data_2OTT
# 
_entry.id   2OTT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OTT         
RCSB  RCSB041576   
WWPDB D_1000041576 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2ja4 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2OTT 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Rodamilans, B.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of the third extracellular domain of CD5 reveals the fold of a group B scavenger cysteine-rich receptor domain.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                12669 
_citation.page_last                 12677 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17322294 
_citation.pdbx_database_id_DOI      10.1074/jbc.M611699200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rodamilans, B.'      1 
primary 'Munoz, I.G.'         2 
primary 'Bragado-Nilsson, E.' 3 
primary 'Sarrias, M.R.'       4 
primary 'Padilla, O.'         5 
primary 'Blanco, F.J.'        6 
primary 'Lozano, F.'          7 
primary 'Montoya, G.'         8 
# 
_cell.entry_id           2OTT 
_cell.length_a           74.161 
_cell.length_b           74.161 
_cell.length_c           128.990 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OTT 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                91 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'T-cell surface glycoprotein CD5' 10912.171 2  ? ? CD5_DIII ? 
2 water   nat water                             18.015    77 ? ? ?        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Lymphocyte antigen T1/Leu- 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCH
ELWERNSYCKKVFVTCQD
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PAVESRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCH
ELWERNSYCKKVFVTCQD
;
_entity_poly.pdbx_strand_id                 X,Y 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  PRO n 
1 2  ALA n 
1 3  VAL n 
1 4  GLU n 
1 5  SER n 
1 6  ARG n 
1 7  LEU n 
1 8  VAL n 
1 9  GLY n 
1 10 GLY n 
1 11 SER n 
1 12 SER n 
1 13 ILE n 
1 14 CYS n 
1 15 GLU n 
1 16 GLY n 
1 17 THR n 
1 18 VAL n 
1 19 GLU n 
1 20 VAL n 
1 21 ARG n 
1 22 GLN n 
1 23 GLY n 
1 24 ALA n 
1 25 GLN n 
1 26 TRP n 
1 27 ALA n 
1 28 ALA n 
1 29 LEU n 
1 30 CYS n 
1 31 ASP n 
1 32 SER n 
1 33 SER n 
1 34 SER n 
1 35 ALA n 
1 36 ARG n 
1 37 SER n 
1 38 SER n 
1 39 LEU n 
1 40 ARG n 
1 41 TRP n 
1 42 GLU n 
1 43 GLU n 
1 44 VAL n 
1 45 CYS n 
1 46 ARG n 
1 47 GLU n 
1 48 GLN n 
1 49 GLN n 
1 50 CYS n 
1 51 GLY n 
1 52 SER n 
1 53 VAL n 
1 54 ASN n 
1 55 SER n 
1 56 TYR n 
1 57 ARG n 
1 58 VAL n 
1 59 LEU n 
1 60 ASP n 
1 61 ALA n 
1 62 GLY n 
1 63 ASP n 
1 64 PRO n 
1 65 THR n 
1 66 SER n 
1 67 ARG n 
1 68 GLY n 
1 69 LEU n 
1 70 PHE n 
1 71 CYS n 
1 72 PRO n 
1 73 HIS n 
1 74 GLN n 
1 75 LYS n 
1 76 LEU n 
1 77 SER n 
1 78 GLN n 
1 79 CYS n 
1 80 HIS n 
1 81 GLU n 
1 82 LEU n 
1 83 TRP n 
1 84 GLU n 
1 85 ARG n 
1 86 ASN n 
1 87 SER n 
1 88 TYR n 
1 89 CYS n 
1 90 LYS n 
1 91 LYS n 
1 92 VAL n 
1 93 PHE n 
1 94 VAL n 
1 95 THR n 
1 96 CYS n 
1 97 GLN n 
1 98 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CD5, LEU1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 B-LYMPHOCYTE 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               'KIDNEY CELLS' 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HEK 293-EBNA' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK-293EBNA 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCEP-Pu 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD5_HUMAN 
_struct_ref.pdbx_db_accession          P06127 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWE
RNSYCKKVFVTCQ
;
_struct_ref.pdbx_align_begin           276 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2OTT X 5 ? 97 ? P06127 276 ? 368 ? 11 103 
2 1 2OTT Y 5 ? 97 ? P06127 276 ? 368 ? 11 103 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OTT PRO X 1  ? UNP P06127 ? ? 'CLONING ARTIFACT' 7   1  
1 2OTT ALA X 2  ? UNP P06127 ? ? 'CLONING ARTIFACT' 8   2  
1 2OTT VAL X 3  ? UNP P06127 ? ? 'CLONING ARTIFACT' 9   3  
1 2OTT GLU X 4  ? UNP P06127 ? ? 'CLONING ARTIFACT' 10  4  
1 2OTT ASP X 98 ? UNP P06127 ? ? 'CLONING ARTIFACT' 104 5  
2 2OTT PRO Y 1  ? UNP P06127 ? ? 'CLONING ARTIFACT' 7   6  
2 2OTT ALA Y 2  ? UNP P06127 ? ? 'CLONING ARTIFACT' 8   7  
2 2OTT VAL Y 3  ? UNP P06127 ? ? 'CLONING ARTIFACT' 9   8  
2 2OTT GLU Y 4  ? UNP P06127 ? ? 'CLONING ARTIFACT' 10  9  
2 2OTT ASP Y 98 ? UNP P06127 ? ? 'CLONING ARTIFACT' 104 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2OTT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.06 
_exptl_crystal.density_percent_sol   69.72 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    '10mM Hepes, 300mM Na,Cl pH7.4, VAPOR DIFFUSION, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-08-03 
_diffrn_detector.details                'dinamically bendable mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'LN2 cooled fixed-exit Si(11) monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97 
# 
_reflns.entry_id                     2OTT 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   12350 
_reflns.number_all                   13033 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.65 
_reflns_shell.percent_possible_all   98.9 
_reflns_shell.Rmerge_I_obs           0.34 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        9.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2OTT 
_refine.ls_number_reflns_obs                     12350 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.69 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    99.60 
_refine.ls_R_factor_obs                          0.21842 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.21638 
_refine.ls_R_factor_R_free                       0.25863 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  631 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.925 
_refine.correlation_coeff_Fo_to_Fc_free          0.894 
_refine.B_iso_mean                               24.904 
_refine.aniso_B[1][1]                            -0.02 
_refine.aniso_B[2][2]                            -0.02 
_refine.aniso_B[3][3]                            0.04 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.273 
_refine.pdbx_overall_ESU_R_Free                  0.232 
_refine.overall_SU_ML                            0.141 
_refine.overall_SU_B                             11.690 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1452 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               1529 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        40.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.025  0.021  ? 1486 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.409  1.929  ? 2010 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       9.829  5.000  ? 182  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       40.536 23.784 ? 74   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       20.622 15.000 ? 248  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       24.979 15.000 ? 14   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.187  0.200  ? 212  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 1134 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                0.251  0.200  ? 551  'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              0.318  0.200  ? 989  'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        0.167  0.200  ? 73   'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       0.224  0.200  ? 37   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     0.127  0.200  ? 10   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.447  1.500  ? 946  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.385  2.000  ? 1470 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.719  3.000  ? 627  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.694  4.500  ? 540  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.503 
_refine_ls_shell.d_res_low                        2.568 
_refine_ls_shell.number_reflns_R_work             868 
_refine_ls_shell.R_factor_R_work                  0.290 
_refine_ls_shell.percent_reflns_obs               97.98 
_refine_ls_shell.R_factor_R_free                  0.327 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             53 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OTT 
_struct.title                     'Crystal structure of CD5_DIII' 
_struct.pdbx_descriptor           'T-cell surface glycoprotein CD5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OTT 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'SRCR group B domain, Immune System' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 37 ? GLN A 48 ? SER X 43 GLN X 54 1 ? 12 
HELX_P HELX_P2 2 LYS A 75 ? CYS A 79 ? LYS X 81 CYS X 85 5 ? 5  
HELX_P HELX_P3 3 SER B 38 ? GLN B 49 ? SER Y 44 GLN Y 55 1 ? 12 
HELX_P HELX_P4 4 LYS B 75 ? CYS B 79 ? LYS Y 81 CYS Y 85 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 50 SG ? ? X CYS 20 X CYS 56  1_555 ? ? ? ? ? ? ? 2.149 ? 
disulf2 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 89 SG ? ? X CYS 36 X CYS 95  1_555 ? ? ? ? ? ? ? 2.121 ? 
disulf3 disulf ? ? A CYS 45 SG ? ? ? 1_555 A CYS 96 SG ? ? X CYS 51 X CYS 102 1_555 ? ? ? ? ? ? ? 2.061 ? 
disulf4 disulf ? ? A CYS 71 SG ? ? ? 1_555 A CYS 79 SG ? ? X CYS 77 X CYS 85  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5 disulf ? ? B CYS 14 SG ? ? ? 1_555 B CYS 50 SG ? ? Y CYS 20 Y CYS 56  1_555 ? ? ? ? ? ? ? 2.096 ? 
disulf6 disulf ? ? B CYS 30 SG ? ? ? 1_555 B CYS 89 SG ? ? Y CYS 36 Y CYS 95  1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf7 disulf ? ? B CYS 45 SG ? ? ? 1_555 B CYS 96 SG ? ? Y CYS 51 Y CYS 102 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf8 disulf ? ? B CYS 71 SG ? ? ? 1_555 B CYS 79 SG ? ? Y CYS 77 Y CYS 85  1_555 ? ? ? ? ? ? ? 2.082 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           24 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            30 
_struct_mon_prot_cis.auth_asym_id           Y 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLN 
_struct_mon_prot_cis.pdbx_label_seq_id_2    25 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLN 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     31 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    Y 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       19.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 2 ? 
D ? 3 ? 
E ? 4 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 4  ? GLY A 9  ? GLU X 10 GLY X 15  
A 2 GLU A 15 ? ARG A 21 ? GLU X 21 ARG X 27  
A 3 ALA A 27 ? ALA A 28 ? ALA X 33 ALA X 34  
B 1 GLU A 4  ? GLY A 9  ? GLU X 10 GLY X 15  
B 2 GLU A 15 ? ARG A 21 ? GLU X 21 ARG X 27  
B 3 LYS A 91 ? CYS A 96 ? LYS X 97 CYS X 102 
B 4 VAL A 53 ? LEU A 59 ? VAL X 59 LEU X 65  
C 1 GLY A 68 ? PHE A 70 ? GLY X 74 PHE X 76  
C 2 TRP A 83 ? ARG A 85 ? TRP X 89 ARG X 91  
D 1 GLU B 4  ? GLY B 9  ? GLU Y 10 GLY Y 15  
D 2 GLU B 15 ? ARG B 21 ? GLU Y 21 ARG Y 27  
D 3 ALA B 27 ? ALA B 28 ? ALA Y 33 ALA Y 34  
E 1 GLU B 4  ? GLY B 9  ? GLU Y 10 GLY Y 15  
E 2 GLU B 15 ? ARG B 21 ? GLU Y 21 ARG Y 27  
E 3 LYS B 91 ? CYS B 96 ? LYS Y 97 CYS Y 102 
E 4 VAL B 53 ? LEU B 59 ? VAL Y 59 LEU Y 65  
F 1 GLY B 68 ? PHE B 70 ? GLY Y 74 PHE Y 76  
F 2 TRP B 83 ? ARG B 85 ? TRP Y 89 ARG Y 91  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 4  ? N GLU X 10  O ARG A 21 ? O ARG X 27  
A 2 3 N VAL A 20 ? N VAL X 26  O ALA A 27 ? O ALA X 33  
B 1 2 N GLU A 4  ? N GLU X 10  O ARG A 21 ? O ARG X 27  
B 2 3 N GLY A 16 ? N GLY X 22  O VAL A 94 ? O VAL X 100 
B 3 4 O THR A 95 ? O THR X 101 N ASN A 54 ? N ASN X 60  
C 1 2 N PHE A 70 ? N PHE X 76  O TRP A 83 ? O TRP X 89  
D 1 2 N ARG B 6  ? N ARG Y 12  O GLU B 19 ? O GLU Y 25  
D 2 3 N VAL B 20 ? N VAL Y 26  O ALA B 27 ? O ALA Y 33  
E 1 2 N ARG B 6  ? N ARG Y 12  O GLU B 19 ? O GLU Y 25  
E 2 3 N GLY B 16 ? N GLY Y 22  O VAL B 94 ? O VAL Y 100 
E 3 4 O PHE B 93 ? O PHE Y 99  N ARG B 57 ? N ARG Y 63  
F 1 2 N GLY B 68 ? N GLY Y 74  O ARG B 85 ? O ARG Y 91  
# 
_database_PDB_matrix.entry_id          2OTT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2OTT 
_atom_sites.fract_transf_matrix[1][1]   0.013484 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013484 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007753 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 1  ? 18.201 66.893 -12.067 1.00 22.37 ? 7   PRO X N   1 
ATOM   2    C CA  . PRO A 1 1  ? 18.734 66.665 -10.691 1.00 22.03 ? 7   PRO X CA  1 
ATOM   3    C C   . PRO A 1 1  ? 19.187 65.220 -10.515 1.00 21.34 ? 7   PRO X C   1 
ATOM   4    O O   . PRO A 1 1  ? 18.397 64.296 -10.725 1.00 21.96 ? 7   PRO X O   1 
ATOM   5    C CB  . PRO A 1 1  ? 17.521 66.934 -9.787  1.00 21.97 ? 7   PRO X CB  1 
ATOM   6    C CG  . PRO A 1 1  ? 16.301 66.624 -10.680 1.00 22.46 ? 7   PRO X CG  1 
ATOM   7    C CD  . PRO A 1 1  ? 16.722 66.926 -12.116 1.00 22.07 ? 7   PRO X CD  1 
ATOM   8    N N   . ALA A 1 2  ? 20.436 65.019 -10.144 1.00 20.12 ? 8   ALA X N   1 
ATOM   9    C CA  . ALA A 1 2  ? 20.915 63.674 -9.879  1.00 19.85 ? 8   ALA X CA  1 
ATOM   10   C C   . ALA A 1 2  ? 20.200 63.045 -8.647  1.00 19.91 ? 8   ALA X C   1 
ATOM   11   O O   . ALA A 1 2  ? 19.541 63.748 -7.839  1.00 19.81 ? 8   ALA X O   1 
ATOM   12   C CB  . ALA A 1 2  ? 22.449 63.674 -9.723  1.00 19.49 ? 8   ALA X CB  1 
ATOM   13   N N   . VAL A 1 3  ? 20.270 61.722 -8.545  1.00 18.65 ? 9   VAL X N   1 
ATOM   14   C CA  . VAL A 1 3  ? 19.787 61.031 -7.394  1.00 17.81 ? 9   VAL X CA  1 
ATOM   15   C C   . VAL A 1 3  ? 20.904 61.129 -6.346  1.00 17.21 ? 9   VAL X C   1 
ATOM   16   O O   . VAL A 1 3  ? 22.032 60.871 -6.671  1.00 17.97 ? 9   VAL X O   1 
ATOM   17   C CB  . VAL A 1 3  ? 19.541 59.557 -7.745  1.00 17.83 ? 9   VAL X CB  1 
ATOM   18   C CG1 . VAL A 1 3  ? 19.375 58.727 -6.484  1.00 18.36 ? 9   VAL X CG1 1 
ATOM   19   C CG2 . VAL A 1 3  ? 18.318 59.420 -8.596  1.00 18.54 ? 9   VAL X CG2 1 
ATOM   20   N N   . GLU A 1 4  ? 20.582 61.512 -5.122  1.00 15.71 ? 10  GLU X N   1 
ATOM   21   C CA  . GLU A 1 4  ? 21.539 61.588 -4.031  1.00 15.19 ? 10  GLU X CA  1 
ATOM   22   C C   . GLU A 1 4  ? 21.293 60.422 -3.114  1.00 13.50 ? 10  GLU X C   1 
ATOM   23   O O   . GLU A 1 4  ? 20.160 59.974 -2.963  1.00 11.22 ? 10  GLU X O   1 
ATOM   24   C CB  . GLU A 1 4  ? 21.241 62.808 -3.188  1.00 16.31 ? 10  GLU X CB  1 
ATOM   25   C CG  . GLU A 1 4  ? 22.000 64.010 -3.624  1.00 22.86 ? 10  GLU X CG  1 
ATOM   26   C CD  . GLU A 1 4  ? 21.547 65.231 -2.843  1.00 26.73 ? 10  GLU X CD  1 
ATOM   27   O OE1 . GLU A 1 4  ? 20.414 65.668 -3.054  1.00 25.08 ? 10  GLU X OE1 1 
ATOM   28   O OE2 . GLU A 1 4  ? 22.340 65.753 -2.022  1.00 31.25 ? 10  GLU X OE2 1 
ATOM   29   N N   . SER A 1 5  ? 22.338 59.906 -2.502  1.00 12.12 ? 11  SER X N   1 
ATOM   30   C CA  . SER A 1 5  ? 22.085 58.875 -1.546  1.00 12.64 ? 11  SER X CA  1 
ATOM   31   C C   . SER A 1 5  ? 22.799 59.172 -0.238  1.00 11.33 ? 11  SER X C   1 
ATOM   32   O O   . SER A 1 5  ? 23.690 59.994 -0.182  1.00 10.37 ? 11  SER X O   1 
ATOM   33   C CB  . SER A 1 5  ? 22.570 57.524 -2.074  1.00 12.15 ? 11  SER X CB  1 
ATOM   34   O OG  . SER A 1 5  ? 23.979 57.653 -2.223  1.00 14.03 ? 11  SER X OG  1 
ATOM   35   N N   . ARG A 1 6  ? 22.510 58.352 0.754   1.00 11.45 ? 12  ARG X N   1 
ATOM   36   C CA  . ARG A 1 6  ? 22.939 58.631 2.116   1.00 12.66 ? 12  ARG X CA  1 
ATOM   37   C C   . ARG A 1 6  ? 22.598 57.434 2.983   1.00 11.96 ? 12  ARG X C   1 
ATOM   38   O O   . ARG A 1 6  ? 21.661 56.712 2.677   1.00 10.34 ? 12  ARG X O   1 
ATOM   39   C CB  . ARG A 1 6  ? 22.048 59.692 2.586   1.00 13.60 ? 12  ARG X CB  1 
ATOM   40   C CG  . ARG A 1 6  ? 22.673 60.679 3.313   1.00 19.48 ? 12  ARG X CG  1 
ATOM   41   C CD  . ARG A 1 6  ? 21.676 60.718 4.477   1.00 28.25 ? 12  ARG X CD  1 
ATOM   42   N NE  . ARG A 1 6  ? 20.400 61.304 4.197   1.00 21.18 ? 12  ARG X NE  1 
ATOM   43   C CZ  . ARG A 1 6  ? 19.880 62.130 5.128   1.00 30.88 ? 12  ARG X CZ  1 
ATOM   44   N NH1 . ARG A 1 6  ? 20.552 62.331 6.293   1.00 25.80 ? 12  ARG X NH1 1 
ATOM   45   N NH2 . ARG A 1 6  ? 18.713 62.754 4.929   1.00 31.91 ? 12  ARG X NH2 1 
ATOM   46   N N   . LEU A 1 7  ? 23.346 57.264 4.070   1.00 11.55 ? 13  LEU X N   1 
ATOM   47   C CA  . LEU A 1 7  ? 23.188 56.136 4.966   1.00 9.69  ? 13  LEU X CA  1 
ATOM   48   C C   . LEU A 1 7  ? 22.706 56.684 6.290   1.00 10.24 ? 13  LEU X C   1 
ATOM   49   O O   . LEU A 1 7  ? 23.372 57.524 6.950   1.00 10.20 ? 13  LEU X O   1 
ATOM   50   C CB  . LEU A 1 7  ? 24.506 55.382 5.135   1.00 8.40  ? 13  LEU X CB  1 
ATOM   51   C CG  . LEU A 1 7  ? 25.043 54.828 3.841   1.00 7.93  ? 13  LEU X CG  1 
ATOM   52   C CD1 . LEU A 1 7  ? 26.441 54.265 4.084   1.00 8.87  ? 13  LEU X CD1 1 
ATOM   53   C CD2 . LEU A 1 7  ? 24.092 53.804 3.209   1.00 8.25  ? 13  LEU X CD2 1 
ATOM   54   N N   . VAL A 1 8  ? 21.528 56.218 6.685   1.00 9.66  ? 14  VAL X N   1 
ATOM   55   C CA  . VAL A 1 8  ? 20.837 56.807 7.791   1.00 8.53  ? 14  VAL X CA  1 
ATOM   56   C C   . VAL A 1 8  ? 20.793 55.790 8.941   1.00 10.15 ? 14  VAL X C   1 
ATOM   57   O O   . VAL A 1 8  ? 20.490 54.565 8.788   1.00 8.54  ? 14  VAL X O   1 
ATOM   58   C CB  . VAL A 1 8  ? 19.382 57.153 7.361   1.00 9.74  ? 14  VAL X CB  1 
ATOM   59   C CG1 . VAL A 1 8  ? 18.581 57.535 8.542   1.00 8.33  ? 14  VAL X CG1 1 
ATOM   60   C CG2 . VAL A 1 8  ? 19.346 58.325 6.390   1.00 8.35  ? 14  VAL X CG2 1 
ATOM   61   N N   . GLY A 1 9  ? 21.086 56.275 10.134  1.00 10.39 ? 15  GLY X N   1 
ATOM   62   C CA  . GLY A 1 9  ? 20.715 55.456 11.268  1.00 9.84  ? 15  GLY X CA  1 
ATOM   63   C C   . GLY A 1 9  ? 21.916 54.744 11.832  1.00 10.53 ? 15  GLY X C   1 
ATOM   64   O O   . GLY A 1 9  ? 21.752 54.100 12.871  1.00 10.63 ? 15  GLY X O   1 
ATOM   65   N N   . GLY A 1 10 ? 23.095 54.847 11.171  1.00 8.88  ? 16  GLY X N   1 
ATOM   66   C CA  . GLY A 1 10 ? 24.278 54.125 11.618  1.00 10.25 ? 16  GLY X CA  1 
ATOM   67   C C   . GLY A 1 10 ? 25.167 54.837 12.650  1.00 11.24 ? 16  GLY X C   1 
ATOM   68   O O   . GLY A 1 10 ? 25.070 56.063 12.835  1.00 12.12 ? 16  GLY X O   1 
ATOM   69   N N   . SER A 1 11 ? 26.103 54.116 13.258  1.00 9.39  ? 17  SER X N   1 
ATOM   70   C CA  . SER A 1 11 ? 26.906 54.764 14.287  1.00 10.89 ? 17  SER X CA  1 
ATOM   71   C C   . SER A 1 11 ? 27.900 55.689 13.673  1.00 9.40  ? 17  SER X C   1 
ATOM   72   O O   . SER A 1 11 ? 28.573 56.406 14.404  1.00 9.46  ? 17  SER X O   1 
ATOM   73   C CB  . SER A 1 11 ? 27.682 53.771 15.181  1.00 10.22 ? 17  SER X CB  1 
ATOM   74   O OG  . SER A 1 11 ? 28.475 53.065 14.276  1.00 15.24 ? 17  SER X OG  1 
ATOM   75   N N   . SER A 1 12 ? 28.025 55.662 12.355  1.00 8.98  ? 18  SER X N   1 
ATOM   76   C CA  . SER A 1 12 ? 28.577 56.793 11.639  1.00 9.28  ? 18  SER X CA  1 
ATOM   77   C C   . SER A 1 12 ? 27.909 57.004 10.255  1.00 10.45 ? 18  SER X C   1 
ATOM   78   O O   . SER A 1 12 ? 26.983 56.256 9.888   1.00 10.71 ? 18  SER X O   1 
ATOM   79   C CB  . SER A 1 12 ? 30.059 56.675 11.523  1.00 7.25  ? 18  SER X CB  1 
ATOM   80   O OG  . SER A 1 12 ? 30.323 55.908 10.403  1.00 11.27 ? 18  SER X OG  1 
ATOM   81   N N   . ILE A 1 13 ? 28.330 58.017 9.496   1.00 11.00 ? 19  ILE X N   1 
ATOM   82   C CA  . ILE A 1 13 ? 27.709 58.222 8.187   1.00 13.18 ? 19  ILE X CA  1 
ATOM   83   C C   . ILE A 1 13 ? 28.172 57.104 7.188   1.00 14.42 ? 19  ILE X C   1 
ATOM   84   O O   . ILE A 1 13 ? 27.642 57.008 6.048   1.00 13.63 ? 19  ILE X O   1 
ATOM   85   C CB  . ILE A 1 13 ? 28.000 59.637 7.597   1.00 12.59 ? 19  ILE X CB  1 
ATOM   86   C CG1 . ILE A 1 13 ? 29.511 59.844 7.446   1.00 16.05 ? 19  ILE X CG1 1 
ATOM   87   C CG2 . ILE A 1 13 ? 27.435 60.765 8.504   1.00 10.49 ? 19  ILE X CG2 1 
ATOM   88   C CD1 . ILE A 1 13 ? 29.905 60.929 6.396   1.00 15.77 ? 19  ILE X CD1 1 
ATOM   89   N N   . CYS A 1 14 ? 29.163 56.290 7.606   1.00 13.22 ? 20  CYS X N   1 
ATOM   90   C CA  . CYS A 1 14 ? 29.659 55.211 6.764   1.00 13.74 ? 20  CYS X CA  1 
ATOM   91   C C   . CYS A 1 14 ? 28.807 53.969 6.887   1.00 12.12 ? 20  CYS X C   1 
ATOM   92   O O   . CYS A 1 14 ? 29.126 52.948 6.302   1.00 12.98 ? 20  CYS X O   1 
ATOM   93   C CB  . CYS A 1 14 ? 31.132 54.884 7.110   1.00 14.16 ? 20  CYS X CB  1 
ATOM   94   S SG  . CYS A 1 14 ? 32.127 56.343 6.597   1.00 26.38 ? 20  CYS X SG  1 
ATOM   95   N N   . GLU A 1 15 ? 27.701 54.012 7.635   1.00 11.50 ? 21  GLU X N   1 
ATOM   96   C CA  . GLU A 1 15 ? 26.865 52.820 7.691   1.00 9.77  ? 21  GLU X CA  1 
ATOM   97   C C   . GLU A 1 15 ? 25.416 53.138 7.968   1.00 10.01 ? 21  GLU X C   1 
ATOM   98   O O   . GLU A 1 15 ? 25.118 54.168 8.525   1.00 9.93  ? 21  GLU X O   1 
ATOM   99   C CB  . GLU A 1 15 ? 27.498 51.900 8.689   1.00 10.48 ? 21  GLU X CB  1 
ATOM   100  C CG  . GLU A 1 15 ? 27.215 52.011 10.094  1.00 13.79 ? 21  GLU X CG  1 
ATOM   101  C CD  . GLU A 1 15 ? 27.964 50.892 10.784  1.00 23.29 ? 21  GLU X CD  1 
ATOM   102  O OE1 . GLU A 1 15 ? 29.209 50.739 10.476  1.00 28.37 ? 21  GLU X OE1 1 
ATOM   103  O OE2 . GLU A 1 15 ? 27.347 50.134 11.578  1.00 21.00 ? 21  GLU X OE2 1 
ATOM   104  N N   . GLY A 1 16 ? 24.483 52.335 7.472   1.00 9.57  ? 22  GLY X N   1 
ATOM   105  C CA  . GLY A 1 16 ? 23.107 52.623 7.734   1.00 8.08  ? 22  GLY X CA  1 
ATOM   106  C C   . GLY A 1 16 ? 22.184 52.202 6.617   1.00 9.48  ? 22  GLY X C   1 
ATOM   107  O O   . GLY A 1 16 ? 22.626 51.587 5.633   1.00 8.92  ? 22  GLY X O   1 
ATOM   108  N N   . THR A 1 17 ? 20.887 52.463 6.805   1.00 8.41  ? 23  THR X N   1 
ATOM   109  C CA  . THR A 1 17 ? 19.910 52.168 5.810   1.00 9.13  ? 23  THR X CA  1 
ATOM   110  C C   . THR A 1 17 ? 20.058 53.137 4.630   1.00 11.06 ? 23  THR X C   1 
ATOM   111  O O   . THR A 1 17 ? 20.236 54.353 4.839   1.00 10.66 ? 23  THR X O   1 
ATOM   112  C CB  . THR A 1 17 ? 18.526 52.377 6.421   1.00 8.00  ? 23  THR X CB  1 
ATOM   113  O OG1 . THR A 1 17 ? 18.392 51.394 7.435   1.00 8.70  ? 23  THR X OG1 1 
ATOM   114  C CG2 . THR A 1 17 ? 17.385 52.172 5.396   1.00 5.67  ? 23  THR X CG2 1 
ATOM   115  N N   . VAL A 1 18 ? 19.959 52.635 3.397   1.00 10.36 ? 24  VAL X N   1 
ATOM   116  C CA  . VAL A 1 18 ? 20.140 53.567 2.269   1.00 10.45 ? 24  VAL X CA  1 
ATOM   117  C C   . VAL A 1 18 ? 18.885 54.395 2.062   1.00 10.30 ? 24  VAL X C   1 
ATOM   118  O O   . VAL A 1 18 ? 17.742 53.849 1.954   1.00 10.28 ? 24  VAL X O   1 
ATOM   119  C CB  . VAL A 1 18 ? 20.557 52.804 0.941   1.00 11.16 ? 24  VAL X CB  1 
ATOM   120  C CG1 . VAL A 1 18 ? 20.788 53.775 -0.236  1.00 10.76 ? 24  VAL X CG1 1 
ATOM   121  C CG2 . VAL A 1 18 ? 21.812 51.991 1.186   1.00 6.93  ? 24  VAL X CG2 1 
ATOM   122  N N   . GLU A 1 19 ? 19.106 55.693 1.954   1.00 9.54  ? 25  GLU X N   1 
ATOM   123  C CA  . GLU A 1 19 ? 18.073 56.649 1.591   1.00 10.86 ? 25  GLU X CA  1 
ATOM   124  C C   . GLU A 1 19 ? 18.490 57.434 0.359   1.00 10.85 ? 25  GLU X C   1 
ATOM   125  O O   . GLU A 1 19 ? 19.695 57.701 0.145   1.00 9.91  ? 25  GLU X O   1 
ATOM   126  C CB  . GLU A 1 19 ? 17.780 57.599 2.743   1.00 9.85  ? 25  GLU X CB  1 
ATOM   127  C CG  . GLU A 1 19 ? 17.066 56.828 3.786   1.00 17.04 ? 25  GLU X CG  1 
ATOM   128  C CD  . GLU A 1 19 ? 16.382 57.703 4.799   1.00 27.13 ? 25  GLU X CD  1 
ATOM   129  O OE1 . GLU A 1 19 ? 16.304 58.935 4.578   1.00 27.38 ? 25  GLU X OE1 1 
ATOM   130  O OE2 . GLU A 1 19 ? 15.965 57.149 5.846   1.00 32.80 ? 25  GLU X OE2 1 
ATOM   131  N N   . VAL A 1 20 ? 17.493 57.783 -0.452  1.00 10.17 ? 26  VAL X N   1 
ATOM   132  C CA  . VAL A 1 20 ? 17.754 58.522 -1.693  1.00 9.93  ? 26  VAL X CA  1 
ATOM   133  C C   . VAL A 1 20 ? 16.794 59.649 -1.879  1.00 12.07 ? 26  VAL X C   1 
ATOM   134  O O   . VAL A 1 20 ? 15.742 59.725 -1.263  1.00 13.37 ? 26  VAL X O   1 
ATOM   135  C CB  . VAL A 1 20 ? 17.631 57.623 -2.925  1.00 9.34  ? 26  VAL X CB  1 
ATOM   136  C CG1 . VAL A 1 20 ? 18.823 56.657 -3.050  1.00 4.23  ? 26  VAL X CG1 1 
ATOM   137  C CG2 . VAL A 1 20 ? 16.272 56.881 -2.888  1.00 3.06  ? 26  VAL X CG2 1 
ATOM   138  N N   . ARG A 1 21 ? 17.113 60.512 -2.799  1.00 15.60 ? 27  ARG X N   1 
ATOM   139  C CA  . ARG A 1 21 ? 16.272 61.660 -3.074  1.00 18.57 ? 27  ARG X CA  1 
ATOM   140  C C   . ARG A 1 21 ? 16.684 62.245 -4.402  1.00 20.31 ? 27  ARG X C   1 
ATOM   141  O O   . ARG A 1 21 ? 17.862 62.257 -4.771  1.00 20.21 ? 27  ARG X O   1 
ATOM   142  C CB  . ARG A 1 21 ? 16.415 62.661 -1.934  1.00 19.06 ? 27  ARG X CB  1 
ATOM   143  C CG  . ARG A 1 21 ? 16.850 64.014 -2.324  1.00 22.02 ? 27  ARG X CG  1 
ATOM   144  C CD  . ARG A 1 21 ? 16.953 64.908 -1.128  1.00 26.56 ? 27  ARG X CD  1 
ATOM   145  N NE  . ARG A 1 21 ? 18.200 65.661 -1.243  1.00 29.78 ? 27  ARG X NE  1 
ATOM   146  C CZ  . ARG A 1 21 ? 18.504 66.765 -0.569  1.00 30.19 ? 27  ARG X CZ  1 
ATOM   147  N NH1 . ARG A 1 21 ? 19.696 67.325 -0.778  1.00 30.47 ? 27  ARG X NH1 1 
ATOM   148  N NH2 . ARG A 1 21 ? 17.641 67.296 0.308   1.00 27.16 ? 27  ARG X NH2 1 
ATOM   149  N N   . GLN A 1 22 ? 15.690 62.664 -5.147  1.00 23.78 ? 28  GLN X N   1 
ATOM   150  C CA  . GLN A 1 22 ? 15.921 63.446 -6.350  1.00 27.60 ? 28  GLN X CA  1 
ATOM   151  C C   . GLN A 1 22 ? 15.463 64.945 -6.161  1.00 28.90 ? 28  GLN X C   1 
ATOM   152  O O   . GLN A 1 22 ? 16.223 65.787 -5.642  1.00 30.71 ? 28  GLN X O   1 
ATOM   153  C CB  . GLN A 1 22 ? 15.276 62.750 -7.525  1.00 27.79 ? 28  GLN X CB  1 
ATOM   154  C CG  . GLN A 1 22 ? 16.030 62.890 -8.780  1.00 31.56 ? 28  GLN X CG  1 
ATOM   155  C CD  . GLN A 1 22 ? 15.604 61.885 -9.796  1.00 35.74 ? 28  GLN X CD  1 
ATOM   156  O OE1 . GLN A 1 22 ? 14.437 61.463 -9.819  1.00 39.49 ? 28  GLN X OE1 1 
ATOM   157  N NE2 . GLN A 1 22 ? 16.537 61.481 -10.651 1.00 35.40 ? 28  GLN X NE2 1 
ATOM   158  N N   . GLY A 1 23 ? 14.266 65.317 -6.529  1.00 29.26 ? 29  GLY X N   1 
ATOM   159  C CA  . GLY A 1 23 ? 13.870 66.691 -6.144  1.00 31.52 ? 29  GLY X CA  1 
ATOM   160  C C   . GLY A 1 23 ? 12.928 66.386 -5.004  1.00 32.84 ? 29  GLY X C   1 
ATOM   161  O O   . GLY A 1 23 ? 11.731 66.245 -5.195  1.00 34.18 ? 29  GLY X O   1 
ATOM   162  N N   . ALA A 1 24 ? 13.431 66.148 -3.815  1.00 32.95 ? 30  ALA X N   1 
ATOM   163  C CA  . ALA A 1 24 ? 12.603 65.278 -3.017  1.00 32.62 ? 30  ALA X CA  1 
ATOM   164  C C   . ALA A 1 24 ? 12.694 65.428 -1.505  1.00 32.02 ? 30  ALA X C   1 
ATOM   165  O O   . ALA A 1 24 ? 13.565 66.133 -0.930  1.00 31.95 ? 30  ALA X O   1 
ATOM   166  C CB  . ALA A 1 24 ? 12.859 63.712 -3.465  1.00 32.92 ? 30  ALA X CB  1 
ATOM   167  N N   . GLN A 1 25 ? 11.744 64.749 -0.881  1.00 30.04 ? 31  GLN X N   1 
ATOM   168  C CA  . GLN A 1 25 ? 11.986 64.207 0.401   1.00 28.35 ? 31  GLN X CA  1 
ATOM   169  C C   . GLN A 1 25 ? 12.944 63.031 0.281   1.00 24.52 ? 31  GLN X C   1 
ATOM   170  O O   . GLN A 1 25 ? 13.079 62.385 -0.748  1.00 22.49 ? 31  GLN X O   1 
ATOM   171  C CB  . GLN A 1 25 ? 10.667 63.741 0.985   1.00 29.97 ? 31  GLN X CB  1 
ATOM   172  C CG  . GLN A 1 25 ? 10.157 64.800 2.002   1.00 36.42 ? 31  GLN X CG  1 
ATOM   173  C CD  . GLN A 1 25 ? 8.722  64.516 2.426   1.00 39.88 ? 31  GLN X CD  1 
ATOM   174  O OE1 . GLN A 1 25 ? 7.785  65.122 1.892   1.00 38.87 ? 31  GLN X OE1 1 
ATOM   175  N NE2 . GLN A 1 25 ? 8.543  63.568 3.375   1.00 40.63 ? 31  GLN X NE2 1 
ATOM   176  N N   . TRP A 1 26 ? 13.633 62.776 1.362   1.00 21.33 ? 32  TRP X N   1 
ATOM   177  C CA  . TRP A 1 26 ? 14.399 61.558 1.442   1.00 18.76 ? 32  TRP X CA  1 
ATOM   178  C C   . TRP A 1 26 ? 13.432 60.401 1.614   1.00 16.89 ? 32  TRP X C   1 
ATOM   179  O O   . TRP A 1 26 ? 12.386 60.547 2.267   1.00 17.75 ? 32  TRP X O   1 
ATOM   180  C CB  . TRP A 1 26 ? 15.345 61.644 2.610   1.00 15.60 ? 32  TRP X CB  1 
ATOM   181  C CG  . TRP A 1 26 ? 16.484 62.578 2.350   1.00 17.24 ? 32  TRP X CG  1 
ATOM   182  C CD1 . TRP A 1 26 ? 16.571 63.893 2.758   1.00 15.16 ? 32  TRP X CD1 1 
ATOM   183  C CD2 . TRP A 1 26 ? 17.711 62.306 1.604   1.00 11.80 ? 32  TRP X CD2 1 
ATOM   184  N NE1 . TRP A 1 26 ? 17.774 64.428 2.345   1.00 14.54 ? 32  TRP X NE1 1 
ATOM   185  C CE2 . TRP A 1 26 ? 18.488 63.478 1.643   1.00 14.25 ? 32  TRP X CE2 1 
ATOM   186  C CE3 . TRP A 1 26 ? 18.220 61.184 0.932   1.00 11.92 ? 32  TRP X CE3 1 
ATOM   187  C CZ2 . TRP A 1 26 ? 19.782 63.555 1.052   1.00 12.34 ? 32  TRP X CZ2 1 
ATOM   188  C CZ3 . TRP A 1 26 ? 19.471 61.257 0.352   1.00 11.24 ? 32  TRP X CZ3 1 
ATOM   189  C CH2 . TRP A 1 26 ? 20.240 62.450 0.405   1.00 11.24 ? 32  TRP X CH2 1 
ATOM   190  N N   . ALA A 1 27 ? 13.768 59.257 1.046   1.00 13.82 ? 33  ALA X N   1 
ATOM   191  C CA  . ALA A 1 27 ? 12.916 58.090 1.207   1.00 11.43 ? 33  ALA X CA  1 
ATOM   192  C C   . ALA A 1 27 ? 13.913 56.948 1.194   1.00 10.92 ? 33  ALA X C   1 
ATOM   193  O O   . ALA A 1 27 ? 15.017 57.085 0.669   1.00 9.43  ? 33  ALA X O   1 
ATOM   194  C CB  . ALA A 1 27 ? 11.959 57.997 0.049   1.00 8.92  ? 33  ALA X CB  1 
ATOM   195  N N   . ALA A 1 28 ? 13.533 55.834 1.806   1.00 10.39 ? 34  ALA X N   1 
ATOM   196  C CA  . ALA A 1 28 ? 14.344 54.653 1.740   1.00 10.11 ? 34  ALA X CA  1 
ATOM   197  C C   . ALA A 1 28 ? 14.502 54.225 0.283   1.00 10.28 ? 34  ALA X C   1 
ATOM   198  O O   . ALA A 1 28 ? 13.573 54.385 -0.500  1.00 10.97 ? 34  ALA X O   1 
ATOM   199  C CB  . ALA A 1 28 ? 13.695 53.582 2.533   1.00 8.79  ? 34  ALA X CB  1 
ATOM   200  N N   . LEU A 1 29 ? 15.637 53.639 -0.071  1.00 10.04 ? 35  LEU X N   1 
ATOM   201  C CA  . LEU A 1 29 ? 15.785 52.953 -1.348  1.00 10.99 ? 35  LEU X CA  1 
ATOM   202  C C   . LEU A 1 29 ? 15.318 51.542 -1.246  1.00 13.25 ? 35  LEU X C   1 
ATOM   203  O O   . LEU A 1 29 ? 15.780 50.823 -0.325  1.00 14.85 ? 35  LEU X O   1 
ATOM   204  C CB  . LEU A 1 29 ? 17.250 52.897 -1.760  1.00 9.69  ? 35  LEU X CB  1 
ATOM   205  C CG  . LEU A 1 29 ? 17.634 52.111 -3.028  1.00 10.51 ? 35  LEU X CG  1 
ATOM   206  C CD1 . LEU A 1 29 ? 17.115 52.779 -4.330  1.00 8.92  ? 35  LEU X CD1 1 
ATOM   207  C CD2 . LEU A 1 29 ? 19.143 52.009 -3.107  1.00 10.09 ? 35  LEU X CD2 1 
ATOM   208  N N   . CYS A 1 30 ? 14.503 51.090 -2.201  1.00 14.81 ? 36  CYS X N   1 
ATOM   209  C CA  . CYS A 1 30 ? 14.066 49.696 -2.239  1.00 19.39 ? 36  CYS X CA  1 
ATOM   210  C C   . CYS A 1 30 ? 14.949 48.946 -3.139  1.00 21.00 ? 36  CYS X C   1 
ATOM   211  O O   . CYS A 1 30 ? 15.224 49.441 -4.242  1.00 22.05 ? 36  CYS X O   1 
ATOM   212  C CB  . CYS A 1 30 ? 12.667 49.548 -2.843  1.00 18.99 ? 36  CYS X CB  1 
ATOM   213  S SG  . CYS A 1 30 ? 11.539 50.631 -2.051  1.00 29.87 ? 36  CYS X SG  1 
ATOM   214  N N   . ASP A 1 31 ? 15.334 47.721 -2.812  1.00 24.43 ? 37  ASP X N   1 
ATOM   215  C CA  . ASP A 1 31 ? 16.144 47.049 -3.843  1.00 28.97 ? 37  ASP X CA  1 
ATOM   216  C C   . ASP A 1 31 ? 15.692 45.670 -4.187  1.00 31.04 ? 37  ASP X C   1 
ATOM   217  O O   . ASP A 1 31 ? 15.108 45.060 -3.375  1.00 32.37 ? 37  ASP X O   1 
ATOM   218  C CB  . ASP A 1 31 ? 17.620 47.046 -3.404  1.00 29.63 ? 37  ASP X CB  1 
ATOM   219  C CG  . ASP A 1 31 ? 18.613 46.736 -4.576  1.00 32.34 ? 37  ASP X CG  1 
ATOM   220  O OD1 . ASP A 1 31 ? 18.562 45.599 -5.105  1.00 35.64 ? 37  ASP X OD1 1 
ATOM   221  O OD2 . ASP A 1 31 ? 19.456 47.600 -4.958  1.00 34.09 ? 37  ASP X OD2 1 
ATOM   222  N N   . SER A 1 32 ? 15.976 45.150 -5.383  1.00 35.77 ? 38  SER X N   1 
ATOM   223  C CA  . SER A 1 32 ? 16.492 43.698 -5.462  1.00 38.02 ? 38  SER X CA  1 
ATOM   224  C C   . SER A 1 32 ? 17.343 43.322 -6.673  1.00 38.81 ? 38  SER X C   1 
ATOM   225  O O   . SER A 1 32 ? 18.477 42.815 -6.535  1.00 41.21 ? 38  SER X O   1 
ATOM   226  C CB  . SER A 1 32 ? 15.410 42.636 -5.224  1.00 38.46 ? 38  SER X CB  1 
ATOM   227  O OG  . SER A 1 32 ? 14.631 42.511 -6.381  1.00 41.25 ? 38  SER X OG  1 
ATOM   228  N N   . SER A 1 37 ? 26.079 43.199 -8.117  1.00 35.18 ? 43  SER X N   1 
ATOM   229  C CA  . SER A 1 37 ? 25.133 43.936 -7.276  1.00 36.42 ? 43  SER X CA  1 
ATOM   230  C C   . SER A 1 37 ? 25.838 44.807 -6.221  1.00 35.73 ? 43  SER X C   1 
ATOM   231  O O   . SER A 1 37 ? 25.274 45.837 -5.762  1.00 36.26 ? 43  SER X O   1 
ATOM   232  C CB  . SER A 1 37 ? 24.085 43.016 -6.600  1.00 37.00 ? 43  SER X CB  1 
ATOM   233  O OG  . SER A 1 37 ? 23.377 43.736 -5.564  1.00 38.54 ? 43  SER X OG  1 
ATOM   234  N N   . SER A 1 38 ? 27.061 44.409 -5.848  1.00 33.39 ? 44  SER X N   1 
ATOM   235  C CA  . SER A 1 38 ? 27.904 45.295 -5.069  1.00 31.22 ? 44  SER X CA  1 
ATOM   236  C C   . SER A 1 38 ? 28.281 46.609 -5.748  1.00 28.10 ? 44  SER X C   1 
ATOM   237  O O   . SER A 1 38 ? 28.706 47.547 -5.070  1.00 26.90 ? 44  SER X O   1 
ATOM   238  C CB  . SER A 1 38 ? 29.135 44.575 -4.534  1.00 32.24 ? 44  SER X CB  1 
ATOM   239  O OG  . SER A 1 38 ? 28.771 44.124 -3.221  1.00 36.71 ? 44  SER X OG  1 
ATOM   240  N N   . LEU A 1 39 ? 28.097 46.668 -7.066  1.00 24.57 ? 45  LEU X N   1 
ATOM   241  C CA  . LEU A 1 39 ? 28.327 47.872 -7.854  1.00 22.14 ? 45  LEU X CA  1 
ATOM   242  C C   . LEU A 1 39 ? 27.578 49.094 -7.286  1.00 19.93 ? 45  LEU X C   1 
ATOM   243  O O   . LEU A 1 39 ? 28.177 50.142 -6.977  1.00 19.46 ? 45  LEU X O   1 
ATOM   244  C CB  . LEU A 1 39 ? 27.988 47.612 -9.324  1.00 21.76 ? 45  LEU X CB  1 
ATOM   245  C CG  . LEU A 1 39 ? 29.081 46.783 -10.038 1.00 24.78 ? 45  LEU X CG  1 
ATOM   246  C CD1 . LEU A 1 39 ? 28.715 46.420 -11.531 1.00 25.48 ? 45  LEU X CD1 1 
ATOM   247  C CD2 . LEU A 1 39 ? 30.451 47.463 -9.989  1.00 21.70 ? 45  LEU X CD2 1 
ATOM   248  N N   . ARG A 1 40 ? 26.297 48.922 -7.051  1.00 16.93 ? 46  ARG X N   1 
ATOM   249  C CA  . ARG A 1 40 ? 25.515 50.005 -6.544  1.00 15.88 ? 46  ARG X CA  1 
ATOM   250  C C   . ARG A 1 40 ? 25.959 50.446 -5.155  1.00 13.40 ? 46  ARG X C   1 
ATOM   251  O O   . ARG A 1 40 ? 25.957 51.669 -4.850  1.00 14.11 ? 46  ARG X O   1 
ATOM   252  C CB  . ARG A 1 40 ? 24.034 49.624 -6.632  1.00 14.86 ? 46  ARG X CB  1 
ATOM   253  C CG  . ARG A 1 40 ? 23.136 50.411 -5.739  1.00 16.99 ? 46  ARG X CG  1 
ATOM   254  C CD  . ARG A 1 40 ? 21.646 49.986 -5.953  1.00 19.41 ? 46  ARG X CD  1 
ATOM   255  N NE  . ARG A 1 40 ? 21.105 50.202 -7.319  1.00 20.14 ? 46  ARG X NE  1 
ATOM   256  C CZ  . ARG A 1 40 ? 19.809 50.123 -7.590  1.00 20.91 ? 46  ARG X CZ  1 
ATOM   257  N NH1 . ARG A 1 40 ? 18.957 49.866 -6.585  1.00 15.06 ? 46  ARG X NH1 1 
ATOM   258  N NH2 . ARG A 1 40 ? 19.364 50.323 -8.855  1.00 23.97 ? 46  ARG X NH2 1 
ATOM   259  N N   . TRP A 1 41 ? 26.383 49.506 -4.312  1.00 11.55 ? 47  TRP X N   1 
ATOM   260  C CA  . TRP A 1 41 ? 26.672 49.878 -2.909  1.00 10.01 ? 47  TRP X CA  1 
ATOM   261  C C   . TRP A 1 41 ? 28.012 50.574 -2.795  1.00 10.11 ? 47  TRP X C   1 
ATOM   262  O O   . TRP A 1 41 ? 28.184 51.529 -1.963  1.00 10.35 ? 47  TRP X O   1 
ATOM   263  C CB  . TRP A 1 41 ? 26.536 48.694 -1.931  1.00 10.04 ? 47  TRP X CB  1 
ATOM   264  C CG  . TRP A 1 41 ? 25.282 47.964 -2.111  1.00 9.94  ? 47  TRP X CG  1 
ATOM   265  C CD1 . TRP A 1 41 ? 25.113 46.588 -2.286  1.00 9.53  ? 47  TRP X CD1 1 
ATOM   266  C CD2 . TRP A 1 41 ? 23.975 48.555 -2.257  1.00 8.87  ? 47  TRP X CD2 1 
ATOM   267  N NE1 . TRP A 1 41 ? 23.751 46.323 -2.471  1.00 10.58 ? 47  TRP X NE1 1 
ATOM   268  C CE2 . TRP A 1 41 ? 23.051 47.501 -2.488  1.00 7.29  ? 47  TRP X CE2 1 
ATOM   269  C CE3 . TRP A 1 41 ? 23.508 49.872 -2.231  1.00 9.42  ? 47  TRP X CE3 1 
ATOM   270  C CZ2 . TRP A 1 41 ? 21.678 47.725 -2.685  1.00 12.12 ? 47  TRP X CZ2 1 
ATOM   271  C CZ3 . TRP A 1 41 ? 22.113 50.109 -2.401  1.00 11.27 ? 47  TRP X CZ3 1 
ATOM   272  C CH2 . TRP A 1 41 ? 21.216 49.024 -2.615  1.00 11.79 ? 47  TRP X CH2 1 
ATOM   273  N N   . GLU A 1 42 ? 28.928 50.195 -3.686  1.00 8.92  ? 48  GLU X N   1 
ATOM   274  C CA  . GLU A 1 42 ? 30.194 50.862 -3.754  1.00 9.50  ? 48  GLU X CA  1 
ATOM   275  C C   . GLU A 1 42 ? 30.003 52.346 -4.144  1.00 11.77 ? 48  GLU X C   1 
ATOM   276  O O   . GLU A 1 42 ? 30.660 53.209 -3.550  1.00 13.56 ? 48  GLU X O   1 
ATOM   277  C CB  . GLU A 1 42 ? 31.125 50.180 -4.758  1.00 8.57  ? 48  GLU X CB  1 
ATOM   278  C CG  . GLU A 1 42 ? 32.426 50.923 -4.979  1.00 8.73  ? 48  GLU X CG  1 
ATOM   279  C CD  . GLU A 1 42 ? 33.391 50.766 -3.727  1.00 13.25 ? 48  GLU X CD  1 
ATOM   280  O OE1 . GLU A 1 42 ? 32.989 50.075 -2.745  1.00 14.64 ? 48  GLU X OE1 1 
ATOM   281  O OE2 . GLU A 1 42 ? 34.505 51.349 -3.694  1.00 9.25  ? 48  GLU X OE2 1 
ATOM   282  N N   . GLU A 1 43 ? 29.153 52.655 -5.133  1.00 12.03 ? 49  GLU X N   1 
ATOM   283  C CA  . GLU A 1 43 ? 28.871 54.044 -5.488  1.00 14.12 ? 49  GLU X CA  1 
ATOM   284  C C   . GLU A 1 43 ? 28.318 54.779 -4.247  1.00 12.34 ? 49  GLU X C   1 
ATOM   285  O O   . GLU A 1 43 ? 28.755 55.909 -3.959  1.00 12.03 ? 49  GLU X O   1 
ATOM   286  C CB  . GLU A 1 43 ? 27.779 54.159 -6.552  1.00 14.94 ? 49  GLU X CB  1 
ATOM   287  C CG  . GLU A 1 43 ? 28.162 54.003 -7.919  1.00 28.64 ? 49  GLU X CG  1 
ATOM   288  C CD  . GLU A 1 43 ? 28.437 55.366 -8.619  1.00 45.69 ? 49  GLU X CD  1 
ATOM   289  O OE1 . GLU A 1 43 ? 28.185 56.426 -7.943  1.00 50.87 ? 49  GLU X OE1 1 
ATOM   290  O OE2 . GLU A 1 43 ? 28.908 55.366 -9.828  1.00 48.59 ? 49  GLU X OE2 1 
ATOM   291  N N   . VAL A 1 44 ? 27.344 54.161 -3.569  1.00 9.80  ? 50  VAL X N   1 
ATOM   292  C CA  . VAL A 1 44 ? 26.736 54.775 -2.400  1.00 9.34  ? 50  VAL X CA  1 
ATOM   293  C C   . VAL A 1 44 ? 27.786 55.074 -1.291  1.00 10.13 ? 50  VAL X C   1 
ATOM   294  O O   . VAL A 1 44 ? 27.783 56.157 -0.714  1.00 10.66 ? 50  VAL X O   1 
ATOM   295  C CB  . VAL A 1 44 ? 25.569 53.925 -1.831  1.00 9.87  ? 50  VAL X CB  1 
ATOM   296  C CG1 . VAL A 1 44 ? 25.152 54.453 -0.462  1.00 10.10 ? 50  VAL X CG1 1 
ATOM   297  C CG2 . VAL A 1 44 ? 24.339 53.939 -2.797  1.00 5.94  ? 50  VAL X CG2 1 
ATOM   298  N N   . CYS A 1 45 ? 28.690 54.143 -1.012  1.00 9.19  ? 51  CYS X N   1 
ATOM   299  C CA  . CYS A 1 45 ? 29.751 54.381 -0.020  1.00 8.34  ? 51  CYS X CA  1 
ATOM   300  C C   . CYS A 1 45 ? 30.638 55.538 -0.448  1.00 9.01  ? 51  CYS X C   1 
ATOM   301  O O   . CYS A 1 45 ? 30.933 56.423 0.372   1.00 8.64  ? 51  CYS X O   1 
ATOM   302  C CB  . CYS A 1 45 ? 30.614 53.125 0.161   1.00 7.01  ? 51  CYS X CB  1 
ATOM   303  S SG  . CYS A 1 45 ? 29.633 51.853 1.063   1.00 11.97 ? 51  CYS X SG  1 
ATOM   304  N N   . ARG A 1 46 ? 31.067 55.543 -1.703  1.00 7.28  ? 52  ARG X N   1 
ATOM   305  C CA  . ARG A 1 46 ? 32.053 56.484 -2.114  1.00 7.53  ? 52  ARG X CA  1 
ATOM   306  C C   . ARG A 1 46 ? 31.459 57.894 -2.244  1.00 9.53  ? 52  ARG X C   1 
ATOM   307  O O   . ARG A 1 46 ? 32.164 58.867 -2.078  1.00 11.54 ? 52  ARG X O   1 
ATOM   308  C CB  . ARG A 1 46 ? 32.740 56.020 -3.436  1.00 7.78  ? 52  ARG X CB  1 
ATOM   309  C CG  . ARG A 1 46 ? 33.554 54.664 -3.345  1.00 4.80  ? 52  ARG X CG  1 
ATOM   310  C CD  . ARG A 1 46 ? 34.795 54.803 -2.424  1.00 5.24  ? 52  ARG X CD  1 
ATOM   311  N NE  . ARG A 1 46 ? 35.766 55.705 -3.060  1.00 4.19  ? 52  ARG X NE  1 
ATOM   312  C CZ  . ARG A 1 46 ? 36.177 56.868 -2.584  1.00 2.00  ? 52  ARG X CZ  1 
ATOM   313  N NH1 . ARG A 1 46 ? 35.798 57.267 -1.378  1.00 2.00  ? 52  ARG X NH1 1 
ATOM   314  N NH2 . ARG A 1 46 ? 37.011 57.572 -3.305  1.00 2.00  ? 52  ARG X NH2 1 
ATOM   315  N N   . GLU A 1 47 ? 30.181 58.016 -2.538  1.00 11.51 ? 53  GLU X N   1 
ATOM   316  C CA  . GLU A 1 47 ? 29.498 59.284 -2.590  1.00 14.21 ? 53  GLU X CA  1 
ATOM   317  C C   . GLU A 1 47 ? 29.436 59.926 -1.170  1.00 13.79 ? 53  GLU X C   1 
ATOM   318  O O   . GLU A 1 47 ? 29.318 61.119 -1.037  1.00 13.23 ? 53  GLU X O   1 
ATOM   319  C CB  . GLU A 1 47 ? 28.061 59.041 -3.118  1.00 13.31 ? 53  GLU X CB  1 
ATOM   320  C CG  . GLU A 1 47 ? 27.208 60.328 -3.356  1.00 18.33 ? 53  GLU X CG  1 
ATOM   321  C CD  . GLU A 1 47 ? 25.685 60.065 -3.664  1.00 21.58 ? 53  GLU X CD  1 
ATOM   322  O OE1 . GLU A 1 47 ? 25.291 58.894 -4.016  1.00 31.92 ? 53  GLU X OE1 1 
ATOM   323  O OE2 . GLU A 1 47 ? 24.864 61.031 -3.540  1.00 29.26 ? 53  GLU X OE2 1 
ATOM   324  N N   . GLN A 1 48 ? 29.445 59.110 -0.111  1.00 14.05 ? 54  GLN X N   1 
ATOM   325  C CA  . GLN A 1 48 ? 29.515 59.598 1.263   1.00 13.07 ? 54  GLN X CA  1 
ATOM   326  C C   . GLN A 1 48 ? 30.981 60.009 1.543   1.00 13.54 ? 54  GLN X C   1 
ATOM   327  O O   . GLN A 1 48 ? 31.266 60.540 2.613   1.00 12.69 ? 54  GLN X O   1 
ATOM   328  C CB  . GLN A 1 48 ? 29.182 58.472 2.247   1.00 13.17 ? 54  GLN X CB  1 
ATOM   329  C CG  . GLN A 1 48 ? 27.953 57.645 1.893   1.00 13.79 ? 54  GLN X CG  1 
ATOM   330  C CD  . GLN A 1 48 ? 26.785 58.581 1.510   1.00 14.84 ? 54  GLN X CD  1 
ATOM   331  O OE1 . GLN A 1 48 ? 26.482 59.475 2.268   1.00 11.58 ? 54  GLN X OE1 1 
ATOM   332  N NE2 . GLN A 1 48 ? 26.210 58.418 0.307   1.00 11.33 ? 54  GLN X NE2 1 
ATOM   333  N N   . GLN A 1 49 ? 31.903 59.716 0.620   1.00 12.01 ? 55  GLN X N   1 
ATOM   334  C CA  . GLN A 1 49 ? 33.314 59.943 0.913   1.00 15.71 ? 55  GLN X CA  1 
ATOM   335  C C   . GLN A 1 49 ? 33.865 58.992 2.030   1.00 13.45 ? 55  GLN X C   1 
ATOM   336  O O   . GLN A 1 49 ? 34.781 59.306 2.751   1.00 12.07 ? 55  GLN X O   1 
ATOM   337  C CB  . GLN A 1 49 ? 33.475 61.458 1.106   1.00 15.14 ? 55  GLN X CB  1 
ATOM   338  C CG  . GLN A 1 49 ? 34.594 61.987 1.806   1.00 21.59 ? 55  GLN X CG  1 
ATOM   339  C CD  . GLN A 1 49 ? 34.836 63.525 1.439   1.00 23.81 ? 55  GLN X CD  1 
ATOM   340  O OE1 . GLN A 1 49 ? 33.870 64.254 1.112   1.00 28.68 ? 55  GLN X OE1 1 
ATOM   341  N NE2 . GLN A 1 49 ? 36.146 63.976 1.461   1.00 30.19 ? 55  GLN X NE2 1 
ATOM   342  N N   . CYS A 1 50 ? 33.278 57.798 2.115   1.00 12.60 ? 56  CYS X N   1 
ATOM   343  C CA  . CYS A 1 50 ? 33.755 56.694 2.953   1.00 13.53 ? 56  CYS X CA  1 
ATOM   344  C C   . CYS A 1 50 ? 34.601 55.756 2.087   1.00 11.72 ? 56  CYS X C   1 
ATOM   345  O O   . CYS A 1 50 ? 34.889 56.052 0.924   1.00 11.76 ? 56  CYS X O   1 
ATOM   346  C CB  . CYS A 1 50 ? 32.542 55.904 3.531   1.00 13.71 ? 56  CYS X CB  1 
ATOM   347  S SG  . CYS A 1 50 ? 31.579 56.938 4.606   1.00 18.99 ? 56  CYS X SG  1 
ATOM   348  N N   . GLY A 1 51 ? 35.015 54.641 2.674   1.00 10.69 ? 57  GLY X N   1 
ATOM   349  C CA  . GLY A 1 51 ? 35.804 53.663 2.007   1.00 10.32 ? 57  GLY X CA  1 
ATOM   350  C C   . GLY A 1 51 ? 34.824 52.768 1.273   1.00 10.78 ? 57  GLY X C   1 
ATOM   351  O O   . GLY A 1 51 ? 33.635 53.117 1.160   1.00 11.06 ? 57  GLY X O   1 
ATOM   352  N N   . SER A 1 52 ? 35.300 51.603 0.810   1.00 9.87  ? 58  SER X N   1 
ATOM   353  C CA  . SER A 1 52 ? 34.490 50.663 0.041   1.00 9.13  ? 58  SER X CA  1 
ATOM   354  C C   . SER A 1 52 ? 33.500 49.901 0.844   1.00 9.52  ? 58  SER X C   1 
ATOM   355  O O   . SER A 1 52 ? 33.645 49.767 2.033   1.00 8.97  ? 58  SER X O   1 
ATOM   356  C CB  . SER A 1 52 ? 35.387 49.667 -0.636  1.00 7.63  ? 58  SER X CB  1 
ATOM   357  O OG  . SER A 1 52 ? 36.083 50.439 -1.540  1.00 7.61  ? 58  SER X OG  1 
ATOM   358  N N   . VAL A 1 53 ? 32.494 49.372 0.157   1.00 10.22 ? 59  VAL X N   1 
ATOM   359  C CA  . VAL A 1 53 ? 31.430 48.668 0.821   1.00 9.86  ? 59  VAL X CA  1 
ATOM   360  C C   . VAL A 1 53 ? 32.081 47.481 1.482   1.00 10.26 ? 59  VAL X C   1 
ATOM   361  O O   . VAL A 1 53 ? 32.860 46.786 0.863   1.00 10.00 ? 59  VAL X O   1 
ATOM   362  C CB  . VAL A 1 53 ? 30.280 48.224 -0.157  1.00 9.78  ? 59  VAL X CB  1 
ATOM   363  C CG1 . VAL A 1 53 ? 30.804 47.381 -1.368  1.00 6.13  ? 59  VAL X CG1 1 
ATOM   364  C CG2 . VAL A 1 53 ? 29.161 47.466 0.605   1.00 8.80  ? 59  VAL X CG2 1 
ATOM   365  N N   . ASN A 1 54 ? 31.781 47.240 2.748   1.00 12.01 ? 60  ASN X N   1 
ATOM   366  C CA  . ASN A 1 54 ? 32.097 45.943 3.176   1.00 14.12 ? 60  ASN X CA  1 
ATOM   367  C C   . ASN A 1 54 ? 31.061 44.909 3.468   1.00 13.65 ? 60  ASN X C   1 
ATOM   368  O O   . ASN A 1 54 ? 31.387 43.786 3.431   1.00 14.39 ? 60  ASN X O   1 
ATOM   369  C CB  . ASN A 1 54 ? 33.296 45.919 4.052   1.00 17.79 ? 60  ASN X CB  1 
ATOM   370  C CG  . ASN A 1 54 ? 32.972 45.986 5.391   1.00 24.86 ? 60  ASN X CG  1 
ATOM   371  O OD1 . ASN A 1 54 ? 33.396 45.108 6.172   1.00 31.36 ? 60  ASN X OD1 1 
ATOM   372  N ND2 . ASN A 1 54 ? 32.213 47.025 5.756   1.00 31.01 ? 60  ASN X ND2 1 
ATOM   373  N N   . SER A 1 55 ? 29.788 45.260 3.558   1.00 12.84 ? 61  SER X N   1 
ATOM   374  C CA  . SER A 1 55 ? 28.766 44.248 3.652   1.00 13.25 ? 61  SER X CA  1 
ATOM   375  C C   . SER A 1 55 ? 27.427 44.981 3.499   1.00 12.97 ? 61  SER X C   1 
ATOM   376  O O   . SER A 1 55 ? 27.387 46.174 3.582   1.00 11.74 ? 61  SER X O   1 
ATOM   377  C CB  . SER A 1 55 ? 28.840 43.561 5.030   1.00 13.41 ? 61  SER X CB  1 
ATOM   378  O OG  . SER A 1 55 ? 28.222 44.415 6.020   1.00 13.53 ? 61  SER X OG  1 
ATOM   379  N N   . TYR A 1 56 ? 26.333 44.258 3.300   1.00 14.19 ? 62  TYR X N   1 
ATOM   380  C CA  . TYR A 1 56 ? 24.980 44.850 3.180   1.00 14.71 ? 62  TYR X CA  1 
ATOM   381  C C   . TYR A 1 56 ? 24.005 43.740 3.474   1.00 14.32 ? 62  TYR X C   1 
ATOM   382  O O   . TYR A 1 56 ? 24.325 42.583 3.330   1.00 12.92 ? 62  TYR X O   1 
ATOM   383  C CB  . TYR A 1 56 ? 24.710 45.411 1.769   1.00 17.47 ? 62  TYR X CB  1 
ATOM   384  C CG  . TYR A 1 56 ? 25.179 44.536 0.637   1.00 18.50 ? 62  TYR X CG  1 
ATOM   385  C CD1 . TYR A 1 56 ? 26.500 44.549 0.294   1.00 24.65 ? 62  TYR X CD1 1 
ATOM   386  C CD2 . TYR A 1 56 ? 24.315 43.697 -0.081  1.00 21.68 ? 62  TYR X CD2 1 
ATOM   387  C CE1 . TYR A 1 56 ? 27.005 43.755 -0.747  1.00 26.23 ? 62  TYR X CE1 1 
ATOM   388  C CE2 . TYR A 1 56 ? 24.813 42.868 -1.165  1.00 17.77 ? 62  TYR X CE2 1 
ATOM   389  C CZ  . TYR A 1 56 ? 26.150 42.936 -1.465  1.00 23.08 ? 62  TYR X CZ  1 
ATOM   390  O OH  . TYR A 1 56 ? 26.801 42.209 -2.482  1.00 27.97 ? 62  TYR X OH  1 
ATOM   391  N N   . ARG A 1 57 ? 22.813 44.081 3.905   1.00 14.49 ? 63  ARG X N   1 
ATOM   392  C CA  . ARG A 1 57 ? 21.849 43.086 4.229   1.00 14.72 ? 63  ARG X CA  1 
ATOM   393  C C   . ARG A 1 57 ? 20.554 43.736 3.853   1.00 13.69 ? 63  ARG X C   1 
ATOM   394  O O   . ARG A 1 57 ? 20.389 44.947 3.998   1.00 14.42 ? 63  ARG X O   1 
ATOM   395  C CB  . ARG A 1 57 ? 21.952 42.657 5.716   1.00 13.69 ? 63  ARG X CB  1 
ATOM   396  C CG  . ARG A 1 57 ? 21.193 43.476 6.704   1.00 18.37 ? 63  ARG X CG  1 
ATOM   397  C CD  . ARG A 1 57 ? 21.280 43.039 8.233   1.00 18.02 ? 63  ARG X CD  1 
ATOM   398  N NE  . ARG A 1 57 ? 22.499 43.653 8.757   1.00 29.83 ? 63  ARG X NE  1 
ATOM   399  C CZ  . ARG A 1 57 ? 22.648 44.759 9.529   1.00 30.85 ? 63  ARG X CZ  1 
ATOM   400  N NH1 . ARG A 1 57 ? 21.605 45.509 10.081  1.00 20.12 ? 63  ARG X NH1 1 
ATOM   401  N NH2 . ARG A 1 57 ? 23.947 45.078 9.764   1.00 28.88 ? 63  ARG X NH2 1 
ATOM   402  N N   . VAL A 1 58 ? 19.648 42.922 3.348   1.00 13.79 ? 64  VAL X N   1 
ATOM   403  C CA  . VAL A 1 58 ? 18.314 43.311 2.931   1.00 13.11 ? 64  VAL X CA  1 
ATOM   404  C C   . VAL A 1 58 ? 17.436 43.317 4.205   1.00 13.56 ? 64  VAL X C   1 
ATOM   405  O O   . VAL A 1 58 ? 17.415 42.319 4.941   1.00 13.91 ? 64  VAL X O   1 
ATOM   406  C CB  . VAL A 1 58 ? 17.805 42.208 1.894   1.00 14.07 ? 64  VAL X CB  1 
ATOM   407  C CG1 . VAL A 1 58 ? 16.320 42.343 1.518   1.00 11.36 ? 64  VAL X CG1 1 
ATOM   408  C CG2 . VAL A 1 58 ? 18.747 42.163 0.650   1.00 13.18 ? 64  VAL X CG2 1 
ATOM   409  N N   . LEU A 1 59 ? 16.658 44.381 4.382   1.00 12.37 ? 65  LEU X N   1 
ATOM   410  C CA  . LEU A 1 59 ? 15.822 44.634 5.531   1.00 12.68 ? 65  LEU X CA  1 
ATOM   411  C C   . LEU A 1 59 ? 14.318 44.627 5.195   1.00 12.81 ? 65  LEU X C   1 
ATOM   412  O O   . LEU A 1 59 ? 13.933 44.973 4.065   1.00 12.27 ? 65  LEU X O   1 
ATOM   413  C CB  . LEU A 1 59 ? 16.135 46.071 5.995   1.00 13.56 ? 65  LEU X CB  1 
ATOM   414  C CG  . LEU A 1 59 ? 17.581 46.442 6.409   1.00 10.54 ? 65  LEU X CG  1 
ATOM   415  C CD1 . LEU A 1 59 ? 17.512 47.943 6.611   1.00 6.34  ? 65  LEU X CD1 1 
ATOM   416  C CD2 . LEU A 1 59 ? 17.952 45.699 7.667   1.00 2.00  ? 65  LEU X CD2 1 
ATOM   417  N N   . ASP A 1 60 ? 13.462 44.281 6.164   1.00 11.68 ? 66  ASP X N   1 
ATOM   418  C CA  . ASP A 1 60 ? 12.017 44.581 6.006   1.00 12.17 ? 66  ASP X CA  1 
ATOM   419  C C   . ASP A 1 60 ? 11.234 43.717 5.014   1.00 11.95 ? 66  ASP X C   1 
ATOM   420  O O   . ASP A 1 60 ? 10.053 44.023 4.730   1.00 13.69 ? 66  ASP X O   1 
ATOM   421  C CB  . ASP A 1 60 ? 11.743 46.073 5.704   1.00 10.32 ? 66  ASP X CB  1 
ATOM   422  C CG  . ASP A 1 60 ? 12.436 47.003 6.707   1.00 14.06 ? 66  ASP X CG  1 
ATOM   423  O OD1 . ASP A 1 60 ? 12.422 48.195 6.493   1.00 22.37 ? 66  ASP X OD1 1 
ATOM   424  O OD2 . ASP A 1 60 ? 13.052 46.586 7.713   1.00 16.64 ? 66  ASP X OD2 1 
ATOM   425  N N   . ALA A 1 61 ? 11.839 42.646 4.506   1.00 10.47 ? 67  ALA X N   1 
ATOM   426  C CA  . ALA A 1 61 ? 11.126 41.705 3.653   1.00 9.54  ? 67  ALA X CA  1 
ATOM   427  C C   . ALA A 1 61 ? 9.829  41.349 4.369   1.00 10.05 ? 67  ALA X C   1 
ATOM   428  O O   . ALA A 1 61 ? 9.823  41.087 5.602   1.00 10.30 ? 67  ALA X O   1 
ATOM   429  C CB  . ALA A 1 61 ? 11.953 40.387 3.429   1.00 7.28  ? 67  ALA X CB  1 
ATOM   430  N N   . GLY A 1 62 ? 8.752  41.309 3.614   1.00 9.36  ? 68  GLY X N   1 
ATOM   431  C CA  . GLY A 1 62 ? 7.497  40.812 4.146   1.00 10.15 ? 68  GLY X CA  1 
ATOM   432  C C   . GLY A 1 62 ? 6.701  41.774 4.963   1.00 11.35 ? 68  GLY X C   1 
ATOM   433  O O   . GLY A 1 62 ? 5.705  41.356 5.567   1.00 13.39 ? 68  GLY X O   1 
ATOM   434  N N   . ASP A 1 63 ? 7.090  43.060 4.983   1.00 11.05 ? 69  ASP X N   1 
ATOM   435  C CA  . ASP A 1 63 ? 6.382  44.075 5.751   1.00 11.13 ? 69  ASP X CA  1 
ATOM   436  C C   . ASP A 1 63 ? 5.562  44.901 4.779   1.00 10.52 ? 69  ASP X C   1 
ATOM   437  O O   . ASP A 1 63 ? 6.154  45.678 4.037   1.00 10.53 ? 69  ASP X O   1 
ATOM   438  C CB  . ASP A 1 63 ? 7.351  44.996 6.491   1.00 10.35 ? 69  ASP X CB  1 
ATOM   439  C CG  . ASP A 1 63 ? 6.622  46.053 7.372   1.00 15.01 ? 69  ASP X CG  1 
ATOM   440  O OD1 . ASP A 1 63 ? 5.340  46.180 7.351   1.00 15.00 ? 69  ASP X OD1 1 
ATOM   441  O OD2 . ASP A 1 63 ? 7.340  46.769 8.116   1.00 15.32 ? 69  ASP X OD2 1 
ATOM   442  N N   . PRO A 1 64 ? 4.212  44.776 4.791   1.00 9.43  ? 70  PRO X N   1 
ATOM   443  C CA  . PRO A 1 64 ? 3.496  45.498 3.744   1.00 9.95  ? 70  PRO X CA  1 
ATOM   444  C C   . PRO A 1 64 ? 3.588  46.989 3.979   1.00 11.35 ? 70  PRO X C   1 
ATOM   445  O O   . PRO A 1 64 ? 3.339  47.731 3.054   1.00 14.09 ? 70  PRO X O   1 
ATOM   446  C CB  . PRO A 1 64 ? 2.028  45.063 3.907   1.00 9.07  ? 70  PRO X CB  1 
ATOM   447  C CG  . PRO A 1 64 ? 1.951  44.543 5.300   1.00 8.48  ? 70  PRO X CG  1 
ATOM   448  C CD  . PRO A 1 64 ? 3.309  43.991 5.638   1.00 8.50  ? 70  PRO X CD  1 
ATOM   449  N N   . THR A 1 65 ? 3.903  47.451 5.186   1.00 10.64 ? 71  THR X N   1 
ATOM   450  C CA  . THR A 1 65 ? 3.899  48.895 5.427   1.00 9.42  ? 71  THR X CA  1 
ATOM   451  C C   . THR A 1 65 ? 5.220  49.573 5.035   1.00 9.65  ? 71  THR X C   1 
ATOM   452  O O   . THR A 1 65 ? 5.319  50.781 5.133   1.00 10.72 ? 71  THR X O   1 
ATOM   453  C CB  . THR A 1 65 ? 3.679  49.255 6.902   1.00 8.44  ? 71  THR X CB  1 
ATOM   454  O OG1 . THR A 1 65 ? 4.764  48.735 7.724   1.00 13.31 ? 71  THR X OG1 1 
ATOM   455  C CG2 . THR A 1 65 ? 2.437  48.687 7.374   1.00 5.86  ? 71  THR X CG2 1 
ATOM   456  N N   . SER A 1 66 ? 6.210  48.822 4.596   1.00 9.28  ? 72  SER X N   1 
ATOM   457  C CA  . SER A 1 66 ? 7.525  49.315 4.296   1.00 10.32 ? 72  SER X CA  1 
ATOM   458  C C   . SER A 1 66 ? 7.428  49.987 2.942   1.00 12.56 ? 72  SER X C   1 
ATOM   459  O O   . SER A 1 66 ? 7.026  49.335 1.991   1.00 11.98 ? 72  SER X O   1 
ATOM   460  C CB  . SER A 1 66 ? 8.450  48.117 4.188   1.00 9.27  ? 72  SER X CB  1 
ATOM   461  O OG  . SER A 1 66 ? 9.800  48.466 3.880   1.00 12.86 ? 72  SER X OG  1 
ATOM   462  N N   . ARG A 1 67 ? 7.738  51.308 2.862   1.00 14.32 ? 73  ARG X N   1 
ATOM   463  C CA  . ARG A 1 67 ? 7.789  52.012 1.571   1.00 15.37 ? 73  ARG X CA  1 
ATOM   464  C C   . ARG A 1 67 ? 9.041  52.757 1.236   1.00 14.33 ? 73  ARG X C   1 
ATOM   465  O O   . ARG A 1 67 ? 9.883  53.053 2.145   1.00 15.78 ? 73  ARG X O   1 
ATOM   466  C CB  . ARG A 1 67 ? 6.647  52.996 1.443   1.00 16.79 ? 73  ARG X CB  1 
ATOM   467  C CG  . ARG A 1 67 ? 6.003  53.342 2.654   1.00 25.43 ? 73  ARG X CG  1 
ATOM   468  C CD  . ARG A 1 67 ? 6.104  54.869 3.020   1.00 35.81 ? 73  ARG X CD  1 
ATOM   469  N NE  . ARG A 1 67 ? 5.623  55.832 2.015   1.00 39.11 ? 73  ARG X NE  1 
ATOM   470  C CZ  . ARG A 1 67 ? 4.420  55.815 1.439   1.00 43.71 ? 73  ARG X CZ  1 
ATOM   471  N NH1 . ARG A 1 67 ? 3.529  54.841 1.742   1.00 44.06 ? 73  ARG X NH1 1 
ATOM   472  N NH2 . ARG A 1 67 ? 4.123  56.764 0.542   1.00 39.17 ? 73  ARG X NH2 1 
ATOM   473  N N   . GLY A 1 68 ? 9.190  53.103 -0.043  1.00 12.47 ? 74  GLY X N   1 
ATOM   474  C CA  . GLY A 1 68 ? 10.328 53.913 -0.452  1.00 12.71 ? 74  GLY X CA  1 
ATOM   475  C C   . GLY A 1 68 ? 10.367 54.145 -1.920  1.00 12.69 ? 74  GLY X C   1 
ATOM   476  O O   . GLY A 1 68 ? 9.312  54.178 -2.558  1.00 13.48 ? 74  GLY X O   1 
ATOM   477  N N   . LEU A 1 69 ? 11.568 54.269 -2.475  1.00 11.77 ? 75  LEU X N   1 
ATOM   478  C CA  . LEU A 1 69 ? 11.740 54.637 -3.868  1.00 11.71 ? 75  LEU X CA  1 
ATOM   479  C C   . LEU A 1 69 ? 12.626 53.614 -4.496  1.00 13.38 ? 75  LEU X C   1 
ATOM   480  O O   . LEU A 1 69 ? 13.503 53.047 -3.838  1.00 15.13 ? 75  LEU X O   1 
ATOM   481  C CB  . LEU A 1 69 ? 12.415 56.003 -3.942  1.00 9.73  ? 75  LEU X CB  1 
ATOM   482  C CG  . LEU A 1 69 ? 11.547 57.110 -3.352  1.00 9.80  ? 75  LEU X CG  1 
ATOM   483  C CD1 . LEU A 1 69 ? 12.275 58.476 -3.538  1.00 10.90 ? 75  LEU X CD1 1 
ATOM   484  C CD2 . LEU A 1 69 ? 10.189 57.166 -4.079  1.00 8.73  ? 75  LEU X CD2 1 
ATOM   485  N N   . PHE A 1 70 ? 12.517 53.459 -5.787  1.00 15.19 ? 76  PHE X N   1 
ATOM   486  C CA  . PHE A 1 70 ? 13.011 52.285 -6.461  1.00 17.73 ? 76  PHE X CA  1 
ATOM   487  C C   . PHE A 1 70 ? 13.561 52.844 -7.770  1.00 20.16 ? 76  PHE X C   1 
ATOM   488  O O   . PHE A 1 70 ? 13.047 53.824 -8.349  1.00 19.46 ? 76  PHE X O   1 
ATOM   489  C CB  . PHE A 1 70 ? 11.768 51.373 -6.694  1.00 17.99 ? 76  PHE X CB  1 
ATOM   490  C CG  . PHE A 1 70 ? 12.007 50.245 -7.586  1.00 18.88 ? 76  PHE X CG  1 
ATOM   491  C CD1 . PHE A 1 70 ? 11.588 50.288 -8.906  1.00 20.49 ? 76  PHE X CD1 1 
ATOM   492  C CD2 . PHE A 1 70 ? 12.645 49.093 -7.117  1.00 25.41 ? 76  PHE X CD2 1 
ATOM   493  C CE1 . PHE A 1 70 ? 11.842 49.207 -9.770  1.00 22.53 ? 76  PHE X CE1 1 
ATOM   494  C CE2 . PHE A 1 70 ? 12.909 47.963 -7.983  1.00 24.12 ? 76  PHE X CE2 1 
ATOM   495  C CZ  . PHE A 1 70 ? 12.504 48.026 -9.295  1.00 22.67 ? 76  PHE X CZ  1 
ATOM   496  N N   . CYS A 1 71 ? 14.593 52.209 -8.275  1.00 25.45 ? 77  CYS X N   1 
ATOM   497  C CA  . CYS A 1 71 ? 15.262 52.674 -9.496  1.00 27.45 ? 77  CYS X CA  1 
ATOM   498  C C   . CYS A 1 71 ? 15.504 51.410 -10.315 1.00 28.11 ? 77  CYS X C   1 
ATOM   499  O O   . CYS A 1 71 ? 16.201 50.529 -9.863  1.00 28.01 ? 77  CYS X O   1 
ATOM   500  C CB  . CYS A 1 71 ? 16.587 53.344 -9.106  1.00 28.18 ? 77  CYS X CB  1 
ATOM   501  S SG  . CYS A 1 71 ? 17.684 53.792 -10.517 1.00 34.23 ? 77  CYS X SG  1 
ATOM   502  N N   . PRO A 1 72 ? 14.859 51.273 -11.474 1.00 29.63 ? 78  PRO X N   1 
ATOM   503  C CA  . PRO A 1 72 ? 15.041 50.058 -12.277 1.00 31.14 ? 78  PRO X CA  1 
ATOM   504  C C   . PRO A 1 72 ? 16.218 50.194 -13.253 1.00 32.85 ? 78  PRO X C   1 
ATOM   505  O O   . PRO A 1 72 ? 15.972 50.317 -14.445 1.00 33.99 ? 78  PRO X O   1 
ATOM   506  C CB  . PRO A 1 72 ? 13.765 50.002 -13.080 1.00 31.14 ? 78  PRO X CB  1 
ATOM   507  C CG  . PRO A 1 72 ? 13.396 51.472 -13.310 1.00 30.13 ? 78  PRO X CG  1 
ATOM   508  C CD  . PRO A 1 72 ? 13.937 52.233 -12.112 1.00 29.78 ? 78  PRO X CD  1 
ATOM   509  N N   . HIS A 1 73 ? 17.454 50.223 -12.746 1.00 33.63 ? 79  HIS X N   1 
ATOM   510  C CA  . HIS A 1 73 ? 18.721 50.417 -13.488 1.00 35.61 ? 79  HIS X CA  1 
ATOM   511  C C   . HIS A 1 73 ? 19.768 50.112 -12.429 1.00 37.07 ? 79  HIS X C   1 
ATOM   512  O O   . HIS A 1 73 ? 19.644 50.533 -11.239 1.00 36.94 ? 79  HIS X O   1 
ATOM   513  C CB  . HIS A 1 73 ? 19.011 51.865 -13.947 1.00 35.50 ? 79  HIS X CB  1 
ATOM   514  C CG  . HIS A 1 73 ? 18.140 52.356 -15.055 1.00 37.17 ? 79  HIS X CG  1 
ATOM   515  N ND1 . HIS A 1 73 ? 17.270 53.418 -14.899 1.00 39.68 ? 79  HIS X ND1 1 
ATOM   516  C CD2 . HIS A 1 73 ? 17.996 51.941 -16.333 1.00 38.87 ? 79  HIS X CD2 1 
ATOM   517  C CE1 . HIS A 1 73 ? 16.617 53.627 -16.030 1.00 39.33 ? 79  HIS X CE1 1 
ATOM   518  N NE2 . HIS A 1 73 ? 17.041 52.746 -16.918 1.00 40.14 ? 79  HIS X NE2 1 
ATOM   519  N N   . GLN A 1 74 ? 20.804 49.394 -12.837 1.00 38.42 ? 80  GLN X N   1 
ATOM   520  C CA  . GLN A 1 74 ? 21.768 48.875 -11.879 1.00 40.37 ? 80  GLN X CA  1 
ATOM   521  C C   . GLN A 1 74 ? 22.294 50.004 -10.974 1.00 39.62 ? 80  GLN X C   1 
ATOM   522  O O   . GLN A 1 74 ? 22.273 49.902 -9.741  1.00 40.03 ? 80  GLN X O   1 
ATOM   523  C CB  . GLN A 1 74 ? 22.884 48.063 -12.610 1.00 41.96 ? 80  GLN X CB  1 
ATOM   524  C CG  . GLN A 1 74 ? 23.558 46.924 -11.744 1.00 48.04 ? 80  GLN X CG  1 
ATOM   525  C CD  . GLN A 1 74 ? 22.549 46.171 -10.804 1.00 53.75 ? 80  GLN X CD  1 
ATOM   526  O OE1 . GLN A 1 74 ? 22.067 45.073 -11.138 1.00 57.20 ? 80  GLN X OE1 1 
ATOM   527  N NE2 . GLN A 1 74 ? 22.231 46.775 -9.645  1.00 52.46 ? 80  GLN X NE2 1 
ATOM   528  N N   . LYS A 1 75 ? 22.675 51.117 -11.588 1.00 39.10 ? 81  LYS X N   1 
ATOM   529  C CA  . LYS A 1 75 ? 23.309 52.206 -10.858 1.00 38.65 ? 81  LYS X CA  1 
ATOM   530  C C   . LYS A 1 75 ? 22.370 53.370 -10.711 1.00 36.12 ? 81  LYS X C   1 
ATOM   531  O O   . LYS A 1 75 ? 21.709 53.792 -11.669 1.00 35.02 ? 81  LYS X O   1 
ATOM   532  C CB  . LYS A 1 75 ? 24.590 52.694 -11.572 1.00 39.35 ? 81  LYS X CB  1 
ATOM   533  C CG  . LYS A 1 75 ? 25.870 51.824 -11.439 1.00 41.37 ? 81  LYS X CG  1 
ATOM   534  C CD  . LYS A 1 75 ? 27.079 52.620 -12.016 1.00 41.85 ? 81  LYS X CD  1 
ATOM   535  C CE  . LYS A 1 75 ? 28.123 51.744 -12.735 1.00 46.80 ? 81  LYS X CE  1 
ATOM   536  N NZ  . LYS A 1 75 ? 27.514 51.142 -13.978 1.00 48.55 ? 81  LYS X NZ  1 
ATOM   537  N N   . LEU A 1 76 ? 22.377 53.879 -9.486  1.00 34.49 ? 82  LEU X N   1 
ATOM   538  C CA  . LEU A 1 76 ? 21.729 55.113 -9.066  1.00 31.88 ? 82  LEU X CA  1 
ATOM   539  C C   . LEU A 1 76 ? 22.103 56.263 -9.956  1.00 32.44 ? 82  LEU X C   1 
ATOM   540  O O   . LEU A 1 76 ? 21.237 56.968 -10.411 1.00 32.61 ? 82  LEU X O   1 
ATOM   541  C CB  . LEU A 1 76 ? 22.066 55.419 -7.597  1.00 30.49 ? 82  LEU X CB  1 
ATOM   542  C CG  . LEU A 1 76 ? 20.968 55.021 -6.631  1.00 29.02 ? 82  LEU X CG  1 
ATOM   543  C CD1 . LEU A 1 76 ? 20.201 53.816 -7.080  1.00 26.85 ? 82  LEU X CD1 1 
ATOM   544  C CD2 . LEU A 1 76 ? 21.465 54.845 -5.174  1.00 28.34 ? 82  LEU X CD2 1 
ATOM   545  N N   . SER A 1 77 ? 23.390 56.454 -10.214 1.00 34.06 ? 83  SER X N   1 
ATOM   546  C CA  . SER A 1 77 ? 23.825 57.536 -11.110 1.00 35.59 ? 83  SER X CA  1 
ATOM   547  C C   . SER A 1 77 ? 23.235 57.459 -12.536 1.00 36.31 ? 83  SER X C   1 
ATOM   548  O O   . SER A 1 77 ? 23.477 58.340 -13.362 1.00 36.29 ? 83  SER X O   1 
ATOM   549  C CB  . SER A 1 77 ? 25.359 57.570 -11.199 1.00 35.68 ? 83  SER X CB  1 
ATOM   550  O OG  . SER A 1 77 ? 25.820 56.653 -12.186 1.00 36.52 ? 83  SER X OG  1 
ATOM   551  N N   . GLN A 1 78 ? 22.480 56.408 -12.845 1.00 37.42 ? 84  GLN X N   1 
ATOM   552  C CA  . GLN A 1 78 ? 21.837 56.337 -14.167 1.00 38.61 ? 84  GLN X CA  1 
ATOM   553  C C   . GLN A 1 78 ? 20.323 56.306 -14.076 1.00 38.17 ? 84  GLN X C   1 
ATOM   554  O O   . GLN A 1 78 ? 19.655 55.733 -14.947 1.00 38.31 ? 84  GLN X O   1 
ATOM   555  C CB  . GLN A 1 78 ? 22.331 55.133 -14.939 1.00 39.13 ? 84  GLN X CB  1 
ATOM   556  C CG  . GLN A 1 78 ? 23.842 55.096 -15.048 1.00 43.50 ? 84  GLN X CG  1 
ATOM   557  C CD  . GLN A 1 78 ? 24.278 54.088 -16.070 1.00 49.35 ? 84  GLN X CD  1 
ATOM   558  O OE1 . GLN A 1 78 ? 23.493 53.191 -16.428 1.00 51.17 ? 84  GLN X OE1 1 
ATOM   559  N NE2 . GLN A 1 78 ? 25.524 54.217 -16.562 1.00 49.59 ? 84  GLN X NE2 1 
ATOM   560  N N   . CYS A 1 79 ? 19.790 56.912 -13.014 1.00 36.80 ? 85  CYS X N   1 
ATOM   561  C CA  . CYS A 1 79 ? 18.359 57.039 -12.891 1.00 36.51 ? 85  CYS X CA  1 
ATOM   562  C C   . CYS A 1 79 ? 17.849 58.447 -13.189 1.00 34.98 ? 85  CYS X C   1 
ATOM   563  O O   . CYS A 1 79 ? 18.123 59.402 -12.470 1.00 35.32 ? 85  CYS X O   1 
ATOM   564  C CB  . CYS A 1 79 ? 17.916 56.607 -11.499 1.00 36.23 ? 85  CYS X CB  1 
ATOM   565  S SG  . CYS A 1 79 ? 16.710 55.247 -11.569 1.00 41.76 ? 85  CYS X SG  1 
ATOM   566  N N   . HIS A 1 80 ? 17.067 58.573 -14.233 1.00 33.39 ? 86  HIS X N   1 
ATOM   567  C CA  . HIS A 1 80 ? 16.446 59.852 -14.511 1.00 32.75 ? 86  HIS X CA  1 
ATOM   568  C C   . HIS A 1 80 ? 15.221 60.159 -13.587 1.00 31.73 ? 86  HIS X C   1 
ATOM   569  O O   . HIS A 1 80 ? 14.876 61.324 -13.349 1.00 31.78 ? 86  HIS X O   1 
ATOM   570  C CB  . HIS A 1 80 ? 16.157 59.929 -16.018 1.00 32.66 ? 86  HIS X CB  1 
ATOM   571  C CG  . HIS A 1 80 ? 17.406 59.844 -16.862 1.00 34.39 ? 86  HIS X CG  1 
ATOM   572  N ND1 . HIS A 1 80 ? 17.399 59.971 -18.240 1.00 36.21 ? 86  HIS X ND1 1 
ATOM   573  C CD2 . HIS A 1 80 ? 18.712 59.684 -16.510 1.00 35.55 ? 86  HIS X CD2 1 
ATOM   574  C CE1 . HIS A 1 80 ? 18.638 59.879 -18.698 1.00 36.71 ? 86  HIS X CE1 1 
ATOM   575  N NE2 . HIS A 1 80 ? 19.454 59.707 -17.668 1.00 36.20 ? 86  HIS X NE2 1 
ATOM   576  N N   . GLU A 1 81 ? 14.602 59.118 -13.033 1.00 30.16 ? 87  GLU X N   1 
ATOM   577  C CA  . GLU A 1 81 ? 13.399 59.253 -12.195 1.00 29.22 ? 87  GLU X CA  1 
ATOM   578  C C   . GLU A 1 81 ? 13.324 58.091 -11.184 1.00 26.13 ? 87  GLU X C   1 
ATOM   579  O O   . GLU A 1 81 ? 13.645 56.960 -11.522 1.00 26.37 ? 87  GLU X O   1 
ATOM   580  C CB  . GLU A 1 81 ? 12.184 59.310 -13.112 1.00 29.91 ? 87  GLU X CB  1 
ATOM   581  C CG  . GLU A 1 81 ? 10.847 59.064 -12.451 1.00 39.54 ? 87  GLU X CG  1 
ATOM   582  C CD  . GLU A 1 81 ? 10.209 60.316 -11.820 1.00 48.39 ? 87  GLU X CD  1 
ATOM   583  O OE1 . GLU A 1 81 ? 10.706 61.446 -12.072 1.00 52.85 ? 87  GLU X OE1 1 
ATOM   584  O OE2 . GLU A 1 81 ? 9.191  60.160 -11.089 1.00 49.58 ? 87  GLU X OE2 1 
ATOM   585  N N   . LEU A 1 82 ? 12.972 58.359 -9.931  1.00 22.70 ? 88  LEU X N   1 
ATOM   586  C CA  . LEU A 1 82 ? 12.691 57.254 -9.004  1.00 18.79 ? 88  LEU X CA  1 
ATOM   587  C C   . LEU A 1 82 ? 11.180 56.940 -8.988  1.00 18.24 ? 88  LEU X C   1 
ATOM   588  O O   . LEU A 1 82 ? 10.343 57.845 -9.241  1.00 17.44 ? 88  LEU X O   1 
ATOM   589  C CB  . LEU A 1 82 ? 13.186 57.579 -7.624  1.00 17.78 ? 88  LEU X CB  1 
ATOM   590  C CG  . LEU A 1 82 ? 14.660 57.891 -7.432  1.00 15.58 ? 88  LEU X CG  1 
ATOM   591  C CD1 . LEU A 1 82 ? 14.822 58.687 -6.156  1.00 12.00 ? 88  LEU X CD1 1 
ATOM   592  C CD2 . LEU A 1 82 ? 15.495 56.610 -7.355  1.00 15.36 ? 88  LEU X CD2 1 
ATOM   593  N N   . TRP A 1 83 ? 10.843 55.660 -8.766  1.00 16.32 ? 89  TRP X N   1 
ATOM   594  C CA  . TRP A 1 83 ? 9.466  55.190 -8.756  1.00 15.12 ? 89  TRP X CA  1 
ATOM   595  C C   . TRP A 1 83 ? 9.130  54.875 -7.316  1.00 14.89 ? 89  TRP X C   1 
ATOM   596  O O   . TRP A 1 83 ? 9.983  54.416 -6.566  1.00 14.10 ? 89  TRP X O   1 
ATOM   597  C CB  . TRP A 1 83 ? 9.267  53.894 -9.571  1.00 15.51 ? 89  TRP X CB  1 
ATOM   598  C CG  . TRP A 1 83 ? 9.593  53.936 -11.036 1.00 17.65 ? 89  TRP X CG  1 
ATOM   599  C CD1 . TRP A 1 83 ? 9.932  55.036 -11.771 1.00 19.64 ? 89  TRP X CD1 1 
ATOM   600  C CD2 . TRP A 1 83 ? 9.602  52.819 -11.962 1.00 18.65 ? 89  TRP X CD2 1 
ATOM   601  N NE1 . TRP A 1 83 ? 10.161 54.686 -13.075 1.00 20.68 ? 89  TRP X NE1 1 
ATOM   602  C CE2 . TRP A 1 83 ? 9.980  53.336 -13.229 1.00 20.03 ? 89  TRP X CE2 1 
ATOM   603  C CE3 . TRP A 1 83 ? 9.349  51.433 -11.835 1.00 17.59 ? 89  TRP X CE3 1 
ATOM   604  C CZ2 . TRP A 1 83 ? 10.091 52.513 -14.405 1.00 20.14 ? 89  TRP X CZ2 1 
ATOM   605  C CZ3 . TRP A 1 83 ? 9.446  50.608 -12.990 1.00 19.60 ? 89  TRP X CZ3 1 
ATOM   606  C CH2 . TRP A 1 83 ? 9.822  51.155 -14.264 1.00 19.82 ? 89  TRP X CH2 1 
ATOM   607  N N   . GLU A 1 84 ? 7.876  55.056 -6.939  1.00 14.76 ? 90  GLU X N   1 
ATOM   608  C CA  . GLU A 1 84 ? 7.419  54.698 -5.612  1.00 16.23 ? 90  GLU X CA  1 
ATOM   609  C C   . GLU A 1 84 ? 7.068  53.209 -5.555  1.00 14.55 ? 90  GLU X C   1 
ATOM   610  O O   . GLU A 1 84 ? 6.481  52.663 -6.494  1.00 14.63 ? 90  GLU X O   1 
ATOM   611  C CB  . GLU A 1 84 ? 6.172  55.515 -5.282  1.00 15.95 ? 90  GLU X CB  1 
ATOM   612  C CG  . GLU A 1 84 ? 6.437  57.026 -5.146  1.00 18.93 ? 90  GLU X CG  1 
ATOM   613  C CD  . GLU A 1 84 ? 5.157  57.847 -4.802  1.00 21.55 ? 90  GLU X CD  1 
ATOM   614  O OE1 . GLU A 1 84 ? 3.998  57.327 -4.862  1.00 27.73 ? 90  GLU X OE1 1 
ATOM   615  O OE2 . GLU A 1 84 ? 5.295  59.048 -4.500  1.00 29.67 ? 90  GLU X OE2 1 
ATOM   616  N N   . ARG A 1 85 ? 7.456  52.564 -4.467  1.00 13.08 ? 91  ARG X N   1 
ATOM   617  C CA  . ARG A 1 85 ? 7.018  51.245 -4.098  1.00 12.60 ? 91  ARG X CA  1 
ATOM   618  C C   . ARG A 1 85 ? 6.497  51.525 -2.681  1.00 13.62 ? 91  ARG X C   1 
ATOM   619  O O   . ARG A 1 85 ? 7.251  51.743 -1.738  1.00 13.64 ? 91  ARG X O   1 
ATOM   620  C CB  . ARG A 1 85 ? 8.172  50.250 -4.109  1.00 13.00 ? 91  ARG X CB  1 
ATOM   621  C CG  . ARG A 1 85 ? 7.799  48.869 -3.546  1.00 13.39 ? 91  ARG X CG  1 
ATOM   622  C CD  . ARG A 1 85 ? 8.833  47.735 -3.831  1.00 12.36 ? 91  ARG X CD  1 
ATOM   623  N NE  . ARG A 1 85 ? 8.070  46.873 -4.660  1.00 19.62 ? 91  ARG X NE  1 
ATOM   624  C CZ  . ARG A 1 85 ? 7.547  45.700 -4.359  1.00 19.35 ? 91  ARG X CZ  1 
ATOM   625  N NH1 . ARG A 1 85 ? 7.784  45.053 -3.228  1.00 20.60 ? 91  ARG X NH1 1 
ATOM   626  N NH2 . ARG A 1 85 ? 6.812  45.144 -5.285  1.00 18.53 ? 91  ARG X NH2 1 
ATOM   627  N N   . ASN A 1 86 ? 5.189  51.645 -2.590  1.00 13.26 ? 92  ASN X N   1 
ATOM   628  C CA  . ASN A 1 86 ? 4.475  51.977 -1.387  1.00 12.18 ? 92  ASN X CA  1 
ATOM   629  C C   . ASN A 1 86 ? 4.084  50.810 -0.495  1.00 11.87 ? 92  ASN X C   1 
ATOM   630  O O   . ASN A 1 86 ? 3.443  50.986 0.537   1.00 10.48 ? 92  ASN X O   1 
ATOM   631  C CB  . ASN A 1 86 ? 3.296  52.806 -1.817  1.00 9.94  ? 92  ASN X CB  1 
ATOM   632  C CG  . ASN A 1 86 ? 3.778  54.138 -2.278  1.00 11.40 ? 92  ASN X CG  1 
ATOM   633  O OD1 . ASN A 1 86 ? 4.730  54.641 -1.715  1.00 18.03 ? 92  ASN X OD1 1 
ATOM   634  N ND2 . ASN A 1 86 ? 3.208  54.689 -3.296  1.00 7.80  ? 92  ASN X ND2 1 
ATOM   635  N N   . SER A 1 87 ? 4.565  49.621 -0.819  1.00 11.09 ? 93  SER X N   1 
ATOM   636  C CA  . SER A 1 87 ? 4.388  48.567 0.161   1.00 11.50 ? 93  SER X CA  1 
ATOM   637  C C   . SER A 1 87 ? 5.407  47.510 -0.167  1.00 11.58 ? 93  SER X C   1 
ATOM   638  O O   . SER A 1 87 ? 5.851  47.436 -1.281  1.00 12.21 ? 93  SER X O   1 
ATOM   639  C CB  . SER A 1 87 ? 2.955  48.034 0.133   1.00 10.65 ? 93  SER X CB  1 
ATOM   640  O OG  . SER A 1 87 ? 2.599  47.449 -1.134  1.00 11.86 ? 93  SER X OG  1 
ATOM   641  N N   . TYR A 1 88 ? 5.812  46.723 0.822   1.00 11.38 ? 94  TYR X N   1 
ATOM   642  C CA  . TYR A 1 88 ? 6.757  45.689 0.615   1.00 10.49 ? 94  TYR X CA  1 
ATOM   643  C C   . TYR A 1 88 ? 8.089  46.148 0.066   1.00 11.02 ? 94  TYR X C   1 
ATOM   644  O O   . TYR A 1 88 ? 8.739  45.400 -0.608  1.00 8.15  ? 94  TYR X O   1 
ATOM   645  C CB  . TYR A 1 88 ? 6.216  44.577 -0.244  1.00 8.73  ? 94  TYR X CB  1 
ATOM   646  C CG  . TYR A 1 88 ? 5.171  43.798 0.491   1.00 9.97  ? 94  TYR X CG  1 
ATOM   647  C CD1 . TYR A 1 88 ? 5.510  42.957 1.554   1.00 10.31 ? 94  TYR X CD1 1 
ATOM   648  C CD2 . TYR A 1 88 ? 3.803  43.887 0.104   1.00 6.88  ? 94  TYR X CD2 1 
ATOM   649  C CE1 . TYR A 1 88 ? 4.485  42.214 2.252   1.00 9.82  ? 94  TYR X CE1 1 
ATOM   650  C CE2 . TYR A 1 88 ? 2.831  43.198 0.770   1.00 8.43  ? 94  TYR X CE2 1 
ATOM   651  C CZ  . TYR A 1 88 ? 3.161  42.356 1.848   1.00 9.39  ? 94  TYR X CZ  1 
ATOM   652  O OH  . TYR A 1 88 ? 2.103  41.673 2.496   1.00 8.79  ? 94  TYR X OH  1 
ATOM   653  N N   . CYS A 1 89 ? 8.511  47.336 0.431   1.00 13.30 ? 95  CYS X N   1 
ATOM   654  C CA  . CYS A 1 89 ? 9.815  47.813 0.018   1.00 14.55 ? 95  CYS X CA  1 
ATOM   655  C C   . CYS A 1 89 ? 10.950 47.081 0.845   1.00 14.67 ? 95  CYS X C   1 
ATOM   656  O O   . CYS A 1 89 ? 10.973 47.098 2.109   1.00 13.72 ? 95  CYS X O   1 
ATOM   657  C CB  . CYS A 1 89 ? 9.812  49.338 0.166   1.00 15.50 ? 95  CYS X CB  1 
ATOM   658  S SG  . CYS A 1 89 ? 11.436 50.127 0.007   1.00 18.94 ? 95  CYS X SG  1 
ATOM   659  N N   . LYS A 1 90 ? 11.861 46.414 0.151   1.00 13.08 ? 96  LYS X N   1 
ATOM   660  C CA  . LYS A 1 90 ? 12.991 45.786 0.847   1.00 13.15 ? 96  LYS X CA  1 
ATOM   661  C C   . LYS A 1 90 ? 14.041 46.859 0.903   1.00 12.26 ? 96  LYS X C   1 
ATOM   662  O O   . LYS A 1 90 ? 14.573 47.271 -0.127  1.00 12.88 ? 96  LYS X O   1 
ATOM   663  C CB  . LYS A 1 90 ? 13.555 44.599 0.069   1.00 12.33 ? 96  LYS X CB  1 
ATOM   664  C CG  . LYS A 1 90 ? 12.594 43.373 0.019   1.00 15.55 ? 96  LYS X CG  1 
ATOM   665  C CD  . LYS A 1 90 ? 13.088 42.296 -1.024  1.00 16.38 ? 96  LYS X CD  1 
ATOM   666  C CE  . LYS A 1 90 ? 12.087 41.072 -1.228  1.00 17.35 ? 96  LYS X CE  1 
ATOM   667  N NZ  . LYS A 1 90 ? 10.583 41.503 -1.126  1.00 27.15 ? 96  LYS X NZ  1 
ATOM   668  N N   . LYS A 1 91 ? 14.387 47.282 2.095   1.00 11.24 ? 97  LYS X N   1 
ATOM   669  C CA  . LYS A 1 91 ? 15.355 48.309 2.243   1.00 12.07 ? 97  LYS X CA  1 
ATOM   670  C C   . LYS A 1 91 ? 16.733 47.672 2.338   1.00 13.09 ? 97  LYS X C   1 
ATOM   671  O O   . LYS A 1 91 ? 16.845 46.460 2.273   1.00 12.38 ? 97  LYS X O   1 
ATOM   672  C CB  . LYS A 1 91 ? 15.019 49.127 3.467   1.00 12.22 ? 97  LYS X CB  1 
ATOM   673  C CG  . LYS A 1 91 ? 13.769 49.897 3.268   1.00 12.56 ? 97  LYS X CG  1 
ATOM   674  C CD  . LYS A 1 91 ? 13.378 50.637 4.501   1.00 17.15 ? 97  LYS X CD  1 
ATOM   675  C CE  . LYS A 1 91 ? 11.869 50.743 4.527   1.00 20.45 ? 97  LYS X CE  1 
ATOM   676  N NZ  . LYS A 1 91 ? 11.557 52.076 4.958   1.00 25.19 ? 97  LYS X NZ  1 
ATOM   677  N N   . VAL A 1 92 ? 17.792 48.478 2.460   1.00 12.89 ? 98  VAL X N   1 
ATOM   678  C CA  . VAL A 1 92 ? 19.115 47.923 2.443   1.00 12.76 ? 98  VAL X CA  1 
ATOM   679  C C   . VAL A 1 92 ? 19.933 48.592 3.517   1.00 11.42 ? 98  VAL X C   1 
ATOM   680  O O   . VAL A 1 92 ? 19.945 49.822 3.596   1.00 12.97 ? 98  VAL X O   1 
ATOM   681  C CB  . VAL A 1 92 ? 19.803 48.107 1.068   1.00 13.95 ? 98  VAL X CB  1 
ATOM   682  C CG1 . VAL A 1 92 ? 21.257 47.406 1.045   1.00 12.45 ? 98  VAL X CG1 1 
ATOM   683  C CG2 . VAL A 1 92 ? 19.015 47.434 0.011   1.00 15.53 ? 98  VAL X CG2 1 
ATOM   684  N N   . PHE A 1 93 ? 20.654 47.804 4.313   1.00 10.24 ? 99  PHE X N   1 
ATOM   685  C CA  . PHE A 1 93 ? 21.605 48.363 5.311   1.00 9.59  ? 99  PHE X CA  1 
ATOM   686  C C   . PHE A 1 93 ? 23.009 48.113 4.731   1.00 10.56 ? 99  PHE X C   1 
ATOM   687  O O   . PHE A 1 93 ? 23.367 46.946 4.450   1.00 9.58  ? 99  PHE X O   1 
ATOM   688  C CB  . PHE A 1 93 ? 21.474 47.674 6.643   1.00 8.19  ? 99  PHE X CB  1 
ATOM   689  C CG  . PHE A 1 93 ? 22.305 48.275 7.743   1.00 10.09 ? 99  PHE X CG  1 
ATOM   690  C CD1 . PHE A 1 93 ? 21.705 49.003 8.775   1.00 7.11  ? 99  PHE X CD1 1 
ATOM   691  C CD2 . PHE A 1 93 ? 23.674 48.068 7.808   1.00 10.68 ? 99  PHE X CD2 1 
ATOM   692  C CE1 . PHE A 1 93 ? 22.457 49.547 9.779   1.00 7.32  ? 99  PHE X CE1 1 
ATOM   693  C CE2 . PHE A 1 93 ? 24.432 48.635 8.873   1.00 10.70 ? 99  PHE X CE2 1 
ATOM   694  C CZ  . PHE A 1 93 ? 23.825 49.369 9.830   1.00 6.81  ? 99  PHE X CZ  1 
ATOM   695  N N   . VAL A 1 94 ? 23.764 49.206 4.503   1.00 9.52  ? 100 VAL X N   1 
ATOM   696  C CA  . VAL A 1 94 ? 25.090 49.088 3.943   1.00 10.21 ? 100 VAL X CA  1 
ATOM   697  C C   . VAL A 1 94 ? 26.097 49.471 4.994   1.00 9.86  ? 100 VAL X C   1 
ATOM   698  O O   . VAL A 1 94 ? 25.879 50.417 5.771   1.00 9.12  ? 100 VAL X O   1 
ATOM   699  C CB  . VAL A 1 94 ? 25.245 50.003 2.676   1.00 11.27 ? 100 VAL X CB  1 
ATOM   700  C CG1 . VAL A 1 94 ? 26.705 50.103 2.200   1.00 8.51  ? 100 VAL X CG1 1 
ATOM   701  C CG2 . VAL A 1 94 ? 24.418 49.465 1.568   1.00 8.77  ? 100 VAL X CG2 1 
ATOM   702  N N   . THR A 1 95 ? 27.189 48.720 5.063   1.00 9.20  ? 101 THR X N   1 
ATOM   703  C CA  . THR A 1 95 ? 28.251 49.147 5.925   1.00 9.55  ? 101 THR X CA  1 
ATOM   704  C C   . THR A 1 95 ? 29.507 49.326 5.067   1.00 10.41 ? 101 THR X C   1 
ATOM   705  O O   . THR A 1 95 ? 29.916 48.419 4.356   1.00 8.55  ? 101 THR X O   1 
ATOM   706  C CB  . THR A 1 95 ? 28.453 48.339 7.302   1.00 10.97 ? 101 THR X CB  1 
ATOM   707  O OG1 . THR A 1 95 ? 29.793 47.840 7.386   1.00 13.36 ? 101 THR X OG1 1 
ATOM   708  C CG2 . THR A 1 95 ? 27.465 47.230 7.581   1.00 7.51  ? 101 THR X CG2 1 
ATOM   709  N N   . CYS A 1 96 ? 30.053 50.550 5.081   1.00 10.90 ? 102 CYS X N   1 
ATOM   710  C CA  . CYS A 1 96 ? 31.267 50.879 4.301   1.00 12.55 ? 102 CYS X CA  1 
ATOM   711  C C   . CYS A 1 96 ? 32.484 50.837 5.229   1.00 12.87 ? 102 CYS X C   1 
ATOM   712  O O   . CYS A 1 96 ? 32.328 51.106 6.387   1.00 14.31 ? 102 CYS X O   1 
ATOM   713  C CB  . CYS A 1 96 ? 31.156 52.304 3.762   1.00 9.61  ? 102 CYS X CB  1 
ATOM   714  S SG  . CYS A 1 96 ? 29.566 52.631 2.970   1.00 15.57 ? 102 CYS X SG  1 
ATOM   715  N N   . GLN A 1 97 ? 33.692 50.616 4.748   1.00 13.47 ? 103 GLN X N   1 
ATOM   716  C CA  . GLN A 1 97 ? 34.868 50.991 5.530   1.00 16.31 ? 103 GLN X CA  1 
ATOM   717  C C   . GLN A 1 97 ? 34.971 52.513 5.724   1.00 18.78 ? 103 GLN X C   1 
ATOM   718  O O   . GLN A 1 97 ? 34.480 53.293 4.897   1.00 18.89 ? 103 GLN X O   1 
ATOM   719  C CB  . GLN A 1 97 ? 36.104 50.537 4.784   1.00 16.18 ? 103 GLN X CB  1 
ATOM   720  C CG  . GLN A 1 97 ? 36.015 49.105 4.566   1.00 18.01 ? 103 GLN X CG  1 
ATOM   721  C CD  . GLN A 1 97 ? 37.294 48.534 4.378   1.00 21.54 ? 103 GLN X CD  1 
ATOM   722  O OE1 . GLN A 1 97 ? 37.525 47.832 3.400   1.00 22.09 ? 103 GLN X OE1 1 
ATOM   723  N NE2 . GLN A 1 97 ? 38.209 48.857 5.276   1.00 26.39 ? 103 GLN X NE2 1 
ATOM   724  N N   . ASP A 1 98 ? 35.640 52.948 6.791   1.00 20.77 ? 104 ASP X N   1 
ATOM   725  C CA  . ASP A 1 98 ? 35.848 54.392 7.045   1.00 22.88 ? 104 ASP X CA  1 
ATOM   726  C C   . ASP A 1 98 ? 36.548 55.172 5.915   1.00 22.59 ? 104 ASP X C   1 
ATOM   727  O O   . ASP A 1 98 ? 36.272 56.351 5.646   1.00 22.62 ? 104 ASP X O   1 
ATOM   728  C CB  . ASP A 1 98 ? 36.794 54.512 8.251   1.00 24.16 ? 104 ASP X CB  1 
ATOM   729  C CG  . ASP A 1 98 ? 36.087 54.270 9.567   1.00 29.74 ? 104 ASP X CG  1 
ATOM   730  O OD1 . ASP A 1 98 ? 34.823 54.307 9.564   1.00 29.38 ? 104 ASP X OD1 1 
ATOM   731  O OD2 . ASP A 1 98 ? 36.812 54.045 10.591  1.00 33.69 ? 104 ASP X OD2 1 
ATOM   732  O OXT . ASP A 1 98 ? 37.531 54.672 5.334   1.00 21.32 ? 104 ASP X OXT 1 
ATOM   733  N N   . PRO B 1 1  ? 18.037 82.538 3.778   1.00 29.92 ? 7   PRO Y N   1 
ATOM   734  C CA  . PRO B 1 1  ? 18.166 82.000 5.149   1.00 30.03 ? 7   PRO Y CA  1 
ATOM   735  C C   . PRO B 1 1  ? 19.555 81.400 5.442   1.00 29.65 ? 7   PRO Y C   1 
ATOM   736  O O   . PRO B 1 1  ? 19.830 80.270 5.055   1.00 30.15 ? 7   PRO Y O   1 
ATOM   737  C CB  . PRO B 1 1  ? 17.089 80.909 5.200   1.00 30.21 ? 7   PRO Y CB  1 
ATOM   738  C CG  . PRO B 1 1  ? 16.938 80.468 3.742   1.00 31.06 ? 7   PRO Y CG  1 
ATOM   739  C CD  . PRO B 1 1  ? 17.281 81.652 2.871   1.00 29.75 ? 7   PRO Y CD  1 
ATOM   740  N N   . ALA B 1 2  ? 20.428 82.138 6.117   1.00 28.99 ? 8   ALA Y N   1 
ATOM   741  C CA  . ALA B 1 2  ? 21.809 81.681 6.279   1.00 27.89 ? 8   ALA Y CA  1 
ATOM   742  C C   . ALA B 1 2  ? 21.990 80.846 7.545   1.00 27.44 ? 8   ALA Y C   1 
ATOM   743  O O   . ALA B 1 2  ? 21.251 80.986 8.531   1.00 27.64 ? 8   ALA Y O   1 
ATOM   744  C CB  . ALA B 1 2  ? 22.805 82.871 6.213   1.00 27.86 ? 8   ALA Y CB  1 
ATOM   745  N N   . VAL B 1 3  ? 22.954 79.939 7.510   1.00 26.41 ? 9   VAL Y N   1 
ATOM   746  C CA  . VAL B 1 3  ? 23.202 79.109 8.659   1.00 25.78 ? 9   VAL Y CA  1 
ATOM   747  C C   . VAL B 1 3  ? 23.970 79.945 9.645   1.00 25.62 ? 9   VAL Y C   1 
ATOM   748  O O   . VAL B 1 3  ? 25.017 80.456 9.319   1.00 25.15 ? 9   VAL Y O   1 
ATOM   749  C CB  . VAL B 1 3  ? 24.079 77.862 8.343   1.00 25.61 ? 9   VAL Y CB  1 
ATOM   750  C CG1 . VAL B 1 3  ? 24.200 77.032 9.566   1.00 24.88 ? 9   VAL Y CG1 1 
ATOM   751  C CG2 . VAL B 1 3  ? 23.514 77.032 7.198   1.00 24.75 ? 9   VAL Y CG2 1 
ATOM   752  N N   . GLU B 1 4  ? 23.481 80.076 10.864  1.00 26.03 ? 10  GLU Y N   1 
ATOM   753  C CA  . GLU B 1 4  ? 24.349 80.671 11.874  1.00 26.30 ? 10  GLU Y CA  1 
ATOM   754  C C   . GLU B 1 4  ? 24.735 79.684 12.944  1.00 25.12 ? 10  GLU Y C   1 
ATOM   755  O O   . GLU B 1 4  ? 24.080 78.682 13.137  1.00 25.31 ? 10  GLU Y O   1 
ATOM   756  C CB  . GLU B 1 4  ? 23.774 81.959 12.446  1.00 26.90 ? 10  GLU Y CB  1 
ATOM   757  C CG  . GLU B 1 4  ? 22.734 81.781 13.518  1.00 28.54 ? 10  GLU Y CG  1 
ATOM   758  C CD  . GLU B 1 4  ? 21.803 82.986 13.554  1.00 30.12 ? 10  GLU Y CD  1 
ATOM   759  O OE1 . GLU B 1 4  ? 20.682 82.879 13.028  1.00 29.00 ? 10  GLU Y OE1 1 
ATOM   760  O OE2 . GLU B 1 4  ? 22.214 84.042 14.082  1.00 31.13 ? 10  GLU Y OE2 1 
ATOM   761  N N   . SER B 1 5  ? 25.846 79.958 13.592  1.00 24.42 ? 11  SER Y N   1 
ATOM   762  C CA  . SER B 1 5  ? 26.413 79.047 14.541  1.00 24.13 ? 11  SER Y CA  1 
ATOM   763  C C   . SER B 1 5  ? 26.630 79.750 15.884  1.00 24.14 ? 11  SER Y C   1 
ATOM   764  O O   . SER B 1 5  ? 26.645 80.984 15.950  1.00 23.08 ? 11  SER Y O   1 
ATOM   765  C CB  . SER B 1 5  ? 27.750 78.608 14.023  1.00 23.67 ? 11  SER Y CB  1 
ATOM   766  O OG  . SER B 1 5  ? 28.542 79.768 13.899  1.00 25.74 ? 11  SER Y OG  1 
ATOM   767  N N   . ARG B 1 6  ? 26.805 78.957 16.951  1.00 24.23 ? 12  ARG Y N   1 
ATOM   768  C CA  . ARG B 1 6  ? 27.235 79.495 18.256  1.00 23.92 ? 12  ARG Y CA  1 
ATOM   769  C C   . ARG B 1 6  ? 27.886 78.467 19.131  1.00 23.47 ? 12  ARG Y C   1 
ATOM   770  O O   . ARG B 1 6  ? 27.824 77.266 18.836  1.00 24.62 ? 12  ARG Y O   1 
ATOM   771  C CB  . ARG B 1 6  ? 26.132 80.209 19.045  1.00 23.77 ? 12  ARG Y CB  1 
ATOM   772  C CG  . ARG B 1 6  ? 24.728 79.871 18.676  1.00 26.62 ? 12  ARG Y CG  1 
ATOM   773  C CD  . ARG B 1 6  ? 24.030 78.955 19.574  1.00 25.29 ? 12  ARG Y CD  1 
ATOM   774  N NE  . ARG B 1 6  ? 23.942 79.532 20.903  1.00 32.01 ? 12  ARG Y NE  1 
ATOM   775  C CZ  . ARG B 1 6  ? 22.827 79.855 21.551  1.00 29.08 ? 12  ARG Y CZ  1 
ATOM   776  N NH1 . ARG B 1 6  ? 21.630 79.712 20.983  1.00 29.31 ? 12  ARG Y NH1 1 
ATOM   777  N NH2 . ARG B 1 6  ? 22.941 80.335 22.779  1.00 24.98 ? 12  ARG Y NH2 1 
ATOM   778  N N   . LEU B 1 7  ? 28.527 78.945 20.198  1.00 21.54 ? 13  LEU Y N   1 
ATOM   779  C CA  . LEU B 1 7  ? 29.193 78.072 21.100  1.00 20.02 ? 13  LEU Y CA  1 
ATOM   780  C C   . LEU B 1 7  ? 28.438 78.055 22.391  1.00 19.93 ? 13  LEU Y C   1 
ATOM   781  O O   . LEU B 1 7  ? 28.266 79.076 23.055  1.00 18.85 ? 13  LEU Y O   1 
ATOM   782  C CB  . LEU B 1 7  ? 30.633 78.456 21.290  1.00 19.57 ? 13  LEU Y CB  1 
ATOM   783  C CG  . LEU B 1 7  ? 31.353 78.514 19.953  1.00 19.04 ? 13  LEU Y CG  1 
ATOM   784  C CD1 . LEU B 1 7  ? 32.776 78.879 20.231  1.00 20.65 ? 13  LEU Y CD1 1 
ATOM   785  C CD2 . LEU B 1 7  ? 31.302 77.212 19.236  1.00 20.67 ? 13  LEU Y CD2 1 
ATOM   786  N N   . VAL B 1 8  ? 27.959 76.864 22.724  1.00 19.04 ? 14  VAL Y N   1 
ATOM   787  C CA  . VAL B 1 8  ? 27.150 76.680 23.909  1.00 18.86 ? 14  VAL Y CA  1 
ATOM   788  C C   . VAL B 1 8  ? 27.857 75.931 25.035  1.00 20.17 ? 14  VAL Y C   1 
ATOM   789  O O   . VAL B 1 8  ? 28.540 74.917 24.826  1.00 20.42 ? 14  VAL Y O   1 
ATOM   790  C CB  . VAL B 1 8  ? 25.819 75.990 23.550  1.00 18.69 ? 14  VAL Y CB  1 
ATOM   791  C CG1 . VAL B 1 8  ? 25.037 75.692 24.776  1.00 13.83 ? 14  VAL Y CG1 1 
ATOM   792  C CG2 . VAL B 1 8  ? 25.022 76.948 22.684  1.00 17.49 ? 14  VAL Y CG2 1 
ATOM   793  N N   . GLY B 1 9  ? 27.690 76.446 26.241  1.00 20.58 ? 15  GLY Y N   1 
ATOM   794  C CA  . GLY B 1 9  ? 28.014 75.680 27.440  1.00 20.77 ? 15  GLY Y CA  1 
ATOM   795  C C   . GLY B 1 9  ? 29.430 75.898 27.907  1.00 21.43 ? 15  GLY Y C   1 
ATOM   796  O O   . GLY B 1 9  ? 29.818 75.332 28.951  1.00 22.90 ? 15  GLY Y O   1 
ATOM   797  N N   . GLY B 1 10 ? 30.193 76.732 27.193  1.00 20.33 ? 16  GLY Y N   1 
ATOM   798  C CA  . GLY B 1 10 ? 31.538 77.147 27.673  1.00 20.23 ? 16  GLY Y CA  1 
ATOM   799  C C   . GLY B 1 10 ? 31.618 78.266 28.722  1.00 19.04 ? 16  GLY Y C   1 
ATOM   800  O O   . GLY B 1 10 ? 30.672 79.038 28.871  1.00 19.99 ? 16  GLY Y O   1 
ATOM   801  N N   . SER B 1 11 ? 32.759 78.416 29.404  1.00 17.82 ? 17  SER Y N   1 
ATOM   802  C CA  . SER B 1 11 ? 32.866 79.501 30.408  1.00 17.81 ? 17  SER Y CA  1 
ATOM   803  C C   . SER B 1 11 ? 32.914 80.850 29.813  1.00 16.97 ? 17  SER Y C   1 
ATOM   804  O O   . SER B 1 11 ? 32.845 81.814 30.553  1.00 17.31 ? 17  SER Y O   1 
ATOM   805  C CB  . SER B 1 11 ? 34.058 79.355 31.322  1.00 18.08 ? 17  SER Y CB  1 
ATOM   806  O OG  . SER B 1 11 ? 35.167 79.263 30.513  1.00 17.76 ? 17  SER Y OG  1 
ATOM   807  N N   . SER B 1 12 ? 32.995 80.939 28.481  1.00 17.13 ? 18  SER Y N   1 
ATOM   808  C CA  . SER B 1 12 ? 32.640 82.176 27.774  1.00 17.21 ? 18  SER Y CA  1 
ATOM   809  C C   . SER B 1 12 ? 32.055 81.824 26.425  1.00 18.04 ? 18  SER Y C   1 
ATOM   810  O O   . SER B 1 12 ? 31.954 80.629 26.074  1.00 18.10 ? 18  SER Y O   1 
ATOM   811  C CB  . SER B 1 12 ? 33.830 83.115 27.647  1.00 16.56 ? 18  SER Y CB  1 
ATOM   812  O OG  . SER B 1 12 ? 34.701 82.667 26.629  1.00 18.78 ? 18  SER Y OG  1 
ATOM   813  N N   . ILE B 1 13 ? 31.644 82.837 25.666  1.00 19.08 ? 19  ILE Y N   1 
ATOM   814  C CA  . ILE B 1 13 ? 31.053 82.594 24.338  1.00 20.67 ? 19  ILE Y CA  1 
ATOM   815  C C   . ILE B 1 13 ? 32.126 82.198 23.279  1.00 22.49 ? 19  ILE Y C   1 
ATOM   816  O O   . ILE B 1 13 ? 31.761 81.782 22.134  1.00 22.48 ? 19  ILE Y O   1 
ATOM   817  C CB  . ILE B 1 13 ? 30.207 83.775 23.819  1.00 20.92 ? 19  ILE Y CB  1 
ATOM   818  C CG1 . ILE B 1 13 ? 31.088 85.007 23.538  1.00 22.05 ? 19  ILE Y CG1 1 
ATOM   819  C CG2 . ILE B 1 13 ? 29.092 84.121 24.788  1.00 20.39 ? 19  ILE Y CG2 1 
ATOM   820  C CD1 . ILE B 1 13 ? 30.516 85.969 22.498  1.00 25.66 ? 19  ILE Y CD1 1 
ATOM   821  N N   . CYS B 1 14 ? 33.415 82.309 23.657  1.00 23.06 ? 20  CYS Y N   1 
ATOM   822  C CA  . CYS B 1 14 ? 34.539 81.847 22.808  1.00 24.58 ? 20  CYS Y CA  1 
ATOM   823  C C   . CYS B 1 14 ? 34.892 80.345 22.946  1.00 24.34 ? 20  CYS Y C   1 
ATOM   824  O O   . CYS B 1 14 ? 35.907 79.896 22.409  1.00 25.13 ? 20  CYS Y O   1 
ATOM   825  C CB  . CYS B 1 14 ? 35.770 82.708 23.063  1.00 24.08 ? 20  CYS Y CB  1 
ATOM   826  S SG  . CYS B 1 14 ? 35.501 84.463 22.466  1.00 33.10 ? 20  CYS Y SG  1 
ATOM   827  N N   . GLU B 1 15 ? 34.066 79.579 23.655  1.00 23.51 ? 21  GLU Y N   1 
ATOM   828  C CA  . GLU B 1 15 ? 34.370 78.182 24.004  1.00 23.71 ? 21  GLU Y CA  1 
ATOM   829  C C   . GLU B 1 15 ? 32.996 77.494 24.072  1.00 22.77 ? 21  GLU Y C   1 
ATOM   830  O O   . GLU B 1 15 ? 32.084 78.026 24.717  1.00 21.61 ? 21  GLU Y O   1 
ATOM   831  C CB  . GLU B 1 15 ? 34.869 78.110 25.448  1.00 24.47 ? 21  GLU Y CB  1 
ATOM   832  C CG  . GLU B 1 15 ? 36.297 78.059 25.845  1.00 27.83 ? 21  GLU Y CG  1 
ATOM   833  C CD  . GLU B 1 15 ? 36.429 77.102 27.029  1.00 36.80 ? 21  GLU Y CD  1 
ATOM   834  O OE1 . GLU B 1 15 ? 35.481 77.065 27.881  1.00 40.79 ? 21  GLU Y OE1 1 
ATOM   835  O OE2 . GLU B 1 15 ? 37.421 76.308 27.087  1.00 40.62 ? 21  GLU Y OE2 1 
ATOM   836  N N   . GLY B 1 16 ? 32.846 76.313 23.493  1.00 22.57 ? 22  GLY Y N   1 
ATOM   837  C CA  . GLY B 1 16 ? 31.623 75.489 23.762  1.00 23.49 ? 22  GLY Y CA  1 
ATOM   838  C C   . GLY B 1 16 ? 31.276 74.474 22.677  1.00 24.28 ? 22  GLY Y C   1 
ATOM   839  O O   . GLY B 1 16 ? 32.068 74.258 21.713  1.00 25.28 ? 22  GLY Y O   1 
ATOM   840  N N   . THR B 1 17 ? 30.102 73.861 22.776  1.00 23.71 ? 23  THR Y N   1 
ATOM   841  C CA  . THR B 1 17 ? 29.763 72.906 21.777  1.00 23.31 ? 23  THR Y CA  1 
ATOM   842  C C   . THR B 1 17 ? 29.096 73.656 20.629  1.00 23.63 ? 23  THR Y C   1 
ATOM   843  O O   . THR B 1 17 ? 28.339 74.623 20.850  1.00 24.41 ? 23  THR Y O   1 
ATOM   844  C CB  . THR B 1 17 ? 29.071 71.582 22.323  1.00 24.36 ? 23  THR Y CB  1 
ATOM   845  O OG1 . THR B 1 17 ? 27.712 71.449 21.896  1.00 29.87 ? 23  THR Y OG1 1 
ATOM   846  C CG2 . THR B 1 17 ? 29.155 71.428 23.739  1.00 19.42 ? 23  THR Y CG2 1 
ATOM   847  N N   . VAL B 1 18 ? 29.434 73.285 19.391  1.00 22.33 ? 24  VAL Y N   1 
ATOM   848  C CA  . VAL B 1 18 ? 29.009 74.085 18.257  1.00 20.95 ? 24  VAL Y CA  1 
ATOM   849  C C   . VAL B 1 18 ? 27.520 73.865 18.035  1.00 20.91 ? 24  VAL Y C   1 
ATOM   850  O O   . VAL B 1 18 ? 27.121 72.720 17.894  1.00 21.72 ? 24  VAL Y O   1 
ATOM   851  C CB  . VAL B 1 18 ? 29.846 73.774 16.990  1.00 20.58 ? 24  VAL Y CB  1 
ATOM   852  C CG1 . VAL B 1 18 ? 29.357 74.615 15.831  1.00 19.37 ? 24  VAL Y CG1 1 
ATOM   853  C CG2 . VAL B 1 18 ? 31.289 74.085 17.265  1.00 19.29 ? 24  VAL Y CG2 1 
ATOM   854  N N   . GLU B 1 19 ? 26.699 74.918 18.051  1.00 19.47 ? 25  GLU Y N   1 
ATOM   855  C CA  . GLU B 1 19 ? 25.307 74.745 17.641  1.00 20.47 ? 25  GLU Y CA  1 
ATOM   856  C C   . GLU B 1 19 ? 25.018 75.528 16.386  1.00 19.67 ? 25  GLU Y C   1 
ATOM   857  O O   . GLU B 1 19 ? 25.694 76.540 16.128  1.00 20.57 ? 25  GLU Y O   1 
ATOM   858  C CB  . GLU B 1 19 ? 24.291 75.083 18.761  1.00 19.44 ? 25  GLU Y CB  1 
ATOM   859  C CG  . GLU B 1 19 ? 24.329 74.039 19.870  1.00 22.67 ? 25  GLU Y CG  1 
ATOM   860  C CD  . GLU B 1 19 ? 23.244 74.207 20.936  1.00 24.57 ? 25  GLU Y CD  1 
ATOM   861  O OE1 . GLU B 1 19 ? 22.428 75.136 20.852  1.00 30.06 ? 25  GLU Y OE1 1 
ATOM   862  O OE2 . GLU B 1 19 ? 23.171 73.361 21.860  1.00 35.97 ? 25  GLU Y OE2 1 
ATOM   863  N N   . VAL B 1 20 ? 24.000 75.126 15.627  1.00 18.61 ? 26  VAL Y N   1 
ATOM   864  C CA  . VAL B 1 20 ? 23.725 75.821 14.356  1.00 19.57 ? 26  VAL Y CA  1 
ATOM   865  C C   . VAL B 1 20 ? 22.243 75.969 14.150  1.00 20.16 ? 26  VAL Y C   1 
ATOM   866  O O   . VAL B 1 20 ? 21.471 75.258 14.813  1.00 20.40 ? 26  VAL Y O   1 
ATOM   867  C CB  . VAL B 1 20 ? 24.297 75.050 13.168  1.00 19.51 ? 26  VAL Y CB  1 
ATOM   868  C CG1 . VAL B 1 20 ? 25.797 75.190 13.160  1.00 17.79 ? 26  VAL Y CG1 1 
ATOM   869  C CG2 . VAL B 1 20 ? 23.890 73.566 13.271  1.00 16.24 ? 26  VAL Y CG2 1 
ATOM   870  N N   . ARG B 1 21 ? 21.843 76.883 13.279  1.00 20.61 ? 27  ARG Y N   1 
ATOM   871  C CA  . ARG B 1 21 ? 20.441 76.906 12.836  1.00 23.39 ? 27  ARG Y CA  1 
ATOM   872  C C   . ARG B 1 21 ? 20.218 77.502 11.457  1.00 24.74 ? 27  ARG Y C   1 
ATOM   873  O O   . ARG B 1 21 ? 21.125 78.097 10.878  1.00 24.72 ? 27  ARG Y O   1 
ATOM   874  C CB  . ARG B 1 21 ? 19.546 77.630 13.848  1.00 23.70 ? 27  ARG Y CB  1 
ATOM   875  C CG  . ARG B 1 21 ? 19.876 79.079 14.049  1.00 22.01 ? 27  ARG Y CG  1 
ATOM   876  C CD  . ARG B 1 21 ? 18.717 79.764 14.715  1.00 21.57 ? 27  ARG Y CD  1 
ATOM   877  N NE  . ARG B 1 21 ? 18.860 81.214 14.579  1.00 24.54 ? 27  ARG Y NE  1 
ATOM   878  C CZ  . ARG B 1 21 ? 18.148 82.097 15.269  1.00 25.80 ? 27  ARG Y CZ  1 
ATOM   879  N NH1 . ARG B 1 21 ? 18.338 83.400 15.087  1.00 22.44 ? 27  ARG Y NH1 1 
ATOM   880  N NH2 . ARG B 1 21 ? 17.250 81.666 16.154  1.00 27.84 ? 27  ARG Y NH2 1 
ATOM   881  N N   . GLN B 1 22 ? 19.005 77.309 10.949  1.00 27.11 ? 28  GLN Y N   1 
ATOM   882  C CA  . GLN B 1 22 ? 18.491 77.985 9.749   1.00 29.36 ? 28  GLN Y CA  1 
ATOM   883  C C   . GLN B 1 22 ? 17.047 78.427 9.983   1.00 30.50 ? 28  GLN Y C   1 
ATOM   884  O O   . GLN B 1 22 ? 16.105 77.721 9.667   1.00 30.26 ? 28  GLN Y O   1 
ATOM   885  C CB  . GLN B 1 22 ? 18.622 77.125 8.503   1.00 29.77 ? 28  GLN Y CB  1 
ATOM   886  C CG  . GLN B 1 22 ? 20.029 77.160 7.921   1.00 32.23 ? 28  GLN Y CG  1 
ATOM   887  C CD  . GLN B 1 22 ? 20.094 76.781 6.436   1.00 33.39 ? 28  GLN Y CD  1 
ATOM   888  O OE1 . GLN B 1 22 ? 20.109 75.600 6.076   1.00 37.09 ? 28  GLN Y OE1 1 
ATOM   889  N NE2 . GLN B 1 22 ? 20.169 77.779 5.585   1.00 31.80 ? 28  GLN Y NE2 1 
ATOM   890  N N   . GLY B 1 23 ? 16.927 79.651 10.494  1.00 32.64 ? 29  GLY Y N   1 
ATOM   891  C CA  . GLY B 1 23 ? 15.836 80.106 11.390  1.00 34.38 ? 29  GLY Y CA  1 
ATOM   892  C C   . GLY B 1 23 ? 14.589 79.237 11.604  1.00 34.91 ? 29  GLY Y C   1 
ATOM   893  O O   . GLY B 1 23 ? 13.817 79.032 10.645  1.00 34.30 ? 29  GLY Y O   1 
ATOM   894  N N   . ALA B 1 24 ? 14.386 78.676 12.812  1.00 34.30 ? 30  ALA Y N   1 
ATOM   895  C CA  . ALA B 1 24 ? 15.396 78.178 13.738  1.00 33.59 ? 30  ALA Y CA  1 
ATOM   896  C C   . ALA B 1 24 ? 14.855 76.756 13.647  1.00 33.40 ? 30  ALA Y C   1 
ATOM   897  O O   . ALA B 1 24 ? 14.058 76.507 12.707  1.00 32.69 ? 30  ALA Y O   1 
ATOM   898  C CB  . ALA B 1 24 ? 15.234 78.777 15.156  1.00 33.74 ? 30  ALA Y CB  1 
ATOM   899  N N   . GLN B 1 25 ? 15.150 75.819 14.559  1.00 32.36 ? 31  GLN Y N   1 
ATOM   900  C CA  . GLN B 1 25 ? 15.646 75.965 15.919  1.00 31.82 ? 31  GLN Y CA  1 
ATOM   901  C C   . GLN B 1 25 ? 17.158 75.719 16.029  1.00 29.77 ? 31  GLN Y C   1 
ATOM   902  O O   . GLN B 1 25 ? 17.755 75.126 15.129  1.00 30.51 ? 31  GLN Y O   1 
ATOM   903  C CB  . GLN B 1 25 ? 14.969 74.866 16.758  1.00 32.97 ? 31  GLN Y CB  1 
ATOM   904  C CG  . GLN B 1 25 ? 13.480 75.044 16.912  1.00 37.41 ? 31  GLN Y CG  1 
ATOM   905  C CD  . GLN B 1 25 ? 13.158 76.163 17.875  1.00 43.17 ? 31  GLN Y CD  1 
ATOM   906  O OE1 . GLN B 1 25 ? 12.511 77.162 17.512  1.00 48.41 ? 31  GLN Y OE1 1 
ATOM   907  N NE2 . GLN B 1 25 ? 13.624 76.022 19.113  1.00 46.01 ? 31  GLN Y NE2 1 
ATOM   908  N N   . TRP B 1 26 ? 17.771 76.105 17.146  1.00 26.40 ? 32  TRP Y N   1 
ATOM   909  C CA  . TRP B 1 26 ? 19.160 75.716 17.368  1.00 24.79 ? 32  TRP Y CA  1 
ATOM   910  C C   . TRP B 1 26 ? 19.325 74.211 17.542  1.00 23.59 ? 32  TRP Y C   1 
ATOM   911  O O   . TRP B 1 26 ? 18.465 73.569 18.106  1.00 25.77 ? 32  TRP Y O   1 
ATOM   912  C CB  . TRP B 1 26 ? 19.688 76.379 18.591  1.00 22.59 ? 32  TRP Y CB  1 
ATOM   913  C CG  . TRP B 1 26 ? 19.796 77.799 18.399  1.00 23.99 ? 32  TRP Y CG  1 
ATOM   914  C CD1 . TRP B 1 26 ? 18.921 78.742 18.851  1.00 21.55 ? 32  TRP Y CD1 1 
ATOM   915  C CD2 . TRP B 1 26 ? 20.837 78.507 17.698  1.00 20.81 ? 32  TRP Y CD2 1 
ATOM   916  N NE1 . TRP B 1 26 ? 19.349 79.979 18.489  1.00 21.61 ? 32  TRP Y NE1 1 
ATOM   917  C CE2 . TRP B 1 26 ? 20.528 79.880 17.791  1.00 20.98 ? 32  TRP Y CE2 1 
ATOM   918  C CE3 . TRP B 1 26 ? 21.986 78.112 17.003  1.00 20.17 ? 32  TRP Y CE3 1 
ATOM   919  C CZ2 . TRP B 1 26 ? 21.327 80.890 17.206  1.00 19.23 ? 32  TRP Y CZ2 1 
ATOM   920  C CZ3 . TRP B 1 26 ? 22.807 79.107 16.440  1.00 21.98 ? 32  TRP Y CZ3 1 
ATOM   921  C CH2 . TRP B 1 26 ? 22.463 80.492 16.547  1.00 21.06 ? 32  TRP Y CH2 1 
ATOM   922  N N   . ALA B 1 27 ? 20.396 73.631 17.054  1.00 21.28 ? 33  ALA Y N   1 
ATOM   923  C CA  . ALA B 1 27 ? 20.608 72.200 17.290  1.00 21.59 ? 33  ALA Y CA  1 
ATOM   924  C C   . ALA B 1 27 ? 22.110 72.017 17.278  1.00 21.93 ? 33  ALA Y C   1 
ATOM   925  O O   . ALA B 1 27 ? 22.834 72.878 16.770  1.00 22.33 ? 33  ALA Y O   1 
ATOM   926  C CB  . ALA B 1 27 ? 19.988 71.373 16.207  1.00 19.99 ? 33  ALA Y CB  1 
ATOM   927  N N   . ALA B 1 28 ? 22.593 70.935 17.857  1.00 21.63 ? 34  ALA Y N   1 
ATOM   928  C CA  . ALA B 1 28 ? 24.022 70.707 17.795  1.00 22.51 ? 34  ALA Y CA  1 
ATOM   929  C C   . ALA B 1 28 ? 24.431 70.412 16.333  1.00 22.48 ? 34  ALA Y C   1 
ATOM   930  O O   . ALA B 1 28 ? 23.684 69.807 15.601  1.00 22.62 ? 34  ALA Y O   1 
ATOM   931  C CB  . ALA B 1 28 ? 24.429 69.542 18.744  1.00 20.43 ? 34  ALA Y CB  1 
ATOM   932  N N   . LEU B 1 29 ? 25.643 70.800 15.959  1.00 22.55 ? 35  LEU Y N   1 
ATOM   933  C CA  . LEU B 1 29 ? 26.251 70.416 14.727  1.00 22.40 ? 35  LEU Y CA  1 
ATOM   934  C C   . LEU B 1 29 ? 26.869 69.030 14.844  1.00 24.55 ? 35  LEU Y C   1 
ATOM   935  O O   . LEU B 1 29 ? 27.757 68.834 15.669  1.00 23.82 ? 35  LEU Y O   1 
ATOM   936  C CB  . LEU B 1 29 ? 27.404 71.382 14.460  1.00 20.52 ? 35  LEU Y CB  1 
ATOM   937  C CG  . LEU B 1 29 ? 27.928 71.772 13.065  1.00 19.86 ? 35  LEU Y CG  1 
ATOM   938  C CD1 . LEU B 1 29 ? 29.464 71.777 12.924  1.00 21.36 ? 35  LEU Y CD1 1 
ATOM   939  C CD2 . LEU B 1 29 ? 27.224 71.248 11.852  1.00 10.08 ? 35  LEU Y CD2 1 
ATOM   940  N N   . CYS B 1 30 ? 26.548 68.136 13.903  1.00 26.73 ? 36  CYS Y N   1 
ATOM   941  C CA  . CYS B 1 30 ? 27.258 66.869 13.749  1.00 29.95 ? 36  CYS Y CA  1 
ATOM   942  C C   . CYS B 1 30 ? 28.517 66.944 12.884  1.00 30.61 ? 36  CYS Y C   1 
ATOM   943  O O   . CYS B 1 30 ? 28.458 67.370 11.746  1.00 31.22 ? 36  CYS Y O   1 
ATOM   944  C CB  . CYS B 1 30 ? 26.314 65.825 13.202  1.00 28.22 ? 36  CYS Y CB  1 
ATOM   945  S SG  . CYS B 1 30 ? 24.760 65.702 14.162  1.00 41.66 ? 36  CYS Y SG  1 
ATOM   946  N N   . ASP B 1 31 ? 29.652 66.507 13.420  1.00 33.64 ? 37  ASP Y N   1 
ATOM   947  C CA  . ASP B 1 31 ? 30.922 66.522 12.671  1.00 34.00 ? 37  ASP Y CA  1 
ATOM   948  C C   . ASP B 1 31 ? 30.723 65.718 11.446  1.00 32.88 ? 37  ASP Y C   1 
ATOM   949  O O   . ASP B 1 31 ? 31.164 64.614 11.433  1.00 32.18 ? 37  ASP Y O   1 
ATOM   950  C CB  . ASP B 1 31 ? 32.134 65.896 13.441  1.00 35.95 ? 37  ASP Y CB  1 
ATOM   951  C CG  . ASP B 1 31 ? 33.544 66.208 12.739  1.00 38.42 ? 37  ASP Y CG  1 
ATOM   952  O OD1 . ASP B 1 31 ? 33.781 65.817 11.544  1.00 45.37 ? 37  ASP Y OD1 1 
ATOM   953  O OD2 . ASP B 1 31 ? 34.420 66.878 13.376  1.00 45.27 ? 37  ASP Y OD2 1 
ATOM   954  N N   . SER B 1 38 ? 38.231 72.047 10.475  1.00 43.76 ? 44  SER Y N   1 
ATOM   955  C CA  . SER B 1 38 ? 39.532 72.721 10.601  1.00 44.07 ? 44  SER Y CA  1 
ATOM   956  C C   . SER B 1 38 ? 39.511 74.164 10.068  1.00 43.04 ? 44  SER Y C   1 
ATOM   957  O O   . SER B 1 38 ? 39.702 75.115 10.834  1.00 43.28 ? 44  SER Y O   1 
ATOM   958  C CB  . SER B 1 38 ? 40.636 71.896 9.925   1.00 44.72 ? 44  SER Y CB  1 
ATOM   959  O OG  . SER B 1 38 ? 40.815 70.674 10.627  1.00 47.18 ? 44  SER Y OG  1 
ATOM   960  N N   . LEU B 1 39 ? 39.298 74.316 8.759   1.00 41.60 ? 45  LEU Y N   1 
ATOM   961  C CA  . LEU B 1 39 ? 38.858 75.591 8.190   1.00 39.84 ? 45  LEU Y CA  1 
ATOM   962  C C   . LEU B 1 39 ? 37.448 75.915 8.699   1.00 38.52 ? 45  LEU Y C   1 
ATOM   963  O O   . LEU B 1 39 ? 37.113 77.072 8.918   1.00 39.12 ? 45  LEU Y O   1 
ATOM   964  C CB  . LEU B 1 39 ? 38.869 75.542 6.658   1.00 39.93 ? 45  LEU Y CB  1 
ATOM   965  C CG  . LEU B 1 39 ? 40.207 75.747 5.928   1.00 40.47 ? 45  LEU Y CG  1 
ATOM   966  C CD1 . LEU B 1 39 ? 40.257 74.862 4.678   1.00 41.26 ? 45  LEU Y CD1 1 
ATOM   967  C CD2 . LEU B 1 39 ? 40.519 77.236 5.600   1.00 37.99 ? 45  LEU Y CD2 1 
ATOM   968  N N   . ARG B 1 40 ? 36.644 74.876 8.909   1.00 36.52 ? 46  ARG Y N   1 
ATOM   969  C CA  . ARG B 1 40 ? 35.276 75.001 9.386   1.00 34.30 ? 46  ARG Y CA  1 
ATOM   970  C C   . ARG B 1 40 ? 35.143 75.770 10.691  1.00 32.36 ? 46  ARG Y C   1 
ATOM   971  O O   . ARG B 1 40 ? 34.180 76.531 10.858  1.00 31.25 ? 46  ARG Y O   1 
ATOM   972  C CB  . ARG B 1 40 ? 34.693 73.605 9.587   1.00 34.78 ? 46  ARG Y CB  1 
ATOM   973  C CG  . ARG B 1 40 ? 33.159 73.542 9.684   1.00 34.74 ? 46  ARG Y CG  1 
ATOM   974  C CD  . ARG B 1 40 ? 32.703 72.093 9.444   1.00 35.51 ? 46  ARG Y CD  1 
ATOM   975  N NE  . ARG B 1 40 ? 31.729 72.002 8.356   1.00 33.77 ? 46  ARG Y NE  1 
ATOM   976  C CZ  . ARG B 1 40 ? 30.621 71.255 8.379   1.00 32.21 ? 46  ARG Y CZ  1 
ATOM   977  N NH1 . ARG B 1 40 ? 30.297 70.514 9.474   1.00 26.19 ? 46  ARG Y NH1 1 
ATOM   978  N NH2 . ARG B 1 40 ? 29.820 71.287 7.308   1.00 28.58 ? 46  ARG Y NH2 1 
ATOM   979  N N   . TRP B 1 41 ? 36.093 75.543 11.605  1.00 30.37 ? 47  TRP Y N   1 
ATOM   980  C CA  . TRP B 1 41 ? 36.078 76.167 12.942  1.00 29.21 ? 47  TRP Y CA  1 
ATOM   981  C C   . TRP B 1 41 ? 36.529 77.639 13.000  1.00 28.81 ? 47  TRP Y C   1 
ATOM   982  O O   . TRP B 1 41 ? 36.113 78.367 13.896  1.00 27.21 ? 47  TRP Y O   1 
ATOM   983  C CB  . TRP B 1 41 ? 36.825 75.308 13.975  1.00 28.56 ? 47  TRP Y CB  1 
ATOM   984  C CG  . TRP B 1 41 ? 36.504 73.863 13.832  1.00 27.85 ? 47  TRP Y CG  1 
ATOM   985  C CD1 . TRP B 1 41 ? 37.395 72.846 13.722  1.00 28.32 ? 47  TRP Y CD1 1 
ATOM   986  C CD2 . TRP B 1 41 ? 35.202 73.269 13.696  1.00 28.01 ? 47  TRP Y CD2 1 
ATOM   987  N NE1 . TRP B 1 41 ? 36.742 71.651 13.542  1.00 28.84 ? 47  TRP Y NE1 1 
ATOM   988  C CE2 . TRP B 1 41 ? 35.397 71.878 13.517  1.00 27.21 ? 47  TRP Y CE2 1 
ATOM   989  C CE3 . TRP B 1 41 ? 33.892 73.777 13.697  1.00 27.39 ? 47  TRP Y CE3 1 
ATOM   990  C CZ2 . TRP B 1 41 ? 34.351 70.990 13.345  1.00 26.66 ? 47  TRP Y CZ2 1 
ATOM   991  C CZ3 . TRP B 1 41 ? 32.842 72.885 13.536  1.00 27.85 ? 47  TRP Y CZ3 1 
ATOM   992  C CH2 . TRP B 1 41 ? 33.081 71.502 13.362  1.00 27.97 ? 47  TRP Y CH2 1 
ATOM   993  N N   . GLU B 1 42 ? 37.363 78.059 12.036  1.00 29.44 ? 48  GLU Y N   1 
ATOM   994  C CA  . GLU B 1 42 ? 37.790 79.450 11.883  1.00 29.99 ? 48  GLU Y CA  1 
ATOM   995  C C   . GLU B 1 42 ? 36.579 80.319 11.730  1.00 29.29 ? 48  GLU Y C   1 
ATOM   996  O O   . GLU B 1 42 ? 36.407 81.281 12.472  1.00 28.62 ? 48  GLU Y O   1 
ATOM   997  C CB  . GLU B 1 42 ? 38.637 79.628 10.611  1.00 31.25 ? 48  GLU Y CB  1 
ATOM   998  C CG  . GLU B 1 42 ? 40.145 79.459 10.782  1.00 35.47 ? 48  GLU Y CG  1 
ATOM   999  C CD  . GLU B 1 42 ? 40.640 79.840 12.187  1.00 41.12 ? 48  GLU Y CD  1 
ATOM   1000 O OE1 . GLU B 1 42 ? 40.919 81.037 12.453  1.00 42.79 ? 48  GLU Y OE1 1 
ATOM   1001 O OE2 . GLU B 1 42 ? 40.752 78.920 13.026  1.00 44.55 ? 48  GLU Y OE2 1 
ATOM   1002 N N   . GLU B 1 43 ? 35.751 79.939 10.753  1.00 29.20 ? 49  GLU Y N   1 
ATOM   1003 C CA  . GLU B 1 43 ? 34.514 80.616 10.371  1.00 30.03 ? 49  GLU Y CA  1 
ATOM   1004 C C   . GLU B 1 43 ? 33.610 80.775 11.600  1.00 29.72 ? 49  GLU Y C   1 
ATOM   1005 O O   . GLU B 1 43 ? 33.086 81.860 11.869  1.00 30.36 ? 49  GLU Y O   1 
ATOM   1006 C CB  . GLU B 1 43 ? 33.820 79.807 9.260   1.00 29.42 ? 49  GLU Y CB  1 
ATOM   1007 C CG  . GLU B 1 43 ? 33.008 80.606 8.215   1.00 31.56 ? 49  GLU Y CG  1 
ATOM   1008 C CD  . GLU B 1 43 ? 32.607 79.764 6.931   1.00 32.24 ? 49  GLU Y CD  1 
ATOM   1009 O OE1 . GLU B 1 43 ? 33.168 80.040 5.817   1.00 34.75 ? 49  GLU Y OE1 1 
ATOM   1010 O OE2 . GLU B 1 43 ? 31.732 78.848 7.029   1.00 34.00 ? 49  GLU Y OE2 1 
ATOM   1011 N N   . VAL B 1 44 ? 33.466 79.687 12.349  1.00 29.44 ? 50  VAL Y N   1 
ATOM   1012 C CA  . VAL B 1 44 ? 32.725 79.668 13.575  1.00 29.10 ? 50  VAL Y CA  1 
ATOM   1013 C C   . VAL B 1 44 ? 33.316 80.605 14.644  1.00 29.36 ? 50  VAL Y C   1 
ATOM   1014 O O   . VAL B 1 44 ? 32.555 81.277 15.356  1.00 29.31 ? 50  VAL Y O   1 
ATOM   1015 C CB  . VAL B 1 44 ? 32.626 78.221 14.083  1.00 29.28 ? 50  VAL Y CB  1 
ATOM   1016 C CG1 . VAL B 1 44 ? 32.148 78.166 15.504  1.00 28.55 ? 50  VAL Y CG1 1 
ATOM   1017 C CG2 . VAL B 1 44 ? 31.682 77.428 13.201  1.00 29.83 ? 50  VAL Y CG2 1 
ATOM   1018 N N   . CYS B 1 45 ? 34.642 80.647 14.780  1.00 29.43 ? 51  CYS Y N   1 
ATOM   1019 C CA  . CYS B 1 45 ? 35.281 81.572 15.751  1.00 30.54 ? 51  CYS Y CA  1 
ATOM   1020 C C   . CYS B 1 45 ? 35.159 83.030 15.331  1.00 30.61 ? 51  CYS Y C   1 
ATOM   1021 O O   . CYS B 1 45 ? 34.686 83.864 16.103  1.00 29.89 ? 51  CYS Y O   1 
ATOM   1022 C CB  . CYS B 1 45 ? 36.756 81.232 15.982  1.00 30.82 ? 51  CYS Y CB  1 
ATOM   1023 S SG  . CYS B 1 45 ? 36.978 79.699 16.945  1.00 32.22 ? 51  CYS Y SG  1 
ATOM   1024 N N   . ARG B 1 46 ? 35.585 83.307 14.099  1.00 30.93 ? 52  ARG Y N   1 
ATOM   1025 C CA  . ARG B 1 46 ? 35.325 84.574 13.426  1.00 32.02 ? 52  ARG Y CA  1 
ATOM   1026 C C   . ARG B 1 46 ? 33.849 84.978 13.634  1.00 31.67 ? 52  ARG Y C   1 
ATOM   1027 O O   . ARG B 1 46 ? 33.571 86.042 14.146  1.00 31.41 ? 52  ARG Y O   1 
ATOM   1028 C CB  . ARG B 1 46 ? 35.711 84.477 11.928  1.00 31.52 ? 52  ARG Y CB  1 
ATOM   1029 C CG  . ARG B 1 46 ? 36.100 85.817 11.240  1.00 33.84 ? 52  ARG Y CG  1 
ATOM   1030 C CD  . ARG B 1 46 ? 36.672 85.677 9.766   1.00 34.00 ? 52  ARG Y CD  1 
ATOM   1031 N NE  . ARG B 1 46 ? 35.950 84.661 8.982   1.00 38.74 ? 52  ARG Y NE  1 
ATOM   1032 C CZ  . ARG B 1 46 ? 36.468 83.526 8.497   1.00 39.34 ? 52  ARG Y CZ  1 
ATOM   1033 N NH1 . ARG B 1 46 ? 37.755 83.228 8.640   1.00 39.56 ? 52  ARG Y NH1 1 
ATOM   1034 N NH2 . ARG B 1 46 ? 35.684 82.683 7.840   1.00 40.81 ? 52  ARG Y NH2 1 
ATOM   1035 N N   . GLU B 1 47 ? 32.899 84.111 13.306  1.00 32.08 ? 53  GLU Y N   1 
ATOM   1036 C CA  . GLU B 1 47 ? 31.497 84.508 13.417  1.00 32.57 ? 53  GLU Y CA  1 
ATOM   1037 C C   . GLU B 1 47 ? 31.054 84.841 14.869  1.00 32.18 ? 53  GLU Y C   1 
ATOM   1038 O O   . GLU B 1 47 ? 30.129 85.625 15.043  1.00 32.52 ? 53  GLU Y O   1 
ATOM   1039 C CB  . GLU B 1 47 ? 30.579 83.479 12.738  1.00 32.78 ? 53  GLU Y CB  1 
ATOM   1040 C CG  . GLU B 1 47 ? 29.104 83.876 12.633  1.00 36.11 ? 53  GLU Y CG  1 
ATOM   1041 C CD  . GLU B 1 47 ? 28.160 82.670 12.603  1.00 40.90 ? 53  GLU Y CD  1 
ATOM   1042 O OE1 . GLU B 1 47 ? 28.603 81.563 12.219  1.00 44.80 ? 53  GLU Y OE1 1 
ATOM   1043 O OE2 . GLU B 1 47 ? 26.970 82.810 12.968  1.00 41.87 ? 53  GLU Y OE2 1 
ATOM   1044 N N   . GLN B 1 48 ? 31.717 84.273 15.889  1.00 31.39 ? 54  GLN Y N   1 
ATOM   1045 C CA  . GLN B 1 48 ? 31.480 84.629 17.299  1.00 30.50 ? 54  GLN Y CA  1 
ATOM   1046 C C   . GLN B 1 48 ? 32.134 85.964 17.648  1.00 31.08 ? 54  GLN Y C   1 
ATOM   1047 O O   . GLN B 1 48 ? 31.839 86.551 18.711  1.00 30.73 ? 54  GLN Y O   1 
ATOM   1048 C CB  . GLN B 1 48 ? 32.032 83.577 18.266  1.00 30.53 ? 54  GLN Y CB  1 
ATOM   1049 C CG  . GLN B 1 48 ? 31.521 82.116 18.076  1.00 30.44 ? 54  GLN Y CG  1 
ATOM   1050 C CD  . GLN B 1 48 ? 30.092 82.080 17.552  1.00 33.24 ? 54  GLN Y CD  1 
ATOM   1051 O OE1 . GLN B 1 48 ? 29.171 82.548 18.245  1.00 32.70 ? 54  GLN Y OE1 1 
ATOM   1052 N NE2 . GLN B 1 48 ? 29.899 81.577 16.299  1.00 29.27 ? 54  GLN Y NE2 1 
ATOM   1053 N N   . GLN B 1 49 ? 33.005 86.434 16.746  1.00 30.93 ? 55  GLN Y N   1 
ATOM   1054 C CA  . GLN B 1 49 ? 33.934 87.552 16.975  1.00 31.27 ? 55  GLN Y CA  1 
ATOM   1055 C C   . GLN B 1 49 ? 35.036 87.333 18.034  1.00 31.26 ? 55  GLN Y C   1 
ATOM   1056 O O   . GLN B 1 49 ? 35.480 88.270 18.695  1.00 30.63 ? 55  GLN Y O   1 
ATOM   1057 C CB  . GLN B 1 49 ? 33.177 88.852 17.202  1.00 31.37 ? 55  GLN Y CB  1 
ATOM   1058 C CG  . GLN B 1 49 ? 32.871 89.558 15.898  1.00 33.42 ? 55  GLN Y CG  1 
ATOM   1059 C CD  . GLN B 1 49 ? 31.703 90.489 16.041  1.00 35.44 ? 55  GLN Y CD  1 
ATOM   1060 O OE1 . GLN B 1 49 ? 30.733 90.163 16.742  1.00 36.83 ? 55  GLN Y OE1 1 
ATOM   1061 N NE2 . GLN B 1 49 ? 31.773 91.655 15.384  1.00 32.81 ? 55  GLN Y NE2 1 
ATOM   1062 N N   . CYS B 1 50 ? 35.453 86.081 18.185  1.00 32.06 ? 56  CYS Y N   1 
ATOM   1063 C CA  . CYS B 1 50 ? 36.622 85.696 18.966  1.00 33.10 ? 56  CYS Y CA  1 
ATOM   1064 C C   . CYS B 1 50 ? 37.670 85.581 17.928  1.00 33.80 ? 56  CYS Y C   1 
ATOM   1065 O O   . CYS B 1 50 ? 37.360 85.785 16.765  1.00 34.53 ? 56  CYS Y O   1 
ATOM   1066 C CB  . CYS B 1 50 ? 36.418 84.333 19.591  1.00 32.80 ? 56  CYS Y CB  1 
ATOM   1067 S SG  . CYS B 1 50 ? 34.918 84.291 20.460  1.00 33.42 ? 56  CYS Y SG  1 
ATOM   1068 N N   . GLY B 1 51 ? 38.898 85.235 18.307  1.00 34.85 ? 57  GLY Y N   1 
ATOM   1069 C CA  . GLY B 1 51 ? 40.029 85.322 17.349  1.00 35.64 ? 57  GLY Y CA  1 
ATOM   1070 C C   . GLY B 1 51 ? 40.059 84.107 16.441  1.00 35.90 ? 57  GLY Y C   1 
ATOM   1071 O O   . GLY B 1 51 ? 39.057 83.773 15.788  1.00 36.91 ? 57  GLY Y O   1 
ATOM   1072 N N   . SER B 1 52 ? 41.194 83.420 16.412  1.00 35.30 ? 58  SER Y N   1 
ATOM   1073 C CA  . SER B 1 52 ? 41.244 82.102 15.771  1.00 34.37 ? 58  SER Y CA  1 
ATOM   1074 C C   . SER B 1 52 ? 41.143 80.977 16.806  1.00 33.53 ? 58  SER Y C   1 
ATOM   1075 O O   . SER B 1 52 ? 41.300 81.220 18.021  1.00 33.89 ? 58  SER Y O   1 
ATOM   1076 C CB  . SER B 1 52 ? 42.518 81.966 14.941  1.00 34.33 ? 58  SER Y CB  1 
ATOM   1077 O OG  . SER B 1 52 ? 43.634 82.190 15.761  1.00 33.19 ? 58  SER Y OG  1 
ATOM   1078 N N   . VAL B 1 53 ? 40.905 79.765 16.296  1.00 32.09 ? 59  VAL Y N   1 
ATOM   1079 C CA  . VAL B 1 53 ? 40.770 78.540 17.066  1.00 31.31 ? 59  VAL Y CA  1 
ATOM   1080 C C   . VAL B 1 53 ? 42.058 78.113 17.710  1.00 30.54 ? 59  VAL Y C   1 
ATOM   1081 O O   . VAL B 1 53 ? 43.084 78.150 17.065  1.00 30.76 ? 59  VAL Y O   1 
ATOM   1082 C CB  . VAL B 1 53 ? 40.330 77.344 16.170  1.00 31.28 ? 59  VAL Y CB  1 
ATOM   1083 C CG1 . VAL B 1 53 ? 39.151 77.704 15.325  1.00 31.40 ? 59  VAL Y CG1 1 
ATOM   1084 C CG2 . VAL B 1 53 ? 41.476 76.856 15.268  1.00 31.93 ? 59  VAL Y CG2 1 
ATOM   1085 N N   . ASN B 1 54 ? 42.024 77.669 18.961  1.00 30.33 ? 60  ASN Y N   1 
ATOM   1086 C CA  . ASN B 1 54 ? 43.185 76.945 19.438  1.00 30.71 ? 60  ASN Y CA  1 
ATOM   1087 C C   . ASN B 1 54 ? 43.015 75.457 19.721  1.00 30.75 ? 60  ASN Y C   1 
ATOM   1088 O O   . ASN B 1 54 ? 44.017 74.785 19.969  1.00 30.90 ? 60  ASN Y O   1 
ATOM   1089 C CB  . ASN B 1 54 ? 43.946 77.683 20.550  1.00 31.72 ? 60  ASN Y CB  1 
ATOM   1090 C CG  . ASN B 1 54 ? 43.218 77.688 21.855  1.00 33.39 ? 60  ASN Y CG  1 
ATOM   1091 O OD1 . ASN B 1 54 ? 43.494 78.532 22.721  1.00 35.72 ? 60  ASN Y OD1 1 
ATOM   1092 N ND2 . ASN B 1 54 ? 42.271 76.757 22.021  1.00 35.22 ? 60  ASN Y ND2 1 
ATOM   1093 N N   . SER B 1 55 ? 41.776 74.938 19.675  1.00 30.27 ? 61  SER Y N   1 
ATOM   1094 C CA  . SER B 1 55 ? 41.543 73.485 19.807  1.00 30.01 ? 61  SER Y CA  1 
ATOM   1095 C C   . SER B 1 55 ? 40.113 73.087 19.492  1.00 30.07 ? 61  SER Y C   1 
ATOM   1096 O O   . SER B 1 55 ? 39.231 73.907 19.552  1.00 30.88 ? 61  SER Y O   1 
ATOM   1097 C CB  . SER B 1 55 ? 41.964 72.967 21.187  1.00 28.95 ? 61  SER Y CB  1 
ATOM   1098 O OG  . SER B 1 55 ? 41.446 73.785 22.205  1.00 30.44 ? 61  SER Y OG  1 
ATOM   1099 N N   . TYR B 1 56 ? 39.891 71.831 19.129  1.00 30.84 ? 62  TYR Y N   1 
ATOM   1100 C CA  . TYR B 1 56 ? 38.548 71.278 18.948  1.00 31.25 ? 62  TYR Y CA  1 
ATOM   1101 C C   . TYR B 1 56 ? 38.598 69.831 19.376  1.00 30.98 ? 62  TYR Y C   1 
ATOM   1102 O O   . TYR B 1 56 ? 39.633 69.188 19.242  1.00 30.48 ? 62  TYR Y O   1 
ATOM   1103 C CB  . TYR B 1 56 ? 38.058 71.373 17.493  1.00 32.66 ? 62  TYR Y CB  1 
ATOM   1104 C CG  . TYR B 1 56 ? 39.066 70.978 16.421  1.00 34.88 ? 62  TYR Y CG  1 
ATOM   1105 C CD1 . TYR B 1 56 ? 40.164 71.802 16.183  1.00 38.99 ? 62  TYR Y CD1 1 
ATOM   1106 C CD2 . TYR B 1 56 ? 38.932 69.796 15.639  1.00 37.27 ? 62  TYR Y CD2 1 
ATOM   1107 C CE1 . TYR B 1 56 ? 41.125 71.509 15.226  1.00 39.97 ? 62  TYR Y CE1 1 
ATOM   1108 C CE2 . TYR B 1 56 ? 39.921 69.467 14.644  1.00 35.58 ? 62  TYR Y CE2 1 
ATOM   1109 C CZ  . TYR B 1 56 ? 41.015 70.363 14.448  1.00 38.54 ? 62  TYR Y CZ  1 
ATOM   1110 O OH  . TYR B 1 56 ? 42.063 70.225 13.507  1.00 37.57 ? 62  TYR Y OH  1 
ATOM   1111 N N   . ARG B 1 57 ? 37.500 69.312 19.914  1.00 30.77 ? 63  ARG Y N   1 
ATOM   1112 C CA  . ARG B 1 57 ? 37.403 67.873 20.118  1.00 31.22 ? 63  ARG Y CA  1 
ATOM   1113 C C   . ARG B 1 57 ? 36.008 67.349 19.741  1.00 30.39 ? 63  ARG Y C   1 
ATOM   1114 O O   . ARG B 1 57 ? 34.998 68.084 19.795  1.00 31.07 ? 63  ARG Y O   1 
ATOM   1115 C CB  . ARG B 1 57 ? 37.891 67.444 21.514  1.00 30.29 ? 63  ARG Y CB  1 
ATOM   1116 C CG  . ARG B 1 57 ? 36.992 67.871 22.605  1.00 33.29 ? 63  ARG Y CG  1 
ATOM   1117 C CD  . ARG B 1 57 ? 37.532 67.586 24.041  1.00 33.88 ? 63  ARG Y CD  1 
ATOM   1118 N NE  . ARG B 1 57 ? 36.521 68.061 25.031  1.00 40.58 ? 63  ARG Y NE  1 
ATOM   1119 C CZ  . ARG B 1 57 ? 36.518 69.248 25.677  1.00 37.46 ? 63  ARG Y CZ  1 
ATOM   1120 N NH1 . ARG B 1 57 ? 37.496 70.143 25.502  1.00 37.49 ? 63  ARG Y NH1 1 
ATOM   1121 N NH2 . ARG B 1 57 ? 35.528 69.529 26.522  1.00 32.93 ? 63  ARG Y NH2 1 
ATOM   1122 N N   . VAL B 1 58 ? 36.004 66.096 19.280  1.00 29.03 ? 64  VAL Y N   1 
ATOM   1123 C CA  . VAL B 1 58 ? 34.820 65.303 18.905  1.00 26.79 ? 64  VAL Y CA  1 
ATOM   1124 C C   . VAL B 1 58 ? 34.204 64.794 20.186  1.00 26.05 ? 64  VAL Y C   1 
ATOM   1125 O O   . VAL B 1 58 ? 34.873 64.163 20.995  1.00 25.56 ? 64  VAL Y O   1 
ATOM   1126 C CB  . VAL B 1 58 ? 35.261 64.099 17.964  1.00 26.49 ? 64  VAL Y CB  1 
ATOM   1127 C CG1 . VAL B 1 58 ? 34.115 63.205 17.561  1.00 26.13 ? 64  VAL Y CG1 1 
ATOM   1128 C CG2 . VAL B 1 58 ? 35.893 64.676 16.722  1.00 27.60 ? 64  VAL Y CG2 1 
ATOM   1129 N N   . LEU B 1 59 ? 32.923 65.090 20.345  1.00 25.65 ? 65  LEU Y N   1 
ATOM   1130 C CA  . LEU B 1 59 ? 32.098 64.676 21.467  1.00 25.31 ? 65  LEU Y CA  1 
ATOM   1131 C C   . LEU B 1 59 ? 31.072 63.597 21.096  1.00 24.80 ? 65  LEU Y C   1 
ATOM   1132 O O   . LEU B 1 59 ? 30.576 63.531 19.939  1.00 23.90 ? 65  LEU Y O   1 
ATOM   1133 C CB  . LEU B 1 59 ? 31.324 65.898 21.998  1.00 26.20 ? 65  LEU Y CB  1 
ATOM   1134 C CG  . LEU B 1 59 ? 32.173 67.089 22.454  1.00 25.10 ? 65  LEU Y CG  1 
ATOM   1135 C CD1 . LEU B 1 59 ? 31.223 68.235 22.749  1.00 25.49 ? 65  LEU Y CD1 1 
ATOM   1136 C CD2 . LEU B 1 59 ? 32.956 66.656 23.678  1.00 20.94 ? 65  LEU Y CD2 1 
ATOM   1137 N N   . ASP B 1 60 ? 30.777 62.747 22.082  1.00 23.73 ? 66  ASP Y N   1 
ATOM   1138 C CA  . ASP B 1 60 ? 29.599 61.895 22.031  1.00 23.24 ? 66  ASP Y CA  1 
ATOM   1139 C C   . ASP B 1 60 ? 29.654 60.726 21.028  1.00 23.45 ? 66  ASP Y C   1 
ATOM   1140 O O   . ASP B 1 60 ? 28.612 60.150 20.708  1.00 24.86 ? 66  ASP Y O   1 
ATOM   1141 C CB  . ASP B 1 60 ? 28.350 62.742 21.768  1.00 22.62 ? 66  ASP Y CB  1 
ATOM   1142 C CG  . ASP B 1 60 ? 28.174 63.915 22.788  1.00 22.77 ? 66  ASP Y CG  1 
ATOM   1143 O OD1 . ASP B 1 60 ? 28.921 64.153 23.738  1.00 27.05 ? 66  ASP Y OD1 1 
ATOM   1144 O OD2 . ASP B 1 60 ? 27.215 64.621 22.670  1.00 28.06 ? 66  ASP Y OD2 1 
ATOM   1145 N N   . ALA B 1 61 ? 30.831 60.390 20.515  1.00 22.02 ? 67  ALA Y N   1 
ATOM   1146 C CA  . ALA B 1 61 ? 30.981 59.193 19.717  1.00 22.36 ? 67  ALA Y CA  1 
ATOM   1147 C C   . ALA B 1 61 ? 30.244 58.020 20.401  1.00 22.82 ? 67  ALA Y C   1 
ATOM   1148 O O   . ALA B 1 61 ? 30.403 57.791 21.634  1.00 24.56 ? 67  ALA Y O   1 
ATOM   1149 C CB  . ALA B 1 61 ? 32.497 58.820 19.561  1.00 20.25 ? 67  ALA Y CB  1 
ATOM   1150 N N   . GLY B 1 62 ? 29.476 57.267 19.651  1.00 20.13 ? 68  GLY Y N   1 
ATOM   1151 C CA  . GLY B 1 62 ? 28.959 56.059 20.245  1.00 20.95 ? 68  GLY Y CA  1 
ATOM   1152 C C   . GLY B 1 62 ? 27.640 56.168 21.008  1.00 21.40 ? 68  GLY Y C   1 
ATOM   1153 O O   . GLY B 1 62 ? 27.153 55.122 21.532  1.00 20.81 ? 68  GLY Y O   1 
ATOM   1154 N N   . ASP B 1 63 ? 27.056 57.389 21.045  1.00 19.61 ? 69  ASP Y N   1 
ATOM   1155 C CA  . ASP B 1 63 ? 25.789 57.638 21.762  1.00 19.78 ? 69  ASP Y CA  1 
ATOM   1156 C C   . ASP B 1 63 ? 24.520 57.632 20.875  1.00 19.06 ? 69  ASP Y C   1 
ATOM   1157 O O   . ASP B 1 63 ? 24.255 58.590 20.163  1.00 18.36 ? 69  ASP Y O   1 
ATOM   1158 C CB  . ASP B 1 63 ? 25.885 58.946 22.547  1.00 18.55 ? 69  ASP Y CB  1 
ATOM   1159 C CG  . ASP B 1 63 ? 24.601 59.239 23.377  1.00 22.31 ? 69  ASP Y CG  1 
ATOM   1160 O OD1 . ASP B 1 63 ? 23.566 58.491 23.238  1.00 22.00 ? 69  ASP Y OD1 1 
ATOM   1161 O OD2 . ASP B 1 63 ? 24.615 60.243 24.167  1.00 20.97 ? 69  ASP Y OD2 1 
ATOM   1162 N N   . PRO B 1 64 ? 23.702 56.574 20.941  1.00 19.54 ? 70  PRO Y N   1 
ATOM   1163 C CA  . PRO B 1 64 ? 22.634 56.567 19.904  1.00 18.48 ? 70  PRO Y CA  1 
ATOM   1164 C C   . PRO B 1 64 ? 21.652 57.665 20.109  1.00 18.31 ? 70  PRO Y C   1 
ATOM   1165 O O   . PRO B 1 64 ? 20.974 58.001 19.172  1.00 21.01 ? 70  PRO Y O   1 
ATOM   1166 C CB  . PRO B 1 64 ? 21.907 55.204 20.078  1.00 17.43 ? 70  PRO Y CB  1 
ATOM   1167 C CG  . PRO B 1 64 ? 22.377 54.675 21.429  1.00 17.88 ? 70  PRO Y CG  1 
ATOM   1168 C CD  . PRO B 1 64 ? 23.668 55.372 21.812  1.00 19.55 ? 70  PRO Y CD  1 
ATOM   1169 N N   . THR B 1 65 ? 21.554 58.237 21.285  1.00 16.15 ? 71  THR Y N   1 
ATOM   1170 C CA  . THR B 1 65 ? 20.505 59.205 21.497  1.00 16.36 ? 71  THR Y CA  1 
ATOM   1171 C C   . THR B 1 65 ? 21.030 60.651 21.187  1.00 18.88 ? 71  THR Y C   1 
ATOM   1172 O O   . THR B 1 65 ? 20.371 61.643 21.470  1.00 18.29 ? 71  THR Y O   1 
ATOM   1173 C CB  . THR B 1 65 ? 20.028 59.222 22.974  1.00 15.16 ? 71  THR Y CB  1 
ATOM   1174 O OG1 . THR B 1 65 ? 21.111 59.670 23.825  1.00 16.14 ? 71  THR Y OG1 1 
ATOM   1175 C CG2 . THR B 1 65 ? 19.591 57.896 23.382  1.00 8.72  ? 71  THR Y CG2 1 
ATOM   1176 N N   . SER B 1 66 ? 22.245 60.739 20.683  1.00 19.60 ? 72  SER Y N   1 
ATOM   1177 C CA  . SER B 1 66 ? 22.870 61.994 20.418  1.00 22.28 ? 72  SER Y CA  1 
ATOM   1178 C C   . SER B 1 66 ? 22.386 62.473 19.042  1.00 24.09 ? 72  SER Y C   1 
ATOM   1179 O O   . SER B 1 66 ? 22.437 61.729 18.070  1.00 23.91 ? 72  SER Y O   1 
ATOM   1180 C CB  . SER B 1 66 ? 24.386 61.773 20.363  1.00 20.96 ? 72  SER Y CB  1 
ATOM   1181 O OG  . SER B 1 66 ? 25.004 62.905 19.772  1.00 21.19 ? 72  SER Y OG  1 
ATOM   1182 N N   . ARG B 1 67 ? 21.874 63.695 18.965  1.00 25.83 ? 73  ARG Y N   1 
ATOM   1183 C CA  . ARG B 1 67 ? 21.149 64.081 17.753  1.00 28.66 ? 73  ARG Y CA  1 
ATOM   1184 C C   . ARG B 1 67 ? 21.499 65.525 17.355  1.00 27.23 ? 73  ARG Y C   1 
ATOM   1185 O O   . ARG B 1 67 ? 21.827 66.352 18.219  1.00 26.54 ? 73  ARG Y O   1 
ATOM   1186 C CB  . ARG B 1 67 ? 19.627 63.808 17.951  1.00 27.45 ? 73  ARG Y CB  1 
ATOM   1187 C CG  . ARG B 1 67 ? 18.767 64.967 18.361  1.00 31.66 ? 73  ARG Y CG  1 
ATOM   1188 C CD  . ARG B 1 67 ? 17.281 64.481 18.707  1.00 34.51 ? 73  ARG Y CD  1 
ATOM   1189 N NE  . ARG B 1 67 ? 17.347 63.463 19.789  1.00 52.00 ? 73  ARG Y NE  1 
ATOM   1190 C CZ  . ARG B 1 67 ? 17.295 62.111 19.679  1.00 53.31 ? 73  ARG Y CZ  1 
ATOM   1191 N NH1 . ARG B 1 67 ? 17.061 61.522 18.496  1.00 52.81 ? 73  ARG Y NH1 1 
ATOM   1192 N NH2 . ARG B 1 67 ? 17.441 61.349 20.797  1.00 48.00 ? 73  ARG Y NH2 1 
ATOM   1193 N N   . GLY B 1 68 ? 21.508 65.815 16.059  1.00 26.04 ? 74  GLY Y N   1 
ATOM   1194 C CA  . GLY B 1 68 ? 21.917 67.109 15.622  1.00 23.41 ? 74  GLY Y CA  1 
ATOM   1195 C C   . GLY B 1 68 ? 21.585 67.338 14.180  1.00 23.19 ? 74  GLY Y C   1 
ATOM   1196 O O   . GLY B 1 68 ? 20.770 66.590 13.572  1.00 21.69 ? 74  GLY Y O   1 
ATOM   1197 N N   . LEU B 1 69 ? 22.203 68.399 13.657  1.00 21.69 ? 75  LEU Y N   1 
ATOM   1198 C CA  . LEU B 1 69 ? 22.037 68.834 12.299  1.00 22.59 ? 75  LEU Y CA  1 
ATOM   1199 C C   . LEU B 1 69 ? 23.404 68.792 11.649  1.00 23.74 ? 75  LEU Y C   1 
ATOM   1200 O O   . LEU B 1 69 ? 24.398 69.099 12.293  1.00 25.31 ? 75  LEU Y O   1 
ATOM   1201 C CB  . LEU B 1 69 ? 21.487 70.272 12.231  1.00 20.38 ? 75  LEU Y CB  1 
ATOM   1202 C CG  . LEU B 1 69 ? 20.030 70.545 12.648  1.00 18.40 ? 75  LEU Y CG  1 
ATOM   1203 C CD1 . LEU B 1 69 ? 19.755 72.142 12.723  1.00 10.87 ? 75  LEU Y CD1 1 
ATOM   1204 C CD2 . LEU B 1 69 ? 18.986 69.880 11.793  1.00 10.75 ? 75  LEU Y CD2 1 
ATOM   1205 N N   . PHE B 1 70 ? 23.417 68.516 10.362  1.00 24.26 ? 76  PHE Y N   1 
ATOM   1206 C CA  . PHE B 1 70 ? 24.553 68.000 9.611   1.00 26.57 ? 76  PHE Y CA  1 
ATOM   1207 C C   . PHE B 1 70 ? 24.635 68.822 8.287   1.00 26.72 ? 76  PHE Y C   1 
ATOM   1208 O O   . PHE B 1 70 ? 23.630 69.180 7.726   1.00 24.16 ? 76  PHE Y O   1 
ATOM   1209 C CB  . PHE B 1 70 ? 24.267 66.458 9.334   1.00 27.22 ? 76  PHE Y CB  1 
ATOM   1210 C CG  . PHE B 1 70 ? 25.290 65.797 8.478   1.00 30.13 ? 76  PHE Y CG  1 
ATOM   1211 C CD1 . PHE B 1 70 ? 25.047 65.575 7.120   1.00 31.81 ? 76  PHE Y CD1 1 
ATOM   1212 C CD2 . PHE B 1 70 ? 26.530 65.444 9.012   1.00 35.34 ? 76  PHE Y CD2 1 
ATOM   1213 C CE1 . PHE B 1 70 ? 26.008 65.011 6.299   1.00 34.62 ? 76  PHE Y CE1 1 
ATOM   1214 C CE2 . PHE B 1 70 ? 27.545 64.876 8.199   1.00 37.14 ? 76  PHE Y CE2 1 
ATOM   1215 C CZ  . PHE B 1 70 ? 27.282 64.652 6.823   1.00 35.33 ? 76  PHE Y CZ  1 
ATOM   1216 N N   . CYS B 1 71 ? 25.824 69.161 7.824   1.00 30.28 ? 77  CYS Y N   1 
ATOM   1217 C CA  . CYS B 1 71 ? 25.950 69.795 6.531   1.00 32.23 ? 77  CYS Y CA  1 
ATOM   1218 C C   . CYS B 1 71 ? 26.988 69.032 5.736   1.00 33.78 ? 77  CYS Y C   1 
ATOM   1219 O O   . CYS B 1 71 ? 28.152 69.033 6.061   1.00 33.40 ? 77  CYS Y O   1 
ATOM   1220 C CB  . CYS B 1 71 ? 26.298 71.276 6.662   1.00 32.61 ? 77  CYS Y CB  1 
ATOM   1221 S SG  . CYS B 1 71 ? 26.583 72.109 5.078   1.00 36.45 ? 77  CYS Y SG  1 
ATOM   1222 N N   . PRO B 1 72 ? 26.560 68.332 4.693   1.00 35.79 ? 78  PRO Y N   1 
ATOM   1223 C CA  . PRO B 1 72 ? 27.504 67.455 4.032   1.00 37.94 ? 78  PRO Y CA  1 
ATOM   1224 C C   . PRO B 1 72 ? 28.561 68.191 3.183   1.00 39.10 ? 78  PRO Y C   1 
ATOM   1225 O O   . PRO B 1 72 ? 29.503 67.543 2.763   1.00 39.73 ? 78  PRO Y O   1 
ATOM   1226 C CB  . PRO B 1 72 ? 26.600 66.618 3.140   1.00 37.95 ? 78  PRO Y CB  1 
ATOM   1227 C CG  . PRO B 1 72 ? 25.533 67.623 2.731   1.00 37.32 ? 78  PRO Y CG  1 
ATOM   1228 C CD  . PRO B 1 72 ? 25.235 68.293 4.052   1.00 36.09 ? 78  PRO Y CD  1 
ATOM   1229 N N   . HIS B 1 73 ? 28.405 69.502 2.933   1.00 40.46 ? 79  HIS Y N   1 
ATOM   1230 C CA  . HIS B 1 73 ? 29.458 70.350 2.294   1.00 41.19 ? 79  HIS Y CA  1 
ATOM   1231 C C   . HIS B 1 73 ? 30.509 70.931 3.262   1.00 42.34 ? 79  HIS Y C   1 
ATOM   1232 O O   . HIS B 1 73 ? 30.208 71.199 4.426   1.00 42.54 ? 79  HIS Y O   1 
ATOM   1233 C CB  . HIS B 1 73 ? 28.861 71.438 1.394   1.00 41.49 ? 79  HIS Y CB  1 
ATOM   1234 C CG  . HIS B 1 73 ? 29.146 71.208 -0.053  1.00 43.04 ? 79  HIS Y CG  1 
ATOM   1235 N ND1 . HIS B 1 73 ? 29.886 72.089 -0.820  1.00 46.37 ? 79  HIS Y ND1 1 
ATOM   1236 C CD2 . HIS B 1 73 ? 28.860 70.160 -0.862  1.00 44.23 ? 79  HIS Y CD2 1 
ATOM   1237 C CE1 . HIS B 1 73 ? 30.005 71.619 -2.052  1.00 45.87 ? 79  HIS Y CE1 1 
ATOM   1238 N NE2 . HIS B 1 73 ? 29.393 70.447 -2.104  1.00 46.32 ? 79  HIS Y NE2 1 
ATOM   1239 N N   . GLN B 1 74 ? 31.743 71.099 2.781   1.00 43.63 ? 80  GLN Y N   1 
ATOM   1240 C CA  . GLN B 1 74 ? 32.889 71.445 3.660   1.00 44.17 ? 80  GLN Y CA  1 
ATOM   1241 C C   . GLN B 1 74 ? 32.610 72.616 4.616   1.00 43.87 ? 80  GLN Y C   1 
ATOM   1242 O O   . GLN B 1 74 ? 32.760 72.465 5.831   1.00 43.94 ? 80  GLN Y O   1 
ATOM   1243 C CB  . GLN B 1 74 ? 34.233 71.622 2.861   1.00 44.87 ? 80  GLN Y CB  1 
ATOM   1244 C CG  . GLN B 1 74 ? 35.498 72.314 3.590   1.00 45.26 ? 80  GLN Y CG  1 
ATOM   1245 C CD  . GLN B 1 74 ? 35.776 71.904 5.104   1.00 48.31 ? 80  GLN Y CD  1 
ATOM   1246 O OE1 . GLN B 1 74 ? 35.331 70.844 5.583   1.00 48.86 ? 80  GLN Y OE1 1 
ATOM   1247 N NE2 . GLN B 1 74 ? 36.514 72.773 5.838   1.00 46.78 ? 80  GLN Y NE2 1 
ATOM   1248 N N   . LYS B 1 75 ? 32.208 73.768 4.085   1.00 43.20 ? 81  LYS Y N   1 
ATOM   1249 C CA  . LYS B 1 75 ? 32.000 74.912 4.952   1.00 42.63 ? 81  LYS Y CA  1 
ATOM   1250 C C   . LYS B 1 75 ? 30.545 75.290 5.057   1.00 42.44 ? 81  LYS Y C   1 
ATOM   1251 O O   . LYS B 1 75 ? 29.824 75.286 4.062   1.00 42.33 ? 81  LYS Y O   1 
ATOM   1252 C CB  . LYS B 1 75 ? 32.848 76.091 4.494   1.00 42.56 ? 81  LYS Y CB  1 
ATOM   1253 C CG  . LYS B 1 75 ? 34.347 75.859 4.675   1.00 42.06 ? 81  LYS Y CG  1 
ATOM   1254 C CD  . LYS B 1 75 ? 35.136 76.335 3.458   1.00 41.08 ? 81  LYS Y CD  1 
ATOM   1255 C CE  . LYS B 1 75 ? 35.131 77.844 3.372   1.00 39.33 ? 81  LYS Y CE  1 
ATOM   1256 N NZ  . LYS B 1 75 ? 35.422 78.257 2.004   1.00 37.93 ? 81  LYS Y NZ  1 
ATOM   1257 N N   . LEU B 1 76 ? 30.135 75.605 6.283   1.00 42.39 ? 82  LEU Y N   1 
ATOM   1258 C CA  . LEU B 1 76 ? 28.774 76.037 6.618   1.00 42.66 ? 82  LEU Y CA  1 
ATOM   1259 C C   . LEU B 1 76 ? 28.228 77.195 5.775   1.00 43.31 ? 82  LEU Y C   1 
ATOM   1260 O O   . LEU B 1 76 ? 27.037 77.223 5.449   1.00 44.21 ? 82  LEU Y O   1 
ATOM   1261 C CB  . LEU B 1 76 ? 28.718 76.457 8.079   1.00 42.40 ? 82  LEU Y CB  1 
ATOM   1262 C CG  . LEU B 1 76 ? 28.390 75.386 9.134   1.00 44.12 ? 82  LEU Y CG  1 
ATOM   1263 C CD1 . LEU B 1 76 ? 29.588 74.579 9.572   1.00 42.98 ? 82  LEU Y CD1 1 
ATOM   1264 C CD2 . LEU B 1 76 ? 27.827 76.110 10.316  1.00 45.42 ? 82  LEU Y CD2 1 
ATOM   1265 N N   . SER B 1 77 ? 29.082 78.161 5.443   1.00 42.48 ? 83  SER Y N   1 
ATOM   1266 C CA  . SER B 1 77 ? 28.662 79.284 4.641   1.00 42.20 ? 83  SER Y CA  1 
ATOM   1267 C C   . SER B 1 77 ? 28.050 78.855 3.291   1.00 42.11 ? 83  SER Y C   1 
ATOM   1268 O O   . SER B 1 77 ? 27.268 79.596 2.689   1.00 41.62 ? 83  SER Y O   1 
ATOM   1269 C CB  . SER B 1 77 ? 29.857 80.212 4.403   1.00 42.47 ? 83  SER Y CB  1 
ATOM   1270 O OG  . SER B 1 77 ? 30.971 79.504 3.862   1.00 42.50 ? 83  SER Y OG  1 
ATOM   1271 N N   . GLN B 1 78 ? 28.399 77.657 2.823   1.00 41.48 ? 84  GLN Y N   1 
ATOM   1272 C CA  . GLN B 1 78 ? 28.025 77.237 1.476   1.00 41.06 ? 84  GLN Y CA  1 
ATOM   1273 C C   . GLN B 1 78 ? 26.916 76.193 1.560   1.00 39.80 ? 84  GLN Y C   1 
ATOM   1274 O O   . GLN B 1 78 ? 26.746 75.348 0.678   1.00 39.67 ? 84  GLN Y O   1 
ATOM   1275 C CB  . GLN B 1 78 ? 29.264 76.721 0.714   1.00 41.27 ? 84  GLN Y CB  1 
ATOM   1276 C CG  . GLN B 1 78 ? 29.941 75.472 1.345   1.00 43.00 ? 84  GLN Y CG  1 
ATOM   1277 C CD  . GLN B 1 78 ? 31.305 75.101 0.726   1.00 42.63 ? 84  GLN Y CD  1 
ATOM   1278 O OE1 . GLN B 1 78 ? 32.129 74.420 1.364   1.00 45.00 ? 84  GLN Y OE1 1 
ATOM   1279 N NE2 . GLN B 1 78 ? 31.536 75.530 -0.512  1.00 42.87 ? 84  GLN Y NE2 1 
ATOM   1280 N N   . CYS B 1 79 ? 26.145 76.278 2.633   1.00 38.22 ? 85  CYS Y N   1 
ATOM   1281 C CA  . CYS B 1 79 ? 25.161 75.273 2.944   1.00 36.79 ? 85  CYS Y CA  1 
ATOM   1282 C C   . CYS B 1 79 ? 23.739 75.808 2.832   1.00 35.48 ? 85  CYS Y C   1 
ATOM   1283 O O   . CYS B 1 79 ? 23.358 76.708 3.553   1.00 35.29 ? 85  CYS Y O   1 
ATOM   1284 C CB  . CYS B 1 79 ? 25.425 74.817 4.355   1.00 36.98 ? 85  CYS Y CB  1 
ATOM   1285 S SG  . CYS B 1 79 ? 24.865 73.210 4.664   1.00 40.02 ? 85  CYS Y SG  1 
ATOM   1286 N N   . HIS B 1 80 ? 22.941 75.250 1.938   1.00 34.23 ? 86  HIS Y N   1 
ATOM   1287 C CA  . HIS B 1 80 ? 21.584 75.759 1.755   1.00 33.45 ? 86  HIS Y CA  1 
ATOM   1288 C C   . HIS B 1 80 ? 20.530 75.165 2.695   1.00 32.35 ? 86  HIS Y C   1 
ATOM   1289 O O   . HIS B 1 80 ? 19.492 75.762 2.936   1.00 31.95 ? 86  HIS Y O   1 
ATOM   1290 C CB  . HIS B 1 80 ? 21.151 75.583 0.297   1.00 33.69 ? 86  HIS Y CB  1 
ATOM   1291 C CG  . HIS B 1 80 ? 21.730 76.611 -0.626  1.00 35.28 ? 86  HIS Y CG  1 
ATOM   1292 N ND1 . HIS B 1 80 ? 21.962 76.368 -1.964  1.00 37.15 ? 86  HIS Y ND1 1 
ATOM   1293 C CD2 . HIS B 1 80 ? 22.126 77.890 -0.403  1.00 36.72 ? 86  HIS Y CD2 1 
ATOM   1294 C CE1 . HIS B 1 80 ? 22.463 77.454 -2.530  1.00 37.66 ? 86  HIS Y CE1 1 
ATOM   1295 N NE2 . HIS B 1 80 ? 22.575 78.391 -1.603  1.00 37.88 ? 86  HIS Y NE2 1 
ATOM   1296 N N   . GLU B 1 81 ? 20.811 73.991 3.231   1.00 31.28 ? 87  GLU Y N   1 
ATOM   1297 C CA  . GLU B 1 81 ? 19.808 73.133 3.812   1.00 30.48 ? 87  GLU Y CA  1 
ATOM   1298 C C   . GLU B 1 81 ? 20.635 72.300 4.779   1.00 28.80 ? 87  GLU Y C   1 
ATOM   1299 O O   . GLU B 1 81 ? 21.672 71.797 4.398   1.00 29.18 ? 87  GLU Y O   1 
ATOM   1300 C CB  . GLU B 1 81 ? 19.191 72.307 2.649   1.00 31.22 ? 87  GLU Y CB  1 
ATOM   1301 C CG  . GLU B 1 81 ? 18.151 71.194 2.991   1.00 35.74 ? 87  GLU Y CG  1 
ATOM   1302 C CD  . GLU B 1 81 ? 16.917 71.691 3.810   1.00 39.95 ? 87  GLU Y CD  1 
ATOM   1303 O OE1 . GLU B 1 81 ? 16.158 72.564 3.298   1.00 39.81 ? 87  GLU Y OE1 1 
ATOM   1304 O OE2 . GLU B 1 81 ? 16.702 71.168 4.948   1.00 39.49 ? 87  GLU Y OE2 1 
ATOM   1305 N N   . LEU B 1 82 ? 20.260 72.219 6.048   1.00 27.02 ? 88  LEU Y N   1 
ATOM   1306 C CA  . LEU B 1 82 ? 20.965 71.326 6.982   1.00 24.00 ? 88  LEU Y CA  1 
ATOM   1307 C C   . LEU B 1 82 ? 20.153 70.066 7.096   1.00 24.05 ? 88  LEU Y C   1 
ATOM   1308 O O   . LEU B 1 82 ? 18.923 70.128 6.996   1.00 23.89 ? 88  LEU Y O   1 
ATOM   1309 C CB  . LEU B 1 82 ? 21.082 71.949 8.354   1.00 23.36 ? 88  LEU Y CB  1 
ATOM   1310 C CG  . LEU B 1 82 ? 21.966 73.177 8.550   1.00 19.95 ? 88  LEU Y CG  1 
ATOM   1311 C CD1 . LEU B 1 82 ? 21.535 73.797 9.793   1.00 15.66 ? 88  LEU Y CD1 1 
ATOM   1312 C CD2 . LEU B 1 82 ? 23.430 72.823 8.648   1.00 15.83 ? 88  LEU Y CD2 1 
ATOM   1313 N N   . TRP B 1 83 ? 20.836 68.928 7.270   1.00 23.42 ? 89  TRP Y N   1 
ATOM   1314 C CA  . TRP B 1 83 ? 20.195 67.627 7.377   1.00 23.63 ? 89  TRP Y CA  1 
ATOM   1315 C C   . TRP B 1 83 ? 20.094 67.188 8.821   1.00 23.63 ? 89  TRP Y C   1 
ATOM   1316 O O   . TRP B 1 83 ? 20.927 67.530 9.676   1.00 23.70 ? 89  TRP Y O   1 
ATOM   1317 C CB  . TRP B 1 83 ? 20.932 66.505 6.591   1.00 23.92 ? 89  TRP Y CB  1 
ATOM   1318 C CG  . TRP B 1 83 ? 21.124 66.725 5.132   1.00 23.80 ? 89  TRP Y CG  1 
ATOM   1319 C CD1 . TRP B 1 83 ? 20.612 67.731 4.406   1.00 22.09 ? 89  TRP Y CD1 1 
ATOM   1320 C CD2 . TRP B 1 83 ? 21.874 65.893 4.209   1.00 23.36 ? 89  TRP Y CD2 1 
ATOM   1321 N NE1 . TRP B 1 83 ? 21.015 67.621 3.106   1.00 23.27 ? 89  TRP Y NE1 1 
ATOM   1322 C CE2 . TRP B 1 83 ? 21.779 66.496 2.947   1.00 23.26 ? 89  TRP Y CE2 1 
ATOM   1323 C CE3 . TRP B 1 83 ? 22.617 64.708 4.339   1.00 23.66 ? 89  TRP Y CE3 1 
ATOM   1324 C CZ2 . TRP B 1 83 ? 22.400 65.954 1.780   1.00 24.17 ? 89  TRP Y CZ2 1 
ATOM   1325 C CZ3 . TRP B 1 83 ? 23.229 64.159 3.199   1.00 22.24 ? 89  TRP Y CZ3 1 
ATOM   1326 C CH2 . TRP B 1 83 ? 23.119 64.787 1.935   1.00 23.38 ? 89  TRP Y CH2 1 
ATOM   1327 N N   . GLU B 1 84 ? 19.093 66.370 9.096   1.00 23.81 ? 90  GLU Y N   1 
ATOM   1328 C CA  . GLU B 1 84 ? 18.966 65.823 10.433  1.00 23.06 ? 90  GLU Y CA  1 
ATOM   1329 C C   . GLU B 1 84 ? 19.735 64.521 10.532  1.00 21.68 ? 90  GLU Y C   1 
ATOM   1330 O O   . GLU B 1 84 ? 19.609 63.720 9.643   1.00 21.25 ? 90  GLU Y O   1 
ATOM   1331 C CB  . GLU B 1 84 ? 17.530 65.558 10.710  1.00 23.18 ? 90  GLU Y CB  1 
ATOM   1332 C CG  . GLU B 1 84 ? 16.812 66.823 11.002  1.00 27.89 ? 90  GLU Y CG  1 
ATOM   1333 C CD  . GLU B 1 84 ? 15.311 66.570 11.157  1.00 37.67 ? 90  GLU Y CD  1 
ATOM   1334 O OE1 . GLU B 1 84 ? 14.921 65.375 11.313  1.00 40.39 ? 90  GLU Y OE1 1 
ATOM   1335 O OE2 . GLU B 1 84 ? 14.525 67.557 11.111  1.00 40.63 ? 90  GLU Y OE2 1 
ATOM   1336 N N   . ARG B 1 85 ? 20.548 64.364 11.583  1.00 19.47 ? 91  ARG Y N   1 
ATOM   1337 C CA  . ARG B 1 85 ? 21.182 63.127 11.971  1.00 19.89 ? 91  ARG Y CA  1 
ATOM   1338 C C   . ARG B 1 85 ? 20.623 62.941 13.411  1.00 19.58 ? 91  ARG Y C   1 
ATOM   1339 O O   . ARG B 1 85 ? 21.012 63.615 14.387  1.00 18.36 ? 91  ARG Y O   1 
ATOM   1340 C CB  . ARG B 1 85 ? 22.738 63.219 11.893  1.00 19.36 ? 91  ARG Y CB  1 
ATOM   1341 C CG  . ARG B 1 85 ? 23.447 62.184 12.645  1.00 22.40 ? 91  ARG Y CG  1 
ATOM   1342 C CD  . ARG B 1 85 ? 25.019 61.936 12.340  1.00 22.02 ? 91  ARG Y CD  1 
ATOM   1343 N NE  . ARG B 1 85 ? 24.911 60.809 11.487  1.00 27.57 ? 91  ARG Y NE  1 
ATOM   1344 C CZ  . ARG B 1 85 ? 25.238 59.547 11.692  1.00 23.29 ? 91  ARG Y CZ  1 
ATOM   1345 N NH1 . ARG B 1 85 ? 25.932 59.111 12.714  1.00 20.74 ? 91  ARG Y NH1 1 
ATOM   1346 N NH2 . ARG B 1 85 ? 24.895 58.722 10.725  1.00 21.56 ? 91  ARG Y NH2 1 
ATOM   1347 N N   . ASN B 1 86 ? 19.655 62.043 13.519  1.00 18.97 ? 92  ASN Y N   1 
ATOM   1348 C CA  . ASN B 1 86 ? 18.897 61.862 14.723  1.00 19.49 ? 92  ASN Y CA  1 
ATOM   1349 C C   . ASN B 1 86 ? 19.436 60.806 15.676  1.00 20.03 ? 92  ASN Y C   1 
ATOM   1350 O O   . ASN B 1 86 ? 18.768 60.448 16.655  1.00 19.34 ? 92  ASN Y O   1 
ATOM   1351 C CB  . ASN B 1 86 ? 17.458 61.587 14.311  1.00 18.44 ? 92  ASN Y CB  1 
ATOM   1352 C CG  . ASN B 1 86 ? 16.810 62.860 13.886  1.00 21.97 ? 92  ASN Y CG  1 
ATOM   1353 O OD1 . ASN B 1 86 ? 17.050 63.902 14.542  1.00 24.84 ? 92  ASN Y OD1 1 
ATOM   1354 N ND2 . ASN B 1 86 ? 16.144 62.860 12.745  1.00 16.83 ? 92  ASN Y ND2 1 
ATOM   1355 N N   . SER B 1 87 ? 20.620 60.291 15.388  1.00 19.39 ? 93  SER Y N   1 
ATOM   1356 C CA  . SER B 1 87 ? 21.217 59.419 16.347  1.00 21.55 ? 93  SER Y CA  1 
ATOM   1357 C C   . SER B 1 87 ? 22.647 59.313 15.937  1.00 21.56 ? 93  SER Y C   1 
ATOM   1358 O O   . SER B 1 87 ? 22.948 59.425 14.749  1.00 23.10 ? 93  SER Y O   1 
ATOM   1359 C CB  . SER B 1 87 ? 20.538 58.039 16.354  1.00 20.70 ? 93  SER Y CB  1 
ATOM   1360 O OG  . SER B 1 87 ? 20.611 57.401 15.081  1.00 22.64 ? 93  SER Y OG  1 
ATOM   1361 N N   . TYR B 1 88 ? 23.506 59.050 16.912  1.00 20.03 ? 94  TYR Y N   1 
ATOM   1362 C CA  . TYR B 1 88 ? 24.906 58.964 16.697  1.00 19.88 ? 94  TYR Y CA  1 
ATOM   1363 C C   . TYR B 1 88 ? 25.484 60.235 16.060  1.00 22.09 ? 94  TYR Y C   1 
ATOM   1364 O O   . TYR B 1 88 ? 26.413 60.174 15.286  1.00 21.49 ? 94  TYR Y O   1 
ATOM   1365 C CB  . TYR B 1 88 ? 25.280 57.740 15.906  1.00 17.36 ? 94  TYR Y CB  1 
ATOM   1366 C CG  . TYR B 1 88 ? 25.056 56.399 16.643  1.00 17.54 ? 94  TYR Y CG  1 
ATOM   1367 C CD1 . TYR B 1 88 ? 25.925 55.947 17.659  1.00 16.58 ? 94  TYR Y CD1 1 
ATOM   1368 C CD2 . TYR B 1 88 ? 23.987 55.583 16.307  1.00 13.61 ? 94  TYR Y CD2 1 
ATOM   1369 C CE1 . TYR B 1 88 ? 25.734 54.689 18.252  1.00 12.22 ? 94  TYR Y CE1 1 
ATOM   1370 C CE2 . TYR B 1 88 ? 23.776 54.381 16.929  1.00 14.32 ? 94  TYR Y CE2 1 
ATOM   1371 C CZ  . TYR B 1 88 ? 24.642 53.939 17.892  1.00 14.03 ? 94  TYR Y CZ  1 
ATOM   1372 O OH  . TYR B 1 88 ? 24.370 52.705 18.477  1.00 13.96 ? 94  TYR Y OH  1 
ATOM   1373 N N   . CYS B 1 89 ? 24.937 61.392 16.411  1.00 24.17 ? 95  CYS Y N   1 
ATOM   1374 C CA  . CYS B 1 89 ? 25.529 62.636 16.030  1.00 23.83 ? 95  CYS Y CA  1 
ATOM   1375 C C   . CYS B 1 89 ? 26.861 62.869 16.792  1.00 22.99 ? 95  CYS Y C   1 
ATOM   1376 O O   . CYS B 1 89 ? 26.895 62.896 17.996  1.00 21.98 ? 95  CYS Y O   1 
ATOM   1377 C CB  . CYS B 1 89 ? 24.509 63.698 16.350  1.00 25.47 ? 95  CYS Y CB  1 
ATOM   1378 S SG  . CYS B 1 89 ? 25.094 65.397 16.181  1.00 30.05 ? 95  CYS Y SG  1 
ATOM   1379 N N   . LYS B 1 90 ? 27.981 62.984 16.104  1.00 23.56 ? 96  LYS Y N   1 
ATOM   1380 C CA  . LYS B 1 90 ? 29.210 63.366 16.805  1.00 25.88 ? 96  LYS Y CA  1 
ATOM   1381 C C   . LYS B 1 90 ? 29.241 64.939 16.896  1.00 25.81 ? 96  LYS Y C   1 
ATOM   1382 O O   . LYS B 1 90 ? 29.297 65.629 15.860  1.00 27.28 ? 96  LYS Y O   1 
ATOM   1383 C CB  . LYS B 1 90 ? 30.434 62.898 15.994  1.00 25.97 ? 96  LYS Y CB  1 
ATOM   1384 C CG  . LYS B 1 90 ? 30.699 61.345 15.976  1.00 26.95 ? 96  LYS Y CG  1 
ATOM   1385 C CD  . LYS B 1 90 ? 32.003 61.094 15.132  1.00 30.04 ? 96  LYS Y CD  1 
ATOM   1386 C CE  . LYS B 1 90 ? 32.011 59.752 14.336  1.00 35.93 ? 96  LYS Y CE  1 
ATOM   1387 N NZ  . LYS B 1 90 ? 30.995 58.835 14.947  1.00 36.77 ? 96  LYS Y NZ  1 
ATOM   1388 N N   . LYS B 1 91 ? 29.258 65.499 18.091  1.00 24.17 ? 97  LYS Y N   1 
ATOM   1389 C CA  . LYS B 1 91 ? 29.157 66.929 18.250  1.00 23.83 ? 97  LYS Y CA  1 
ATOM   1390 C C   . LYS B 1 91 ? 30.578 67.421 18.325  1.00 24.74 ? 97  LYS Y C   1 
ATOM   1391 O O   . LYS B 1 91 ? 31.506 66.587 18.275  1.00 23.87 ? 97  LYS Y O   1 
ATOM   1392 C CB  . LYS B 1 91 ? 28.434 67.225 19.514  1.00 23.05 ? 97  LYS Y CB  1 
ATOM   1393 C CG  . LYS B 1 91 ? 27.058 66.727 19.430  1.00 23.18 ? 97  LYS Y CG  1 
ATOM   1394 C CD  . LYS B 1 91 ? 26.254 67.100 20.621  1.00 23.09 ? 97  LYS Y CD  1 
ATOM   1395 C CE  . LYS B 1 91 ? 24.910 66.493 20.391  1.00 26.41 ? 97  LYS Y CE  1 
ATOM   1396 N NZ  . LYS B 1 91 ? 24.053 66.842 21.505  1.00 31.76 ? 97  LYS Y NZ  1 
ATOM   1397 N N   . VAL B 1 92 ? 30.772 68.748 18.411  1.00 24.43 ? 98  VAL Y N   1 
ATOM   1398 C CA  . VAL B 1 92 ? 32.145 69.260 18.497  1.00 24.07 ? 98  VAL Y CA  1 
ATOM   1399 C C   . VAL B 1 92 ? 32.288 70.296 19.610  1.00 23.35 ? 98  VAL Y C   1 
ATOM   1400 O O   . VAL B 1 92 ? 31.417 71.140 19.800  1.00 23.64 ? 98  VAL Y O   1 
ATOM   1401 C CB  . VAL B 1 92 ? 32.642 69.936 17.145  1.00 24.90 ? 98  VAL Y CB  1 
ATOM   1402 C CG1 . VAL B 1 92 ? 34.163 69.910 17.058  1.00 23.96 ? 98  VAL Y CG1 1 
ATOM   1403 C CG2 . VAL B 1 92 ? 32.071 69.280 15.928  1.00 24.17 ? 98  VAL Y CG2 1 
ATOM   1404 N N   . PHE B 1 93 ? 33.402 70.270 20.319  1.00 22.21 ? 99  PHE Y N   1 
ATOM   1405 C CA  . PHE B 1 93 ? 33.670 71.331 21.245  1.00 21.81 ? 99  PHE Y CA  1 
ATOM   1406 C C   . PHE B 1 93 ? 34.783 72.178 20.661  1.00 22.89 ? 99  PHE Y C   1 
ATOM   1407 O O   . PHE B 1 93 ? 35.869 71.665 20.359  1.00 22.47 ? 99  PHE Y O   1 
ATOM   1408 C CB  . PHE B 1 93 ? 34.113 70.751 22.568  1.00 21.83 ? 99  PHE Y CB  1 
ATOM   1409 C CG  . PHE B 1 93 ? 34.178 71.745 23.681  1.00 21.33 ? 99  PHE Y CG  1 
ATOM   1410 C CD1 . PHE B 1 93 ? 33.117 71.881 24.572  1.00 21.12 ? 99  PHE Y CD1 1 
ATOM   1411 C CD2 . PHE B 1 93 ? 35.314 72.536 23.861  1.00 22.46 ? 99  PHE Y CD2 1 
ATOM   1412 C CE1 . PHE B 1 93 ? 33.171 72.794 25.611  1.00 22.92 ? 99  PHE Y CE1 1 
ATOM   1413 C CE2 . PHE B 1 93 ? 35.379 73.485 24.915  1.00 22.13 ? 99  PHE Y CE2 1 
ATOM   1414 C CZ  . PHE B 1 93 ? 34.320 73.609 25.787  1.00 21.24 ? 99  PHE Y CZ  1 
ATOM   1415 N N   . VAL B 1 94 ? 34.521 73.483 20.518  1.00 22.91 ? 100 VAL Y N   1 
ATOM   1416 C CA  . VAL B 1 94 ? 35.520 74.395 20.012  1.00 23.22 ? 100 VAL Y CA  1 
ATOM   1417 C C   . VAL B 1 94 ? 35.950 75.368 21.103  1.00 24.90 ? 100 VAL Y C   1 
ATOM   1418 O O   . VAL B 1 94 ? 35.121 75.912 21.833  1.00 25.12 ? 100 VAL Y O   1 
ATOM   1419 C CB  . VAL B 1 94 ? 35.047 75.107 18.725  1.00 22.78 ? 100 VAL Y CB  1 
ATOM   1420 C CG1 . VAL B 1 94 ? 36.090 76.177 18.230  1.00 23.31 ? 100 VAL Y CG1 1 
ATOM   1421 C CG2 . VAL B 1 94 ? 34.832 74.070 17.638  1.00 19.13 ? 100 VAL Y CG2 1 
ATOM   1422 N N   . THR B 1 95 ? 37.259 75.538 21.251  1.00 26.17 ? 101 THR Y N   1 
ATOM   1423 C CA  . THR B 1 95 ? 37.741 76.646 22.022  1.00 28.20 ? 101 THR Y CA  1 
ATOM   1424 C C   . THR B 1 95 ? 38.587 77.614 21.185  1.00 29.15 ? 101 THR Y C   1 
ATOM   1425 O O   . THR B 1 95 ? 39.550 77.200 20.574  1.00 29.57 ? 101 THR Y O   1 
ATOM   1426 C CB  . THR B 1 95 ? 38.345 76.219 23.408  1.00 28.80 ? 101 THR Y CB  1 
ATOM   1427 O OG1 . THR B 1 95 ? 39.623 76.845 23.617  1.00 28.73 ? 101 THR Y OG1 1 
ATOM   1428 C CG2 . THR B 1 95 ? 38.440 74.762 23.557  1.00 25.40 ? 101 THR Y CG2 1 
ATOM   1429 N N   . CYS B 1 96 ? 38.170 78.883 21.121  1.00 30.79 ? 102 CYS Y N   1 
ATOM   1430 C CA  . CYS B 1 96 ? 38.868 79.928 20.332  1.00 32.60 ? 102 CYS Y CA  1 
ATOM   1431 C C   . CYS B 1 96 ? 39.611 80.769 21.317  1.00 34.21 ? 102 CYS Y C   1 
ATOM   1432 O O   . CYS B 1 96 ? 39.203 80.842 22.462  1.00 34.71 ? 102 CYS Y O   1 
ATOM   1433 C CB  . CYS B 1 96 ? 37.878 80.881 19.647  1.00 31.60 ? 102 CYS Y CB  1 
ATOM   1434 S SG  . CYS B 1 96 ? 36.395 80.210 18.853  1.00 32.01 ? 102 CYS Y SG  1 
ATOM   1435 N N   . GLN B 1 97 ? 40.655 81.479 20.929  1.00 37.28 ? 103 GLN Y N   1 
ATOM   1436 C CA  . GLN B 1 97 ? 41.076 82.490 21.909  1.00 39.90 ? 103 GLN Y CA  1 
ATOM   1437 C C   . GLN B 1 97 ? 40.338 83.799 21.839  1.00 40.73 ? 103 GLN Y C   1 
ATOM   1438 O O   . GLN B 1 97 ? 39.774 84.140 20.805  1.00 40.59 ? 103 GLN Y O   1 
ATOM   1439 C CB  . GLN B 1 97 ? 42.579 82.628 22.122  1.00 40.12 ? 103 GLN Y CB  1 
ATOM   1440 C CG  . GLN B 1 97 ? 43.451 82.657 20.938  1.00 42.97 ? 103 GLN Y CG  1 
ATOM   1441 C CD  . GLN B 1 97 ? 44.896 82.496 21.396  1.00 47.01 ? 103 GLN Y CD  1 
ATOM   1442 O OE1 . GLN B 1 97 ? 45.509 81.442 21.185  1.00 50.21 ? 103 GLN Y OE1 1 
ATOM   1443 N NE2 . GLN B 1 97 ? 45.423 83.511 22.079  1.00 47.77 ? 103 GLN Y NE2 1 
ATOM   1444 N N   . ASP B 1 98 ? 40.279 84.456 22.996  1.00 42.74 ? 104 ASP Y N   1 
ATOM   1445 C CA  . ASP B 1 98 ? 39.743 85.814 23.178  1.00 45.02 ? 104 ASP Y CA  1 
ATOM   1446 C C   . ASP B 1 98 ? 39.800 86.678 21.936  1.00 45.48 ? 104 ASP Y C   1 
ATOM   1447 O O   . ASP B 1 98 ? 40.877 87.098 21.476  1.00 45.45 ? 104 ASP Y O   1 
ATOM   1448 C CB  . ASP B 1 98 ? 40.513 86.560 24.276  1.00 45.36 ? 104 ASP Y CB  1 
ATOM   1449 C CG  . ASP B 1 98 ? 40.191 86.050 25.662  1.00 47.74 ? 104 ASP Y CG  1 
ATOM   1450 O OD1 . ASP B 1 98 ? 39.300 85.162 25.804  1.00 49.79 ? 104 ASP Y OD1 1 
ATOM   1451 O OD2 . ASP B 1 98 ? 40.844 86.552 26.602  1.00 50.26 ? 104 ASP Y OD2 1 
ATOM   1452 O OXT . ASP B 1 98 ? 38.732 86.962 21.396  1.00 46.26 ? 104 ASP Y OXT 1 
HETATM 1453 O O   . HOH C 2 .  ? 17.059 51.172 2.004   1.00 20.14 ? 105 HOH X O   1 
HETATM 1454 O O   . HOH C 2 .  ? 38.927 52.554 5.887   1.00 31.78 ? 106 HOH X O   1 
HETATM 1455 O O   . HOH C 2 .  ? 25.803 45.380 6.372   1.00 24.53 ? 107 HOH X O   1 
HETATM 1456 O O   . HOH C 2 .  ? 29.776 60.068 11.517  1.00 32.10 ? 108 HOH X O   1 
HETATM 1457 O O   . HOH C 2 .  ? 37.053 60.031 -0.046  0.50 22.64 ? 109 HOH X O   1 
HETATM 1458 O O   . HOH C 2 .  ? 27.403 41.373 2.406   1.00 39.80 ? 110 HOH X O   1 
HETATM 1459 O O   . HOH C 2 .  ? 14.705 41.309 5.175   1.00 40.11 ? 111 HOH X O   1 
HETATM 1460 O O   . HOH C 2 .  ? 11.165 41.848 7.854   1.00 34.38 ? 112 HOH X O   1 
HETATM 1461 O O   . HOH C 2 .  ? 10.883 55.478 2.756   1.00 29.81 ? 113 HOH X O   1 
HETATM 1462 O O   . HOH C 2 .  ? 20.866 40.179 3.202   1.00 41.48 ? 114 HOH X O   1 
HETATM 1463 O O   . HOH C 2 .  ? 15.956 49.905 -6.646  1.00 37.46 ? 115 HOH X O   1 
HETATM 1464 O O   . HOH C 2 .  ? 8.978  42.182 0.995   1.00 34.75 ? 116 HOH X O   1 
HETATM 1465 O O   . HOH C 2 .  ? 11.889 45.900 -3.166  1.00 26.89 ? 117 HOH X O   1 
HETATM 1466 O O   . HOH C 2 .  ? 20.371 54.621 15.028  1.00 23.54 ? 118 HOH X O   1 
HETATM 1467 O O   . HOH C 2 .  ? 4.885  44.445 -6.670  1.00 23.47 ? 119 HOH X O   1 
HETATM 1468 O O   . HOH C 2 .  ? 8.868  52.615 5.242   1.00 30.10 ? 120 HOH X O   1 
HETATM 1469 O O   . HOH C 2 .  ? 23.338 60.427 6.532   1.00 36.05 ? 121 HOH X O   1 
HETATM 1470 O O   . HOH C 2 .  ? 25.695 51.194 13.037  1.00 33.74 ? 122 HOH X O   1 
HETATM 1471 O O   . HOH C 2 .  ? 21.439 59.352 10.311  1.00 33.05 ? 123 HOH X O   1 
HETATM 1472 O O   . HOH C 2 .  ? 6.000  55.885 -9.342  1.00 43.56 ? 124 HOH X O   1 
HETATM 1473 O O   . HOH C 2 .  ? 13.835 40.508 8.036   1.00 42.48 ? 125 HOH X O   1 
HETATM 1474 O O   . HOH C 2 .  ? 25.776 58.710 4.810   1.00 32.65 ? 126 HOH X O   1 
HETATM 1475 O O   . HOH C 2 .  ? 26.039 40.015 1.599   1.00 61.99 ? 127 HOH X O   1 
HETATM 1476 O O   . HOH C 2 .  ? 17.446 67.189 3.762   1.00 59.21 ? 128 HOH X O   1 
HETATM 1477 O O   . HOH C 2 .  ? 37.058 51.112 8.568   1.00 55.81 ? 129 HOH X O   1 
HETATM 1478 O O   . HOH C 2 .  ? 7.593  49.436 8.055   1.00 37.28 ? 130 HOH X O   1 
HETATM 1479 O O   . HOH C 2 .  ? 27.739 47.460 10.425  1.00 51.16 ? 131 HOH X O   1 
HETATM 1480 O O   . HOH C 2 .  ? 29.559 52.813 18.273  1.00 46.97 ? 132 HOH X O   1 
HETATM 1481 O O   . HOH C 2 .  ? 11.126 43.333 -3.886  1.00 43.23 ? 133 HOH X O   1 
HETATM 1482 O O   . HOH C 2 .  ? 15.795 47.478 -7.855  1.00 50.67 ? 134 HOH X O   1 
HETATM 1483 O O   . HOH C 2 .  ? 9.860  37.979 1.043   1.00 58.44 ? 135 HOH X O   1 
HETATM 1484 O O   . HOH C 2 .  ? 24.580 53.258 -7.086  1.00 61.11 ? 136 HOH X O   1 
HETATM 1485 O O   . HOH C 2 .  ? 22.738 52.241 -13.989 1.00 84.12 ? 137 HOH X O   1 
HETATM 1486 O O   . HOH C 2 .  ? 13.267 64.600 3.901   1.00 44.76 ? 138 HOH X O   1 
HETATM 1487 O O   . HOH C 2 .  ? -0.547 41.916 1.869   1.00 47.12 ? 139 HOH X O   1 
HETATM 1488 O O   . HOH C 2 .  ? 19.334 44.525 -2.695  1.00 65.44 ? 140 HOH X O   1 
HETATM 1489 O O   . HOH C 2 .  ? 7.845  56.624 -12.564 1.00 66.19 ? 141 HOH X O   1 
HETATM 1490 O O   . HOH C 2 .  ? 7.599  55.899 5.419   1.00 66.98 ? 142 HOH X O   1 
HETATM 1491 O O   . HOH D 2 .  ? 24.378 56.728 9.411   1.00 17.46 ? 105 HOH Y O   1 
HETATM 1492 O O   . HOH D 2 .  ? 22.514 50.950 18.140  1.00 26.43 ? 106 HOH Y O   1 
HETATM 1493 O O   . HOH D 2 .  ? 20.966 68.766 18.858  1.00 35.60 ? 107 HOH Y O   1 
HETATM 1494 O O   . HOH D 2 .  ? 26.102 80.870 22.552  1.00 44.25 ? 108 HOH Y O   1 
HETATM 1495 O O   . HOH D 2 .  ? 28.475 70.239 17.881  1.00 32.68 ? 109 HOH Y O   1 
HETATM 1496 O O   . HOH D 2 .  ? 30.997 59.320 23.721  1.00 27.30 ? 110 HOH Y O   1 
HETATM 1497 O O   . HOH D 2 .  ? 28.155 62.744 13.049  1.00 29.28 ? 111 HOH Y O   1 
HETATM 1498 O O   . HOH D 2 .  ? 15.399 64.345 16.935  1.00 59.20 ? 112 HOH Y O   1 
HETATM 1499 O O   . HOH D 2 .  ? 23.567 70.008 22.182  1.00 50.29 ? 113 HOH Y O   1 
HETATM 1500 O O   . HOH D 2 .  ? 42.777 70.362 18.665  1.00 59.14 ? 114 HOH Y O   1 
HETATM 1501 O O   . HOH D 2 .  ? 25.561 81.314 24.843  1.00 40.10 ? 115 HOH Y O   1 
HETATM 1502 O O   . HOH D 2 .  ? 22.851 61.062 8.992   1.00 24.80 ? 116 HOH Y O   1 
HETATM 1503 O O   . HOH D 2 .  ? 18.770 60.495 11.156  1.00 38.30 ? 117 HOH Y O   1 
HETATM 1504 O O   . HOH D 2 .  ? 23.049 62.323 23.885  1.00 39.06 ? 118 HOH Y O   1 
HETATM 1505 O O   . HOH D 2 .  ? 28.387 74.611 31.033  1.00 29.66 ? 119 HOH Y O   1 
HETATM 1506 O O   . HOH D 2 .  ? 27.079 83.815 17.751  1.00 45.05 ? 120 HOH Y O   1 
HETATM 1507 O O   . HOH D 2 .  ? 21.527 65.355 21.540  1.00 18.89 ? 121 HOH Y O   1 
HETATM 1508 O O   . HOH D 2 .  ? 38.385 65.024 19.296  1.00 56.47 ? 122 HOH Y O   1 
HETATM 1509 O O   . HOH D 2 .  ? 17.533 65.435 6.854   1.00 45.76 ? 123 HOH Y O   1 
HETATM 1510 O O   . HOH D 2 .  ? 28.825 58.020 16.948  1.00 35.82 ? 124 HOH Y O   1 
HETATM 1511 O O   . HOH D 2 .  ? 20.674 63.691 23.335  1.00 32.51 ? 125 HOH Y O   1 
HETATM 1512 O O   . HOH D 2 .  ? 30.855 54.849 17.479  1.00 54.29 ? 126 HOH Y O   1 
HETATM 1513 O O   . HOH D 2 .  ? 19.617 60.348 26.278  1.00 45.05 ? 127 HOH Y O   1 
HETATM 1514 O O   . HOH D 2 .  ? 17.842 57.584 13.028  1.00 47.94 ? 128 HOH Y O   1 
HETATM 1515 O O   . HOH D 2 .  ? 32.513 68.413 11.104  1.00 53.64 ? 129 HOH Y O   1 
HETATM 1516 O O   . HOH D 2 .  ? 30.466 66.214 8.321   1.00 64.91 ? 130 HOH Y O   1 
HETATM 1517 O O   . HOH D 2 .  ? 35.895 65.142 10.258  1.00 63.40 ? 131 HOH Y O   1 
HETATM 1518 O O   . HOH D 2 .  ? 31.915 55.484 22.680  1.00 62.14 ? 132 HOH Y O   1 
HETATM 1519 O O   . HOH D 2 .  ? 22.427 57.796 12.540  1.00 29.57 ? 133 HOH Y O   1 
HETATM 1520 O O   . HOH D 2 .  ? 16.863 72.993 9.847   1.00 57.75 ? 134 HOH Y O   1 
HETATM 1521 O O   . HOH D 2 .  ? 18.089 81.867 11.146  1.00 58.09 ? 135 HOH Y O   1 
HETATM 1522 O O   . HOH D 2 .  ? 39.266 72.374 6.849   1.00 77.14 ? 136 HOH Y O   1 
HETATM 1523 O O   . HOH D 2 .  ? 42.154 83.590 24.881  1.00 70.27 ? 137 HOH Y O   1 
HETATM 1524 O O   . HOH D 2 .  ? 16.328 85.807 11.529  1.00 85.54 ? 138 HOH Y O   1 
HETATM 1525 O O   . HOH D 2 .  ? 16.084 72.868 14.910  1.00 66.99 ? 139 HOH Y O   1 
HETATM 1526 O O   . HOH D 2 .  ? 38.831 72.171 22.444  1.00 49.00 ? 140 HOH Y O   1 
HETATM 1527 O O   . HOH D 2 .  ? 33.548 61.442 20.993  1.00 55.67 ? 141 HOH Y O   1 
HETATM 1528 O O   . HOH D 2 .  ? 37.395 81.140 25.174  1.00 68.63 ? 142 HOH Y O   1 
HETATM 1529 O O   . HOH D 2 .  ? 34.653 75.640 30.730  1.00 60.38 ? 143 HOH Y O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  PRO 1  7   7   PRO PRO X . n 
A 1 2  ALA 2  8   8   ALA ALA X . n 
A 1 3  VAL 3  9   9   VAL VAL X . n 
A 1 4  GLU 4  10  10  GLU GLU X . n 
A 1 5  SER 5  11  11  SER SER X . n 
A 1 6  ARG 6  12  12  ARG ARG X . n 
A 1 7  LEU 7  13  13  LEU LEU X . n 
A 1 8  VAL 8  14  14  VAL VAL X . n 
A 1 9  GLY 9  15  15  GLY GLY X . n 
A 1 10 GLY 10 16  16  GLY GLY X . n 
A 1 11 SER 11 17  17  SER SER X . n 
A 1 12 SER 12 18  18  SER SER X . n 
A 1 13 ILE 13 19  19  ILE ILE X . n 
A 1 14 CYS 14 20  20  CYS CYS X . n 
A 1 15 GLU 15 21  21  GLU GLU X . n 
A 1 16 GLY 16 22  22  GLY GLY X . n 
A 1 17 THR 17 23  23  THR THR X . n 
A 1 18 VAL 18 24  24  VAL VAL X . n 
A 1 19 GLU 19 25  25  GLU GLU X . n 
A 1 20 VAL 20 26  26  VAL VAL X . n 
A 1 21 ARG 21 27  27  ARG ARG X . n 
A 1 22 GLN 22 28  28  GLN GLN X . n 
A 1 23 GLY 23 29  29  GLY GLY X . n 
A 1 24 ALA 24 30  30  ALA ALA X . n 
A 1 25 GLN 25 31  31  GLN GLN X . n 
A 1 26 TRP 26 32  32  TRP TRP X . n 
A 1 27 ALA 27 33  33  ALA ALA X . n 
A 1 28 ALA 28 34  34  ALA ALA X . n 
A 1 29 LEU 29 35  35  LEU LEU X . n 
A 1 30 CYS 30 36  36  CYS CYS X . n 
A 1 31 ASP 31 37  37  ASP ASP X . n 
A 1 32 SER 32 38  38  SER SER X . n 
A 1 33 SER 33 39  ?   ?   ?   X . n 
A 1 34 SER 34 40  ?   ?   ?   X . n 
A 1 35 ALA 35 41  ?   ?   ?   X . n 
A 1 36 ARG 36 42  ?   ?   ?   X . n 
A 1 37 SER 37 43  43  SER SER X . n 
A 1 38 SER 38 44  44  SER SER X . n 
A 1 39 LEU 39 45  45  LEU LEU X . n 
A 1 40 ARG 40 46  46  ARG ARG X . n 
A 1 41 TRP 41 47  47  TRP TRP X . n 
A 1 42 GLU 42 48  48  GLU GLU X . n 
A 1 43 GLU 43 49  49  GLU GLU X . n 
A 1 44 VAL 44 50  50  VAL VAL X . n 
A 1 45 CYS 45 51  51  CYS CYS X . n 
A 1 46 ARG 46 52  52  ARG ARG X . n 
A 1 47 GLU 47 53  53  GLU GLU X . n 
A 1 48 GLN 48 54  54  GLN GLN X . n 
A 1 49 GLN 49 55  55  GLN GLN X . n 
A 1 50 CYS 50 56  56  CYS CYS X . n 
A 1 51 GLY 51 57  57  GLY GLY X . n 
A 1 52 SER 52 58  58  SER SER X . n 
A 1 53 VAL 53 59  59  VAL VAL X . n 
A 1 54 ASN 54 60  60  ASN ASN X . n 
A 1 55 SER 55 61  61  SER SER X . n 
A 1 56 TYR 56 62  62  TYR TYR X . n 
A 1 57 ARG 57 63  63  ARG ARG X . n 
A 1 58 VAL 58 64  64  VAL VAL X . n 
A 1 59 LEU 59 65  65  LEU LEU X . n 
A 1 60 ASP 60 66  66  ASP ASP X . n 
A 1 61 ALA 61 67  67  ALA ALA X . n 
A 1 62 GLY 62 68  68  GLY GLY X . n 
A 1 63 ASP 63 69  69  ASP ASP X . n 
A 1 64 PRO 64 70  70  PRO PRO X . n 
A 1 65 THR 65 71  71  THR THR X . n 
A 1 66 SER 66 72  72  SER SER X . n 
A 1 67 ARG 67 73  73  ARG ARG X . n 
A 1 68 GLY 68 74  74  GLY GLY X . n 
A 1 69 LEU 69 75  75  LEU LEU X . n 
A 1 70 PHE 70 76  76  PHE PHE X . n 
A 1 71 CYS 71 77  77  CYS CYS X . n 
A 1 72 PRO 72 78  78  PRO PRO X . n 
A 1 73 HIS 73 79  79  HIS HIS X . n 
A 1 74 GLN 74 80  80  GLN GLN X . n 
A 1 75 LYS 75 81  81  LYS LYS X . n 
A 1 76 LEU 76 82  82  LEU LEU X . n 
A 1 77 SER 77 83  83  SER SER X . n 
A 1 78 GLN 78 84  84  GLN GLN X . n 
A 1 79 CYS 79 85  85  CYS CYS X . n 
A 1 80 HIS 80 86  86  HIS HIS X . n 
A 1 81 GLU 81 87  87  GLU GLU X . n 
A 1 82 LEU 82 88  88  LEU LEU X . n 
A 1 83 TRP 83 89  89  TRP TRP X . n 
A 1 84 GLU 84 90  90  GLU GLU X . n 
A 1 85 ARG 85 91  91  ARG ARG X . n 
A 1 86 ASN 86 92  92  ASN ASN X . n 
A 1 87 SER 87 93  93  SER SER X . n 
A 1 88 TYR 88 94  94  TYR TYR X . n 
A 1 89 CYS 89 95  95  CYS CYS X . n 
A 1 90 LYS 90 96  96  LYS LYS X . n 
A 1 91 LYS 91 97  97  LYS LYS X . n 
A 1 92 VAL 92 98  98  VAL VAL X . n 
A 1 93 PHE 93 99  99  PHE PHE X . n 
A 1 94 VAL 94 100 100 VAL VAL X . n 
A 1 95 THR 95 101 101 THR THR X . n 
A 1 96 CYS 96 102 102 CYS CYS X . n 
A 1 97 GLN 97 103 103 GLN GLN X . n 
A 1 98 ASP 98 104 104 ASP ASP X . n 
B 1 1  PRO 1  7   7   PRO PRO Y . n 
B 1 2  ALA 2  8   8   ALA ALA Y . n 
B 1 3  VAL 3  9   9   VAL VAL Y . n 
B 1 4  GLU 4  10  10  GLU GLU Y . n 
B 1 5  SER 5  11  11  SER SER Y . n 
B 1 6  ARG 6  12  12  ARG ARG Y . n 
B 1 7  LEU 7  13  13  LEU LEU Y . n 
B 1 8  VAL 8  14  14  VAL VAL Y . n 
B 1 9  GLY 9  15  15  GLY GLY Y . n 
B 1 10 GLY 10 16  16  GLY GLY Y . n 
B 1 11 SER 11 17  17  SER SER Y . n 
B 1 12 SER 12 18  18  SER SER Y . n 
B 1 13 ILE 13 19  19  ILE ILE Y . n 
B 1 14 CYS 14 20  20  CYS CYS Y . n 
B 1 15 GLU 15 21  21  GLU GLU Y . n 
B 1 16 GLY 16 22  22  GLY GLY Y . n 
B 1 17 THR 17 23  23  THR THR Y . n 
B 1 18 VAL 18 24  24  VAL VAL Y . n 
B 1 19 GLU 19 25  25  GLU GLU Y . n 
B 1 20 VAL 20 26  26  VAL VAL Y . n 
B 1 21 ARG 21 27  27  ARG ARG Y . n 
B 1 22 GLN 22 28  28  GLN GLN Y . n 
B 1 23 GLY 23 29  29  GLY GLY Y . n 
B 1 24 ALA 24 30  30  ALA ALA Y . n 
B 1 25 GLN 25 31  31  GLN GLN Y . n 
B 1 26 TRP 26 32  32  TRP TRP Y . n 
B 1 27 ALA 27 33  33  ALA ALA Y . n 
B 1 28 ALA 28 34  34  ALA ALA Y . n 
B 1 29 LEU 29 35  35  LEU LEU Y . n 
B 1 30 CYS 30 36  36  CYS CYS Y . n 
B 1 31 ASP 31 37  37  ASP ASP Y . n 
B 1 32 SER 32 38  ?   ?   ?   Y . n 
B 1 33 SER 33 39  ?   ?   ?   Y . n 
B 1 34 SER 34 40  ?   ?   ?   Y . n 
B 1 35 ALA 35 41  ?   ?   ?   Y . n 
B 1 36 ARG 36 42  ?   ?   ?   Y . n 
B 1 37 SER 37 43  ?   ?   ?   Y . n 
B 1 38 SER 38 44  44  SER SER Y . n 
B 1 39 LEU 39 45  45  LEU LEU Y . n 
B 1 40 ARG 40 46  46  ARG ARG Y . n 
B 1 41 TRP 41 47  47  TRP TRP Y . n 
B 1 42 GLU 42 48  48  GLU GLU Y . n 
B 1 43 GLU 43 49  49  GLU GLU Y . n 
B 1 44 VAL 44 50  50  VAL VAL Y . n 
B 1 45 CYS 45 51  51  CYS CYS Y . n 
B 1 46 ARG 46 52  52  ARG ARG Y . n 
B 1 47 GLU 47 53  53  GLU GLU Y . n 
B 1 48 GLN 48 54  54  GLN GLN Y . n 
B 1 49 GLN 49 55  55  GLN GLN Y . n 
B 1 50 CYS 50 56  56  CYS CYS Y . n 
B 1 51 GLY 51 57  57  GLY GLY Y . n 
B 1 52 SER 52 58  58  SER SER Y . n 
B 1 53 VAL 53 59  59  VAL VAL Y . n 
B 1 54 ASN 54 60  60  ASN ASN Y . n 
B 1 55 SER 55 61  61  SER SER Y . n 
B 1 56 TYR 56 62  62  TYR TYR Y . n 
B 1 57 ARG 57 63  63  ARG ARG Y . n 
B 1 58 VAL 58 64  64  VAL VAL Y . n 
B 1 59 LEU 59 65  65  LEU LEU Y . n 
B 1 60 ASP 60 66  66  ASP ASP Y . n 
B 1 61 ALA 61 67  67  ALA ALA Y . n 
B 1 62 GLY 62 68  68  GLY GLY Y . n 
B 1 63 ASP 63 69  69  ASP ASP Y . n 
B 1 64 PRO 64 70  70  PRO PRO Y . n 
B 1 65 THR 65 71  71  THR THR Y . n 
B 1 66 SER 66 72  72  SER SER Y . n 
B 1 67 ARG 67 73  73  ARG ARG Y . n 
B 1 68 GLY 68 74  74  GLY GLY Y . n 
B 1 69 LEU 69 75  75  LEU LEU Y . n 
B 1 70 PHE 70 76  76  PHE PHE Y . n 
B 1 71 CYS 71 77  77  CYS CYS Y . n 
B 1 72 PRO 72 78  78  PRO PRO Y . n 
B 1 73 HIS 73 79  79  HIS HIS Y . n 
B 1 74 GLN 74 80  80  GLN GLN Y . n 
B 1 75 LYS 75 81  81  LYS LYS Y . n 
B 1 76 LEU 76 82  82  LEU LEU Y . n 
B 1 77 SER 77 83  83  SER SER Y . n 
B 1 78 GLN 78 84  84  GLN GLN Y . n 
B 1 79 CYS 79 85  85  CYS CYS Y . n 
B 1 80 HIS 80 86  86  HIS HIS Y . n 
B 1 81 GLU 81 87  87  GLU GLU Y . n 
B 1 82 LEU 82 88  88  LEU LEU Y . n 
B 1 83 TRP 83 89  89  TRP TRP Y . n 
B 1 84 GLU 84 90  90  GLU GLU Y . n 
B 1 85 ARG 85 91  91  ARG ARG Y . n 
B 1 86 ASN 86 92  92  ASN ASN Y . n 
B 1 87 SER 87 93  93  SER SER Y . n 
B 1 88 TYR 88 94  94  TYR TYR Y . n 
B 1 89 CYS 89 95  95  CYS CYS Y . n 
B 1 90 LYS 90 96  96  LYS LYS Y . n 
B 1 91 LYS 91 97  97  LYS LYS Y . n 
B 1 92 VAL 92 98  98  VAL VAL Y . n 
B 1 93 PHE 93 99  99  PHE PHE Y . n 
B 1 94 VAL 94 100 100 VAL VAL Y . n 
B 1 95 THR 95 101 101 THR THR Y . n 
B 1 96 CYS 96 102 102 CYS CYS Y . n 
B 1 97 GLN 97 103 103 GLN GLN Y . n 
B 1 98 ASP 98 104 104 ASP ASP Y . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  105 1  HOH HOH X . 
C 2 HOH 2  106 2  HOH HOH X . 
C 2 HOH 3  107 3  HOH HOH X . 
C 2 HOH 4  108 5  HOH HOH X . 
C 2 HOH 5  109 6  HOH HOH X . 
C 2 HOH 6  110 8  HOH HOH X . 
C 2 HOH 7  111 9  HOH HOH X . 
C 2 HOH 8  112 10 HOH HOH X . 
C 2 HOH 9  113 11 HOH HOH X . 
C 2 HOH 10 114 13 HOH HOH X . 
C 2 HOH 11 115 14 HOH HOH X . 
C 2 HOH 12 116 16 HOH HOH X . 
C 2 HOH 13 117 18 HOH HOH X . 
C 2 HOH 14 118 23 HOH HOH X . 
C 2 HOH 15 119 24 HOH HOH X . 
C 2 HOH 16 120 26 HOH HOH X . 
C 2 HOH 17 121 27 HOH HOH X . 
C 2 HOH 18 122 31 HOH HOH X . 
C 2 HOH 19 123 32 HOH HOH X . 
C 2 HOH 20 124 33 HOH HOH X . 
C 2 HOH 21 125 34 HOH HOH X . 
C 2 HOH 22 126 39 HOH HOH X . 
C 2 HOH 23 127 40 HOH HOH X . 
C 2 HOH 24 128 42 HOH HOH X . 
C 2 HOH 25 129 44 HOH HOH X . 
C 2 HOH 26 130 46 HOH HOH X . 
C 2 HOH 27 131 47 HOH HOH X . 
C 2 HOH 28 132 53 HOH HOH X . 
C 2 HOH 29 133 56 HOH HOH X . 
C 2 HOH 30 134 58 HOH HOH X . 
C 2 HOH 31 135 61 HOH HOH X . 
C 2 HOH 32 136 63 HOH HOH X . 
C 2 HOH 33 137 67 HOH HOH X . 
C 2 HOH 34 138 70 HOH HOH X . 
C 2 HOH 35 139 77 HOH HOH X . 
C 2 HOH 36 140 84 HOH HOH X . 
C 2 HOH 37 141 85 HOH HOH X . 
C 2 HOH 38 142 87 HOH HOH X . 
D 2 HOH 1  105 4  HOH HOH Y . 
D 2 HOH 2  106 7  HOH HOH Y . 
D 2 HOH 3  107 12 HOH HOH Y . 
D 2 HOH 4  108 15 HOH HOH Y . 
D 2 HOH 5  109 19 HOH HOH Y . 
D 2 HOH 6  110 20 HOH HOH Y . 
D 2 HOH 7  111 21 HOH HOH Y . 
D 2 HOH 8  112 22 HOH HOH Y . 
D 2 HOH 9  113 25 HOH HOH Y . 
D 2 HOH 10 114 28 HOH HOH Y . 
D 2 HOH 11 115 29 HOH HOH Y . 
D 2 HOH 12 116 30 HOH HOH Y . 
D 2 HOH 13 117 35 HOH HOH Y . 
D 2 HOH 14 118 36 HOH HOH Y . 
D 2 HOH 15 119 37 HOH HOH Y . 
D 2 HOH 16 120 38 HOH HOH Y . 
D 2 HOH 17 121 41 HOH HOH Y . 
D 2 HOH 18 122 43 HOH HOH Y . 
D 2 HOH 19 123 45 HOH HOH Y . 
D 2 HOH 20 124 48 HOH HOH Y . 
D 2 HOH 21 125 50 HOH HOH Y . 
D 2 HOH 22 126 52 HOH HOH Y . 
D 2 HOH 23 127 54 HOH HOH Y . 
D 2 HOH 24 128 55 HOH HOH Y . 
D 2 HOH 25 129 57 HOH HOH Y . 
D 2 HOH 26 130 59 HOH HOH Y . 
D 2 HOH 27 131 60 HOH HOH Y . 
D 2 HOH 28 132 64 HOH HOH Y . 
D 2 HOH 29 133 66 HOH HOH Y . 
D 2 HOH 30 134 71 HOH HOH Y . 
D 2 HOH 31 135 73 HOH HOH Y . 
D 2 HOH 32 136 74 HOH HOH Y . 
D 2 HOH 33 137 75 HOH HOH Y . 
D 2 HOH 34 138 76 HOH HOH Y . 
D 2 HOH 35 139 79 HOH HOH Y . 
D 2 HOH 36 140 82 HOH HOH Y . 
D 2 HOH 37 141 83 HOH HOH Y . 
D 2 HOH 38 142 92 HOH HOH Y . 
D 2 HOH 39 143 94 HOH HOH Y . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    X 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     109 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-03-13 
2 'Structure model' 1 1 2008-05-01 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 19.7903 53.0589 -0.7280 0.1163 0.2732 0.1835 0.0294  0.0170 0.0293 7.6415 1.3863 1.8939 0.9449 0.5072 0.2946 -0.0823 
0.8015 0.1066 -0.2313 0.0785 0.0094  -0.0696 0.0615 0.0038  'X-RAY DIFFRACTION' 
2 ? refined 28.7053 72.9264 15.3588 0.3891 0.1051 0.1857 -0.0596 0.1188 0.0562 3.2003 7.4032 4.3299 1.9873 1.0100 2.7133 -0.2821 
0.6243 0.4015 -1.1375 0.3089 -0.3461 -1.0391 0.3531 -0.0268 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 X 7 A 1 X 104 A 98 ? 'X-RAY DIFFRACTION' ? 
2 2 Y 7 B 1 Y 104 B 98 ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement        5.2.0019 ? 1 
HKL-2000  'data collection' .        ? 2 
DENZO     'data reduction'  .        ? 3 
SCALEPACK 'data scaling'    .        ? 4 
SnB       phasing           .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   X 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    110 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   X 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    127 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            X 
_pdbx_validate_rmsd_bond.auth_comp_id_1            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_1             30 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_2            X 
_pdbx_validate_rmsd_bond.auth_comp_id_2            ALA 
_pdbx_validate_rmsd_bond.auth_seq_id_2             30 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.649 
_pdbx_validate_rmsd_bond.bond_target_value         1.520 
_pdbx_validate_rmsd_bond.bond_deviation            0.129 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.021 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE X ARG 63 ? ? CZ X ARG 63 ? ? NH1 X ARG 63 ? ? 125.44 120.30 5.14   0.50 N 
2 1 NE X ARG 63 ? ? CZ X ARG 63 ? ? NH2 X ARG 63 ? ? 113.26 120.30 -7.04  0.50 N 
3 1 NE X ARG 91 ? ? CZ X ARG 91 ? ? NH1 X ARG 91 ? ? 123.94 120.30 3.64   0.50 N 
4 1 NE X ARG 91 ? ? CZ X ARG 91 ? ? NH2 X ARG 91 ? ? 116.09 120.30 -4.21  0.50 N 
5 1 N  Y ALA 30 ? ? CA Y ALA 30 ? ? C   Y ALA 30 ? ? 92.00  111.00 -19.00 2.70 N 
6 1 CB Y ASP 66 ? ? CG Y ASP 66 ? ? OD1 Y ASP 66 ? ? 125.42 118.30 7.12   0.90 N 
7 1 NE Y ARG 91 ? ? CZ Y ARG 91 ? ? NH1 Y ARG 91 ? ? 124.80 120.30 4.50   0.50 N 
8 1 NE Y ARG 91 ? ? CZ Y ARG 91 ? ? NH2 Y ARG 91 ? ? 114.87 120.30 -5.43  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN X 28 ? ? -109.46 -94.06  
2 1 HIS X 79 ? ? -170.51 138.51  
3 1 SER X 83 ? ? -58.48  -4.19   
4 1 ALA Y 30 ? ? -117.55 -162.18 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ALA X 30 ? ? GLN X 31 ? ? 148.77  
2 1 ASP X 37 ? ? SER X 38 ? ? 135.26  
3 1 GLN Y 28 ? ? GLY Y 29 ? ? -149.25 
4 1 GLY Y 29 ? ? ALA Y 30 ? ? -34.34  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X SER 39 ? A SER 33 
2  1 Y 1 X SER 40 ? A SER 34 
3  1 Y 1 X ALA 41 ? A ALA 35 
4  1 Y 1 X ARG 42 ? A ARG 36 
5  1 Y 1 Y SER 38 ? B SER 32 
6  1 Y 1 Y SER 39 ? B SER 33 
7  1 Y 1 Y SER 40 ? B SER 34 
8  1 Y 1 Y ALA 41 ? B ALA 35 
9  1 Y 1 Y ARG 42 ? B ARG 36 
10 1 Y 1 Y SER 43 ? B SER 37 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#