data_2OU0
# 
_entry.id   2OU0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2OU0         
RCSB  RCSB041583   
WWPDB D_1000041583 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          181L 
_pdbx_database_related.details        'The same protein complexed with benzene.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2OU0 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-02-09 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Graves, A.P.'   1 
'Shoichet, B.K.' 2 
# 
_citation.id                        primary 
_citation.title                     'Predicting absolute ligand binding free energies to a simple model site.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            371 
_citation.page_first                1118 
_citation.page_last                 1134 
_citation.year                      2007 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17599350 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2007.06.002 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mobley, D.L.'     1 
primary 'Graves, A.P.'     2 
primary 'Chodera, J.D.'    3 
primary 'McReynolds, A.C.' 4 
primary 'Shoichet, B.K.'   5 
primary 'Dill, K.A.'       6 
# 
_cell.entry_id           2OU0 
_cell.length_a           60.205 
_cell.length_b           60.205 
_cell.length_c           96.372 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2OU0 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Lysozyme            18359.023 1   3.2.1.17 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'     94.971    2   ?        ? ? ? 
3 non-polymer syn 1-METHYL-1H-PYRROLE 81.116    2   ?        ? ? ? 
4 water       nat water               18.015    196 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Lysis protein, Muramidase, Endolysin' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   ILE n 
1 4   PHE n 
1 5   GLU n 
1 6   MET n 
1 7   LEU n 
1 8   ARG n 
1 9   ILE n 
1 10  ASP n 
1 11  GLU n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  LYS n 
1 17  ILE n 
1 18  TYR n 
1 19  LYS n 
1 20  ASP n 
1 21  THR n 
1 22  GLU n 
1 23  GLY n 
1 24  TYR n 
1 25  TYR n 
1 26  THR n 
1 27  ILE n 
1 28  GLY n 
1 29  ILE n 
1 30  GLY n 
1 31  HIS n 
1 32  LEU n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  SER n 
1 37  PRO n 
1 38  SER n 
1 39  LEU n 
1 40  ASN n 
1 41  ALA n 
1 42  ALA n 
1 43  LYS n 
1 44  SER n 
1 45  GLU n 
1 46  LEU n 
1 47  ASP n 
1 48  LYS n 
1 49  ALA n 
1 50  ILE n 
1 51  GLY n 
1 52  ARG n 
1 53  ASN n 
1 54  THR n 
1 55  ASN n 
1 56  GLY n 
1 57  VAL n 
1 58  ILE n 
1 59  THR n 
1 60  LYS n 
1 61  ASP n 
1 62  GLU n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  LEU n 
1 67  PHE n 
1 68  ASN n 
1 69  GLN n 
1 70  ASP n 
1 71  VAL n 
1 72  ASP n 
1 73  ALA n 
1 74  ALA n 
1 75  VAL n 
1 76  ARG n 
1 77  GLY n 
1 78  ILE n 
1 79  LEU n 
1 80  ARG n 
1 81  ASN n 
1 82  ALA n 
1 83  LYS n 
1 84  LEU n 
1 85  LYS n 
1 86  PRO n 
1 87  VAL n 
1 88  TYR n 
1 89  ASP n 
1 90  SER n 
1 91  LEU n 
1 92  ASP n 
1 93  ALA n 
1 94  VAL n 
1 95  ARG n 
1 96  ARG n 
1 97  ALA n 
1 98  ALA n 
1 99  ALA n 
1 100 ILE n 
1 101 ASN n 
1 102 MET n 
1 103 VAL n 
1 104 PHE n 
1 105 GLN n 
1 106 MET n 
1 107 GLY n 
1 108 GLU n 
1 109 THR n 
1 110 GLY n 
1 111 VAL n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 THR n 
1 116 ASN n 
1 117 SER n 
1 118 LEU n 
1 119 ARG n 
1 120 MET n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 LYS n 
1 125 ARG n 
1 126 TRP n 
1 127 ASP n 
1 128 GLU n 
1 129 ALA n 
1 130 ALA n 
1 131 VAL n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 LYS n 
1 136 SER n 
1 137 ARG n 
1 138 TRP n 
1 139 TYR n 
1 140 ASN n 
1 141 GLN n 
1 142 THR n 
1 143 PRO n 
1 144 ASN n 
1 145 ARG n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 VAL n 
1 150 ILE n 
1 151 THR n 
1 152 THR n 
1 153 PHE n 
1 154 ARG n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 TRP n 
1 159 ASP n 
1 160 ALA n 
1 161 TYR n 
1 162 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 E 
_entity_src_gen.gene_src_species                   'Enterobacteria phage T4 sensu lato' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       M13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYS_BPT4 
_struct_ref.pdbx_db_accession          P00720 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2OU0 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 162 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00720 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  162 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       162 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2OU0 THR X 54 ? UNP P00720 CYS 54 ENGINEERED 54 1 
1 2OU0 ALA X 97 ? UNP P00720 CYS 97 ENGINEERED 97 2 
1 2OU0 ALA X 99 ? UNP P00720 LEU 99 ENGINEERED 99 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
MR3 non-polymer         . 1-METHYL-1H-PYRROLE ? 'C5 H7 N'        81.116  
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'     ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          2OU0 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.75 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.20 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.1 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;2.2M sodium-potassium phosphate, 0.05M beta-mercaptoethanol, 0.05M 2-hydroxyethyldisulfide, pH 7.1, VAPOR DIFFUSION, HANGING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2006-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     2OU0 
_reflns.d_resolution_high            1.940 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   15355 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_netI_over_sigmaI        8.700 
_reflns.pdbx_chi_squared             1.008 
_reflns.pdbx_redundancy              3.500 
_reflns.percent_possible_obs         99.400 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   15355 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              2.01 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.569 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       1.014 
_reflns_shell.pdbx_redundancy        3.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1484 
_reflns_shell.percent_possible_all   98.40 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2OU0 
_refine.ls_d_res_high                            1.940 
_refine.ls_d_res_low                             52.130 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    97.160 
_refine.ls_number_reflns_obs                     14992 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_R_work                       0.191 
_refine.ls_R_factor_R_free                       0.234 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  749 
_refine.B_iso_mean                               15.959 
_refine.aniso_B[1][1]                            0.160 
_refine.aniso_B[2][2]                            0.160 
_refine.aniso_B[3][3]                            -0.240 
_refine.aniso_B[1][2]                            0.080 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.941 
_refine.correlation_coeff_Fo_to_Fc_free          0.913 
_refine.pdbx_overall_ESU_R                       0.164 
_refine.pdbx_overall_ESU_R_Free                  0.152 
_refine.overall_SU_ML                            0.103 
_refine.overall_SU_B                             3.592 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     14992 
_refine.ls_R_factor_all                          0.193 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      181L 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1293 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             200 
_refine_hist.number_atoms_total               1515 
_refine_hist.d_res_high                       1.940 
_refine_hist.d_res_low                        52.130 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         1330 0.009  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1794 1.074  1.964  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   164  4.902  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   62   33.928 23.387 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   239  12.899 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   13   15.046 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           197  0.070  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     996  0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            677  0.185  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          913  0.296  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    178  0.118  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   37   0.145  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 25   0.104  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              840  0.635  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             1291 0.730  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              559  1.667  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             501  2.164  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.942 
_refine_ls_shell.d_res_low                        1.993 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.520 
_refine_ls_shell.number_reflns_R_work             984 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.289 
_refine_ls_shell.R_factor_R_free                  0.345 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             51 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                1035 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2OU0 
_struct.title                     '1-methylpyrrole in complex with T4 Lysozyme L99A' 
_struct.pdbx_descriptor           'Lysozyme (E.C.3.2.1.17)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2OU0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, PROTEIN-LIGAND COMPLEX, MODEL SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 2   ? GLY A 12  ? ASN X 2   GLY X 12  1 ? 11 
HELX_P HELX_P2  2  SER A 38  ? GLY A 51  ? SER X 38  GLY X 51  1 ? 14 
HELX_P HELX_P3  3  THR A 59  ? ASN A 81  ? THR X 59  ASN X 81  1 ? 23 
HELX_P HELX_P4  4  LYS A 83  ? LEU A 91  ? LYS X 83  LEU X 91  1 ? 9  
HELX_P HELX_P5  5  ASP A 92  ? GLY A 113 ? ASP X 92  GLY X 113 1 ? 22 
HELX_P HELX_P6  6  PHE A 114 ? GLN A 123 ? PHE X 114 GLN X 123 1 ? 10 
HELX_P HELX_P7  7  ARG A 125 ? ALA A 134 ? ARG X 125 ALA X 134 1 ? 10 
HELX_P HELX_P8  8  SER A 136 ? THR A 142 ? SER X 136 THR X 142 1 ? 7  
HELX_P HELX_P9  9  THR A 142 ? GLY A 156 ? THR X 142 GLY X 156 1 ? 15 
HELX_P HELX_P10 10 TRP A 158 ? LYS A 162 ? TRP X 158 LYS X 162 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 14 ? LYS A 19 ? ARG X 14 LYS X 19 
A 2 TYR A 25 ? GLY A 28 ? TYR X 25 GLY X 28 
A 3 HIS A 31 ? LEU A 32 ? HIS X 31 LEU X 32 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR A 18 ? N TYR X 18 O THR A 26 ? O THR X 26 
A 2 3 N ILE A 27 ? N ILE X 27 O HIS A 31 ? O HIS X 31 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE PO4 X 301' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE PO4 X 302' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MR3 X 303' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MR3 X 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ARG A 14  ? ARG X 14  . ? 4_565 ? 
2  AC1 9 LYS A 19  ? LYS X 19  . ? 4_565 ? 
3  AC1 9 ARG A 125 ? ARG X 125 . ? 1_555 ? 
4  AC1 9 TRP A 126 ? TRP X 126 . ? 1_555 ? 
5  AC1 9 ASP A 127 ? ASP X 127 . ? 1_555 ? 
6  AC1 9 GLU A 128 ? GLU X 128 . ? 1_555 ? 
7  AC1 9 HOH F .   ? HOH X 324 . ? 1_555 ? 
8  AC1 9 HOH F .   ? HOH X 412 . ? 1_555 ? 
9  AC1 9 HOH F .   ? HOH X 481 . ? 1_555 ? 
10 AC2 4 GLN A 122 ? GLN X 122 . ? 4_455 ? 
11 AC2 4 ASN A 144 ? ASN X 144 . ? 1_555 ? 
12 AC2 4 ARG A 148 ? ARG X 148 . ? 1_555 ? 
13 AC2 4 HOH F .   ? HOH X 334 . ? 4_455 ? 
14 AC3 4 ALA A 99  ? ALA X 99  . ? 1_555 ? 
15 AC3 4 VAL A 111 ? VAL X 111 . ? 1_555 ? 
16 AC3 4 LEU A 118 ? LEU X 118 . ? 1_555 ? 
17 AC3 4 PHE A 153 ? PHE X 153 . ? 1_555 ? 
18 AC4 5 ILE A 3   ? ILE X 3   . ? 6_554 ? 
19 AC4 5 PHE A 4   ? PHE X 4   . ? 1_555 ? 
20 AC4 5 ASN A 68  ? ASN X 68  . ? 1_555 ? 
21 AC4 5 ASP A 72  ? ASP X 72  . ? 1_555 ? 
22 AC4 5 HOH F .   ? HOH X 484 . ? 6_554 ? 
# 
_atom_sites.entry_id                    2OU0 
_atom_sites.fract_transf_matrix[1][1]   0.016610 
_atom_sites.fract_transf_matrix[1][2]   0.009590 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019179 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010376 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? -5.690  15.700 -8.959  1.00 13.73 ? 1   MET X N   1 
ATOM   2    C CA  A MET A 1 1   ? -7.118  15.736 -8.925  0.50 13.48 ? 1   MET X CA  1 
ATOM   3    C CA  B MET A 1 1   ? -7.130  15.782 -8.937  0.50 13.48 ? 1   MET X CA  1 
ATOM   4    C C   . MET A 1 1   ? -7.702  17.046 -9.542  1.00 13.63 ? 1   MET X C   1 
ATOM   5    O O   . MET A 1 1   ? -7.121  18.041 -9.487  1.00 13.34 ? 1   MET X O   1 
ATOM   6    C CB  A MET A 1 1   ? -7.577  15.409 -7.489  0.50 13.61 ? 1   MET X CB  1 
ATOM   7    C CB  B MET A 1 1   ? -7.681  15.642 -7.523  0.50 13.61 ? 1   MET X CB  1 
ATOM   8    C CG  A MET A 1 1   ? -9.004  15.037 -7.242  0.50 13.06 ? 1   MET X CG  1 
ATOM   9    C CG  B MET A 1 1   ? -7.997  14.302 -7.090  0.50 13.06 ? 1   MET X CG  1 
ATOM   10   S SD  A MET A 1 1   ? -9.762  13.729 -8.151  0.50 11.18 ? 1   MET X SD  1 
ATOM   11   S SD  B MET A 1 1   ? -9.220  13.392 -8.090  0.50 11.18 ? 1   MET X SD  1 
ATOM   12   C CE  A MET A 1 1   ? -8.523  12.584 -8.033  0.50 13.09 ? 1   MET X CE  1 
ATOM   13   C CE  B MET A 1 1   ? -10.483 14.300 -8.140  0.50 13.09 ? 1   MET X CE  1 
ATOM   14   N N   . ASN A 1 2   ? -8.887  16.938 -10.079 1.00 13.10 ? 2   ASN X N   1 
ATOM   15   C CA  . ASN A 1 2   ? -9.641  18.096 -10.560 1.00 12.68 ? 2   ASN X CA  1 
ATOM   16   C C   . ASN A 1 2   ? -11.124 17.698 -10.648 1.00 12.33 ? 2   ASN X C   1 
ATOM   17   O O   . ASN A 1 2   ? -11.461 16.537 -10.388 1.00 11.45 ? 2   ASN X O   1 
ATOM   18   C CB  . ASN A 1 2   ? -9.091  18.575 -11.918 1.00 12.77 ? 2   ASN X CB  1 
ATOM   19   C CG  . ASN A 1 2   ? -9.145  17.497 -12.981 1.00 13.41 ? 2   ASN X CG  1 
ATOM   20   O OD1 . ASN A 1 2   ? -10.200 16.926 -13.239 1.00 13.12 ? 2   ASN X OD1 1 
ATOM   21   N ND2 . ASN A 1 2   ? -8.002  17.209 -13.599 1.00 12.37 ? 2   ASN X ND2 1 
ATOM   22   N N   . ILE A 1 3   ? -11.996 18.639 -11.014 1.00 11.74 ? 3   ILE X N   1 
ATOM   23   C CA  . ILE A 1 3   ? -13.444 18.366 -11.109 1.00 11.83 ? 3   ILE X CA  1 
ATOM   24   C C   . ILE A 1 3   ? -13.816 17.208 -12.062 1.00 11.81 ? 3   ILE X C   1 
ATOM   25   O O   . ILE A 1 3   ? -14.767 16.450 -11.796 1.00 11.56 ? 3   ILE X O   1 
ATOM   26   C CB  . ILE A 1 3   ? -14.277 19.647 -11.443 1.00 11.82 ? 3   ILE X CB  1 
ATOM   27   C CG1 . ILE A 1 3   ? -15.786 19.374 -11.357 1.00 11.98 ? 3   ILE X CG1 1 
ATOM   28   C CG2 . ILE A 1 3   ? -13.883 20.239 -12.808 1.00 12.58 ? 3   ILE X CG2 1 
ATOM   29   C CD1 . ILE A 1 3   ? -16.274 18.932 -9.966  1.00 11.52 ? 3   ILE X CD1 1 
ATOM   30   N N   . PHE A 1 4   ? -13.077 17.072 -13.163 1.00 11.58 ? 4   PHE X N   1 
ATOM   31   C CA  . PHE A 1 4   ? -13.344 15.973 -14.089 1.00 11.67 ? 4   PHE X CA  1 
ATOM   32   C C   . PHE A 1 4   ? -13.032 14.642 -13.423 1.00 11.45 ? 4   PHE X C   1 
ATOM   33   O O   . PHE A 1 4   ? -13.842 13.718 -13.482 1.00 10.88 ? 4   PHE X O   1 
ATOM   34   C CB  . PHE A 1 4   ? -12.607 16.150 -15.426 1.00 11.81 ? 4   PHE X CB  1 
ATOM   35   C CG  . PHE A 1 4   ? -13.193 17.234 -16.291 1.00 12.48 ? 4   PHE X CG  1 
ATOM   36   C CD1 . PHE A 1 4   ? -14.174 16.932 -17.245 1.00 13.65 ? 4   PHE X CD1 1 
ATOM   37   C CD2 . PHE A 1 4   ? -12.798 18.560 -16.133 1.00 12.70 ? 4   PHE X CD2 1 
ATOM   38   C CE1 . PHE A 1 4   ? -14.728 17.947 -18.040 1.00 14.47 ? 4   PHE X CE1 1 
ATOM   39   C CE2 . PHE A 1 4   ? -13.345 19.582 -16.919 1.00 13.54 ? 4   PHE X CE2 1 
ATOM   40   C CZ  . PHE A 1 4   ? -14.309 19.275 -17.874 1.00 14.47 ? 4   PHE X CZ  1 
ATOM   41   N N   . GLU A 1 5   ? -11.873 14.560 -12.766 1.00 11.65 ? 5   GLU X N   1 
ATOM   42   C CA  . GLU A 1 5   ? -11.428 13.308 -12.134 1.00 11.79 ? 5   GLU X CA  1 
ATOM   43   C C   . GLU A 1 5   ? -12.304 12.952 -10.935 1.00 11.57 ? 5   GLU X C   1 
ATOM   44   O O   . GLU A 1 5   ? -12.580 11.774 -10.667 1.00 11.22 ? 5   GLU X O   1 
ATOM   45   C CB  . GLU A 1 5   ? -9.965  13.416 -11.697 1.00 11.91 ? 5   GLU X CB  1 
ATOM   46   C CG  . GLU A 1 5   ? -8.973  13.600 -12.842 1.00 13.11 ? 5   GLU X CG  1 
ATOM   47   C CD  . GLU A 1 5   ? -7.528  13.439 -12.394 1.00 16.35 ? 5   GLU X CD  1 
ATOM   48   O OE1 . GLU A 1 5   ? -7.303  13.015 -11.240 1.00 17.59 ? 5   GLU X OE1 1 
ATOM   49   O OE2 . GLU A 1 5   ? -6.621  13.705 -13.206 1.00 16.63 ? 5   GLU X OE2 1 
ATOM   50   N N   . MET A 1 6   ? -12.738 13.994 -10.234 1.00 11.52 ? 6   MET X N   1 
ATOM   51   C CA  . MET A 1 6   ? -13.563 13.878 -9.042  1.00 11.09 ? 6   MET X CA  1 
ATOM   52   C C   . MET A 1 6   ? -14.927 13.301 -9.404  1.00 10.91 ? 6   MET X C   1 
ATOM   53   O O   . MET A 1 6   ? -15.385 12.328 -8.791  1.00 10.77 ? 6   MET X O   1 
ATOM   54   C CB  . MET A 1 6   ? -13.695 15.261 -8.404  1.00 11.23 ? 6   MET X CB  1 
ATOM   55   C CG  . MET A 1 6   ? -14.378 15.300 -7.054  1.00 11.26 ? 6   MET X CG  1 
ATOM   56   S SD  . MET A 1 6   ? -15.037 16.946 -6.788  1.00 11.04 ? 6   MET X SD  1 
ATOM   57   C CE  . MET A 1 6   ? -15.173 17.010 -5.002  1.00 10.29 ? 6   MET X CE  1 
ATOM   58   N N   . LEU A 1 7   ? -15.570 13.892 -10.405 1.00 10.52 ? 7   LEU X N   1 
ATOM   59   C CA  . LEU A 1 7   ? -16.868 13.401 -10.851 1.00 10.33 ? 7   LEU X CA  1 
ATOM   60   C C   . LEU A 1 7   ? -16.793 12.025 -11.525 1.00 10.60 ? 7   LEU X C   1 
ATOM   61   O O   . LEU A 1 7   ? -17.740 11.241 -11.439 1.00 10.58 ? 7   LEU X O   1 
ATOM   62   C CB  . LEU A 1 7   ? -17.579 14.431 -11.732 1.00 10.11 ? 7   LEU X CB  1 
ATOM   63   C CG  . LEU A 1 7   ? -18.343 15.507 -10.948 1.00 10.04 ? 7   LEU X CG  1 
ATOM   64   C CD1 . LEU A 1 7   ? -18.672 16.717 -11.822 1.00 9.35  ? 7   LEU X CD1 1 
ATOM   65   C CD2 . LEU A 1 7   ? -19.613 14.925 -10.302 1.00 8.77  ? 7   LEU X CD2 1 
ATOM   66   N N   . ARG A 1 8   ? -15.673 11.733 -12.183 1.00 10.52 ? 8   ARG X N   1 
ATOM   67   C CA  . ARG A 1 8   ? -15.462 10.412 -12.777 1.00 10.82 ? 8   ARG X CA  1 
ATOM   68   C C   . ARG A 1 8   ? -15.423 9.327  -11.689 1.00 11.08 ? 8   ARG X C   1 
ATOM   69   O O   . ARG A 1 8   ? -15.995 8.242  -11.855 1.00 11.19 ? 8   ARG X O   1 
ATOM   70   C CB  . ARG A 1 8   ? -14.194 10.416 -13.631 1.00 10.98 ? 8   ARG X CB  1 
ATOM   71   C CG  . ARG A 1 8   ? -13.778 9.076  -14.196 1.00 11.66 ? 8   ARG X CG  1 
ATOM   72   C CD  . ARG A 1 8   ? -14.872 8.417  -15.057 1.00 13.16 ? 8   ARG X CD  1 
ATOM   73   N NE  . ARG A 1 8   ? -14.414 7.098  -15.491 1.00 15.18 ? 8   ARG X NE  1 
ATOM   74   C CZ  . ARG A 1 8   ? -14.483 5.998  -14.747 1.00 16.23 ? 8   ARG X CZ  1 
ATOM   75   N NH1 . ARG A 1 8   ? -15.007 6.042  -13.524 1.00 17.42 ? 8   ARG X NH1 1 
ATOM   76   N NH2 . ARG A 1 8   ? -14.024 4.847  -15.222 1.00 18.12 ? 8   ARG X NH2 1 
ATOM   77   N N   . ILE A 1 9   ? -14.775 9.629  -10.566 1.00 11.10 ? 9   ILE X N   1 
ATOM   78   C CA  . ILE A 1 9   ? -14.807 8.729  -9.409  1.00 10.98 ? 9   ILE X CA  1 
ATOM   79   C C   . ILE A 1 9   ? -16.236 8.597  -8.845  1.00 11.09 ? 9   ILE X C   1 
ATOM   80   O O   . ILE A 1 9   ? -16.732 7.482  -8.649  1.00 10.58 ? 9   ILE X O   1 
ATOM   81   C CB  . ILE A 1 9   ? -13.770 9.164  -8.331  1.00 11.05 ? 9   ILE X CB  1 
ATOM   82   C CG1 . ILE A 1 9   ? -12.355 8.832  -8.812  1.00 10.52 ? 9   ILE X CG1 1 
ATOM   83   C CG2 . ILE A 1 9   ? -14.040 8.493  -6.979  1.00 11.08 ? 9   ILE X CG2 1 
ATOM   84   C CD1 . ILE A 1 9   ? -11.238 9.540  -8.016  1.00 9.72  ? 9   ILE X CD1 1 
ATOM   85   N N   . ASP A 1 10  ? -16.911 9.722  -8.618  1.00 10.79 ? 10  ASP X N   1 
ATOM   86   C CA  . ASP A 1 10  ? -18.258 9.682  -8.015  1.00 11.55 ? 10  ASP X CA  1 
ATOM   87   C C   . ASP A 1 10  ? -19.359 9.095  -8.896  1.00 11.88 ? 10  ASP X C   1 
ATOM   88   O O   . ASP A 1 10  ? -20.302 8.484  -8.385  1.00 12.01 ? 10  ASP X O   1 
ATOM   89   C CB  . ASP A 1 10  ? -18.680 11.063 -7.522  1.00 11.32 ? 10  ASP X CB  1 
ATOM   90   C CG  . ASP A 1 10  ? -17.876 11.517 -6.320  1.00 12.08 ? 10  ASP X CG  1 
ATOM   91   O OD1 . ASP A 1 10  ? -17.426 10.643 -5.535  1.00 11.62 ? 10  ASP X OD1 1 
ATOM   92   O OD2 . ASP A 1 10  ? -17.700 12.744 -6.165  1.00 12.32 ? 10  ASP X OD2 1 
ATOM   93   N N   . GLU A 1 11  ? -19.235 9.270  -10.208 1.00 11.89 ? 11  GLU X N   1 
ATOM   94   C CA  . GLU A 1 11  ? -20.299 8.880  -11.132 1.00 11.96 ? 11  GLU X CA  1 
ATOM   95   C C   . GLU A 1 11  ? -20.039 7.560  -11.854 1.00 12.18 ? 11  GLU X C   1 
ATOM   96   O O   . GLU A 1 11  ? -20.982 6.904  -12.311 1.00 12.27 ? 11  GLU X O   1 
ATOM   97   C CB  . GLU A 1 11  ? -20.564 9.997  -12.151 1.00 11.87 ? 11  GLU X CB  1 
ATOM   98   C CG  . GLU A 1 11  ? -21.089 11.310 -11.569 1.00 12.21 ? 11  GLU X CG  1 
ATOM   99   C CD  . GLU A 1 11  ? -22.463 11.187 -10.906 1.00 13.14 ? 11  GLU X CD  1 
ATOM   100  O OE1 . GLU A 1 11  ? -23.155 10.162 -11.086 1.00 14.82 ? 11  GLU X OE1 1 
ATOM   101  O OE2 . GLU A 1 11  ? -22.853 12.127 -10.195 1.00 13.06 ? 11  GLU X OE2 1 
ATOM   102  N N   . GLY A 1 12  ? -18.766 7.185  -11.983 1.00 12.30 ? 12  GLY X N   1 
ATOM   103  C CA  . GLY A 1 12  ? -18.387 5.991  -12.733 1.00 12.79 ? 12  GLY X CA  1 
ATOM   104  C C   . GLY A 1 12  ? -18.478 6.231  -14.231 1.00 13.58 ? 12  GLY X C   1 
ATOM   105  O O   . GLY A 1 12  ? -18.751 7.356  -14.673 1.00 13.29 ? 12  GLY X O   1 
ATOM   106  N N   . LEU A 1 13  ? -18.240 5.177  -15.010 1.00 13.63 ? 13  LEU X N   1 
ATOM   107  C CA  . LEU A 1 13  ? -18.441 5.221  -16.464 1.00 14.30 ? 13  LEU X CA  1 
ATOM   108  C C   . LEU A 1 13  ? -19.171 3.959  -16.909 1.00 14.60 ? 13  LEU X C   1 
ATOM   109  O O   . LEU A 1 13  ? -18.681 2.852  -16.700 1.00 14.70 ? 13  LEU X O   1 
ATOM   110  C CB  . LEU A 1 13  ? -17.097 5.362  -17.200 1.00 14.13 ? 13  LEU X CB  1 
ATOM   111  C CG  . LEU A 1 13  ? -17.028 5.120  -18.718 1.00 14.63 ? 13  LEU X CG  1 
ATOM   112  C CD1 . LEU A 1 13  ? -17.630 6.282  -19.495 1.00 15.74 ? 13  LEU X CD1 1 
ATOM   113  C CD2 . LEU A 1 13  ? -15.599 4.860  -19.181 0.50 14.86 ? 13  LEU X CD2 1 
ATOM   114  N N   . ARG A 1 14  ? -20.355 4.124  -17.494 1.00 14.94 ? 14  ARG X N   1 
ATOM   115  C CA  . ARG A 1 14  ? -21.103 2.989  -18.043 1.00 15.07 ? 14  ARG X CA  1 
ATOM   116  C C   . ARG A 1 14  ? -21.606 3.344  -19.435 1.00 15.11 ? 14  ARG X C   1 
ATOM   117  O O   . ARG A 1 14  ? -22.185 4.418  -19.642 1.00 15.03 ? 14  ARG X O   1 
ATOM   118  C CB  . ARG A 1 14  ? -22.248 2.568  -17.108 1.00 15.32 ? 14  ARG X CB  1 
ATOM   119  C CG  . ARG A 1 14  ? -21.762 2.107  -15.717 1.00 15.98 ? 14  ARG X CG  1 
ATOM   120  C CD  . ARG A 1 14  ? -22.899 1.680  -14.803 1.00 18.55 ? 14  ARG X CD  1 
ATOM   121  N NE  . ARG A 1 14  ? -23.471 0.385  -15.188 1.00 19.51 ? 14  ARG X NE  1 
ATOM   122  C CZ  . ARG A 1 14  ? -24.504 -0.197 -14.577 1.00 20.31 ? 14  ARG X CZ  1 
ATOM   123  N NH1 . ARG A 1 14  ? -25.091 0.387  -13.542 1.00 20.75 ? 14  ARG X NH1 1 
ATOM   124  N NH2 . ARG A 1 14  ? -24.958 -1.362 -15.010 1.00 21.29 ? 14  ARG X NH2 1 
ATOM   125  N N   . LEU A 1 15  ? -21.377 2.446  -20.389 1.00 14.59 ? 15  LEU X N   1 
ATOM   126  C CA  . LEU A 1 15  ? -21.589 2.766  -21.797 1.00 14.74 ? 15  LEU X CA  1 
ATOM   127  C C   . LEU A 1 15  ? -22.954 2.345  -22.331 1.00 14.69 ? 15  LEU X C   1 
ATOM   128  O O   . LEU A 1 15  ? -23.270 2.588  -23.499 1.00 15.33 ? 15  LEU X O   1 
ATOM   129  C CB  . LEU A 1 15  ? -20.461 2.184  -22.660 1.00 14.43 ? 15  LEU X CB  1 
ATOM   130  C CG  . LEU A 1 15  ? -19.050 2.739  -22.459 1.00 14.87 ? 15  LEU X CG  1 
ATOM   131  C CD1 . LEU A 1 15  ? -18.090 2.151  -23.505 1.00 14.85 ? 15  LEU X CD1 1 
ATOM   132  C CD2 . LEU A 1 15  ? -19.022 4.272  -22.477 1.00 14.83 ? 15  LEU X CD2 1 
ATOM   133  N N   . LYS A 1 16  ? -23.749 1.716  -21.473 1.00 14.43 ? 16  LYS X N   1 
ATOM   134  C CA  . LYS A 1 16  ? -25.117 1.335  -21.799 1.00 14.95 ? 16  LYS X CA  1 
ATOM   135  C C   . LYS A 1 16  ? -26.060 2.028  -20.824 1.00 14.71 ? 16  LYS X C   1 
ATOM   136  O O   . LYS A 1 16  ? -25.665 2.344  -19.698 1.00 14.78 ? 16  LYS X O   1 
ATOM   137  C CB  . LYS A 1 16  ? -25.304 -0.183 -21.706 1.00 14.74 ? 16  LYS X CB  1 
ATOM   138  C CG  . LYS A 1 16  ? -24.347 -0.998 -22.568 1.00 16.00 ? 16  LYS X CG  1 
ATOM   139  N N   . ILE A 1 17  ? -27.296 2.265  -21.253 1.00 14.38 ? 17  ILE X N   1 
ATOM   140  C CA  . ILE A 1 17  ? -28.292 2.905  -20.386 1.00 14.25 ? 17  ILE X CA  1 
ATOM   141  C C   . ILE A 1 17  ? -28.453 2.110  -19.082 1.00 14.44 ? 17  ILE X C   1 
ATOM   142  O O   . ILE A 1 17  ? -28.653 0.894  -19.104 1.00 14.09 ? 17  ILE X O   1 
ATOM   143  C CB  . ILE A 1 17  ? -29.656 3.043  -21.086 1.00 14.41 ? 17  ILE X CB  1 
ATOM   144  C CG1 . ILE A 1 17  ? -29.577 4.071  -22.224 1.00 14.14 ? 17  ILE X CG1 1 
ATOM   145  C CG2 . ILE A 1 17  ? -30.754 3.424  -20.080 1.00 13.65 ? 17  ILE X CG2 1 
ATOM   146  C CD1 . ILE A 1 17  ? -30.847 4.128  -23.083 1.00 14.42 ? 17  ILE X CD1 1 
ATOM   147  N N   . TYR A 1 18  ? -28.335 2.811  -17.961 1.00 14.25 ? 18  TYR X N   1 
ATOM   148  C CA  . TYR A 1 18  ? -28.521 2.221  -16.637 1.00 14.39 ? 18  TYR X CA  1 
ATOM   149  C C   . TYR A 1 18  ? -29.382 3.161  -15.790 1.00 13.86 ? 18  TYR X C   1 
ATOM   150  O O   . TYR A 1 18  ? -29.632 4.300  -16.175 1.00 13.98 ? 18  TYR X O   1 
ATOM   151  C CB  . TYR A 1 18  ? -27.160 1.959  -15.967 1.00 14.20 ? 18  TYR X CB  1 
ATOM   152  C CG  . TYR A 1 18  ? -26.369 3.211  -15.619 1.00 14.84 ? 18  TYR X CG  1 
ATOM   153  C CD1 . TYR A 1 18  ? -25.614 3.884  -16.589 1.00 14.81 ? 18  TYR X CD1 1 
ATOM   154  C CD2 . TYR A 1 18  ? -26.358 3.712  -14.309 1.00 15.47 ? 18  TYR X CD2 1 
ATOM   155  C CE1 . TYR A 1 18  ? -24.884 5.033  -16.272 1.00 15.60 ? 18  TYR X CE1 1 
ATOM   156  C CE2 . TYR A 1 18  ? -25.633 4.870  -13.981 1.00 15.67 ? 18  TYR X CE2 1 
ATOM   157  C CZ  . TYR A 1 18  ? -24.900 5.517  -14.965 1.00 16.03 ? 18  TYR X CZ  1 
ATOM   158  O OH  . TYR A 1 18  ? -24.182 6.647  -14.643 1.00 16.26 ? 18  TYR X OH  1 
ATOM   159  N N   . LYS A 1 19  ? -29.849 2.681  -14.646 1.00 13.61 ? 19  LYS X N   1 
ATOM   160  C CA  . LYS A 1 19  ? -30.591 3.533  -13.730 1.00 13.20 ? 19  LYS X CA  1 
ATOM   161  C C   . LYS A 1 19  ? -29.651 4.060  -12.648 1.00 13.01 ? 19  LYS X C   1 
ATOM   162  O O   . LYS A 1 19  ? -28.836 3.310  -12.098 1.00 13.18 ? 19  LYS X O   1 
ATOM   163  C CB  . LYS A 1 19  ? -31.770 2.782  -13.109 1.00 13.00 ? 19  LYS X CB  1 
ATOM   164  C CG  . LYS A 1 19  ? -32.893 2.462  -14.084 1.00 13.49 ? 19  LYS X CG  1 
ATOM   165  C CD  . LYS A 1 19  ? -34.032 1.778  -13.364 1.00 14.54 ? 19  LYS X CD  1 
ATOM   166  C CE  . LYS A 1 19  ? -35.184 1.451  -14.297 1.00 14.51 ? 19  LYS X CE  1 
ATOM   167  N NZ  . LYS A 1 19  ? -36.231 0.685  -13.564 1.00 16.37 ? 19  LYS X NZ  1 
ATOM   168  N N   . ASP A 1 20  ? -29.771 5.349  -12.345 1.00 12.58 ? 20  ASP X N   1 
ATOM   169  C CA  . ASP A 1 20  ? -28.943 5.982  -11.318 1.00 12.62 ? 20  ASP X CA  1 
ATOM   170  C C   . ASP A 1 20  ? -29.443 5.621  -9.906  1.00 12.97 ? 20  ASP X C   1 
ATOM   171  O O   . ASP A 1 20  ? -30.315 4.747  -9.764  1.00 12.58 ? 20  ASP X O   1 
ATOM   172  C CB  . ASP A 1 20  ? -28.844 7.502  -11.553 1.00 12.09 ? 20  ASP X CB  1 
ATOM   173  C CG  . ASP A 1 20  ? -30.144 8.254  -11.252 1.00 12.17 ? 20  ASP X CG  1 
ATOM   174  O OD1 . ASP A 1 20  ? -31.128 7.675  -10.734 1.00 12.52 ? 20  ASP X OD1 1 
ATOM   175  O OD2 . ASP A 1 20  ? -30.186 9.461  -11.549 1.00 12.30 ? 20  ASP X OD2 1 
ATOM   176  N N   . THR A 1 21  ? -28.900 6.279  -8.878  1.00 12.90 ? 21  THR X N   1 
ATOM   177  C CA  . THR A 1 21  ? -29.221 5.950  -7.484  1.00 13.30 ? 21  THR X CA  1 
ATOM   178  C C   . THR A 1 21  ? -30.674 6.278  -7.129  1.00 13.56 ? 21  THR X C   1 
ATOM   179  O O   . THR A 1 21  ? -31.218 5.757  -6.149  1.00 13.54 ? 21  THR X O   1 
ATOM   180  C CB  . THR A 1 21  ? -28.297 6.686  -6.490  1.00 13.51 ? 21  THR X CB  1 
ATOM   181  O OG1 . THR A 1 21  ? -28.606 8.082  -6.506  1.00 13.29 ? 21  THR X OG1 1 
ATOM   182  C CG2 . THR A 1 21  ? -26.819 6.498  -6.857  1.00 13.25 ? 21  THR X CG2 1 
ATOM   183  N N   . GLU A 1 22  ? -31.294 7.141  -7.931  1.00 13.63 ? 22  GLU X N   1 
ATOM   184  C CA  . GLU A 1 22  ? -32.692 7.514  -7.745  1.00 13.70 ? 22  GLU X CA  1 
ATOM   185  C C   . GLU A 1 22  ? -33.631 6.688  -8.623  1.00 13.48 ? 22  GLU X C   1 
ATOM   186  O O   . GLU A 1 22  ? -34.852 6.864  -8.581  1.00 13.56 ? 22  GLU X O   1 
ATOM   187  C CB  . GLU A 1 22  ? -32.892 9.012  -8.003  1.00 14.32 ? 22  GLU X CB  1 
ATOM   188  C CG  . GLU A 1 22  ? -32.247 9.927  -6.966  1.00 15.86 ? 22  GLU X CG  1 
ATOM   189  C CD  . GLU A 1 22  ? -32.882 9.832  -5.576  1.00 19.14 ? 22  GLU X CD  1 
ATOM   190  O OE1 . GLU A 1 22  ? -34.086 9.520  -5.469  1.00 21.27 ? 22  GLU X OE1 1 
ATOM   191  O OE2 . GLU A 1 22  ? -32.172 10.086 -4.577  1.00 21.31 ? 22  GLU X OE2 1 
ATOM   192  N N   . GLY A 1 23  ? -33.047 5.788  -9.411  1.00 13.08 ? 23  GLY X N   1 
ATOM   193  C CA  . GLY A 1 23  ? -33.790 4.934  -10.324 1.00 13.03 ? 23  GLY X CA  1 
ATOM   194  C C   . GLY A 1 23  ? -34.052 5.557  -11.688 1.00 13.21 ? 23  GLY X C   1 
ATOM   195  O O   . GLY A 1 23  ? -34.909 5.077  -12.429 1.00 13.02 ? 23  GLY X O   1 
ATOM   196  N N   . TYR A 1 24  ? -33.313 6.616  -12.026 1.00 13.34 ? 24  TYR X N   1 
ATOM   197  C CA  . TYR A 1 24  ? -33.536 7.336  -13.284 1.00 13.77 ? 24  TYR X CA  1 
ATOM   198  C C   . TYR A 1 24  ? -32.563 6.925  -14.375 1.00 13.39 ? 24  TYR X C   1 
ATOM   199  O O   . TYR A 1 24  ? -31.358 6.819  -14.121 1.00 12.90 ? 24  TYR X O   1 
ATOM   200  C CB  . TYR A 1 24  ? -33.442 8.852  -13.087 1.00 14.15 ? 24  TYR X CB  1 
ATOM   201  C CG  . TYR A 1 24  ? -34.440 9.430  -12.109 1.00 17.06 ? 24  TYR X CG  1 
ATOM   202  C CD1 . TYR A 1 24  ? -35.779 9.027  -12.122 1.00 18.68 ? 24  TYR X CD1 1 
ATOM   203  C CD2 . TYR A 1 24  ? -34.046 10.385 -11.175 1.00 18.39 ? 24  TYR X CD2 1 
ATOM   204  C CE1 . TYR A 1 24  ? -36.703 9.563  -11.217 1.00 21.05 ? 24  TYR X CE1 1 
ATOM   205  C CE2 . TYR A 1 24  ? -34.961 10.932 -10.268 1.00 20.70 ? 24  TYR X CE2 1 
ATOM   206  C CZ  . TYR A 1 24  ? -36.282 10.511 -10.292 1.00 22.13 ? 24  TYR X CZ  1 
ATOM   207  O OH  . TYR A 1 24  ? -37.187 11.051 -9.398  1.00 24.37 ? 24  TYR X OH  1 
ATOM   208  N N   . TYR A 1 25  ? -33.096 6.734  -15.587 1.00 13.17 ? 25  TYR X N   1 
ATOM   209  C CA  . TYR A 1 25  ? -32.301 6.342  -16.755 1.00 13.35 ? 25  TYR X CA  1 
ATOM   210  C C   . TYR A 1 25  ? -31.154 7.311  -17.029 1.00 12.69 ? 25  TYR X C   1 
ATOM   211  O O   . TYR A 1 25  ? -31.350 8.529  -17.132 1.00 12.00 ? 25  TYR X O   1 
ATOM   212  C CB  . TYR A 1 25  ? -33.175 6.169  -18.000 1.00 13.62 ? 25  TYR X CB  1 
ATOM   213  C CG  . TYR A 1 25  ? -34.086 4.963  -17.935 1.00 14.57 ? 25  TYR X CG  1 
ATOM   214  C CD1 . TYR A 1 25  ? -33.564 3.673  -17.780 1.00 16.33 ? 25  TYR X CD1 1 
ATOM   215  C CD2 . TYR A 1 25  ? -35.469 5.106  -18.035 1.00 15.57 ? 25  TYR X CD2 1 
ATOM   216  C CE1 . TYR A 1 25  ? -34.395 2.560  -17.716 1.00 16.25 ? 25  TYR X CE1 1 
ATOM   217  C CE2 . TYR A 1 25  ? -36.308 4.003  -17.970 1.00 16.04 ? 25  TYR X CE2 1 
ATOM   218  C CZ  . TYR A 1 25  ? -35.767 2.738  -17.813 1.00 16.86 ? 25  TYR X CZ  1 
ATOM   219  O OH  . TYR A 1 25  ? -36.600 1.647  -17.761 1.00 17.90 ? 25  TYR X OH  1 
ATOM   220  N N   . THR A 1 26  ? -29.960 6.734  -17.128 1.00 12.40 ? 26  THR X N   1 
ATOM   221  C CA  . THR A 1 26  ? -28.703 7.468  -17.162 1.00 12.18 ? 26  THR X CA  1 
ATOM   222  C C   . THR A 1 26  ? -27.739 6.733  -18.102 1.00 12.07 ? 26  THR X C   1 
ATOM   223  O O   . THR A 1 26  ? -27.923 5.540  -18.374 1.00 12.01 ? 26  THR X O   1 
ATOM   224  C CB  . THR A 1 26  ? -28.121 7.592  -15.704 1.00 12.45 ? 26  THR X CB  1 
ATOM   225  O OG1 . THR A 1 26  ? -29.075 8.265  -14.870 1.00 12.68 ? 26  THR X OG1 1 
ATOM   226  C CG2 . THR A 1 26  ? -26.800 8.364  -15.656 1.00 11.58 ? 26  THR X CG2 1 
ATOM   227  N N   . ILE A 1 27  ? -26.731 7.443  -18.615 1.00 11.33 ? 27  ILE X N   1 
ATOM   228  C CA  . ILE A 1 27  ? -25.646 6.811  -19.363 1.00 11.14 ? 27  ILE X CA  1 
ATOM   229  C C   . ILE A 1 27  ? -24.309 7.533  -19.136 1.00 10.82 ? 27  ILE X C   1 
ATOM   230  O O   . ILE A 1 27  ? -24.280 8.666  -18.656 1.00 10.60 ? 27  ILE X O   1 
ATOM   231  C CB  . ILE A 1 27  ? -25.974 6.719  -20.882 1.00 10.96 ? 27  ILE X CB  1 
ATOM   232  C CG1 . ILE A 1 27  ? -25.188 5.571  -21.546 1.00 11.16 ? 27  ILE X CG1 1 
ATOM   233  C CG2 . ILE A 1 27  ? -25.760 8.070  -21.573 1.00 11.73 ? 27  ILE X CG2 1 
ATOM   234  C CD1 . ILE A 1 27  ? -25.765 5.125  -22.885 1.00 10.57 ? 27  ILE X CD1 1 
ATOM   235  N N   . GLY A 1 28  ? -23.215 6.866  -19.481 1.00 10.45 ? 28  GLY X N   1 
ATOM   236  C CA  . GLY A 1 28  ? -21.889 7.497  -19.497 1.00 10.20 ? 28  GLY X CA  1 
ATOM   237  C C   . GLY A 1 28  ? -21.374 7.785  -18.102 1.00 10.04 ? 28  GLY X C   1 
ATOM   238  O O   . GLY A 1 28  ? -21.361 6.896  -17.236 1.00 10.16 ? 28  GLY X O   1 
ATOM   239  N N   . ILE A 1 29  ? -20.957 9.030  -17.896 1.00 9.88  ? 29  ILE X N   1 
ATOM   240  C CA  . ILE A 1 29  ? -20.475 9.491  -16.592 1.00 10.33 ? 29  ILE X CA  1 
ATOM   241  C C   . ILE A 1 29  ? -21.570 10.323 -15.905 1.00 10.17 ? 29  ILE X C   1 
ATOM   242  O O   . ILE A 1 29  ? -21.506 11.545 -15.853 1.00 10.48 ? 29  ILE X O   1 
ATOM   243  C CB  . ILE A 1 29  ? -19.120 10.261 -16.719 1.00 10.02 ? 29  ILE X CB  1 
ATOM   244  C CG1 . ILE A 1 29  ? -18.125 9.467  -17.581 1.00 9.71  ? 29  ILE X CG1 1 
ATOM   245  C CG2 . ILE A 1 29  ? -18.524 10.577 -15.346 1.00 9.76  ? 29  ILE X CG2 1 
ATOM   246  C CD1 . ILE A 1 29  ? -16.985 10.310 -18.174 1.00 9.53  ? 29  ILE X CD1 1 
ATOM   247  N N   . GLY A 1 30  ? -22.594 9.637  -15.409 1.00 10.49 ? 30  GLY X N   1 
ATOM   248  C CA  . GLY A 1 30  ? -23.697 10.291 -14.702 1.00 10.65 ? 30  GLY X CA  1 
ATOM   249  C C   . GLY A 1 30  ? -24.482 11.276 -15.551 1.00 11.07 ? 30  GLY X C   1 
ATOM   250  O O   . GLY A 1 30  ? -24.970 12.291 -15.048 1.00 10.96 ? 30  GLY X O   1 
ATOM   251  N N   . HIS A 1 31  ? -24.604 10.998 -16.842 1.00 11.52 ? 31  HIS X N   1 
ATOM   252  C CA  . HIS A 1 31  ? -25.464 11.824 -17.677 1.00 11.92 ? 31  HIS X CA  1 
ATOM   253  C C   . HIS A 1 31  ? -26.921 11.371 -17.586 1.00 11.88 ? 31  HIS X C   1 
ATOM   254  O O   . HIS A 1 31  ? -27.321 10.398 -18.231 1.00 12.19 ? 31  HIS X O   1 
ATOM   255  C CB  . HIS A 1 31  ? -25.027 11.840 -19.134 1.00 11.81 ? 31  HIS X CB  1 
ATOM   256  C CG  . HIS A 1 31  ? -25.915 12.684 -19.991 1.00 11.92 ? 31  HIS X CG  1 
ATOM   257  N ND1 . HIS A 1 31  ? -25.723 14.039 -20.145 1.00 12.14 ? 31  HIS X ND1 1 
ATOM   258  C CD2 . HIS A 1 31  ? -27.031 12.379 -20.695 1.00 12.36 ? 31  HIS X CD2 1 
ATOM   259  C CE1 . HIS A 1 31  ? -26.669 14.530 -20.927 1.00 12.55 ? 31  HIS X CE1 1 
ATOM   260  N NE2 . HIS A 1 31  ? -27.477 13.543 -21.272 1.00 12.55 ? 31  HIS X NE2 1 
ATOM   261  N N   . LEU A 1 32  ? -27.697 12.082 -16.773 1.00 12.36 ? 32  LEU X N   1 
ATOM   262  C CA  . LEU A 1 32  ? -29.121 11.816 -16.612 1.00 12.77 ? 32  LEU X CA  1 
ATOM   263  C C   . LEU A 1 32  ? -29.863 12.010 -17.933 1.00 13.12 ? 32  LEU X C   1 
ATOM   264  O O   . LEU A 1 32  ? -29.789 13.073 -18.560 1.00 12.30 ? 32  LEU X O   1 
ATOM   265  C CB  . LEU A 1 32  ? -29.721 12.719 -15.530 1.00 12.78 ? 32  LEU X CB  1 
ATOM   266  C CG  . LEU A 1 32  ? -31.236 12.626 -15.303 1.00 13.31 ? 32  LEU X CG  1 
ATOM   267  C CD1 . LEU A 1 32  ? -31.627 11.279 -14.703 1.00 12.69 ? 32  LEU X CD1 1 
ATOM   268  C CD2 . LEU A 1 32  ? -31.724 13.787 -14.424 1.00 13.87 ? 32  LEU X CD2 1 
ATOM   269  N N   . LEU A 1 33  ? -30.564 10.970 -18.364 1.00 13.82 ? 33  LEU X N   1 
ATOM   270  C CA  . LEU A 1 33  ? -31.272 11.042 -19.630 1.00 14.69 ? 33  LEU X CA  1 
ATOM   271  C C   . LEU A 1 33  ? -32.681 11.604 -19.454 1.00 15.54 ? 33  LEU X C   1 
ATOM   272  O O   . LEU A 1 33  ? -33.097 12.485 -20.207 1.00 15.79 ? 33  LEU X O   1 
ATOM   273  C CB  . LEU A 1 33  ? -31.296 9.680  -20.323 1.00 14.51 ? 33  LEU X CB  1 
ATOM   274  C CG  . LEU A 1 33  ? -29.954 9.171  -20.856 1.00 14.26 ? 33  LEU X CG  1 
ATOM   275  C CD1 . LEU A 1 33  ? -30.059 7.675  -21.123 1.00 13.87 ? 33  LEU X CD1 1 
ATOM   276  C CD2 . LEU A 1 33  ? -29.537 9.933  -22.116 1.00 13.94 ? 33  LEU X CD2 1 
ATOM   277  N N   . THR A 1 34  ? -33.399 11.091 -18.457 1.00 16.50 ? 34  THR X N   1 
ATOM   278  C CA  . THR A 1 34  ? -34.781 11.479 -18.193 1.00 17.56 ? 34  THR X CA  1 
ATOM   279  C C   . THR A 1 34  ? -35.238 10.926 -16.856 1.00 18.54 ? 34  THR X C   1 
ATOM   280  O O   . THR A 1 34  ? -34.740 9.885  -16.394 1.00 19.17 ? 34  THR X O   1 
ATOM   281  C CB  . THR A 1 34  ? -35.764 10.976 -19.302 1.00 17.83 ? 34  THR X CB  1 
ATOM   282  O OG1 . THR A 1 34  ? -37.087 11.449 -19.023 1.00 18.29 ? 34  THR X OG1 1 
ATOM   283  C CG2 . THR A 1 34  ? -35.778 9.446  -19.398 1.00 16.43 ? 34  THR X CG2 1 
ATOM   284  N N   . LYS A 1 35  ? -36.199 11.612 -16.243 1.00 19.06 ? 35  LYS X N   1 
ATOM   285  C CA  . LYS A 1 35  ? -36.839 11.104 -15.033 1.00 19.41 ? 35  LYS X CA  1 
ATOM   286  C C   . LYS A 1 35  ? -38.052 10.221 -15.351 1.00 19.69 ? 35  LYS X C   1 
ATOM   287  O O   . LYS A 1 35  ? -38.677 9.659  -14.449 1.00 19.88 ? 35  LYS X O   1 
ATOM   288  C CB  . LYS A 1 35  ? -37.188 12.257 -14.087 1.00 19.45 ? 35  LYS X CB  1 
ATOM   289  C CG  . LYS A 1 35  ? -35.945 12.909 -13.496 1.00 19.22 ? 35  LYS X CG  1 
ATOM   290  C CD  . LYS A 1 35  ? -36.272 13.883 -12.372 0.50 19.26 ? 35  LYS X CD  1 
ATOM   291  C CE  . LYS A 1 35  ? -35.003 14.599 -11.923 0.50 19.05 ? 35  LYS X CE  1 
ATOM   292  N NZ  . LYS A 1 35  ? -35.268 15.608 -10.862 0.50 19.17 ? 35  LYS X NZ  1 
ATOM   293  N N   . SER A 1 36  ? -38.351 10.075 -16.639 1.00 19.66 ? 36  SER X N   1 
ATOM   294  C CA  . SER A 1 36  ? -39.429 9.207  -17.104 1.00 19.92 ? 36  SER X CA  1 
ATOM   295  C C   . SER A 1 36  ? -39.132 7.720  -16.894 1.00 20.02 ? 36  SER X C   1 
ATOM   296  O O   . SER A 1 36  ? -38.003 7.274  -17.120 1.00 19.77 ? 36  SER X O   1 
ATOM   297  C CB  . SER A 1 36  ? -39.706 9.453  -18.588 1.00 19.79 ? 36  SER X CB  1 
ATOM   298  O OG  . SER A 1 36  ? -40.649 8.516  -19.074 1.00 20.11 ? 36  SER X OG  1 
ATOM   299  N N   . PRO A 1 37  ? -40.149 6.947  -16.460 1.00 20.39 ? 37  PRO X N   1 
ATOM   300  C CA  . PRO A 1 37  ? -40.010 5.491  -16.341 1.00 20.31 ? 37  PRO X CA  1 
ATOM   301  C C   . PRO A 1 37  ? -39.981 4.754  -17.682 1.00 20.26 ? 37  PRO X C   1 
ATOM   302  O O   . PRO A 1 37  ? -39.871 3.533  -17.706 1.00 20.70 ? 37  PRO X O   1 
ATOM   303  C CB  . PRO A 1 37  ? -41.245 5.086  -15.532 1.00 20.37 ? 37  PRO X CB  1 
ATOM   304  C CG  . PRO A 1 37  ? -42.249 6.135  -15.833 1.00 20.76 ? 37  PRO X CG  1 
ATOM   305  C CD  . PRO A 1 37  ? -41.474 7.414  -16.007 1.00 20.36 ? 37  PRO X CD  1 
ATOM   306  N N   . SER A 1 38  ? -40.061 5.484  -18.789 1.00 20.29 ? 38  SER X N   1 
ATOM   307  C CA  . SER A 1 38  ? -40.070 4.859  -20.111 1.00 20.07 ? 38  SER X CA  1 
ATOM   308  C C   . SER A 1 38  ? -38.665 4.746  -20.687 1.00 19.93 ? 38  SER X C   1 
ATOM   309  O O   . SER A 1 38  ? -38.005 5.766  -20.919 1.00 20.18 ? 38  SER X O   1 
ATOM   310  C CB  . SER A 1 38  ? -40.965 5.657  -21.067 1.00 20.14 ? 38  SER X CB  1 
ATOM   311  O OG  . SER A 1 38  ? -40.792 5.214  -22.400 1.00 20.22 ? 38  SER X OG  1 
ATOM   312  N N   . LEU A 1 39  ? -38.220 3.514  -20.936 1.00 19.59 ? 39  LEU X N   1 
ATOM   313  C CA  . LEU A 1 39  ? -36.902 3.276  -21.529 1.00 19.49 ? 39  LEU X CA  1 
ATOM   314  C C   . LEU A 1 39  ? -36.817 3.844  -22.943 1.00 19.46 ? 39  LEU X C   1 
ATOM   315  O O   . LEU A 1 39  ? -35.789 4.401  -23.334 1.00 19.17 ? 39  LEU X O   1 
ATOM   316  C CB  . LEU A 1 39  ? -36.524 1.788  -21.514 1.00 19.39 ? 39  LEU X CB  1 
ATOM   317  C CG  . LEU A 1 39  ? -35.181 1.400  -22.163 1.00 19.32 ? 39  LEU X CG  1 
ATOM   318  C CD1 . LEU A 1 39  ? -33.967 1.883  -21.354 1.00 17.23 ? 39  LEU X CD1 1 
ATOM   319  C CD2 . LEU A 1 39  ? -35.114 -0.088 -22.383 1.00 18.58 ? 39  LEU X CD2 1 
ATOM   320  N N   . ASN A 1 40  ? -37.905 3.711  -23.696 1.00 19.60 ? 40  ASN X N   1 
ATOM   321  C CA  . ASN A 1 40  ? -37.995 4.301  -25.025 1.00 19.77 ? 40  ASN X CA  1 
ATOM   322  C C   . ASN A 1 40  ? -37.826 5.820  -25.002 1.00 19.36 ? 40  ASN X C   1 
ATOM   323  O O   . ASN A 1 40  ? -37.191 6.383  -25.890 1.00 19.64 ? 40  ASN X O   1 
ATOM   324  C CB  . ASN A 1 40  ? -39.320 3.928  -25.702 1.00 20.41 ? 40  ASN X CB  1 
ATOM   325  C CG  . ASN A 1 40  ? -39.314 2.524  -26.272 1.00 21.57 ? 40  ASN X CG  1 
ATOM   326  O OD1 . ASN A 1 40  ? -38.280 2.002  -26.690 1.00 23.87 ? 40  ASN X OD1 1 
ATOM   327  N ND2 . ASN A 1 40  ? -40.486 1.908  -26.311 1.00 24.81 ? 40  ASN X ND2 1 
ATOM   328  N N   . ALA A 1 41  ? -38.400 6.474  -23.992 1.00 18.78 ? 41  ALA X N   1 
ATOM   329  C CA  . ALA A 1 41  ? -38.223 7.918  -23.808 1.00 18.21 ? 41  ALA X CA  1 
ATOM   330  C C   . ALA A 1 41  ? -36.756 8.259  -23.541 1.00 17.71 ? 41  ALA X C   1 
ATOM   331  O O   . ALA A 1 41  ? -36.233 9.246  -24.079 1.00 17.08 ? 41  ALA X O   1 
ATOM   332  C CB  . ALA A 1 41  ? -39.111 8.442  -22.684 1.00 17.96 ? 41  ALA X CB  1 
ATOM   333  N N   . ALA A 1 42  ? -36.110 7.434  -22.714 1.00 16.98 ? 42  ALA X N   1 
ATOM   334  C CA  . ALA A 1 42  ? -34.686 7.566  -22.407 1.00 16.54 ? 42  ALA X CA  1 
ATOM   335  C C   . ALA A 1 42  ? -33.827 7.360  -23.648 1.00 16.18 ? 42  ALA X C   1 
ATOM   336  O O   . ALA A 1 42  ? -32.862 8.098  -23.872 1.00 15.95 ? 42  ALA X O   1 
ATOM   337  C CB  . ALA A 1 42  ? -34.286 6.574  -21.325 1.00 16.78 ? 42  ALA X CB  1 
ATOM   338  N N   . LYS A 1 43  ? -34.184 6.362  -24.453 1.00 15.81 ? 43  LYS X N   1 
ATOM   339  C CA  . LYS A 1 43  ? -33.451 6.077  -25.684 1.00 15.91 ? 43  LYS X CA  1 
ATOM   340  C C   . LYS A 1 43  ? -33.558 7.254  -26.656 1.00 15.37 ? 43  LYS X C   1 
ATOM   341  O O   . LYS A 1 43  ? -32.606 7.564  -27.361 1.00 14.94 ? 43  LYS X O   1 
ATOM   342  C CB  . LYS A 1 43  ? -33.933 4.772  -26.325 1.00 16.30 ? 43  LYS X CB  1 
ATOM   343  C CG  . LYS A 1 43  ? -33.351 3.509  -25.680 1.00 18.49 ? 43  LYS X CG  1 
ATOM   344  C CD  . LYS A 1 43  ? -33.992 2.244  -26.233 1.00 21.06 ? 43  LYS X CD  1 
ATOM   345  C CE  . LYS A 1 43  ? -33.246 1.004  -25.761 1.00 22.59 ? 43  LYS X CE  1 
ATOM   346  N NZ  . LYS A 1 43  ? -33.888 -0.247 -26.265 1.00 24.65 ? 43  LYS X NZ  1 
ATOM   347  N N   . SER A 1 44  ? -34.713 7.918  -26.658 1.00 15.27 ? 44  SER X N   1 
ATOM   348  C CA  . SER A 1 44  ? -34.932 9.098  -27.497 1.00 15.67 ? 44  SER X CA  1 
ATOM   349  C C   . SER A 1 44  ? -34.070 10.283 -27.054 1.00 15.09 ? 44  SER X C   1 
ATOM   350  O O   . SER A 1 44  ? -33.470 10.968 -27.884 1.00 15.18 ? 44  SER X O   1 
ATOM   351  C CB  . SER A 1 44  ? -36.408 9.497  -27.484 1.00 15.93 ? 44  SER X CB  1 
ATOM   352  O OG  . SER A 1 44  ? -36.623 10.587 -28.366 1.00 18.42 ? 44  SER X OG  1 
ATOM   353  N N   . GLU A 1 45  ? -34.026 10.521 -25.744 1.00 14.51 ? 45  GLU X N   1 
ATOM   354  C CA  . GLU A 1 45  ? -33.176 11.565 -25.164 1.00 14.48 ? 45  GLU X CA  1 
ATOM   355  C C   . GLU A 1 45  ? -31.694 11.318 -25.476 1.00 14.10 ? 45  GLU X C   1 
ATOM   356  O O   . GLU A 1 45  ? -30.957 12.260 -25.790 1.00 14.42 ? 45  GLU X O   1 
ATOM   357  C CB  . GLU A 1 45  ? -33.400 11.672 -23.655 1.00 13.99 ? 45  GLU X CB  1 
ATOM   358  C CG  . GLU A 1 45  ? -34.749 12.256 -23.260 1.00 15.05 ? 45  GLU X CG  1 
ATOM   359  C CD  . GLU A 1 45  ? -34.947 13.671 -23.779 1.00 15.83 ? 45  GLU X CD  1 
ATOM   360  O OE1 . GLU A 1 45  ? -34.062 14.532 -23.580 1.00 17.12 ? 45  GLU X OE1 1 
ATOM   361  O OE2 . GLU A 1 45  ? -35.999 13.934 -24.388 1.00 18.03 ? 45  GLU X OE2 1 
ATOM   362  N N   . LEU A 1 46  ? -31.283 10.052 -25.408 1.00 13.53 ? 46  LEU X N   1 
ATOM   363  C CA  . LEU A 1 46  ? -29.916 9.651  -25.738 1.00 13.72 ? 46  LEU X CA  1 
ATOM   364  C C   . LEU A 1 46  ? -29.559 9.966  -27.193 1.00 13.86 ? 46  LEU X C   1 
ATOM   365  O O   . LEU A 1 46  ? -28.505 10.551 -27.470 1.00 13.81 ? 46  LEU X O   1 
ATOM   366  C CB  . LEU A 1 46  ? -29.707 8.154  -25.474 1.00 13.42 ? 46  LEU X CB  1 
ATOM   367  C CG  . LEU A 1 46  ? -28.286 7.622  -25.710 1.00 13.73 ? 46  LEU X CG  1 
ATOM   368  C CD1 . LEU A 1 46  ? -27.260 8.415  -24.896 1.00 13.13 ? 46  LEU X CD1 1 
ATOM   369  C CD2 . LEU A 1 46  ? -28.209 6.145  -25.377 1.00 13.49 ? 46  LEU X CD2 1 
ATOM   370  N N   . ASP A 1 47  ? -30.432 9.561  -28.110 1.00 13.76 ? 47  ASP X N   1 
ATOM   371  C CA  . ASP A 1 47  ? -30.211 9.770  -29.541 1.00 14.45 ? 47  ASP X CA  1 
ATOM   372  C C   . ASP A 1 47  ? -30.102 11.252 -29.870 1.00 14.35 ? 47  ASP X C   1 
ATOM   373  O O   . ASP A 1 47  ? -29.236 11.656 -30.655 1.00 14.65 ? 47  ASP X O   1 
ATOM   374  C CB  . ASP A 1 47  ? -31.337 9.130  -30.367 1.00 14.43 ? 47  ASP X CB  1 
ATOM   375  C CG  . ASP A 1 47  ? -31.326 7.611  -30.306 1.00 15.65 ? 47  ASP X CG  1 
ATOM   376  O OD1 . ASP A 1 47  ? -30.347 7.018  -29.802 1.00 17.27 ? 47  ASP X OD1 1 
ATOM   377  O OD2 . ASP A 1 47  ? -32.310 7.005  -30.780 1.00 16.53 ? 47  ASP X OD2 1 
ATOM   378  N N   . LYS A 1 48  ? -30.986 12.039 -29.255 1.00 14.15 ? 48  LYS X N   1 
ATOM   379  C CA  . LYS A 1 48  ? -31.012 13.500 -29.366 1.00 14.00 ? 48  LYS X CA  1 
ATOM   380  C C   . LYS A 1 48  ? -29.704 14.142 -28.857 1.00 13.97 ? 48  LYS X C   1 
ATOM   381  O O   . LYS A 1 48  ? -29.141 15.026 -29.510 1.00 13.74 ? 48  LYS X O   1 
ATOM   382  C CB  . LYS A 1 48  ? -32.246 14.043 -28.615 1.00 13.74 ? 48  LYS X CB  1 
ATOM   383  C CG  . LYS A 1 48  ? -32.389 15.566 -28.571 1.00 14.42 ? 48  LYS X CG  1 
ATOM   384  C CD  . LYS A 1 48  ? -33.785 16.013 -28.122 1.00 14.05 ? 48  LYS X CD  1 
ATOM   385  C CE  . LYS A 1 48  ? -34.146 15.547 -26.725 1.00 14.45 ? 48  LYS X CE  1 
ATOM   386  N NZ  . LYS A 1 48  ? -33.642 16.467 -25.695 1.00 14.16 ? 48  LYS X NZ  1 
ATOM   387  N N   . ALA A 1 49  ? -29.219 13.672 -27.709 1.00 14.15 ? 49  ALA X N   1 
ATOM   388  C CA  . ALA A 1 49  ? -27.969 14.158 -27.115 1.00 14.43 ? 49  ALA X CA  1 
ATOM   389  C C   . ALA A 1 49  ? -26.724 13.816 -27.948 1.00 15.03 ? 49  ALA X C   1 
ATOM   390  O O   . ALA A 1 49  ? -25.813 14.645 -28.069 1.00 15.40 ? 49  ALA X O   1 
ATOM   391  C CB  . ALA A 1 49  ? -27.815 13.649 -25.677 1.00 14.28 ? 49  ALA X CB  1 
ATOM   392  N N   . ILE A 1 50  ? -26.707 12.620 -28.535 1.00 15.22 ? 50  ILE X N   1 
ATOM   393  C CA  . ILE A 1 50  ? -25.560 12.123 -29.313 1.00 16.09 ? 50  ILE X CA  1 
ATOM   394  C C   . ILE A 1 50  ? -25.603 12.508 -30.802 1.00 16.50 ? 50  ILE X C   1 
ATOM   395  O O   . ILE A 1 50  ? -24.558 12.645 -31.452 1.00 16.60 ? 50  ILE X O   1 
ATOM   396  C CB  . ILE A 1 50  ? -25.449 10.568 -29.190 1.00 15.89 ? 50  ILE X CB  1 
ATOM   397  C CG1 . ILE A 1 50  ? -25.346 10.141 -27.714 1.00 16.57 ? 50  ILE X CG1 1 
ATOM   398  C CG2 . ILE A 1 50  ? -24.290 10.027 -30.023 1.00 16.13 ? 50  ILE X CG2 1 
ATOM   399  C CD1 . ILE A 1 50  ? -24.160 10.708 -26.943 1.00 18.43 ? 50  ILE X CD1 1 
ATOM   400  N N   . GLY A 1 51  ? -26.810 12.660 -31.337 1.00 17.06 ? 51  GLY X N   1 
ATOM   401  C CA  . GLY A 1 51  ? -26.993 13.025 -32.740 1.00 17.67 ? 51  GLY X CA  1 
ATOM   402  C C   . GLY A 1 51  ? -27.028 11.838 -33.694 1.00 18.39 ? 51  GLY X C   1 
ATOM   403  O O   . GLY A 1 51  ? -26.791 11.997 -34.887 1.00 18.57 ? 51  GLY X O   1 
ATOM   404  N N   . ARG A 1 52  ? -27.305 10.648 -33.167 1.00 18.49 ? 52  ARG X N   1 
ATOM   405  C CA  . ARG A 1 52  ? -27.469 9.442  -33.986 1.00 18.83 ? 52  ARG X CA  1 
ATOM   406  C C   . ARG A 1 52  ? -28.352 8.442  -33.254 1.00 18.83 ? 52  ARG X C   1 
ATOM   407  O O   . ARG A 1 52  ? -28.600 8.593  -32.063 1.00 18.11 ? 52  ARG X O   1 
ATOM   408  C CB  . ARG A 1 52  ? -26.120 8.797  -34.313 1.00 18.91 ? 52  ARG X CB  1 
ATOM   409  C CG  . ARG A 1 52  ? -25.377 8.273  -33.090 1.00 19.95 ? 52  ARG X CG  1 
ATOM   410  C CD  . ARG A 1 52  ? -24.065 7.620  -33.450 1.00 20.40 ? 52  ARG X CD  1 
ATOM   411  N NE  . ARG A 1 52  ? -23.419 7.070  -32.261 1.00 20.28 ? 52  ARG X NE  1 
ATOM   412  C CZ  . ARG A 1 52  ? -23.625 5.846  -31.791 1.00 19.74 ? 52  ARG X CZ  1 
ATOM   413  N NH1 . ARG A 1 52  ? -24.458 5.010  -32.409 1.00 19.24 ? 52  ARG X NH1 1 
ATOM   414  N NH2 . ARG A 1 52  ? -22.983 5.454  -30.704 1.00 20.75 ? 52  ARG X NH2 1 
ATOM   415  N N   . ASN A 1 53  ? -28.819 7.425  -33.976 1.00 18.83 ? 53  ASN X N   1 
ATOM   416  C CA  . ASN A 1 53  ? -29.615 6.368  -33.383 1.00 19.14 ? 53  ASN X CA  1 
ATOM   417  C C   . ASN A 1 53  ? -28.696 5.369  -32.690 1.00 19.12 ? 53  ASN X C   1 
ATOM   418  O O   . ASN A 1 53  ? -28.040 4.561  -33.344 1.00 19.27 ? 53  ASN X O   1 
ATOM   419  C CB  . ASN A 1 53  ? -30.479 5.687  -34.450 0.50 19.20 ? 53  ASN X CB  1 
ATOM   420  C CG  . ASN A 1 53  ? -31.720 5.051  -33.867 0.50 19.24 ? 53  ASN X CG  1 
ATOM   421  O OD1 . ASN A 1 53  ? -32.822 5.574  -34.021 0.50 20.50 ? 53  ASN X OD1 1 
ATOM   422  N ND2 . ASN A 1 53  ? -31.548 3.932  -33.177 0.50 18.50 ? 53  ASN X ND2 1 
ATOM   423  N N   . THR A 1 54  ? -28.641 5.448  -31.363 1.00 19.26 ? 54  THR X N   1 
ATOM   424  C CA  . THR A 1 54  ? -27.662 4.702  -30.574 1.00 19.54 ? 54  THR X CA  1 
ATOM   425  C C   . THR A 1 54  ? -28.114 3.301  -30.150 1.00 20.08 ? 54  THR X C   1 
ATOM   426  O O   . THR A 1 54  ? -27.275 2.430  -29.888 1.00 20.72 ? 54  THR X O   1 
ATOM   427  C CB  . THR A 1 54  ? -27.297 5.451  -29.281 1.00 19.29 ? 54  THR X CB  1 
ATOM   428  O OG1 . THR A 1 54  ? -28.465 5.563  -28.454 1.00 19.21 ? 54  THR X OG1 1 
ATOM   429  C CG2 . THR A 1 54  ? -26.733 6.838  -29.588 1.00 19.13 ? 54  THR X CG2 1 
ATOM   430  N N   . ASN A 1 55  ? -29.425 3.102  -30.052 1.00 20.27 ? 55  ASN X N   1 
ATOM   431  C CA  . ASN A 1 55  ? -30.015 1.893  -29.464 0.50 20.41 ? 55  ASN X CA  1 
ATOM   432  C C   . ASN A 1 55  ? -29.456 1.589  -28.064 1.00 20.59 ? 55  ASN X C   1 
ATOM   433  O O   . ASN A 1 55  ? -29.086 0.446  -27.754 1.00 21.11 ? 55  ASN X O   1 
ATOM   434  C CB  . ASN A 1 55  ? -29.870 0.686  -30.403 0.50 20.40 ? 55  ASN X CB  1 
ATOM   435  C CG  . ASN A 1 55  ? -30.903 -0.406 -30.135 0.50 20.12 ? 55  ASN X CG  1 
ATOM   436  O OD1 . ASN A 1 55  ? -31.775 -0.275 -29.272 0.50 20.03 ? 55  ASN X OD1 1 
ATOM   437  N ND2 . ASN A 1 55  ? -30.808 -1.488 -30.885 0.50 20.66 ? 55  ASN X ND2 1 
ATOM   438  N N   . GLY A 1 56  ? -29.369 2.637  -27.245 1.00 20.28 ? 56  GLY X N   1 
ATOM   439  C CA  . GLY A 1 56  ? -29.005 2.523  -25.834 1.00 19.84 ? 56  GLY X CA  1 
ATOM   440  C C   . GLY A 1 56  ? -27.547 2.295  -25.502 1.00 19.38 ? 56  GLY X C   1 
ATOM   441  O O   . GLY A 1 56  ? -27.218 2.066  -24.343 1.00 19.41 ? 56  GLY X O   1 
ATOM   442  N N   . VAL A 1 57  ? -26.678 2.347  -26.513 1.00 19.08 ? 57  VAL X N   1 
ATOM   443  C CA  . VAL A 1 57  ? -25.247 2.094  -26.347 1.00 18.81 ? 57  VAL X CA  1 
ATOM   444  C C   . VAL A 1 57  ? -24.442 3.233  -26.971 1.00 18.40 ? 57  VAL X C   1 
ATOM   445  O O   . VAL A 1 57  ? -24.734 3.671  -28.092 1.00 18.22 ? 57  VAL X O   1 
ATOM   446  C CB  . VAL A 1 57  ? -24.814 0.730  -26.967 1.00 19.08 ? 57  VAL X CB  1 
ATOM   447  C CG1 . VAL A 1 57  ? -23.357 0.440  -26.683 1.00 19.94 ? 57  VAL X CG1 1 
ATOM   448  C CG2 . VAL A 1 57  ? -25.678 -0.424 -26.425 1.00 19.55 ? 57  VAL X CG2 1 
ATOM   449  N N   . ILE A 1 58  ? -23.448 3.722  -26.227 1.00 17.63 ? 58  ILE X N   1 
ATOM   450  C CA  . ILE A 1 58  ? -22.529 4.761  -26.713 1.00 16.99 ? 58  ILE X CA  1 
ATOM   451  C C   . ILE A 1 58  ? -21.056 4.369  -26.513 1.00 16.64 ? 58  ILE X C   1 
ATOM   452  O O   . ILE A 1 58  ? -20.738 3.431  -25.775 1.00 16.59 ? 58  ILE X O   1 
ATOM   453  C CB  . ILE A 1 58  ? -22.813 6.152  -26.060 1.00 16.85 ? 58  ILE X CB  1 
ATOM   454  C CG1 . ILE A 1 58  ? -22.605 6.103  -24.537 1.00 17.06 ? 58  ILE X CG1 1 
ATOM   455  C CG2 . ILE A 1 58  ? -24.219 6.651  -26.439 1.00 16.95 ? 58  ILE X CG2 1 
ATOM   456  C CD1 . ILE A 1 58  ? -22.521 7.460  -23.860 1.00 16.32 ? 58  ILE X CD1 1 
ATOM   457  N N   . THR A 1 59  ? -20.160 5.099  -27.167 1.00 15.75 ? 59  THR X N   1 
ATOM   458  C CA  . THR A 1 59  ? -18.735 4.871  -27.015 1.00 15.57 ? 59  THR X CA  1 
ATOM   459  C C   . THR A 1 59  ? -18.174 5.690  -25.840 1.00 15.43 ? 59  THR X C   1 
ATOM   460  O O   . THR A 1 59  ? -18.865 6.562  -25.290 1.00 15.39 ? 59  THR X O   1 
ATOM   461  C CB  . THR A 1 59  ? -17.970 5.205  -28.317 1.00 15.43 ? 59  THR X CB  1 
ATOM   462  O OG1 . THR A 1 59  ? -18.036 6.613  -28.552 1.00 14.84 ? 59  THR X OG1 1 
ATOM   463  C CG2 . THR A 1 59  ? -18.574 4.455  -29.526 1.00 15.12 ? 59  THR X CG2 1 
ATOM   464  N N   . LYS A 1 60  ? -16.932 5.398  -25.458 1.00 15.16 ? 60  LYS X N   1 
ATOM   465  C CA  . LYS A 1 60  ? -16.247 6.131  -24.387 1.00 15.11 ? 60  LYS X CA  1 
ATOM   466  C C   . LYS A 1 60  ? -16.041 7.598  -24.753 1.00 14.85 ? 60  LYS X C   1 
ATOM   467  O O   . LYS A 1 60  ? -16.233 8.475  -23.913 1.00 14.23 ? 60  LYS X O   1 
ATOM   468  C CB  . LYS A 1 60  ? -14.900 5.484  -24.052 1.00 15.28 ? 60  LYS X CB  1 
ATOM   469  C CG  . LYS A 1 60  ? -14.283 5.992  -22.757 1.00 15.93 ? 60  LYS X CG  1 
ATOM   470  C CD  . LYS A 1 60  ? -12.971 5.292  -22.435 1.00 17.70 ? 60  LYS X CD  1 
ATOM   471  C CE  . LYS A 1 60  ? -12.310 5.887  -21.199 1.00 18.45 ? 60  LYS X CE  1 
ATOM   472  N N   . ASP A 1 61  ? -15.659 7.853  -26.007 1.00 14.61 ? 61  ASP X N   1 
ATOM   473  C CA  . ASP A 1 61  ? -15.512 9.219  -26.513 1.00 14.80 ? 61  ASP X CA  1 
ATOM   474  C C   . ASP A 1 61  ? -16.824 9.986  -26.411 1.00 14.29 ? 61  ASP X C   1 
ATOM   475  O O   . ASP A 1 61  ? -16.843 11.154 -25.997 1.00 14.29 ? 61  ASP X O   1 
ATOM   476  C CB  . ASP A 1 61  ? -15.015 9.221  -27.964 1.00 15.22 ? 61  ASP X CB  1 
ATOM   477  C CG  . ASP A 1 61  ? -13.538 8.878  -28.079 1.00 17.99 ? 61  ASP X CG  1 
ATOM   478  O OD1 . ASP A 1 61  ? -12.898 8.600  -27.038 1.00 20.00 ? 61  ASP X OD1 1 
ATOM   479  O OD2 . ASP A 1 61  ? -13.007 8.905  -29.215 1.00 19.81 ? 61  ASP X OD2 1 
ATOM   480  N N   . GLU A 1 62  ? -17.918 9.331  -26.794 1.00 13.83 ? 62  GLU X N   1 
ATOM   481  C CA  . GLU A 1 62  ? -19.235 9.955  -26.743 1.00 13.31 ? 62  GLU X CA  1 
ATOM   482  C C   . GLU A 1 62  ? -19.621 10.245 -25.291 1.00 13.03 ? 62  GLU X C   1 
ATOM   483  O O   . GLU A 1 62  ? -20.172 11.302 -24.993 1.00 13.22 ? 62  GLU X O   1 
ATOM   484  C CB  . GLU A 1 62  ? -20.283 9.079  -27.430 1.00 12.98 ? 62  GLU X CB  1 
ATOM   485  C CG  . GLU A 1 62  ? -20.117 8.995  -28.950 1.00 13.63 ? 62  GLU X CG  1 
ATOM   486  C CD  . GLU A 1 62  ? -21.055 7.991  -29.609 1.00 13.87 ? 62  GLU X CD  1 
ATOM   487  O OE1 . GLU A 1 62  ? -21.479 7.005  -28.960 1.00 13.19 ? 62  GLU X OE1 1 
ATOM   488  O OE2 . GLU A 1 62  ? -21.346 8.175  -30.801 1.00 15.56 ? 62  GLU X OE2 1 
ATOM   489  N N   . ALA A 1 63  ? -19.313 9.309  -24.396 1.00 12.77 ? 63  ALA X N   1 
ATOM   490  C CA  . ALA A 1 63  ? -19.566 9.495  -22.968 1.00 12.57 ? 63  ALA X CA  1 
ATOM   491  C C   . ALA A 1 63  ? -18.788 10.699 -22.408 1.00 12.29 ? 63  ALA X C   1 
ATOM   492  O O   . ALA A 1 63  ? -19.344 11.526 -21.668 1.00 12.05 ? 63  ALA X O   1 
ATOM   493  C CB  . ALA A 1 63  ? -19.232 8.226  -22.208 1.00 12.53 ? 63  ALA X CB  1 
ATOM   494  N N   . GLU A 1 64  ? -17.515 10.806 -22.785 1.00 11.53 ? 64  GLU X N   1 
ATOM   495  C CA  . GLU A 1 64  ? -16.661 11.901 -22.331 1.00 11.52 ? 64  GLU X CA  1 
ATOM   496  C C   . GLU A 1 64  ? -17.115 13.247 -22.908 1.00 11.26 ? 64  GLU X C   1 
ATOM   497  O O   . GLU A 1 64  ? -17.036 14.279 -22.234 1.00 11.17 ? 64  GLU X O   1 
ATOM   498  C CB  . GLU A 1 64  ? -15.192 11.604 -22.659 1.00 11.69 ? 64  GLU X CB  1 
ATOM   499  C CG  . GLU A 1 64  ? -14.619 10.525 -21.740 1.00 13.32 ? 64  GLU X CG  1 
ATOM   500  C CD  . GLU A 1 64  ? -13.241 10.040 -22.143 1.00 16.97 ? 64  GLU X CD  1 
ATOM   501  O OE1 . GLU A 1 64  ? -12.789 10.336 -23.274 1.00 19.06 ? 64  GLU X OE1 1 
ATOM   502  O OE2 . GLU A 1 64  ? -12.620 9.337  -21.321 1.00 19.01 ? 64  GLU X OE2 1 
ATOM   503  N N   . LYS A 1 65  ? -17.623 13.219 -24.136 1.00 10.97 ? 65  LYS X N   1 
ATOM   504  C CA  . LYS A 1 65  ? -18.184 14.425 -24.752 1.00 11.40 ? 65  LYS X CA  1 
ATOM   505  C C   . LYS A 1 65  ? -19.389 14.948 -23.962 1.00 11.36 ? 65  LYS X C   1 
ATOM   506  O O   . LYS A 1 65  ? -19.453 16.140 -23.646 1.00 11.12 ? 65  LYS X O   1 
ATOM   507  C CB  . LYS A 1 65  ? -18.544 14.168 -26.217 1.00 11.43 ? 65  LYS X CB  1 
ATOM   508  C CG  . LYS A 1 65  ? -19.062 15.397 -26.961 1.00 12.47 ? 65  LYS X CG  1 
ATOM   509  C CD  . LYS A 1 65  ? -19.289 15.045 -28.426 1.00 15.08 ? 65  LYS X CD  1 
ATOM   510  C CE  . LYS A 1 65  ? -19.959 16.171 -29.207 1.00 16.68 ? 65  LYS X CE  1 
ATOM   511  N NZ  . LYS A 1 65  ? -19.038 17.319 -29.470 1.00 15.16 ? 65  LYS X NZ  1 
ATOM   512  N N   . LEU A 1 66  ? -20.336 14.066 -23.623 1.00 11.64 ? 66  LEU X N   1 
ATOM   513  C CA  . LEU A 1 66  ? -21.493 14.493 -22.821 1.00 11.37 ? 66  LEU X CA  1 
ATOM   514  C C   . LEU A 1 66  ? -21.044 14.988 -21.450 1.00 11.36 ? 66  LEU X C   1 
ATOM   515  O O   . LEU A 1 66  ? -21.568 15.980 -20.930 1.00 11.21 ? 66  LEU X O   1 
ATOM   516  C CB  . LEU A 1 66  ? -22.502 13.362 -22.645 1.00 11.50 ? 66  LEU X CB  1 
ATOM   517  C CG  . LEU A 1 66  ? -23.232 12.812 -23.871 1.00 11.67 ? 66  LEU X CG  1 
ATOM   518  C CD1 . LEU A 1 66  ? -24.239 11.770 -23.412 1.00 12.90 ? 66  LEU X CD1 1 
ATOM   519  C CD2 . LEU A 1 66  ? -23.918 13.935 -24.676 1.00 12.09 ? 66  LEU X CD2 1 
ATOM   520  N N   . PHE A 1 67  ? -20.068 14.288 -20.879 1.00 11.36 ? 67  PHE X N   1 
ATOM   521  C CA  . PHE A 1 67  ? -19.503 14.638 -19.572 1.00 11.85 ? 67  PHE X CA  1 
ATOM   522  C C   . PHE A 1 67  ? -18.919 16.053 -19.558 1.00 12.09 ? 67  PHE X C   1 
ATOM   523  O O   . PHE A 1 67  ? -19.182 16.829 -18.638 1.00 12.05 ? 67  PHE X O   1 
ATOM   524  C CB  . PHE A 1 67  ? -18.442 13.607 -19.162 1.00 11.54 ? 67  PHE X CB  1 
ATOM   525  C CG  . PHE A 1 67  ? -17.858 13.832 -17.785 1.00 11.62 ? 67  PHE X CG  1 
ATOM   526  C CD1 . PHE A 1 67  ? -18.684 14.116 -16.691 1.00 10.99 ? 67  PHE X CD1 1 
ATOM   527  C CD2 . PHE A 1 67  ? -16.482 13.713 -17.575 1.00 11.41 ? 67  PHE X CD2 1 
ATOM   528  C CE1 . PHE A 1 67  ? -18.146 14.297 -15.409 1.00 11.36 ? 67  PHE X CE1 1 
ATOM   529  C CE2 . PHE A 1 67  ? -15.935 13.893 -16.303 1.00 12.83 ? 67  PHE X CE2 1 
ATOM   530  C CZ  . PHE A 1 67  ? -16.776 14.185 -15.216 1.00 11.55 ? 67  PHE X CZ  1 
ATOM   531  N N   . ASN A 1 68  ? -18.140 16.392 -20.583 1.00 12.64 ? 68  ASN X N   1 
ATOM   532  C CA  . ASN A 1 68  ? -17.579 17.739 -20.697 1.00 13.02 ? 68  ASN X CA  1 
ATOM   533  C C   . ASN A 1 68  ? -18.682 18.798 -20.790 1.00 12.79 ? 68  ASN X C   1 
ATOM   534  O O   . ASN A 1 68  ? -18.597 19.853 -20.164 1.00 12.72 ? 68  ASN X O   1 
ATOM   535  C CB  . ASN A 1 68  ? -16.633 17.829 -21.898 1.00 13.69 ? 68  ASN X CB  1 
ATOM   536  C CG  . ASN A 1 68  ? -15.740 19.078 -21.868 1.00 15.94 ? 68  ASN X CG  1 
ATOM   537  O OD1 . ASN A 1 68  ? -16.013 20.054 -21.154 1.00 19.21 ? 68  ASN X OD1 1 
ATOM   538  N ND2 . ASN A 1 68  ? -14.675 19.056 -22.664 1.00 19.38 ? 68  ASN X ND2 1 
ATOM   539  N N   . GLN A 1 69  ? -19.719 18.500 -21.570 1.00 12.02 ? 69  GLN X N   1 
ATOM   540  C CA  . GLN A 1 69  ? -20.845 19.403 -21.728 1.00 11.53 ? 69  GLN X CA  1 
ATOM   541  C C   . GLN A 1 69  ? -21.562 19.611 -20.403 1.00 11.34 ? 69  GLN X C   1 
ATOM   542  O O   . GLN A 1 69  ? -21.885 20.735 -20.054 1.00 10.86 ? 69  GLN X O   1 
ATOM   543  C CB  . GLN A 1 69  ? -21.813 18.863 -22.781 1.00 11.53 ? 69  GLN X CB  1 
ATOM   544  C CG  . GLN A 1 69  ? -21.215 18.877 -24.172 1.00 10.87 ? 69  GLN X CG  1 
ATOM   545  C CD  . GLN A 1 69  ? -22.160 18.431 -25.260 1.00 11.23 ? 69  GLN X CD  1 
ATOM   546  O OE1 . GLN A 1 69  ? -21.872 18.628 -26.438 1.00 10.95 ? 69  GLN X OE1 1 
ATOM   547  N NE2 . GLN A 1 69  ? -23.286 17.822 -24.885 1.00 12.28 ? 69  GLN X NE2 1 
ATOM   548  N N   . ASP A 1 70  ? -21.773 18.514 -19.669 1.00 11.57 ? 70  ASP X N   1 
ATOM   549  C CA  . ASP A 1 70  ? -22.459 18.517 -18.382 1.00 11.96 ? 70  ASP X CA  1 
ATOM   550  C C   . ASP A 1 70  ? -21.699 19.277 -17.294 1.00 12.30 ? 70  ASP X C   1 
ATOM   551  O O   . ASP A 1 70  ? -22.311 20.030 -16.524 1.00 12.64 ? 70  ASP X O   1 
ATOM   552  C CB  . ASP A 1 70  ? -22.736 17.080 -17.914 1.00 11.48 ? 70  ASP X CB  1 
ATOM   553  C CG  . ASP A 1 70  ? -23.757 16.359 -18.782 1.00 12.55 ? 70  ASP X CG  1 
ATOM   554  O OD1 . ASP A 1 70  ? -24.461 17.013 -19.583 1.00 12.03 ? 70  ASP X OD1 1 
ATOM   555  O OD2 . ASP A 1 70  ? -23.858 15.121 -18.658 1.00 12.94 ? 70  ASP X OD2 1 
ATOM   556  N N   . VAL A 1 71  ? -20.381 19.092 -17.227 1.00 12.62 ? 71  VAL X N   1 
ATOM   557  C CA  . VAL A 1 71  ? -19.552 19.868 -16.282 1.00 13.25 ? 71  VAL X CA  1 
ATOM   558  C C   . VAL A 1 71  ? -19.639 21.359 -16.630 1.00 14.02 ? 71  VAL X C   1 
ATOM   559  O O   . VAL A 1 71  ? -19.891 22.209 -15.761 1.00 13.95 ? 71  VAL X O   1 
ATOM   560  C CB  . VAL A 1 71  ? -18.071 19.392 -16.269 1.00 13.24 ? 71  VAL X CB  1 
ATOM   561  C CG1 . VAL A 1 71  ? -17.191 20.358 -15.456 1.00 12.52 ? 71  VAL X CG1 1 
ATOM   562  C CG2 . VAL A 1 71  ? -17.965 17.968 -15.709 1.00 13.27 ? 71  VAL X CG2 1 
ATOM   563  N N   . ASP A 1 72  ? -19.453 21.656 -17.915 1.00 14.75 ? 72  ASP X N   1 
ATOM   564  C CA  . ASP A 1 72  ? -19.555 23.019 -18.437 1.00 15.58 ? 72  ASP X CA  1 
ATOM   565  C C   . ASP A 1 72  ? -20.900 23.644 -18.038 1.00 15.59 ? 72  ASP X C   1 
ATOM   566  O O   . ASP A 1 72  ? -20.937 24.727 -17.454 1.00 15.44 ? 72  ASP X O   1 
ATOM   567  C CB  . ASP A 1 72  ? -19.380 22.987 -19.963 1.00 16.03 ? 72  ASP X CB  1 
ATOM   568  C CG  . ASP A 1 72  ? -18.974 24.323 -20.546 1.00 18.63 ? 72  ASP X CG  1 
ATOM   569  O OD1 . ASP A 1 72  ? -18.568 25.224 -19.784 1.00 22.38 ? 72  ASP X OD1 1 
ATOM   570  O OD2 . ASP A 1 72  ? -19.063 24.473 -21.785 1.00 20.91 ? 72  ASP X OD2 1 
ATOM   571  N N   . ALA A 1 73  ? -21.991 22.937 -18.333 1.00 15.83 ? 73  ALA X N   1 
ATOM   572  C CA  . ALA A 1 73  ? -23.347 23.353 -17.963 1.00 16.16 ? 73  ALA X CA  1 
ATOM   573  C C   . ALA A 1 73  ? -23.546 23.621 -16.465 1.00 16.14 ? 73  ALA X C   1 
ATOM   574  O O   . ALA A 1 73  ? -24.214 24.595 -16.087 1.00 16.19 ? 73  ALA X O   1 
ATOM   575  C CB  . ALA A 1 73  ? -24.382 22.320 -18.467 1.00 16.38 ? 73  ALA X CB  1 
ATOM   576  N N   . ALA A 1 74  ? -22.989 22.755 -15.621 1.00 15.97 ? 74  ALA X N   1 
ATOM   577  C CA  . ALA A 1 74  ? -23.107 22.903 -14.164 1.00 15.51 ? 74  ALA X CA  1 
ATOM   578  C C   . ALA A 1 74  ? -22.433 24.189 -13.661 1.00 15.73 ? 74  ALA X C   1 
ATOM   579  O O   . ALA A 1 74  ? -23.021 24.944 -12.877 1.00 15.25 ? 74  ALA X O   1 
ATOM   580  C CB  . ALA A 1 74  ? -22.539 21.682 -13.466 1.00 15.43 ? 74  ALA X CB  1 
ATOM   581  N N   . VAL A 1 75  ? -21.204 24.432 -14.119 1.00 15.79 ? 75  VAL X N   1 
ATOM   582  C CA  . VAL A 1 75  ? -20.481 25.672 -13.808 1.00 16.44 ? 75  VAL X CA  1 
ATOM   583  C C   . VAL A 1 75  ? -21.258 26.891 -14.304 1.00 16.75 ? 75  VAL X C   1 
ATOM   584  O O   . VAL A 1 75  ? -21.508 27.824 -13.542 1.00 16.48 ? 75  VAL X O   1 
ATOM   585  C CB  . VAL A 1 75  ? -19.060 25.691 -14.434 1.00 16.71 ? 75  VAL X CB  1 
ATOM   586  C CG1 . VAL A 1 75  ? -18.315 27.001 -14.066 1.00 17.29 ? 75  VAL X CG1 1 
ATOM   587  C CG2 . VAL A 1 75  ? -18.267 24.489 -13.986 1.00 16.13 ? 75  VAL X CG2 1 
ATOM   588  N N   . ARG A 1 76  ? -21.640 26.873 -15.580 1.00 17.29 ? 76  ARG X N   1 
ATOM   589  C CA  . ARG A 1 76  ? -22.341 28.012 -16.174 1.00 18.41 ? 76  ARG X CA  1 
ATOM   590  C C   . ARG A 1 76  ? -23.657 28.291 -15.454 1.00 18.71 ? 76  ARG X C   1 
ATOM   591  O O   . ARG A 1 76  ? -24.017 29.452 -15.255 1.00 19.61 ? 76  ARG X O   1 
ATOM   592  C CB  . ARG A 1 76  ? -22.515 27.850 -17.695 1.00 18.45 ? 76  ARG X CB  1 
ATOM   593  C CG  . ARG A 1 76  ? -21.197 28.040 -18.474 0.50 19.24 ? 76  ARG X CG  1 
ATOM   594  C CD  . ARG A 1 76  ? -21.411 28.310 -19.973 0.50 20.15 ? 76  ARG X CD  1 
ATOM   595  N NE  . ARG A 1 76  ? -21.165 29.691 -20.443 0.50 20.20 ? 76  ARG X NE  1 
ATOM   596  C CZ  . ARG A 1 76  ? -21.165 30.811 -19.710 0.50 20.30 ? 76  ARG X CZ  1 
ATOM   597  N NH1 . ARG A 1 76  ? -21.402 30.796 -18.403 0.50 20.25 ? 76  ARG X NH1 1 
ATOM   598  N NH2 . ARG A 1 76  ? -20.930 31.976 -20.304 0.50 19.43 ? 76  ARG X NH2 1 
ATOM   599  N N   . GLY A 1 77  ? -24.338 27.229 -15.023 1.00 18.87 ? 77  GLY X N   1 
ATOM   600  C CA  . GLY A 1 77  ? -25.535 27.345 -14.182 1.00 18.80 ? 77  GLY X CA  1 
ATOM   601  C C   . GLY A 1 77  ? -25.299 28.018 -12.833 1.00 18.68 ? 77  GLY X C   1 
ATOM   602  O O   . GLY A 1 77  ? -26.071 28.898 -12.419 1.00 18.57 ? 77  GLY X O   1 
ATOM   603  N N   . ILE A 1 78  ? -24.236 27.600 -12.147 1.00 18.15 ? 78  ILE X N   1 
ATOM   604  C CA  . ILE A 1 78  ? -23.813 28.221 -10.896 1.00 18.12 ? 78  ILE X CA  1 
ATOM   605  C C   . ILE A 1 78  ? -23.632 29.727 -11.074 1.00 18.52 ? 78  ILE X C   1 
ATOM   606  O O   . ILE A 1 78  ? -24.160 30.515 -10.285 1.00 18.45 ? 78  ILE X O   1 
ATOM   607  C CB  . ILE A 1 78  ? -22.512 27.577 -10.345 1.00 17.68 ? 78  ILE X CB  1 
ATOM   608  C CG1 . ILE A 1 78  ? -22.820 26.206 -9.727  1.00 16.75 ? 78  ILE X CG1 1 
ATOM   609  C CG2 . ILE A 1 78  ? -21.861 28.476 -9.306  1.00 17.26 ? 78  ILE X CG2 1 
ATOM   610  C CD1 . ILE A 1 78  ? -21.592 25.314 -9.513  1.00 14.57 ? 78  ILE X CD1 1 
ATOM   611  N N   . LEU A 1 79  ? -22.911 30.117 -12.127 1.00 18.93 ? 79  LEU X N   1 
ATOM   612  C CA  . LEU A 1 79  ? -22.604 31.533 -12.374 1.00 19.51 ? 79  LEU X CA  1 
ATOM   613  C C   . LEU A 1 79  ? -23.837 32.363 -12.764 1.00 19.95 ? 79  LEU X C   1 
ATOM   614  O O   . LEU A 1 79  ? -23.863 33.579 -12.546 1.00 20.11 ? 79  LEU X O   1 
ATOM   615  C CB  . LEU A 1 79  ? -21.470 31.686 -13.406 1.00 19.65 ? 79  LEU X CB  1 
ATOM   616  C CG  . LEU A 1 79  ? -20.144 30.956 -13.128 1.00 19.99 ? 79  LEU X CG  1 
ATOM   617  C CD1 . LEU A 1 79  ? -19.157 31.123 -14.279 1.00 22.00 ? 79  LEU X CD1 1 
ATOM   618  C CD2 . LEU A 1 79  ? -19.504 31.389 -11.810 1.00 20.13 ? 79  LEU X CD2 1 
ATOM   619  N N   . ARG A 1 80  ? -24.862 31.705 -13.309 1.00 19.85 ? 80  ARG X N   1 
ATOM   620  C CA  . ARG A 1 80  ? -26.106 32.391 -13.655 1.00 20.16 ? 80  ARG X CA  1 
ATOM   621  C C   . ARG A 1 80  ? -27.081 32.443 -12.492 1.00 20.16 ? 80  ARG X C   1 
ATOM   622  O O   . ARG A 1 80  ? -28.079 33.164 -12.552 1.00 20.06 ? 80  ARG X O   1 
ATOM   623  C CB  . ARG A 1 80  ? -26.768 31.737 -14.867 1.00 20.22 ? 80  ARG X CB  1 
ATOM   624  C CG  . ARG A 1 80  ? -26.210 32.253 -16.160 1.00 22.00 ? 80  ARG X CG  1 
ATOM   625  C CD  . ARG A 1 80  ? -26.556 31.348 -17.322 1.00 24.90 ? 80  ARG X CD  1 
ATOM   626  N NE  . ARG A 1 80  ? -25.757 31.732 -18.480 1.00 26.24 ? 80  ARG X NE  1 
ATOM   627  C CZ  . ARG A 1 80  ? -25.283 30.886 -19.386 1.00 27.66 ? 80  ARG X CZ  1 
ATOM   628  N NH1 . ARG A 1 80  ? -25.519 29.584 -19.279 1.00 28.25 ? 80  ARG X NH1 1 
ATOM   629  N NH2 . ARG A 1 80  ? -24.562 31.351 -20.404 1.00 30.10 ? 80  ARG X NH2 1 
ATOM   630  N N   . ASN A 1 81  ? -26.792 31.675 -11.441 1.00 19.59 ? 81  ASN X N   1 
ATOM   631  C CA  . ASN A 1 81  ? -27.654 31.613 -10.276 1.00 19.33 ? 81  ASN X CA  1 
ATOM   632  C C   . ASN A 1 81  ? -27.279 32.680 -9.254  1.00 19.04 ? 81  ASN X C   1 
ATOM   633  O O   . ASN A 1 81  ? -26.149 32.717 -8.765  1.00 19.19 ? 81  ASN X O   1 
ATOM   634  C CB  . ASN A 1 81  ? -27.619 30.212 -9.650  1.00 19.52 ? 81  ASN X CB  1 
ATOM   635  C CG  . ASN A 1 81  ? -28.729 29.995 -8.633  1.00 19.76 ? 81  ASN X CG  1 
ATOM   636  O OD1 . ASN A 1 81  ? -28.744 30.609 -7.563  1.00 20.98 ? 81  ASN X OD1 1 
ATOM   637  N ND2 . ASN A 1 81  ? -29.655 29.099 -8.954  1.00 19.70 ? 81  ASN X ND2 1 
ATOM   638  N N   . ALA A 1 82  ? -28.240 33.538 -8.928  1.00 18.56 ? 82  ALA X N   1 
ATOM   639  C CA  . ALA A 1 82  ? -28.015 34.663 -8.017  1.00 18.37 ? 82  ALA X CA  1 
ATOM   640  C C   . ALA A 1 82  ? -27.664 34.253 -6.587  1.00 18.09 ? 82  ALA X C   1 
ATOM   641  O O   . ALA A 1 82  ? -26.992 35.002 -5.884  1.00 18.30 ? 82  ALA X O   1 
ATOM   642  C CB  . ALA A 1 82  ? -29.225 35.600 -8.017  1.00 18.28 ? 82  ALA X CB  1 
ATOM   643  N N   . LYS A 1 83  ? -28.128 33.077 -6.159  1.00 17.99 ? 83  LYS X N   1 
ATOM   644  C CA  . LYS A 1 83  ? -27.814 32.566 -4.825  1.00 17.93 ? 83  LYS X CA  1 
ATOM   645  C C   . LYS A 1 83  ? -26.474 31.831 -4.799  1.00 17.51 ? 83  LYS X C   1 
ATOM   646  O O   . LYS A 1 83  ? -25.719 31.943 -3.832  1.00 18.38 ? 83  LYS X O   1 
ATOM   647  C CB  . LYS A 1 83  ? -28.930 31.655 -4.300  1.00 18.12 ? 83  LYS X CB  1 
ATOM   648  C CG  . LYS A 1 83  ? -30.180 32.397 -3.823  1.00 18.86 ? 83  LYS X CG  1 
ATOM   649  C CD  . LYS A 1 83  ? -31.208 31.442 -3.240  0.50 17.75 ? 83  LYS X CD  1 
ATOM   650  N N   . LEU A 1 84  ? -26.174 31.103 -5.869  1.00 16.44 ? 84  LEU X N   1 
ATOM   651  C CA  . LEU A 1 84  ? -24.972 30.273 -5.925  1.00 15.69 ? 84  LEU X CA  1 
ATOM   652  C C   . LEU A 1 84  ? -23.707 31.034 -6.286  1.00 15.00 ? 84  LEU X C   1 
ATOM   653  O O   . LEU A 1 84  ? -22.642 30.754 -5.745  1.00 14.66 ? 84  LEU X O   1 
ATOM   654  C CB  . LEU A 1 84  ? -25.160 29.096 -6.895  1.00 15.40 ? 84  LEU X CB  1 
ATOM   655  C CG  . LEU A 1 84  ? -26.309 28.128 -6.581  1.00 15.86 ? 84  LEU X CG  1 
ATOM   656  C CD1 . LEU A 1 84  ? -26.310 26.943 -7.554  1.00 16.02 ? 84  LEU X CD1 1 
ATOM   657  C CD2 . LEU A 1 84  ? -26.220 27.647 -5.138  1.00 15.94 ? 84  LEU X CD2 1 
ATOM   658  N N   . LYS A 1 85  ? -23.829 31.979 -7.212  1.00 14.83 ? 85  LYS X N   1 
ATOM   659  C CA  . LYS A 1 85  ? -22.667 32.699 -7.734  1.00 14.51 ? 85  LYS X CA  1 
ATOM   660  C C   . LYS A 1 85  ? -21.779 33.368 -6.667  1.00 14.04 ? 85  LYS X C   1 
ATOM   661  O O   . LYS A 1 85  ? -20.568 33.146 -6.669  1.00 14.30 ? 85  LYS X O   1 
ATOM   662  C CB  . LYS A 1 85  ? -23.080 33.696 -8.820  1.00 14.69 ? 85  LYS X CB  1 
ATOM   663  C CG  . LYS A 1 85  ? -21.905 34.337 -9.538  1.00 15.03 ? 85  LYS X CG  1 
ATOM   664  C CD  . LYS A 1 85  ? -22.355 35.607 -10.235 1.00 17.66 ? 85  LYS X CD  1 
ATOM   665  C CE  . LYS A 1 85  ? -21.341 36.087 -11.256 1.00 17.22 ? 85  LYS X CE  1 
ATOM   666  N NZ  . LYS A 1 85  ? -19.991 36.223 -10.666 1.00 19.19 ? 85  LYS X NZ  1 
ATOM   667  N N   . PRO A 1 86  ? -22.362 34.187 -5.762  1.00 13.73 ? 86  PRO X N   1 
ATOM   668  C CA  . PRO A 1 86  ? -21.476 34.821 -4.771  1.00 13.58 ? 86  PRO X CA  1 
ATOM   669  C C   . PRO A 1 86  ? -20.773 33.816 -3.841  1.00 13.24 ? 86  PRO X C   1 
ATOM   670  O O   . PRO A 1 86  ? -19.641 34.050 -3.423  1.00 13.64 ? 86  PRO X O   1 
ATOM   671  C CB  . PRO A 1 86  ? -22.418 35.735 -3.974  1.00 13.68 ? 86  PRO X CB  1 
ATOM   672  C CG  . PRO A 1 86  ? -23.792 35.182 -4.205  1.00 14.14 ? 86  PRO X CG  1 
ATOM   673  C CD  . PRO A 1 86  ? -23.771 34.594 -5.585  1.00 13.80 ? 86  PRO X CD  1 
ATOM   674  N N   . VAL A 1 87  ? -21.436 32.711 -3.523  1.00 12.84 ? 87  VAL X N   1 
ATOM   675  C CA  . VAL A 1 87  ? -20.830 31.693 -2.679  1.00 12.58 ? 87  VAL X CA  1 
ATOM   676  C C   . VAL A 1 87  ? -19.684 31.024 -3.448  1.00 12.41 ? 87  VAL X C   1 
ATOM   677  O O   . VAL A 1 87  ? -18.569 30.908 -2.939  1.00 11.83 ? 87  VAL X O   1 
ATOM   678  C CB  . VAL A 1 87  ? -21.872 30.663 -2.170  1.00 12.84 ? 87  VAL X CB  1 
ATOM   679  C CG1 . VAL A 1 87  ? -21.192 29.575 -1.330  1.00 12.08 ? 87  VAL X CG1 1 
ATOM   680  C CG2 . VAL A 1 87  ? -22.959 31.370 -1.340  1.00 12.58 ? 87  VAL X CG2 1 
ATOM   681  N N   . TYR A 1 88  ? -19.961 30.634 -4.691  1.00 12.10 ? 88  TYR X N   1 
ATOM   682  C CA  . TYR A 1 88  ? -18.958 30.022 -5.567  1.00 11.92 ? 88  TYR X CA  1 
ATOM   683  C C   . TYR A 1 88  ? -17.730 30.914 -5.735  1.00 12.21 ? 88  TYR X C   1 
ATOM   684  O O   . TYR A 1 88  ? -16.581 30.453 -5.612  1.00 12.20 ? 88  TYR X O   1 
ATOM   685  C CB  . TYR A 1 88  ? -19.588 29.731 -6.938  1.00 11.80 ? 88  TYR X CB  1 
ATOM   686  C CG  . TYR A 1 88  ? -18.670 29.029 -7.910  1.00 12.31 ? 88  TYR X CG  1 
ATOM   687  C CD1 . TYR A 1 88  ? -18.513 27.638 -7.874  1.00 12.83 ? 88  TYR X CD1 1 
ATOM   688  C CD2 . TYR A 1 88  ? -17.960 29.750 -8.866  1.00 12.64 ? 88  TYR X CD2 1 
ATOM   689  C CE1 . TYR A 1 88  ? -17.662 26.986 -8.773  1.00 12.92 ? 88  TYR X CE1 1 
ATOM   690  C CE2 . TYR A 1 88  ? -17.114 29.115 -9.764  1.00 14.27 ? 88  TYR X CE2 1 
ATOM   691  C CZ  . TYR A 1 88  ? -16.971 27.732 -9.713  1.00 14.31 ? 88  TYR X CZ  1 
ATOM   692  O OH  . TYR A 1 88  ? -16.124 27.110 -10.607 1.00 14.97 ? 88  TYR X OH  1 
ATOM   693  N N   . ASP A 1 89  ? -17.976 32.192 -6.014  1.00 12.06 ? 89  ASP X N   1 
ATOM   694  C CA  . ASP A 1 89  ? -16.903 33.152 -6.235  1.00 12.61 ? 89  ASP X CA  1 
ATOM   695  C C   . ASP A 1 89  ? -16.023 33.351 -5.012  1.00 12.52 ? 89  ASP X C   1 
ATOM   696  O O   . ASP A 1 89  ? -14.824 33.580 -5.155  1.00 12.59 ? 89  ASP X O   1 
ATOM   697  C CB  . ASP A 1 89  ? -17.463 34.492 -6.708  1.00 12.99 ? 89  ASP X CB  1 
ATOM   698  C CG  . ASP A 1 89  ? -17.792 34.496 -8.193  1.00 13.85 ? 89  ASP X CG  1 
ATOM   699  O OD1 . ASP A 1 89  ? -17.336 33.594 -8.921  1.00 15.50 ? 89  ASP X OD1 1 
ATOM   700  O OD2 . ASP A 1 89  ? -18.508 35.414 -8.635  1.00 16.27 ? 89  ASP X OD2 1 
ATOM   701  N N   . SER A 1 90  ? -16.619 33.228 -3.823  1.00 12.24 ? 90  SER X N   1 
ATOM   702  C CA  . SER A 1 90  ? -15.913 33.392 -2.546  1.00 11.85 ? 90  SER X CA  1 
ATOM   703  C C   . SER A 1 90  ? -14.959 32.222 -2.225  1.00 11.86 ? 90  SER X C   1 
ATOM   704  O O   . SER A 1 90  ? -14.067 32.344 -1.373  1.00 11.80 ? 90  SER X O   1 
ATOM   705  C CB  . SER A 1 90  ? -16.928 33.559 -1.411  1.00 11.74 ? 90  SER X CB  1 
ATOM   706  O OG  . SER A 1 90  ? -17.443 32.304 -0.981  1.00 10.85 ? 90  SER X OG  1 
ATOM   707  N N   . LEU A 1 91  ? -15.168 31.094 -2.904  1.00 11.36 ? 91  LEU X N   1 
ATOM   708  C CA  . LEU A 1 91  ? -14.448 29.854 -2.634  1.00 11.35 ? 91  LEU X CA  1 
ATOM   709  C C   . LEU A 1 91  ? -13.129 29.786 -3.399  1.00 11.39 ? 91  LEU X C   1 
ATOM   710  O O   . LEU A 1 91  ? -12.966 30.454 -4.430  1.00 11.47 ? 91  LEU X O   1 
ATOM   711  C CB  . LEU A 1 91  ? -15.319 28.625 -2.988  1.00 11.32 ? 91  LEU X CB  1 
ATOM   712  C CG  . LEU A 1 91  ? -16.645 28.378 -2.240  1.00 10.92 ? 91  LEU X CG  1 
ATOM   713  C CD1 . LEU A 1 91  ? -17.425 27.249 -2.909  1.00 11.69 ? 91  LEU X CD1 1 
ATOM   714  C CD2 . LEU A 1 91  ? -16.417 28.067 -0.764  1.00 10.12 ? 91  LEU X CD2 1 
ATOM   715  N N   . ASP A 1 92  ? -12.194 29.000 -2.866  1.00 10.90 ? 92  ASP X N   1 
ATOM   716  C CA  . ASP A 1 92  ? -10.968 28.569 -3.576  1.00 10.91 ? 92  ASP X CA  1 
ATOM   717  C C   . ASP A 1 92  ? -11.295 27.485 -4.606  1.00 10.48 ? 92  ASP X C   1 
ATOM   718  O O   . ASP A 1 92  ? -12.384 26.922 -4.578  1.00 9.80  ? 92  ASP X O   1 
ATOM   719  C CB  . ASP A 1 92  ? -9.987  27.954 -2.580  1.00 10.80 ? 92  ASP X CB  1 
ATOM   720  C CG  . ASP A 1 92  ? -10.599 26.789 -1.827  1.00 11.15 ? 92  ASP X CG  1 
ATOM   721  O OD1 . ASP A 1 92  ? -11.326 27.044 -0.850  1.00 12.44 ? 92  ASP X OD1 1 
ATOM   722  O OD2 . ASP A 1 92  ? -10.375 25.624 -2.226  1.00 12.06 ? 92  ASP X OD2 1 
ATOM   723  N N   . ALA A 1 93  ? -10.320 27.163 -5.461  1.00 10.35 ? 93  ALA X N   1 
ATOM   724  C CA  . ALA A 1 93  ? -10.513 26.217 -6.565  1.00 10.35 ? 93  ALA X CA  1 
ATOM   725  C C   . ALA A 1 93  ? -10.900 24.788 -6.157  1.00 10.08 ? 93  ALA X C   1 
ATOM   726  O O   . ALA A 1 93  ? -11.670 24.136 -6.864  1.00 10.19 ? 93  ALA X O   1 
ATOM   727  C CB  . ALA A 1 93  ? -9.291  26.206 -7.489  1.00 10.26 ? 93  ALA X CB  1 
ATOM   728  N N   . VAL A 1 94  ? -10.371 24.304 -5.037  1.00 10.31 ? 94  VAL X N   1 
ATOM   729  C CA  . VAL A 1 94  ? -10.696 22.942 -4.557  1.00 9.88  ? 94  VAL X CA  1 
ATOM   730  C C   . VAL A 1 94  ? -12.162 22.874 -4.114  1.00 10.24 ? 94  VAL X C   1 
ATOM   731  O O   . VAL A 1 94  ? -12.910 22.007 -4.570  1.00 9.74  ? 94  VAL X O   1 
ATOM   732  C CB  . VAL A 1 94  ? -9.712  22.423 -3.457  1.00 10.26 ? 94  VAL X CB  1 
ATOM   733  C CG1 . VAL A 1 94  ? -10.126 21.013 -2.963  1.00 9.99  ? 94  VAL X CG1 1 
ATOM   734  C CG2 . VAL A 1 94  ? -8.284  22.389 -3.992  1.00 9.57  ? 94  VAL X CG2 1 
ATOM   735  N N   . ARG A 1 95  ? -12.578 23.812 -3.264  1.00 10.16 ? 95  ARG X N   1 
ATOM   736  C CA  . ARG A 1 95  ? -13.978 23.877 -2.821  1.00 10.15 ? 95  ARG X CA  1 
ATOM   737  C C   . ARG A 1 95  ? -14.966 24.207 -3.942  1.00 10.25 ? 95  ARG X C   1 
ATOM   738  O O   . ARG A 1 95  ? -16.096 23.741 -3.916  1.00 10.27 ? 95  ARG X O   1 
ATOM   739  C CB  . ARG A 1 95  ? -14.135 24.845 -1.646  1.00 10.02 ? 95  ARG X CB  1 
ATOM   740  C CG  . ARG A 1 95  ? -13.388 24.364 -0.400  1.00 9.64  ? 95  ARG X CG  1 
ATOM   741  C CD  . ARG A 1 95  ? -13.570 25.330 0.739   1.00 10.40 ? 95  ARG X CD  1 
ATOM   742  N NE  . ARG A 1 95  ? -13.063 24.805 2.007   1.00 9.56  ? 95  ARG X NE  1 
ATOM   743  C CZ  . ARG A 1 95  ? -11.868 25.087 2.515   1.00 10.13 ? 95  ARG X CZ  1 
ATOM   744  N NH1 . ARG A 1 95  ? -11.026 25.878 1.852   1.00 10.97 ? 95  ARG X NH1 1 
ATOM   745  N NH2 . ARG A 1 95  ? -11.507 24.565 3.681   1.00 8.42  ? 95  ARG X NH2 1 
ATOM   746  N N   . ARG A 1 96  ? -14.535 25.001 -4.922  1.00 10.26 ? 96  ARG X N   1 
ATOM   747  C CA  . ARG A 1 96  ? -15.331 25.229 -6.126  1.00 10.55 ? 96  ARG X CA  1 
ATOM   748  C C   . ARG A 1 96  ? -15.687 23.920 -6.834  1.00 10.54 ? 96  ARG X C   1 
ATOM   749  O O   . ARG A 1 96  ? -16.794 23.774 -7.341  1.00 10.64 ? 96  ARG X O   1 
ATOM   750  C CB  . ARG A 1 96  ? -14.614 26.186 -7.087  1.00 10.20 ? 96  ARG X CB  1 
ATOM   751  C CG  . ARG A 1 96  ? -14.716 27.652 -6.662  1.00 10.93 ? 96  ARG X CG  1 
ATOM   752  C CD  . ARG A 1 96  ? -14.079 28.581 -7.680  1.00 12.76 ? 96  ARG X CD  1 
ATOM   753  N NE  . ARG A 1 96  ? -14.098 29.965 -7.210  1.00 13.20 ? 96  ARG X NE  1 
ATOM   754  C CZ  . ARG A 1 96  ? -13.475 30.978 -7.812  1.00 15.91 ? 96  ARG X CZ  1 
ATOM   755  N NH1 . ARG A 1 96  ? -12.761 30.777 -8.914  1.00 16.40 ? 96  ARG X NH1 1 
ATOM   756  N NH2 . ARG A 1 96  ? -13.555 32.200 -7.303  1.00 14.97 ? 96  ARG X NH2 1 
ATOM   757  N N   . ALA A 1 97  ? -14.747 22.980 -6.871  1.00 10.75 ? 97  ALA X N   1 
ATOM   758  C CA  . ALA A 1 97  ? -15.009 21.659 -7.444  1.00 11.11 ? 97  ALA X CA  1 
ATOM   759  C C   . ALA A 1 97  ? -16.077 20.894 -6.656  1.00 11.01 ? 97  ALA X C   1 
ATOM   760  O O   . ALA A 1 97  ? -16.939 20.240 -7.242  1.00 11.03 ? 97  ALA X O   1 
ATOM   761  C CB  . ALA A 1 97  ? -13.724 20.857 -7.546  1.00 11.17 ? 97  ALA X CB  1 
ATOM   762  N N   . ALA A 1 98  ? -16.033 21.013 -5.332  1.00 10.75 ? 98  ALA X N   1 
ATOM   763  C CA  . ALA A 1 98  ? -17.056 20.414 -4.472  1.00 10.46 ? 98  ALA X CA  1 
ATOM   764  C C   . ALA A 1 98  ? -18.441 20.999 -4.762  1.00 10.15 ? 98  ALA X C   1 
ATOM   765  O O   . ALA A 1 98  ? -19.434 20.267 -4.787  1.00 9.54  ? 98  ALA X O   1 
ATOM   766  C CB  . ALA A 1 98  ? -16.695 20.595 -3.009  1.00 10.25 ? 98  ALA X CB  1 
ATOM   767  N N   . ALA A 1 99  ? -18.493 22.317 -4.973  1.00 10.01 ? 99  ALA X N   1 
ATOM   768  C CA  . ALA A 1 99  ? -19.729 23.001 -5.354  1.00 10.29 ? 99  ALA X CA  1 
ATOM   769  C C   . ALA A 1 99  ? -20.259 22.520 -6.700  1.00 10.26 ? 99  ALA X C   1 
ATOM   770  O O   . ALA A 1 99  ? -21.458 22.281 -6.833  1.00 10.29 ? 99  ALA X O   1 
ATOM   771  C CB  . ALA A 1 99  ? -19.518 24.525 -5.378  1.00 10.60 ? 99  ALA X CB  1 
ATOM   772  N N   . ILE A 1 100 ? -19.372 22.385 -7.690  1.00 10.14 ? 100 ILE X N   1 
ATOM   773  C CA  . ILE A 1 100 ? -19.766 21.849 -9.004  1.00 10.20 ? 100 ILE X CA  1 
ATOM   774  C C   . ILE A 1 100 ? -20.295 20.413 -8.858  1.00 10.22 ? 100 ILE X C   1 
ATOM   775  O O   . ILE A 1 100 ? -21.354 20.083 -9.404  1.00 10.00 ? 100 ILE X O   1 
ATOM   776  C CB  . ILE A 1 100 ? -18.623 21.922 -10.062 1.00 10.42 ? 100 ILE X CB  1 
ATOM   777  C CG1 . ILE A 1 100 ? -18.188 23.378 -10.308 1.00 10.37 ? 100 ILE X CG1 1 
ATOM   778  C CG2 . ILE A 1 100 ? -19.070 21.293 -11.404 1.00 9.50  ? 100 ILE X CG2 1 
ATOM   779  C CD1 . ILE A 1 100 ? -16.728 23.515 -10.776 1.00 10.73 ? 100 ILE X CD1 1 
ATOM   780  N N   . ASN A 1 101 ? -19.575 19.585 -8.097  1.00 10.36 ? 101 ASN X N   1 
ATOM   781  C CA  . ASN A 1 101 ? -19.998 18.212 -7.820  1.00 10.34 ? 101 ASN X CA  1 
ATOM   782  C C   . ASN A 1 101 ? -21.466 18.156 -7.360  1.00 10.80 ? 101 ASN X C   1 
ATOM   783  O O   . ASN A 1 101 ? -22.275 17.428 -7.945  1.00 10.41 ? 101 ASN X O   1 
ATOM   784  C CB  . ASN A 1 101 ? -19.067 17.554 -6.792  1.00 10.02 ? 101 ASN X CB  1 
ATOM   785  C CG  . ASN A 1 101 ? -19.185 16.033 -6.776  1.00 10.07 ? 101 ASN X CG  1 
ATOM   786  O OD1 . ASN A 1 101 ? -20.279 15.476 -6.625  1.00 7.90  ? 101 ASN X OD1 1 
ATOM   787  N ND2 . ASN A 1 101 ? -18.056 15.354 -6.951  1.00 7.80  ? 101 ASN X ND2 1 
ATOM   788  N N   . MET A 1 102 ? -21.795 18.938 -6.330  1.00 11.04 ? 102 MET X N   1 
ATOM   789  C CA  . MET A 1 102 ? -23.158 19.015 -5.798  1.00 11.88 ? 102 MET X CA  1 
ATOM   790  C C   . MET A 1 102 ? -24.205 19.363 -6.865  1.00 12.22 ? 102 MET X C   1 
ATOM   791  O O   . MET A 1 102 ? -25.228 18.674 -6.984  1.00 11.96 ? 102 MET X O   1 
ATOM   792  C CB  . MET A 1 102 ? -23.232 20.023 -4.653  1.00 11.99 ? 102 MET X CB  1 
ATOM   793  C CG  . MET A 1 102 ? -22.596 19.547 -3.360  1.00 12.80 ? 102 MET X CG  1 
ATOM   794  S SD  . MET A 1 102 ? -23.102 20.575 -1.960  1.00 14.51 ? 102 MET X SD  1 
ATOM   795  C CE  . MET A 1 102 ? -24.774 20.015 -1.666  1.00 14.23 ? 102 MET X CE  1 
ATOM   796  N N   . VAL A 1 103 ? -23.942 20.423 -7.632  1.00 12.29 ? 103 VAL X N   1 
ATOM   797  C CA  . VAL A 1 103 ? -24.850 20.859 -8.704  1.00 12.78 ? 103 VAL X CA  1 
ATOM   798  C C   . VAL A 1 103 ? -24.994 19.782 -9.772  1.00 12.97 ? 103 VAL X C   1 
ATOM   799  O O   . VAL A 1 103 ? -26.107 19.485 -10.210 1.00 12.98 ? 103 VAL X O   1 
ATOM   800  C CB  . VAL A 1 103 ? -24.417 22.211 -9.339  1.00 12.97 ? 103 VAL X CB  1 
ATOM   801  C CG1 . VAL A 1 103 ? -25.258 22.524 -10.598 1.00 12.86 ? 103 VAL X CG1 1 
ATOM   802  C CG2 . VAL A 1 103 ? -24.569 23.351 -8.324  1.00 13.11 ? 103 VAL X CG2 1 
ATOM   803  N N   . PHE A 1 104 ? -23.875 19.179 -10.165 1.00 13.33 ? 104 PHE X N   1 
ATOM   804  C CA  . PHE A 1 104 ? -23.899 18.058 -11.101 1.00 13.59 ? 104 PHE X CA  1 
ATOM   805  C C   . PHE A 1 104 ? -24.886 16.973 -10.648 1.00 14.15 ? 104 PHE X C   1 
ATOM   806  O O   . PHE A 1 104 ? -25.672 16.469 -11.452 1.00 14.13 ? 104 PHE X O   1 
ATOM   807  C CB  . PHE A 1 104 ? -22.499 17.464 -11.264 1.00 13.23 ? 104 PHE X CB  1 
ATOM   808  C CG  . PHE A 1 104 ? -22.383 16.479 -12.398 1.00 13.20 ? 104 PHE X CG  1 
ATOM   809  C CD1 . PHE A 1 104 ? -22.744 15.145 -12.222 1.00 13.40 ? 104 PHE X CD1 1 
ATOM   810  C CD2 . PHE A 1 104 ? -21.904 16.889 -13.645 1.00 13.31 ? 104 PHE X CD2 1 
ATOM   811  C CE1 . PHE A 1 104 ? -22.645 14.223 -13.276 1.00 12.48 ? 104 PHE X CE1 1 
ATOM   812  C CE2 . PHE A 1 104 ? -21.792 15.984 -14.697 1.00 12.47 ? 104 PHE X CE2 1 
ATOM   813  C CZ  . PHE A 1 104 ? -22.166 14.642 -14.506 1.00 13.07 ? 104 PHE X CZ  1 
ATOM   814  N N   . GLN A 1 105 ? -24.837 16.620 -9.364  1.00 14.44 ? 105 GLN X N   1 
ATOM   815  C CA  . GLN A 1 105 ? -25.634 15.512 -8.848  1.00 15.33 ? 105 GLN X CA  1 
ATOM   816  C C   . GLN A 1 105 ? -27.094 15.879 -8.593  1.00 15.99 ? 105 GLN X C   1 
ATOM   817  O O   . GLN A 1 105 ? -27.992 15.094 -8.913  1.00 15.83 ? 105 GLN X O   1 
ATOM   818  C CB  . GLN A 1 105 ? -25.011 14.931 -7.566  1.00 15.16 ? 105 GLN X CB  1 
ATOM   819  C CG  . GLN A 1 105 ? -25.735 13.675 -7.029  1.00 14.00 ? 105 GLN X CG  1 
ATOM   820  C CD  . GLN A 1 105 ? -25.295 13.253 -5.636  1.00 12.99 ? 105 GLN X CD  1 
ATOM   821  O OE1 . GLN A 1 105 ? -24.399 13.845 -5.041  1.00 12.83 ? 105 GLN X OE1 1 
ATOM   822  N NE2 . GLN A 1 105 ? -25.923 12.205 -5.116  1.00 13.59 ? 105 GLN X NE2 1 
ATOM   823  N N   . MET A 1 106 ? -27.335 17.060 -8.026  1.00 16.75 ? 106 MET X N   1 
ATOM   824  C CA  A MET A 1 106 ? -28.693 17.368 -7.565  0.50 17.24 ? 106 MET X CA  1 
ATOM   825  C CA  B MET A 1 106 ? -28.655 17.436 -7.509  0.50 17.43 ? 106 MET X CA  1 
ATOM   826  C C   . MET A 1 106 ? -29.385 18.513 -8.301  1.00 17.70 ? 106 MET X C   1 
ATOM   827  O O   . MET A 1 106 ? -30.575 18.758 -8.083  1.00 17.73 ? 106 MET X O   1 
ATOM   828  C CB  A MET A 1 106 ? -28.738 17.564 -6.040  0.50 17.23 ? 106 MET X CB  1 
ATOM   829  C CB  B MET A 1 106 ? -28.512 17.916 -6.070  0.50 17.46 ? 106 MET X CB  1 
ATOM   830  C CG  A MET A 1 106 ? -28.180 18.877 -5.542  0.50 16.41 ? 106 MET X CG  1 
ATOM   831  C CG  B MET A 1 106 ? -28.517 16.810 -5.052  0.50 17.74 ? 106 MET X CG  1 
ATOM   832  S SD  A MET A 1 106 ? -28.115 18.985 -3.745  0.50 15.71 ? 106 MET X SD  1 
ATOM   833  S SD  B MET A 1 106 ? -28.071 17.439 -3.436  0.50 19.00 ? 106 MET X SD  1 
ATOM   834  C CE  A MET A 1 106 ? -26.759 17.857 -3.409  0.50 15.57 ? 106 MET X CE  1 
ATOM   835  C CE  B MET A 1 106 ? -29.004 18.966 -3.399  0.50 18.25 ? 106 MET X CE  1 
ATOM   836  N N   . GLY A 1 107 ? -28.665 19.186 -9.186  1.00 18.56 ? 107 GLY X N   1 
ATOM   837  C CA  . GLY A 1 107 ? -29.241 20.295 -9.927  1.00 20.10 ? 107 GLY X CA  1 
ATOM   838  C C   . GLY A 1 107 ? -29.173 21.573 -9.111  1.00 21.38 ? 107 GLY X C   1 
ATOM   839  O O   . GLY A 1 107 ? -29.141 21.550 -7.870  1.00 21.02 ? 107 GLY X O   1 
ATOM   840  N N   . GLU A 1 108 ? -29.165 22.701 -9.806  1.00 22.79 ? 108 GLU X N   1 
ATOM   841  C CA  . GLU A 1 108 ? -28.863 23.956 -9.145  1.00 24.51 ? 108 GLU X CA  1 
ATOM   842  C C   . GLU A 1 108 ? -29.972 24.458 -8.220  1.00 25.06 ? 108 GLU X C   1 
ATOM   843  O O   . GLU A 1 108 ? -29.685 25.160 -7.253  1.00 25.14 ? 108 GLU X O   1 
ATOM   844  C CB  . GLU A 1 108 ? -28.428 25.017 -10.152 1.00 24.91 ? 108 GLU X CB  1 
ATOM   845  C CG  . GLU A 1 108 ? -29.544 25.719 -10.843 1.00 26.87 ? 108 GLU X CG  1 
ATOM   846  C CD  . GLU A 1 108 ? -29.044 26.887 -11.622 1.00 28.92 ? 108 GLU X CD  1 
ATOM   847  O OE1 . GLU A 1 108 ? -28.106 26.690 -12.427 1.00 31.10 ? 108 GLU X OE1 1 
ATOM   848  O OE2 . GLU A 1 108 ? -29.576 28.001 -11.425 1.00 29.96 ? 108 GLU X OE2 1 
ATOM   849  N N   . THR A 1 109 ? -31.223 24.080 -8.501  1.00 25.80 ? 109 THR X N   1 
ATOM   850  C CA  . THR A 1 109 ? -32.335 24.414 -7.608  1.00 26.35 ? 109 THR X CA  1 
ATOM   851  C C   . THR A 1 109 ? -32.179 23.667 -6.286  1.00 26.53 ? 109 THR X C   1 
ATOM   852  O O   . THR A 1 109 ? -32.276 24.273 -5.206  1.00 26.92 ? 109 THR X O   1 
ATOM   853  C CB  . THR A 1 109 ? -33.721 24.128 -8.243  1.00 26.49 ? 109 THR X CB  1 
ATOM   854  O OG1 . THR A 1 109 ? -33.824 24.834 -9.483  1.00 26.67 ? 109 THR X OG1 1 
ATOM   855  C CG2 . THR A 1 109 ? -34.845 24.592 -7.324  0.50 26.52 ? 109 THR X CG2 1 
ATOM   856  N N   . GLY A 1 110 ? -31.933 22.359 -6.379  1.00 26.40 ? 110 GLY X N   1 
ATOM   857  C CA  . GLY A 1 110 ? -31.618 21.536 -5.211  1.00 26.24 ? 110 GLY X CA  1 
ATOM   858  C C   . GLY A 1 110 ? -30.571 22.168 -4.305  1.00 26.10 ? 110 GLY X C   1 
ATOM   859  O O   . GLY A 1 110 ? -30.791 22.310 -3.097  1.00 26.50 ? 110 GLY X O   1 
ATOM   860  N N   . VAL A 1 111 ? -29.442 22.568 -4.890  1.00 25.62 ? 111 VAL X N   1 
ATOM   861  C CA  . VAL A 1 111 ? -28.322 23.141 -4.131  1.00 25.17 ? 111 VAL X CA  1 
ATOM   862  C C   . VAL A 1 111 ? -28.646 24.521 -3.546  1.00 25.39 ? 111 VAL X C   1 
ATOM   863  O O   . VAL A 1 111 ? -28.287 24.812 -2.400  1.00 25.37 ? 111 VAL X O   1 
ATOM   864  C CB  . VAL A 1 111 ? -27.028 23.220 -4.974  1.00 25.18 ? 111 VAL X CB  1 
ATOM   865  C CG1 . VAL A 1 111 ? -25.892 23.830 -4.166  0.50 24.59 ? 111 VAL X CG1 1 
ATOM   866  C CG2 . VAL A 1 111 ? -26.630 21.842 -5.470  1.00 24.06 ? 111 VAL X CG2 1 
ATOM   867  N N   . ALA A 1 112 ? -29.332 25.359 -4.325  1.00 25.32 ? 112 ALA X N   1 
ATOM   868  C CA  . ALA A 1 112 ? -29.694 26.708 -3.874  1.00 25.32 ? 112 ALA X CA  1 
ATOM   869  C C   . ALA A 1 112 ? -30.594 26.721 -2.631  1.00 25.36 ? 112 ALA X C   1 
ATOM   870  O O   . ALA A 1 112 ? -30.672 27.742 -1.943  1.00 26.10 ? 112 ALA X O   1 
ATOM   871  C CB  . ALA A 1 112 ? -30.325 27.506 -5.013  1.00 25.34 ? 112 ALA X CB  1 
ATOM   872  N N   . GLY A 1 113 ? -31.259 25.595 -2.346  1.00 25.25 ? 113 GLY X N   1 
ATOM   873  C CA  . GLY A 1 113 ? -32.063 25.428 -1.117  1.00 24.51 ? 113 GLY X CA  1 
ATOM   874  C C   . GLY A 1 113 ? -31.265 24.938 0.098   1.00 24.27 ? 113 GLY X C   1 
ATOM   875  O O   . GLY A 1 113 ? -31.840 24.611 1.149   1.00 24.66 ? 113 GLY X O   1 
ATOM   876  N N   . PHE A 1 114 ? -29.942 24.868 -0.055  1.00 22.97 ? 114 PHE X N   1 
ATOM   877  C CA  . PHE A 1 114 ? -29.021 24.613 1.045   1.00 21.65 ? 114 PHE X CA  1 
ATOM   878  C C   . PHE A 1 114 ? -28.606 25.972 1.617   1.00 20.98 ? 114 PHE X C   1 
ATOM   879  O O   . PHE A 1 114 ? -27.430 26.206 1.886   1.00 20.94 ? 114 PHE X O   1 
ATOM   880  C CB  . PHE A 1 114 ? -27.782 23.849 0.539   1.00 21.61 ? 114 PHE X CB  1 
ATOM   881  C CG  . PHE A 1 114 ? -27.940 22.345 0.517   1.00 21.29 ? 114 PHE X CG  1 
ATOM   882  C CD1 . PHE A 1 114 ? -28.751 21.720 -0.433  1.00 21.36 ? 114 PHE X CD1 1 
ATOM   883  C CD2 . PHE A 1 114 ? -27.250 21.551 1.434   1.00 19.71 ? 114 PHE X CD2 1 
ATOM   884  C CE1 . PHE A 1 114 ? -28.888 20.324 -0.452  1.00 20.26 ? 114 PHE X CE1 1 
ATOM   885  C CE2 . PHE A 1 114 ? -27.375 20.161 1.424   1.00 19.74 ? 114 PHE X CE2 1 
ATOM   886  C CZ  . PHE A 1 114 ? -28.199 19.545 0.478   1.00 19.66 ? 114 PHE X CZ  1 
ATOM   887  N N   . THR A 1 115 ? -29.587 26.852 1.824   1.00 20.13 ? 115 THR X N   1 
ATOM   888  C CA  . THR A 1 115 ? -29.347 28.255 2.198   1.00 19.12 ? 115 THR X CA  1 
ATOM   889  C C   . THR A 1 115 ? -28.419 28.436 3.398   1.00 18.27 ? 115 THR X C   1 
ATOM   890  O O   . THR A 1 115 ? -27.548 29.305 3.387   1.00 17.37 ? 115 THR X O   1 
ATOM   891  C CB  . THR A 1 115 ? -30.683 28.992 2.477   1.00 19.43 ? 115 THR X CB  1 
ATOM   892  O OG1 . THR A 1 115 ? -31.597 28.717 1.415   1.00 19.85 ? 115 THR X OG1 1 
ATOM   893  C CG2 . THR A 1 115 ? -30.470 30.503 2.570   0.50 19.25 ? 115 THR X CG2 1 
ATOM   894  N N   . ASN A 1 116 ? -28.619 27.622 4.432   1.00 17.17 ? 116 ASN X N   1 
ATOM   895  C CA  . ASN A 1 116 ? -27.830 27.745 5.651   1.00 16.85 ? 116 ASN X CA  1 
ATOM   896  C C   . ASN A 1 116 ? -26.394 27.250 5.476   1.00 15.71 ? 116 ASN X C   1 
ATOM   897  O O   . ASN A 1 116 ? -25.456 27.871 5.980   1.00 15.49 ? 116 ASN X O   1 
ATOM   898  C CB  . ASN A 1 116 ? -28.553 27.082 6.840   1.00 16.93 ? 116 ASN X CB  1 
ATOM   899  C CG  . ASN A 1 116 ? -29.946 27.678 7.073   1.00 19.04 ? 116 ASN X CG  1 
ATOM   900  O OD1 . ASN A 1 116 ? -30.145 28.891 6.937   1.00 21.03 ? 116 ASN X OD1 1 
ATOM   901  N ND2 . ASN A 1 116 ? -30.912 26.829 7.407   1.00 18.72 ? 116 ASN X ND2 1 
ATOM   902  N N   . SER A 1 117 ? -26.234 26.143 4.751   1.00 14.99 ? 117 SER X N   1 
ATOM   903  C CA  . SER A 1 117 ? -24.903 25.620 4.400   1.00 14.42 ? 117 SER X CA  1 
ATOM   904  C C   . SER A 1 117 ? -24.154 26.620 3.536   1.00 14.28 ? 117 SER X C   1 
ATOM   905  O O   . SER A 1 117 ? -22.978 26.911 3.786   1.00 14.41 ? 117 SER X O   1 
ATOM   906  C CB  . SER A 1 117 ? -25.008 24.296 3.649   1.00 13.97 ? 117 SER X CB  1 
ATOM   907  O OG  . SER A 1 117 ? -25.306 23.230 4.522   1.00 15.17 ? 117 SER X OG  1 
ATOM   908  N N   . LEU A 1 118 ? -24.847 27.145 2.525   1.00 13.99 ? 118 LEU X N   1 
ATOM   909  C CA  . LEU A 1 118 ? -24.293 28.175 1.642   1.00 14.18 ? 118 LEU X CA  1 
ATOM   910  C C   . LEU A 1 118 ? -23.766 29.387 2.396   1.00 13.90 ? 118 LEU X C   1 
ATOM   911  O O   . LEU A 1 118 ? -22.669 29.867 2.106   1.00 13.31 ? 118 LEU X O   1 
ATOM   912  C CB  . LEU A 1 118 ? -25.323 28.629 0.603   1.00 14.07 ? 118 LEU X CB  1 
ATOM   913  C CG  . LEU A 1 118 ? -25.720 27.643 -0.495  1.00 14.60 ? 118 LEU X CG  1 
ATOM   914  C CD1 . LEU A 1 118 ? -26.811 28.267 -1.363  1.00 15.23 ? 118 LEU X CD1 1 
ATOM   915  C CD2 . LEU A 1 118 ? -24.511 27.224 -1.339  1.00 14.68 ? 118 LEU X CD2 1 
ATOM   916  N N   . ARG A 1 119 ? -24.551 29.887 3.350   1.00 13.87 ? 119 ARG X N   1 
ATOM   917  C CA  . ARG A 1 119 ? -24.109 31.011 4.175   1.00 14.03 ? 119 ARG X CA  1 
ATOM   918  C C   . ARG A 1 119 ? -22.820 30.682 4.929   1.00 13.52 ? 119 ARG X C   1 
ATOM   919  O O   . ARG A 1 119 ? -21.879 31.479 4.919   1.00 13.39 ? 119 ARG X O   1 
ATOM   920  C CB  . ARG A 1 119 ? -25.199 31.443 5.159   1.00 14.36 ? 119 ARG X CB  1 
ATOM   921  C CG  . ARG A 1 119 ? -24.859 32.727 5.925   1.00 16.20 ? 119 ARG X CG  1 
ATOM   922  C CD  . ARG A 1 119 ? -25.974 33.138 6.872   1.00 19.03 ? 119 ARG X CD  1 
ATOM   923  N NE  . ARG A 1 119 ? -27.262 33.215 6.177   0.50 20.12 ? 119 ARG X NE  1 
ATOM   924  C CZ  . ARG A 1 119 ? -28.238 32.312 6.273   0.50 20.47 ? 119 ARG X CZ  1 
ATOM   925  N NH1 . ARG A 1 119 ? -28.105 31.242 7.051   0.50 20.02 ? 119 ARG X NH1 1 
ATOM   926  N NH2 . ARG A 1 119 ? -29.360 32.488 5.586   0.50 20.88 ? 119 ARG X NH2 1 
ATOM   927  N N   . MET A 1 120 ? -22.791 29.513 5.573   1.00 13.08 ? 120 MET X N   1 
ATOM   928  C CA  . MET A 1 120 ? -21.627 29.046 6.330   1.00 13.17 ? 120 MET X CA  1 
ATOM   929  C C   . MET A 1 120 ? -20.389 28.888 5.439   1.00 12.56 ? 120 MET X C   1 
ATOM   930  O O   . MET A 1 120 ? -19.276 29.180 5.863   1.00 12.52 ? 120 MET X O   1 
ATOM   931  C CB  . MET A 1 120 ? -21.931 27.718 7.032   1.00 13.20 ? 120 MET X CB  1 
ATOM   932  C CG  . MET A 1 120 ? -22.882 27.850 8.215   1.00 15.03 ? 120 MET X CG  1 
ATOM   933  S SD  . MET A 1 120 ? -23.328 26.236 8.870   1.00 16.99 ? 120 MET X SD  1 
ATOM   934  C CE  . MET A 1 120 ? -24.953 26.568 9.546   1.00 16.76 ? 120 MET X CE  1 
ATOM   935  N N   . LEU A 1 121 ? -20.600 28.420 4.212   1.00 12.64 ? 121 LEU X N   1 
ATOM   936  C CA  . LEU A 1 121 ? -19.519 28.258 3.233   1.00 12.76 ? 121 LEU X CA  1 
ATOM   937  C C   . LEU A 1 121 ? -18.925 29.614 2.862   1.00 13.30 ? 121 LEU X C   1 
ATOM   938  O O   . LEU A 1 121 ? -17.704 29.753 2.779   1.00 13.54 ? 121 LEU X O   1 
ATOM   939  C CB  . LEU A 1 121 ? -20.002 27.513 1.975   1.00 12.37 ? 121 LEU X CB  1 
ATOM   940  C CG  . LEU A 1 121 ? -20.198 25.991 2.082   1.00 12.33 ? 121 LEU X CG  1 
ATOM   941  C CD1 . LEU A 1 121 ? -20.822 25.434 0.797   1.00 12.20 ? 121 LEU X CD1 1 
ATOM   942  C CD2 . LEU A 1 121 ? -18.886 25.272 2.418   1.00 10.63 ? 121 LEU X CD2 1 
ATOM   943  N N   . GLN A 1 122 ? -19.787 30.609 2.653   1.00 13.49 ? 122 GLN X N   1 
ATOM   944  C CA  . GLN A 1 122 ? -19.320 31.961 2.320   1.00 14.38 ? 122 GLN X CA  1 
ATOM   945  C C   . GLN A 1 122 ? -18.596 32.628 3.498   1.00 14.03 ? 122 GLN X C   1 
ATOM   946  O O   . GLN A 1 122 ? -17.625 33.373 3.305   1.00 14.08 ? 122 GLN X O   1 
ATOM   947  C CB  . GLN A 1 122 ? -20.457 32.841 1.802   1.00 14.66 ? 122 GLN X CB  1 
ATOM   948  C CG  . GLN A 1 122 ? -20.008 34.272 1.481   1.00 17.47 ? 122 GLN X CG  1 
ATOM   949  C CD  . GLN A 1 122 ? -20.625 34.832 0.233   1.00 21.53 ? 122 GLN X CD  1 
ATOM   950  O OE1 . GLN A 1 122 ? -21.644 34.327 -0.253  1.00 23.94 ? 122 GLN X OE1 1 
ATOM   951  N NE2 . GLN A 1 122 ? -20.018 35.903 -0.303  1.00 22.31 ? 122 GLN X NE2 1 
ATOM   952  N N   . GLN A 1 123 ? -19.048 32.333 4.711   1.00 13.72 ? 123 GLN X N   1 
ATOM   953  C CA  . GLN A 1 123 ? -18.384 32.847 5.911   1.00 13.84 ? 123 GLN X CA  1 
ATOM   954  C C   . GLN A 1 123 ? -17.106 32.075 6.227   1.00 13.20 ? 123 GLN X C   1 
ATOM   955  O O   . GLN A 1 123 ? -16.376 32.456 7.145   1.00 13.05 ? 123 GLN X O   1 
ATOM   956  C CB  . GLN A 1 123 ? -19.321 32.777 7.120   1.00 14.27 ? 123 GLN X CB  1 
ATOM   957  C CG  . GLN A 1 123 ? -20.644 33.503 6.962   1.00 16.36 ? 123 GLN X CG  1 
ATOM   958  C CD  . GLN A 1 123 ? -21.612 33.167 8.093   1.00 19.13 ? 123 GLN X CD  1 
ATOM   959  O OE1 . GLN A 1 123 ? -22.060 34.046 8.817   1.00 22.37 ? 123 GLN X OE1 1 
ATOM   960  N NE2 . GLN A 1 123 ? -21.922 31.890 8.253   1.00 19.22 ? 123 GLN X NE2 1 
ATOM   961  N N   . LYS A 1 124 ? -16.852 30.992 5.481   1.00 12.71 ? 124 LYS X N   1 
ATOM   962  C CA  . LYS A 1 124 ? -15.687 30.109 5.685   1.00 12.57 ? 124 LYS X CA  1 
ATOM   963  C C   . LYS A 1 124 ? -15.678 29.445 7.079   1.00 12.50 ? 124 LYS X C   1 
ATOM   964  O O   . LYS A 1 124 ? -14.628 29.237 7.685   1.00 11.88 ? 124 LYS X O   1 
ATOM   965  C CB  . LYS A 1 124 ? -14.356 30.844 5.401   1.00 12.94 ? 124 LYS X CB  1 
ATOM   966  C CG  . LYS A 1 124 ? -14.314 31.540 4.036   1.00 12.17 ? 124 LYS X CG  1 
ATOM   967  C CD  . LYS A 1 124 ? -12.887 31.830 3.574   1.00 12.95 ? 124 LYS X CD  1 
ATOM   968  C CE  . LYS A 1 124 ? -12.883 32.432 2.175   1.00 12.67 ? 124 LYS X CE  1 
ATOM   969  N NZ  . LYS A 1 124 ? -13.412 31.495 1.137   1.00 13.87 ? 124 LYS X NZ  1 
ATOM   970  N N   . ARG A 1 125 ? -16.867 29.121 7.572   1.00 12.54 ? 125 ARG X N   1 
ATOM   971  C CA  . ARG A 1 125 ? -17.017 28.336 8.801   1.00 12.96 ? 125 ARG X CA  1 
ATOM   972  C C   . ARG A 1 125 ? -17.117 26.870 8.416   1.00 12.37 ? 125 ARG X C   1 
ATOM   973  O O   . ARG A 1 125 ? -18.202 26.283 8.400   1.00 12.03 ? 125 ARG X O   1 
ATOM   974  C CB  . ARG A 1 125 ? -18.242 28.814 9.576   1.00 13.47 ? 125 ARG X CB  1 
ATOM   975  C CG  . ARG A 1 125 ? -17.966 30.120 10.291  1.00 16.45 ? 125 ARG X CG  1 
ATOM   976  C CD  . ARG A 1 125 ? -19.014 31.140 9.990   1.00 21.37 ? 125 ARG X CD  1 
ATOM   977  N NE  . ARG A 1 125 ? -20.030 31.218 11.022  1.00 24.92 ? 125 ARG X NE  1 
ATOM   978  C CZ  . ARG A 1 125 ? -20.243 32.279 11.801  1.00 26.81 ? 125 ARG X CZ  1 
ATOM   979  N NH1 . ARG A 1 125 ? -19.506 33.381 11.690  1.00 27.29 ? 125 ARG X NH1 1 
ATOM   980  N NH2 . ARG A 1 125 ? -21.208 32.234 12.704  1.00 28.03 ? 125 ARG X NH2 1 
ATOM   981  N N   . TRP A 1 126 ? -15.959 26.294 8.098   1.00 12.48 ? 126 TRP X N   1 
ATOM   982  C CA  . TRP A 1 126 ? -15.871 25.019 7.386   1.00 12.17 ? 126 TRP X CA  1 
ATOM   983  C C   . TRP A 1 126 ? -16.424 23.824 8.143   1.00 12.50 ? 126 TRP X C   1 
ATOM   984  O O   . TRP A 1 126 ? -17.108 22.985 7.558   1.00 12.24 ? 126 TRP X O   1 
ATOM   985  C CB  . TRP A 1 126 ? -14.427 24.731 6.964   1.00 11.64 ? 126 TRP X CB  1 
ATOM   986  C CG  . TRP A 1 126 ? -13.769 25.821 6.165   1.00 11.34 ? 126 TRP X CG  1 
ATOM   987  C CD1 . TRP A 1 126 ? -12.586 26.442 6.461   1.00 10.71 ? 126 TRP X CD1 1 
ATOM   988  C CD2 . TRP A 1 126 ? -14.242 26.419 4.942   1.00 10.37 ? 126 TRP X CD2 1 
ATOM   989  N NE1 . TRP A 1 126 ? -12.292 27.379 5.499   1.00 11.32 ? 126 TRP X NE1 1 
ATOM   990  C CE2 . TRP A 1 126 ? -13.289 27.386 4.557   1.00 10.26 ? 126 TRP X CE2 1 
ATOM   991  C CE3 . TRP A 1 126 ? -15.373 26.223 4.131   1.00 10.59 ? 126 TRP X CE3 1 
ATOM   992  C CZ2 . TRP A 1 126 ? -13.425 28.159 3.394   1.00 10.26 ? 126 TRP X CZ2 1 
ATOM   993  C CZ3 . TRP A 1 126 ? -15.519 27.005 2.990   1.00 9.79  ? 126 TRP X CZ3 1 
ATOM   994  C CH2 . TRP A 1 126 ? -14.540 27.957 2.627   1.00 11.53 ? 126 TRP X CH2 1 
ATOM   995  N N   . ASP A 1 127 ? -16.101 23.729 9.431   1.00 12.71 ? 127 ASP X N   1 
ATOM   996  C CA  . ASP A 1 127 ? -16.613 22.647 10.266  1.00 13.08 ? 127 ASP X CA  1 
ATOM   997  C C   . ASP A 1 127 ? -18.126 22.755 10.437  1.00 13.14 ? 127 ASP X C   1 
ATOM   998  O O   . ASP A 1 127 ? -18.842 21.750 10.366  1.00 12.61 ? 127 ASP X O   1 
ATOM   999  C CB  . ASP A 1 127 ? -15.897 22.596 11.620  1.00 13.22 ? 127 ASP X CB  1 
ATOM   1000 C CG  . ASP A 1 127 ? -14.528 21.914 11.537  1.00 13.98 ? 127 ASP X CG  1 
ATOM   1001 O OD1 . ASP A 1 127 ? -13.887 21.939 10.461  1.00 14.40 ? 127 ASP X OD1 1 
ATOM   1002 O OD2 . ASP A 1 127 ? -14.089 21.360 12.562  1.00 13.87 ? 127 ASP X OD2 1 
ATOM   1003 N N   . GLU A 1 128 ? -18.611 23.982 10.616  1.00 13.09 ? 128 GLU X N   1 
ATOM   1004 C CA  . GLU A 1 128 ? -20.047 24.225 10.743  1.00 13.11 ? 128 GLU X CA  1 
ATOM   1005 C C   . GLU A 1 128 ? -20.803 23.920 9.448   1.00 13.21 ? 128 GLU X C   1 
ATOM   1006 O O   . GLU A 1 128 ? -21.867 23.273 9.479   1.00 13.46 ? 128 GLU X O   1 
ATOM   1007 C CB  . GLU A 1 128 ? -20.308 25.650 11.223  1.00 12.97 ? 128 GLU X CB  1 
ATOM   1008 C CG  . GLU A 1 128 ? -19.787 25.872 12.633  1.00 13.52 ? 128 GLU X CG  1 
ATOM   1009 C CD  . GLU A 1 128 ? -19.911 27.305 13.093  0.50 13.30 ? 128 GLU X CD  1 
ATOM   1010 O OE1 . GLU A 1 128 ? -21.005 27.688 13.553  0.50 13.45 ? 128 GLU X OE1 1 
ATOM   1011 O OE2 . GLU A 1 128 ? -18.908 28.037 13.014  0.50 11.85 ? 128 GLU X OE2 1 
ATOM   1012 N N   . ALA A 1 129 ? -20.248 24.371 8.318   1.00 13.09 ? 129 ALA X N   1 
ATOM   1013 C CA  . ALA A 1 129 ? -20.789 24.037 6.999   1.00 12.99 ? 129 ALA X CA  1 
ATOM   1014 C C   . ALA A 1 129 ? -20.916 22.521 6.850   1.00 12.86 ? 129 ALA X C   1 
ATOM   1015 O O   . ALA A 1 129 ? -21.968 22.013 6.462   1.00 13.12 ? 129 ALA X O   1 
ATOM   1016 C CB  . ALA A 1 129 ? -19.904 24.607 5.890   1.00 12.81 ? 129 ALA X CB  1 
ATOM   1017 N N   . ALA A 1 130 ? -19.839 21.812 7.174   1.00 12.83 ? 130 ALA X N   1 
ATOM   1018 C CA  . ALA A 1 130 ? -19.770 20.361 7.024   1.00 13.14 ? 130 ALA X CA  1 
ATOM   1019 C C   . ALA A 1 130 ? -20.876 19.640 7.800   1.00 13.04 ? 130 ALA X C   1 
ATOM   1020 O O   . ALA A 1 130 ? -21.520 18.726 7.275   1.00 12.41 ? 130 ALA X O   1 
ATOM   1021 C CB  . ALA A 1 130 ? -18.393 19.853 7.445   1.00 13.30 ? 130 ALA X CB  1 
ATOM   1022 N N   . VAL A 1 131 ? -21.087 20.060 9.048   1.00 12.92 ? 131 VAL X N   1 
ATOM   1023 C CA  . VAL A 1 131 ? -22.149 19.504 9.893   1.00 12.99 ? 131 VAL X CA  1 
ATOM   1024 C C   . VAL A 1 131 ? -23.536 19.793 9.299   1.00 12.49 ? 131 VAL X C   1 
ATOM   1025 O O   . VAL A 1 131 ? -24.407 18.919 9.271   1.00 12.52 ? 131 VAL X O   1 
ATOM   1026 C CB  . VAL A 1 131 ? -22.028 20.018 11.360  1.00 13.03 ? 131 VAL X CB  1 
ATOM   1027 C CG1 . VAL A 1 131 ? -23.293 19.715 12.172  1.00 13.88 ? 131 VAL X CG1 1 
ATOM   1028 C CG2 . VAL A 1 131 ? -20.801 19.409 12.021  1.00 13.25 ? 131 VAL X CG2 1 
ATOM   1029 N N   . ASN A 1 132 ? -23.730 21.015 8.813   1.00 12.26 ? 132 ASN X N   1 
ATOM   1030 C CA  . ASN A 1 132 ? -25.014 21.411 8.236   1.00 12.27 ? 132 ASN X CA  1 
ATOM   1031 C C   . ASN A 1 132 ? -25.327 20.651 6.937   1.00 11.99 ? 132 ASN X C   1 
ATOM   1032 O O   . ASN A 1 132 ? -26.471 20.241 6.710   1.00 11.82 ? 132 ASN X O   1 
ATOM   1033 C CB  . ASN A 1 132 ? -25.046 22.918 7.987   1.00 12.31 ? 132 ASN X CB  1 
ATOM   1034 C CG  . ASN A 1 132 ? -26.429 23.420 7.659   1.00 12.85 ? 132 ASN X CG  1 
ATOM   1035 O OD1 . ASN A 1 132 ? -26.775 23.624 6.494   1.00 14.59 ? 132 ASN X OD1 1 
ATOM   1036 N ND2 . ASN A 1 132 ? -27.237 23.612 8.687   1.00 13.82 ? 132 ASN X ND2 1 
ATOM   1037 N N   . LEU A 1 133 ? -24.299 20.464 6.106   1.00 11.74 ? 133 LEU X N   1 
ATOM   1038 C CA  . LEU A 1 133 ? -24.434 19.771 4.816   1.00 12.04 ? 133 LEU X CA  1 
ATOM   1039 C C   . LEU A 1 133 ? -24.930 18.334 4.972   1.00 11.79 ? 133 LEU X C   1 
ATOM   1040 O O   . LEU A 1 133 ? -25.669 17.835 4.123   1.00 12.04 ? 133 LEU X O   1 
ATOM   1041 C CB  . LEU A 1 133 ? -23.100 19.790 4.036   1.00 11.68 ? 133 LEU X CB  1 
ATOM   1042 C CG  . LEU A 1 133 ? -22.711 21.102 3.328   1.00 12.03 ? 133 LEU X CG  1 
ATOM   1043 C CD1 . LEU A 1 133 ? -21.217 21.146 3.019   1.00 11.78 ? 133 LEU X CD1 1 
ATOM   1044 C CD2 . LEU A 1 133 ? -23.537 21.311 2.065   1.00 11.24 ? 133 LEU X CD2 1 
ATOM   1045 N N   . ALA A 1 134 ? -24.526 17.683 6.062   1.00 11.86 ? 134 ALA X N   1 
ATOM   1046 C CA  . ALA A 1 134 ? -24.883 16.286 6.314   1.00 12.04 ? 134 ALA X CA  1 
ATOM   1047 C C   . ALA A 1 134 ? -26.311 16.117 6.820   1.00 11.68 ? 134 ALA X C   1 
ATOM   1048 O O   . ALA A 1 134 ? -26.828 15.003 6.834   1.00 11.73 ? 134 ALA X O   1 
ATOM   1049 C CB  . ALA A 1 134 ? -23.890 15.634 7.277   1.00 11.95 ? 134 ALA X CB  1 
ATOM   1050 N N   . LYS A 1 135 ? -26.939 17.218 7.227   1.00 11.49 ? 135 LYS X N   1 
ATOM   1051 C CA  . LYS A 1 135 ? -28.322 17.203 7.687   1.00 11.87 ? 135 LYS X CA  1 
ATOM   1052 C C   . LYS A 1 135 ? -29.244 17.356 6.474   1.00 11.76 ? 135 LYS X C   1 
ATOM   1053 O O   . LYS A 1 135 ? -29.901 18.383 6.293   1.00 11.78 ? 135 LYS X O   1 
ATOM   1054 C CB  . LYS A 1 135 ? -28.558 18.319 8.712   1.00 12.10 ? 135 LYS X CB  1 
ATOM   1055 C CG  . LYS A 1 135 ? -27.702 18.204 9.972   1.00 13.20 ? 135 LYS X CG  1 
ATOM   1056 C CD  . LYS A 1 135 ? -27.951 19.368 10.926  1.00 15.94 ? 135 LYS X CD  1 
ATOM   1057 C CE  . LYS A 1 135 ? -27.195 19.166 12.233  0.50 15.73 ? 135 LYS X CE  1 
ATOM   1058 N NZ  . LYS A 1 135 ? -27.269 20.366 13.110  0.50 16.93 ? 135 LYS X NZ  1 
ATOM   1059 N N   . SER A 1 136 ? -29.258 16.331 5.628   1.00 11.48 ? 136 SER X N   1 
ATOM   1060 C CA  . SER A 1 136 ? -29.875 16.439 4.302   1.00 11.46 ? 136 SER X CA  1 
ATOM   1061 C C   . SER A 1 136 ? -30.318 15.078 3.764   1.00 11.46 ? 136 SER X C   1 
ATOM   1062 O O   . SER A 1 136 ? -29.739 14.043 4.111   1.00 10.78 ? 136 SER X O   1 
ATOM   1063 C CB  . SER A 1 136 ? -28.887 17.067 3.320   1.00 10.98 ? 136 SER X CB  1 
ATOM   1064 O OG  . SER A 1 136 ? -27.695 16.296 3.238   1.00 10.99 ? 136 SER X OG  1 
ATOM   1065 N N   . ARG A 1 137 ? -31.342 15.093 2.911   1.00 11.34 ? 137 ARG X N   1 
ATOM   1066 C CA  . ARG A 1 137 ? -31.718 13.900 2.170   1.00 11.56 ? 137 ARG X CA  1 
ATOM   1067 C C   . ARG A 1 137 ? -30.508 13.412 1.363   1.00 11.56 ? 137 ARG X C   1 
ATOM   1068 O O   . ARG A 1 137 ? -30.227 12.212 1.316   1.00 11.32 ? 137 ARG X O   1 
ATOM   1069 C CB  . ARG A 1 137 ? -32.914 14.162 1.234   1.00 11.38 ? 137 ARG X CB  1 
ATOM   1070 C CG  . ARG A 1 137 ? -33.309 12.903 0.456   1.00 11.72 ? 137 ARG X CG  1 
ATOM   1071 C CD  . ARG A 1 137 ? -34.471 13.075 -0.499  1.00 13.36 ? 137 ARG X CD  1 
ATOM   1072 N NE  . ARG A 1 137 ? -34.812 11.781 -1.098  1.00 15.61 ? 137 ARG X NE  1 
ATOM   1073 C CZ  . ARG A 1 137 ? -34.241 11.276 -2.193  1.00 17.40 ? 137 ARG X CZ  1 
ATOM   1074 N NH1 . ARG A 1 137 ? -33.301 11.954 -2.836  1.00 16.89 ? 137 ARG X NH1 1 
ATOM   1075 N NH2 . ARG A 1 137 ? -34.614 10.086 -2.654  1.00 16.95 ? 137 ARG X NH2 1 
ATOM   1076 N N   . TRP A 1 138 ? -29.795 14.360 0.754   1.00 11.65 ? 138 TRP X N   1 
ATOM   1077 C CA  . TRP A 1 138 ? -28.569 14.088 -0.013  1.00 12.04 ? 138 TRP X CA  1 
ATOM   1078 C C   . TRP A 1 138 ? -27.596 13.153 0.713   1.00 12.33 ? 138 TRP X C   1 
ATOM   1079 O O   . TRP A 1 138 ? -27.177 12.132 0.166   1.00 12.94 ? 138 TRP X O   1 
ATOM   1080 C CB  . TRP A 1 138 ? -27.871 15.412 -0.340  1.00 11.59 ? 138 TRP X CB  1 
ATOM   1081 C CG  . TRP A 1 138 ? -26.481 15.298 -0.942  1.00 11.19 ? 138 TRP X CG  1 
ATOM   1082 C CD1 . TRP A 1 138 ? -26.113 14.580 -2.053  1.00 10.93 ? 138 TRP X CD1 1 
ATOM   1083 C CD2 . TRP A 1 138 ? -25.289 15.973 -0.489  1.00 10.05 ? 138 TRP X CD2 1 
ATOM   1084 N NE1 . TRP A 1 138 ? -24.758 14.750 -2.302  1.00 10.29 ? 138 TRP X NE1 1 
ATOM   1085 C CE2 . TRP A 1 138 ? -24.234 15.596 -1.358  1.00 9.76  ? 138 TRP X CE2 1 
ATOM   1086 C CE3 . TRP A 1 138 ? -25.013 16.846 0.569   1.00 10.61 ? 138 TRP X CE3 1 
ATOM   1087 C CZ2 . TRP A 1 138 ? -22.919 16.082 -1.208  1.00 9.70  ? 138 TRP X CZ2 1 
ATOM   1088 C CZ3 . TRP A 1 138 ? -23.706 17.317 0.733   1.00 9.73  ? 138 TRP X CZ3 1 
ATOM   1089 C CH2 . TRP A 1 138 ? -22.674 16.934 -0.158  1.00 10.29 ? 138 TRP X CH2 1 
ATOM   1090 N N   . TYR A 1 139 ? -27.247 13.520 1.940   1.00 12.63 ? 139 TYR X N   1 
ATOM   1091 C CA  . TYR A 1 139 ? -26.323 12.752 2.762   1.00 13.28 ? 139 TYR X CA  1 
ATOM   1092 C C   . TYR A 1 139 ? -26.884 11.371 3.095   1.00 13.14 ? 139 TYR X C   1 
ATOM   1093 O O   . TYR A 1 139 ? -26.182 10.371 2.966   1.00 13.39 ? 139 TYR X O   1 
ATOM   1094 C CB  . TYR A 1 139 ? -25.991 13.523 4.041   1.00 13.63 ? 139 TYR X CB  1 
ATOM   1095 C CG  . TYR A 1 139 ? -25.046 12.799 4.973   1.00 16.39 ? 139 TYR X CG  1 
ATOM   1096 C CD1 . TYR A 1 139 ? -23.664 12.949 4.847   1.00 17.99 ? 139 TYR X CD1 1 
ATOM   1097 C CD2 . TYR A 1 139 ? -25.536 11.959 5.978   1.00 18.96 ? 139 TYR X CD2 1 
ATOM   1098 C CE1 . TYR A 1 139 ? -22.794 12.287 5.693   1.00 20.97 ? 139 TYR X CE1 1 
ATOM   1099 C CE2 . TYR A 1 139 ? -24.668 11.283 6.834   1.00 21.69 ? 139 TYR X CE2 1 
ATOM   1100 C CZ  . TYR A 1 139 ? -23.299 11.458 6.682   1.00 22.45 ? 139 TYR X CZ  1 
ATOM   1101 O OH  . TYR A 1 139 ? -22.433 10.804 7.525   1.00 25.41 ? 139 TYR X OH  1 
ATOM   1102 N N   . ASN A 1 140 ? -28.144 11.312 3.518   1.00 12.80 ? 140 ASN X N   1 
ATOM   1103 C CA  . ASN A 1 140 ? -28.756 10.036 3.897   1.00 12.51 ? 140 ASN X CA  1 
ATOM   1104 C C   . ASN A 1 140 ? -28.889 9.045  2.743   1.00 12.09 ? 140 ASN X C   1 
ATOM   1105 O O   . ASN A 1 140 ? -28.708 7.846  2.940   1.00 12.44 ? 140 ASN X O   1 
ATOM   1106 C CB  . ASN A 1 140 ? -30.101 10.259 4.579   1.00 12.95 ? 140 ASN X CB  1 
ATOM   1107 C CG  . ASN A 1 140 ? -29.949 10.768 6.006   1.00 14.48 ? 140 ASN X CG  1 
ATOM   1108 O OD1 . ASN A 1 140 ? -29.963 11.979 6.260   1.00 14.16 ? 140 ASN X OD1 1 
ATOM   1109 N ND2 . ASN A 1 140 ? -29.778 9.843  6.941   1.00 15.41 ? 140 ASN X ND2 1 
ATOM   1110 N N   . GLN A 1 141 ? -29.180 9.544  1.545   1.00 11.48 ? 141 GLN X N   1 
ATOM   1111 C CA  . GLN A 1 141 ? -29.373 8.665  0.385   1.00 11.54 ? 141 GLN X CA  1 
ATOM   1112 C C   . GLN A 1 141 ? -28.052 8.244  -0.279  1.00 11.36 ? 141 GLN X C   1 
ATOM   1113 O O   . GLN A 1 141 ? -27.955 7.142  -0.829  1.00 11.27 ? 141 GLN X O   1 
ATOM   1114 C CB  . GLN A 1 141 ? -30.328 9.286  -0.654  1.00 11.11 ? 141 GLN X CB  1 
ATOM   1115 C CG  . GLN A 1 141 ? -31.731 9.648  -0.143  1.00 11.68 ? 141 GLN X CG  1 
ATOM   1116 C CD  . GLN A 1 141 ? -32.491 8.473  0.455   1.00 12.28 ? 141 GLN X CD  1 
ATOM   1117 O OE1 . GLN A 1 141 ? -33.057 8.574  1.545   1.00 13.63 ? 141 GLN X OE1 1 
ATOM   1118 N NE2 . GLN A 1 141 ? -32.498 7.355  -0.250  1.00 11.71 ? 141 GLN X NE2 1 
ATOM   1119 N N   . THR A 1 142 ? -27.054 9.135  -0.252  1.00 11.26 ? 142 THR X N   1 
ATOM   1120 C CA  . THR A 1 142 ? -25.725 8.852  -0.814  1.00 10.77 ? 142 THR X CA  1 
ATOM   1121 C C   . THR A 1 142 ? -24.641 9.282  0.177   1.00 10.85 ? 142 THR X C   1 
ATOM   1122 O O   . THR A 1 142 ? -23.914 10.239 -0.085  1.00 10.93 ? 142 THR X O   1 
ATOM   1123 C CB  . THR A 1 142 ? -25.488 9.521  -2.225  1.00 10.86 ? 142 THR X CB  1 
ATOM   1124 O OG1 . THR A 1 142 ? -25.671 10.940 -2.149  1.00 10.61 ? 142 THR X OG1 1 
ATOM   1125 C CG2 . THR A 1 142 ? -26.440 8.951  -3.296  1.00 11.15 ? 142 THR X CG2 1 
ATOM   1126 N N   . PRO A 1 143 ? -24.545 8.589  1.335   1.00 11.11 ? 143 PRO X N   1 
ATOM   1127 C CA  . PRO A 1 143 ? -23.625 9.034  2.400   1.00 11.29 ? 143 PRO X CA  1 
ATOM   1128 C C   . PRO A 1 143 ? -22.140 9.001  2.027   1.00 11.29 ? 143 PRO X C   1 
ATOM   1129 O O   . PRO A 1 143 ? -21.418 9.922  2.389   1.00 11.61 ? 143 PRO X O   1 
ATOM   1130 C CB  . PRO A 1 143 ? -23.921 8.075  3.569   1.00 11.38 ? 143 PRO X CB  1 
ATOM   1131 C CG  . PRO A 1 143 ? -24.679 6.924  2.982   1.00 11.26 ? 143 PRO X CG  1 
ATOM   1132 C CD  . PRO A 1 143 ? -25.312 7.386  1.717   1.00 10.85 ? 143 PRO X CD  1 
ATOM   1133 N N   . ASN A 1 144 ? -21.692 7.969  1.311   1.00 10.93 ? 144 ASN X N   1 
ATOM   1134 C CA  . ASN A 1 144 ? -20.269 7.854  0.991   1.00 11.15 ? 144 ASN X CA  1 
ATOM   1135 C C   . ASN A 1 144 ? -19.791 8.956  0.049   1.00 10.49 ? 144 ASN X C   1 
ATOM   1136 O O   . ASN A 1 144 ? -18.756 9.579  0.288   1.00 9.85  ? 144 ASN X O   1 
ATOM   1137 C CB  . ASN A 1 144 ? -19.922 6.467  0.459   1.00 11.38 ? 144 ASN X CB  1 
ATOM   1138 C CG  . ASN A 1 144 ? -19.947 5.404  1.560   1.00 13.50 ? 144 ASN X CG  1 
ATOM   1139 O OD1 . ASN A 1 144 ? -20.229 5.702  2.721   1.00 15.54 ? 144 ASN X OD1 1 
ATOM   1140 N ND2 . ASN A 1 144 ? -19.650 4.172  1.197   1.00 13.95 ? 144 ASN X ND2 1 
ATOM   1141 N N   . ARG A 1 145 ? -20.558 9.189  -1.011  1.00 9.87  ? 145 ARG X N   1 
ATOM   1142 C CA  . ARG A 1 145 ? -20.293 10.296 -1.913  1.00 10.00 ? 145 ARG X CA  1 
ATOM   1143 C C   . ARG A 1 145 ? -20.414 11.645 -1.189  1.00 9.94  ? 145 ARG X C   1 
ATOM   1144 O O   . ARG A 1 145 ? -19.525 12.495 -1.313  1.00 10.44 ? 145 ARG X O   1 
ATOM   1145 C CB  . ARG A 1 145 ? -21.230 10.239 -3.122  1.00 9.81  ? 145 ARG X CB  1 
ATOM   1146 C CG  . ARG A 1 145 ? -20.729 11.048 -4.341  1.00 11.02 ? 145 ARG X CG  1 
ATOM   1147 C CD  . ARG A 1 145 ? -21.811 11.965 -4.798  1.00 11.78 ? 145 ARG X CD  1 
ATOM   1148 N NE  . ARG A 1 145 ? -21.481 12.827 -5.937  1.00 10.97 ? 145 ARG X NE  1 
ATOM   1149 C CZ  . ARG A 1 145 ? -21.916 12.623 -7.183  1.00 11.00 ? 145 ARG X CZ  1 
ATOM   1150 N NH1 . ARG A 1 145 ? -22.677 11.571 -7.470  1.00 10.45 ? 145 ARG X NH1 1 
ATOM   1151 N NH2 . ARG A 1 145 ? -21.599 13.477 -8.151  1.00 8.69  ? 145 ARG X NH2 1 
ATOM   1152 N N   . ALA A 1 146 ? -21.495 11.838 -0.432  1.00 9.84  ? 146 ALA X N   1 
ATOM   1153 C CA  . ALA A 1 146 ? -21.686 13.079 0.325   1.00 10.17 ? 146 ALA X CA  1 
ATOM   1154 C C   . ALA A 1 146 ? -20.522 13.349 1.289   1.00 10.55 ? 146 ALA X C   1 
ATOM   1155 O O   . ALA A 1 146 ? -20.032 14.485 1.364   1.00 9.95  ? 146 ALA X O   1 
ATOM   1156 C CB  . ALA A 1 146 ? -23.025 13.093 1.057   1.00 10.36 ? 146 ALA X CB  1 
ATOM   1157 N N   . LYS A 1 147 ? -20.063 12.309 1.996   1.00 10.77 ? 147 LYS X N   1 
ATOM   1158 C CA  . LYS A 1 147 ? -18.911 12.441 2.905   1.00 11.66 ? 147 LYS X CA  1 
ATOM   1159 C C   . LYS A 1 147 ? -17.647 12.915 2.185   1.00 11.29 ? 147 LYS X C   1 
ATOM   1160 O O   . LYS A 1 147 ? -16.908 13.742 2.718   1.00 11.27 ? 147 LYS X O   1 
ATOM   1161 C CB  . LYS A 1 147 ? -18.589 11.129 3.615   1.00 11.89 ? 147 LYS X CB  1 
ATOM   1162 C CG  . LYS A 1 147 ? -19.496 10.775 4.774   1.00 14.65 ? 147 LYS X CG  1 
ATOM   1163 C CD  . LYS A 1 147 ? -19.184 9.355  5.231   1.00 17.13 ? 147 LYS X CD  1 
ATOM   1164 C CE  . LYS A 1 147 ? -19.953 8.984  6.478   1.00 20.89 ? 147 LYS X CE  1 
ATOM   1165 N NZ  . LYS A 1 147 ? -21.398 8.897  6.182   1.00 24.66 ? 147 LYS X NZ  1 
ATOM   1166 N N   . ARG A 1 148 ? -17.393 12.374 0.993   1.00 10.90 ? 148 ARG X N   1 
ATOM   1167 C CA  . ARG A 1 148 ? -16.244 12.817 0.196   1.00 10.76 ? 148 ARG X CA  1 
ATOM   1168 C C   . ARG A 1 148 ? -16.372 14.301 -0.160  1.00 10.59 ? 148 ARG X C   1 
ATOM   1169 O O   . ARG A 1 148 ? -15.415 15.068 0.001   1.00 9.99  ? 148 ARG X O   1 
ATOM   1170 C CB  . ARG A 1 148 ? -16.081 11.979 -1.077  1.00 10.87 ? 148 ARG X CB  1 
ATOM   1171 C CG  . ARG A 1 148 ? -15.545 10.571 -0.842  1.00 9.90  ? 148 ARG X CG  1 
ATOM   1172 C CD  . ARG A 1 148 ? -15.104 9.934  -2.143  1.00 10.22 ? 148 ARG X CD  1 
ATOM   1173 N NE  . ARG A 1 148 ? -16.210 9.658  -3.060  1.00 10.16 ? 148 ARG X NE  1 
ATOM   1174 C CZ  . ARG A 1 148 ? -16.971 8.568  -3.019  1.00 10.64 ? 148 ARG X CZ  1 
ATOM   1175 N NH1 . ARG A 1 148 ? -16.779 7.644  -2.076  1.00 9.51  ? 148 ARG X NH1 1 
ATOM   1176 N NH2 . ARG A 1 148 ? -17.941 8.411  -3.911  1.00 9.86  ? 148 ARG X NH2 1 
ATOM   1177 N N   . VAL A 1 149 ? -17.558 14.698 -0.626  1.00 10.72 ? 149 VAL X N   1 
ATOM   1178 C CA  . VAL A 1 149 ? -17.790 16.083 -1.070  1.00 10.94 ? 149 VAL X CA  1 
ATOM   1179 C C   . VAL A 1 149 ? -17.707 17.027 0.132   1.00 11.18 ? 149 VAL X C   1 
ATOM   1180 O O   . VAL A 1 149 ? -17.109 18.105 0.045   1.00 10.59 ? 149 VAL X O   1 
ATOM   1181 C CB  . VAL A 1 149 ? -19.139 16.244 -1.836  1.00 10.78 ? 149 VAL X CB  1 
ATOM   1182 C CG1 . VAL A 1 149 ? -19.463 17.736 -2.089  1.00 11.93 ? 149 VAL X CG1 1 
ATOM   1183 C CG2 . VAL A 1 149 ? -19.110 15.466 -3.153  1.00 11.33 ? 149 VAL X CG2 1 
ATOM   1184 N N   . ILE A 1 150 ? -18.285 16.596 1.256   1.00 11.17 ? 150 ILE X N   1 
ATOM   1185 C CA  . ILE A 1 150 ? -18.226 17.359 2.506   1.00 11.61 ? 150 ILE X CA  1 
ATOM   1186 C C   . ILE A 1 150 ? -16.788 17.524 3.049   1.00 11.69 ? 150 ILE X C   1 
ATOM   1187 O O   . ILE A 1 150 ? -16.420 18.605 3.513   1.00 11.44 ? 150 ILE X O   1 
ATOM   1188 C CB  . ILE A 1 150 ? -19.178 16.783 3.591   1.00 11.32 ? 150 ILE X CB  1 
ATOM   1189 C CG1 . ILE A 1 150 ? -20.639 17.001 3.174   1.00 12.54 ? 150 ILE X CG1 1 
ATOM   1190 C CG2 . ILE A 1 150 ? -18.961 17.503 4.918   1.00 11.86 ? 150 ILE X CG2 1 
ATOM   1191 C CD1 . ILE A 1 150 ? -21.652 16.147 3.947   1.00 13.00 ? 150 ILE X CD1 1 
ATOM   1192 N N   . THR A 1 151 ? -15.981 16.464 2.976   1.00 11.61 ? 151 THR X N   1 
ATOM   1193 C CA  . THR A 1 151 ? -14.580 16.547 3.414   1.00 12.03 ? 151 THR X CA  1 
ATOM   1194 C C   . THR A 1 151 ? -13.822 17.591 2.591   1.00 11.62 ? 151 THR X C   1 
ATOM   1195 O O   . THR A 1 151 ? -12.958 18.308 3.110   1.00 11.64 ? 151 THR X O   1 
ATOM   1196 C CB  . THR A 1 151 ? -13.888 15.175 3.328   1.00 12.33 ? 151 THR X CB  1 
ATOM   1197 O OG1 . THR A 1 151 ? -14.501 14.298 4.274   1.00 12.64 ? 151 THR X OG1 1 
ATOM   1198 C CG2 . THR A 1 151 ? -12.391 15.275 3.637   1.00 12.45 ? 151 THR X CG2 1 
ATOM   1199 N N   . THR A 1 152 ? -14.166 17.660 1.309   1.00 11.25 ? 152 THR X N   1 
ATOM   1200 C CA  . THR A 1 152 ? -13.570 18.599 0.376   1.00 11.53 ? 152 THR X CA  1 
ATOM   1201 C C   . THR A 1 152 ? -13.918 20.044 0.769   1.00 11.46 ? 152 THR X C   1 
ATOM   1202 O O   . THR A 1 152 ? -13.025 20.893 0.840   1.00 11.72 ? 152 THR X O   1 
ATOM   1203 C CB  . THR A 1 152 ? -13.977 18.263 -1.082  1.00 11.23 ? 152 THR X CB  1 
ATOM   1204 O OG1 . THR A 1 152 ? -13.757 16.863 -1.313  1.00 11.58 ? 152 THR X OG1 1 
ATOM   1205 C CG2 . THR A 1 152 ? -13.158 19.081 -2.089  1.00 11.00 ? 152 THR X CG2 1 
ATOM   1206 N N   . PHE A 1 153 ? -15.197 20.305 1.059   1.00 11.68 ? 153 PHE X N   1 
ATOM   1207 C CA  . PHE A 1 153 ? -15.617 21.597 1.626   1.00 11.74 ? 153 PHE X CA  1 
ATOM   1208 C C   . PHE A 1 153 ? -14.972 21.891 2.980   1.00 12.10 ? 153 PHE X C   1 
ATOM   1209 O O   . PHE A 1 153 ? -14.611 23.028 3.261   1.00 12.33 ? 153 PHE X O   1 
ATOM   1210 C CB  . PHE A 1 153 ? -17.135 21.666 1.803   1.00 11.64 ? 153 PHE X CB  1 
ATOM   1211 C CG  . PHE A 1 153 ? -17.891 22.014 0.558   1.00 11.41 ? 153 PHE X CG  1 
ATOM   1212 C CD1 . PHE A 1 153 ? -17.581 23.157 -0.177  1.00 11.23 ? 153 PHE X CD1 1 
ATOM   1213 C CD2 . PHE A 1 153 ? -18.952 21.213 0.139   1.00 11.41 ? 153 PHE X CD2 1 
ATOM   1214 C CE1 . PHE A 1 153 ? -18.304 23.491 -1.325  1.00 9.62  ? 153 PHE X CE1 1 
ATOM   1215 C CE2 . PHE A 1 153 ? -19.684 21.538 -1.010  1.00 10.98 ? 153 PHE X CE2 1 
ATOM   1216 C CZ  . PHE A 1 153 ? -19.357 22.683 -1.740  1.00 9.61  ? 153 PHE X CZ  1 
ATOM   1217 N N   . ARG A 1 154 ? -14.843 20.876 3.831   1.00 12.50 ? 154 ARG X N   1 
ATOM   1218 C CA  . ARG A 1 154 ? -14.300 21.099 5.177   1.00 12.57 ? 154 ARG X CA  1 
ATOM   1219 C C   . ARG A 1 154 ? -12.810 21.448 5.175   1.00 12.43 ? 154 ARG X C   1 
ATOM   1220 O O   . ARG A 1 154 ? -12.380 22.315 5.947   1.00 11.88 ? 154 ARG X O   1 
ATOM   1221 C CB  . ARG A 1 154 ? -14.569 19.896 6.097   1.00 12.77 ? 154 ARG X CB  1 
ATOM   1222 C CG  . ARG A 1 154 ? -14.161 20.134 7.563   1.00 14.06 ? 154 ARG X CG  1 
ATOM   1223 C CD  . ARG A 1 154 ? -14.378 18.914 8.458   1.00 16.56 ? 154 ARG X CD  1 
ATOM   1224 N NE  . ARG A 1 154 ? -13.762 17.692 7.932   1.00 19.75 ? 154 ARG X NE  1 
ATOM   1225 C CZ  . ARG A 1 154 ? -12.501 17.306 8.150   1.00 21.97 ? 154 ARG X CZ  1 
ATOM   1226 N NH1 . ARG A 1 154 ? -11.676 18.046 8.886   1.00 23.02 ? 154 ARG X NH1 1 
ATOM   1227 N NH2 . ARG A 1 154 ? -12.057 16.173 7.616   1.00 22.73 ? 154 ARG X NH2 1 
ATOM   1228 N N   . THR A 1 155 ? -12.044 20.789 4.299   1.00 12.58 ? 155 THR X N   1 
ATOM   1229 C CA  . THR A 1 155 ? -10.570 20.859 4.315   1.00 12.85 ? 155 THR X CA  1 
ATOM   1230 C C   . THR A 1 155 ? -9.945  21.700 3.204   1.00 12.91 ? 155 THR X C   1 
ATOM   1231 O O   . THR A 1 155 ? -8.847  22.237 3.374   1.00 12.70 ? 155 THR X O   1 
ATOM   1232 C CB  . THR A 1 155 ? -9.931  19.457 4.221   1.00 12.80 ? 155 THR X CB  1 
ATOM   1233 O OG1 . THR A 1 155 ? -10.293 18.853 2.966   1.00 12.83 ? 155 THR X OG1 1 
ATOM   1234 C CG2 . THR A 1 155 ? -10.363 18.564 5.398   1.00 13.06 ? 155 THR X CG2 1 
ATOM   1235 N N   . GLY A 1 156 ? -10.626 21.790 2.064   1.00 12.67 ? 156 GLY X N   1 
ATOM   1236 C CA  . GLY A 1 156 ? -10.073 22.460 0.896   1.00 12.67 ? 156 GLY X CA  1 
ATOM   1237 C C   . GLY A 1 156 ? -8.907  21.652 0.339   1.00 12.69 ? 156 GLY X C   1 
ATOM   1238 O O   . GLY A 1 156 ? -7.994  22.199 -0.275  1.00 12.50 ? 156 GLY X O   1 
ATOM   1239 N N   . THR A 1 157 ? -8.929  20.347 0.603   1.00 12.51 ? 157 THR X N   1 
ATOM   1240 C CA  . THR A 1 157 ? -7.948  19.417 0.071   1.00 12.29 ? 157 THR X CA  1 
ATOM   1241 C C   . THR A 1 157 ? -8.684  18.332 -0.715  1.00 12.43 ? 157 THR X C   1 
ATOM   1242 O O   . THR A 1 157 ? -9.911  18.211 -0.623  1.00 12.28 ? 157 THR X O   1 
ATOM   1243 C CB  . THR A 1 157 ? -7.126  18.737 1.182   1.00 12.64 ? 157 THR X CB  1 
ATOM   1244 O OG1 . THR A 1 157 ? -7.968  17.847 1.927   1.00 12.43 ? 157 THR X OG1 1 
ATOM   1245 C CG2 . THR A 1 157 ? -6.460  19.766 2.112   1.00 12.27 ? 157 THR X CG2 1 
ATOM   1246 N N   . TRP A 1 158 ? -7.922  17.549 -1.475  1.00 12.38 ? 158 TRP X N   1 
ATOM   1247 C CA  . TRP A 1 158 ? -8.440  16.401 -2.204  1.00 12.46 ? 158 TRP X CA  1 
ATOM   1248 C C   . TRP A 1 158 ? -8.252  15.081 -1.450  1.00 13.05 ? 158 TRP X C   1 
ATOM   1249 O O   . TRP A 1 158 ? -8.253  14.005 -2.061  1.00 12.73 ? 158 TRP X O   1 
ATOM   1250 C CB  . TRP A 1 158 ? -7.728  16.298 -3.550  1.00 12.32 ? 158 TRP X CB  1 
ATOM   1251 C CG  . TRP A 1 158 ? -8.046  17.401 -4.517  1.00 11.79 ? 158 TRP X CG  1 
ATOM   1252 C CD1 . TRP A 1 158 ? -7.206  18.381 -4.943  1.00 12.26 ? 158 TRP X CD1 1 
ATOM   1253 C CD2 . TRP A 1 158 ? -9.293  17.618 -5.189  1.00 12.86 ? 158 TRP X CD2 1 
ATOM   1254 N NE1 . TRP A 1 158 ? -7.847  19.202 -5.843  1.00 11.95 ? 158 TRP X NE1 1 
ATOM   1255 C CE2 . TRP A 1 158 ? -9.129  18.749 -6.018  1.00 13.06 ? 158 TRP X CE2 1 
ATOM   1256 C CE3 . TRP A 1 158 ? -10.530 16.950 -5.188  1.00 13.30 ? 158 TRP X CE3 1 
ATOM   1257 C CZ2 . TRP A 1 158 ? -10.159 19.243 -6.828  1.00 13.01 ? 158 TRP X CZ2 1 
ATOM   1258 C CZ3 . TRP A 1 158 ? -11.553 17.438 -6.001  1.00 12.84 ? 158 TRP X CZ3 1 
ATOM   1259 C CH2 . TRP A 1 158 ? -11.356 18.572 -6.810  1.00 12.98 ? 158 TRP X CH2 1 
ATOM   1260 N N   . ASP A 1 159 ? -8.092  15.151 -0.131  1.00 13.56 ? 159 ASP X N   1 
ATOM   1261 C CA  . ASP A 1 159 ? -7.775  13.956 0.666   1.00 14.46 ? 159 ASP X CA  1 
ATOM   1262 C C   . ASP A 1 159 ? -8.793  12.819 0.521   1.00 14.38 ? 159 ASP X C   1 
ATOM   1263 O O   . ASP A 1 159 ? -8.421  11.646 0.458   1.00 14.07 ? 159 ASP X O   1 
ATOM   1264 C CB  . ASP A 1 159 ? -7.596  14.322 2.140   1.00 15.28 ? 159 ASP X CB  1 
ATOM   1265 C CG  . ASP A 1 159 ? -6.285  15.055 2.409   1.00 16.90 ? 159 ASP X CG  1 
ATOM   1266 O OD1 . ASP A 1 159 ? -5.446  15.191 1.489   1.00 19.08 ? 159 ASP X OD1 1 
ATOM   1267 O OD2 . ASP A 1 159 ? -6.092  15.493 3.557   1.00 19.88 ? 159 ASP X OD2 1 
ATOM   1268 N N   . ALA A 1 160 ? -10.072 13.172 0.452   1.00 14.53 ? 160 ALA X N   1 
ATOM   1269 C CA  . ALA A 1 160 ? -11.149 12.185 0.317   1.00 14.49 ? 160 ALA X CA  1 
ATOM   1270 C C   . ALA A 1 160 ? -11.156 11.452 -1.036  1.00 14.55 ? 160 ALA X C   1 
ATOM   1271 O O   . ALA A 1 160 ? -11.862 10.453 -1.194  1.00 14.48 ? 160 ALA X O   1 
ATOM   1272 C CB  . ALA A 1 160 ? -12.515 12.844 0.592   1.00 14.24 ? 160 ALA X CB  1 
ATOM   1273 N N   . TYR A 1 161 ? -10.381 11.949 -2.001  1.00 14.90 ? 161 TYR X N   1 
ATOM   1274 C CA  . TYR A 1 161 ? -10.296 11.328 -3.328  1.00 15.62 ? 161 TYR X CA  1 
ATOM   1275 C C   . TYR A 1 161 ? -8.944  10.658 -3.627  1.00 17.08 ? 161 TYR X C   1 
ATOM   1276 O O   . TYR A 1 161 ? -8.767  10.053 -4.684  1.00 17.02 ? 161 TYR X O   1 
ATOM   1277 C CB  . TYR A 1 161 ? -10.681 12.324 -4.430  1.00 15.29 ? 161 TYR X CB  1 
ATOM   1278 C CG  . TYR A 1 161 ? -12.147 12.687 -4.393  1.00 13.58 ? 161 TYR X CG  1 
ATOM   1279 C CD1 . TYR A 1 161 ? -12.593 13.751 -3.618  1.00 11.99 ? 161 TYR X CD1 1 
ATOM   1280 C CD2 . TYR A 1 161 ? -13.092 11.942 -5.111  1.00 11.83 ? 161 TYR X CD2 1 
ATOM   1281 C CE1 . TYR A 1 161 ? -13.932 14.079 -3.553  1.00 10.59 ? 161 TYR X CE1 1 
ATOM   1282 C CE2 . TYR A 1 161 ? -14.442 12.260 -5.060  1.00 10.89 ? 161 TYR X CE2 1 
ATOM   1283 C CZ  . TYR A 1 161 ? -14.855 13.333 -4.276  1.00 10.31 ? 161 TYR X CZ  1 
ATOM   1284 O OH  . TYR A 1 161 ? -16.178 13.667 -4.210  1.00 8.52  ? 161 TYR X OH  1 
ATOM   1285 N N   . LYS A 1 162 ? -8.014  10.796 -2.695  1.00 20.00 ? 162 LYS X N   1 
ATOM   1286 C CA  . LYS A 1 162 ? -6.803  9.995  -2.415  1.00 20.00 ? 162 LYS X CA  1 
ATOM   1287 C C   . LYS A 1 162 ? -5.540  10.818 -2.169  1.00 20.00 ? 162 LYS X C   1 
ATOM   1288 O O   . LYS A 1 162 ? -5.377  11.917 -2.714  1.00 21.67 ? 162 LYS X O   1 
ATOM   1289 C CB  . LYS A 1 162 ? -6.555  8.739  -3.231  1.00 20.00 ? 162 LYS X CB  1 
ATOM   1290 C CG  . LYS A 1 162 ? -6.842  7.516  -2.470  1.00 20.00 ? 162 LYS X CG  1 
ATOM   1291 C CD  . LYS A 1 162 ? -6.631  6.217  -3.228  1.00 20.00 ? 162 LYS X CD  1 
ATOM   1292 C CE  . LYS A 1 162 ? -7.974  5.554  -3.655  1.00 20.00 ? 162 LYS X CE  1 
ATOM   1293 N NZ  . LYS A 1 162 ? -8.731  6.348  -4.621  1.00 20.00 ? 162 LYS X NZ  1 
HETATM 1294 P P   . PO4 B 2 .   ? -15.712 26.690 12.170  0.50 8.58  ? 301 PO4 X P   1 
HETATM 1295 O O1  . PO4 B 2 .   ? -15.401 26.377 13.630  0.50 5.42  ? 301 PO4 X O1  1 
HETATM 1296 O O2  . PO4 B 2 .   ? -15.501 28.174 11.935  0.50 5.04  ? 301 PO4 X O2  1 
HETATM 1297 O O3  . PO4 B 2 .   ? -14.872 25.789 11.293  0.50 3.53  ? 301 PO4 X O3  1 
HETATM 1298 O O4  . PO4 B 2 .   ? -17.157 26.385 11.824  0.50 4.66  ? 301 PO4 X O4  1 
HETATM 1299 P P   . PO4 C 2 .   ? -18.153 3.966  -2.002  0.50 20.30 ? 302 PO4 X P   1 
HETATM 1300 O O1  . PO4 C 2 .   ? -17.337 2.889  -2.679  0.50 20.77 ? 302 PO4 X O1  1 
HETATM 1301 O O2  . PO4 C 2 .   ? -18.673 4.970  -3.000  0.50 20.84 ? 302 PO4 X O2  1 
HETATM 1302 O O3  . PO4 C 2 .   ? -19.315 3.288  -1.306  0.50 20.06 ? 302 PO4 X O3  1 
HETATM 1303 O O4  . PO4 C 2 .   ? -17.295 4.664  -0.982  0.50 20.93 ? 302 PO4 X O4  1 
HETATM 1304 C CAA . MR3 D 3 .   ? -22.478 24.237 -2.864  1.00 19.17 ? 303 MR3 X CAA 1 
HETATM 1305 N NAF . MR3 D 3 .   ? -22.334 25.406 -3.761  1.00 19.00 ? 303 MR3 X NAF 1 
HETATM 1306 C CAD . MR3 D 3 .   ? -22.815 25.479 -4.998  1.00 19.36 ? 303 MR3 X CAD 1 
HETATM 1307 C CAB . MR3 D 3 .   ? -22.478 26.679 -5.473  1.00 18.96 ? 303 MR3 X CAB 1 
HETATM 1308 C CAC . MR3 D 3 .   ? -21.793 27.320 -4.522  1.00 19.60 ? 303 MR3 X CAC 1 
HETATM 1309 C CAE . MR3 D 3 .   ? -21.695 26.531 -3.448  1.00 19.27 ? 303 MR3 X CAE 1 
HETATM 1310 C CAA . MR3 E 3 .   ? -16.105 24.768 -17.074 1.00 32.69 ? 304 MR3 X CAA 1 
HETATM 1311 N NAF . MR3 E 3 .   ? -15.310 24.042 -18.090 1.00 32.98 ? 304 MR3 X NAF 1 
HETATM 1312 C CAD . MR3 E 3 .   ? -15.627 22.857 -18.597 1.00 32.35 ? 304 MR3 X CAD 1 
HETATM 1313 C CAB . MR3 E 3 .   ? -14.675 22.552 -19.471 1.00 32.01 ? 304 MR3 X CAB 1 
HETATM 1314 C CAC . MR3 E 3 .   ? -13.793 23.551 -19.497 1.00 32.18 ? 304 MR3 X CAC 1 
HETATM 1315 C CAE . MR3 E 3 .   ? -14.182 24.484 -18.631 1.00 32.44 ? 304 MR3 X CAE 1 
HETATM 1316 O O   . HOH F 4 .   ? -29.368 6.748  -3.350  1.00 20.89 ? 305 HOH X O   1 
HETATM 1317 O O   . HOH F 4 .   ? -23.181 5.458  0.074   1.00 6.58  ? 306 HOH X O   1 
HETATM 1318 O O   . HOH F 4 .   ? -21.997 13.190 -18.036 1.00 10.74 ? 307 HOH X O   1 
HETATM 1319 O O   . HOH F 4 .   ? -11.289 15.801 -0.268  1.00 10.68 ? 308 HOH X O   1 
HETATM 1320 O O   . HOH F 4 .   ? -21.355 11.113 -19.889 1.00 10.81 ? 309 HOH X O   1 
HETATM 1321 O O   . HOH F 4 .   ? -33.342 10.812 3.402   1.00 11.17 ? 310 HOH X O   1 
HETATM 1322 O O   . HOH F 4 .   ? -30.942 17.179 0.453   1.00 10.24 ? 311 HOH X O   1 
HETATM 1323 O O   . HOH F 4 .   ? -16.079 30.958 1.107   1.00 12.04 ? 312 HOH X O   1 
HETATM 1324 O O   . HOH F 4 .   ? -24.384 16.733 10.808  1.00 16.34 ? 313 HOH X O   1 
HETATM 1325 O O   . HOH F 4 .   ? -28.788 24.551 4.693   1.00 25.22 ? 314 HOH X O   1 
HETATM 1326 O O   . HOH F 4 .   ? -20.914 22.917 -22.976 1.00 21.11 ? 315 HOH X O   1 
HETATM 1327 O O   . HOH F 4 .   ? -25.808 9.402  -11.982 1.00 16.11 ? 316 HOH X O   1 
HETATM 1328 O O   . HOH F 4 .   ? -22.798 7.447  -1.830  1.00 9.27  ? 317 HOH X O   1 
HETATM 1329 O O   . HOH F 4 .   ? -15.906 16.301 6.934   1.00 20.75 ? 318 HOH X O   1 
HETATM 1330 O O   . HOH F 4 .   ? -11.189 21.267 -10.778 1.00 18.71 ? 319 HOH X O   1 
HETATM 1331 O O   . HOH F 4 .   ? -22.456 15.908 -4.777  1.00 11.94 ? 320 HOH X O   1 
HETATM 1332 O O   . HOH F 4 .   ? -24.597 16.876 -22.519 1.00 14.47 ? 321 HOH X O   1 
HETATM 1333 O O   . HOH F 4 .   ? -39.091 1.368  -16.880 1.00 13.65 ? 322 HOH X O   1 
HETATM 1334 O O   . HOH F 4 .   ? -11.573 29.362 0.731   1.00 12.76 ? 323 HOH X O   1 
HETATM 1335 O O   . HOH F 4 .   ? -13.200 26.549 9.545   1.00 15.79 ? 324 HOH X O   1 
HETATM 1336 O O   . HOH F 4 .   ? -17.293 19.192 10.646  1.00 13.10 ? 325 HOH X O   1 
HETATM 1337 O O   . HOH F 4 .   ? -27.465 6.694  5.132   1.00 8.81  ? 326 HOH X O   1 
HETATM 1338 O O   . HOH F 4 .   ? -32.751 13.670 5.760   1.00 7.90  ? 327 HOH X O   1 
HETATM 1339 O O   . HOH F 4 .   ? -28.578 29.469 -13.237 1.00 19.94 ? 328 HOH X O   1 
HETATM 1340 O O   . HOH F 4 .   ? -10.855 9.892  -11.758 1.00 13.42 ? 329 HOH X O   1 
HETATM 1341 O O   . HOH F 4 .   ? -14.596 5.718  -27.762 1.00 20.53 ? 330 HOH X O   1 
HETATM 1342 O O   . HOH F 4 .   ? -26.800 12.668 -13.076 1.00 11.74 ? 331 HOH X O   1 
HETATM 1343 O O   . HOH F 4 .   ? -33.637 4.596  -5.658  1.00 11.86 ? 332 HOH X O   1 
HETATM 1344 O O   . HOH F 4 .   ? -23.736 7.272  -11.912 1.00 12.16 ? 333 HOH X O   1 
HETATM 1345 O O   . HOH F 4 .   ? -16.095 34.932 1.721   1.00 15.12 ? 334 HOH X O   1 
HETATM 1346 O O   . HOH F 4 .   ? -14.770 7.371  0.046   1.00 18.74 ? 335 HOH X O   1 
HETATM 1347 O O   . HOH F 4 .   ? -7.423  15.159 -15.426 1.00 11.77 ? 336 HOH X O   1 
HETATM 1348 O O   . HOH F 4 .   ? -20.412 7.870  -5.759  1.00 14.90 ? 337 HOH X O   1 
HETATM 1349 O O   . HOH F 4 .   ? -23.497 23.621 11.637  1.00 16.08 ? 338 HOH X O   1 
HETATM 1350 O O   . HOH F 4 .   ? -16.902 8.393  2.004   1.00 10.80 ? 339 HOH X O   1 
HETATM 1351 O O   . HOH F 4 .   ? -36.709 2.989  -11.615 1.00 19.48 ? 340 HOH X O   1 
HETATM 1352 O O   . HOH F 4 .   ? -35.881 7.499  -15.743 1.00 14.29 ? 341 HOH X O   1 
HETATM 1353 O O   . HOH F 4 .   ? -20.401 16.451 8.237   1.00 13.64 ? 342 HOH X O   1 
HETATM 1354 O O   . HOH F 4 .   ? -5.631  22.289 -1.497  1.00 13.03 ? 343 HOH X O   1 
HETATM 1355 O O   . HOH F 4 .   ? -31.988 6.486  -2.948  1.00 18.90 ? 344 HOH X O   1 
HETATM 1356 O O   . HOH F 4 .   ? -7.270  21.770 5.550   1.00 20.33 ? 345 HOH X O   1 
HETATM 1357 O O   . HOH F 4 .   ? -17.652 17.868 -25.154 1.00 25.94 ? 346 HOH X O   1 
HETATM 1358 O O   . HOH F 4 .   ? -23.112 15.165 -28.671 1.00 15.87 ? 347 HOH X O   1 
HETATM 1359 O O   . HOH F 4 .   ? -27.355 31.632 2.183   1.00 18.03 ? 348 HOH X O   1 
HETATM 1360 O O   . HOH F 4 .   ? -15.117 28.890 -12.414 1.00 20.88 ? 349 HOH X O   1 
HETATM 1361 O O   . HOH F 4 .   ? -15.748 2.891  -26.313 1.00 18.19 ? 350 HOH X O   1 
HETATM 1362 O O   . HOH F 4 .   ? -36.692 5.164  -14.452 1.00 22.75 ? 351 HOH X O   1 
HETATM 1363 O O   . HOH F 4 .   ? -25.510 12.359 -10.368 1.00 12.90 ? 352 HOH X O   1 
HETATM 1364 O O   . HOH F 4 .   ? -26.613 15.033 -15.937 1.00 19.01 ? 353 HOH X O   1 
HETATM 1365 O O   . HOH F 4 .   ? -5.111  18.234 -1.765  1.00 15.73 ? 354 HOH X O   1 
HETATM 1366 O O   . HOH F 4 .   ? -34.535 5.556  1.161   1.00 15.04 ? 355 HOH X O   1 
HETATM 1367 O O   . HOH F 4 .   ? -12.744 12.229 -25.116 1.00 21.30 ? 356 HOH X O   1 
HETATM 1368 O O   . HOH F 4 .   ? -29.591 9.401  -4.359  1.00 21.00 ? 357 HOH X O   1 
HETATM 1369 O O   . HOH F 4 .   ? -21.623 5.530  -14.631 1.00 22.15 ? 358 HOH X O   1 
HETATM 1370 O O   . HOH F 4 .   ? -32.013 28.945 -7.233  1.00 33.15 ? 359 HOH X O   1 
HETATM 1371 O O   . HOH F 4 .   ? -20.578 10.433 -32.106 1.00 20.57 ? 360 HOH X O   1 
HETATM 1372 O O   . HOH F 4 .   ? -36.880 5.581  -28.478 1.00 20.37 ? 361 HOH X O   1 
HETATM 1373 O O   . HOH F 4 .   ? -28.509 11.742 -2.799  1.00 20.29 ? 362 HOH X O   1 
HETATM 1374 O O   . HOH F 4 .   ? -38.236 2.809  -14.906 1.00 26.85 ? 363 HOH X O   1 
HETATM 1375 O O   . HOH F 4 .   ? -13.592 30.485 9.921   1.00 15.40 ? 364 HOH X O   1 
HETATM 1376 O O   . HOH F 4 .   ? -24.572 2.566  -30.725 1.00 28.66 ? 365 HOH X O   1 
HETATM 1377 O O   . HOH F 4 .   ? -19.151 22.565 13.740  1.00 24.66 ? 366 HOH X O   1 
HETATM 1378 O O   . HOH F 4 .   ? -28.324 10.432 -13.105 1.00 15.66 ? 367 HOH X O   1 
HETATM 1379 O O   A HOH F 4 .   ? -20.206 -0.031 -19.820 0.50 11.03 ? 368 HOH X O   1 
HETATM 1380 O O   B HOH F 4 .   ? -21.992 -0.718 -18.948 0.50 16.13 ? 368 HOH X O   1 
HETATM 1381 O O   . HOH F 4 .   ? -27.120 -1.018 -17.900 1.00 27.64 ? 369 HOH X O   1 
HETATM 1382 O O   . HOH F 4 .   ? -37.733 -0.847 -15.344 1.00 25.77 ? 370 HOH X O   1 
HETATM 1383 O O   . HOH F 4 .   ? -24.533 33.696 1.988   1.00 36.91 ? 371 HOH X O   1 
HETATM 1384 O O   . HOH F 4 .   ? -15.306 3.253  -12.325 1.00 33.19 ? 372 HOH X O   1 
HETATM 1385 O O   . HOH F 4 .   ? -23.820 9.393  -6.124  1.00 23.34 ? 373 HOH X O   1 
HETATM 1386 O O   . HOH F 4 .   ? -26.135 22.867 11.535  1.00 16.31 ? 374 HOH X O   1 
HETATM 1387 O O   . HOH F 4 .   ? -12.787 8.846  0.791   1.00 18.37 ? 375 HOH X O   1 
HETATM 1388 O O   . HOH F 4 .   ? -17.139 14.090 5.686   1.00 14.48 ? 376 HOH X O   1 
HETATM 1389 O O   . HOH F 4 .   ? -30.749 11.658 -10.149 1.00 21.69 ? 377 HOH X O   1 
HETATM 1390 O O   . HOH F 4 .   ? -23.167 11.332 -33.477 1.00 33.06 ? 378 HOH X O   1 
HETATM 1391 O O   . HOH F 4 .   ? -20.750 3.628  -32.114 1.00 23.52 ? 379 HOH X O   1 
HETATM 1392 O O   . HOH F 4 .   ? -14.904 13.027 -26.299 1.00 14.77 ? 380 HOH X O   1 
HETATM 1393 O O   . HOH F 4 .   ? -26.141 25.633 -17.528 1.00 23.17 ? 381 HOH X O   1 
HETATM 1394 O O   . HOH F 4 .   ? -35.955 7.949  -6.489  1.00 30.52 ? 382 HOH X O   1 
HETATM 1395 O O   . HOH F 4 .   ? -5.067  15.807 -11.616 1.00 23.09 ? 383 HOH X O   1 
HETATM 1396 O O   . HOH F 4 .   ? -26.076 33.074 -1.636  1.00 28.55 ? 384 HOH X O   1 
HETATM 1397 O O   . HOH F 4 .   ? -20.079 6.186  -32.514 1.00 19.92 ? 385 HOH X O   1 
HETATM 1398 O O   . HOH F 4 .   ? -18.326 2.673  -13.401 1.00 22.05 ? 386 HOH X O   1 
HETATM 1399 O O   . HOH F 4 .   ? -29.111 -0.668 -21.049 1.00 28.67 ? 387 HOH X O   1 
HETATM 1400 O O   . HOH F 4 .   ? -34.498 6.695  -4.371  1.00 25.35 ? 388 HOH X O   1 
HETATM 1401 O O   . HOH F 4 .   ? -32.557 17.509 -6.690  1.00 40.01 ? 389 HOH X O   1 
HETATM 1402 O O   . HOH F 4 .   ? -8.422  10.410 -10.593 1.00 26.71 ? 390 HOH X O   1 
HETATM 1403 O O   . HOH F 4 .   ? -25.853 37.386 -6.749  1.00 35.11 ? 391 HOH X O   1 
HETATM 1404 O O   . HOH F 4 .   ? -25.129 19.360 -15.679 1.00 34.92 ? 392 HOH X O   1 
HETATM 1405 O O   . HOH F 4 .   ? -20.493 12.279 8.267   1.00 14.80 ? 393 HOH X O   1 
HETATM 1406 O O   . HOH F 4 .   ? -14.083 34.491 6.601   1.00 26.25 ? 394 HOH X O   1 
HETATM 1407 O O   . HOH F 4 .   ? -12.071 24.094 9.659   1.00 14.80 ? 395 HOH X O   1 
HETATM 1408 O O   . HOH F 4 .   ? -18.731 36.390 -3.273  1.00 14.77 ? 396 HOH X O   1 
HETATM 1409 O O   . HOH F 4 .   ? -29.816 7.128  6.461   1.00 22.96 ? 397 HOH X O   1 
HETATM 1410 O O   . HOH F 4 .   ? -21.906 2.563  -29.951 1.00 22.06 ? 398 HOH X O   1 
HETATM 1411 O O   . HOH F 4 .   ? -37.292 6.437  -9.780  1.00 30.08 ? 399 HOH X O   1 
HETATM 1412 O O   . HOH F 4 .   ? -40.846 2.015  -22.759 1.00 32.44 ? 400 HOH X O   1 
HETATM 1413 O O   . HOH F 4 .   ? -17.094 7.228  -30.790 1.00 26.23 ? 401 HOH X O   1 
HETATM 1414 O O   . HOH F 4 .   ? -16.268 5.249  -9.974  1.00 22.87 ? 402 HOH X O   1 
HETATM 1415 O O   . HOH F 4 .   ? -38.372 6.945  -13.307 1.00 29.67 ? 403 HOH X O   1 
HETATM 1416 O O   . HOH F 4 .   ? -31.781 14.617 -2.423  1.00 26.50 ? 404 HOH X O   1 
HETATM 1417 O O   . HOH F 4 .   ? -23.823 21.860 -22.352 1.00 24.65 ? 405 HOH X O   1 
HETATM 1418 O O   A HOH F 4 .   ? -37.506 14.026 -17.502 0.50 15.98 ? 406 HOH X O   1 
HETATM 1419 O O   B HOH F 4 .   ? -37.074 14.037 -19.796 0.50 12.92 ? 406 HOH X O   1 
HETATM 1420 O O   . HOH F 4 .   ? -25.628 16.965 -14.572 1.00 27.25 ? 407 HOH X O   1 
HETATM 1421 O O   . HOH F 4 .   ? -13.093 5.504  -10.752 1.00 29.31 ? 408 HOH X O   1 
HETATM 1422 O O   . HOH F 4 .   ? -20.037 0.951  -26.520 1.00 23.07 ? 409 HOH X O   1 
HETATM 1423 O O   . HOH F 4 .   ? -11.368 12.404 -15.651 1.00 21.28 ? 410 HOH X O   1 
HETATM 1424 O O   . HOH F 4 .   ? -33.862 26.149 -4.259  1.00 30.11 ? 411 HOH X O   1 
HETATM 1425 O O   . HOH F 4 .   ? -17.684 26.873 15.388  1.00 35.56 ? 412 HOH X O   1 
HETATM 1426 O O   . HOH F 4 .   ? -6.497  10.524 2.140   1.00 33.50 ? 413 HOH X O   1 
HETATM 1427 O O   . HOH F 4 .   ? -31.236 14.610 -24.389 1.00 19.98 ? 414 HOH X O   1 
HETATM 1428 O O   . HOH F 4 .   ? -36.053 8.402  -0.916  1.00 28.32 ? 415 HOH X O   1 
HETATM 1429 O O   . HOH F 4 .   ? -30.885 33.283 -9.985  1.00 28.60 ? 416 HOH X O   1 
HETATM 1430 O O   . HOH F 4 .   ? -6.737  23.827 2.339   1.00 23.57 ? 417 HOH X O   1 
HETATM 1431 O O   . HOH F 4 .   ? -26.597 13.218 8.665   1.00 33.03 ? 418 HOH X O   1 
HETATM 1432 O O   . HOH F 4 .   ? -26.594 14.750 10.542  1.00 28.58 ? 419 HOH X O   1 
HETATM 1433 O O   . HOH F 4 .   ? -28.909 28.927 -15.856 1.00 29.35 ? 420 HOH X O   1 
HETATM 1434 O O   . HOH F 4 .   ? -32.364 21.092 -8.853  1.00 30.65 ? 421 HOH X O   1 
HETATM 1435 O O   . HOH F 4 .   ? -11.397 8.503  -24.514 1.00 39.73 ? 422 HOH X O   1 
HETATM 1436 O O   . HOH F 4 .   ? -4.002  15.854 -2.415  1.00 30.63 ? 423 HOH X O   1 
HETATM 1437 O O   . HOH F 4 .   ? -26.871 10.313 -7.049  1.00 27.92 ? 424 HOH X O   1 
HETATM 1438 O O   . HOH F 4 .   ? -36.465 8.979  -30.844 1.00 38.44 ? 425 HOH X O   1 
HETATM 1439 O O   . HOH F 4 .   ? -39.919 1.263  -20.493 1.00 31.30 ? 426 HOH X O   1 
HETATM 1440 O O   . HOH F 4 .   ? -18.128 37.736 -5.589  1.00 26.71 ? 427 HOH X O   1 
HETATM 1441 O O   . HOH F 4 .   ? -28.530 15.619 12.531  1.00 27.36 ? 428 HOH X O   1 
HETATM 1442 O O   . HOH F 4 .   ? -36.504 -0.022 -25.887 1.00 36.36 ? 429 HOH X O   1 
HETATM 1443 O O   . HOH F 4 .   ? -14.409 14.732 -24.088 1.00 25.54 ? 430 HOH X O   1 
HETATM 1444 O O   . HOH F 4 .   ? -26.155 7.785  -9.775  1.00 28.99 ? 431 HOH X O   1 
HETATM 1445 O O   . HOH F 4 .   ? -32.152 22.771 -11.104 1.00 27.44 ? 432 HOH X O   1 
HETATM 1446 O O   . HOH F 4 .   ? -25.897 35.566 -11.421 1.00 28.46 ? 433 HOH X O   1 
HETATM 1447 O O   . HOH F 4 .   ? -23.996 8.945  -8.947  1.00 32.10 ? 434 HOH X O   1 
HETATM 1448 O O   . HOH F 4 .   ? -11.638 20.553 10.080  1.00 23.62 ? 435 HOH X O   1 
HETATM 1449 O O   . HOH F 4 .   ? -30.765 16.550 11.429  1.00 32.14 ? 436 HOH X O   1 
HETATM 1450 O O   . HOH F 4 .   ? -17.084 33.937 9.329   1.00 34.64 ? 437 HOH X O   1 
HETATM 1451 O O   . HOH F 4 .   ? -29.593 13.510 8.494   1.00 27.11 ? 438 HOH X O   1 
HETATM 1452 O O   . HOH F 4 .   ? -39.271 7.603  -8.602  1.00 41.14 ? 439 HOH X O   1 
HETATM 1453 O O   . HOH F 4 .   ? -25.050 5.575  -10.134 1.00 26.44 ? 440 HOH X O   1 
HETATM 1454 O O   . HOH F 4 .   ? -28.621 -0.076 -23.562 1.00 36.01 ? 441 HOH X O   1 
HETATM 1455 O O   . HOH F 4 .   ? -37.217 10.449 -6.796  1.00 40.35 ? 442 HOH X O   1 
HETATM 1456 O O   . HOH F 4 .   ? -25.587 4.948  -34.963 1.00 36.13 ? 443 HOH X O   1 
HETATM 1457 O O   . HOH F 4 .   ? -10.129 10.197 -14.261 1.00 17.03 ? 444 HOH X O   1 
HETATM 1458 O O   . HOH F 4 .   ? -20.613 0.436  -29.088 1.00 23.02 ? 445 HOH X O   1 
HETATM 1459 O O   . HOH F 4 .   ? -4.480  15.359 -5.071  1.00 31.22 ? 446 HOH X O   1 
HETATM 1460 O O   . HOH F 4 .   ? -11.485 7.143  -12.011 1.00 25.41 ? 447 HOH X O   1 
HETATM 1461 O O   . HOH F 4 .   ? -32.073 14.840 8.193   1.00 20.36 ? 448 HOH X O   1 
HETATM 1462 O O   . HOH F 4 .   ? -29.618 14.093 -3.595  1.00 23.17 ? 449 HOH X O   1 
HETATM 1463 O O   . HOH F 4 .   ? -18.086 20.318 14.329  1.00 16.86 ? 450 HOH X O   1 
HETATM 1464 O O   . HOH F 4 .   ? -13.314 11.661 -17.386 1.00 26.54 ? 451 HOH X O   1 
HETATM 1465 O O   . HOH F 4 .   ? -27.542 11.278 -9.265  1.00 28.89 ? 452 HOH X O   1 
HETATM 1466 O O   . HOH F 4 .   ? -31.273 -0.191 -22.958 1.00 35.50 ? 453 HOH X O   1 
HETATM 1467 O O   A HOH F 4 .   ? -13.114 13.652 -19.233 0.50 2.00  ? 454 HOH X O   1 
HETATM 1468 O O   B HOH F 4 .   ? -14.627 14.906 -20.587 0.50 10.22 ? 454 HOH X O   1 
HETATM 1469 O O   . HOH F 4 .   ? -29.726 13.277 -6.014  1.00 33.73 ? 455 HOH X O   1 
HETATM 1470 O O   . HOH F 4 .   ? -12.015 35.704 4.616   1.00 16.89 ? 456 HOH X O   1 
HETATM 1471 O O   . HOH F 4 .   ? -10.483 23.606 7.436   1.00 15.70 ? 457 HOH X O   1 
HETATM 1472 O O   . HOH F 4 .   ? -17.927 16.889 9.119   1.00 18.53 ? 458 HOH X O   1 
HETATM 1473 O O   . HOH F 4 .   ? -21.704 15.502 10.402  1.00 18.82 ? 459 HOH X O   1 
HETATM 1474 O O   . HOH F 4 .   ? -17.488 12.024 -29.408 1.00 21.51 ? 460 HOH X O   1 
HETATM 1475 O O   . HOH F 4 .   ? -31.649 0.124  -17.786 1.00 23.88 ? 461 HOH X O   1 
HETATM 1476 O O   . HOH F 4 .   ? -33.008 -1.325 -19.426 1.00 28.54 ? 462 HOH X O   1 
HETATM 1477 O O   . HOH F 4 .   ? -27.779 15.048 -12.664 1.00 29.56 ? 463 HOH X O   1 
HETATM 1478 O O   A HOH F 4 .   ? -25.532 19.928 -21.039 0.50 9.97  ? 464 HOH X O   1 
HETATM 1479 O O   B HOH F 4 .   ? -26.038 19.118 -19.458 0.50 9.85  ? 464 HOH X O   1 
HETATM 1480 O O   . HOH F 4 .   ? -13.249 9.321  -18.640 1.00 34.13 ? 465 HOH X O   1 
HETATM 1481 O O   . HOH F 4 .   ? -24.803 0.294  -18.230 1.00 39.02 ? 466 HOH X O   1 
HETATM 1482 O O   . HOH F 4 .   ? -27.990 15.778 -17.889 1.00 35.98 ? 467 HOH X O   1 
HETATM 1483 O O   . HOH F 4 .   ? -32.195 14.462 -21.626 1.00 28.98 ? 468 HOH X O   1 
HETATM 1484 O O   . HOH F 4 .   ? -14.157 9.692  -31.418 1.00 31.35 ? 469 HOH X O   1 
HETATM 1485 O O   . HOH F 4 .   ? -35.608 -0.921 -17.939 1.00 37.54 ? 470 HOH X O   1 
HETATM 1486 O O   . HOH F 4 .   ? -23.643 26.102 12.951  1.00 40.84 ? 471 HOH X O   1 
HETATM 1487 O O   . HOH F 4 .   ? -22.438 12.843 9.868   1.00 38.32 ? 472 HOH X O   1 
HETATM 1488 O O   . HOH F 4 .   ? -9.972  9.032  -21.447 1.00 28.51 ? 473 HOH X O   1 
HETATM 1489 O O   . HOH F 4 .   ? -24.107 30.847 9.601   1.00 36.12 ? 474 HOH X O   1 
HETATM 1490 O O   . HOH F 4 .   ? -16.011 35.245 4.844   1.00 33.45 ? 475 HOH X O   1 
HETATM 1491 O O   . HOH F 4 .   ? -8.554  21.914 7.890   1.00 32.24 ? 476 HOH X O   1 
HETATM 1492 O O   . HOH F 4 .   ? -19.643 14.337 6.504   1.00 20.64 ? 477 HOH X O   1 
HETATM 1493 O O   . HOH F 4 .   ? -19.815 12.538 -30.468 1.00 23.62 ? 478 HOH X O   1 
HETATM 1494 O O   . HOH F 4 .   ? -15.512 13.915 -28.874 1.00 24.79 ? 479 HOH X O   1 
HETATM 1495 O O   . HOH F 4 .   ? -18.685 1.989  -32.268 1.00 37.32 ? 480 HOH X O   1 
HETATM 1496 O O   . HOH F 4 .   ? -15.262 24.254 15.396  1.00 30.99 ? 481 HOH X O   1 
HETATM 1497 O O   . HOH F 4 .   ? -31.991 18.343 -1.852  1.00 33.14 ? 482 HOH X O   1 
HETATM 1498 O O   . HOH F 4 .   ? -25.246 32.057 0.775   1.00 31.47 ? 483 HOH X O   1 
HETATM 1499 O O   . HOH F 4 .   ? -13.026 25.918 -10.378 1.00 35.26 ? 484 HOH X O   1 
HETATM 1500 O O   . HOH F 4 .   ? -12.565 23.684 -9.522  1.00 24.46 ? 485 HOH X O   1 
HETATM 1501 O O   . HOH F 4 .   ? -6.384  18.968 5.781   1.00 37.89 ? 486 HOH X O   1 
HETATM 1502 O O   . HOH F 4 .   ? -22.013 13.789 -30.560 1.00 31.91 ? 487 HOH X O   1 
HETATM 1503 O O   . HOH F 4 .   ? -34.239 15.779 -3.520  1.00 37.28 ? 488 HOH X O   1 
HETATM 1504 O O   . HOH F 4 .   ? -19.934 35.800 4.246   1.00 35.87 ? 489 HOH X O   1 
HETATM 1505 O O   . HOH F 4 .   ? -18.324 24.191 15.678  1.00 34.95 ? 490 HOH X O   1 
HETATM 1506 O O   . HOH F 4 .   ? -28.414 31.669 -0.248  1.00 36.48 ? 491 HOH X O   1 
HETATM 1507 O O   . HOH F 4 .   ? -14.966 2.375  -21.699 1.00 30.53 ? 492 HOH X O   1 
HETATM 1508 O O   . HOH F 4 .   ? -16.488 0.975  -20.131 1.00 37.14 ? 493 HOH X O   1 
HETATM 1509 O O   . HOH F 4 .   ? -11.233 11.705 3.800   1.00 30.61 ? 494 HOH X O   1 
HETATM 1510 O O   . HOH F 4 .   ? -14.852 9.701  2.839   1.00 33.69 ? 495 HOH X O   1 
HETATM 1511 O O   . HOH F 4 .   ? -18.333 5.944  -6.356  1.00 38.92 ? 496 HOH X O   1 
HETATM 1512 O O   . HOH F 4 .   ? -13.919 11.857 4.069   1.00 23.77 ? 497 HOH X O   1 
HETATM 1513 O O   . HOH F 4 .   ? -15.026 21.755 14.920  1.00 28.93 ? 498 HOH X O   1 
HETATM 1514 O O   . HOH F 4 .   ? -14.143 1.875  -24.355 1.00 32.54 ? 499 HOH X O   1 
HETATM 1515 O O   . HOH F 4 .   ? -21.837 22.730 14.179  1.00 25.05 ? 500 HOH X O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET X . n 
A 1 2   ASN 2   2   2   ASN ASN X . n 
A 1 3   ILE 3   3   3   ILE ILE X . n 
A 1 4   PHE 4   4   4   PHE PHE X . n 
A 1 5   GLU 5   5   5   GLU GLU X . n 
A 1 6   MET 6   6   6   MET MET X . n 
A 1 7   LEU 7   7   7   LEU LEU X . n 
A 1 8   ARG 8   8   8   ARG ARG X . n 
A 1 9   ILE 9   9   9   ILE ILE X . n 
A 1 10  ASP 10  10  10  ASP ASP X . n 
A 1 11  GLU 11  11  11  GLU GLU X . n 
A 1 12  GLY 12  12  12  GLY GLY X . n 
A 1 13  LEU 13  13  13  LEU LEU X . n 
A 1 14  ARG 14  14  14  ARG ARG X . n 
A 1 15  LEU 15  15  15  LEU LEU X . n 
A 1 16  LYS 16  16  16  LYS LYS X . n 
A 1 17  ILE 17  17  17  ILE ILE X . n 
A 1 18  TYR 18  18  18  TYR TYR X . n 
A 1 19  LYS 19  19  19  LYS LYS X . n 
A 1 20  ASP 20  20  20  ASP ASP X . n 
A 1 21  THR 21  21  21  THR THR X . n 
A 1 22  GLU 22  22  22  GLU GLU X . n 
A 1 23  GLY 23  23  23  GLY GLY X . n 
A 1 24  TYR 24  24  24  TYR TYR X . n 
A 1 25  TYR 25  25  25  TYR TYR X . n 
A 1 26  THR 26  26  26  THR THR X . n 
A 1 27  ILE 27  27  27  ILE ILE X . n 
A 1 28  GLY 28  28  28  GLY GLY X . n 
A 1 29  ILE 29  29  29  ILE ILE X . n 
A 1 30  GLY 30  30  30  GLY GLY X . n 
A 1 31  HIS 31  31  31  HIS HIS X . n 
A 1 32  LEU 32  32  32  LEU LEU X . n 
A 1 33  LEU 33  33  33  LEU LEU X . n 
A 1 34  THR 34  34  34  THR THR X . n 
A 1 35  LYS 35  35  35  LYS LYS X . n 
A 1 36  SER 36  36  36  SER SER X . n 
A 1 37  PRO 37  37  37  PRO PRO X . n 
A 1 38  SER 38  38  38  SER SER X . n 
A 1 39  LEU 39  39  39  LEU LEU X . n 
A 1 40  ASN 40  40  40  ASN ASN X . n 
A 1 41  ALA 41  41  41  ALA ALA X . n 
A 1 42  ALA 42  42  42  ALA ALA X . n 
A 1 43  LYS 43  43  43  LYS LYS X . n 
A 1 44  SER 44  44  44  SER SER X . n 
A 1 45  GLU 45  45  45  GLU GLU X . n 
A 1 46  LEU 46  46  46  LEU LEU X . n 
A 1 47  ASP 47  47  47  ASP ASP X . n 
A 1 48  LYS 48  48  48  LYS LYS X . n 
A 1 49  ALA 49  49  49  ALA ALA X . n 
A 1 50  ILE 50  50  50  ILE ILE X . n 
A 1 51  GLY 51  51  51  GLY GLY X . n 
A 1 52  ARG 52  52  52  ARG ARG X . n 
A 1 53  ASN 53  53  53  ASN ASN X . n 
A 1 54  THR 54  54  54  THR THR X . n 
A 1 55  ASN 55  55  55  ASN ASN X . n 
A 1 56  GLY 56  56  56  GLY GLY X . n 
A 1 57  VAL 57  57  57  VAL VAL X . n 
A 1 58  ILE 58  58  58  ILE ILE X . n 
A 1 59  THR 59  59  59  THR THR X . n 
A 1 60  LYS 60  60  60  LYS LYS X . n 
A 1 61  ASP 61  61  61  ASP ASP X . n 
A 1 62  GLU 62  62  62  GLU GLU X . n 
A 1 63  ALA 63  63  63  ALA ALA X . n 
A 1 64  GLU 64  64  64  GLU GLU X . n 
A 1 65  LYS 65  65  65  LYS LYS X . n 
A 1 66  LEU 66  66  66  LEU LEU X . n 
A 1 67  PHE 67  67  67  PHE PHE X . n 
A 1 68  ASN 68  68  68  ASN ASN X . n 
A 1 69  GLN 69  69  69  GLN GLN X . n 
A 1 70  ASP 70  70  70  ASP ASP X . n 
A 1 71  VAL 71  71  71  VAL VAL X . n 
A 1 72  ASP 72  72  72  ASP ASP X . n 
A 1 73  ALA 73  73  73  ALA ALA X . n 
A 1 74  ALA 74  74  74  ALA ALA X . n 
A 1 75  VAL 75  75  75  VAL VAL X . n 
A 1 76  ARG 76  76  76  ARG ARG X . n 
A 1 77  GLY 77  77  77  GLY GLY X . n 
A 1 78  ILE 78  78  78  ILE ILE X . n 
A 1 79  LEU 79  79  79  LEU LEU X . n 
A 1 80  ARG 80  80  80  ARG ARG X . n 
A 1 81  ASN 81  81  81  ASN ASN X . n 
A 1 82  ALA 82  82  82  ALA ALA X . n 
A 1 83  LYS 83  83  83  LYS LYS X . n 
A 1 84  LEU 84  84  84  LEU LEU X . n 
A 1 85  LYS 85  85  85  LYS LYS X . n 
A 1 86  PRO 86  86  86  PRO PRO X . n 
A 1 87  VAL 87  87  87  VAL VAL X . n 
A 1 88  TYR 88  88  88  TYR TYR X . n 
A 1 89  ASP 89  89  89  ASP ASP X . n 
A 1 90  SER 90  90  90  SER SER X . n 
A 1 91  LEU 91  91  91  LEU LEU X . n 
A 1 92  ASP 92  92  92  ASP ASP X . n 
A 1 93  ALA 93  93  93  ALA ALA X . n 
A 1 94  VAL 94  94  94  VAL VAL X . n 
A 1 95  ARG 95  95  95  ARG ARG X . n 
A 1 96  ARG 96  96  96  ARG ARG X . n 
A 1 97  ALA 97  97  97  ALA ALA X . n 
A 1 98  ALA 98  98  98  ALA ALA X . n 
A 1 99  ALA 99  99  99  ALA ALA X . n 
A 1 100 ILE 100 100 100 ILE ILE X . n 
A 1 101 ASN 101 101 101 ASN ASN X . n 
A 1 102 MET 102 102 102 MET MET X . n 
A 1 103 VAL 103 103 103 VAL VAL X . n 
A 1 104 PHE 104 104 104 PHE PHE X . n 
A 1 105 GLN 105 105 105 GLN GLN X . n 
A 1 106 MET 106 106 106 MET MET X . n 
A 1 107 GLY 107 107 107 GLY GLY X . n 
A 1 108 GLU 108 108 108 GLU GLU X . n 
A 1 109 THR 109 109 109 THR THR X . n 
A 1 110 GLY 110 110 110 GLY GLY X . n 
A 1 111 VAL 111 111 111 VAL VAL X . n 
A 1 112 ALA 112 112 112 ALA ALA X . n 
A 1 113 GLY 113 113 113 GLY GLY X . n 
A 1 114 PHE 114 114 114 PHE PHE X . n 
A 1 115 THR 115 115 115 THR THR X . n 
A 1 116 ASN 116 116 116 ASN ASN X . n 
A 1 117 SER 117 117 117 SER SER X . n 
A 1 118 LEU 118 118 118 LEU LEU X . n 
A 1 119 ARG 119 119 119 ARG ARG X . n 
A 1 120 MET 120 120 120 MET MET X . n 
A 1 121 LEU 121 121 121 LEU LEU X . n 
A 1 122 GLN 122 122 122 GLN GLN X . n 
A 1 123 GLN 123 123 123 GLN GLN X . n 
A 1 124 LYS 124 124 124 LYS LYS X . n 
A 1 125 ARG 125 125 125 ARG ARG X . n 
A 1 126 TRP 126 126 126 TRP TRP X . n 
A 1 127 ASP 127 127 127 ASP ASP X . n 
A 1 128 GLU 128 128 128 GLU GLU X . n 
A 1 129 ALA 129 129 129 ALA ALA X . n 
A 1 130 ALA 130 130 130 ALA ALA X . n 
A 1 131 VAL 131 131 131 VAL VAL X . n 
A 1 132 ASN 132 132 132 ASN ASN X . n 
A 1 133 LEU 133 133 133 LEU LEU X . n 
A 1 134 ALA 134 134 134 ALA ALA X . n 
A 1 135 LYS 135 135 135 LYS LYS X . n 
A 1 136 SER 136 136 136 SER SER X . n 
A 1 137 ARG 137 137 137 ARG ARG X . n 
A 1 138 TRP 138 138 138 TRP TRP X . n 
A 1 139 TYR 139 139 139 TYR TYR X . n 
A 1 140 ASN 140 140 140 ASN ASN X . n 
A 1 141 GLN 141 141 141 GLN GLN X . n 
A 1 142 THR 142 142 142 THR THR X . n 
A 1 143 PRO 143 143 143 PRO PRO X . n 
A 1 144 ASN 144 144 144 ASN ASN X . n 
A 1 145 ARG 145 145 145 ARG ARG X . n 
A 1 146 ALA 146 146 146 ALA ALA X . n 
A 1 147 LYS 147 147 147 LYS LYS X . n 
A 1 148 ARG 148 148 148 ARG ARG X . n 
A 1 149 VAL 149 149 149 VAL VAL X . n 
A 1 150 ILE 150 150 150 ILE ILE X . n 
A 1 151 THR 151 151 151 THR THR X . n 
A 1 152 THR 152 152 152 THR THR X . n 
A 1 153 PHE 153 153 153 PHE PHE X . n 
A 1 154 ARG 154 154 154 ARG ARG X . n 
A 1 155 THR 155 155 155 THR THR X . n 
A 1 156 GLY 156 156 156 GLY GLY X . n 
A 1 157 THR 157 157 157 THR THR X . n 
A 1 158 TRP 158 158 158 TRP TRP X . n 
A 1 159 ASP 159 159 159 ASP ASP X . n 
A 1 160 ALA 160 160 160 ALA ALA X . n 
A 1 161 TYR 161 161 161 TYR TYR X . n 
A 1 162 LYS 162 162 162 LYS LYS X . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1   301 301 PO4 PO4 X . 
C 2 PO4 1   302 302 PO4 PO4 X . 
D 3 MR3 1   303 303 MR3 MR3 X . 
E 3 MR3 1   304 304 MR3 MR3 X . 
F 4 HOH 1   305 1   HOH HOH X . 
F 4 HOH 2   306 2   HOH HOH X . 
F 4 HOH 3   307 3   HOH HOH X . 
F 4 HOH 4   308 4   HOH HOH X . 
F 4 HOH 5   309 5   HOH HOH X . 
F 4 HOH 6   310 6   HOH HOH X . 
F 4 HOH 7   311 7   HOH HOH X . 
F 4 HOH 8   312 8   HOH HOH X . 
F 4 HOH 9   313 9   HOH HOH X . 
F 4 HOH 10  314 10  HOH HOH X . 
F 4 HOH 11  315 11  HOH HOH X . 
F 4 HOH 12  316 12  HOH HOH X . 
F 4 HOH 13  317 13  HOH HOH X . 
F 4 HOH 14  318 14  HOH HOH X . 
F 4 HOH 15  319 15  HOH HOH X . 
F 4 HOH 16  320 16  HOH HOH X . 
F 4 HOH 17  321 17  HOH HOH X . 
F 4 HOH 18  322 18  HOH HOH X . 
F 4 HOH 19  323 19  HOH HOH X . 
F 4 HOH 20  324 20  HOH HOH X . 
F 4 HOH 21  325 21  HOH HOH X . 
F 4 HOH 22  326 22  HOH HOH X . 
F 4 HOH 23  327 23  HOH HOH X . 
F 4 HOH 24  328 24  HOH HOH X . 
F 4 HOH 25  329 25  HOH HOH X . 
F 4 HOH 26  330 26  HOH HOH X . 
F 4 HOH 27  331 27  HOH HOH X . 
F 4 HOH 28  332 28  HOH HOH X . 
F 4 HOH 29  333 29  HOH HOH X . 
F 4 HOH 30  334 30  HOH HOH X . 
F 4 HOH 31  335 31  HOH HOH X . 
F 4 HOH 32  336 32  HOH HOH X . 
F 4 HOH 33  337 33  HOH HOH X . 
F 4 HOH 34  338 34  HOH HOH X . 
F 4 HOH 35  339 35  HOH HOH X . 
F 4 HOH 36  340 36  HOH HOH X . 
F 4 HOH 37  341 37  HOH HOH X . 
F 4 HOH 38  342 38  HOH HOH X . 
F 4 HOH 39  343 39  HOH HOH X . 
F 4 HOH 40  344 40  HOH HOH X . 
F 4 HOH 41  345 41  HOH HOH X . 
F 4 HOH 42  346 42  HOH HOH X . 
F 4 HOH 43  347 43  HOH HOH X . 
F 4 HOH 44  348 44  HOH HOH X . 
F 4 HOH 45  349 45  HOH HOH X . 
F 4 HOH 46  350 46  HOH HOH X . 
F 4 HOH 47  351 47  HOH HOH X . 
F 4 HOH 48  352 48  HOH HOH X . 
F 4 HOH 49  353 49  HOH HOH X . 
F 4 HOH 50  354 50  HOH HOH X . 
F 4 HOH 51  355 51  HOH HOH X . 
F 4 HOH 52  356 52  HOH HOH X . 
F 4 HOH 53  357 53  HOH HOH X . 
F 4 HOH 54  358 54  HOH HOH X . 
F 4 HOH 55  359 55  HOH HOH X . 
F 4 HOH 56  360 56  HOH HOH X . 
F 4 HOH 57  361 57  HOH HOH X . 
F 4 HOH 58  362 58  HOH HOH X . 
F 4 HOH 59  363 59  HOH HOH X . 
F 4 HOH 60  364 60  HOH HOH X . 
F 4 HOH 61  365 61  HOH HOH X . 
F 4 HOH 62  366 62  HOH HOH X . 
F 4 HOH 63  367 63  HOH HOH X . 
F 4 HOH 64  368 64  HOH HOH X . 
F 4 HOH 65  369 66  HOH HOH X . 
F 4 HOH 66  370 67  HOH HOH X . 
F 4 HOH 67  371 68  HOH HOH X . 
F 4 HOH 68  372 69  HOH HOH X . 
F 4 HOH 69  373 70  HOH HOH X . 
F 4 HOH 70  374 71  HOH HOH X . 
F 4 HOH 71  375 72  HOH HOH X . 
F 4 HOH 72  376 73  HOH HOH X . 
F 4 HOH 73  377 74  HOH HOH X . 
F 4 HOH 74  378 75  HOH HOH X . 
F 4 HOH 75  379 76  HOH HOH X . 
F 4 HOH 76  380 78  HOH HOH X . 
F 4 HOH 77  381 79  HOH HOH X . 
F 4 HOH 78  382 80  HOH HOH X . 
F 4 HOH 79  383 81  HOH HOH X . 
F 4 HOH 80  384 82  HOH HOH X . 
F 4 HOH 81  385 83  HOH HOH X . 
F 4 HOH 82  386 87  HOH HOH X . 
F 4 HOH 83  387 88  HOH HOH X . 
F 4 HOH 84  388 89  HOH HOH X . 
F 4 HOH 85  389 90  HOH HOH X . 
F 4 HOH 86  390 96  HOH HOH X . 
F 4 HOH 87  391 97  HOH HOH X . 
F 4 HOH 88  392 98  HOH HOH X . 
F 4 HOH 89  393 100 HOH HOH X . 
F 4 HOH 90  394 102 HOH HOH X . 
F 4 HOH 91  395 103 HOH HOH X . 
F 4 HOH 92  396 104 HOH HOH X . 
F 4 HOH 93  397 105 HOH HOH X . 
F 4 HOH 94  398 106 HOH HOH X . 
F 4 HOH 95  399 107 HOH HOH X . 
F 4 HOH 96  400 108 HOH HOH X . 
F 4 HOH 97  401 109 HOH HOH X . 
F 4 HOH 98  402 110 HOH HOH X . 
F 4 HOH 99  403 111 HOH HOH X . 
F 4 HOH 100 404 112 HOH HOH X . 
F 4 HOH 101 405 113 HOH HOH X . 
F 4 HOH 102 406 114 HOH HOH X . 
F 4 HOH 103 407 116 HOH HOH X . 
F 4 HOH 104 408 117 HOH HOH X . 
F 4 HOH 105 409 118 HOH HOH X . 
F 4 HOH 106 410 120 HOH HOH X . 
F 4 HOH 107 411 122 HOH HOH X . 
F 4 HOH 108 412 123 HOH HOH X . 
F 4 HOH 109 413 124 HOH HOH X . 
F 4 HOH 110 414 125 HOH HOH X . 
F 4 HOH 111 415 126 HOH HOH X . 
F 4 HOH 112 416 127 HOH HOH X . 
F 4 HOH 113 417 128 HOH HOH X . 
F 4 HOH 114 418 129 HOH HOH X . 
F 4 HOH 115 419 130 HOH HOH X . 
F 4 HOH 116 420 131 HOH HOH X . 
F 4 HOH 117 421 132 HOH HOH X . 
F 4 HOH 118 422 133 HOH HOH X . 
F 4 HOH 119 423 134 HOH HOH X . 
F 4 HOH 120 424 135 HOH HOH X . 
F 4 HOH 121 425 136 HOH HOH X . 
F 4 HOH 122 426 137 HOH HOH X . 
F 4 HOH 123 427 138 HOH HOH X . 
F 4 HOH 124 428 139 HOH HOH X . 
F 4 HOH 125 429 140 HOH HOH X . 
F 4 HOH 126 430 141 HOH HOH X . 
F 4 HOH 127 431 142 HOH HOH X . 
F 4 HOH 128 432 143 HOH HOH X . 
F 4 HOH 129 433 144 HOH HOH X . 
F 4 HOH 130 434 146 HOH HOH X . 
F 4 HOH 131 435 147 HOH HOH X . 
F 4 HOH 132 436 148 HOH HOH X . 
F 4 HOH 133 437 150 HOH HOH X . 
F 4 HOH 134 438 151 HOH HOH X . 
F 4 HOH 135 439 153 HOH HOH X . 
F 4 HOH 136 440 157 HOH HOH X . 
F 4 HOH 137 441 159 HOH HOH X . 
F 4 HOH 138 442 160 HOH HOH X . 
F 4 HOH 139 443 166 HOH HOH X . 
F 4 HOH 140 444 168 HOH HOH X . 
F 4 HOH 141 445 170 HOH HOH X . 
F 4 HOH 142 446 171 HOH HOH X . 
F 4 HOH 143 447 172 HOH HOH X . 
F 4 HOH 144 448 173 HOH HOH X . 
F 4 HOH 145 449 174 HOH HOH X . 
F 4 HOH 146 450 175 HOH HOH X . 
F 4 HOH 147 451 176 HOH HOH X . 
F 4 HOH 148 452 177 HOH HOH X . 
F 4 HOH 149 453 179 HOH HOH X . 
F 4 HOH 150 454 180 HOH HOH X . 
F 4 HOH 151 455 181 HOH HOH X . 
F 4 HOH 152 456 182 HOH HOH X . 
F 4 HOH 153 457 183 HOH HOH X . 
F 4 HOH 154 458 184 HOH HOH X . 
F 4 HOH 155 459 185 HOH HOH X . 
F 4 HOH 156 460 186 HOH HOH X . 
F 4 HOH 157 461 187 HOH HOH X . 
F 4 HOH 158 462 188 HOH HOH X . 
F 4 HOH 159 463 190 HOH HOH X . 
F 4 HOH 160 464 192 HOH HOH X . 
F 4 HOH 161 465 194 HOH HOH X . 
F 4 HOH 162 466 195 HOH HOH X . 
F 4 HOH 163 467 196 HOH HOH X . 
F 4 HOH 164 468 197 HOH HOH X . 
F 4 HOH 165 469 198 HOH HOH X . 
F 4 HOH 166 470 199 HOH HOH X . 
F 4 HOH 167 471 200 HOH HOH X . 
F 4 HOH 168 472 203 HOH HOH X . 
F 4 HOH 169 473 204 HOH HOH X . 
F 4 HOH 170 474 206 HOH HOH X . 
F 4 HOH 171 475 209 HOH HOH X . 
F 4 HOH 172 476 218 HOH HOH X . 
F 4 HOH 173 477 219 HOH HOH X . 
F 4 HOH 174 478 220 HOH HOH X . 
F 4 HOH 175 479 221 HOH HOH X . 
F 4 HOH 176 480 222 HOH HOH X . 
F 4 HOH 177 481 223 HOH HOH X . 
F 4 HOH 178 482 224 HOH HOH X . 
F 4 HOH 179 483 225 HOH HOH X . 
F 4 HOH 180 484 227 HOH HOH X . 
F 4 HOH 181 485 228 HOH HOH X . 
F 4 HOH 182 486 230 HOH HOH X . 
F 4 HOH 183 487 231 HOH HOH X . 
F 4 HOH 184 488 235 HOH HOH X . 
F 4 HOH 185 489 237 HOH HOH X . 
F 4 HOH 186 490 241 HOH HOH X . 
F 4 HOH 187 491 243 HOH HOH X . 
F 4 HOH 188 492 245 HOH HOH X . 
F 4 HOH 189 493 246 HOH HOH X . 
F 4 HOH 190 494 249 HOH HOH X . 
F 4 HOH 191 495 250 HOH HOH X . 
F 4 HOH 192 496 251 HOH HOH X . 
F 4 HOH 193 497 254 HOH HOH X . 
F 4 HOH 194 498 255 HOH HOH X . 
F 4 HOH 195 499 257 HOH HOH X . 
F 4 HOH 196 500 258 HOH HOH X . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2007-08-07 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-10-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_software.classification'       
2 3 'Structure model' '_software.contact_author'       
3 3 'Structure model' '_software.contact_author_email' 
4 3 'Structure model' '_software.date'                 
5 3 'Structure model' '_software.language'             
6 3 'Structure model' '_software.location'             
7 3 'Structure model' '_software.name'                 
8 3 'Structure model' '_software.type'                 
9 3 'Structure model' '_software.version'              
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?                package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
REFMAC      .     ?                program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran_77 ? 3 
PDB_EXTRACT 2.000 'April. 3, 2006' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 4 
HKL-2000    .     ?                ?       ?                    ?                        'data collection' ? ?          ? 5 
HKL-2000    .     ?                ?       ?                    ?                        'data reduction'  ? ?          ? 6 
REFMAC      .     ?                ?       ?                    ?                        phasing           ? ?          ? 7 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   X 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    371 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   X 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    483 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE X 29  ? ? -102.62 74.30 
2 1 PHE X 114 ? ? -91.12  45.89 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 X LYS 16 ? CD ? A LYS 16 CD 
2 1 Y 1 X LYS 16 ? CE ? A LYS 16 CE 
3 1 Y 1 X LYS 16 ? NZ ? A LYS 16 NZ 
4 1 Y 1 X LYS 60 ? NZ ? A LYS 60 NZ 
5 1 Y 1 X LYS 83 ? CE ? A LYS 83 CE 
6 1 Y 1 X LYS 83 ? NZ ? A LYS 83 NZ 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION'     PO4 
3 1-METHYL-1H-PYRROLE MR3 
4 water               HOH 
#