
ATOM   1724 C  CA  . TYR A 1 231 ? -3.924  52.779 43.025 1.00 15.09 ? 272  TYR A CA  1 
ATOM   1725 C  C   . TYR A 1 231 ? -3.531  51.311 43.321 1.00 15.41 ? 272  TYR A C   1 
ATOM   1726 O  O   . TYR A 1 231 ? -2.965  50.651 42.466 1.00 14.87 ? 272  TYR A O   1 
ATOM   1727 C  CB  . TYR A 1 231 ? -5.268  52.845 42.274 1.00 15.62 ? 272  TYR A CB  1 
ATOM   1728 C  CG  . TYR A 1 231 ? -5.578  54.269 41.906 1.00 15.30 ? 272  TYR A CG  1 
ATOM   1729 C  CD1 . TYR A 1 231 ? -6.121  55.149 42.857 1.00 19.00 ? 272  TYR A CD1 1 
ATOM   1730 C  CD2 . TYR A 1 231 ? -5.241  54.765 40.638 1.00 15.79 ? 272  TYR A CD2 1 
ATOM   1731 C  CE1 . TYR A 1 231 ? -6.333  56.482 42.527 1.00 17.06 ? 272  TYR A CE1 1 
ATOM   1732 C  CE2 . TYR A 1 231 ? -5.445  56.088 40.275 1.00 15.04 ? 272  TYR A CE2 1 
ATOM   1733 C  CZ  . TYR A 1 231 ? -6.028  56.948 41.238 1.00 16.05 ? 272  TYR A CZ  1 
ATOM   1734 O  OH  . TYR A 1 231 ? -6.173  58.280 40.898 1.00 17.92 ? 272  TYR A OH  1 
ATOM   1735 N  N   . PRO A 1 232 ? -3.921  50.764 44.478 1.00 15.49 ? 273  PRO A N   1 
ATOM   1736 C  CA  . PRO A 1 232 ? -3.518  49.368 44.716 1.00 15.73 ? 273  PRO A CA  1 
ATOM   1737 C  C   . PRO A 1 232 ? -4.240  48.374 43.796 1.00 15.63 ? 273  PRO A C   1 
ATOM   1738 O  O   . PRO A 1 232 ? -5.458  48.546 43.523 1.00 15.15 ? 273  PRO A O   1 
ATOM   1739 C  CB  . PRO A 1 232 ? -3.908  49.125 46.205 1.00 14.93 ? 273  PRO A CB  1 
ATOM   1740 C  CG  . PRO A 1 232 ? -5.135  50.084 46.398 1.00 17.25 ? 273  PRO A CG  1 
ATOM   1741 C  CD  . PRO A 1 232 ? -4.715  51.317 45.598 1.00 17.33 ? 273  PRO A CD  1 
ATOM   1742 N  N   . ALA A 1 233 ? -3.509  47.303 43.442 1.00 15.56 ? 274  ALA A N   1 
ATOM   1743 C  CA  . ALA A 1 233 ? -3.981  46.264 42.536 1.00 14.85 ? 274  ALA A CA  1 
ATOM   1744 C  C   . ALA A 1 233 ? -4.859  45.254 43.310 1.00 17.37 ? 274  ALA A C   1 
ATOM   1745 O  O   . ALA A 1 233 ? -4.463  44.071 43.522 1.00 17.42 ? 274  ALA A O   1 
ATOM   1746 C  CB  . ALA A 1 233 ? -2.745  45.593 41.923 1.00 17.40 ? 274  ALA A CB  1 
ATOM   1747 N  N   . ASN A 1 234 ? -5.970  45.779 43.810 1.00 17.20 ? 275  ASN A N   1 
ATOM   1748 C  CA  . ASN A 1 234 ? -6.861  44.987 44.644 1.00 19.50 ? 275  ASN A CA  1 
ATOM   1749 C  C   . ASN A 1 234 ? -7.872  44.236 43.766 1.00 20.21 ? 275  ASN A C   1 
ATOM   1750 O  O   . ASN A 1 234 ? -7.715  44.162 42.559 1.00 20.43 ? 275  ASN A O   1 
ATOM   1751 C  CB  . ASN A 1 234 ? -7.528  45.899 45.703 1.00 21.27 ? 275  ASN A CB  1 
ATOM   1752 C  CG  . ASN A 1 234 ? -8.346  46.998 45.078 1.00 20.11 ? 275  ASN A CG  1 
ATOM   1753 O  OD1 . ASN A 1 234 ? -8.838  46.880 43.962 1.00 22.54 ? 275  ASN A OD1 1 
ATOM   1754 N  ND2 . ASN A 1 234 ? -8.519  48.130 45.839 1.00 24.31 ? 275  ASN A ND2 1 
ATOM   1755 N  N   . GLU A 1 235 ? -8.916  43.702 44.406 1.00 22.97 ? 276  GLU A N   1 
ATOM   1756 C  CA  . GLU A 1 235 ? -9.823  42.769 43.751 1.00 25.99 ? 276  GLU A CA  1 
ATOM   1757 C  C   . GLU A 1 235 ? -10.648 43.480 42.700 1.00 26.55 ? 276  GLU A C   1 
ATOM   1758 O  O   . GLU A 1 235 ? -10.970 42.905 41.656 1.00 29.18 ? 276  GLU A O   1 
ATOM   1759 C  CB  C GLU A 1 235 ? -10.709 41.986 44.751 0.65 26.99 ? 276  GLU A CB  1 
ATOM   1760 C  CB  D GLU A 1 235 ? -10.764 42.208 44.830 0.35 26.03 ? 276  GLU A CB  1 
ATOM   1761 C  CG  C GLU A 1 235 ? -11.507 40.840 44.090 0.65 30.06 ? 276  GLU A CG  1 
ATOM   1762 C  CG  D GLU A 1 235 ? -10.974 40.720 44.795 0.35 27.09 ? 276  GLU A CG  1 
ATOM   1763 C  CD  C GLU A 1 235 ? -10.650 39.589 43.822 0.65 32.63 ? 276  GLU A CD  1 
ATOM   1764 C  CD  D GLU A 1 235 ? -9.740  39.928 45.150 0.35 26.73 ? 276  GLU A CD  1 
ATOM   1765 O  OE1 C GLU A 1 235 ? -10.073 39.014 44.792 0.65 31.51 ? 276  GLU A OE1 1 
ATOM   1766 O  OE1 D GLU A 1 235 ? -9.301  39.986 46.323 0.35 25.77 ? 276  GLU A OE1 1 
ATOM   1767 O  OE2 C GLU A 1 235 ? -10.571 39.176 42.644 0.65 34.00 ? 276  GLU A OE2 1 
ATOM   1768 O  OE2 D GLU A 1 235 ? -9.234  39.212 44.252 0.35 24.16 ? 276  GLU A OE2 1 
ATOM   1769 N  N   . TYR A 1 236 ? -10.983 44.749 42.945 1.00 25.01 ? 277  TYR A N   1 
ATOM   1770 C  CA  . TYR A 1 236 ? -11.856 45.453 42.034 1.00 25.37 ? 277  TYR A CA  1 
ATOM   1771 C  C   . TYR A 1 236 ? -11.141 46.474 41.169 1.00 24.57 ? 277  TYR A C   1 
ATOM   1772 O  O   . TYR A 1 236 ? -11.790 47.243 40.476 1.00 25.01 ? 277  TYR A O   1 
ATOM   1773 C  CB  . TYR A 1 236 ? -13.033 46.080 42.811 1.00 25.81 ? 277  TYR A CB  1 
ATOM   1774 C  CG  . TYR A 1 236 ? -12.578 47.022 43.870 1.00 23.72 ? 277  TYR A CG  1 
ATOM   1775 C  CD1 . TYR A 1 236 ? -12.319 48.366 43.535 1.00 26.98 ? 277  TYR A CD1 1 
ATOM   1776 C  CD2 . TYR A 1 236 ? -12.300 46.583 45.168 1.00 21.94 ? 277  TYR A CD2 1 
ATOM   1777 C  CE1 . TYR A 1 236 ? -11.851 49.275 44.500 1.00 25.69 ? 277  TYR A CE1 1 
ATOM   1778 C  CE2 . TYR A 1 236 ? -11.809 47.493 46.146 1.00 24.28 ? 277  TYR A CE2 1 
ATOM   1779 C  CZ  . TYR A 1 236 ? -11.599 48.843 45.753 1.00 25.66 ? 277  TYR A CZ  1 
ATOM   1780 O  OH  . TYR A 1 236 ? -11.110 49.754 46.671 1.00 26.42 ? 277  TYR A OH  1 
ATOM   1781 N  N   . ALA A 1 237 ? -9.804  46.455 41.179 1.00 24.42 ? 278  ALA A N   1 
ATOM   1782 C  CA  . ALA A 1 237 ? -9.006  47.387 40.405 1.00 25.42 ? 278  ALA A CA  1 
ATOM   1783 C  C   . ALA A 1 237 ? -9.340  47.369 38.926 1.00 27.09 ? 278  ALA A C   1 
ATOM   1784 O  O   . ALA A 1 237 ? -9.515  46.280 38.351 1.00 26.43 ? 278  ALA A O   1 
ATOM   1785 C  CB  . ALA A 1 237 ? -7.514  47.058 40.557 1.00 25.91 ? 278  ALA A CB  1 
ATOM   1786 N  N   . TYR A 1 238 ? -9.416  48.553 38.313 1.00 27.39 ? 279  TYR A N   1 
ATOM   1787 C  CA  . TYR A 1 238 ? -9.531  48.603 36.870 1.00 28.20 ? 279  TYR A CA  1 
ATOM   1788 C  C   . TYR A 1 238 ? -8.084  48.629 36.329 1.00 27.85 ? 279  TYR A C   1 
ATOM   1789 O  O   . TYR A 1 238 ? -7.186  49.254 36.895 1.00 29.81 ? 279  TYR A O   1 
ATOM   1790 C  CB  B TYR A 1 238 ? -10.394 49.792 36.388 0.65 29.86 ? 279  TYR A CB  1 
ATOM   1791 C  CB  C TYR A 1 238 ? -10.301 49.872 36.456 0.35 28.63 ? 279  TYR A CB  1 
ATOM   1792 C  CG  B TYR A 1 238 ? -10.739 49.752 34.904 0.65 30.29 ? 279  TYR A CG  1 
ATOM   1793 C  CG  C TYR A 1 238 ? -10.382 50.121 34.959 0.35 28.49 ? 279  TYR A CG  1 
ATOM   1794 C  CD1 B TYR A 1 238 ? -11.773 48.926 34.435 0.65 30.75 ? 279  TYR A CD1 1 
ATOM   1795 C  CD1 C TYR A 1 238 ? -11.426 49.586 34.205 0.35 27.63 ? 279  TYR A CD1 1 
ATOM   1796 C  CD2 B TYR A 1 238 ? -10.007 50.510 33.964 0.65 30.21 ? 279  TYR A CD2 1 
ATOM   1797 C  CD2 C TYR A 1 238 ? -9.415  50.892 34.299 0.35 26.30 ? 279  TYR A CD2 1 
ATOM   1798 C  CE1 B TYR A 1 238 ? -12.087 48.862 33.091 0.65 33.72 ? 279  TYR A CE1 1 
ATOM   1799 C  CE1 C TYR A 1 238 ? -11.513 49.803 32.831 0.35 30.02 ? 279  TYR A CE1 1 
ATOM   1800 C  CE2 B TYR A 1 238 ? -10.316 50.453 32.615 0.65 32.56 ? 279  TYR A CE2 1 
ATOM   1801 C  CE2 C TYR A 1 238 ? -9.487  51.109 32.924 0.35 28.04 ? 279  TYR A CE2 1 
ATOM   1802 C  CZ  B TYR A 1 238 ? -11.373 49.622 32.181 0.65 33.29 ? 279  TYR A CZ  1 
ATOM   1803 C  CZ  C TYR A 1 238 ? -10.539 50.565 32.198 0.35 29.54 ? 279  TYR A CZ  1 
ATOM   1804 O  OH  B TYR A 1 238 ? -11.731 49.520 30.850 0.65 34.29 ? 279  TYR A OH  1 
ATOM   1805 O  OH  C TYR A 1 238 ? -10.627 50.772 30.835 0.35 29.59 ? 279  TYR A OH  1 
ATOM   1806 N  N   . ARG A 1 239 ? -7.824  47.853 35.292 1.00 26.93 ? 280  ARG A N   1 
ATOM   1807 C  CA  . ARG A 1 239 ? -6.434  47.688 34.834 1.00 26.34 ? 280  ARG A CA  1 
ATOM   1808 C  C   . ARG A 1 239 ? -6.241  48.274 33.464 1.00 28.21 ? 280  ARG A C   1 
ATOM   1809 O  O   . ARG A 1 239 ? -7.131  48.105 32.579 1.00 26.42 ? 280  ARG A O   1 
ATOM   1810 C  CB  A ARG A 1 239 ? -6.028  46.200 34.946 0.65 26.28 ? 280  ARG A CB  1 
ATOM   1811 C  CB  B ARG A 1 239 ? -6.072  46.211 34.722 0.35 25.78 ? 280  ARG A CB  1 
ATOM   1812 C  CG  A ARG A 1 239 ? -6.256  45.696 36.404 0.65 24.09 ? 280  ARG A CG  1 
ATOM   1813 C  CG  B ARG A 1 239 ? -5.657  45.624 36.012 0.35 22.23 ? 280  ARG A CG  1 
ATOM   1814 C  CD  A ARG A 1 239 ? -5.861  44.235 36.721 0.65 25.11 ? 280  ARG A CD  1 
ATOM   1815 C  CD  B ARG A 1 239 ? -5.335  44.187 35.884 0.35 18.31 ? 280  ARG A CD  1 
ATOM   1816 N  NE  A ARG A 1 239 ? -5.418  44.074 38.126 0.65 19.70 ? 280  ARG A NE  1 
ATOM   1817 N  NE  B ARG A 1 239 ? -5.072  43.673 37.207 0.35 17.95 ? 280  ARG A NE  1 
ATOM   1818 C  CZ  A ARG A 1 239 ? -6.186  43.894 39.212 0.65 19.51 ? 280  ARG A CZ  1 
ATOM   1819 C  CZ  B ARG A 1 239 ? -6.006  43.304 38.074 0.35 19.47 ? 280  ARG A CZ  1 
ATOM   1820 N  NH1 A ARG A 1 239 ? -7.512  43.899 39.145 0.65 25.94 ? 280  ARG A NH1 1 
ATOM   1821 N  NH1 B ARG A 1 239 ? -7.297  43.358 37.750 0.35 20.00 ? 280  ARG A NH1 1 
ATOM   1822 N  NH2 A ARG A 1 239 ? -5.625  43.707 40.395 0.65 18.57 ? 280  ARG A NH2 1 
ATOM   1823 N  NH2 B ARG A 1 239 ? -5.638  42.879 39.268 0.35 18.38 ? 280  ARG A NH2 1 
ATOM   1824 N  N   . ARG A 1 240 ? -5.114  48.968 33.272 1.00 27.93 ? 281  ARG A N   1 
ATOM   1825 C  CA  . ARG A 1 240 ? -4.727  49.336 31.906 1.00 30.94 ? 281  ARG A CA  1 
ATOM   1826 C  C   . ARG A 1 240 ? -4.640  48.089 31.050 1.00 32.97 ? 281  ARG A C   1 
ATOM   1827 O  O   . ARG A 1 240 ? -4.257  46.994 31.526 1.00 32.02 ? 281  ARG A O   1 
ATOM   1828 C  CB  . ARG A 1 240 ? -3.371  50.028 31.860 1.00 30.46 ? 281  ARG A CB  1 
ATOM   1829 C  CG  . ARG A 1 240 ? -3.402  51.308 32.644 1.00 31.08 ? 281  ARG A CG  1 
ATOM   1830 C  CD  . ARG A 1 240 ? -2.164  52.120 32.382 1.00 32.92 ? 281  ARG A CD  1 
ATOM   1831 N  NE  . ARG A 1 240 ? -2.286  53.441 33.002 1.00 35.01 ? 281  ARG A NE  1 
ATOM   1832 C  CZ  . ARG A 1 240 ? -1.385  54.409 32.853 1.00 38.92 ? 281  ARG A CZ  1 
ATOM   1833 N  NH1 . ARG A 1 240 ? -0.328  54.195 32.095 1.00 40.13 ? 281  ARG A NH1 1 
ATOM   1834 N  NH2 . ARG A 1 240 ? -1.540  55.581 33.462 1.00 39.69 ? 281  ARG A NH2 1 
ATOM   1835 N  N   . GLY A 1 241 ? -5.020  48.255 29.786 1.00 36.29 ? 282  GLY A N   1 
ATOM   1836 C  CA  . GLY A 1 241 ? -4.755  47.236 28.792 1.00 40.58 ? 282  GLY A CA  1 
ATOM   1837 C  C   . GLY A 1 241 ? -3.253  47.185 28.620 1.00 43.27 ? 282  GLY A C   1 
ATOM   1838 O  O   . GLY A 1 241 ? -2.569  48.210 28.739 1.00 44.38 ? 282  GLY A O   1 
ATOM   1839 N  N   . ILE A 1 242 ? -2.728  45.991 28.375 1.00 45.94 ? 283  ILE A N   1 
ATOM   1840 C  CA  . ILE A 1 242 ? -1.285  45.805 28.195 1.00 47.77 ? 283  ILE A CA  1 
ATOM   1841 C  C   . ILE A 1 242 ? -0.624  46.883 27.287 1.00 48.89 ? 283  ILE A C   1 
ATOM   1842 O  O   . ILE A 1 242 ? 0.464   47.393 27.614 1.00 49.49 ? 283  ILE A O   1 
ATOM   1843 C  CB  A ILE A 1 242 ? -0.945  44.344 27.753 0.65 47.79 ? 283  ILE A CB  1 
ATOM   1844 C  CB  B ILE A 1 242 ? -0.958  44.369 27.694 0.35 47.64 ? 283  ILE A CB  1 
ATOM   1845 C  CG1 A ILE A 1 242 ? 0.544   44.034 27.945 0.65 48.24 ? 283  ILE A CG1 1 
ATOM   1846 C  CG1 B ILE A 1 242 ? -1.161  43.351 28.824 0.35 47.30 ? 283  ILE A CG1 1 
ATOM   1847 C  CG2 A ILE A 1 242 ? -1.412  44.066 26.324 0.65 47.70 ? 283  ILE A CG2 1 
ATOM   1848 C  CG2 B ILE A 1 242 ? 0.458   44.283 27.102 0.35 47.81 ? 283  ILE A CG2 1 
ATOM   1849 C  CD1 A ILE A 1 242 ? 0.924   43.647 29.364 0.65 47.67 ? 283  ILE A CD1 1 
ATOM   1850 C  CD1 B ILE A 1 242 ? -0.322  43.605 30.079 0.35 47.02 ? 283  ILE A CD1 1 
ATOM   1851 N  N   . ALA A 1 243 ? -1.292  47.277 26.201 1.00 50.10 ? 284  ALA A N   1 
ATOM   1852 C  CA  . ALA A 1 243 ? -0.717  48.294 25.301 1.00 50.98 ? 284  ALA A CA  1 
ATOM   1853 C  C   . ALA A 1 243 ? -0.422  49.639 25.985 1.00 51.33 ? 284  ALA A C   1 
ATOM   1854 O  O   . ALA A 1 243 ? 0.452   50.389 25.527 1.00 51.75 ? 284  ALA A O   1 
ATOM   1855 C  CB  . ALA A 1 243 ? -1.594  48.493 24.045 1.00 51.02 ? 284  ALA A CB  1 
ATOM   1856 N  N   . GLU A 1 244 ? -1.137  49.943 27.072 1.00 51.56 ? 285  GLU A N   1 
ATOM   1857 C  CA  . GLU A 1 244 ? -0.908  51.199 27.821 1.00 51.69 ? 285  GLU A CA  1 
ATOM   1858 C  C   . GLU A 1 244 ? -0.137  50.977 29.136 1.00 50.83 ? 285  GLU A C   1 
ATOM   1859 O  O   . GLU A 1 244 ? -0.049  51.893 29.981 1.00 50.82 ? 285  GLU A O   1 
ATOM   1860 C  CB  . GLU A 1 244 ? -2.226  51.947 28.098 1.00 52.23 ? 285  GLU A CB  1 
ATOM   1861 C  CG  . GLU A 1 244 ? -2.817  52.632 26.878 1.00 55.10 ? 285  GLU A CG  1 
ATOM   1862 C  CD  . GLU A 1 244 ? -3.678  51.699 26.002 1.00 60.05 ? 285  GLU A CD  1 
ATOM   1863 O  OE1 . GLU A 1 244 ? -3.659  50.452 26.200 1.00 60.61 ? 285  GLU A OE1 1 
ATOM   1864 O  OE2 . GLU A 1 244 ? -4.384  52.230 25.107 1.00 61.80 ? 285  GLU A OE2 1 
ATOM   1865 N  N   . ALA A 1 245 ? 0.420   49.776 29.299 1.00 49.32 ? 286  ALA A N   1 
ATOM   1866 C  CA  . ALA A 1 245 ? 1.109   49.439 30.529 1.00 48.02 ? 286  ALA A CA  1 
ATOM   1867 C  C   . ALA A 1 245 ? 2.347   50.320 30.773 1.00 47.31 ? 286  ALA A C   1 
ATOM   1868 O  O   . ALA A 1 245 ? 2.937   50.931 29.861 1.00 46.28 ? 286  ALA A O   1 
ATOM   1869 C  CB  . ALA A 1 245 ? 1.443   47.950 30.601 1.00 48.06 ? 286  ALA A CB  1 
ATOM   1870 N  N   . VAL A 1 246 ? 2.699   50.422 32.045 1.00 45.29 ? 287  VAL A N   1 
ATOM   1871 C  CA  . VAL A 1 246 ? 3.769   51.295 32.426 1.00 44.00 ? 287  VAL A CA  1 
ATOM   1872 C  C   . VAL A 1 246 ? 5.125   50.584 32.292 1.00 42.91 ? 287  VAL A C   1 
ATOM   1873 O  O   . VAL A 1 246 ? 5.318   49.493 32.835 1.00 42.77 ? 287  VAL A O   1 
ATOM   1874 C  CB  . VAL A 1 246 ? 3.549   51.854 33.858 1.00 43.65 ? 287  VAL A CB  1 
ATOM   1875 C  CG1 . VAL A 1 246 ? 4.730   52.715 34.244 1.00 42.91 ? 287  VAL A CG1 1 
ATOM   1876 C  CG2 . VAL A 1 246 ? 2.284   52.682 33.915 1.00 44.39 ? 287  VAL A CG2 1 
ATOM   1877 N  N   . GLY A 1 247 ? 6.032   51.194 31.529 1.00 41.87 ? 288  GLY A N   1 
ATOM   1878 C  CA  . GLY A 1 247 ? 7.450   50.819 31.535 1.00 39.47 ? 288  GLY A CA  1 
ATOM   1879 C  C   . GLY A 1 247 ? 7.882   49.577 30.765 1.00 38.26 ? 288  GLY A C   1 
ATOM   1880 O  O   . GLY A 1 247 ? 9.041   49.100 30.969 1.00 36.39 ? 288  GLY A O   1 
ATOM   1881 N  N   . LEU A 1 248 ? 6.978   49.075 29.900 1.00 36.79 ? 289  LEU A N   1 
ATOM   1882 C  CA  . LEU A 1 248 ? 7.219   47.824 29.149 1.00 35.19 ? 289  LEU A CA  1 
ATOM   1883 C  C   . LEU A 1 248 ? 8.122   48.095 27.969 1.00 34.22 ? 289  LEU A C   1 
ATOM   1884 O  O   . LEU A 1 248 ? 7.877   49.053 27.182 1.00 33.16 ? 289  LEU A O   1 
ATOM   1885 C  CB  A LEU A 1 248 ? 5.917   47.163 28.640 0.65 34.18 ? 289  LEU A CB  1 
ATOM   1886 C  CB  B LEU A 1 248 ? 5.914   47.139 28.709 0.35 34.85 ? 289  LEU A CB  1 
ATOM   1887 C  CG  A LEU A 1 248 ? 4.861   46.564 29.583 0.65 35.04 ? 289  LEU A CG  1 
ATOM   1888 C  CG  B LEU A 1 248 ? 5.381   46.053 29.659 0.35 35.80 ? 289  LEU A CG  1 
ATOM   1889 C  CD1 A LEU A 1 248 ? 3.729   45.980 28.784 0.65 33.78 ? 289  LEU A CD1 1 
ATOM   1890 C  CD1 B LEU A 1 248 ? 4.836   46.634 30.979 0.35 35.22 ? 289  LEU A CD1 1 
ATOM   1891 C  CD2 A LEU A 1 248 ? 5.443   45.477 30.504 0.65 34.48 ? 289  LEU A CD2 1 
ATOM   1892 C  CD2 B LEU A 1 248 ? 4.319   45.191 28.978 0.35 34.73 ? 289  LEU A CD2 1 
ATOM   1893 N  N   . PRO A 1 249 ? 9.191   47.280 27.847 1.00 34.12 ? 290  PRO A N   1 
ATOM   1894 C  CA  . PRO A 1 249 ? 10.142  47.456 26.751 1.00 33.78 ? 290  PRO A CA  1 
ATOM   1895 C  C   . PRO A 1 249 ? 9.483   47.052 25.454 1.00 33.43 ? 290  PRO A C   1 
ATOM   1896 O  O   . PRO A 1 249 ? 8.611   46.169 25.461 1.00 32.97 ? 290  PRO A O   1 
ATOM   1897 C  CB  . PRO A 1 249 ? 11.286  46.490 27.088 1.00 34.27 ? 290  PRO A CB  1 
ATOM   1898 C  CG  . PRO A 1 249 ? 10.752  45.554 28.046 1.00 34.58 ? 290  PRO A CG  1 
ATOM   1899 C  CD  . PRO A 1 249 ? 9.551   46.154 28.729 1.00 34.10 ? 290  PRO A CD  1 
ATOM   1900 N  N   . SER A 1 250 ? 9.890   47.692 24.364 1.00 33.07 ? 291  SER A N   1 
ATOM   1901 C  CA  . SER A 1 250 ? 9.344   47.387 23.038 1.00 32.45 ? 291  SER A CA  1 
ATOM   1902 C  C   . SER A 1 250 ? 10.218  46.449 22.215 1.00 30.43 ? 291  SER A C   1 
ATOM   1903 O  O   . SER A 1 250 ? 9.858   46.112 21.094 1.00 30.05 ? 291  SER A O   1 
ATOM   1904 C  CB  . SER A 1 250 ? 9.097   48.687 22.266 1.00 33.90 ? 291  SER A CB  1 
ATOM   1905 O  OG  . SER A 1 250 ? 10.297  49.444 22.206 1.00 37.88 ? 291  SER A OG  1 
ATOM   1906 N  N   . ILE A 1 251 ? 11.352  46.034 22.774 1.00 28.22 ? 292  ILE A N   1 
ATOM   1907 C  CA  . ILE A 1 251 ? 12.303  45.145 22.069 1.00 26.27 ? 292  ILE A CA  1 
ATOM   1908 C  C   . ILE A 1 251 ? 12.693  43.959 22.956 1.00 25.24 ? 292  ILE A C   1 
ATOM   1909 O  O   . ILE A 1 251 ? 12.771  44.076 24.204 1.00 24.02 ? 292  ILE A O   1 
ATOM   1910 C  CB  . ILE A 1 251 ? 13.565  45.900 21.514 1.00 25.23 ? 292  ILE A CB  1 
ATOM   1911 C  CG1 . ILE A 1 251 ? 14.408  46.557 22.613 1.00 24.46 ? 292  ILE A CG1 1 
ATOM   1912 C  CG2 . ILE A 1 251 ? 13.158  46.961 20.430 1.00 27.66 ? 292  ILE A CG2 1 
ATOM   1913 C  CD1 . ILE A 1 251 ? 15.653  47.299 22.077 1.00 26.12 ? 292  ILE A CD1 1 
ATOM   1914 N  N   . PRO A 1 252 ? 12.874  42.775 22.353 1.00 24.63 ? 293  PRO A N   1 
ATOM   1915 C  CA  . PRO A 1 252 ? 13.264  41.605 23.167 1.00 23.17 ? 293  PRO A CA  1 
ATOM   1916 C  C   . PRO A 1 252 ? 14.596  41.742 23.850 1.00 22.10 ? 293  PRO A C   1 
ATOM   1917 O  O   . PRO A 1 252 ? 15.491  42.394 23.323 1.00 21.96 ? 293  PRO A O   1 
ATOM   1918 C  CB  . PRO A 1 252 ? 13.402  40.477 22.113 1.00 24.14 ? 293  PRO A CB  1 
ATOM   1919 C  CG  . PRO A 1 252 ? 12.450  40.955 21.007 1.00 25.97 ? 293  PRO A CG  1 
ATOM   1920 C  CD  . PRO A 1 252 ? 12.678  42.413 20.932 1.00 25.05 ? 293  PRO A CD  1 
ATOM   1921 N  N   . VAL A 1 253 ? 14.729  41.125 25.025 1.00 20.44 ? 294  VAL A N   1 
ATOM   1922 C  CA  . VAL A 1 253 ? 15.972  41.201 25.802 1.00 19.13 ? 294  VAL A CA  1 
ATOM   1923 C  C   . VAL A 1 253 ? 16.249  39.852 26.428 1.00 18.93 ? 294  VAL A C   1 
ATOM   1924 O  O   . VAL A 1 253 ? 15.336  39.177 26.862 1.00 19.08 ? 294  VAL A O   1 
ATOM   1925 C  CB  . VAL A 1 253 ? 15.873  42.284 26.992 1.00 18.62 ? 294  VAL A CB  1 
ATOM   1926 C  CG1 . VAL A 1 253 ? 17.202  42.419 27.831 1.00 20.20 ? 294  VAL A CG1 1 
ATOM   1927 C  CG2 . VAL A 1 253 ? 15.354  43.632 26.464 1.00 20.39 ? 294  VAL A CG2 1 
ATOM   1928 N  N   . HIS A 1 254 ? 17.518  39.477 26.524 1.00 20.32 ? 295  HIS A N   1 
ATOM   1929 C  CA  . HIS A 1 254 ? 17.886  38.199 27.108 1.00 18.80 ? 295  HIS A CA  1 
ATOM   1930 C  C   . HIS A 1 254 ? 19.311  38.278 27.674 1.00 18.98 ? 295  HIS A C   1 
ATOM   1931 O  O   . HIS A 1 254 ? 20.175  38.924 27.053 1.00 20.89 ? 295  HIS A O   1 
ATOM   1932 C  CB  . HIS A 1 254 ? 17.762  37.046 26.038 1.00 20.51 ? 295  HIS A CB  1 
ATOM   1933 C  CG  . HIS A 1 254 ? 17.805  35.662 26.608 1.00 21.16 ? 295  HIS A CG  1 
ATOM   1934 N  ND1 . HIS A 1 254 ? 16.811  35.173 27.444 1.00 20.53 ? 295  HIS A ND1 1 
ATOM   1935 C  CD2 . HIS A 1 254 ? 18.706  34.641 26.461 1.00 21.88 ? 295  HIS A CD2 1 
ATOM   1936 C  CE1 . HIS A 1 254 ? 17.103  33.928 27.792 1.00 22.69 ? 295  HIS A CE1 1 
ATOM   1937 N  NE2 . HIS A 1 254 ? 18.246  33.578 27.206 1.00 22.14 ? 295  HIS A NE2 1 
ATOM   1938 N  N   . PRO A 1 255 ? 19.543  37.678 28.854 1.00 19.44 ? 296  PRO A N   1 
ATOM   1939 C  CA  . PRO A 1 255 ? 20.866  37.638 29.491 1.00 18.63 ? 296  PRO A CA  1 
ATOM   1940 C  C   . PRO A 1 255 ? 21.580  36.291 29.268 1.00 19.90 ? 296  PRO A C   1 
ATOM   1941 O  O   . PRO A 1 255 ? 20.907  35.246 29.188 1.00 20.61 ? 296  PRO A O   1 
ATOM   1942 C  CB  . PRO A 1 255 ? 20.507  37.792 30.998 1.00 20.21 ? 296  PRO A CB  1 
ATOM   1943 C  CG  . PRO A 1 255 ? 19.175  37.019 31.123 1.00 21.23 ? 296  PRO A CG  1 
ATOM   1944 C  CD  . PRO A 1 255 ? 18.526  37.032 29.728 1.00 19.08 ? 296  PRO A CD  1 
ATOM   1945 N  N   . ILE A 1 256 ? 22.909  36.351 29.198 1.00 21.71 ? 297  ILE A N   1 
ATOM   1946 C  CA  . ILE A 1 256 ? 23.747  35.168 28.945 1.00 21.97 ? 297  ILE A CA  1 
ATOM   1947 C  C   . ILE A 1 256 ? 25.015  35.294 29.763 1.00 22.49 ? 297  ILE A C   1 
ATOM   1948 O  O   . ILE A 1 256 ? 25.398  36.404 30.245 1.00 21.57 ? 297  ILE A O   1 
ATOM   1949 C  CB  . ILE A 1 256 ? 24.140  35.041 27.411 1.00 22.18 ? 297  ILE A CB  1 
ATOM   1950 C  CG1 . ILE A 1 256 ? 25.106  36.161 26.985 1.00 23.58 ? 297  ILE A CG1 1 
ATOM   1951 C  CG2 . ILE A 1 256 ? 22.919  34.886 26.531 1.00 22.19 ? 297  ILE A CG2 1 
ATOM   1952 C  CD1 . ILE A 1 256 ? 25.541  36.062 25.502 1.00 23.97 ? 297  ILE A CD1 1 
ATOM   1953 N  N   . GLY A 1 257 ? 25.676  34.142 29.949 1.00 21.38 ? 298  GLY A N   1 
ATOM   1954 C  CA  . GLY A 1 257 ? 26.975  34.072 30.600 1.00 22.01 ? 298  GLY A CA  1 
ATOM   1955 C  C   . GLY A 1 257 ? 28.159  34.345 29.658 1.00 22.58 ? 298  GLY A C   1 
ATOM   1956 O  O   . GLY A 1 257 ? 27.993  34.601 28.467 1.00 23.37 ? 298  GLY A O   1 
ATOM   1957 N  N   . TYR A 1 258 ? 29.368  34.359 30.207 1.00 23.49 ? 299  TYR A N   1 
ATOM   1958 C  CA  . TYR A 1 258 ? 30.500  34.800 29.396 1.00 23.16 ? 299  TYR A CA  1 
ATOM   1959 C  C   . TYR A 1 258 ? 31.049  33.691 28.465 1.00 24.89 ? 299  TYR A C   1 
ATOM   1960 O  O   . TYR A 1 258 ? 31.652  34.042 27.450 1.00 26.00 ? 299  TYR A O   1 
ATOM   1961 C  CB  . TYR A 1 258 ? 31.631  35.453 30.201 1.00 24.32 ? 299  TYR A CB  1 
ATOM   1962 C  CG  . TYR A 1 258 ? 32.213  34.706 31.370 1.00 23.82 ? 299  TYR A CG  1 
ATOM   1963 C  CD1 . TYR A 1 258 ? 31.813  34.989 32.709 1.00 21.83 ? 299  TYR A CD1 1 
ATOM   1964 C  CD2 . TYR A 1 258 ? 33.247  33.746 31.182 1.00 24.04 ? 299  TYR A CD2 1 
ATOM   1965 C  CE1 . TYR A 1 258 ? 32.377  34.318 33.782 1.00 23.44 ? 299  TYR A CE1 1 
ATOM   1966 C  CE2 . TYR A 1 258 ? 33.810  33.104 32.259 1.00 22.54 ? 299  TYR A CE2 1 
ATOM   1967 C  CZ  . TYR A 1 258 ? 33.387  33.386 33.566 1.00 23.36 ? 299  TYR A CZ  1 
ATOM   1968 O  OH  . TYR A 1 258 ? 33.932  32.761 34.662 1.00 24.92 ? 299  TYR A OH  1 
ATOM   1969 N  N   . TYR A 1 259 ? 30.792  32.417 28.768 1.00 24.67 ? 300  TYR A N   1 
ATOM   1970 C  CA  . TYR A 1 259 ? 31.100  31.373 27.714 1.00 25.52 ? 300  TYR A CA  1 
ATOM   1971 C  C   . TYR A 1 259 ? 30.313  31.654 26.448 1.00 25.98 ? 300  TYR A C   1 
ATOM   1972 O  O   . TYR A 1 259 ? 30.890  31.719 25.328 1.00 28.75 ? 300  TYR A O   1 
ATOM   1973 C  CB  . TYR A 1 259 ? 30.847  29.950 28.206 1.00 25.11 ? 300  TYR A CB  1 
ATOM   1974 C  CG  . TYR A 1 259 ? 31.761  29.417 29.275 1.00 26.10 ? 300  TYR A CG  1 
ATOM   1975 C  CD1 . TYR A 1 259 ? 33.054  29.949 29.510 1.00 27.08 ? 300  TYR A CD1 1 
ATOM   1976 C  CD2 . TYR A 1 259 ? 31.363  28.306 30.026 1.00 28.53 ? 300  TYR A CD2 1 
ATOM   1977 C  CE1 . TYR A 1 259 ? 33.875  29.415 30.481 1.00 25.84 ? 300  TYR A CE1 1 
ATOM   1978 C  CE2 . TYR A 1 259 ? 32.196  27.750 30.984 1.00 27.73 ? 300  TYR A CE2 1 
ATOM   1979 C  CZ  . TYR A 1 259 ? 33.446  28.302 31.198 1.00 27.11 ? 300  TYR A CZ  1 
ATOM   1980 O  OH  . TYR A 1 259 ? 34.243  27.756 32.166 1.00 30.84 ? 300  TYR A OH  1 
ATOM   1981 N  N   . ASP A 1 260 ? 28.998  31.828 26.591 1.00 24.24 ? 301  ASP A N   1 
ATOM   1982 C  CA  . ASP A 1 260 ? 28.128  32.176 25.484 1.00 26.24 ? 301  ASP A CA  1 
ATOM   1983 C  C   . ASP A 1 260 ? 28.466  33.543 24.864 1.00 26.17 ? 301  ASP A C   1 
ATOM   1984 O  O   . ASP A 1 260 ? 28.414  33.715 23.630 1.00 27.12 ? 301  ASP A O   1 
ATOM   1985 C  CB  . ASP A 1 260 ? 26.666  32.133 25.917 1.00 25.88 ? 301  ASP A CB  1 
ATOM   1986 C  CG  . ASP A 1 260 ? 26.104  30.715 25.998 1.00 29.66 ? 301  ASP A CG  1 
ATOM   1987 O  OD1 . ASP A 1 260 ? 26.732  29.776 25.399 1.00 30.10 ? 301  ASP A OD1 1 
ATOM   1988 O  OD2 . ASP A 1 260 ? 25.030  30.508 26.652 1.00 26.84 ? 301  ASP A OD2 1 
ATOM   1989 N  N   . ALA A 1 261 ? 28.768  34.542 25.717 1.00 25.61 ? 302  ALA A N   1 
ATOM   1990 C  CA  . ALA A 1 261 ? 29.131  35.863 25.167 1.00 27.27 ? 302  ALA A CA  1 
ATOM   1991 C  C   . ALA A 1 261 ? 30.384  35.787 24.286 1.00 27.58 ? 302  ALA A C   1 
ATOM   1992 O  O   . ALA A 1 261 ? 30.427  36.475 23.258 1.00 29.45 ? 302  ALA A O   1 
ATOM   1993 C  CB  . ALA A 1 261 ? 29.349  36.872 26.243 1.00 26.45 ? 302  ALA A CB  1 
ATOM   1994 N  N   . GLN A 1 262 ? 31.390  35.033 24.743 1.00 28.64 ? 303  GLN A N   1 
ATOM   1995 C  CA  . GLN A 1 262 ? 32.629  34.846 23.972 1.00 30.24 ? 303  GLN A CA  1 
ATOM   1996 C  C   . GLN A 1 262 ? 32.313  34.411 22.532 1.00 30.09 ? 303  GLN A C   1 
ATOM   1997 O  O   . GLN A 1 262 ? 32.868  34.959 21.569 1.00 30.79 ? 303  GLN A O   1 
ATOM   1998 C  CB  . GLN A 1 262 ? 33.507  33.802 24.616 1.00 30.59 ? 303  GLN A CB  1 
ATOM   1999 C  CG  . GLN A 1 262 ? 34.787  33.614 23.816 1.00 34.16 ? 303  GLN A CG  1 
ATOM   2000 C  CD  . GLN A 1 262 ? 35.960  34.190 24.533 1.00 39.48 ? 303  GLN A CD  1 
ATOM   2001 O  OE1 . GLN A 1 262 ? 36.688  35.053 24.005 1.00 45.53 ? 303  GLN A OE1 1 
ATOM   2002 N  NE2 . GLN A 1 262 ? 36.167  33.726 25.752 1.00 36.81 ? 303  GLN A NE2 1 
ATOM   2003 N  N   . LYS A 1 263 ? 31.380  33.477 22.398 1.00 30.94 ? 304  LYS A N   1 
ATOM   2004 C  CA  . LYS A 1 263 ? 30.954  32.977 21.075 1.00 30.64 ? 304  LYS A CA  1 
ATOM   2005 C  C   . LYS A 1 263 ? 30.290  34.036 20.219 1.00 31.88 ? 304  LYS A C   1 
ATOM   2006 O  O   . LYS A 1 263 ? 30.426  34.038 18.985 1.00 31.72 ? 304  LYS A O   1 
ATOM   2007 C  CB  . LYS A 1 263 ? 30.043  31.756 21.212 1.00 31.64 ? 304  LYS A CB  1 
ATOM   2008 C  CG  . LYS A 1 263 ? 30.694  30.628 21.951 1.00 33.19 ? 304  LYS A CG  1 
ATOM   2009 C  CD  . LYS A 1 263 ? 31.725  29.930 21.048 1.00 40.92 ? 304  LYS A CD  1 
ATOM   2010 C  CE  . LYS A 1 263 ? 32.932  29.527 21.869 1.00 44.24 ? 304  LYS A CE  1 
ATOM   2011 N  NZ  . LYS A 1 263 ? 33.653  28.400 21.217 1.00 50.77 ? 304  LYS A NZ  1 
ATOM   2012 N  N   . LEU A 1 264 ? 29.563  34.968 20.849 1.00 30.15 ? 305  LEU A N   1 
ATOM   2013 C  CA  . LEU A 1 264 ? 28.908  36.033 20.084 1.00 30.82 ? 305  LEU A CA  1 
ATOM   2014 C  C   . LEU A 1 264 ? 29.862  37.175 19.724 1.00 30.14 ? 305  LEU A C   1 
ATOM   2015 O  O   . LEU A 1 264 ? 29.707  37.814 18.685 1.00 31.97 ? 305  LEU A O   1 
ATOM   2016 C  CB  . LEU A 1 264 ? 27.679  36.576 20.847 1.00 28.84 ? 305  LEU A CB  1 
ATOM   2017 C  CG  . LEU A 1 264 ? 26.590  35.533 21.144 1.00 29.97 ? 305  LEU A CG  1 
ATOM   2018 C  CD1 . LEU A 1 264 ? 25.430  36.175 21.967 1.00 28.55 ? 305  LEU A CD1 1 
ATOM   2019 C  CD2 . LEU A 1 264 ? 26.024  34.906 19.883 1.00 29.64 ? 305  LEU A CD2 1 
ATOM   2020 N  N   . LEU A 1 265 ? 30.832  37.428 20.586 1.00 30.06 ? 306  LEU A N   1 
ATOM   2021 C  CA  . LEU A 1 265 ? 31.734  38.558 20.447 1.00 30.52 ? 306  LEU A CA  1 
ATOM   2022 C  C   . LEU A 1 265 ? 32.974  38.217 19.595 1.00 32.06 ? 306  LEU A C   1 
ATOM   2023 O  O   . LEU A 1 265 ? 33.562  39.108 18.962 1.00 32.18 ? 306  LEU A O   1 
ATOM   2024 C  CB  . LEU A 1 265 ? 32.212  38.996 21.818 1.00 30.48 ? 306  LEU A CB  1 
ATOM   2025 C  CG  . LEU A 1 265 ? 31.146  39.606 22.764 1.00 28.32 ? 306  LEU A CG  1 
ATOM   2026 C  CD1 . LEU A 1 265 ? 31.798  39.765 24.127 1.00 27.80 ? 306  LEU A CD1 1 
ATOM   2027 C  CD2 . LEU A 1 265 ? 30.630  40.927 22.205 1.00 27.33 ? 306  LEU A CD2 1 
ATOM   2028 N  N   . GLU A 1 266 ? 33.388  36.948 19.634 1.00 32.81 ? 307  GLU A N   1 
ATOM   2029 C  CA  . GLU A 1 266 ? 34.652  36.550 18.964 1.00 34.19 ? 307  GLU A CA  1 
ATOM   2030 C  C   . GLU A 1 266 ? 34.740  36.915 17.470 1.00 34.87 ? 307  GLU A C   1 
ATOM   2031 O  O   . GLU A 1 266 ? 35.823  37.287 17.001 1.00 35.97 ? 307  GLU A O   1 
ATOM   2032 C  CB  . GLU A 1 266 ? 34.982  35.077 19.211 1.00 33.65 ? 307  GLU A CB  1 
ATOM   2033 C  CG  . GLU A 1 266 ? 34.127  34.121 18.451 1.00 36.78 ? 307  GLU A CG  1 
ATOM   2034 C  CD  . GLU A 1 266 ? 34.350  32.683 18.886 1.00 39.15 ? 307  GLU A CD  1 
ATOM   2035 O  OE1 . GLU A 1 266 ? 35.228  32.433 19.762 1.00 41.94 ? 307  GLU A OE1 1 
ATOM   2036 O  OE2 . GLU A 1 266 ? 33.615  31.816 18.364 1.00 39.19 ? 307  GLU A OE2 1 
ATOM   2037 N  N   . LYS A 1 267 ? 33.632  36.815 16.745 1.00 34.72 ? 308  LYS A N   1 
ATOM   2038 C  CA  . LYS A 1 267 ? 33.617  37.112 15.311 1.00 35.95 ? 308  LYS A CA  1 
ATOM   2039 C  C   . LYS A 1 267 ? 33.377  38.582 14.961 1.00 36.12 ? 308  LYS A C   1 
ATOM   2040 O  O   . LYS A 1 267 ? 33.312  38.958 13.770 1.00 34.61 ? 308  LYS A O   1 
ATOM   2041 C  CB  . LYS A 1 267 ? 32.567  36.243 14.605 1.00 36.37 ? 308  LYS A CB  1 
ATOM   2042 C  CG  . LYS A 1 267 ? 32.819  34.741 14.688 1.00 37.75 ? 308  LYS A CG  1 
ATOM   2043 C  CD  . LYS A 1 267 ? 31.688  33.972 14.023 1.00 37.06 ? 308  LYS A CD  1 
ATOM   2044 C  CE  . LYS A 1 267 ? 31.956  32.455 14.084 1.00 39.91 ? 308  LYS A CE  1 
ATOM   2045 N  NZ  . LYS A 1 267 ? 30.864  31.684 13.428 1.00 41.36 ? 308  LYS A NZ  1 
ATOM   2046 N  N   . MET A 1 268 ? 33.199  39.431 15.981 1.00 35.62 ? 309  MET A N   1 
ATOM   2047 C  CA  . MET A 1 268 ? 32.821  40.823 15.695 1.00 35.73 ? 309  MET A CA  1 
ATOM   2048 C  C   . MET A 1 268 ? 33.826  41.628 14.851 1.00 36.19 ? 309  MET A C   1 
ATOM   2049 O  O   . MET A 1 268 ? 35.027  41.613 15.116 1.00 36.09 ? 309  MET A O   1 
ATOM   2050 C  CB  . MET A 1 268 ? 32.444  41.580 16.977 1.00 36.33 ? 309  MET A CB  1 
ATOM   2051 C  CG  A MET A 1 268 ? 31.103  41.017 17.503 0.50 35.73 ? 309  MET A CG  1 
ATOM   2052 C  CG  B MET A 1 268 ? 31.197  41.106 17.683 0.50 37.38 ? 309  MET A CG  1 
ATOM   2053 S  SD  A MET A 1 268 ? 30.027  42.027 18.529 0.50 32.79 ? 309  MET A SD  1 
ATOM   2054 S  SD  B MET A 1 268 ? 29.742  41.695 16.837 0.50 38.35 ? 309  MET A SD  1 
ATOM   2055 C  CE  A MET A 1 268 ? 29.786  43.482 17.500 0.50 33.50 ? 309  MET A CE  1 
ATOM   2056 C  CE  B MET A 1 268 ? 29.776  43.459 17.198 0.50 37.48 ? 309  MET A CE  1 
ATOM   2057 N  N   . GLY A 1 269 ? 33.281  42.354 13.877 1.00 37.09 ? 310  GLY A N   1 
ATOM   2058 C  CA  . GLY A 1 269 ? 34.062  43.193 12.979 1.00 37.86 ? 310  GLY A CA  1 
ATOM   2059 C  C   . GLY A 1 269 ? 33.781  44.673 13.139 1.00 39.77 ? 310  GLY A C   1 
ATOM   2060 O  O   . GLY A 1 269 ? 33.566  45.165 14.271 1.00 39.66 ? 310  GLY A O   1 
ATOM   2061 N  N   . GLY A 1 270 ? 33.776  45.386 12.008 1.00 40.23 ? 311  GLY A N   1 
ATOM   2062 C  CA  . GLY A 1 270 ? 33.602  46.843 11.988 1.00 40.31 ? 311  GLY A CA  1 
ATOM   2063 C  C   . GLY A 1 270 ? 34.691  47.549 12.761 1.00 40.69 ? 311  GLY A C   1 
ATOM   2064 O  O   . GLY A 1 270 ? 35.846  47.120 12.765 1.00 41.48 ? 311  GLY A O   1 
ATOM   2065 N  N   . SER A 1 271 ? 34.313  48.618 13.459 1.00 40.24 ? 312  SER A N   1 
ATOM   2066 C  CA  . SER A 1 271 ? 35.262  49.512 14.108 1.00 39.62 ? 312  SER A CA  1 
ATOM   2067 C  C   . SER A 1 271 ? 35.867  48.897 15.358 1.00 39.45 ? 312  SER A C   1 
ATOM   2068 O  O   . SER A 1 271 ? 35.213  48.106 16.053 1.00 40.49 ? 312  SER A O   1 
ATOM   2069 C  CB  . SER A 1 271 ? 34.557  50.842 14.449 1.00 39.92 ? 312  SER A CB  1 
ATOM   2070 O  OG  A SER A 1 271 ? 35.476  51.789 14.953 0.50 39.92 ? 312  SER A OG  1 
ATOM   2071 O  OG  B SER A 1 271 ? 33.797  51.340 13.351 0.50 38.53 ? 312  SER A OG  1 
ATOM   2072 N  N   . ALA A 1 272 ? 37.112  49.246 15.661 1.00 38.71 ? 313  ALA A N   1 
ATOM   2073 C  CA  . ALA A 1 272 ? 37.748  48.773 16.883 1.00 38.65 ? 313  ALA A CA  1 
ATOM   2074 C  C   . ALA A 1 272 ? 37.118  49.511 18.089 1.00 38.68 ? 313  ALA A C   1 
ATOM   2075 O  O   . ALA A 1 272 ? 36.530  50.575 17.899 1.00 38.61 ? 313  ALA A O   1 
ATOM   2076 C  CB  . ALA A 1 272 ? 39.249  49.039 16.853 1.00 38.95 ? 313  ALA A CB  1 
ATOM   2077 N  N   . PRO A 1 273 ? 37.287  48.968 19.314 1.00 38.81 ? 314  PRO A N   1 
ATOM   2078 C  CA  . PRO A 1 273 ? 36.822  49.680 20.502 1.00 39.21 ? 314  PRO A CA  1 
ATOM   2079 C  C   . PRO A 1 273 ? 37.511  51.044 20.548 1.00 39.88 ? 314  PRO A C   1 
ATOM   2080 O  O   . PRO A 1 273 ? 38.706  51.132 20.209 1.00 40.20 ? 314  PRO A O   1 
ATOM   2081 C  CB  . PRO A 1 273 ? 37.310  48.802 21.662 1.00 38.95 ? 314  PRO A CB  1 
ATOM   2082 C  CG  . PRO A 1 273 ? 38.393  47.920 21.067 1.00 38.84 ? 314  PRO A CG  1 
ATOM   2083 C  CD  . PRO A 1 273 ? 37.957  47.701 19.664 1.00 38.78 ? 314  PRO A CD  1 
ATOM   2084 N  N   . PRO A 1 274 ? 36.784  52.106 20.967 1.00 39.95 ? 315  PRO A N   1 
ATOM   2085 C  CA  . PRO A 1 274 ? 37.359  53.454 20.941 1.00 39.75 ? 315  PRO A CA  1 
ATOM   2086 C  C   . PRO A 1 274 ? 38.526  53.646 21.916 1.00 40.23 ? 315  PRO A C   1 
ATOM   2087 O  O   . PRO A 1 274 ? 39.386  54.511 21.707 1.00 40.72 ? 315  PRO A O   1 
ATOM   2088 C  CB  . PRO A 1 274 ? 36.155  54.355 21.288 1.00 40.01 ? 315  PRO A CB  1 
ATOM   2089 C  CG  . PRO A 1 274 ? 35.273  53.467 22.134 1.00 39.15 ? 315  PRO A CG  1 
ATOM   2090 C  CD  . PRO A 1 274 ? 35.396  52.111 21.473 1.00 39.85 ? 315  PRO A CD  1 
ATOM   2091 N  N   . ASP A 1 275 ? 38.557  52.860 22.980 1.00 40.02 ? 316  ASP A N   1 
ATOM   2092 C  CA  . ASP A 1 275 ? 39.631  52.936 23.957 1.00 39.92 ? 316  ASP A CA  1 
ATOM   2093 C  C   . ASP A 1 275 ? 39.501  51.764 24.919 1.00 40.09 ? 316  ASP A C   1 
ATOM   2094 O  O   . ASP A 1 275 ? 38.572  50.959 24.797 1.00 39.87 ? 316  ASP A O   1 
ATOM   2095 C  CB  . ASP A 1 275 ? 39.624  54.289 24.696 1.00 40.38 ? 316  ASP A CB  1 
ATOM   2096 C  CG  . ASP A 1 275 ? 38.369  54.502 25.532 1.00 41.86 ? 316  ASP A CG  1 
ATOM   2097 O  OD1 . ASP A 1 275 ? 38.141  53.728 26.472 1.00 44.04 ? 316  ASP A OD1 1 
ATOM   2098 O  OD2 . ASP A 1 275 ? 37.619  55.450 25.246 1.00 44.43 ? 316  ASP A OD2 1 
ATOM   2099 N  N   . SER A 1 276 ? 40.429  51.670 25.870 1.00 39.72 ? 317  SER A N   1 
ATOM   2100 C  CA  . SER A 1 276 ? 40.555  50.483 26.711 1.00 39.96 ? 317  SER A CA  1 
ATOM   2101 C  C   . SER A 1 276 ? 39.375  50.267 27.678 1.00 39.34 ? 317  SER A C   1 
ATOM   2102 O  O   . SER A 1 276 ? 39.141  49.123 28.127 1.00 39.52 ? 317  SER A O   1 
ATOM   2103 C  CB  . SER A 1 276 ? 41.877  50.511 27.480 1.00 40.41 ? 317  SER A CB  1 
ATOM   2104 O  OG  . SER A 1 276 ? 41.839  51.511 28.483 1.00 42.57 ? 317  SER A OG  1 
ATOM   2105 N  N   . SER A 1 277 ? 38.651  51.350 28.006 1.00 38.37 ? 318  SER A N   1 
ATOM   2106 C  CA  . SER A 1 277 ? 37.538  51.286 28.979 1.00 35.89 ? 318  SER A CA  1 
ATOM   2107 C  C   . SER A 1 277 ? 36.324  50.584 28.373 1.00 35.25 ? 318  SER A C   1 
ATOM   2108 O  O   . SER A 1 277 ? 35.299  50.369 29.062 1.00 34.80 ? 318  SER A O   1 
ATOM   2109 C  CB  . SER A 1 277 ? 37.162  52.684 29.479 1.00 36.64 ? 318  SER A CB  1 
ATOM   2110 O  OG  . SER A 1 277 ? 36.472  53.408 28.484 1.00 34.66 ? 318  SER A OG  1 
ATOM   2111 N  N   . TRP A 1 278 ? 36.441  50.242 27.084 1.00 32.89 ? 319  TRP A N   1 
ATOM   2112 C  CA  . TRP A 1 278 ? 35.429  49.487 26.346 1.00 31.26 ? 319  TRP A CA  1 
ATOM   2113 C  C   . TRP A 1 278 ? 35.798  48.001 26.230 1.00 31.38 ? 319  TRP A C   1 
ATOM   2114 O  O   . TRP A 1 278 ? 34.996  47.194 25.778 1.00 30.43 ? 319  TRP A O   1 
ATOM   2115 C  CB  . TRP A 1 278 ? 35.246  50.056 24.942 1.00 30.73 ? 319  TRP A CB  1 
ATOM   2116 C  CG  . TRP A 1 278 ? 34.319  51.215 24.882 1.00 29.22 ? 319  TRP A CG  1 
ATOM   2117 C  CD1 . TRP A 1 278 ? 34.448  52.424 25.536 1.00 28.33 ? 319  TRP A CD1 1 
ATOM   2118 C  CD2 . TRP A 1 278 ? 33.109  51.290 24.135 1.00 28.13 ? 319  TRP A CD2 1 
ATOM   2119 N  NE1 . TRP A 1 278 ? 33.395  53.239 25.217 1.00 30.10 ? 319  TRP A NE1 1 
ATOM   2120 C  CE2 . TRP A 1 278 ? 32.535  52.571 24.393 1.00 27.87 ? 319  TRP A CE2 1 
ATOM   2121 C  CE3 . TRP A 1 278 ? 32.420  50.396 23.298 1.00 27.73 ? 319  TRP A CE3 1 
ATOM   2122 C  CZ2 . TRP A 1 278 ? 31.342  52.987 23.801 1.00 27.84 ? 319  TRP A CZ2 1 
ATOM   2123 C  CZ3 . TRP A 1 278 ? 31.242  50.803 22.724 1.00 28.57 ? 319  TRP A CZ3 1 
ATOM   2124 C  CH2 . TRP A 1 278 ? 30.696  52.100 22.997 1.00 28.95 ? 319  TRP A CH2 1 
ATOM   2125 N  N   . ARG A 1 279 ? 37.026  47.661 26.614 1.00 31.84 ? 320  ARG A N   1 
ATOM   2126 C  CA  . ARG A 1 279 ? 37.487  46.285 26.554 1.00 33.63 ? 320  ARG A CA  1 
ATOM   2127 C  C   . ARG A 1 279 ? 37.305  45.589 27.902 1.00 31.38 ? 320  ARG A C   1 
ATOM   2128 O  O   . ARG A 1 279 ? 37.840  46.032 28.907 1.00 32.47 ? 320  ARG A O   1 
ATOM   2129 C  CB  . ARG A 1 279 ? 38.977  46.226 26.142 1.00 32.34 ? 320  ARG A CB  1 
ATOM   2130 C  CG  . ARG A 1 279 ? 39.222  46.446 24.667 1.00 36.37 ? 320  ARG A CG  1 
ATOM   2131 C  CD  . ARG A 1 279 ? 40.709  46.229 24.304 1.00 38.34 ? 320  ARG A CD  1 
ATOM   2132 N  NE  . ARG A 1 279 ? 41.185  47.408 23.586 1.00 49.36 ? 320  ARG A NE  1 
ATOM   2133 C  CZ  . ARG A 1 279 ? 42.066  48.279 24.074 1.00 50.84 ? 320  ARG A CZ  1 
ATOM   2134 N  NH1 . ARG A 1 279 ? 42.627  48.086 25.271 1.00 52.13 ? 320  ARG A NH1 1 
ATOM   2135 N  NH2 . ARG A 1 279 ? 42.403  49.337 23.348 1.00 53.87 ? 320  ARG A NH2 1 
ATOM   2136 N  N   . GLY A 1 280 ? 36.550  44.494 27.917 1.00 31.72 ? 321  GLY A N   1 
ATOM   2137 C  CA  . GLY A 1 280 ? 36.506  43.583 29.060 1.00 31.53 ? 321  GLY A CA  1 
ATOM   2138 C  C   . GLY A 1 280 ? 37.678  42.603 29.096 1.00 32.83 ? 321  GLY A C   1 
ATOM   2139 O  O   . GLY A 1 280 ? 38.728  42.883 28.491 1.00 31.33 ? 321  GLY A O   1 
ATOM   2140 N  N   . SER A 1 281 ? 37.493  41.476 29.791 1.00 32.80 ? 322  SER A N   1 
ATOM   2141 C  CA  . SER A 1 281 ? 38.581  40.529 30.091 1.00 34.25 ? 322  SER A CA  1 
ATOM   2142 C  C   . SER A 1 281 ? 38.590  39.276 29.212 1.00 33.64 ? 322  SER A C   1 
ATOM   2143 O  O   . SER A 1 281 ? 39.476  38.442 29.348 1.00 34.03 ? 322  SER A O   1 
ATOM   2144 C  CB  . SER A 1 281 ? 38.548  40.113 31.551 1.00 34.37 ? 322  SER A CB  1 
ATOM   2145 O  OG  . SER A 1 281 ? 38.958  41.213 32.357 1.00 39.42 ? 322  SER A OG  1 
ATOM   2146 N  N   . LEU A 1 282 ? 37.640  39.155 28.305 1.00 32.64 ? 323  LEU A N   1 
ATOM   2147 C  CA  . LEU A 1 282 ? 37.579  37.997 27.429 1.00 33.19 ? 323  LEU A CA  1 
ATOM   2148 C  C   . LEU A 1 282 ? 38.638  38.117 26.332 1.00 34.55 ? 323  LEU A C   1 
ATOM   2149 O  O   . LEU A 1 282 ? 39.056  39.230 25.962 1.00 34.32 ? 323  LEU A O   1 
ATOM   2150 C  CB  . LEU A 1 282 ? 36.198  37.881 26.789 1.00 32.81 ? 323  LEU A CB  1 
ATOM   2151 C  CG  . LEU A 1 282 ? 35.006  37.524 27.708 1.00 30.08 ? 323  LEU A CG  1 
ATOM   2152 C  CD1 . LEU A 1 282 ? 33.693  37.659 26.957 1.00 29.21 ? 323  LEU A CD1 1 
ATOM   2153 C  CD2 . LEU A 1 282 ? 35.170  36.137 28.325 1.00 29.50 ? 323  LEU A CD2 1 
ATOM   2154 N  N   . LYS A 1 283 ? 39.027  36.974 25.784 1.00 35.12 ? 324  LYS A N   1 
ATOM   2155 C  CA  . LYS A 1 283 ? 40.030  36.966 24.724 1.00 36.88 ? 324  LYS A CA  1 
ATOM   2156 C  C   . LYS A 1 283 ? 39.356  37.228 23.382 1.00 36.41 ? 324  LYS A C   1 
ATOM   2157 O  O   . LYS A 1 283 ? 39.223  36.312 22.550 1.00 37.15 ? 324  LYS A O   1 
ATOM   2158 C  CB  . LYS A 1 283 ? 40.829  35.662 24.792 1.00 36.95 ? 324  LYS A CB  1 
ATOM   2159 C  CG  . LYS A 1 283 ? 41.599  35.556 26.133 1.00 37.98 ? 324  LYS A CG  1 
ATOM   2160 C  CD  . LYS A 1 283 ? 42.238  34.171 26.376 1.00 40.25 ? 324  LYS A CD  1 
ATOM   2161 C  CE  . LYS A 1 283 ? 42.715  34.048 27.846 1.00 43.00 ? 324  LYS A CE  1 
ATOM   2162 N  NZ  . LYS A 1 283 ? 43.373  32.734 28.144 1.00 45.30 ? 324  LYS A NZ  1 
ATOM   2163 N  N   . VAL A 1 284 ? 38.902  38.480 23.210 1.00 34.87 ? 325  VAL A N   1 
ATOM   2164 C  CA  . VAL A 1 284 ? 38.237  38.969 22.006 1.00 34.19 ? 325  VAL A CA  1 
ATOM   2165 C  C   . VAL A 1 284 ? 38.662  40.432 21.754 1.00 33.85 ? 325  VAL A C   1 
ATOM   2166 O  O   . VAL A 1 284 ? 39.140  41.104 22.682 1.00 34.08 ? 325  VAL A O   1 
ATOM   2167 C  CB  . VAL A 1 284 ? 36.680  38.848 22.070 1.00 33.95 ? 325  VAL A CB  1 
ATOM   2168 C  CG1 . VAL A 1 284 ? 36.198  37.391 22.161 1.00 33.76 ? 325  VAL A CG1 1 
ATOM   2169 C  CG2 . VAL A 1 284 ? 36.096  39.696 23.235 1.00 33.91 ? 325  VAL A CG2 1 
ATOM   2170 N  N   . PRO A 1 285 ? 38.515  40.926 20.503 1.00 34.94 ? 326  PRO A N   1 
ATOM   2171 C  CA  . PRO A 1 285 ? 38.939  42.319 20.243 1.00 35.32 ? 326  PRO A CA  1 
ATOM   2172 C  C   . PRO A 1 285 ? 38.032  43.382 20.883 1.00 34.52 ? 326  PRO A C   1 
ATOM   2173 O  O   . PRO A 1 285 ? 38.498  44.489 21.158 1.00 34.87 ? 326  PRO A O   1 
ATOM   2174 C  CB  . PRO A 1 285 ? 38.845  42.459 18.721 1.00 35.21 ? 326  PRO A CB  1 
ATOM   2175 C  CG  . PRO A 1 285 ? 37.971  41.323 18.250 1.00 35.85 ? 326  PRO A CG  1 
ATOM   2176 C  CD  . PRO A 1 285 ? 37.993  40.248 19.295 1.00 34.77 ? 326  PRO A CD  1 
ATOM   2177 N  N   . TYR A 1 286 ? 36.759  43.044 21.087 1.00 34.51 ? 327  TYR A N   1 
ATOM   2178 C  CA  . TYR A 1 286 ? 35.743  44.007 21.591 1.00 33.09 ? 327  TYR A CA  1 
ATOM   2179 C  C   . TYR A 1 286 ? 35.486  45.084 20.542 1.00 33.86 ? 327  TYR A C   1 
ATOM   2180 O  O   . TYR A 1 286 ? 35.291  46.267 20.875 1.00 33.76 ? 327  TYR A O   1 
ATOM   2181 C  CB  . TYR A 1 286 ? 36.127  44.611 22.962 1.00 32.87 ? 327  TYR A CB  1 
ATOM   2182 C  CG  . TYR A 1 286 ? 35.974  43.646 24.132 1.00 32.04 ? 327  TYR A CG  1 
ATOM   2183 C  CD1 . TYR A 1 286 ? 34.707  43.419 24.734 1.00 29.06 ? 327  TYR A CD1 1 
ATOM   2184 C  CD2 . TYR A 1 286 ? 37.080  42.951 24.642 1.00 30.86 ? 327  TYR A CD2 1 
ATOM   2185 C  CE1 . TYR A 1 286 ? 34.575  42.534 25.799 1.00 28.28 ? 327  TYR A CE1 1 
ATOM   2186 C  CE2 . TYR A 1 286 ? 36.960  42.070 25.712 1.00 29.50 ? 327  TYR A CE2 1 
ATOM   2187 C  CZ  . TYR A 1 286 ? 35.694  41.849 26.276 1.00 30.15 ? 327  TYR A CZ  1 
ATOM   2188 O  OH  . TYR A 1 286 ? 35.583  40.986 27.342 1.00 31.69 ? 327  TYR A OH  1 
ATOM   2189 N  N   . ASN A 1 287 ? 35.513  44.657 19.273 1.00 33.72 ? 328  ASN A N   1 
ATOM   2190 C  CA  . ASN A 1 287 ? 35.146  45.492 18.145 1.00 34.07 ? 328  ASN A CA  1 
ATOM   2191 C  C   . ASN A 1 287 ? 33.692  45.854 18.314 1.00 33.79 ? 328  ASN A C   1 
ATOM   2192 O  O   . ASN A 1 287 ? 32.880  45.053 18.791 1.00 33.16 ? 328  ASN A O   1 
ATOM   2193 C  CB  . ASN A 1 287 ? 35.329  44.755 16.812 1.00 34.25 ? 328  ASN A CB  1 
ATOM   2194 C  CG  . ASN A 1 287 ? 36.807  44.493 16.474 1.00 36.44 ? 328  ASN A CG  1 
ATOM   2195 O  OD1 . ASN A 1 287 ? 37.714  45.249 16.885 1.00 36.41 ? 328  ASN A OD1 1 
ATOM   2196 N  ND2 . ASN A 1 287 ? 37.053  43.402 15.735 1.00 37.10 ? 328  ASN A ND2 1 
ATOM   2197 N  N   . VAL A 1 288 ? 33.369  47.073 17.943 1.00 34.62 ? 329  VAL A N   1 
ATOM   2198 C  CA  . VAL A 1 288 ? 32.025  47.596 18.149 1.00 34.62 ? 329  VAL A CA  1 
ATOM   2199 C  C   . VAL A 1 288 ? 31.051  47.095 17.084 1.00 35.14 ? 329  VAL A C   1 
ATOM   2200 O  O   . VAL A 1 288 ? 29.852  47.089 17.287 1.00 35.49 ? 329  VAL A O   1 
ATOM   2201 C  CB  . VAL A 1 288 ? 32.063  49.136 18.217 1.00 35.08 ? 329  VAL A CB  1 
ATOM   2202 C  CG1 . VAL A 1 288 ? 30.655  49.711 18.109 1.00 36.97 ? 329  VAL A CG1 1 
ATOM   2203 C  CG2 . VAL A 1 288 ? 32.751  49.588 19.503 1.00 33.55 ? 329  VAL A CG2 1 
ATOM   2204 N  N   . GLY A 1 289 ? 31.555  46.660 15.927 1.00 35.64 ? 330  GLY A N   1 
ATOM   2205 C  CA  . GLY A 1 289 ? 30.658  46.263 14.837 1.00 35.58 ? 330  GLY A CA  1 
ATOM   2206 C  C   . GLY A 1 289 ? 30.397  47.447 13.920 1.00 36.04 ? 330  GLY A C   1 
ATOM   2207 O  O   . GLY A 1 289 ? 31.226  48.356 13.844 1.00 37.01 ? 330  GLY A O   1 
ATOM   2208 N  N   . PRO A 1 290 ? 29.248  47.473 13.237 1.00 36.80 ? 331  PRO A N   1 
ATOM   2209 C  CA  . PRO A 1 290 ? 28.207  46.451 13.221 1.00 37.27 ? 331  PRO A CA  1 
ATOM   2210 C  C   . PRO A 1 290 ? 28.659  45.135 12.560 1.00 38.71 ? 331  PRO A C   1 
ATOM   2211 O  O   . PRO A 1 290 ? 29.530  45.149 11.670 1.00 38.89 ? 331  PRO A O   1 
ATOM   2212 C  CB  . PRO A 1 290 ? 27.075  47.099 12.422 1.00 37.94 ? 331  PRO A CB  1 
ATOM   2213 C  CG  . PRO A 1 290 ? 27.741  48.186 11.621 1.00 37.89 ? 331  PRO A CG  1 
ATOM   2214 C  CD  . PRO A 1 290 ? 28.903  48.652 12.420 1.00 37.18 ? 331  PRO A CD  1 
ATOM   2215 N  N   . GLY A 1 291 ? 28.081  44.023 13.008 1.00 38.50 ? 332  GLY A N   1 
ATOM   2216 C  CA  . GLY A 1 291 ? 28.298  42.717 12.381 1.00 39.55 ? 332  GLY A CA  1 
ATOM   2217 C  C   . GLY A 1 291 ? 29.654  42.059 12.545 1.00 39.94 ? 332  GLY A C   1 
ATOM   2218 O  O   . GLY A 1 291 ? 30.528  42.544 13.283 1.00 39.78 ? 332  GLY A O   1 
ATOM   2219 N  N   . PHE A 1 292 ? 29.821  40.947 11.818 1.00 40.39 ? 333  PHE A N   1 
ATOM   2220 C  CA  . PHE A 1 292 ? 30.989  40.065 11.928 1.00 40.82 ? 333  PHE A CA  1 
ATOM   2221 C  C   . PHE A 1 292 ? 32.060  40.370 10.859 1.00 41.76 ? 333  PHE A C   1 
ATOM   2222 O  O   . PHE A 1 292 ? 31.725  40.937 9.813  1.00 40.76 ? 333  PHE A O   1 
ATOM   2223 C  CB  . PHE A 1 292 ? 30.555  38.603 11.792 1.00 40.25 ? 333  PHE A CB  1 
ATOM   2224 C  CG  . PHE A 1 292 ? 29.647  38.111 12.907 1.00 41.06 ? 333  PHE A CG  1 
ATOM   2225 C  CD1 . PHE A 1 292 ? 28.650  37.173 12.636 1.00 40.01 ? 333  PHE A CD1 1 
ATOM   2226 C  CD2 . PHE A 1 292 ? 29.796  38.569 14.215 1.00 40.25 ? 333  PHE A CD2 1 
ATOM   2227 C  CE1 . PHE A 1 292 ? 27.810  36.705 13.643 1.00 42.67 ? 333  PHE A CE1 1 
ATOM   2228 C  CE2 . PHE A 1 292 ? 28.959  38.098 15.232 1.00 39.32 ? 333  PHE A CE2 1 
ATOM   2229 C  CZ  . PHE A 1 292 ? 27.968  37.174 14.947 1.00 38.16 ? 333  PHE A CZ  1 
ATOM   2230 N  N   . THR A 1 293 ? 33.318  40.008 11.146 1.00 42.80 ? 334  THR A N   1 
ATOM   2231 C  CA  . THR A 1 293 ? 34.452  40.178 10.196 1.00 44.99 ? 334  THR A CA  1 
ATOM   2232 C  C   . THR A 1 293 ? 34.222  39.394 8.906  1.00 46.20 ? 334  THR A C   1 
ATOM   2233 O  O   . THR A 1 293 ? 33.565  38.344 8.921  1.00 46.00 ? 334  THR A O   1 
ATOM   2234 C  CB  . THR A 1 293 ? 35.797  39.706 10.771 1.00 45.15 ? 334  THR A CB  1 
ATOM   2235 O  OG1 . THR A 1 293 ? 35.705  38.321 11.140 1.00 46.23 ? 334  THR A OG1 1 
ATOM   2236 C  CG2 . THR A 1 293 ? 36.231  40.540 11.964 1.00 45.03 ? 334  THR A CG2 1 
ATOM   2237 N  N   . GLY A 1 294 ? 34.810  39.899 7.809  1.00 47.31 ? 335  GLY A N   1 
ATOM   2238 C  CA  . GLY A 1 294 ? 34.591  39.407 6.438  1.00 48.35 ? 335  GLY A CA  1 
ATOM   2239 C  C   . GLY A 1 294 ? 34.164  37.977 6.183  1.00 48.75 ? 335  GLY A C   1 
ATOM   2240 O  O   . GLY A 1 294 ? 33.165  37.750 5.507  1.00 49.54 ? 335  GLY A O   1 
ATOM   2241 N  N   . ASN A 1 295 ? 34.924  37.016 6.705  1.00 49.41 ? 336  ASN A N   1 
ATOM   2242 C  CA  . ASN A 1 295 ? 34.627  35.582 6.520  1.00 50.29 ? 336  ASN A CA  1 
ATOM   2243 C  C   . ASN A 1 295 ? 33.236  35.159 7.003  1.00 50.19 ? 336  ASN A C   1 
ATOM   2244 O  O   . ASN A 1 295 ? 32.600  34.256 6.441  1.00 50.06 ? 336  ASN A O   1 
ATOM   2245 C  CB  . ASN A 1 295 ? 35.681  34.711 7.233  1.00 50.87 ? 336  ASN A CB  1 
ATOM   2246 C  CG  . ASN A 1 295 ? 37.049  34.705 6.522  1.00 52.53 ? 336  ASN A CG  1 
ATOM   2247 O  OD1 . ASN A 1 295 ? 37.320  35.508 5.620  1.00 53.85 ? 336  ASN A OD1 1 
ATOM   2248 N  ND2 . ASN A 1 295 ? 37.916  33.793 6.944  1.00 53.91 ? 336  ASN A ND2 1 
ATOM   2249 N  N   . PHE A 1 296 ? 32.783  35.815 8.067  1.00 49.82 ? 337  PHE A N   1 
ATOM   2250 C  CA  . PHE A 1 296 ? 31.504  35.506 8.693  1.00 48.75 ? 337  PHE A CA  1 
ATOM   2251 C  C   . PHE A 1 296 ? 30.455  36.599 8.455  1.00 48.58 ? 337  PHE A C   1 
ATOM   2252 O  O   . PHE A 1 296 ? 29.388  36.591 9.083  1.00 48.23 ? 337  PHE A O   1 
ATOM   2253 C  CB  . PHE A 1 296 ? 31.711  35.317 10.197 1.00 49.01 ? 337  PHE A CB  1 
ATOM   2254 C  CG  . PHE A 1 296 ? 32.859  34.412 10.554 1.00 48.77 ? 337  PHE A CG  1 
ATOM   2255 C  CD1 . PHE A 1 296 ? 34.095  34.939 10.907 1.00 49.62 ? 337  PHE A CD1 1 
ATOM   2256 C  CD2 . PHE A 1 296 ? 32.696  33.027 10.570 1.00 49.68 ? 337  PHE A CD2 1 
ATOM   2257 C  CE1 . PHE A 1 296 ? 35.165  34.101 11.259 1.00 48.46 ? 337  PHE A CE1 1 
ATOM   2258 C  CE2 . PHE A 1 296 ? 33.766  32.184 10.919 1.00 49.52 ? 337  PHE A CE2 1 
ATOM   2259 C  CZ  . PHE A 1 296 ? 34.998  32.729 11.267 1.00 48.47 ? 337  PHE A CZ  1 
ATOM   2260 N  N   . SER A 1 297 ? 30.748  37.521 7.538  1.00 47.81 ? 338  SER A N   1 
ATOM   2261 C  CA  . SER A 1 297 ? 29.915  38.701 7.312  1.00 47.52 ? 338  SER A CA  1 
ATOM   2262 C  C   . SER A 1 297 ? 28.456  38.384 7.003  1.00 46.78 ? 338  SER A C   1 
ATOM   2263 O  O   . SER A 1 297 ? 27.597  39.238 7.191  1.00 47.84 ? 338  SER A O   1 
ATOM   2264 C  CB  . SER A 1 297 ? 30.508  39.579 6.206  1.00 47.66 ? 338  SER A CB  1 
ATOM   2265 O  OG  . SER A 1 297 ? 30.150  39.069 4.925  1.00 48.97 ? 338  SER A OG  1 
ATOM   2266 N  N   . THR A 1 298 ? 28.168  37.171 6.541  1.00 45.55 ? 339  THR A N   1 
ATOM   2267 C  CA  . THR A 1 298 ? 26.788  36.800 6.186  1.00 44.29 ? 339  THR A CA  1 
ATOM   2268 C  C   . THR A 1 298 ? 26.023  36.083 7.310  1.00 42.97 ? 339  THR A C   1 
ATOM   2269 O  O   . THR A 1 298 ? 24.820  35.842 7.185  1.00 42.63 ? 339  THR A O   1 
ATOM   2270 C  CB  . THR A 1 298 ? 26.717  35.937 4.884  1.00 44.54 ? 339  THR A CB  1 
ATOM   2271 O  OG1 . THR A 1 298 ? 27.619  34.833 5.006  1.00 46.11 ? 339  THR A OG1 1 
ATOM   2272 C  CG2 . THR A 1 298 ? 27.066  36.784 3.655  1.00 44.99 ? 339  THR A CG2 1 
ATOM   2273 N  N   . GLN A 1 299 ? 26.727  35.712 8.378  1.00 41.63 ? 340  GLN A N   1 
ATOM   2274 C  CA  . GLN A 1 299 ? 26.074  35.169 9.574  1.00 40.87 ? 340  GLN A CA  1 
ATOM   2275 C  C   . GLN A 1 299 ? 25.390  36.312 10.350 1.00 40.02 ? 340  GLN A C   1 
ATOM   2276 O  O   . GLN A 1 299 ? 25.863  37.438 10.336 1.00 38.77 ? 340  GLN A O   1 
ATOM   2277 C  CB  . GLN A 1 299 ? 27.074  34.433 10.453 1.00 40.31 ? 340  GLN A CB  1 
ATOM   2278 C  CG  . GLN A 1 299 ? 27.707  33.218 9.742  1.00 41.54 ? 340  GLN A CG  1 
ATOM   2279 C  CD  . GLN A 1 299 ? 28.774  32.499 10.549 1.00 42.77 ? 340  GLN A CD  1 
ATOM   2280 O  OE1 . GLN A 1 299 ? 29.152  32.901 11.653 1.00 45.02 ? 340  GLN A OE1 1 
ATOM   2281 N  NE2 . GLN A 1 299 ? 29.275  31.407 9.986  1.00 45.87 ? 340  GLN A NE2 1 
ATOM   2282 N  N   . LYS A 1 300 ? 24.245  36.008 10.962 1.00 38.55 ? 341  LYS A N   1 
ATOM   2283 C  CA  . LYS A 1 300 ? 23.508  36.998 11.770 1.00 37.37 ? 341  LYS A CA  1 
ATOM   2284 C  C   . LYS A 1 300 ? 23.305  36.420 13.166 1.00 35.93 ? 341  LYS A C   1 
ATOM   2285 O  O   . LYS A 1 300 ? 23.605  35.254 13.436 1.00 34.61 ? 341  LYS A O   1 
ATOM   2286 C  CB  . LYS A 1 300 ? 22.130  37.307 11.161 1.00 37.77 ? 341  LYS A CB  1 
ATOM   2287 C  CG  . LYS A 1 300 ? 22.087  37.690 9.684  1.00 41.41 ? 341  LYS A CG  1 
ATOM   2288 C  CD  . LYS A 1 300 ? 22.413  39.139 9.466  1.00 45.97 ? 341  LYS A CD  1 
ATOM   2289 C  CE  . LYS A 1 300 ? 22.909  39.368 8.054  1.00 48.64 ? 341  LYS A CE  1 
ATOM   2290 N  NZ  . LYS A 1 300 ? 23.805  40.572 8.025  1.00 49.49 ? 341  LYS A NZ  1 
ATOM   2291 N  N   . VAL A 1 301 ? 22.791  37.261 14.068 1.00 32.81 ? 342  VAL A N   1 
ATOM   2292 C  CA  . VAL A 1 301 ? 22.390  36.792 15.392 1.00 32.44 ? 342  VAL A CA  1 
ATOM   2293 C  C   . VAL A 1 301 ? 20.870  36.815 15.437 1.00 30.67 ? 342  VAL A C   1 
ATOM   2294 O  O   . VAL A 1 301 ? 20.250  37.735 14.901 1.00 31.07 ? 342  VAL A O   1 
ATOM   2295 C  CB  . VAL A 1 301 ? 22.989  37.671 16.491 1.00 31.52 ? 342  VAL A CB  1 
ATOM   2296 C  CG1 . VAL A 1 301 ? 22.344  37.339 17.846 1.00 32.38 ? 342  VAL A CG1 1 
ATOM   2297 C  CG2 . VAL A 1 301 ? 24.519  37.490 16.514 1.00 33.05 ? 342  VAL A CG2 1 
ATOM   2298 N  N   . LYS A 1 302 ? 20.281  35.769 16.015 1.00 29.78 ? 343  LYS A N   1 
ATOM   2299 C  CA  . LYS A 1 302 ? 18.834  35.645 16.104 1.00 30.33 ? 343  LYS A CA  1 
ATOM   2300 C  C   . LYS A 1 302 ? 18.375  35.339 17.549 1.00 29.84 ? 343  LYS A C   1 
ATOM   2301 O  O   . LYS A 1 302 ? 18.776  34.343 18.171 1.00 28.87 ? 343  LYS A O   1 
ATOM   2302 C  CB  . LYS A 1 302 ? 18.319  34.577 15.128 1.00 30.65 ? 343  LYS A CB  1 
ATOM   2303 C  CG  . LYS A 1 302 ? 16.824  34.463 15.056 1.00 33.49 ? 343  LYS A CG  1 
ATOM   2304 C  CD  . LYS A 1 302 ? 16.431  33.262 14.178 1.00 36.75 ? 343  LYS A CD  1 
ATOM   2305 C  CE  . LYS A 1 302 ? 14.936  33.104 14.121 1.00 39.67 ? 343  LYS A CE  1 
ATOM   2306 N  NZ  . LYS A 1 302 ? 14.337  34.340 13.531 1.00 44.36 ? 343  LYS A NZ  1 
ATOM   2307 N  N   . MET A 1 303 ? 17.521  36.208 18.084 1.00 29.49 ? 344  MET A N   1 
ATOM   2308 C  CA  . MET A 1 303 ? 16.970  35.971 19.412 1.00 28.82 ? 344  MET A CA  1 
ATOM   2309 C  C   . MET A 1 303 ? 15.677  35.178 19.283 1.00 28.37 ? 344  MET A C   1 
ATOM   2310 O  O   . MET A 1 303 ? 14.957  35.305 18.276 1.00 30.35 ? 344  MET A O   1 
ATOM   2311 C  CB  . MET A 1 303 ? 16.716  37.330 20.091 1.00 27.13 ? 344  MET A CB  1 
ATOM   2312 C  CG  . MET A 1 303 ? 17.910  38.251 20.069 1.00 28.11 ? 344  MET A CG  1 
ATOM   2313 S  SD  . MET A 1 303 ? 17.584  39.798 21.030 1.00 27.55 ? 344  MET A SD  1 
ATOM   2314 C  CE  . MET A 1 303 ? 17.541  39.048 22.677 1.00 24.57 ? 344  MET A CE  1 
ATOM   2315 N  N   . HIS A 1 304 ? 15.371  34.368 20.290 1.00 27.76 ? 345  HIS A N   1 
ATOM   2316 C  CA  . HIS A 1 304 ? 14.055  33.710 20.370 1.00 27.77 ? 345  HIS A CA  1 
ATOM   2317 C  C   . HIS A 1 304 ? 13.518  33.894 21.776 1.00 27.30 ? 345  HIS A C   1 
ATOM   2318 O  O   . HIS A 1 304 ? 13.940  33.192 22.704 1.00 27.81 ? 345  HIS A O   1 
ATOM   2319 C  CB  . HIS A 1 304 ? 14.100  32.208 20.092 1.00 28.55 ? 345  HIS A CB  1 
ATOM   2320 C  CG  . HIS A 1 304 ? 14.990  31.821 18.956 1.00 30.75 ? 345  HIS A CG  1 
ATOM   2321 N  ND1 . HIS A 1 304 ? 16.361  31.957 18.997 1.00 34.86 ? 345  HIS A ND1 1 
ATOM   2322 C  CD2 . HIS A 1 304 ? 14.699  31.257 17.757 1.00 34.44 ? 345  HIS A CD2 1 
ATOM   2323 C  CE1 . HIS A 1 304 ? 16.875  31.532 17.852 1.00 35.77 ? 345  HIS A CE1 1 
ATOM   2324 N  NE2 . HIS A 1 304 ? 15.887  31.125 17.078 1.00 36.17 ? 345  HIS A NE2 1 
ATOM   2325 N  N   . ILE A 1 305 ? 12.557  34.806 21.896 1.00 26.73 ? 346  ILE A N   1 
ATOM   2326 C  CA  . ILE A 1 305 ? 11.990  35.167 23.213 1.00 25.85 ? 346  ILE A CA  1 
ATOM   2327 C  C   . ILE A 1 305 ? 10.482  34.932 23.188 1.00 24.98 ? 346  ILE A C   1 
ATOM   2328 O  O   . ILE A 1 305 ? 9.761   35.483 22.333 1.00 26.01 ? 346  ILE A O   1 
ATOM   2329 C  CB  . ILE A 1 305 ? 12.335  36.641 23.599 1.00 24.87 ? 346  ILE A CB  1 
ATOM   2330 C  CG1 . ILE A 1 305 ? 13.847  36.943 23.476 1.00 26.04 ? 346  ILE A CG1 1 
ATOM   2331 C  CG2 . ILE A 1 305 ? 11.753  36.929 24.984 1.00 24.64 ? 346  ILE A CG2 1 
ATOM   2332 C  CD1 . ILE A 1 305 ? 14.782  36.075 24.324 1.00 25.51 ? 346  ILE A CD1 1 
ATOM   2333 N  N   . HIS A 1 306 ? 10.018  34.108 24.126 1.00 24.79 ? 347  HIS A N   1 
ATOM   2334 C  CA  . HIS A 1 306 ? 8.625   33.652 24.163 1.00 26.58 ? 347  HIS A CA  1 
ATOM   2335 C  C   . HIS A 1 306 ? 7.988   33.795 25.550 1.00 25.61 ? 347  HIS A C   1 
ATOM   2336 O  O   . HIS A 1 306 ? 6.908   33.253 25.829 1.00 26.15 ? 347  HIS A O   1 
ATOM   2337 C  CB  . HIS A 1 306 ? 8.542   32.189 23.701 1.00 27.44 ? 347  HIS A CB  1 
ATOM   2338 C  CG  . HIS A 1 306 ? 9.175   31.974 22.360 1.00 31.36 ? 347  HIS A CG  1 
ATOM   2339 N  ND1 . HIS A 1 306 ? 10.319  31.228 22.181 1.00 37.14 ? 347  HIS A ND1 1 
ATOM   2340 C  CD2 . HIS A 1 306 ? 8.845   32.464 21.138 1.00 34.82 ? 347  HIS A CD2 1 
ATOM   2341 C  CE1 . HIS A 1 306 ? 10.657  31.252 20.904 1.00 35.33 ? 347  HIS A CE1 1 
ATOM   2342 N  NE2 . HIS A 1 306 ? 9.778   31.989 20.250 1.00 36.37 ? 347  HIS A NE2 1 
ATOM   2343 N  N   . SER A 1 307 ? 8.650   34.587 26.409 1.00 24.19 ? 348  SER A N   1 
ATOM   2344 C  CA  . SER A 1 307 ? 8.118   34.771 27.766 1.00 23.14 ? 348  SER A CA  1 
ATOM   2345 C  C   . SER A 1 307 ? 6.753   35.445 27.692 1.00 23.16 ? 348  SER A C   1 
ATOM   2346 O  O   . SER A 1 307 ? 6.493   36.189 26.762 1.00 22.90 ? 348  SER A O   1 
ATOM   2347 C  CB  . SER A 1 307 ? 9.060   35.686 28.561 1.00 22.23 ? 348  SER A CB  1 
ATOM   2348 O  OG  . SER A 1 307 ? 10.365  35.163 28.601 1.00 22.76 ? 348  SER A OG  1 
ATOM   2349 N  N   . THR A 1 308 ? 5.958   35.285 28.747 1.00 23.18 ? 349  THR A N   1 
ATOM   2350 C  CA  . THR A 1 308 ? 4.634   35.899 28.788 1.00 23.94 ? 349  THR A CA  1 
ATOM   2351 C  C   . THR A 1 308 ? 4.403   36.665 30.061 1.00 22.23 ? 349  THR A C   1 
ATOM   2352 O  O   . THR A 1 308 ? 4.893   36.258 31.090 1.00 22.94 ? 349  THR A O   1 
ATOM   2353 C  CB  . THR A 1 308 ? 3.546   34.852 28.697 1.00 25.87 ? 349  THR A CB  1 
ATOM   2354 O  OG1 . THR A 1 308 ? 3.641   33.972 29.826 1.00 32.00 ? 349  THR A OG1 1 
ATOM   2355 C  CG2 . THR A 1 308 ? 3.714   34.088 27.390 1.00 26.20 ? 349  THR A CG2 1 
ATOM   2356 N  N   . ASN A 1 309 ? 3.667   37.751 29.950 1.00 21.68 ? 350  ASN A N   1 
ATOM   2357 C  CA  . ASN A 1 309 ? 3.283   38.553 31.100 1.00 21.25 ? 350  ASN A CA  1 
ATOM   2358 C  C   . ASN A 1 309 ? 1.931   38.088 31.555 1.00 21.97 ? 350  ASN A C   1 
ATOM   2359 O  O   . ASN A 1 309 ? 1.012   37.890 30.750 1.00 24.17 ? 350  ASN A O   1 
ATOM   2360 C  CB  . ASN A 1 309 ? 3.155   40.026 30.678 1.00 21.42 ? 350  ASN A CB  1 
ATOM   2361 C  CG  . ASN A 1 309 ? 4.462   40.605 30.192 1.00 21.03 ? 350  ASN A CG  1 
ATOM   2362 O  OD1 . ASN A 1 309 ? 5.518   40.190 30.612 1.00 22.01 ? 350  ASN A OD1 1 
ATOM   2363 N  ND2 . ASN A 1 309 ? 4.382   41.568 29.275 1.00 28.54 ? 350  ASN A ND2 1 
ATOM   2364 N  N   . GLU A 1 310 ? 1.743   37.963 32.861 1.00 21.76 ? 351  GLU A N   1 
ATOM   2365 C  CA  . GLU A 1 310 ? 0.485   37.439 33.372 1.00 22.78 ? 351  GLU A CA  1 
ATOM   2366 C  C   . GLU A 1 310 ? 0.159   38.027 34.738 1.00 21.70 ? 351  GLU A C   1 
ATOM   2367 O  O   . GLU A 1 310 ? 1.039   38.102 35.610 1.00 21.90 ? 351  GLU A O   1 
ATOM   2368 C  CB  A GLU A 1 310 ? 0.511   35.920 33.471 0.65 24.36 ? 351  GLU A CB  1 
ATOM   2369 C  CB  B GLU A 1 310 ? 0.550   35.915 33.527 0.35 23.30 ? 351  GLU A CB  1 
ATOM   2370 C  CG  A GLU A 1 310 ? 1.813   35.346 33.977 0.65 27.88 ? 351  GLU A CG  1 
ATOM   2371 C  CG  B GLU A 1 310 ? 1.462   35.184 32.541 0.35 24.32 ? 351  GLU A CG  1 
ATOM   2372 C  CD  A GLU A 1 310 ? 2.020   33.908 33.484 0.65 35.40 ? 351  GLU A CD  1 
ATOM   2373 C  CD  B GLU A 1 310 ? 0.888   33.865 32.085 0.35 29.28 ? 351  GLU A CD  1 
ATOM   2374 O  OE1 A GLU A 1 310 ? 2.808   33.707 32.510 0.65 38.74 ? 351  GLU A OE1 1 
ATOM   2375 O  OE1 B GLU A 1 310 ? 1.153   33.473 30.925 0.35 30.98 ? 351  GLU A OE1 1 
ATOM   2376 O  OE2 A GLU A 1 310 ? 1.383   32.998 34.063 0.65 34.23 ? 351  GLU A OE2 1 
ATOM   2377 O  OE2 B GLU A 1 310 ? 0.173   33.219 32.880 0.35 32.15 ? 351  GLU A OE2 1 
ATOM   2378 N  N   . VAL A 1 311 ? -1.098  38.409 34.909 1.00 21.10 ? 352  VAL A N   1 
ATOM   2379 C  CA  . VAL A 1 311 ? -1.534  38.956 36.218 1.00 19.77 ? 352  VAL A CA  1 
ATOM   2380 C  C   . VAL A 1 311 ? -1.523  37.811 37.216 1.00 20.08 ? 352  VAL A C   1 
ATOM   2381 O  O   . VAL A 1 311 ? -2.127  36.745 36.964 1.00 21.55 ? 352  VAL A O   1 
ATOM   2382 C  CB  . VAL A 1 311 ? -2.870  39.653 36.144 1.00 19.42 ? 352  VAL A CB  1 
ATOM   2383 C  CG1 . VAL A 1 311 ? -3.400  40.022 37.558 1.00 20.26 ? 352  VAL A CG1 1 
ATOM   2384 C  CG2 . VAL A 1 311 ? -2.798  40.918 35.245 1.00 21.28 ? 352  VAL A CG2 1 
ATOM   2385 N  N   . THR A 1 312 ? -0.836  38.008 38.327 1.00 17.62 ? 353  THR A N   1 
ATOM   2386 C  CA  . THR A 1 312 ? -0.543  36.957 39.292 1.00 17.40 ? 353  THR A CA  1 
ATOM   2387 C  C   . THR A 1 312 ? -0.640  37.497 40.728 1.00 17.53 ? 353  THR A C   1 
ATOM   2388 O  O   . THR A 1 312 ? -0.264  38.641 40.980 1.00 17.26 ? 353  THR A O   1 
ATOM   2389 C  CB  . THR A 1 312 ? 0.887   36.380 39.042 1.00 18.44 ? 353  THR A CB  1 
ATOM   2390 O  OG1 . THR A 1 312 ? 1.046   36.080 37.651 1.00 21.46 ? 353  THR A OG1 1 
ATOM   2391 C  CG2 . THR A 1 312 ? 1.186   35.175 39.931 1.00 19.90 ? 353  THR A CG2 1 
ATOM   2392 N  N   . ARG A 1 313 ? -1.098  36.673 41.643 1.00 17.38 ? 354  ARG A N   1 
ATOM   2393 C  CA  . ARG A 1 313 ? -1.307  37.134 43.014 1.00 16.07 ? 354  ARG A CA  1 
ATOM   2394 C  C   . ARG A 1 313 ? 0.034   37.089 43.749 1.00 18.01 ? 354  ARG A C   1 
ATOM   2395 O  O   . ARG A 1 313 ? 0.812   36.127 43.603 1.00 18.40 ? 354  ARG A O   1 
ATOM   2396 C  CB  . ARG A 1 313 ? -2.383  36.300 43.734 1.00 17.32 ? 354  ARG A CB  1 
ATOM   2397 C  CG  . ARG A 1 313 ? -2.643  36.763 45.153 1.00 20.26 ? 354  ARG A CG  1 
ATOM   2398 C  CD  . ARG A 1 313 ? -4.049  36.270 45.585 1.00 24.19 ? 354  ARG A CD  1 
ATOM   2399 N  NE  . ARG A 1 313 ? -5.054  36.996 44.820 1.00 24.04 ? 354  ARG A NE  1 
ATOM   2400 C  CZ  . ARG A 1 313 ? -6.358  36.984 45.071 1.00 27.71 ? 354  ARG A CZ  1 
ATOM   2401 N  NH1 . ARG A 1 313 ? -6.837  36.229 46.048 1.00 26.76 ? 354  ARG A NH1 1 
ATOM   2402 N  NH2 . ARG A 1 313 ? -7.177  37.716 44.322 1.00 29.23 ? 354  ARG A NH2 1 
ATOM   2403 N  N   . ILE A 1 314 ? 0.274   38.138 44.528 1.00 16.62 ? 355  ILE A N   1 
ATOM   2404 C  CA  . ILE A 1 314 ? 1.477   38.265 45.367 1.00 16.84 ? 355  ILE A CA  1 
ATOM   2405 C  C   . ILE A 1 314 ? 1.011   38.571 46.796 1.00 17.30 ? 355  ILE A C   1 
ATOM   2406 O  O   . ILE A 1 314 ? -0.109  39.025 47.011 1.00 17.40 ? 355  ILE A O   1 
ATOM   2407 C  CB  . ILE A 1 314 ? 2.430   39.376 44.859 1.00 16.74 ? 355  ILE A CB  1 
ATOM   2408 C  CG1 . ILE A 1 314 ? 1.707   40.737 44.798 1.00 16.04 ? 355  ILE A CG1 1 
ATOM   2409 C  CG2 . ILE A 1 314 ? 2.887   39.045 43.498 1.00 15.89 ? 355  ILE A CG2 1 
ATOM   2410 C  CD1 . ILE A 1 314 ? 2.734   41.935 44.739 1.00 16.31 ? 355  ILE A CD1 1 
ATOM   2411 N  N   . TYR A 1 315 ? 1.908   38.333 47.736 1.00 16.41 ? 356  TYR A N   1 
ATOM   2412 C  CA  . TYR A 1 315 ? 1.569   38.368 49.144 1.00 16.26 ? 356  TYR A CA  1 
ATOM   2413 C  C   . TYR A 1 315 ? 2.613   39.056 49.974 1.00 15.69 ? 356  TYR A C   1 
ATOM   2414 O  O   . TYR A 1 315 ? 3.767   38.590 50.106 1.00 16.52 ? 356  TYR A O   1 
ATOM   2415 C  CB  . TYR A 1 315 ? 1.378   36.952 49.733 1.00 16.36 ? 356  TYR A CB  1 
ATOM   2416 C  CG  . TYR A 1 315 ? 0.316   36.131 49.048 1.00 17.81 ? 356  TYR A CG  1 
ATOM   2417 C  CD1 . TYR A 1 315 ? -0.990  36.109 49.532 1.00 19.54 ? 356  TYR A CD1 1 
ATOM   2418 C  CD2 . TYR A 1 315 ? 0.643   35.373 47.935 1.00 17.86 ? 356  TYR A CD2 1 
ATOM   2419 C  CE1 . TYR A 1 315 ? -1.970  35.343 48.888 1.00 19.61 ? 356  TYR A CE1 1 
ATOM   2420 C  CE2 . TYR A 1 315 ? -0.309  34.572 47.295 1.00 18.87 ? 356  TYR A CE2 1 
ATOM   2421 C  CZ  . TYR A 1 315 ? -1.626  34.597 47.769 1.00 19.46 ? 356  TYR A CZ  1 
ATOM   2422 O  OH  . TYR A 1 315 ? -2.645  33.852 47.177 1.00 22.44 ? 356  TYR A OH  1 
ATOM   2423 N  N   . ASN A 1 316 ? 2.221   40.131 50.673 1.00 15.20 ? 357  ASN A N   1 
ATOM   2424 C  CA  . ASN A 1 316 ? 3.119   40.764 51.639 1.00 15.38 ? 357  ASN A CA  1 
ATOM   2425 C  C   . ASN A 1 316 ? 2.746   40.292 53.041 1.00 16.26 ? 357  ASN A C   1 
ATOM   2426 O  O   . ASN A 1 316 ? 1.547   40.179 53.308 1.00 18.33 ? 357  ASN A O   1 
ATOM   2427 C  CB  . ASN A 1 316 ? 2.937   42.301 51.659 1.00 15.90 ? 357  ASN A CB  1 
ATOM   2428 C  CG  . ASN A 1 316 ? 3.331   42.986 50.363 1.00 16.22 ? 357  ASN A CG  1 
ATOM   2429 O  OD1 . ASN A 1 316 ? 4.217   42.548 49.640 1.00 16.09 ? 357  ASN A OD1 1 
ATOM   2430 N  ND2 . ASN A 1 316 ? 2.657   44.140 50.084 1.00 18.95 ? 357  ASN A ND2 1 
ATOM   2431 N  N   . VAL A 1 317 ? 3.708   40.086 53.930 1.00 16.94 ? 358  VAL A N   1 
ATOM   2432 C  CA  . VAL A 1 317 ? 3.385   39.800 55.338 1.00 17.89 ? 358  VAL A CA  1 
ATOM   2433 C  C   . VAL A 1 317 ? 3.585   41.099 56.106 1.00 16.68 ? 358  VAL A C   1 
ATOM   2434 O  O   . VAL A 1 317 ? 4.626   41.709 55.994 1.00 16.18 ? 358  VAL A O   1 
ATOM   2435 C  CB  . VAL A 1 317 ? 4.284   38.714 55.968 1.00 17.66 ? 358  VAL A CB  1 
ATOM   2436 C  CG1 . VAL A 1 317 ? 3.702   38.345 57.368 1.00 18.56 ? 358  VAL A CG1 1 
ATOM   2437 C  CG2 . VAL A 1 317 ? 4.346   37.531 55.057 1.00 18.68 ? 358  VAL A CG2 1 
ATOM   2438 N  N   . ILE A 1 318 ? 2.559   41.550 56.837 1.00 16.89 ? 359  ILE A N   1 
ATOM   2439 C  CA  . ILE A 1 318 ? 2.644   42.841 57.583 1.00 17.14 ? 359  ILE A CA  1 
ATOM   2440 C  C   . ILE A 1 318 ? 2.397   42.549 59.086 1.00 15.62 ? 359  ILE A C   1 
ATOM   2441 O  O   . ILE A 1 318 ? 1.292   42.104 59.406 1.00 17.00 ? 359  ILE A O   1 
ATOM   2442 C  CB  . ILE A 1 318 ? 1.571   43.838 57.022 1.00 17.30 ? 359  ILE A CB  1 
ATOM   2443 C  CG1 . ILE A 1 318 ? 1.717   44.036 55.489 1.00 19.15 ? 359  ILE A CG1 1 
ATOM   2444 C  CG2 . ILE A 1 318 ? 1.617   45.192 57.797 1.00 17.97 ? 359  ILE A CG2 1 
ATOM   2445 C  CD1 . ILE A 1 318 ? 2.977   44.725 55.084 1.00 22.43 ? 359  ILE A CD1 1 
ATOM   2446 N  N   . GLY A 1 319 ? 3.425   42.737 59.885 1.00 18.20 ? 360  GLY A N   1 
ATOM   2447 C  CA  . GLY A 1 319 ? 3.338   42.505 61.381 1.00 19.06 ? 360  GLY A CA  1 
ATOM   2448 C  C   . GLY A 1 319 ? 3.345   43.833 62.124 1.00 19.39 ? 360  GLY A C   1 
ATOM   2449 O  O   . GLY A 1 319 ? 4.091   44.759 61.743 1.00 19.28 ? 360  GLY A O   1 
ATOM   2450 N  N   . THR A 1 320 ? 2.571   43.920 63.214 1.00 19.75 ? 361  THR A N   1 
ATOM   2451 C  CA  . THR A 1 320 ? 2.440   45.180 63.942 1.00 19.83 ? 361  THR A CA  1 
ATOM   2452 C  C   . THR A 1 320 ? 2.830   44.924 65.385 1.00 20.56 ? 361  THR A C   1 
ATOM   2453 O  O   . THR A 1 320 ? 2.361   43.946 65.966 1.00 20.96 ? 361  THR A O   1 
ATOM   2454 C  CB  . THR A 1 320 ? 0.953   45.639 63.900 1.00 21.39 ? 361  THR A CB  1 
ATOM   2455 O  OG1 . THR A 1 320 ? 0.577   45.869 62.540 1.00 23.01 ? 361  THR A OG1 1 
ATOM   2456 C  CG2 . THR A 1 320 ? 0.709   46.899 64.676 1.00 19.96 ? 361  THR A CG2 1 
ATOM   2457 N  N   . LEU A 1 321 ? 3.652   45.788 65.934 1.00 20.34 ? 362  LEU A N   1 
ATOM   2458 C  CA  . LEU A 1 321 ? 3.904   45.797 67.377 1.00 20.83 ? 362  LEU A CA  1 
ATOM   2459 C  C   . LEU A 1 321 ? 3.429   47.184 67.815 1.00 20.33 ? 362  LEU A C   1 
ATOM   2460 O  O   . LEU A 1 321 ? 4.135   48.167 67.605 1.00 20.24 ? 362  LEU A O   1 
ATOM   2461 C  CB  . LEU A 1 321 ? 5.405   45.624 67.618 1.00 21.67 ? 362  LEU A CB  1 
ATOM   2462 C  CG  . LEU A 1 321 ? 5.925   45.620 69.065 1.00 24.21 ? 362  LEU A CG  1 
ATOM   2463 C  CD1 . LEU A 1 321 ? 5.147   44.605 69.876 1.00 27.02 ? 362  LEU A CD1 1 
ATOM   2464 C  CD2 . LEU A 1 321 ? 7.347   45.295 69.037 1.00 26.45 ? 362  LEU A CD2 1 
ATOM   2465 N  N   . ARG A 1 322 ? 2.229   47.236 68.384 1.00 20.86 ? 363  ARG A N   1 
ATOM   2466 C  CA  . ARG A 1 322 ? 1.644   48.530 68.793 1.00 22.67 ? 363  ARG A CA  1 
ATOM   2467 C  C   . ARG A 1 322 ? 2.477   49.330 69.819 1.00 23.32 ? 363  ARG A C   1 
ATOM   2468 O  O   . ARG A 1 322 ? 2.937   48.761 70.846 1.00 22.67 ? 363  ARG A O   1 
ATOM   2469 C  CB  . ARG A 1 322 ? 0.239   48.259 69.289 1.00 22.68 ? 363  ARG A CB  1 
ATOM   2470 C  CG  . ARG A 1 322 ? -0.381  49.463 70.033 1.00 28.49 ? 363  ARG A CG  1 
ATOM   2471 C  CD  . ARG A 1 322 ? -1.827  49.186 70.382 1.00 34.64 ? 363  ARG A CD  1 
ATOM   2472 N  NE  . ARG A 1 322 ? -2.069  47.762 70.649 1.00 42.97 ? 363  ARG A NE  1 
ATOM   2473 C  CZ  . ARG A 1 322 ? -1.888  47.136 71.815 1.00 45.38 ? 363  ARG A CZ  1 
ATOM   2474 N  NH1 . ARG A 1 322 ? -1.486  47.796 72.906 1.00 46.32 ? 363  ARG A NH1 1 
ATOM   2475 N  NH2 . ARG A 1 322 ? -2.142  45.833 71.886 1.00 45.69 ? 363  ARG A NH2 1 
ATOM   2476 N  N   . GLY A 1 323 ? 2.665   50.645 69.594 1.00 22.35 ? 364  GLY A N   1 
ATOM   2477 C  CA  . GLY A 1 323 ? 3.369   51.523 70.519 1.00 21.56 ? 364  GLY A CA  1 
ATOM   2478 C  C   . GLY A 1 323 ? 2.536   51.783 71.783 1.00 21.31 ? 364  GLY A C   1 
ATOM   2479 O  O   . GLY A 1 323 ? 1.303   51.746 71.765 1.00 22.52 ? 364  GLY A O   1 
ATOM   2480 N  N   . ALA A 1 324 ? 3.258   51.956 72.877 1.00 22.08 ? 365  ALA A N   1 
ATOM   2481 C  CA  . ALA A 1 324 ? 2.628   52.141 74.205 1.00 22.98 ? 365  ALA A CA  1 
ATOM   2482 C  C   . ALA A 1 324 ? 2.126   53.561 74.346 1.00 24.52 ? 365  ALA A C   1 
ATOM   2483 O  O   . ALA A 1 324 ? 1.146   53.782 75.102 1.00 26.20 ? 365  ALA A O   1 
ATOM   2484 C  CB  . ALA A 1 324 ? 3.658   51.872 75.275 1.00 21.65 ? 365  ALA A CB  1 
ATOM   2485 N  N   . VAL A 1 325 ? 2.773   54.512 73.664 1.00 23.22 ? 366  VAL A N   1 
ATOM   2486 C  CA  . VAL A 1 325 ? 2.509   55.943 73.956 1.00 24.99 ? 366  VAL A CA  1 
ATOM   2487 C  C   . VAL A 1 325 ? 2.041   56.652 72.668 1.00 25.27 ? 366  VAL A C   1 
ATOM   2488 O  O   . VAL A 1 325 ? 1.052   57.439 72.680 1.00 25.49 ? 366  VAL A O   1 
ATOM   2489 C  CB  . VAL A 1 325 ? 3.751   56.600 74.534 1.00 25.73 ? 366  VAL A CB  1 
ATOM   2490 C  CG1 . VAL A 1 325 ? 3.612   58.156 74.725 1.00 24.29 ? 366  VAL A CG1 1 
ATOM   2491 C  CG2 . VAL A 1 325 ? 4.083   55.964 75.885 1.00 29.11 ? 366  VAL A CG2 1 
ATOM   2492 N  N   . GLU A 1 326 ? 2.736   56.355 71.566 1.00 22.71 ? 367  GLU A N   1 
ATOM   2493 C  CA  . GLU A 1 326 ? 2.320   56.965 70.275 1.00 22.05 ? 367  GLU A CA  1 
ATOM   2494 C  C   . GLU A 1 326 ? 2.018   55.862 69.255 1.00 18.94 ? 367  GLU A C   1 
ATOM   2495 O  O   . GLU A 1 326 ? 2.860   55.746 68.311 1.00 19.58 ? 367  GLU A O   1 
ATOM   2496 C  CB  . GLU A 1 326 ? 3.413   57.867 69.746 1.00 21.30 ? 367  GLU A CB  1 
ATOM   2497 C  CG  . GLU A 1 326 ? 3.851   58.971 70.720 1.00 23.01 ? 367  GLU A CG  1 
ATOM   2498 C  CD  . GLU A 1 326 ? 4.740   59.942 70.047 1.00 23.71 ? 367  GLU A CD  1 
ATOM   2499 O  OE1 . GLU A 1 326 ? 4.223   60.831 69.296 1.00 26.44 ? 367  GLU A OE1 1 
ATOM   2500 O  OE2 . GLU A 1 326 ? 5.959   59.882 70.287 1.00 26.67 ? 367  GLU A OE2 1 
ATOM   2501 N  N   . PRO A 1 327 ? 0.911   55.110 69.442 1.00 20.24 ? 368  PRO A N   1 
ATOM   2502 C  CA  . PRO A 1 327 ? 0.563   54.005 68.539 1.00 19.86 ? 368  PRO A CA  1 
ATOM   2503 C  C   . PRO A 1 327 ? 0.269   54.508 67.122 1.00 20.73 ? 368  PRO A C   1 
ATOM   2504 O  O   . PRO A 1 327 ? 0.315   53.716 66.209 1.00 21.52 ? 368  PRO A O   1 
ATOM   2505 C  CB  . PRO A 1 327 ? -0.659  53.368 69.146 1.00 22.28 ? 368  PRO A CB  1 
ATOM   2506 C  CG  . PRO A 1 327 ? -1.206  54.397 70.089 1.00 21.90 ? 368  PRO A CG  1 
ATOM   2507 C  CD  . PRO A 1 327 ? -0.083  55.180 70.561 1.00 19.69 ? 368  PRO A CD  1 
ATOM   2508 N  N   . ASP A 1 328 ? -0.033  55.798 66.992 1.00 19.50 ? 369  ASP A N   1 
ATOM   2509 C  CA  . ASP A 1 328 ? -0.310  56.343 65.662 1.00 19.89 ? 369  ASP A CA  1 
ATOM   2510 C  C   . ASP A 1 328 ? 0.932   56.921 65.015 1.00 18.54 ? 369  ASP A C   1 
ATOM   2511 O  O   . ASP A 1 328 ? 0.818   57.806 64.121 1.00 17.10 ? 369  ASP A O   1 
ATOM   2512 C  CB  . ASP A 1 328 ? -1.367  57.441 65.789 1.00 20.32 ? 369  ASP A CB  1 
ATOM   2513 C  CG  . ASP A 1 328 ? -0.841  58.670 66.472 1.00 21.68 ? 369  ASP A CG  1 
ATOM   2514 O  OD1 . ASP A 1 328 ? 0.141   58.676 67.295 1.00 23.93 ? 369  ASP A OD1 1 
ATOM   2515 O  OD2 . ASP A 1 328 ? -1.435  59.773 66.217 1.00 25.95 ? 369  ASP A OD2 1 
ATOM   2516 N  N   . ARG A 1 329 ? 2.130   56.460 65.396 1.00 17.57 ? 370  ARG A N   1 
ATOM   2517 C  CA  . ARG A 1 329 ? 3.366   56.854 64.755 1.00 16.65 ? 370  ARG A CA  1 
ATOM   2518 C  C   . ARG A 1 329 ? 4.067   55.563 64.386 1.00 17.95 ? 370  ARG A C   1 
ATOM   2519 O  O   . ARG A 1 329 ? 4.216   54.720 65.248 1.00 17.51 ? 370  ARG A O   1 
ATOM   2520 C  CB  . ARG A 1 329 ? 4.239   57.708 65.658 1.00 17.20 ? 370  ARG A CB  1 
ATOM   2521 C  CG  . ARG A 1 329 ? 3.514   59.066 65.914 1.00 15.24 ? 370  ARG A CG  1 
ATOM   2522 C  CD  . ARG A 1 329 ? 3.797   59.925 64.698 1.00 19.57 ? 370  ARG A CD  1 
ATOM   2523 N  NE  . ARG A 1 329 ? 3.164   61.266 64.774 1.00 19.25 ? 370  ARG A NE  1 
ATOM   2524 C  CZ  . ARG A 1 329 ? 1.913   61.563 64.369 1.00 16.96 ? 370  ARG A CZ  1 
ATOM   2525 N  NH1 . ARG A 1 329 ? 1.004   60.671 63.927 1.00 16.84 ? 370  ARG A NH1 1 
ATOM   2526 N  NH2 . ARG A 1 329 ? 1.566   62.879 64.382 1.00 18.74 ? 370  ARG A NH2 1 
ATOM   2527 N  N   . TYR A 1 330 ? 4.388   55.405 63.094 1.00 17.06 ? 371  TYR A N   1 
ATOM   2528 C  CA  . TYR A 1 330 ? 4.902   54.136 62.519 1.00 15.86 ? 371  TYR A CA  1 
ATOM   2529 C  C   . TYR A 1 330 ? 6.362   54.214 62.140 1.00 16.41 ? 371  TYR A C   1 
ATOM   2530 O  O   . TYR A 1 330 ? 6.820   55.077 61.362 1.00 15.75 ? 371  TYR A O   1 
ATOM   2531 C  CB  . TYR A 1 330 ? 4.129   53.722 61.303 1.00 16.63 ? 371  TYR A CB  1 
ATOM   2532 C  CG  . TYR A 1 330 ? 2.645   53.657 61.442 1.00 16.44 ? 371  TYR A CG  1 
ATOM   2533 C  CD1 . TYR A 1 330 ? 2.006   53.296 62.648 1.00 17.27 ? 371  TYR A CD1 1 
ATOM   2534 C  CD2 . TYR A 1 330 ? 1.841   53.960 60.348 1.00 14.52 ? 371  TYR A CD2 1 
ATOM   2535 C  CE1 . TYR A 1 330 ? 0.568   53.227 62.711 1.00 16.25 ? 371  TYR A CE1 1 
ATOM   2536 C  CE2 . TYR A 1 330 ? 0.485   53.920 60.381 1.00 13.97 ? 371  TYR A CE2 1 
ATOM   2537 C  CZ  . TYR A 1 330 ? -0.206  53.521 61.576 1.00 15.38 ? 371  TYR A CZ  1 
ATOM   2538 O  OH  . TYR A 1 330 ? -1.559  53.479 61.680 1.00 16.85 ? 371  TYR A OH  1 
ATOM   2539 N  N   . VAL A 1 331 ? 7.130   53.267 62.704 1.00 15.76 ? 372  VAL A N   1 
ATOM   2540 C  CA  . VAL A 1 331 ? 8.502   53.070 62.265 1.00 15.23 ? 372  VAL A CA  1 
ATOM   2541 C  C   . VAL A 1 331 ? 8.495   51.699 61.544 1.00 15.68 ? 372  VAL A C   1 
ATOM   2542 O  O   . VAL A 1 331 ? 8.023   50.759 62.107 1.00 17.04 ? 372  VAL A O   1 
ATOM   2543 C  CB  . VAL A 1 331 ? 9.438   52.979 63.465 1.00 17.51 ? 372  VAL A CB  1 
ATOM   2544 C  CG1 . VAL A 1 331 ? 10.858  52.600 63.090 1.00 16.12 ? 372  VAL A CG1 1 
ATOM   2545 C  CG2 . VAL A 1 331 ? 9.490   54.315 64.187 1.00 19.62 ? 372  VAL A CG2 1 
ATOM   2546 N  N   . ILE A 1 332 ? 8.951   51.670 60.301 1.00 15.54 ? 373  ILE A N   1 
ATOM   2547 C  CA  . ILE A 1 332 ? 8.744   50.487 59.469 1.00 15.62 ? 373  ILE A CA  1 
ATOM   2548 C  C   . ILE A 1 332 ? 10.078  49.846 59.142 1.00 14.48 ? 373  ILE A C   1 
ATOM   2549 O  O   . ILE A 1 332 ? 11.028  50.515 58.729 1.00 15.23 ? 373  ILE A O   1 
ATOM   2550 C  CB  . ILE A 1 332 ? 8.016   50.876 58.136 1.00 15.51 ? 373  ILE A CB  1 
ATOM   2551 C  CG1 . ILE A 1 332 ? 6.725   51.632 58.436 1.00 17.56 ? 373  ILE A CG1 1 
ATOM   2552 C  CG2 . ILE A 1 332 ? 7.736   49.558 57.270 1.00 17.10 ? 373  ILE A CG2 1 
ATOM   2553 C  CD1 . ILE A 1 332 ? 6.070   52.215 57.149 1.00 19.91 ? 373  ILE A CD1 1 
ATOM   2554 N  N   . LEU A 1 333 ? 10.177  48.526 59.365 1.00 14.28 ? 374  LEU A N   1 
ATOM   2555 C  CA  . LEU A 1 333 ? 11.374  47.740 58.891 1.00 13.05 ? 374  LEU A CA  1 
ATOM   2556 C  C   . LEU A 1 333 ? 10.891  46.781 57.850 1.00 14.48 ? 374  LEU A C   1 
ATOM   2557 O  O   . LEU A 1 333 ? 10.109  45.894 58.152 1.00 15.43 ? 374  LEU A O   1 
ATOM   2558 C  CB  . LEU A 1 333 ? 11.944  46.932 60.070 1.00 16.46 ? 374  LEU A CB  1 
ATOM   2559 C  CG  . LEU A 1 333 ? 13.136  46.044 59.714 1.00 15.67 ? 374  LEU A CG  1 
ATOM   2560 C  CD1 . LEU A 1 333 ? 14.351  46.830 59.162 1.00 17.45 ? 374  LEU A CD1 1 
ATOM   2561 C  CD2 . LEU A 1 333 ? 13.492  45.182 61.028 1.00 18.13 ? 374  LEU A CD2 1 
ATOM   2562 N  N   . GLY A 1 334 ? 11.377  46.936 56.630 1.00 13.18 ? 375  GLY A N   1 
ATOM   2563 C  CA  . GLY A 1 334 ? 10.800  46.104 55.542 1.00 14.66 ? 375  GLY A CA  1 
ATOM   2564 C  C   . GLY A 1 334 ? 11.900  45.620 54.636 1.00 15.39 ? 375  GLY A C   1 
ATOM   2565 O  O   . GLY A 1 334 ? 12.845  46.332 54.332 1.00 15.52 ? 375  GLY A O   1 
ATOM   2566 N  N   . GLY A 1 335 ? 11.664  44.423 54.074 1.00 15.91 ? 376  GLY A N   1 
ATOM   2567 C  CA  . GLY A 1 335 ? 12.597  43.932 53.034 1.00 16.24 ? 376  GLY A CA  1 
ATOM   2568 C  C   . GLY A 1 335 ? 11.857  42.810 52.324 1.00 16.31 ? 376  GLY A C   1 
ATOM   2569 O  O   . GLY A 1 335 ? 10.827  42.286 52.850 1.00 16.67 ? 376  GLY A O   1 
ATOM   2570 N  N   . HIS A 1 336 ? 12.370  42.433 51.136 1.00 15.73 ? 377  HIS A N   1 
ATOM   2571 C  CA  . HIS A 1 336 ? 11.583  41.468 50.366 1.00 15.35 ? 377  HIS A CA  1 
ATOM   2572 C  C   . HIS A 1 336 ? 11.903  40.002 50.687 1.00 15.53 ? 377  HIS A C   1 
ATOM   2573 O  O   . HIS A 1 336 ? 12.920  39.716 51.329 1.00 16.21 ? 377  HIS A O   1 
ATOM   2574 C  CB  . HIS A 1 336 ? 11.634  41.775 48.853 1.00 15.60 ? 377  HIS A CB  1 
ATOM   2575 C  CG  . HIS A 1 336 ? 12.942  41.468 48.176 1.00 14.24 ? 377  HIS A CG  1 
ATOM   2576 N  ND1 . HIS A 1 336 ? 13.078  40.350 47.360 1.00 15.14 ? 377  HIS A ND1 1 
ATOM   2577 C  CD2 . HIS A 1 336 ? 14.110  42.148 48.086 1.00 15.35 ? 377  HIS A CD2 1 
ATOM   2578 C  CE1 . HIS A 1 336 ? 14.266  40.387 46.782 1.00 13.38 ? 377  HIS A CE1 1 
ATOM   2579 N  NE2 . HIS A 1 336 ? 14.928  41.436 47.233 1.00 15.98 ? 377  HIS A NE2 1 
ATOM   2580 N  N   . ARG A 1 337 ? 11.016  39.137 50.216 1.00 14.16 ? 378  ARG A N   1 
ATOM   2581 C  CA  . ARG A 1 337 ? 11.031  37.689 50.498 1.00 14.68 ? 378  ARG A CA  1 
ATOM   2582 C  C   . ARG A 1 337 ? 11.219  36.928 49.154 1.00 16.10 ? 378  ARG A C   1 
ATOM   2583 O  O   . ARG A 1 337 ? 11.782  35.799 49.157 1.00 16.32 ? 378  ARG A O   1 
ATOM   2584 C  CB  . ARG A 1 337 ? 9.690   37.292 51.084 1.00 16.75 ? 378  ARG A CB  1 
ATOM   2585 C  CG  . ARG A 1 337 ? 9.579   35.776 51.435 1.00 15.78 ? 378  ARG A CG  1 
ATOM   2586 C  CD  . ARG A 1 337 ? 8.187   35.498 51.973 1.00 17.10 ? 378  ARG A CD  1 
ATOM   2587 N  NE  . ARG A 1 337 ? 7.208   35.586 50.897 1.00 19.84 ? 378  ARG A NE  1 
ATOM   2588 C  CZ  . ARG A 1 337 ? 6.335   36.584 50.717 1.00 18.60 ? 378  ARG A CZ  1 
ATOM   2589 N  NH1 . ARG A 1 337 ? 6.276   37.615 51.575 1.00 15.16 ? 378  ARG A NH1 1 
ATOM   2590 N  NH2 . ARG A 1 337 ? 5.474   36.534 49.696 1.00 20.20 ? 378  ARG A NH2 1 
ATOM   2591 N  N   . ASP A 1 338 ? 10.674  37.458 48.062 1.00 15.08 ? 379  ASP A N   1 
ATOM   2592 C  CA  . ASP A 1 338 ? 10.788  36.762 46.752 1.00 15.69 ? 379  ASP A CA  1 
ATOM   2593 C  C   . ASP A 1 338 ? 12.213  36.761 46.279 1.00 16.28 ? 379  ASP A C   1 
ATOM   2594 O  O   . ASP A 1 338 ? 12.970  37.719 46.509 1.00 15.41 ? 379  ASP A O   1 
ATOM   2595 C  CB  . ASP A 1 338 ? 9.906   37.425 45.703 1.00 14.60 ? 379  ASP A CB  1 
ATOM   2596 C  CG  . ASP A 1 338 ? 10.333  38.844 45.367 1.00 15.69 ? 379  ASP A CG  1 
ATOM   2597 O  OD1 . ASP A 1 338 ? 10.366  39.704 46.340 1.00 16.43 ? 379  ASP A OD1 1 
ATOM   2598 O  OD2 . ASP A 1 338 ? 10.537  39.096 44.140 1.00 15.32 ? 379  ASP A OD2 1 
ATOM   2599 N  N   . SER A 1 339 ? 12.606  35.671 45.587 1.00 16.24 ? 380  SER A N   1 
ATOM   2600 C  CA  . SER A 1 339 ? 13.979  35.572 45.108 1.00 16.99 ? 380  SER A CA  1 
ATOM   2601 C  C   . SER A 1 339 ? 13.885  35.120 43.645 1.00 17.75 ? 380  SER A C   1 
ATOM   2602 O  O   . SER A 1 339 ? 12.814  34.638 43.223 1.00 17.94 ? 380  SER A O   1 
ATOM   2603 C  CB  . SER A 1 339 ? 14.728  34.530 45.952 1.00 18.28 ? 380  SER A CB  1 
ATOM   2604 O  OG  . SER A 1 339 ? 14.035  33.281 45.856 1.00 18.36 ? 380  SER A OG  1 
ATOM   2605 N  N   . TRP A 1 340 ? 14.962  35.272 42.895 1.00 17.60 ? 381  TRP A N   1 
ATOM   2606 C  CA  . TRP A 1 340 ? 14.999  34.727 41.520 1.00 15.70 ? 381  TRP A CA  1 
ATOM   2607 C  C   . TRP A 1 340 ? 15.126  33.213 41.573 1.00 17.18 ? 381  TRP A C   1 
ATOM   2608 O  O   . TRP A 1 340 ? 14.403  32.524 40.863 1.00 17.49 ? 381  TRP A O   1 
ATOM   2609 C  CB  . TRP A 1 340 ? 16.150  35.360 40.683 1.00 17.75 ? 381  TRP A CB  1 
ATOM   2610 C  CG  . TRP A 1 340 ? 15.717  36.708 40.148 1.00 14.89 ? 381  TRP A CG  1 
ATOM   2611 C  CD1 . TRP A 1 340 ? 16.240  37.976 40.476 1.00 17.41 ? 381  TRP A CD1 1 
ATOM   2612 C  CD2 . TRP A 1 340 ? 14.610  36.936 39.281 1.00 16.26 ? 381  TRP A CD2 1 
ATOM   2613 N  NE1 . TRP A 1 340 ? 15.542  38.956 39.773 1.00 16.43 ? 381  TRP A NE1 1 
ATOM   2614 C  CE2 . TRP A 1 340 ? 14.512  38.344 39.065 1.00 15.93 ? 381  TRP A CE2 1 
ATOM   2615 C  CE3 . TRP A 1 340 ? 13.670  36.074 38.657 1.00 14.93 ? 381  TRP A CE3 1 
ATOM   2616 C  CZ2 . TRP A 1 340 ? 13.516  38.896 38.236 1.00 17.88 ? 381  TRP A CZ2 1 
ATOM   2617 C  CZ3 . TRP A 1 340 ? 12.655  36.614 37.868 1.00 16.33 ? 381  TRP A CZ3 1 
ATOM   2618 C  CH2 . TRP A 1 340 ? 12.596  38.036 37.645 1.00 15.97 ? 381  TRP A CH2 1 
ATOM   2619 N  N   . VAL A 1 341 ? 16.074  32.728 42.372 1.00 18.04 ? 382  VAL A N   1 
ATOM   2620 C  CA  . VAL A 1 341 ? 16.166  31.279 42.610 1.00 19.09 ? 382  VAL A CA  1 
ATOM   2621 C  C   . VAL A 1 341 ? 16.193  31.032 44.134 1.00 17.79 ? 382  VAL A C   1 
ATOM   2622 O  O   . VAL A 1 341 ? 15.154  31.166 44.800 1.00 18.21 ? 382  VAL A O   1 
ATOM   2623 C  CB  . VAL A 1 341 ? 17.331  30.598 41.807 1.00 19.47 ? 382  VAL A CB  1 
ATOM   2624 C  CG1 . VAL A 1 341 ? 17.128  29.048 41.872 1.00 20.82 ? 382  VAL A CG1 1 
ATOM   2625 C  CG2 . VAL A 1 341 ? 17.316  31.017 40.360 1.00 20.84 ? 382  VAL A CG2 1 
ATOM   2626 N  N   . PHE A 1 342 ? 17.327  30.619 44.698 1.00 17.25 ? 383  PHE A N   1 
ATOM   2627 C  CA  . PHE A 1 342 ? 17.380  30.262 46.121 1.00 17.97 ? 383  PHE A CA  1 
ATOM   2628 C  C   . PHE A 1 342 ? 17.522  31.475 47.019 1.00 18.93 ? 383  PHE A C   1 
ATOM   2629 O  O   . PHE A 1 342 ? 17.268  31.376 48.201 1.00 18.95 ? 383  PHE A O   1 
ATOM   2630 C  CB  . PHE A 1 342 ? 18.571  29.315 46.422 1.00 19.30 ? 383  PHE A CB  1 
ATOM   2631 C  CG  . PHE A 1 342 ? 18.472  28.025 45.615 1.00 20.40 ? 383  PHE A CG  1 
ATOM   2632 C  CD1 . PHE A 1 342 ? 17.472  27.114 45.932 1.00 21.27 ? 383  PHE A CD1 1 
ATOM   2633 C  CD2 . PHE A 1 342 ? 19.304  27.809 44.514 1.00 24.05 ? 383  PHE A CD2 1 
ATOM   2634 C  CE1 . PHE A 1 342 ? 17.315  25.930 45.151 1.00 22.70 ? 383  PHE A CE1 1 
ATOM   2635 C  CE2 . PHE A 1 342 ? 19.145  26.620 43.704 1.00 23.00 ? 383  PHE A CE2 1 
ATOM   2636 C  CZ  . PHE A 1 342 ? 18.155  25.726 44.046 1.00 21.34 ? 383  PHE A CZ  1 
ATOM   2637 N  N   . GLY A 1 343 ? 18.011  32.582 46.451 1.00 19.26 ? 384  GLY A N   1 
ATOM   2638 C  CA  . GLY A 1 343 ? 18.153  33.833 47.253 1.00 19.16 ? 384  GLY A CA  1 
ATOM   2639 C  C   . GLY A 1 343 ? 19.085  33.763 48.452 1.00 19.53 ? 384  GLY A C   1 
ATOM   2640 O  O   . GLY A 1 343 ? 18.864  34.458 49.486 1.00 18.58 ? 384  GLY A O   1 
ATOM   2641 N  N   . GLY A 1 344 ? 20.201  33.009 48.345 1.00 18.38 ? 385  GLY A N   1 
ATOM   2642 C  CA  . GLY A 1 344 ? 21.101  32.840 49.474 1.00 18.55 ? 385  GLY A CA  1 
ATOM   2643 C  C   . GLY A 1 344 ? 21.626  34.165 50.007 1.00 17.12 ? 385  GLY A C   1 
ATOM   2644 O  O   . GLY A 1 344 ? 21.781  34.293 51.218 1.00 20.54 ? 385  GLY A O   1 
ATOM   2645 N  N   . ILE A 1 345 ? 21.928  35.120 49.126 1.00 18.67 ? 386  ILE A N   1 
ATOM   2646 C  CA  . ILE A 1 345 ? 22.200  36.488 49.635 1.00 18.58 ? 386  ILE A CA  1 
ATOM   2647 C  C   . ILE A 1 345 ? 20.934  37.346 49.419 1.00 19.07 ? 386  ILE A C   1 
ATOM   2648 O  O   . ILE A 1 345 ? 20.408  37.940 50.395 1.00 18.83 ? 386  ILE A O   1 
ATOM   2649 C  CB  . ILE A 1 345 ? 23.419  37.092 48.938 1.00 18.99 ? 386  ILE A CB  1 
ATOM   2650 C  CG1 . ILE A 1 345 ? 24.694  36.336 49.418 1.00 22.75 ? 386  ILE A CG1 1 
ATOM   2651 C  CG2 . ILE A 1 345 ? 23.554  38.657 49.231 1.00 18.23 ? 386  ILE A CG2 1 
ATOM   2652 C  CD1 . ILE A 1 345 ? 25.859  36.725 48.564 1.00 21.03 ? 386  ILE A CD1 1 
ATOM   2653 N  N   . ASP A 1 346 ? 20.483  37.398 48.187 1.00 18.40 ? 387  ASP A N   1 
ATOM   2654 C  CA  . ASP A 1 346 ? 19.400  38.341 47.820 1.00 17.65 ? 387  ASP A CA  1 
ATOM   2655 C  C   . ASP A 1 346 ? 18.067  37.593 47.688 1.00 16.44 ? 387  ASP A C   1 
ATOM   2656 O  O   . ASP A 1 346 ? 17.866  36.931 46.649 1.00 17.39 ? 387  ASP A O   1 
ATOM   2657 C  CB  . ASP A 1 346 ? 19.846  39.006 46.538 1.00 17.59 ? 387  ASP A CB  1 
ATOM   2658 C  CG  . ASP A 1 346 ? 18.791  39.898 45.969 1.00 17.48 ? 387  ASP A CG  1 
ATOM   2659 O  OD1 . ASP A 1 346 ? 17.867  40.250 46.733 1.00 18.13 ? 387  ASP A OD1 1 
ATOM   2660 O  OD2 . ASP A 1 346 ? 18.882  40.209 44.765 1.00 19.78 ? 387  ASP A OD2 1 
ATOM   2661 N  N   . PRO A 1 347 ? 17.107  37.731 48.626 1.00 16.46 ? 388  PRO A N   1 
ATOM   2662 C  CA  . PRO A 1 347 ? 17.072  38.626 49.808 1.00 15.34 ? 388  PRO A CA  1 
ATOM   2663 C  C   . PRO A 1 347 ? 17.259  37.924 51.125 1.00 16.83 ? 388  PRO A C   1 
ATOM   2664 O  O   . PRO A 1 347 ? 17.158  38.559 52.158 1.00 16.70 ? 388  PRO A O   1 
ATOM   2665 C  CB  . PRO A 1 347 ? 15.605  39.159 49.766 1.00 16.14 ? 388  PRO A CB  1 
ATOM   2666 C  CG  . PRO A 1 347 ? 14.741  37.939 49.350 1.00 16.15 ? 388  PRO A CG  1 
ATOM   2667 C  CD  . PRO A 1 347 ? 15.741  37.186 48.353 1.00 15.30 ? 388  PRO A CD  1 
ATOM   2668 N  N   . GLN A 1 348 ? 17.486  36.585 51.123 1.00 16.96 ? 389  GLN A N   1 
ATOM   2669 C  CA  . GLN A 1 348 ? 17.345  35.895 52.393 1.00 17.25 ? 389  GLN A CA  1 
ATOM   2670 C  C   . GLN A 1 348 ? 18.376  36.243 53.478 1.00 16.29 ? 389  GLN A C   1 
ATOM   2671 O  O   . GLN A 1 348 ? 18.045  36.116 54.652 1.00 17.07 ? 389  GLN A O   1 
ATOM   2672 C  CB  . GLN A 1 348 ? 17.159  34.355 52.195 1.00 17.83 ? 389  GLN A CB  1 
ATOM   2673 C  CG  . GLN A 1 348 ? 16.099  33.928 51.154 1.00 19.30 ? 389  GLN A CG  1 
ATOM   2674 C  CD  . GLN A 1 348 ? 14.674  34.473 51.371 1.00 16.86 ? 389  GLN A CD  1 
ATOM   2675 O  OE1 . GLN A 1 348 ? 14.343  35.067 52.428 1.00 18.04 ? 389  GLN A OE1 1 
ATOM   2676 N  NE2 . GLN A 1 348 ? 13.804  34.268 50.336 1.00 17.61 ? 389  GLN A NE2 1 
ATOM   2677 N  N   . SER A 1 349 ? 19.520  36.756 53.082 1.00 17.06 ? 390  SER A N   1 
ATOM   2678 C  CA  . SER A 1 349 ? 20.477  37.223 54.121 1.00 19.16 ? 390  SER A CA  1 
ATOM   2679 C  C   . SER A 1 349 ? 19.858  38.413 54.842 1.00 18.49 ? 390  SER A C   1 
ATOM   2680 O  O   . SER A 1 349 ? 20.157  38.628 55.981 1.00 19.25 ? 390  SER A O   1 
ATOM   2681 C  CB  . SER A 1 349 ? 21.854  37.633 53.594 1.00 20.45 ? 390  SER A CB  1 
ATOM   2682 O  OG  . SER A 1 349 ? 21.785  38.622 52.599 1.00 22.76 ? 390  SER A OG  1 
ATOM   2683 N  N   . GLY A 1 350 ? 19.022  39.189 54.149 1.00 18.07 ? 391  GLY A N   1 
ATOM   2684 C  CA  . GLY A 1 350 ? 18.282  40.305 54.814 1.00 16.81 ? 391  GLY A CA  1 
ATOM   2685 C  C   . GLY A 1 350 ? 17.029  39.821 55.559 1.00 16.42 ? 391  GLY A C   1 
ATOM   2686 O  O   . GLY A 1 350 ? 16.816  40.202 56.710 1.00 17.69 ? 391  GLY A O   1 
ATOM   2687 N  N   . ALA A 1 351 ? 16.224  38.950 54.943 1.00 14.85 ? 392  ALA A N   1 
ATOM   2688 C  CA  . ALA A 1 351 ? 15.014  38.411 55.557 1.00 16.13 ? 392  ALA A CA  1 
ATOM   2689 C  C   . ALA A 1 351 ? 15.338  37.642 56.866 1.00 16.97 ? 392  ALA A C   1 
ATOM   2690 O  O   . ALA A 1 351 ? 14.606  37.731 57.819 1.00 18.21 ? 392  ALA A O   1 
ATOM   2691 C  CB  . ALA A 1 351 ? 14.189  37.555 54.561 1.00 16.83 ? 392  ALA A CB  1 
ATOM   2692 N  N   . ALA A 1 352 ? 16.483  36.932 56.898 1.00 18.76 ? 393  ALA A N   1 
ATOM   2693 C  CA  . ALA A 1 352 ? 16.873  36.215 58.122 1.00 17.74 ? 393  ALA A CA  1 
ATOM   2694 C  C   . ALA A 1 352 ? 17.189  37.174 59.246 1.00 17.70 ? 393  ALA A C   1 
ATOM   2695 O  O   . ALA A 1 352 ? 16.885  36.915 60.436 1.00 19.21 ? 393  ALA A O   1 
ATOM   2696 C  CB  . ALA A 1 352 ? 18.104  35.331 57.828 1.00 19.42 ? 393  ALA A CB  1 
ATOM   2697 N  N   . VAL A 1 353 ? 17.811  38.286 58.853 1.00 17.71 ? 394  VAL A N   1 
ATOM   2698 C  CA  . VAL A 1 353 ? 18.124  39.384 59.818 1.00 18.38 ? 394  VAL A CA  1 
ATOM   2699 C  C   . VAL A 1 353 ? 16.800  39.996 60.341 1.00 19.18 ? 394  VAL A C   1 
ATOM   2700 O  O   . VAL A 1 353 ? 16.644  40.200 61.564 1.00 18.10 ? 394  VAL A O   1 
ATOM   2701 C  CB  . VAL A 1 353 ? 19.067  40.407 59.200 1.00 18.95 ? 394  VAL A CB  1 
ATOM   2702 C  CG1 . VAL A 1 353 ? 19.015  41.771 59.970 1.00 19.18 ? 394  VAL A CG1 1 
ATOM   2703 C  CG2 . VAL A 1 353 ? 20.530  39.866 59.237 1.00 18.16 ? 394  VAL A CG2 1 
ATOM   2704 N  N   . VAL A 1 354 ? 15.842  40.302 59.446 1.00 18.61 ? 395  VAL A N   1 
ATOM   2705 C  CA  . VAL A 1 354 ? 14.537  40.808 59.918 1.00 18.38 ? 395  VAL A CA  1 
ATOM   2706 C  C   . VAL A 1 354 ? 13.836  39.823 60.863 1.00 18.75 ? 395  VAL A C   1 
ATOM   2707 O  O   . VAL A 1 354 ? 13.295  40.215 61.890 1.00 17.35 ? 395  VAL A O   1 
ATOM   2708 C  CB  . VAL A 1 354 ? 13.598  41.144 58.732 1.00 19.38 ? 395  VAL A CB  1 
ATOM   2709 C  CG1 . VAL A 1 354 ? 12.157  41.483 59.198 1.00 19.60 ? 395  VAL A CG1 1 
ATOM   2710 C  CG2 . VAL A 1 354 ? 14.226  42.291 57.919 1.00 19.44 ? 395  VAL A CG2 1 
ATOM   2711 N  N   . HIS A 1 355 ? 13.881  38.546 60.503 1.00 18.84 ? 396  HIS A N   1 
ATOM   2712 C  CA  . HIS A 1 355 ? 13.287  37.511 61.324 1.00 19.44 ? 396  HIS A CA  1 
ATOM   2713 C  C   . HIS A 1 355 ? 13.863  37.539 62.745 1.00 20.15 ? 396  HIS A C   1 
ATOM   2714 O  O   . HIS A 1 355 ? 13.098  37.486 63.719 1.00 22.05 ? 396  HIS A O   1 
ATOM   2715 C  CB  . HIS A 1 355 ? 13.500  36.173 60.618 1.00 19.37 ? 396  HIS A CB  1 
ATOM   2716 C  CG  . HIS A 1 355 ? 12.358  35.225 60.761 1.00 20.30 ? 396  HIS A CG  1 
ATOM   2717 N  ND1 . HIS A 1 355 ? 11.057  35.543 60.422 1.00 21.70 ? 396  HIS A ND1 1 
ATOM   2718 C  CD2 . HIS A 1 355 ? 12.339  33.914 61.125 1.00 24.66 ? 396  HIS A CD2 1 
ATOM   2719 C  CE1 . HIS A 1 355 ? 10.279  34.493 60.604 1.00 24.94 ? 396  HIS A CE1 1 
ATOM   2720 N  NE2 . HIS A 1 355 ? 11.037  33.486 61.024 1.00 23.65 ? 396  HIS A NE2 1 
ATOM   2721 N  N   . GLU A 1 356 ? 15.181  37.656 62.855 1.00 19.68 ? 397  GLU A N   1 
ATOM   2722 C  CA  . GLU A 1 356 ? 15.819  37.658 64.200 1.00 21.13 ? 397  GLU A CA  1 
ATOM   2723 C  C   . GLU A 1 356 ? 15.515  38.945 64.951 1.00 21.87 ? 397  GLU A C   1 
ATOM   2724 O  O   . GLU A 1 356 ? 15.351  38.960 66.167 1.00 22.34 ? 397  GLU A O   1 
ATOM   2725 C  CB  . GLU A 1 356 ? 17.311  37.351 64.062 1.00 23.04 ? 397  GLU A CB  1 
ATOM   2726 C  CG  . GLU A 1 356 ? 18.118  37.385 65.359 1.00 20.75 ? 397  GLU A CG  1 
ATOM   2727 C  CD  . GLU A 1 356 ? 17.701  36.309 66.352 1.00 23.99 ? 397  GLU A CD  1 
ATOM   2728 O  OE1 . GLU A 1 356 ? 16.704  35.575 66.123 1.00 25.61 ? 397  GLU A OE1 1 
ATOM   2729 O  OE2 . GLU A 1 356 ? 18.398  36.232 67.398 1.00 27.37 ? 397  GLU A OE2 1 
ATOM   2730 N  N   . ILE A 1 357 ? 15.382  40.049 64.210 1.00 20.35 ? 398  ILE A N   1 
ATOM   2731 C  CA  . ILE A 1 357 ? 14.962  41.316 64.854 1.00 19.13 ? 398  ILE A CA  1 
ATOM   2732 C  C   . ILE A 1 357 ? 13.548  41.240 65.394 1.00 18.75 ? 398  ILE A C   1 
ATOM   2733 O  O   . ILE A 1 357 ? 13.248  41.673 66.556 1.00 20.48 ? 398  ILE A O   1 
ATOM   2734 C  CB  . ILE A 1 357 ? 15.104  42.473 63.826 1.00 17.40 ? 398  ILE A CB  1 
ATOM   2735 C  CG1 . ILE A 1 357 ? 16.573  42.809 63.627 1.00 17.44 ? 398  ILE A CG1 1 
ATOM   2736 C  CG2 . ILE A 1 357 ? 14.403  43.721 64.358 1.00 16.76 ? 398  ILE A CG2 1 
ATOM   2737 C  CD1 . ILE A 1 357 ? 16.946  43.703 62.404 1.00 19.67 ? 398  ILE A CD1 1 
ATOM   2738 N  N   . VAL A 1 358 ? 12.633  40.678 64.610 1.00 19.36 ? 399  VAL A N   1 
ATOM   2739 C  CA  . VAL A 1 358 ? 11.279  40.431 65.090 1.00 19.60 ? 399  VAL A CA  1 
ATOM   2740 C  C   . VAL A 1 358 ? 11.334  39.556 66.356 1.00 21.70 ? 399  VAL A C   1 
ATOM   2741 O  O   . VAL A 1 358 ? 10.691  39.891 67.352 1.00 21.72 ? 399  VAL A O   1 
ATOM   2742 C  CB  . VAL A 1 358 ? 10.367  39.820 64.060 1.00 19.13 ? 399  VAL A CB  1 
ATOM   2743 C  CG1 . VAL A 1 358 ? 8.978   39.558 64.632 1.00 19.57 ? 399  VAL A CG1 1 
ATOM   2744 C  CG2 . VAL A 1 358 ? 10.264  40.839 62.862 1.00 20.37 ? 399  VAL A CG2 1 
ATOM   2745 N  N   . ARG A 1 359 ? 12.132  38.491 66.302 1.00 21.42 ? 400  ARG A N   1 
ATOM   2746 C  CA  . ARG A 1 359 ? 12.199  37.577 67.452 1.00 23.38 ? 400  ARG A CA  1 
ATOM   2747 C  C   . ARG A 1 359 ? 12.650  38.312 68.728 1.00 22.88 ? 400  ARG A C   1 
ATOM   2748 O  O   . ARG A 1 359 ? 12.063  38.087 69.798 1.00 23.64 ? 400  ARG A O   1 
ATOM   2749 C  CB  . ARG A 1 359 ? 13.093  36.348 67.146 1.00 23.38 ? 400  ARG A CB  1 
ATOM   2750 C  CG  . ARG A 1 359 ? 12.873  35.188 68.179 1.00 24.97 ? 400  ARG A CG  1 
ATOM   2751 C  CD  . ARG A 1 359 ? 14.082  34.191 68.113 1.00 25.16 ? 400  ARG A CD  1 
ATOM   2752 N  NE  . ARG A 1 359 ? 15.347  34.854 68.362 1.00 26.06 ? 400  ARG A NE  1 
ATOM   2753 C  CZ  . ARG A 1 359 ? 15.779  35.174 69.580 1.00 26.85 ? 400  ARG A CZ  1 
ATOM   2754 N  NH1 . ARG A 1 359 ? 16.923  35.789 69.742 1.00 24.82 ? 400  ARG A NH1 1 
ATOM   2755 N  NH2 . ARG A 1 359 ? 15.035  34.860 70.650 1.00 27.36 ? 400  ARG A NH2 1 
ATOM   2756 N  N   . SER A 1 360 ? 13.691  39.138 68.619 1.00 22.74 ? 401  SER A N   1 
ATOM   2757 C  CA  . SER A 1 360 ? 14.258  39.898 69.724 1.00 24.36 ? 401  SER A CA  1 
ATOM   2758 C  C   . SER A 1 360 ? 13.220  40.895 70.262 1.00 25.37 ? 401  SER A C   1 
ATOM   2759 O  O   . SER A 1 360 ? 12.993  40.957 71.475 1.00 25.71 ? 401  SER A O   1 
ATOM   2760 C  CB  . SER A 1 360 ? 15.577  40.582 69.345 1.00 23.84 ? 401  SER A CB  1 
ATOM   2761 O  OG  A SER A 1 360 ? 16.106  41.337 70.441 0.50 22.71 ? 401  SER A OG  1 
ATOM   2762 O  OG  B SER A 1 360 ? 16.573  39.616 69.012 0.50 28.33 ? 401  SER A OG  1 
ATOM   2763 N  N   . PHE A 1 361 ? 12.571  41.681 69.373 1.00 25.30 ? 402  PHE A N   1 
ATOM   2764 C  CA  . PHE A 1 361 ? 11.555  42.641 69.869 1.00 25.58 ? 402  PHE A CA  1 
ATOM   2765 C  C   . PHE A 1 361 ? 10.416  41.891 70.542 1.00 27.27 ? 402  PHE A C   1 
ATOM   2766 O  O   . PHE A 1 361 ? 9.901   42.359 71.571 1.00 27.76 ? 402  PHE A O   1 
ATOM   2767 C  CB  . PHE A 1 361 ? 10.965  43.518 68.725 1.00 24.26 ? 402  PHE A CB  1 
ATOM   2768 C  CG  . PHE A 1 361 ? 11.784  44.728 68.367 1.00 23.32 ? 402  PHE A CG  1 
ATOM   2769 C  CD1 . PHE A 1 361 ? 11.958  45.802 69.263 1.00 21.99 ? 402  PHE A CD1 1 
ATOM   2770 C  CD2 . PHE A 1 361 ? 12.328  44.852 67.088 1.00 20.86 ? 402  PHE A CD2 1 
ATOM   2771 C  CE1 . PHE A 1 361 ? 12.695  46.924 68.906 1.00 22.78 ? 402  PHE A CE1 1 
ATOM   2772 C  CE2 . PHE A 1 361 ? 13.067  45.979 66.732 1.00 21.80 ? 402  PHE A CE2 1 
ATOM   2773 C  CZ  . PHE A 1 361 ? 13.235  47.030 67.630 1.00 24.92 ? 402  PHE A CZ  1 
ATOM   2774 N  N   . GLY A 1 362 ? 10.002  40.741 69.992 1.00 26.34 ? 403  GLY A N   1 
ATOM   2775 C  CA  . GLY A 1 362 ? 8.954   39.901 70.569 1.00 27.47 ? 403  GLY A CA  1 
ATOM   2776 C  C   . GLY A 1 362 ? 9.359   39.373 71.957 1.00 27.21 ? 403  GLY A C   1 
ATOM   2777 O  O   . GLY A 1 362 ? 8.524   39.338 72.862 1.00 29.51 ? 403  GLY A O   1 
ATOM   2778 N  N   . THR A 1 363 ? 10.636  39.055 72.149 1.00 29.41 ? 404  THR A N   1 
ATOM   2779 C  CA  . THR A 1 363 ? 11.131  38.611 73.480 1.00 29.57 ? 404  THR A CA  1 
ATOM   2780 C  C   . THR A 1 363 ? 10.961  39.725 74.545 1.00 30.98 ? 404  THR A C   1 
ATOM   2781 O  O   . THR A 1 363 ? 10.518  39.457 75.664 1.00 32.37 ? 404  THR A O   1 
ATOM   2782 C  CB  . THR A 1 363 ? 12.604  38.103 73.455 1.00 30.26 ? 404  THR A CB  1 
ATOM   2783 O  OG1 A THR A 1 363 ? 12.682  36.998 72.539 0.50 30.12 ? 404  THR A OG1 1 
ATOM   2784 O  OG1 B THR A 1 363 ? 13.511  39.211 73.582 0.50 30.44 ? 404  THR A OG1 1 
ATOM   2785 C  CG2 A THR A 1 363 ? 13.097  37.662 74.824 0.50 27.61 ? 404  THR A CG2 1 
ATOM   2786 C  CG2 B THR A 1 363 ? 12.929  37.263 72.220 0.50 29.54 ? 404  THR A CG2 1 
ATOM   2787 N  N   . LEU A 1 364 ? 11.266  40.974 74.196 1.00 30.19 ? 405  LEU A N   1 
ATOM   2788 C  CA  . LEU A 1 364 ? 11.042  42.096 75.119 1.00 29.98 ? 405  LEU A CA  1 
ATOM   2789 C  C   . LEU A 1 364 ? 9.570   42.276 75.386 1.00 30.38 ? 405  LEU A C   1 
ATOM   2790 O  O   . LEU A 1 364 ? 9.136   42.482 76.536 1.00 28.29 ? 405  LEU A O   1 
ATOM   2791 C  CB  . LEU A 1 364 ? 11.599  43.415 74.541 1.00 29.98 ? 405  LEU A CB  1 
ATOM   2792 C  CG  A LEU A 1 364 ? 13.114  43.537 74.413 0.50 30.40 ? 405  LEU A CG  1 
ATOM   2793 C  CG  B LEU A 1 364 ? 13.056  43.720 74.880 0.50 30.12 ? 405  LEU A CG  1 
ATOM   2794 C  CD1 A LEU A 1 364 ? 13.476  44.858 73.761 0.50 30.88 ? 405  LEU A CD1 1 
ATOM   2795 C  CD1 B LEU A 1 364 ? 14.031  42.723 74.232 0.50 30.52 ? 405  LEU A CD1 1 
ATOM   2796 C  CD2 A LEU A 1 364 ? 13.797  43.397 75.768 0.50 31.91 ? 405  LEU A CD2 1 
ATOM   2797 C  CD2 B LEU A 1 364 ? 13.406  45.154 74.493 0.50 30.18 ? 405  LEU A CD2 1 
ATOM   2798 N  N   . LYS A 1 365 ? 8.785   42.229 74.323 1.00 30.20 ? 406  LYS A N   1 
ATOM   2799 C  CA  . LYS A 1 365 ? 7.367   42.381 74.462 1.00 31.03 ? 406  LYS A CA  1 
ATOM   2800 C  C   . LYS A 1 365 ? 6.776   41.314 75.413 1.00 32.37 ? 406  LYS A C   1 
ATOM   2801 O  O   . LYS A 1 365 ? 5.908   41.654 76.229 1.00 31.94 ? 406  LYS A O   1 
ATOM   2802 C  CB  . LYS A 1 365 ? 6.672   42.344 73.097 1.00 30.66 ? 406  LYS A CB  1 
ATOM   2803 C  CG  . LYS A 1 365 ? 5.227   42.772 73.181 1.00 33.37 ? 406  LYS A CG  1 
ATOM   2804 C  CD  . LYS A 1 365 ? 4.432   42.012 72.208 1.00 37.96 ? 406  LYS A CD  1 
ATOM   2805 C  CE  . LYS A 1 365 ? 2.955   42.101 72.489 1.00 37.48 ? 406  LYS A CE  1 
ATOM   2806 N  NZ  . LYS A 1 365 ? 2.307   40.818 72.153 1.00 38.28 ? 406  LYS A NZ  1 
ATOM   2807 N  N   . LYS A 1 366 ? 7.243   40.059 75.331 1.00 31.82 ? 407  LYS A N   1 
ATOM   2808 C  CA  . LYS A 1 366 ? 6.693   39.018 76.219 1.00 33.78 ? 407  LYS A CA  1 
ATOM   2809 C  C   . LYS A 1 366 ? 6.975   39.272 77.688 1.00 34.26 ? 407  LYS A C   1 
ATOM   2810 O  O   . LYS A 1 366 ? 6.224   38.799 78.558 1.00 35.01 ? 407  LYS A O   1 
ATOM   2811 C  CB  . LYS A 1 366 ? 7.155   37.627 75.810 1.00 33.44 ? 407  LYS A CB  1 
ATOM   2812 C  CG  . LYS A 1 366 ? 6.334   37.070 74.673 1.00 36.00 ? 407  LYS A CG  1 
ATOM   2813 C  CD  . LYS A 1 366 ? 7.023   35.898 73.997 1.00 35.68 ? 407  LYS A CD  1 
ATOM   2814 C  CE  . LYS A 1 366 ? 6.212   35.475 72.798 1.00 37.47 ? 407  LYS A CE  1 
ATOM   2815 N  NZ  . LYS A 1 366 ? 6.798   34.259 72.195 1.00 41.41 ? 407  LYS A NZ  1 
ATOM   2816 N  N   . GLU A 1 367 ? 8.046   40.003 77.953 1.00 34.39 ? 408  GLU A N   1 
ATOM   2817 C  CA  . GLU A 1 367 ? 8.453   40.434 79.316 1.00 36.10 ? 408  GLU A CA  1 
ATOM   2818 C  C   . GLU A 1 367 ? 7.816   41.769 79.733 1.00 36.20 ? 408  GLU A C   1 
ATOM   2819 O  O   . GLU A 1 367 ? 8.214   42.382 80.764 1.00 36.74 ? 408  GLU A O   1 
ATOM   2820 C  CB  . GLU A 1 367 ? 9.966   40.599 79.380 1.00 36.20 ? 408  GLU A CB  1 
ATOM   2821 C  CG  . GLU A 1 367 ? 10.729  39.332 79.050 1.00 42.21 ? 408  GLU A CG  1 
ATOM   2822 C  CD  . GLU A 1 367 ? 12.223  39.543 78.969 1.00 49.16 ? 408  GLU A CD  1 
ATOM   2823 O  OE1 . GLU A 1 367 ? 12.918  38.616 78.474 1.00 53.34 ? 408  GLU A OE1 1 
ATOM   2824 O  OE2 . GLU A 1 367 ? 12.716  40.629 79.381 1.00 53.17 ? 408  GLU A OE2 1 
ATOM   2825 N  N   . GLY A 1 368 ? 6.874   42.247 78.915 1.00 35.04 ? 409  GLY A N   1 
ATOM   2826 C  CA  . GLY A 1 368 ? 6.057   43.405 79.281 1.00 34.22 ? 409  GLY A CA  1 
ATOM   2827 C  C   . GLY A 1 368 ? 6.413   44.736 78.657 1.00 33.27 ? 409  GLY A C   1 
ATOM   2828 O  O   . GLY A 1 368 ? 5.804   45.766 79.002 1.00 34.04 ? 409  GLY A O   1 
ATOM   2829 N  N   . TRP A 1 369 ? 7.416   44.745 77.778 1.00 31.35 ? 410  TRP A N   1 
ATOM   2830 C  CA  . TRP A 1 369 ? 7.860   45.982 77.184 1.00 29.47 ? 410  TRP A CA  1 
ATOM   2831 C  C   . TRP A 1 369 ? 7.068   46.198 75.889 1.00 28.59 ? 410  TRP A C   1 
ATOM   2832 O  O   . TRP A 1 369 ? 6.605   45.253 75.229 1.00 28.93 ? 410  TRP A O   1 
ATOM   2833 C  CB  . TRP A 1 369 ? 9.359   45.932 76.928 1.00 29.91 ? 410  TRP A CB  1 
ATOM   2834 C  CG  . TRP A 1 369 ? 9.965   47.022 76.086 1.00 31.14 ? 410  TRP A CG  1 
ATOM   2835 C  CD1 . TRP A 1 369 ? 10.557  48.187 76.520 1.00 30.90 ? 410  TRP A CD1 1 
ATOM   2836 C  CD2 . TRP A 1 369 ? 10.108  47.014 74.644 1.00 30.95 ? 410  TRP A CD2 1 
ATOM   2837 N  NE1 . TRP A 1 369 ? 11.022  48.917 75.430 1.00 30.75 ? 410  TRP A NE1 1 
ATOM   2838 C  CE2 . TRP A 1 369 ? 10.769  48.215 74.279 1.00 31.21 ? 410  TRP A CE2 1 
ATOM   2839 C  CE3 . TRP A 1 369 ? 9.720   46.117 73.633 1.00 30.11 ? 410  TRP A CE3 1 
ATOM   2840 C  CZ2 . TRP A 1 369 ? 11.063  48.532 72.930 1.00 27.96 ? 410  TRP A CZ2 1 
ATOM   2841 C  CZ3 . TRP A 1 369 ? 9.989   46.428 72.313 1.00 29.62 ? 410  TRP A CZ3 1 
ATOM   2842 C  CH2 . TRP A 1 369 ? 10.650  47.646 71.974 1.00 26.77 ? 410  TRP A CH2 1 
ATOM   2843 N  N   . ARG A 1 370 ? 6.892   47.463 75.562 1.00 26.41 ? 411  ARG A N   1 
ATOM   2844 C  CA  . ARG A 1 370 ? 6.377   47.850 74.232 1.00 25.74 ? 411  ARG A CA  1 
ATOM   2845 C  C   . ARG A 1 370 ? 7.192   49.053 73.875 1.00 23.70 ? 411  ARG A C   1 
ATOM   2846 O  O   . ARG A 1 370 ? 7.619   49.840 74.746 1.00 24.20 ? 411  ARG A O   1 
ATOM   2847 C  CB  . ARG A 1 370 ? 4.913   48.234 74.283 1.00 25.57 ? 411  ARG A CB  1 
ATOM   2848 C  CG  . ARG A 1 370 ? 3.979   47.142 74.113 1.00 27.42 ? 411  ARG A CG  1 
ATOM   2849 C  CD  . ARG A 1 370 ? 2.575   47.629 74.180 1.00 24.71 ? 411  ARG A CD  1 
ATOM   2850 N  NE  . ARG A 1 370 ? 1.698   46.490 74.118 1.00 26.82 ? 411  ARG A NE  1 
ATOM   2851 C  CZ  . ARG A 1 370 ? 1.478   45.762 73.031 1.00 28.27 ? 411  ARG A CZ  1 
ATOM   2852 N  NH1 . ARG A 1 370 ? 1.996   46.129 71.846 1.00 24.40 ? 411  ARG A NH1 1 
ATOM   2853 N  NH2 . ARG A 1 370 ? 0.689   44.709 73.099 1.00 29.01 ? 411  ARG A NH2 1 
ATOM   2854 N  N   . PRO A 1 371 ? 7.442   49.240 72.556 1.00 22.29 ? 412  PRO A N   1 
ATOM   2855 C  CA  . PRO A 1 371 ? 8.148   50.433 72.127 1.00 22.05 ? 412  PRO A CA  1 
ATOM   2856 C  C   . PRO A 1 371 ? 7.237   51.671 72.321 1.00 19.47 ? 412  PRO A C   1 
ATOM   2857 O  O   . PRO A 1 371 ? 6.029   51.500 72.407 1.00 21.20 ? 412  PRO A O   1 
ATOM   2858 C  CB  . PRO A 1 371 ? 8.328   50.204 70.589 1.00 21.36 ? 412  PRO A CB  1 
ATOM   2859 C  CG  . PRO A 1 371 ? 7.276   49.279 70.223 1.00 21.83 ? 412  PRO A CG  1 
ATOM   2860 C  CD  . PRO A 1 371 ? 6.980   48.388 71.438 1.00 22.49 ? 412  PRO A CD  1 
ATOM   2861 N  N   . ARG A 1 372 ? 7.836   52.844 72.289 1.00 20.31 ? 413  ARG A N   1 
ATOM   2862 C  CA  . ARG A 1 372 ? 7.057   54.106 72.485 1.00 20.23 ? 413  ARG A CA  1 
ATOM   2863 C  C   . ARG A 1 372 ? 6.075   54.265 71.285 1.00 20.03 ? 413  ARG A C   1 
ATOM   2864 O  O   . ARG A 1 372 ? 4.866   54.423 71.457 1.00 19.18 ? 413  ARG A O   1 
ATOM   2865 C  CB  . ARG A 1 372 ? 7.991   55.276 72.540 1.00 20.64 ? 413  ARG A CB  1 
ATOM   2866 C  CG  . ARG A 1 372 ? 7.205   56.646 72.595 1.00 20.76 ? 413  ARG A CG  1 
ATOM   2867 C  CD  . ARG A 1 372 ? 8.128   57.770 72.583 1.00 23.72 ? 413  ARG A CD  1 
ATOM   2868 N  NE  . ARG A 1 372 ? 7.347   59.023 72.544 1.00 27.51 ? 413  ARG A NE  1 
ATOM   2869 C  CZ  . ARG A 1 372 ? 6.956   59.697 73.632 1.00 33.45 ? 413  ARG A CZ  1 
ATOM   2870 N  NH1 . ARG A 1 372 ? 7.252   59.244 74.863 1.00 30.09 ? 413  ARG A NH1 1 
ATOM   2871 N  NH2 . ARG A 1 372 ? 6.245   60.811 73.481 1.00 32.60 ? 413  ARG A NH2 1 
ATOM   2872 N  N   . ARG A 1 373 ? 6.643   54.181 70.074 1.00 19.41 ? 414  ARG A N   1 
ATOM   2873 C  CA  . ARG A 1 373 ? 5.850   54.237 68.818 1.00 18.39 ? 414  ARG A CA  1 
ATOM   2874 C  C   . ARG A 1 373 ? 5.641   52.829 68.241 1.00 20.37 ? 414  ARG A C   1 
ATOM   2875 O  O   . ARG A 1 373 ? 6.321   51.866 68.627 1.00 19.85 ? 414  ARG A O   1 
ATOM   2876 C  CB  . ARG A 1 373 ? 6.645   55.062 67.781 1.00 18.39 ? 414  ARG A CB  1 
ATOM   2877 C  CG  . ARG A 1 373 ? 7.136   56.446 68.244 1.00 18.25 ? 414  ARG A CG  1 
ATOM   2878 C  CD  . ARG A 1 373 ? 7.928   57.309 67.216 1.00 17.67 ? 414  ARG A CD  1 
ATOM   2879 N  NE  . ARG A 1 373 ? 8.121   58.578 67.915 1.00 19.02 ? 414  ARG A NE  1 
ATOM   2880 C  CZ  . ARG A 1 373 ? 9.068   58.793 68.816 1.00 21.47 ? 414  ARG A CZ  1 
ATOM   2881 N  NH1 . ARG A 1 373 ? 10.031  57.880 69.002 1.00 19.29 ? 414  ARG A NH1 1 
ATOM   2882 N  NH2 . ARG A 1 373 ? 9.078   59.949 69.505 1.00 19.46 ? 414  ARG A NH2 1 
ATOM   2883 N  N   . THR A 1 374 ? 4.704   52.711 67.311 1.00 17.31 ? 415  THR A N   1 
ATOM   2884 C  CA  . THR A 1 374 ? 4.328   51.459 66.663 1.00 17.99 ? 415  THR A CA  1 
ATOM   2885 C  C   . THR A 1 374 ? 5.474   51.088 65.691 1.00 17.24 ? 415  THR A C   1 
ATOM   2886 O  O   . THR A 1 374 ? 6.015   51.935 64.968 1.00 17.38 ? 415  THR A O   1 
ATOM   2887 C  CB  . THR A 1 374 ? 2.982   51.615 65.920 1.00 18.35 ? 415  THR A CB  1 
ATOM   2888 O  OG1 . THR A 1 374 ? 1.903   51.553 66.856 1.00 17.50 ? 415  THR A OG1 1 
ATOM   2889 C  CG2 . THR A 1 374 ? 2.716   50.452 64.990 1.00 18.75 ? 415  THR A CG2 1 
ATOM   2890 N  N   . ILE A 1 375 ? 5.832   49.805 65.704 1.00 16.48 ? 416  ILE A N   1 
ATOM   2891 C  CA  . ILE A 1 375 ? 6.769   49.281 64.713 1.00 16.76 ? 416  ILE A CA  1 
ATOM   2892 C  C   . ILE A 1 375 ? 5.999   48.344 63.796 1.00 16.59 ? 416  ILE A C   1 
ATOM   2893 O  O   . ILE A 1 375 ? 5.222   47.504 64.231 1.00 16.45 ? 416  ILE A O   1 
ATOM   2894 C  CB  . ILE A 1 375 ? 7.970   48.497 65.343 1.00 15.86 ? 416  ILE A CB  1 
ATOM   2895 C  CG1 . ILE A 1 375 ? 8.740   49.379 66.319 1.00 17.67 ? 416  ILE A CG1 1 
ATOM   2896 C  CG2 . ILE A 1 375 ? 8.908   48.009 64.226 1.00 18.85 ? 416  ILE A CG2 1 
ATOM   2897 C  CD1 . ILE A 1 375 ? 9.808   48.605 67.178 1.00 18.31 ? 416  ILE A CD1 1 
ATOM   2898 N  N   . LEU A 1 376 ? 6.165   48.569 62.486 1.00 15.64 ? 417  LEU A N   1 
ATOM   2899 C  CA  . LEU A 1 376 ? 5.579   47.691 61.469 1.00 15.54 ? 417  LEU A CA  1 
ATOM   2900 C  C   . LEU A 1 376 ? 6.772   46.962 60.800 1.00 14.15 ? 417  LEU A C   1 
ATOM   2901 O  O   . LEU A 1 376 ? 7.792   47.536 60.453 1.00 17.20 ? 417  LEU A O   1 
ATOM   2902 C  CB  . LEU A 1 376 ? 4.863   48.539 60.384 1.00 14.95 ? 417  LEU A CB  1 
ATOM   2903 C  CG  . LEU A 1 376 ? 3.655   49.380 60.932 1.00 17.92 ? 417  LEU A CG  1 
ATOM   2904 C  CD1 . LEU A 1 376 ? 2.965   50.092 59.707 1.00 18.82 ? 417  LEU A CD1 1 
ATOM   2905 C  CD2 . LEU A 1 376 ? 2.650   48.532 61.680 1.00 18.74 ? 417  LEU A CD2 1 
ATOM   2906 N  N   . PHE A 1 377 ? 6.581   45.667 60.584 1.00 15.65 ? 418  PHE A N   1 
ATOM   2907 C  CA  . PHE A 1 377 ? 7.556   44.766 59.941 1.00 14.51 ? 418  PHE A CA  1 
ATOM   2908 C  C   . PHE A 1 377 ? 6.938   44.242 58.679 1.00 15.30 ? 418  PHE A C   1 
ATOM   2909 O  O   . PHE A 1 377 ? 5.766   43.823 58.675 1.00 15.60 ? 418  PHE A O   1 
ATOM   2910 C  CB  . PHE A 1 377 ? 7.809   43.566 60.898 1.00 16.56 ? 418  PHE A CB  1 
ATOM   2911 C  CG  . PHE A 1 377 ? 8.401   43.962 62.214 1.00 16.47 ? 418  PHE A CG  1 
ATOM   2912 C  CD1 . PHE A 1 377 ? 9.769   44.239 62.333 1.00 18.52 ? 418  PHE A CD1 1 
ATOM   2913 C  CD2 . PHE A 1 377 ? 7.568   44.097 63.344 1.00 18.58 ? 418  PHE A CD2 1 
ATOM   2914 C  CE1 . PHE A 1 377 ? 10.334  44.602 63.571 1.00 19.42 ? 418  PHE A CE1 1 
ATOM   2915 C  CE2 . PHE A 1 377 ? 8.137   44.481 64.626 1.00 20.68 ? 418  PHE A CE2 1 
ATOM   2916 C  CZ  . PHE A 1 377 ? 9.494   44.719 64.730 1.00 17.82 ? 418  PHE A CZ  1 
ATOM   2917 N  N   . ALA A 1 378 ? 7.702   44.267 57.599 1.00 16.72 ? 419  ALA A N   1 
ATOM   2918 C  CA  . ALA A 1 378 ? 7.138   43.820 56.331 1.00 14.82 ? 419  ALA A CA  1 
ATOM   2919 C  C   . ALA A 1 378 ? 8.089   42.841 55.632 1.00 14.99 ? 419  ALA A C   1 
ATOM   2920 O  O   . ALA A 1 378 ? 9.300   43.049 55.605 1.00 15.07 ? 419  ALA A O   1 
ATOM   2921 C  CB  . ALA A 1 378 ? 6.827   44.991 55.410 1.00 15.11 ? 419  ALA A CB  1 
ATOM   2922 N  N   . SER A 1 379 ? 7.449   41.802 55.088 1.00 15.27 ? 420  SER A N   1 
ATOM   2923 C  CA  . SER A 1 379 ? 8.092   40.801 54.195 1.00 14.28 ? 420  SER A CA  1 
ATOM   2924 C  C   . SER A 1 379 ? 7.454   41.052 52.830 1.00 14.26 ? 420  SER A C   1 
ATOM   2925 O  O   . SER A 1 379 ? 6.311   40.602 52.550 1.00 14.91 ? 420  SER A O   1 
ATOM   2926 C  CB  . SER A 1 379 ? 7.752   39.397 54.702 1.00 15.78 ? 420  SER A CB  1 
ATOM   2927 O  OG  . SER A 1 379 ? 8.269   38.429 53.759 1.00 15.71 ? 420  SER A OG  1 
ATOM   2928 N  N   . TRP A 1 380 ? 8.132   41.817 51.992 1.00 14.30 ? 421  TRP A N   1 
ATOM   2929 C  CA  . TRP A 1 380 ? 7.482   42.240 50.722 1.00 13.68 ? 421  TRP A CA  1 
ATOM   2930 C  C   . TRP A 1 380 ? 7.596   41.142 49.664 1.00 15.11 ? 421  TRP A C   1 
ATOM   2931 O  O   . TRP A 1 380 ? 8.610   40.398 49.641 1.00 15.52 ? 421  TRP A O   1 
ATOM   2932 C  CB  . TRP A 1 380 ? 8.150   43.464 50.146 1.00 15.04 ? 421  TRP A CB  1 
ATOM   2933 C  CG  . TRP A 1 380 ? 8.273   44.667 51.025 1.00 13.79 ? 421  TRP A CG  1 
ATOM   2934 C  CD1 . TRP A 1 380 ? 9.424   45.309 51.347 1.00 13.83 ? 421  TRP A CD1 1 
ATOM   2935 C  CD2 . TRP A 1 380 ? 7.187   45.429 51.590 1.00 13.91 ? 421  TRP A CD2 1 
ATOM   2936 N  NE1 . TRP A 1 380 ? 9.145   46.454 52.138 1.00 13.20 ? 421  TRP A NE1 1 
ATOM   2937 C  CE2 . TRP A 1 380 ? 7.778   46.513 52.300 1.00 13.11 ? 421  TRP A CE2 1 
ATOM   2938 C  CE3 . TRP A 1 380 ? 5.778   45.269 51.623 1.00 15.53 ? 421  TRP A CE3 1 
ATOM   2939 C  CZ2 . TRP A 1 380 ? 7.005   47.465 53.000 1.00 15.72 ? 421  TRP A CZ2 1 
ATOM   2940 C  CZ3 . TRP A 1 380 ? 5.011   46.222 52.349 1.00 14.63 ? 421  TRP A CZ3 1 
ATOM   2941 C  CH2 . TRP A 1 380 ? 5.670   47.300 53.019 1.00 14.26 ? 421  TRP A CH2 1 
ATOM   2942 N  N   . ASP A 1 381 ? 6.633   41.169 48.748 1.00 12.99 ? 422  ASP A N   1 
ATOM   2943 C  CA  . ASP A 1 381 ? 6.638   40.201 47.627 1.00 13.74 ? 422  ASP A CA  1 
ATOM   2944 C  C   . ASP A 1 381 ? 7.013   40.961 46.363 1.00 14.44 ? 422  ASP A C   1 
ATOM   2945 O  O   . ASP A 1 381 ? 6.851   42.200 46.266 1.00 14.95 ? 422  ASP A O   1 
ATOM   2946 C  CB  . ASP A 1 381 ? 5.267   39.521 47.463 1.00 16.17 ? 422  ASP A CB  1 
ATOM   2947 C  CG  . ASP A 1 381 ? 5.356   38.114 46.788 1.00 15.91 ? 422  ASP A CG  1 
ATOM   2948 O  OD1 . ASP A 1 381 ? 6.401   37.777 46.183 1.00 16.38 ? 422  ASP A OD1 1 
ATOM   2949 O  OD2 . ASP A 1 381 ? 4.355   37.386 46.818 1.00 16.05 ? 422  ASP A OD2 1 
ATOM   2950 N  N   . ALA A 1 382 ? 7.440   40.214 45.334 1.00 13.53 ? 423  ALA A N   1 
ATOM   2951 C  CA  . ALA A 1 382 ? 7.668   40.751 43.997 1.00 14.80 ? 423  ALA A CA  1 
ATOM   2952 C  C   . ALA A 1 382 ? 8.596   41.973 43.915 1.00 12.11 ? 423  ALA A C   1 
ATOM   2953 O  O   . ALA A 1 382 ? 8.441   42.807 42.998 1.00 14.08 ? 423  ALA A O   1 
ATOM   2954 C  CB  . ALA A 1 382 ? 6.331   40.989 43.259 1.00 13.97 ? 423  ALA A CB  1 
ATOM   2955 N  N   . GLU A 1 383 ? 9.586   42.065 44.816 1.00 14.13 ? 424  GLU A N   1 
ATOM   2956 C  CA  . GLU A 1 383 ? 10.580  43.144 44.684 1.00 14.04 ? 424  GLU A CA  1 
ATOM   2957 C  C   . GLU A 1 383 ? 11.297  42.964 43.369 1.00 13.53 ? 424  GLU A C   1 
ATOM   2958 O  O   . GLU A 1 383 ? 11.572  43.937 42.657 1.00 14.15 ? 424  GLU A O   1 
ATOM   2959 C  CB  . GLU A 1 383 ? 11.520  43.151 45.912 1.00 14.88 ? 424  GLU A CB  1 
ATOM   2960 C  CG  . GLU A 1 383 ? 12.541  44.328 45.943 1.00 14.43 ? 424  GLU A CG  1 
ATOM   2961 C  CD  . GLU A 1 383 ? 13.768  44.241 45.052 1.00 17.57 ? 424  GLU A CD  1 
ATOM   2962 O  OE1 . GLU A 1 383 ? 14.069  43.114 44.530 1.00 16.93 ? 424  GLU A OE1 1 
ATOM   2963 O  OE2 . GLU A 1 383 ? 14.487  45.277 44.993 1.00 16.70 ? 424  GLU A OE2 1 
ATOM   2964 N  N   . GLU A 1 384 ? 11.567  41.700 43.013 1.00 14.08 ? 425  GLU A N   1 
ATOM   2965 C  CA  . GLU A 1 384 ? 12.421  41.423 41.835 1.00 15.31 ? 425  GLU A CA  1 
ATOM   2966 C  C   . GLU A 1 384 ? 11.745  41.821 40.506 1.00 14.47 ? 425  GLU A C   1 
ATOM   2967 O  O   . GLU A 1 384 ? 12.411  41.953 39.484 1.00 16.60 ? 425  GLU A O   1 
ATOM   2968 C  CB  . GLU A 1 384 ? 12.780  39.931 41.829 1.00 14.01 ? 425  GLU A CB  1 
ATOM   2969 C  CG  . GLU A 1 384 ? 13.635  39.502 43.014 1.00 15.10 ? 425  GLU A CG  1 
ATOM   2970 C  CD  . GLU A 1 384 ? 15.083  40.099 43.009 1.00 15.49 ? 425  GLU A CD  1 
ATOM   2971 O  OE1 . GLU A 1 384 ? 15.415  41.027 42.198 1.00 15.70 ? 425  GLU A OE1 1 
ATOM   2972 O  OE2 . GLU A 1 384 ? 15.857  39.613 43.853 1.00 17.05 ? 425  GLU A OE2 1 
ATOM   2973 N  N   . PHE A 1 385 ? 10.424  42.041 40.542 1.00 14.19 ? 426  PHE A N   1 
ATOM   2974 C  CA  . PHE A 1 385 ? 9.661   42.385 39.355 1.00 14.95 ? 426  PHE A CA  1 
ATOM   2975 C  C   . PHE A 1 385 ? 9.351   43.875 39.269 1.00 15.90 ? 426  PHE A C   1 
ATOM   2976 O  O   . PHE A 1 385 ? 8.483   44.277 38.508 1.00 15.97 ? 426  PHE A O   1 
ATOM   2977 C  CB  . PHE A 1 385 ? 8.385   41.550 39.291 1.00 15.59 ? 426  PHE A CB  1 
ATOM   2978 C  CG  . PHE A 1 385 ? 8.656   40.080 38.938 1.00 13.85 ? 426  PHE A CG  1 
ATOM   2979 C  CD1 . PHE A 1 385 ? 8.648   39.703 37.590 1.00 16.07 ? 426  PHE A CD1 1 
ATOM   2980 C  CD2 . PHE A 1 385 ? 8.958   39.142 39.945 1.00 16.16 ? 426  PHE A CD2 1 
ATOM   2981 C  CE1 . PHE A 1 385 ? 8.879   38.305 37.213 1.00 17.08 ? 426  PHE A CE1 1 
ATOM   2982 C  CE2 . PHE A 1 385 ? 9.217   37.763 39.609 1.00 17.17 ? 426  PHE A CE2 1 
ATOM   2983 C  CZ  . PHE A 1 385 ? 9.144   37.366 38.240 1.00 15.66 ? 426  PHE A CZ  1 
ATOM   2984 N  N   . GLY A 1 386 ? 10.050  44.675 40.081 1.00 16.49 ? 427  GLY A N   1 
ATOM   2985 C  CA  . GLY A 1 386 ? 9.871   46.138 40.039 1.00 15.72 ? 427  GLY A CA  1 
ATOM   2986 C  C   . GLY A 1 386 ? 9.322   46.755 41.339 1.00 14.50 ? 427  GLY A C   1 
ATOM   2987 O  O   . GLY A 1 386 ? 8.567   47.750 41.248 1.00 13.93 ? 427  GLY A O   1 
ATOM   2988 N  N   . LEU A 1 387 ? 9.706   46.214 42.489 1.00 12.77 ? 428  LEU A N   1 
ATOM   2989 C  CA  . LEU A 1 387 ? 9.234   46.781 43.798 1.00 13.39 ? 428  LEU A CA  1 
ATOM   2990 C  C   . LEU A 1 387 ? 7.703   46.724 43.915 1.00 13.00 ? 428  LEU A C   1 
ATOM   2991 O  O   . LEU A 1 387 ? 7.056   47.615 44.516 1.00 12.92 ? 428  LEU A O   1 
ATOM   2992 C  CB  . LEU A 1 387 ? 9.726   48.237 43.918 1.00 14.66 ? 428  LEU A CB  1 
ATOM   2993 C  CG  . LEU A 1 387 ? 11.158  48.540 43.457 1.00 14.40 ? 428  LEU A CG  1 
ATOM   2994 C  CD1 . LEU A 1 387 ? 11.485  50.027 43.718 1.00 15.39 ? 428  LEU A CD1 1 
ATOM   2995 C  CD2 . LEU A 1 387 ? 12.161  47.664 44.167 1.00 15.75 ? 428  LEU A CD2 1 
ATOM   2996 N  N   . LEU A 1 388 ? 7.094   45.656 43.382 1.00 14.05 ? 429  LEU A N   1 
ATOM   2997 C  CA  . LEU A 1 388 ? 5.637   45.679 43.211 1.00 14.04 ? 429  LEU A CA  1 
ATOM   2998 C  C   . LEU A 1 388 ? 4.945   45.542 44.554 1.00 13.57 ? 429  LEU A C   1 
ATOM   2999 O  O   . LEU A 1 388 ? 3.950   46.230 44.758 1.00 15.51 ? 429  LEU A O   1 
ATOM   3000 C  CB  . LEU A 1 388 ? 5.157   44.598 42.204 1.00 13.32 ? 429  LEU A CB  1 
ATOM   3001 C  CG  . LEU A 1 388 ? 5.888   44.629 40.879 1.00 14.98 ? 429  LEU A CG  1 
ATOM   3002 C  CD1 . LEU A 1 388 ? 5.244   43.528 40.022 1.00 17.47 ? 429  LEU A CD1 1 
ATOM   3003 C  CD2 . LEU A 1 388 ? 5.875   45.976 40.128 1.00 16.93 ? 429  LEU A CD2 1 
ATOM   3004 N  N   . GLY A 1 389 ? 5.379   44.652 45.444 1.00 14.56 ? 430  GLY A N   1 
ATOM   3005 C  CA  . GLY A 1 389 ? 4.632   44.434 46.727 1.00 14.69 ? 430  GLY A CA  1 
ATOM   3006 C  C   . GLY A 1 389 ? 4.658   45.654 47.663 1.00 13.63 ? 430  GLY A C   1 
ATOM   3007 O  O   . GLY A 1 389 ? 3.612   46.067 48.206 1.00 14.47 ? 430  GLY A O   1 
ATOM   3008 N  N   . SER A 1 390 ? 5.869   46.248 47.793 1.00 13.13 ? 431  SER A N   1 
ATOM   3009 C  CA  . SER A 1 390 ? 6.030   47.448 48.678 1.00 12.62 ? 431  SER A CA  1 
ATOM   3010 C  C   . SER A 1 390 ? 5.181   48.572 48.077 1.00 12.32 ? 431  SER A C   1 
ATOM   3011 O  O   . SER A 1 390 ? 4.429   49.291 48.816 1.00 14.21 ? 431  SER A O   1 
ATOM   3012 C  CB  . SER A 1 390 ? 7.466   47.864 48.860 1.00 13.34 ? 431  SER A CB  1 
ATOM   3013 O  OG  . SER A 1 390 ? 8.071   48.102 47.596 1.00 14.77 ? 431  SER A OG  1 
ATOM   3014 N  N   . THR A 1 391 ? 5.281   48.707 46.755 1.00 12.28 ? 432  THR A N   1 
ATOM   3015 C  CA  . THR A 1 391 ? 4.644   49.866 46.114 1.00 12.78 ? 432  THR A CA  1 
ATOM   3016 C  C   . THR A 1 391 ? 3.137   49.749 46.209 1.00 12.23 ? 432  THR A C   1 
ATOM   3017 O  O   . THR A 1 391 ? 2.461   50.739 46.524 1.00 13.06 ? 432  THR A O   1 
ATOM   3018 C  CB  . THR A 1 391 ? 5.149   50.077 44.641 1.00 13.42 ? 432  THR A CB  1 
ATOM   3019 O  OG1 . THR A 1 391 ? 6.566   50.238 44.721 1.00 14.71 ? 432  THR A OG1 1 
ATOM   3020 C  CG2 . THR A 1 391 ? 4.598   51.421 44.119 1.00 14.62 ? 432  THR A CG2 1 
ATOM   3021 N  N   . GLU A 1 392 ? 2.576   48.561 45.929 1.00 12.12 ? 433  GLU A N   1 
ATOM   3022 C  CA  . GLU A 1 392 ? 1.089   48.423 45.978 1.00 12.75 ? 433  GLU A CA  1 
ATOM   3023 C  C   . GLU A 1 392 ? 0.615   48.634 47.421 1.00 13.24 ? 433  GLU A C   1 
ATOM   3024 O  O   . GLU A 1 392 ? -0.409  49.307 47.626 1.00 13.90 ? 433  GLU A O   1 
ATOM   3025 C  CB  . GLU A 1 392 ? 0.655   47.044 45.475 1.00 13.14 ? 433  GLU A CB  1 
ATOM   3026 C  CG  . GLU A 1 392 ? 0.954   46.841 43.962 1.00 11.94 ? 433  GLU A CG  1 
ATOM   3027 C  CD  . GLU A 1 392 ? 0.345   47.946 43.108 1.00 14.30 ? 433  GLU A CD  1 
ATOM   3028 O  OE1 . GLU A 1 392 ? -0.901  48.165 43.216 1.00 14.67 ? 433  GLU A OE1 1 
ATOM   3029 O  OE2 . GLU A 1 392 ? 1.080   48.619 42.346 1.00 14.93 ? 433  GLU A OE2 1 
ATOM   3030 N  N   . TRP A 1 393 ? 1.355   48.104 48.410 1.00 13.60 ? 434  TRP A N   1 
ATOM   3031 C  CA  . TRP A 1 393 ? 0.946   48.316 49.794 1.00 15.04 ? 434  TRP A CA  1 
ATOM   3032 C  C   . TRP A 1 393 ? 0.978   49.803 50.188 1.00 15.78 ? 434  TRP A C   1 
ATOM   3033 O  O   . TRP A 1 393 ? 0.055   50.304 50.860 1.00 14.27 ? 434  TRP A O   1 
ATOM   3034 C  CB  . TRP A 1 393 ? 1.823   47.480 50.706 1.00 15.74 ? 434  TRP A CB  1 
ATOM   3035 C  CG  . TRP A 1 393 ? 1.378   47.499 52.172 1.00 14.28 ? 434  TRP A CG  1 
ATOM   3036 C  CD1 . TRP A 1 393 ? 0.393   46.742 52.762 1.00 16.29 ? 434  TRP A CD1 1 
ATOM   3037 C  CD2 . TRP A 1 393 ? 1.894   48.370 53.162 1.00 15.51 ? 434  TRP A CD2 1 
ATOM   3038 N  NE1 . TRP A 1 393 ? 0.339   47.043 54.108 1.00 16.45 ? 434  TRP A NE1 1 
ATOM   3039 C  CE2 . TRP A 1 393 ? 1.228   48.051 54.380 1.00 13.82 ? 434  TRP A CE2 1 
ATOM   3040 C  CE3 . TRP A 1 393 ? 2.893   49.340 53.161 1.00 14.21 ? 434  TRP A CE3 1 
ATOM   3041 C  CZ2 . TRP A 1 393 ? 1.514   48.728 55.589 1.00 16.29 ? 434  TRP A CZ2 1 
ATOM   3042 C  CZ3 . TRP A 1 393 ? 3.211   50.034 54.379 1.00 15.69 ? 434  TRP A CZ3 1 
ATOM   3043 C  CH2 . TRP A 1 393 ? 2.527   49.671 55.590 1.00 16.14 ? 434  TRP A CH2 1 
ATOM   3044 N  N   . ALA A 1 394 ? 2.023   50.489 49.744 1.00 14.24 ? 435  ALA A N   1 
ATOM   3045 C  CA  . ALA A 1 394 ? 2.142   51.917 50.057 1.00 15.23 ? 435  ALA A CA  1 
ATOM   3046 C  C   . ALA A 1 394 ? 1.050   52.689 49.312 1.00 14.97 ? 435  ALA A C   1 
ATOM   3047 O  O   . ALA A 1 394 ? 0.464   53.640 49.882 1.00 14.18 ? 435  ALA A O   1 
ATOM   3048 C  CB  . ALA A 1 394 ? 3.531   52.440 49.658 1.00 14.92 ? 435  ALA A CB  1 
ATOM   3049 N  N   . GLU A 1 395 ? 0.708   52.298 48.067 1.00 12.85 ? 436  GLU A N   1 
ATOM   3050 C  CA  . GLU A 1 395 ? -0.457  52.933 47.371 1.00 14.45 ? 436  GLU A CA  1 
ATOM   3051 C  C   . GLU A 1 395 ? -1.775  52.714 48.173 1.00 14.99 ? 436  GLU A C   1 
ATOM   3052 O  O   . GLU A 1 395 ? -2.605  53.639 48.318 1.00 17.09 ? 436  GLU A O   1 
ATOM   3053 C  CB  . GLU A 1 395 ? -0.603  52.413 45.949 1.00 14.61 ? 436  GLU A CB  1 
ATOM   3054 C  CG  . GLU A 1 395 ? 0.579   52.926 45.084 1.00 12.68 ? 436  GLU A CG  1 
ATOM   3055 C  CD  . GLU A 1 395 ? 0.377   52.610 43.590 1.00 17.14 ? 436  GLU A CD  1 
ATOM   3056 O  OE1 . GLU A 1 395 ? 0.690   53.497 42.763 1.00 14.20 ? 436  GLU A OE1 1 
ATOM   3057 O  OE2 . GLU A 1 395 ? -0.169  51.499 43.330 1.00 17.42 ? 436  GLU A OE2 1 
ATOM   3058 N  N   . GLU A 1 396 ? -1.972  51.504 48.694 1.00 14.84 ? 437  GLU A N   1 
ATOM   3059 C  CA  . GLU A 1 396 ? -3.180  51.212 49.426 1.00 15.12 ? 437  GLU A CA  1 
ATOM   3060 C  C   . GLU A 1 396 ? -3.196  52.078 50.706 1.00 13.96 ? 437  GLU A C   1 
ATOM   3061 O  O   . GLU A 1 396 ? -4.280  52.588 51.046 1.00 15.24 ? 437  GLU A O   1 
ATOM   3062 C  CB  . GLU A 1 396 ? -3.171  49.742 49.810 1.00 16.27 ? 437  GLU A CB  1 
ATOM   3063 C  CG  . GLU A 1 396 ? -4.514  49.320 50.505 1.00 16.92 ? 437  GLU A CG  1 
ATOM   3064 C  CD  . GLU A 1 396 ? -4.726  47.828 50.205 1.00 28.19 ? 437  GLU A CD  1 
ATOM   3065 O  OE1 . GLU A 1 396 ? -5.638  47.440 49.430 1.00 38.19 ? 437  GLU A OE1 1 
ATOM   3066 O  OE2 . GLU A 1 396 ? -3.887  47.078 50.643 1.00 25.49 ? 437  GLU A OE2 1 
ATOM   3067 N  N   . ASN A 1 397 ? -2.056  52.230 51.380 1.00 12.99 ? 438  ASN A N   1 
ATOM   3068 C  CA  . ASN A 1 397 ? -1.977  52.840 52.735 1.00 13.69 ? 438  ASN A CA  1 
ATOM   3069 C  C   . ASN A 1 397 ? -1.432  54.238 52.763 1.00 12.64 ? 438  ASN A C   1 
ATOM   3070 O  O   . ASN A 1 397 ? -1.021  54.757 53.819 1.00 14.53 ? 438  ASN A O   1 
ATOM   3071 C  CB  . ASN A 1 397 ? -1.183  51.877 53.655 1.00 13.68 ? 438  ASN A CB  1 
ATOM   3072 C  CG  . ASN A 1 397 ? -1.979  50.605 53.880 1.00 16.17 ? 438  ASN A CG  1 
ATOM   3073 O  OD1 . ASN A 1 397 ? -3.057  50.632 54.493 1.00 18.71 ? 438  ASN A OD1 1 
ATOM   3074 N  ND2 . ASN A 1 397 ? -1.559  49.505 53.276 1.00 15.88 ? 438  ASN A ND2 1 
ATOM   3075 N  N   . SER A 1 398 ? -1.405  54.911 51.590 1.00 13.46 ? 439  SER A N   1 
ATOM   3076 C  CA  . SER A 1 398 ? -0.648  56.184 51.504 1.00 13.84 ? 439  SER A CA  1 
ATOM   3077 C  C   . SER A 1 398 ? -1.120  57.230 52.477 1.00 13.45 ? 439  SER A C   1 
ATOM   3078 O  O   . SER A 1 398 ? -0.296  57.972 52.968 1.00 15.22 ? 439  SER A O   1 
ATOM   3079 C  CB  . SER A 1 398 ? -0.791  56.763 50.055 1.00 14.16 ? 439  SER A CB  1 
ATOM   3080 O  OG  . SER A 1 398 ? -2.164  56.999 49.754 1.00 16.05 ? 439  SER A OG  1 
ATOM   3081 N  N   . ARG A 1 399 ? -2.419  57.273 52.757 1.00 13.34 ? 440  ARG A N   1 
ATOM   3082 C  CA  . ARG A 1 399 ? -2.899  58.338 53.689 1.00 13.40 ? 440  ARG A CA  1 
ATOM   3083 C  C   . ARG A 1 399 ? -2.372  58.065 55.103 1.00 13.19 ? 440  ARG A C   1 
ATOM   3084 O  O   . ARG A 1 399 ? -2.067  59.011 55.869 1.00 15.47 ? 440  ARG A O   1 
ATOM   3085 C  CB  . ARG A 1 399 ? -4.395  58.377 53.668 1.00 14.18 ? 440  ARG A CB  1 
ATOM   3086 C  CG  . ARG A 1 399 ? -4.926  58.851 52.311 1.00 16.03 ? 440  ARG A CG  1 
ATOM   3087 C  CD  . ARG A 1 399 ? -6.284  58.285 51.908 1.00 19.86 ? 440  ARG A CD  1 
ATOM   3088 N  NE  . ARG A 1 399 ? -6.649  58.825 50.582 1.00 19.42 ? 440  ARG A NE  1 
ATOM   3089 C  CZ  . ARG A 1 399 ? -6.225  58.375 49.408 1.00 21.65 ? 440  ARG A CZ  1 
ATOM   3090 N  NH1 . ARG A 1 399 ? -5.391  57.301 49.336 1.00 21.70 ? 440  ARG A NH1 1 
ATOM   3091 N  NH2 . ARG A 1 399 ? -6.642  58.999 48.305 1.00 20.86 ? 440  ARG A NH2 1 
ATOM   3092 N  N   . LEU A 1 400 ? -2.368  56.801 55.497 1.00 13.42 ? 441  LEU A N   1 
ATOM   3093 C  CA  . LEU A 1 400 ? -1.859  56.470 56.821 1.00 13.90 ? 441  LEU A CA  1 
ATOM   3094 C  C   . LEU A 1 400 ? -0.352  56.751 56.912 1.00 14.60 ? 441  LEU A C   1 
ATOM   3095 O  O   . LEU A 1 400 ? 0.164   57.306 57.889 1.00 15.90 ? 441  LEU A O   1 
ATOM   3096 C  CB  . LEU A 1 400 ? -2.124  54.971 57.133 1.00 12.15 ? 441  LEU A CB  1 
ATOM   3097 C  CG  . LEU A 1 400 ? -3.579  54.494 56.968 1.00 14.93 ? 441  LEU A CG  1 
ATOM   3098 C  CD1 . LEU A 1 400 ? -3.638  53.036 57.387 1.00 19.40 ? 441  LEU A CD1 1 
ATOM   3099 C  CD2 . LEU A 1 400 ? -4.573  55.302 57.823 1.00 22.14 ? 441  LEU A CD2 1 
ATOM   3100 N  N   . LEU A 1 401 ? 0.384   56.425 55.833 1.00 14.92 ? 442  LEU A N   1 
ATOM   3101 C  CA  . LEU A 1 401 ? 1.816   56.558 55.845 1.00 15.61 ? 442  LEU A CA  1 
ATOM   3102 C  C   . LEU A 1 401 ? 2.208   58.011 55.838 1.00 16.41 ? 442  LEU A C   1 
ATOM   3103 O  O   . LEU A 1 401 ? 3.139   58.396 56.526 1.00 19.01 ? 442  LEU A O   1 
ATOM   3104 C  CB  . LEU A 1 401 ? 2.423   55.821 54.607 1.00 15.21 ? 442  LEU A CB  1 
ATOM   3105 C  CG  . LEU A 1 401 ? 2.205   54.336 54.696 1.00 15.90 ? 442  LEU A CG  1 
ATOM   3106 C  CD1 . LEU A 1 401 ? 2.562   53.688 53.300 1.00 16.00 ? 442  LEU A CD1 1 
ATOM   3107 C  CD2 . LEU A 1 401 ? 3.157   53.768 55.758 1.00 19.21 ? 442  LEU A CD2 1 
ATOM   3108 N  N   . GLN A 1 402 ? 1.527   58.814 55.033 1.00 17.19 ? 443  GLN A N   1 
ATOM   3109 C  CA  . GLN A 1 402 ? 1.925   60.210 54.933 1.00 16.99 ? 443  GLN A CA  1 
ATOM   3110 C  C   . GLN A 1 402 ? 1.657   61.000 56.210 1.00 15.99 ? 443  GLN A C   1 
ATOM   3111 O  O   . GLN A 1 402 ? 2.422   61.900 56.509 1.00 17.44 ? 443  GLN A O   1 
ATOM   3112 C  CB  B GLN A 1 402 ? 1.583   60.882 53.656 0.65 17.58 ? 443  GLN A CB  1 
ATOM   3113 C  CB  C GLN A 1 402 ? 0.938   60.797 53.906 0.35 16.62 ? 443  GLN A CB  1 
ATOM   3114 C  CG  B GLN A 1 402 ? 0.144   61.029 53.560 0.65 14.41 ? 443  GLN A CG  1 
ATOM   3115 C  CG  C GLN A 1 402 ? 0.450   62.223 54.090 0.35 13.75 ? 443  GLN A CG  1 
ATOM   3116 C  CD  B GLN A 1 402 ? -0.205  61.382 52.160 0.65 18.79 ? 443  GLN A CD  1 
ATOM   3117 C  CD  C GLN A 1 402 ? 1.239   63.157 53.266 0.35 17.53 ? 443  GLN A CD  1 
ATOM   3118 O  OE1 B GLN A 1 402 ? 0.649   61.322 51.236 0.65 17.55 ? 443  GLN A OE1 1 
ATOM   3119 O  OE1 C GLN A 1 402 ? 1.655   62.773 52.177 0.35 18.70 ? 443  GLN A OE1 1 
ATOM   3120 N  NE2 B GLN A 1 402 ? -1.441  61.760 51.967 0.65 20.90 ? 443  GLN A NE2 1 
ATOM   3121 N  NE2 C GLN A 1 402 ? 1.477   64.384 53.776 0.35 7.52  ? 443  GLN A NE2 1 
ATOM   3122 N  N   . GLU A 1 403 ? 0.624   60.600 56.949 1.00 14.89 ? 444  GLU A N   1 
ATOM   3123 C  CA  . GLU A 1 403 ? 0.314   61.392 58.171 1.00 14.95 ? 444  GLU A CA  1 
ATOM   3124 C  C   . GLU A 1 403 ? 0.928   60.768 59.447 1.00 17.21 ? 444  GLU A C   1 
ATOM   3125 O  O   . GLU A 1 403 ? 1.036   61.473 60.443 1.00 15.87 ? 444  GLU A O   1 
ATOM   3126 C  CB  . GLU A 1 403 ? -1.226  61.553 58.354 1.00 17.24 ? 444  GLU A CB  1 
ATOM   3127 C  CG  . GLU A 1 403 ? -1.943  62.188 57.135 1.00 19.84 ? 444  GLU A CG  1 
ATOM   3128 C  CD  . GLU A 1 403 ? -1.285  63.471 56.596 1.00 22.70 ? 444  GLU A CD  1 
ATOM   3129 O  OE1 . GLU A 1 403 ? -0.314  64.018 57.178 1.00 21.18 ? 444  GLU A OE1 1 
ATOM   3130 O  OE2 . GLU A 1 403 ? -1.736  63.921 55.504 1.00 23.36 ? 444  GLU A OE2 1 
ATOM   3131 N  N   . ARG A 1 404 ? 1.423   59.545 59.347 1.00 14.38 ? 445  ARG A N   1 
ATOM   3132 C  CA  . ARG A 1 404 ? 1.874   58.809 60.535 1.00 14.32 ? 445  ARG A CA  1 
ATOM   3133 C  C   . ARG A 1 404 ? 3.246   58.207 60.382 1.00 16.89 ? 445  ARG A C   1 
ATOM   3134 O  O   . ARG A 1 404 ? 3.767   57.708 61.390 1.00 17.72 ? 445  ARG A O   1 
ATOM   3135 C  CB  . ARG A 1 404 ? 0.878   57.689 60.879 1.00 14.34 ? 445  ARG A CB  1 
ATOM   3136 C  CG  . ARG A 1 404 ? -0.536  58.183 61.173 1.00 16.31 ? 445  ARG A CG  1 
ATOM   3137 C  CD  . ARG A 1 404 ? -1.469  57.050 61.396 1.00 14.22 ? 445  ARG A CD  1 
ATOM   3138 N  NE  . ARG A 1 404 ? -2.891  57.449 61.312 1.00 14.33 ? 445  ARG A NE  1 
ATOM   3139 C  CZ  . ARG A 1 404 ? -3.959  56.632 61.317 1.00 14.44 ? 445  ARG A CZ  1 
ATOM   3140 N  NH1 . ARG A 1 404 ? -3.831  55.275 61.330 1.00 15.52 ? 445  ARG A NH1 1 
ATOM   3141 N  NH2 . ARG A 1 404 ? -5.201  57.148 61.166 1.00 17.47 ? 445  ARG A NH2 1 
ATOM   3142 N  N   . GLY A 1 405 ? 3.815   58.203 59.163 1.00 16.10 ? 446  GLY A N   1 
ATOM   3143 C  CA  . GLY A 1 405 ? 5.100   57.482 58.918 1.00 16.66 ? 446  GLY A CA  1 
ATOM   3144 C  C   . GLY A 1 405 ? 6.305   58.274 59.419 1.00 15.02 ? 446  GLY A C   1 
ATOM   3145 O  O   . GLY A 1 405 ? 6.683   59.334 58.941 1.00 16.03 ? 446  GLY A O   1 
ATOM   3146 N  N   . VAL A 1 406 ? 6.957   57.734 60.442 1.00 14.88 ? 447  VAL A N   1 
ATOM   3147 C  CA  . VAL A 1 406 ? 8.183   58.317 60.955 1.00 15.34 ? 447  VAL A CA  1 
ATOM   3148 C  C   . VAL A 1 406 ? 9.425   58.029 60.107 1.00 15.70 ? 447  VAL A C   1 
ATOM   3149 O  O   . VAL A 1 406 ? 10.159  58.906 59.750 1.00 15.29 ? 447  VAL A O   1 
ATOM   3150 C  CB  . VAL A 1 406 ? 8.381   57.840 62.418 1.00 16.26 ? 447  VAL A CB  1 
ATOM   3151 C  CG1 . VAL A 1 406 ? 9.732   58.267 62.950 1.00 16.90 ? 447  VAL A CG1 1 
ATOM   3152 C  CG2 . VAL A 1 406 ? 7.225   58.384 63.311 1.00 18.92 ? 447  VAL A CG2 1 
ATOM   3153 N  N   . ALA A 1 407 ? 9.641   56.743 59.810 1.00 15.31 ? 448  ALA A N   1 
ATOM   3154 C  CA  . ALA A 1 407 ? 10.831  56.332 59.119 1.00 15.06 ? 448  ALA A CA  1 
ATOM   3155 C  C   . ALA A 1 407 ? 10.620  54.928 58.585 1.00 14.20 ? 448  ALA A C   1 
ATOM   3156 O  O   . ALA A 1 407 ? 9.740   54.206 59.051 1.00 15.83 ? 448  ALA A O   1 
ATOM   3157 C  CB  . ALA A 1 407 ? 12.023  56.284 60.066 1.00 16.35 ? 448  ALA A CB  1 
ATOM   3158 N  N   . TYR A 1 408 ? 11.429  54.654 57.553 1.00 14.59 ? 449  TYR A N   1 
ATOM   3159 C  CA  . TYR A 1 408 ? 11.449  53.341 56.865 1.00 14.11 ? 449  TYR A CA  1 
ATOM   3160 C  C   . TYR A 1 408 ? 12.899  52.930 56.818 1.00 14.01 ? 449  TYR A C   1 
ATOM   3161 O  O   . TYR A 1 408 ? 13.755  53.630 56.276 1.00 13.62 ? 449  TYR A O   1 
ATOM   3162 C  CB  . TYR A 1 408 ? 10.848  53.456 55.453 1.00 13.31 ? 449  TYR A CB  1 
ATOM   3163 C  CG  . TYR A 1 408 ? 10.943  52.132 54.732 1.00 14.74 ? 449  TYR A CG  1 
ATOM   3164 C  CD1 . TYR A 1 408 ? 9.952   51.176 54.916 1.00 16.46 ? 449  TYR A CD1 1 
ATOM   3165 C  CD2 . TYR A 1 408 ? 12.029  51.877 53.926 1.00 15.93 ? 449  TYR A CD2 1 
ATOM   3166 C  CE1 . TYR A 1 408 ? 10.043  49.907 54.264 1.00 16.58 ? 449  TYR A CE1 1 
ATOM   3167 C  CE2 . TYR A 1 408 ? 12.140  50.633 53.226 1.00 15.12 ? 449  TYR A CE2 1 
ATOM   3168 C  CZ  . TYR A 1 408 ? 11.149  49.703 53.426 1.00 16.00 ? 449  TYR A CZ  1 
ATOM   3169 O  OH  . TYR A 1 408 ? 11.209  48.444 52.798 1.00 16.23 ? 449  TYR A OH  1 
ATOM   3170 N  N   . ILE A 1 409 ? 13.155  51.724 57.348 1.00 14.44 ? 450  ILE A N   1 
ATOM   3171 C  CA  . ILE A 1 409 ? 14.475  51.111 57.231 1.00 14.01 ? 450  ILE A CA  1 
ATOM   3172 C  C   . ILE A 1 409 ? 14.347  49.837 56.370 1.00 13.50 ? 450  ILE A C   1 
ATOM   3173 O  O   . ILE A 1 409 ? 13.524  48.966 56.653 1.00 14.19 ? 450  ILE A O   1 
ATOM   3174 C  CB  . ILE A 1 409 ? 14.983  50.670 58.613 1.00 15.23 ? 450  ILE A CB  1 
ATOM   3175 C  CG1 . ILE A 1 409 ? 15.113  51.897 59.622 1.00 16.54 ? 450  ILE A CG1 1 
ATOM   3176 C  CG2 . ILE A 1 409 ? 16.379  49.988 58.452 1.00 17.57 ? 450  ILE A CG2 1 
ATOM   3177 C  CD1 . ILE A 1 409 ? 15.945  52.992 59.130 1.00 18.85 ? 450  ILE A CD1 1 
ATOM   3178 N  N   . ASN A 1 410 ? 15.098  49.830 55.278 1.00 14.32 ? 451  ASN A N   1 
ATOM   3179 C  CA  . ASN A 1 410 ? 15.037  48.692 54.330 1.00 15.73 ? 451  ASN A CA  1 
ATOM   3180 C  C   . ASN A 1 410 ? 15.830  47.511 54.879 1.00 17.74 ? 451  ASN A C   1 
ATOM   3181 O  O   . ASN A 1 410 ? 16.710  47.690 55.735 1.00 18.52 ? 451  ASN A O   1 
ATOM   3182 C  CB  . ASN A 1 410 ? 15.599  49.130 52.975 1.00 16.02 ? 451  ASN A CB  1 
ATOM   3183 C  CG  . ASN A 1 410 ? 15.000  48.329 51.821 1.00 16.09 ? 451  ASN A CG  1 
ATOM   3184 O  OD1 . ASN A 1 410 ? 13.767  48.152 51.721 1.00 17.66 ? 451  ASN A OD1 1 
ATOM   3185 N  ND2 . ASN A 1 410 ? 15.877  47.760 50.996 1.00 17.36 ? 451  ASN A ND2 1 
ATOM   3186 N  N   . ALA A 1 411 ? 15.586  46.311 54.327 1.00 17.33 ? 452  ALA A N   1 
ATOM   3187 C  CA  . ALA A 1 411 ? 16.340  45.133 54.807 1.00 16.89 ? 452  ALA A CA  1 
ATOM   3188 C  C   . ALA A 1 411 ? 16.377  44.073 53.684 1.00 17.79 ? 452  ALA A C   1 
ATOM   3189 O  O   . ALA A 1 411 ? 15.909  42.933 53.889 1.00 16.89 ? 452  ALA A O   1 
ATOM   3190 C  CB  . ALA A 1 411 ? 15.685  44.563 56.103 1.00 19.31 ? 452  ALA A CB  1 
ATOM   3191 N  N   . ASP A 1 412 ? 16.911  44.473 52.536 1.00 17.03 ? 453  ASP A N   1 
ATOM   3192 C  CA  . ASP A 1 412 ? 17.326  43.477 51.516 1.00 16.65 ? 453  ASP A CA  1 
ATOM   3193 C  C   . ASP A 1 412 ? 18.681  42.880 52.010 1.00 17.87 ? 453  ASP A C   1 
ATOM   3194 O  O   . ASP A 1 412 ? 18.988  42.953 53.207 1.00 16.89 ? 453  ASP A O   1 
ATOM   3195 C  CB  . ASP A 1 412 ? 17.437  44.077 50.130 1.00 18.60 ? 453  ASP A CB  1 
ATOM   3196 C  CG  . ASP A 1 412 ? 17.294  43.023 49.042 1.00 18.23 ? 453  ASP A CG  1 
ATOM   3197 O  OD1 . ASP A 1 412 ? 17.264  41.844 49.402 1.00 18.79 ? 453  ASP A OD1 1 
ATOM   3198 O  OD2 . ASP A 1 412 ? 17.205  43.382 47.861 1.00 17.60 ? 453  ASP A OD2 1 
ATOM   3199 N  N   . SER A 1 413 ? 19.455  42.309 51.089 1.00 17.12 ? 454  SER A N   1 
ATOM   3200 C  CA  . SER A 1 413 ? 20.701  41.550 51.436 1.00 19.07 ? 454  SER A CA  1 
ATOM   3201 C  C   . SER A 1 413 ? 21.519  42.220 52.521 1.00 20.51 ? 454  SER A C   1 
ATOM   3202 O  O   . SER A 1 413 ? 21.856  43.415 52.431 1.00 19.93 ? 454  SER A O   1 
ATOM   3203 C  CB  . SER A 1 413 ? 21.550  41.439 50.219 1.00 20.95 ? 454  SER A CB  1 
ATOM   3204 O  OG  . SER A 1 413 ? 20.745  40.933 49.192 1.00 18.59 ? 454  SER A OG  1 
ATOM   3205 N  N   . SER A 1 414 ? 21.842  41.435 53.547 1.00 20.20 ? 455  SER A N   1 
ATOM   3206 C  CA  . SER A 1 414 ? 22.654  41.976 54.658 1.00 21.41 ? 455  SER A CA  1 
ATOM   3207 C  C   . SER A 1 414 ? 24.135  42.079 54.306 1.00 22.29 ? 455  SER A C   1 
ATOM   3208 O  O   . SER A 1 414 ? 24.893  42.842 54.914 1.00 21.91 ? 455  SER A O   1 
ATOM   3209 C  CB  . SER A 1 414 ? 22.511  41.110 55.886 1.00 22.29 ? 455  SER A CB  1 
ATOM   3210 O  OG  . SER A 1 414 ? 21.205  41.168 56.424 1.00 25.78 ? 455  SER A OG  1 
ATOM   3211 N  N   . ILE A 1 415 ? 24.574  41.256 53.367 1.00 23.53 ? 456  ILE A N   1 
ATOM   3212 C  CA  . ILE A 1 415 ? 25.985  41.189 52.997 1.00 27.22 ? 456  ILE A CA  1 
ATOM   3213 C  C   . ILE A 1 415 ? 26.064  41.147 51.498 1.00 27.04 ? 456  ILE A C   1 
ATOM   3214 O  O   . ILE A 1 415 ? 25.280  40.440 50.890 1.00 31.28 ? 456  ILE A O   1 
ATOM   3215 C  CB  . ILE A 1 415 ? 26.687  39.915 53.601 1.00 26.18 ? 456  ILE A CB  1 
ATOM   3216 C  CG1 . ILE A 1 415 ? 25.905  38.651 53.239 1.00 28.65 ? 456  ILE A CG1 1 
ATOM   3217 C  CG2 . ILE A 1 415 ? 26.790  40.053 55.124 1.00 27.95 ? 456  ILE A CG2 1 
ATOM   3218 C  CD1 . ILE A 1 415 ? 26.745  37.332 53.061 1.00 31.77 ? 456  ILE A CD1 1 
ATOM   3219 N  N   . GLU A 1 416 ? 26.971  41.896 50.902 1.00 26.60 ? 457  GLU A N   1 
ATOM   3220 C  CA  . GLU A 1 416 ? 27.340  41.710 49.493 1.00 27.67 ? 457  GLU A CA  1 
ATOM   3221 C  C   . GLU A 1 416 ? 28.852  41.613 49.393 1.00 26.60 ? 457  GLU A C   1 
ATOM   3222 O  O   . GLU A 1 416 ? 29.439  41.691 48.311 1.00 26.76 ? 457  GLU A O   1 
ATOM   3223 C  CB  . GLU A 1 416 ? 26.821  42.876 48.658 1.00 26.82 ? 457  GLU A CB  1 
ATOM   3224 C  CG  . GLU A 1 416 ? 27.271  44.275 49.161 1.00 29.80 ? 457  GLU A CG  1 
ATOM   3225 C  CD  . GLU A 1 416 ? 26.674  45.449 48.330 1.00 30.43 ? 457  GLU A CD  1 
ATOM   3226 O  OE1 . GLU A 1 416 ? 25.634  45.241 47.647 1.00 31.93 ? 457  GLU A OE1 1 
ATOM   3227 O  OE2 . GLU A 1 416 ? 27.246  46.552 48.362 1.00 30.60 ? 457  GLU A OE2 1 
ATOM   3228 N  N   . GLY A 1 417 ? 29.459  41.458 50.573 1.00 26.83 ? 458  GLY A N   1 
ATOM   3229 C  CA  . GLY A 1 417 ? 30.899  41.429 50.756 1.00 26.63 ? 458  GLY A CA  1 
ATOM   3230 C  C   . GLY A 1 417 ? 31.183  41.350 52.247 1.00 26.18 ? 458  GLY A C   1 
ATOM   3231 O  O   . GLY A 1 417 ? 30.250  41.291 53.091 1.00 25.99 ? 458  GLY A O   1 
ATOM   3232 N  N   . ASN A 1 418 ? 32.456  41.336 52.607 1.00 25.81 ? 459  ASN A N   1 
ATOM   3233 C  CA  . ASN A 1 418 ? 32.798  41.242 54.024 1.00 26.88 ? 459  ASN A CA  1 
ATOM   3234 C  C   . ASN A 1 418 ? 33.868  42.246 54.447 1.00 27.00 ? 459  ASN A C   1 
ATOM   3235 O  O   . ASN A 1 418 ? 34.629  42.028 55.402 1.00 27.68 ? 459  ASN A O   1 
ATOM   3236 C  CB  . ASN A 1 418 ? 33.161  39.788 54.412 1.00 27.93 ? 459  ASN A CB  1 
ATOM   3237 C  CG  . ASN A 1 418 ? 34.375  39.260 53.690 1.00 31.25 ? 459  ASN A CG  1 
ATOM   3238 O  OD1 . ASN A 1 418 ? 35.168  40.003 53.053 1.00 31.54 ? 459  ASN A OD1 1 
ATOM   3239 N  ND2 . ASN A 1 418 ? 34.525  37.908 53.770 1.00 39.81 ? 459  ASN A ND2 1 
ATOM   3240 N  N   . TYR A 1 419 ? 33.919  43.355 53.732 1.00 26.08 ? 460  TYR A N   1 
ATOM   3241 C  CA  . TYR A 1 419 ? 34.937  44.364 53.959 1.00 26.37 ? 460  TYR A CA  1 
ATOM   3242 C  C   . TYR A 1 419 ? 34.518  45.426 54.987 1.00 26.09 ? 460  TYR A C   1 
ATOM   3243 O  O   . TYR A 1 419 ? 35.154  45.604 56.044 1.00 25.94 ? 460  TYR A O   1 
ATOM   3244 C  CB  . TYR A 1 419 ? 35.273  45.003 52.647 1.00 27.39 ? 460  TYR A CB  1 
ATOM   3245 C  CG  . TYR A 1 419 ? 36.372  45.984 52.743 1.00 30.41 ? 460  TYR A CG  1 
ATOM   3246 C  CD1 . TYR A 1 419 ? 37.639  45.592 53.210 1.00 33.03 ? 460  TYR A CD1 1 
ATOM   3247 C  CD2 . TYR A 1 419 ? 36.172  47.314 52.369 1.00 32.62 ? 460  TYR A CD2 1 
ATOM   3248 C  CE1 . TYR A 1 419 ? 38.696  46.501 53.287 1.00 36.03 ? 460  TYR A CE1 1 
ATOM   3249 C  CE2 . TYR A 1 419 ? 37.237  48.243 52.446 1.00 34.89 ? 460  TYR A CE2 1 
ATOM   3250 C  CZ  . TYR A 1 419 ? 38.484  47.815 52.911 1.00 35.69 ? 460  TYR A CZ  1 
ATOM   3251 O  OH  . TYR A 1 419 ? 39.546  48.699 53.001 1.00 36.76 ? 460  TYR A OH  1 
ATOM   3252 N  N   . THR A 1 420 ? 33.417  46.133 54.692 1.00 24.43 ? 461  THR A N   1 
ATOM   3253 C  CA  . THR A 1 420 ? 32.986  47.169 55.636 1.00 24.26 ? 461  THR A CA  1 
ATOM   3254 C  C   . THR A 1 420 ? 31.496  47.477 55.454 1.00 23.59 ? 461  THR A C   1 
ATOM   3255 O  O   . THR A 1 420 ? 30.834  46.894 54.596 1.00 23.17 ? 461  THR A O   1 
ATOM   3256 C  CB  . THR A 1 420 ? 33.809  48.481 55.470 1.00 24.67 ? 461  THR A CB  1 
ATOM   3257 O  OG1 . THR A 1 420 ? 33.646  49.307 56.644 1.00 26.85 ? 461  THR A OG1 1 
ATOM   3258 C  CG2 . THR A 1 420 ? 33.387  49.246 54.199 1.00 23.98 ? 461  THR A CG2 1 
ATOM   3259 N  N   . LEU A 1 421 ? 31.008  48.418 56.244 1.00 22.12 ? 462  LEU A N   1 
ATOM   3260 C  CA  . LEU A 1 421 ? 29.580  48.781 56.250 1.00 20.77 ? 462  LEU A CA  1 
ATOM   3261 C  C   . LEU A 1 421 ? 29.324  49.698 55.084 1.00 20.11 ? 462  LEU A C   1 
ATOM   3262 O  O   . LEU A 1 421 ? 30.212  50.458 54.689 1.00 20.84 ? 462  LEU A O   1 
ATOM   3263 C  CB  . LEU A 1 421 ? 29.254  49.559 57.553 1.00 21.44 ? 462  LEU A CB  1 
ATOM   3264 C  CG  . LEU A 1 421 ? 27.763  49.681 57.875 1.00 20.79 ? 462  LEU A CG  1 
ATOM   3265 C  CD1 . LEU A 1 421 ? 27.156  48.339 58.156 1.00 21.27 ? 462  LEU A CD1 1 
ATOM   3266 C  CD2 . LEU A 1 421 ? 27.588  50.608 59.112 1.00 21.82 ? 462  LEU A CD2 1 
ATOM   3267 N  N   . ARG A 1 422 ? 28.091  49.670 54.576 1.00 20.21 ? 463  ARG A N   1 
ATOM   3268 C  CA  . ARG A 1 422 ? 27.697  50.554 53.496 1.00 20.59 ? 463  ARG A CA  1 
ATOM   3269 C  C   . ARG A 1 422 ? 26.337  51.114 53.928 1.00 19.92 ? 463  ARG A C   1 
ATOM   3270 O  O   . ARG A 1 422 ? 25.407  50.342 54.115 1.00 19.83 ? 463  ARG A O   1 
ATOM   3271 C  CB  . ARG A 1 422 ? 27.512  49.755 52.175 1.00 21.71 ? 463  ARG A CB  1 
ATOM   3272 C  CG  . ARG A 1 422 ? 27.123  50.598 50.952 1.00 22.22 ? 463  ARG A CG  1 
ATOM   3273 C  CD  . ARG A 1 422 ? 27.078  49.747 49.654 1.00 24.33 ? 463  ARG A CD  1 
ATOM   3274 N  NE  . ARG A 1 422 ? 26.666  50.513 48.479 1.00 34.42 ? 463  ARG A NE  1 
ATOM   3275 C  CZ  . ARG A 1 422 ? 26.459  49.997 47.259 1.00 35.13 ? 463  ARG A CZ  1 
ATOM   3276 N  NH1 . ARG A 1 422 ? 26.638  48.682 47.022 1.00 35.06 ? 463  ARG A NH1 1 
ATOM   3277 N  NH2 . ARG A 1 422 ? 26.068  50.793 46.259 1.00 38.84 ? 463  ARG A NH2 1 
ATOM   3278 N  N   . VAL A 1 423 ? 26.222  52.447 54.021 1.00 18.12 ? 464  VAL A N   1 
ATOM   3279 C  CA  . VAL A 1 423 ? 24.948  53.032 54.522 1.00 17.98 ? 464  VAL A CA  1 
ATOM   3280 C  C   . VAL A 1 423 ? 24.528  54.064 53.481 1.00 17.53 ? 464  VAL A C   1 
ATOM   3281 O  O   . VAL A 1 423 ? 25.334  54.835 53.021 1.00 18.65 ? 464  VAL A O   1 
ATOM   3282 C  CB  . VAL A 1 423 ? 25.144  53.724 55.914 1.00 18.40 ? 464  VAL A CB  1 
ATOM   3283 C  CG1 . VAL A 1 423 ? 23.865  54.375 56.393 1.00 17.38 ? 464  VAL A CG1 1 
ATOM   3284 C  CG2 . VAL A 1 423 ? 25.570  52.698 56.940 1.00 21.91 ? 464  VAL A CG2 1 
ATOM   3285 N  N   . ASP A 1 424 ? 23.253  54.038 53.091 1.00 16.14 ? 465  ASP A N   1 
ATOM   3286 C  CA  . ASP A 1 424 ? 22.660  55.073 52.222 1.00 18.32 ? 465  ASP A CA  1 
ATOM   3287 C  C   . ASP A 1 424 ? 21.406  55.531 53.012 1.00 16.36 ? 465  ASP A C   1 
ATOM   3288 O  O   . ASP A 1 424 ? 20.571  54.721 53.468 1.00 16.94 ? 465  ASP A O   1 
ATOM   3289 C  CB  . ASP A 1 424 ? 22.126  54.510 50.884 1.00 18.35 ? 465  ASP A CB  1 
ATOM   3290 C  CG  . ASP A 1 424 ? 23.178  53.755 50.072 1.00 25.09 ? 465  ASP A CG  1 
ATOM   3291 O  OD1 . ASP A 1 424 ? 24.352  53.642 50.488 1.00 27.69 ? 465  ASP A OD1 1 
ATOM   3292 O  OD2 . ASP A 1 424 ? 22.825  53.264 48.977 1.00 29.64 ? 465  ASP A OD2 1 
ATOM   3293 N  N   . CYS A 1 425 ? 21.259  56.860 53.205 1.00 16.60 ? 466  CYS A N   1 
ATOM   3294 C  CA  . CYS A 1 425 ? 20.122  57.304 54.028 1.00 17.32 ? 466  CYS A CA  1 
ATOM   3295 C  C   . CYS A 1 425 ? 19.886  58.766 53.882 1.00 17.64 ? 466  CYS A C   1 
ATOM   3296 O  O   . CYS A 1 425 ? 20.720  59.453 53.377 1.00 20.73 ? 466  CYS A O   1 
ATOM   3297 C  CB  . CYS A 1 425 ? 20.246  56.965 55.536 1.00 16.90 ? 466  CYS A CB  1 
ATOM   3298 S  SG  . CYS A 1 425 ? 21.577  57.839 56.449 1.00 19.30 ? 466  CYS A SG  1 
ATOM   3299 N  N   . THR A 1 426 ? 18.716  59.232 54.313 1.00 17.13 ? 467  THR A N   1 
ATOM   3300 C  CA  . THR A 1 426 ? 18.484  60.674 54.399 1.00 16.57 ? 467  THR A CA  1 
ATOM   3301 C  C   . THR A 1 426 ? 19.476  61.365 55.361 1.00 16.19 ? 467  THR A C   1 
ATOM   3302 O  O   . THR A 1 426 ? 19.807  60.785 56.408 1.00 17.13 ? 467  THR A O   1 
ATOM   3303 C  CB  . THR A 1 426 ? 17.056  60.921 54.913 1.00 15.26 ? 467  THR A CB  1 
ATOM   3304 O  OG1 . THR A 1 426 ? 16.889  62.323 55.115 1.00 16.89 ? 467  THR A OG1 1 
ATOM   3305 C  CG2 . THR A 1 426 ? 16.783  60.182 56.259 1.00 16.99 ? 467  THR A CG2 1 
ATOM   3306 N  N   . PRO A 1 427 ? 19.874  62.613 55.057 1.00 14.90 ? 468  PRO A N   1 
ATOM   3307 C  CA  . PRO A 1 427 ? 20.664  63.391 56.045 1.00 17.79 ? 468  PRO A CA  1 
ATOM   3308 C  C   . PRO A 1 427 ? 20.045  63.385 57.425 1.00 16.85 ? 468  PRO A C   1 
ATOM   3309 O  O   . PRO A 1 427 ? 20.791  63.543 58.437 1.00 18.20 ? 468  PRO A O   1 
ATOM   3310 C  CB  . PRO A 1 427 ? 20.610  64.808 55.483 1.00 18.09 ? 468  PRO A CB  1 
ATOM   3311 C  CG  . PRO A 1 427 ? 20.630  64.576 53.979 1.00 18.25 ? 468  PRO A CG  1 
ATOM   3312 C  CD  . PRO A 1 427 ? 19.631  63.402 53.812 1.00 16.24 ? 468  PRO A CD  1 
ATOM   3313 N  N   . LEU A 1 428 ? 18.704  63.279 57.541 1.00 16.85 ? 469  LEU A N   1 
ATOM   3314 C  CA  . LEU A 1 428 ? 18.061  63.306 58.857 1.00 17.14 ? 469  LEU A CA  1 
ATOM   3315 C  C   . LEU A 1 428 ? 18.524  62.186 59.803 1.00 18.01 ? 469  LEU A C   1 
ATOM   3316 O  O   . LEU A 1 428 ? 18.415  62.312 61.036 1.00 19.65 ? 469  LEU A O   1 
ATOM   3317 C  CB  . LEU A 1 428 ? 16.552  63.216 58.764 1.00 15.94 ? 469  LEU A CB  1 
ATOM   3318 C  CG  . LEU A 1 428 ? 15.978  64.492 58.166 1.00 17.14 ? 469  LEU A CG  1 
ATOM   3319 C  CD1 . LEU A 1 428 ? 14.455  64.280 58.135 1.00 19.17 ? 469  LEU A CD1 1 
ATOM   3320 C  CD2 . LEU A 1 428 ? 16.378  65.752 59.044 1.00 18.22 ? 469  LEU A CD2 1 
ATOM   3321 N  N   . MET A 1 429 ? 19.029  61.106 59.202 1.00 16.31 ? 470  MET A N   1 
ATOM   3322 C  CA  . MET A 1 429 ? 19.492  59.968 59.984 1.00 17.84 ? 470  MET A CA  1 
ATOM   3323 C  C   . MET A 1 429 ? 21.025  59.903 60.157 1.00 17.21 ? 470  MET A C   1 
ATOM   3324 O  O   . MET A 1 429 ? 21.491  58.954 60.860 1.00 17.92 ? 470  MET A O   1 
ATOM   3325 C  CB  A MET A 1 429 ? 19.059  58.662 59.297 0.65 17.66 ? 470  MET A CB  1 
ATOM   3326 C  CB  B MET A 1 429 ? 18.876  58.663 59.492 0.35 17.80 ? 470  MET A CB  1 
ATOM   3327 C  CG  A MET A 1 429 ? 17.613  58.203 59.601 0.65 17.86 ? 470  MET A CG  1 
ATOM   3328 C  CG  B MET A 1 429 ? 17.355  58.668 59.625 0.35 17.59 ? 470  MET A CG  1 
ATOM   3329 S  SD  A MET A 1 429 ? 17.171  56.754 58.589 0.65 17.67 ? 470  MET A SD  1 
ATOM   3330 S  SD  B MET A 1 429 ? 16.613  57.040 59.715 0.35 18.89 ? 470  MET A SD  1 
ATOM   3331 C  CE  A MET A 1 429 ? 15.405  56.693 58.867 0.65 20.57 ? 470  MET A CE  1 
ATOM   3332 C  CE  B MET A 1 429 ? 15.352  57.208 58.471 0.35 19.68 ? 470  MET A CE  1 
ATOM   3333 N  N   . TYR A 1 430 ? 21.799  60.839 59.598 1.00 18.33 ? 471  TYR A N   1 
ATOM   3334 C  CA  . TYR A 1 430 ? 23.270  60.809 59.746 1.00 20.31 ? 471  TYR A CA  1 
ATOM   3335 C  C   . TYR A 1 430 ? 23.722  60.674 61.210 1.00 21.52 ? 471  TYR A C   1 
ATOM   3336 O  O   . TYR A 1 430 ? 24.567  59.819 61.547 1.00 21.13 ? 471  TYR A O   1 
ATOM   3337 C  CB  . TYR A 1 430 ? 23.942  62.019 59.139 1.00 20.39 ? 471  TYR A CB  1 
ATOM   3338 C  CG  . TYR A 1 430 ? 23.937  62.146 57.633 1.00 18.29 ? 471  TYR A CG  1 
ATOM   3339 C  CD1 . TYR A 1 430 ? 23.382  61.146 56.772 1.00 17.75 ? 471  TYR A CD1 1 
ATOM   3340 C  CD2 . TYR A 1 430 ? 24.456  63.304 57.029 1.00 19.08 ? 471  TYR A CD2 1 
ATOM   3341 C  CE1 . TYR A 1 430 ? 23.432  61.335 55.355 1.00 19.85 ? 471  TYR A CE1 1 
ATOM   3342 C  CE2 . TYR A 1 430 ? 24.458  63.502 55.673 1.00 20.65 ? 471  TYR A CE2 1 
ATOM   3343 C  CZ  . TYR A 1 430 ? 23.954  62.515 54.828 1.00 22.17 ? 471  TYR A CZ  1 
ATOM   3344 O  OH  . TYR A 1 430 ? 24.009  62.790 53.461 1.00 22.58 ? 471  TYR A OH  1 
ATOM   3345 N  N   . SER A 1 431 ? 23.202  61.562 62.067 1.00 20.54 ? 472  SER A N   1 
ATOM   3346 C  CA  . SER A 1 431 ? 23.638  61.575 63.483 1.00 21.12 ? 472  SER A CA  1 
ATOM   3347 C  C   . SER A 1 431 ? 23.265  60.291 64.197 1.00 22.15 ? 472  SER A C   1 
ATOM   3348 O  O   . SER A 1 431 ? 24.100  59.737 64.944 1.00 22.66 ? 472  SER A O   1 
ATOM   3349 C  CB  . SER A 1 431 ? 23.067  62.820 64.173 1.00 22.18 ? 472  SER A CB  1 
ATOM   3350 O  OG  A SER A 1 431 ? 23.751  63.945 63.642 0.50 21.25 ? 472  SER A OG  1 
ATOM   3351 O  OG  B SER A 1 431 ? 23.442  62.934 65.559 0.50 18.74 ? 472  SER A OG  1 
ATOM   3352 N  N   . LEU A 1 432 ? 22.052  59.798 63.972 1.00 20.40 ? 473  LEU A N   1 
ATOM   3353 C  CA  . LEU A 1 432 ? 21.609  58.520 64.486 1.00 20.78 ? 473  LEU A CA  1 
ATOM   3354 C  C   . LEU A 1 432 ? 22.619  57.411 64.096 1.00 20.90 ? 473  LEU A C   1 
ATOM   3355 O  O   . LEU A 1 432 ? 23.070  56.618 64.961 1.00 21.87 ? 473  LEU A O   1 
ATOM   3356 C  CB  . LEU A 1 432 ? 20.226  58.172 63.972 1.00 21.05 ? 473  LEU A CB  1 
ATOM   3357 C  CG  . LEU A 1 432 ? 19.703  56.736 64.196 1.00 19.86 ? 473  LEU A CG  1 
ATOM   3358 C  CD1 . LEU A 1 432 ? 19.636  56.315 65.678 1.00 24.90 ? 473  LEU A CD1 1 
ATOM   3359 C  CD2 . LEU A 1 432 ? 18.344  56.624 63.533 1.00 24.65 ? 473  LEU A CD2 1 
ATOM   3360 N  N   . VAL A 1 433 ? 22.974  57.359 62.817 1.00 19.51 ? 474  VAL A N   1 
ATOM   3361 C  CA  . VAL A 1 433 ? 23.869  56.272 62.324 1.00 21.47 ? 474  VAL A CA  1 
ATOM   3362 C  C   . VAL A 1 433 ? 25.253  56.400 62.954 1.00 21.35 ? 474  VAL A C   1 
ATOM   3363 O  O   . VAL A 1 433 ? 25.822  55.388 63.420 1.00 21.68 ? 474  VAL A O   1 
ATOM   3364 C  CB  . VAL A 1 433 ? 23.950  56.308 60.777 1.00 21.89 ? 474  VAL A CB  1 
ATOM   3365 C  CG1 . VAL A 1 433 ? 25.127  55.473 60.256 1.00 25.61 ? 474  VAL A CG1 1 
ATOM   3366 C  CG2 . VAL A 1 433 ? 22.599  55.841 60.270 1.00 24.80 ? 474  VAL A CG2 1 
ATOM   3367 N  N   . HIS A 1 434 ? 25.776  57.624 62.994 1.00 21.05 ? 475  HIS A N   1 
ATOM   3368 C  CA  . HIS A 1 434 ? 27.106  57.874 63.586 1.00 22.83 ? 475  HIS A CA  1 
ATOM   3369 C  C   . HIS A 1 434 ? 27.080  57.449 65.049 1.00 22.92 ? 475  HIS A C   1 
ATOM   3370 O  O   . HIS A 1 434 ? 27.955  56.685 65.521 1.00 24.27 ? 475  HIS A O   1 
ATOM   3371 C  CB  . HIS A 1 434 ? 27.501  59.338 63.499 1.00 21.94 ? 475  HIS A CB  1 
ATOM   3372 C  CG  . HIS A 1 434 ? 27.749  59.817 62.108 1.00 23.61 ? 475  HIS A CG  1 
ATOM   3373 N  ND1 . HIS A 1 434 ? 27.583  61.133 61.746 1.00 29.35 ? 475  HIS A ND1 1 
ATOM   3374 C  CD2 . HIS A 1 434 ? 28.045  59.149 60.969 1.00 23.76 ? 475  HIS A CD2 1 
ATOM   3375 C  CE1 . HIS A 1 434 ? 27.868  61.271 60.464 1.00 30.51 ? 475  HIS A CE1 1 
ATOM   3376 N  NE2 . HIS A 1 434 ? 28.175  60.084 59.977 1.00 26.11 ? 475  HIS A NE2 1 
ATOM   3377 N  N   . ASN A 1 435 ? 26.075  57.904 65.783 1.00 21.53 ? 476  ASN A N   1 
ATOM   3378 C  CA  . ASN A 1 435 ? 26.009  57.576 67.204 1.00 23.06 ? 476  ASN A CA  1 
ATOM   3379 C  C   . ASN A 1 435 ? 25.895  56.095 67.440 1.00 24.10 ? 476  ASN A C   1 
ATOM   3380 O  O   . ASN A 1 435 ? 26.537  55.570 68.354 1.00 25.70 ? 476  ASN A O   1 
ATOM   3381 C  CB  . ASN A 1 435 ? 24.862  58.323 67.902 1.00 23.38 ? 476  ASN A CB  1 
ATOM   3382 C  CG  . ASN A 1 435 ? 25.146  59.815 68.055 1.00 21.35 ? 476  ASN A CG  1 
ATOM   3383 O  OD1 . ASN A 1 435 ? 26.167  60.334 67.602 1.00 23.23 ? 476  ASN A OD1 1 
ATOM   3384 N  ND2 . ASN A 1 435 ? 24.150  60.521 68.649 1.00 25.90 ? 476  ASN A ND2 1 
ATOM   3385 N  N   . LEU A 1 436 ? 25.051  55.412 66.651 1.00 21.80 ? 477  LEU A N   1 
ATOM   3386 C  CA  . LEU A 1 436 ? 24.748  54.018 66.936 1.00 22.47 ? 477  LEU A CA  1 
ATOM   3387 C  C   . LEU A 1 436 ? 25.987  53.192 66.633 1.00 22.40 ? 477  LEU A C   1 
ATOM   3388 O  O   . LEU A 1 436 ? 26.366  52.307 67.432 1.00 23.35 ? 477  LEU A O   1 
ATOM   3389 C  CB  . LEU A 1 436 ? 23.590  53.540 66.022 1.00 23.00 ? 477  LEU A CB  1 
ATOM   3390 C  CG  . LEU A 1 436 ? 23.353  52.042 66.053 1.00 23.62 ? 477  LEU A CG  1 
ATOM   3391 C  CD1 . LEU A 1 436 ? 23.057  51.508 67.463 1.00 21.63 ? 477  LEU A CD1 1 
ATOM   3392 C  CD2 . LEU A 1 436 ? 22.204  51.770 65.072 1.00 24.40 ? 477  LEU A CD2 1 
ATOM   3393 N  N   . THR A 1 437 ? 26.623  53.483 65.505 1.00 21.59 ? 478  THR A N   1 
ATOM   3394 C  CA  . THR A 1 437 ? 27.838  52.709 65.122 1.00 22.92 ? 478  THR A CA  1 
ATOM   3395 C  C   . THR A 1 437 ? 29.019  52.900 66.101 1.00 24.53 ? 478  THR A C   1 
ATOM   3396 O  O   . THR A 1 437 ? 29.883  52.020 66.198 1.00 24.63 ? 478  THR A O   1 
ATOM   3397 C  CB  . THR A 1 437 ? 28.302  52.940 63.672 1.00 22.37 ? 478  THR A CB  1 
ATOM   3398 O  OG1 . THR A 1 437 ? 28.679  54.312 63.447 1.00 21.93 ? 478  THR A OG1 1 
ATOM   3399 C  CG2 . THR A 1 437 ? 27.172  52.456 62.637 1.00 20.82 ? 478  THR A CG2 1 
ATOM   3400 N  N   . LYS A 1 438 ? 29.078  54.049 66.786 1.00 24.88 ? 479  LYS A N   1 
ATOM   3401 C  CA  . LYS A 1 438 ? 30.059  54.252 67.872 1.00 26.90 ? 479  LYS A CA  1 
ATOM   3402 C  C   . LYS A 1 438 ? 29.834  53.352 69.074 1.00 27.65 ? 479  LYS A C   1 
ATOM   3403 O  O   . LYS A 1 438 ? 30.775  53.127 69.864 1.00 30.10 ? 479  LYS A O   1 
ATOM   3404 C  CB  . LYS A 1 438 ? 30.066  55.729 68.282 1.00 25.12 ? 479  LYS A CB  1 
ATOM   3405 C  CG  . LYS A 1 438 ? 30.764  56.614 67.251 1.00 25.72 ? 479  LYS A CG  1 
ATOM   3406 C  CD  . LYS A 1 438 ? 30.643  58.091 67.624 1.00 27.12 ? 479  LYS A CD  1 
ATOM   3407 C  CE  . LYS A 1 438 ? 31.165  58.957 66.501 1.00 28.91 ? 479  LYS A CE  1 
ATOM   3408 N  NZ  . LYS A 1 438 ? 30.895  60.421 66.769 1.00 31.02 ? 479  LYS A NZ  1 
ATOM   3409 N  N   . GLU A 1 439 ? 28.629  52.829 69.231 1.00 28.31 ? 480  GLU A N   1 
ATOM   3410 C  CA  . GLU A 1 439 ? 28.241  52.017 70.376 1.00 31.48 ? 480  GLU A CA  1 
ATOM   3411 C  C   . GLU A 1 439 ? 28.343  50.531 70.061 1.00 29.36 ? 480  GLU A C   1 
ATOM   3412 O  O   . GLU A 1 439 ? 28.045  49.716 70.924 1.00 29.94 ? 480  GLU A O   1 
ATOM   3413 C  CB  . GLU A 1 439 ? 26.765  52.229 70.752 1.00 32.04 ? 480  GLU A CB  1 
ATOM   3414 C  CG  . GLU A 1 439 ? 26.384  53.364 71.702 1.00 37.85 ? 480  GLU A CG  1 
ATOM   3415 C  CD  . GLU A 1 439 ? 24.860  53.254 72.115 1.00 38.18 ? 480  GLU A CD  1 
ATOM   3416 O  OE1 . GLU A 1 439 ? 23.964  53.599 71.293 1.00 45.62 ? 480  GLU A OE1 1 
ATOM   3417 O  OE2 . GLU A 1 439 ? 24.557  52.788 73.259 1.00 48.37 ? 480  GLU A OE2 1 
ATOM   3418 N  N   . LEU A 1 440 ? 28.600  50.190 68.795 1.00 27.47 ? 481  LEU A N   1 
ATOM   3419 C  CA  . LEU A 1 440 ? 28.577  48.788 68.360 1.00 26.95 ? 481  LEU A CA  1 
ATOM   3420 C  C   . LEU A 1 440 ? 30.004  48.326 68.154 1.00 26.48 ? 481  LEU A C   1 
ATOM   3421 O  O   . LEU A 1 440 ? 30.870  49.104 67.733 1.00 26.80 ? 481  LEU A O   1 
ATOM   3422 C  CB  . LEU A 1 440 ? 27.803  48.623 67.032 1.00 25.64 ? 481  LEU A CB  1 
ATOM   3423 C  CG  . LEU A 1 440 ? 26.305  48.932 67.033 1.00 24.14 ? 481  LEU A CG  1 
ATOM   3424 C  CD1 . LEU A 1 440 ? 25.710  48.726 65.598 1.00 22.56 ? 481  LEU A CD1 1 
ATOM   3425 C  CD2 . LEU A 1 440 ? 25.523  48.177 68.094 1.00 22.17 ? 481  LEU A CD2 1 
ATOM   3426 N  N   . LYS A 1 441 ? 30.226  47.038 68.415 1.00 27.98 ? 482  LYS A N   1 
ATOM   3427 C  CA  . LYS A 1 441 ? 31.559  46.453 68.216 1.00 28.38 ? 482  LYS A CA  1 
ATOM   3428 C  C   . LYS A 1 441 ? 31.801  46.179 66.748 1.00 27.75 ? 482  LYS A C   1 
ATOM   3429 O  O   . LYS A 1 441 ? 30.865  45.757 66.049 1.00 28.60 ? 482  LYS A O   1 
ATOM   3430 C  CB  . LYS A 1 441 ? 31.649  45.119 68.933 1.00 28.42 ? 482  LYS A CB  1 
ATOM   3431 C  CG  . LYS A 1 441 ? 31.465  45.158 70.422 1.00 30.96 ? 482  LYS A CG  1 
ATOM   3432 C  CD  . LYS A 1 441 ? 31.566  43.720 70.914 1.00 36.18 ? 482  LYS A CD  1 
ATOM   3433 C  CE  . LYS A 1 441 ? 31.502  43.644 72.442 1.00 42.30 ? 482  LYS A CE  1 
ATOM   3434 N  NZ  . LYS A 1 441 ? 30.081  43.646 72.971 1.00 45.06 ? 482  LYS A NZ  1 
ATOM   3435 N  N   . SER A 1 442 ? 33.020  46.407 66.292 1.00 27.32 ? 483  SER A N   1 
ATOM   3436 C  CA  . SER A 1 442 ? 33.410  46.024 64.934 1.00 27.12 ? 483  SER A CA  1 
ATOM   3437 C  C   . SER A 1 442 ? 33.604  44.516 64.835 1.00 27.31 ? 483  SER A C   1 
ATOM   3438 O  O   . SER A 1 442 ? 34.238  43.909 65.746 1.00 28.25 ? 483  SER A O   1 
ATOM   3439 C  CB  . SER A 1 442 ? 34.671  46.748 64.485 1.00 26.06 ? 483  SER A CB  1 
ATOM   3440 O  OG  . SER A 1 442 ? 35.068  46.327 63.183 1.00 26.97 ? 483  SER A OG  1 
ATOM   3441 N  N   . PRO A 1 443 ? 33.096  43.909 63.745 1.00 26.67 ? 484  PRO A N   1 
ATOM   3442 C  CA  . PRO A 1 443 ? 33.329  42.467 63.508 1.00 26.40 ? 484  PRO A CA  1 
ATOM   3443 C  C   . PRO A 1 443 ? 34.609  42.226 62.726 1.00 27.40 ? 484  PRO A C   1 
ATOM   3444 O  O   . PRO A 1 443 ? 34.956  41.050 62.477 1.00 28.11 ? 484  PRO A O   1 
ATOM   3445 C  CB  . PRO A 1 443 ? 32.142  42.082 62.653 1.00 26.01 ? 484  PRO A CB  1 
ATOM   3446 C  CG  . PRO A 1 443 ? 31.907  43.306 61.795 1.00 26.27 ? 484  PRO A CG  1 
ATOM   3447 C  CD  . PRO A 1 443 ? 32.248  44.499 62.676 1.00 26.91 ? 484  PRO A CD  1 
ATOM   3448 N  N   . ASP A 1 444 ? 35.294  43.302 62.337 1.00 27.80 ? 485  ASP A N   1 
ATOM   3449 C  CA  . ASP A 1 444 ? 36.341  43.246 61.333 1.00 29.33 ? 485  ASP A CA  1 
ATOM   3450 C  C   . ASP A 1 444 ? 37.615  42.674 61.956 1.00 31.70 ? 485  ASP A C   1 
ATOM   3451 O  O   . ASP A 1 444 ? 37.905  42.928 63.145 1.00 31.81 ? 485  ASP A O   1 
ATOM   3452 C  CB  . ASP A 1 444 ? 36.680  44.635 60.771 1.00 29.13 ? 485  ASP A CB  1 
ATOM   3453 C  CG  . ASP A 1 444 ? 35.548  45.225 59.933 1.00 27.56 ? 485  ASP A CG  1 
ATOM   3454 O  OD1 . ASP A 1 444 ? 34.467  44.617 59.912 1.00 30.72 ? 485  ASP A OD1 1 
ATOM   3455 O  OD2 . ASP A 1 444 ? 35.764  46.271 59.297 1.00 28.35 ? 485  ASP A OD2 1 
ATOM   3456 N  N   . GLU A 1 445 ? 38.356  41.932 61.140 1.00 34.02 ? 486  GLU A N   1 
ATOM   3457 C  CA  . GLU A 1 445 ? 39.697  41.457 61.523 1.00 37.04 ? 486  GLU A CA  1 
ATOM   3458 C  C   . GLU A 1 445 ? 40.609  42.658 61.752 1.00 36.17 ? 486  GLU A C   1 
ATOM   3459 O  O   . GLU A 1 445 ? 40.756  43.526 60.883 1.00 36.48 ? 486  GLU A O   1 
ATOM   3460 C  CB  . GLU A 1 445 ? 40.321  40.591 60.415 1.00 37.66 ? 486  GLU A CB  1 
ATOM   3461 C  CG  . GLU A 1 445 ? 39.340  39.792 59.540 1.00 45.34 ? 486  GLU A CG  1 
ATOM   3462 C  CD  . GLU A 1 445 ? 38.647  38.637 60.271 1.00 51.18 ? 486  GLU A CD  1 
ATOM   3463 O  OE1 . GLU A 1 445 ? 39.138  38.232 61.358 1.00 55.38 ? 486  GLU A OE1 1 
ATOM   3464 O  OE2 . GLU A 1 445 ? 37.622  38.121 59.747 1.00 55.51 ? 486  GLU A OE2 1 
ATOM   3465 N  N   . GLY A 1 446 ? 41.245  42.696 62.907 1.00 36.05 ? 487  GLY A N   1 
ATOM   3466 C  CA  . GLY A 1 446 ? 42.215  43.755 63.162 1.00 35.30 ? 487  GLY A CA  1 
ATOM   3467 C  C   . GLY A 1 446 ? 41.587  44.931 63.889 1.00 35.60 ? 487  GLY A C   1 
ATOM   3468 O  O   . GLY A 1 446 ? 42.275  45.881 64.249 1.00 36.43 ? 487  GLY A O   1 
ATOM   3469 N  N   . PHE A 1 447 ? 40.277  44.885 64.088 1.00 34.43 ? 488  PHE A N   1 
ATOM   3470 C  CA  . PHE A 1 447 ? 39.609  45.986 64.785 1.00 33.31 ? 488  PHE A CA  1 
ATOM   3471 C  C   . PHE A 1 447 ? 38.944  45.433 65.999 1.00 34.01 ? 488  PHE A C   1 
ATOM   3472 O  O   . PHE A 1 447 ? 37.951  45.973 66.478 1.00 34.20 ? 488  PHE A O   1 
ATOM   3473 C  CB  . PHE A 1 447 ? 38.584  46.674 63.858 1.00 32.68 ? 488  PHE A CB  1 
ATOM   3474 C  CG  . PHE A 1 447 ? 39.217  47.459 62.762 1.00 31.40 ? 488  PHE A CG  1 
ATOM   3475 C  CD1 . PHE A 1 447 ? 39.462  48.819 62.911 1.00 30.59 ? 488  PHE A CD1 1 
ATOM   3476 C  CD2 . PHE A 1 447 ? 39.599  46.836 61.590 1.00 29.23 ? 488  PHE A CD2 1 
ATOM   3477 C  CE1 . PHE A 1 447 ? 40.069  49.547 61.900 1.00 30.34 ? 488  PHE A CE1 1 
ATOM   3478 C  CE2 . PHE A 1 447 ? 40.188  47.554 60.562 1.00 30.73 ? 488  PHE A CE2 1 
ATOM   3479 C  CZ  . PHE A 1 447 ? 40.431  48.912 60.715 1.00 34.07 ? 488  PHE A CZ  1 
ATOM   3480 N  N   . GLU A 1 448 ? 39.466  44.332 66.535 1.00 34.78 ? 489  GLU A N   1 
ATOM   3481 C  CA  . GLU A 1 448 ? 38.824  43.780 67.717 1.00 35.17 ? 489  GLU A CA  1 
ATOM   3482 C  C   . GLU A 1 448 ? 38.932  44.744 68.912 1.00 35.14 ? 489  GLU A C   1 
ATOM   3483 O  O   . GLU A 1 448 ? 39.923  45.456 69.078 1.00 36.00 ? 489  GLU A O   1 
ATOM   3484 C  CB  . GLU A 1 448 ? 39.213  42.311 68.061 1.00 36.02 ? 489  GLU A CB  1 
ATOM   3485 C  CG  . GLU A 1 448 ? 40.540  41.730 67.590 1.00 37.83 ? 489  GLU A CG  1 
ATOM   3486 C  CD  . GLU A 1 448 ? 40.760  41.632 66.077 1.00 36.62 ? 489  GLU A CD  1 
ATOM   3487 O  OE1 . GLU A 1 448 ? 40.276  40.689 65.395 1.00 39.44 ? 489  GLU A OE1 1 
ATOM   3488 O  OE2 . GLU A 1 448 ? 41.527  42.474 65.591 1.00 37.97 ? 489  GLU A OE2 1 
ATOM   3489 N  N   . GLY A 1 449 ? 37.847  44.846 69.660 1.00 34.42 ? 490  GLY A N   1 
ATOM   3490 C  CA  . GLY A 1 449 ? 37.725  45.865 70.699 1.00 34.80 ? 490  GLY A CA  1 
ATOM   3491 C  C   . GLY A 1 449 ? 37.532  47.308 70.200 1.00 34.25 ? 490  GLY A C   1 
ATOM   3492 O  O   . GLY A 1 449 ? 37.397  48.206 71.024 1.00 35.76 ? 490  GLY A O   1 
ATOM   3493 N  N   . LYS A 1 450 ? 37.499  47.525 68.877 1.00 32.78 ? 491  LYS A N   1 
ATOM   3494 C  CA  . LYS A 1 450 ? 37.225  48.844 68.279 1.00 31.61 ? 491  LYS A CA  1 
ATOM   3495 C  C   . LYS A 1 450 ? 35.731  48.935 67.929 1.00 29.50 ? 491  LYS A C   1 
ATOM   3496 O  O   . LYS A 1 450 ? 35.052  47.910 67.785 1.00 27.56 ? 491  LYS A O   1 
ATOM   3497 C  CB  . LYS A 1 450 ? 38.061  49.081 67.031 1.00 32.39 ? 491  LYS A CB  1 
ATOM   3498 C  CG  . LYS A 1 450 ? 39.586  49.036 67.244 1.00 36.47 ? 491  LYS A CG  1 
ATOM   3499 C  CD  . LYS A 1 450 ? 40.029  49.888 68.442 1.00 39.92 ? 491  LYS A CD  1 
ATOM   3500 C  CE  . LYS A 1 450 ? 41.560  50.052 68.467 1.00 41.12 ? 491  LYS A CE  1 
ATOM   3501 N  NZ  . LYS A 1 450 ? 42.126  50.289 67.076 1.00 46.61 ? 491  LYS A NZ  1 
ATOM   3502 N  N   . SER A 1 451 ? 35.227  50.159 67.819 1.00 28.02 ? 492  SER A N   1 
ATOM   3503 C  CA  . SER A 1 451 ? 33.800  50.357 67.440 1.00 27.28 ? 492  SER A CA  1 
ATOM   3504 C  C   . SER A 1 451 ? 33.651  50.121 65.935 1.00 26.04 ? 492  SER A C   1 
ATOM   3505 O  O   . SER A 1 451 ? 34.597  50.282 65.153 1.00 26.22 ? 492  SER A O   1 
ATOM   3506 C  CB  . SER A 1 451 ? 33.350  51.792 67.754 1.00 27.38 ? 492  SER A CB  1 
ATOM   3507 O  OG  . SER A 1 451 ? 33.951  52.668 66.835 1.00 26.48 ? 492  SER A OG  1 
ATOM   3508 N  N   . LEU A 1 452 ? 32.415  49.834 65.534 1.00 26.24 ? 493  LEU A N   1 
ATOM   3509 C  CA  . LEU A 1 452 ? 32.054  49.737 64.103 1.00 24.21 ? 493  LEU A CA  1 
ATOM   3510 C  C   . LEU A 1 452 ? 32.288  51.093 63.426 1.00 24.15 ? 493  LEU A C   1 
ATOM   3511 O  O   . LEU A 1 452 ? 32.726  51.177 62.282 1.00 22.07 ? 493  LEU A O   1 
ATOM   3512 C  CB  . LEU A 1 452 ? 30.588  49.296 63.987 1.00 23.42 ? 493  LEU A CB  1 
ATOM   3513 C  CG  . LEU A 1 452 ? 30.001  49.201 62.555 1.00 23.54 ? 493  LEU A CG  1 
ATOM   3514 C  CD1 . LEU A 1 452 ? 30.834  48.182 61.662 1.00 23.94 ? 493  LEU A CD1 1 
ATOM   3515 C  CD2 . LEU A 1 452 ? 28.573  48.764 62.601 1.00 23.60 ? 493  LEU A CD2 1 
ATOM   3516 N  N   . TYR A 1 453 ? 31.988  52.188 64.143 1.00 23.69 ? 494  TYR A N   1 
ATOM   3517 C  CA  . TYR A 1 453 ? 32.260  53.504 63.573 1.00 24.95 ? 494  TYR A CA  1 
ATOM   3518 C  C   . TYR A 1 453 ? 33.725  53.627 63.211 1.00 24.51 ? 494  TYR A C   1 
ATOM   3519 O  O   . TYR A 1 453 ? 34.068  54.185 62.180 1.00 22.83 ? 494  TYR A O   1 
ATOM   3520 C  CB  . TYR A 1 453 ? 31.904  54.631 64.576 1.00 26.05 ? 494  TYR A CB  1 
ATOM   3521 C  CG  . TYR A 1 453 ? 32.150  56.032 64.004 1.00 26.09 ? 494  TYR A CG  1 
ATOM   3522 C  CD1 . TYR A 1 453 ? 31.100  56.726 63.393 1.00 26.73 ? 494  TYR A CD1 1 
ATOM   3523 C  CD2 . TYR A 1 453 ? 33.409  56.674 64.086 1.00 25.68 ? 494  TYR A CD2 1 
ATOM   3524 C  CE1 . TYR A 1 453 ? 31.290  57.998 62.868 1.00 26.88 ? 494  TYR A CE1 1 
ATOM   3525 C  CE2 . TYR A 1 453 ? 33.615  57.944 63.573 1.00 26.35 ? 494  TYR A CE2 1 
ATOM   3526 C  CZ  . TYR A 1 453 ? 32.521  58.625 62.976 1.00 28.35 ? 494  TYR A CZ  1 
ATOM   3527 O  OH  . TYR A 1 453 ? 32.665  59.860 62.428 1.00 27.06 ? 494  TYR A OH  1 
ATOM   3528 N  N   . GLU A 1 454 ? 34.609  53.152 64.106 1.00 25.23 ? 495  GLU A N   1 
ATOM   3529 C  CA  . GLU A 1 454 ? 36.042  53.249 63.823 1.00 26.89 ? 495  GLU A CA  1 
ATOM   3530 C  C   . GLU A 1 454 ? 36.457  52.426 62.595 1.00 26.01 ? 495  GLU A C   1 
ATOM   3531 O  O   . GLU A 1 454 ? 37.130  52.954 61.732 1.00 26.39 ? 495  GLU A O   1 
ATOM   3532 C  CB  . GLU A 1 454 ? 36.896  52.851 65.054 1.00 28.01 ? 495  GLU A CB  1 
ATOM   3533 C  CG  . GLU A 1 454 ? 38.370  53.141 64.800 1.00 32.79 ? 495  GLU A CG  1 
ATOM   3534 C  CD  . GLU A 1 454 ? 39.226  52.804 66.004 1.00 37.82 ? 495  GLU A CD  1 
ATOM   3535 O  OE1 . GLU A 1 454 ? 38.831  53.202 67.129 1.00 39.92 ? 495  GLU A OE1 1 
ATOM   3536 O  OE2 . GLU A 1 454 ? 40.271  52.133 65.807 1.00 41.35 ? 495  GLU A OE2 1 
ATOM   3537 N  N   . SER A 1 455 ? 36.000  51.173 62.484 1.00 25.76 ? 496  SER A N   1 
ATOM   3538 C  CA  . SER A 1 455 ? 36.413  50.368 61.317 1.00 26.52 ? 496  SER A CA  1 
ATOM   3539 C  C   . SER A 1 455 ? 35.805  50.885 60.004 1.00 25.98 ? 496  SER A C   1 
ATOM   3540 O  O   . SER A 1 455 ? 36.469  51.007 58.985 1.00 25.46 ? 496  SER A O   1 
ATOM   3541 C  CB  . SER A 1 455 ? 36.125  48.873 61.535 1.00 26.47 ? 496  SER A CB  1 
ATOM   3542 O  OG  . SER A 1 455 ? 34.765  48.544 61.702 1.00 26.46 ? 496  SER A OG  1 
ATOM   3543 N  N   . TRP A 1 456 ? 34.525  51.238 60.067 1.00 25.41 ? 497  TRP A N   1 
ATOM   3544 C  CA  . TRP A 1 456 ? 33.837  51.825 58.919 1.00 25.09 ? 497  TRP A CA  1 
ATOM   3545 C  C   . TRP A 1 456 ? 34.471  53.130 58.409 1.00 24.21 ? 497  TRP A C   1 
ATOM   3546 O  O   . TRP A 1 456 ? 34.709  53.296 57.221 1.00 22.69 ? 497  TRP A O   1 
ATOM   3547 C  CB  . TRP A 1 456 ? 32.357  51.971 59.309 1.00 24.52 ? 497  TRP A CB  1 
ATOM   3548 C  CG  . TRP A 1 456 ? 31.462  52.625 58.255 1.00 24.73 ? 497  TRP A CG  1 
ATOM   3549 C  CD1 . TRP A 1 456 ? 31.540  52.537 56.895 1.00 24.35 ? 497  TRP A CD1 1 
ATOM   3550 C  CD2 . TRP A 1 456 ? 30.327  53.458 58.550 1.00 25.89 ? 497  TRP A CD2 1 
ATOM   3551 N  NE1 . TRP A 1 456 ? 30.508  53.280 56.310 1.00 24.61 ? 497  TRP A NE1 1 
ATOM   3552 C  CE2 . TRP A 1 456 ? 29.748  53.839 57.307 1.00 24.54 ? 497  TRP A CE2 1 
ATOM   3553 C  CE3 . TRP A 1 456 ? 29.733  53.905 59.759 1.00 23.95 ? 497  TRP A CE3 1 
ATOM   3554 C  CZ2 . TRP A 1 456 ? 28.606  54.696 57.227 1.00 23.11 ? 497  TRP A CZ2 1 
ATOM   3555 C  CZ3 . TRP A 1 456 ? 28.597  54.756 59.685 1.00 24.30 ? 497  TRP A CZ3 1 
ATOM   3556 C  CH2 . TRP A 1 456 ? 28.049  55.127 58.403 1.00 25.08 ? 497  TRP A CH2 1 
ATOM   3557 N  N   . THR A 1 457 ? 34.782  54.065 59.308 1.00 24.46 ? 498  THR A N   1 
ATOM   3558 C  CA  . THR A 1 457 ? 35.347  55.344 58.905 1.00 26.98 ? 498  THR A CA  1 
ATOM   3559 C  C   . THR A 1 457 ? 36.752  55.174 58.305 1.00 27.64 ? 498  THR A C   1 
ATOM   3560 O  O   . THR A 1 457 ? 37.125  55.827 57.318 1.00 28.43 ? 498  THR A O   1 
ATOM   3561 C  CB  . THR A 1 457 ? 35.390  56.301 60.134 1.00 27.06 ? 498  THR A CB  1 
ATOM   3562 O  OG1 . THR A 1 457 ? 34.039  56.576 60.591 1.00 27.53 ? 498  THR A OG1 1 
ATOM   3563 C  CG2 . THR A 1 457 ? 36.126  57.579 59.800 1.00 29.05 ? 498  THR A CG2 1 
ATOM   3564 N  N   . LYS A 1 458 ? 37.506  54.242 58.878 1.00 28.88 ? 499  LYS A N   1 
ATOM   3565 C  CA  . LYS A 1 458 ? 38.827  53.947 58.329 1.00 30.56 ? 499  LYS A CA  1 
ATOM   3566 C  C   . LYS A 1 458 ? 38.744  53.352 56.916 1.00 30.03 ? 499  LYS A C   1 
ATOM   3567 O  O   . LYS A 1 458 ? 39.431  53.819 56.011 1.00 31.36 ? 499  LYS A O   1 
ATOM   3568 C  CB  . LYS A 1 458 ? 39.653  53.070 59.275 1.00 31.46 ? 499  LYS A CB  1 
ATOM   3569 C  CG  . LYS A 1 458 ? 41.104  52.960 58.779 1.00 35.02 ? 499  LYS A CG  1 
ATOM   3570 C  CD  . LYS A 1 458 ? 41.994  52.119 59.682 1.00 42.17 ? 499  LYS A CD  1 
ATOM   3571 C  CE  . LYS A 1 458 ? 43.490  52.442 59.456 1.00 44.82 ? 499  LYS A CE  1 
ATOM   3572 N  NZ  . LYS A 1 458 ? 43.786  53.310 58.265 1.00 47.98 ? 499  LYS A NZ  1 
ATOM   3573 N  N   . LYS A 1 459 ? 37.835  52.385 56.722 1.00 30.07 ? 500  LYS A N   1 
ATOM   3574 C  CA  . LYS A 1 459 ? 37.721  51.653 55.447 1.00 29.31 ? 500  LYS A CA  1 
ATOM   3575 C  C   . LYS A 1 459 ? 36.942  52.371 54.345 1.00 30.41 ? 500  LYS A C   1 
ATOM   3576 O  O   . LYS A 1 459 ? 37.126  52.057 53.157 1.00 30.76 ? 500  LYS A O   1 
ATOM   3577 C  CB  . LYS A 1 459 ? 37.097  50.289 55.682 1.00 29.76 ? 500  LYS A CB  1 
ATOM   3578 C  CG  . LYS A 1 459 ? 38.013  49.313 56.433 1.00 28.66 ? 500  LYS A CG  1 
ATOM   3579 C  CD  . LYS A 1 459 ? 37.410  47.932 56.460 1.00 31.21 ? 500  LYS A CD  1 
ATOM   3580 C  CE  . LYS A 1 459 ? 38.273  46.945 57.280 1.00 31.55 ? 500  LYS A CE  1 
ATOM   3581 N  NZ  . LYS A 1 459 ? 37.642  45.588 57.450 1.00 30.75 ? 500  LYS A NZ  1 
ATOM   3582 N  N   . SER A 1 460 ? 36.056  53.288 54.732 1.00 30.35 ? 501  SER A N   1 
ATOM   3583 C  CA  . SER A 1 460 ? 35.188  54.001 53.789 1.00 30.76 ? 501  SER A CA  1 
ATOM   3584 C  C   . SER A 1 460 ? 35.083  55.492 54.173 1.00 31.88 ? 501  SER A C   1 
ATOM   3585 O  O   . SER A 1 460 ? 34.018  55.971 54.583 1.00 30.32 ? 501  SER A O   1 
ATOM   3586 C  CB  . SER A 1 460 ? 33.785  53.340 53.743 1.00 31.24 ? 501  SER A CB  1 
ATOM   3587 O  OG  . SER A 1 460 ? 33.040  53.893 52.671 1.00 32.37 ? 501  SER A OG  1 
ATOM   3588 N  N   . PRO A 1 461 ? 36.222  56.214 54.092 1.00 33.15 ? 502  PRO A N   1 
ATOM   3589 C  CA  . PRO A 1 461 ? 36.285  57.590 54.546 1.00 34.28 ? 502  PRO A CA  1 
ATOM   3590 C  C   . PRO A 1 461 ? 35.346  58.473 53.738 1.00 35.37 ? 502  PRO A C   1 
ATOM   3591 O  O   . PRO A 1 461 ? 35.198  58.281 52.520 1.00 34.78 ? 502  PRO A O   1 
ATOM   3592 C  CB  . PRO A 1 461 ? 37.751  57.989 54.277 1.00 34.20 ? 502  PRO A CB  1 
ATOM   3593 C  CG  . PRO A 1 461 ? 38.249  56.984 53.244 1.00 34.69 ? 502  PRO A CG  1 
ATOM   3594 C  CD  . PRO A 1 461 ? 37.519  55.725 53.572 1.00 32.97 ? 502  PRO A CD  1 
ATOM   3595 N  N   . SER A 1 462 ? 34.710  59.429 54.413 1.00 37.64 ? 503  SER A N   1 
ATOM   3596 C  CA  . SER A 1 462 ? 33.939  60.459 53.720 1.00 41.26 ? 503  SER A CA  1 
ATOM   3597 C  C   . SER A 1 462 ? 34.810  61.239 52.744 1.00 42.67 ? 503  SER A C   1 
ATOM   3598 O  O   . SER A 1 462 ? 35.924  61.633 53.110 1.00 43.55 ? 503  SER A O   1 
ATOM   3599 C  CB  . SER A 1 462 ? 33.370  61.447 54.729 1.00 40.91 ? 503  SER A CB  1 
ATOM   3600 O  OG  . SER A 1 462 ? 32.829  62.560 54.040 1.00 44.46 ? 503  SER A OG  1 
ATOM   3601 N  N   . PRO A 1 463 ? 34.328  61.470 51.512 1.00 44.50 ? 504  PRO A N   1 
ATOM   3602 C  CA  . PRO A 1 463 ? 35.120  62.346 50.643 1.00 46.65 ? 504  PRO A CA  1 
ATOM   3603 C  C   . PRO A 1 463 ? 35.211  63.796 51.175 1.00 48.62 ? 504  PRO A C   1 
ATOM   3604 O  O   . PRO A 1 463 ? 36.234  64.466 50.971 1.00 49.34 ? 504  PRO A O   1 
ATOM   3605 C  CB  . PRO A 1 463 ? 34.404  62.267 49.287 1.00 46.10 ? 504  PRO A CB  1 
ATOM   3606 C  CG  . PRO A 1 463 ? 33.021  61.801 49.598 1.00 46.05 ? 504  PRO A CG  1 
ATOM   3607 C  CD  . PRO A 1 463 ? 33.114  60.964 50.843 1.00 44.54 ? 504  PRO A CD  1 
ATOM   3608 N  N   . GLU A 1 464 ? 34.183  64.257 51.887 1.00 50.59 ? 505  GLU A N   1 
ATOM   3609 C  CA  . GLU A 1 464 ? 34.197  65.617 52.467 1.00 52.08 ? 505  GLU A CA  1 
ATOM   3610 C  C   . GLU A 1 464 ? 34.951  65.801 53.815 1.00 52.57 ? 505  GLU A C   1 
ATOM   3611 O  O   . GLU A 1 464 ? 35.729  66.752 53.951 1.00 53.15 ? 505  GLU A O   1 
ATOM   3612 C  CB  . GLU A 1 464 ? 32.777  66.199 52.555 1.00 52.37 ? 505  GLU A CB  1 
ATOM   3613 C  CG  . GLU A 1 464 ? 31.992  66.162 51.229 1.00 54.92 ? 505  GLU A CG  1 
ATOM   3614 C  CD  . GLU A 1 464 ? 30.869  65.107 51.191 1.00 58.52 ? 505  GLU A CD  1 
ATOM   3615 O  OE1 . GLU A 1 464 ? 30.479  64.676 50.066 1.00 59.54 ? 505  GLU A OE1 1 
ATOM   3616 O  OE2 . GLU A 1 464 ? 30.360  64.725 52.280 1.00 58.95 ? 505  GLU A OE2 1 
ATOM   3617 N  N   . PHE A 1 465 ? 34.738  64.916 54.794 1.00 52.40 ? 506  PHE A N   1 
ATOM   3618 C  CA  . PHE A 1 465 ? 35.210  65.195 56.154 1.00 52.59 ? 506  PHE A CA  1 
ATOM   3619 C  C   . PHE A 1 465 ? 36.148  64.155 56.754 1.00 51.83 ? 506  PHE A C   1 
ATOM   3620 O  O   . PHE A 1 465 ? 35.857  62.952 56.760 1.00 52.11 ? 506  PHE A O   1 
ATOM   3621 C  CB  . PHE A 1 465 ? 34.028  65.421 57.103 1.00 53.39 ? 506  PHE A CB  1 
ATOM   3622 C  CG  . PHE A 1 465 ? 32.852  66.113 56.462 1.00 55.49 ? 506  PHE A CG  1 
ATOM   3623 C  CD1 . PHE A 1 465 ? 31.765  65.373 55.999 1.00 56.21 ? 506  PHE A CD1 1 
ATOM   3624 C  CD2 . PHE A 1 465 ? 32.836  67.506 56.309 1.00 57.75 ? 506  PHE A CD2 1 
ATOM   3625 C  CE1 . PHE A 1 465 ? 30.669  66.005 55.397 1.00 57.88 ? 506  PHE A CE1 1 
ATOM   3626 C  CE2 . PHE A 1 465 ? 31.744  68.153 55.701 1.00 57.80 ? 506  PHE A CE2 1 
ATOM   3627 C  CZ  . PHE A 1 465 ? 30.659  67.402 55.249 1.00 56.61 ? 506  PHE A CZ  1 
ATOM   3628 N  N   . SER A 1 466 ? 37.268  64.626 57.288 1.00 50.65 ? 507  SER A N   1 
ATOM   3629 C  CA  . SER A 1 466 ? 38.203  63.752 57.980 1.00 48.63 ? 507  SER A CA  1 
ATOM   3630 C  C   . SER A 1 466 ? 37.466  63.155 59.161 1.00 46.95 ? 507  SER A C   1 
ATOM   3631 O  O   . SER A 1 466 ? 36.691  63.851 59.839 1.00 46.95 ? 507  SER A O   1 
ATOM   3632 C  CB  . SER A 1 466 ? 39.422  64.534 58.514 1.00 49.40 ? 507  SER A CB  1 
ATOM   3633 O  OG  . SER A 1 466 ? 40.012  65.348 57.517 1.00 49.53 ? 507  SER A OG  1 
ATOM   3634 N  N   . GLY A 1 467 ? 37.714  61.875 59.416 1.00 44.07 ? 508  GLY A N   1 
ATOM   3635 C  CA  . GLY A 1 467 ? 37.229  61.246 60.643 1.00 40.86 ? 508  GLY A CA  1 
ATOM   3636 C  C   . GLY A 1 467 ? 35.737  60.958 60.611 1.00 37.88 ? 508  GLY A C   1 
ATOM   3637 O  O   . GLY A 1 467 ? 35.185  60.548 61.633 1.00 37.43 ? 508  GLY A O   1 
ATOM   3638 N  N   . MET A 1 468 ? 35.118  61.186 59.446 1.00 35.92 ? 509  MET A N   1 
ATOM   3639 C  CA  . MET A 1 468 ? 33.712  60.769 59.133 1.00 33.86 ? 509  MET A CA  1 
ATOM   3640 C  C   . MET A 1 468 ? 33.639  59.669 58.035 1.00 30.89 ? 509  MET A C   1 
ATOM   3641 O  O   . MET A 1 468 ? 34.382  59.731 57.032 1.00 30.96 ? 509  MET A O   1 
ATOM   3642 C  CB  . MET A 1 468 ? 32.880  61.921 58.569 1.00 34.61 ? 509  MET A CB  1 
ATOM   3643 C  CG  . MET A 1 468 ? 32.801  63.227 59.365 1.00 38.43 ? 509  MET A CG  1 
ATOM   3644 S  SD  . MET A 1 468 ? 32.040  63.050 60.949 1.00 46.77 ? 509  MET A SD  1 
ATOM   3645 C  CE  . MET A 1 468 ? 30.739  64.271 60.755 1.00 47.58 ? 509  MET A CE  1 
ATOM   3646 N  N   . PRO A 1 469 ? 32.681  58.724 58.172 1.00 28.22 ? 510  PRO A N   1 
ATOM   3647 C  CA  . PRO A 1 469 ? 32.480  57.689 57.132 1.00 26.62 ? 510  PRO A CA  1 
ATOM   3648 C  C   . PRO A 1 469 ? 31.626  58.189 55.954 1.00 26.40 ? 510  PRO A C   1 
ATOM   3649 O  O   . PRO A 1 469 ? 30.831  59.122 56.116 1.00 24.60 ? 510  PRO A O   1 
ATOM   3650 C  CB  . PRO A 1 469 ? 31.711  56.608 57.895 1.00 26.32 ? 510  PRO A CB  1 
ATOM   3651 C  CG  . PRO A 1 469 ? 30.828  57.380 58.852 1.00 27.01 ? 510  PRO A CG  1 
ATOM   3652 C  CD  . PRO A 1 469 ? 31.731  58.560 59.288 1.00 27.89 ? 510  PRO A CD  1 
ATOM   3653 N  N   . ARG A 1 470 ? 31.743  57.534 54.793 1.00 25.09 ? 511  ARG A N   1 
ATOM   3654 C  CA  . ARG A 1 470 ? 30.912  57.839 53.641 1.00 24.71 ? 511  ARG A CA  1 
ATOM   3655 C  C   . ARG A 1 470 ? 29.454  57.338 53.905 1.00 22.66 ? 511  ARG A C   1 
ATOM   3656 O  O   . ARG A 1 470 ? 29.218  56.233 54.391 1.00 22.40 ? 511  ARG A O   1 
ATOM   3657 C  CB  . ARG A 1 470 ? 31.500  57.113 52.391 1.00 25.35 ? 511  ARG A CB  1 
ATOM   3658 C  CG  . ARG A 1 470 ? 30.711  57.270 51.098 1.00 27.70 ? 511  ARG A CG  1 
ATOM   3659 C  CD  . ARG A 1 470 ? 31.268  56.327 50.016 1.00 30.90 ? 511  ARG A CD  1 
ATOM   3660 N  NE  . ARG A 1 470 ? 32.548  56.848 49.548 1.00 37.33 ? 511  ARG A NE  1 
ATOM   3661 C  CZ  . ARG A 1 470 ? 32.689  57.792 48.615 1.00 40.73 ? 511  ARG A CZ  1 
ATOM   3662 N  NH1 . ARG A 1 470 ? 31.612  58.315 48.041 1.00 41.89 ? 511  ARG A NH1 1 
ATOM   3663 N  NH2 . ARG A 1 470 ? 33.910  58.217 48.252 1.00 42.58 ? 511  ARG A NH2 1 
ATOM   3664 N  N   . ILE A 1 471 ? 28.477  58.189 53.579 1.00 20.35 ? 512  ILE A N   1 
ATOM   3665 C  CA  . ILE A 1 471 ? 27.058  57.748 53.540 1.00 21.02 ? 512  ILE A CA  1 
ATOM   3666 C  C   . ILE A 1 471 ? 26.521  58.254 52.214 1.00 21.39 ? 512  ILE A C   1 
ATOM   3667 O  O   . ILE A 1 471 ? 26.650  59.450 51.916 1.00 23.10 ? 512  ILE A O   1 
ATOM   3668 C  CB  . ILE A 1 471 ? 26.220  58.383 54.707 1.00 20.21 ? 512  ILE A CB  1 
ATOM   3669 C  CG1 . ILE A 1 471 ? 26.726  57.885 56.087 1.00 20.21 ? 512  ILE A CG1 1 
ATOM   3670 C  CG2 . ILE A 1 471 ? 24.667  58.188 54.474 1.00 20.50 ? 512  ILE A CG2 1 
ATOM   3671 C  CD1 . ILE A 1 471 ? 25.990  58.445 57.328 1.00 21.86 ? 512  ILE A CD1 1 
ATOM   3672 N  N   . SER A 1 472 ? 25.928  57.368 51.422 1.00 19.70 ? 513  SER A N   1 
ATOM   3673 C  CA  . SER A 1 472 ? 25.492  57.704 50.089 1.00 20.89 ? 513  SER A CA  1 
ATOM   3674 C  C   . SER A 1 472 ? 24.019  58.133 50.058 1.00 19.12 ? 513  SER A C   1 
ATOM   3675 O  O   . SER A 1 472 ? 23.281  57.961 51.042 1.00 19.04 ? 513  SER A O   1 
ATOM   3676 C  CB  . SER A 1 472 ? 25.701  56.504 49.159 1.00 21.56 ? 513  SER A CB  1 
ATOM   3677 O  OG  . SER A 1 472 ? 27.102  56.296 49.004 1.00 25.68 ? 513  SER A OG  1 
ATOM   3678 N  N   . LYS A 1 473 ? 23.652  58.684 48.905 1.00 17.99 ? 514  LYS A N   1 
ATOM   3679 C  CA  . LYS A 1 473 ? 22.283  59.216 48.664 1.00 19.55 ? 514  LYS A CA  1 
ATOM   3680 C  C   . LYS A 1 473 ? 21.386  58.059 48.297 1.00 20.74 ? 514  LYS A C   1 
ATOM   3681 O  O   . LYS A 1 473 ? 21.873  57.057 47.731 1.00 21.78 ? 514  LYS A O   1 
ATOM   3682 C  CB  . LYS A 1 473 ? 22.310  60.211 47.503 1.00 20.34 ? 514  LYS A CB  1 
ATOM   3683 C  CG  . LYS A 1 473 ? 23.262  61.415 47.750 1.00 21.73 ? 514  LYS A CG  1 
ATOM   3684 C  CD  . LYS A 1 473 ? 23.057  62.464 46.674 1.00 23.57 ? 514  LYS A CD  1 
ATOM   3685 C  CE  . LYS A 1 473 ? 23.681  62.043 45.398 1.00 26.11 ? 514  LYS A CE  1 
ATOM   3686 N  NZ  . LYS A 1 473 ? 25.140  62.252 45.554 1.00 31.25 ? 514  LYS A NZ  1 
ATOM   3687 N  N   . LEU A 1 474 ? 20.088  58.228 48.508 1.00 19.22 ? 515  LEU A N   1 
ATOM   3688 C  CA  . LEU A 1 474 ? 19.085  57.228 48.085 1.00 18.10 ? 515  LEU A CA  1 
ATOM   3689 C  C   . LEU A 1 474 ? 18.513  57.585 46.726 1.00 18.74 ? 515  LEU A C   1 
ATOM   3690 O  O   . LEU A 1 474 ? 18.052  58.706 46.476 1.00 19.11 ? 515  LEU A O   1 
ATOM   3691 C  CB  . LEU A 1 474 ? 17.915  57.174 49.081 1.00 18.97 ? 515  LEU A CB  1 
ATOM   3692 C  CG  . LEU A 1 474 ? 18.219  56.709 50.503 1.00 19.86 ? 515  LEU A CG  1 
ATOM   3693 C  CD1 . LEU A 1 474 ? 17.053  57.035 51.415 1.00 19.18 ? 515  LEU A CD1 1 
ATOM   3694 C  CD2 . LEU A 1 474 ? 18.460  55.179 50.543 1.00 20.41 ? 515  LEU A CD2 1 
ATOM   3695 N  N   . GLY A 1 475 ? 18.598  56.612 45.808 1.00 18.56 ? 516  GLY A N   1 
ATOM   3696 C  CA  . GLY A 1 475 ? 17.970  56.721 44.516 1.00 17.88 ? 516  GLY A CA  1 
ATOM   3697 C  C   . GLY A 1 475 ? 16.840  55.692 44.537 1.00 17.58 ? 516  GLY A C   1 
ATOM   3698 O  O   . GLY A 1 475 ? 15.871  55.814 45.285 1.00 16.51 ? 516  GLY A O   1 
ATOM   3699 N  N   . SER A 1 476 ? 16.975  54.630 43.729 1.00 16.75 ? 517  SER A N   1 
ATOM   3700 C  CA  . SER A 1 476 ? 16.017  53.545 43.770 1.00 16.94 ? 517  SER A CA  1 
ATOM   3701 C  C   . SER A 1 476 ? 16.784  52.208 43.755 1.00 17.82 ? 517  SER A C   1 
ATOM   3702 O  O   . SER A 1 476 ? 17.942  52.158 44.223 1.00 20.01 ? 517  SER A O   1 
ATOM   3703 C  CB  . SER A 1 476 ? 15.018  53.653 42.594 1.00 18.34 ? 517  SER A CB  1 
ATOM   3704 O  OG  . SER A 1 476 ? 13.979  52.643 42.746 1.00 21.62 ? 517  SER A OG  1 
ATOM   3705 N  N   . GLY A 1 477 ? 16.144  51.166 43.203 1.00 17.06 ? 518  GLY A N   1 
ATOM   3706 C  CA  . GLY A 1 477 ? 16.795  49.829 43.145 1.00 17.85 ? 518  GLY A CA  1 
ATOM   3707 C  C   . GLY A 1 477 ? 16.406  48.944 44.320 1.00 16.86 ? 518  GLY A C   1 
ATOM   3708 O  O   . GLY A 1 477 ? 16.948  47.814 44.464 1.00 17.80 ? 518  GLY A O   1 
ATOM   3709 N  N   . ASN A 1 478 ? 15.462  49.422 45.170 1.00 15.39 ? 519  ASN A N   1 
ATOM   3710 C  CA  . ASN A 1 478 ? 14.986  48.619 46.289 1.00 15.59 ? 519  ASN A CA  1 
ATOM   3711 C  C   . ASN A 1 478 ? 13.706  49.191 46.944 1.00 15.07 ? 519  ASN A C   1 
ATOM   3712 O  O   . ASN A 1 478 ? 13.238  50.269 46.530 1.00 14.22 ? 519  ASN A O   1 
ATOM   3713 C  CB  . ASN A 1 478 ? 16.088  48.341 47.324 1.00 15.03 ? 519  ASN A CB  1 
ATOM   3714 C  CG  . ASN A 1 478 ? 16.087  46.857 47.751 1.00 17.74 ? 519  ASN A CG  1 
ATOM   3715 O  OD1 . ASN A 1 478 ? 15.157  46.383 48.372 1.00 19.06 ? 519  ASN A OD1 1 
ATOM   3716 N  ND2 . ASN A 1 478 ? 17.125  46.115 47.268 1.00 17.65 ? 519  ASN A ND2 1 
ATOM   3717 N  N   . ASP A 1 479 ? 13.150  48.446 47.899 1.00 14.40 ? 520  ASP A N   1 
ATOM   3718 C  CA  . ASP A 1 479 ? 11.782  48.674 48.364 1.00 13.13 ? 520  ASP A CA  1 
ATOM   3719 C  C   . ASP A 1 479 ? 11.598  49.980 49.136 1.00 13.31 ? 520  ASP A C   1 
ATOM   3720 O  O   . ASP A 1 479 ? 10.463  50.343 49.372 1.00 15.22 ? 520  ASP A O   1 
ATOM   3721 C  CB  . ASP A 1 479 ? 11.257  47.498 49.213 1.00 12.83 ? 520  ASP A CB  1 
ATOM   3722 C  CG  . ASP A 1 479 ? 10.899  46.303 48.347 1.00 17.56 ? 520  ASP A CG  1 
ATOM   3723 O  OD1 . ASP A 1 479 ? 10.222  46.508 47.346 1.00 15.01 ? 520  ASP A OD1 1 
ATOM   3724 O  OD2 . ASP A 1 479 ? 11.303  45.161 48.701 1.00 19.08 ? 520  ASP A OD2 1 
ATOM   3725 N  N   . PHE A 1 480 ? 12.692  50.673 49.474 1.00 14.42 ? 521  PHE A N   1 
ATOM   3726 C  CA  . PHE A 1 480 ? 12.492  51.971 50.158 1.00 13.06 ? 521  PHE A CA  1 
ATOM   3727 C  C   . PHE A 1 480 ? 11.931  53.012 49.154 1.00 13.34 ? 521  PHE A C   1 
ATOM   3728 O  O   . PHE A 1 480 ? 11.549  54.112 49.547 1.00 14.65 ? 521  PHE A O   1 
ATOM   3729 C  CB  . PHE A 1 480 ? 13.822  52.461 50.758 1.00 15.41 ? 521  PHE A CB  1 
ATOM   3730 C  CG  . PHE A 1 480 ? 14.871  52.709 49.679 1.00 12.58 ? 521  PHE A CG  1 
ATOM   3731 C  CD1 . PHE A 1 480 ? 14.838  53.914 48.933 1.00 15.44 ? 521  PHE A CD1 1 
ATOM   3732 C  CD2 . PHE A 1 480 ? 15.805  51.696 49.305 1.00 16.34 ? 521  PHE A CD2 1 
ATOM   3733 C  CE1 . PHE A 1 480 ? 15.776  54.099 47.870 1.00 18.42 ? 521  PHE A CE1 1 
ATOM   3734 C  CE2 . PHE A 1 480 ? 16.766  51.887 48.271 1.00 20.40 ? 521  PHE A CE2 1 
ATOM   3735 C  CZ  . PHE A 1 480 ? 16.705  53.074 47.511 1.00 18.45 ? 521  PHE A CZ  1 
ATOM   3736 N  N   . GLU A 1 481 ? 12.007  52.733 47.844 1.00 14.15 ? 522  GLU A N   1 
ATOM   3737 C  CA  . GLU A 1 481 ? 11.735  53.786 46.858 1.00 13.98 ? 522  GLU A CA  1 
ATOM   3738 C  C   . GLU A 1 481 ? 10.379  54.496 47.076 1.00 13.44 ? 522  GLU A C   1 
ATOM   3739 O  O   . GLU A 1 481 ? 10.309  55.745 47.090 1.00 13.74 ? 522  GLU A O   1 
ATOM   3740 C  CB  . GLU A 1 481 ? 11.767  53.200 45.448 1.00 15.26 ? 522  GLU A CB  1 
ATOM   3741 C  CG  . GLU A 1 481 ? 11.597  54.240 44.320 1.00 15.70 ? 522  GLU A CG  1 
ATOM   3742 C  CD  . GLU A 1 481 ? 11.156  53.619 42.961 1.00 19.46 ? 522  GLU A CD  1 
ATOM   3743 O  OE1 . GLU A 1 481 ? 10.019  53.166 42.855 1.00 26.76 ? 522  GLU A OE1 1 
ATOM   3744 O  OE2 . GLU A 1 481 ? 11.904  53.655 41.974 1.00 22.06 ? 522  GLU A OE2 1 
ATOM   3745 N  N   . VAL A 1 482 ? 9.299   53.730 47.217 1.00 12.74 ? 523  VAL A N   1 
ATOM   3746 C  CA  . VAL A 1 482 ? 8.007   54.400 47.306 1.00 14.34 ? 523  VAL A CA  1 
ATOM   3747 C  C   . VAL A 1 482 ? 7.929   55.255 48.588 1.00 14.35 ? 523  VAL A C   1 
ATOM   3748 O  O   . VAL A 1 482 ? 7.376   56.358 48.554 1.00 15.41 ? 523  VAL A O   1 
ATOM   3749 C  CB  . VAL A 1 482 ? 6.845   53.413 47.203 1.00 15.74 ? 523  VAL A CB  1 
ATOM   3750 C  CG1 . VAL A 1 482 ? 6.832   52.435 48.402 1.00 12.80 ? 523  VAL A CG1 1 
ATOM   3751 C  CG2 . VAL A 1 482 ? 5.515   54.142 46.985 1.00 16.10 ? 523  VAL A CG2 1 
ATOM   3752 N  N   . PHE A 1 483 ? 8.464   54.728 49.678 1.00 13.60 ? 524  PHE A N   1 
ATOM   3753 C  CA  . PHE A 1 483 ? 8.432   55.500 50.934 1.00 13.74 ? 524  PHE A CA  1 
ATOM   3754 C  C   . PHE A 1 483 ? 9.198   56.774 50.854 1.00 14.56 ? 524  PHE A C   1 
ATOM   3755 O  O   . PHE A 1 483 ? 8.690   57.804 51.429 1.00 15.88 ? 524  PHE A O   1 
ATOM   3756 C  CB  . PHE A 1 483 ? 8.959   54.609 52.044 1.00 12.74 ? 524  PHE A CB  1 
ATOM   3757 C  CG  . PHE A 1 483 ? 8.130   53.356 52.180 1.00 13.08 ? 524  PHE A CG  1 
ATOM   3758 C  CD1 . PHE A 1 483 ? 6.920   53.391 52.871 1.00 17.01 ? 524  PHE A CD1 1 
ATOM   3759 C  CD2 . PHE A 1 483 ? 8.570   52.166 51.557 1.00 15.32 ? 524  PHE A CD2 1 
ATOM   3760 C  CE1 . PHE A 1 483 ? 6.147   52.191 52.957 1.00 19.76 ? 524  PHE A CE1 1 
ATOM   3761 C  CE2 . PHE A 1 483 ? 7.830   50.972 51.625 1.00 14.66 ? 524  PHE A CE2 1 
ATOM   3762 C  CZ  . PHE A 1 483 ? 6.628   50.985 52.310 1.00 16.78 ? 524  PHE A CZ  1 
ATOM   3763 N  N   . PHE A 1 484 ? 10.382  56.771 50.216 1.00 13.95 ? 525  PHE A N   1 
ATOM   3764 C  CA  . PHE A 1 484 ? 11.255  57.971 50.241 1.00 14.04 ? 525  PHE A CA  1 
ATOM   3765 C  C   . PHE A 1 484 ? 10.931  58.900 49.094 1.00 13.69 ? 525  PHE A C   1 
ATOM   3766 O  O   . PHE A 1 484 ? 10.596  60.103 49.299 1.00 15.17 ? 525  PHE A O   1 
ATOM   3767 C  CB  . PHE A 1 484 ? 12.712  57.566 50.135 1.00 14.82 ? 525  PHE A CB  1 
ATOM   3768 C  CG  . PHE A 1 484 ? 13.635  58.701 50.394 1.00 13.91 ? 525  PHE A CG  1 
ATOM   3769 C  CD1 . PHE A 1 484 ? 13.602  59.329 51.680 1.00 13.23 ? 525  PHE A CD1 1 
ATOM   3770 C  CD2 . PHE A 1 484 ? 14.502  59.161 49.414 1.00 14.82 ? 525  PHE A CD2 1 
ATOM   3771 C  CE1 . PHE A 1 484 ? 14.491  60.392 51.948 1.00 14.48 ? 525  PHE A CE1 1 
ATOM   3772 C  CE2 . PHE A 1 484 ? 15.401  60.216 49.677 1.00 17.07 ? 525  PHE A CE2 1 
ATOM   3773 C  CZ  . PHE A 1 484 ? 15.371  60.846 50.983 1.00 16.06 ? 525  PHE A CZ  1 
ATOM   3774 N  N   . GLN A 1 485 ? 10.912  58.334 47.859 1.00 12.43 ? 526  GLN A N   1 
ATOM   3775 C  CA  . GLN A 1 485 ? 10.795  59.201 46.681 1.00 12.29 ? 526  GLN A CA  1 
ATOM   3776 C  C   . GLN A 1 485 ? 9.338   59.639 46.383 1.00 11.73 ? 526  GLN A C   1 
ATOM   3777 O  O   . GLN A 1 485 ? 9.134   60.757 45.775 1.00 14.05 ? 526  GLN A O   1 
ATOM   3778 C  CB  . GLN A 1 485 ? 11.333  58.462 45.401 1.00 13.91 ? 526  GLN A CB  1 
ATOM   3779 C  CG  . GLN A 1 485 ? 12.792  57.902 45.519 1.00 14.90 ? 526  GLN A CG  1 
ATOM   3780 C  CD  . GLN A 1 485 ? 13.845  58.986 45.699 1.00 16.04 ? 526  GLN A CD  1 
ATOM   3781 O  OE1 . GLN A 1 485 ? 13.546  60.202 45.596 1.00 17.52 ? 526  GLN A OE1 1 
ATOM   3782 N  NE2 . GLN A 1 485 ? 15.096  58.575 45.911 1.00 16.64 ? 526  GLN A NE2 1 
ATOM   3783 N  N   . ARG A 1 486 ? 8.364   58.764 46.730 1.00 12.22 ? 527  ARG A N   1 
ATOM   3784 C  CA  . ARG A 1 486 ? 6.963   59.125 46.453 1.00 12.95 ? 527  ARG A CA  1 
ATOM   3785 C  C   . ARG A 1 486 ? 6.346   59.834 47.639 1.00 15.26 ? 527  ARG A C   1 
ATOM   3786 O  O   . ARG A 1 486 ? 5.750   60.905 47.496 1.00 14.41 ? 527  ARG A O   1 
ATOM   3787 C  CB  . ARG A 1 486 ? 6.091   57.939 45.994 1.00 14.84 ? 527  ARG A CB  1 
ATOM   3788 C  CG  . ARG A 1 486 ? 4.802   58.471 45.414 1.00 14.37 ? 527  ARG A CG  1 
ATOM   3789 C  CD  . ARG A 1 486 ? 3.637   57.466 45.180 1.00 15.26 ? 527  ARG A CD  1 
ATOM   3790 N  NE  . ARG A 1 486 ? 4.063   56.378 44.264 1.00 14.44 ? 527  ARG A NE  1 
ATOM   3791 C  CZ  . ARG A 1 486 ? 3.152   55.566 43.678 1.00 14.54 ? 527  ARG A CZ  1 
ATOM   3792 N  NH1 . ARG A 1 486 ? 1.845   55.702 43.928 1.00 15.17 ? 527  ARG A NH1 1 
ATOM   3793 N  NH2 . ARG A 1 486 ? 3.539   54.557 42.874 1.00 14.02 ? 527  ARG A NH2 1 
ATOM   3794 N  N   . LEU A 1 487 ? 6.503   59.231 48.824 1.00 13.80 ? 528  LEU A N   1 
ATOM   3795 C  CA  . LEU A 1 487 ? 5.822   59.731 49.992 1.00 14.17 ? 528  LEU A CA  1 
ATOM   3796 C  C   . LEU A 1 487 ? 6.626   60.673 50.905 1.00 15.32 ? 528  LEU A C   1 
ATOM   3797 O  O   . LEU A 1 487 ? 5.999   61.320 51.743 1.00 16.73 ? 528  LEU A O   1 
ATOM   3798 C  CB  . LEU A 1 487 ? 5.348   58.542 50.832 1.00 12.89 ? 528  LEU A CB  1 
ATOM   3799 C  CG  . LEU A 1 487 ? 4.373   57.604 50.070 1.00 13.31 ? 528  LEU A CG  1 
ATOM   3800 C  CD1 . LEU A 1 487 ? 3.860   56.481 50.981 1.00 17.83 ? 528  LEU A CD1 1 
ATOM   3801 C  CD2 . LEU A 1 487 ? 3.103   58.381 49.463 1.00 18.16 ? 528  LEU A CD2 1 
ATOM   3802 N  N   . GLY A 1 488 ? 7.948   60.715 50.827 1.00 13.12 ? 529  GLY A N   1 
ATOM   3803 C  CA  . GLY A 1 488 ? 8.722   61.645 51.652 1.00 13.65 ? 529  GLY A CA  1 
ATOM   3804 C  C   . GLY A 1 488 ? 8.798   61.197 53.077 1.00 13.21 ? 529  GLY A C   1 
ATOM   3805 O  O   . GLY A 1 488 ? 8.810   62.096 53.971 1.00 13.40 ? 529  GLY A O   1 
ATOM   3806 N  N   . ILE A 1 489 ? 8.938   59.886 53.305 1.00 12.86 ? 530  ILE A N   1 
ATOM   3807 C  CA  . ILE A 1 489 ? 9.180   59.347 54.673 1.00 12.62 ? 530  ILE A CA  1 
ATOM   3808 C  C   . ILE A 1 489 ? 10.698  59.097 54.814 1.00 13.50 ? 530  ILE A C   1 
ATOM   3809 O  O   . ILE A 1 489 ? 11.329  58.482 53.934 1.00 14.70 ? 530  ILE A O   1 
ATOM   3810 C  CB  . ILE A 1 489 ? 8.406   58.071 54.849 1.00 12.78 ? 530  ILE A CB  1 
ATOM   3811 C  CG1 . ILE A 1 489 ? 6.884   58.362 54.850 1.00 13.82 ? 530  ILE A CG1 1 
ATOM   3812 C  CG2 . ILE A 1 489 ? 8.845   57.374 56.166 1.00 14.39 ? 530  ILE A CG2 1 
ATOM   3813 C  CD1 . ILE A 1 489 ? 6.051   57.128 54.664 1.00 15.06 ? 530  ILE A CD1 1 
ATOM   3814 N  N   . ALA A 1 490 ? 11.314  59.660 55.877 1.00 14.04 ? 531  ALA A N   1 
ATOM   3815 C  CA  . ALA A 1 490 ? 12.762  59.502 56.113 1.00 14.26 ? 531  ALA A CA  1 
ATOM   3816 C  C   . ALA A 1 490 ? 13.132  58.013 56.010 1.00 13.33 ? 531  ALA A C   1 
ATOM   3817 O  O   . ALA A 1 490 ? 12.485  57.186 56.669 1.00 13.91 ? 531  ALA A O   1 
ATOM   3818 C  CB  . ALA A 1 490 ? 13.080  59.988 57.574 1.00 15.09 ? 531  ALA A CB  1 
ATOM   3819 N  N   . SER A 1 491 ? 14.112  57.690 55.165 1.00 14.66 ? 532  SER A N   1 
ATOM   3820 C  CA  . SER A 1 491 ? 14.461  56.269 54.943 1.00 13.88 ? 532  SER A CA  1 
ATOM   3821 C  C   . SER A 1 491 ? 15.977  56.046 55.052 1.00 14.81 ? 532  SER A C   1 
ATOM   3822 O  O   . SER A 1 491 ? 16.813  56.947 54.779 1.00 15.06 ? 532  SER A O   1 
ATOM   3823 C  CB  . SER A 1 491 ? 13.975  55.853 53.516 1.00 14.92 ? 532  SER A CB  1 
ATOM   3824 O  OG  . SER A 1 491 ? 12.549  55.952 53.410 1.00 15.05 ? 532  SER A OG  1 
ATOM   3825 N  N   . GLY A 1 492 ? 16.328  54.785 55.342 1.00 14.51 ? 533  GLY A N   1 
ATOM   3826 C  CA  . GLY A 1 492 ? 17.759  54.424 55.373 1.00 15.60 ? 533  GLY A CA  1 
ATOM   3827 C  C   . GLY A 1 492 ? 17.923  52.914 55.099 1.00 15.13 ? 533  GLY A C   1 
ATOM   3828 O  O   . GLY A 1 492 ? 16.974  52.112 55.159 1.00 16.10 ? 533  GLY A O   1 
ATOM   3829 N  N   . ARG A 1 493 ? 19.182  52.582 54.828 1.00 16.55 ? 534  ARG A N   1 
ATOM   3830 C  CA  . ARG A 1 493 ? 19.550  51.185 54.597 1.00 18.00 ? 534  ARG A CA  1 
ATOM   3831 C  C   . ARG A 1 493 ? 21.017  51.026 55.016 1.00 17.23 ? 534  ARG A C   1 
ATOM   3832 O  O   . ARG A 1 493 ? 21.818  51.987 54.935 1.00 17.29 ? 534  ARG A O   1 
ATOM   3833 C  CB  . ARG A 1 493 ? 19.344  50.808 53.129 1.00 19.38 ? 534  ARG A CB  1 
ATOM   3834 C  CG  . ARG A 1 493 ? 20.193  51.483 52.129 1.00 19.23 ? 534  ARG A CG  1 
ATOM   3835 C  CD  . ARG A 1 493 ? 19.593  51.327 50.667 1.00 22.32 ? 534  ARG A CD  1 
ATOM   3836 N  NE  . ARG A 1 493 ? 19.531  49.915 50.250 1.00 22.54 ? 534  ARG A NE  1 
ATOM   3837 C  CZ  . ARG A 1 493 ? 19.673  49.481 48.990 1.00 24.29 ? 534  ARG A CZ  1 
ATOM   3838 N  NH1 . ARG A 1 493 ? 19.557  48.161 48.723 1.00 25.35 ? 534  ARG A NH1 1 
ATOM   3839 N  NH2 . ARG A 1 493 ? 19.841  50.348 48.006 1.00 24.56 ? 534  ARG A NH2 1 
ATOM   3840 N  N   . ALA A 1 494 ? 21.373  49.780 55.400 1.00 16.63 ? 535  ALA A N   1 
ATOM   3841 C  CA  . ALA A 1 494 ? 22.787  49.503 55.802 1.00 17.88 ? 535  ALA A CA  1 
ATOM   3842 C  C   . ALA A 1 494 ? 23.027  48.017 55.480 1.00 18.84 ? 535  ALA A C   1 
ATOM   3843 O  O   . ALA A 1 494 ? 22.138  47.190 55.626 1.00 18.14 ? 535  ALA A O   1 
ATOM   3844 C  CB  . ALA A 1 494 ? 22.976  49.747 57.294 1.00 18.25 ? 535  ALA A CB  1 
ATOM   3845 N  N   . ARG A 1 495 ? 24.238  47.712 55.059 1.00 19.19 ? 536  ARG A N   1 
ATOM   3846 C  CA  . ARG A 1 495 ? 24.621  46.325 54.744 1.00 19.88 ? 536  ARG A CA  1 
ATOM   3847 C  C   . ARG A 1 495 ? 26.119  46.277 54.797 1.00 20.03 ? 536  ARG A C   1 
ATOM   3848 O  O   . ARG A 1 495 ? 26.796  47.302 54.708 1.00 19.01 ? 536  ARG A O   1 
ATOM   3849 C  CB  A ARG A 1 495 ? 24.101  45.827 53.375 0.65 20.98 ? 536  ARG A CB  1 
ATOM   3850 C  CB  B ARG A 1 495 ? 24.187  45.949 53.318 0.35 20.01 ? 536  ARG A CB  1 
ATOM   3851 C  CG  A ARG A 1 495 ? 24.420  46.705 52.154 0.65 21.28 ? 536  ARG A CG  1 
ATOM   3852 C  CG  B ARG A 1 495 ? 24.949  46.677 52.175 0.35 17.96 ? 536  ARG A CG  1 
ATOM   3853 C  CD  A ARG A 1 495 ? 23.224  47.648 51.919 0.65 26.56 ? 536  ARG A CD  1 
ATOM   3854 C  CD  B ARG A 1 495 ? 24.466  46.239 50.818 0.35 20.81 ? 536  ARG A CD  1 
ATOM   3855 N  NE  A ARG A 1 495 ? 23.321  48.429 50.688 0.65 28.34 ? 536  ARG A NE  1 
ATOM   3856 N  NE  B ARG A 1 495 ? 23.047  45.909 50.892 0.35 17.37 ? 536  ARG A NE  1 
ATOM   3857 C  CZ  A ARG A 1 495 ? 23.418  49.758 50.667 0.65 28.58 ? 536  ARG A CZ  1 
ATOM   3858 C  CZ  B ARG A 1 495 ? 22.257  45.564 49.883 0.35 17.64 ? 536  ARG A CZ  1 
ATOM   3859 N  NH1 A ARG A 1 495 ? 23.497  50.387 49.509 0.65 23.08 ? 536  ARG A NH1 1 
ATOM   3860 N  NH1 B ARG A 1 495 ? 22.712  45.513 48.645 0.35 22.75 ? 536  ARG A NH1 1 
ATOM   3861 N  NH2 A ARG A 1 495 ? 23.443  50.439 51.823 0.65 27.49 ? 536  ARG A NH2 1 
ATOM   3862 N  NH2 B ARG A 1 495 ? 20.998  45.255 50.141 0.35 10.54 ? 536  ARG A NH2 1 
ATOM   3863 N  N   . TYR A 1 496 ? 26.634  45.047 54.805 1.00 20.43 ? 537  TYR A N   1 
ATOM   3864 C  CA  . TYR A 1 496 ? 28.084  44.880 54.613 1.00 21.50 ? 537  TYR A CA  1 
ATOM   3865 C  C   . TYR A 1 496 ? 28.387  44.728 53.141 1.00 22.33 ? 537  TYR A C   1 
ATOM   3866 O  O   . TYR A 1 496 ? 27.583  44.136 52.412 1.00 21.52 ? 537  TYR A O   1 
ATOM   3867 C  CB  . TYR A 1 496 ? 28.631  43.692 55.425 1.00 22.02 ? 537  TYR A CB  1 
ATOM   3868 C  CG  . TYR A 1 496 ? 29.597  44.184 56.486 1.00 23.40 ? 537  TYR A CG  1 
ATOM   3869 C  CD1 . TYR A 1 496 ? 29.122  44.902 57.565 1.00 23.79 ? 537  TYR A CD1 1 
ATOM   3870 C  CD2 . TYR A 1 496 ? 30.988  43.974 56.398 1.00 24.41 ? 537  TYR A CD2 1 
ATOM   3871 C  CE1 . TYR A 1 496 ? 29.999  45.381 58.572 1.00 24.41 ? 537  TYR A CE1 1 
ATOM   3872 C  CE2 . TYR A 1 496 ? 31.861  44.479 57.386 1.00 25.19 ? 537  TYR A CE2 1 
ATOM   3873 C  CZ  . TYR A 1 496 ? 31.354  45.164 58.473 1.00 25.25 ? 537  TYR A CZ  1 
ATOM   3874 O  OH  . TYR A 1 496 ? 32.180  45.669 59.465 1.00 25.10 ? 537  TYR A OH  1 
ATOM   3875 N  N   . THR A 1 497 ? 29.517  45.282 52.710 1.00 22.93 ? 538  THR A N   1 
ATOM   3876 C  CA  . THR A 1 497 ? 29.858  45.371 51.313 1.00 24.31 ? 538  THR A CA  1 
ATOM   3877 C  C   . THR A 1 497 ? 31.351  45.003 51.075 1.00 26.91 ? 538  THR A C   1 
ATOM   3878 O  O   . THR A 1 497 ? 32.136  44.852 52.024 1.00 25.59 ? 538  THR A O   1 
ATOM   3879 C  CB  . THR A 1 497 ? 29.579  46.804 50.736 1.00 25.54 ? 538  THR A CB  1 
ATOM   3880 O  OG1 . THR A 1 497 ? 29.703  46.793 49.310 1.00 27.12 ? 538  THR A OG1 1 
ATOM   3881 C  CG2 . THR A 1 497 ? 30.562  47.818 51.303 1.00 23.92 ? 538  THR A CG2 1 
ATOM   3882 N  N   . LYS A 1 498 ? 31.709  44.869 49.802 1.00 29.76 ? 539  LYS A N   1 
ATOM   3883 C  CA  . LYS A 1 498 ? 33.106  44.635 49.403 1.00 34.02 ? 539  LYS A CA  1 
ATOM   3884 C  C   . LYS A 1 498 ? 33.952  45.906 49.247 1.00 35.65 ? 539  LYS A C   1 
ATOM   3885 O  O   . LYS A 1 498 ? 33.415  47.009 49.301 1.00 35.74 ? 539  LYS A O   1 
ATOM   3886 C  CB  . LYS A 1 498 ? 33.161  43.797 48.114 1.00 34.60 ? 539  LYS A CB  1 
ATOM   3887 C  CG  . LYS A 1 498 ? 31.924  43.790 47.272 1.00 39.22 ? 539  LYS A CG  1 
ATOM   3888 C  CD  . LYS A 1 498 ? 31.773  45.036 46.413 1.00 43.86 ? 539  LYS A CD  1 
ATOM   3889 C  CE  . LYS A 1 498 ? 30.337  45.101 45.807 1.00 48.36 ? 539  LYS A CE  1 
ATOM   3890 N  NZ  . LYS A 1 498 ? 30.281  45.045 44.303 1.00 47.46 ? 539  LYS A NZ  1 
ATOM   3891 N  N   . ASN A 1 499 ? 35.274  45.732 49.094 1.00 37.33 ? 540  ASN A N   1 
ATOM   3892 C  CA  . ASN A 1 499 ? 36.196  46.806 48.726 1.00 39.84 ? 540  ASN A CA  1 
ATOM   3893 C  C   . ASN A 1 499 ? 36.184  46.994 47.221 1.00 41.10 ? 540  ASN A C   1 
ATOM   3894 O  O   . ASN A 1 499 ? 35.353  47.735 46.685 1.00 42.36 ? 540  ASN A O   1 
ATOM   3895 C  CB  . ASN A 1 499 ? 37.637  46.476 49.165 1.00 39.76 ? 540  ASN A CB  1 
ATOM   3896 C  CG  . ASN A 1 499 ? 38.565  47.704 49.153 1.00 43.25 ? 540  ASN A CG  1 
ATOM   3897 O  OD1 . ASN A 1 499 ? 38.208  48.800 48.682 1.00 44.26 ? 540  ASN A OD1 1 
ATOM   3898 N  ND2 . ASN A 1 499 ? 39.780  47.513 49.680 1.00 44.99 ? 540  ASN A ND2 1 
ATOM   3899 N  N   . ASN A 1 503 ? 33.015  48.763 41.267 1.00 50.25 ? 544  ASN A N   1 
ATOM   3900 C  CA  . ASN A 1 503 ? 31.887  47.847 41.068 1.00 50.21 ? 544  ASN A CA  1 
ATOM   3901 C  C   . ASN A 1 503 ? 30.623  48.127 41.899 1.00 49.12 ? 544  ASN A C   1 
ATOM   3902 O  O   . ASN A 1 503 ? 29.736  47.263 41.977 1.00 49.44 ? 544  ASN A O   1 
ATOM   3903 C  CB  . ASN A 1 503 ? 32.335  46.385 41.226 1.00 51.10 ? 544  ASN A CB  1 
ATOM   3904 C  CG  . ASN A 1 503 ? 32.683  45.740 39.885 1.00 53.69 ? 544  ASN A CG  1 
ATOM   3905 O  OD1 . ASN A 1 503 ? 33.417  46.322 39.070 1.00 57.75 ? 544  ASN A OD1 1 
ATOM   3906 N  ND2 . ASN A 1 503 ? 32.143  44.542 39.642 1.00 54.67 ? 544  ASN A ND2 1 
ATOM   3907 N  N   . LYS A 1 504 ? 30.541  49.337 42.474 1.00 47.71 ? 545  LYS A N   1 
ATOM   3908 C  CA  . LYS A 1 504 ? 29.461  49.749 43.386 1.00 46.11 ? 545  LYS A CA  1 
ATOM   3909 C  C   . LYS A 1 504 ? 28.022  49.374 42.928 1.00 44.41 ? 545  LYS A C   1 
ATOM   3910 O  O   . LYS A 1 504 ? 27.249  48.794 43.706 1.00 44.53 ? 545  LYS A O   1 
ATOM   3911 C  CB  . LYS A 1 504 ? 29.560  51.267 43.684 1.00 46.73 ? 545  LYS A CB  1 
ATOM   3912 C  CG  . LYS A 1 504 ? 28.365  51.835 44.441 1.00 46.36 ? 545  LYS A CG  1 
ATOM   3913 C  CD  . LYS A 1 504 ? 28.590  53.265 44.958 1.00 47.74 ? 545  LYS A CD  1 
ATOM   3914 C  CE  . LYS A 1 504 ? 27.355  53.762 45.774 1.00 48.29 ? 545  LYS A CE  1 
ATOM   3915 N  NZ  . LYS A 1 504 ? 27.342  55.237 46.072 1.00 48.48 ? 545  LYS A NZ  1 
ATOM   3916 N  N   . PHE A 1 505 ? 27.683  49.693 41.681 1.00 41.74 ? 546  PHE A N   1 
ATOM   3917 C  CA  . PHE A 1 505 ? 26.341  49.413 41.149 1.00 39.97 ? 546  PHE A CA  1 
ATOM   3918 C  C   . PHE A 1 505 ? 26.273  48.111 40.348 1.00 39.31 ? 546  PHE A C   1 
ATOM   3919 O  O   . PHE A 1 505 ? 25.228  47.790 39.786 1.00 38.80 ? 546  PHE A O   1 
ATOM   3920 C  CB  . PHE A 1 505 ? 25.819  50.586 40.297 1.00 39.30 ? 546  PHE A CB  1 
ATOM   3921 C  CG  . PHE A 1 505 ? 25.769  51.907 41.047 1.00 38.83 ? 546  PHE A CG  1 
ATOM   3922 C  CD1 . PHE A 1 505 ? 26.526  53.000 40.607 1.00 40.84 ? 546  PHE A CD1 1 
ATOM   3923 C  CD2 . PHE A 1 505 ? 25.015  52.035 42.219 1.00 37.75 ? 546  PHE A CD2 1 
ATOM   3924 C  CE1 . PHE A 1 505 ? 26.501  54.215 41.294 1.00 38.87 ? 546  PHE A CE1 1 
ATOM   3925 C  CE2 . PHE A 1 505 ? 24.979  53.244 42.928 1.00 37.27 ? 546  PHE A CE2 1 
ATOM   3926 C  CZ  . PHE A 1 505 ? 25.721  54.334 42.473 1.00 37.68 ? 546  PHE A CZ  1 
ATOM   3927 N  N   . SER A 1 506 ? 27.364  47.347 40.313 1.00 38.14 ? 547  SER A N   1 
ATOM   3928 C  CA  . SER A 1 506 ? 27.410  46.166 39.401 1.00 37.23 ? 547  SER A CA  1 
ATOM   3929 C  C   . SER A 1 506 ? 26.882  44.860 40.046 1.00 37.14 ? 547  SER A C   1 
ATOM   3930 O  O   . SER A 1 506 ? 26.335  43.967 39.345 1.00 36.83 ? 547  SER A O   1 
ATOM   3931 C  CB  . SER A 1 506 ? 28.829  45.965 38.877 1.00 37.01 ? 547  SER A CB  1 
ATOM   3932 O  OG  A SER A 1 506 ? 29.331  47.131 38.218 0.50 32.45 ? 547  SER A OG  1 
ATOM   3933 O  OG  B SER A 1 506 ? 29.648  45.515 39.940 0.50 39.21 ? 547  SER A OG  1 
ATOM   3934 N  N   . GLY A 1 507 ? 26.991  44.785 41.382 1.00 36.03 ? 548  GLY A N   1 
ATOM   3935 C  CA  . GLY A 1 507 ? 26.638  43.572 42.134 1.00 35.16 ? 548  GLY A CA  1 
ATOM   3936 C  C   . GLY A 1 507 ? 27.859  42.666 42.310 1.00 33.42 ? 548  GLY A C   1 
ATOM   3937 O  O   . GLY A 1 507 ? 28.829  42.768 41.539 1.00 34.63 ? 548  GLY A O   1 
ATOM   3938 N  N   . TYR A 1 508 ? 27.793  41.825 43.347 1.00 29.73 ? 549  TYR A N   1 
ATOM   3939 C  CA  . TYR A 1 508 ? 28.743  40.750 43.629 1.00 26.16 ? 549  TYR A CA  1 
ATOM   3940 C  C   . TYR A 1 508 ? 28.622  39.714 42.481 1.00 23.83 ? 549  TYR A C   1 
ATOM   3941 O  O   . TYR A 1 508 ? 27.641  39.713 41.731 1.00 22.25 ? 549  TYR A O   1 
ATOM   3942 C  CB  . TYR A 1 508 ? 28.429  40.127 44.998 1.00 24.35 ? 549  TYR A CB  1 
ATOM   3943 C  CG  . TYR A 1 508 ? 26.966  39.773 45.194 1.00 24.17 ? 549  TYR A CG  1 
ATOM   3944 C  CD1 . TYR A 1 508 ? 26.482  38.474 45.000 1.00 21.52 ? 549  TYR A CD1 1 
ATOM   3945 C  CD2 . TYR A 1 508 ? 26.060  40.749 45.599 1.00 23.99 ? 549  TYR A CD2 1 
ATOM   3946 C  CE1 . TYR A 1 508 ? 25.115  38.149 45.141 1.00 19.89 ? 549  TYR A CE1 1 
ATOM   3947 C  CE2 . TYR A 1 508 ? 24.724  40.452 45.788 1.00 22.65 ? 549  TYR A CE2 1 
ATOM   3948 C  CZ  . TYR A 1 508 ? 24.227  39.182 45.533 1.00 20.45 ? 549  TYR A CZ  1 
ATOM   3949 O  OH  . TYR A 1 508 ? 22.910  38.926 45.758 1.00 21.66 ? 549  TYR A OH  1 
ATOM   3950 N  N   . PRO A 1 509 ? 29.671  38.890 42.254 1.00 22.16 ? 550  PRO A N   1 
ATOM   3951 C  CA  . PRO A 1 509 ? 29.687  38.049 41.050 1.00 21.74 ? 550  PRO A CA  1 
ATOM   3952 C  C   . PRO A 1 509 ? 28.478  37.136 40.860 1.00 19.04 ? 550  PRO A C   1 
ATOM   3953 O  O   . PRO A 1 509 ? 28.043  37.016 39.720 1.00 20.86 ? 550  PRO A O   1 
ATOM   3954 C  CB  . PRO A 1 509 ? 30.969  37.225 41.244 1.00 20.71 ? 550  PRO A CB  1 
ATOM   3955 C  CG  . PRO A 1 509 ? 31.894  38.182 41.996 1.00 23.46 ? 550  PRO A CG  1 
ATOM   3956 C  CD  . PRO A 1 509 ? 30.943  38.816 43.008 1.00 23.16 ? 550  PRO A CD  1 
ATOM   3957 N  N   . LEU A 1 510 ? 27.962  36.546 41.935 1.00 18.82 ? 551  LEU A N   1 
ATOM   3958 C  CA  . LEU A 1 510 ? 26.878  35.533 41.788 1.00 19.18 ? 551  LEU A CA  1 
ATOM   3959 C  C   . LEU A 1 510 ? 25.473  36.129 41.866 1.00 19.16 ? 551  LEU A C   1 
ATOM   3960 O  O   . LEU A 1 510 ? 24.465  35.397 41.967 1.00 19.94 ? 551  LEU A O   1 
ATOM   3961 C  CB  . LEU A 1 510 ? 27.017  34.395 42.777 1.00 19.23 ? 551  LEU A CB  1 
ATOM   3962 C  CG  . LEU A 1 510 ? 28.354  33.633 42.529 1.00 20.02 ? 551  LEU A CG  1 
ATOM   3963 C  CD1 . LEU A 1 510 ? 28.610  32.616 43.604 1.00 20.30 ? 551  LEU A CD1 1 
ATOM   3964 C  CD2 . LEU A 1 510 ? 28.309  32.953 41.113 1.00 18.57 ? 551  LEU A CD2 1 
ATOM   3965 N  N   . TYR A 1 511 ? 25.440  37.460 41.836 1.00 18.86 ? 552  TYR A N   1 
ATOM   3966 C  CA  . TYR A 1 511 ? 24.122  38.151 41.872 1.00 18.35 ? 552  TYR A CA  1 
ATOM   3967 C  C   . TYR A 1 511 ? 23.069  37.586 40.899 1.00 16.70 ? 552  TYR A C   1 
ATOM   3968 O  O   . TYR A 1 511 ? 23.292  37.607 39.664 1.00 18.16 ? 552  TYR A O   1 
ATOM   3969 C  CB  . TYR A 1 511 ? 24.444  39.631 41.568 1.00 17.85 ? 552  TYR A CB  1 
ATOM   3970 C  CG  . TYR A 1 511 ? 23.267  40.623 41.545 1.00 18.65 ? 552  TYR A CG  1 
ATOM   3971 C  CD1 . TYR A 1 511 ? 22.395  40.759 42.662 1.00 21.16 ? 552  TYR A CD1 1 
ATOM   3972 C  CD2 . TYR A 1 511 ? 23.026  41.404 40.397 1.00 20.98 ? 552  TYR A CD2 1 
ATOM   3973 C  CE1 . TYR A 1 511 ? 21.318  41.686 42.606 1.00 20.05 ? 552  TYR A CE1 1 
ATOM   3974 C  CE2 . TYR A 1 511 ? 21.984  42.342 40.376 1.00 19.38 ? 552  TYR A CE2 1 
ATOM   3975 C  CZ  . TYR A 1 511 ? 21.133  42.439 41.455 1.00 17.28 ? 552  TYR A CZ  1 
ATOM   3976 O  OH  . TYR A 1 511 ? 20.103  43.396 41.341 1.00 19.03 ? 552  TYR A OH  1 
ATOM   3977 N  N   . HIS A 1 512 ? 21.902  37.155 41.438 1.00 17.03 ? 553  HIS A N   1 
ATOM   3978 C  CA  . HIS A 1 512 ? 20.686  36.771 40.645 1.00 15.81 ? 553  HIS A CA  1 
ATOM   3979 C  C   . HIS A 1 512 ? 20.959  35.522 39.777 1.00 15.60 ? 553  HIS A C   1 
ATOM   3980 O  O   . HIS A 1 512 ? 20.237  35.247 38.805 1.00 18.18 ? 553  HIS A O   1 
ATOM   3981 C  CB  . HIS A 1 512 ? 20.225  37.910 39.731 1.00 15.51 ? 553  HIS A CB  1 
ATOM   3982 C  CG  . HIS A 1 512 ? 19.452  39.009 40.454 1.00 16.27 ? 553  HIS A CG  1 
ATOM   3983 N  ND1 . HIS A 1 512 ? 18.834  40.038 39.763 1.00 16.31 ? 553  HIS A ND1 1 
ATOM   3984 C  CD2 . HIS A 1 512 ? 19.248  39.256 41.773 1.00 17.37 ? 553  HIS A CD2 1 
ATOM   3985 C  CE1 . HIS A 1 512 ? 18.211  40.835 40.627 1.00 17.48 ? 553  HIS A CE1 1 
ATOM   3986 N  NE2 . HIS A 1 512 ? 18.407  40.365 41.849 1.00 16.80 ? 553  HIS A NE2 1 
ATOM   3987 N  N   . SER A 1 513 ? 21.955  34.798 40.236 1.00 18.56 ? 554  SER A N   1 
ATOM   3988 C  CA  . SER A 1 513 ? 22.296  33.540 39.555 1.00 17.11 ? 554  SER A CA  1 
ATOM   3989 C  C   . SER A 1 513 ? 21.833  32.311 40.476 1.00 20.11 ? 554  SER A C   1 
ATOM   3990 O  O   . SER A 1 513 ? 21.609  32.435 41.648 1.00 20.02 ? 554  SER A O   1 
ATOM   3991 C  CB  . SER A 1 513 ? 23.805  33.489 39.307 1.00 16.76 ? 554  SER A CB  1 
ATOM   3992 O  OG  A SER A 1 513 ? 24.488  33.256 40.520 0.50 19.12 ? 554  SER A OG  1 
ATOM   3993 O  OG  B SER A 1 513 ? 24.323  32.117 39.103 0.50 18.87 ? 554  SER A OG  1 
ATOM   3994 N  N   . VAL A 1 514 ? 21.664  31.162 39.805 1.00 18.40 ? 555  VAL A N   1 
ATOM   3995 C  CA  . VAL A 1 514 ? 21.380  29.909 40.552 1.00 19.51 ? 555  VAL A CA  1 
ATOM   3996 C  C   . VAL A 1 514 ? 22.444  29.600 41.653 1.00 19.81 ? 555  VAL A C   1 
ATOM   3997 O  O   . VAL A 1 514 ? 22.118  28.829 42.597 1.00 21.61 ? 555  VAL A O   1 
ATOM   3998 C  CB  . VAL A 1 514 ? 21.261  28.700 39.582 1.00 19.90 ? 555  VAL A CB  1 
ATOM   3999 C  CG1 . VAL A 1 514 ? 22.670  28.307 39.063 1.00 21.33 ? 555  VAL A CG1 1 
ATOM   4000 C  CG2 . VAL A 1 514 ? 20.625  27.505 40.250 1.00 20.78 ? 555  VAL A CG2 1 
ATOM   4001 N  N   . TYR A 1 515 ? 23.662  30.184 41.563 1.00 18.50 ? 556  TYR A N   1 
ATOM   4002 C  CA  . TYR A 1 515 ? 24.775  29.831 42.472 1.00 20.57 ? 556  TYR A CA  1 
ATOM   4003 C  C   . TYR A 1 515 ? 24.686  30.582 43.800 1.00 21.34 ? 556  TYR A C   1 
ATOM   4004 O  O   . TYR A 1 515 ? 25.442  30.306 44.755 1.00 22.66 ? 556  TYR A O   1 
ATOM   4005 C  CB  . TYR A 1 515 ? 26.133  30.059 41.782 1.00 20.15 ? 556  TYR A CB  1 
ATOM   4006 C  CG  . TYR A 1 515 ? 26.221  29.272 40.499 1.00 19.24 ? 556  TYR A CG  1 
ATOM   4007 C  CD1 . TYR A 1 515 ? 26.139  27.875 40.528 1.00 21.96 ? 556  TYR A CD1 1 
ATOM   4008 C  CD2 . TYR A 1 515 ? 26.358  29.894 39.292 1.00 20.49 ? 556  TYR A CD2 1 
ATOM   4009 C  CE1 . TYR A 1 515 ? 26.196  27.128 39.358 1.00 20.36 ? 556  TYR A CE1 1 
ATOM   4010 C  CE2 . TYR A 1 515 ? 26.418  29.135 38.072 1.00 21.77 ? 556  TYR A CE2 1 
ATOM   4011 C  CZ  . TYR A 1 515 ? 26.330  27.755 38.136 1.00 20.94 ? 556  TYR A CZ  1 
ATOM   4012 O  OH  . TYR A 1 515 ? 26.360  27.012 36.955 1.00 21.99 ? 556  TYR A OH  1 
ATOM   4013 N  N   . GLU A 1 516 ? 23.709  31.508 43.882 1.00 20.04 ? 557  GLU A N   1 
ATOM   4014 C  CA  . GLU A 1 516 ? 23.539  32.273 45.087 1.00 21.17 ? 557  GLU A CA  1 
ATOM   4015 C  C   . GLU A 1 516 ? 22.769  31.405 46.120 1.00 19.88 ? 557  GLU A C   1 
ATOM   4016 O  O   . GLU A 1 516 ? 21.535  31.385 46.216 1.00 20.46 ? 557  GLU A O   1 
ATOM   4017 C  CB  . GLU A 1 516 ? 22.788  33.573 44.710 1.00 21.84 ? 557  GLU A CB  1 
ATOM   4018 C  CG  . GLU A 1 516 ? 23.183  34.693 45.550 1.00 26.42 ? 557  GLU A CG  1 
ATOM   4019 C  CD  . GLU A 1 516 ? 22.118  35.816 45.453 1.00 20.25 ? 557  GLU A CD  1 
ATOM   4020 O  OE1 . GLU A 1 516 ? 22.192  36.617 44.484 1.00 25.61 ? 557  GLU A OE1 1 
ATOM   4021 O  OE2 . GLU A 1 516 ? 21.195  35.751 46.264 1.00 25.57 ? 557  GLU A OE2 1 
ATOM   4022 N  N   . THR A 1 517 ? 23.529  30.631 46.889 1.00 17.89 ? 558  THR A N   1 
ATOM   4023 C  CA  . THR A 1 517 ? 22.965  29.646 47.772 1.00 20.09 ? 558  THR A CA  1 
ATOM   4024 C  C   . THR A 1 517 ? 23.357  29.854 49.225 1.00 18.75 ? 558  THR A C   1 
ATOM   4025 O  O   . THR A 1 517 ? 24.277  30.639 49.520 1.00 20.69 ? 558  THR A O   1 
ATOM   4026 C  CB  . THR A 1 517 ? 23.526  28.238 47.388 1.00 19.46 ? 558  THR A CB  1 
ATOM   4027 O  OG1 . THR A 1 517 ? 24.956  28.321 47.440 1.00 24.41 ? 558  THR A OG1 1 
ATOM   4028 C  CG2 . THR A 1 517 ? 23.043  27.856 45.981 1.00 20.23 ? 558  THR A CG2 1 
ATOM   4029 N  N   . TYR A 1 518 ? 22.740  29.079 50.104 1.00 20.36 ? 559  TYR A N   1 
ATOM   4030 C  CA  . TYR A 1 518 ? 23.125  29.053 51.493 1.00 21.42 ? 559  TYR A CA  1 
ATOM   4031 C  C   . TYR A 1 518 ? 24.642  28.723 51.601 1.00 21.59 ? 559  TYR A C   1 
ATOM   4032 O  O   . TYR A 1 518 ? 25.381  29.369 52.329 1.00 21.86 ? 559  TYR A O   1 
ATOM   4033 C  CB  . TYR A 1 518 ? 22.318  28.032 52.289 1.00 22.95 ? 559  TYR A CB  1 
ATOM   4034 C  CG  . TYR A 1 518 ? 22.853  27.791 53.666 1.00 23.15 ? 559  TYR A CG  1 
ATOM   4035 C  CD1 . TYR A 1 518 ? 22.570  28.663 54.706 1.00 24.28 ? 559  TYR A CD1 1 
ATOM   4036 C  CD2 . TYR A 1 518 ? 23.688  26.683 53.958 1.00 26.85 ? 559  TYR A CD2 1 
ATOM   4037 C  CE1 . TYR A 1 518 ? 23.039  28.452 56.009 1.00 24.75 ? 559  TYR A CE1 1 
ATOM   4038 C  CE2 . TYR A 1 518 ? 24.186  26.467 55.263 1.00 27.00 ? 559  TYR A CE2 1 
ATOM   4039 C  CZ  . TYR A 1 518 ? 23.882  27.357 56.284 1.00 26.53 ? 559  TYR A CZ  1 
ATOM   4040 O  OH  . TYR A 1 518 ? 24.341  27.164 57.578 1.00 27.69 ? 559  TYR A OH  1 
ATOM   4041 N  N   . GLU A 1 519 ? 25.097  27.769 50.782 1.00 22.60 ? 560  GLU A N   1 
ATOM   4042 C  CA  . GLU A 1 519 ? 26.541  27.397 50.853 1.00 22.99 ? 560  GLU A CA  1 
ATOM   4043 C  C   . GLU A 1 519 ? 27.508  28.493 50.442 1.00 22.19 ? 560  GLU A C   1 
ATOM   4044 O  O   . GLU A 1 519 ? 28.608  28.620 50.992 1.00 23.03 ? 560  GLU A O   1 
ATOM   4045 C  CB  . GLU A 1 519 ? 26.793  26.094 50.059 1.00 23.55 ? 560  GLU A CB  1 
ATOM   4046 C  CG  . GLU A 1 519 ? 26.093  24.907 50.694 1.00 23.44 ? 560  GLU A CG  1 
ATOM   4047 C  CD  . GLU A 1 519 ? 24.620  24.827 50.325 1.00 22.06 ? 560  GLU A CD  1 
ATOM   4048 O  OE1 . GLU A 1 519 ? 24.251  25.303 49.229 1.00 23.68 ? 560  GLU A OE1 1 
ATOM   4049 O  OE2 . GLU A 1 519 ? 23.849  24.250 51.118 1.00 25.43 ? 560  GLU A OE2 1 
ATOM   4050 N  N   . LEU A 1 520 ? 27.138  29.296 49.456 1.00 19.91 ? 561  LEU A N   1 
ATOM   4051 C  CA  . LEU A 1 520 ? 27.937  30.435 49.132 1.00 20.65 ? 561  LEU A CA  1 
ATOM   4052 C  C   . LEU A 1 520 ? 28.167  31.295 50.357 1.00 21.76 ? 561  LEU A C   1 
ATOM   4053 O  O   . LEU A 1 520 ? 29.283  31.766 50.585 1.00 21.53 ? 561  LEU A O   1 
ATOM   4054 C  CB  . LEU A 1 520 ? 27.207  31.249 48.054 1.00 20.55 ? 561  LEU A CB  1 
ATOM   4055 C  CG  . LEU A 1 520 ? 27.885  32.552 47.713 1.00 20.66 ? 561  LEU A CG  1 
ATOM   4056 C  CD1 . LEU A 1 520 ? 29.316  32.389 47.181 1.00 21.81 ? 561  LEU A CD1 1 
ATOM   4057 C  CD2 . LEU A 1 520 ? 26.958  33.380 46.774 1.00 21.68 ? 561  LEU A CD2 1 
ATOM   4058 N  N   . VAL A 1 521 ? 27.086  31.561 51.091 1.00 21.11 ? 562  VAL A N   1 
ATOM   4059 C  CA  . VAL A 1 521 ? 27.228  32.432 52.260 1.00 21.68 ? 562  VAL A CA  1 
ATOM   4060 C  C   . VAL A 1 521 ? 28.042  31.790 53.393 1.00 22.86 ? 562  VAL A C   1 
ATOM   4061 O  O   . VAL A 1 521 ? 29.012  32.423 53.899 1.00 23.35 ? 562  VAL A O   1 
ATOM   4062 C  CB  . VAL A 1 521 ? 25.842  32.899 52.767 1.00 20.14 ? 562  VAL A CB  1 
ATOM   4063 C  CG1 . VAL A 1 521 ? 26.006  33.720 54.094 1.00 22.14 ? 562  VAL A CG1 1 
ATOM   4064 C  CG2 . VAL A 1 521 ? 25.152  33.714 51.622 1.00 20.85 ? 562  VAL A CG2 1 
ATOM   4065 N  N   . GLU A 1 522 ? 27.649  30.575 53.778 1.00 23.83 ? 563  GLU A N   1 
ATOM   4066 C  CA  . GLU A 1 522 ? 28.246  29.863 54.910 1.00 25.65 ? 563  GLU A CA  1 
ATOM   4067 C  C   . GLU A 1 522 ? 29.727  29.559 54.642 1.00 25.19 ? 563  GLU A C   1 
ATOM   4068 O  O   . GLU A 1 522 ? 30.552  29.649 55.557 1.00 26.86 ? 563  GLU A O   1 
ATOM   4069 C  CB  . GLU A 1 522 ? 27.450  28.595 55.197 1.00 26.74 ? 563  GLU A CB  1 
ATOM   4070 C  CG  . GLU A 1 522 ? 27.785  27.941 56.541 1.00 31.07 ? 563  GLU A CG  1 
ATOM   4071 C  CD  . GLU A 1 522 ? 28.991  27.008 56.411 1.00 38.11 ? 563  GLU A CD  1 
ATOM   4072 O  OE1 . GLU A 1 522 ? 29.197  26.454 55.297 1.00 39.93 ? 563  GLU A OE1 1 
ATOM   4073 O  OE2 . GLU A 1 522 ? 29.732  26.858 57.415 1.00 41.74 ? 563  GLU A OE2 1 
ATOM   4074 N  N   . LYS A 1 523 ? 30.073  29.257 53.398 1.00 25.42 ? 564  LYS A N   1 
ATOM   4075 C  CA  . LYS A 1 523 ? 31.479  28.917 53.085 1.00 25.03 ? 564  LYS A CA  1 
ATOM   4076 C  C   . LYS A 1 523 ? 32.378  30.114 52.804 1.00 26.50 ? 564  LYS A C   1 
ATOM   4077 O  O   . LYS A 1 523 ? 33.530  30.164 53.277 1.00 27.72 ? 564  LYS A O   1 
ATOM   4078 C  CB  . LYS A 1 523 ? 31.538  27.967 51.893 1.00 24.77 ? 564  LYS A CB  1 
ATOM   4079 C  CG  . LYS A 1 523 ? 30.991  26.579 52.156 1.00 27.21 ? 564  LYS A CG  1 
ATOM   4080 C  CD  . LYS A 1 523 ? 31.152  25.737 50.840 1.00 26.50 ? 564  LYS A CD  1 
ATOM   4081 C  CE  . LYS A 1 523 ? 30.339  24.424 50.894 1.00 33.32 ? 564  LYS A CE  1 
ATOM   4082 N  NZ  . LYS A 1 523 ? 30.719  23.635 52.086 1.00 34.65 ? 564  LYS A NZ  1 
ATOM   4083 N  N   . PHE A 1 524 ? 31.879  31.084 52.033 1.00 24.91 ? 565  PHE A N   1 
ATOM   4084 C  CA  . PHE A 1 524 ? 32.725  32.087 51.449 1.00 25.92 ? 565  PHE A CA  1 
ATOM   4085 C  C   . PHE A 1 524 ? 32.438  33.493 51.890 1.00 26.96 ? 565  PHE A C   1 
ATOM   4086 O  O   . PHE A 1 524 ? 33.294  34.315 51.667 1.00 28.76 ? 565  PHE A O   1 
ATOM   4087 C  CB  . PHE A 1 524 ? 32.661  32.033 49.929 1.00 26.11 ? 565  PHE A CB  1 
ATOM   4088 C  CG  . PHE A 1 524 ? 32.988  30.669 49.379 1.00 28.77 ? 565  PHE A CG  1 
ATOM   4089 C  CD1 . PHE A 1 524 ? 34.202  30.061 49.738 1.00 30.71 ? 565  PHE A CD1 1 
ATOM   4090 C  CD2 . PHE A 1 524 ? 32.101  29.985 48.587 1.00 28.77 ? 565  PHE A CD2 1 
ATOM   4091 C  CE1 . PHE A 1 524 ? 34.545  28.806 49.237 1.00 30.59 ? 565  PHE A CE1 1 
ATOM   4092 C  CE2 . PHE A 1 524 ? 32.437  28.695 48.074 1.00 31.67 ? 565  PHE A CE2 1 
ATOM   4093 C  CZ  . PHE A 1 524 ? 33.676  28.118 48.434 1.00 29.61 ? 565  PHE A CZ  1 
ATOM   4094 N  N   . TYR A 1 525 ? 31.245  33.779 52.443 1.00 24.57 ? 566  TYR A N   1 
ATOM   4095 C  CA  . TYR A 1 525 ? 30.986  35.179 52.872 1.00 24.61 ? 566  TYR A CA  1 
ATOM   4096 C  C   . TYR A 1 525 ? 31.120  35.407 54.368 1.00 23.91 ? 566  TYR A C   1 
ATOM   4097 O  O   . TYR A 1 525 ? 31.820  36.369 54.817 1.00 24.84 ? 566  TYR A O   1 
ATOM   4098 C  CB  . TYR A 1 525 ? 29.610  35.699 52.361 1.00 23.95 ? 566  TYR A CB  1 
ATOM   4099 C  CG  . TYR A 1 525 ? 29.673  36.190 50.961 1.00 24.28 ? 566  TYR A CG  1 
ATOM   4100 C  CD1 . TYR A 1 525 ? 29.758  35.281 49.884 1.00 21.88 ? 566  TYR A CD1 1 
ATOM   4101 C  CD2 . TYR A 1 525 ? 29.698  37.562 50.649 1.00 25.00 ? 566  TYR A CD2 1 
ATOM   4102 C  CE1 . TYR A 1 525 ? 29.856  35.706 48.575 1.00 21.38 ? 566  TYR A CE1 1 
ATOM   4103 C  CE2 . TYR A 1 525 ? 29.779  38.017 49.303 1.00 23.27 ? 566  TYR A CE2 1 
ATOM   4104 C  CZ  . TYR A 1 525 ? 29.873  37.079 48.268 1.00 22.79 ? 566  TYR A CZ  1 
ATOM   4105 O  OH  . TYR A 1 525 ? 29.994  37.496 46.996 1.00 26.01 ? 566  TYR A OH  1 
ATOM   4106 N  N   . ASP A 1 526 ? 30.465  34.562 55.149 1.00 23.22 ? 567  ASP A N   1 
ATOM   4107 C  CA  . ASP A 1 526 ? 30.249  34.851 56.561 1.00 24.26 ? 567  ASP A CA  1 
ATOM   4108 C  C   . ASP A 1 526 ? 30.055  33.601 57.398 1.00 24.31 ? 567  ASP A C   1 
ATOM   4109 O  O   . ASP A 1 526 ? 29.024  33.340 57.979 1.00 25.61 ? 567  ASP A O   1 
ATOM   4110 C  CB  . ASP A 1 526 ? 29.056  35.816 56.714 1.00 22.38 ? 567  ASP A CB  1 
ATOM   4111 C  CG  . ASP A 1 526 ? 28.963  36.463 58.130 1.00 24.21 ? 567  ASP A CG  1 
ATOM   4112 O  OD1 . ASP A 1 526 ? 29.904  36.385 58.988 1.00 25.02 ? 567  ASP A OD1 1 
ATOM   4113 O  OD2 . ASP A 1 526 ? 27.903  37.067 58.384 1.00 24.78 ? 567  ASP A OD2 1 
ATOM   4114 N  N   . PRO A 1 527 ? 31.121  32.764 57.482 1.00 25.66 ? 568  PRO A N   1 
ATOM   4115 C  CA  . PRO A 1 527 ? 30.920  31.476 58.162 1.00 25.54 ? 568  PRO A CA  1 
ATOM   4116 C  C   . PRO A 1 527 ? 30.461  31.520 59.598 1.00 25.68 ? 568  PRO A C   1 
ATOM   4117 O  O   . PRO A 1 527 ? 29.707  30.641 60.040 1.00 26.30 ? 568  PRO A O   1 
ATOM   4118 C  CB  . PRO A 1 527 ? 32.289  30.778 58.017 1.00 26.08 ? 568  PRO A CB  1 
ATOM   4119 C  CG  . PRO A 1 527 ? 33.215  31.784 57.708 1.00 26.75 ? 568  PRO A CG  1 
ATOM   4120 C  CD  . PRO A 1 527 ? 32.480  32.943 56.979 1.00 26.21 ? 568  PRO A CD  1 
ATOM   4121 N  N   . MET A 1 528 ? 30.873  32.573 60.307 1.00 25.74 ? 569  MET A N   1 
ATOM   4122 C  CA  . MET A 1 528 ? 30.497  32.779 61.690 1.00 26.77 ? 569  MET A CA  1 
ATOM   4123 C  C   . MET A 1 528 ? 29.200  33.603 61.853 1.00 26.28 ? 569  MET A C   1 
ATOM   4124 O  O   . MET A 1 528 ? 28.704  33.775 62.984 1.00 25.89 ? 569  MET A O   1 
ATOM   4125 C  CB  . MET A 1 528 ? 31.634  33.504 62.404 1.00 28.70 ? 569  MET A CB  1 
ATOM   4126 C  CG  . MET A 1 528 ? 32.978  32.742 62.381 1.00 33.40 ? 569  MET A CG  1 
ATOM   4127 S  SD  . MET A 1 528 ? 32.817  31.027 63.004 1.00 46.72 ? 569  MET A SD  1 
ATOM   4128 C  CE  . MET A 1 528 ? 32.111  31.184 64.661 1.00 43.34 ? 569  MET A CE  1 
ATOM   4129 N  N   . PHE A 1 529 ? 28.685  34.099 60.720 1.00 24.51 ? 570  PHE A N   1 
ATOM   4130 C  CA  . PHE A 1 529 ? 27.480  34.960 60.747 1.00 23.43 ? 570  PHE A CA  1 
ATOM   4131 C  C   . PHE A 1 529 ? 27.699  36.204 61.624 1.00 23.79 ? 570  PHE A C   1 
ATOM   4132 O  O   . PHE A 1 529 ? 26.741  36.826 62.127 1.00 23.53 ? 570  PHE A O   1 
ATOM   4133 C  CB  . PHE A 1 529 ? 26.230  34.159 61.043 1.00 23.18 ? 570  PHE A CB  1 
ATOM   4134 C  CG  . PHE A 1 529 ? 25.818  33.340 59.853 1.00 25.31 ? 570  PHE A CG  1 
ATOM   4135 C  CD1 . PHE A 1 529 ? 24.863  33.807 58.925 1.00 23.32 ? 570  PHE A CD1 1 
ATOM   4136 C  CD2 . PHE A 1 529 ? 26.454  32.115 59.608 1.00 22.55 ? 570  PHE A CD2 1 
ATOM   4137 C  CE1 . PHE A 1 529 ? 24.552  33.040 57.789 1.00 25.46 ? 570  PHE A CE1 1 
ATOM   4138 C  CE2 . PHE A 1 529 ? 26.131  31.347 58.487 1.00 24.58 ? 570  PHE A CE2 1 
ATOM   4139 C  CZ  . PHE A 1 529 ? 25.160  31.787 57.595 1.00 25.30 ? 570  PHE A CZ  1 
ATOM   4140 N  N   . LYS A 1 530 ? 28.951  36.623 61.700 1.00 22.23 ? 571  LYS A N   1 
ATOM   4141 C  CA  . LYS A 1 530 ? 29.260  37.840 62.490 1.00 23.83 ? 571  LYS A CA  1 
ATOM   4142 C  C   . LYS A 1 530 ? 28.927  39.136 61.707 1.00 24.08 ? 571  LYS A C   1 
ATOM   4143 O  O   . LYS A 1 530 ? 28.601  40.188 62.318 1.00 24.63 ? 571  LYS A O   1 
ATOM   4144 C  CB  . LYS A 1 530 ? 30.718  37.847 62.988 1.00 24.01 ? 571  LYS A CB  1 
ATOM   4145 C  CG  . LYS A 1 530 ? 31.720  37.937 61.924 1.00 24.60 ? 571  LYS A CG  1 
ATOM   4146 C  CD  . LYS A 1 530 ? 33.139  38.095 62.549 1.00 28.78 ? 571  LYS A CD  1 
ATOM   4147 C  CE  . LYS A 1 530 ? 34.177  38.123 61.459 1.00 30.10 ? 571  LYS A CE  1 
ATOM   4148 N  NZ  . LYS A 1 530 ? 35.585  38.576 61.949 1.00 30.39 ? 571  LYS A NZ  1 
ATOM   4149 N  N   . TYR A 1 531 ? 29.036  39.106 60.380 1.00 23.65 ? 572  TYR A N   1 
ATOM   4150 C  CA  . TYR A 1 531 ? 28.727  40.306 59.588 1.00 22.81 ? 572  TYR A CA  1 
ATOM   4151 C  C   . TYR A 1 531 ? 27.201  40.455 59.575 1.00 23.05 ? 572  TYR A C   1 
ATOM   4152 O  O   . TYR A 1 531 ? 26.670  41.579 59.752 1.00 21.71 ? 572  TYR A O   1 
ATOM   4153 C  CB  . TYR A 1 531 ? 29.314  40.234 58.186 1.00 24.12 ? 572  TYR A CB  1 
ATOM   4154 C  CG  . TYR A 1 531 ? 30.822  40.166 58.248 1.00 24.69 ? 572  TYR A CG  1 
ATOM   4155 C  CD1 . TYR A 1 531 ? 31.583  41.233 58.763 1.00 22.85 ? 572  TYR A CD1 1 
ATOM   4156 C  CD2 . TYR A 1 531 ? 31.478  38.992 57.878 1.00 26.85 ? 572  TYR A CD2 1 
ATOM   4157 C  CE1 . TYR A 1 531 ? 32.962  41.157 58.850 1.00 26.97 ? 572  TYR A CE1 1 
ATOM   4158 C  CE2 . TYR A 1 531 ? 32.843  38.893 57.991 1.00 27.95 ? 572  TYR A CE2 1 
ATOM   4159 C  CZ  . TYR A 1 531 ? 33.584  39.968 58.464 1.00 28.40 ? 572  TYR A CZ  1 
ATOM   4160 O  OH  . TYR A 1 531 ? 34.962  39.830 58.550 1.00 31.34 ? 572  TYR A OH  1 
ATOM   4161 N  N   . HIS A 1 532 ? 26.483  39.340 59.401 1.00 20.98 ? 573  HIS A N   1 
ATOM   4162 C  CA  . HIS A 1 532 ? 25.018  39.320 59.546 1.00 21.29 ? 573  HIS A CA  1 
ATOM   4163 C  C   . HIS A 1 532 ? 24.616  39.891 60.924 1.00 21.59 ? 573  HIS A C   1 
ATOM   4164 O  O   . HIS A 1 532 ? 23.706  40.738 61.024 1.00 20.01 ? 573  HIS A O   1 
ATOM   4165 C  CB  . HIS A 1 532 ? 24.457  37.897 59.437 1.00 21.79 ? 573  HIS A CB  1 
ATOM   4166 C  CG  . HIS A 1 532 ? 24.313  37.374 58.036 1.00 22.27 ? 573  HIS A CG  1 
ATOM   4167 N  ND1 . HIS A 1 532 ? 25.369  36.860 57.308 1.00 23.58 ? 573  HIS A ND1 1 
ATOM   4168 C  CD2 . HIS A 1 532 ? 23.212  37.224 57.257 1.00 25.50 ? 573  HIS A CD2 1 
ATOM   4169 C  CE1 . HIS A 1 532 ? 24.938  36.485 56.112 1.00 25.71 ? 573  HIS A CE1 1 
ATOM   4170 N  NE2 . HIS A 1 532 ? 23.625  36.651 56.069 1.00 24.66 ? 573  HIS A NE2 1 
ATOM   4171 N  N   . LEU A 1 533 ? 25.269  39.438 62.006 1.00 20.71 ? 574  LEU A N   1 
ATOM   4172 C  CA  . LEU A 1 533 ? 24.909  39.943 63.308 1.00 20.80 ? 574  LEU A CA  1 
ATOM   4173 C  C   . LEU A 1 533 ? 25.123  41.454 63.405 1.00 20.71 ? 574  LEU A C   1 
ATOM   4174 O  O   . LEU A 1 533 ? 24.214  42.145 63.918 1.00 21.17 ? 574  LEU A O   1 
ATOM   4175 C  CB  . LEU A 1 533 ? 25.675  39.199 64.427 1.00 20.91 ? 574  LEU A CB  1 
ATOM   4176 C  CG  . LEU A 1 533 ? 25.265  39.721 65.820 1.00 22.40 ? 574  LEU A CG  1 
ATOM   4177 C  CD1 . LEU A 1 533 ? 23.802  39.493 66.174 1.00 23.23 ? 574  LEU A CD1 1 
ATOM   4178 C  CD2 . LEU A 1 533 ? 26.185  39.015 66.860 1.00 25.25 ? 574  LEU A CD2 1 
ATOM   4179 N  N   . THR A 1 534 ? 26.234  41.963 62.874 1.00 19.81 ? 575  THR A N   1 
ATOM   4180 C  CA  . THR A 1 534 ? 26.577  43.390 62.900 1.00 19.94 ? 575  THR A CA  1 
ATOM   4181 C  C   . THR A 1 534 ? 25.471  44.155 62.158 1.00 20.64 ? 575  THR A C   1 
ATOM   4182 O  O   . THR A 1 534 ? 24.944  45.157 62.671 1.00 19.87 ? 575  THR A O   1 
ATOM   4183 C  CB  . THR A 1 534 ? 27.927  43.644 62.283 1.00 21.92 ? 575  THR A CB  1 
ATOM   4184 O  OG1 . THR A 1 534 ? 28.920  43.140 63.215 1.00 23.78 ? 575  THR A OG1 1 
ATOM   4185 C  CG2 . THR A 1 534 ? 28.251  45.143 62.078 1.00 20.42 ? 575  THR A CG2 1 
ATOM   4186 N  N   . VAL A 1 535 ? 25.092  43.629 60.989 1.00 19.39 ? 576  VAL A N   1 
ATOM   4187 C  CA  . VAL A 1 535 ? 23.971  44.306 60.240 1.00 18.93 ? 576  VAL A CA  1 
ATOM   4188 C  C   . VAL A 1 535 ? 22.642  44.261 61.002 1.00 19.54 ? 576  VAL A C   1 
ATOM   4189 O  O   . VAL A 1 535 ? 21.873  45.260 60.959 1.00 20.70 ? 576  VAL A O   1 
ATOM   4190 C  CB  . VAL A 1 535 ? 23.900  43.767 58.797 1.00 19.21 ? 576  VAL A CB  1 
ATOM   4191 C  CG1 . VAL A 1 535 ? 22.646  44.363 58.099 1.00 20.48 ? 576  VAL A CG1 1 
ATOM   4192 C  CG2 . VAL A 1 535 ? 25.191  44.101 58.085 1.00 18.38 ? 576  VAL A CG2 1 
ATOM   4193 N  N   . ALA A 1 536 ? 22.334  43.169 61.702 1.00 17.65 ? 577  ALA A N   1 
ATOM   4194 C  CA  . ALA A 1 536 ? 21.120  43.061 62.522 1.00 18.50 ? 577  ALA A CA  1 
ATOM   4195 C  C   . ALA A 1 536 ? 21.157  44.143 63.622 1.00 19.80 ? 577  ALA A C   1 
ATOM   4196 O  O   . ALA A 1 536 ? 20.132  44.764 63.934 1.00 19.32 ? 577  ALA A O   1 
ATOM   4197 C  CB  . ALA A 1 536 ? 21.011  41.700 63.136 1.00 18.51 ? 577  ALA A CB  1 
ATOM   4198 N  N   . GLN A 1 537 ? 22.342  44.349 64.169 1.00 19.49 ? 578  GLN A N   1 
ATOM   4199 C  CA  . GLN A 1 537 ? 22.526  45.379 65.217 1.00 20.00 ? 578  GLN A CA  1 
ATOM   4200 C  C   . GLN A 1 537 ? 22.283  46.783 64.668 1.00 19.90 ? 578  GLN A C   1 
ATOM   4201 O  O   . GLN A 1 537 ? 21.648  47.617 65.395 1.00 20.23 ? 578  GLN A O   1 
ATOM   4202 C  CB  . GLN A 1 537 ? 23.922  45.297 65.856 1.00 21.53 ? 578  GLN A CB  1 
ATOM   4203 C  CG  . GLN A 1 537 ? 23.990  44.048 66.744 1.00 20.34 ? 578  GLN A CG  1 
ATOM   4204 C  CD  . GLN A 1 537 ? 25.410  43.813 67.273 1.00 20.64 ? 578  GLN A CD  1 
ATOM   4205 O  OE1 . GLN A 1 537 ? 26.349  44.556 66.965 1.00 23.17 ? 578  GLN A OE1 1 
ATOM   4206 N  NE2 . GLN A 1 537 ? 25.565  42.700 68.052 1.00 25.06 ? 578  GLN A NE2 1 
ATOM   4207 N  N   . VAL A 1 538 ? 22.805  47.055 63.468 1.00 19.32 ? 579  VAL A N   1 
ATOM   4208 C  CA  . VAL A 1 538 ? 22.645  48.409 62.837 1.00 19.09 ? 579  VAL A CA  1 
ATOM   4209 C  C   . VAL A 1 538 ? 21.169  48.611 62.506 1.00 19.74 ? 579  VAL A C   1 
ATOM   4210 O  O   . VAL A 1 538 ? 20.536  49.591 62.950 1.00 18.98 ? 579  VAL A O   1 
ATOM   4211 C  CB  . VAL A 1 538 ? 23.491  48.576 61.602 1.00 20.33 ? 579  VAL A CB  1 
ATOM   4212 C  CG1 . VAL A 1 538 ? 23.148  49.931 60.917 1.00 18.38 ? 579  VAL A CG1 1 
ATOM   4213 C  CG2 . VAL A 1 538 ? 24.989  48.437 61.942 1.00 20.28 ? 579  VAL A CG2 1 
ATOM   4214 N  N   . ARG A 1 539 ? 20.606  47.715 61.720 1.00 18.50 ? 580  ARG A N   1 
ATOM   4215 C  CA  . ARG A 1 539 ? 19.180  47.867 61.325 1.00 18.09 ? 580  ARG A CA  1 
ATOM   4216 C  C   . ARG A 1 539 ? 18.231  47.880 62.499 1.00 19.65 ? 580  ARG A C   1 
ATOM   4217 O  O   . ARG A 1 539 ? 17.376  48.777 62.603 1.00 18.39 ? 580  ARG A O   1 
ATOM   4218 C  CB  . ARG A 1 539 ? 18.766  46.762 60.340 1.00 19.50 ? 580  ARG A CB  1 
ATOM   4219 C  CG  . ARG A 1 539 ? 19.551  46.845 59.059 1.00 16.17 ? 580  ARG A CG  1 
ATOM   4220 C  CD  . ARG A 1 539 ? 19.171  45.605 58.153 1.00 18.91 ? 580  ARG A CD  1 
ATOM   4221 N  NE  . ARG A 1 539 ? 19.891  45.709 56.902 1.00 18.51 ? 580  ARG A NE  1 
ATOM   4222 C  CZ  . ARG A 1 539 ? 19.870  44.784 55.939 1.00 18.06 ? 580  ARG A CZ  1 
ATOM   4223 N  NH1 . ARG A 1 539 ? 19.092  43.713 56.083 1.00 19.41 ? 580  ARG A NH1 1 
ATOM   4224 N  NH2 . ARG A 1 539 ? 20.556  45.007 54.821 1.00 18.16 ? 580  ARG A NH2 1 
ATOM   4225 N  N   . GLY A 1 540 ? 18.380  46.904 63.399 1.00 18.02 ? 581  GLY A N   1 
ATOM   4226 C  CA  . GLY A 1 540 ? 17.524  46.762 64.592 1.00 17.55 ? 581  GLY A CA  1 
ATOM   4227 C  C   . GLY A 1 540 ? 17.712  47.950 65.559 1.00 18.25 ? 581  GLY A C   1 
ATOM   4228 O  O   . GLY A 1 540 ? 16.728  48.480 66.092 1.00 18.63 ? 581  GLY A O   1 
ATOM   4229 N  N   . GLY A 1 541 ? 18.957  48.364 65.730 1.00 17.42 ? 582  GLY A N   1 
ATOM   4230 C  CA  . GLY A 1 541 ? 19.322  49.494 66.612 1.00 18.72 ? 582  GLY A CA  1 
ATOM   4231 C  C   . GLY A 1 541 ? 18.665  50.772 66.071 1.00 19.87 ? 582  GLY A C   1 
ATOM   4232 O  O   . GLY A 1 541 ? 18.077  51.566 66.839 1.00 20.02 ? 582  GLY A O   1 
ATOM   4233 N  N   . MET A 1 542 ? 18.770  50.977 64.755 1.00 18.32 ? 583  MET A N   1 
ATOM   4234 C  CA  . MET A 1 542 ? 18.065  52.158 64.168 1.00 18.16 ? 583  MET A CA  1 
ATOM   4235 C  C   . MET A 1 542 ? 16.559  52.143 64.439 1.00 18.14 ? 583  MET A C   1 
ATOM   4236 O  O   . MET A 1 542 ? 15.975  53.174 64.861 1.00 17.83 ? 583  MET A O   1 
ATOM   4237 C  CB  . MET A 1 542 ? 18.354  52.235 62.669 1.00 16.72 ? 583  MET A CB  1 
ATOM   4238 C  CG  . MET A 1 542 ? 19.801  52.650 62.371 1.00 19.20 ? 583  MET A CG  1 
ATOM   4239 S  SD  . MET A 1 542 ? 20.222  52.708 60.631 1.00 23.95 ? 583  MET A SD  1 
ATOM   4240 C  CE  . MET A 1 542 ? 19.529  54.330 60.114 1.00 22.54 ? 583  MET A CE  1 
ATOM   4241 N  N   . VAL A 1 543 ? 15.893  50.994 64.193 1.00 16.59 ? 584  VAL A N   1 
ATOM   4242 C  CA  . VAL A 1 543 ? 14.470  50.839 64.411 1.00 16.85 ? 584  VAL A CA  1 
ATOM   4243 C  C   . VAL A 1 543 ? 14.203  51.111 65.900 1.00 19.12 ? 584  VAL A C   1 
ATOM   4244 O  O   . VAL A 1 543 ? 13.296  51.855 66.257 1.00 18.04 ? 584  VAL A O   1 
ATOM   4245 C  CB  . VAL A 1 543 ? 14.025  49.464 64.013 1.00 17.62 ? 584  VAL A CB  1 
ATOM   4246 C  CG1 . VAL A 1 543 ? 12.619  49.173 64.485 1.00 17.82 ? 584  VAL A CG1 1 
ATOM   4247 C  CG2 . VAL A 1 543 ? 14.141  49.320 62.445 1.00 15.73 ? 584  VAL A CG2 1 
ATOM   4248 N  N   . PHE A 1 544 ? 15.025  50.494 66.770 1.00 18.38 ? 585  PHE A N   1 
ATOM   4249 C  CA  . PHE A 1 544 ? 14.857  50.718 68.192 1.00 19.53 ? 585  PHE A CA  1 
ATOM   4250 C  C   . PHE A 1 544 ? 14.827  52.189 68.569 1.00 18.91 ? 585  PHE A C   1 
ATOM   4251 O  O   . PHE A 1 544 ? 13.884  52.633 69.279 1.00 20.79 ? 585  PHE A O   1 
ATOM   4252 C  CB  . PHE A 1 544 ? 15.934  49.947 69.008 1.00 19.62 ? 585  PHE A CB  1 
ATOM   4253 C  CG  . PHE A 1 544 ? 15.623  49.912 70.488 1.00 20.29 ? 585  PHE A CG  1 
ATOM   4254 C  CD1 . PHE A 1 544 ? 15.020  48.790 71.040 1.00 23.52 ? 585  PHE A CD1 1 
ATOM   4255 C  CD2 . PHE A 1 544 ? 15.844  51.062 71.274 1.00 23.15 ? 585  PHE A CD2 1 
ATOM   4256 C  CE1 . PHE A 1 544 ? 14.676  48.764 72.395 1.00 26.94 ? 585  PHE A CE1 1 
ATOM   4257 C  CE2 . PHE A 1 544 ? 15.535  51.041 72.633 1.00 24.39 ? 585  PHE A CE2 1 
ATOM   4258 C  CZ  . PHE A 1 544 ? 14.926  49.907 73.179 1.00 23.31 ? 585  PHE A CZ  1 
ATOM   4259 N  N   . GLU A 1 545 ? 15.843  52.915 68.158 1.00 18.83 ? 586  GLU A N   1 
ATOM   4260 C  CA  . GLU A 1 545 ? 16.003  54.362 68.531 1.00 20.41 ? 586  GLU A CA  1 
ATOM   4261 C  C   . GLU A 1 545 ? 14.850  55.168 67.924 1.00 21.09 ? 586  GLU A C   1 
ATOM   4262 O  O   . GLU A 1 545 ? 14.202  55.959 68.596 1.00 20.08 ? 586  GLU A O   1 
ATOM   4263 C  CB  . GLU A 1 545 ? 17.293  54.914 68.018 1.00 22.63 ? 586  GLU A CB  1 
ATOM   4264 C  CG  . GLU A 1 545 ? 18.448  54.627 68.932 1.00 31.00 ? 586  GLU A CG  1 
ATOM   4265 C  CD  . GLU A 1 545 ? 18.183  55.268 70.319 1.00 37.76 ? 586  GLU A CD  1 
ATOM   4266 O  OE1 . GLU A 1 545 ? 17.667  54.550 71.198 1.00 39.69 ? 586  GLU A OE1 1 
ATOM   4267 O  OE2 . GLU A 1 545 ? 18.393  56.499 70.473 1.00 45.15 ? 586  GLU A OE2 1 
ATOM   4268 N  N   . LEU A 1 546 ? 14.563  54.923 66.633 1.00 19.79 ? 587  LEU A N   1 
ATOM   4269 C  CA  . LEU A 1 546 ? 13.403  55.607 66.007 1.00 19.19 ? 587  LEU A CA  1 
ATOM   4270 C  C   . LEU A 1 546 ? 12.086  55.360 66.725 1.00 19.43 ? 587  LEU A C   1 
ATOM   4271 O  O   . LEU A 1 546 ? 11.242  56.287 66.792 1.00 20.93 ? 587  LEU A O   1 
ATOM   4272 C  CB  . LEU A 1 546 ? 13.263  55.171 64.518 1.00 16.97 ? 587  LEU A CB  1 
ATOM   4273 C  CG  . LEU A 1 546 ? 14.442  55.665 63.685 1.00 16.13 ? 587  LEU A CG  1 
ATOM   4274 C  CD1 . LEU A 1 546 ? 14.724  54.837 62.376 1.00 18.14 ? 587  LEU A CD1 1 
ATOM   4275 C  CD2 . LEU A 1 546 ? 14.176  57.143 63.265 1.00 21.34 ? 587  LEU A CD2 1 
ATOM   4276 N  N   . ALA A 1 547 ? 11.842  54.138 67.214 1.00 18.01 ? 588  ALA A N   1 
ATOM   4277 C  CA  . ALA A 1 547 ? 10.576  53.762 67.767 1.00 19.83 ? 588  ALA A CA  1 
ATOM   4278 C  C   . ALA A 1 547 ? 10.498  54.124 69.282 1.00 18.83 ? 588  ALA A C   1 
ATOM   4279 O  O   . ALA A 1 547 ? 9.411   54.115 69.831 1.00 21.70 ? 588  ALA A O   1 
ATOM   4280 C  CB  . ALA A 1 547 ? 10.282  52.257 67.520 1.00 20.22 ? 588  ALA A CB  1 
ATOM   4281 N  N   . ASN A 1 548 ? 11.655  54.415 69.880 1.00 20.61 ? 589  ASN A N   1 
ATOM   4282 C  CA  . ASN A 1 548 ? 11.703  54.546 71.362 1.00 21.36 ? 589  ASN A CA  1 
ATOM   4283 C  C   . ASN A 1 548 ? 12.208  55.838 71.911 1.00 22.03 ? 589  ASN A C   1 
ATOM   4284 O  O   . ASN A 1 548 ? 11.849  56.177 73.077 1.00 23.72 ? 589  ASN A O   1 
ATOM   4285 C  CB  B ASN A 1 548 ? 12.519  53.405 71.981 0.65 22.13 ? 589  ASN A CB  1 
ATOM   4286 C  CB  C ASN A 1 548 ? 12.437  53.340 71.981 0.35 21.08 ? 589  ASN A CB  1 
ATOM   4287 C  CG  B ASN A 1 548 ? 11.938  52.959 73.272 0.65 23.15 ? 589  ASN A CG  1 
ATOM   4288 C  CG  C ASN A 1 548 ? 11.588  52.084 71.965 0.35 19.26 ? 589  ASN A CG  1 
ATOM   4289 O  OD1 B ASN A 1 548 ? 12.621  52.984 74.318 0.65 29.88 ? 589  ASN A OD1 1 
ATOM   4290 O  OD1 C ASN A 1 548 ? 10.615  51.979 72.705 0.35 17.09 ? 589  ASN A OD1 1 
ATOM   4291 N  ND2 B ASN A 1 548 ? 10.682  52.557 73.241 0.65 21.61 ? 589  ASN A ND2 1 
ATOM   4292 N  ND2 C ASN A 1 548 ? 11.965  51.105 71.121 0.35 20.46 ? 589  ASN A ND2 1 
ATOM   4293 N  N   . SER A 1 549 ? 13.026  56.561 71.158 1.00 20.05 ? 590  SER A N   1 
ATOM   4294 C  CA  . SER A 1 549 ? 13.564  57.866 71.610 1.00 21.98 ? 590  SER A CA  1 
ATOM   4295 C  C   . SER A 1 549 ? 12.426  58.833 71.902 1.00 21.45 ? 590  SER A C   1 
ATOM   4296 O  O   . SER A 1 549 ? 11.413  58.869 71.167 1.00 22.97 ? 590  SER A O   1 
ATOM   4297 C  CB  . SER A 1 549 ? 14.518  58.433 70.607 1.00 21.51 ? 590  SER A CB  1 
ATOM   4298 O  OG  . SER A 1 549 ? 15.198  59.596 71.088 1.00 25.83 ? 590  SER A OG  1 
ATOM   4299 N  N   . ILE A 1 550 ? 12.543  59.585 72.996 1.00 19.44 ? 591  ILE A N   1 
ATOM   4300 C  CA  . ILE A 1 550 ? 11.447  60.522 73.289 1.00 20.60 ? 591  ILE A CA  1 
ATOM   4301 C  C   . ILE A 1 550 ? 11.370  61.598 72.210 1.00 19.39 ? 591  ILE A C   1 
ATOM   4302 O  O   . ILE A 1 550 ? 10.247  61.863 71.692 1.00 20.49 ? 591  ILE A O   1 
ATOM   4303 C  CB  . ILE A 1 550 ? 11.675  61.151 74.700 1.00 20.54 ? 591  ILE A CB  1 
ATOM   4304 C  CG1 . ILE A 1 550 ? 11.541  60.055 75.773 1.00 21.73 ? 591  ILE A CG1 1 
ATOM   4305 C  CG2 . ILE A 1 550 ? 10.734  62.335 74.918 1.00 23.22 ? 591  ILE A CG2 1 
ATOM   4306 C  CD1 . ILE A 1 550 ? 10.314  59.320 75.808 1.00 25.29 ? 591  ILE A CD1 1 
ATOM   4307 N  N   . VAL A 1 551 ? 12.500  62.219 71.915 1.00 20.12 ? 592  VAL A N   1 
ATOM   4308 C  CA  . VAL A 1 551 ? 12.560  63.148 70.768 1.00 22.02 ? 592  VAL A CA  1 
ATOM   4309 C  C   . VAL A 1 551 ? 13.037  62.293 69.587 1.00 21.68 ? 592  VAL A C   1 
ATOM   4310 O  O   . VAL A 1 551 ? 14.008  61.551 69.706 1.00 22.29 ? 592  VAL A O   1 
ATOM   4311 C  CB  . VAL A 1 551 ? 13.524  64.262 71.014 1.00 21.38 ? 592  VAL A CB  1 
ATOM   4312 C  CG1 . VAL A 1 551 ? 13.674  65.182 69.812 1.00 23.97 ? 592  VAL A CG1 1 
ATOM   4313 C  CG2 . VAL A 1 551 ? 13.037  65.076 72.278 1.00 25.34 ? 592  VAL A CG2 1 
ATOM   4314 N  N   . LEU A 1 552 ? 12.360  62.425 68.447 1.00 19.75 ? 593  LEU A N   1 
ATOM   4315 C  CA  . LEU A 1 552 ? 12.816  61.652 67.289 1.00 19.21 ? 593  LEU A CA  1 
ATOM   4316 C  C   . LEU A 1 552 ? 14.294  61.954 67.002 1.00 18.52 ? 593  LEU A C   1 
ATOM   4317 O  O   . LEU A 1 552 ? 14.755  63.093 67.052 1.00 18.78 ? 593  LEU A O   1 
ATOM   4318 C  CB  . LEU A 1 552 ? 11.911  61.995 66.069 1.00 18.18 ? 593  LEU A CB  1 
ATOM   4319 C  CG  . LEU A 1 552 ? 10.508  61.394 66.052 1.00 21.21 ? 593  LEU A CG  1 
ATOM   4320 C  CD1 . LEU A 1 552 ? 9.676   61.938 64.878 1.00 21.87 ? 593  LEU A CD1 1 
ATOM   4321 C  CD2 . LEU A 1 552 ? 10.666  59.854 65.925 1.00 21.75 ? 593  LEU A CD2 1 
ATOM   4322 N  N   . PRO A 1 553 ? 15.094  60.897 66.654 1.00 18.48 ? 594  PRO A N   1 
ATOM   4323 C  CA  . PRO A 1 553 ? 16.534  61.030 66.488 1.00 20.81 ? 594  PRO A CA  1 
ATOM   4324 C  C   . PRO A 1 553 ? 16.922  61.526 65.091 1.00 21.65 ? 594  PRO A C   1 
ATOM   4325 O  O   . PRO A 1 553 ? 17.726  60.878 64.381 1.00 21.48 ? 594  PRO A O   1 
ATOM   4326 C  CB  . PRO A 1 553 ? 17.049  59.586 66.719 1.00 20.08 ? 594  PRO A CB  1 
ATOM   4327 C  CG  . PRO A 1 553 ? 15.923  58.708 66.171 1.00 20.63 ? 594  PRO A CG  1 
ATOM   4328 C  CD  . PRO A 1 553 ? 14.618  59.507 66.522 1.00 20.19 ? 594  PRO A CD  1 
ATOM   4329 N  N   . PHE A 1 554 ? 16.398  62.703 64.720 1.00 19.66 ? 595  PHE A N   1 
ATOM   4330 C  CA  . PHE A 1 554 ? 16.696  63.360 63.449 1.00 19.77 ? 595  PHE A CA  1 
ATOM   4331 C  C   . PHE A 1 554 ? 17.393  64.676 63.743 1.00 20.53 ? 595  PHE A C   1 
ATOM   4332 O  O   . PHE A 1 554 ? 16.948  65.379 64.689 1.00 21.94 ? 595  PHE A O   1 
ATOM   4333 C  CB  . PHE A 1 554 ? 15.414  63.739 62.678 1.00 19.84 ? 595  PHE A CB  1 
ATOM   4334 C  CG  . PHE A 1 554 ? 14.587  62.570 62.197 1.00 17.67 ? 595  PHE A CG  1 
ATOM   4335 C  CD1 . PHE A 1 554 ? 15.197  61.342 61.863 1.00 19.82 ? 595  PHE A CD1 1 
ATOM   4336 C  CD2 . PHE A 1 554 ? 13.211  62.727 61.964 1.00 18.64 ? 595  PHE A CD2 1 
ATOM   4337 C  CE1 . PHE A 1 554 ? 14.381  60.254 61.411 1.00 19.96 ? 595  PHE A CE1 1 
ATOM   4338 C  CE2 . PHE A 1 554 ? 12.366  61.638 61.493 1.00 17.13 ? 595  PHE A CE2 1 
ATOM   4339 C  CZ  . PHE A 1 554 ? 12.983  60.402 61.214 1.00 19.20 ? 595  PHE A CZ  1 
ATOM   4340 N  N   . ASP A 1 555 ? 18.422  65.003 62.977 1.00 19.75 ? 596  ASP A N   1 
ATOM   4341 C  CA  . ASP A 1 555 ? 19.071  66.296 63.094 1.00 20.36 ? 596  ASP A CA  1 
ATOM   4342 C  C   . ASP A 1 555 ? 18.908  67.101 61.804 1.00 18.77 ? 596  ASP A C   1 
ATOM   4343 O  O   . ASP A 1 555 ? 19.603  66.870 60.775 1.00 19.12 ? 596  ASP A O   1 
ATOM   4344 C  CB  . ASP A 1 555 ? 20.522  66.141 63.509 1.00 18.76 ? 596  ASP A CB  1 
ATOM   4345 C  CG  . ASP A 1 555 ? 21.138  67.460 63.973 1.00 26.28 ? 596  ASP A CG  1 
ATOM   4346 O  OD1 . ASP A 1 555 ? 20.570  68.551 63.714 1.00 24.21 ? 596  ASP A OD1 1 
ATOM   4347 O  OD2 . ASP A 1 555 ? 22.229  67.395 64.569 1.00 27.94 ? 596  ASP A OD2 1 
ATOM   4348 N  N   . CYS A 1 556 ? 17.950  68.057 61.855 1.00 19.92 ? 597  CYS A N   1 
ATOM   4349 C  CA  . CYS A 1 556 ? 17.741  68.950 60.697 1.00 19.74 ? 597  CYS A CA  1 
ATOM   4350 C  C   . CYS A 1 556 ? 18.963  69.721 60.242 1.00 19.36 ? 597  CYS A C   1 
ATOM   4351 O  O   . CYS A 1 556 ? 19.100  70.080 59.066 1.00 19.10 ? 597  CYS A O   1 
ATOM   4352 C  CB  . CYS A 1 556 ? 16.565  69.895 60.947 1.00 17.98 ? 597  CYS A CB  1 
ATOM   4353 S  SG  . CYS A 1 556 ? 16.855  71.011 62.427 1.00 25.31 ? 597  CYS A SG  1 
ATOM   4354 N  N   . ARG A 1 557 ? 19.950  69.967 61.139 1.00 20.03 ? 598  ARG A N   1 
ATOM   4355 C  CA  . ARG A 1 557 ? 21.153  70.686 60.714 1.00 19.61 ? 598  ARG A CA  1 
ATOM   4356 C  C   . ARG A 1 557 ? 21.988  69.954 59.670 1.00 20.26 ? 598  ARG A C   1 
ATOM   4357 O  O   . ARG A 1 557 ? 22.664  70.556 58.844 1.00 21.05 ? 598  ARG A O   1 
ATOM   4358 C  CB  . ARG A 1 557 ? 22.019  71.027 61.930 1.00 21.53 ? 598  ARG A CB  1 
ATOM   4359 C  CG  . ARG A 1 557 ? 21.257  71.963 62.860 1.00 21.80 ? 598  ARG A CG  1 
ATOM   4360 C  CD  . ARG A 1 557 ? 22.024  72.122 64.212 1.00 23.91 ? 598  ARG A CD  1 
ATOM   4361 N  NE  . ARG A 1 557 ? 22.062  70.846 64.917 1.00 25.78 ? 598  ARG A NE  1 
ATOM   4362 C  CZ  . ARG A 1 557 ? 22.673  70.640 66.078 1.00 29.80 ? 598  ARG A CZ  1 
ATOM   4363 N  NH1 . ARG A 1 557 ? 23.260  71.658 66.691 1.00 25.93 ? 598  ARG A NH1 1 
ATOM   4364 N  NH2 . ARG A 1 557 ? 22.643  69.430 66.633 1.00 27.86 ? 598  ARG A NH2 1 
ATOM   4365 N  N   . ASP A 1 558 ? 21.897  68.621 59.727 1.00 19.71 ? 599  ASP A N   1 
ATOM   4366 C  CA  . ASP A 1 558 ? 22.599  67.777 58.746 1.00 19.64 ? 599  ASP A CA  1 
ATOM   4367 C  C   . ASP A 1 558 ? 21.989  67.967 57.366 1.00 18.48 ? 599  ASP A C   1 
ATOM   4368 O  O   . ASP A 1 558 ? 22.702  67.933 56.382 1.00 20.17 ? 599  ASP A O   1 
ATOM   4369 C  CB  . ASP A 1 558 ? 22.518  66.318 59.201 1.00 19.72 ? 599  ASP A CB  1 
ATOM   4370 C  CG  . ASP A 1 558 ? 23.504  66.031 60.362 1.00 24.13 ? 599  ASP A CG  1 
ATOM   4371 O  OD1 . ASP A 1 558 ? 24.523  66.745 60.453 1.00 32.56 ? 599  ASP A OD1 1 
ATOM   4372 O  OD2 . ASP A 1 558 ? 23.208  65.194 61.232 1.00 25.09 ? 599  ASP A OD2 1 
ATOM   4373 N  N   . TYR A 1 559 ? 20.675  68.188 57.315 1.00 18.97 ? 600  TYR A N   1 
ATOM   4374 C  CA  . TYR A 1 559 ? 20.108  68.535 55.992 1.00 18.11 ? 600  TYR A CA  1 
ATOM   4375 C  C   . TYR A 1 559 ? 20.645  69.857 55.507 1.00 18.00 ? 600  TYR A C   1 
ATOM   4376 O  O   . TYR A 1 559 ? 20.979  70.028 54.343 1.00 17.52 ? 600  TYR A O   1 
ATOM   4377 C  CB  . TYR A 1 559 ? 18.576  68.591 56.002 1.00 17.20 ? 600  TYR A CB  1 
ATOM   4378 C  CG  . TYR A 1 559 ? 17.922  67.587 55.006 1.00 16.19 ? 600  TYR A CG  1 
ATOM   4379 C  CD1 . TYR A 1 559 ? 18.255  67.641 53.671 1.00 17.59 ? 600  TYR A CD1 1 
ATOM   4380 C  CD2 . TYR A 1 559 ? 16.952  66.677 55.449 1.00 18.32 ? 600  TYR A CD2 1 
ATOM   4381 C  CE1 . TYR A 1 559 ? 17.647  66.758 52.749 1.00 18.83 ? 600  TYR A CE1 1 
ATOM   4382 C  CE2 . TYR A 1 559 ? 16.312  65.746 54.548 1.00 17.06 ? 600  TYR A CE2 1 
ATOM   4383 C  CZ  . TYR A 1 559 ? 16.696  65.840 53.186 1.00 18.79 ? 600  TYR A CZ  1 
ATOM   4384 O  OH  . TYR A 1 559 ? 16.159  64.967 52.238 1.00 18.56 ? 600  TYR A OH  1 
ATOM   4385 N  N   . ALA A 1 560 ? 20.748  70.848 56.411 1.00 17.47 ? 601  ALA A N   1 
ATOM   4386 C  CA  . ALA A 1 560 ? 21.292  72.145 55.940 1.00 19.27 ? 601  ALA A CA  1 
ATOM   4387 C  C   . ALA A 1 560 ? 22.701  72.097 55.310 1.00 18.74 ? 601  ALA A C   1 
ATOM   4388 O  O   . ALA A 1 560 ? 22.974  72.697 54.260 1.00 18.97 ? 601  ALA A O   1 
ATOM   4389 C  CB  . ALA A 1 560 ? 21.289  73.126 57.153 1.00 19.14 ? 601  ALA A CB  1 
ATOM   4390 N  N   . VAL A 1 561 ? 23.574  71.294 55.931 1.00 20.91 ? 602  VAL A N   1 
ATOM   4391 C  CA  . VAL A 1 561 ? 24.897  71.066 55.461 1.00 20.77 ? 602  VAL A CA  1 
ATOM   4392 C  C   . VAL A 1 561 ? 24.879  70.477 54.049 1.00 20.25 ? 602  VAL A C   1 
ATOM   4393 O  O   . VAL A 1 561 ? 25.509  71.018 53.141 1.00 21.43 ? 602  VAL A O   1 
ATOM   4394 C  CB  . VAL A 1 561 ? 25.713  70.149 56.416 1.00 21.53 ? 602  VAL A CB  1 
ATOM   4395 C  CG1 . VAL A 1 561 ? 27.040  69.766 55.747 1.00 24.05 ? 602  VAL A CG1 1 
ATOM   4396 C  CG2 . VAL A 1 561 ? 25.979  70.900 57.711 1.00 24.25 ? 602  VAL A CG2 1 
ATOM   4397 N  N   . VAL A 1 562 ? 24.090  69.415 53.844 1.00 19.36 ? 603  VAL A N   1 
ATOM   4398 C  CA  . VAL A 1 562 ? 24.170  68.810 52.487 1.00 18.74 ? 603  VAL A CA  1 
ATOM   4399 C  C   . VAL A 1 562 ? 23.484  69.679 51.456 1.00 17.60 ? 603  VAL A C   1 
ATOM   4400 O  O   . VAL A 1 562 ? 23.882  69.678 50.291 1.00 18.89 ? 603  VAL A O   1 
ATOM   4401 C  CB  . VAL A 1 562 ? 23.662  67.346 52.412 1.00 20.53 ? 603  VAL A CB  1 
ATOM   4402 C  CG1 . VAL A 1 562 ? 24.433  66.493 53.456 1.00 22.15 ? 603  VAL A CG1 1 
ATOM   4403 C  CG2 . VAL A 1 562 ? 22.206  67.266 52.671 1.00 23.60 ? 603  VAL A CG2 1 
ATOM   4404 N  N   . LEU A 1 563 ? 22.451  70.412 51.862 1.00 17.74 ? 604  LEU A N   1 
ATOM   4405 C  CA  . LEU A 1 563 ? 21.805  71.285 50.848 1.00 17.52 ? 604  LEU A CA  1 
ATOM   4406 C  C   . LEU A 1 563 ? 22.781  72.290 50.269 1.00 17.76 ? 604  LEU A C   1 
ATOM   4407 O  O   . LEU A 1 563 ? 22.741  72.600 49.072 1.00 18.67 ? 604  LEU A O   1 
ATOM   4408 C  CB  . LEU A 1 563 ? 20.541  71.968 51.405 1.00 17.18 ? 604  LEU A CB  1 
ATOM   4409 C  CG  . LEU A 1 563 ? 19.367  71.057 51.776 1.00 17.00 ? 604  LEU A CG  1 
ATOM   4410 C  CD1 . LEU A 1 563 ? 18.398  71.834 52.590 1.00 18.55 ? 604  LEU A CD1 1 
ATOM   4411 C  CD2 . LEU A 1 563 ? 18.707  70.675 50.418 1.00 17.35 ? 604  LEU A CD2 1 
ATOM   4412 N  N   . ARG A 1 564 ? 23.668  72.842 51.136 1.00 18.67 ? 605  ARG A N   1 
ATOM   4413 C  CA  . ARG A 1 564 ? 24.668  73.734 50.602 1.00 20.07 ? 605  ARG A CA  1 
ATOM   4414 C  C   . ARG A 1 564 ? 25.638  73.031 49.659 1.00 19.20 ? 605  ARG A C   1 
ATOM   4415 O  O   . ARG A 1 564 ? 25.948  73.558 48.605 1.00 18.68 ? 605  ARG A O   1 
ATOM   4416 C  CB  . ARG A 1 564 ? 25.395  74.481 51.745 1.00 20.21 ? 605  ARG A CB  1 
ATOM   4417 C  CG  . ARG A 1 564 ? 26.492  75.392 51.261 1.00 23.19 ? 605  ARG A CG  1 
ATOM   4418 C  CD  . ARG A 1 564 ? 26.001  76.514 50.271 1.00 27.58 ? 605  ARG A CD  1 
ATOM   4419 N  NE  . ARG A 1 564 ? 27.122  77.319 49.785 1.00 31.12 ? 605  ARG A NE  1 
ATOM   4420 C  CZ  . ARG A 1 564 ? 27.617  78.353 50.474 1.00 35.17 ? 605  ARG A CZ  1 
ATOM   4421 N  NH1 . ARG A 1 564 ? 27.077  78.676 51.648 1.00 35.50 ? 605  ARG A NH1 1 
ATOM   4422 N  NH2 . ARG A 1 564 ? 28.648  79.049 50.000 1.00 35.88 ? 605  ARG A NH2 1 
ATOM   4423 N  N   . LYS A 1 565 ? 26.081  71.824 50.013 1.00 19.73 ? 606  LYS A N   1 
ATOM   4424 C  CA  . LYS A 1 565 ? 26.955  71.074 49.115 1.00 21.68 ? 606  LYS A CA  1 
ATOM   4425 C  C   . LYS A 1 565 ? 26.236  70.839 47.730 1.00 19.42 ? 606  LYS A C   1 
ATOM   4426 O  O   . LYS A 1 565 ? 26.822  71.020 46.663 1.00 19.11 ? 606  LYS A O   1 
ATOM   4427 C  CB  . LYS A 1 565 ? 27.279  69.774 49.844 1.00 21.69 ? 606  LYS A CB  1 
ATOM   4428 C  CG  . LYS A 1 565 ? 28.187  68.812 49.102 1.00 28.26 ? 606  LYS A CG  1 
ATOM   4429 C  CD  . LYS A 1 565 ? 28.373  67.544 49.958 1.00 29.35 ? 606  LYS A CD  1 
ATOM   4430 C  CE  . LYS A 1 565 ? 27.127  66.639 50.005 1.00 35.86 ? 606  LYS A CE  1 
ATOM   4431 N  NZ  . LYS A 1 565 ? 27.500  65.266 50.445 1.00 37.91 ? 606  LYS A NZ  1 
ATOM   4432 N  N   . TYR A 1 566 ? 24.958  70.429 47.777 1.00 18.56 ? 607  TYR A N   1 
ATOM   4433 C  CA  . TYR A 1 566 ? 24.216  70.143 46.527 1.00 18.40 ? 607  TYR A CA  1 
ATOM   4434 C  C   . TYR A 1 566 ? 24.033  71.398 45.691 1.00 16.72 ? 607  TYR A C   1 
ATOM   4435 O  O   . TYR A 1 566 ? 24.145  71.363 44.482 1.00 18.77 ? 607  TYR A O   1 
ATOM   4436 C  CB  . TYR A 1 566 ? 22.849  69.538 46.840 1.00 18.37 ? 607  TYR A CB  1 
ATOM   4437 C  CG  . TYR A 1 566 ? 22.893  68.223 47.620 1.00 17.81 ? 607  TYR A CG  1 
ATOM   4438 C  CD1 . TYR A 1 566 ? 24.052  67.419 47.605 1.00 15.85 ? 607  TYR A CD1 1 
ATOM   4439 C  CD2 . TYR A 1 566 ? 21.776  67.765 48.319 1.00 19.06 ? 607  TYR A CD2 1 
ATOM   4440 C  CE1 . TYR A 1 566 ? 24.092  66.212 48.351 1.00 18.27 ? 607  TYR A CE1 1 
ATOM   4441 C  CE2 . TYR A 1 566 ? 21.810  66.561 49.083 1.00 18.58 ? 607  TYR A CE2 1 
ATOM   4442 C  CZ  . TYR A 1 566 ? 22.970  65.775 49.032 1.00 18.08 ? 607  TYR A CZ  1 
ATOM   4443 O  OH  . TYR A 1 566 ? 22.991  64.610 49.741 1.00 20.32 ? 607  TYR A OH  1 
ATOM   4444 N  N   . ALA A 1 567 ? 23.772  72.528 46.370 1.00 18.38 ? 608  ALA A N   1 
ATOM   4445 C  CA  . ALA A 1 567 ? 23.628  73.802 45.664 1.00 17.85 ? 608  ALA A CA  1 
ATOM   4446 C  C   . ALA A 1 567 ? 24.943  74.239 45.001 1.00 19.34 ? 608  ALA A C   1 
ATOM   4447 O  O   . ALA A 1 567 ? 24.944  74.579 43.809 1.00 20.68 ? 608  ALA A O   1 
ATOM   4448 C  CB  . ALA A 1 567 ? 23.112  74.888 46.648 1.00 17.23 ? 608  ALA A CB  1 
ATOM   4449 N  N   . ASP A 1 568 ? 26.072  74.149 45.731 1.00 20.12 ? 609  ASP A N   1 
ATOM   4450 C  CA  . ASP A 1 568 ? 27.392  74.387 45.102 1.00 20.86 ? 609  ASP A CA  1 
ATOM   4451 C  C   . ASP A 1 568 ? 27.630  73.493 43.871 1.00 20.62 ? 609  ASP A C   1 
ATOM   4452 O  O   . ASP A 1 568 ? 28.108  73.925 42.831 1.00 20.86 ? 609  ASP A O   1 
ATOM   4453 C  CB  . ASP A 1 568 ? 28.504  74.118 46.116 1.00 22.15 ? 609  ASP A CB  1 
ATOM   4454 C  CG  . ASP A 1 568 ? 28.567  75.123 47.220 1.00 26.67 ? 609  ASP A CG  1 
ATOM   4455 O  OD1 . ASP A 1 568 ? 28.027  76.225 47.088 1.00 29.03 ? 609  ASP A OD1 1 
ATOM   4456 O  OD2 . ASP A 1 568 ? 29.204  74.778 48.254 1.00 30.91 ? 609  ASP A OD2 1 
ATOM   4457 N  N   . LYS A 1 569 ? 27.240  72.233 43.984 1.00 19.11 ? 610  LYS A N   1 
ATOM   4458 C  CA  . LYS A 1 569 ? 27.463  71.287 42.940 1.00 20.19 ? 610  LYS A CA  1 
ATOM   4459 C  C   . LYS A 1 569 ? 26.623  71.585 41.689 1.00 19.89 ? 610  LYS A C   1 
ATOM   4460 O  O   . LYS A 1 569 ? 27.135  71.570 40.553 1.00 21.39 ? 610  LYS A O   1 
ATOM   4461 C  CB  . LYS A 1 569 ? 27.219  69.874 43.493 1.00 20.58 ? 610  LYS A CB  1 
ATOM   4462 C  CG  . LYS A 1 569 ? 27.353  68.816 42.452 1.00 22.36 ? 610  LYS A CG  1 
ATOM   4463 C  CD  . LYS A 1 569 ? 27.012  67.479 43.049 1.00 29.34 ? 610  LYS A CD  1 
ATOM   4464 C  CE  . LYS A 1 569 ? 27.414  66.402 42.057 1.00 33.08 ? 610  LYS A CE  1 
ATOM   4465 N  NZ  . LYS A 1 569 ? 26.749  65.113 42.413 1.00 37.04 ? 610  LYS A NZ  1 
ATOM   4466 N  N   . ILE A 1 570 ? 25.320  71.859 41.890 1.00 17.68 ? 611  ILE A N   1 
ATOM   4467 C  CA  . ILE A 1 570 ? 24.487  72.117 40.699 1.00 17.65 ? 611  ILE A CA  1 
ATOM   4468 C  C   . ILE A 1 570 ? 24.911  73.475 40.058 1.00 17.88 ? 611  ILE A C   1 
ATOM   4469 O  O   . ILE A 1 570 ? 24.932  73.617 38.845 1.00 19.34 ? 611  ILE A O   1 
ATOM   4470 C  CB  . ILE A 1 570 ? 22.986  72.047 41.060 1.00 18.22 ? 611  ILE A CB  1 
ATOM   4471 C  CG1 . ILE A 1 570 ? 22.185  71.981 39.753 1.00 19.04 ? 611  ILE A CG1 1 
ATOM   4472 C  CG2 . ILE A 1 570 ? 22.591  73.202 41.993 1.00 20.09 ? 611  ILE A CG2 1 
ATOM   4473 C  CD1 . ILE A 1 570 ? 22.355  70.633 39.003 1.00 19.15 ? 611  ILE A CD1 1 
ATOM   4474 N  N   . TYR A 1 571 ? 25.250  74.452 40.904 1.00 19.52 ? 612  TYR A N   1 
ATOM   4475 C  CA  . TYR A 1 571 ? 25.751  75.721 40.385 1.00 21.95 ? 612  TYR A CA  1 
ATOM   4476 C  C   . TYR A 1 571 ? 27.000  75.498 39.508 1.00 21.61 ? 612  TYR A C   1 
ATOM   4477 O  O   . TYR A 1 571 ? 27.131  76.063 38.419 1.00 21.63 ? 612  TYR A O   1 
ATOM   4478 C  CB  . TYR A 1 571 ? 26.058  76.664 41.562 1.00 22.47 ? 612  TYR A CB  1 
ATOM   4479 C  CG  . TYR A 1 571 ? 26.761  77.908 41.081 1.00 28.74 ? 612  TYR A CG  1 
ATOM   4480 C  CD1 . TYR A 1 571 ? 26.035  78.912 40.446 1.00 30.59 ? 612  TYR A CD1 1 
ATOM   4481 C  CD2 . TYR A 1 571 ? 28.147  78.014 41.170 1.00 32.49 ? 612  TYR A CD2 1 
ATOM   4482 C  CE1 . TYR A 1 571 ? 26.670  80.062 39.967 1.00 34.47 ? 612  TYR A CE1 1 
ATOM   4483 C  CE2 . TYR A 1 571 ? 28.812  79.163 40.681 1.00 33.91 ? 612  TYR A CE2 1 
ATOM   4484 C  CZ  . TYR A 1 571 ? 28.051  80.155 40.059 1.00 32.42 ? 612  TYR A CZ  1 
ATOM   4485 O  OH  . TYR A 1 571 ? 28.665  81.313 39.568 1.00 36.06 ? 612  TYR A OH  1 
ATOM   4486 N  N   . SER A 1 572 ? 27.911  74.639 39.982 1.00 22.02 ? 613  SER A N   1 
ATOM   4487 C  CA  . SER A 1 572 ? 29.150  74.351 39.280 1.00 22.86 ? 613  SER A CA  1 
ATOM   4488 C  C   . SER A 1 572 ? 28.896  73.662 37.935 1.00 23.74 ? 613  SER A C   1 
ATOM   4489 O  O   . SER A 1 572 ? 29.566  73.934 36.953 1.00 25.51 ? 613  SER A O   1 
ATOM   4490 C  CB  . SER A 1 572 ? 30.132  73.572 40.154 1.00 22.61 ? 613  SER A CB  1 
ATOM   4491 O  OG  A SER A 1 572 ? 30.557  74.351 41.269 0.50 22.59 ? 613  SER A OG  1 
ATOM   4492 O  OG  B SER A 1 572 ? 29.800  72.198 40.201 0.50 25.03 ? 613  SER A OG  1 
ATOM   4493 N  N   . ILE A 1 573 ? 27.907  72.756 37.877 1.00 22.69 ? 614  ILE A N   1 
ATOM   4494 C  CA  . ILE A 1 573 ? 27.490  72.216 36.609 1.00 21.91 ? 614  ILE A CA  1 
ATOM   4495 C  C   . ILE A 1 573 ? 26.996  73.291 35.636 1.00 22.47 ? 614  ILE A C   1 
ATOM   4496 O  O   . ILE A 1 573 ? 27.318  73.277 34.445 1.00 23.39 ? 614  ILE A O   1 
ATOM   4497 C  CB  . ILE A 1 573 ? 26.386  71.102 36.815 1.00 22.71 ? 614  ILE A CB  1 
ATOM   4498 C  CG1 . ILE A 1 573 ? 27.042  69.942 37.596 1.00 21.69 ? 614  ILE A CG1 1 
ATOM   4499 C  CG2 . ILE A 1 573 ? 25.765  70.685 35.465 1.00 22.64 ? 614  ILE A CG2 1 
ATOM   4500 C  CD1 . ILE A 1 573 ? 26.063  68.888 38.041 1.00 25.44 ? 614  ILE A CD1 1 
ATOM   4501 N  N   . SER A 1 574 ? 26.199  74.229 36.148 1.00 21.93 ? 615  SER A N   1 
ATOM   4502 C  CA  . SER A 1 574 ? 25.641  75.271 35.290 1.00 21.86 ? 615  SER A CA  1 
ATOM   4503 C  C   . SER A 1 574 ? 26.758  76.157 34.747 1.00 22.77 ? 615  SER A C   1 
ATOM   4504 O  O   . SER A 1 574 ? 26.717  76.559 33.570 1.00 23.26 ? 615  SER A O   1 
ATOM   4505 C  CB  . SER A 1 574 ? 24.637  76.130 36.057 1.00 21.97 ? 615  SER A CB  1 
ATOM   4506 O  OG  . SER A 1 574 ? 23.906  76.938 35.142 1.00 22.70 ? 615  SER A OG  1 
ATOM   4507 N  N   . MET A 1 575 ? 27.714  76.443 35.616 1.00 24.02 ? 616  MET A N   1 
ATOM   4508 C  CA  . MET A 1 575 ? 28.833  77.347 35.283 1.00 26.46 ? 616  MET A CA  1 
ATOM   4509 C  C   . MET A 1 575 ? 29.827  76.786 34.254 1.00 28.24 ? 616  MET A C   1 
ATOM   4510 O  O   . MET A 1 575 ? 30.786  77.477 33.841 1.00 30.07 ? 616  MET A O   1 
ATOM   4511 C  CB  . MET A 1 575 ? 29.520  77.811 36.554 1.00 26.15 ? 616  MET A CB  1 
ATOM   4512 C  CG  . MET A 1 575 ? 28.766  78.927 37.237 1.00 31.90 ? 616  MET A CG  1 
ATOM   4513 S  SD  . MET A 1 575 ? 28.656  80.464 36.214 1.00 39.78 ? 616  MET A SD  1 
ATOM   4514 C  CE  . MET A 1 575 ? 30.368  81.027 36.278 1.00 37.06 ? 616  MET A CE  1 
ATOM   4515 N  N   . LYS A 1 576 ? 29.606  75.567 33.786 1.00 29.25 ? 617  LYS A N   1 
ATOM   4516 C  CA  . LYS A 1 576 ? 30.271  75.099 32.554 1.00 29.96 ? 617  LYS A CA  1 
ATOM   4517 C  C   . LYS A 1 576 ? 29.786  75.870 31.319 1.00 29.26 ? 617  LYS A C   1 
ATOM   4518 O  O   . LYS A 1 576 ? 30.406  75.789 30.242 1.00 29.38 ? 617  LYS A O   1 
ATOM   4519 C  CB  . LYS A 1 576 ? 30.062  73.590 32.375 1.00 30.65 ? 617  LYS A CB  1 
ATOM   4520 C  CG  . LYS A 1 576 ? 30.902  72.762 33.344 1.00 34.41 ? 617  LYS A CG  1 
ATOM   4521 C  CD  . LYS A 1 576 ? 30.159  71.522 33.914 1.00 41.31 ? 617  LYS A CD  1 
ATOM   4522 C  CE  . LYS A 1 576 ? 29.624  70.551 32.855 1.00 43.03 ? 617  LYS A CE  1 
ATOM   4523 N  NZ  . LYS A 1 576 ? 29.243  69.217 33.435 1.00 42.25 ? 617  LYS A NZ  1 
ATOM   4524 N  N   . HIS A 1 577 ? 28.695  76.631 31.470 1.00 27.73 ? 618  HIS A N   1 
ATOM   4525 C  CA  . HIS A 1 577 ? 28.067  77.334 30.349 1.00 27.57 ? 618  HIS A CA  1 
ATOM   4526 C  C   . HIS A 1 577 ? 27.877  78.828 30.660 1.00 27.80 ? 618  HIS A C   1 
ATOM   4527 O  O   . HIS A 1 577 ? 26.742  79.318 30.668 1.00 25.97 ? 618  HIS A O   1 
ATOM   4528 C  CB  . HIS A 1 577 ? 26.693  76.739 30.088 1.00 27.68 ? 618  HIS A CB  1 
ATOM   4529 C  CG  . HIS A 1 577 ? 26.698  75.252 29.919 1.00 30.62 ? 618  HIS A CG  1 
ATOM   4530 N  ND1 . HIS A 1 577 ? 26.533  74.373 30.975 1.00 35.23 ? 618  HIS A ND1 1 
ATOM   4531 C  CD2 . HIS A 1 577 ? 26.826  74.493 28.810 1.00 30.09 ? 618  HIS A CD2 1 
ATOM   4532 C  CE1 . HIS A 1 577 ? 26.551  73.132 30.513 1.00 33.19 ? 618  HIS A CE1 1 
ATOM   4533 N  NE2 . HIS A 1 577 ? 26.728  73.179 29.203 1.00 33.95 ? 618  HIS A NE2 1 
ATOM   4534 N  N   . PRO A 1 578 ? 28.987  79.554 30.963 1.00 28.51 ? 619  PRO A N   1 
ATOM   4535 C  CA  . PRO A 1 578 ? 28.866  80.965 31.386 1.00 28.02 ? 619  PRO A CA  1 
ATOM   4536 C  C   . PRO A 1 578 ? 28.170  81.847 30.375 1.00 27.38 ? 619  PRO A C   1 
ATOM   4537 O  O   . PRO A 1 578 ? 27.352  82.674 30.786 1.00 26.74 ? 619  PRO A O   1 
ATOM   4538 C  CB  . PRO A 1 578 ? 30.334  81.418 31.595 1.00 28.56 ? 619  PRO A CB  1 
ATOM   4539 C  CG  . PRO A 1 578 ? 31.142  80.428 30.809 1.00 29.81 ? 619  PRO A CG  1 
ATOM   4540 C  CD  . PRO A 1 578 ? 30.383  79.116 30.920 1.00 28.42 ? 619  PRO A CD  1 
ATOM   4541 N  N   . GLN A 1 579 ? 28.450  81.675 29.075 1.00 27.41 ? 620  GLN A N   1 
ATOM   4542 C  CA  . GLN A 1 579 ? 27.819  82.514 28.057 1.00 27.84 ? 620  GLN A CA  1 
ATOM   4543 C  C   . GLN A 1 579 ? 26.290  82.412 28.112 1.00 27.40 ? 620  GLN A C   1 
ATOM   4544 O  O   . GLN A 1 579 ? 25.572  83.426 28.034 1.00 25.36 ? 620  GLN A O   1 
ATOM   4545 C  CB  . GLN A 1 579 ? 28.277  82.153 26.635 1.00 29.44 ? 620  GLN A CB  1 
ATOM   4546 C  CG  . GLN A 1 579 ? 27.551  82.987 25.558 1.00 34.19 ? 620  GLN A CG  1 
ATOM   4547 C  CD  . GLN A 1 579 ? 27.800  84.490 25.734 1.00 40.69 ? 620  GLN A CD  1 
ATOM   4548 O  OE1 . GLN A 1 579 ? 26.902  85.267 26.132 1.00 39.27 ? 620  GLN A OE1 1 
ATOM   4549 N  NE2 . GLN A 1 579 ? 29.046  84.899 25.494 1.00 43.75 ? 620  GLN A NE2 1 
ATOM   4550 N  N   . GLU A 1 580 ? 25.790  81.174 28.238 1.00 24.97 ? 621  GLU A N   1 
ATOM   4551 C  CA  . GLU A 1 580 ? 24.360  80.974 28.289 1.00 24.10 ? 621  GLU A CA  1 
ATOM   4552 C  C   . GLU A 1 580 ? 23.763  81.537 29.566 1.00 22.61 ? 621  GLU A C   1 
ATOM   4553 O  O   . GLU A 1 580 ? 22.656  82.084 29.557 1.00 23.24 ? 621  GLU A O   1 
ATOM   4554 C  CB  . GLU A 1 580 ? 24.018  79.478 28.151 1.00 24.74 ? 621  GLU A CB  1 
ATOM   4555 C  CG  . GLU A 1 580 ? 24.181  79.003 26.726 1.00 29.89 ? 621  GLU A CG  1 
ATOM   4556 C  CD  . GLU A 1 580 ? 25.635  78.766 26.335 1.00 33.23 ? 621  GLU A CD  1 
ATOM   4557 O  OE1 . GLU A 1 580 ? 26.560  78.668 27.194 1.00 35.09 ? 621  GLU A OE1 1 
ATOM   4558 O  OE2 . GLU A 1 580 ? 25.867  78.683 25.113 1.00 40.57 ? 621  GLU A OE2 1 
ATOM   4559 N  N   . MET A 1 581 ? 24.472  81.392 30.678 1.00 21.60 ? 622  MET A N   1 
ATOM   4560 C  CA  . MET A 1 581 ? 23.965  81.955 31.915 1.00 22.00 ? 622  MET A CA  1 
ATOM   4561 C  C   . MET A 1 581 ? 23.843  83.481 31.809 1.00 23.30 ? 622  MET A C   1 
ATOM   4562 O  O   . MET A 1 581 ? 22.912  84.068 32.357 1.00 21.63 ? 622  MET A O   1 
ATOM   4563 C  CB  . MET A 1 581 ? 24.816  81.555 33.091 1.00 21.69 ? 622  MET A CB  1 
ATOM   4564 C  CG  . MET A 1 581 ? 24.825  80.014 33.319 1.00 21.21 ? 622  MET A CG  1 
ATOM   4565 S  SD  . MET A 1 581 ? 25.677  79.573 34.817 1.00 23.44 ? 622  MET A SD  1 
ATOM   4566 C  CE  . MET A 1 581 ? 24.848  80.467 36.126 1.00 22.23 ? 622  MET A CE  1 
ATOM   4567 N  N   . LYS A 1 582 ? 24.771  84.111 31.071 1.00 23.43 ? 623  LYS A N   1 
ATOM   4568 C  CA  . LYS A 1 582 ? 24.689  85.557 30.823 1.00 24.38 ? 623  LYS A CA  1 
ATOM   4569 C  C   . LYS A 1 582 ? 23.506  85.927 29.915 1.00 23.98 ? 623  LYS A C   1 
ATOM   4570 O  O   . LYS A 1 582 ? 22.697  86.779 30.273 1.00 24.50 ? 623  LYS A O   1 
ATOM   4571 C  CB  . LYS A 1 582 ? 25.989  86.050 30.182 1.00 24.62 ? 623  LYS A CB  1 
ATOM   4572 C  CG  . LYS A 1 582 ? 27.149  86.069 31.162 1.00 25.67 ? 623  LYS A CG  1 
ATOM   4573 C  CD  . LYS A 1 582 ? 28.451  86.325 30.406 1.00 32.34 ? 623  LYS A CD  1 
ATOM   4574 C  CE  . LYS A 1 582 ? 29.570  86.272 31.397 1.00 37.68 ? 623  LYS A CE  1 
ATOM   4575 N  NZ  . LYS A 1 582 ? 30.803  85.653 30.851 1.00 41.15 ? 623  LYS A NZ  1 
ATOM   4576 N  N   . THR A 1 583 ? 23.388  85.230 28.787 1.00 24.02 ? 624  THR A N   1 
ATOM   4577 C  CA  . THR A 1 583 ? 22.359  85.460 27.803 1.00 25.30 ? 624  THR A CA  1 
ATOM   4578 C  C   . THR A 1 583 ? 20.973  85.312 28.409 1.00 25.45 ? 624  THR A C   1 
ATOM   4579 O  O   . THR A 1 583 ? 20.073  86.125 28.185 1.00 25.46 ? 624  THR A O   1 
ATOM   4580 C  CB  . THR A 1 583 ? 22.513  84.474 26.573 1.00 25.92 ? 624  THR A CB  1 
ATOM   4581 O  OG1 . THR A 1 583 ? 23.773  84.709 25.925 1.00 30.50 ? 624  THR A OG1 1 
ATOM   4582 C  CG2 . THR A 1 583 ? 21.388  84.630 25.559 1.00 26.70 ? 624  THR A CG2 1 
ATOM   4583 N  N   . TYR A 1 584 ? 20.786  84.243 29.186 1.00 24.61 ? 625  TYR A N   1 
ATOM   4584 C  CA  . TYR A 1 584 ? 19.439  83.944 29.656 1.00 24.77 ? 625  TYR A CA  1 
ATOM   4585 C  C   . TYR A 1 584 ? 19.203  84.350 31.092 1.00 23.71 ? 625  TYR A C   1 
ATOM   4586 O  O   . TYR A 1 584 ? 18.145  84.035 31.664 1.00 22.68 ? 625  TYR A O   1 
ATOM   4587 C  CB  . TYR A 1 584 ? 19.112  82.455 29.443 1.00 25.46 ? 625  TYR A CB  1 
ATOM   4588 C  CG  . TYR A 1 584 ? 19.185  82.111 27.987 1.00 24.82 ? 625  TYR A CG  1 
ATOM   4589 C  CD1 . TYR A 1 584 ? 18.272  82.650 27.067 1.00 26.95 ? 625  TYR A CD1 1 
ATOM   4590 C  CD2 . TYR A 1 584 ? 20.202  81.297 27.521 1.00 26.85 ? 625  TYR A CD2 1 
ATOM   4591 C  CE1 . TYR A 1 584 ? 18.371  82.354 25.709 1.00 26.73 ? 625  TYR A CE1 1 
ATOM   4592 C  CE2 . TYR A 1 584 ? 20.302  80.967 26.189 1.00 28.34 ? 625  TYR A CE2 1 
ATOM   4593 C  CZ  . TYR A 1 584 ? 19.395  81.513 25.283 1.00 28.27 ? 625  TYR A CZ  1 
ATOM   4594 O  OH  . TYR A 1 584 ? 19.511  81.203 23.949 1.00 31.19 ? 625  TYR A OH  1 
ATOM   4595 N  N   . SER A 1 585 ? 20.157  85.090 31.671 1.00 21.89 ? 626  SER A N   1 
ATOM   4596 C  CA  . SER A 1 585 ? 20.027  85.634 33.036 1.00 21.36 ? 626  SER A CA  1 
ATOM   4597 C  C   . SER A 1 585 ? 19.712  84.527 34.055 1.00 21.12 ? 626  SER A C   1 
ATOM   4598 O  O   . SER A 1 585 ? 18.734  84.639 34.794 1.00 20.82 ? 626  SER A O   1 
ATOM   4599 C  CB  . SER A 1 585 ? 18.931  86.694 33.156 1.00 22.73 ? 626  SER A CB  1 
ATOM   4600 O  OG  . SER A 1 585 ? 19.238  87.848 32.339 1.00 28.29 ? 626  SER A OG  1 
ATOM   4601 N  N   . VAL A 1 586 ? 20.518  83.486 34.021 1.00 19.68 ? 627  VAL A N   1 
ATOM   4602 C  CA  . VAL A 1 586 ? 20.291  82.272 34.844 1.00 19.99 ? 627  VAL A CA  1 
ATOM   4603 C  C   . VAL A 1 586 ? 20.986  82.494 36.181 1.00 19.97 ? 627  VAL A C   1 
ATOM   4604 O  O   . VAL A 1 586 ? 22.258  82.514 36.259 1.00 23.22 ? 627  VAL A O   1 
ATOM   4605 C  CB  . VAL A 1 586 ? 20.894  81.048 34.152 1.00 19.75 ? 627  VAL A CB  1 
ATOM   4606 C  CG1 . VAL A 1 586 ? 20.518  79.759 35.003 1.00 17.25 ? 627  VAL A CG1 1 
ATOM   4607 C  CG2 . VAL A 1 586 ? 20.368  80.926 32.737 1.00 20.16 ? 627  VAL A CG2 1 
ATOM   4608 N  N   . SER A 1 587 ? 20.201  82.767 37.219 1.00 20.75 ? 628  SER A N   1 
ATOM   4609 C  CA  . SER A 1 587 ? 20.759  83.019 38.560 1.00 21.42 ? 628  SER A CA  1 
ATOM   4610 C  C   . SER A 1 587 ? 20.400  81.922 39.551 1.00 20.33 ? 628  SER A C   1 
ATOM   4611 O  O   . SER A 1 587 ? 19.234  81.516 39.644 1.00 20.80 ? 628  SER A O   1 
ATOM   4612 C  CB  . SER A 1 587 ? 20.232  84.325 39.128 1.00 22.86 ? 628  SER A CB  1 
ATOM   4613 O  OG  . SER A 1 587 ? 20.741  84.547 40.435 1.00 27.13 ? 628  SER A OG  1 
ATOM   4614 N  N   . PHE A 1 588 ? 21.392  81.488 40.315 1.00 19.94 ? 629  PHE A N   1 
ATOM   4615 C  CA  . PHE A 1 588 ? 21.146  80.582 41.449 1.00 19.21 ? 629  PHE A CA  1 
ATOM   4616 C  C   . PHE A 1 588 ? 20.963  81.336 42.776 1.00 19.19 ? 629  PHE A C   1 
ATOM   4617 O  O   . PHE A 1 588 ? 20.794  80.725 43.845 1.00 18.39 ? 629  PHE A O   1 
ATOM   4618 C  CB  . PHE A 1 588 ? 22.271  79.541 41.528 1.00 20.65 ? 629  PHE A CB  1 
ATOM   4619 C  CG  . PHE A 1 588 ? 22.184  78.496 40.480 1.00 20.86 ? 629  PHE A CG  1 
ATOM   4620 C  CD1 . PHE A 1 588 ? 21.628  77.251 40.787 1.00 21.24 ? 629  PHE A CD1 1 
ATOM   4621 C  CD2 . PHE A 1 588 ? 22.649  78.739 39.197 1.00 22.38 ? 629  PHE A CD2 1 
ATOM   4622 C  CE1 . PHE A 1 588 ? 21.522  76.282 39.801 1.00 19.91 ? 629  PHE A CE1 1 
ATOM   4623 C  CE2 . PHE A 1 588 ? 22.582  77.772 38.206 1.00 22.53 ? 629  PHE A CE2 1 
ATOM   4624 C  CZ  . PHE A 1 588 ? 21.971  76.515 38.535 1.00 20.17 ? 629  PHE A CZ  1 
ATOM   4625 N  N   . ASP A 1 589 ? 20.870  82.680 42.731 1.00 19.45 ? 630  ASP A N   1 
ATOM   4626 C  CA  . ASP A 1 589 ? 20.710  83.409 44.010 1.00 21.00 ? 630  ASP A CA  1 
ATOM   4627 C  C   . ASP A 1 589 ? 19.542  82.963 44.902 1.00 20.34 ? 630  ASP A C   1 
ATOM   4628 O  O   . ASP A 1 589 ? 19.700  82.896 46.134 1.00 20.71 ? 630  ASP A O   1 
ATOM   4629 C  CB  . ASP A 1 589 ? 20.675  84.949 43.772 1.00 22.09 ? 630  ASP A CB  1 
ATOM   4630 C  CG  . ASP A 1 589 ? 22.024  85.520 43.205 1.00 27.56 ? 630  ASP A CG  1 
ATOM   4631 O  OD1 . ASP A 1 589 ? 23.056  84.800 43.081 1.00 30.10 ? 630  ASP A OD1 1 
ATOM   4632 O  OD2 . ASP A 1 589 ? 22.011  86.744 42.876 1.00 33.12 ? 630  ASP A OD2 1 
ATOM   4633 N  N   . SER A 1 590 ? 18.387  82.644 44.291 1.00 19.70 ? 631  SER A N   1 
ATOM   4634 C  CA  . SER A 1 590 ? 17.194  82.252 45.076 1.00 19.22 ? 631  SER A CA  1 
ATOM   4635 C  C   . SER A 1 590 ? 17.486  80.948 45.822 1.00 17.62 ? 631  SER A C   1 
ATOM   4636 O  O   . SER A 1 590 ? 17.067  80.791 46.965 1.00 17.59 ? 631  SER A O   1 
ATOM   4637 C  CB  . SER A 1 590 ? 15.920  82.135 44.217 1.00 19.95 ? 631  SER A CB  1 
ATOM   4638 O  OG  . SER A 1 590 ? 16.120  81.199 43.158 1.00 21.66 ? 631  SER A OG  1 
ATOM   4639 N  N   . LEU A 1 591 ? 18.165  80.035 45.122 1.00 17.75 ? 632  LEU A N   1 
ATOM   4640 C  CA  . LEU A 1 591 ? 18.504  78.744 45.762 1.00 17.66 ? 632  LEU A CA  1 
ATOM   4641 C  C   . LEU A 1 591 ? 19.498  78.863 46.907 1.00 17.98 ? 632  LEU A C   1 
ATOM   4642 O  O   . LEU A 1 591 ? 19.235  78.341 47.999 1.00 18.14 ? 632  LEU A O   1 
ATOM   4643 C  CB  . LEU A 1 591 ? 18.987  77.747 44.723 1.00 17.38 ? 632  LEU A CB  1 
ATOM   4644 C  CG  . LEU A 1 591 ? 19.252  76.323 45.270 1.00 17.36 ? 632  LEU A CG  1 
ATOM   4645 C  CD1 . LEU A 1 591 ? 18.007  75.653 45.837 1.00 18.57 ? 632  LEU A CD1 1 
ATOM   4646 C  CD2 . LEU A 1 591 ? 19.763  75.520 44.087 1.00 20.09 ? 632  LEU A CD2 1 
ATOM   4647 N  N   . PHE A 1 592 ? 20.584  79.623 46.714 1.00 17.65 ? 633  PHE A N   1 
ATOM   4648 C  CA  . PHE A 1 592 ? 21.463  79.852 47.854 1.00 19.29 ? 633  PHE A CA  1 
ATOM   4649 C  C   . PHE A 1 592 ? 20.785  80.622 49.003 1.00 18.44 ? 633  PHE A C   1 
ATOM   4650 O  O   . PHE A 1 592 ? 21.001  80.330 50.192 1.00 19.09 ? 633  PHE A O   1 
ATOM   4651 C  CB  . PHE A 1 592 ? 22.677  80.584 47.316 1.00 18.54 ? 633  PHE A CB  1 
ATOM   4652 C  CG  . PHE A 1 592 ? 23.612  79.703 46.582 1.00 19.41 ? 633  PHE A CG  1 
ATOM   4653 C  CD1 . PHE A 1 592 ? 24.381  78.756 47.303 1.00 22.38 ? 633  PHE A CD1 1 
ATOM   4654 C  CD2 . PHE A 1 592 ? 23.710  79.748 45.223 1.00 22.96 ? 633  PHE A CD2 1 
ATOM   4655 C  CE1 . PHE A 1 592 ? 25.256  77.868 46.620 1.00 20.97 ? 633  PHE A CE1 1 
ATOM   4656 C  CE2 . PHE A 1 592 ? 24.602  78.884 44.534 1.00 22.81 ? 633  PHE A CE2 1 
ATOM   4657 C  CZ  . PHE A 1 592 ? 25.378  77.955 45.255 1.00 23.19 ? 633  PHE A CZ  1 
ATOM   4658 N  N   . SER A 1 593 ? 19.917  81.587 48.682 1.00 17.18 ? 634  SER A N   1 
ATOM   4659 C  CA  . SER A 1 593 ? 19.092  82.249 49.733 1.00 17.68 ? 634  SER A CA  1 
ATOM   4660 C  C   . SER A 1 593 ? 18.238  81.296 50.589 1.00 16.35 ? 634  SER A C   1 
ATOM   4661 O  O   . SER A 1 593 ? 18.177  81.332 51.826 1.00 19.04 ? 634  SER A O   1 
ATOM   4662 C  CB  . SER A 1 593 ? 18.229  83.368 49.097 1.00 16.99 ? 634  SER A CB  1 
ATOM   4663 O  OG  . SER A 1 593 ? 17.406  83.979 50.075 1.00 19.04 ? 634  SER A OG  1 
ATOM   4664 N  N   . ALA A 1 594 ? 17.539  80.387 49.876 1.00 16.44 ? 635  ALA A N   1 
ATOM   4665 C  CA  . ALA A 1 594 ? 16.701  79.413 50.530 1.00 16.20 ? 635  ALA A CA  1 
ATOM   4666 C  C   . ALA A 1 594 ? 17.556  78.488 51.425 1.00 16.15 ? 635  ALA A C   1 
ATOM   4667 O  O   . ALA A 1 594 ? 17.132  78.175 52.567 1.00 17.04 ? 635  ALA A O   1 
ATOM   4668 C  CB  . ALA A 1 594 ? 15.920  78.595 49.479 1.00 16.97 ? 635  ALA A CB  1 
ATOM   4669 N  N   . VAL A 1 595 ? 18.748  78.124 50.907 1.00 17.25 ? 636  VAL A N   1 
ATOM   4670 C  CA  . VAL A 1 595 ? 19.676  77.254 51.673 1.00 16.13 ? 636  VAL A CA  1 
ATOM   4671 C  C   . VAL A 1 595 ? 20.164  77.969 52.950 1.00 18.69 ? 636  VAL A C   1 
ATOM   4672 O  O   . VAL A 1 595 ? 20.132  77.397 54.029 1.00 17.33 ? 636  VAL A O   1 
ATOM   4673 C  CB  . VAL A 1 595 ? 20.785  76.702 50.806 1.00 15.78 ? 636  VAL A CB  1 
ATOM   4674 C  CG1 . VAL A 1 595 ? 21.796  75.939 51.700 1.00 18.64 ? 636  VAL A CG1 1 
ATOM   4675 C  CG2 . VAL A 1 595 ? 20.161  75.741 49.732 1.00 18.44 ? 636  VAL A CG2 1 
ATOM   4676 N  N   . LYS A 1 596 ? 20.548  79.229 52.785 1.00 20.00 ? 637  LYS A N   1 
ATOM   4677 C  CA  . LYS A 1 596 ? 20.932  80.056 53.939 1.00 20.40 ? 637  LYS A CA  1 
ATOM   4678 C  C   . LYS A 1 596 ? 19.837  80.158 54.976 1.00 18.99 ? 637  LYS A C   1 
ATOM   4679 O  O   . LYS A 1 596 ? 20.057  79.952 56.166 1.00 18.60 ? 637  LYS A O   1 
ATOM   4680 C  CB  . LYS A 1 596 ? 21.308  81.440 53.427 1.00 22.75 ? 637  LYS A CB  1 
ATOM   4681 C  CG  . LYS A 1 596 ? 21.742  82.417 54.548 1.00 25.82 ? 637  LYS A CG  1 
ATOM   4682 C  CD  . LYS A 1 596 ? 22.119  83.763 53.878 1.00 30.41 ? 637  LYS A CD  1 
ATOM   4683 C  CE  . LYS A 1 596 ? 22.418  84.879 54.914 1.00 30.97 ? 637  LYS A CE  1 
ATOM   4684 N  NZ  . LYS A 1 596 ? 21.213  85.217 55.751 1.00 35.44 ? 637  LYS A NZ  1 
ATOM   4685 N  N   . ASN A 1 597 ? 18.589  80.417 54.529 1.00 18.40 ? 638  ASN A N   1 
ATOM   4686 C  CA  . ASN A 1 597 ? 17.445  80.460 55.396 1.00 18.83 ? 638  ASN A CA  1 
ATOM   4687 C  C   . ASN A 1 597 ? 17.184  79.131 56.152 1.00 18.08 ? 638  ASN A C   1 
ATOM   4688 O  O   . ASN A 1 597 ? 16.927  79.090 57.370 1.00 17.54 ? 638  ASN A O   1 
ATOM   4689 C  CB  . ASN A 1 597 ? 16.217  80.881 54.561 1.00 18.67 ? 638  ASN A CB  1 
ATOM   4690 C  CG  . ASN A 1 597 ? 16.229  82.356 54.181 1.00 21.94 ? 638  ASN A CG  1 
ATOM   4691 O  OD1 . ASN A 1 597 ? 17.133  83.120 54.587 1.00 22.94 ? 638  ASN A OD1 1 
ATOM   4692 N  ND2 . ASN A 1 597 ? 15.269  82.737 53.345 1.00 21.15 ? 638  ASN A ND2 1 
ATOM   4693 N  N   . PHE A 1 598 ? 17.261  78.004 55.412 1.00 16.17 ? 639  PHE A N   1 
ATOM   4694 C  CA  . PHE A 1 598 ? 17.084  76.705 55.986 1.00 16.65 ? 639  PHE A CA  1 
ATOM   4695 C  C   . PHE A 1 598 ? 18.119  76.521 57.113 1.00 17.07 ? 639  PHE A C   1 
ATOM   4696 O  O   . PHE A 1 598 ? 17.776  76.050 58.170 1.00 16.73 ? 639  PHE A O   1 
ATOM   4697 C  CB  . PHE A 1 598 ? 17.278  75.602 54.927 1.00 16.38 ? 639  PHE A CB  1 
ATOM   4698 C  CG  . PHE A 1 598 ? 16.876  74.247 55.407 1.00 18.12 ? 639  PHE A CG  1 
ATOM   4699 C  CD1 . PHE A 1 598 ? 15.635  73.709 54.979 1.00 15.20 ? 639  PHE A CD1 1 
ATOM   4700 C  CD2 . PHE A 1 598 ? 17.677  73.451 56.261 1.00 16.18 ? 639  PHE A CD2 1 
ATOM   4701 C  CE1 . PHE A 1 598 ? 15.189  72.480 55.422 1.00 18.20 ? 639  PHE A CE1 1 
ATOM   4702 C  CE2 . PHE A 1 598 ? 17.196  72.191 56.695 1.00 17.77 ? 639  PHE A CE2 1 
ATOM   4703 C  CZ  . PHE A 1 598 ? 15.973  71.701 56.276 1.00 18.95 ? 639  PHE A CZ  1 
ATOM   4704 N  N   . THR A 1 599 ? 19.338  76.941 56.848 1.00 18.50 ? 640  THR A N   1 
ATOM   4705 C  CA  . THR A 1 599 ? 20.460  76.713 57.772 1.00 20.07 ? 640  THR A CA  1 
ATOM   4706 C  C   . THR A 1 599 ? 20.199  77.522 59.056 1.00 20.87 ? 640  THR A C   1 
ATOM   4707 O  O   . THR A 1 599 ? 20.287  77.002 60.174 1.00 20.67 ? 640  THR A O   1 
ATOM   4708 C  CB  . THR A 1 599 ? 21.750  77.175 57.139 1.00 19.77 ? 640  THR A CB  1 
ATOM   4709 O  OG1 . THR A 1 599 ? 22.029  76.497 55.881 1.00 20.90 ? 640  THR A OG1 1 
ATOM   4710 C  CG2 . THR A 1 599 ? 22.964  76.904 58.089 1.00 20.48 ? 640  THR A CG2 1 
ATOM   4711 N  N   . GLU A 1 600 ? 19.828  78.794 58.873 1.00 20.35 ? 641  GLU A N   1 
ATOM   4712 C  CA  . GLU A 1 600 ? 19.447  79.668 60.012 1.00 22.89 ? 641  GLU A CA  1 
ATOM   4713 C  C   . GLU A 1 600 ? 18.259  79.158 60.815 1.00 20.65 ? 641  GLU A C   1 
ATOM   4714 O  O   . GLU A 1 600 ? 18.299  79.005 62.049 1.00 21.05 ? 641  GLU A O   1 
ATOM   4715 C  CB  . GLU A 1 600 ? 19.259  81.122 59.509 1.00 21.01 ? 641  GLU A CB  1 
ATOM   4716 C  CG  . GLU A 1 600 ? 20.582  81.711 58.981 1.00 27.80 ? 641  GLU A CG  1 
ATOM   4717 C  CD  . GLU A 1 600 ? 20.459  83.134 58.373 1.00 29.31 ? 641  GLU A CD  1 
ATOM   4718 O  OE1 . GLU A 1 600 ? 21.488  83.640 57.872 1.00 38.44 ? 641  GLU A OE1 1 
ATOM   4719 O  OE2 . GLU A 1 600 ? 19.352  83.733 58.383 1.00 38.86 ? 641  GLU A OE2 1 
ATOM   4720 N  N   . ILE A 1 601 ? 17.144  78.768 60.145 1.00 19.26 ? 642  ILE A N   1 
ATOM   4721 C  CA  . ILE A 1 601 ? 15.984  78.320 60.817 1.00 20.30 ? 642  ILE A CA  1 
ATOM   4722 C  C   . ILE A 1 601 ? 16.218  76.961 61.539 1.00 18.58 ? 642  ILE A C   1 
ATOM   4723 O  O   . ILE A 1 601 ? 15.695  76.698 62.616 1.00 20.62 ? 642  ILE A O   1 
ATOM   4724 C  CB  . ILE A 1 601 ? 14.750  78.271 59.797 1.00 19.17 ? 642  ILE A CB  1 
ATOM   4725 C  CG1 . ILE A 1 601 ? 14.410  79.699 59.377 1.00 19.97 ? 642  ILE A CG1 1 
ATOM   4726 C  CG2 . ILE A 1 601 ? 13.568  77.604 60.376 1.00 20.23 ? 642  ILE A CG2 1 
ATOM   4727 C  CD1 . ILE A 1 601 ? 13.429  79.750 58.134 1.00 21.63 ? 642  ILE A CD1 1 
ATOM   4728 N  N   . ALA A 1 602 ? 16.975  76.073 60.868 1.00 19.77 ? 643  ALA A N   1 
ATOM   4729 C  CA  . ALA A 1 602 ? 17.271  74.757 61.468 1.00 21.36 ? 643  ALA A CA  1 
ATOM   4730 C  C   . ALA A 1 602 ? 18.141  74.949 62.721 1.00 22.14 ? 643  ALA A C   1 
ATOM   4731 O  O   . ALA A 1 602 ? 17.927  74.270 63.727 1.00 22.47 ? 643  ALA A O   1 
ATOM   4732 C  CB  . ALA A 1 602 ? 17.954  73.803 60.447 1.00 22.19 ? 643  ALA A CB  1 
ATOM   4733 N  N   . SER A 1 603 ? 19.067  75.898 62.650 1.00 23.63 ? 644  SER A N   1 
ATOM   4734 C  CA  . SER A 1 603 ? 19.894  76.172 63.859 1.00 25.85 ? 644  SER A CA  1 
ATOM   4735 C  C   . SER A 1 603 ? 19.012  76.621 65.031 1.00 25.32 ? 644  SER A C   1 
ATOM   4736 O  O   . SER A 1 603 ? 19.112  76.112 66.170 1.00 25.26 ? 644  SER A O   1 
ATOM   4737 C  CB  . SER A 1 603 ? 20.972  77.173 63.546 1.00 27.46 ? 644  SER A CB  1 
ATOM   4738 O  OG  . SER A 1 603 ? 21.634  77.586 64.763 1.00 32.28 ? 644  SER A OG  1 
ATOM   4739 N  N   . LYS A 1 604 ? 18.105  77.553 64.772 1.00 25.05 ? 645  LYS A N   1 
ATOM   4740 C  CA  . LYS A 1 604 ? 17.191  77.961 65.828 1.00 25.42 ? 645  LYS A CA  1 
ATOM   4741 C  C   . LYS A 1 604 ? 16.220  76.870 66.315 1.00 24.09 ? 645  LYS A C   1 
ATOM   4742 O  O   . LYS A 1 604 ? 15.941  76.725 67.488 1.00 23.11 ? 645  LYS A O   1 
ATOM   4743 C  CB  . LYS A 1 604 ? 16.444  79.246 65.414 1.00 25.57 ? 645  LYS A CB  1 
ATOM   4744 C  CG  . LYS A 1 604 ? 17.392  80.440 65.077 1.00 26.93 ? 645  LYS A CG  1 
ATOM   4745 C  CD  . LYS A 1 604 ? 16.582  81.697 64.776 1.00 31.31 ? 645  LYS A CD  1 
ATOM   4746 C  CE  . LYS A 1 604 ? 17.410  83.021 64.841 1.00 37.10 ? 645  LYS A CE  1 
ATOM   4747 N  NZ  . LYS A 1 604 ? 17.960  83.383 63.469 1.00 41.97 ? 645  LYS A NZ  1 
ATOM   4748 N  N   . PHE A 1 605 ? 15.692  76.042 65.393 1.00 21.29 ? 646  PHE A N   1 
ATOM   4749 C  CA  . PHE A 1 605 ? 14.815  74.975 65.805 1.00 21.31 ? 646  PHE A CA  1 
ATOM   4750 C  C   . PHE A 1 605 ? 15.576  74.005 66.746 1.00 20.23 ? 646  PHE A C   1 
ATOM   4751 O  O   . PHE A 1 605 ? 15.039  73.536 67.716 1.00 22.02 ? 646  PHE A O   1 
ATOM   4752 C  CB  . PHE A 1 605 ? 14.367  74.209 64.527 1.00 21.01 ? 646  PHE A CB  1 
ATOM   4753 C  CG  . PHE A 1 605 ? 13.527  73.016 64.822 1.00 19.10 ? 646  PHE A CG  1 
ATOM   4754 C  CD1 . PHE A 1 605 ? 12.172  73.109 65.109 1.00 20.84 ? 646  PHE A CD1 1 
ATOM   4755 C  CD2 . PHE A 1 605 ? 14.133  71.718 64.882 1.00 19.80 ? 646  PHE A CD2 1 
ATOM   4756 C  CE1 . PHE A 1 605 ? 11.392  71.995 65.380 1.00 22.55 ? 646  PHE A CE1 1 
ATOM   4757 C  CE2 . PHE A 1 605 ? 13.344  70.593 65.220 1.00 21.32 ? 646  PHE A CE2 1 
ATOM   4758 C  CZ  . PHE A 1 605 ? 12.013  70.701 65.442 1.00 19.93 ? 646  PHE A CZ  1 
ATOM   4759 N  N   . SER A 1 606 ? 16.833  73.719 66.414 1.00 21.84 ? 647  SER A N   1 
ATOM   4760 C  CA  . SER A 1 606 ? 17.629  72.788 67.206 1.00 23.76 ? 647  SER A CA  1 
ATOM   4761 C  C   . SER A 1 606 ? 17.851  73.341 68.628 1.00 24.51 ? 647  SER A C   1 
ATOM   4762 O  O   . SER A 1 606 ? 17.795  72.578 69.597 1.00 24.01 ? 647  SER A O   1 
ATOM   4763 C  CB  . SER A 1 606 ? 18.993  72.622 66.605 1.00 24.32 ? 647  SER A CB  1 
ATOM   4764 O  OG  A SER A 1 606 ? 18.938  72.164 65.275 0.50 24.17 ? 647  SER A OG  1 
ATOM   4765 O  OG  B SER A 1 606 ? 19.624  71.538 67.273 0.50 24.79 ? 647  SER A OG  1 
ATOM   4766 N  N   . GLU A 1 607 ? 18.113  74.641 68.690 1.00 24.87 ? 648  GLU A N   1 
ATOM   4767 C  CA  . GLU A 1 607 ? 18.188  75.322 70.018 1.00 27.69 ? 648  GLU A CA  1 
ATOM   4768 C  C   . GLU A 1 607 ? 16.899  75.094 70.797 1.00 26.70 ? 648  GLU A C   1 
ATOM   4769 O  O   . GLU A 1 607 ? 16.909  74.598 71.960 1.00 27.34 ? 648  GLU A O   1 
ATOM   4770 C  CB  . GLU A 1 607 ? 18.459  76.821 69.842 1.00 27.35 ? 648  GLU A CB  1 
ATOM   4771 C  CG  . GLU A 1 607 ? 19.791  77.171 69.207 1.00 33.48 ? 648  GLU A CG  1 
ATOM   4772 C  CD  . GLU A 1 607 ? 20.033  78.703 69.002 1.00 34.33 ? 648  GLU A CD  1 
ATOM   4773 O  OE1 . GLU A 1 607 ? 19.364  79.563 69.630 1.00 43.00 ? 648  GLU A OE1 1 
ATOM   4774 O  OE2 . GLU A 1 607 ? 20.926  79.026 68.188 1.00 45.51 ? 648  GLU A OE2 1 
ATOM   4775 N  N   . ARG A 1 608 ? 15.740  75.393 70.172 1.00 25.36 ? 649  ARG A N   1 
ATOM   4776 C  CA  . ARG A 1 608 ? 14.497  75.147 70.860 1.00 24.50 ? 649  ARG A CA  1 
ATOM   4777 C  C   . ARG A 1 608 ? 14.295  73.704 71.278 1.00 25.94 ? 649  ARG A C   1 
ATOM   4778 O  O   . ARG A 1 608 ? 13.698  73.425 72.288 1.00 25.76 ? 649  ARG A O   1 
ATOM   4779 C  CB  . ARG A 1 608 ? 13.282  75.637 70.050 1.00 25.85 ? 649  ARG A CB  1 
ATOM   4780 C  CG  . ARG A 1 608 ? 13.287  77.116 69.709 1.00 23.81 ? 649  ARG A CG  1 
ATOM   4781 C  CD  . ARG A 1 608 ? 11.841  77.588 69.322 1.00 24.31 ? 649  ARG A CD  1 
ATOM   4782 N  NE  . ARG A 1 608 ? 11.309  76.839 68.166 1.00 22.65 ? 649  ARG A NE  1 
ATOM   4783 C  CZ  . ARG A 1 608 ? 11.642  77.108 66.905 1.00 22.48 ? 649  ARG A CZ  1 
ATOM   4784 N  NH1 . ARG A 1 608 ? 12.576  78.003 66.588 1.00 22.67 ? 649  ARG A NH1 1 
ATOM   4785 N  NH2 . ARG A 1 608 ? 11.066  76.384 65.918 1.00 23.31 ? 649  ARG A NH2 1 
ATOM   4786 N  N   . LEU A 1 609 ? 14.764  72.764 70.445 1.00 25.88 ? 650  LEU A N   1 
ATOM   4787 C  CA  . LEU A 1 609 ? 14.582  71.344 70.703 1.00 29.29 ? 650  LEU A CA  1 
ATOM   4788 C  C   . LEU A 1 609 ? 15.397  70.952 71.943 1.00 31.01 ? 650  LEU A C   1 
ATOM   4789 O  O   . LEU A 1 609 ? 14.976  70.112 72.717 1.00 31.52 ? 650  LEU A O   1 
ATOM   4790 C  CB  . LEU A 1 609 ? 15.040  70.535 69.459 1.00 28.94 ? 650  LEU A CB  1 
ATOM   4791 C  CG  . LEU A 1 609 ? 14.604  69.077 69.328 1.00 30.10 ? 650  LEU A CG  1 
ATOM   4792 C  CD1 . LEU A 1 609 ? 13.089  68.899 69.128 1.00 28.81 ? 650  LEU A CD1 1 
ATOM   4793 C  CD2 . LEU A 1 609 ? 15.439  68.428 68.203 1.00 30.74 ? 650  LEU A CD2 1 
ATOM   4794 N  N   . GLN A 1 610 ? 16.541  71.584 72.108 1.00 33.46 ? 651  GLN A N   1 
ATOM   4795 C  CA  . GLN A 1 610 ? 17.337  71.344 73.305 1.00 38.31 ? 651  GLN A CA  1 
ATOM   4796 C  C   . GLN A 1 610 ? 16.801  72.114 74.525 1.00 37.09 ? 651  GLN A C   1 
ATOM   4797 O  O   . GLN A 1 610 ? 16.877  71.587 75.635 1.00 39.17 ? 651  GLN A O   1 
ATOM   4798 C  CB  . GLN A 1 610 ? 18.827  71.591 73.052 1.00 38.42 ? 651  GLN A CB  1 
ATOM   4799 C  CG  . GLN A 1 610 ? 19.497  70.479 72.212 1.00 43.07 ? 651  GLN A CG  1 
ATOM   4800 C  CD  . GLN A 1 610 ? 20.938  70.820 71.758 1.00 43.93 ? 651  GLN A CD  1 
ATOM   4801 O  OE1 . GLN A 1 610 ? 21.853  70.968 72.596 1.00 51.29 ? 651  GLN A OE1 1 
ATOM   4802 N  NE2 . GLN A 1 610 ? 21.149  70.924 70.426 1.00 49.02 ? 651  GLN A NE2 1 
ATOM   4803 N  N   A ASP A 1 611 ? 16.222  73.294 74.290 0.50 36.36 ? 652  ASP A N   1 
ATOM   4804 N  N   B ASP A 1 611 ? 16.321  73.352 74.316 0.50 36.67 ? 652  ASP A N   1 
ATOM   4805 C  CA  A ASP A 1 611 ? 15.663  74.165 75.338 0.50 34.86 ? 652  ASP A CA  1 
ATOM   4806 C  CA  B ASP A 1 611 ? 15.930  74.318 75.389 0.50 35.32 ? 652  ASP A CA  1 
ATOM   4807 C  C   A ASP A 1 611 ? 14.278  73.767 75.844 0.50 33.20 ? 652  ASP A C   1 
ATOM   4808 C  C   B ASP A 1 611 ? 14.439  74.354 75.730 0.50 34.08 ? 652  ASP A C   1 
ATOM   4809 O  O   A ASP A 1 611 ? 13.951  74.090 76.976 0.50 32.96 ? 652  ASP A O   1 
ATOM   4810 O  O   B ASP A 1 611 ? 14.020  75.035 76.653 0.50 33.81 ? 652  ASP A O   1 
ATOM   4811 C  CB  A ASP A 1 611 ? 15.536  75.623 74.850 0.50 35.61 ? 652  ASP A CB  1 
ATOM   4812 C  CB  B ASP A 1 611 ? 16.307  75.749 75.002 0.50 36.25 ? 652  ASP A CB  1 
ATOM   4813 C  CG  A ASP A 1 611 ? 16.877  76.292 74.589 0.50 37.81 ? 652  ASP A CG  1 
ATOM   4814 C  CG  B ASP A 1 611 ? 17.796  75.988 74.997 0.50 37.64 ? 652  ASP A CG  1 
ATOM   4815 O  OD1 A ASP A 1 611 ? 16.895  77.537 74.417 0.50 39.11 ? 652  ASP A OD1 1 
ATOM   4816 O  OD1 B ASP A 1 611 ? 18.213  77.004 74.376 0.50 39.86 ? 652  ASP A OD1 1 
ATOM   4817 O  OD2 A ASP A 1 611 ? 17.909  75.577 74.549 0.50 39.95 ? 652  ASP A OD2 1 
ATOM   4818 O  OD2 B ASP A 1 611 ? 18.535  75.169 75.597 0.50 38.74 ? 652  ASP A OD2 1 
ATOM   4819 N  N   A PHE A 1 612 ? 13.450  73.116 75.016 0.55 31.23 ? 653  PHE A N   1 
ATOM   4820 N  N   B PHE A 1 612 ? 13.612  73.654 74.954 0.45 32.63 ? 653  PHE A N   1 
ATOM   4821 C  CA  A PHE A 1 612 ? 12.008  73.183 75.264 0.55 29.05 ? 653  PHE A CA  1 
ATOM   4822 C  CA  B PHE A 1 612 ? 12.190  73.557 75.288 0.45 31.00 ? 653  PHE A CA  1 
ATOM   4823 C  C   A PHE A 1 612 ? 11.618  72.584 76.581 0.55 27.37 ? 653  PHE A C   1 
ATOM   4824 C  C   B PHE A 1 612 ? 12.030  72.738 76.557 0.45 30.45 ? 653  PHE A C   1 
ATOM   4825 O  O   A PHE A 1 612 ? 12.241  71.637 77.049 0.55 29.12 ? 653  PHE A O   1 
ATOM   4826 O  O   B PHE A 1 612 ? 13.014  72.295 77.151 0.45 30.31 ? 653  PHE A O   1 
ATOM   4827 C  CB  A PHE A 1 612 ? 11.160  72.668 74.096 0.55 28.13 ? 653  PHE A CB  1 
ATOM   4828 C  CB  B PHE A 1 612 ? 11.367  72.901 74.160 0.45 30.31 ? 653  PHE A CB  1 
ATOM   4829 C  CG  A PHE A 1 612 ? 10.896  71.162 74.068 0.55 26.14 ? 653  PHE A CG  1 
ATOM   4830 C  CG  B PHE A 1 612 ? 11.360  71.374 74.187 0.45 28.77 ? 653  PHE A CG  1 
ATOM   4831 C  CD1 A PHE A 1 612 ? 9.825   70.612 74.761 0.55 25.20 ? 653  PHE A CD1 1 
ATOM   4832 C  CD1 B PHE A 1 612 ? 10.363  70.678 74.853 0.45 27.09 ? 653  PHE A CD1 1 
ATOM   4833 C  CD2 A PHE A 1 612 ? 11.627  70.341 73.213 0.55 26.71 ? 653  PHE A CD2 1 
ATOM   4834 C  CD2 B PHE A 1 612 ? 12.327  70.652 73.500 0.45 26.75 ? 653  PHE A CD2 1 
ATOM   4835 C  CE1 A PHE A 1 612 ? 9.510   69.282 74.652 0.55 22.45 ? 653  PHE A CE1 1 
ATOM   4836 C  CE1 B PHE A 1 612 ? 10.339  69.298 74.864 0.45 29.66 ? 653  PHE A CE1 1 
ATOM   4837 C  CE2 A PHE A 1 612 ? 11.325  68.987 73.096 0.55 22.78 ? 653  PHE A CE2 1 
ATOM   4838 C  CE2 B PHE A 1 612 ? 12.319  69.260 73.499 0.45 28.55 ? 653  PHE A CE2 1 
ATOM   4839 C  CZ  A PHE A 1 612 ? 10.276  68.453 73.829 0.55 25.41 ? 653  PHE A CZ  1 
ATOM   4840 C  CZ  B PHE A 1 612 ? 11.326  68.573 74.185 0.45 29.73 ? 653  PHE A CZ  1 
ATOM   4841 N  N   A ASP A 1 613 ? 10.584  73.159 77.183 0.55 25.51 ? 654  ASP A N   1 
ATOM   4842 N  N   B ASP A 1 613 ? 10.771  72.514 76.925 0.45 30.89 ? 654  ASP A N   1 
ATOM   4843 C  CA  A ASP A 1 613 ? 10.118  72.627 78.457 0.55 23.17 ? 654  ASP A CA  1 
ATOM   4844 C  CA  B ASP A 1 613 ? 10.408  71.762 78.134 0.45 29.89 ? 654  ASP A CA  1 
ATOM   4845 C  C   A ASP A 1 613 ? 9.935   71.100 78.304 0.55 21.54 ? 654  ASP A C   1 
ATOM   4846 C  C   B ASP A 1 613 ? 10.876  70.327 78.085 0.45 29.18 ? 654  ASP A C   1 
ATOM   4847 O  O   A ASP A 1 613 ? 8.967   70.653 77.670 0.55 21.16 ? 654  ASP A O   1 
ATOM   4848 O  O   B ASP A 1 613 ? 11.968  70.016 77.542 0.45 28.45 ? 654  ASP A O   1 
ATOM   4849 C  CB  A ASP A 1 613 ? 8.818   73.306 78.906 0.55 22.29 ? 654  ASP A CB  1 
ATOM   4850 C  CB  B ASP A 1 613 ? 8.885   71.781 78.349 0.45 31.41 ? 654  ASP A CB  1 
ATOM   4851 C  CG  A ASP A 1 613 ? 8.400   72.875 80.316 0.55 24.37 ? 654  ASP A CG  1 
ATOM   4852 C  CG  B ASP A 1 613 ? 8.485   71.513 79.815 0.45 31.36 ? 654  ASP A CG  1 
ATOM   4853 O  OD1 A ASP A 1 613 ? 7.614   73.604 80.997 0.55 21.63 ? 654  ASP A OD1 1 
ATOM   4854 O  OD1 B ASP A 1 613 ? 7.668   72.302 80.343 0.45 32.71 ? 654  ASP A OD1 1 
ATOM   4855 O  OD2 A ASP A 1 613 ? 8.890   71.794 80.743 0.55 24.06 ? 654  ASP A OD2 1 
ATOM   4856 O  OD2 B ASP A 1 613 ? 8.977   70.529 80.428 0.45 31.39 ? 654  ASP A OD2 1 
ATOM   4857 N  N   A LYS A 1 614 ? 10.816  70.302 78.907 0.55 21.32 ? 655  LYS A N   1 
ATOM   4858 N  N   B LYS A 1 614 ? 10.022  69.449 78.637 0.45 28.07 ? 655  LYS A N   1 
ATOM   4859 C  CA  A LYS A 1 614 ? 10.795  68.845 78.599 0.55 23.07 ? 655  LYS A CA  1 
ATOM   4860 C  CA  B LYS A 1 614 ? 10.267  67.997 78.644 0.45 24.95 ? 655  LYS A CA  1 
ATOM   4861 C  C   A LYS A 1 614 ? 9.666   68.110 79.349 0.55 22.08 ? 655  LYS A C   1 
ATOM   4862 C  C   B LYS A 1 614 ? 9.074   67.031 78.476 0.45 25.20 ? 655  LYS A C   1 
ATOM   4863 O  O   A LYS A 1 614 ? 9.562   66.888 79.233 0.55 22.89 ? 655  LYS A O   1 
ATOM   4864 O  O   B LYS A 1 614 ? 8.989   66.456 77.392 0.45 23.98 ? 655  LYS A O   1 
ATOM   4865 C  CB  A LYS A 1 614 ? 12.159  68.126 78.781 0.55 23.70 ? 655  LYS A CB  1 
ATOM   4866 C  CB  B LYS A 1 614 ? 11.091  67.625 79.897 0.45 26.69 ? 655  LYS A CB  1 
ATOM   4867 C  CG  A LYS A 1 614 ? 12.359  67.131 77.563 0.55 26.01 ? 655  LYS A CG  1 
ATOM   4868 C  CG  B LYS A 1 614 ? 12.544  67.457 79.606 0.45 24.15 ? 655  LYS A CG  1 
ATOM   4869 C  CD  A LYS A 1 614 ? 13.634  66.241 77.483 0.55 26.57 ? 655  LYS A CD  1 
ATOM   4870 C  CD  B LYS A 1 614 ? 13.111  66.258 80.368 0.45 29.02 ? 655  LYS A CD  1 
ATOM   4871 C  CE  A LYS A 1 614 ? 13.354  65.040 76.525 0.55 26.03 ? 655  LYS A CE  1 
ATOM   4872 C  CE  B LYS A 1 614 ? 14.509  65.879 79.845 0.45 30.27 ? 655  LYS A CE  1 
ATOM   4873 N  NZ  A LYS A 1 614 ? 14.570  64.242 76.002 0.55 27.82 ? 655  LYS A NZ  1 
ATOM   4874 N  NZ  B LYS A 1 614 ? 15.214  64.863 80.695 0.45 32.80 ? 655  LYS A NZ  1 
ATOM   4875 N  N   A SER A 1 615 ? 8.944   68.845 80.215 0.55 20.74 ? 656  SER A N   1 
ATOM   4876 N  N   B SER A 1 615 ? 8.238   66.882 79.548 0.45 22.45 ? 656  SER A N   1 
ATOM   4877 C  CA  A SER A 1 615 ? 7.742   68.356 80.855 0.55 20.00 ? 656  SER A CA  1 
ATOM   4878 C  CA  B SER A 1 615 ? 7.063   65.981 79.877 0.45 21.12 ? 656  SER A CA  1 
ATOM   4879 C  C   A SER A 1 615 ? 6.466   68.475 79.960 0.55 18.59 ? 656  SER A C   1 
ATOM   4880 C  C   B SER A 1 615 ? 5.660   66.589 79.669 0.45 19.36 ? 656  SER A C   1 
ATOM   4881 O  O   A SER A 1 615 ? 5.387   67.949 80.312 0.55 19.79 ? 656  SER A O   1 
ATOM   4882 O  O   B SER A 1 615 ? 4.672   66.182 80.295 0.45 19.41 ? 656  SER A O   1 
ATOM   4883 C  CB  A SER A 1 615 ? 7.552   69.127 82.186 0.55 16.63 ? 656  SER A CB  1 
ATOM   4884 C  CB  B SER A 1 615 ? 7.103   65.668 81.385 0.45 20.47 ? 656  SER A CB  1 
ATOM   4885 O  OG  A SER A 1 615 ? 7.084   70.396 81.942 0.55 18.28 ? 656  SER A OG  1 
ATOM   4886 O  OG  B SER A 1 615 ? 8.117   64.778 81.659 0.45 21.41 ? 656  SER A OG  1 
ATOM   4887 N  N   A ASN A 1 616 ? 6.576   69.163 78.818 0.55 18.56 ? 657  ASN A N   1 
ATOM   4888 N  N   B ASN A 1 616 ? 5.575   67.585 78.803 0.45 19.24 ? 657  ASN A N   1 
ATOM   4889 C  CA  A ASN A 1 616 ? 5.406   69.453 77.990 0.55 17.82 ? 657  ASN A CA  1 
ATOM   4890 C  CA  B ASN A 1 616 ? 4.300   68.166 78.398 0.45 19.14 ? 657  ASN A CA  1 
ATOM   4891 C  C   A ASN A 1 616 ? 5.269   68.511 76.772 0.55 17.03 ? 657  ASN A C   1 
ATOM   4892 C  C   B ASN A 1 616 ? 3.881   67.413 77.121 0.45 19.08 ? 657  ASN A C   1 
ATOM   4893 O  O   A ASN A 1 616 ? 6.034   68.654 75.796 0.55 17.23 ? 657  ASN A O   1 
ATOM   4894 O  O   B ASN A 1 616 ? 4.443   67.681 76.077 0.45 19.56 ? 657  ASN A O   1 
ATOM   4895 C  CB  A ASN A 1 616 ? 5.430   70.884 77.516 0.55 17.67 ? 657  ASN A CB  1 
ATOM   4896 C  CB  B ASN A 1 616 ? 4.550   69.643 78.084 0.45 18.54 ? 657  ASN A CB  1 
ATOM   4897 C  CG  A ASN A 1 616 ? 4.097   71.327 77.015 0.55 21.42 ? 657  ASN A CG  1 
ATOM   4898 C  CG  B ASN A 1 616 ? 3.316   70.361 77.568 0.45 18.58 ? 657  ASN A CG  1 
ATOM   4899 O  OD1 A ASN A 1 616 ? 3.394   70.580 76.318 0.55 20.44 ? 657  ASN A OD1 1 
ATOM   4900 O  OD1 B ASN A 1 616 ? 2.475   69.778 76.857 0.45 21.62 ? 657  ASN A OD1 1 
ATOM   4901 N  ND2 A ASN A 1 616 ? 3.723   72.552 77.356 0.55 25.83 ? 657  ASN A ND2 1 
ATOM   4902 N  ND2 B ASN A 1 616 ? 3.202   71.634 77.918 0.45 19.86 ? 657  ASN A ND2 1 
ATOM   4903 N  N   A PRO A 1 617 ? 4.302   67.554 76.817 0.55 16.50 ? 658  PRO A N   1 
ATOM   4904 N  N   B PRO A 1 617 ? 2.958   66.427 77.220 0.45 18.86 ? 658  PRO A N   1 
ATOM   4905 C  CA  A PRO A 1 617 ? 4.205   66.552 75.753 0.55 16.39 ? 658  PRO A CA  1 
ATOM   4906 C  CA  B PRO A 1 617 ? 2.652   65.580 76.026 0.45 18.04 ? 658  PRO A CA  1 
ATOM   4907 C  C   A PRO A 1 617 ? 3.682   67.167 74.456 0.55 17.34 ? 658  PRO A C   1 
ATOM   4908 C  C   B PRO A 1 617 ? 2.344   66.321 74.714 0.45 17.59 ? 658  PRO A C   1 
ATOM   4909 O  O   A PRO A 1 617 ? 3.943   66.619 73.398 0.55 17.37 ? 658  PRO A O   1 
ATOM   4910 O  O   B PRO A 1 617 ? 2.862   65.920 73.648 0.45 15.95 ? 658  PRO A O   1 
ATOM   4911 C  CB  A PRO A 1 617 ? 3.176   65.552 76.296 0.55 15.58 ? 658  PRO A CB  1 
ATOM   4912 C  CB  B PRO A 1 617 ? 1.405   64.814 76.449 0.45 18.06 ? 658  PRO A CB  1 
ATOM   4913 C  CG  A PRO A 1 617 ? 2.292   66.445 77.227 0.55 17.44 ? 658  PRO A CG  1 
ATOM   4914 C  CG  B PRO A 1 617 ? 1.502   64.752 77.967 0.45 19.74 ? 658  PRO A CG  1 
ATOM   4915 C  CD  A PRO A 1 617 ? 3.319   67.281 77.895 0.55 17.44 ? 658  PRO A CD  1 
ATOM   4916 C  CD  B PRO A 1 617 ? 2.149   66.026 78.394 0.45 19.33 ? 658  PRO A CD  1 
ATOM   4917 N  N   A ILE A 1 618 ? 2.906   68.253 74.546 0.55 16.63 ? 659  ILE A N   1 
ATOM   4918 N  N   B ILE A 1 618 ? 1.531   67.374 74.760 0.45 16.94 ? 659  ILE A N   1 
ATOM   4919 C  CA  A ILE A 1 618 ? 2.340   68.879 73.344 0.55 18.67 ? 659  ILE A CA  1 
ATOM   4920 C  CA  B ILE A 1 618 ? 1.178   68.065 73.513 0.45 16.52 ? 659  ILE A CA  1 
ATOM   4921 C  C   A ILE A 1 618 ? 3.429   69.630 72.590 0.55 17.73 ? 659  ILE A C   1 
ATOM   4922 C  C   B ILE A 1 618 ? 2.361   68.848 72.964 0.45 15.38 ? 659  ILE A C   1 
ATOM   4923 O  O   A ILE A 1 618 ? 3.469   69.596 71.377 0.55 17.43 ? 659  ILE A O   1 
ATOM   4924 O  O   B ILE A 1 618 ? 2.567   68.873 71.772 0.45 16.17 ? 659  ILE A O   1 
ATOM   4925 C  CB  A ILE A 1 618 ? 1.166   69.837 73.662 0.55 19.75 ? 659  ILE A CB  1 
ATOM   4926 C  CB  B ILE A 1 618 ? -0.125  68.919 73.553 0.45 16.69 ? 659  ILE A CB  1 
ATOM   4927 C  CG1 A ILE A 1 618 ? 0.048   69.121 74.437 0.55 23.62 ? 659  ILE A CG1 1 
ATOM   4928 C  CG1 B ILE A 1 618 ? -1.335  68.001 73.655 0.45 16.75 ? 659  ILE A CG1 1 
ATOM   4929 C  CG2 A ILE A 1 618 ? 0.625   70.487 72.387 0.55 18.16 ? 659  ILE A CG2 1 
ATOM   4930 C  CG2 B ILE A 1 618 ? -0.330  69.714 72.293 0.45 20.43 ? 659  ILE A CG2 1 
ATOM   4931 C  CD1 A ILE A 1 618 ? -0.276  67.719 73.897 0.55 26.64 ? 659  ILE A CD1 1 
ATOM   4932 C  CD1 B ILE A 1 618 ? -1.122  66.649 72.952 0.45 21.25 ? 659  ILE A CD1 1 
ATOM   4933 N  N   A VAL A 1 619 ? 4.273   70.341 73.320 0.55 17.38 ? 660  VAL A N   1 
ATOM   4934 N  N   B VAL A 1 619 ? 3.148   69.495 73.829 0.45 13.89 ? 660  VAL A N   1 
ATOM   4935 C  CA  A VAL A 1 619 ? 5.450   70.962 72.720 0.55 17.60 ? 660  VAL A CA  1 
ATOM   4936 C  CA  B VAL A 1 619 ? 4.303   70.212 73.300 0.45 14.26 ? 660  VAL A CA  1 
ATOM   4937 C  C   A VAL A 1 619 ? 6.373   69.878 72.148 0.55 16.42 ? 660  VAL A C   1 
ATOM   4938 C  C   B VAL A 1 619 ? 5.286   69.213 72.666 0.45 13.18 ? 660  VAL A C   1 
ATOM   4939 O  O   A VAL A 1 619 ? 6.827   70.000 71.007 0.55 16.71 ? 660  VAL A O   1 
ATOM   4940 O  O   B VAL A 1 619 ? 5.868   69.463 71.612 0.45 13.65 ? 660  VAL A O   1 
ATOM   4941 C  CB  A VAL A 1 619 ? 6.192   71.856 73.718 0.55 17.54 ? 660  VAL A CB  1 
ATOM   4942 C  CB  B VAL A 1 619 ? 5.001   71.085 74.376 0.45 14.87 ? 660  VAL A CB  1 
ATOM   4943 C  CG1 A VAL A 1 619 ? 7.429   72.443 73.075 0.55 18.08 ? 660  VAL A CG1 1 
ATOM   4944 C  CG1 B VAL A 1 619 ? 6.324   71.664 73.851 0.45 15.05 ? 660  VAL A CG1 1 
ATOM   4945 C  CG2 A VAL A 1 619 ? 5.243   72.958 74.212 0.55 20.01 ? 660  VAL A CG2 1 
ATOM   4946 C  CG2 B VAL A 1 619 ? 4.054   72.218 74.831 0.45 16.85 ? 660  VAL A CG2 1 
ATOM   4947 N  N   A LEU A 1 620 ? 6.608   68.807 72.920 0.55 15.72 ? 661  LEU A N   1 
ATOM   4948 N  N   B LEU A 1 620 ? 5.465   68.075 73.314 0.45 12.56 ? 661  LEU A N   1 
ATOM   4949 C  CA  A LEU A 1 620 ? 7.433   67.696 72.424 0.55 14.80 ? 661  LEU A CA  1 
ATOM   4950 C  CA  B LEU A 1 620 ? 6.331   67.077 72.764 0.45 12.84 ? 661  LEU A CA  1 
ATOM   4951 C  C   A LEU A 1 620 ? 6.855   67.137 71.131 0.55 15.40 ? 661  LEU A C   1 
ATOM   4952 C  C   B LEU A 1 620 ? 5.743   66.616 71.421 0.45 12.72 ? 661  LEU A C   1 
ATOM   4953 O  O   A LEU A 1 620 ? 7.604   67.013 70.159 0.55 14.54 ? 661  LEU A O   1 
ATOM   4954 O  O   B LEU A 1 620 ? 6.472   66.458 70.424 0.45 13.01 ? 661  LEU A O   1 
ATOM   4955 C  CB  A LEU A 1 620 ? 7.540   66.595 73.462 0.55 15.03 ? 661  LEU A CB  1 
ATOM   4956 C  CB  B LEU A 1 620 ? 6.442   65.900 73.726 0.45 12.37 ? 661  LEU A CB  1 
ATOM   4957 C  CG  A LEU A 1 620 ? 8.127   65.240 73.072 0.55 15.44 ? 661  LEU A CG  1 
ATOM   4958 C  CG  B LEU A 1 620 ? 7.307   64.735 73.188 0.45 13.35 ? 661  LEU A CG  1 
ATOM   4959 C  CD1 A LEU A 1 620 ? 9.543   65.384 72.615 0.55 17.14 ? 661  LEU A CD1 1 
ATOM   4960 C  CD1 B LEU A 1 620 ? 8.707   65.187 72.770 0.45 14.22 ? 661  LEU A CD1 1 
ATOM   4961 C  CD2 A LEU A 1 620 ? 8.051   64.317 74.269 0.55 16.76 ? 661  LEU A CD2 1 
ATOM   4962 C  CD2 B LEU A 1 620 ? 7.349   63.617 74.219 0.45 11.90 ? 661  LEU A CD2 1 
ATOM   4963 N  N   A ARG A 1 621 ? 5.541   66.857 71.119 0.55 14.53 ? 662  ARG A N   1 
ATOM   4964 N  N   B ARG A 1 621 ? 4.449   66.340 71.393 0.45 12.07 ? 662  ARG A N   1 
ATOM   4965 C  CA  A ARG A 1 621 ? 4.911   66.220 69.950 0.55 15.69 ? 662  ARG A CA  1 
ATOM   4966 C  CA  B ARG A 1 621 ? 3.829   65.947 70.095 0.45 13.90 ? 662  ARG A CA  1 
ATOM   4967 C  C   A ARG A 1 621 ? 4.983   67.194 68.769 0.55 15.00 ? 662  ARG A C   1 
ATOM   4968 C  C   B ARG A 1 621 ? 4.036   66.995 68.963 0.45 13.97 ? 662  ARG A C   1 
ATOM   4969 O  O   A ARG A 1 621 ? 5.197   66.775 67.683 0.55 12.48 ? 662  ARG A O   1 
ATOM   4970 O  O   B ARG A 1 621 ? 4.261   66.580 67.800 0.45 14.05 ? 662  ARG A O   1 
ATOM   4971 C  CB  A ARG A 1 621 ? 3.449   65.804 70.245 0.55 13.89 ? 662  ARG A CB  1 
ATOM   4972 C  CB  B ARG A 1 621 ? 2.368   65.447 70.239 0.45 13.85 ? 662  ARG A CB  1 
ATOM   4973 C  CG  A ARG A 1 621 ? 2.583   65.375 69.010 0.55 16.10 ? 662  ARG A CG  1 
ATOM   4974 C  CG  B ARG A 1 621 ? 1.562   65.168 68.924 0.45 13.46 ? 662  ARG A CG  1 
ATOM   4975 C  CD  A ARG A 1 621 ? 3.299   64.268 68.277 0.55 18.51 ? 662  ARG A CD  1 
ATOM   4976 C  CD  B ARG A 1 621 ? 1.990   63.986 67.916 0.45 13.13 ? 662  ARG A CD  1 
ATOM   4977 N  NE  A ARG A 1 621 ? 2.977   62.903 68.603 0.55 25.29 ? 662  ARG A NE  1 
ATOM   4978 N  NE  B ARG A 1 621 ? 1.723   62.629 68.346 0.45 21.33 ? 662  ARG A NE  1 
ATOM   4979 C  CZ  A ARG A 1 621 ? 1.882   62.236 68.231 0.55 23.59 ? 662  ARG A CZ  1 
ATOM   4980 C  CZ  B ARG A 1 621 ? 0.727   61.815 67.964 0.45 13.34 ? 662  ARG A CZ  1 
ATOM   4981 N  NH1 A ARG A 1 621 ? 0.830   62.828 67.637 0.55 18.77 ? 662  ARG A NH1 1 
ATOM   4982 N  NH1 B ARG A 1 621 ? -0.242  62.136 67.121 0.45 13.64 ? 662  ARG A NH1 1 
ATOM   4983 N  NH2 A ARG A 1 621 ? 1.805   60.975 68.578 0.55 17.44 ? 662  ARG A NH2 1 
ATOM   4984 N  NH2 B ARG A 1 621 ? 0.711   60.629 68.526 0.45 19.62 ? 662  ARG A NH2 1 
ATOM   4985 N  N   A MET A 1 622 ? 4.843   68.505 69.008 0.50 16.50 ? 663  MET A N   1 
ATOM   4986 N  N   B MET A 1 622 ? 3.970   68.306 69.270 0.50 14.21 ? 663  MET A N   1 
ATOM   4987 C  CA  A MET A 1 622 ? 4.800   69.535 67.931 0.50 17.20 ? 663  MET A CA  1 
ATOM   4988 C  CA  B MET A 1 622 ? 4.432   69.388 68.325 0.50 18.08 ? 663  MET A CA  1 
ATOM   4989 C  C   A MET A 1 622 ? 6.141   69.531 67.379 0.50 19.14 ? 663  MET A C   1 
ATOM   4990 C  C   B MET A 1 622 ? 5.849   69.318 67.626 0.50 18.34 ? 663  MET A C   1 
ATOM   4991 O  O   A MET A 1 622 ? 6.431   69.668 66.154 0.50 16.07 ? 663  MET A O   1 
ATOM   4992 O  O   B MET A 1 622 ? 5.830   69.234 66.413 0.50 17.85 ? 663  MET A O   1 
ATOM   4993 C  CB  A MET A 1 622 ? 4.545   70.927 68.545 0.50 17.61 ? 663  MET A CB  1 
ATOM   4994 C  CB  B MET A 1 622 ? 4.005   70.782 68.813 0.50 18.03 ? 663  MET A CB  1 
ATOM   4995 C  CG  A MET A 1 622 ? 4.799   72.104 67.645 0.50 17.57 ? 663  MET A CG  1 
ATOM   4996 C  CG  B MET A 1 622 ? 2.535   70.729 69.161 0.50 18.37 ? 663  MET A CG  1 
ATOM   4997 S  SD  A MET A 1 622 ? 4.494   73.615 68.613 0.50 18.47 ? 663  MET A SD  1 
ATOM   4998 S  SD  B MET A 1 622 ? 1.635   72.229 69.623 0.50 23.10 ? 663  MET A SD  1 
ATOM   4999 C  CE  A MET A 1 622 ? 6.110   73.810 69.397 0.50 21.60 ? 663  MET A CE  1 
ATOM   5000 C  CE  B MET A 1 622 ? 2.602   72.767 71.091 0.50 19.15 ? 663  MET A CE  1 
ATOM   5001 N  N   . MET A 1 623 ? 7.048   69.307 68.314 1.00 18.10 ? 664  MET A N   1 
ATOM   5002 C  CA  . MET A 1 623 ? 8.362   69.283 67.791 1.00 19.78 ? 664  MET A CA  1 
ATOM   5003 C  C   . MET A 1 623 ? 8.661   67.959 67.031 1.00 17.95 ? 664  MET A C   1 
ATOM   5004 O  O   . MET A 1 623 ? 9.350   68.023 66.021 1.00 19.50 ? 664  MET A O   1 
ATOM   5005 C  CB  A MET A 1 623 ? 9.356   69.341 68.984 0.50 21.01 ? 664  MET A CB  1 
ATOM   5006 C  CB  B MET A 1 623 ? 9.467   69.745 68.795 0.50 19.36 ? 664  MET A CB  1 
ATOM   5007 C  CG  A MET A 1 623 ? 9.024   70.374 70.025 0.50 25.50 ? 664  MET A CG  1 
ATOM   5008 C  CG  B MET A 1 623 ? 9.284   71.185 69.216 0.50 20.07 ? 664  MET A CG  1 
ATOM   5009 S  SD  A MET A 1 623 ? 9.151   71.958 69.235 0.50 30.38 ? 664  MET A SD  1 
ATOM   5010 S  SD  B MET A 1 623 ? 10.689  71.873 70.111 0.50 19.74 ? 664  MET A SD  1 
ATOM   5011 C  CE  A MET A 1 623 ? 10.918  72.266 69.375 0.50 22.42 ? 664  MET A CE  1 
ATOM   5012 C  CE  B MET A 1 623 ? 11.679  72.521 68.750 0.50 19.27 ? 664  MET A CE  1 
ATOM   5013 N  N   . ASN A 1 624 ? 8.172   66.862 67.584 1.00 19.94 ? 665  ASN A N   1 
ATOM   5014 C  CA  . ASN A 1 624 ? 8.336   65.528 66.905 1.00 19.15 ? 665  ASN A CA  1 
ATOM   5015 C  C   . ASN A 1 624 ? 7.641   65.582 65.536 1.00 20.43 ? 665  ASN A C   1 
ATOM   5016 O  O   . ASN A 1 624 ? 8.211   65.092 64.566 1.00 20.10 ? 665  ASN A O   1 
ATOM   5017 C  CB  . ASN A 1 624 ? 7.839   64.379 67.720 1.00 19.62 ? 665  ASN A CB  1 
ATOM   5018 C  CG  . ASN A 1 624 ? 8.950   63.886 68.684 1.00 16.81 ? 665  ASN A CG  1 
ATOM   5019 O  OD1 . ASN A 1 624 ? 10.127  64.163 68.468 1.00 18.65 ? 665  ASN A OD1 1 
ATOM   5020 N  ND2 . ASN A 1 624 ? 8.512   63.317 69.777 1.00 19.47 ? 665  ASN A ND2 1 
ATOM   5021 N  N   . ASP A 1 625 ? 6.449   66.174 65.497 1.00 19.70 ? 666  ASP A N   1 
ATOM   5022 C  CA  . ASP A 1 625 ? 5.725   66.384 64.195 1.00 18.97 ? 666  ASP A CA  1 
ATOM   5023 C  C   . ASP A 1 625 ? 6.540   67.246 63.227 1.00 19.36 ? 666  ASP A C   1 
ATOM   5024 O  O   . ASP A 1 625 ? 6.616   66.946 62.028 1.00 19.35 ? 666  ASP A O   1 
ATOM   5025 C  CB  . ASP A 1 625 ? 4.313   66.962 64.466 1.00 19.20 ? 666  ASP A CB  1 
ATOM   5026 C  CG  . ASP A 1 625 ? 3.298   65.932 64.947 1.00 20.39 ? 666  ASP A CG  1 
ATOM   5027 O  OD1 . ASP A 1 625 ? 3.612   64.681 65.080 1.00 21.29 ? 666  ASP A OD1 1 
ATOM   5028 O  OD2 . ASP A 1 625 ? 2.110   66.349 65.135 1.00 23.87 ? 666  ASP A OD2 1 
ATOM   5029 N  N   . GLN A 1 626 ? 7.163   68.343 63.692 1.00 16.24 ? 667  GLN A N   1 
ATOM   5030 C  CA  . GLN A 1 626 ? 8.041   69.150 62.858 1.00 16.43 ? 667  GLN A CA  1 
ATOM   5031 C  C   . GLN A 1 626 ? 9.168   68.272 62.308 1.00 17.51 ? 667  GLN A C   1 
ATOM   5032 O  O   . GLN A 1 626 ? 9.528   68.329 61.124 1.00 18.14 ? 667  GLN A O   1 
ATOM   5033 C  CB  . GLN A 1 626 ? 8.537   70.406 63.601 1.00 18.59 ? 667  GLN A CB  1 
ATOM   5034 C  CG  . GLN A 1 626 ? 7.357   71.411 63.743 1.00 18.94 ? 667  GLN A CG  1 
ATOM   5035 C  CD  . GLN A 1 626 ? 7.836   72.660 64.463 1.00 21.11 ? 667  GLN A CD  1 
ATOM   5036 O  OE1 . GLN A 1 626 ? 8.015   72.623 65.692 1.00 21.56 ? 667  GLN A OE1 1 
ATOM   5037 N  NE2 . GLN A 1 626 ? 8.104   73.736 63.712 1.00 20.82 ? 667  GLN A NE2 1 
ATOM   5038 N  N   . LEU A 1 627 ? 9.715   67.425 63.184 1.00 19.20 ? 668  LEU A N   1 
ATOM   5039 C  CA  . LEU A 1 627 ? 10.805  66.544 62.732 1.00 18.01 ? 668  LEU A CA  1 
ATOM   5040 C  C   . LEU A 1 627 ? 10.318  65.496 61.694 1.00 17.17 ? 668  LEU A C   1 
ATOM   5041 O  O   . LEU A 1 627 ? 10.996  65.335 60.651 1.00 19.49 ? 668  LEU A O   1 
ATOM   5042 C  CB  . LEU A 1 627 ? 11.427  65.826 63.934 1.00 19.02 ? 668  LEU A CB  1 
ATOM   5043 C  CG  . LEU A 1 627 ? 12.437  66.831 64.580 1.00 19.55 ? 668  LEU A CG  1 
ATOM   5044 C  CD1 . LEU A 1 627 ? 12.777  66.129 65.908 1.00 23.00 ? 668  LEU A CD1 1 
ATOM   5045 C  CD2 . LEU A 1 627 ? 13.685  67.324 63.779 1.00 20.72 ? 668  LEU A CD2 1 
ATOM   5046 N  N   . MET A 1 628 ? 9.149   64.957 61.949 1.00 17.84 ? 669  MET A N   1 
ATOM   5047 C  CA  . MET A 1 628 ? 8.619   63.865 61.127 1.00 18.56 ? 669  MET A CA  1 
ATOM   5048 C  C   . MET A 1 628 ? 8.221   64.443 59.785 1.00 18.17 ? 669  MET A C   1 
ATOM   5049 O  O   . MET A 1 628 ? 8.447   63.826 58.736 1.00 19.53 ? 669  MET A O   1 
ATOM   5050 C  CB  . MET A 1 628 ? 7.377   63.305 61.748 1.00 19.18 ? 669  MET A CB  1 
ATOM   5051 C  CG  . MET A 1 628 ? 6.692   62.198 60.915 1.00 22.28 ? 669  MET A CG  1 
ATOM   5052 S  SD  . MET A 1 628 ? 5.285   61.447 61.683 1.00 24.84 ? 669  MET A SD  1 
ATOM   5053 C  CE  . MET A 1 628 ? 3.982   62.754 61.600 1.00 21.49 ? 669  MET A CE  1 
ATOM   5054 N  N   . PHE A 1 629 ? 7.586   65.592 59.837 1.00 15.38 ? 670  PHE A N   1 
ATOM   5055 C  CA  . PHE A 1 629 ? 7.175   66.238 58.508 1.00 15.93 ? 670  PHE A CA  1 
ATOM   5056 C  C   . PHE A 1 629 ? 8.245   66.982 57.713 1.00 15.09 ? 670  PHE A C   1 
ATOM   5057 O  O   . PHE A 1 629 ? 7.991   67.533 56.575 1.00 14.89 ? 670  PHE A O   1 
ATOM   5058 C  CB  . PHE A 1 629 ? 5.896   67.114 58.725 1.00 14.18 ? 670  PHE A CB  1 
ATOM   5059 C  CG  . PHE A 1 629 ? 4.648   66.331 59.057 1.00 16.10 ? 670  PHE A CG  1 
ATOM   5060 C  CD1 . PHE A 1 629 ? 4.100   65.383 58.125 1.00 17.14 ? 670  PHE A CD1 1 
ATOM   5061 C  CD2 . PHE A 1 629 ? 3.934   66.566 60.233 1.00 15.85 ? 670  PHE A CD2 1 
ATOM   5062 C  CE1 . PHE A 1 629 ? 2.934   64.679 58.415 1.00 18.43 ? 670  PHE A CE1 1 
ATOM   5063 C  CE2 . PHE A 1 629 ? 2.742   65.881 60.513 1.00 17.26 ? 670  PHE A CE2 1 
ATOM   5064 C  CZ  . PHE A 1 629 ? 2.259   64.892 59.605 1.00 18.49 ? 670  PHE A CZ  1 
ATOM   5065 N  N   . LEU A 1 630 ? 9.487   67.039 58.193 1.00 14.61 ? 671  LEU A N   1 
ATOM   5066 C  CA  . LEU A 1 630 ? 10.514  67.736 57.498 1.00 14.41 ? 671  LEU A CA  1 
ATOM   5067 C  C   . LEU A 1 630 ? 10.864  67.007 56.194 1.00 13.65 ? 671  LEU A C   1 
ATOM   5068 O  O   . LEU A 1 630 ? 10.906  67.642 55.148 1.00 15.64 ? 671  LEU A O   1 
ATOM   5069 C  CB  . LEU A 1 630 ? 11.735  67.918 58.432 1.00 16.44 ? 671  LEU A CB  1 
ATOM   5070 C  CG  . LEU A 1 630 ? 12.865  68.658 57.780 1.00 16.30 ? 671  LEU A CG  1 
ATOM   5071 C  CD1 . LEU A 1 630 ? 12.524  70.059 57.270 1.00 17.28 ? 671  LEU A CD1 1 
ATOM   5072 C  CD2 . LEU A 1 630 ? 14.072  68.732 58.776 1.00 18.13 ? 671  LEU A CD2 1 
ATOM   5073 N  N   . GLU A 1 631 ? 11.044  65.683 56.268 1.00 14.32 ? 672  GLU A N   1 
ATOM   5074 C  CA  . GLU A 1 631 ? 11.275  64.954 55.005 1.00 15.50 ? 672  GLU A CA  1 
ATOM   5075 C  C   . GLU A 1 631 ? 10.057  65.151 54.056 1.00 13.45 ? 672  GLU A C   1 
ATOM   5076 O  O   . GLU A 1 631 ? 10.249  65.332 52.829 1.00 15.73 ? 672  GLU A O   1 
ATOM   5077 C  CB  . GLU A 1 631 ? 11.474  63.457 55.298 1.00 14.70 ? 672  GLU A CB  1 
ATOM   5078 C  CG  . GLU A 1 631 ? 12.080  62.795 54.046 1.00 14.02 ? 672  GLU A CG  1 
ATOM   5079 C  CD  . GLU A 1 631 ? 13.575  63.082 53.927 1.00 17.10 ? 672  GLU A CD  1 
ATOM   5080 O  OE1 . GLU A 1 631 ? 14.306  62.597 54.817 1.00 18.23 ? 672  GLU A OE1 1 
ATOM   5081 O  OE2 . GLU A 1 631 ? 14.084  63.733 52.957 1.00 16.82 ? 672  GLU A OE2 1 
ATOM   5082 N  N   . ARG A 1 632 ? 8.879   65.158 54.648 1.00 13.68 ? 673  ARG A N   1 
ATOM   5083 C  CA  . ARG A 1 632 ? 7.635   65.259 53.910 1.00 13.48 ? 673  ARG A CA  1 
ATOM   5084 C  C   . ARG A 1 632 ? 7.624   66.571 53.149 1.00 14.03 ? 673  ARG A C   1 
ATOM   5085 O  O   . ARG A 1 632 ? 7.064   66.667 52.069 1.00 14.45 ? 673  ARG A O   1 
ATOM   5086 C  CB  . ARG A 1 632 ? 6.435   65.175 54.863 1.00 15.29 ? 673  ARG A CB  1 
ATOM   5087 C  CG  . ARG A 1 632 ? 5.264   64.500 54.164 1.00 14.85 ? 673  ARG A CG  1 
ATOM   5088 C  CD  . ARG A 1 632 ? 5.442   62.942 54.256 1.00 15.77 ? 673  ARG A CD  1 
ATOM   5089 N  NE  . ARG A 1 632 ? 4.949   62.452 55.548 1.00 14.86 ? 673  ARG A NE  1 
ATOM   5090 C  CZ  . ARG A 1 632 ? 5.731   61.895 56.464 1.00 13.30 ? 673  ARG A CZ  1 
ATOM   5091 N  NH1 . ARG A 1 632 ? 7.068   61.804 56.303 1.00 15.44 ? 673  ARG A NH1 1 
ATOM   5092 N  NH2 . ARG A 1 632 ? 5.177   61.497 57.611 1.00 15.42 ? 673  ARG A NH2 1 
ATOM   5093 N  N   . ALA A 1 633 ? 8.229   67.617 53.735 1.00 12.84 ? 674  ALA A N   1 
ATOM   5094 C  CA  . ALA A 1 633 ? 8.146   68.942 53.076 1.00 13.28 ? 674  ALA A CA  1 
ATOM   5095 C  C   . ALA A 1 633 ? 8.926   69.043 51.759 1.00 12.84 ? 674  ALA A C   1 
ATOM   5096 O  O   . ALA A 1 633 ? 8.763   70.037 51.027 1.00 15.88 ? 674  ALA A O   1 
ATOM   5097 C  CB  . ALA A 1 633 ? 8.698   69.970 54.085 1.00 14.85 ? 674  ALA A CB  1 
ATOM   5098 N  N   . PHE A 1 634 ? 9.867   68.091 51.489 1.00 13.39 ? 675  PHE A N   1 
ATOM   5099 C  CA  . PHE A 1 634 ? 10.590  68.134 50.250 1.00 13.18 ? 675  PHE A CA  1 
ATOM   5100 C  C   . PHE A 1 634 ? 9.814   67.526 49.102 1.00 12.56 ? 675  PHE A C   1 
ATOM   5101 O  O   . PHE A 1 634 ? 10.320  67.540 47.976 1.00 13.83 ? 675  PHE A O   1 
ATOM   5102 C  CB  . PHE A 1 634 ? 11.926  67.441 50.384 1.00 13.53 ? 675  PHE A CB  1 
ATOM   5103 C  CG  . PHE A 1 634 ? 12.882  68.209 51.319 1.00 15.69 ? 675  PHE A CG  1 
ATOM   5104 C  CD1 . PHE A 1 634 ? 13.330  69.450 50.920 1.00 17.55 ? 675  PHE A CD1 1 
ATOM   5105 C  CD2 . PHE A 1 634 ? 13.278  67.681 52.563 1.00 19.09 ? 675  PHE A CD2 1 
ATOM   5106 C  CE1 . PHE A 1 634 ? 14.215  70.224 51.755 1.00 17.37 ? 675  PHE A CE1 1 
ATOM   5107 C  CE2 . PHE A 1 634 ? 14.167  68.452 53.393 1.00 18.44 ? 675  PHE A CE2 1 
ATOM   5108 C  CZ  . PHE A 1 634 ? 14.639  69.695 52.946 1.00 15.80 ? 675  PHE A CZ  1 
ATOM   5109 N  N   . ILE A 1 635 ? 8.639   67.028 49.408 1.00 13.31 ? 676  ILE A N   1 
ATOM   5110 C  CA  . ILE A 1 635 ? 7.770   66.433 48.353 1.00 14.13 ? 676  ILE A CA  1 
ATOM   5111 C  C   . ILE A 1 635 ? 7.047   67.535 47.548 1.00 14.34 ? 676  ILE A C   1 
ATOM   5112 O  O   . ILE A 1 635 ? 6.454   68.467 48.142 1.00 16.68 ? 676  ILE A O   1 
ATOM   5113 C  CB  . ILE A 1 635 ? 6.715   65.483 48.966 1.00 13.68 ? 676  ILE A CB  1 
ATOM   5114 C  CG1 . ILE A 1 635 ? 7.407   64.256 49.590 1.00 13.05 ? 676  ILE A CG1 1 
ATOM   5115 C  CG2 . ILE A 1 635 ? 5.543   65.094 47.951 1.00 16.34 ? 676  ILE A CG2 1 
ATOM   5116 C  CD1 . ILE A 1 635 ? 8.125   63.396 48.482 1.00 17.89 ? 676  ILE A CD1 1 
ATOM   5117 N  N   . ASP A 1 636 ? 7.074   67.473 46.216 1.00 14.55 ? 677  ASP A N   1 
ATOM   5118 C  CA  . ASP A 1 636 ? 6.260   68.367 45.389 1.00 14.46 ? 677  ASP A CA  1 
ATOM   5119 C  C   . ASP A 1 636 ? 5.061   67.564 44.847 1.00 15.14 ? 677  ASP A C   1 
ATOM   5120 O  O   . ASP A 1 636 ? 5.281   66.540 44.195 1.00 15.38 ? 677  ASP A O   1 
ATOM   5121 C  CB  . ASP A 1 636 ? 7.106   68.804 44.210 1.00 15.10 ? 677  ASP A CB  1 
ATOM   5122 C  CG  . ASP A 1 636 ? 6.410   69.864 43.339 1.00 14.46 ? 677  ASP A CG  1 
ATOM   5123 O  OD1 . ASP A 1 636 ? 5.158   69.874 43.218 1.00 16.67 ? 677  ASP A OD1 1 
ATOM   5124 O  OD2 . ASP A 1 636 ? 7.175   70.672 42.739 1.00 15.87 ? 677  ASP A OD2 1 
ATOM   5125 N  N   . PRO A 1 637 ? 3.840   67.975 45.151 1.00 16.12 ? 678  PRO A N   1 
ATOM   5126 C  CA  . PRO A 1 637 ? 2.643   67.179 44.754 1.00 18.11 ? 678  PRO A CA  1 
ATOM   5127 C  C   . PRO A 1 637 ? 2.512   67.068 43.239 1.00 19.99 ? 678  PRO A C   1 
ATOM   5128 O  O   . PRO A 1 637 ? 1.741   66.208 42.748 1.00 22.54 ? 678  PRO A O   1 
ATOM   5129 C  CB  . PRO A 1 637 ? 1.433   67.967 45.323 1.00 19.86 ? 678  PRO A CB  1 
ATOM   5130 C  CG  . PRO A 1 637 ? 1.986   69.373 45.637 1.00 20.23 ? 678  PRO A CG  1 
ATOM   5131 C  CD  . PRO A 1 637 ? 3.497   69.213 45.893 1.00 17.29 ? 678  PRO A CD  1 
ATOM   5132 N  N   . LEU A 1 638 ? 3.235   67.895 42.491 1.00 15.78 ? 679  LEU A N   1 
ATOM   5133 C  CA  . LEU A 1 638 ? 3.178   67.779 41.003 1.00 17.09 ? 679  LEU A CA  1 
ATOM   5134 C  C   . LEU A 1 638 ? 4.228   66.788 40.439 1.00 17.90 ? 679  LEU A C   1 
ATOM   5135 O  O   . LEU A 1 638 ? 4.232   66.485 39.208 1.00 18.30 ? 679  LEU A O   1 
ATOM   5136 C  CB  . LEU A 1 638 ? 3.347   69.159 40.333 1.00 17.46 ? 679  LEU A CB  1 
ATOM   5137 C  CG  . LEU A 1 638 ? 2.232   70.147 40.751 1.00 18.91 ? 679  LEU A CG  1 
ATOM   5138 C  CD1 . LEU A 1 638 ? 2.501   71.504 40.075 1.00 18.33 ? 679  LEU A CD1 1 
ATOM   5139 C  CD2 . LEU A 1 638 ? 0.862   69.618 40.386 1.00 19.48 ? 679  LEU A CD2 1 
ATOM   5140 N  N   . GLY A 1 639 ? 5.127   66.298 41.309 1.00 16.16 ? 680  GLY A N   1 
ATOM   5141 C  CA  . GLY A 1 639 ? 6.174   65.391 40.886 1.00 16.65 ? 680  GLY A CA  1 
ATOM   5142 C  C   . GLY A 1 639 ? 7.262   66.027 40.037 1.00 17.35 ? 680  GLY A C   1 
ATOM   5143 O  O   . GLY A 1 639 ? 7.183   67.226 39.699 1.00 18.71 ? 680  GLY A O   1 
ATOM   5144 N  N   . LEU A 1 640 ? 8.274   65.236 39.668 1.00 17.91 ? 681  LEU A N   1 
ATOM   5145 C  CA  . LEU A 1 640 ? 9.315   65.743 38.778 1.00 18.51 ? 681  LEU A CA  1 
ATOM   5146 C  C   . LEU A 1 640 ? 8.887   65.634 37.311 1.00 20.36 ? 681  LEU A C   1 
ATOM   5147 O  O   . LEU A 1 640 ? 8.008   64.841 36.986 1.00 18.79 ? 681  LEU A O   1 
ATOM   5148 C  CB  . LEU A 1 640 ? 10.636  64.975 38.996 1.00 18.92 ? 681  LEU A CB  1 
ATOM   5149 C  CG  . LEU A 1 640 ? 11.263  65.225 40.386 1.00 17.39 ? 681  LEU A CG  1 
ATOM   5150 C  CD1 . LEU A 1 640 ? 12.387  64.196 40.775 1.00 20.80 ? 681  LEU A CD1 1 
ATOM   5151 C  CD2 . LEU A 1 640 ? 11.837  66.706 40.489 1.00 18.59 ? 681  LEU A CD2 1 
ATOM   5152 N  N   . PRO A 1 641 ? 9.553   66.394 36.400 1.00 22.38 ? 682  PRO A N   1 
ATOM   5153 C  CA  . PRO A 1 641 ? 9.114   66.353 34.983 1.00 22.83 ? 682  PRO A CA  1 
ATOM   5154 C  C   . PRO A 1 641 ? 9.016   64.974 34.352 1.00 23.22 ? 682  PRO A C   1 
ATOM   5155 O  O   . PRO A 1 641 ? 9.984   64.235 34.308 1.00 23.90 ? 682  PRO A O   1 
ATOM   5156 C  CB  . PRO A 1 641 ? 10.172  67.219 34.253 1.00 23.41 ? 682  PRO A CB  1 
ATOM   5157 C  CG  . PRO A 1 641 ? 10.586  68.199 35.308 1.00 24.28 ? 682  PRO A CG  1 
ATOM   5158 C  CD  . PRO A 1 641 ? 10.647  67.364 36.601 1.00 22.88 ? 682  PRO A CD  1 
ATOM   5159 N  N   . ASP A 1 642 ? 7.822   64.642 33.884 1.00 23.81 ? 683  ASP A N   1 
ATOM   5160 C  CA  . ASP A 1 642 ? 7.510   63.353 33.262 1.00 23.86 ? 683  ASP A CA  1 
ATOM   5161 C  C   . ASP A 1 642 ? 7.755   62.149 34.167 1.00 22.45 ? 683  ASP A C   1 
ATOM   5162 O  O   . ASP A 1 642 ? 7.705   61.003 33.697 1.00 22.39 ? 683  ASP A O   1 
ATOM   5163 C  CB  . ASP A 1 642 ? 8.260   63.153 31.939 1.00 27.23 ? 683  ASP A CB  1 
ATOM   5164 C  CG  . ASP A 1 642 ? 7.889   64.202 30.899 1.00 32.26 ? 683  ASP A CG  1 
ATOM   5165 O  OD1 . ASP A 1 642 ? 6.681   64.348 30.587 1.00 38.73 ? 683  ASP A OD1 1 
ATOM   5166 O  OD2 . ASP A 1 642 ? 8.838   64.861 30.421 1.00 39.91 ? 683  ASP A OD2 1 
ATOM   5167 N  N   . ARG A 1 643 ? 7.941   62.405 35.475 1.00 19.75 ? 684  ARG A N   1 
ATOM   5168 C  CA  . ARG A 1 643 ? 8.086   61.271 36.441 1.00 19.18 ? 684  ARG A CA  1 
ATOM   5169 C  C   . ARG A 1 643 ? 7.218   61.585 37.675 1.00 17.43 ? 684  ARG A C   1 
ATOM   5170 O  O   . ARG A 1 643 ? 7.725   61.949 38.768 1.00 17.41 ? 684  ARG A O   1 
ATOM   5171 C  CB  . ARG A 1 643 ? 9.539   60.978 36.796 1.00 19.18 ? 684  ARG A CB  1 
ATOM   5172 C  CG  . ARG A 1 643 ? 10.404  60.594 35.544 1.00 21.49 ? 684  ARG A CG  1 
ATOM   5173 C  CD  . ARG A 1 643 ? 11.797  60.129 35.980 1.00 19.54 ? 684  ARG A CD  1 
ATOM   5174 N  NE  . ARG A 1 643 ? 12.576  61.232 36.576 1.00 18.83 ? 684  ARG A NE  1 
ATOM   5175 C  CZ  . ARG A 1 643 ? 13.727  61.118 37.238 1.00 20.57 ? 684  ARG A CZ  1 
ATOM   5176 N  NH1 . ARG A 1 643 ? 14.305  59.922 37.406 1.00 18.34 ? 684  ARG A NH1 1 
ATOM   5177 N  NH2 . ARG A 1 643 ? 14.307  62.244 37.722 1.00 18.76 ? 684  ARG A NH2 1 
ATOM   5178 N  N   . PRO A 1 644 ? 5.900   61.450 37.509 1.00 17.98 ? 685  PRO A N   1 
ATOM   5179 C  CA  . PRO A 1 644 ? 4.947   61.878 38.527 1.00 17.86 ? 685  PRO A CA  1 
ATOM   5180 C  C   . PRO A 1 644 ? 5.076   61.164 39.855 1.00 16.50 ? 685  PRO A C   1 
ATOM   5181 O  O   . PRO A 1 644 ? 4.582   61.681 40.864 1.00 17.24 ? 685  PRO A O   1 
ATOM   5182 C  CB  . PRO A 1 644 ? 3.548   61.541 37.935 1.00 19.36 ? 685  PRO A CB  1 
ATOM   5183 C  CG  . PRO A 1 644 ? 3.768   60.632 36.741 1.00 19.36 ? 685  PRO A CG  1 
ATOM   5184 C  CD  . PRO A 1 644 ? 5.251   60.865 36.318 1.00 18.93 ? 685  PRO A CD  1 
ATOM   5185 N  N   . PHE A 1 645 ? 5.644   59.978 39.838 1.00 15.85 ? 686  PHE A N   1 
ATOM   5186 C  CA  . PHE A 1 645 ? 5.801   59.196 41.068 1.00 14.19 ? 686  PHE A CA  1 
ATOM   5187 C  C   . PHE A 1 645 ? 7.182   59.419 41.783 1.00 14.13 ? 686  PHE A C   1 
ATOM   5188 O  O   . PHE A 1 645 ? 7.442   58.821 42.885 1.00 15.29 ? 686  PHE A O   1 
ATOM   5189 C  CB  . PHE A 1 645 ? 5.552   57.709 40.787 1.00 13.75 ? 686  PHE A CB  1 
ATOM   5190 C  CG  . PHE A 1 645 ? 4.118   57.427 40.338 1.00 17.07 ? 686  PHE A CG  1 
ATOM   5191 C  CD1 . PHE A 1 645 ? 3.039   57.784 41.130 1.00 15.14 ? 686  PHE A CD1 1 
ATOM   5192 C  CD2 . PHE A 1 645 ? 3.882   56.910 39.109 1.00 17.58 ? 686  PHE A CD2 1 
ATOM   5193 C  CE1 . PHE A 1 645 ? 1.728   57.590 40.746 1.00 16.98 ? 686  PHE A CE1 1 
ATOM   5194 C  CE2 . PHE A 1 645 ? 2.608   56.693 38.679 1.00 17.49 ? 686  PHE A CE2 1 
ATOM   5195 C  CZ  . PHE A 1 645 ? 1.503   57.015 39.488 1.00 16.42 ? 686  PHE A CZ  1 
ATOM   5196 N  N   . TYR A 1 646 ? 8.039   60.272 41.206 1.00 13.25 ? 687  TYR A N   1 
ATOM   5197 C  CA  . TYR A 1 646 ? 9.242   60.700 41.932 1.00 14.31 ? 687  TYR A CA  1 
ATOM   5198 C  C   . TYR A 1 646 ? 8.907   62.138 42.300 1.00 14.37 ? 687  TYR A C   1 
ATOM   5199 O  O   . TYR A 1 646 ? 8.884   63.050 41.439 1.00 15.31 ? 687  TYR A O   1 
ATOM   5200 C  CB  . TYR A 1 646 ? 10.507  60.604 41.026 1.00 14.12 ? 687  TYR A CB  1 
ATOM   5201 C  CG  . TYR A 1 646 ? 10.929  59.175 40.696 1.00 14.11 ? 687  TYR A CG  1 
ATOM   5202 C  CD1 . TYR A 1 646 ? 10.600  58.113 41.552 1.00 16.74 ? 687  TYR A CD1 1 
ATOM   5203 C  CD2 . TYR A 1 646 ? 11.677  58.913 39.536 1.00 14.33 ? 687  TYR A CD2 1 
ATOM   5204 C  CE1 . TYR A 1 646 ? 11.009  56.787 41.269 1.00 15.55 ? 687  TYR A CE1 1 
ATOM   5205 C  CE2 . TYR A 1 646 ? 12.097  57.637 39.257 1.00 15.84 ? 687  TYR A CE2 1 
ATOM   5206 C  CZ  . TYR A 1 646 ? 11.748  56.584 40.126 1.00 16.65 ? 687  TYR A CZ  1 
ATOM   5207 O  OH  . TYR A 1 646 ? 12.151  55.307 39.821 1.00 16.19 ? 687  TYR A OH  1 
ATOM   5208 N  N   . ARG A 1 647 ? 8.657   62.365 43.583 1.00 12.24 ? 688  ARG A N   1 
ATOM   5209 C  CA  . ARG A 1 647 ? 8.134   63.672 44.011 1.00 12.47 ? 688  ARG A CA  1 
ATOM   5210 C  C   . ARG A 1 647 ? 9.070   64.441 44.950 1.00 13.15 ? 688  ARG A C   1 
ATOM   5211 O  O   . ARG A 1 647 ? 8.767   65.570 45.327 1.00 14.46 ? 688  ARG A O   1 
ATOM   5212 C  CB  . ARG A 1 647 ? 6.776   63.492 44.708 1.00 13.59 ? 688  ARG A CB  1 
ATOM   5213 C  CG  . ARG A 1 647 ? 5.827   62.680 43.834 1.00 14.36 ? 688  ARG A CG  1 
ATOM   5214 C  CD  . ARG A 1 647 ? 4.379   62.818 44.247 1.00 13.44 ? 688  ARG A CD  1 
ATOM   5215 N  NE  . ARG A 1 647 ? 4.159   62.467 45.681 1.00 15.74 ? 688  ARG A NE  1 
ATOM   5216 C  CZ  . ARG A 1 647 ? 3.100   62.795 46.425 1.00 19.48 ? 688  ARG A CZ  1 
ATOM   5217 N  NH1 . ARG A 1 647 ? 3.126   62.423 47.736 1.00 17.39 ? 688  ARG A NH1 1 
ATOM   5218 N  NH2 . ARG A 1 647 ? 2.040   63.497 45.935 1.00 17.45 ? 688  ARG A NH2 1 
ATOM   5219 N  N   . HIS A 1 648 ? 10.193  63.825 45.329 1.00 12.18 ? 689  HIS A N   1 
ATOM   5220 C  CA  . HIS A 1 648 ? 11.141  64.502 46.236 1.00 12.92 ? 689  HIS A CA  1 
ATOM   5221 C  C   . HIS A 1 648 ? 11.949  65.466 45.374 1.00 13.40 ? 689  HIS A C   1 
ATOM   5222 O  O   . HIS A 1 648 ? 12.442  65.116 44.298 1.00 14.37 ? 689  HIS A O   1 
ATOM   5223 C  CB  . HIS A 1 648 ? 12.099  63.479 46.833 1.00 12.42 ? 689  HIS A CB  1 
ATOM   5224 C  CG  . HIS A 1 648 ? 12.709  63.878 48.130 1.00 14.01 ? 689  HIS A CG  1 
ATOM   5225 N  ND1 . HIS A 1 648 ? 13.691  64.857 48.258 1.00 14.06 ? 689  HIS A ND1 1 
ATOM   5226 C  CD2 . HIS A 1 648 ? 12.503  63.364 49.356 1.00 14.51 ? 689  HIS A CD2 1 
ATOM   5227 C  CE1 . HIS A 1 648 ? 14.028  64.935 49.541 1.00 14.53 ? 689  HIS A CE1 1 
ATOM   5228 N  NE2 . HIS A 1 648 ? 13.301  64.063 50.235 1.00 13.30 ? 689  HIS A NE2 1 
ATOM   5229 N  N   . VAL A 1 649 ? 12.077  66.703 45.857 1.00 12.61 ? 690  VAL A N   1 
ATOM   5230 C  CA  . VAL A 1 649 ? 12.776  67.712 45.045 1.00 13.17 ? 690  VAL A CA  1 
ATOM   5231 C  C   . VAL A 1 649 ? 14.307  67.704 45.292 1.00 13.72 ? 690  VAL A C   1 
ATOM   5232 O  O   . VAL A 1 649 ? 15.055  68.282 44.502 1.00 16.92 ? 690  VAL A O   1 
ATOM   5233 C  CB  . VAL A 1 649 ? 12.170  69.103 45.379 1.00 14.25 ? 690  VAL A CB  1 
ATOM   5234 C  CG1 . VAL A 1 649 ? 12.998  70.242 44.722 1.00 14.28 ? 690  VAL A CG1 1 
ATOM   5235 C  CG2 . VAL A 1 649 ? 10.682  69.134 44.948 1.00 14.18 ? 690  VAL A CG2 1 
ATOM   5236 N  N   . ILE A 1 650 ? 14.741  67.144 46.422 1.00 14.59 ? 691  ILE A N   1 
ATOM   5237 C  CA  . ILE A 1 650 ? 16.185  67.178 46.715 1.00 15.76 ? 691  ILE A CA  1 
ATOM   5238 C  C   . ILE A 1 650 ? 16.873  65.936 46.097 1.00 15.37 ? 691  ILE A C   1 
ATOM   5239 O  O   . ILE A 1 650 ? 18.012  66.028 45.699 1.00 15.05 ? 691  ILE A O   1 
ATOM   5240 C  CB  . ILE A 1 650 ? 16.507  67.214 48.247 1.00 16.10 ? 691  ILE A CB  1 
ATOM   5241 C  CG1 . ILE A 1 650 ? 15.652  68.272 48.961 1.00 16.60 ? 691  ILE A CG1 1 
ATOM   5242 C  CG2 . ILE A 1 650 ? 18.059  67.423 48.471 1.00 15.47 ? 691  ILE A CG2 1 
ATOM   5243 C  CD1 . ILE A 1 650 ? 15.843  69.683 48.309 1.00 17.53 ? 691  ILE A CD1 1 
ATOM   5244 N  N   . TYR A 1 651 ? 16.185  64.784 46.115 1.00 15.07 ? 692  TYR A N   1 
ATOM   5245 C  CA  . TYR A 1 651 ? 16.794  63.530 45.603 1.00 14.96 ? 692  TYR A CA  1 
ATOM   5246 C  C   . TYR A 1 651 ? 15.869  62.885 44.624 1.00 15.94 ? 692  TYR A C   1 
ATOM   5247 O  O   . TYR A 1 651 ? 14.648  63.025 44.751 1.00 13.97 ? 692  TYR A O   1 
ATOM   5248 C  CB  . TYR A 1 651 ? 16.912  62.564 46.783 1.00 14.97 ? 692  TYR A CB  1 
ATOM   5249 C  CG  . TYR A 1 651 ? 17.877  63.020 47.866 1.00 15.84 ? 692  TYR A CG  1 
ATOM   5250 C  CD1 . TYR A 1 651 ? 19.254  63.073 47.579 1.00 16.83 ? 692  TYR A CD1 1 
ATOM   5251 C  CD2 . TYR A 1 651 ? 17.412  63.301 49.164 1.00 17.53 ? 692  TYR A CD2 1 
ATOM   5252 C  CE1 . TYR A 1 651 ? 20.157  63.460 48.560 1.00 18.15 ? 692  TYR A CE1 1 
ATOM   5253 C  CE2 . TYR A 1 651 ? 18.292  63.688 50.160 1.00 17.02 ? 692  TYR A CE2 1 
ATOM   5254 C  CZ  . TYR A 1 651 ? 19.675  63.743 49.839 1.00 18.86 ? 692  TYR A CZ  1 
ATOM   5255 O  OH  . TYR A 1 651 ? 20.606  64.114 50.808 1.00 20.04 ? 692  TYR A OH  1 
ATOM   5256 N  N   . ALA A 1 652 ? 16.413  62.206 43.621 1.00 14.37 ? 693  ALA A N   1 
ATOM   5257 C  CA  . ALA A 1 652 ? 15.598  61.259 42.840 1.00 15.29 ? 693  ALA A CA  1 
ATOM   5258 C  C   . ALA A 1 652 ? 16.565  60.177 42.340 1.00 15.54 ? 693  ALA A C   1 
ATOM   5259 O  O   . ALA A 1 652 ? 17.807  60.350 42.333 1.00 15.81 ? 693  ALA A O   1 
ATOM   5260 C  CB  . ALA A 1 652 ? 14.980  61.910 41.629 1.00 14.73 ? 693  ALA A CB  1 
ATOM   5261 N  N   . PRO A 1 653 ? 15.998  59.042 41.894 1.00 14.89 ? 694  PRO A N   1 
ATOM   5262 C  CA  . PRO A 1 653 ? 16.865  58.079 41.200 1.00 15.42 ? 694  PRO A CA  1 
ATOM   5263 C  C   . PRO A 1 653 ? 17.378  58.765 39.957 1.00 14.68 ? 694  PRO A C   1 
ATOM   5264 O  O   . PRO A 1 653 ? 16.591  59.436 39.238 1.00 15.86 ? 694  PRO A O   1 
ATOM   5265 C  CB  . PRO A 1 653 ? 15.884  56.959 40.813 1.00 16.63 ? 694  PRO A CB  1 
ATOM   5266 C  CG  . PRO A 1 653 ? 14.702  57.085 41.784 1.00 16.61 ? 694  PRO A CG  1 
ATOM   5267 C  CD  . PRO A 1 653 ? 14.581  58.628 41.948 1.00 16.23 ? 694  PRO A CD  1 
ATOM   5268 N  N   . SER A 1 654 ? 18.658  58.554 39.630 1.00 14.04 ? 695  SER A N   1 
ATOM   5269 C  CA  . SER A 1 654 ? 19.219  59.172 38.426 1.00 16.29 ? 695  SER A CA  1 
ATOM   5270 C  C   . SER A 1 654 ? 18.471  58.718 37.187 1.00 16.44 ? 695  SER A C   1 
ATOM   5271 O  O   . SER A 1 654 ? 18.185  57.542 37.069 1.00 17.17 ? 695  SER A O   1 
ATOM   5272 C  CB  . SER A 1 654 ? 20.693  58.736 38.288 1.00 18.02 ? 695  SER A CB  1 
ATOM   5273 O  OG  . SER A 1 654 ? 21.186  59.185 37.042 1.00 18.48 ? 695  SER A OG  1 
ATOM   5274 N  N   . SER A 1 655 ? 18.154  59.631 36.259 1.00 16.57 ? 696  SER A N   1 
ATOM   5275 C  CA  . SER A 1 655 ? 17.459  59.292 35.010 1.00 18.59 ? 696  SER A CA  1 
ATOM   5276 C  C   . SER A 1 655 ? 18.332  58.379 34.110 1.00 19.42 ? 696  SER A C   1 
ATOM   5277 O  O   . SER A 1 655 ? 17.819  57.830 33.108 1.00 21.75 ? 696  SER A O   1 
ATOM   5278 C  CB  . SER A 1 655 ? 17.132  60.578 34.243 1.00 20.71 ? 696  SER A CB  1 
ATOM   5279 O  OG  . SER A 1 655 ? 16.137  61.282 34.986 1.00 22.98 ? 696  SER A OG  1 
ATOM   5280 N  N   . HIS A 1 656 ? 19.607  58.284 34.463 1.00 18.54 ? 697  HIS A N   1 
ATOM   5281 C  CA  . HIS A 1 656 ? 20.600  57.442 33.728 1.00 20.22 ? 697  HIS A CA  1 
ATOM   5282 C  C   . HIS A 1 656 ? 20.945  56.156 34.417 1.00 21.39 ? 697  HIS A C   1 
ATOM   5283 O  O   . HIS A 1 656 ? 21.569  55.250 33.827 1.00 21.11 ? 697  HIS A O   1 
ATOM   5284 C  CB  . HIS A 1 656 ? 21.873  58.280 33.454 1.00 21.39 ? 697  HIS A CB  1 
ATOM   5285 C  CG  . HIS A 1 656 ? 21.541  59.553 32.755 1.00 23.14 ? 697  HIS A CG  1 
ATOM   5286 N  ND1 . HIS A 1 656 ? 21.291  59.605 31.401 1.00 25.52 ? 697  HIS A ND1 1 
ATOM   5287 C  CD2 . HIS A 1 656 ? 21.316  60.801 33.231 1.00 24.24 ? 697  HIS A CD2 1 
ATOM   5288 C  CE1 . HIS A 1 656 ? 20.912  60.832 31.073 1.00 27.42 ? 697  HIS A CE1 1 
ATOM   5289 N  NE2 . HIS A 1 656 ? 20.890  61.569 32.174 1.00 24.94 ? 697  HIS A NE2 1 
ATOM   5290 N  N   . ASN A 1 657 ? 20.509  56.024 35.659 1.00 19.29 ? 698  ASN A N   1 
ATOM   5291 C  CA  . ASN A 1 657 ? 20.892  54.864 36.467 1.00 18.68 ? 698  ASN A CA  1 
ATOM   5292 C  C   . ASN A 1 657 ? 20.027  54.820 37.706 1.00 17.77 ? 698  ASN A C   1 
ATOM   5293 O  O   . ASN A 1 657 ? 20.333  55.474 38.702 1.00 18.09 ? 698  ASN A O   1 
ATOM   5294 C  CB  . ASN A 1 657 ? 22.381  54.908 36.887 1.00 17.82 ? 698  ASN A CB  1 
ATOM   5295 C  CG  . ASN A 1 657 ? 22.768  53.743 37.829 1.00 16.94 ? 698  ASN A CG  1 
ATOM   5296 O  OD1 . ASN A 1 657 ? 21.999  52.784 37.995 1.00 18.93 ? 698  ASN A OD1 1 
ATOM   5297 N  ND2 . ASN A 1 657 ? 23.948  53.843 38.469 1.00 19.37 ? 698  ASN A ND2 1 
ATOM   5298 N  N   . LYS A 1 658 ? 18.959  54.029 37.670 1.00 18.44 ? 699  LYS A N   1 
ATOM   5299 C  CA  . LYS A 1 658 ? 17.999  53.962 38.805 1.00 19.40 ? 699  LYS A CA  1 
ATOM   5300 C  C   . LYS A 1 658 ? 18.672  53.675 40.135 1.00 17.87 ? 699  LYS A C   1 
ATOM   5301 O  O   . LYS A 1 658 ? 18.160  54.058 41.197 1.00 17.66 ? 699  LYS A O   1 
ATOM   5302 C  CB  . LYS A 1 658 ? 17.003  52.852 38.452 1.00 21.78 ? 699  LYS A CB  1 
ATOM   5303 C  CG  . LYS A 1 658 ? 16.048  52.440 39.414 1.00 26.03 ? 699  LYS A CG  1 
ATOM   5304 C  CD  . LYS A 1 658 ? 14.958  51.652 38.683 1.00 23.60 ? 699  LYS A CD  1 
ATOM   5305 C  CE  . LYS A 1 658 ? 13.586  52.022 39.328 1.00 28.46 ? 699  LYS A CE  1 
ATOM   5306 N  NZ  . LYS A 1 658 ? 12.593  50.942 39.035 1.00 27.39 ? 699  LYS A NZ  1 
ATOM   5307 N  N   . TYR A 1 659 ? 19.843  53.009 40.136 1.00 16.80 ? 700  TYR A N   1 
ATOM   5308 C  CA  . TYR A 1 659 ? 20.449  52.639 41.386 1.00 16.64 ? 700  TYR A CA  1 
ATOM   5309 C  C   . TYR A 1 659 ? 21.142  53.798 42.105 1.00 16.55 ? 700  TYR A C   1 
ATOM   5310 O  O   . TYR A 1 659 ? 21.477  53.664 43.257 1.00 18.90 ? 700  TYR A O   1 
ATOM   5311 C  CB  . TYR A 1 659 ? 21.529  51.617 41.124 1.00 18.12 ? 700  TYR A CB  1 
ATOM   5312 C  CG  . TYR A 1 659 ? 21.060  50.213 40.688 1.00 16.66 ? 700  TYR A CG  1 
ATOM   5313 C  CD1 . TYR A 1 659 ? 19.886  49.662 41.147 1.00 17.83 ? 700  TYR A CD1 1 
ATOM   5314 C  CD2 . TYR A 1 659 ? 21.896  49.422 39.889 1.00 19.87 ? 700  TYR A CD2 1 
ATOM   5315 C  CE1 . TYR A 1 659 ? 19.467  48.333 40.765 1.00 18.30 ? 700  TYR A CE1 1 
ATOM   5316 C  CE2 . TYR A 1 659 ? 21.506  48.120 39.510 1.00 20.90 ? 700  TYR A CE2 1 
ATOM   5317 C  CZ  . TYR A 1 659 ? 20.317  47.578 39.980 1.00 21.70 ? 700  TYR A CZ  1 
ATOM   5318 O  OH  . TYR A 1 659 ? 19.906  46.307 39.624 1.00 20.41 ? 700  TYR A OH  1 
ATOM   5319 N  N   . ALA A 1 660 ? 21.401  54.879 41.372 1.00 16.62 ? 701  ALA A N   1 
ATOM   5320 C  CA  . ALA A 1 660 ? 22.173  56.019 41.884 1.00 18.10 ? 701  ALA A CA  1 
ATOM   5321 C  C   . ALA A 1 660 ? 21.183  57.123 42.312 1.00 18.24 ? 701  ALA A C   1 
ATOM   5322 O  O   . ALA A 1 660 ? 20.177  57.397 41.623 1.00 17.47 ? 701  ALA A O   1 
ATOM   5323 C  CB  . ALA A 1 660 ? 23.073  56.549 40.764 1.00 18.56 ? 701  ALA A CB  1 
ATOM   5324 N  N   . GLY A 1 661 ? 21.450  57.742 43.454 1.00 17.99 ? 702  GLY A N   1 
ATOM   5325 C  CA  . GLY A 1 661 ? 20.636  58.905 43.844 1.00 19.22 ? 702  GLY A CA  1 
ATOM   5326 C  C   . GLY A 1 661 ? 21.282  60.101 43.138 1.00 19.19 ? 702  GLY A C   1 
ATOM   5327 O  O   . GLY A 1 661 ? 22.536  60.155 42.957 1.00 21.09 ? 702  GLY A O   1 
ATOM   5328 N  N   . GLU A 1 662 ? 20.448  61.042 42.723 1.00 17.45 ? 703  GLU A N   1 
ATOM   5329 C  CA  . GLU A 1 662 ? 20.891  62.309 42.141 1.00 17.22 ? 703  GLU A CA  1 
ATOM   5330 C  C   . GLU A 1 662 ? 20.329  63.448 43.014 1.00 16.58 ? 703  GLU A C   1 
ATOM   5331 O  O   . GLU A 1 662 ? 19.234  63.350 43.529 1.00 17.91 ? 703  GLU A O   1 
ATOM   5332 C  CB  . GLU A 1 662 ? 20.373  62.452 40.737 1.00 16.58 ? 703  GLU A CB  1 
ATOM   5333 C  CG  . GLU A 1 662 ? 20.944  63.729 40.056 1.00 20.08 ? 703  GLU A CG  1 
ATOM   5334 C  CD  . GLU A 1 662 ? 22.473  63.680 40.076 1.00 20.55 ? 703  GLU A CD  1 
ATOM   5335 O  OE1 . GLU A 1 662 ? 23.034  62.944 39.226 1.00 21.30 ? 703  GLU A OE1 1 
ATOM   5336 O  OE2 . GLU A 1 662 ? 23.121  64.363 40.934 1.00 22.59 ? 703  GLU A OE2 1 
ATOM   5337 N  N   . SER A 1 663 ? 21.152  64.495 43.247 1.00 17.11 ? 704  SER A N   1 
ATOM   5338 C  CA  . SER A 1 663 ? 20.647  65.626 44.026 1.00 16.78 ? 704  SER A CA  1 
ATOM   5339 C  C   . SER A 1 663 ? 20.171  66.751 43.124 1.00 16.57 ? 704  SER A C   1 
ATOM   5340 O  O   . SER A 1 663 ? 20.595  66.874 41.955 1.00 16.29 ? 704  SER A O   1 
ATOM   5341 C  CB  . SER A 1 663 ? 21.722  66.131 45.008 1.00 18.20 ? 704  SER A CB  1 
ATOM   5342 O  OG  . SER A 1 663 ? 22.946  66.399 44.274 1.00 19.42 ? 704  SER A OG  1 
ATOM   5343 N  N   . PHE A 1 664 ? 19.243  67.553 43.645 1.00 16.41 ? 705  PHE A N   1 
ATOM   5344 C  CA  . PHE A 1 664 ? 18.543  68.559 42.793 1.00 16.52 ? 705  PHE A CA  1 
ATOM   5345 C  C   . PHE A 1 664 ? 18.226  68.000 41.399 1.00 15.33 ? 705  PHE A C   1 
ATOM   5346 O  O   . PHE A 1 664 ? 18.548  68.573 40.364 1.00 16.85 ? 705  PHE A O   1 
ATOM   5347 C  CB  . PHE A 1 664 ? 19.289  69.905 42.749 1.00 16.07 ? 705  PHE A CB  1 
ATOM   5348 C  CG  . PHE A 1 664 ? 19.191  70.658 44.071 1.00 15.32 ? 705  PHE A CG  1 
ATOM   5349 C  CD1 . PHE A 1 664 ? 17.917  70.934 44.655 1.00 14.61 ? 705  PHE A CD1 1 
ATOM   5350 C  CD2 . PHE A 1 664 ? 20.339  71.097 44.703 1.00 17.77 ? 705  PHE A CD2 1 
ATOM   5351 C  CE1 . PHE A 1 664 ? 17.774  71.611 45.898 1.00 17.65 ? 705  PHE A CE1 1 
ATOM   5352 C  CE2 . PHE A 1 664 ? 20.235  71.781 45.938 1.00 16.54 ? 705  PHE A CE2 1 
ATOM   5353 C  CZ  . PHE A 1 664 ? 18.988  72.022 46.538 1.00 15.94 ? 705  PHE A CZ  1 
ATOM   5354 N  N   . PRO A 1 665 ? 17.543  66.842 41.386 1.00 14.49 ? 706  PRO A N   1 
ATOM   5355 C  CA  . PRO A 1 665 ? 17.335  66.137 40.117 1.00 14.73 ? 706  PRO A CA  1 
ATOM   5356 C  C   . PRO A 1 665 ? 16.654  66.942 39.056 1.00 15.01 ? 706  PRO A C   1 
ATOM   5357 O  O   . PRO A 1 665 ? 16.955  66.753 37.862 1.00 16.47 ? 706  PRO A O   1 
ATOM   5358 C  CB  . PRO A 1 665 ? 16.439  64.926 40.545 1.00 14.82 ? 706  PRO A CB  1 
ATOM   5359 C  CG  . PRO A 1 665 ? 15.782  65.385 41.827 1.00 16.85 ? 706  PRO A CG  1 
ATOM   5360 C  CD  . PRO A 1 665 ? 16.855  66.172 42.528 1.00 16.04 ? 706  PRO A CD  1 
ATOM   5361 N  N   . GLY A 1 666 ? 15.716  67.822 39.445 1.00 15.32 ? 707  GLY A N   1 
ATOM   5362 C  CA  . GLY A 1 666 ? 14.970  68.560 38.416 1.00 15.26 ? 707  GLY A CA  1 
ATOM   5363 C  C   . GLY A 1 666 ? 15.891  69.536 37.727 1.00 16.70 ? 707  GLY A C   1 
ATOM   5364 O  O   . GLY A 1 666 ? 15.867  69.660 36.504 1.00 17.65 ? 707  GLY A O   1 
ATOM   5365 N  N   . ILE A 1 667 ? 16.752  70.218 38.503 1.00 16.33 ? 708  ILE A N   1 
ATOM   5366 C  CA  . ILE A 1 667 ? 17.754  71.089 37.843 1.00 16.84 ? 708  ILE A CA  1 
ATOM   5367 C  C   . ILE A 1 667 ? 18.815  70.260 37.090 1.00 17.00 ? 708  ILE A C   1 
ATOM   5368 O  O   . ILE A 1 667 ? 19.180  70.604 35.987 1.00 18.14 ? 708  ILE A O   1 
ATOM   5369 C  CB  . ILE A 1 667 ? 18.487  72.016 38.866 1.00 15.82 ? 708  ILE A CB  1 
ATOM   5370 C  CG1 . ILE A 1 667 ? 17.499  72.754 39.762 1.00 18.35 ? 708  ILE A CG1 1 
ATOM   5371 C  CG2 . ILE A 1 667 ? 19.326  73.080 38.080 1.00 16.23 ? 708  ILE A CG2 1 
ATOM   5372 C  CD1 . ILE A 1 667 ? 18.252  73.414 40.979 1.00 17.83 ? 708  ILE A CD1 1 
ATOM   5373 N  N   . TYR A 1 668 ? 19.328  69.185 37.715 1.00 17.82 ? 709  TYR A N   1 
ATOM   5374 C  CA  . TYR A 1 668 ? 20.317  68.332 37.049 1.00 18.77 ? 709  TYR A CA  1 
ATOM   5375 C  C   . TYR A 1 668 ? 19.833  67.882 35.648 1.00 17.64 ? 709  TYR A C   1 
ATOM   5376 O  O   . TYR A 1 668 ? 20.534  68.035 34.636 1.00 18.23 ? 709  TYR A O   1 
ATOM   5377 C  CB  . TYR A 1 668 ? 20.681  67.130 37.939 1.00 18.06 ? 709  TYR A CB  1 
ATOM   5378 C  CG  . TYR A 1 668 ? 21.774  66.320 37.281 1.00 17.20 ? 709  TYR A CG  1 
ATOM   5379 C  CD1 . TYR A 1 668 ? 23.128  66.519 37.628 1.00 20.28 ? 709  TYR A CD1 1 
ATOM   5380 C  CD2 . TYR A 1 668 ? 21.440  65.362 36.304 1.00 20.06 ? 709  TYR A CD2 1 
ATOM   5381 C  CE1 . TYR A 1 668 ? 24.161  65.791 36.999 1.00 19.76 ? 709  TYR A CE1 1 
ATOM   5382 C  CE2 . TYR A 1 668 ? 22.464  64.630 35.643 1.00 19.31 ? 709  TYR A CE2 1 
ATOM   5383 C  CZ  . TYR A 1 668 ? 23.813  64.855 36.007 1.00 20.83 ? 709  TYR A CZ  1 
ATOM   5384 O  OH  . TYR A 1 668 ? 24.818  64.091 35.382 1.00 21.46 ? 709  TYR A OH  1 
ATOM   5385 N  N   . ASP A 1 669 ? 18.635  67.286 35.578 1.00 16.91 ? 710  ASP A N   1 
ATOM   5386 C  CA  . ASP A 1 669 ? 18.082  66.847 34.294 1.00 16.94 ? 710  ASP A CA  1 
ATOM   5387 C  C   . ASP A 1 669 ? 17.853  67.986 33.295 1.00 17.64 ? 710  ASP A C   1 
ATOM   5388 O  O   . ASP A 1 669 ? 18.081  67.839 32.109 1.00 20.56 ? 710  ASP A O   1 
ATOM   5389 C  CB  . ASP A 1 669 ? 16.824  66.037 34.523 1.00 18.05 ? 710  ASP A CB  1 
ATOM   5390 C  CG  . ASP A 1 669 ? 17.130  64.632 35.032 1.00 20.90 ? 710  ASP A CG  1 
ATOM   5391 O  OD1 . ASP A 1 669 ? 18.291  64.168 34.950 1.00 20.02 ? 710  ASP A OD1 1 
ATOM   5392 O  OD2 . ASP A 1 669 ? 16.160  63.966 35.406 1.00 23.03 ? 710  ASP A OD2 1 
ATOM   5393 N  N   . ALA A 1 670 ? 17.405  69.143 33.760 1.00 17.77 ? 711  ALA A N   1 
ATOM   5394 C  CA  . ALA A 1 670 ? 17.288  70.325 32.876 1.00 18.03 ? 711  ALA A CA  1 
ATOM   5395 C  C   . ALA A 1 670 ? 18.652  70.718 32.271 1.00 18.75 ? 711  ALA A C   1 
ATOM   5396 O  O   . ALA A 1 670 ? 18.702  71.173 31.100 1.00 19.80 ? 711  ALA A O   1 
ATOM   5397 C  CB  . ALA A 1 670 ? 16.714  71.519 33.643 1.00 19.23 ? 711  ALA A CB  1 
ATOM   5398 N  N   . LEU A 1 671 ? 19.719  70.582 33.038 1.00 17.75 ? 712  LEU A N   1 
ATOM   5399 C  CA  . LEU A 1 671 ? 21.089  70.934 32.546 1.00 19.24 ? 712  LEU A CA  1 
ATOM   5400 C  C   . LEU A 1 671 ? 21.754  69.840 31.705 1.00 20.50 ? 712  LEU A C   1 
ATOM   5401 O  O   . LEU A 1 671 ? 22.734  70.116 30.981 1.00 22.55 ? 712  LEU A O   1 
ATOM   5402 C  CB  . LEU A 1 671 ? 21.982  71.236 33.749 1.00 20.23 ? 712  LEU A CB  1 
ATOM   5403 C  CG  . LEU A 1 671 ? 21.741  72.636 34.347 1.00 19.86 ? 712  LEU A CG  1 
ATOM   5404 C  CD1 . LEU A 1 671 ? 22.391  72.782 35.696 1.00 21.27 ? 712  LEU A CD1 1 
ATOM   5405 C  CD2 . LEU A 1 671 ? 22.266  73.705 33.362 1.00 20.45 ? 712  LEU A CD2 1 
ATOM   5406 N  N   . PHE A 1 672 ? 21.334  68.582 31.894 1.00 19.49 ? 713  PHE A N   1 
ATOM   5407 C  CA  . PHE A 1 672 ? 22.081  67.478 31.298 1.00 20.41 ? 713  PHE A CA  1 
ATOM   5408 C  C   . PHE A 1 672 ? 22.099  67.577 29.777 1.00 20.82 ? 713  PHE A C   1 
ATOM   5409 O  O   . PHE A 1 672 ? 21.041  67.692 29.146 1.00 22.09 ? 713  PHE A O   1 
ATOM   5410 C  CB  . PHE A 1 672 ? 21.514  66.103 31.705 1.00 21.11 ? 713  PHE A CB  1 
ATOM   5411 C  CG  . PHE A 1 672 ? 22.355  64.951 31.220 1.00 20.19 ? 713  PHE A CG  1 
ATOM   5412 C  CD1 . PHE A 1 672 ? 23.549  64.556 31.915 1.00 22.42 ? 713  PHE A CD1 1 
ATOM   5413 C  CD2 . PHE A 1 672 ? 22.018  64.333 30.027 1.00 24.05 ? 713  PHE A CD2 1 
ATOM   5414 C  CE1 . PHE A 1 672 ? 24.342  63.498 31.424 1.00 23.79 ? 713  PHE A CE1 1 
ATOM   5415 C  CE2 . PHE A 1 672 ? 22.795  63.263 29.540 1.00 22.19 ? 713  PHE A CE2 1 
ATOM   5416 C  CZ  . PHE A 1 672 ? 23.956  62.859 30.225 1.00 23.98 ? 713  PHE A CZ  1 
ATOM   5417 N  N   . ASP A 1 673 ? 23.296  67.534 29.205 1.00 23.16 ? 714  ASP A N   1 
ATOM   5418 C  CA  . ASP A 1 673 ? 23.437  67.539 27.726 1.00 24.45 ? 714  ASP A CA  1 
ATOM   5419 C  C   . ASP A 1 673 ? 22.764  68.769 27.098 1.00 25.75 ? 714  ASP A C   1 
ATOM   5420 O  O   . ASP A 1 673 ? 22.290  68.722 25.962 1.00 25.92 ? 714  ASP A O   1 
ATOM   5421 C  CB  . ASP A 1 673 ? 22.900  66.226 27.089 1.00 24.63 ? 714  ASP A CB  1 
ATOM   5422 C  CG  . ASP A 1 673 ? 23.346  66.046 25.610 1.00 26.32 ? 714  ASP A CG  1 
ATOM   5423 O  OD1 . ASP A 1 673 ? 24.505  66.398 25.289 1.00 29.50 ? 714  ASP A OD1 1 
ATOM   5424 O  OD2 . ASP A 1 673 ? 22.517  65.583 24.777 1.00 27.16 ? 714  ASP A OD2 1 
ATOM   5425 N  N   . ILE A 1 674 ? 22.696  69.875 27.848 1.00 25.92 ? 715  ILE A N   1 
ATOM   5426 C  CA  . ILE A 1 674 ? 21.957  71.046 27.370 1.00 25.97 ? 715  ILE A CA  1 
ATOM   5427 C  C   . ILE A 1 674 ? 22.577  71.677 26.109 1.00 27.78 ? 715  ILE A C   1 
ATOM   5428 O  O   . ILE A 1 674 ? 21.836  72.221 25.284 1.00 27.95 ? 715  ILE A O   1 
ATOM   5429 C  CB  . ILE A 1 674 ? 21.775  72.099 28.474 1.00 25.54 ? 715  ILE A CB  1 
ATOM   5430 C  CG1 . ILE A 1 674 ? 20.722  73.133 28.078 1.00 24.37 ? 715  ILE A CG1 1 
ATOM   5431 C  CG2 . ILE A 1 674 ? 23.115  72.651 28.931 1.00 25.17 ? 715  ILE A CG2 1 
ATOM   5432 C  CD1 . ILE A 1 674 ? 20.321  73.943 29.274 1.00 24.84 ? 715  ILE A CD1 1 
ATOM   5433 N  N   . GLU A 1 675 ? 23.898  71.568 25.967 1.00 29.61 ? 716  GLU A N   1 
ATOM   5434 C  CA  . GLU A 1 675 ? 24.590  72.132 24.769 1.00 32.22 ? 716  GLU A CA  1 
ATOM   5435 C  C   . GLU A 1 675 ? 24.114  71.476 23.464 1.00 33.45 ? 716  GLU A C   1 
ATOM   5436 O  O   . GLU A 1 675 ? 24.337  72.021 22.356 1.00 34.49 ? 716  GLU A O   1 
ATOM   5437 C  CB  . GLU A 1 675 ? 26.109  72.033 24.922 1.00 32.74 ? 716  GLU A CB  1 
ATOM   5438 C  CG  . GLU A 1 675 ? 26.683  70.616 24.807 1.00 35.13 ? 716  GLU A CG  1 
ATOM   5439 C  CD  . GLU A 1 675 ? 26.685  69.870 26.139 1.00 36.06 ? 716  GLU A CD  1 
ATOM   5440 O  OE1 . GLU A 1 675 ? 25.901  70.213 27.059 1.00 30.89 ? 716  GLU A OE1 1 
ATOM   5441 O  OE2 . GLU A 1 675 ? 27.477  68.923 26.260 1.00 40.67 ? 716  GLU A OE2 1 
ATOM   5442 N  N   . SER A 1 676 ? 23.422  70.340 23.577 1.00 33.89 ? 717  SER A N   1 
ATOM   5443 C  CA  . SER A 1 676 ? 22.855  69.631 22.415 1.00 34.46 ? 717  SER A CA  1 
ATOM   5444 C  C   . SER A 1 676 ? 21.408  69.965 22.097 1.00 35.25 ? 717  SER A C   1 
ATOM   5445 O  O   . SER A 1 676 ? 20.852  69.464 21.104 1.00 36.14 ? 717  SER A O   1 
ATOM   5446 C  CB  . SER A 1 676 ? 23.000  68.106 22.570 1.00 33.81 ? 717  SER A CB  1 
ATOM   5447 O  OG  . SER A 1 676 ? 24.354  67.765 22.754 1.00 35.99 ? 717  SER A OG  1 
ATOM   5448 N  N   . LYS A 1 677 ? 20.778  70.809 22.917 1.00 35.46 ? 718  LYS A N   1 
ATOM   5449 C  CA  . LYS A 1 677 ? 19.369  71.115 22.707 1.00 35.72 ? 718  LYS A CA  1 
ATOM   5450 C  C   . LYS A 1 677 ? 19.193  72.090 21.541 1.00 36.52 ? 718  LYS A C   1 
ATOM   5451 O  O   . LYS A 1 677 ? 19.954  73.043 21.393 1.00 36.56 ? 718  LYS A O   1 
ATOM   5452 C  CB  . LYS A 1 677 ? 18.719  71.679 23.984 1.00 36.06 ? 718  LYS A CB  1 
ATOM   5453 C  CG  . LYS A 1 677 ? 18.709  70.694 25.138 1.00 36.65 ? 718  LYS A CG  1 
ATOM   5454 C  CD  . LYS A 1 677 ? 18.023  69.405 24.732 1.00 39.54 ? 718  LYS A CD  1 
ATOM   5455 C  CE  . LYS A 1 677 ? 18.118  68.346 25.846 1.00 42.59 ? 718  LYS A CE  1 
ATOM   5456 N  NZ  . LYS A 1 677 ? 17.286  68.752 27.037 1.00 42.62 ? 718  LYS A NZ  1 
ATOM   5457 N  N   . VAL A 1 678 ? 18.171  71.857 20.737 1.00 36.86 ? 719  VAL A N   1 
ATOM   5458 C  CA  . VAL A 1 678 ? 17.983  72.668 19.540 1.00 38.04 ? 719  VAL A CA  1 
ATOM   5459 C  C   . VAL A 1 678 ? 17.502  74.101 19.839 1.00 37.68 ? 719  VAL A C   1 
ATOM   5460 O  O   . VAL A 1 678 ? 17.820  75.046 19.094 1.00 38.48 ? 719  VAL A O   1 
ATOM   5461 C  CB  . VAL A 1 678 ? 17.091  71.909 18.515 1.00 38.36 ? 719  VAL A CB  1 
ATOM   5462 C  CG1 . VAL A 1 678 ? 16.131  72.836 17.785 1.00 40.29 ? 719  VAL A CG1 1 
ATOM   5463 C  CG2 . VAL A 1 678 ? 17.994  71.157 17.532 1.00 38.87 ? 719  VAL A CG2 1 
ATOM   5464 N  N   . ASP A 1 679 ? 16.758  74.267 20.934 1.00 36.70 ? 720  ASP A N   1 
ATOM   5465 C  CA  . ASP A 1 679 ? 16.198  75.568 21.312 1.00 35.25 ? 720  ASP A CA  1 
ATOM   5466 C  C   . ASP A 1 679 ? 16.793  75.955 22.663 1.00 34.28 ? 720  ASP A C   1 
ATOM   5467 O  O   . ASP A 1 679 ? 16.231  75.592 23.723 1.00 33.05 ? 720  ASP A O   1 
ATOM   5468 C  CB  . ASP A 1 679 ? 14.686  75.449 21.410 1.00 35.64 ? 720  ASP A CB  1 
ATOM   5469 C  CG  . ASP A 1 679 ? 13.989  76.767 21.598 1.00 36.44 ? 720  ASP A CG  1 
ATOM   5470 O  OD1 . ASP A 1 679 ? 14.631  77.802 21.904 1.00 36.03 ? 720  ASP A OD1 1 
ATOM   5471 O  OD2 . ASP A 1 679 ? 12.741  76.766 21.482 1.00 41.57 ? 720  ASP A OD2 1 
ATOM   5472 N  N   . PRO A 1 680 ? 17.922  76.686 22.657 1.00 32.83 ? 721  PRO A N   1 
ATOM   5473 C  CA  . PRO A 1 680 ? 18.589  76.948 23.928 1.00 31.84 ? 721  PRO A CA  1 
ATOM   5474 C  C   . PRO A 1 680 ? 17.757  77.828 24.847 1.00 30.73 ? 721  PRO A C   1 
ATOM   5475 O  O   . PRO A 1 680 ? 17.836  77.681 26.065 1.00 30.12 ? 721  PRO A O   1 
ATOM   5476 C  CB  . PRO A 1 680 ? 19.868  77.698 23.525 1.00 32.69 ? 721  PRO A CB  1 
ATOM   5477 C  CG  . PRO A 1 680 ? 19.985  77.553 22.056 1.00 33.33 ? 721  PRO A CG  1 
ATOM   5478 C  CD  . PRO A 1 680 ? 18.628  77.318 21.516 1.00 33.45 ? 721  PRO A CD  1 
ATOM   5479 N  N   . SER A 1 681 ? 16.979  78.738 24.259 1.00 29.88 ? 722  SER A N   1 
ATOM   5480 C  CA  . SER A 1 681 ? 16.149  79.651 25.025 1.00 30.50 ? 722  SER A CA  1 
ATOM   5481 C  C   . SER A 1 681 ? 15.130  78.880 25.866 1.00 29.28 ? 722  SER A C   1 
ATOM   5482 O  O   . SER A 1 681 ? 14.920  79.190 27.047 1.00 29.08 ? 722  SER A O   1 
ATOM   5483 C  CB  . SER A 1 681 ? 15.430  80.652 24.111 1.00 31.47 ? 722  SER A CB  1 
ATOM   5484 O  OG  . SER A 1 681 ? 14.596  81.452 24.916 1.00 35.59 ? 722  SER A OG  1 
ATOM   5485 N  N   . LYS A 1 682 ? 14.496  77.892 25.232 1.00 27.71 ? 723  LYS A N   1 
ATOM   5486 C  CA  . LYS A 1 682 ? 13.563  77.007 25.910 1.00 27.93 ? 723  LYS A CA  1 
ATOM   5487 C  C   . LYS A 1 682 ? 14.252  76.162 26.995 1.00 26.48 ? 723  LYS A C   1 
ATOM   5488 O  O   . LYS A 1 682 ? 13.724  76.057 28.130 1.00 25.08 ? 723  LYS A O   1 
ATOM   5489 C  CB  . LYS A 1 682 ? 12.887  76.106 24.875 1.00 29.22 ? 723  LYS A CB  1 
ATOM   5490 C  CG  . LYS A 1 682 ? 11.849  75.173 25.457 1.00 32.82 ? 723  LYS A CG  1 
ATOM   5491 C  CD  . LYS A 1 682 ? 11.138  74.385 24.350 1.00 39.52 ? 723  LYS A CD  1 
ATOM   5492 C  CE  . LYS A 1 682 ? 10.399  73.171 24.905 1.00 42.94 ? 723  LYS A CE  1 
ATOM   5493 N  NZ  . LYS A 1 682 ? 9.615   72.531 23.783 1.00 46.21 ? 723  LYS A NZ  1 
ATOM   5494 N  N   . ALA A 1 683 ? 15.402  75.578 26.634 1.00 25.37 ? 724  ALA A N   1 
ATOM   5495 C  CA  . ALA A 1 683 ? 16.146  74.683 27.531 1.00 23.66 ? 724  ALA A CA  1 
ATOM   5496 C  C   . ALA A 1 683 ? 16.595  75.446 28.770 1.00 23.46 ? 724  ALA A C   1 
ATOM   5497 O  O   . ALA A 1 683 ? 16.439  74.968 29.893 1.00 20.63 ? 724  ALA A O   1 
ATOM   5498 C  CB  . ALA A 1 683 ? 17.356  74.063 26.842 1.00 25.17 ? 724  ALA A CB  1 
ATOM   5499 N  N   . TRP A 1 684 ? 17.105  76.655 28.579 1.00 22.41 ? 725  TRP A N   1 
ATOM   5500 C  CA  . TRP A 1 684 ? 17.570  77.433 29.740 1.00 21.24 ? 725  TRP A CA  1 
ATOM   5501 C  C   . TRP A 1 684 ? 16.399  78.007 30.544 1.00 20.50 ? 725  TRP A C   1 
ATOM   5502 O  O   . TRP A 1 684 ? 16.502  78.187 31.772 1.00 21.31 ? 725  TRP A O   1 
ATOM   5503 C  CB  . TRP A 1 684 ? 18.602  78.504 29.293 1.00 21.32 ? 725  TRP A CB  1 
ATOM   5504 C  CG  . TRP A 1 684 ? 19.938  77.893 29.026 1.00 20.78 ? 725  TRP A CG  1 
ATOM   5505 C  CD1 . TRP A 1 684 ? 20.442  77.500 27.794 1.00 22.11 ? 725  TRP A CD1 1 
ATOM   5506 C  CD2 . TRP A 1 684 ? 20.914  77.492 30.006 1.00 20.31 ? 725  TRP A CD2 1 
ATOM   5507 N  NE1 . TRP A 1 684 ? 21.692  76.923 27.962 1.00 23.20 ? 725  TRP A NE1 1 
ATOM   5508 C  CE2 . TRP A 1 684 ? 22.012  76.909 29.294 1.00 22.14 ? 725  TRP A CE2 1 
ATOM   5509 C  CE3 . TRP A 1 684 ? 20.988  77.586 31.405 1.00 18.62 ? 725  TRP A CE3 1 
ATOM   5510 C  CZ2 . TRP A 1 684 ? 23.157  76.433 29.934 1.00 20.43 ? 725  TRP A CZ2 1 
ATOM   5511 C  CZ3 . TRP A 1 684 ? 22.164  77.097 32.070 1.00 20.26 ? 725  TRP A CZ3 1 
ATOM   5512 C  CH2 . TRP A 1 684 ? 23.214  76.512 31.312 1.00 21.56 ? 725  TRP A CH2 1 
ATOM   5513 N  N   . GLY A 1 685 ? 15.278  78.274 29.881 1.00 19.61 ? 726  GLY A N   1 
ATOM   5514 C  CA  . GLY A 1 685 ? 14.046  78.688 30.548 1.00 19.73 ? 726  GLY A CA  1 
ATOM   5515 C  C   . GLY A 1 685 ? 13.662  77.576 31.530 1.00 19.42 ? 726  GLY A C   1 
ATOM   5516 O  O   . GLY A 1 685 ? 13.277  77.881 32.674 1.00 19.40 ? 726  GLY A O   1 
ATOM   5517 N  N   . GLU A 1 686 ? 13.779  76.336 31.089 1.00 18.93 ? 727  GLU A N   1 
ATOM   5518 C  CA  . GLU A 1 686 ? 13.431  75.199 31.985 1.00 19.38 ? 727  GLU A CA  1 
ATOM   5519 C  C   . GLU A 1 686 ? 14.412  75.026 33.132 1.00 18.72 ? 727  GLU A C   1 
ATOM   5520 O  O   . GLU A 1 686 ? 14.021  74.691 34.258 1.00 16.87 ? 727  GLU A O   1 
ATOM   5521 C  CB  . GLU A 1 686 ? 13.257  73.950 31.126 1.00 20.26 ? 727  GLU A CB  1 
ATOM   5522 C  CG  . GLU A 1 686 ? 12.804  72.697 31.912 1.00 21.89 ? 727  GLU A CG  1 
ATOM   5523 C  CD  . GLU A 1 686 ? 11.473  72.810 32.643 1.00 26.42 ? 727  GLU A CD  1 
ATOM   5524 O  OE1 . GLU A 1 686 ? 10.637  73.708 32.344 1.00 27.65 ? 727  GLU A OE1 1 
ATOM   5525 O  OE2 . GLU A 1 686 ? 11.259  71.910 33.520 1.00 25.02 ? 727  GLU A OE2 1 
ATOM   5526 N  N   . VAL A 1 687 ? 15.705  75.285 32.903 1.00 17.84 ? 728  VAL A N   1 
ATOM   5527 C  CA  . VAL A 1 687 ? 16.668  75.349 34.019 1.00 17.55 ? 728  VAL A CA  1 
ATOM   5528 C  C   . VAL A 1 687 ? 16.193  76.375 35.064 1.00 17.63 ? 728  VAL A C   1 
ATOM   5529 O  O   . VAL A 1 687 ? 16.170  76.115 36.262 1.00 16.57 ? 728  VAL A O   1 
ATOM   5530 C  CB  . VAL A 1 687 ? 18.122  75.697 33.545 1.00 17.52 ? 728  VAL A CB  1 
ATOM   5531 C  CG1 . VAL A 1 687 ? 19.065  75.980 34.773 1.00 18.99 ? 728  VAL A CG1 1 
ATOM   5532 C  CG2 . VAL A 1 687 ? 18.664  74.591 32.569 1.00 18.48 ? 728  VAL A CG2 1 
ATOM   5533 N  N   . LYS A 1 688 ? 15.833  77.573 34.591 1.00 18.12 ? 729  LYS A N   1 
ATOM   5534 C  CA  . LYS A 1 688 ? 15.391  78.615 35.528 1.00 18.36 ? 729  LYS A CA  1 
ATOM   5535 C  C   . LYS A 1 688 ? 14.117  78.195 36.268 1.00 17.99 ? 729  LYS A C   1 
ATOM   5536 O  O   . LYS A 1 688 ? 13.980  78.451 37.449 1.00 17.67 ? 729  LYS A O   1 
ATOM   5537 C  CB  B LYS A 1 688 ? 15.153  79.907 34.771 0.65 18.80 ? 729  LYS A CB  1 
ATOM   5538 C  CB  C LYS A 1 688 ? 15.195  79.938 34.806 0.35 18.69 ? 729  LYS A CB  1 
ATOM   5539 C  CG  B LYS A 1 688 ? 16.469  80.519 34.352 0.65 19.25 ? 729  LYS A CG  1 
ATOM   5540 C  CG  C LYS A 1 688 ? 16.513  80.475 34.292 0.35 19.05 ? 729  LYS A CG  1 
ATOM   5541 C  CD  B LYS A 1 688 ? 16.270  81.783 33.425 0.65 17.70 ? 729  LYS A CD  1 
ATOM   5542 C  CD  C LYS A 1 688 ? 16.387  81.900 33.690 0.35 19.91 ? 729  LYS A CD  1 
ATOM   5543 C  CE  B LYS A 1 688 ? 15.736  83.000 34.201 0.65 22.27 ? 729  LYS A CE  1 
ATOM   5544 C  CE  C LYS A 1 688 ? 15.423  81.973 32.518 0.35 22.52 ? 729  LYS A CE  1 
ATOM   5545 N  NZ  B LYS A 1 688 ? 15.761  84.257 33.344 0.65 22.79 ? 729  LYS A NZ  1 
ATOM   5546 N  NZ  C LYS A 1 688 ? 15.714  83.172 31.671 0.35 22.22 ? 729  LYS A NZ  1 
ATOM   5547 N  N   . ARG A 1 689 ? 13.201  77.554 35.541 1.00 16.56 ? 730  ARG A N   1 
ATOM   5548 C  CA  . ARG A 1 689 ? 11.993  77.039 36.192 1.00 16.23 ? 730  ARG A CA  1 
ATOM   5549 C  C   . ARG A 1 689 ? 12.360  76.067 37.317 1.00 15.71 ? 730  ARG A C   1 
ATOM   5550 O  O   . ARG A 1 689 ? 11.836  76.154 38.418 1.00 14.89 ? 730  ARG A O   1 
ATOM   5551 C  CB  . ARG A 1 689 ? 11.073  76.336 35.213 1.00 16.73 ? 730  ARG A CB  1 
ATOM   5552 C  CG  . ARG A 1 689 ? 9.700   76.184 35.876 1.00 18.45 ? 730  ARG A CG  1 
ATOM   5553 C  CD  . ARG A 1 689 ? 8.623   75.624 34.921 1.00 22.24 ? 730  ARG A CD  1 
ATOM   5554 N  NE  . ARG A 1 689 ? 8.850   74.220 34.624 1.00 25.13 ? 730  ARG A NE  1 
ATOM   5555 C  CZ  . ARG A 1 689 ? 8.392   73.229 35.407 1.00 29.28 ? 730  ARG A CZ  1 
ATOM   5556 N  NH1 . ARG A 1 689 ? 7.744   73.522 36.542 1.00 27.54 ? 730  ARG A NH1 1 
ATOM   5557 N  NH2 . ARG A 1 689 ? 8.598   71.961 35.085 1.00 24.03 ? 730  ARG A NH2 1 
ATOM   5558 N  N   . GLN A 1 690 ? 13.287  75.169 37.038 1.00 15.32 ? 731  GLN A N   1 
ATOM   5559 C  CA  . GLN A 1 690 ? 13.684  74.160 38.074 1.00 15.93 ? 731  GLN A CA  1 
ATOM   5560 C  C   . GLN A 1 690 ? 14.429  74.804 39.266 1.00 16.00 ? 731  GLN A C   1 
ATOM   5561 O  O   . GLN A 1 690 ? 14.321  74.352 40.416 1.00 16.14 ? 731  GLN A O   1 
ATOM   5562 C  CB  . GLN A 1 690 ? 14.492  73.055 37.423 1.00 16.68 ? 731  GLN A CB  1 
ATOM   5563 C  CG  . GLN A 1 690 ? 13.653  72.284 36.378 1.00 17.12 ? 731  GLN A CG  1 
ATOM   5564 C  CD  . GLN A 1 690 ? 12.484  71.583 37.054 1.00 19.77 ? 731  GLN A CD  1 
ATOM   5565 O  OE1 . GLN A 1 690 ? 12.622  71.080 38.183 1.00 17.37 ? 731  GLN A OE1 1 
ATOM   5566 N  NE2 . GLN A 1 690 ? 11.333  71.507 36.363 1.00 22.72 ? 731  GLN A NE2 1 
ATOM   5567 N  N   . ILE A 1 691 ? 15.227  75.859 38.977 1.00 15.47 ? 732  ILE A N   1 
ATOM   5568 C  CA  . ILE A 1 691 ? 15.851  76.588 40.092 1.00 15.86 ? 732  ILE A CA  1 
ATOM   5569 C  C   . ILE A 1 691 ? 14.780  77.192 40.983 1.00 15.63 ? 732  ILE A C   1 
ATOM   5570 O  O   . ILE A 1 691 ? 14.899  77.078 42.219 1.00 17.14 ? 732  ILE A O   1 
ATOM   5571 C  CB  . ILE A 1 691 ? 16.797  77.721 39.533 1.00 15.57 ? 732  ILE A CB  1 
ATOM   5572 C  CG1 . ILE A 1 691 ? 17.999  77.109 38.848 1.00 17.38 ? 732  ILE A CG1 1 
ATOM   5573 C  CG2 . ILE A 1 691 ? 17.251  78.691 40.730 1.00 16.80 ? 732  ILE A CG2 1 
ATOM   5574 C  CD1 . ILE A 1 691 ? 18.765  78.154 38.028 1.00 15.45 ? 732  ILE A CD1 1 
ATOM   5575 N  N   . TYR A 1 692 ? 13.767  77.810 40.391 1.00 15.22 ? 733  TYR A N   1 
ATOM   5576 C  CA  . TYR A 1 692 ? 12.601  78.378 41.130 1.00 15.80 ? 733  TYR A CA  1 
ATOM   5577 C  C   . TYR A 1 692 ? 11.896  77.293 41.969 1.00 16.91 ? 733  TYR A C   1 
ATOM   5578 O  O   . TYR A 1 692 ? 11.648  77.477 43.153 1.00 15.76 ? 733  TYR A O   1 
ATOM   5579 C  CB  . TYR A 1 692 ? 11.602  78.989 40.140 1.00 17.17 ? 733  TYR A CB  1 
ATOM   5580 C  CG  . TYR A 1 692 ? 10.138  79.265 40.569 1.00 19.00 ? 733  TYR A CG  1 
ATOM   5581 C  CD1 . TYR A 1 692 ? 9.816   80.024 41.727 1.00 22.72 ? 733  TYR A CD1 1 
ATOM   5582 C  CD2 . TYR A 1 692 ? 9.033   78.871 39.709 1.00 18.11 ? 733  TYR A CD2 1 
ATOM   5583 C  CE1 . TYR A 1 692 ? 8.420   80.345 42.045 1.00 21.91 ? 733  TYR A CE1 1 
ATOM   5584 C  CE2 . TYR A 1 692 ? 7.743   79.189 40.001 1.00 20.53 ? 733  TYR A CE2 1 
ATOM   5585 C  CZ  . TYR A 1 692 ? 7.419   79.947 41.157 1.00 21.21 ? 733  TYR A CZ  1 
ATOM   5586 O  OH  . TYR A 1 692 ? 6.095   80.298 41.391 1.00 21.48 ? 733  TYR A OH  1 
ATOM   5587 N  N   . VAL A 1 693 ? 11.601  76.148 41.357 1.00 15.31 ? 734  VAL A N   1 
ATOM   5588 C  CA  . VAL A 1 693 ? 10.924  75.103 42.133 1.00 14.89 ? 734  VAL A CA  1 
ATOM   5589 C  C   . VAL A 1 693 ? 11.786  74.636 43.327 1.00 14.44 ? 734  VAL A C   1 
ATOM   5590 O  O   . VAL A 1 693 ? 11.296  74.451 44.446 1.00 15.01 ? 734  VAL A O   1 
ATOM   5591 C  CB  . VAL A 1 693 ? 10.605  73.938 41.179 1.00 15.28 ? 734  VAL A CB  1 
ATOM   5592 C  CG1 . VAL A 1 693 ? 10.102  72.727 41.975 1.00 16.28 ? 734  VAL A CG1 1 
ATOM   5593 C  CG2 . VAL A 1 693 ? 9.532   74.414 40.184 1.00 16.68 ? 734  VAL A CG2 1 
ATOM   5594 N  N   . ALA A 1 694 ? 13.078  74.468 43.070 1.00 13.78 ? 735  ALA A N   1 
ATOM   5595 C  CA  . ALA A 1 694 ? 13.993  74.002 44.130 1.00 13.75 ? 735  ALA A CA  1 
ATOM   5596 C  C   . ALA A 1 694 ? 14.123  75.013 45.281 1.00 13.77 ? 735  ALA A C   1 
ATOM   5597 O  O   . ALA A 1 694 ? 14.040  74.623 46.461 1.00 14.47 ? 735  ALA A O   1 
ATOM   5598 C  CB  . ALA A 1 694 ? 15.352  73.662 43.524 1.00 15.02 ? 735  ALA A CB  1 
ATOM   5599 N  N   . ALA A 1 695 ? 14.347  76.291 44.896 1.00 14.38 ? 736  ALA A N   1 
ATOM   5600 C  CA  . ALA A 1 695 ? 14.425  77.368 45.929 1.00 14.18 ? 736  ALA A CA  1 
ATOM   5601 C  C   . ALA A 1 695 ? 13.152  77.467 46.757 1.00 14.62 ? 736  ALA A C   1 
ATOM   5602 O  O   . ALA A 1 695 ? 13.182  77.497 48.001 1.00 15.59 ? 736  ALA A O   1 
ATOM   5603 C  CB  . ALA A 1 695 ? 14.759  78.704 45.267 1.00 15.58 ? 736  ALA A CB  1 
ATOM   5604 N  N   . PHE A 1 696 ? 12.020  77.408 46.057 1.00 14.73 ? 737  PHE A N   1 
ATOM   5605 C  CA  . PHE A 1 696 ? 10.763  77.502 46.723 1.00 13.62 ? 737  PHE A CA  1 
ATOM   5606 C  C   . PHE A 1 696 ? 10.623  76.322 47.709 1.00 14.23 ? 737  PHE A C   1 
ATOM   5607 O  O   . PHE A 1 696 ? 10.210  76.492 48.869 1.00 14.53 ? 737  PHE A O   1 
ATOM   5608 C  CB  . PHE A 1 696 ? 9.593   77.493 45.730 1.00 14.88 ? 737  PHE A CB  1 
ATOM   5609 C  CG  . PHE A 1 696 ? 8.294   77.138 46.409 1.00 15.03 ? 737  PHE A CG  1 
ATOM   5610 C  CD1 . PHE A 1 696 ? 7.711   78.009 47.364 1.00 18.10 ? 737  PHE A CD1 1 
ATOM   5611 C  CD2 . PHE A 1 696 ? 7.704   75.888 46.179 1.00 19.19 ? 737  PHE A CD2 1 
ATOM   5612 C  CE1 . PHE A 1 696 ? 6.512   77.613 48.065 1.00 18.99 ? 737  PHE A CE1 1 
ATOM   5613 C  CE2 . PHE A 1 696 ? 6.463   75.477 46.852 1.00 16.91 ? 737  PHE A CE2 1 
ATOM   5614 C  CZ  . PHE A 1 696 ? 5.889   76.346 47.788 1.00 16.85 ? 737  PHE A CZ  1 
ATOM   5615 N  N   . THR A 1 697 ? 10.926  75.107 47.219 1.00 12.75 ? 738  THR A N   1 
ATOM   5616 C  CA  . THR A 1 697 ? 10.720  73.918 48.069 1.00 13.41 ? 738  THR A CA  1 
ATOM   5617 C  C   . THR A 1 697 ? 11.663  73.932 49.309 1.00 13.93 ? 738  THR A C   1 
ATOM   5618 O  O   . THR A 1 697 ? 11.227  73.574 50.416 1.00 14.78 ? 738  THR A O   1 
ATOM   5619 C  CB  . THR A 1 697 ? 10.942  72.632 47.291 1.00 14.30 ? 738  THR A CB  1 
ATOM   5620 O  OG1 . THR A 1 697 ? 10.033  72.646 46.156 1.00 14.24 ? 738  THR A OG1 1 
ATOM   5621 C  CG2 . THR A 1 697 ? 10.559  71.449 48.180 1.00 13.88 ? 738  THR A CG2 1 
ATOM   5622 N  N   . VAL A 1 698 ? 12.913  74.354 49.099 1.00 14.26 ? 739  VAL A N   1 
ATOM   5623 C  CA  . VAL A 1 698 ? 13.894  74.471 50.222 1.00 14.15 ? 739  VAL A CA  1 
ATOM   5624 C  C   . VAL A 1 698 ? 13.382  75.477 51.267 1.00 14.36 ? 739  VAL A C   1 
ATOM   5625 O  O   . VAL A 1 698 ? 13.297  75.185 52.469 1.00 14.77 ? 739  VAL A O   1 
ATOM   5626 C  CB  . VAL A 1 698 ? 15.283  74.818 49.764 1.00 15.26 ? 739  VAL A CB  1 
ATOM   5627 C  CG1 . VAL A 1 698 ? 16.198  75.069 50.985 1.00 15.95 ? 739  VAL A CG1 1 
ATOM   5628 C  CG2 . VAL A 1 698 ? 15.866  73.648 48.966 1.00 14.64 ? 739  VAL A CG2 1 
ATOM   5629 N  N   . GLN A 1 699 ? 12.952  76.648 50.772 1.00 15.20 ? 740  GLN A N   1 
ATOM   5630 C  CA  . GLN A 1 699 ? 12.360  77.652 51.695 1.00 15.76 ? 740  GLN A CA  1 
ATOM   5631 C  C   . GLN A 1 699 ? 11.093  77.142 52.413 1.00 13.99 ? 740  GLN A C   1 
ATOM   5632 O  O   . GLN A 1 699 ? 10.903  77.302 53.630 1.00 15.41 ? 740  GLN A O   1 
ATOM   5633 C  CB  . GLN A 1 699 ? 12.062  78.939 50.960 1.00 15.85 ? 740  GLN A CB  1 
ATOM   5634 C  CG  . GLN A 1 699 ? 11.440  80.034 51.830 1.00 17.30 ? 740  GLN A CG  1 
ATOM   5635 C  CD  . GLN A 1 699 ? 12.466  80.649 52.779 1.00 18.55 ? 740  GLN A CD  1 
ATOM   5636 O  OE1 . GLN A 1 699 ? 13.671  80.638 52.503 1.00 20.60 ? 740  GLN A OE1 1 
ATOM   5637 N  NE2 . GLN A 1 699 ? 11.981  81.174 53.920 1.00 20.60 ? 740  GLN A NE2 1 
ATOM   5638 N  N   . ALA A 1 700 ? 10.204  76.431 51.709 1.00 14.20 ? 741  ALA A N   1 
ATOM   5639 C  CA  . ALA A 1 700 ? 8.977   75.970 52.317 1.00 15.08 ? 741  ALA A CA  1 
ATOM   5640 C  C   . ALA A 1 700 ? 9.276   74.923 53.386 1.00 14.52 ? 741  ALA A C   1 
ATOM   5641 O  O   . ALA A 1 700 ? 8.655   74.875 54.432 1.00 15.77 ? 741  ALA A O   1 
ATOM   5642 C  CB  . ALA A 1 700 ? 8.080   75.321 51.217 1.00 16.37 ? 741  ALA A CB  1 
ATOM   5643 N  N   . ALA A 1 701 ? 10.258  74.062 53.090 1.00 14.15 ? 742  ALA A N   1 
ATOM   5644 C  CA  . ALA A 1 701 ? 10.654  73.049 54.087 1.00 14.78 ? 742  ALA A CA  1 
ATOM   5645 C  C   . ALA A 1 701 ? 11.234  73.762 55.343 1.00 15.38 ? 742  ALA A C   1 
ATOM   5646 O  O   . ALA A 1 701 ? 10.829  73.406 56.452 1.00 16.51 ? 742  ALA A O   1 
ATOM   5647 C  CB  . ALA A 1 701 ? 11.643  72.089 53.477 1.00 16.32 ? 742  ALA A CB  1 
ATOM   5648 N  N   . ALA A 1 702 ? 12.119  74.752 55.092 1.00 16.54 ? 743  ALA A N   1 
ATOM   5649 C  CA  . ALA A 1 702 ? 12.691  75.587 56.201 1.00 16.94 ? 743  ALA A CA  1 
ATOM   5650 C  C   . ALA A 1 702 ? 11.554  76.114 57.062 1.00 16.76 ? 743  ALA A C   1 
ATOM   5651 O  O   . ALA A 1 702 ? 11.563  76.015 58.329 1.00 16.36 ? 743  ALA A O   1 
ATOM   5652 C  CB  . ALA A 1 702 ? 13.511  76.717 55.633 1.00 15.62 ? 743  ALA A CB  1 
ATOM   5653 N  N   . GLU A 1 703 ? 10.540  76.691 56.402 1.00 15.62 ? 744  GLU A N   1 
ATOM   5654 C  CA  . GLU A 1 703 ? 9.401   77.282 57.134 1.00 16.90 ? 744  GLU A CA  1 
ATOM   5655 C  C   . GLU A 1 703 ? 8.579   76.332 57.989 1.00 17.22 ? 744  GLU A C   1 
ATOM   5656 O  O   . GLU A 1 703 ? 7.962   76.729 58.930 1.00 17.36 ? 744  GLU A O   1 
ATOM   5657 C  CB  . GLU A 1 703 ? 8.528   78.159 56.196 1.00 17.66 ? 744  GLU A CB  1 
ATOM   5658 C  CG  . GLU A 1 703 ? 9.362   79.307 55.696 1.00 18.79 ? 744  GLU A CG  1 
ATOM   5659 C  CD  . GLU A 1 703 ? 8.603   80.258 54.821 1.00 24.40 ? 744  GLU A CD  1 
ATOM   5660 O  OE1 . GLU A 1 703 ? 7.446   79.932 54.465 1.00 24.47 ? 744  GLU A OE1 1 
ATOM   5661 O  OE2 . GLU A 1 703 ? 9.190   81.306 54.436 1.00 25.27 ? 744  GLU A OE2 1 
ATOM   5662 N  N   . THR A 1 704 ? 8.669   74.997 57.766 1.00 15.60 ? 745  THR A N   1 
ATOM   5663 C  CA  . THR A 1 704 ? 8.011   74.053 58.627 1.00 15.83 ? 745  THR A CA  1 
ATOM   5664 C  C   . THR A 1 704 ? 8.692   73.936 60.018 1.00 14.34 ? 745  THR A C   1 
ATOM   5665 O  O   . THR A 1 704 ? 8.088   73.423 60.896 1.00 17.04 ? 745  THR A O   1 
ATOM   5666 C  CB  . THR A 1 704 ? 7.873   72.625 58.034 1.00 17.53 ? 745  THR A CB  1 
ATOM   5667 O  OG1 . THR A 1 704 ? 9.151   72.000 57.927 1.00 16.18 ? 745  THR A OG1 1 
ATOM   5668 C  CG2 . THR A 1 704 ? 7.228   72.736 56.589 1.00 15.37 ? 745  THR A CG2 1 
ATOM   5669 N  N   . LEU A 1 705 ? 9.952   74.409 60.051 1.00 16.15 ? 746  LEU A N   1 
ATOM   5670 C  CA  . LEU A 1 705 ? 10.802  74.350 61.262 1.00 17.63 ? 746  LEU A CA  1 
ATOM   5671 C  C   . LEU A 1 705 ? 10.713  75.691 62.009 1.00 18.92 ? 746  LEU A C   1 
ATOM   5672 O  O   . LEU A 1 705 ? 11.149  75.748 63.184 1.00 19.61 ? 746  LEU A O   1 
ATOM   5673 C  CB  . LEU A 1 705 ? 12.229  74.051 60.920 1.00 17.27 ? 746  LEU A CB  1 
ATOM   5674 C  CG  . LEU A 1 705 ? 12.353  72.635 60.302 1.00 19.29 ? 746  LEU A CG  1 
ATOM   5675 C  CD1 . LEU A 1 705 ? 13.834  72.579 60.020 1.00 17.91 ? 746  LEU A CD1 1 
ATOM   5676 C  CD2 . LEU A 1 705 ? 11.873  71.490 61.176 1.00 19.17 ? 746  LEU A CD2 1 
ATOM   5677 N  N   . SER A 1 706 ? 10.172  76.736 61.357 1.00 16.84 ? 747  SER A N   1 
ATOM   5678 C  CA  . SER A 1 706 ? 9.869   77.988 62.151 1.00 17.74 ? 747  SER A CA  1 
ATOM   5679 C  C   . SER A 1 706 ? 8.873   77.755 63.325 1.00 17.72 ? 747  SER A C   1 
ATOM   5680 O  O   . SER A 1 706 ? 8.047   76.807 63.390 1.00 17.91 ? 747  SER A O   1 
ATOM   5681 C  CB  . SER A 1 706 ? 9.269   79.027 61.205 1.00 16.78 ? 747  SER A CB  1 
ATOM   5682 O  OG  . SER A 1 706 ? 10.186  79.386 60.213 1.00 19.60 ? 747  SER A OG  1 
ATOM   5683 N  N   . GLU A 1 707 ? 8.830   78.695 64.311 1.00 18.84 ? 748  GLU A N   1 
ATOM   5684 C  CA  . GLU A 1 707 ? 7.779   78.591 65.298 1.00 21.33 ? 748  GLU A CA  1 
ATOM   5685 C  C   . GLU A 1 707 ? 6.410   78.607 64.617 1.00 20.20 ? 748  GLU A C   1 
ATOM   5686 O  O   . GLU A 1 707 ? 6.266   79.273 63.561 1.00 20.50 ? 748  GLU A O   1 
ATOM   5687 C  CB  . GLU A 1 707 ? 7.867   79.729 66.353 1.00 24.19 ? 748  GLU A CB  1 
ATOM   5688 C  CG  . GLU A 1 707 ? 9.257   79.788 66.940 1.00 29.63 ? 748  GLU A CG  1 
ATOM   5689 C  CD  . GLU A 1 707 ? 9.320   80.568 68.235 1.00 37.12 ? 748  GLU A CD  1 
ATOM   5690 O  OE1 . GLU A 1 707 ? 9.958   81.640 68.234 1.00 40.76 ? 748  GLU A OE1 1 
ATOM   5691 O  OE2 . GLU A 1 707 ? 8.726   80.098 69.224 1.00 41.52 ? 748  GLU A OE2 1 
ATOM   5692 N  N   . VAL A 1 708 ? 5.504   77.819 65.151 1.00 21.14 ? 749  VAL A N   1 
ATOM   5693 C  CA  . VAL A 1 708 ? 4.288   77.398 64.419 1.00 21.32 ? 749  VAL A CA  1 
ATOM   5694 C  C   . VAL A 1 708 ? 3.270   78.551 64.403 1.00 22.73 ? 749  VAL A C   1 
ATOM   5695 O  O   . VAL A 1 708 ? 2.397   78.614 63.544 1.00 24.38 ? 749  VAL A O   1 
ATOM   5696 C  CB  . VAL A 1 708 ? 3.684   76.072 64.905 1.00 21.40 ? 749  VAL A CB  1 
ATOM   5697 C  CG1 . VAL A 1 708 ? 4.773   74.948 64.871 1.00 23.11 ? 749  VAL A CG1 1 
ATOM   5698 C  CG2 . VAL A 1 708 ? 3.043   76.231 66.321 1.00 21.38 ? 749  VAL A CG2 1 
ATOM   5699 N  N   . ALA A 1 709 ? 3.425   79.470 65.372 1.00 22.66 ? 750  ALA A N   1 
ATOM   5700 C  CA  . ALA A 1 709 ? 2.479   80.609 65.530 1.00 25.19 ? 750  ALA A CA  1 
ATOM   5701 C  C   . ALA A 1 709 ? 3.029   81.593 66.570 1.00 28.00 ? 750  ALA A C   1 
ATOM   5702 O  O   . ALA A 1 709 ? 2.327   82.601 66.917 1.00 29.72 ? 750  ALA A O   1 
ATOM   5703 C  CB  . ALA A 1 709 ? 1.171   80.125 65.962 1.00 23.65 ? 750  ALA A CB  1 
ATOM   5704 O  OXT . ALA A 1 709 ? 4.128   81.362 67.101 1.00 28.65 ? 750  ALA A OXT 1 
HETATM 5705 C  C1  . NAG B 2 .   ? 11.577  26.119 58.066 1.00 31.94 ? 1755 NAG A C1  1 
HETATM 5706 C  C2  . NAG B 2 .   ? 11.423  24.653 57.671 1.00 35.46 ? 1755 NAG A C2  1 
HETATM 5707 C  C3  . NAG B 2 .   ? 9.979   24.184 57.884 1.00 35.80 ? 1755 NAG A C3  1 
HETATM 5708 C  C4  . NAG B 2 .   ? 9.413   24.549 59.240 1.00 35.53 ? 1755 NAG A C4  1 
HETATM 5709 C  C5  . NAG B 2 .   ? 9.766   25.997 59.544 1.00 36.00 ? 1755 NAG A C5  1 
HETATM 5710 C  C6  . NAG B 2 .   ? 9.287   26.431 60.943 1.00 35.89 ? 1755 NAG A C6  1 
HETATM 5711 C  C7  . NAG B 2 .   ? 12.992  23.882 56.000 1.00 40.75 ? 1755 NAG A C7  1 
HETATM 5712 C  C8  . NAG B 2 .   ? 13.393  23.842 54.563 1.00 41.53 ? 1755 NAG A C8  1 
HETATM 5713 N  N2  . NAG B 2 .   ? 11.813  24.464 56.282 1.00 37.60 ? 1755 NAG A N2  1 
HETATM 5714 O  O3  . NAG B 2 .   ? 9.928   22.784 57.832 1.00 38.30 ? 1755 NAG A O3  1 
HETATM 5715 O  O4  . NAG B 2 .   ? 8.011   24.415 59.102 1.00 38.57 ? 1755 NAG A O4  1 
HETATM 5716 O  O5  . NAG B 2 .   ? 11.159  26.215 59.403 1.00 31.99 ? 1755 NAG A O5  1 
HETATM 5717 O  O6  . NAG B 2 .   ? 10.052  25.806 61.958 1.00 42.69 ? 1755 NAG A O6  1 
HETATM 5718 O  O7  . NAG B 2 .   ? 13.752  23.420 56.862 1.00 44.00 ? 1755 NAG A O7  1 
HETATM 5719 C  C1  . NAG C 2 .   ? 7.459   23.588 60.143 1.00 42.94 ? 1756 NAG A C1  1 
HETATM 5720 C  C2  . NAG C 2 .   ? 5.966   23.940 60.216 1.00 44.38 ? 1756 NAG A C2  1 
HETATM 5721 C  C3  . NAG C 2 .   ? 5.119   22.912 60.974 1.00 47.57 ? 1756 NAG A C3  1 
HETATM 5722 C  C4  . NAG C 2 .   ? 5.511   21.466 60.648 1.00 48.05 ? 1756 NAG A C4  1 
HETATM 5723 C  C5  . NAG C 2 .   ? 7.039   21.301 60.758 1.00 49.12 ? 1756 NAG A C5  1 
HETATM 5724 C  C6  . NAG C 2 .   ? 7.475   19.878 60.396 1.00 49.08 ? 1756 NAG A C6  1 
HETATM 5725 C  C7  . NAG C 2 .   ? 5.451   26.364 60.285 1.00 42.99 ? 1756 NAG A C7  1 
HETATM 5726 C  C8  . NAG C 2 .   ? 5.126   26.287 58.839 1.00 40.51 ? 1756 NAG A C8  1 
HETATM 5727 N  N2  . NAG C 2 .   ? 5.813   25.224 60.890 1.00 42.70 ? 1756 NAG A N2  1 
HETATM 5728 O  O3  . NAG C 2 .   ? 3.775   23.188 60.641 1.00 48.73 ? 1756 NAG A O3  1 
HETATM 5729 O  O4  . NAG C 2 .   ? 4.846   20.548 61.518 1.00 52.28 ? 1756 NAG A O4  1 
HETATM 5730 O  O5  . NAG C 2 .   ? 7.709   22.215 59.891 1.00 44.96 ? 1756 NAG A O5  1 
HETATM 5731 O  O6  . NAG C 2 .   ? 7.204   19.632 59.028 1.00 51.18 ? 1756 NAG A O6  1 
HETATM 5732 O  O7  . NAG C 2 .   ? 5.389   27.455 60.887 1.00 45.00 ? 1756 NAG A O7  1 
HETATM 5733 C  C1  . NAG D 2 .   ? 4.104   28.060 25.445 1.00 45.21 ? 1757 NAG A C1  1 
HETATM 5734 C  C2  . NAG D 2 .   ? 2.753   28.708 25.192 1.00 48.37 ? 1757 NAG A C2  1 
HETATM 5735 C  C3  . NAG D 2 .   ? 1.734   27.786 24.525 1.00 51.62 ? 1757 NAG A C3  1 
HETATM 5736 C  C4  . NAG D 2 .   ? 2.286   27.032 23.308 1.00 54.22 ? 1757 NAG A C4  1 
HETATM 5737 C  C5  . NAG D 2 .   ? 3.826   27.055 23.167 1.00 54.94 ? 1757 NAG A C5  1 
HETATM 5738 C  C6  . NAG D 2 .   ? 4.293   28.003 22.034 1.00 56.11 ? 1757 NAG A C6  1 
HETATM 5739 C  C7  . NAG D 2 .   ? 1.931   30.402 26.732 1.00 49.17 ? 1757 NAG A C7  1 
HETATM 5740 C  C8  . NAG D 2 .   ? 1.874   31.374 25.588 1.00 49.72 ? 1757 NAG A C8  1 
HETATM 5741 N  N2  . NAG D 2 .   ? 2.250   29.132 26.478 1.00 47.87 ? 1757 NAG A N2  1 
HETATM 5742 O  O3  . NAG D 2 .   ? 0.670   28.599 24.087 1.00 52.61 ? 1757 NAG A O3  1 
HETATM 5743 O  O4  . NAG D 2 .   ? 1.805   25.686 23.271 1.00 56.19 ? 1757 NAG A O4  1 
HETATM 5744 O  O5  . NAG D 2 .   ? 4.588   27.267 24.376 1.00 48.43 ? 1757 NAG A O5  1 
HETATM 5745 O  O6  . NAG D 2 .   ? 3.266   28.824 21.497 1.00 56.81 ? 1757 NAG A O6  1 
HETATM 5746 O  O7  . NAG D 2 .   ? 1.677   30.790 27.867 1.00 51.56 ? 1757 NAG A O7  1 
HETATM 5747 C  C1  . NAG E 2 .   ? 20.036  25.278 17.915 1.00 37.44 ? 1758 NAG A C1  1 
HETATM 5748 C  C2  . NAG E 2 .   ? 20.648  24.053 17.198 1.00 39.99 ? 1758 NAG A C2  1 
HETATM 5749 C  C3  . NAG E 2 .   ? 19.829  23.693 15.959 1.00 42.27 ? 1758 NAG A C3  1 
HETATM 5750 C  C4  . NAG E 2 .   ? 18.322  23.595 16.259 1.00 42.08 ? 1758 NAG A C4  1 
HETATM 5751 C  C5  . NAG E 2 .   ? 17.866  24.801 17.125 1.00 39.60 ? 1758 NAG A C5  1 
HETATM 5752 C  C6  . NAG E 2 .   ? 16.409  24.732 17.586 1.00 37.36 ? 1758 NAG A C6  1 
HETATM 5753 C  C7  . NAG E 2 .   ? 23.046  23.726 17.370 1.00 41.31 ? 1758 NAG A C7  1 
HETATM 5754 C  C8  . NAG E 2 .   ? 24.400  24.197 16.941 1.00 41.88 ? 1758 NAG A C8  1 
HETATM 5755 N  N2  . NAG E 2 .   ? 22.009  24.318 16.793 1.00 39.91 ? 1758 NAG A N2  1 
HETATM 5756 O  O3  . NAG E 2 .   ? 20.308  22.452 15.446 1.00 42.41 ? 1758 NAG A O3  1 
HETATM 5757 O  O4  . NAG E 2 .   ? 17.607  23.587 15.037 1.00 46.80 ? 1758 NAG A O4  1 
HETATM 5758 O  O5  . NAG E 2 .   ? 18.712  24.895 18.248 1.00 38.49 ? 1758 NAG A O5  1 
HETATM 5759 O  O6  . NAG E 2 .   ? 16.147  23.537 18.283 1.00 36.92 ? 1758 NAG A O6  1 
HETATM 5760 O  O7  . NAG E 2 .   ? 22.950  22.838 18.224 1.00 44.34 ? 1758 NAG A O7  1 
HETATM 5761 C  C1  . NAG F 2 .   ? 16.608  22.535 14.966 1.00 52.25 ? 1767 NAG A C1  1 
HETATM 5762 C  C2  . NAG F 2 .   ? 15.597  22.947 13.891 1.00 53.83 ? 1767 NAG A C2  1 
HETATM 5763 C  C3  . NAG F 2 .   ? 14.602  21.826 13.558 1.00 56.41 ? 1767 NAG A C3  1 
HETATM 5764 C  C4  . NAG F 2 .   ? 15.373  20.545 13.240 1.00 57.54 ? 1767 NAG A C4  1 
HETATM 5765 C  C5  . NAG F 2 .   ? 16.209  20.209 14.485 1.00 57.80 ? 1767 NAG A C5  1 
HETATM 5766 C  C6  . NAG F 2 .   ? 16.916  18.862 14.392 1.00 58.27 ? 1767 NAG A C6  1 
HETATM 5767 C  C7  . NAG F 2 .   ? 15.301  25.416 13.934 1.00 52.59 ? 1767 NAG A C7  1 
HETATM 5768 C  C8  . NAG F 2 .   ? 16.419  25.587 12.963 1.00 50.72 ? 1767 NAG A C8  1 
HETATM 5769 N  N2  . NAG F 2 .   ? 14.895  24.176 14.257 1.00 53.12 ? 1767 NAG A N2  1 
HETATM 5770 O  O3  . NAG F 2 .   ? 13.786  22.196 12.466 1.00 57.84 ? 1767 NAG A O3  1 
HETATM 5771 O  O4  . NAG F 2 .   ? 14.497  19.502 12.843 1.00 59.70 ? 1767 NAG A O4  1 
HETATM 5772 O  O5  . NAG F 2 .   ? 17.168  21.248 14.696 1.00 55.09 ? 1767 NAG A O5  1 
HETATM 5773 O  O6  . NAG F 2 .   ? 17.976  18.982 13.470 1.00 60.97 ? 1767 NAG A O6  1 
HETATM 5774 O  O7  . NAG F 2 .   ? 14.792  26.432 14.414 1.00 54.28 ? 1767 NAG A O7  1 
HETATM 5775 C  C1  . NAG G 2 .   ? 20.272  55.245 11.455 1.00 58.53 ? 1759 NAG A C1  1 
HETATM 5776 C  C2  . NAG G 2 .   ? 19.849  56.629 10.970 1.00 62.90 ? 1759 NAG A C2  1 
HETATM 5777 C  C3  . NAG G 2 .   ? 18.331  56.598 10.875 1.00 63.59 ? 1759 NAG A C3  1 
HETATM 5778 C  C4  . NAG G 2 .   ? 17.962  55.623 9.752  1.00 63.40 ? 1759 NAG A C4  1 
HETATM 5779 C  C5  . NAG G 2 .   ? 18.592  54.237 9.946  1.00 62.44 ? 1759 NAG A C5  1 
HETATM 5780 C  C6  . NAG G 2 .   ? 18.674  53.524 8.595  1.00 62.82 ? 1759 NAG A C6  1 
HETATM 5781 C  C7  . NAG G 2 .   ? 21.515  58.335 11.546 1.00 66.78 ? 1759 NAG A C7  1 
HETATM 5782 C  C8  . NAG G 2 .   ? 21.738  59.655 12.236 1.00 66.21 ? 1759 NAG A C8  1 
HETATM 5783 N  N2  . NAG G 2 .   ? 20.356  57.709 11.806 1.00 64.51 ? 1759 NAG A N2  1 
HETATM 5784 O  O3  . NAG G 2 .   ? 17.825  57.892 10.635 1.00 64.53 ? 1759 NAG A O3  1 
HETATM 5785 O  O4  . NAG G 2 .   ? 16.564  55.482 9.657  1.00 65.36 ? 1759 NAG A O4  1 
HETATM 5786 O  O5  . NAG G 2 .   ? 19.918  54.261 10.486 1.00 60.79 ? 1759 NAG A O5  1 
HETATM 5787 O  O6  . NAG G 2 .   ? 17.441  52.930 8.250  1.00 62.88 ? 1759 NAG A O6  1 
HETATM 5788 O  O7  . NAG G 2 .   ? 22.386  57.874 10.789 1.00 67.73 ? 1759 NAG A O7  1 
HETATM 5789 C  C1  . NAG H 2 .   ? 35.781  37.415 53.234 1.00 43.60 ? 1760 NAG A C1  1 
HETATM 5790 C  C2  . NAG H 2 .   ? 35.947  37.510 51.716 1.00 43.63 ? 1760 NAG A C2  1 
HETATM 5791 C  C3  . NAG H 2 .   ? 37.202  36.757 51.275 1.00 48.70 ? 1760 NAG A C3  1 
HETATM 5792 C  C4  . NAG H 2 .   ? 38.430  37.308 51.994 1.00 52.69 ? 1760 NAG A C4  1 
HETATM 5793 C  C5  . NAG H 2 .   ? 38.227  37.493 53.512 1.00 52.64 ? 1760 NAG A C5  1 
HETATM 5794 C  C6  . NAG H 2 .   ? 39.273  38.476 54.059 1.00 55.41 ? 1760 NAG A C6  1 
HETATM 5795 C  C7  . NAG H 2 .   ? 34.172  37.695 50.102 1.00 32.42 ? 1760 NAG A C7  1 
HETATM 5796 C  C8  . NAG H 2 .   ? 33.055  37.017 49.391 1.00 31.55 ? 1760 NAG A C8  1 
HETATM 5797 N  N2  . NAG H 2 .   ? 34.737  37.011 51.090 1.00 37.25 ? 1760 NAG A N2  1 
HETATM 5798 O  O3  . NAG H 2 .   ? 37.411  36.944 49.897 1.00 50.70 ? 1760 NAG A O3  1 
HETATM 5799 O  O4  . NAG H 2 .   ? 39.586  36.518 51.702 1.00 56.10 ? 1760 NAG A O4  1 
HETATM 5800 O  O5  . NAG H 2 .   ? 36.924  37.953 53.898 1.00 49.36 ? 1760 NAG A O5  1 
HETATM 5801 O  O6  . NAG H 2 .   ? 39.886  39.283 53.053 1.00 56.46 ? 1760 NAG A O6  1 
HETATM 5802 O  O7  . NAG H 2 .   ? 34.534  38.821 49.762 1.00 28.33 ? 1760 NAG A O7  1 
HETATM 5803 C  C1  . NAG I 2 .   ? 24.422  61.924 68.924 1.00 26.59 ? 1761 NAG A C1  1 
HETATM 5804 C  C2  . NAG I 2 .   ? 23.002  62.482 69.167 1.00 25.54 ? 1761 NAG A C2  1 
HETATM 5805 C  C3  . NAG I 2 .   ? 23.132  63.930 69.623 1.00 27.99 ? 1761 NAG A C3  1 
HETATM 5806 C  C4  . NAG I 2 .   ? 24.123  64.050 70.802 1.00 27.42 ? 1761 NAG A C4  1 
HETATM 5807 C  C5  . NAG I 2 .   ? 25.447  63.359 70.452 1.00 28.02 ? 1761 NAG A C5  1 
HETATM 5808 C  C6  . NAG I 2 .   ? 26.469  63.355 71.596 1.00 30.31 ? 1761 NAG A C6  1 
HETATM 5809 C  C7  . NAG I 2 .   ? 20.970  61.877 67.948 1.00 29.71 ? 1761 NAG A C7  1 
HETATM 5810 C  C8  . NAG I 2 .   ? 20.444  61.333 69.215 1.00 32.60 ? 1761 NAG A C8  1 
HETATM 5811 N  N2  . NAG I 2 .   ? 22.152  62.422 67.977 1.00 27.07 ? 1761 NAG A N2  1 
HETATM 5812 O  O3  . NAG I 2 .   ? 21.858  64.421 69.983 1.00 29.02 ? 1761 NAG A O3  1 
HETATM 5813 O  O4  . NAG I 2 .   ? 24.405  65.411 70.964 1.00 28.22 ? 1761 NAG A O4  1 
HETATM 5814 O  O5  . NAG I 2 .   ? 25.044  62.018 70.211 1.00 26.38 ? 1761 NAG A O5  1 
HETATM 5815 O  O6  . NAG I 2 .   ? 25.793  62.793 72.688 1.00 33.45 ? 1761 NAG A O6  1 
HETATM 5816 O  O7  . NAG I 2 .   ? 20.243  61.861 66.892 1.00 39.02 ? 1761 NAG A O7  1 
HETATM 5817 C  C1  . NAG J 2 .   ? 24.202  65.847 72.344 1.00 29.83 ? 1762 NAG A C1  1 
HETATM 5818 C  C2  . NAG J 2 .   ? 24.837  67.227 72.399 1.00 34.26 ? 1762 NAG A C2  1 
HETATM 5819 C  C3  . NAG J 2 .   ? 24.619  67.859 73.769 1.00 36.91 ? 1762 NAG A C3  1 
HETATM 5820 C  C4  . NAG J 2 .   ? 23.140  67.775 74.163 1.00 36.77 ? 1762 NAG A C4  1 
HETATM 5821 C  C5  . NAG J 2 .   ? 22.597  66.341 74.047 1.00 36.54 ? 1762 NAG A C5  1 
HETATM 5822 C  C6  . NAG J 2 .   ? 21.091  66.301 74.261 1.00 37.38 ? 1762 NAG A C6  1 
HETATM 5823 C  C7  . NAG J 2 .   ? 26.777  67.532 70.927 1.00 38.35 ? 1762 NAG A C7  1 
HETATM 5824 C  C8  . NAG J 2 .   ? 25.896  68.098 69.857 1.00 36.47 ? 1762 NAG A C8  1 
HETATM 5825 N  N2  . NAG J 2 .   ? 26.244  67.112 72.078 1.00 35.98 ? 1762 NAG A N2  1 
HETATM 5826 O  O3  . NAG J 2 .   ? 25.044  69.213 73.695 1.00 37.71 ? 1762 NAG A O3  1 
HETATM 5827 O  O4  . NAG J 2 .   ? 22.974  68.279 75.482 1.00 39.87 ? 1762 NAG A O4  1 
HETATM 5828 O  O5  . NAG J 2 .   ? 22.846  65.897 72.722 1.00 31.47 ? 1762 NAG A O5  1 
HETATM 5829 O  O6  . NAG J 2 .   ? 20.523  67.288 73.403 1.00 41.62 ? 1762 NAG A O6  1 
HETATM 5830 O  O7  . NAG J 2 .   ? 27.990  67.436 70.692 1.00 45.28 ? 1762 NAG A O7  1 
HETATM 5831 C  C1  . NAG K 2 .   ? 15.200  84.127 52.920 1.00 21.67 ? 1763 NAG A C1  1 
HETATM 5832 C  C2  . NAG K 2 .   ? 14.170  84.213 51.761 1.00 22.23 ? 1763 NAG A C2  1 
HETATM 5833 C  C3  . NAG K 2 .   ? 13.972  85.707 51.414 1.00 24.67 ? 1763 NAG A C3  1 
HETATM 5834 C  C4  . NAG K 2 .   ? 13.593  86.508 52.694 1.00 25.75 ? 1763 NAG A C4  1 
HETATM 5835 C  C5  . NAG K 2 .   ? 14.512  86.195 53.876 1.00 26.85 ? 1763 NAG A C5  1 
HETATM 5836 C  C6  . NAG K 2 .   ? 13.867  86.781 55.143 1.00 28.05 ? 1763 NAG A C6  1 
HETATM 5837 C  C7  . NAG K 2 .   ? 13.735  82.696 49.869 1.00 20.90 ? 1763 NAG A C7  1 
HETATM 5838 C  C8  . NAG K 2 .   ? 14.339  81.969 48.684 1.00 20.37 ? 1763 NAG A C8  1 
HETATM 5839 N  N2  . NAG K 2 .   ? 14.603  83.425 50.614 1.00 20.17 ? 1763 NAG A N2  1 
HETATM 5840 O  O3  . NAG K 2 .   ? 12.995  85.821 50.375 1.00 25.32 ? 1763 NAG A O3  1 
HETATM 5841 O  O4  . NAG K 2 .   ? 13.728  87.917 52.517 1.00 29.44 ? 1763 NAG A O4  1 
HETATM 5842 O  O5  . NAG K 2 .   ? 14.617  84.782 54.046 1.00 23.49 ? 1763 NAG A O5  1 
HETATM 5843 O  O6  . NAG K 2 .   ? 14.879  86.915 56.128 1.00 39.04 ? 1763 NAG A O6  1 
HETATM 5844 O  O7  . NAG K 2 .   ? 12.529  82.652 50.198 1.00 21.49 ? 1763 NAG A O7  1 
HETATM 5845 C  C1  . NAG L 2 .   ? 12.632  88.483 51.781 1.00 32.72 ? 1764 NAG A C1  1 
HETATM 5846 C  C2  . NAG L 2 .   ? 12.143  89.792 52.405 1.00 35.26 ? 1764 NAG A C2  1 
HETATM 5847 C  C3  . NAG L 2 .   ? 11.194  90.527 51.435 1.00 36.20 ? 1764 NAG A C3  1 
HETATM 5848 C  C4  . NAG L 2 .   ? 11.783  90.610 50.030 1.00 35.60 ? 1764 NAG A C4  1 
HETATM 5849 C  C5  . NAG L 2 .   ? 12.028  89.152 49.628 1.00 36.75 ? 1764 NAG A C5  1 
HETATM 5850 C  C6  . NAG L 2 .   ? 12.394  88.980 48.163 1.00 41.38 ? 1764 NAG A C6  1 
HETATM 5851 C  C7  . NAG L 2 .   ? 11.897  89.816 54.902 1.00 38.08 ? 1764 NAG A C7  1 
HETATM 5852 C  C8  . NAG L 2 .   ? 13.269  90.375 55.134 1.00 35.02 ? 1764 NAG A C8  1 
HETATM 5853 N  N2  . NAG L 2 .   ? 11.454  89.508 53.660 1.00 36.36 ? 1764 NAG A N2  1 
HETATM 5854 O  O3  . NAG L 2 .   ? 10.858  91.810 51.946 1.00 38.65 ? 1764 NAG A O3  1 
HETATM 5855 O  O4  . NAG L 2 .   ? 10.843  91.104 49.085 1.00 35.30 ? 1764 NAG A O4  1 
HETATM 5856 O  O5  . NAG L 2 .   ? 13.063  88.674 50.465 1.00 33.01 ? 1764 NAG A O5  1 
HETATM 5857 O  O6  . NAG L 2 .   ? 13.703  89.464 48.004 1.00 46.79 ? 1764 NAG A O6  1 
HETATM 5858 O  O7  . NAG L 2 .   ? 11.197  89.661 55.905 1.00 42.40 ? 1764 NAG A O7  1 
HETATM 5859 C  C1  . BMA M 3 .   ? 10.781  92.529 49.019 1.00 35.44 ? 1765 BMA A C1  1 
HETATM 5860 C  C2  . BMA M 3 .   ? 10.495  92.998 47.588 1.00 36.70 ? 1765 BMA A C2  1 
HETATM 5861 C  C3  . BMA M 3 .   ? 10.243  94.501 47.560 1.00 39.28 ? 1765 BMA A C3  1 
HETATM 5862 C  C4  . BMA M 3 .   ? 9.200   94.882 48.599 1.00 40.45 ? 1765 BMA A C4  1 
HETATM 5863 C  C5  . BMA M 3 .   ? 9.534   94.271 49.954 1.00 38.81 ? 1765 BMA A C5  1 
HETATM 5864 C  C6  . BMA M 3 .   ? 8.438   94.563 50.968 1.00 38.05 ? 1765 BMA A C6  1 
HETATM 5865 O  O2  . BMA M 3 .   ? 9.349   92.306 47.095 1.00 35.96 ? 1765 BMA A O2  1 
HETATM 5866 O  O3  . BMA M 3 .   ? 9.578   94.903 46.408 1.00 41.69 ? 1765 BMA A O3  1 
HETATM 5867 O  O4  . BMA M 3 .   ? 9.078   96.286 48.671 1.00 42.95 ? 1765 BMA A O4  1 
HETATM 5868 O  O5  . BMA M 3 .   ? 9.670   92.865 49.790 1.00 34.05 ? 1765 BMA A O5  1 
HETATM 5869 O  O6  . BMA M 3 .   ? 8.788   93.967 52.209 1.00 39.12 ? 1765 BMA A O6  1 
HETATM 5870 C  C1  . MAN N 4 .   ? 10.347  95.201 45.240 1.00 44.80 ? 1766 MAN A C1  1 
HETATM 5871 C  C2  . MAN N 4 .   ? 9.587   95.977 44.186 1.00 45.17 ? 1766 MAN A C2  1 
HETATM 5872 C  C3  . MAN N 4 .   ? 9.867   95.086 42.989 1.00 44.94 ? 1766 MAN A C3  1 
HETATM 5873 C  C4  . MAN N 4 .   ? 11.368  94.792 42.850 1.00 45.90 ? 1766 MAN A C4  1 
HETATM 5874 C  C5  . MAN N 4 .   ? 12.047  94.463 44.197 1.00 45.66 ? 1766 MAN A C5  1 
HETATM 5875 C  C6  . MAN N 4 .   ? 13.540  94.138 44.105 1.00 49.13 ? 1766 MAN A C6  1 
HETATM 5876 O  O2  . MAN N 4 .   ? 10.133  97.278 44.017 1.00 46.45 ? 1766 MAN A O2  1 
HETATM 5877 O  O3  . MAN N 4 .   ? 9.345   95.623 41.799 1.00 48.80 ? 1766 MAN A O3  1 
HETATM 5878 O  O4  . MAN N 4 .   ? 11.506  93.688 41.981 1.00 45.07 ? 1766 MAN A O4  1 
HETATM 5879 O  O5  . MAN N 4 .   ? 11.742  95.427 45.205 1.00 43.17 ? 1766 MAN A O5  1 
HETATM 5880 O  O6  . MAN N 4 .   ? 14.178  95.140 43.342 1.00 51.57 ? 1766 MAN A O6  1 
HETATM 5881 ZN ZN  . ZN  O 5 .   ? 17.400  40.934 43.567 1.00 20.43 ? 1751 ZN  A ZN  1 
HETATM 5882 ZN ZN  . ZN  P 5 .   ? 16.803  41.922 46.619 1.00 18.26 ? 1752 ZN  A ZN  1 
HETATM 5883 CA CA  . CA  Q 6 .   ? -0.802  50.064 41.634 1.00 15.32 ? 1753 CA  A CA  1 
HETATM 5884 CL CL  . CL  R 7 .   ? 18.929  47.149 51.858 1.00 21.45 ? 1754 CL  A CL  1 
HETATM 5885 C  C01 . QUS S 8 .   ? 16.924  44.679 40.872 1.00 21.24 ? 1801 QUS A C01 1 
HETATM 5886 C  C02 . QUS S 8 .   ? 15.925  44.806 41.934 1.00 18.97 ? 1801 QUS A C02 1 
HETATM 5887 C  C03 . QUS S 8 .   ? 14.498  44.988 41.502 1.00 17.77 ? 1801 QUS A C03 1 
HETATM 5888 C  C04 . QUS S 8 .   ? 13.609  46.756 39.983 1.00 28.71 ? 1801 QUS A C04 1 
HETATM 5889 C  C05 . QUS S 8 .   ? 14.196  48.470 41.151 1.00 29.35 ? 1801 QUS A C05 1 
HETATM 5890 N  NP3 . QUS S 8 .   ? 16.330  45.253 43.215 1.00 17.83 ? 1801 QUS A NP3 1 
HETATM 5891 N  N14 . QUS S 8 .   ? 14.658  46.275 40.788 1.00 21.97 ? 1801 QUS A N14 1 
HETATM 5892 N  N15 . QUS S 8 .   ? 13.437  48.085 40.135 1.00 28.01 ? 1801 QUS A N15 1 
HETATM 5893 O  O16 . QUS S 8 .   ? 17.778  45.566 40.991 1.00 18.48 ? 1801 QUS A O16 1 
HETATM 5894 O  O17 . QUS S 8 .   ? 16.888  43.886 39.872 1.00 17.82 ? 1801 QUS A O17 1 
HETATM 5895 O  O18 . QUS S 8 .   ? 13.032  45.957 39.275 1.00 29.87 ? 1801 QUS A O18 1 
HETATM 5896 O  O19 . QUS S 8 .   ? 14.323  49.550 41.682 1.00 30.35 ? 1801 QUS A O19 1 
HETATM 5897 O  O20 . QUS S 8 .   ? 15.039  47.380 41.626 1.00 27.16 ? 1801 QUS A O20 1 
HETATM 5898 O  O   . HOH T 9 .   ? 6.890   58.503 37.614 1.00 19.43 ? 1802 HOH A O   1 
HETATM 5899 O  O   . HOH T 9 .   ? 7.976   69.772 59.399 1.00 15.97 ? 1803 HOH A O   1 
HETATM 5900 O  O   . HOH T 9 .   ? 13.593  44.788 50.062 1.00 15.99 ? 1804 HOH A O   1 
HETATM 5901 O  O   . HOH T 9 .   ? 9.166   50.859 46.692 1.00 16.57 ? 1805 HOH A O   1 
HETATM 5902 O  O   . HOH T 9 .   ? 1.003   50.645 40.049 1.00 15.25 ? 1806 HOH A O   1 
HETATM 5903 O  O   . HOH T 9 .   ? 12.016  61.982 43.890 1.00 17.05 ? 1807 HOH A O   1 
HETATM 5904 O  O   . HOH T 9 .   ? 13.487  29.927 40.351 1.00 19.88 ? 1808 HOH A O   1 
HETATM 5905 O  O   . HOH T 9 .   ? 15.127  41.948 39.029 1.00 16.25 ? 1809 HOH A O   1 
HETATM 5906 O  O   . HOH T 9 .   ? 9.655   61.050 57.893 1.00 16.56 ? 1810 HOH A O   1 
HETATM 5907 O  O   . HOH T 9 .   ? 10.818  36.845 42.536 1.00 17.08 ? 1811 HOH A O   1 
HETATM 5908 O  O   . HOH T 9 .   ? -5.382  59.890 60.022 1.00 15.99 ? 1812 HOH A O   1 
HETATM 5909 O  O   . HOH T 9 .   ? 13.577  27.112 51.853 1.00 23.05 ? 1813 HOH A O   1 
HETATM 5910 O  O   . HOH T 9 .   ? 7.480   71.962 45.458 1.00 18.74 ? 1814 HOH A O   1 
HETATM 5911 O  O   . HOH T 9 .   ? 5.830   69.124 55.668 1.00 18.06 ? 1815 HOH A O   1 
HETATM 5912 O  O   . HOH T 9 .   ? 16.801  37.072 44.239 1.00 18.58 ? 1816 HOH A O   1 
HETATM 5913 O  O   . HOH T 9 .   ? -3.631  62.403 54.215 1.00 17.47 ? 1817 HOH A O   1 
HETATM 5914 O  O   . HOH T 9 .   ? 29.378  36.128 44.613 1.00 22.94 ? 1818 HOH A O   1 
HETATM 5915 O  O   . HOH T 9 .   ? 6.402   76.152 61.263 1.00 18.00 ? 1819 HOH A O   1 
HETATM 5916 O  O   . HOH T 9 .   ? -3.499  60.216 62.052 1.00 17.32 ? 1820 HOH A O   1 
HETATM 5917 O  O   . HOH T 9 .   ? 19.343  47.964 54.962 1.00 21.49 ? 1821 HOH A O   1 
HETATM 5918 O  O   . HOH T 9 .   ? 3.980   70.632 64.621 1.00 20.39 ? 1822 HOH A O   1 
HETATM 5919 O  O   . HOH T 9 .   ? 19.023  62.331 36.747 1.00 19.79 ? 1823 HOH A O   1 
HETATM 5920 O  O   . HOH T 9 .   ? -7.031  51.704 51.688 1.00 20.41 ? 1824 HOH A O   1 
HETATM 5921 O  O   . HOH T 9 .   ? 17.846  40.744 32.495 1.00 18.86 ? 1825 HOH A O   1 
HETATM 5922 O  O   . HOH T 9 .   ? 20.049  61.572 63.092 1.00 19.79 ? 1826 HOH A O   1 
HETATM 5923 O  O   . HOH T 9 .   ? -4.436  59.627 57.475 1.00 17.65 ? 1827 HOH A O   1 
HETATM 5924 O  O   . HOH T 9 .   ? 3.553   72.198 43.734 1.00 17.43 ? 1828 HOH A O   1 
HETATM 5925 O  O   . HOH T 9 .   ? 30.069  42.796 32.850 1.00 23.41 ? 1829 HOH A O   1 
HETATM 5926 O  O   . HOH T 9 .   ? 23.907  46.164 35.150 1.00 19.64 ? 1830 HOH A O   1 
HETATM 5927 O  O   . HOH T 9 .   ? 14.798  36.927 28.241 1.00 18.58 ? 1831 HOH A O   1 
HETATM 5928 O  O   . HOH T 9 .   ? 18.448  33.602 43.717 1.00 18.66 ? 1832 HOH A O   1 
HETATM 5929 O  O   . HOH T 9 .   ? 28.916  33.969 33.170 1.00 23.13 ? 1833 HOH A O   1 
HETATM 5930 O  O   . HOH T 9 .   ? 5.996   75.606 54.349 1.00 18.79 ? 1834 HOH A O   1 
HETATM 5931 O  O   . HOH T 9 .   ? 3.683   62.495 50.676 1.00 18.14 ? 1835 HOH A O   1 
HETATM 5932 O  O   . HOH T 9 .   ? 14.532  32.167 48.451 1.00 20.02 ? 1836 HOH A O   1 
HETATM 5933 O  O   . HOH T 9 .   ? 4.511   35.123 45.618 1.00 20.58 ? 1837 HOH A O   1 
HETATM 5934 O  O   . HOH T 9 .   ? 0.238   57.115 45.891 1.00 21.10 ? 1838 HOH A O   1 
HETATM 5935 O  O   . HOH T 9 .   ? -0.410  43.619 61.025 1.00 26.78 ? 1839 HOH A O   1 
HETATM 5936 O  O   . HOH T 9 .   ? 14.469  38.202 35.097 1.00 20.40 ? 1840 HOH A O   1 
HETATM 5937 O  O   . HOH T 9 .   ? 22.418  88.040 32.628 1.00 23.91 ? 1841 HOH A O   1 
HETATM 5938 O  O   . HOH T 9 .   ? 23.376  67.878 34.565 1.00 22.46 ? 1842 HOH A O   1 
HETATM 5939 O  O   . HOH T 9 .   ? 23.189  68.962 43.340 1.00 21.53 ? 1843 HOH A O   1 
HETATM 5940 O  O   . HOH T 9 .   ? 20.519  45.848 36.935 1.00 19.36 ? 1844 HOH A O   1 
HETATM 5941 O  O   . HOH T 9 .   ? 24.524  37.299 32.943 1.00 21.36 ? 1845 HOH A O   1 
HETATM 5942 O  O   . HOH T 9 .   ? 16.292  55.837 35.819 1.00 19.98 ? 1846 HOH A O   1 
HETATM 5943 O  O   . HOH T 9 .   ? 25.703  37.143 38.445 1.00 21.11 ? 1847 HOH A O   1 
HETATM 5944 O  O   . HOH T 9 .   ? 9.392   29.257 43.258 1.00 20.16 ? 1848 HOH A O   1 
HETATM 5945 O  O   . HOH T 9 .   ? 27.563  31.222 28.955 1.00 25.94 ? 1849 HOH A O   1 
HETATM 5946 O  O   . HOH T 9 .   ? 20.665  27.500 49.009 1.00 23.67 ? 1850 HOH A O   1 
HETATM 5947 O  O   . HOH T 9 .   ? 10.077  31.100 26.807 1.00 25.93 ? 1851 HOH A O   1 
HETATM 5948 O  O   . HOH T 9 .   ? 29.088  60.717 57.379 1.00 26.42 ? 1852 HOH A O   1 
HETATM 5949 O  O   . HOH T 9 .   ? 17.062  62.238 38.713 1.00 20.01 ? 1853 HOH A O   1 
HETATM 5950 O  O   . HOH T 9 .   ? 19.354  36.159 43.519 1.00 19.48 ? 1854 HOH A O   1 
HETATM 5951 O  O   . HOH T 9 .   ? 20.114  31.366 43.838 1.00 24.32 ? 1855 HOH A O   1 
HETATM 5952 O  O   . HOH T 9 .   ? 8.003   50.428 40.927 1.00 24.10 ? 1856 HOH A O   1 
HETATM 5953 O  O   . HOH T 9 .   ? -2.665  44.355 37.991 1.00 20.44 ? 1857 HOH A O   1 
HETATM 5954 O  O   . HOH T 9 .   ? 6.570   60.965 67.355 1.00 22.10 ? 1858 HOH A O   1 
HETATM 5955 O  O   . HOH T 9 .   ? 5.213   64.947 37.250 1.00 22.49 ? 1859 HOH A O   1 
HETATM 5956 O  O   . HOH T 9 .   ? 14.839  80.950 38.380 1.00 23.59 ? 1860 HOH A O   1 
HETATM 5957 O  O   . HOH T 9 .   ? 6.859   55.484 43.820 1.00 26.16 ? 1861 HOH A O   1 
HETATM 5958 O  O   . HOH T 9 .   ? 13.881  40.913 53.727 1.00 20.27 ? 1862 HOH A O   1 
HETATM 5959 O  O   . HOH T 9 .   ? 11.021  27.584 54.560 1.00 22.34 ? 1863 HOH A O   1 
HETATM 5960 O  O   . HOH T 9 .   ? 22.922  44.479 37.167 1.00 19.11 ? 1864 HOH A O   1 
HETATM 5961 O  O   . HOH T 9 .   ? 13.981  68.185 34.951 1.00 19.31 ? 1865 HOH A O   1 
HETATM 5962 O  O   . HOH T 9 .   ? 4.348   67.179 51.722 1.00 17.97 ? 1866 HOH A O   1 
HETATM 5963 O  O   . HOH T 9 .   ? 3.992   68.798 49.415 1.00 18.54 ? 1867 HOH A O   1 
HETATM 5964 O  O   . HOH T 9 .   ? -4.596  55.365 52.018 1.00 20.05 ? 1868 HOH A O   1 
HETATM 5965 O  O   . HOH T 9 .   ? 1.329   59.459 46.588 1.00 24.72 ? 1869 HOH A O   1 
HETATM 5966 O  O   . HOH T 9 .   ? 2.570   33.213 45.556 1.00 22.35 ? 1870 HOH A O   1 
HETATM 5967 O  O   . HOH T 9 .   ? -3.841  57.830 46.546 1.00 24.09 ? 1871 HOH A O   1 
HETATM 5968 O  O   . HOH T 9 .   ? 11.107  63.530 58.505 1.00 22.73 ? 1872 HOH A O   1 
HETATM 5969 O  O   . HOH T 9 .   ? 28.570  53.919 53.163 1.00 23.34 ? 1873 HOH A O   1 
HETATM 5970 O  O   . HOH T 9 .   ? 13.785  71.572 40.797 1.00 19.97 ? 1874 HOH A O   1 
HETATM 5971 O  O   . HOH T 9 .   ? 18.910  27.709 35.346 1.00 23.83 ? 1875 HOH A O   1 
HETATM 5972 O  O   . HOH T 9 .   ? 13.391  77.959 63.822 1.00 25.20 ? 1876 HOH A O   1 
HETATM 5973 O  O   . HOH T 9 .   ? 34.345  41.671 50.402 1.00 29.44 ? 1877 HOH A O   1 
HETATM 5974 O  O   . HOH T 9 .   ? 26.461  39.093 36.708 1.00 23.04 ? 1878 HOH A O   1 
HETATM 5975 O  O   . HOH T 9 .   ? -2.479  59.481 48.783 1.00 24.01 ? 1879 HOH A O   1 
HETATM 5976 O  O   . HOH T 9 .   ? 8.786   74.834 66.931 1.00 24.05 ? 1880 HOH A O   1 
HETATM 5977 O  O   . HOH T 9 .   ? 24.345  31.790 28.880 1.00 25.82 ? 1881 HOH A O   1 
HETATM 5978 O  O   . HOH T 9 .   ? 5.625   62.837 65.212 1.00 26.92 ? 1882 HOH A O   1 
HETATM 5979 O  O   . HOH T 9 .   ? 14.328  32.011 29.696 1.00 23.33 ? 1883 HOH A O   1 
HETATM 5980 O  O   . HOH T 9 .   ? 12.014  35.126 53.971 1.00 21.15 ? 1884 HOH A O   1 
HETATM 5981 O  O   . HOH T 9 .   ? 10.561  37.413 54.672 1.00 28.53 ? 1885 HOH A O   1 
HETATM 5982 O  O   . HOH T 9 .   ? 21.220  63.670 61.221 1.00 21.95 ? 1886 HOH A O   1 
HETATM 5983 O  O   . HOH T 9 .   ? 3.431   27.804 41.623 1.00 27.63 ? 1887 HOH A O   1 
HETATM 5984 O  O   . HOH T 9 .   ? 19.727  54.038 45.436 1.00 20.69 ? 1888 HOH A O   1 
HETATM 5985 O  O   . HOH T 9 .   ? 19.320  60.375 50.215 1.00 26.34 ? 1889 HOH A O   1 
HETATM 5986 O  O   . HOH T 9 .   ? 20.286  53.215 48.059 1.00 25.00 ? 1890 HOH A O   1 
HETATM 5987 O  O   . HOH T 9 .   ? 31.035  40.025 46.876 1.00 27.45 ? 1891 HOH A O   1 
HETATM 5988 O  O   . HOH T 9 .   ? 5.386   78.201 54.747 1.00 23.14 ? 1892 HOH A O   1 
HETATM 5989 O  O   . HOH T 9 .   ? 32.134  35.081 59.570 1.00 25.25 ? 1893 HOH A O   1 
HETATM 5990 O  O   . HOH T 9 .   ? 21.873  61.785 37.100 1.00 21.82 ? 1894 HOH A O   1 
HETATM 5991 O  O   . HOH T 9 .   ? 16.412  72.221 29.995 1.00 25.22 ? 1895 HOH A O   1 
HETATM 5992 O  O   . HOH T 9 .   ? 14.813  59.202 74.838 1.00 29.89 ? 1896 HOH A O   1 
HETATM 5993 O  O   . HOH T 9 .   ? 29.522  70.581 46.430 1.00 25.44 ? 1897 HOH A O   1 
HETATM 5994 O  O   . HOH T 9 .   ? -2.213  55.688 46.382 1.00 23.96 ? 1898 HOH A O   1 
HETATM 5995 O  O   . HOH T 9 .   ? 23.965  40.737 69.671 1.00 30.12 ? 1899 HOH A O   1 
HETATM 5996 O  O   . HOH T 9 .   ? 5.702   62.960 70.751 1.00 24.62 ? 1900 HOH A O   1 
HETATM 5997 O  O   . HOH T 9 .   ? 16.828  68.405 64.511 1.00 22.38 ? 1901 HOH A O   1 
HETATM 5998 O  O   . HOH T 9 .   ? 25.100  32.973 68.131 1.00 33.25 ? 1902 HOH A O   1 
HETATM 5999 O  O   . HOH T 9 .   ? -6.263  58.838 38.220 1.00 26.79 ? 1903 HOH A O   1 
HETATM 6000 O  O   . HOH T 9 .   ? 15.004  61.885 73.407 1.00 25.05 ? 1904 HOH A O   1 
HETATM 6001 O  O   . HOH T 9 .   ? 0.146   31.616 58.484 1.00 30.76 ? 1905 HOH A O   1 
HETATM 6002 O  O   . HOH T 9 .   ? 18.541  55.478 30.973 1.00 26.05 ? 1906 HOH A O   1 
HETATM 6003 O  O   . HOH T 9 .   ? 9.044   69.213 41.160 1.00 23.96 ? 1907 HOH A O   1 
HETATM 6004 O  O   . HOH T 9 .   ? 12.121  37.175 28.911 1.00 19.90 ? 1908 HOH A O   1 
HETATM 6005 O  O   . HOH T 9 .   ? 0.449   33.533 43.577 1.00 22.50 ? 1909 HOH A O   1 
HETATM 6006 O  O   . HOH T 9 .   ? 1.231   63.425 43.129 1.00 26.43 ? 1910 HOH A O   1 
HETATM 6007 O  O   . HOH T 9 .   ? 33.894  48.005 59.074 1.00 28.04 ? 1911 HOH A O   1 
HETATM 6008 O  O   . HOH T 9 .   ? 17.276  81.915 37.595 1.00 26.08 ? 1912 HOH A O   1 
HETATM 6009 O  O   . HOH T 9 .   ? 15.279  69.271 41.913 1.00 22.72 ? 1913 HOH A O   1 
HETATM 6010 O  O   . HOH T 9 .   ? 16.402  26.253 34.953 1.00 24.42 ? 1914 HOH A O   1 
HETATM 6011 O  O   . HOH T 9 .   ? 23.260  55.363 31.654 1.00 26.77 ? 1915 HOH A O   1 
HETATM 6012 O  O   . HOH T 9 .   ? 17.731  82.750 41.489 1.00 27.82 ? 1916 HOH A O   1 
HETATM 6013 O  O   . HOH T 9 .   ? 24.113  75.316 54.764 1.00 24.35 ? 1917 HOH A O   1 
HETATM 6014 O  O   . HOH T 9 .   ? 23.176  67.738 40.872 1.00 25.80 ? 1918 HOH A O   1 
HETATM 6015 O  O   . HOH T 9 .   ? 8.003   51.849 43.081 1.00 26.56 ? 1919 HOH A O   1 
HETATM 6016 O  O   . HOH T 9 .   ? 29.926  27.101 33.869 1.00 27.67 ? 1920 HOH A O   1 
HETATM 6017 O  O   . HOH T 9 .   ? 6.309   38.904 26.681 1.00 30.42 ? 1921 HOH A O   1 
HETATM 6018 O  O   . HOH T 9 .   ? 18.923  69.213 66.020 1.00 27.47 ? 1922 HOH A O   1 
HETATM 6019 O  O   . HOH T 9 .   ? 25.730  59.152 46.605 1.00 27.23 ? 1923 HOH A O   1 
HETATM 6020 O  O   . HOH T 9 .   ? 21.874  74.724 60.762 1.00 26.01 ? 1924 HOH A O   1 
HETATM 6021 O  O   . HOH T 9 .   ? -2.264  34.137 40.738 1.00 26.80 ? 1925 HOH A O   1 
HETATM 6022 O  O   . HOH T 9 .   ? 13.444  83.002 55.942 1.00 26.92 ? 1926 HOH A O   1 
HETATM 6023 O  O   . HOH T 9 .   ? 25.645  35.648 68.479 1.00 28.73 ? 1927 HOH A O   1 
HETATM 6024 O  O   . HOH T 9 .   ? 23.805  73.342 59.592 1.00 28.99 ? 1928 HOH A O   1 
HETATM 6025 O  O   . HOH T 9 .   ? -1.239  61.792 62.519 1.00 24.23 ? 1929 HOH A O   1 
HETATM 6026 O  O   . HOH T 9 .   ? 9.924   36.114 70.302 1.00 30.48 ? 1930 HOH A O   1 
HETATM 6027 O  O   . HOH T 9 .   ? 14.066  57.663 35.414 1.00 23.78 ? 1931 HOH A O   1 
HETATM 6028 O  O   . HOH T 9 .   ? 13.586  29.616 28.766 1.00 24.06 ? 1932 HOH A O   1 
HETATM 6029 O  O   . HOH T 9 .   ? 36.826  42.595 65.299 1.00 29.71 ? 1933 HOH A O   1 
HETATM 6030 O  O   . HOH T 9 .   ? 10.793  29.137 40.627 1.00 26.86 ? 1934 HOH A O   1 
HETATM 6031 O  O   . HOH T 9 .   ? 11.699  41.048 55.623 1.00 21.18 ? 1935 HOH A O   1 
HETATM 6032 O  O   . HOH T 9 .   ? 19.348  63.741 32.533 1.00 29.00 ? 1936 HOH A O   1 
HETATM 6033 O  O   . HOH T 9 .   ? 12.601  53.151 36.228 1.00 29.85 ? 1937 HOH A O   1 
HETATM 6034 O  O   . HOH T 9 .   ? 23.322  56.630 45.452 1.00 30.73 ? 1938 HOH A O   1 
HETATM 6035 O  O   . HOH T 9 .   ? 21.865  61.383 51.712 1.00 28.48 ? 1939 HOH A O   1 
HETATM 6036 O  O   . HOH T 9 .   ? 25.742  27.331 24.535 1.00 34.09 ? 1940 HOH A O   1 
HETATM 6037 O  O   . HOH T 9 .   ? 25.573  56.176 37.861 1.00 28.30 ? 1941 HOH A O   1 
HETATM 6038 O  O   . HOH T 9 .   ? 20.293  31.681 26.509 1.00 25.62 ? 1942 HOH A O   1 
HETATM 6039 O  O   . HOH T 9 .   ? 30.853  52.412 52.919 1.00 31.52 ? 1943 HOH A O   1 
HETATM 6040 O  O   . HOH T 9 .   ? 6.524   76.454 67.599 1.00 28.74 ? 1944 HOH A O   1 
HETATM 6041 O  O   . HOH T 9 .   ? 10.613  55.579 75.457 1.00 30.60 ? 1945 HOH A O   1 
HETATM 6042 O  O   . HOH T 9 .   ? 21.352  32.584 28.957 1.00 25.59 ? 1946 HOH A O   1 
HETATM 6043 O  O   . HOH T 9 .   ? 25.433  70.683 31.519 1.00 25.07 ? 1947 HOH A O   1 
HETATM 6044 O  O   . HOH T 9 .   ? 19.148  69.741 28.756 1.00 30.37 ? 1948 HOH A O   1 
HETATM 6045 O  O   . HOH T 9 .   ? 23.601  79.265 50.940 1.00 28.05 ? 1949 HOH A O   1 
HETATM 6046 O  O   . HOH T 9 .   ? -9.940  46.106 34.599 1.00 41.21 ? 1950 HOH A O   1 
HETATM 6047 O  O   . HOH T 9 .   ? 29.086  40.345 65.130 1.00 31.03 ? 1951 HOH A O   1 
HETATM 6048 O  O   . HOH T 9 .   ? 11.560  27.919 29.512 1.00 33.84 ? 1952 HOH A O   1 
HETATM 6049 O  O   . HOH T 9 .   ? 25.269  63.591 50.288 1.00 27.03 ? 1953 HOH A O   1 
HETATM 6050 O  O   . HOH T 9 .   ? 16.166  29.149 28.348 1.00 26.86 ? 1954 HOH A O   1 
HETATM 6051 O  O   . HOH T 9 .   ? 13.899  79.947 68.264 1.00 31.65 ? 1955 HOH A O   1 
HETATM 6052 O  O   . HOH T 9 .   ? 4.988   31.695 30.571 1.00 35.63 ? 1956 HOH A O   1 
HETATM 6053 O  O   . HOH T 9 .   ? 14.472  81.624 41.039 1.00 32.90 ? 1957 HOH A O   1 
HETATM 6054 O  O   . HOH T 9 .   ? 10.313  81.276 63.922 1.00 28.51 ? 1958 HOH A O   1 
HETATM 6055 O  O   . HOH T 9 .   ? 4.269   63.621 72.999 1.00 24.07 ? 1959 HOH A O   1 
HETATM 6056 O  O   . HOH T 9 .   ? -10.485 48.785 48.918 1.00 29.20 ? 1960 HOH A O   1 
HETATM 6057 O  O   . HOH T 9 .   ? 21.725  84.260 47.372 1.00 31.38 ? 1961 HOH A O   1 
HETATM 6058 O  O   . HOH T 9 .   ? 27.432  54.229 50.684 1.00 32.54 ? 1962 HOH A O   1 
HETATM 6059 O  O   . HOH T 9 .   ? 20.937  50.478 76.390 1.00 34.29 ? 1963 HOH A O   1 
HETATM 6060 O  O   . HOH T 9 .   ? 7.662   38.830 29.493 1.00 27.63 ? 1964 HOH A O   1 
HETATM 6061 O  O   . HOH T 9 .   ? 38.347  34.517 26.904 1.00 38.18 ? 1965 HOH A O   1 
HETATM 6062 O  O   . HOH T 9 .   ? 4.608   62.207 75.427 1.00 26.44 ? 1966 HOH A O   1 
HETATM 6063 O  O   . HOH T 9 .   ? -1.640  32.396 45.035 1.00 32.78 ? 1967 HOH A O   1 
HETATM 6064 O  O   . HOH T 9 .   ? -12.943 47.542 37.902 1.00 31.97 ? 1968 HOH A O   1 
HETATM 6065 O  O   . HOH T 9 .   ? 29.536  50.502 39.575 1.00 39.22 ? 1969 HOH A O   1 
HETATM 6066 O  O   . HOH T 9 .   ? 19.789  50.165 45.130 1.00 27.54 ? 1970 HOH A O   1 
HETATM 6067 O  O   . HOH T 9 .   ? -10.097 43.925 47.186 1.00 29.24 ? 1971 HOH A O   1 
HETATM 6068 O  O   . HOH T 9 .   ? 29.944  25.193 47.564 1.00 29.14 ? 1972 HOH A O   1 
HETATM 6069 O  O   . HOH T 9 .   ? 29.437  54.402 35.217 1.00 29.29 ? 1973 HOH A O   1 
HETATM 6070 O  O   . HOH T 9 .   ? 11.924  48.474 37.564 1.00 33.80 ? 1974 HOH A O   1 
HETATM 6071 O  O   . HOH T 9 .   ? 0.671   72.134 43.552 1.00 19.53 ? 1975 HOH A O   1 
HETATM 6072 O  O   . HOH T 9 .   ? 22.882  58.586 24.602 1.00 31.42 ? 1976 HOH A O   1 
HETATM 6073 O  O   . HOH T 9 .   ? -3.079  38.843 63.185 1.00 31.32 ? 1977 HOH A O   1 
HETATM 6074 O  O   . HOH T 9 .   ? 11.613  38.550 57.010 1.00 28.53 ? 1978 HOH A O   1 
HETATM 6075 O  O   . HOH T 9 .   ? 25.769  67.120 30.476 1.00 27.77 ? 1979 HOH A O   1 
HETATM 6076 O  O   . HOH T 9 .   ? 16.817  69.197 21.068 1.00 48.55 ? 1980 HOH A O   1 
HETATM 6077 O  O   . HOH T 9 .   ? 12.180  63.923 35.794 1.00 29.78 ? 1981 HOH A O   1 
HETATM 6078 O  O   . HOH T 9 .   ? 25.144  65.986 40.468 1.00 34.57 ? 1982 HOH A O   1 
HETATM 6079 O  O   . HOH T 9 .   ? 31.902  55.381 26.803 1.00 35.32 ? 1983 HOH A O   1 
HETATM 6080 O  O   . HOH T 9 .   ? 18.115  31.198 29.374 1.00 26.78 ? 1984 HOH A O   1 
HETATM 6081 O  O   . HOH T 9 .   ? 28.953  26.070 36.336 1.00 30.21 ? 1985 HOH A O   1 
HETATM 6082 O  O   . HOH T 9 .   ? 16.786  79.766 21.417 1.00 41.04 ? 1986 HOH A O   1 
HETATM 6083 O  O   . HOH T 9 .   ? 19.855  25.697 37.139 1.00 28.15 ? 1987 HOH A O   1 
HETATM 6084 O  O   . HOH T 9 .   ? 28.114  45.286 69.192 1.00 30.94 ? 1988 HOH A O   1 
HETATM 6085 O  O   . HOH T 9 .   ? 17.840  52.478 75.308 1.00 35.22 ? 1989 HOH A O   1 
HETATM 6086 O  O   . HOH T 9 .   ? 13.473  93.878 40.568 1.00 37.50 ? 1990 HOH A O   1 
HETATM 6087 O  O   . HOH T 9 .   ? 0.402   33.625 36.752 1.00 41.83 ? 1991 HOH A O   1 
HETATM 6088 O  O   . HOH T 9 .   ? 30.856  48.603 47.601 1.00 51.45 ? 1992 HOH A O   1 
HETATM 6089 O  O   . HOH T 9 .   ? 25.558  25.644 20.237 1.00 36.12 ? 1993 HOH A O   1 
HETATM 6090 O  O   . HOH T 9 .   ? 35.034  51.102 31.515 1.00 41.55 ? 1994 HOH A O   1 
HETATM 6091 O  O   . HOH T 9 .   ? 20.553  30.336 30.056 1.00 29.06 ? 1995 HOH A O   1 
HETATM 6092 O  O   . HOH T 9 .   ? 12.816  69.657 32.943 1.00 32.37 ? 1996 HOH A O   1 
HETATM 6093 O  O   . HOH T 9 .   ? 24.655  29.495 30.642 1.00 29.27 ? 1997 HOH A O   1 
HETATM 6094 O  O   . HOH T 9 .   ? 26.339  40.261 13.666 1.00 36.98 ? 1998 HOH A O   1 
HETATM 6095 O  O   . HOH T 9 .   ? -2.851  33.041 56.042 1.00 37.58 ? 1999 HOH A O   1 
HETATM 6096 O  O   . HOH T 9 .   ? 24.246  82.408 42.565 1.00 41.47 ? 2000 HOH A O   1 
HETATM 6097 O  O   . HOH T 9 .   ? 29.350  79.119 27.729 1.00 37.80 ? 2001 HOH A O   1 
HETATM 6098 O  O   . HOH T 9 .   ? 10.390  27.253 51.787 1.00 29.11 ? 2002 HOH A O   1 
HETATM 6099 O  O   . HOH T 9 .   ? 5.172   40.405 23.397 1.00 37.79 ? 2003 HOH A O   1 
HETATM 6100 O  O   . HOH T 9 .   ? 36.019  43.044 57.616 1.00 38.58 ? 2004 HOH A O   1 
HETATM 6101 O  O   . HOH T 9 .   ? 36.861  52.403 68.579 1.00 36.05 ? 2005 HOH A O   1 
HETATM 6102 O  O   . HOH T 9 .   ? 10.013  70.062 38.918 1.00 30.27 ? 2006 HOH A O   1 
HETATM 6103 O  O   . HOH T 9 .   ? 22.925  65.483 66.274 1.00 30.42 ? 2007 HOH A O   1 
HETATM 6104 O  O   . HOH T 9 .   ? 27.326  57.100 70.510 1.00 35.71 ? 2008 HOH A O   1 
HETATM 6105 O  O   . HOH T 9 .   ? 6.956   76.103 37.841 1.00 28.98 ? 2009 HOH A O   1 
HETATM 6106 O  O   . HOH T 9 .   ? 34.928  41.392 19.948 1.00 39.63 ? 2010 HOH A O   1 
HETATM 6107 O  O   . HOH T 9 .   ? 39.618  43.906 58.438 1.00 33.59 ? 2011 HOH A O   1 
HETATM 6108 O  O   . HOH T 9 .   ? 24.030  82.199 39.448 1.00 45.00 ? 2012 HOH A O   1 
HETATM 6109 O  O   . HOH T 9 .   ? 27.825  72.506 53.472 1.00 30.11 ? 2013 HOH A O   1 
HETATM 6110 O  O   . HOH T 9 .   ? 5.024   31.720 24.666 1.00 36.12 ? 2014 HOH A O   1 
HETATM 6111 O  O   . HOH T 9 .   ? 30.936  41.508 40.781 1.00 39.83 ? 2015 HOH A O   1 
HETATM 6112 O  O   . HOH T 9 .   ? 26.501  60.354 31.032 1.00 36.73 ? 2016 HOH A O   1 
HETATM 6113 O  O   . HOH T 9 .   ? -1.693  46.235 55.994 1.00 33.87 ? 2017 HOH A O   1 
HETATM 6114 O  O   . HOH T 9 .   ? 1.506   31.318 65.083 1.00 35.84 ? 2018 HOH A O   1 
HETATM 6115 O  O   . HOH T 9 .   ? 21.590  25.331 24.130 1.00 34.46 ? 2019 HOH A O   1 
HETATM 6116 O  O   . HOH T 9 .   ? 0.758   66.306 63.188 1.00 33.78 ? 2020 HOH A O   1 
HETATM 6117 O  O   . HOH T 9 .   ? 24.012  61.486 35.123 1.00 27.80 ? 2021 HOH A O   1 
HETATM 6118 O  O   . HOH T 9 .   ? 11.232  76.804 28.785 1.00 33.43 ? 2022 HOH A O   1 
HETATM 6119 O  O   . HOH T 9 .   ? 26.247  23.438 45.705 1.00 32.93 ? 2023 HOH A O   1 
HETATM 6120 O  O   . HOH T 9 .   ? 20.505  44.127 11.754 1.00 40.60 ? 2024 HOH A O   1 
HETATM 6121 O  O   . HOH T 9 .   ? -3.999  37.578 56.840 1.00 38.64 ? 2025 HOH A O   1 
HETATM 6122 O  O   . HOH T 9 .   ? 16.120  67.707 73.085 1.00 38.98 ? 2026 HOH A O   1 
HETATM 6123 O  O   . HOH T 9 .   ? 5.534   66.363 34.308 1.00 36.55 ? 2027 HOH A O   1 
HETATM 6124 O  O   . HOH T 9 .   ? -3.093  37.920 32.848 1.00 30.98 ? 2028 HOH A O   1 
HETATM 6125 O  O   . HOH T 9 .   ? 24.449  78.078 53.231 1.00 33.99 ? 2029 HOH A O   1 
HETATM 6126 O  O   . HOH T 9 .   ? 20.924  74.578 23.991 1.00 34.72 ? 2030 HOH A O   1 
HETATM 6127 O  O   . HOH T 9 .   ? 10.251  51.953 40.124 1.00 19.50 ? 2031 HOH A O   1 
HETATM 6128 O  O   . HOH T 9 .   ? 30.844  84.164 28.616 1.00 37.80 ? 2032 HOH A O   1 
HETATM 6129 O  O   . HOH T 9 .   ? 0.370   63.517 48.186 1.00 32.77 ? 2033 HOH A O   1 
HETATM 6130 O  O   . HOH T 9 .   ? 26.669  66.123 26.723 1.00 38.63 ? 2034 HOH A O   1 
HETATM 6131 O  O   . HOH T 9 .   ? 31.725  46.852 37.055 1.00 38.97 ? 2035 HOH A O   1 
HETATM 6132 O  O   . HOH T 9 .   ? 28.151  63.928 23.486 1.00 44.89 ? 2036 HOH A O   1 
HETATM 6133 O  O   . HOH T 9 .   ? -4.236  53.351 37.368 1.00 27.92 ? 2037 HOH A O   1 
HETATM 6134 O  O   . HOH T 9 .   ? 28.669  44.482 65.643 1.00 33.70 ? 2038 HOH A O   1 
HETATM 6135 O  O   . HOH T 9 .   ? 8.448   82.646 52.195 1.00 31.23 ? 2039 HOH A O   1 
HETATM 6136 O  O   . HOH T 9 .   ? 33.121  30.089 24.921 1.00 40.58 ? 2040 HOH A O   1 
HETATM 6137 O  O   . HOH T 9 .   ? 14.885  53.046 35.065 1.00 34.91 ? 2041 HOH A O   1 
HETATM 6138 O  O   . HOH T 9 .   ? 15.130  24.745 58.679 1.00 37.33 ? 2042 HOH A O   1 
HETATM 6139 O  O   . HOH T 9 .   ? 4.226   43.879 76.288 1.00 42.37 ? 2043 HOH A O   1 
HETATM 6140 O  O   . HOH T 9 .   ? 9.642   52.516 75.456 1.00 35.13 ? 2044 HOH A O   1 
HETATM 6141 O  O   . HOH T 9 .   ? 18.933  66.071 28.168 1.00 32.02 ? 2045 HOH A O   1 
HETATM 6142 O  O   . HOH T 9 .   ? 17.855  32.307 70.869 1.00 36.67 ? 2046 HOH A O   1 
HETATM 6143 O  O   . HOH T 9 .   ? 14.134  50.537 19.230 1.00 32.07 ? 2047 HOH A O   1 
HETATM 6144 O  O   . HOH T 9 .   ? 22.260  51.447 45.018 1.00 36.53 ? 2048 HOH A O   1 
HETATM 6145 O  O   . HOH T 9 .   ? 24.526  61.172 51.276 1.00 37.18 ? 2049 HOH A O   1 
HETATM 6146 O  O   . HOH T 9 .   ? 17.907  65.463 30.833 1.00 31.46 ? 2050 HOH A O   1 
HETATM 6147 O  O   . HOH T 9 .   ? 3.218   27.544 57.581 1.00 43.28 ? 2051 HOH A O   1 
HETATM 6148 O  O   . HOH T 9 .   ? 37.466  41.058 58.649 1.00 40.00 ? 2052 HOH A O   1 
HETATM 6149 O  O   . HOH T 9 .   ? 25.766  24.885 57.803 1.00 35.42 ? 2053 HOH A O   1 
HETATM 6150 O  O   . HOH T 9 .   ? 29.469  70.103 39.966 1.00 37.64 ? 2054 HOH A O   1 
HETATM 6151 O  O   . HOH T 9 .   ? 3.542   27.426 54.891 1.00 30.12 ? 2055 HOH A O   1 
HETATM 6152 O  O   . HOH T 9 .   ? 15.213  81.673 28.576 1.00 40.00 ? 2056 HOH A O   1 
HETATM 6153 O  O   . HOH T 9 .   ? 24.119  45.483 39.551 1.00 27.99 ? 2057 HOH A O   1 
HETATM 6154 O  O   . HOH T 9 .   ? -4.472  53.904 34.618 1.00 33.42 ? 2058 HOH A O   1 
HETATM 6155 O  O   . HOH T 9 .   ? 21.601  75.432 67.301 1.00 36.55 ? 2059 HOH A O   1 
HETATM 6156 O  O   . HOH T 9 .   ? 21.739  50.876 11.463 1.00 48.49 ? 2060 HOH A O   1 
HETATM 6157 O  O   . HOH T 9 .   ? 21.566  88.715 44.299 1.00 35.42 ? 2061 HOH A O   1 
HETATM 6158 O  O   . HOH T 9 .   ? -4.316  37.328 51.949 1.00 43.76 ? 2062 HOH A O   1 
HETATM 6159 O  O   . HOH T 9 .   ? 33.781  28.927 34.376 1.00 38.73 ? 2063 HOH A O   1 
HETATM 6160 O  O   . HOH T 9 .   ? -6.029  41.656 44.476 1.00 42.67 ? 2064 HOH A O   1 
HETATM 6161 O  O   . HOH T 9 .   ? 14.138  65.401 36.435 1.00 40.25 ? 2065 HOH A O   1 
HETATM 6162 O  O   . HOH T 9 .   ? 33.565  40.028 47.710 1.00 33.03 ? 2066 HOH A O   1 
HETATM 6163 O  O   . HOH T 9 .   ? 30.593  59.834 25.718 1.00 39.20 ? 2067 HOH A O   1 
HETATM 6164 O  O   . HOH T 9 .   ? 5.103   53.365 78.177 1.00 40.77 ? 2068 HOH A O   1 
HETATM 6165 O  O   . HOH T 9 .   ? 12.455  43.733 17.421 1.00 38.28 ? 2069 HOH A O   1 
HETATM 6166 O  O   . HOH T 9 .   ? 26.650  69.240 29.511 1.00 36.16 ? 2070 HOH A O   1 
HETATM 6167 O  O   . HOH T 9 .   ? -5.139  42.236 50.798 1.00 34.51 ? 2071 HOH A O   1 
HETATM 6168 O  O   . HOH T 9 .   ? 36.266  43.235 49.394 1.00 48.31 ? 2072 HOH A O   1 
HETATM 6169 O  O   . HOH T 9 .   ? 13.184  28.343 17.208 1.00 38.12 ? 2073 HOH A O   1 
HETATM 6170 O  O   . HOH T 9 .   ? -3.228  47.234 53.519 1.00 32.58 ? 2074 HOH A O   1 
HETATM 6171 O  O   . HOH T 9 .   ? -7.368  48.255 48.222 1.00 36.11 ? 2075 HOH A O   1 
HETATM 6172 O  O   . HOH T 9 .   ? 10.131  24.574 54.580 1.00 36.11 ? 2076 HOH A O   1 
HETATM 6173 O  O   . HOH T 9 .   ? -6.513  42.387 46.885 1.00 41.11 ? 2077 HOH A O   1 
HETATM 6174 O  O   . HOH T 9 .   ? -0.926  32.335 60.795 1.00 35.18 ? 2078 HOH A O   1 
HETATM 6175 O  O   . HOH T 9 .   ? 16.184  79.436 69.566 1.00 42.28 ? 2079 HOH A O   1 
HETATM 6176 O  O   . HOH T 9 .   ? -8.853  41.707 48.263 1.00 32.55 ? 2080 HOH A O   1 
HETATM 6177 O  O   . HOH T 9 .   ? 19.775  56.140 23.526 1.00 32.24 ? 2081 HOH A O   1 
HETATM 6178 O  O   . HOH T 9 .   ? 32.778  42.983 20.495 1.00 37.54 ? 2082 HOH A O   1 
HETATM 6179 O  O   . HOH T 9 .   ? 21.148  24.206 51.241 1.00 39.88 ? 2083 HOH A O   1 
HETATM 6180 O  O   . HOH T 9 .   ? 16.720  63.751 69.051 1.00 38.83 ? 2084 HOH A O   1 
HETATM 6181 O  O   . HOH T 9 .   ? 28.382  24.170 53.528 1.00 46.57 ? 2085 HOH A O   1 
HETATM 6182 O  O   . HOH T 9 .   ? 23.642  85.427 39.559 1.00 32.57 ? 2086 HOH A O   1 
HETATM 6183 O  O   . HOH T 9 .   ? 5.472   81.794 54.364 1.00 38.47 ? 2087 HOH A O   1 
HETATM 6184 O  O   . HOH T 9 .   ? 7.955   29.626 33.506 1.00 41.53 ? 2088 HOH A O   1 
HETATM 6185 O  O   . HOH T 9 .   ? -1.181  51.698 72.911 1.00 36.40 ? 2089 HOH A O   1 
HETATM 6186 O  O   . HOH T 9 .   ? 38.711  30.752 45.657 1.00 53.78 ? 2090 HOH A O   1 
HETATM 6187 O  O   . HOH T 9 .   ? 37.489  61.554 55.166 1.00 45.98 ? 2091 HOH A O   1 
HETATM 6188 O  O   . HOH T 9 .   ? 8.917   56.517 43.907 1.00 29.32 ? 2092 HOH A O   1 
HETATM 6189 O  O   . HOH T 9 .   ? 23.067  75.792 25.821 1.00 40.32 ? 2093 HOH A O   1 
HETATM 6190 O  O   . HOH T 9 .   ? 5.978   68.696 37.500 1.00 34.79 ? 2094 HOH A O   1 
HETATM 6191 O  O   . HOH T 9 .   ? 12.114  27.987 21.560 1.00 44.37 ? 2095 HOH A O   1 
HETATM 6192 O  O   . HOH T 9 .   ? 29.182  28.359 25.025 1.00 41.53 ? 2096 HOH A O   1 
HETATM 6193 O  O   . HOH T 9 .   ? 38.521  55.342 62.243 1.00 40.70 ? 2097 HOH A O   1 
HETATM 6194 O  O   . HOH T 9 .   ? 12.980  58.496 79.098 1.00 39.35 ? 2098 HOH A O   1 
HETATM 6195 O  O   . HOH T 9 .   ? 11.822  81.332 61.468 1.00 39.49 ? 2099 HOH A O   1 
HETATM 6196 O  O   . HOH T 9 .   ? 1.447   37.264 68.872 1.00 35.06 ? 2100 HOH A O   1 
HETATM 6197 O  O   . HOH T 9 .   ? 42.610  30.908 41.406 1.00 40.24 ? 2101 HOH A O   1 
HETATM 6198 O  O   . HOH T 9 .   ? 5.205   72.789 80.261 1.00 47.10 ? 2102 HOH A O   1 
HETATM 6199 O  O   . HOH T 9 .   ? 28.763  58.210 48.499 1.00 41.63 ? 2103 HOH A O   1 
HETATM 6200 O  O   . HOH T 9 .   ? 12.793  33.128 71.250 1.00 34.62 ? 2104 HOH A O   1 
HETATM 6201 O  O   . HOH T 9 .   ? 3.368   31.593 38.587 1.00 39.10 ? 2105 HOH A O   1 
HETATM 6202 O  O   . HOH T 9 .   ? 19.077  40.788 76.286 1.00 35.65 ? 2106 HOH A O   1 
HETATM 6203 O  O   . HOH T 9 .   ? 20.081  45.884 79.318 1.00 45.86 ? 2107 HOH A O   1 
HETATM 6204 O  O   . HOH T 9 .   ? 5.587   57.551 35.387 1.00 37.48 ? 2108 HOH A O   1 
HETATM 6205 O  O   . HOH T 9 .   ? 23.428  60.279 40.131 1.00 30.29 ? 2109 HOH A O   1 
HETATM 6206 O  O   . HOH T 9 .   ? 30.778  71.721 44.009 1.00 35.17 ? 2110 HOH A O   1 
HETATM 6207 O  O   . HOH T 9 .   ? 8.633   75.004 75.823 1.00 39.26 ? 2111 HOH A O   1 
HETATM 6208 O  O   . HOH T 9 .   ? 3.158   38.839 27.280 1.00 35.04 ? 2112 HOH A O   1 
HETATM 6209 O  O   . HOH T 9 .   ? 38.796  38.648 35.158 1.00 43.77 ? 2113 HOH A O   1 
HETATM 6210 O  O   . HOH T 9 .   ? 18.023  59.674 70.422 1.00 49.10 ? 2114 HOH A O   1 
HETATM 6211 O  O   . HOH T 9 .   ? 38.335  43.003 55.534 1.00 47.68 ? 2115 HOH A O   1 
HETATM 6212 O  O   . HOH T 9 .   ? -0.822  57.387 74.488 1.00 44.05 ? 2116 HOH A O   1 
HETATM 6213 O  O   . HOH T 9 .   ? 26.869  30.998 63.889 1.00 48.95 ? 2117 HOH A O   1 
HETATM 6214 O  O   . HOH T 9 .   ? 25.336  86.097 42.980 1.00 35.15 ? 2118 HOH A O   1 
HETATM 6215 O  O   . HOH T 9 .   ? 12.343  56.686 31.635 1.00 42.18 ? 2119 HOH A O   1 
HETATM 6216 O  O   . HOH T 9 .   ? -14.390 42.709 41.918 1.00 43.83 ? 2120 HOH A O   1 
HETATM 6217 O  O   . HOH T 9 .   ? 22.010  80.787 23.106 1.00 42.41 ? 2121 HOH A O   1 
HETATM 6218 O  O   . HOH T 9 .   ? 40.689  45.257 20.082 1.00 44.72 ? 2122 HOH A O   1 
HETATM 6219 O  O   . HOH T 9 .   ? 10.573  36.894 76.756 1.00 38.72 ? 2123 HOH A O   1 
HETATM 6220 O  O   . HOH T 9 .   ? 28.339  53.680 37.537 1.00 31.11 ? 2124 HOH A O   1 
HETATM 6221 O  O   . HOH T 9 .   ? 28.608  61.092 68.470 1.00 39.60 ? 2125 HOH A O   1 
HETATM 6222 O  O   . HOH T 9 .   ? 26.142  32.709 6.292  1.00 49.89 ? 2126 HOH A O   1 
HETATM 6223 O  O   . HOH T 9 .   ? 24.353  23.017 53.406 1.00 39.81 ? 2127 HOH A O   1 
HETATM 6224 O  O   . HOH T 9 .   ? 25.299  66.674 56.993 1.00 31.82 ? 2128 HOH A O   1 
HETATM 6225 O  O   . HOH T 9 .   ? 15.295  25.629 30.282 1.00 35.41 ? 2129 HOH A O   1 
HETATM 6226 O  O   . HOH T 9 .   ? 30.787  61.314 23.443 1.00 38.11 ? 2130 HOH A O   1 
HETATM 6227 O  O   . HOH T 9 .   ? 7.578   58.142 33.951 1.00 38.44 ? 2131 HOH A O   1 
HETATM 6228 O  O   . HOH T 9 .   ? 14.922  73.244 79.269 1.00 52.24 ? 2132 HOH A O   1 
HETATM 6229 O  O   . HOH T 9 .   ? 6.391   42.668 27.518 1.00 34.49 ? 2133 HOH A O   1 
HETATM 6230 O  O   . HOH T 9 .   ? 35.198  44.236 68.309 1.00 48.24 ? 2134 HOH A O   1 
HETATM 6231 O  O   . HOH T 9 .   ? 37.263  25.968 47.860 1.00 43.98 ? 2135 HOH A O   1 
HETATM 6232 O  O   . HOH T 9 .   ? 11.775  29.195 19.343 1.00 40.18 ? 2136 HOH A O   1 
HETATM 6233 O  O   . HOH T 9 .   ? 26.993  28.474 28.479 1.00 42.90 ? 2137 HOH A O   1 
HETATM 6234 O  O   . HOH T 9 .   ? 15.689  55.096 72.721 1.00 46.39 ? 2138 HOH A O   1 
HETATM 6235 O  O   . HOH T 9 .   ? 6.695   95.926 42.174 1.00 47.56 ? 2139 HOH A O   1 
HETATM 6236 O  O   . HOH T 9 .   ? 9.613   75.084 69.793 1.00 37.38 ? 2140 HOH A O   1 
HETATM 6237 O  O   . HOH T 9 .   ? 10.459  84.293 51.457 1.00 35.58 ? 2141 HOH A O   1 
HETATM 6238 O  O   . HOH T 9 .   ? 10.096  97.476 40.157 1.00 39.69 ? 2142 HOH A O   1 
HETATM 6239 O  O   . HOH T 9 .   ? 30.161  76.072 43.330 1.00 44.24 ? 2143 HOH A O   1 
HETATM 6240 O  O   . HOH T 9 .   ? 25.304  65.173 44.963 1.00 31.35 ? 2144 HOH A O   1 
HETATM 6241 O  O   . HOH T 9 .   ? 25.329  56.999 32.836 1.00 34.17 ? 2145 HOH A O   1 
HETATM 6242 O  O   . HOH T 9 .   ? 39.236  57.556 57.477 1.00 37.09 ? 2146 HOH A O   1 
HETATM 6243 O  O   . HOH T 9 .   ? 29.986  86.455 27.093 1.00 49.34 ? 2147 HOH A O   1 
HETATM 6244 O  O   . HOH T 9 .   ? 23.303  24.458 30.521 1.00 43.75 ? 2148 HOH A O   1 
HETATM 6245 O  O   . HOH T 9 .   ? 6.039   45.147 25.183 1.00 42.63 ? 2149 HOH A O   1 
HETATM 6246 O  O   . HOH T 9 .   ? 17.350  25.859 59.772 1.00 33.64 ? 2150 HOH A O   1 
HETATM 6247 O  O   . HOH T 9 .   ? 2.672   63.558 40.843 1.00 30.75 ? 2151 HOH A O   1 
HETATM 6248 O  O   . HOH T 9 .   ? 23.210  58.749 21.882 1.00 37.00 ? 2152 HOH A O   1 
HETATM 6249 O  O   . HOH T 9 .   ? 21.253  24.256 27.217 1.00 39.00 ? 2153 HOH A O   1 
HETATM 6250 O  O   . HOH T 9 .   ? 34.639  46.116 70.034 1.00 41.42 ? 2154 HOH A O   1 
HETATM 6251 O  O   . HOH T 9 .   ? 42.222  34.644 38.260 1.00 53.48 ? 2155 HOH A O   1 
HETATM 6252 O  O   . HOH T 9 .   ? 29.349  73.244 50.086 1.00 46.94 ? 2156 HOH A O   1 
HETATM 6253 O  O   . HOH T 9 .   ? 22.191  83.794 50.069 1.00 35.61 ? 2157 HOH A O   1 
HETATM 6254 O  O   . HOH T 9 .   ? 12.328  81.294 70.242 1.00 44.16 ? 2158 HOH A O   1 
HETATM 6255 O  O   . HOH T 9 .   ? 24.188  83.865 46.036 1.00 45.47 ? 2159 HOH A O   1 
HETATM 6256 O  O   . HOH T 9 .   ? 26.356  62.496 65.907 1.00 40.07 ? 2160 HOH A O   1 
HETATM 6257 O  O   . HOH T 9 .   ? 5.588   79.107 38.720 1.00 35.95 ? 2161 HOH A O   1 
HETATM 6258 O  O   . HOH T 9 .   ? 24.604  68.344 63.488 1.00 46.62 ? 2162 HOH A O   1 
HETATM 6259 O  O   . HOH T 9 .   ? 37.011  48.291 30.805 1.00 40.91 ? 2163 HOH A O   1 
HETATM 6260 O  O   . HOH T 9 .   ? -0.560  30.813 63.139 1.00 52.68 ? 2164 HOH A O   1 
HETATM 6261 O  O   . HOH T 9 .   ? 30.851  72.239 48.118 1.00 37.89 ? 2165 HOH A O   1 
HETATM 6262 O  O   . HOH T 9 .   ? -5.336  44.821 31.124 1.00 43.57 ? 2166 HOH A O   1 
HETATM 6263 O  O   . HOH T 9 .   ? 27.146  65.078 35.249 1.00 46.79 ? 2167 HOH A O   1 
HETATM 6264 O  O   . HOH T 9 .   ? 17.648  64.862 67.475 1.00 39.08 ? 2168 HOH A O   1 
HETATM 6265 O  O   . HOH T 9 .   ? 27.303  63.189 63.539 1.00 46.03 ? 2169 HOH A O   1 
HETATM 6266 O  O   . HOH T 9 .   ? 33.767  21.498 41.942 1.00 51.54 ? 2170 HOH A O   1 
HETATM 6267 O  O   . HOH T 9 .   ? 19.076  25.463 12.270 1.00 38.83 ? 2171 HOH A O   1 
HETATM 6268 O  O   . HOH T 9 .   ? 33.700  53.388 32.281 1.00 40.20 ? 2172 HOH A O   1 
HETATM 6269 O  O   . HOH T 9 .   ? 30.807  70.523 37.797 1.00 45.01 ? 2173 HOH A O   1 
HETATM 6270 O  O   . HOH T 9 .   ? -1.162  70.278 43.961 1.00 27.28 ? 2174 HOH A O   1 
HETATM 6271 O  O   . HOH T 9 .   ? 2.975   65.065 51.157 1.00 25.10 ? 2175 HOH A O   1 
HETATM 6272 O  O   . HOH T 9 .   ? -8.157  49.610 50.264 1.00 32.47 ? 2176 HOH A O   1 
HETATM 6273 O  O   . HOH T 9 .   ? -4.422  58.092 36.690 1.00 32.94 ? 2177 HOH A O   1 
HETATM 6274 O  O   . HOH T 9 .   ? 9.363   28.778 38.180 1.00 37.60 ? 2178 HOH A O   1 
HETATM 6275 O  O   . HOH T 9 .   ? 15.272  24.974 32.773 1.00 34.78 ? 2179 HOH A O   1 
HETATM 6276 O  O   . HOH T 9 .   ? -1.729  63.735 49.236 1.00 28.44 ? 2180 HOH A O   1 
HETATM 6277 O  O   . HOH T 9 .   ? 28.982  25.711 31.725 1.00 37.64 ? 2181 HOH A O   1 
HETATM 6278 O  O   . HOH T 9 .   ? 26.936  64.893 29.232 1.00 33.03 ? 2182 HOH A O   1 
HETATM 6279 O  O   . HOH T 9 .   ? 25.698  68.182 33.099 1.00 32.44 ? 2183 HOH A O   1 
HETATM 6280 O  O   . HOH T 9 .   ? 28.298  63.529 58.016 1.00 53.68 ? 2184 HOH A O   1 
HETATM 6281 O  O   . HOH T 9 .   ? 29.805  67.830 46.015 1.00 37.90 ? 2185 HOH A O   1 
HETATM 6282 O  O   . HOH T 9 .   ? 29.366  61.942 27.505 1.00 38.34 ? 2186 HOH A O   1 
HETATM 6283 O  O   . HOH T 9 .   ? 27.348  66.312 46.783 1.00 32.32 ? 2187 HOH A O   1 
HETATM 6284 O  O   . HOH T 9 .   ? 18.728  22.991 49.317 1.00 47.79 ? 2188 HOH A O   1 
HETATM 6285 O  O   . HOH T 9 .   ? 34.762  35.698 58.434 1.00 47.02 ? 2189 HOH A O   1 
HETATM 6286 O  O   . HOH T 9 .   ? 24.398  79.743 55.622 1.00 40.92 ? 2190 HOH A O   1 
HETATM 6287 O  O   . HOH T 9 .   ? 11.662  24.899 51.998 1.00 41.70 ? 2191 HOH A O   1 
HETATM 6288 O  O   . HOH T 9 .   ? 21.310  56.719 25.562 1.00 31.31 ? 2192 HOH A O   1 
HETATM 6289 O  O   . HOH T 9 .   ? 28.179  35.975 67.674 1.00 39.38 ? 2193 HOH A O   1 
HETATM 6290 O  O   . HOH T 9 .   ? 29.549  37.952 66.348 1.00 36.05 ? 2194 HOH A O   1 
HETATM 6291 O  O   . HOH T 9 .   ? 13.731  80.613 63.350 1.00 38.21 ? 2195 HOH A O   1 
HETATM 6292 O  O   . HOH T 9 .   ? 12.128  56.567 77.691 1.00 41.03 ? 2196 HOH A O   1 
HETATM 6293 O  O   . HOH T 9 .   ? 35.165  49.136 33.704 1.00 38.44 ? 2197 HOH A O   1 
HETATM 6294 O  O   . HOH T 9 .   ? 37.861  41.449 37.411 1.00 49.90 ? 2198 HOH A O   1 
HETATM 6295 O  O   . HOH T 9 .   ? -3.870  32.602 53.424 1.00 40.14 ? 2199 HOH A O   1 
HETATM 6296 O  O   . HOH T 9 .   ? 30.673  51.591 49.776 1.00 47.12 ? 2200 HOH A O   1 
HETATM 6297 O  O   . HOH T 9 .   ? 14.878  60.236 77.459 1.00 36.89 ? 2201 HOH A O   1 
HETATM 6298 O  O   . HOH T 9 .   ? 25.617  71.881 60.950 1.00 46.86 ? 2202 HOH A O   1 
HETATM 6299 O  O   . HOH T 9 .   ? 23.514  74.690 65.711 1.00 41.18 ? 2203 HOH A O   1 
HETATM 6300 O  O   . HOH T 9 .   ? 14.540  70.179 30.483 1.00 32.04 ? 2204 HOH A O   1 
HETATM 6301 O  O   . HOH T 9 .   ? 40.728  42.657 24.333 1.00 47.00 ? 2205 HOH A O   1 
HETATM 6302 O  O   . HOH T 9 .   ? 10.996  27.444 32.179 1.00 38.51 ? 2206 HOH A O   1 
HETATM 6303 O  O   . HOH T 9 .   ? -16.596 45.401 41.247 1.00 42.92 ? 2207 HOH A O   1 
HETATM 6304 O  O   . HOH T 9 .   ? -2.152  44.656 59.008 1.00 36.24 ? 2208 HOH A O   1 
HETATM 6305 O  O   . HOH T 9 .   ? 28.998  64.075 68.551 1.00 51.42 ? 2209 HOH A O   1 
HETATM 6306 O  O   . HOH T 9 .   ? 31.186  70.064 41.848 1.00 36.65 ? 2210 HOH A O   1 
HETATM 6307 O  O   . HOH T 9 .   ? -5.568  34.380 47.887 1.00 44.00 ? 2211 HOH A O   1 
HETATM 6308 O  O   . HOH T 9 .   ? -5.520  44.402 47.719 1.00 46.01 ? 2212 HOH A O   1 
HETATM 6309 O  O   . HOH T 9 .   ? 13.623  81.454 66.266 1.00 45.39 ? 2213 HOH A O   1 
HETATM 6310 O  O   . HOH T 9 .   ? 7.673   26.582 54.646 1.00 46.66 ? 2214 HOH A O   1 
HETATM 6311 O  O   . HOH T 9 .   ? 17.925  58.495 30.146 1.00 43.34 ? 2215 HOH A O   1 
HETATM 6312 O  O   . HOH T 9 .   ? 5.419   30.232 37.342 1.00 47.74 ? 2216 HOH A O   1 
HETATM 6313 O  O   . HOH T 9 .   ? 1.000   31.881 67.607 1.00 44.85 ? 2217 HOH A O   1 
HETATM 6314 O  O   . HOH T 9 .   ? 15.856  82.955 57.988 1.00 51.13 ? 2218 HOH A O   1 
HETATM 6315 O  O   . HOH T 9 .   ? 37.154  57.017 64.155 1.00 41.94 ? 2219 HOH A O   1 
HETATM 6316 O  O   . HOH T 9 .   ? 27.737  67.502 34.145 1.00 40.50 ? 2220 HOH A O   1 
HETATM 6317 O  O   . HOH T 9 .   ? 18.397  24.641 61.837 1.00 47.61 ? 2221 HOH A O   1 
HETATM 6318 O  O   . HOH T 9 .   ? 12.569  28.611 60.792 1.00 47.17 ? 2222 HOH A O   1 
HETATM 6319 O  O   . HOH T 9 .   ? 10.949  41.320 17.823 1.00 40.14 ? 2223 HOH A O   1 
HETATM 6320 O  O   . HOH T 9 .   ? 23.908  58.387 36.956 1.00 36.65 ? 2224 HOH A O   1 
HETATM 6321 O  O   . HOH T 9 .   ? 32.644  26.483 34.280 1.00 45.51 ? 2225 HOH A O   1 
HETATM 6322 O  O   . HOH T 9 .   ? 32.494  27.587 56.601 1.00 43.20 ? 2226 HOH A O   1 
HETATM 6323 O  O   . HOH T 9 .   ? 19.055  54.152 73.298 1.00 38.32 ? 2227 HOH A O   1 
HETATM 6324 O  O   . HOH T 9 .   ? 10.194  39.047 15.823 1.00 53.62 ? 2228 HOH A O   1 
HETATM 6325 O  O   . HOH T 9 .   ? 25.819  74.633 58.416 1.00 44.93 ? 2229 HOH A O   1 
HETATM 6326 O  O   . HOH T 9 .   ? -8.997  46.404 32.380 1.00 44.15 ? 2230 HOH A O   1 
HETATM 6327 O  O   . HOH T 9 .   ? 27.301  62.211 29.187 1.00 37.94 ? 2231 HOH A O   1 
HETATM 6328 O  O   . HOH T 9 .   ? 29.995  42.057 66.871 1.00 36.06 ? 2232 HOH A O   1 
HETATM 6329 O  O   . HOH T 9 .   ? 27.414  25.993 22.693 1.00 53.60 ? 2233 HOH A O   1 
HETATM 6330 O  O   . HOH T 9 .   ? 29.006  64.483 26.023 1.00 41.15 ? 2234 HOH A O   1 
HETATM 6331 O  O   . HOH T 9 .   ? 17.739  87.893 29.929 1.00 46.75 ? 2235 HOH A O   1 
HETATM 6332 O  O   . HOH T 9 .   ? 39.877  57.309 60.260 1.00 45.98 ? 2236 HOH A O   1 
HETATM 6333 O  O   . HOH T 9 .   ? 6.720   81.830 62.969 1.00 40.33 ? 2237 HOH A O   1 
HETATM 6334 O  O   . HOH T 9 .   ? 28.373  56.812 34.442 1.00 41.53 ? 2238 HOH A O   1 
HETATM 6335 O  O   . HOH T 9 .   ? 26.136  75.115 56.258 1.00 45.50 ? 2239 HOH A O   1 
HETATM 6336 O  O   . HOH T 9 .   ? -9.175  46.059 48.916 1.00 42.17 ? 2240 HOH A O   1 
HETATM 6337 O  O   . HOH T 9 .   ? 6.031   75.045 77.195 1.00 48.00 ? 2241 HOH A O   1 
HETATM 6338 O  O   . HOH T 9 .   ? 24.855  60.120 32.938 1.00 40.16 ? 2242 HOH A O   1 
HETATM 6339 O  O   . HOH T 9 .   ? -4.072  47.176 25.383 1.00 51.52 ? 2243 HOH A O   1 
HETATM 6340 O  O   . HOH T 9 .   ? 40.416  45.600 17.322 1.00 43.62 ? 2244 HOH A O   1 
HETATM 6341 O  O   . HOH T 9 .   ? 24.537  81.754 50.561 1.00 43.19 ? 2245 HOH A O   1 
HETATM 6342 O  O   . HOH T 9 .   ? 14.092  55.090 37.610 1.00 37.28 ? 2246 HOH A O   1 
HETATM 6343 O  O   . HOH T 9 .   ? 19.933  22.656 12.691 1.00 46.60 ? 2247 HOH A O   1 
HETATM 6344 O  O   . HOH T 9 .   ? 22.554  55.295 69.820 1.00 48.20 ? 2248 HOH A O   1 
HETATM 6345 O  O   . HOH T 9 .   ? -10.736 43.603 39.049 1.00 45.21 ? 2249 HOH A O   1 
HETATM 6346 O  O   . HOH T 9 .   ? 15.617  30.219 13.016 1.00 49.23 ? 2250 HOH A O   1 
HETATM 6347 O  O   . HOH T 9 .   ? 2.115   66.951 37.409 1.00 44.22 ? 2251 HOH A O   1 
HETATM 6348 O  O   . HOH T 9 .   ? 31.708  74.107 44.362 1.00 50.14 ? 2252 HOH A O   1 
HETATM 6349 O  O   . HOH T 9 .   ? 34.266  55.114 67.930 1.00 46.85 ? 2253 HOH A O   1 
HETATM 6350 O  O   . HOH T 9 .   ? 19.462  41.599 78.681 1.00 42.45 ? 2254 HOH A O   1 
HETATM 6351 O  O   . HOH T 9 .   ? -12.684 45.897 35.750 1.00 42.76 ? 2255 HOH A O   1 
HETATM 6352 O  O   . HOH T 9 .   ? 28.413  42.051 68.871 1.00 37.20 ? 2256 HOH A O   1 
HETATM 6353 O  O   . HOH T 9 .   ? 15.458  71.696 21.967 1.00 44.93 ? 2257 HOH A O   1 
HETATM 6354 O  O   . HOH T 9 .   ? 16.907  20.939 51.895 1.00 43.90 ? 2258 HOH A O   1 
HETATM 6355 O  O   . HOH T 9 .   ? 20.210  57.840 27.941 1.00 34.23 ? 2259 HOH A O   1 
HETATM 6356 O  O   . HOH T 9 .   ? 4.255   79.106 68.872 1.00 41.99 ? 2260 HOH A O   1 
HETATM 6357 O  O   . HOH T 9 .   ? 40.441  41.381 26.859 1.00 45.85 ? 2261 HOH A O   1 
HETATM 6358 O  O   . HOH T 9 .   ? 32.580  41.610 67.533 1.00 43.76 ? 2262 HOH A O   1 
HETATM 6359 O  O   . HOH T 9 .   ? -0.456  40.917 71.606 1.00 48.30 ? 2263 HOH A O   1 
HETATM 6360 O  O   . HOH T 9 .   ? 16.058  68.190 29.668 1.00 40.51 ? 2264 HOH A O   1 
HETATM 6361 O  O   . HOH T 9 .   ? 23.775  24.355 26.710 1.00 57.12 ? 2265 HOH A O   1 
HETATM 6362 O  O   . HOH T 9 .   ? 25.592  57.124 35.168 1.00 41.70 ? 2266 HOH A O   1 
HETATM 6363 O  O   . HOH T 9 .   ? 14.181  68.934 75.667 1.00 34.41 ? 2267 HOH A O   1 
HETATM 6364 O  O   . HOH T 9 .   ? 8.030   30.225 36.467 1.00 41.42 ? 2268 HOH A O   1 
HETATM 6365 O  O   . HOH T 9 .   ? -4.275  44.148 49.936 1.00 41.62 ? 2269 HOH A O   1 
HETATM 6366 O  O   . HOH T 9 .   ? 32.066  74.781 36.972 1.00 44.68 ? 2270 HOH A O   1 
HETATM 6367 O  O   . HOH T 9 .   ? -4.669  35.130 56.574 1.00 53.77 ? 2271 HOH A O   1 
HETATM 6368 O  O   . HOH T 9 .   ? 30.923  61.507 64.275 1.00 39.40 ? 2272 HOH A O   1 
HETATM 6369 O  O   . HOH T 9 .   ? 44.738  27.540 40.983 1.00 46.21 ? 2273 HOH A O   1 
HETATM 6370 O  O   . HOH T 9 .   ? 30.385  25.760 38.583 1.00 37.03 ? 2274 HOH A O   1 
HETATM 6371 O  O   . HOH T 9 .   ? -4.194  29.714 52.957 1.00 52.69 ? 2275 HOH A O   1 
HETATM 6372 O  O   . HOH T 9 .   ? 18.523  68.385 75.162 1.00 38.50 ? 2276 HOH A O   1 
HETATM 6373 O  O   . HOH T 9 .   ? 26.864  63.325 47.693 1.00 37.82 ? 2277 HOH A O   1 
HETATM 6374 O  O   . HOH T 9 .   ? 17.288  66.271 71.193 1.00 51.48 ? 2278 HOH A O   1 
HETATM 6375 O  O   . HOH T 9 .   ? 6.863   49.607 77.897 1.00 56.73 ? 2279 HOH A O   1 
HETATM 6376 O  O   . HOH T 9 .   ? 12.088  25.206 35.739 1.00 44.54 ? 2280 HOH A O   1 
HETATM 6377 O  O   . HOH T 9 .   ? 33.165  54.637 70.550 1.00 43.93 ? 2281 HOH A O   1 
HETATM 6378 O  O   . HOH T 9 .   ? 14.383  41.053 12.491 1.00 55.27 ? 2282 HOH A O   1 
HETATM 6379 O  O   . HOH T 9 .   ? 10.143  28.411 34.042 1.00 46.17 ? 2283 HOH A O   1 
HETATM 6380 O  O   . HOH T 9 .   ? 25.190  69.362 61.060 1.00 41.65 ? 2284 HOH A O   1 
HETATM 6381 O  O   . HOH T 9 .   ? 16.371  27.939 11.614 1.00 49.23 ? 2285 HOH A O   1 
HETATM 6382 O  O   . HOH T 9 .   ? 40.694  47.551 29.381 1.00 56.65 ? 2286 HOH A O   1 
HETATM 6383 O  O   . HOH T 9 .   ? 10.945  82.430 66.237 1.00 51.02 ? 2287 HOH A O   1 
HETATM 6384 O  O   . HOH T 9 .   ? 21.464  54.633 16.633 1.00 43.53 ? 2288 HOH A O   1 
HETATM 6385 O  O   . HOH T 9 .   ? 12.225  24.974 33.200 1.00 39.44 ? 2289 HOH A O   1 
HETATM 6386 O  O   . HOH T 9 .   ? -0.131  60.748 48.607 1.00 29.17 ? 2290 HOH A O   1 
HETATM 6387 O  O   . HOH T 9 .   ? -9.979  54.196 31.203 1.00 39.13 ? 2291 HOH A O   1 
HETATM 6388 O  O   . HOH T 9 .   ? 22.308  45.530 41.808 1.00 37.04 ? 2292 HOH A O   1 
HETATM 6389 O  O   . HOH T 9 .   ? 8.020   56.661 75.995 1.00 28.99 ? 2293 HOH A O   1 
HETATM 6390 O  O   . HOH T 9 .   ? 6.792   53.985 75.800 1.00 29.86 ? 2294 HOH A O   1 
HETATM 6391 O  O   . HOH T 9 .   ? 20.628  43.468 47.226 1.00 37.53 ? 2295 HOH A O   1 
HETATM 6392 O  O   . HOH T 9 .   ? 18.971  44.086 43.957 1.00 26.81 ? 2296 HOH A O   1 
HETATM 6393 O  O   . HOH T 9 .   ? 8.182   44.829 46.583 1.00 14.21 ? 2297 HOH A O   1 
HETATM 6394 O  O   . HOH T 9 .   ? 19.968  47.106 46.244 1.00 32.85 ? 2298 HOH A O   1 
HETATM 6395 O  O   . HOH T 9 .   ? 36.707  46.585 32.577 1.00 39.49 ? 2299 HOH A O   1 
HETATM 6396 O  O   . HOH T 9 .   ? 14.842  96.514 45.362 1.00 43.12 ? 2300 HOH A O   1 
HETATM 6397 O  O   . HOH T 9 .   ? 42.565  30.335 43.837 1.00 48.53 ? 2301 HOH A O   1 
HETATM 6398 O  O   . HOH T 9 .   ? 23.776  53.419 46.429 1.00 38.29 ? 2302 HOH A O   1 
HETATM 6399 O  O   . HOH T 9 .   ? 29.611  34.793 65.339 1.00 44.87 ? 2303 HOH A O   1 
HETATM 6400 O  O   . HOH T 9 .   ? 6.722   83.724 65.671 1.00 51.05 ? 2304 HOH A O   1 
HETATM 6401 O  O   . HOH T 9 .   ? 20.097  81.060 63.211 1.00 48.34 ? 2305 HOH A O   1 
HETATM 6402 O  O   . HOH T 9 .   ? -7.563  41.558 41.096 1.00 39.88 ? 2306 HOH A O   1 
HETATM 6403 O  O   . HOH T 9 .   ? 29.529  61.001 52.615 1.00 30.73 ? 2307 HOH A O   1 
HETATM 6404 O  O   . HOH T 9 .   ? 32.085  49.479 38.467 1.00 50.16 ? 2308 HOH A O   1 
HETATM 6405 O  O   . HOH T 9 .   ? 26.086  53.069 48.819 1.00 40.22 ? 2309 HOH A O   1 
HETATM 6406 O  O   . HOH T 9 .   ? 2.920   84.444 68.750 1.00 47.45 ? 2310 HOH A O   1 
HETATM 6407 O  O   . HOH T 9 .   ? 5.714   54.992 34.794 1.00 35.11 ? 2311 HOH A O   1 
HETATM 6408 O  O   . HOH T 9 .   ? 24.430  82.248 24.729 1.00 43.89 ? 2312 HOH A O   1 
HETATM 6409 O  O   . HOH T 9 .   ? 1.878   61.238 42.340 1.00 43.02 ? 2313 HOH A O   1 
HETATM 6410 O  O   . HOH T 9 .   ? 16.522  85.753 28.985 1.00 51.98 ? 2314 HOH A O   1 
HETATM 6411 O  O   . HOH T 9 .   ? 23.241  68.767 69.320 1.00 46.95 ? 2315 HOH A O   1 
HETATM 6412 O  O   . HOH T 9 .   ? 27.303  65.372 38.788 1.00 40.15 ? 2316 HOH A O   1 
HETATM 6413 O  O   . HOH T 9 .   ? 36.883  40.234 55.765 1.00 44.24 ? 2317 HOH A O   1 
HETATM 6414 O  O   . HOH T 9 .   ? 22.565  80.688 57.385 1.00 45.25 ? 2318 HOH A O   1 
HETATM 6415 O  O   . HOH T 9 .   ? 31.036  35.858 17.262 1.00 46.01 ? 2319 HOH A O   1 
HETATM 6416 O  O   . HOH T 9 .   ? 31.286  31.937 17.378 1.00 41.74 ? 2320 HOH A O   1 
HETATM 6417 O  O   . HOH T 9 .   ? 16.782  71.035 79.416 1.00 42.99 ? 2321 HOH A O   1 
HETATM 6418 O  O   . HOH T 9 .   ? 15.205  73.224 23.823 1.00 51.83 ? 2322 HOH A O   1 
HETATM 6419 O  O   . HOH T 9 .   ? 12.783  50.382 27.754 1.00 46.59 ? 2323 HOH A O   1 
HETATM 6420 O  O   . HOH T 9 .   ? 25.303  66.768 67.439 1.00 44.44 ? 2324 HOH A O   1 
HETATM 6421 O  O   . HOH T 9 .   ? 8.913   78.839 49.940 1.00 37.03 ? 2325 HOH A O   1 
HETATM 6422 O  O   . HOH T 9 .   ? 4.966   27.506 30.756 1.00 51.98 ? 2326 HOH A O   1 
HETATM 6423 O  O   . HOH T 9 .   ? 6.551   25.341 20.741 1.00 54.58 ? 2327 HOH A O   1 
HETATM 6424 O  O   . HOH T 9 .   ? 19.550  58.393 68.949 1.00 50.36 ? 2328 HOH A O   1 
HETATM 6425 O  O   . HOH T 9 .   ? 9.177   94.109 54.453 1.00 41.33 ? 2329 HOH A O   1 
HETATM 6426 O  O   . HOH T 9 .   ? 8.402   70.150 37.309 1.00 48.51 ? 2330 HOH A O   1 
HETATM 6427 O  O   . HOH T 9 .   ? 24.558  20.694 33.804 1.00 47.06 ? 2331 HOH A O   1 
HETATM 6428 O  O   . HOH T 9 .   ? 15.995  82.134 61.947 1.00 49.83 ? 2332 HOH A O   1 
HETATM 6429 O  O   . HOH T 9 .   ? 20.784  79.925 65.774 1.00 50.42 ? 2333 HOH A O   1 
HETATM 6430 O  O   . HOH T 9 .   ? 25.912  74.627 22.521 1.00 45.95 ? 2334 HOH A O   1 
HETATM 6431 O  O   . HOH T 9 .   ? 9.350   42.056 20.036 1.00 44.07 ? 2335 HOH A O   1 
HETATM 6432 O  O   . HOH T 9 .   ? 31.771  50.375 12.120 1.00 49.58 ? 2336 HOH A O   1 
HETATM 6433 O  O   . HOH T 9 .   ? 26.502  26.768 30.581 1.00 48.64 ? 2337 HOH A O   1 
HETATM 6434 O  O   . HOH T 9 .   ? 29.396  60.745 49.997 1.00 51.79 ? 2338 HOH A O   1 
HETATM 6435 O  O   . HOH T 9 .   ? 21.634  73.601 69.346 1.00 50.39 ? 2339 HOH A O   1 
HETATM 6436 O  O   . HOH T 9 .   ? 3.996   64.302 34.939 1.00 42.69 ? 2340 HOH A O   1 
HETATM 6437 O  O   . HOH T 9 .   ? 24.027  54.703 17.457 1.00 43.60 ? 2341 HOH A O   1 
HETATM 6438 O  O   . HOH T 9 .   ? 24.693  37.434 70.505 1.00 47.99 ? 2342 HOH A O   1 
HETATM 6439 O  O   . HOH T 9 .   ? 42.735  53.262 25.660 1.00 47.51 ? 2343 HOH A O   1 
HETATM 6440 O  O   . HOH T 9 .   ? 10.947  84.807 54.269 1.00 48.34 ? 2344 HOH A O   1 
HETATM 6441 O  O   . HOH T 9 .   ? 41.960  45.993 67.502 1.00 54.28 ? 2345 HOH A O   1 
HETATM 6442 O  O   . HOH T 9 .   ? 20.512  63.273 71.963 1.00 39.64 ? 2346 HOH A O   1 
HETATM 6443 O  O   . HOH T 9 .   ? 35.279  20.852 44.280 1.00 43.71 ? 2347 HOH A O   1 
HETATM 6444 O  O   . HOH T 9 .   ? 32.678  41.570 45.111 1.00 52.00 ? 2348 HOH A O   1 
HETATM 6445 O  O   . HOH T 9 .   ? 11.495  48.801 29.799 1.00 44.08 ? 2349 HOH A O   1 
HETATM 6446 O  O   . HOH T 9 .   ? 19.089  34.608 72.637 1.00 47.98 ? 2350 HOH A O   1 
HETATM 6447 O  O   . HOH T 9 .   ? 19.148  70.036 68.942 1.00 42.19 ? 2351 HOH A O   1 
HETATM 6448 O  O   . HOH T 9 .   ? 27.112  64.480 60.220 1.00 51.65 ? 2352 HOH A O   1 
HETATM 6449 O  O   . HOH T 9 .   ? 23.599  75.216 63.041 1.00 41.84 ? 2353 HOH A O   1 
HETATM 6450 O  O   . HOH T 9 .   ? 35.982  41.601 47.199 1.00 47.87 ? 2354 HOH A O   1 
HETATM 6451 O  O   . HOH T 9 .   ? 18.864  86.940 25.783 1.00 54.76 ? 2355 HOH A O   1 
HETATM 6452 O  O   . HOH T 9 .   ? 6.814   93.971 53.433 1.00 49.14 ? 2356 HOH A O   1 
HETATM 6453 O  O   . HOH T 9 .   ? 2.266   85.100 65.888 1.00 44.77 ? 2357 HOH A O   1 
HETATM 6454 O  O   . HOH T 9 .   ? -2.353  43.795 56.477 1.00 43.87 ? 2358 HOH A O   1 
HETATM 6455 O  O   . HOH T 9 .   ? 31.457  47.828 45.218 1.00 54.07 ? 2359 HOH A O   1 
HETATM 6456 O  O   . HOH T 9 .   ? 41.037  34.062 52.256 1.00 56.43 ? 2360 HOH A O   1 
HETATM 6457 O  O   . HOH T 9 .   ? 13.129  86.029 47.741 1.00 48.12 ? 2361 HOH A O   1 
HETATM 6458 O  O   . HOH T 9 .   ? 23.393  78.568 23.166 1.00 43.36 ? 2362 HOH A O   1 
HETATM 6459 O  O   . HOH T 9 .   ? 23.485  61.025 20.468 1.00 44.40 ? 2363 HOH A O   1 
HETATM 6460 O  O   . HOH T 9 .   ? 28.556  29.553 62.314 1.00 47.43 ? 2364 HOH A O   1 
HETATM 6461 O  O   . HOH T 9 .   ? 34.490  32.836 27.737 1.00 42.50 ? 2365 HOH A O   1 
HETATM 6462 O  O   . HOH T 9 .   ? 12.551  79.933 72.408 1.00 50.86 ? 2366 HOH A O   1 
HETATM 6463 O  O   . HOH T 9 .   ? 6.140   33.590 20.886 1.00 51.68 ? 2367 HOH A O   1 
HETATM 6464 O  O   . HOH T 9 .   ? 27.644  66.200 55.002 1.00 47.69 ? 2368 HOH A O   1 
HETATM 6465 O  O   . HOH T 9 .   ? -4.470  44.637 52.580 1.00 49.41 ? 2369 HOH A O   1 
HETATM 6466 O  O   . HOH T 9 .   ? 4.104   70.799 81.244 1.00 44.28 ? 2370 HOH A O   1 
HETATM 6467 O  O   . HOH T 9 .   ? 36.821  37.746 13.097 1.00 45.26 ? 2371 HOH A O   1 
HETATM 6468 O  O   . HOH T 9 .   ? 20.668  38.406 76.053 1.00 55.39 ? 2372 HOH A O   1 
HETATM 6469 O  O   . HOH T 9 .   ? -0.620  27.225 20.936 1.00 54.06 ? 2373 HOH A O   1 
HETATM 6470 O  O   . HOH T 9 .   ? 35.284  23.250 47.022 1.00 47.64 ? 2374 HOH A O   1 
HETATM 6471 O  O   . HOH T 9 .   ? 15.716  22.560 46.442 1.00 48.17 ? 2375 HOH A O   1 
HETATM 6472 O  O   . HOH T 9 .   ? 8.862   22.662 46.769 1.00 47.08 ? 2376 HOH A O   1 
HETATM 6473 O  O   . HOH T 9 .   ? 25.166  62.878 42.472 1.00 51.98 ? 2377 HOH A O   1 
HETATM 6474 O  O   . HOH T 9 .   ? 14.203  61.687 33.256 1.00 46.07 ? 2378 HOH A O   1 
HETATM 6475 O  O   . HOH T 9 .   ? 10.195  26.662 36.807 1.00 57.71 ? 2379 HOH A O   1 
HETATM 6476 O  O   . HOH T 9 .   ? -1.862  56.968 37.031 1.00 38.67 ? 2380 HOH A O   1 
HETATM 6477 O  O   . HOH T 9 .   ? 20.772  60.077 25.133 1.00 46.96 ? 2381 HOH A O   1 
HETATM 6478 O  O   . HOH T 9 .   ? 21.846  69.121 77.466 1.00 58.71 ? 2382 HOH A O   1 
HETATM 6479 O  O   . HOH T 9 .   ? 7.959   27.409 50.923 1.00 51.44 ? 2383 HOH A O   1 
HETATM 6480 O  O   . HOH T 9 .   ? 21.308  43.544 78.417 1.00 53.25 ? 2384 HOH A O   1 
HETATM 6481 O  O   . HOH T 9 .   ? 17.493  56.762 27.519 1.00 47.29 ? 2385 HOH A O   1 
HETATM 6482 O  O   . HOH T 9 .   ? 29.490  30.571 15.467 1.00 51.49 ? 2386 HOH A O   1 
HETATM 6483 O  O   . HOH T 9 .   ? 37.463  29.620 47.830 1.00 48.77 ? 2387 HOH A O   1 
HETATM 6484 O  O   . HOH T 9 .   ? -0.180  29.832 45.164 1.00 54.57 ? 2388 HOH A O   1 
HETATM 6485 O  O   . HOH T 9 .   ? 0.905   64.003 38.621 1.00 46.42 ? 2389 HOH A O   1 
HETATM 6486 O  O   . HOH T 9 .   ? 2.264   28.544 65.719 1.00 54.82 ? 2390 HOH A O   1 
HETATM 6487 O  O   . HOH T 9 .   ? -5.235  36.376 40.914 1.00 50.27 ? 2391 HOH A O   1 
HETATM 6488 O  O   . HOH T 9 .   ? 34.869  55.888 51.063 1.00 47.72 ? 2392 HOH A O   1 
HETATM 6489 O  O   . HOH T 9 .   ? 27.796  40.730 9.640  1.00 56.96 ? 2393 HOH A O   1 
HETATM 6490 O  O   . HOH T 9 .   ? 21.448  67.163 69.990 1.00 43.91 ? 2394 HOH A O   1 
HETATM 6491 O  O   . HOH T 9 .   ? 20.152  64.246 26.094 1.00 47.16 ? 2395 HOH A O   1 
HETATM 6492 O  O   . HOH T 9 .   ? 13.749  82.773 30.054 1.00 55.53 ? 2396 HOH A O   1 
HETATM 6493 O  O   . HOH T 9 .   ? 11.734  50.055 19.666 1.00 50.28 ? 2397 HOH A O   1 
HETATM 6494 O  O   . HOH T 9 .   ? 12.750  23.458 15.887 1.00 55.98 ? 2398 HOH A O   1 
HETATM 6495 O  O   . HOH T 9 .   ? 33.188  39.803 65.976 1.00 49.07 ? 2399 HOH A O   1 
HETATM 6496 O  O   . HOH T 9 .   ? 29.167  67.374 39.282 1.00 49.62 ? 2400 HOH A O   1 
HETATM 6497 O  O   . HOH T 9 .   ? 15.706  78.451 72.346 1.00 48.58 ? 2401 HOH A O   1 
HETATM 6498 O  O   . HOH T 9 .   ? 2.445   33.775 24.352 1.00 51.77 ? 2402 HOH A O   1 
HETATM 6499 O  O   . HOH T 9 .   ? 29.133  28.035 59.752 1.00 46.50 ? 2403 HOH A O   1 
HETATM 6500 O  O   . HOH T 9 .   ? 22.406  58.860 70.161 1.00 51.72 ? 2404 HOH A O   1 
HETATM 6501 O  O   . HOH T 9 .   ? 25.736  63.242 39.292 1.00 47.22 ? 2405 HOH A O   1 
HETATM 6502 O  O   . HOH T 9 .   ? 6.013   49.306 24.509 1.00 55.22 ? 2406 HOH A O   1 
HETATM 6503 O  O   . HOH T 9 .   ? 35.272  25.869 40.636 1.00 42.84 ? 2407 HOH A O   1 
HETATM 6504 O  O   . HOH T 9 .   ? 39.415  51.081 52.082 1.00 43.12 ? 2408 HOH A O   1 
HETATM 6505 O  O   . HOH T 9 .   ? 23.739  47.605 42.477 1.00 51.34 ? 2409 HOH A O   1 
HETATM 6506 O  O   . HOH T 9 .   ? 24.923  43.184 71.743 1.00 48.01 ? 2410 HOH A O   1 
HETATM 6507 O  O   . HOH T 9 .   ? 36.910  27.930 31.949 1.00 54.87 ? 2411 HOH A O   1 
HETATM 6508 O  O   . HOH T 9 .   ? 9.293   81.482 58.921 1.00 47.93 ? 2412 HOH A O   1 
HETATM 6509 O  O   . HOH T 9 .   ? 6.215   26.879 40.856 1.00 56.48 ? 2413 HOH A O   1 
HETATM 6510 O  O   . HOH T 9 .   ? 18.213  69.622 77.833 1.00 54.91 ? 2414 HOH A O   1 
HETATM 6511 O  O   . HOH T 9 .   ? 32.299  57.966 26.750 1.00 52.47 ? 2415 HOH A O   1 
HETATM 6512 O  O   . HOH T 9 .   ? 6.874   22.026 57.225 1.00 61.29 ? 2416 HOH A O   1 
HETATM 6513 O  O   . HOH T 9 .   ? 30.983  29.339 11.650 1.00 54.14 ? 2417 HOH A O   1 
HETATM 6514 O  O   . HOH T 9 .   ? 20.418  57.236 21.118 1.00 48.89 ? 2418 HOH A O   1 
HETATM 6515 O  O   . HOH T 9 .   ? 31.670  56.963 31.651 1.00 47.86 ? 2419 HOH A O   1 
HETATM 6516 O  O   . HOH T 9 .   ? -2.008  40.990 30.777 1.00 50.80 ? 2420 HOH A O   1 
HETATM 6517 O  O   . HOH T 9 .   ? 28.783  22.908 33.014 1.00 43.54 ? 2421 HOH A O   1 
HETATM 6518 O  O   . HOH T 9 .   ? 19.880  22.010 26.840 1.00 40.99 ? 2422 HOH A O   1 
HETATM 6519 O  O   . HOH T 9 .   ? 39.623  42.479 14.579 1.00 45.73 ? 2423 HOH A O   1 
HETATM 6520 O  O   . HOH T 9 .   ? 7.023   78.109 69.269 1.00 54.53 ? 2424 HOH A O   1 
HETATM 6521 O  O   . HOH T 9 .   ? 40.855  44.805 29.567 1.00 57.86 ? 2425 HOH A O   1 
HETATM 6522 O  O   . HOH T 9 .   ? 35.865  34.237 51.094 1.00 52.83 ? 2426 HOH A O   1 
HETATM 6523 O  O   . HOH T 9 .   ? 29.953  69.546 52.853 1.00 49.92 ? 2427 HOH A O   1 
HETATM 6524 O  O   . HOH T 9 .   ? 18.304  70.586 81.539 1.00 65.54 ? 2428 HOH A O   1 
HETATM 6525 O  O   . HOH T 9 .   ? 15.098  70.533 76.960 1.00 49.92 ? 2429 HOH A O   1 
HETATM 6526 O  O   . HOH T 9 .   ? 10.240  33.366 70.294 1.00 58.31 ? 2430 HOH A O   1 
HETATM 6527 O  O   . HOH T 9 .   ? 0.098   57.743 35.693 1.00 46.98 ? 2431 HOH A O   1 
HETATM 6528 O  O   . HOH T 9 .   ? 18.559  85.031 52.345 1.00 52.22 ? 2432 HOH A O   1 
HETATM 6529 O  O   . HOH T 9 .   ? 27.822  31.591 66.265 1.00 60.28 ? 2433 HOH A O   1 
HETATM 6530 O  O   . HOH T 9 .   ? -3.507  48.217 56.032 1.00 56.30 ? 2434 HOH A O   1 
HETATM 6531 O  O   . HOH T 9 .   ? 31.025  24.440 55.636 1.00 50.46 ? 2435 HOH A O   1 
HETATM 6532 O  O   . HOH T 9 .   ? 37.144  59.954 57.076 1.00 56.19 ? 2436 HOH A O   1 
HETATM 6533 O  O   . HOH T 9 .   ? 32.308  37.444 66.716 1.00 41.37 ? 2437 HOH A O   1 
HETATM 6534 O  O   . HOH T 9 .   ? 15.629  86.232 31.161 1.00 56.31 ? 2438 HOH A O   1 
HETATM 6535 O  O   . HOH T 9 .   ? 32.558  85.026 32.582 1.00 49.41 ? 2439 HOH A O   1 
HETATM 6536 O  O   . HOH T 9 .   ? 35.945  37.813 57.159 1.00 51.34 ? 2440 HOH A O   1 
HETATM 6537 O  O   . HOH T 9 .   ? 24.505  58.219 44.018 1.00 49.33 ? 2441 HOH A O   1 
HETATM 6538 O  O   . HOH T 9 .   ? 37.452  41.461 53.339 1.00 55.77 ? 2442 HOH A O   1 
HETATM 6539 O  O   . HOH T 9 .   ? 24.155  21.970 31.539 1.00 50.59 ? 2443 HOH A O   1 
HETATM 6540 O  O   . HOH T 9 .   ? 16.596  85.330 46.127 1.00 49.57 ? 2444 HOH A O   1 
HETATM 6541 O  O   . HOH T 9 .   ? 25.651  44.255 45.289 1.00 39.42 ? 2445 HOH A O   1 
HETATM 6542 O  O   . HOH T 9 .   ? 36.570  39.305 15.367 1.00 46.61 ? 2446 HOH A O   1 
HETATM 6543 O  O   . HOH T 9 .   ? 38.144  34.174 48.593 1.00 53.69 ? 2447 HOH A O   1 
HETATM 6544 O  O   . HOH T 9 .   ? -6.822  45.063 49.726 1.00 51.20 ? 2448 HOH A O   1 
HETATM 6545 O  O   . HOH T 9 .   ? 26.144  82.369 48.412 1.00 59.28 ? 2449 HOH A O   1 
HETATM 6546 O  O   . HOH T 9 .   ? -3.752  35.919 34.865 1.00 50.57 ? 2450 HOH A O   1 
HETATM 6547 O  O   . HOH T 9 .   ? 8.963   54.080 31.558 1.00 52.45 ? 2451 HOH A O   1 
HETATM 6548 O  O   . HOH T 9 .   ? 4.902   42.685 25.580 1.00 51.07 ? 2452 HOH A O   1 
HETATM 6549 O  O   . HOH T 9 .   ? 21.287  23.548 20.821 1.00 50.19 ? 2453 HOH A O   1 
HETATM 6550 O  O   . HOH T 9 .   ? 18.026  24.084 36.340 1.00 49.03 ? 2454 HOH A O   1 
HETATM 6551 O  O   . HOH T 9 .   ? 25.574  59.938 35.826 1.00 57.64 ? 2455 HOH A O   1 
HETATM 6552 O  O   . HOH T 9 .   ? 33.786  54.249 28.796 1.00 49.48 ? 2456 HOH A O   1 
HETATM 6553 O  O   . HOH T 9 .   ? 11.884  74.368 20.115 1.00 53.16 ? 2457 HOH A O   1 
HETATM 6554 O  O   . HOH T 9 .   ? 28.570  66.638 36.584 1.00 51.04 ? 2458 HOH A O   1 
HETATM 6555 O  O   . HOH T 9 .   ? 24.564  32.723 72.352 1.00 56.27 ? 2459 HOH A O   1 
HETATM 6556 O  O   . HOH T 9 .   ? 15.620  30.517 67.836 1.00 53.06 ? 2460 HOH A O   1 
HETATM 6557 O  O   . HOH T 9 .   ? 9.388   28.891 17.785 1.00 55.42 ? 2461 HOH A O   1 
HETATM 6558 O  O   . HOH T 9 .   ? 13.152  29.860 14.771 1.00 50.59 ? 2462 HOH A O   1 
HETATM 6559 O  O   . HOH T 9 .   ? 19.457  86.739 47.405 1.00 51.98 ? 2463 HOH A O   1 
HETATM 6560 O  O   . HOH T 9 .   ? 14.643  57.736 19.999 1.00 56.03 ? 2464 HOH A O   1 
HETATM 6561 O  O   . HOH T 9 .   ? 3.555   34.675 70.938 1.00 56.42 ? 2465 HOH A O   1 
HETATM 6562 O  O   . HOH T 9 .   ? 41.112  56.358 56.064 1.00 51.93 ? 2466 HOH A O   1 
HETATM 6563 O  O   . HOH T 9 .   ? 19.245  18.198 40.190 1.00 50.22 ? 2467 HOH A O   1 
HETATM 6564 O  O   . HOH T 9 .   ? 8.852   92.181 55.781 1.00 50.39 ? 2468 HOH A O   1 
HETATM 6565 O  O   . HOH T 9 .   ? 23.048  79.831 60.538 1.00 53.51 ? 2469 HOH A O   1 
HETATM 6566 O  O   . HOH T 9 .   ? 3.905   25.392 28.523 1.00 56.70 ? 2470 HOH A O   1 
HETATM 6567 O  O   . HOH T 9 .   ? 16.825  57.571 73.472 1.00 47.91 ? 2471 HOH A O   1 
HETATM 6568 O  O   . HOH T 9 .   ? 2.399   26.911 63.422 1.00 57.49 ? 2472 HOH A O   1 
HETATM 6569 O  O   . HOH T 9 .   ? 10.389  82.740 56.737 1.00 52.47 ? 2473 HOH A O   1 
HETATM 6570 O  O   . HOH T 9 .   ? 13.667  55.238 33.248 1.00 51.43 ? 2474 HOH A O   1 
HETATM 6571 O  O   . HOH T 9 .   ? -9.172  43.597 35.764 1.00 55.21 ? 2475 HOH A O   1 
HETATM 6572 O  O   . HOH T 9 .   ? 38.110  52.620 17.014 1.00 55.49 ? 2476 HOH A O   1 
HETATM 6573 O  O   . HOH T 9 .   ? 13.891  49.191 29.941 1.00 48.78 ? 2477 HOH A O   1 
HETATM 6574 O  O   . HOH T 9 .   ? 12.172  98.801 45.456 1.00 56.51 ? 2478 HOH A O   1 
HETATM 6575 O  O   . HOH T 9 .   ? -8.197  42.639 50.545 1.00 59.14 ? 2479 HOH A O   1 
HETATM 6576 O  O   . HOH T 9 .   ? 39.866  40.854 34.747 1.00 53.21 ? 2480 HOH A O   1 
HETATM 6577 O  O   . HOH T 9 .   ? 0.182   31.862 41.236 1.00 51.50 ? 2481 HOH A O   1 
HETATM 6578 O  O   . HOH T 9 .   ? -4.467  42.079 55.010 1.00 47.49 ? 2482 HOH A O   1 
HETATM 6579 O  O   . HOH T 9 .   ? -3.494  32.797 42.755 1.00 54.01 ? 2483 HOH A O   1 
HETATM 6580 O  O   . HOH T 9 .   ? -2.333  39.898 69.921 1.00 57.72 ? 2484 HOH A O   1 
HETATM 6581 O  O   . HOH T 9 .   ? 12.614  83.393 60.358 1.00 59.24 ? 2485 HOH A O   1 
HETATM 6582 O  O   . HOH T 9 .   ? -7.080  40.299 38.182 1.00 56.28 ? 2486 HOH A O   1 
HETATM 6583 O  O   . HOH T 9 .   ? -5.332  39.402 33.025 1.00 48.88 ? 2487 HOH A O   1 
HETATM 6584 O  O   . HOH T 9 .   ? 28.417  38.979 69.550 1.00 50.10 ? 2488 HOH A O   1 
HETATM 6585 O  O   . HOH T 9 .   ? -14.417 45.191 39.666 1.00 50.14 ? 2489 HOH A O   1 
HETATM 6586 O  O   . HOH T 9 .   ? 35.271  56.043 26.368 1.00 52.96 ? 2490 HOH A O   1 
HETATM 6587 O  O   . HOH T 9 .   ? -8.314  48.508 30.293 1.00 49.49 ? 2491 HOH A O   1 
HETATM 6588 O  O   . HOH T 9 .   ? 21.729  41.694 46.536 1.00 44.32 ? 2492 HOH A O   1 
HETATM 6589 O  O   . HOH T 9 .   ? 26.924  52.455 11.526 1.00 55.62 ? 2493 HOH A O   1 
HETATM 6590 O  O   . HOH T 9 .   ? 28.749  78.991 47.270 1.00 53.42 ? 2494 HOH A O   1 
HETATM 6591 O  O   . HOH T 9 .   ? 25.731  25.654 46.715 1.00 36.26 ? 2495 HOH A O   1 
HETATM 6592 O  O   . HOH T 9 .   ? 18.017  21.286 39.189 1.00 38.75 ? 2496 HOH A O   1 
HETATM 6593 O  O   . HOH T 9 .   ? 20.335  61.854 27.577 1.00 46.25 ? 2497 HOH A O   1 
HETATM 6594 O  O   . HOH T 9 .   ? 14.146  72.073 26.016 1.00 49.28 ? 2498 HOH A O   1 
HETATM 6595 O  O   . HOH T 9 .   ? 16.119  20.805 42.541 1.00 43.47 ? 2499 HOH A O   1 
HETATM 6596 O  O   . HOH T 9 .   ? 26.456  58.076 42.287 1.00 49.36 ? 2500 HOH A O   1 
HETATM 6597 O  O   . HOH T 9 .   ? 13.455  30.943 66.804 1.00 42.87 ? 2501 HOH A O   1 
HETATM 6598 O  O   . HOH T 9 .   ? 39.196  39.964 14.983 1.00 47.39 ? 2502 HOH A O   1 
HETATM 6599 O  O   . HOH T 9 .   ? -2.164  49.966 59.879 1.00 55.82 ? 2503 HOH A O   1 
HETATM 6600 O  O   . HOH T 9 .   ? 23.182  60.487 17.404 1.00 53.28 ? 2504 HOH A O   1 
HETATM 6601 O  O   . HOH T 9 .   ? 15.233  23.028 43.530 1.00 43.59 ? 2505 HOH A O   1 
HETATM 6602 O  O   . HOH T 9 .   ? 27.752  24.911 59.691 1.00 45.42 ? 2506 HOH A O   1 
HETATM 6603 O  O   . HOH T 9 .   ? -7.415  53.297 31.462 1.00 45.19 ? 2507 HOH A O   1 
HETATM 6604 O  O   . HOH T 9 .   ? 19.020  21.683 24.341 1.00 44.35 ? 2508 HOH A O   1 
HETATM 6605 O  O   . HOH T 9 .   ? 4.511   75.754 72.173 1.00 55.95 ? 2509 HOH A O   1 
HETATM 6606 O  O   . HOH T 9 .   ? 3.900   25.883 19.644 1.00 54.48 ? 2510 HOH A O   1 
HETATM 6607 O  O   . HOH T 9 .   ? 31.488  27.587 24.819 1.00 53.84 ? 2511 HOH A O   1 
HETATM 6608 O  O   . HOH T 9 .   ? -6.538  52.205 33.809 1.00 49.42 ? 2512 HOH A O   1 
HETATM 6609 O  O   . HOH T 9 .   ? 27.239  22.742 30.405 1.00 52.68 ? 2513 HOH A O   1 
HETATM 6610 O  O   . HOH T 9 .   ? 1.958   46.068 77.129 1.00 56.12 ? 2514 HOH A O   1 
HETATM 6611 O  O   . HOH T 9 .   ? 3.936   61.816 32.879 1.00 52.88 ? 2515 HOH A O   1 
HETATM 6612 O  O   . HOH T 9 .   ? 18.087  85.556 54.813 1.00 44.57 ? 2516 HOH A O   1 
HETATM 6613 O  O   . HOH T 9 .   ? 17.462  21.490 28.051 1.00 53.88 ? 2517 HOH A O   1 
HETATM 6614 O  O   . HOH T 9 .   ? 13.589  58.736 32.778 1.00 44.97 ? 2518 HOH A O   1 
HETATM 6615 O  O   . HOH T 9 .   ? 18.019  25.893 21.421 1.00 53.16 ? 2519 HOH A O   1 
HETATM 6616 O  O   . HOH T 9 .   ? 19.713  20.441 16.546 1.00 53.01 ? 2520 HOH A O   1 
HETATM 6617 O  O   . HOH T 9 .   ? 27.154  83.061 37.786 1.00 37.69 ? 2521 HOH A O   1 
HETATM 6618 O  O   . HOH T 9 .   ? 12.875  25.695 20.439 1.00 55.48 ? 2522 HOH A O   1 
HETATM 6619 O  O   . HOH T 9 .   ? 4.539   24.750 48.242 1.00 61.22 ? 2523 HOH A O   1 
HETATM 6620 O  O   . HOH T 9 .   ? 27.142  57.376 39.811 1.00 48.12 ? 2524 HOH A O   1 
HETATM 6621 O  O   . HOH T 9 .   ? 15.770  18.420 41.850 1.00 54.40 ? 2525 HOH A O   1 
HETATM 6622 O  O   . HOH T 9 .   ? 15.798  49.950 11.194 1.00 58.61 ? 2526 HOH A O   1 
HETATM 6623 O  O   . HOH T 9 .   ? 19.771  47.724 44.020 1.00 42.22 ? 2527 HOH A O   1 
HETATM 6624 O  O   . HOH T 9 .   ? 25.426  59.092 39.163 1.00 48.76 ? 2528 HOH A O   1 
HETATM 6625 O  O   . HOH T 9 .   ? 41.500  43.004 16.258 1.00 54.21 ? 2529 HOH A O   1 
HETATM 6626 O  O   . HOH T 9 .   ? 17.740  63.879 72.247 1.00 52.79 ? 2530 HOH A O   1 
HETATM 6627 O  O   . HOH T 9 .   ? 41.686  48.017 20.962 1.00 51.15 ? 2531 HOH A O   1 
HETATM 6628 O  O   . HOH T 9 .   ? 26.051  26.528 63.925 1.00 58.94 ? 2532 HOH A O   1 
HETATM 6629 O  O   . HOH T 9 .   ? 18.482  83.000 22.329 1.00 54.94 ? 2533 HOH A O   1 
HETATM 6630 O  O   . HOH T 9 .   ? 1.927   22.365 23.472 1.00 53.75 ? 2534 HOH A O   1 
HETATM 6631 O  O   . HOH T 9 .   ? 4.932   24.139 44.489 1.00 43.90 ? 2535 HOH A O   1 
HETATM 6632 O  O   . HOH T 9 .   ? 17.487  89.647 31.536 1.00 53.03 ? 2536 HOH A O   1 
HETATM 6633 O  O   . HOH T 9 .   ? 5.837   83.025 67.791 1.00 56.25 ? 2537 HOH A O   1 
HETATM 6634 O  O   . HOH T 9 .   ? 23.298  76.037 23.436 1.00 59.84 ? 2538 HOH A O   1 
HETATM 6635 O  O   . HOH T 9 .   ? 22.980  48.620 47.140 1.00 44.92 ? 2539 HOH A O   1 
HETATM 6636 O  O   . HOH T 9 .   ? 32.277  36.573 69.369 1.00 57.15 ? 2540 HOH A O   1 
HETATM 6637 O  O   . HOH T 9 .   ? 0.578   41.414 24.535 1.00 57.57 ? 2541 HOH A O   1 
HETATM 6638 O  O   . HOH T 9 .   ? -0.240  65.052 66.292 0.50 23.01 ? 2542 HOH A O   1 
HETATM 6639 O  O   . HOH T 9 .   ? 31.303  66.898 48.279 0.50 47.74 ? 2543 HOH A O   1 
HETATM 6640 O  O   . HOH T 9 .   ? 5.623   52.337 29.176 0.50 40.15 ? 2544 HOH A O   1 
HETATM 6641 O  O   . HOH T 9 .   ? 19.019  74.294 73.684 0.50 34.05 ? 2545 HOH A O   1 
HETATM 6642 O  O   . HOH T 9 .   ? 23.894  70.298 76.423 0.50 41.10 ? 2546 HOH A O   1 
HETATM 6643 O  O   . HOH T 9 .   ? 15.757  22.842 29.191 0.50 33.60 ? 2547 HOH A O   1 
HETATM 6644 O  O   . HOH T 9 .   ? 9.577   47.292 80.380 0.50 36.10 ? 2548 HOH A O   1 
HETATM 6645 O  O   . HOH T 9 .   ? 13.105  17.671 10.618 0.50 38.87 ? 2549 HOH A O   1 
HETATM 6646 O  O   . HOH T 9 .   ? 13.122  36.591 12.358 0.50 38.09 ? 2550 HOH A O   1 
HETATM 6647 O  O   . HOH T 9 .   ? 27.643  24.860 18.560 0.50 39.72 ? 2551 HOH A O   1 
HETATM 6648 O  O   . HOH T 9 .   ? 15.890  21.692 20.006 0.50 39.96 ? 2552 HOH A O   1 
HETATM 6649 O  O   . HOH T 9 .   ? 23.994  57.074 13.935 0.50 35.27 ? 2553 HOH A O   1 
HETATM 6650 O  O   . HOH T 9 .   ? 40.686  45.018 50.988 0.50 44.06 ? 2554 HOH A O   1 
HETATM 6651 O  O   . HOH T 9 .   ? 3.071   30.444 69.572 0.50 46.73 ? 2555 HOH A O   1 
HETATM 6652 O  O   . HOH T 9 .   ? 38.598  36.182 19.072 0.50 44.77 ? 2556 HOH A O   1 
HETATM 6653 O  O   . HOH T 9 .   ? 28.948  77.860 44.877 0.50 34.64 ? 2557 HOH A O   1 
HETATM 6654 O  O   . HOH T 9 .   ? 0.400   23.989 21.671 0.50 37.70 ? 2558 HOH A O   1 
HETATM 6655 O  O   . HOH T 9 .   ? 28.021  66.227 73.991 0.50 31.84 ? 2559 HOH A O   1 
HETATM 6656 O  O   . HOH T 9 .   ? 14.437  21.363 18.191 0.50 37.83 ? 2560 HOH A O   1 
HETATM 6657 O  O   . HOH T 9 .   ? 33.110  60.610 68.835 0.50 42.26 ? 2561 HOH A O   1 
HETATM 6658 O  O   . HOH T 9 .   ? 18.757  58.621 19.551 0.50 36.98 ? 2562 HOH A O   1 
HETATM 6659 O  O   . HOH T 9 .   ? -0.430  37.805 66.696 0.50 43.07 ? 2563 HOH A O   1 
HETATM 6660 O  O   . HOH T 9 .   ? 4.794   31.052 22.369 0.50 36.95 ? 2564 HOH A O   1 
HETATM 6661 O  O   . HOH T 9 .   ? 28.045  60.010 70.638 0.50 41.04 ? 2565 HOH A O   1 
HETATM 6662 O  O   . HOH T 9 .   ? 15.659  34.743 74.870 0.50 41.67 ? 2566 HOH A O   1 
HETATM 6663 O  O   . HOH T 9 .   ? 27.129  64.291 16.442 0.50 41.16 ? 2567 HOH A O   1 
HETATM 6664 O  O   . HOH T 9 .   ? 12.168  72.246 21.454 0.50 39.13 ? 2568 HOH A O   1 
HETATM 6665 O  O   . HOH T 9 .   ? 7.117   27.745 38.719 0.50 39.24 ? 2569 HOH A O   1 
HETATM 6666 O  O   . HOH T 9 .   ? 14.055  86.739 58.554 0.50 43.34 ? 2570 HOH A O   1 
HETATM 6667 O  O   . HOH T 9 .   ? 29.523  65.595 30.525 0.50 37.03 ? 2571 HOH A O   1 
HETATM 6668 O  O   . HOH T 9 .   ? 18.372  50.526 7.631  0.50 45.94 ? 2572 HOH A O   1 
HETATM 6669 O  O   . HOH T 9 .   ? 30.680  61.868 29.758 0.50 38.42 ? 2573 HOH A O   1 
HETATM 6670 O  O   . HOH T 9 .   ? 6.469   25.249 63.626 0.50 34.31 ? 2574 HOH A O   1 
HETATM 6671 O  O   . HOH T 9 .   ? 27.836  69.806 60.707 0.50 43.32 ? 2575 HOH A O   1 
HETATM 6672 O  O   . HOH T 9 .   ? 33.591  62.160 14.952 0.50 34.96 ? 2576 HOH A O   1 
HETATM 6673 O  O   . HOH T 9 .   ? 41.357  53.650 63.309 0.50 40.10 ? 2577 HOH A O   1 
HETATM 6674 O  O   . HOH T 9 .   ? 43.534  40.123 64.423 0.50 45.65 ? 2578 HOH A O   1 
HETATM 6675 O  O   . HOH T 9 .   ? 11.139  21.133 59.260 0.50 37.11 ? 2579 HOH A O   1 
HETATM 6676 O  O   . HOH T 9 .   ? 39.832  57.744 26.339 0.50 43.17 ? 2580 HOH A O   1 
HETATM 6677 O  O   . HOH T 9 .   ? 2.020   69.712 82.546 0.50 33.89 ? 2581 HOH A O   1 
HETATM 6678 O  O   . HOH T 9 .   ? 0.901   26.435 54.814 0.50 39.54 ? 2582 HOH A O   1 
HETATM 6679 O  O   . HOH T 9 .   ? 21.609  52.037 9.325  0.50 40.76 ? 2583 HOH A O   1 
HETATM 6680 O  O   . HOH T 9 .   ? 26.022  71.136 20.219 0.50 35.55 ? 2584 HOH A O   1 
HETATM 6681 O  O   . HOH T 9 .   ? -1.633  53.380 23.831 0.50 36.87 ? 2585 HOH A O   1 
HETATM 6682 O  O   . HOH T 9 .   ? 4.933   32.333 74.323 0.50 43.12 ? 2586 HOH A O   1 
HETATM 6683 O  O   . HOH T 9 .   ? 35.194  31.486 15.306 0.50 42.48 ? 2587 HOH A O   1 
HETATM 6684 O  O   . HOH T 9 .   ? 34.132  44.513 9.542  0.50 38.75 ? 2588 HOH A O   1 
HETATM 6685 O  O   . HOH T 9 .   ? 35.480  46.345 36.223 0.50 36.30 ? 2589 HOH A O   1 
HETATM 6686 O  O   . HOH T 9 .   ? 16.916  56.023 17.065 0.50 34.49 ? 2590 HOH A O   1 
HETATM 6687 O  O   . HOH T 9 .   ? 36.631  40.023 65.948 0.50 34.73 ? 2591 HOH A O   1 
HETATM 6688 O  O   . HOH T 9 .   ? 43.112  49.114 63.922 0.50 33.10 ? 2592 HOH A O   1 
HETATM 6689 O  O   . HOH T 9 .   ? 13.244  23.949 61.532 0.50 36.98 ? 2593 HOH A O   1 
HETATM 6690 O  O   . HOH T 9 .   ? 16.337  22.186 33.363 0.50 33.47 ? 2594 HOH A O   1 
HETATM 6691 O  O   . HOH T 9 .   ? 2.820   49.198 77.602 0.50 36.63 ? 2595 HOH A O   1 
HETATM 6692 O  O   . HOH T 9 .   ? 9.522   83.914 69.827 0.50 34.14 ? 2596 HOH A O   1 
HETATM 6693 O  O   . HOH T 9 .   ? 1.917   53.501 29.797 0.50 35.05 ? 2597 HOH A O   1 
HETATM 6694 O  O   . HOH T 9 .   ? 35.699  50.343 35.943 0.50 39.34 ? 2598 HOH A O   1 
HETATM 6695 O  O   . HOH T 9 .   ? 7.594   35.656 18.998 0.50 41.39 ? 2599 HOH A O   1 
HETATM 6696 O  O   . HOH T 9 .   ? 18.202  74.606 78.061 0.50 33.58 ? 2600 HOH A O   1 
HETATM 6697 O  O   . HOH T 9 .   ? 18.914  42.824 9.963  0.50 42.37 ? 2601 HOH A O   1 
HETATM 6698 O  O   . HOH T 9 .   ? 24.816  47.808 37.679 0.50 31.71 ? 2602 HOH A O   1 
HETATM 6699 O  O   . HOH T 9 .   ? 30.159  75.821 50.404 0.50 34.78 ? 2603 HOH A O   1 
HETATM 6700 O  O   . HOH T 9 .   ? 10.501  65.171 77.516 0.50 19.89 ? 2604 HOH A O   1 
HETATM 6701 O  O   . HOH T 9 .   ? 4.311   86.676 66.992 0.50 39.25 ? 2605 HOH A O   1 
HETATM 6702 O  O   . HOH T 9 .   ? 7.114   64.367 77.398 0.50 33.49 ? 2606 HOH A O   1 
HETATM 6703 O  O   . HOH T 9 .   ? 19.968  70.840 78.277 0.50 34.47 ? 2607 HOH A O   1 
HETATM 6704 O  O   . HOH T 9 .   ? 18.604  67.944 81.465 0.50 37.64 ? 2608 HOH A O   1 
HETATM 6705 O  O   . HOH T 9 .   ? 6.982   25.122 48.918 0.50 38.37 ? 2609 HOH A O   1 
HETATM 6706 O  O   . HOH T 9 .   ? 29.096  67.784 58.625 0.50 34.50 ? 2610 HOH A O   1 
HETATM 6707 O  O   . HOH T 9 .   ? 33.826  26.901 36.691 0.50 38.24 ? 2611 HOH A O   1 
HETATM 6708 O  O   . HOH T 9 .   ? 34.046  82.068 32.932 0.50 35.81 ? 2612 HOH A O   1 
HETATM 6709 O  O   . HOH T 9 .   ? 11.553  52.561 28.783 0.50 39.12 ? 2613 HOH A O   1 
HETATM 6710 O  O   . HOH T 9 .   ? 27.275  81.211 46.214 0.50 42.34 ? 2614 HOH A O   1 
HETATM 6711 O  O   . HOH T 9 .   ? 4.694   34.404 76.975 0.50 42.46 ? 2615 HOH A O   1 
HETATM 6712 O  O   . HOH T 9 .   ? 35.165  60.140 66.722 0.50 46.34 ? 2616 HOH A O   1 
HETATM 6713 O  O   . HOH T 9 .   ? 38.754  46.032 14.331 0.50 42.09 ? 2617 HOH A O   1 
HETATM 6714 O  O   . HOH T 9 .   ? 16.279  84.506 37.612 0.50 37.36 ? 2618 HOH A O   1 
HETATM 6715 O  O   . HOH T 9 .   ? 16.092  90.226 53.189 0.50 42.03 ? 2619 HOH A O   1 
HETATM 6716 O  O   . HOH T 9 .   ? 18.459  67.475 79.175 0.50 43.77 ? 2620 HOH A O   1 
HETATM 6717 O  O   . HOH T 9 .   ? 3.499   48.967 27.149 0.50 37.11 ? 2621 HOH A O   1 
HETATM 6718 O  O   . HOH T 9 .   ? 28.196  77.795 55.302 0.50 53.86 ? 2622 HOH A O   1 
HETATM 6719 O  O   . HOH T 9 .   ? 35.055  45.565 43.213 0.50 40.22 ? 2623 HOH A O   1 
HETATM 6720 O  O   . HOH T 9 .   ? 26.203  76.726 59.342 0.50 39.45 ? 2624 HOH A O   1 
HETATM 6721 O  O   . HOH T 9 .   ? 1.006   49.843 77.023 0.50 37.79 ? 2625 HOH A O   1 
HETATM 6722 O  O   . HOH T 9 .   ? 29.795  22.455 56.667 0.50 44.17 ? 2626 HOH A O   1 
HETATM 6723 O  O   . HOH T 9 .   ? 9.478   28.952 65.083 0.50 34.94 ? 2627 HOH A O   1 
HETATM 6724 O  O   . HOH T 9 .   ? 28.165  80.955 52.941 0.50 36.38 ? 2628 HOH A O   1 
HETATM 6725 O  O   . HOH T 9 .   ? 44.140  47.807 61.354 0.50 42.64 ? 2629 HOH A O   1 
HETATM 6726 O  O   . HOH T 9 .   ? 24.614  49.765 73.404 0.50 49.75 ? 2630 HOH A O   1 
HETATM 6727 O  O   . HOH T 9 .   ? 18.906  39.620 9.120  0.50 38.73 ? 2631 HOH A O   1 
HETATM 6728 O  O   . HOH T 9 .   ? 20.381  61.899 23.161 0.50 35.52 ? 2632 HOH A O   1 
HETATM 6729 O  O   . HOH T 9 .   ? 30.919  67.347 43.051 0.50 39.99 ? 2633 HOH A O   1 
HETATM 6730 O  O   . HOH T 9 .   ? 25.515  24.799 29.539 0.50 36.25 ? 2634 HOH A O   1 
HETATM 6731 O  O   . HOH T 9 .   ? 16.196  61.517 30.860 0.50 33.28 ? 2635 HOH A O   1 
HETATM 6732 O  O   . HOH T 9 .   ? 15.266  53.743 74.961 0.50 37.33 ? 2636 HOH A O   1 
HETATM 6733 O  O   . HOH T 9 .   ? 12.266  23.008 44.146 0.50 36.39 ? 2637 HOH A O   1 
HETATM 6734 O  O   . HOH T 9 .   ? 33.126  68.572 47.666 0.50 40.89 ? 2638 HOH A O   1 
HETATM 6735 O  O   . HOH T 9 .   ? 12.294  25.890 17.872 0.50 35.13 ? 2639 HOH A O   1 
HETATM 6736 O  O   . HOH T 9 .   ? 29.091  64.210 44.208 0.50 39.27 ? 2640 HOH A O   1 
HETATM 6737 O  O   . HOH T 9 .   ? 0.085   59.335 37.252 0.50 38.92 ? 2641 HOH A O   1 
HETATM 6738 O  O   . HOH T 9 .   ? 21.732  72.029 76.834 0.50 42.66 ? 2642 HOH A O   1 
HETATM 6739 O  O   . HOH T 9 .   ? 10.389  52.839 20.859 0.50 43.45 ? 2643 HOH A O   1 
HETATM 6740 O  O   . HOH T 9 .   ? 15.667  21.534 56.684 0.50 48.06 ? 2644 HOH A O   1 
HETATM 6741 O  O   . HOH T 9 .   ? 15.695  91.235 51.300 0.50 40.35 ? 2645 HOH A O   1 
HETATM 6742 O  O   . HOH T 9 .   ? 27.868  31.004 6.977  0.50 38.18 ? 2646 HOH A O   1 
HETATM 6743 O  O   . HOH T 9 .   ? 4.639   18.859 63.501 0.50 36.91 ? 2647 HOH A O   1 
HETATM 6744 O  O   . HOH T 9 .   ? 16.729  54.862 14.942 0.50 35.98 ? 2648 HOH A O   1 
HETATM 6745 O  O   . HOH T 9 .   ? 8.916   51.151 25.970 0.50 35.73 ? 2649 HOH A O   1 
HETATM 6746 O  O   . HOH T 9 .   ? 33.008  57.286 70.427 0.50 39.98 ? 2650 HOH A O   1 
HETATM 6747 O  O   . HOH T 9 .   ? 28.928  62.548 35.490 0.50 33.54 ? 2651 HOH A O   1 
HETATM 6748 O  O   . HOH T 9 .   ? 44.551  27.860 43.910 0.50 39.22 ? 2652 HOH A O   1 
HETATM 6749 O  O   . HOH T 9 .   ? 16.784  42.416 79.931 0.50 34.01 ? 2653 HOH A O   1 
HETATM 6750 O  O   . HOH T 9 .   ? 11.920  46.490 17.120 0.50 40.21 ? 2654 HOH A O   1 
HETATM 6751 O  O   . HOH T 9 .   ? 24.222  72.533 76.143 0.50 35.62 ? 2655 HOH A O   1 
HETATM 6752 O  O   . HOH T 9 .   ? 37.052  33.265 14.996 0.50 40.85 ? 2656 HOH A O   1 
HETATM 6753 O  O   . HOH T 9 .   ? 17.556  62.160 69.753 0.50 38.06 ? 2657 HOH A O   1 
HETATM 6754 O  O   . HOH T 9 .   ? 6.666   54.438 28.032 0.50 37.00 ? 2658 HOH A O   1 
HETATM 6755 O  O   . HOH T 9 .   ? 31.964  55.047 35.682 0.50 42.98 ? 2659 HOH A O   1 
HETATM 6756 O  O   . HOH T 9 .   ? -1.278  35.944 30.116 0.50 40.31 ? 2660 HOH A O   1 
HETATM 6757 O  O   . HOH T 9 .   ? 0.657   35.478 25.255 0.50 47.22 ? 2661 HOH A O   1 
HETATM 6758 O  O   . HOH T 9 .   ? -6.280  34.623 59.064 0.50 38.00 ? 2662 HOH A O   1 
HETATM 6759 O  O   . HOH T 9 .   ? 11.725  54.835 27.173 0.50 30.02 ? 2663 HOH A O   1 
HETATM 6760 O  O   . HOH T 9 .   ? 25.236  82.012 53.886 0.50 39.92 ? 2664 HOH A O   1 
HETATM 6761 O  O   . HOH T 9 .   ? 11.675  93.427 56.138 0.50 41.05 ? 2665 HOH A O   1 
HETATM 6762 O  O   . HOH T 9 .   ? 1.640   24.908 64.698 0.50 38.49 ? 2666 HOH A O   1 
HETATM 6763 O  O   . HOH T 9 .   ? 10.820  24.420 13.426 0.50 37.70 ? 2667 HOH A O   1 
HETATM 6764 O  O   . HOH T 9 .   ? 7.230   21.269 40.742 0.50 34.95 ? 2668 HOH A O   1 
HETATM 6765 O  O   . HOH T 9 .   ? 39.055  36.224 33.701 0.50 40.18 ? 2669 HOH A O   1 
HETATM 6766 O  O   . HOH T 9 .   ? -2.359  46.517 63.379 0.50 34.50 ? 2670 HOH A O   1 
HETATM 6767 O  O   . HOH T 9 .   ? 40.950  36.783 36.265 0.50 38.35 ? 2671 HOH A O   1 
HETATM 6768 O  O   . HOH T 9 .   ? 30.085  76.092 52.884 0.50 45.02 ? 2672 HOH A O   1 
HETATM 6769 O  O   . HOH T 9 .   ? 33.709  53.359 35.377 0.50 41.69 ? 2673 HOH A O   1 
HETATM 6770 O  O   . HOH T 9 .   ? 6.121   26.698 18.527 0.50 46.83 ? 2674 HOH A O   1 
HETATM 6771 O  O   . HOH T 9 .   ? 16.753  42.499 44.707 1.00 17.43 ? 2675 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
5881 ZN ZN . ZN O . ? 0.2781 0.2545 0.2434 0.0581  0.0101  -0.0559 1751 ZN A ZN 
5882 ZN ZN . ZN P . ? 0.2727 0.1898 0.2313 0.0389  0.0007  -0.0247 1752 ZN A ZN 
5883 CA CA . CA Q . ? 0.2149 0.1764 0.1905 -0.0107 0.0031  -0.0213 1753 CA A CA 
5884 CL CL . CL R . ? 0.2781 0.2341 0.3025 0.0468  -0.0023 -0.0333 1754 CL A CL 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   42  ?   ?   ?   A . n 
A 1 2   SER 2   43  ?   ?   ?   A . n 
A 1 3   LYS 3   44  ?   ?   ?   A . n 
A 1 4   SER 4   45  ?   ?   ?   A . n 
A 1 5   SER 5   46  ?   ?   ?   A . n 
A 1 6   ASN 6   47  ?   ?   ?   A . n 
A 1 7   GLU 7   48  ?   ?   ?   A . n 
A 1 8   ALA 8   49  ?   ?   ?   A . n 
A 1 9   THR 9   50  ?   ?   ?   A . n 
A 1 10  ASN 10  51  ?   ?   ?   A . n 
A 1 11  ILE 11  52  ?   ?   ?   A . n 
A 1 12  THR 12  53  ?   ?   ?   A . n 
A 1 13  PRO 13  54  ?   ?   ?   A . n 
A 1 14  LYS 14  55  55  LYS LYS A . n 
A 1 15  HIS 15  56  56  HIS HIS A . n 
A 1 16  ASN 16  57  57  ASN ASN A . n 
A 1 17  MET 17  58  58  MET MET A . n 
A 1 18  LYS 18  59  59  LYS LYS A . n 
A 1 19  ALA 19  60  60  ALA ALA A . n 
A 1 20  PHE 20  61  61  PHE PHE A . n 
A 1 21  LEU 21  62  62  LEU LEU A . n 
A 1 22  ASP 22  63  63  ASP ASP A . n 
A 1 23  GLU 23  64  64  GLU GLU A . n 
A 1 24  LEU 24  65  65  LEU LEU A . n 
A 1 25  LYS 25  66  66  LYS LYS A . n 
A 1 26  ALA 26  67  67  ALA ALA A . n 
A 1 27  GLU 27  68  68  GLU GLU A . n 
A 1 28  ASN 28  69  69  ASN ASN A . n 
A 1 29  ILE 29  70  70  ILE ILE A . n 
A 1 30  LYS 30  71  71  LYS LYS A . n 
A 1 31  LYS 31  72  72  LYS LYS A . n 
A 1 32  PHE 32  73  73  PHE PHE A . n 
A 1 33  LEU 33  74  74  LEU LEU A . n 
A 1 34  TYR 34  75  75  TYR TYR A . n 
A 1 35  ASN 35  76  76  ASN ASN A . n 
A 1 36  PHE 36  77  77  PHE PHE A . n 
A 1 37  THR 37  78  78  THR THR A . n 
A 1 38  GLN 38  79  79  GLN GLN A . n 
A 1 39  ILE 39  80  80  ILE ILE A . n 
A 1 40  PRO 40  81  81  PRO PRO A . n 
A 1 41  HIS 41  82  82  HIS HIS A . n 
A 1 42  LEU 42  83  83  LEU LEU A . n 
A 1 43  ALA 43  84  84  ALA ALA A . n 
A 1 44  GLY 44  85  85  GLY GLY A . n 
A 1 45  THR 45  86  86  THR THR A . n 
A 1 46  GLU 46  87  87  GLU GLU A . n 
A 1 47  GLN 47  88  88  GLN GLN A . n 
A 1 48  ASN 48  89  89  ASN ASN A . n 
A 1 49  PHE 49  90  90  PHE PHE A . n 
A 1 50  GLN 50  91  91  GLN GLN A . n 
A 1 51  LEU 51  92  92  LEU LEU A . n 
A 1 52  ALA 52  93  93  ALA ALA A . n 
A 1 53  LYS 53  94  94  LYS LYS A . n 
A 1 54  GLN 54  95  95  GLN GLN A . n 
A 1 55  ILE 55  96  96  ILE ILE A . n 
A 1 56  GLN 56  97  97  GLN GLN A . n 
A 1 57  SER 57  98  98  SER SER A . n 
A 1 58  GLN 58  99  99  GLN GLN A . n 
A 1 59  TRP 59  100 100 TRP TRP A . n 
A 1 60  LYS 60  101 101 LYS LYS A . n 
A 1 61  GLU 61  102 102 GLU GLU A . n 
A 1 62  PHE 62  103 103 PHE PHE A . n 
A 1 63  GLY 63  104 104 GLY GLY A . n 
A 1 64  LEU 64  105 105 LEU LEU A . n 
A 1 65  ASP 65  106 106 ASP ASP A . n 
A 1 66  SER 66  107 107 SER SER A . n 
A 1 67  VAL 67  108 108 VAL VAL A . n 
A 1 68  GLU 68  109 109 GLU GLU A . n 
A 1 69  LEU 69  110 110 LEU LEU A . n 
A 1 70  ALA 70  111 111 ALA ALA A . n 
A 1 71  HIS 71  112 112 HIS HIS A . n 
A 1 72  TYR 72  113 113 TYR TYR A . n 
A 1 73  ASP 73  114 114 ASP ASP A . n 
A 1 74  VAL 74  115 115 VAL VAL A . n 
A 1 75  LEU 75  116 116 LEU LEU A . n 
A 1 76  LEU 76  117 117 LEU LEU A . n 
A 1 77  SER 77  118 118 SER SER A . n 
A 1 78  TYR 78  119 119 TYR TYR A . n 
A 1 79  PRO 79  120 120 PRO PRO A . n 
A 1 80  ASN 80  121 121 ASN ASN A . n 
A 1 81  LYS 81  122 122 LYS LYS A . n 
A 1 82  THR 82  123 123 THR THR A . n 
A 1 83  HIS 83  124 124 HIS HIS A . n 
A 1 84  PRO 84  125 125 PRO PRO A . n 
A 1 85  ASN 85  126 126 ASN ASN A . n 
A 1 86  TYR 86  127 127 TYR TYR A . n 
A 1 87  ILE 87  128 128 ILE ILE A . n 
A 1 88  SER 88  129 129 SER SER A . n 
A 1 89  ILE 89  130 130 ILE ILE A . n 
A 1 90  ILE 90  131 131 ILE ILE A . n 
A 1 91  ASN 91  132 132 ASN ASN A . n 
A 1 92  GLU 92  133 133 GLU GLU A . n 
A 1 93  ASP 93  134 134 ASP ASP A . n 
A 1 94  GLY 94  135 135 GLY GLY A . n 
A 1 95  ASN 95  136 136 ASN ASN A . n 
A 1 96  GLU 96  137 137 GLU GLU A . n 
A 1 97  ILE 97  138 138 ILE ILE A . n 
A 1 98  PHE 98  139 139 PHE PHE A . n 
A 1 99  ASN 99  140 140 ASN ASN A . n 
A 1 100 THR 100 141 141 THR THR A . n 
A 1 101 SER 101 142 142 SER SER A . n 
A 1 102 LEU 102 143 143 LEU LEU A . n 
A 1 103 PHE 103 144 144 PHE PHE A . n 
A 1 104 GLU 104 145 145 GLU GLU A . n 
A 1 105 PRO 105 146 146 PRO PRO A . n 
A 1 106 PRO 106 147 147 PRO PRO A . n 
A 1 107 PRO 107 148 148 PRO PRO A . n 
A 1 108 PRO 108 149 149 PRO PRO A . n 
A 1 109 GLY 109 150 150 GLY GLY A . n 
A 1 110 TYR 110 151 151 TYR TYR A . n 
A 1 111 GLU 111 152 ?   ?   ?   A . n 
A 1 112 ASN 112 153 ?   ?   ?   A . n 
A 1 113 VAL 113 154 ?   ?   ?   A . n 
A 1 114 SER 114 155 ?   ?   ?   A . n 
A 1 115 ASP 115 156 156 ASP ASP A . n 
A 1 116 ILE 116 157 157 ILE ILE A . n 
A 1 117 VAL 117 158 158 VAL VAL A . n 
A 1 118 PRO 118 159 159 PRO PRO A . n 
A 1 119 PRO 119 160 160 PRO PRO A . n 
A 1 120 PHE 120 161 161 PHE PHE A . n 
A 1 121 SER 121 162 162 SER SER A . n 
A 1 122 ALA 122 163 163 ALA ALA A . n 
A 1 123 PHE 123 164 164 PHE PHE A . n 
A 1 124 SER 124 165 165 SER SER A . n 
A 1 125 PRO 125 166 166 PRO PRO A . n 
A 1 126 GLN 126 167 167 GLN GLN A . n 
A 1 127 GLY 127 168 168 GLY GLY A . n 
A 1 128 MET 128 169 169 MET MET A . n 
A 1 129 PRO 129 170 170 PRO PRO A . n 
A 1 130 GLU 130 171 171 GLU GLU A . n 
A 1 131 GLY 131 172 172 GLY GLY A . n 
A 1 132 ASP 132 173 173 ASP ASP A . n 
A 1 133 LEU 133 174 174 LEU LEU A . n 
A 1 134 VAL 134 175 175 VAL VAL A . n 
A 1 135 TYR 135 176 176 TYR TYR A . n 
A 1 136 VAL 136 177 177 VAL VAL A . n 
A 1 137 ASN 137 178 178 ASN ASN A . n 
A 1 138 TYR 138 179 179 TYR TYR A . n 
A 1 139 ALA 139 180 180 ALA ALA A . n 
A 1 140 ARG 140 181 181 ARG ARG A . n 
A 1 141 THR 141 182 182 THR THR A . n 
A 1 142 GLU 142 183 183 GLU GLU A . n 
A 1 143 ASP 143 184 184 ASP ASP A . n 
A 1 144 PHE 144 185 185 PHE PHE A . n 
A 1 145 PHE 145 186 186 PHE PHE A . n 
A 1 146 LYS 146 187 187 LYS LYS A . n 
A 1 147 LEU 147 188 188 LEU LEU A . n 
A 1 148 GLU 148 189 189 GLU GLU A . n 
A 1 149 ARG 149 190 190 ARG ARG A . n 
A 1 150 ASP 150 191 191 ASP ASP A . n 
A 1 151 MET 151 192 192 MET MET A . n 
A 1 152 LYS 152 193 193 LYS LYS A . n 
A 1 153 ILE 153 194 194 ILE ILE A . n 
A 1 154 ASN 154 195 195 ASN ASN A . n 
A 1 155 CYS 155 196 196 CYS CYS A . n 
A 1 156 SER 156 197 197 SER SER A . n 
A 1 157 GLY 157 198 198 GLY GLY A . n 
A 1 158 LYS 158 199 199 LYS LYS A . n 
A 1 159 ILE 159 200 200 ILE ILE A . n 
A 1 160 VAL 160 201 201 VAL VAL A . n 
A 1 161 ILE 161 202 202 ILE ILE A . n 
A 1 162 ALA 162 203 203 ALA ALA A . n 
A 1 163 ARG 163 204 204 ARG ARG A . n 
A 1 164 TYR 164 205 205 TYR TYR A . n 
A 1 165 GLY 165 206 206 GLY GLY A . n 
A 1 166 LYS 166 207 207 LYS LYS A . n 
A 1 167 VAL 167 208 208 VAL VAL A . n 
A 1 168 PHE 168 209 209 PHE PHE A . n 
A 1 169 ARG 169 210 210 ARG ARG A . n 
A 1 170 GLY 170 211 211 GLY GLY A . n 
A 1 171 ASN 171 212 212 ASN ASN A . n 
A 1 172 LYS 172 213 213 LYS LYS A . n 
A 1 173 VAL 173 214 214 VAL VAL A . n 
A 1 174 LYS 174 215 215 LYS LYS A . n 
A 1 175 ASN 175 216 216 ASN ASN A . n 
A 1 176 ALA 176 217 217 ALA ALA A . n 
A 1 177 GLN 177 218 218 GLN GLN A . n 
A 1 178 LEU 178 219 219 LEU LEU A . n 
A 1 179 ALA 179 220 220 ALA ALA A . n 
A 1 180 GLY 180 221 221 GLY GLY A . n 
A 1 181 ALA 181 222 222 ALA ALA A . n 
A 1 182 LYS 182 223 223 LYS LYS A . n 
A 1 183 GLY 183 224 224 GLY GLY A . n 
A 1 184 VAL 184 225 225 VAL VAL A . n 
A 1 185 ILE 185 226 226 ILE ILE A . n 
A 1 186 LEU 186 227 227 LEU LEU A . n 
A 1 187 TYR 187 228 228 TYR TYR A . n 
A 1 188 SER 188 229 229 SER SER A . n 
A 1 189 ASP 189 230 230 ASP ASP A . n 
A 1 190 PRO 190 231 231 PRO PRO A . n 
A 1 191 ALA 191 232 232 ALA ALA A . n 
A 1 192 ASP 192 233 233 ASP ASP A . n 
A 1 193 TYR 193 234 234 TYR TYR A . n 
A 1 194 PHE 194 235 235 PHE PHE A . n 
A 1 195 ALA 195 236 236 ALA ALA A . n 
A 1 196 PRO 196 237 237 PRO PRO A . n 
A 1 197 GLY 197 238 238 GLY GLY A . n 
A 1 198 VAL 198 239 239 VAL VAL A . n 
A 1 199 LYS 199 240 240 LYS LYS A . n 
A 1 200 SER 200 241 241 SER SER A . n 
A 1 201 TYR 201 242 242 TYR TYR A . n 
A 1 202 PRO 202 243 243 PRO PRO A . n 
A 1 203 ASP 203 244 244 ASP ASP A . n 
A 1 204 GLY 204 245 245 GLY GLY A . n 
A 1 205 TRP 205 246 246 TRP TRP A . n 
A 1 206 ASN 206 247 247 ASN ASN A . n 
A 1 207 LEU 207 248 248 LEU LEU A . n 
A 1 208 PRO 208 249 249 PRO PRO A . n 
A 1 209 GLY 209 250 250 GLY GLY A . n 
A 1 210 GLY 210 251 251 GLY GLY A . n 
A 1 211 GLY 211 252 252 GLY GLY A . n 
A 1 212 VAL 212 253 253 VAL VAL A . n 
A 1 213 GLN 213 254 254 GLN GLN A . n 
A 1 214 ARG 214 255 255 ARG ARG A . n 
A 1 215 GLY 215 256 256 GLY GLY A . n 
A 1 216 ASN 216 257 257 ASN ASN A . n 
A 1 217 ILE 217 258 258 ILE ILE A . n 
A 1 218 LEU 218 259 259 LEU LEU A . n 
A 1 219 ASN 219 260 260 ASN ASN A . n 
A 1 220 LEU 220 261 261 LEU LEU A . n 
A 1 221 ASN 221 262 262 ASN ASN A . n 
A 1 222 GLY 222 263 263 GLY GLY A . n 
A 1 223 ALA 223 264 264 ALA ALA A . n 
A 1 224 GLY 224 265 265 GLY GLY A . n 
A 1 225 ASP 225 266 266 ASP ASP A . n 
A 1 226 PRO 226 267 267 PRO PRO A . n 
A 1 227 LEU 227 268 268 LEU LEU A . n 
A 1 228 THR 228 269 269 THR THR A . n 
A 1 229 PRO 229 270 270 PRO PRO A . n 
A 1 230 GLY 230 271 271 GLY GLY A . n 
A 1 231 TYR 231 272 272 TYR TYR A . n 
A 1 232 PRO 232 273 273 PRO PRO A . n 
A 1 233 ALA 233 274 274 ALA ALA A . n 
A 1 234 ASN 234 275 275 ASN ASN A . n 
A 1 235 GLU 235 276 276 GLU GLU A . n 
A 1 236 TYR 236 277 277 TYR TYR A . n 
A 1 237 ALA 237 278 278 ALA ALA A . n 
A 1 238 TYR 238 279 279 TYR TYR A . n 
A 1 239 ARG 239 280 280 ARG ARG A . n 
A 1 240 ARG 240 281 281 ARG ARG A . n 
A 1 241 GLY 241 282 282 GLY GLY A . n 
A 1 242 ILE 242 283 283 ILE ILE A . n 
A 1 243 ALA 243 284 284 ALA ALA A . n 
A 1 244 GLU 244 285 285 GLU GLU A . n 
A 1 245 ALA 245 286 286 ALA ALA A . n 
A 1 246 VAL 246 287 287 VAL VAL A . n 
A 1 247 GLY 247 288 288 GLY GLY A . n 
A 1 248 LEU 248 289 289 LEU LEU A . n 
A 1 249 PRO 249 290 290 PRO PRO A . n 
A 1 250 SER 250 291 291 SER SER A . n 
A 1 251 ILE 251 292 292 ILE ILE A . n 
A 1 252 PRO 252 293 293 PRO PRO A . n 
A 1 253 VAL 253 294 294 VAL VAL A . n 
A 1 254 HIS 254 295 295 HIS HIS A . n 
A 1 255 PRO 255 296 296 PRO PRO A . n 
A 1 256 ILE 256 297 297 ILE ILE A . n 
A 1 257 GLY 257 298 298 GLY GLY A . n 
A 1 258 TYR 258 299 299 TYR TYR A . n 
A 1 259 TYR 259 300 300 TYR TYR A . n 
A 1 260 ASP 260 301 301 ASP ASP A . n 
A 1 261 ALA 261 302 302 ALA ALA A . n 
A 1 262 GLN 262 303 303 GLN GLN A . n 
A 1 263 LYS 263 304 304 LYS LYS A . n 
A 1 264 LEU 264 305 305 LEU LEU A . n 
A 1 265 LEU 265 306 306 LEU LEU A . n 
A 1 266 GLU 266 307 307 GLU GLU A . n 
A 1 267 LYS 267 308 308 LYS LYS A . n 
A 1 268 MET 268 309 309 MET MET A . n 
A 1 269 GLY 269 310 310 GLY GLY A . n 
A 1 270 GLY 270 311 311 GLY GLY A . n 
A 1 271 SER 271 312 312 SER SER A . n 
A 1 272 ALA 272 313 313 ALA ALA A . n 
A 1 273 PRO 273 314 314 PRO PRO A . n 
A 1 274 PRO 274 315 315 PRO PRO A . n 
A 1 275 ASP 275 316 316 ASP ASP A . n 
A 1 276 SER 276 317 317 SER SER A . n 
A 1 277 SER 277 318 318 SER SER A . n 
A 1 278 TRP 278 319 319 TRP TRP A . n 
A 1 279 ARG 279 320 320 ARG ARG A . n 
A 1 280 GLY 280 321 321 GLY GLY A . n 
A 1 281 SER 281 322 322 SER SER A . n 
A 1 282 LEU 282 323 323 LEU LEU A . n 
A 1 283 LYS 283 324 324 LYS LYS A . n 
A 1 284 VAL 284 325 325 VAL VAL A . n 
A 1 285 PRO 285 326 326 PRO PRO A . n 
A 1 286 TYR 286 327 327 TYR TYR A . n 
A 1 287 ASN 287 328 328 ASN ASN A . n 
A 1 288 VAL 288 329 329 VAL VAL A . n 
A 1 289 GLY 289 330 330 GLY GLY A . n 
A 1 290 PRO 290 331 331 PRO PRO A . n 
A 1 291 GLY 291 332 332 GLY GLY A . n 
A 1 292 PHE 292 333 333 PHE PHE A . n 
A 1 293 THR 293 334 334 THR THR A . n 
A 1 294 GLY 294 335 335 GLY GLY A . n 
A 1 295 ASN 295 336 336 ASN ASN A . n 
A 1 296 PHE 296 337 337 PHE PHE A . n 
A 1 297 SER 297 338 338 SER SER A . n 
A 1 298 THR 298 339 339 THR THR A . n 
A 1 299 GLN 299 340 340 GLN GLN A . n 
A 1 300 LYS 300 341 341 LYS LYS A . n 
A 1 301 VAL 301 342 342 VAL VAL A . n 
A 1 302 LYS 302 343 343 LYS LYS A . n 
A 1 303 MET 303 344 344 MET MET A . n 
A 1 304 HIS 304 345 345 HIS HIS A . n 
A 1 305 ILE 305 346 346 ILE ILE A . n 
A 1 306 HIS 306 347 347 HIS HIS A . n 
A 1 307 SER 307 348 348 SER SER A . n 
A 1 308 THR 308 349 349 THR THR A . n 
A 1 309 ASN 309 350 350 ASN ASN A . n 
A 1 310 GLU 310 351 351 GLU GLU A . n 
A 1 311 VAL 311 352 352 VAL VAL A . n 
A 1 312 THR 312 353 353 THR THR A . n 
A 1 313 ARG 313 354 354 ARG ARG A . n 
A 1 314 ILE 314 355 355 ILE ILE A . n 
A 1 315 TYR 315 356 356 TYR TYR A . n 
A 1 316 ASN 316 357 357 ASN ASN A . n 
A 1 317 VAL 317 358 358 VAL VAL A . n 
A 1 318 ILE 318 359 359 ILE ILE A . n 
A 1 319 GLY 319 360 360 GLY GLY A . n 
A 1 320 THR 320 361 361 THR THR A . n 
A 1 321 LEU 321 362 362 LEU LEU A . n 
A 1 322 ARG 322 363 363 ARG ARG A . n 
A 1 323 GLY 323 364 364 GLY GLY A . n 
A 1 324 ALA 324 365 365 ALA ALA A . n 
A 1 325 VAL 325 366 366 VAL VAL A . n 
A 1 326 GLU 326 367 367 GLU GLU A . n 
A 1 327 PRO 327 368 368 PRO PRO A . n 
A 1 328 ASP 328 369 369 ASP ASP A . n 
A 1 329 ARG 329 370 370 ARG ARG A . n 
A 1 330 TYR 330 371 371 TYR TYR A . n 
A 1 331 VAL 331 372 372 VAL VAL A . n 
A 1 332 ILE 332 373 373 ILE ILE A . n 
A 1 333 LEU 333 374 374 LEU LEU A . n 
A 1 334 GLY 334 375 375 GLY GLY A . n 
A 1 335 GLY 335 376 376 GLY GLY A . n 
A 1 336 HIS 336 377 377 HIS HIS A . n 
A 1 337 ARG 337 378 378 ARG ARG A . n 
A 1 338 ASP 338 379 379 ASP ASP A . n 
A 1 339 SER 339 380 380 SER SER A . n 
A 1 340 TRP 340 381 381 TRP TRP A . n 
A 1 341 VAL 341 382 382 VAL VAL A . n 
A 1 342 PHE 342 383 383 PHE PHE A . n 
A 1 343 GLY 343 384 384 GLY GLY A . n 
A 1 344 GLY 344 385 385 GLY GLY A . n 
A 1 345 ILE 345 386 386 ILE ILE A . n 
A 1 346 ASP 346 387 387 ASP ASP A . n 
A 1 347 PRO 347 388 388 PRO PRO A . n 
A 1 348 GLN 348 389 389 GLN GLN A . n 
A 1 349 SER 349 390 390 SER SER A . n 
A 1 350 GLY 350 391 391 GLY GLY A . n 
A 1 351 ALA 351 392 392 ALA ALA A . n 
A 1 352 ALA 352 393 393 ALA ALA A . n 
A 1 353 VAL 353 394 394 VAL VAL A . n 
A 1 354 VAL 354 395 395 VAL VAL A . n 
A 1 355 HIS 355 396 396 HIS HIS A . n 
A 1 356 GLU 356 397 397 GLU GLU A . n 
A 1 357 ILE 357 398 398 ILE ILE A . n 
A 1 358 VAL 358 399 399 VAL VAL A . n 
A 1 359 ARG 359 400 400 ARG ARG A . n 
A 1 360 SER 360 401 401 SER SER A . n 
A 1 361 PHE 361 402 402 PHE PHE A . n 
A 1 362 GLY 362 403 403 GLY GLY A . n 
A 1 363 THR 363 404 404 THR THR A . n 
A 1 364 LEU 364 405 405 LEU LEU A . n 
A 1 365 LYS 365 406 406 LYS LYS A . n 
A 1 366 LYS 366 407 407 LYS LYS A . n 
A 1 367 GLU 367 408 408 GLU GLU A . n 
A 1 368 GLY 368 409 409 GLY GLY A . n 
A 1 369 TRP 369 410 410 TRP TRP A . n 
A 1 370 ARG 370 411 411 ARG ARG A . n 
A 1 371 PRO 371 412 412 PRO PRO A . n 
A 1 372 ARG 372 413 413 ARG ARG A . n 
A 1 373 ARG 373 414 414 ARG ARG A . n 
A 1 374 THR 374 415 415 THR THR A . n 
A 1 375 ILE 375 416 416 ILE ILE A . n 
A 1 376 LEU 376 417 417 LEU LEU A . n 
A 1 377 PHE 377 418 418 PHE PHE A . n 
A 1 378 ALA 378 419 419 ALA ALA A . n 
A 1 379 SER 379 420 420 SER SER A . n 
A 1 380 TRP 380 421 421 TRP TRP A . n 
A 1 381 ASP 381 422 422 ASP ASP A . n 
A 1 382 ALA 382 423 423 ALA ALA A . n 
A 1 383 GLU 383 424 424 GLU GLU A . n 
A 1 384 GLU 384 425 425 GLU GLU A . n 
A 1 385 PHE 385 426 426 PHE PHE A . n 
A 1 386 GLY 386 427 427 GLY GLY A . n 
A 1 387 LEU 387 428 428 LEU LEU A . n 
A 1 388 LEU 388 429 429 LEU LEU A . n 
A 1 389 GLY 389 430 430 GLY GLY A . n 
A 1 390 SER 390 431 431 SER SER A . n 
A 1 391 THR 391 432 432 THR THR A . n 
A 1 392 GLU 392 433 433 GLU GLU A . n 
A 1 393 TRP 393 434 434 TRP TRP A . n 
A 1 394 ALA 394 435 435 ALA ALA A . n 
A 1 395 GLU 395 436 436 GLU GLU A . n 
A 1 396 GLU 396 437 437 GLU GLU A . n 
A 1 397 ASN 397 438 438 ASN ASN A . n 
A 1 398 SER 398 439 439 SER SER A . n 
A 1 399 ARG 399 440 440 ARG ARG A . n 
A 1 400 LEU 400 441 441 LEU LEU A . n 
A 1 401 LEU 401 442 442 LEU LEU A . n 
A 1 402 GLN 402 443 443 GLN GLN A . n 
A 1 403 GLU 403 444 444 GLU GLU A . n 
A 1 404 ARG 404 445 445 ARG ARG A . n 
A 1 405 GLY 405 446 446 GLY GLY A . n 
A 1 406 VAL 406 447 447 VAL VAL A . n 
A 1 407 ALA 407 448 448 ALA ALA A . n 
A 1 408 TYR 408 449 449 TYR TYR A . n 
A 1 409 ILE 409 450 450 ILE ILE A . n 
A 1 410 ASN 410 451 451 ASN ASN A . n 
A 1 411 ALA 411 452 452 ALA ALA A . n 
A 1 412 ASP 412 453 453 ASP ASP A . n 
A 1 413 SER 413 454 454 SER SER A . n 
A 1 414 SER 414 455 455 SER SER A . n 
A 1 415 ILE 415 456 456 ILE ILE A . n 
A 1 416 GLU 416 457 457 GLU GLU A . n 
A 1 417 GLY 417 458 458 GLY GLY A . n 
A 1 418 ASN 418 459 459 ASN ASN A . n 
A 1 419 TYR 419 460 460 TYR TYR A . n 
A 1 420 THR 420 461 461 THR THR A . n 
A 1 421 LEU 421 462 462 LEU LEU A . n 
A 1 422 ARG 422 463 463 ARG ARG A . n 
A 1 423 VAL 423 464 464 VAL VAL A . n 
A 1 424 ASP 424 465 465 ASP ASP A . n 
A 1 425 CYS 425 466 466 CYS CYS A . n 
A 1 426 THR 426 467 467 THR THR A . n 
A 1 427 PRO 427 468 468 PRO PRO A . n 
A 1 428 LEU 428 469 469 LEU LEU A . n 
A 1 429 MET 429 470 470 MET MET A . n 
A 1 430 TYR 430 471 471 TYR TYR A . n 
A 1 431 SER 431 472 472 SER SER A . n 
A 1 432 LEU 432 473 473 LEU LEU A . n 
A 1 433 VAL 433 474 474 VAL VAL A . n 
A 1 434 HIS 434 475 475 HIS HIS A . n 
A 1 435 ASN 435 476 476 ASN ASN A . n 
A 1 436 LEU 436 477 477 LEU LEU A . n 
A 1 437 THR 437 478 478 THR THR A . n 
A 1 438 LYS 438 479 479 LYS LYS A . n 
A 1 439 GLU 439 480 480 GLU GLU A . n 
A 1 440 LEU 440 481 481 LEU LEU A . n 
A 1 441 LYS 441 482 482 LYS LYS A . n 
A 1 442 SER 442 483 483 SER SER A . n 
A 1 443 PRO 443 484 484 PRO PRO A . n 
A 1 444 ASP 444 485 485 ASP ASP A . n 
A 1 445 GLU 445 486 486 GLU GLU A . n 
A 1 446 GLY 446 487 487 GLY GLY A . n 
A 1 447 PHE 447 488 488 PHE PHE A . n 
A 1 448 GLU 448 489 489 GLU GLU A . n 
A 1 449 GLY 449 490 490 GLY GLY A . n 
A 1 450 LYS 450 491 491 LYS LYS A . n 
A 1 451 SER 451 492 492 SER SER A . n 
A 1 452 LEU 452 493 493 LEU LEU A . n 
A 1 453 TYR 453 494 494 TYR TYR A . n 
A 1 454 GLU 454 495 495 GLU GLU A . n 
A 1 455 SER 455 496 496 SER SER A . n 
A 1 456 TRP 456 497 497 TRP TRP A . n 
A 1 457 THR 457 498 498 THR THR A . n 
A 1 458 LYS 458 499 499 LYS LYS A . n 
A 1 459 LYS 459 500 500 LYS LYS A . n 
A 1 460 SER 460 501 501 SER SER A . n 
A 1 461 PRO 461 502 502 PRO PRO A . n 
A 1 462 SER 462 503 503 SER SER A . n 
A 1 463 PRO 463 504 504 PRO PRO A . n 
A 1 464 GLU 464 505 505 GLU GLU A . n 
A 1 465 PHE 465 506 506 PHE PHE A . n 
A 1 466 SER 466 507 507 SER SER A . n 
A 1 467 GLY 467 508 508 GLY GLY A . n 
A 1 468 MET 468 509 509 MET MET A . n 
A 1 469 PRO 469 510 510 PRO PRO A . n 
A 1 470 ARG 470 511 511 ARG ARG A . n 
A 1 471 ILE 471 512 512 ILE ILE A . n 
A 1 472 SER 472 513 513 SER SER A . n 
A 1 473 LYS 473 514 514 LYS LYS A . n 
A 1 474 LEU 474 515 515 LEU LEU A . n 
A 1 475 GLY 475 516 516 GLY GLY A . n 
A 1 476 SER 476 517 517 SER SER A . n 
A 1 477 GLY 477 518 518 GLY GLY A . n 
A 1 478 ASN 478 519 519 ASN ASN A . n 
A 1 479 ASP 479 520 520 ASP ASP A . n 
A 1 480 PHE 480 521 521 PHE PHE A . n 
A 1 481 GLU 481 522 522 GLU GLU A . n 
A 1 482 VAL 482 523 523 VAL VAL A . n 
A 1 483 PHE 483 524 524 PHE PHE A . n 
A 1 484 PHE 484 525 525 PHE PHE A . n 
A 1 485 GLN 485 526 526 GLN GLN A . n 
A 1 486 ARG 486 527 527 ARG ARG A . n 
A 1 487 LEU 487 528 528 LEU LEU A . n 
A 1 488 GLY 488 529 529 GLY GLY A . n 
A 1 489 ILE 489 530 530 ILE ILE A . n 
A 1 490 ALA 490 531 531 ALA ALA A . n 
A 1 491 SER 491 532 532 SER SER A . n 
A 1 492 GLY 492 533 533 GLY GLY A . n 
A 1 493 ARG 493 534 534 ARG ARG A . n 
A 1 494 ALA 494 535 535 ALA ALA A . n 
A 1 495 ARG 495 536 536 ARG ARG A . n 
A 1 496 TYR 496 537 537 TYR TYR A . n 
A 1 497 THR 497 538 538 THR THR A . n 
A 1 498 LYS 498 539 539 LYS LYS A . n 
A 1 499 ASN 499 540 540 ASN ASN A . n 
A 1 500 TRP 500 541 ?   ?   ?   A . n 
A 1 501 GLU 501 542 ?   ?   ?   A . n 
A 1 502 THR 502 543 ?   ?   ?   A . n 
A 1 503 ASN 503 544 544 ASN ASN A . n 
A 1 504 LYS 504 545 545 LYS LYS A . n 
A 1 505 PHE 505 546 546 PHE PHE A . n 
A 1 506 SER 506 547 547 SER SER A . n 
A 1 507 GLY 507 548 548 GLY GLY A . n 
A 1 508 TYR 508 549 549 TYR TYR A . n 
A 1 509 PRO 509 550 550 PRO PRO A . n 
A 1 510 LEU 510 551 551 LEU LEU A . n 
A 1 511 TYR 511 552 552 TYR TYR A . n 
A 1 512 HIS 512 553 553 HIS HIS A . n 
A 1 513 SER 513 554 554 SER SER A . n 
A 1 514 VAL 514 555 555 VAL VAL A . n 
A 1 515 TYR 515 556 556 TYR TYR A . n 
A 1 516 GLU 516 557 557 GLU GLU A . n 
A 1 517 THR 517 558 558 THR THR A . n 
A 1 518 TYR 518 559 559 TYR TYR A . n 
A 1 519 GLU 519 560 560 GLU GLU A . n 
A 1 520 LEU 520 561 561 LEU LEU A . n 
A 1 521 VAL 521 562 562 VAL VAL A . n 
A 1 522 GLU 522 563 563 GLU GLU A . n 
A 1 523 LYS 523 564 564 LYS LYS A . n 
A 1 524 PHE 524 565 565 PHE PHE A . n 
A 1 525 TYR 525 566 566 TYR TYR A . n 
A 1 526 ASP 526 567 567 ASP ASP A . n 
A 1 527 PRO 527 568 568 PRO PRO A . n 
A 1 528 MET 528 569 569 MET MET A . n 
A 1 529 PHE 529 570 570 PHE PHE A . n 
A 1 530 LYS 530 571 571 LYS LYS A . n 
A 1 531 TYR 531 572 572 TYR TYR A . n 
A 1 532 HIS 532 573 573 HIS HIS A . n 
A 1 533 LEU 533 574 574 LEU LEU A . n 
A 1 534 THR 534 575 575 THR THR A . n 
A 1 535 VAL 535 576 576 VAL VAL A . n 
A 1 536 ALA 536 577 577 ALA ALA A . n 
A 1 537 GLN 537 578 578 GLN GLN A . n 
A 1 538 VAL 538 579 579 VAL VAL A . n 
A 1 539 ARG 539 580 580 ARG ARG A . n 
A 1 540 GLY 540 581 581 GLY GLY A . n 
A 1 541 GLY 541 582 582 GLY GLY A . n 
A 1 542 MET 542 583 583 MET MET A . n 
A 1 543 VAL 543 584 584 VAL VAL A . n 
A 1 544 PHE 544 585 585 PHE PHE A . n 
A 1 545 GLU 545 586 586 GLU GLU A . n 
A 1 546 LEU 546 587 587 LEU LEU A . n 
A 1 547 ALA 547 588 588 ALA ALA A . n 
A 1 548 ASN 548 589 589 ASN ASN A . n 
A 1 549 SER 549 590 590 SER SER A . n 
A 1 550 ILE 550 591 591 ILE ILE A . n 
A 1 551 VAL 551 592 592 VAL VAL A . n 
A 1 552 LEU 552 593 593 LEU LEU A . n 
A 1 553 PRO 553 594 594 PRO PRO A . n 
A 1 554 PHE 554 595 595 PHE PHE A . n 
A 1 555 ASP 555 596 596 ASP ASP A . n 
A 1 556 CYS 556 597 597 CYS CYS A . n 
A 1 557 ARG 557 598 598 ARG ARG A . n 
A 1 558 ASP 558 599 599 ASP ASP A . n 
A 1 559 TYR 559 600 600 TYR TYR A . n 
A 1 560 ALA 560 601 601 ALA ALA A . n 
A 1 561 VAL 561 602 602 VAL VAL A . n 
A 1 562 VAL 562 603 603 VAL VAL A . n 
A 1 563 LEU 563 604 604 LEU LEU A . n 
A 1 564 ARG 564 605 605 ARG ARG A . n 
A 1 565 LYS 565 606 606 LYS LYS A . n 
A 1 566 TYR 566 607 607 TYR TYR A . n 
A 1 567 ALA 567 608 608 ALA ALA A . n 
A 1 568 ASP 568 609 609 ASP ASP A . n 
A 1 569 LYS 569 610 610 LYS LYS A . n 
A 1 570 ILE 570 611 611 ILE ILE A . n 
A 1 571 TYR 571 612 612 TYR TYR A . n 
A 1 572 SER 572 613 613 SER SER A . n 
A 1 573 ILE 573 614 614 ILE ILE A . n 
A 1 574 SER 574 615 615 SER SER A . n 
A 1 575 MET 575 616 616 MET MET A . n 
A 1 576 LYS 576 617 617 LYS LYS A . n 
A 1 577 HIS 577 618 618 HIS HIS A . n 
A 1 578 PRO 578 619 619 PRO PRO A . n 
A 1 579 GLN 579 620 620 GLN GLN A . n 
A 1 580 GLU 580 621 621 GLU GLU A . n 
A 1 581 MET 581 622 622 MET MET A . n 
A 1 582 LYS 582 623 623 LYS LYS A . n 
A 1 583 THR 583 624 624 THR THR A . n 
A 1 584 TYR 584 625 625 TYR TYR A . n 
A 1 585 SER 585 626 626 SER SER A . n 
A 1 586 VAL 586 627 627 VAL VAL A . n 
A 1 587 SER 587 628 628 SER SER A . n 
A 1 588 PHE 588 629 629 PHE PHE A . n 
A 1 589 ASP 589 630 630 ASP ASP A . n 
A 1 590 SER 590 631 631 SER SER A . n 
A 1 591 LEU 591 632 632 LEU LEU A . n 
A 1 592 PHE 592 633 633 PHE PHE A . n 
A 1 593 SER 593 634 634 SER SER A . n 
A 1 594 ALA 594 635 635 ALA ALA A . n 
A 1 595 VAL 595 636 636 VAL VAL A . n 
A 1 596 LYS 596 637 637 LYS LYS A . n 
A 1 597 ASN 597 638 638 ASN ASN A . n 
A 1 598 PHE 598 639 639 PHE PHE A . n 
A 1 599 THR 599 640 640 THR THR A . n 
A 1 600 GLU 600 641 641 GLU GLU A . n 
A 1 601 ILE 601 642 642 ILE ILE A . n 
A 1 602 ALA 602 643 643 ALA ALA A . n 
A 1 603 SER 603 644 644 SER SER A . n 
A 1 604 LYS 604 645 645 LYS LYS A . n 
A 1 605 PHE 605 646 646 PHE PHE A . n 
A 1 606 SER 606 647 647 SER SER A . n 
A 1 607 GLU 607 648 648 GLU GLU A . n 
A 1 608 ARG 608 649 649 ARG ARG A . n 
A 1 609 LEU 609 650 650 LEU LEU A . n 
A 1 610 GLN 610 651 651 GLN GLN A . n 
A 1 611 ASP 611 652 652 ASP ASP A . n 
A 1 612 PHE 612 653 653 PHE PHE A . n 
A 1 613 ASP 613 654 654 ASP ASP A . n 
A 1 614 LYS 614 655 655 LYS LYS A . n 
A 1 615 SER 615 656 656 SER SER A . n 
A 1 616 ASN 616 657 657 ASN ASN A . n 
A 1 617 PRO 617 658 658 PRO PRO A . n 
A 1 618 ILE 618 659 659 ILE ILE A . n 
A 1 619 VAL 619 660 660 VAL VAL A . n 
A 1 620 LEU 620 661 661 LEU LEU A . n 
A 1 621 ARG 621 662 662 ARG ARG A . n 
A 1 622 MET 622 663 663 MET MET A . n 
A 1 623 MET 623 664 664 MET MET A . n 
A 1 624 ASN 624 665 665 ASN ASN A . n 
A 1 625 ASP 625 666 666 ASP ASP A . n 
A 1 626 GLN 626 667 667 GLN GLN A . n 
A 1 627 LEU 627 668 668 LEU LEU A . n 
A 1 628 MET 628 669 669 MET MET A . n 
A 1 629 PHE 629 670 670 PHE PHE A . n 
A 1 630 LEU 630 671 671 LEU LEU A . n 
A 1 631 GLU 631 672 672 GLU GLU A . n 
A 1 632 ARG 632 673 673 ARG ARG A . n 
A 1 633 ALA 633 674 674 ALA ALA A . n 
A 1 634 PHE 634 675 675 PHE PHE A . n 
A 1 635 ILE 635 676 676 ILE ILE A . n 
A 1 636 ASP 636 677 677 ASP ASP A . n 
A 1 637 PRO 637 678 678 PRO PRO A . n 
A 1 638 LEU 638 679 679 LEU LEU A . n 
A 1 639 GLY 639 680 680 GLY GLY A . n 
A 1 640 LEU 640 681 681 LEU LEU A . n 
A 1 641 PRO 641 682 682 PRO PRO A . n 
A 1 642 ASP 642 683 683 ASP ASP A . n 
A 1 643 ARG 643 684 684 ARG ARG A . n 
A 1 644 PRO 644 685 685 PRO PRO A . n 
A 1 645 PHE 645 686 686 PHE PHE A . n 
A 1 646 TYR 646 687 687 TYR TYR A . n 
A 1 647 ARG 647 688 688 ARG ARG A . n 
A 1 648 HIS 648 689 689 HIS HIS A . n 
A 1 649 VAL 649 690 690 VAL VAL A . n 
A 1 650 ILE 650 691 691 ILE ILE A . n 
A 1 651 TYR 651 692 692 TYR TYR A . n 
A 1 652 ALA 652 693 693 ALA ALA A . n 
A 1 653 PRO 653 694 694 PRO PRO A . n 
A 1 654 SER 654 695 695 SER SER A . n 
A 1 655 SER 655 696 696 SER SER A . n 
A 1 656 HIS 656 697 697 HIS HIS A . n 
A 1 657 ASN 657 698 698 ASN ASN A . n 
A 1 658 LYS 658 699 699 LYS LYS A . n 
A 1 659 TYR 659 700 700 TYR TYR A . n 
A 1 660 ALA 660 701 701 ALA ALA A . n 
A 1 661 GLY 661 702 702 GLY GLY A . n 
A 1 662 GLU 662 703 703 GLU GLU A . n 
A 1 663 SER 663 704 704 SER SER A . n 
A 1 664 PHE 664 705 705 PHE PHE A . n 
A 1 665 PRO 665 706 706 PRO PRO A . n 
A 1 666 GLY 666 707 707 GLY GLY A . n 
A 1 667 ILE 667 708 708 ILE ILE A . n 
A 1 668 TYR 668 709 709 TYR TYR A . n 
A 1 669 ASP 669 710 710 ASP ASP A . n 
A 1 670 ALA 670 711 711 ALA ALA A . n 
A 1 671 LEU 671 712 712 LEU LEU A . n 
A 1 672 PHE 672 713 713 PHE PHE A . n 
A 1 673 ASP 673 714 714 ASP ASP A . n 
A 1 674 ILE 674 715 715 ILE ILE A . n 
A 1 675 GLU 675 716 716 GLU GLU A . n 
A 1 676 SER 676 717 717 SER SER A . n 
A 1 677 LYS 677 718 718 LYS LYS A . n 
A 1 678 VAL 678 719 719 VAL VAL A . n 
A 1 679 ASP 679 720 720 ASP ASP A . n 
A 1 680 PRO 680 721 721 PRO PRO A . n 
A 1 681 SER 681 722 722 SER SER A . n 
A 1 682 LYS 682 723 723 LYS LYS A . n 
A 1 683 ALA 683 724 724 ALA ALA A . n 
A 1 684 TRP 684 725 725 TRP TRP A . n 
A 1 685 GLY 685 726 726 GLY GLY A . n 
A 1 686 GLU 686 727 727 GLU GLU A . n 
A 1 687 VAL 687 728 728 VAL VAL A . n 
A 1 688 LYS 688 729 729 LYS LYS A . n 
A 1 689 ARG 689 730 730 ARG ARG A . n 
A 1 690 GLN 690 731 731 GLN GLN A . n 
A 1 691 ILE 691 732 732 ILE ILE A . n 
A 1 692 TYR 692 733 733 TYR TYR A . n 
A 1 693 VAL 693 734 734 VAL VAL A . n 
A 1 694 ALA 694 735 735 ALA ALA A . n 
A 1 695 ALA 695 736 736 ALA ALA A . n 
A 1 696 PHE 696 737 737 PHE PHE A . n 
A 1 697 THR 697 738 738 THR THR A . n 
A 1 698 VAL 698 739 739 VAL VAL A . n 
A 1 699 GLN 699 740 740 GLN GLN A . n 
A 1 700 ALA 700 741 741 ALA ALA A . n 
A 1 701 ALA 701 742 742 ALA ALA A . n 
A 1 702 ALA 702 743 743 ALA ALA A . n 
A 1 703 GLU 703 744 744 GLU GLU A . n 
A 1 704 THR 704 745 745 THR THR A . n 
A 1 705 LEU 705 746 746 LEU LEU A . n 
A 1 706 SER 706 747 747 SER SER A . n 
A 1 707 GLU 707 748 748 GLU GLU A . n 
A 1 708 VAL 708 749 749 VAL VAL A . n 
A 1 709 ALA 709 750 750 ALA ALA A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NAG 1   1755 1755 NAG NAG A . 
C 2 NAG 2   1756 1756 NAG NAG A . 
D 2 NAG 1   1757 1757 NAG NAG A . 
E 2 NAG 1   1758 1758 NAG NAG A . 
F 2 NAG 2   1767 1767 NAG NAG A . 
G 2 NAG 1   1759 1759 NAG NAG A . 
H 2 NAG 1   1760 1760 NAG NAG A . 
I 2 NAG 1   1761 1761 NAG NAG A . 
J 2 NAG 2   1762 1762 NAG NAG A . 
K 2 NAG 1   1763 1763 NAG NAG A . 
L 2 NAG 2   1764 1764 NAG NAG A . 
M 3 BMA 3   1765 1765 BMA BMA A . 
N 4 MAN 4   1766 1766 MAN MAN A . 
O 5 ZN  1   1751 1751 ZN  ZN  A . 
P 5 ZN  1   1752 1752 ZN  ZN  A . 
Q 6 CA  1   1753 1753 CA  CA  A . 
R 7 CL  1   1754 1754 CL  CL  A . 
S 8 QUS 1   1801 1801 QUS QUS A . 
T 9 HOH 1   1802 1    HOH HOH A . 
T 9 HOH 2   1803 2    HOH HOH A . 
T 9 HOH 3   1804 3    HOH HOH A . 
T 9 HOH 4   1805 4    HOH HOH A . 
T 9 HOH 5   1806 5    HOH HOH A . 
T 9 HOH 6   1807 6    HOH HOH A . 
T 9 HOH 7   1808 7    HOH HOH A . 
T 9 HOH 8   1809 8    HOH HOH A . 
T 9 HOH 9   1810 9    HOH HOH A . 
T 9 HOH 10  1811 10   HOH HOH A . 
T 9 HOH 11  1812 11   HOH HOH A . 
T 9 HOH 12  1813 12   HOH HOH A . 
T 9 HOH 13  1814 13   HOH HOH A . 
T 9 HOH 14  1815 14   HOH HOH A . 
T 9 HOH 15  1816 15   HOH HOH A . 
T 9 HOH 16  1817 16   HOH HOH A . 
T 9 HOH 17  1818 17   HOH HOH A . 
T 9 HOH 18  1819 18   HOH HOH A . 
T 9 HOH 19  1820 19   HOH HOH A . 
T 9 HOH 20  1821 20   HOH HOH A . 
T 9 HOH 21  1822 21   HOH HOH A . 
T 9 HOH 22  1823 22   HOH HOH A . 
T 9 HOH 23  1824 23   HOH HOH A . 
T 9 HOH 24  1825 24   HOH HOH A . 
T 9 HOH 25  1826 25   HOH HOH A . 
T 9 HOH 26  1827 26   HOH HOH A . 
T 9 HOH 27  1828 27   HOH HOH A . 
T 9 HOH 28  1829 28   HOH HOH A . 
T 9 HOH 29  1830 29   HOH HOH A . 
T 9 HOH 30  1831 30   HOH HOH A . 
T 9 HOH 31  1832 31   HOH HOH A . 
T 9 HOH 32  1833 32   HOH HOH A . 
T 9 HOH 33  1834 33   HOH HOH A . 
T 9 HOH 34  1835 34   HOH HOH A . 
T 9 HOH 35  1836 35   HOH HOH A . 
T 9 HOH 36  1837 36   HOH HOH A . 
T 9 HOH 37  1838 37   HOH HOH A . 
T 9 HOH 38  1839 38   HOH HOH A . 
T 9 HOH 39  1840 39   HOH HOH A . 
T 9 HOH 40  1841 40   HOH HOH A . 
T 9 HOH 41  1842 41   HOH HOH A . 
T 9 HOH 42  1843 42   HOH HOH A . 
T 9 HOH 43  1844 43   HOH HOH A . 
T 9 HOH 44  1845 44   HOH HOH A . 
T 9 HOH 45  1846 45   HOH HOH A . 
T 9 HOH 46  1847 46   HOH HOH A . 
T 9 HOH 47  1848 47   HOH HOH A . 
T 9 HOH 48  1849 48   HOH HOH A . 
T 9 HOH 49  1850 49   HOH HOH A . 
T 9 HOH 50  1851 50   HOH HOH A . 
T 9 HOH 51  1852 51   HOH HOH A . 
T 9 HOH 52  1853 52   HOH HOH A . 
T 9 HOH 53  1854 53   HOH HOH A . 
T 9 HOH 54  1855 54   HOH HOH A . 
T 9 HOH 55  1856 55   HOH HOH A . 
T 9 HOH 56  1857 56   HOH HOH A . 
T 9 HOH 57  1858 57   HOH HOH A . 
T 9 HOH 58  1859 58   HOH HOH A . 
T 9 HOH 59  1860 59   HOH HOH A . 
T 9 HOH 60  1861 60   HOH HOH A . 
T 9 HOH 61  1862 61   HOH HOH A . 
T 9 HOH 62  1863 62   HOH HOH A . 
T 9 HOH 63  1864 63   HOH HOH A . 
T 9 HOH 64  1865 64   HOH HOH A . 
T 9 HOH 65  1866 65   HOH HOH A . 
T 9 HOH 66  1867 66   HOH HOH A . 
T 9 HOH 67  1868 67   HOH HOH A . 
T 9 HOH 68  1869 68   HOH HOH A . 
T 9 HOH 69  1870 69   HOH HOH A . 
T 9 HOH 70  1871 70   HOH HOH A . 
T 9 HOH 71  1872 71   HOH HOH A . 
T 9 HOH 72  1873 72   HOH HOH A . 
T 9 HOH 73  1874 73   HOH HOH A . 
T 9 HOH 74  1875 74   HOH HOH A . 
T 9 HOH 75  1876 75   HOH HOH A . 
T 9 HOH 76  1877 76   HOH HOH A . 
T 9 HOH 77  1878 77   HOH HOH A . 
T 9 HOH 78  1879 78   HOH HOH A . 
T 9 HOH 79  1880 79   HOH HOH A . 
T 9 HOH 80  1881 80   HOH HOH A . 
T 9 HOH 81  1882 81   HOH HOH A . 
T 9 HOH 82  1883 82   HOH HOH A . 
T 9 HOH 83  1884 83   HOH HOH A . 
T 9 HOH 84  1885 84   HOH HOH A . 
T 9 HOH 85  1886 85   HOH HOH A . 
T 9 HOH 86  1887 86   HOH HOH A . 
T 9 HOH 87  1888 87   HOH HOH A . 
T 9 HOH 88  1889 88   HOH HOH A . 
T 9 HOH 89  1890 89   HOH HOH A . 
T 9 HOH 90  1891 90   HOH HOH A . 
T 9 HOH 91  1892 91   HOH HOH A . 
T 9 HOH 92  1893 92   HOH HOH A . 
T 9 HOH 93  1894 93   HOH HOH A . 
T 9 HOH 94  1895 94   HOH HOH A . 
T 9 HOH 95  1896 95   HOH HOH A . 
T 9 HOH 96  1897 96   HOH HOH A . 
T 9 HOH 97  1898 97   HOH HOH A . 
T 9 HOH 98  1899 98   HOH HOH A . 
T 9 HOH 99  1900 99   HOH HOH A . 
T 9 HOH 100 1901 100  HOH HOH A . 
T 9 HOH 101 1902 101  HOH HOH A . 
T 9 HOH 102 1903 102  HOH HOH A . 
T 9 HOH 103 1904 103  HOH HOH A . 
T 9 HOH 104 1905 104  HOH HOH A . 
T 9 HOH 105 1906 105  HOH HOH A . 
T 9 HOH 106 1907 106  HOH HOH A . 
T 9 HOH 107 1908 107  HOH HOH A . 
T 9 HOH 108 1909 108  HOH HOH A . 
T 9 HOH 109 1910 109  HOH HOH A . 
T 9 HOH 110 1911 110  HOH HOH A . 
T 9 HOH 111 1912 111  HOH HOH A . 
T 9 HOH 112 1913 112  HOH HOH A . 
T 9 HOH 113 1914 113  HOH HOH A . 
T 9 HOH 114 1915 114  HOH HOH A . 
T 9 HOH 115 1916 115  HOH HOH A . 
T 9 HOH 116 1917 116  HOH HOH A . 
T 9 HOH 117 1918 117  HOH HOH A . 
T 9 HOH 118 1919 118  HOH HOH A . 
T 9 HOH 119 1920 119  HOH HOH A . 
T 9 HOH 120 1921 120  HOH HOH A . 
T 9 HOH 121 1922 121  HOH HOH A . 
T 9 HOH 122 1923 122  HOH HOH A . 
T 9 HOH 123 1924 123  HOH HOH A . 
T 9 HOH 124 1925 124  HOH HOH A . 
T 9 HOH 125 1926 125  HOH HOH A . 
T 9 HOH 126 1927 126  HOH HOH A . 
T 9 HOH 127 1928 127  HOH HOH A . 
T 9 HOH 128 1929 128  HOH HOH A . 
T 9 HOH 129 1930 129  HOH HOH A . 
T 9 HOH 130 1931 130  HOH HOH A . 
T 9 HOH 131 1932 131  HOH HOH A . 
T 9 HOH 132 1933 132  HOH HOH A . 
T 9 HOH 133 1934 133  HOH HOH A . 
T 9 HOH 134 1935 134  HOH HOH A . 
T 9 HOH 135 1936 135  HOH HOH A . 
T 9 HOH 136 1937 136  HOH HOH A . 
T 9 HOH 137 1938 137  HOH HOH A . 
T 9 HOH 138 1939 138  HOH HOH A . 
T 9 HOH 139 1940 139  HOH HOH A . 
T 9 HOH 140 1941 140  HOH HOH A . 
T 9 HOH 141 1942 141  HOH HOH A . 
T 9 HOH 142 1943 142  HOH HOH A . 
T 9 HOH 143 1944 143  HOH HOH A . 
T 9 HOH 144 1945 144  HOH HOH A . 
T 9 HOH 145 1946 145  HOH HOH A . 
T 9 HOH 146 1947 146  HOH HOH A . 
T 9 HOH 147 1948 147  HOH HOH A . 
T 9 HOH 148 1949 148  HOH HOH A . 
T 9 HOH 149 1950 149  HOH HOH A . 
T 9 HOH 150 1951 150  HOH HOH A . 
T 9 HOH 151 1952 151  HOH HOH A . 
T 9 HOH 152 1953 152  HOH HOH A . 
T 9 HOH 153 1954 153  HOH HOH A . 
T 9 HOH 154 1955 154  HOH HOH A . 
T 9 HOH 155 1956 155  HOH HOH A . 
T 9 HOH 156 1957 156  HOH HOH A . 
T 9 HOH 157 1958 157  HOH HOH A . 
T 9 HOH 158 1959 158  HOH HOH A . 
T 9 HOH 159 1960 159  HOH HOH A . 
T 9 HOH 160 1961 160  HOH HOH A . 
T 9 HOH 161 1962 161  HOH HOH A . 
T 9 HOH 162 1963 162  HOH HOH A . 
T 9 HOH 163 1964 163  HOH HOH A . 
T 9 HOH 164 1965 164  HOH HOH A . 
T 9 HOH 165 1966 165  HOH HOH A . 
T 9 HOH 166 1967 166  HOH HOH A . 
T 9 HOH 167 1968 167  HOH HOH A . 
T 9 HOH 168 1969 168  HOH HOH A . 
T 9 HOH 169 1970 169  HOH HOH A . 
T 9 HOH 170 1971 170  HOH HOH A . 
T 9 HOH 171 1972 171  HOH HOH A . 
T 9 HOH 172 1973 172  HOH HOH A . 
T 9 HOH 173 1974 173  HOH HOH A . 
T 9 HOH 174 1975 174  HOH HOH A . 
T 9 HOH 175 1976 175  HOH HOH A . 
T 9 HOH 176 1977 176  HOH HOH A . 
T 9 HOH 177 1978 177  HOH HOH A . 
T 9 HOH 178 1979 178  HOH HOH A . 
T 9 HOH 179 1980 179  HOH HOH A . 
T 9 HOH 180 1981 180  HOH HOH A . 
T 9 HOH 181 1982 181  HOH HOH A . 
T 9 HOH 182 1983 182  HOH HOH A . 
T 9 HOH 183 1984 183  HOH HOH A . 
T 9 HOH 184 1985 184  HOH HOH A . 
T 9 HOH 185 1986 185  HOH HOH A . 
T 9 HOH 186 1987 186  HOH HOH A . 
T 9 HOH 187 1988 187  HOH HOH A . 
T 9 HOH 188 1989 188  HOH HOH A . 
T 9 HOH 189 1990 189  HOH HOH A . 
T 9 HOH 190 1991 190  HOH HOH A . 
T 9 HOH 191 1992 191  HOH HOH A . 
T 9 HOH 192 1993 192  HOH HOH A . 
T 9 HOH 193 1994 193  HOH HOH A . 
T 9 HOH 194 1995 194  HOH HOH A . 
T 9 HOH 195 1996 195  HOH HOH A . 
T 9 HOH 196 1997 196  HOH HOH A . 
T 9 HOH 197 1998 197  HOH HOH A . 
T 9 HOH 198 1999 198  HOH HOH A . 
T 9 HOH 199 2000 199  HOH HOH A . 
T 9 HOH 200 2001 200  HOH HOH A . 
T 9 HOH 201 2002 201  HOH HOH A . 
T 9 HOH 202 2003 202  HOH HOH A . 
T 9 HOH 203 2004 203  HOH HOH A . 
T 9 HOH 204 2005 204  HOH HOH A . 
T 9 HOH 205 2006 205  HOH HOH A . 
T 9 HOH 206 2007 206  HOH HOH A . 
T 9 HOH 207 2008 207  HOH HOH A . 
T 9 HOH 208 2009 208  HOH HOH A . 
T 9 HOH 209 2010 209  HOH HOH A . 
T 9 HOH 210 2011 210  HOH HOH A . 
T 9 HOH 211 2012 211  HOH HOH A . 
T 9 HOH 212 2013 212  HOH HOH A . 
T 9 HOH 213 2014 213  HOH HOH A . 
T 9 HOH 214 2015 214  HOH HOH A . 
T 9 HOH 215 2016 215  HOH HOH A . 
T 9 HOH 216 2017 216  HOH HOH A . 
T 9 HOH 217 2018 217  HOH HOH A . 
T 9 HOH 218 2019 218  HOH HOH A . 
T 9 HOH 219 2020 219  HOH HOH A . 
T 9 HOH 220 2021 220  HOH HOH A . 
T 9 HOH 221 2022 221  HOH HOH A . 
T 9 HOH 222 2023 222  HOH HOH A . 
T 9 HOH 223 2024 223  HOH HOH A . 
T 9 HOH 224 2025 224  HOH HOH A . 
T 9 HOH 225 2026 225  HOH HOH A . 
T 9 HOH 226 2027 226  HOH HOH A . 
T 9 HOH 227 2028 227  HOH HOH A . 
T 9 HOH 228 2029 228  HOH HOH A . 
T 9 HOH 229 2030 229  HOH HOH A . 
T 9 HOH 230 2031 230  HOH HOH A . 
T 9 HOH 231 2032 231  HOH HOH A . 
T 9 HOH 232 2033 232  HOH HOH A . 
T 9 HOH 233 2034 233  HOH HOH A . 
T 9 HOH 234 2035 234  HOH HOH A . 
T 9 HOH 235 2036 235  HOH HOH A . 
T 9 HOH 236 2037 236  HOH HOH A . 
T 9 HOH 237 2038 237  HOH HOH A . 
T 9 HOH 238 2039 238  HOH HOH A . 
T 9 HOH 239 2040 239  HOH HOH A . 
T 9 HOH 240 2041 240  HOH HOH A . 
T 9 HOH 241 2042 241  HOH HOH A . 
T 9 HOH 242 2043 242  HOH HOH A . 
T 9 HOH 243 2044 243  HOH HOH A . 
T 9 HOH 244 2045 244  HOH HOH A . 
T 9 HOH 245 2046 245  HOH HOH A . 
T 9 HOH 246 2047 246  HOH HOH A . 
T 9 HOH 247 2048 247  HOH HOH A . 
T 9 HOH 248 2049 248  HOH HOH A . 
T 9 HOH 249 2050 249  HOH HOH A . 
T 9 HOH 250 2051 250  HOH HOH A . 
T 9 HOH 251 2052 251  HOH HOH A . 
T 9 HOH 252 2053 252  HOH HOH A . 
T 9 HOH 253 2054 253  HOH HOH A . 
T 9 HOH 254 2055 254  HOH HOH A . 
T 9 HOH 255 2056 255  HOH HOH A . 
T 9 HOH 256 2057 256  HOH HOH A . 
T 9 HOH 257 2058 257  HOH HOH A . 
T 9 HOH 258 2059 258  HOH HOH A . 
T 9 HOH 259 2060 259  HOH HOH A . 
T 9 HOH 260 2061 260  HOH HOH A . 
T 9 HOH 261 2062 261  HOH HOH A . 
T 9 HOH 262 2063 262  HOH HOH A . 
T 9 HOH 263 2064 263  HOH HOH A . 
T 9 HOH 264 2065 264  HOH HOH A . 
T 9 HOH 265 2066 265  HOH HOH A . 
T 9 HOH 266 2067 266  HOH HOH A . 
T 9 HOH 267 2068 267  HOH HOH A . 
T 9 HOH 268 2069 268  HOH HOH A . 
T 9 HOH 269 2070 269  HOH HOH A . 
T 9 HOH 270 2071 270  HOH HOH A . 
T 9 HOH 271 2072 271  HOH HOH A . 
T 9 HOH 272 2073 272  HOH HOH A . 
T 9 HOH 273 2074 273  HOH HOH A . 
T 9 HOH 274 2075 274  HOH HOH A . 
T 9 HOH 275 2076 275  HOH HOH A . 
T 9 HOH 276 2077 276  HOH HOH A . 
T 9 HOH 277 2078 277  HOH HOH A . 
T 9 HOH 278 2079 278  HOH HOH A . 
T 9 HOH 279 2080 279  HOH HOH A . 
T 9 HOH 280 2081 280  HOH HOH A . 
T 9 HOH 281 2082 281  HOH HOH A . 
T 9 HOH 282 2083 282  HOH HOH A . 
T 9 HOH 283 2084 283  HOH HOH A . 
T 9 HOH 284 2085 284  HOH HOH A . 
T 9 HOH 285 2086 285  HOH HOH A . 
T 9 HOH 286 2087 286  HOH HOH A . 
T 9 HOH 287 2088 287  HOH HOH A . 
T 9 HOH 288 2089 288  HOH HOH A . 
T 9 HOH 289 2090 289  HOH HOH A . 
T 9 HOH 290 2091 290  HOH HOH A . 
T 9 HOH 291 2092 291  HOH HOH A . 
T 9 HOH 292 2093 292  HOH HOH A . 
T 9 HOH 293 2094 293  HOH HOH A . 
T 9 HOH 294 2095 294  HOH HOH A . 
T 9 HOH 295 2096 295  HOH HOH A . 
T 9 HOH 296 2097 296  HOH HOH A . 
T 9 HOH 297 2098 297  HOH HOH A . 
T 9 HOH 298 2099 298  HOH HOH A . 
T 9 HOH 299 2100 299  HOH HOH A . 
T 9 HOH 300 2101 300  HOH HOH A . 
T 9 HOH 301 2102 301  HOH HOH A . 
T 9 HOH 302 2103 302  HOH HOH A . 
T 9 HOH 303 2104 303  HOH HOH A . 
T 9 HOH 304 2105 304  HOH HOH A . 
T 9 HOH 305 2106 305  HOH HOH A . 
T 9 HOH 306 2107 306  HOH HOH A . 
T 9 HOH 307 2108 307  HOH HOH A . 
T 9 HOH 308 2109 308  HOH HOH A . 
T 9 HOH 309 2110 309  HOH HOH A . 
T 9 HOH 310 2111 310  HOH HOH A . 
T 9 HOH 311 2112 312  HOH HOH A . 
T 9 HOH 312 2113 313  HOH HOH A . 
T 9 HOH 313 2114 314  HOH HOH A . 
T 9 HOH 314 2115 315  HOH HOH A . 
T 9 HOH 315 2116 316  HOH HOH A . 
T 9 HOH 316 2117 317  HOH HOH A . 
T 9 HOH 317 2118 318  HOH HOH A . 
T 9 HOH 318 2119 319  HOH HOH A . 
T 9 HOH 319 2120 320  HOH HOH A . 
T 9 HOH 320 2121 321  HOH HOH A . 
T 9 HOH 321 2122 322  HOH HOH A . 
T 9 HOH 322 2123 323  HOH HOH A . 
T 9 HOH 323 2124 324  HOH HOH A . 
T 9 HOH 324 2125 325  HOH HOH A . 
T 9 HOH 325 2126 326  HOH HOH A . 
T 9 HOH 326 2127 327  HOH HOH A . 
T 9 HOH 327 2128 328  HOH HOH A . 
T 9 HOH 328 2129 329  HOH HOH A . 
T 9 HOH 329 2130 330  HOH HOH A . 
T 9 HOH 330 2131 331  HOH HOH A . 
T 9 HOH 331 2132 332  HOH HOH A . 
T 9 HOH 332 2133 333  HOH HOH A . 
T 9 HOH 333 2134 334  HOH HOH A . 
T 9 HOH 334 2135 335  HOH HOH A . 
T 9 HOH 335 2136 336  HOH HOH A . 
T 9 HOH 336 2137 337  HOH HOH A . 
T 9 HOH 337 2138 338  HOH HOH A . 
T 9 HOH 338 2139 339  HOH HOH A . 
T 9 HOH 339 2140 340  HOH HOH A . 
T 9 HOH 340 2141 341  HOH HOH A . 
T 9 HOH 341 2142 342  HOH HOH A . 
T 9 HOH 342 2143 343  HOH HOH A . 
T 9 HOH 343 2144 344  HOH HOH A . 
T 9 HOH 344 2145 345  HOH HOH A . 
T 9 HOH 345 2146 346  HOH HOH A . 
T 9 HOH 346 2147 347  HOH HOH A . 
T 9 HOH 347 2148 348  HOH HOH A . 
T 9 HOH 348 2149 349  HOH HOH A . 
T 9 HOH 349 2150 350  HOH HOH A . 
T 9 HOH 350 2151 351  HOH HOH A . 
T 9 HOH 351 2152 352  HOH HOH A . 
T 9 HOH 352 2153 353  HOH HOH A . 
T 9 HOH 353 2154 354  HOH HOH A . 
T 9 HOH 354 2155 355  HOH HOH A . 
T 9 HOH 355 2156 356  HOH HOH A . 
T 9 HOH 356 2157 357  HOH HOH A . 
T 9 HOH 357 2158 358  HOH HOH A . 
T 9 HOH 358 2159 359  HOH HOH A . 
T 9 HOH 359 2160 360  HOH HOH A . 
T 9 HOH 360 2161 361  HOH HOH A . 
T 9 HOH 361 2162 362  HOH HOH A . 
T 9 HOH 362 2163 363  HOH HOH A . 
T 9 HOH 363 2164 364  HOH HOH A . 
T 9 HOH 364 2165 365  HOH HOH A . 
T 9 HOH 365 2166 366  HOH HOH A . 
T 9 HOH 366 2167 367  HOH HOH A . 
T 9 HOH 367 2168 368  HOH HOH A . 
T 9 HOH 368 2169 369  HOH HOH A . 
T 9 HOH 369 2170 370  HOH HOH A . 
T 9 HOH 370 2171 371  HOH HOH A . 
T 9 HOH 371 2172 372  HOH HOH A . 
T 9 HOH 372 2173 373  HOH HOH A . 
T 9 HOH 373 2174 374  HOH HOH A . 
T 9 HOH 374 2175 375  HOH HOH A . 
T 9 HOH 375 2176 376  HOH HOH A . 
T 9 HOH 376 2177 377  HOH HOH A . 
T 9 HOH 377 2178 378  HOH HOH A . 
T 9 HOH 378 2179 379  HOH HOH A . 
T 9 HOH 379 2180 380  HOH HOH A . 
T 9 HOH 380 2181 381  HOH HOH A . 
T 9 HOH 381 2182 382  HOH HOH A . 
T 9 HOH 382 2183 383  HOH HOH A . 
T 9 HOH 383 2184 384  HOH HOH A . 
T 9 HOH 384 2185 385  HOH HOH A . 
T 9 HOH 385 2186 386  HOH HOH A . 
T 9 HOH 386 2187 387  HOH HOH A . 
T 9 HOH 387 2188 388  HOH HOH A . 
T 9 HOH 388 2189 389  HOH HOH A . 
T 9 HOH 389 2190 390  HOH HOH A . 
T 9 HOH 390 2191 391  HOH HOH A . 
T 9 HOH 391 2192 392  HOH HOH A . 
T 9 HOH 392 2193 393  HOH HOH A . 
T 9 HOH 393 2194 394  HOH HOH A . 
T 9 HOH 394 2195 395  HOH HOH A . 
T 9 HOH 395 2196 396  HOH HOH A . 
T 9 HOH 396 2197 397  HOH HOH A . 
T 9 HOH 397 2198 398  HOH HOH A . 
T 9 HOH 398 2199 399  HOH HOH A . 
T 9 HOH 399 2200 400  HOH HOH A . 
T 9 HOH 400 2201 401  HOH HOH A . 
T 9 HOH 401 2202 402  HOH HOH A . 
T 9 HOH 402 2203 403  HOH HOH A . 
T 9 HOH 403 2204 404  HOH HOH A . 
T 9 HOH 404 2205 405  HOH HOH A . 
T 9 HOH 405 2206 406  HOH HOH A . 
T 9 HOH 406 2207 407  HOH HOH A . 
T 9 HOH 407 2208 408  HOH HOH A . 
T 9 HOH 408 2209 409  HOH HOH A . 
T 9 HOH 409 2210 410  HOH HOH A . 
T 9 HOH 410 2211 411  HOH HOH A . 
T 9 HOH 411 2212 412  HOH HOH A . 
T 9 HOH 412 2213 413  HOH HOH A . 
T 9 HOH 413 2214 414  HOH HOH A . 
T 9 HOH 414 2215 415  HOH HOH A . 
T 9 HOH 415 2216 416  HOH HOH A . 
T 9 HOH 416 2217 417  HOH HOH A . 
T 9 HOH 417 2218 418  HOH HOH A . 
T 9 HOH 418 2219 419  HOH HOH A . 
T 9 HOH 419 2220 420  HOH HOH A . 
T 9 HOH 420 2221 421  HOH HOH A . 
T 9 HOH 421 2222 422  HOH HOH A . 
T 9 HOH 422 2223 423  HOH HOH A . 
T 9 HOH 423 2224 424  HOH HOH A . 
T 9 HOH 424 2225 425  HOH HOH A . 
T 9 HOH 425 2226 426  HOH HOH A . 
T 9 HOH 426 2227 427  HOH HOH A . 
T 9 HOH 427 2228 428  HOH HOH A . 
T 9 HOH 428 2229 429  HOH HOH A . 
T 9 HOH 429 2230 430  HOH HOH A . 
T 9 HOH 430 2231 431  HOH HOH A . 
T 9 HOH 431 2232 432  HOH HOH A . 
T 9 HOH 432 2233 433  HOH HOH A . 
T 9 HOH 433 2234 434  HOH HOH A . 
T 9 HOH 434 2235 435  HOH HOH A . 
T 9 HOH 435 2236 436  HOH HOH A . 
T 9 HOH 436 2237 437  HOH HOH A . 
T 9 HOH 437 2238 438  HOH HOH A . 
T 9 HOH 438 2239 439  HOH HOH A . 
T 9 HOH 439 2240 440  HOH HOH A . 
T 9 HOH 440 2241 441  HOH HOH A . 
T 9 HOH 441 2242 442  HOH HOH A . 
T 9 HOH 442 2243 443  HOH HOH A . 
T 9 HOH 443 2244 444  HOH HOH A . 
T 9 HOH 444 2245 445  HOH HOH A . 
T 9 HOH 445 2246 446  HOH HOH A . 
T 9 HOH 446 2247 447  HOH HOH A . 
T 9 HOH 447 2248 448  HOH HOH A . 
T 9 HOH 448 2249 449  HOH HOH A . 
T 9 HOH 449 2250 450  HOH HOH A . 
T 9 HOH 450 2251 451  HOH HOH A . 
T 9 HOH 451 2252 452  HOH HOH A . 
T 9 HOH 452 2253 453  HOH HOH A . 
T 9 HOH 453 2254 454  HOH HOH A . 
T 9 HOH 454 2255 455  HOH HOH A . 
T 9 HOH 455 2256 456  HOH HOH A . 
T 9 HOH 456 2257 457  HOH HOH A . 
T 9 HOH 457 2258 458  HOH HOH A . 
T 9 HOH 458 2259 459  HOH HOH A . 
T 9 HOH 459 2260 460  HOH HOH A . 
T 9 HOH 460 2261 461  HOH HOH A . 
T 9 HOH 461 2262 462  HOH HOH A . 
T 9 HOH 462 2263 463  HOH HOH A . 
T 9 HOH 463 2264 464  HOH HOH A . 
T 9 HOH 464 2265 465  HOH HOH A . 
T 9 HOH 465 2266 466  HOH HOH A . 
T 9 HOH 466 2267 467  HOH HOH A . 
T 9 HOH 467 2268 468  HOH HOH A . 
T 9 HOH 468 2269 469  HOH HOH A . 
T 9 HOH 469 2270 470  HOH HOH A . 
T 9 HOH 470 2271 471  HOH HOH A . 
T 9 HOH 471 2272 472  HOH HOH A . 
T 9 HOH 472 2273 473  HOH HOH A . 
T 9 HOH 473 2274 474  HOH HOH A . 
T 9 HOH 474 2275 475  HOH HOH A . 
T 9 HOH 475 2276 476  HOH HOH A . 
T 9 HOH 476 2277 477  HOH HOH A . 
T 9 HOH 477 2278 478  HOH HOH A . 
T 9 HOH 478 2279 479  HOH HOH A . 
T 9 HOH 479 2280 480  HOH HOH A . 
T 9 HOH 480 2281 481  HOH HOH A . 
T 9 HOH 481 2282 482  HOH HOH A . 
T 9 HOH 482 2283 483  HOH HOH A . 
T 9 HOH 483 2284 484  HOH HOH A . 
T 9 HOH 484 2285 485  HOH HOH A . 
T 9 HOH 485 2286 486  HOH HOH A . 
T 9 HOH 486 2287 487  HOH HOH A . 
T 9 HOH 487 2288 488  HOH HOH A . 
T 9 HOH 488 2289 489  HOH HOH A . 
T 9 HOH 489 2290 490  HOH HOH A . 
T 9 HOH 490 2291 491  HOH HOH A . 
T 9 HOH 491 2292 492  HOH HOH A . 
T 9 HOH 492 2293 493  HOH HOH A . 
T 9 HOH 493 2294 494  HOH HOH A . 
T 9 HOH 494 2295 495  HOH HOH A . 
T 9 HOH 495 2296 496  HOH HOH A . 
T 9 HOH 496 2297 497  HOH HOH A . 
T 9 HOH 497 2298 498  HOH HOH A . 
T 9 HOH 498 2299 499  HOH HOH A . 
T 9 HOH 499 2300 500  HOH HOH A . 
T 9 HOH 500 2301 501  HOH HOH A . 
T 9 HOH 501 2302 502  HOH HOH A . 
T 9 HOH 502 2303 503  HOH HOH A . 
T 9 HOH 503 2304 504  HOH HOH A . 
T 9 HOH 504 2305 505  HOH HOH A . 
T 9 HOH 505 2306 506  HOH HOH A . 
T 9 HOH 506 2307 507  HOH HOH A . 
T 9 HOH 507 2308 508  HOH HOH A . 
T 9 HOH 508 2309 509  HOH HOH A . 
T 9 HOH 509 2310 510  HOH HOH A . 
T 9 HOH 510 2311 511  HOH HOH A . 
T 9 HOH 511 2312 512  HOH HOH A . 
T 9 HOH 512 2313 513  HOH HOH A . 
T 9 HOH 513 2314 514  HOH HOH A . 
T 9 HOH 514 2315 515  HOH HOH A . 
T 9 HOH 515 2316 516  HOH HOH A . 
T 9 HOH 516 2317 517  HOH HOH A . 
T 9 HOH 517 2318 518  HOH HOH A . 
T 9 HOH 518 2319 519  HOH HOH A . 
T 9 HOH 519 2320 520  HOH HOH A . 
T 9 HOH 520 2321 521  HOH HOH A . 
T 9 HOH 521 2322 522  HOH HOH A . 
T 9 HOH 522 2323 523  HOH HOH A . 
T 9 HOH 523 2324 524  HOH HOH A . 
T 9 HOH 524 2325 525  HOH HOH A . 
T 9 HOH 525 2326 526  HOH HOH A . 
T 9 HOH 526 2327 527  HOH HOH A . 
T 9 HOH 527 2328 528  HOH HOH A . 
T 9 HOH 528 2329 529  HOH HOH A . 
T 9 HOH 529 2330 530  HOH HOH A . 
T 9 HOH 530 2331 531  HOH HOH A . 
T 9 HOH 531 2332 532  HOH HOH A . 
T 9 HOH 532 2333 533  HOH HOH A . 
T 9 HOH 533 2334 534  HOH HOH A . 
T 9 HOH 534 2335 535  HOH HOH A . 
T 9 HOH 535 2336 536  HOH HOH A . 
T 9 HOH 536 2337 537  HOH HOH A . 
T 9 HOH 537 2338 538  HOH HOH A . 
T 9 HOH 538 2339 539  HOH HOH A . 
T 9 HOH 539 2340 540  HOH HOH A . 
T 9 HOH 540 2341 541  HOH HOH A . 
T 9 HOH 541 2342 542  HOH HOH A . 
T 9 HOH 542 2343 543  HOH HOH A . 
T 9 HOH 543 2344 544  HOH HOH A . 
T 9 HOH 544 2345 545  HOH HOH A . 
T 9 HOH 545 2346 546  HOH HOH A . 
T 9 HOH 546 2347 547  HOH HOH A . 
T 9 HOH 547 2348 548  HOH HOH A . 
T 9 HOH 548 2349 549  HOH HOH A . 
T 9 HOH 549 2350 550  HOH HOH A . 
T 9 HOH 550 2351 551  HOH HOH A . 
T 9 HOH 551 2352 552  HOH HOH A . 
T 9 HOH 552 2353 553  HOH HOH A . 
T 9 HOH 553 2354 554  HOH HOH A . 
T 9 HOH 554 2355 555  HOH HOH A . 
T 9 HOH 555 2356 556  HOH HOH A . 
T 9 HOH 556 2357 557  HOH HOH A . 
T 9 HOH 557 2358 558  HOH HOH A . 
T 9 HOH 558 2359 559  HOH HOH A . 
T 9 HOH 559 2360 560  HOH HOH A . 
T 9 HOH 560 2361 561  HOH HOH A . 
T 9 HOH 561 2362 562  HOH HOH A . 
T 9 HOH 562 2363 563  HOH HOH A . 
T 9 HOH 563 2364 564  HOH HOH A . 
T 9 HOH 564 2365 565  HOH HOH A . 
T 9 HOH 565 2366 566  HOH HOH A . 
T 9 HOH 566 2367 567  HOH HOH A . 
T 9 HOH 567 2368 568  HOH HOH A . 
T 9 HOH 568 2369 569  HOH HOH A . 
T 9 HOH 569 2370 570  HOH HOH A . 
T 9 HOH 570 2371 571  HOH HOH A . 
T 9 HOH 571 2372 572  HOH HOH A . 
T 9 HOH 572 2373 573  HOH HOH A . 
T 9 HOH 573 2374 574  HOH HOH A . 
T 9 HOH 574 2375 575  HOH HOH A . 
T 9 HOH 575 2376 576  HOH HOH A . 
T 9 HOH 576 2377 577  HOH HOH A . 
T 9 HOH 577 2378 578  HOH HOH A . 
T 9 HOH 578 2379 579  HOH HOH A . 
T 9 HOH 579 2380 580  HOH HOH A . 
T 9 HOH 580 2381 581  HOH HOH A . 
T 9 HOH 581 2382 582  HOH HOH A . 
T 9 HOH 582 2383 583  HOH HOH A . 
T 9 HOH 583 2384 584  HOH HOH A . 
T 9 HOH 584 2385 585  HOH HOH A . 
T 9 HOH 585 2386 586  HOH HOH A . 
T 9 HOH 586 2387 587  HOH HOH A . 
T 9 HOH 587 2388 588  HOH HOH A . 
T 9 HOH 588 2389 589  HOH HOH A . 
T 9 HOH 589 2390 590  HOH HOH A . 
T 9 HOH 590 2391 591  HOH HOH A . 
T 9 HOH 591 2392 592  HOH HOH A . 
T 9 HOH 592 2393 593  HOH HOH A . 
T 9 HOH 593 2394 594  HOH HOH A . 
T 9 HOH 594 2395 595  HOH HOH A . 
T 9 HOH 595 2396 596  HOH HOH A . 
T 9 HOH 596 2397 597  HOH HOH A . 
T 9 HOH 597 2398 598  HOH HOH A . 
T 9 HOH 598 2399 599  HOH HOH A . 
T 9 HOH 599 2400 600  HOH HOH A . 
T 9 HOH 600 2401 601  HOH HOH A . 
T 9 HOH 601 2402 602  HOH HOH A . 
T 9 HOH 602 2403 603  HOH HOH A . 
T 9 HOH 603 2404 604  HOH HOH A . 
T 9 HOH 604 2405 605  HOH HOH A . 
T 9 HOH 605 2406 607  HOH HOH A . 
T 9 HOH 606 2407 608  HOH HOH A . 
T 9 HOH 607 2408 609  HOH HOH A . 
T 9 HOH 608 2409 610  HOH HOH A . 
T 9 HOH 609 2410 611  HOH HOH A . 
T 9 HOH 610 2411 612  HOH HOH A . 
T 9 HOH 611 2412 613  HOH HOH A . 
T 9 HOH 612 2413 614  HOH HOH A . 
T 9 HOH 613 2414 615  HOH HOH A . 
T 9 HOH 614 2415 616  HOH HOH A . 
T 9 HOH 615 2416 617  HOH HOH A . 
T 9 HOH 616 2417 619  HOH HOH A . 
T 9 HOH 617 2418 620  HOH HOH A . 
T 9 HOH 618 2419 621  HOH HOH A . 
T 9 HOH 619 2420 622  HOH HOH A . 
T 9 HOH 620 2421 623  HOH HOH A . 
T 9 HOH 621 2422 624  HOH HOH A . 
T 9 HOH 622 2423 625  HOH HOH A . 
T 9 HOH 623 2424 626  HOH HOH A . 
T 9 HOH 624 2425 627  HOH HOH A . 
T 9 HOH 625 2426 628  HOH HOH A . 
T 9 HOH 626 2427 629  HOH HOH A . 
T 9 HOH 627 2428 630  HOH HOH A . 
T 9 HOH 628 2429 631  HOH HOH A . 
T 9 HOH 629 2430 632  HOH HOH A . 
T 9 HOH 630 2431 633  HOH HOH A . 
T 9 HOH 631 2432 635  HOH HOH A . 
T 9 HOH 632 2433 636  HOH HOH A . 
T 9 HOH 633 2434 637  HOH HOH A . 
T 9 HOH 634 2435 638  HOH HOH A . 
T 9 HOH 635 2436 639  HOH HOH A . 
T 9 HOH 636 2437 640  HOH HOH A . 
T 9 HOH 637 2438 641  HOH HOH A . 
T 9 HOH 638 2439 642  HOH HOH A . 
T 9 HOH 639 2440 643  HOH HOH A . 
T 9 HOH 640 2441 644  HOH HOH A . 
T 9 HOH 641 2442 645  HOH HOH A . 
T 9 HOH 642 2443 646  HOH HOH A . 
T 9 HOH 643 2444 647  HOH HOH A . 
T 9 HOH 644 2445 648  HOH HOH A . 
T 9 HOH 645 2446 649  HOH HOH A . 
T 9 HOH 646 2447 650  HOH HOH A . 
T 9 HOH 647 2448 651  HOH HOH A . 
T 9 HOH 648 2449 652  HOH HOH A . 
T 9 HOH 649 2450 653  HOH HOH A . 
T 9 HOH 650 2451 654  HOH HOH A . 
T 9 HOH 651 2452 655  HOH HOH A . 
T 9 HOH 652 2453 656  HOH HOH A . 
T 9 HOH 653 2454 657  HOH HOH A . 
T 9 HOH 654 2455 658  HOH HOH A . 
T 9 HOH 655 2456 659  HOH HOH A . 
T 9 HOH 656 2457 660  HOH HOH A . 
T 9 HOH 657 2458 661  HOH HOH A . 
T 9 HOH 658 2459 662  HOH HOH A . 
T 9 HOH 659 2460 663  HOH HOH A . 
T 9 HOH 660 2461 664  HOH HOH A . 
T 9 HOH 661 2462 665  HOH HOH A . 
T 9 HOH 662 2463 666  HOH HOH A . 
T 9 HOH 663 2464 667  HOH HOH A . 
T 9 HOH 664 2465 668  HOH HOH A . 
T 9 HOH 665 2466 669  HOH HOH A . 
T 9 HOH 666 2467 670  HOH HOH A . 
T 9 HOH 667 2468 671  HOH HOH A . 
T 9 HOH 668 2469 672  HOH HOH A . 
T 9 HOH 669 2470 673  HOH HOH A . 
T 9 HOH 670 2471 674  HOH HOH A . 
T 9 HOH 671 2472 675  HOH HOH A . 
T 9 HOH 672 2473 676  HOH HOH A . 
T 9 HOH 673 2474 677  HOH HOH A . 
T 9 HOH 674 2475 680  HOH HOH A . 
T 9 HOH 675 2476 681  HOH HOH A . 
T 9 HOH 676 2477 682  HOH HOH A . 
T 9 HOH 677 2478 683  HOH HOH A . 
T 9 HOH 678 2479 685  HOH HOH A . 
T 9 HOH 679 2480 686  HOH HOH A . 
T 9 HOH 680 2481 687  HOH HOH A . 
T 9 HOH 681 2482 688  HOH HOH A . 
T 9 HOH 682 2483 689  HOH HOH A . 
T 9 HOH 683 2484 690  HOH HOH A . 
T 9 HOH 684 2485 691  HOH HOH A . 
T 9 HOH 685 2486 692  HOH HOH A . 
T 9 HOH 686 2487 693  HOH HOH A . 
T 9 HOH 687 2488 694  HOH HOH A . 
T 9 HOH 688 2489 695  HOH HOH A . 
T 9 HOH 689 2490 696  HOH HOH A . 
T 9 HOH 690 2491 697  HOH HOH A . 
T 9 HOH 691 2492 698  HOH HOH A . 
T 9 HOH 692 2493 699  HOH HOH A . 
T 9 HOH 693 2494 700  HOH HOH A . 
T 9 HOH 694 2495 701  HOH HOH A . 
T 9 HOH 695 2496 702  HOH HOH A . 
T 9 HOH 696 2497 703  HOH HOH A . 
T 9 HOH 697 2498 704  HOH HOH A . 
T 9 HOH 698 2499 705  HOH HOH A . 
T 9 HOH 699 2500 706  HOH HOH A . 
T 9 HOH 700 2501 707  HOH HOH A . 
T 9 HOH 701 2502 708  HOH HOH A . 
T 9 HOH 702 2503 709  HOH HOH A . 
T 9 HOH 703 2504 710  HOH HOH A . 
T 9 HOH 704 2505 711  HOH HOH A . 
T 9 HOH 705 2506 712  HOH HOH A . 
T 9 HOH 706 2507 713  HOH HOH A . 
T 9 HOH 707 2508 714  HOH HOH A . 
T 9 HOH 708 2509 715  HOH HOH A . 
T 9 HOH 709 2510 716  HOH HOH A . 
T 9 HOH 710 2511 717  HOH HOH A . 
T 9 HOH 711 2512 718  HOH HOH A . 
T 9 HOH 712 2513 719  HOH HOH A . 
T 9 HOH 713 2514 720  HOH HOH A . 
T 9 HOH 714 2515 721  HOH HOH A . 
T 9 HOH 715 2516 722  HOH HOH A . 
T 9 HOH 716 2517 723  HOH HOH A . 
T 9 HOH 717 2518 724  HOH HOH A . 
T 9 HOH 718 2519 725  HOH HOH A . 
T 9 HOH 719 2520 726  HOH HOH A . 
T 9 HOH 720 2521 727  HOH HOH A . 
T 9 HOH 721 2522 729  HOH HOH A . 
T 9 HOH 722 2523 730  HOH HOH A . 
T 9 HOH 723 2524 731  HOH HOH A . 
T 9 HOH 724 2525 734  HOH HOH A . 
T 9 HOH 725 2526 735  HOH HOH A . 
T 9 HOH 726 2527 736  HOH HOH A . 
T 9 HOH 727 2528 737  HOH HOH A . 
T 9 HOH 728 2529 738  HOH HOH A . 
T 9 HOH 729 2530 739  HOH HOH A . 
T 9 HOH 730 2531 740  HOH HOH A . 
T 9 HOH 731 2532 741  HOH HOH A . 
T 9 HOH 732 2533 742  HOH HOH A . 
T 9 HOH 733 2534 743  HOH HOH A . 
T 9 HOH 734 2535 744  HOH HOH A . 
T 9 HOH 735 2536 745  HOH HOH A . 
T 9 HOH 736 2537 746  HOH HOH A . 
T 9 HOH 737 2538 747  HOH HOH A . 
T 9 HOH 738 2539 749  HOH HOH A . 
T 9 HOH 739 2540 750  HOH HOH A . 
T 9 HOH 740 2541 751  HOH HOH A . 
T 9 HOH 741 2542 752  HOH HOH A . 
T 9 HOH 742 2543 754  HOH HOH A . 
T 9 HOH 743 2544 755  HOH HOH A . 
T 9 HOH 744 2545 756  HOH HOH A . 
T 9 HOH 745 2546 757  HOH HOH A . 
T 9 HOH 746 2547 758  HOH HOH A . 
T 9 HOH 747 2548 759  HOH HOH A . 
T 9 HOH 748 2549 760  HOH HOH A . 
T 9 HOH 749 2550 761  HOH HOH A . 
T 9 HOH 750 2551 762  HOH HOH A . 
T 9 HOH 751 2552 764  HOH HOH A . 
T 9 HOH 752 2553 765  HOH HOH A . 
T 9 HOH 753 2554 766  HOH HOH A . 
T 9 HOH 754 2555 768  HOH HOH A . 
T 9 HOH 755 2556 771  HOH HOH A . 
T 9 HOH 756 2557 772  HOH HOH A . 
T 9 HOH 757 2558 774  HOH HOH A . 
T 9 HOH 758 2559 775  HOH HOH A . 
T 9 HOH 759 2560 776  HOH HOH A . 
T 9 HOH 760 2561 780  HOH HOH A . 
T 9 HOH 761 2562 781  HOH HOH A . 
T 9 HOH 762 2563 782  HOH HOH A . 
T 9 HOH 763 2564 783  HOH HOH A . 
T 9 HOH 764 2565 784  HOH HOH A . 
T 9 HOH 765 2566 785  HOH HOH A . 
T 9 HOH 766 2567 786  HOH HOH A . 
T 9 HOH 767 2568 787  HOH HOH A . 
T 9 HOH 768 2569 788  HOH HOH A . 
T 9 HOH 769 2570 789  HOH HOH A . 
T 9 HOH 770 2571 790  HOH HOH A . 
T 9 HOH 771 2572 792  HOH HOH A . 
T 9 HOH 772 2573 793  HOH HOH A . 
T 9 HOH 773 2574 794  HOH HOH A . 
T 9 HOH 774 2575 795  HOH HOH A . 
T 9 HOH 775 2576 796  HOH HOH A . 
T 9 HOH 776 2577 797  HOH HOH A . 
T 9 HOH 777 2578 798  HOH HOH A . 
T 9 HOH 778 2579 800  HOH HOH A . 
T 9 HOH 779 2580 801  HOH HOH A . 
T 9 HOH 780 2581 803  HOH HOH A . 
T 9 HOH 781 2582 805  HOH HOH A . 
T 9 HOH 782 2583 806  HOH HOH A . 
T 9 HOH 783 2584 807  HOH HOH A . 
T 9 HOH 784 2585 808  HOH HOH A . 
T 9 HOH 785 2586 809  HOH HOH A . 
T 9 HOH 786 2587 810  HOH HOH A . 
T 9 HOH 787 2588 811  HOH HOH A . 
T 9 HOH 788 2589 812  HOH HOH A . 
T 9 HOH 789 2590 813  HOH HOH A . 
T 9 HOH 790 2591 814  HOH HOH A . 
T 9 HOH 791 2592 815  HOH HOH A . 
T 9 HOH 792 2593 816  HOH HOH A . 
T 9 HOH 793 2594 817  HOH HOH A . 
T 9 HOH 794 2595 818  HOH HOH A . 
T 9 HOH 795 2596 819  HOH HOH A . 
T 9 HOH 796 2597 820  HOH HOH A . 
T 9 HOH 797 2598 821  HOH HOH A . 
T 9 HOH 798 2599 822  HOH HOH A . 
T 9 HOH 799 2600 823  HOH HOH A . 
T 9 HOH 800 2601 824  HOH HOH A . 
T 9 HOH 801 2602 825  HOH HOH A . 
T 9 HOH 802 2603 826  HOH HOH A . 
T 9 HOH 803 2604 831  HOH HOH A . 
T 9 HOH 804 2605 833  HOH HOH A . 
T 9 HOH 805 2606 834  HOH HOH A . 
T 9 HOH 806 2607 835  HOH HOH A . 
T 9 HOH 807 2608 837  HOH HOH A . 
T 9 HOH 808 2609 838  HOH HOH A . 
T 9 HOH 809 2610 840  HOH HOH A . 
T 9 HOH 810 2611 841  HOH HOH A . 
T 9 HOH 811 2612 842  HOH HOH A . 
T 9 HOH 812 2613 843  HOH HOH A . 
T 9 HOH 813 2614 844  HOH HOH A . 
T 9 HOH 814 2615 846  HOH HOH A . 
T 9 HOH 815 2616 847  HOH HOH A . 
T 9 HOH 816 2617 848  HOH HOH A . 
T 9 HOH 817 2618 849  HOH HOH A . 
T 9 HOH 818 2619 852  HOH HOH A . 
T 9 HOH 819 2620 854  HOH HOH A . 
T 9 HOH 820 2621 855  HOH HOH A . 
T 9 HOH 821 2622 858  HOH HOH A . 
T 9 HOH 822 2623 859  HOH HOH A . 
T 9 HOH 823 2624 860  HOH HOH A . 
T 9 HOH 824 2625 862  HOH HOH A . 
T 9 HOH 825 2626 863  HOH HOH A . 
T 9 HOH 826 2627 864  HOH HOH A . 
T 9 HOH 827 2628 866  HOH HOH A . 
T 9 HOH 828 2629 867  HOH HOH A . 
T 9 HOH 829 2630 868  HOH HOH A . 
T 9 HOH 830 2631 870  HOH HOH A . 
T 9 HOH 831 2632 874  HOH HOH A . 
T 9 HOH 832 2633 876  HOH HOH A . 
T 9 HOH 833 2634 877  HOH HOH A . 
T 9 HOH 834 2635 878  HOH HOH A . 
T 9 HOH 835 2636 881  HOH HOH A . 
T 9 HOH 836 2637 884  HOH HOH A . 
T 9 HOH 837 2638 885  HOH HOH A . 
T 9 HOH 838 2639 886  HOH HOH A . 
T 9 HOH 839 2640 887  HOH HOH A . 
T 9 HOH 840 2641 888  HOH HOH A . 
T 9 HOH 841 2642 889  HOH HOH A . 
T 9 HOH 842 2643 891  HOH HOH A . 
T 9 HOH 843 2644 892  HOH HOH A . 
T 9 HOH 844 2645 893  HOH HOH A . 
T 9 HOH 845 2646 895  HOH HOH A . 
T 9 HOH 846 2647 896  HOH HOH A . 
T 9 HOH 847 2648 898  HOH HOH A . 
T 9 HOH 848 2649 900  HOH HOH A . 
T 9 HOH 849 2650 901  HOH HOH A . 
T 9 HOH 850 2651 903  HOH HOH A . 
T 9 HOH 851 2652 904  HOH HOH A . 
T 9 HOH 852 2653 906  HOH HOH A . 
T 9 HOH 853 2654 907  HOH HOH A . 
T 9 HOH 854 2655 908  HOH HOH A . 
T 9 HOH 855 2656 909  HOH HOH A . 
T 9 HOH 856 2657 910  HOH HOH A . 
T 9 HOH 857 2658 911  HOH HOH A . 
T 9 HOH 858 2659 912  HOH HOH A . 
T 9 HOH 859 2660 914  HOH HOH A . 
T 9 HOH 860 2661 915  HOH HOH A . 
T 9 HOH 861 2662 916  HOH HOH A . 
T 9 HOH 862 2663 918  HOH HOH A . 
T 9 HOH 863 2664 921  HOH HOH A . 
T 9 HOH 864 2665 925  HOH HOH A . 
T 9 HOH 865 2666 926  HOH HOH A . 
T 9 HOH 866 2667 928  HOH HOH A . 
T 9 HOH 867 2668 929  HOH HOH A . 
T 9 HOH 868 2669 931  HOH HOH A . 
T 9 HOH 869 2670 932  HOH HOH A . 
T 9 HOH 870 2671 933  HOH HOH A . 
T 9 HOH 871 2672 934  HOH HOH A . 
T 9 HOH 872 2673 936  HOH HOH A . 
T 9 HOH 873 2674 937  HOH HOH A . 
T 9 HOH 874 2675 938  HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 35  A ASN 76  ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 80  A ASN 121 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 99  A ASN 140 ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 154 A ASN 195 ? ASN 'GLYCOSYLATION SITE' 
5 A ASN 418 A ASN 459 ? ASN 'GLYCOSYLATION SITE' 
6 A ASN 435 A ASN 476 ? ASN 'GLYCOSYLATION SITE' 
7 A ASN 597 A ASN 638 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12920 ? 
1 MORE         -135  ? 
1 'SSA (A^2)'  48920 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -x,-y+1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 130.4370000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 OE2 ? A GLU 384 ? A GLU 425  ? 1_555 59.0  ? 
2  OE1 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 NE2 ? A HIS 512 ? A HIS 553  ? 1_555 86.6  ? 
3  OE2 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 NE2 ? A HIS 512 ? A HIS 553  ? 1_555 107.7 ? 
4  OE1 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 OD2 ? A ASP 346 ? A ASP 387  ? 1_555 160.9 ? 
5  OE2 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 OD2 ? A ASP 346 ? A ASP 387  ? 1_555 103.6 ? 
6  NE2 ? A HIS 512 ? A HIS 553  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 OD2 ? A ASP 346 ? A ASP 387  ? 1_555 92.1  ? 
7  OE1 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 O   ? T HOH .   ? A HOH 2675 ? 1_555 91.5  ? 
8  OE2 ? A GLU 384 ? A GLU 425  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 O   ? T HOH .   ? A HOH 2675 ? 1_555 100.2 ? 
9  NE2 ? A HIS 512 ? A HIS 553  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 O   ? T HOH .   ? A HOH 2675 ? 1_555 145.9 ? 
10 OD2 ? A ASP 346 ? A ASP 387  ? 1_555 ZN ? O ZN . ? A ZN 1751 ? 1_555 O   ? T HOH .   ? A HOH 2675 ? 1_555 100.1 ? 
11 O   ? T HOH .   ? A HOH 2675 ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 NE2 ? A HIS 336 ? A HIS 377  ? 1_555 109.6 ? 
12 O   ? T HOH .   ? A HOH 2675 ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 OD1 ? A ASP 346 ? A ASP 387  ? 1_555 108.2 ? 
13 NE2 ? A HIS 336 ? A HIS 377  ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 OD1 ? A ASP 346 ? A ASP 387  ? 1_555 106.0 ? 
14 O   ? T HOH .   ? A HOH 2675 ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 OD2 ? A ASP 412 ? A ASP 453  ? 1_555 113.4 ? 
15 NE2 ? A HIS 336 ? A HIS 377  ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 OD2 ? A ASP 412 ? A ASP 453  ? 1_555 100.1 ? 
16 OD1 ? A ASP 346 ? A ASP 387  ? 1_555 ZN ? P ZN . ? A ZN 1752 ? 1_555 OD2 ? A ASP 412 ? A ASP 453  ? 1_555 118.8 ? 
17 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? T HOH .   ? A HOH 1806 ? 1_555 97.2  ? 
18 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 91.0  ? 
19 O   ? T HOH .   ? A HOH 1806 ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 128.3 ? 
20 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 86.7  ? 
21 O   ? T HOH .   ? A HOH 1806 ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 76.5  ? 
22 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 53.0  ? 
23 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A THR 228 ? A THR 269  ? 1_555 105.5 ? 
24 O   ? T HOH .   ? A HOH 1806 ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A THR 228 ? A THR 269  ? 1_555 74.5  ? 
25 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A THR 228 ? A THR 269  ? 1_555 150.6 ? 
26 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A THR 228 ? A THR 269  ? 1_555 149.6 ? 
27 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OG1 ? A THR 228 ? A THR 269  ? 1_555 170.5 ? 
28 O   ? T HOH .   ? A HOH 1806 ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OG1 ? A THR 228 ? A THR 269  ? 1_555 90.4  ? 
29 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OG1 ? A THR 228 ? A THR 269  ? 1_555 88.7  ? 
30 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OG1 ? A THR 228 ? A THR 269  ? 1_555 100.7 ? 
31 O   ? A THR 228 ? A THR 269  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 OG1 ? A THR 228 ? A THR 269  ? 1_555 71.0  ? 
32 OE2 ? A GLU 395 ? A GLU 436  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 80.8  ? 
33 O   ? T HOH .   ? A HOH 1806 ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 145.7 ? 
34 OE1 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 86.0  ? 
35 OE2 ? A GLU 392 ? A GLU 433  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 136.9 ? 
36 O   ? A THR 228 ? A THR 269  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 73.2  ? 
37 OG1 ? A THR 228 ? A THR 269  ? 1_555 CA ? Q CA . ? A CA 1753 ? 1_555 O   ? A TYR 231 ? A TYR 272  ? 1_555 89.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-06-12 
2 'Structure model' 1 1 2007-10-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0005 ? 1 
MAR345dtb 'data collection' .        ? 2 
HKL-2000  'data reduction'  .        ? 3 
HKL-2000  'data scaling'    .        ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OH  A TYR 242  ? ? O A HOH 2495 ? ? 2.11 
2 1 OG  A SER 613  ? B O A HOH 2054 ? ? 2.13 
3 1 O   A HOH 2084 ? ? O A HOH 2168 ? ? 2.14 
4 1 ND2 A ASN 260  ? ? O A HOH 2477 ? ? 2.17 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 2174 ? ? 1_555 O A HOH 2313 ? ? 2_565 2.07 
2 1 O A HOH 2176 ? ? 1_555 O A HOH 2325 ? ? 2_565 2.15 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 210 ? ? CZ A ARG 210 ? ? NH1 A ARG 210 ? ? 116.95 120.30 -3.35  0.50 N 
2 1 CB A ASP 369 ? ? CG A ASP 369 ? ? OD1 A ASP 369 ? ? 124.38 118.30 6.08   0.90 N 
3 1 NE A ARG 370 ? ? CZ A ARG 370 ? ? NH1 A ARG 370 ? ? 125.34 120.30 5.04   0.50 N 
4 1 NE A ARG 370 ? ? CZ A ARG 370 ? ? NH2 A ARG 370 ? ? 116.54 120.30 -3.76  0.50 N 
5 1 NE A ARG 662 ? B CZ A ARG 662 ? B NH1 A ARG 662 ? B 125.27 120.30 4.97   0.50 N 
6 1 NE A ARG 662 ? A CZ A ARG 662 ? A NH2 A ARG 662 ? A 117.08 120.30 -3.22  0.50 N 
7 1 NE A ARG 662 ? B CZ A ARG 662 ? B NH2 A ARG 662 ? B 115.80 120.30 -4.50  0.50 N 
8 1 NE A ARG 688 ? ? CZ A ARG 688 ? ? NH1 A ARG 688 ? ? 116.99 120.30 -3.31  0.50 N 
9 1 CB A LEU 746 ? ? CG A LEU 746 ? ? CD1 A LEU 746 ? ? 100.78 111.00 -10.22 1.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS A 124 ? ? -150.20 74.35   
2  1 PHE A 164 ? ? 80.28   6.48    
3  1 ASN A 178 ? ? 59.74   -124.83 
4  1 LYS A 207 ? ? 70.16   -43.43  
5  1 VAL A 382 ? ? -127.87 -109.23 
6  1 ALA A 452 ? ? -155.14 57.81   
7  1 ASP A 453 ? ? -77.32  -158.70 
8  1 SER A 517 ? ? -135.31 -151.13 
9  1 ASP A 567 ? ? -154.80 64.86   
10 1 PHE A 653 ? B -68.12  -176.41 
11 1 ASP A 654 ? A -50.04  107.80  
12 1 ASP A 654 ? B -62.92  -142.96 
13 1 LYS A 655 ? B -143.65 -74.13  
14 1 ASP A 683 ? ? 59.23   13.70   
15 1 ASN A 698 ? ? -167.85 96.69   
16 1 PHE A 705 ? ? 39.33   53.91   
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    C1 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    MAN 
_pdbx_validate_chiral.auth_seq_id     1766 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         'WRONG HAND' 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 42  ? A ARG 1   
2  1 Y 1 A SER 43  ? A SER 2   
3  1 Y 1 A LYS 44  ? A LYS 3   
4  1 Y 1 A SER 45  ? A SER 4   
5  1 Y 1 A SER 46  ? A SER 5   
6  1 Y 1 A ASN 47  ? A ASN 6   
7  1 Y 1 A GLU 48  ? A GLU 7   
8  1 Y 1 A ALA 49  ? A ALA 8   
9  1 Y 1 A THR 50  ? A THR 9   
10 1 Y 1 A ASN 51  ? A ASN 10  
11 1 Y 1 A ILE 52  ? A ILE 11  
12 1 Y 1 A THR 53  ? A THR 12  
13 1 Y 1 A PRO 54  ? A PRO 13  
14 1 Y 1 A GLU 152 ? A GLU 111 
15 1 Y 1 A ASN 153 ? A ASN 112 
16 1 Y 1 A VAL 154 ? A VAL 113 
17 1 Y 1 A SER 155 ? A SER 114 
18 1 Y 1 A TRP 541 ? A TRP 500 
19 1 Y 1 A GLU 542 ? A GLU 501 
20 1 Y 1 A THR 543 ? A THR 502 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 N-ACETYL-D-GLUCOSAMINE                                               NAG 
3 BETA-D-MANNOSE                                                       BMA 
4 ALPHA-D-MANNOSE                                                      MAN 
5 'ZINC ION'                                                           ZN  
6 'CALCIUM ION'                                                        CA  
7 'CHLORIDE ION'                                                       CL  
8 '(S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID' QUS 
9 water                                                                HOH 
#